BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c636_g2_i1 len=327 path=[1489:0-326]

Length=327
                                                                      Score     E

gb|AGI60280.1|  transcription factor MYB305                             201   4e-63   
gb|ABU97107.1|  MYB305 protein v1                                       201   4e-63   Nicotiana langsdorffii x Nicotiana sanderae
ref|XP_009618404.1|  PREDICTED: myb-related protein 305-like            201   4e-63   
gb|ABU97106.1|  MYB305 protein v2                                       201   4e-63   Nicotiana langsdorffii x Nicotiana sanderae
ref|XP_009791355.1|  PREDICTED: myb-related protein 305-like            201   5e-63   
gb|ADT82939.1|  non-opening 1                                           201   5e-63   
emb|CDP02096.1|  unnamed protein product                                201   6e-63   
gb|ACB12237.1|  MYB-like protein NON1                                   200   2e-62   
sp|P81391.1|MYB05_ANTMA  RecName: Full=Myb-related protein 305          200   2e-62   Antirrhinum majus [garden snapdragon]
gb|AGC00813.1|  EOBI                                                    200   2e-62   
gb|AGC00814.1|  EOBI                                                    200   3e-62   
ref|XP_004232307.1|  PREDICTED: myb-related protein 340                 198   1e-61   
ref|XP_011097428.1|  PREDICTED: myb-related protein 305                 198   1e-61   
ref|XP_006338574.1|  PREDICTED: myb-related protein 340-like            198   1e-61   
ref|XP_007031495.1|  Myb domain protein 21                              197   2e-61   
ref|XP_009613846.1|  PREDICTED: myb-related protein 305-like            197   2e-61   
ref|XP_008341440.1|  PREDICTED: myb-related protein 305-like            197   4e-61   
gb|AFJ21697.1|  MYB24                                                   197   4e-61   
ref|XP_008230585.1|  PREDICTED: myb-related protein 305-like            197   4e-61   
ref|XP_009375123.1|  PREDICTED: myb-related protein 305-like            196   6e-61   
ref|XP_007217766.1|  hypothetical protein PRUPE_ppa011751mg             195   1e-60   
sp|P81396.1|MYB40_ANTMA  RecName: Full=Myb-related protein 340          195   1e-60   Antirrhinum majus [garden snapdragon]
ref|XP_004304632.1|  PREDICTED: myb-related protein 305-like            195   2e-60   
gb|KDP46431.1|  hypothetical protein JCGZ_10271                         195   2e-60   
gb|AGN52197.1|  MYB-related transcription factor                        194   2e-60   
gb|AGN52087.1|  MYB-related transcription factor                        194   2e-60   
gb|EYU44761.1|  hypothetical protein MIMGU_mgv1a013642mg                195   2e-60   
ref|XP_006470308.1|  PREDICTED: myb-related protein 305-like isof...    194   3e-60   
gb|KDO66125.1|  hypothetical protein CISIN_1g045384mg                   194   3e-60   
ref|XP_006446527.1|  hypothetical protein CICLE_v10016820mg             194   3e-60   
ref|XP_009783970.1|  PREDICTED: myb-related protein 340-like            194   4e-60   
emb|CAN77103.1|  hypothetical protein VITISV_018445                     194   4e-60   Vitis vinifera
ref|XP_009334094.1|  PREDICTED: myb-related protein 305-like            194   6e-60   
gb|KHG20022.1|  Myb-related protein                                     193   1e-59   
ref|XP_006357153.1|  PREDICTED: myb-related protein 305-like            192   3e-59   
ref|XP_004233330.1|  PREDICTED: myb-related protein 305-like            191   4e-59   
ref|NP_001268062.1|  R2R3 Myb24 transcription factor                    191   5e-59   
emb|CAD87008.1|  MYB8 protein                                           191   6e-59   Gerbera hybrid cultivar
gb|KEH24806.1|  myb transcription factor                                190   2e-58   
emb|CAA71992.1|  Myb26                                                  191   2e-58   Pisum sativum [garden pea]
ref|XP_011005145.1|  PREDICTED: myb-related protein 305 isoform X2      189   2e-58   
ref|XP_002298534.1|  Myb26 family protein                               189   2e-58   Populus trichocarpa [western balsam poplar]
ref|XP_004489258.1|  PREDICTED: myb-related protein 305-like            190   3e-58   
ref|XP_011013637.1|  PREDICTED: myb-related protein 305-like isof...    189   3e-58   
dbj|BAF96931.1|  R2R3-MYB transcriptional factor                        189   5e-58   Gentiana triflora
ref|XP_002323803.1|  Myb26 family protein                               187   1e-57   Populus trichocarpa [western balsam poplar]
ref|NP_001235699.1|  uncharacterized protein LOC100305972               188   1e-57   
ref|XP_011013294.1|  PREDICTED: myb-related protein 305-like isof...    187   2e-57   
gb|AGN52062.1|  MYB-related transcription factor                        187   3e-57   
ref|XP_004516766.1|  PREDICTED: myb-related protein 305-like isof...    187   4e-57   
dbj|BAF96932.1|  R2R3-MYB transcriptional factor                        186   6e-57   Gentiana triflora
ref|XP_008443525.1|  PREDICTED: myb-related protein 305                 186   1e-56   
ref|XP_007151019.1|  hypothetical protein PHAVU_004G012000g             186   1e-56   
ref|XP_004141095.1|  PREDICTED: myb-related protein 305-like            186   2e-56   
ref|XP_010677862.1|  PREDICTED: myb-related protein 305-like            186   2e-56   
gb|KEH22251.1|  myb transcription factor                                185   2e-56   
gb|EPS65034.1|  hypothetical protein M569_09745                         185   2e-56   
gb|ACR15115.1|  MYBF1                                                   184   2e-56   
ref|NP_001235850.1|  MYB transcription factor MYB181                    185   2e-56   
ref|XP_003553814.1|  PREDICTED: myb-related protein 305                 184   3e-56   
ref|XP_010108787.1|  Myb-related protein 305                            185   4e-56   
ref|XP_010033288.1|  PREDICTED: myb-related protein 305                 184   4e-56   
ref|XP_007140962.1|  hypothetical protein PHAVU_008G155700g             184   5e-56   
dbj|BAB40790.1|  LhMyb                                                  182   8e-56   Lilium hybrid division I
ref|XP_008800726.1|  PREDICTED: myb-related protein 305-like            182   2e-55   
ref|XP_006470309.1|  PREDICTED: myb-related protein 305-like isof...    181   3e-55   
ref|XP_008812482.1|  PREDICTED: myb-related protein 305-like            182   3e-55   
ref|XP_006446526.1|  hypothetical protein CICLE_v10016820mg             180   3e-55   
gb|ACL81164.1|  MYB transcription factor                                181   4e-55   Mirabilis jalapa
ref|XP_010528247.1|  PREDICTED: transcription factor MYB21              181   7e-55   
ref|XP_010251229.1|  PREDICTED: myb-related protein 340-like            180   9e-55   
ref|XP_007140964.1|  hypothetical protein PHAVU_008G155900g             179   2e-54   
ref|NP_001235879.1|  MYB transcription factor MYB182                    180   2e-54   
gb|AAM63674.1|  putative transcription factor MYB24                     179   3e-54   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011005144.1|  PREDICTED: myb-related protein 305 isoform X1      179   4e-54   
gb|AEE37094.1|  MYB transcription factor                                179   4e-54   
ref|NP_198851.1|  myb domain protein 24                                 179   4e-54   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001238263.1|  uncharacterized protein LOC100306400               179   4e-54   
ref|NP_001235865.1|  MYB transcription factor MYB98                     179   5e-54   
gb|ACB59076.2|  Myb-like transcription factor EOBI                      175   7e-54   
ref|XP_009419837.1|  PREDICTED: myb-related protein 305-like            178   9e-54   
dbj|BAA21618.1|  ATMYB3                                                 178   1e-53   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010924268.1|  PREDICTED: myb-related protein 305-like            177   2e-53   
ref|XP_010425556.1|  PREDICTED: transcription factor MYB21 isofor...    178   2e-53   
ref|NP_189418.2|  transcription factor MYB21                            178   2e-53   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006395401.1|  hypothetical protein EUTSA_v10004857mg             178   2e-53   
ref|XP_010514490.1|  PREDICTED: transcription factor MYB21-like         178   2e-53   
ref|XP_006292470.1|  hypothetical protein CARUB_v10018700mg             178   2e-53   
ref|XP_010425557.1|  PREDICTED: transcription factor MYB21 isofor...    178   2e-53   
ref|XP_010502785.1|  PREDICTED: transcription factor MYB21-like         178   2e-53   
ref|XP_006405505.1|  hypothetical protein EUTSA_v10027930mg             177   2e-53   
ref|XP_002875402.1|  ATMYB21                                            178   2e-53   
ref|XP_009111584.1|  PREDICTED: transcription factor MYB21              178   2e-53   
ref|XP_010435910.1|  PREDICTED: transcription factor MYB24-like         177   3e-53   
ref|XP_010925776.1|  PREDICTED: myb-related protein 305-like            176   4e-53   
emb|CDY44433.1|  BnaC07g24710D                                          177   4e-53   
ref|XP_010925788.1|  PREDICTED: myb-related protein 305-like            176   4e-53   
gb|AET25524.1|  MYB1                                                    177   4e-53   
emb|CDY20036.1|  BnaA09g02150D                                          177   4e-53   
emb|CDX86471.1|  BnaA06g31880D                                          177   5e-53   
ref|XP_004142797.1|  PREDICTED: myb-related protein 305-like            176   9e-53   
ref|XP_006285780.1|  hypothetical protein CARUB_v10007254mg             176   9e-53   
gb|KFK33688.1|  hypothetical protein AALP_AA5G046900                    176   1e-52   
ref|XP_009151925.1|  PREDICTED: transcription factor MYB21              176   1e-52   
gb|AGO33165.1|  MYB transcription factor                                175   2e-52   
ref|XP_009416734.1|  PREDICTED: myb-related protein 305-like            175   2e-52   
ref|XP_011013638.1|  PREDICTED: myb-related protein 305-like isof...    173   3e-52   
ref|XP_004516765.1|  PREDICTED: myb-related protein 305-like isof...    175   5e-52   
ref|XP_010554050.1|  PREDICTED: transcription factor MYB21-like         173   1e-51   
ref|XP_008458780.1|  PREDICTED: myb-related protein 340-like            173   1e-51   
gb|ABH02872.1|  MYB transcription factor MYB99                          172   2e-51   Glycine max [soybeans]
ref|XP_011013295.1|  PREDICTED: myb-related protein 305-like isof...    171   2e-51   
ref|XP_010029159.1|  PREDICTED: myb-related protein 340-like            171   5e-51   
ref|XP_004156725.1|  PREDICTED: LOW QUALITY PROTEIN: myb-related ...    171   5e-51   
ref|XP_010555954.1|  PREDICTED: transcription factor MYB21-like         171   9e-51   
ref|XP_010450678.1|  PREDICTED: transcription factor MYB24-like         170   1e-50   
ref|XP_010441167.1|  PREDICTED: transcription factor MYB24-like         170   1e-50   
ref|XP_010555957.1|  PREDICTED: transcription factor MYB21-like         169   3e-50   
ref|XP_006841613.1|  hypothetical protein AMTR_s00003p00219710          171   3e-50   
ref|XP_009406298.1|  PREDICTED: myb-related protein 305-like            168   5e-50   
dbj|BAL41446.1|  transcription factor MYB21                             168   1e-49   
gb|ABC54967.1|  MYB-like protein                                        162   1e-48   Vitis vinifera
gb|ABC54957.1|  MYB-like protein                                        162   1e-48   Vitis vinifera
gb|KFK37619.1|  hypothetical protein AALP_AA3G006700                    165   1e-48   
gb|ABC54969.1|  MYB-like protein                                        161   1e-48   Vitis vinifera
gb|ABC54983.1|  MYB-like protein                                        160   3e-48   Vitis vinifera
gb|ABC54973.1|  MYB-like protein                                        160   3e-48   Vitis vinifera
gb|ABC54986.1|  MYB-like protein                                        160   4e-48   Vitis vinifera
gb|ABC54990.1|  MYB-like protein                                        159   1e-47   Vitis vinifera
ref|XP_008793362.1|  PREDICTED: transcription factor MYB108-like        164   2e-47   
gb|ABC54966.1|  MYB-like protein                                        158   2e-47   Vitis vinifera
gb|KHN27441.1|  Myb-related protein 305                                 161   3e-47   
ref|XP_008781174.1|  PREDICTED: transcription factor MYB108             164   3e-47   
ref|XP_009386341.1|  PREDICTED: transcription factor MYB108-like        163   6e-47   
gb|ABC54984.1|  MYB-like protein                                        157   6e-47   Vitis vinifera
gb|KHN27530.1|  Myb-related protein 305                                 160   8e-47   
gb|AAL84762.1|AF474129_1  typical P-type R2R3 Myb protein               159   9e-47   Sorghum bicolor [broomcorn]
ref|XP_009402050.1|  PREDICTED: transcription factor MYB108-like        161   2e-46   
ref|XP_002882176.1|  predicted protein                                  159   2e-46   
gb|ABC54985.1|  MYB-like protein                                        155   2e-46   Vitis vinifera
gb|AAM67076.1|  putative transcription factor                           159   3e-46   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010489626.1|  PREDICTED: transcription factor MYB57-like         156   3e-46   
ref|NP_186802.1|  myb domain protein 57                                 159   3e-46   Arabidopsis thaliana [mouse-ear cress]
gb|AFW82705.1|  putative MYB DNA-binding domain superfamily protein     163   3e-46   
ref|XP_004984581.1|  PREDICTED: myb-related protein P-like              162   3e-46   
ref|XP_010921398.1|  PREDICTED: LOW QUALITY PROTEIN: transcriptio...    161   4e-46   
gb|KHN23525.1|  Transcription factor MYB21                              157   5e-46   
emb|CDX91944.1|  BnaC03g32460D                                          158   5e-46   
ref|XP_009385372.1|  PREDICTED: transcription factor MYB108-like        159   6e-46   
ref|XP_010496298.1|  PREDICTED: transcription factor MYB57-like         158   7e-46   
ref|XP_009416464.1|  PREDICTED: myb-related protein 305-like            160   7e-46   
ref|XP_006300020.1|  hypothetical protein CARUB_v10016245mg             157   8e-46   
ref|XP_007223176.1|  hypothetical protein PRUPE_ppa009143mg             160   8e-46   
ref|XP_010485409.1|  PREDICTED: transcription factor MYB57-like         157   9e-46   
ref|XP_010435630.1|  PREDICTED: transcription factor MYB57              157   1e-45   
ref|XP_009612140.1|  PREDICTED: transcription factor MYB108-like        160   1e-45   
emb|CDY49063.1|  BnaC05g48910D                                          157   1e-45   
ref|XP_008243255.1|  PREDICTED: transcription factor MYB21              160   1e-45   
ref|XP_010914654.1|  PREDICTED: transcription factor MYB108-like        159   1e-45   
ref|XP_010024826.1|  PREDICTED: transcription factor MYB108-like        161   1e-45   
gb|ADG56766.1|  putative MYB transcription factor                       160   1e-45   
ref|XP_004963430.1|  PREDICTED: transcription repressor MYB5-like       160   1e-45   
gb|KHN11407.1|  Transcription factor MYB21                              160   2e-45   
ref|NP_001049937.1|  Os03g0315400                                       160   2e-45   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002465358.1|  hypothetical protein SORBIDRAFT_01g037110          160   2e-45   Sorghum bicolor [broomcorn]
ref|XP_002440534.1|  hypothetical protein SORBIDRAFT_09g002675          162   2e-45   Sorghum bicolor [broomcorn]
gb|EAY89765.1|  hypothetical protein OsI_11306                          160   2e-45   Oryza sativa Indica Group [Indian rice]
ref|XP_009392103.1|  PREDICTED: protein ODORANT1-like                   160   2e-45   
ref|XP_009134610.1|  PREDICTED: transcription factor MYB57-like         157   2e-45   
ref|XP_009791846.1|  PREDICTED: transcription factor MYB108-like        159   2e-45   
ref|XP_003555909.1|  PREDICTED: transcription factor MYB108-like        159   2e-45   
ref|XP_002440535.1|  hypothetical protein SORBIDRAFT_09g002680          160   2e-45   Sorghum bicolor [broomcorn]
ref|XP_006649985.1|  PREDICTED: myb-related protein MYBAS1-like         160   2e-45   
gb|KDO72049.1|  hypothetical protein CISIN_1g019911mg                   160   2e-45   
ref|XP_010938192.1|  PREDICTED: transcription factor MYB108-like        159   3e-45   
gb|EEE58945.1|  hypothetical protein OsJ_10621                          159   3e-45   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006488792.1|  PREDICTED: transcription factor MYB108-like        160   3e-45   
ref|XP_006419304.1|  hypothetical protein CICLE_v10005387mg             160   3e-45   
ref|NP_001140397.1|  putative MYB DNA-binding domain superfamily ...    160   3e-45   Zea mays [maize]
ref|XP_009384442.1|  PREDICTED: transcription factor MYB108-like        159   3e-45   
gb|EMT25040.1|  Transcription factor MYB21                              158   4e-45   
ref|XP_009383942.1|  PREDICTED: transcription factor MYB108-like        157   4e-45   
gb|KCW61339.1|  hypothetical protein EUGRSUZ_H04082                     161   4e-45   
gb|EAZ19253.1|  hypothetical protein OsJ_34790                          155   6e-45   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001060700.1|  Os07g0688200                                       158   7e-45   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004239882.1|  PREDICTED: transcription factor MYB108-like        159   7e-45   
dbj|BAC21351.1|  putative typical P-type R2R3 Myb protein               158   8e-45   Oryza sativa Japonica Group [Japonica rice]
emb|CDY37512.1|  BnaA05g33770D                                          155   1e-44   
ref|XP_009415657.1|  PREDICTED: transcription factor MYB108-like        156   1e-44   
ref|XP_009411608.1|  PREDICTED: transcription factor MYB108             156   1e-44   
ref|XP_010941513.1|  PREDICTED: transcription factor MYB108-like        156   2e-44   
ref|XP_010265100.1|  PREDICTED: myb-related protein MYBAS2-like         157   2e-44   
ref|XP_010264231.1|  PREDICTED: transcription factor MYB108-like        157   2e-44   
ref|XP_003561685.1|  PREDICTED: myb-related protein P-like              157   2e-44   
ref|XP_009382479.1|  PREDICTED: transcription factor MYB108-like        156   2e-44   
ref|XP_004299054.1|  PREDICTED: transcription factor WER-like           156   3e-44   
ref|XP_007142925.1|  hypothetical protein PHAVU_007G028700g             157   3e-44   
gb|EAY83532.1|  hypothetical protein OsI_38744                          156   3e-44   Oryza sativa Indica Group [Indian rice]
ref|XP_009417759.1|  PREDICTED: transcription factor MYB108-like        155   3e-44   
gb|ABA98967.1|  Myb-like DNA-binding domain containing protein, e...    156   3e-44   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006658986.1|  PREDICTED: transcription factor MYB108-like        153   3e-44   
ref|XP_009387805.1|  PREDICTED: transcription factor MYB57-like         155   3e-44   
ref|XP_009392050.1|  PREDICTED: transcription factor MYB108-like        155   4e-44   
emb|CAN76459.1|  hypothetical protein VITISV_010827                     155   4e-44   Vitis vinifera
gb|AAO49418.1|AF485900_1  MYB9                                          151   5e-44   Dendrobium sp. XMW-2002-9
ref|XP_009390937.1|  PREDICTED: myb-related protein 305-like            155   5e-44   
ref|XP_003535723.1|  PREDICTED: transcription factor MYB108-like        156   5e-44   
ref|XP_003592641.1|  R2R3-MYB transcription factor                      156   6e-44   
ref|XP_011027944.1|  PREDICTED: transcription factor MYB108-like        155   7e-44   
ref|NP_001068466.2|  Os11g0684000                                       155   8e-44   Oryza sativa Japonica Group [Japonica rice]
gb|AGL81356.1|  R2R3 MYB transcription factor 3                         153   8e-44   
ref|NP_001141891.1|  putative MYB DNA-binding domain superfamily ...    156   8e-44   Zea mays [maize]
gb|AIB05776.1|  MYB transcription factor                                156   8e-44   
ref|XP_006301020.1|  hypothetical protein CARUB_v10021411mg             155   8e-44   
ref|XP_004497077.1|  PREDICTED: transcription factor MYB21-like         155   9e-44   
gb|ADF43752.1|  MYB                                                     155   9e-44   
ref|XP_008389270.1|  PREDICTED: myb-related protein 305                 155   1e-43   
gb|AEV91149.1|  R2R3-MYB protein                                        155   1e-43   
ref|XP_002311369.1|  GmMYB12 family protein                             155   1e-43   Populus trichocarpa [western balsam poplar]
ref|XP_002316060.2|  hypothetical protein POPTR_0010s15970g             155   1e-43   Populus trichocarpa [western balsam poplar]
ref|NP_001056356.1|  Os05g0568200                                       154   1e-43   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009356251.1|  PREDICTED: transcription factor MYB108-like        155   1e-43   
ref|XP_010470777.1|  PREDICTED: myb-related protein 340-like            154   1e-43   
gb|ACP30364.1|  MYB protein                                             155   1e-43   Malus hybrid cultivar
ref|XP_009147443.1|  PREDICTED: transcription factor MYB57-like         152   1e-43   
gb|EAY99070.1|  hypothetical protein OsI_21027                          153   1e-43   Oryza sativa Indica Group [Indian rice]
ref|XP_009587217.1|  PREDICTED: transcription factor MYB24-like         155   1e-43   
ref|XP_011016230.1|  PREDICTED: transcription factor MYB108-like        155   1e-43   
ref|XP_002279433.1|  PREDICTED: transcription factor MYB24              154   1e-43   Vitis vinifera
ref|XP_004962755.1|  PREDICTED: transcription repressor MYB5-like       154   2e-43   
ref|XP_010544950.1|  PREDICTED: transcription factor MYB108-like        153   2e-43   
ref|NP_001182983.1|  putative MYB DNA-binding domain superfamily ...    155   2e-43   
emb|CBI27001.3|  unnamed protein product                                154   2e-43   
ref|XP_003579302.1|  PREDICTED: transcription factor MYB108-like ...    153   2e-43   
ref|XP_010415449.1|  PREDICTED: myb-related protein 305                 154   2e-43   
ref|XP_002463415.1|  hypothetical protein SORBIDRAFT_02g043420          153   3e-43   Sorghum bicolor [broomcorn]
ref|XP_010237154.1|  PREDICTED: transcription factor MYB108-like ...    153   3e-43   
dbj|BAJ91760.1|  predicted protein                                      153   3e-43   
ref|XP_006655601.1|  PREDICTED: transcription factor MYB21-like         152   4e-43   
gb|EAY96442.1|  hypothetical protein OsI_18339                          154   4e-43   Oryza sativa Indica Group [Indian rice]
ref|XP_006663109.1|  PREDICTED: transcription factor MYB108-like        153   4e-43   
gb|EEE62225.1|  hypothetical protein OsJ_17012                          154   4e-43   Oryza sativa Japonica Group [Japonica rice]
gb|EMT01874.1|  Myb-related protein 305                                 154   4e-43   
ref|XP_006664647.1|  PREDICTED: transcription factor MYB108-like        154   5e-43   
ref|XP_008662919.1|  PREDICTED: myb-like protein AA                     155   5e-43   
ref|XP_009380293.1|  PREDICTED: myb-related protein P-like              154   5e-43   
emb|CBI15464.3|  unnamed protein product                                154   5e-43   
ref|XP_009356946.1|  PREDICTED: transcription factor MYB21-like         153   5e-43   
ref|XP_004958743.1|  PREDICTED: myb-related protein 330-like            153   6e-43   
ref|XP_002276526.3|  PREDICTED: transcription factor MYB108             154   6e-43   Vitis vinifera
ref|XP_010523903.1|  PREDICTED: transcription factor MYB108-like        152   6e-43   
gb|KDP27970.1|  hypothetical protein JCGZ_19050                         153   7e-43   
gb|EEC69869.1|  hypothetical protein OsI_00232                          154   9e-43   Oryza sativa Indica Group [Indian rice]
ref|XP_006654961.1|  PREDICTED: transcription factor MYB108-like        152   9e-43   
ref|XP_011010946.1|  PREDICTED: transcription factor MYB108-like        153   1e-42   
gb|EMT33189.1|  Myb-related protein 305                                 152   1e-42   
ref|XP_007044287.1|  Myb domain protein 62, putative                    152   1e-42   
ref|XP_008240255.1|  PREDICTED: transcription factor MYB108-like        152   1e-42   
ref|XP_002311464.2|  hypothetical protein POPTR_0008s12130g             152   1e-42   Populus trichocarpa [western balsam poplar]
ref|XP_004239413.2|  PREDICTED: transcription factor MYB108             151   1e-42   
ref|XP_007209375.1|  hypothetical protein PRUPE_ppa008877mg             152   2e-42   
ref|XP_009778774.1|  PREDICTED: transcription factor MYB24-like         151   2e-42   
ref|XP_003520762.1|  PREDICTED: transcription factor MYB108-like        151   2e-42   
gb|KDP29432.1|  hypothetical protein JCGZ_18353                         152   2e-42   
ref|XP_010511820.1|  PREDICTED: transcription factor MYB21-like         151   2e-42   
ref|XP_010099251.1|  Transcription factor                               152   2e-42   
ref|NP_001280981.1|  transcription factor MYB21                         152   2e-42   
gb|AAL84765.1|AF474132_1  typical P-type R2R3 Myb protein               148   2e-42   Sorghum bicolor [broomcorn]
gb|KFK41242.1|  hypothetical protein AALP_AA2G104300                    151   2e-42   
ref|XP_009390416.1|  PREDICTED: transcription factor MYB57              151   2e-42   
ref|NP_001041908.1|  Os01g0128000                                       153   2e-42   Oryza sativa Japonica Group [Japonica rice]
dbj|BAB18296.1|  putative dehydration-induced myb-related protein...    152   2e-42   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002318546.1|  hypothetical protein POPTR_0012s05200g             152   2e-42   Populus trichocarpa [western balsam poplar]
ref|XP_010045365.1|  PREDICTED: transcription factor MYB108             152   2e-42   
gb|AFR67332.1|  R2R3 MYB protein                                        152   2e-42   
gb|EMT04483.1|  Transcription factor MYB21                              151   2e-42   
ref|XP_011045847.1|  PREDICTED: myb-related protein Zm38-like           152   2e-42   
gb|ABU93236.1|  R2R3 Myb-like protein                                   152   3e-42   Triticum aestivum [Canadian hard winter wheat]
ref|XP_010926024.1|  PREDICTED: myb-related protein 305-like isof...    151   3e-42   
emb|CDX84981.1|  BnaC05g20740D                                          151   3e-42   
ref|XP_010551244.1|  PREDICTED: myb-related protein 305-like            151   3e-42   
ref|XP_009797951.1|  PREDICTED: transcription factor MYB108-like        150   3e-42   
ref|XP_008667098.1|  PREDICTED: putative MYB DNA-binding domain s...    152   3e-42   
ref|XP_010477945.1|  PREDICTED: transcription factor MYB108-like ...    150   3e-42   
gb|AFW60134.1|  putative MYB DNA-binding domain superfamily protein     152   4e-42   
gb|EMT03743.1|  Transcription factor MYB21                              145   4e-42   
ref|XP_008677864.1|  PREDICTED: transcription factor MYB108-like        152   4e-42   
ref|NP_001141174.1|  MYB transcription factor                           152   4e-42   
emb|CCC14989.1|  Myb transcription factor                               152   5e-42   
ref|NP_564230.1|  putative transcription factor (MYB116)                150   5e-42   
emb|CDP00641.1|  unnamed protein product                                150   6e-42   
ref|XP_002887176.1|  hypothetical protein ARALYDRAFT_339072             150   6e-42   
ref|XP_011022276.1|  PREDICTED: transcription factor MYB108             150   6e-42   
ref|XP_002455261.1|  hypothetical protein SORBIDRAFT_03g007360          152   6e-42   
ref|XP_009398691.1|  PREDICTED: transcription factor MYB108-like        149   7e-42   
emb|CDY42115.1|  BnaA09g28450D                                          150   7e-42   
ref|XP_003536859.1|  PREDICTED: transcription factor MYB108             149   7e-42   
ref|XP_006643700.1|  PREDICTED: transcription repressor MYB4-like       151   7e-42   
ref|XP_007160381.1|  hypothetical protein PHAVU_002G317000g             150   7e-42   
gb|KHN14149.1|  Transcription factor MYB21                              144   9e-42   
ref|XP_008807088.1|  PREDICTED: transcription factor MYB108-like        150   1e-41   
gb|AGN52055.1|  MYB-related transcription factor                        149   1e-41   
ref|XP_009115302.1|  PREDICTED: transcription factor MYB57              149   1e-41   
gb|AIU39030.1|  myb transcription factor 1                              149   1e-41   
ref|XP_006842316.1|  hypothetical protein AMTR_s00079p00140660          149   1e-41   
ref|XP_008445685.1|  PREDICTED: transcription factor MYB108-like        149   1e-41   
ref|NP_001241747.1|  uncharacterized protein LOC100856932               150   1e-41   
ref|XP_003553674.1|  PREDICTED: transcription factor MYB108-like        148   1e-41   
ref|NP_001132469.1|  putative MYB DNA-binding domain superfamily ...    150   1e-41   
ref|XP_007145121.1|  hypothetical protein PHAVU_007G211800g             148   2e-41   
ref|XP_009103061.1|  PREDICTED: transcription factor MYB24-like         149   2e-41   
ref|XP_002451276.1|  hypothetical protein SORBIDRAFT_05g026820          150   2e-41   
ref|XP_004300516.1|  PREDICTED: transcription factor TT2-like           149   2e-41   
gb|AAG51527.1|AC051631_7  myb-related transcription factor (cpm10...    147   2e-41   
ref|XP_007036545.1|  Myb domain protein 62, putative                    149   2e-41   
ref|XP_006344301.1|  PREDICTED: transcription factor MYB48-like         148   2e-41   
ref|NP_001235837.1|  MYB transcription factor MYB184                    148   2e-41   
ref|XP_003569075.1|  PREDICTED: protein ODORANT1-like                   150   2e-41   
emb|CDX95420.1|  BnaC04g27380D                                          147   2e-41   
emb|CDY03859.1|  BnaC07g10840D                                          149   2e-41   
gb|KDO86883.1|  hypothetical protein CISIN_1g043269mg                   146   2e-41   
ref|XP_008672180.1|  PREDICTED: putative MYB DNA-binding domain s...    150   2e-41   
ref|XP_006341595.1|  PREDICTED: myb-related protein 305-like            148   2e-41   
ref|NP_001170329.1|  putative MYB DNA-binding domain superfamily ...    150   2e-41   
ref|XP_008780184.1|  PREDICTED: transcription factor MYB108-like        143   2e-41   
ref|XP_004512906.1|  PREDICTED: transcription factor MYB21-like         148   2e-41   
ref|XP_011070788.1|  PREDICTED: transcription factor MYB24              148   3e-41   
ref|XP_009394051.1|  PREDICTED: transcription factor MYB108-like        149   3e-41   
ref|XP_004495882.1|  PREDICTED: protein ODORANT1-like                   148   3e-41   
gb|AGN52122.1|  MYB-related transcription factor                        147   3e-41   
ref|NP_176999.1|  R2R3-MYB transcription  family                        148   3e-41   
ref|XP_008674336.1|  PREDICTED: myb-related protein 305                 149   3e-41   
ref|XP_007154150.1|  hypothetical protein PHAVU_003G094600g             148   3e-41   
ref|XP_006407939.1|  hypothetical protein EUTSA_v10021126mg             149   3e-41   
ref|XP_009105377.1|  PREDICTED: transcription factor MYB24-like         148   4e-41   
ref|XP_009626235.1|  PREDICTED: transcription factor MYB108-like        147   5e-41   
ref|XP_010681493.1|  PREDICTED: transcription factor MYB108 isofo...    148   5e-41   
ref|XP_004236420.2|  PREDICTED: transcription factor MYB108-like        147   5e-41   
emb|CDX96033.1|  BnaA07g26980D                                          147   5e-41   
ref|XP_008797802.1|  PREDICTED: transcription factor MYB108-like        148   5e-41   
ref|NP_564519.1|  myb domain protein 112                                146   5e-41   
ref|XP_010477944.1|  PREDICTED: transcription factor MYB108-like ...    147   5e-41   
ref|XP_009413670.1|  PREDICTED: transcription factor MYB108-like        147   5e-41   
ref|XP_003565287.1|  PREDICTED: transcription factor MYB24-like         147   6e-41   
ref|XP_006391151.1|  hypothetical protein EUTSA_v10018962mg             147   6e-41   
gb|ABK28415.1|  unknown                                                 147   6e-41   
gb|KHN16570.1|  Transcription factor MYB21                              148   6e-41   
emb|CDY69953.1|  BnaAnng32120D                                          147   6e-41   
emb|CDY69488.1|  BnaCnng63810D                                          147   6e-41   
ref|XP_004968076.1|  PREDICTED: myb-related protein P-like              149   7e-41   
ref|XP_011007699.1|  PREDICTED: transcription factor MYB24              148   7e-41   
ref|XP_010916405.1|  PREDICTED: transcription factor MYB21-like         148   7e-41   
ref|XP_004160829.1|  PREDICTED: transcription factor MYB3-like          147   7e-41   
ref|XP_006584643.1|  PREDICTED: MYB transcription factor MYB184 i...    148   8e-41   
gb|AHW45787.1|  MYB transcription factor                                147   8e-41   
ref|XP_009118865.1|  PREDICTED: transcription factor MYB108-like        147   8e-41   
ref|NP_001241924.1|  uncharacterized LOC100819467                       146   8e-41   
ref|XP_004229031.1|  PREDICTED: transcription factor MYB108-like        147   8e-41   
ref|XP_006468714.1|  PREDICTED: transcription factor MYB108-like        148   8e-41   
ref|XP_006448450.1|  hypothetical protein CICLE_v10015986mg             148   9e-41   
ref|XP_002443369.1|  hypothetical protein SORBIDRAFT_08g018370          148   9e-41   
tpg|DAA47022.1|  TPA: putative MYB DNA-binding domain superfamily...    148   1e-40   
ref|XP_010532345.1|  PREDICTED: myb-related protein 340-like            147   1e-40   
ref|XP_010270853.1|  PREDICTED: transcription factor MYB108             147   1e-40   
ref|XP_002321477.2|  hypothetical protein POPTR_0015s03770g             148   1e-40   
ref|XP_002894088.1|  hypothetical protein ARALYDRAFT_473935             145   1e-40   
ref|XP_011011974.1|  PREDICTED: myb-related protein Myb4-like           148   1e-40   
gb|EPS73052.1|  hypothetical protein M569_01708                         142   1e-40   
ref|XP_009409973.1|  PREDICTED: transcription factor MYB108-like        147   1e-40   
ref|XP_009105051.1|  PREDICTED: transcription factor MYB21-like         146   1e-40   
ref|XP_010094742.1|  Transcription factor                               147   1e-40   
emb|CDP19695.1|  unnamed protein product                                147   1e-40   
ref|XP_003591357.1|  Myb-like transcription factor                      145   2e-40   
ref|XP_009383607.1|  PREDICTED: transcription factor MYB108-like        147   2e-40   
gb|KFK36115.1|  hypothetical protein AALP_AA4G080100                    144   2e-40   
gb|EAY81783.1|  hypothetical protein OsI_36958                          141   2e-40   
emb|CDY27504.1|  BnaC04g51450D                                          145   2e-40   
ref|XP_011076599.1|  PREDICTED: transcription factor MYB108-like        146   2e-40   
ref|XP_006397911.1|  hypothetical protein EUTSA_v10001584mg             145   2e-40   
ref|XP_006492457.1|  PREDICTED: transcription factor MYB108-like        146   2e-40   
ref|NP_182241.1|  R2R3 MYB DNA binding domain transcription factor      145   2e-40   
ref|XP_010506747.1|  PREDICTED: transcription factor MYB108-like        145   2e-40   
ref|XP_010507918.1|  PREDICTED: transcription factor MYB108-like        145   3e-40   
ref|XP_002880286.1|  MYB transcription factor Atmyb2                    145   3e-40   
ref|XP_010499121.1|  PREDICTED: myb-related protein 305-like            145   3e-40   
ref|XP_006444559.1|  hypothetical protein CICLE_v10021479mg             145   3e-40   
ref|XP_009403972.1|  PREDICTED: transcription factor MYB108-like ...    146   3e-40   
ref|NP_001042810.1|  Os01g0298400                                       145   4e-40   
ref|XP_006644414.1|  PREDICTED: transcription factor MYB21-like         143   4e-40   
ref|XP_009142557.1|  PREDICTED: transcription factor MYB108             145   5e-40   
gb|AFM77857.1|  myb domain protein                                      145   5e-40   
gb|KFK44510.1|  hypothetical protein AALP_AA1G266100                    145   5e-40   
dbj|BAB62112.1|  MYB transcription factor Atmyb2                        144   6e-40   
gb|KDP20133.1|  hypothetical protein JCGZ_05902                         145   6e-40   
dbj|BAB62119.1|  MYB transcription factor Atmyb2                        144   6e-40   
dbj|BAB62114.1|  MYB transcription factor Atmyb2                        144   6e-40   
dbj|BAB62121.1|  MYB transcription factor Atmyb2                        144   6e-40   
ref|XP_009403971.1|  PREDICTED: transcription factor MYB108-like ...    146   6e-40   
emb|CDY01906.1|  BnaC06g29460D                                          145   6e-40   
emb|CDY12705.1|  BnaA02g13730D                                          145   6e-40   
dbj|BAJ99893.1|  predicted protein                                      146   7e-40   
dbj|BAB62115.1|  MYB transcription factor Atmyb2                        144   7e-40   
ref|XP_009127621.1|  PREDICTED: transcription factor MYB24-like         145   7e-40   
dbj|BAB62110.1|  MYB transcription factor Atmyb2                        144   7e-40   
gb|KHN20739.1|  Myb-related protein 305                                 145   8e-40   
ref|XP_006393501.1|  hypothetical protein EUTSA_v10012051mg             143   8e-40   
ref|XP_003528951.2|  PREDICTED: transcription factor RAX3-like          145   8e-40   
ref|XP_003591359.1|  MYB transcription factor                           144   8e-40   
ref|NP_001043670.1|  Os01g0637800                                       143   9e-40   
gb|ABR28342.1|  MYB transcription factor MYB61                          144   9e-40   
gb|EEE55059.1|  hypothetical protein OsJ_02763                          143   9e-40   
gb|KDP40980.1|  hypothetical protein JCGZ_24979                         144   9e-40   
gb|KFK37485.1|  hypothetical protein AALP_AA4G263500                    144   9e-40   
gb|EEC71159.1|  hypothetical protein OsI_03001                          143   9e-40   
gb|ACU18510.1|  unknown                                                 145   1e-39   
ref|NP_001235789.1|  MYB transcription factor MYB84                     145   1e-39   
ref|XP_009804370.1|  PREDICTED: transcription factor MYB57-like         144   1e-39   
ref|XP_009347244.1|  PREDICTED: transcription factor WER-like           144   1e-39   
gb|AHY94990.1|  MYB2                                                    144   1e-39   
ref|XP_002534590.1|  DNA binding protein, putative                      143   1e-39   
ref|XP_004963592.1|  PREDICTED: transcription factor MYB12-like         145   1e-39   
ref|XP_010276490.1|  PREDICTED: transcription factor MYB108-like        144   1e-39   
ref|XP_002315935.1|  hypothetical protein POPTR_0010s13290g             144   2e-39   
gb|EMT11819.1|  Transcription factor MYB21                              145   2e-39   
ref|XP_006337993.1|  PREDICTED: myb-related protein 305-like            144   2e-39   
ref|XP_004495885.1|  PREDICTED: transcription factor WER-like           143   2e-39   
ref|NP_001242391.1|  MYB12 protein                                      142   2e-39   
dbj|BAH83498.1|  MYB12 transcription factor a                           142   2e-39   
ref|XP_008367580.1|  PREDICTED: transcription factor MYB108-like        144   2e-39   
ref|XP_006294780.1|  hypothetical protein CARUB_v10023831mg             143   2e-39   
emb|CDY54094.1|  BnaC02g46060D                                          143   2e-39   
ref|XP_010518412.1|  PREDICTED: transcription factor MYB108-like        143   2e-39   
gb|EMS46598.1|  Transcription factor MYB21                              145   2e-39   
emb|CDM80629.1|  unnamed protein product                                144   3e-39   
ref|XP_011002746.1|  PREDICTED: transcription factor MYB108-like        143   3e-39   
ref|XP_010461601.1|  PREDICTED: myb-related protein 340                 142   3e-39   
dbj|BAB62118.1|  MYB transcription factor Atmyb2                        142   4e-39   
ref|XP_007147396.1|  hypothetical protein PHAVU_006G120800g             144   4e-39   
ref|XP_004979993.1|  PREDICTED: myb-related protein Zm38-like           144   4e-39   
ref|XP_006485803.1|  PREDICTED: transcription factor MYB108-like        143   5e-39   
ref|XP_006440994.1|  hypothetical protein CICLE_v10021157mg             143   5e-39   
ref|XP_009621085.1|  PREDICTED: transcription factor MYB108-like        143   5e-39   
ref|XP_002526991.1|  r2r3-myb transcription factor, putative            143   5e-39   
gb|AGN52033.1|  MYB-related transcription factor                        142   6e-39   
ref|XP_010044254.1|  PREDICTED: transcription factor MYB24-like         142   6e-39   
ref|XP_011100718.1|  PREDICTED: transcription factor MYB108-like        143   6e-39   
ref|XP_007163207.1|  hypothetical protein PHAVU_001G215200g             141   1e-38   
ref|XP_008438973.1|  PREDICTED: transcription factor MYB108             142   1e-38   
ref|XP_009591106.1|  PREDICTED: transcription factor MYB57-like         142   1e-38   
ref|XP_002455504.1|  hypothetical protein SORBIDRAFT_03g012310          142   1e-38   
ref|XP_006644098.1|  PREDICTED: transcription factor MYB108-like        142   1e-38   
ref|XP_007163206.1|  hypothetical protein PHAVU_001G215100g             140   1e-38   
ref|XP_011071358.1|  PREDICTED: transcription factor MYB108-like        142   1e-38   
ref|XP_006395046.1|  hypothetical protein EUTSA_v10004588mg             142   1e-38   
ref|XP_008390410.1|  PREDICTED: transcription factor MYB108-like        143   1e-38   
ref|XP_010666321.1|  PREDICTED: transcription factor MYB108-like        142   1e-38   
ref|XP_009784472.1|  PREDICTED: transcription factor MYB108-like        142   2e-38   
ref|XP_010440825.1|  PREDICTED: transcription factor MYB108-like        141   2e-38   
ref|XP_003534166.2|  PREDICTED: transcription repressor MYB6-like       141   2e-38   
ref|XP_003546301.1|  PREDICTED: transcription factor MYB108 isofo...    142   2e-38   
ref|XP_010038307.1|  PREDICTED: transcription factor MYB108-like        140   2e-38   
ref|XP_007227100.1|  hypothetical protein PRUPE_ppa025672mg             142   2e-38   
ref|XP_002456023.1|  hypothetical protein SORBIDRAFT_03g029050          141   2e-38   
ref|XP_004165513.1|  PREDICTED: transcription repressor MYB6-like       140   2e-38   
gb|KHN32052.1|  Myb-related protein 305                                 141   2e-38   
ref|XP_004150815.1|  PREDICTED: transcription repressor MYB6-like       140   2e-38   
ref|XP_003533124.1|  PREDICTED: transcription factor MYB108-like        142   2e-38   
ref|XP_008675301.1|  PREDICTED: myb-related protein 305-like            140   2e-38   
gb|KHN00328.1|  Myb-related protein 305                                 139   2e-38   
ref|XP_006280880.1|  hypothetical protein CARUB_v10026871mg             141   3e-38   
gb|ADR63291.1|  MYB146                                                  140   3e-38   
emb|CDP20749.1|  unnamed protein product                                140   3e-38   
emb|CCA29096.1|  putative MYB transcription factor                      142   3e-38   
gb|ACU20373.1|  unknown                                                 141   3e-38   
ref|XP_003594670.1|  Myb-like transcription factor                      141   3e-38   
emb|CBH32532.1|  Myb-like DNA-binding domain containing protein,e...    140   3e-38   
ref|XP_009360147.1|  PREDICTED: transcription factor MYB108-like        140   4e-38   
gb|ABR28334.1|  MYB transcription factor MYB39                          141   4e-38   
ref|XP_010442426.1|  PREDICTED: transcription factor MYB108-like        140   4e-38   
ref|XP_003565694.1|  PREDICTED: transcription factor MYB108-like        140   4e-38   
gb|EMT27664.1|  Transcription factor MYB21                              139   5e-38   
ref|XP_010102909.1|  Myb-related protein 305                            141   5e-38   
gb|KGN57183.1|  hypothetical protein Csa_3G168940                       140   5e-38   
ref|XP_004295042.1|  PREDICTED: uncharacterized protein LOC101295899    141   5e-38   
ref|XP_008227817.1|  PREDICTED: transcription factor MYB108             140   5e-38   
emb|CDY58599.1|  BnaA07g36940D                                          135   5e-38   
gb|EPS64015.1|  hypothetical protein M569_10766                         140   5e-38   
ref|NP_001267991.1|  R2R3 transcription factor MYB108-like protein 1    140   7e-38   
ref|XP_008348686.1|  PREDICTED: transcription factor MYB108-like        139   7e-38   
emb|CBI22842.3|  unnamed protein product                                140   7e-38   
gb|KDP40983.1|  hypothetical protein JCGZ_24982                         140   8e-38   
emb|CAN63179.1|  hypothetical protein VITISV_029107                     140   8e-38   
ref|XP_010314656.1|  PREDICTED: ABA-induced MYB transcription fac...    138   8e-38   
ref|XP_006355725.1|  PREDICTED: transcription factor MYB21-like         140   9e-38   
ref|XP_004967585.1|  PREDICTED: myb-related protein Myb4-like           139   9e-38   
ref|XP_008223427.1|  PREDICTED: transcription factor MYB108             140   9e-38   
ref|XP_008374762.1|  PREDICTED: transcription factor WER-like           139   9e-38   
ref|XP_004486524.1|  PREDICTED: myb-related protein 330-like            140   9e-38   
ref|XP_010314657.1|  PREDICTED: ABA-induced MYB transcription fac...    138   1e-37   
ref|XP_009367189.1|  PREDICTED: transcription factor MYB108-like        139   1e-37   



>gb|AGI60280.1| transcription factor MYB305 [Nicotiana tabacum]
Length=192

 Score =   201 bits (512),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 94/96 (98%), Positives = 96/96 (100%), Gaps = 0/96 (0%)
 Frame = +3

Query  39   MDKKPCNSQDVEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLN  218
            MDKKPCNSQDVE+RKGPWTMEEDLILINYIANHGEGVWNSLA+SAGLKRTGKSCRLRWLN
Sbjct  1    MDKKPCNSQDVEVRKGPWTMEEDLILINYIANHGEGVWNSLAKSAGLKRTGKSCRLRWLN  60

Query  219  YLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKH  326
            YLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKH
Sbjct  61   YLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKH  96



>gb|ABU97107.1| MYB305 protein v1 [Nicotiana langsdorffii x Nicotiana sanderae]
Length=192

 Score =   201 bits (512),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 94/96 (98%), Positives = 96/96 (100%), Gaps = 0/96 (0%)
 Frame = +3

Query  39   MDKKPCNSQDVEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLN  218
            MDKKPCNSQDVE+RKGPWTMEEDLILINYIANHGEGVWNSLA+SAGLKRTGKSCRLRWLN
Sbjct  1    MDKKPCNSQDVEVRKGPWTMEEDLILINYIANHGEGVWNSLAKSAGLKRTGKSCRLRWLN  60

Query  219  YLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKH  326
            YLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKH
Sbjct  61   YLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKH  96



>ref|XP_009618404.1| PREDICTED: myb-related protein 305-like [Nicotiana tomentosiformis]
Length=192

 Score =   201 bits (512),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 94/96 (98%), Positives = 96/96 (100%), Gaps = 0/96 (0%)
 Frame = +3

Query  39   MDKKPCNSQDVEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLN  218
            MDKKPCNSQDVE+RKGPWTMEEDLILINYIANHGEGVWNSLA+SAGLKRTGKSCRLRWLN
Sbjct  1    MDKKPCNSQDVEVRKGPWTMEEDLILINYIANHGEGVWNSLAKSAGLKRTGKSCRLRWLN  60

Query  219  YLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKH  326
            YLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKH
Sbjct  61   YLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKH  96



>gb|ABU97106.1| MYB305 protein v2 [Nicotiana langsdorffii x Nicotiana sanderae]
Length=192

 Score =   201 bits (512),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 94/96 (98%), Positives = 96/96 (100%), Gaps = 0/96 (0%)
 Frame = +3

Query  39   MDKKPCNSQDVEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLN  218
            MDKKPCNSQDVE+RKGPWTMEEDLILINYIANHGEGVWNSLA+SAGLKRTGKSCRLRWLN
Sbjct  1    MDKKPCNSQDVEVRKGPWTMEEDLILINYIANHGEGVWNSLAKSAGLKRTGKSCRLRWLN  60

Query  219  YLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKH  326
            YLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKH
Sbjct  61   YLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKH  96



>ref|XP_009791355.1| PREDICTED: myb-related protein 305-like [Nicotiana sylvestris]
Length=192

 Score =   201 bits (512),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 94/96 (98%), Positives = 96/96 (100%), Gaps = 0/96 (0%)
 Frame = +3

Query  39   MDKKPCNSQDVEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLN  218
            MDKKPCNSQDVE+RKGPWTMEEDLILINYIANHGEGVWNSLA+SAGLKRTGKSCRLRWLN
Sbjct  1    MDKKPCNSQDVEVRKGPWTMEEDLILINYIANHGEGVWNSLAKSAGLKRTGKSCRLRWLN  60

Query  219  YLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKH  326
            YLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKH
Sbjct  61   YLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKH  96



>gb|ADT82939.1| non-opening 1 [Nicotiana attenuata]
Length=192

 Score =   201 bits (512),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 94/96 (98%), Positives = 96/96 (100%), Gaps = 0/96 (0%)
 Frame = +3

Query  39   MDKKPCNSQDVEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLN  218
            MDKKPCNSQDVE+RKGPWTMEEDLILINYIANHGEGVWNSLA+SAGLKRTGKSCRLRWLN
Sbjct  1    MDKKPCNSQDVEVRKGPWTMEEDLILINYIANHGEGVWNSLAKSAGLKRTGKSCRLRWLN  60

Query  219  YLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKH  326
            YLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKH
Sbjct  61   YLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKH  96



>emb|CDP02096.1| unnamed protein product [Coffea canephora]
Length=189

 Score =   201 bits (511),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 94/96 (98%), Positives = 95/96 (99%), Gaps = 0/96 (0%)
 Frame = +3

Query  39   MDKKPCNSQDVEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLN  218
            MDKKPCNSQD E+RKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLN
Sbjct  1    MDKKPCNSQDAEVRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLN  60

Query  219  YLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKH  326
            YLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKH
Sbjct  61   YLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKH  96



>gb|ACB12237.1| MYB-like protein NON1 [Petunia x hybrida]
 gb|ACB59077.1| Myb-like transcription factor EOBII [Petunia x hybrida]
 gb|AEC11893.1| MYB transcription factor EOBII [Petunia axillaris]
 gb|AEC11894.1| MYB transcription factor EOBII [Petunia exserta]
Length=197

 Score =   200 bits (508),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 93/96 (97%), Positives = 95/96 (99%), Gaps = 0/96 (0%)
 Frame = +3

Query  39   MDKKPCNSQDVEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLN  218
            MDKKPCNSQD E+RKGPWTMEEDLILINYIANHGEGVWNSLA+SAGLKRTGKSCRLRWLN
Sbjct  1    MDKKPCNSQDAEVRKGPWTMEEDLILINYIANHGEGVWNSLAKSAGLKRTGKSCRLRWLN  60

Query  219  YLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKH  326
            YLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKH
Sbjct  61   YLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKH  96



>sp|P81391.1|MYB05_ANTMA RecName: Full=Myb-related protein 305 [Antirrhinum majus]
Length=205

 Score =   200 bits (509),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 94/95 (99%), Positives = 95/95 (100%), Gaps = 0/95 (0%)
 Frame = +3

Query  39   MDKKPCNSQDVEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLN  218
            MDKKPCNSQDVE+RKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLN
Sbjct  1    MDKKPCNSQDVEVRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLN  60

Query  219  YLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAK  323
            YLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAK
Sbjct  61   YLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAK  95



>gb|AGC00813.1| EOBI [Petunia x hybrida]
Length=201

 Score =   200 bits (508),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 93/96 (97%), Positives = 95/96 (99%), Gaps = 0/96 (0%)
 Frame = +3

Query  39   MDKKPCNSQDVEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLN  218
            MDK+ CNSQDVE+RKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLN
Sbjct  1    MDKRTCNSQDVEVRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLN  60

Query  219  YLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKH  326
            YLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKH
Sbjct  61   YLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKH  96



>gb|AGC00814.1| EOBI [Petunia x hybrida]
Length=202

 Score =   200 bits (508),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 93/96 (97%), Positives = 95/96 (99%), Gaps = 0/96 (0%)
 Frame = +3

Query  39   MDKKPCNSQDVEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLN  218
            MDK+ CNSQDVE+RKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLN
Sbjct  1    MDKRTCNSQDVEVRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLN  60

Query  219  YLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKH  326
            YLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKH
Sbjct  61   YLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKH  96



>ref|XP_004232307.1| PREDICTED: myb-related protein 340 [Solanum lycopersicum]
Length=203

 Score =   198 bits (504),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 92/96 (96%), Positives = 95/96 (99%), Gaps = 0/96 (0%)
 Frame = +3

Query  39   MDKKPCNSQDVEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLN  218
            MDK+ C+SQDVE+RKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLN
Sbjct  1    MDKRTCDSQDVEVRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLN  60

Query  219  YLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKH  326
            YLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKH
Sbjct  61   YLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKH  96



>ref|XP_011097428.1| PREDICTED: myb-related protein 305 [Sesamum indicum]
Length=199

 Score =   198 bits (503),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 93/96 (97%), Positives = 95/96 (99%), Gaps = 0/96 (0%)
 Frame = +3

Query  39   MDKKPCNSQDVEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLN  218
            MDKKPCNSQD E+RKGPWTMEEDLILINYIANHGEGVWNSLA+SAGLKRTGKSCRLRWLN
Sbjct  1    MDKKPCNSQDPEVRKGPWTMEEDLILINYIANHGEGVWNSLAKSAGLKRTGKSCRLRWLN  60

Query  219  YLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKH  326
            YLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKH
Sbjct  61   YLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKH  96



>ref|XP_006338574.1| PREDICTED: myb-related protein 340-like [Solanum tuberosum]
Length=207

 Score =   198 bits (503),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 92/96 (96%), Positives = 95/96 (99%), Gaps = 0/96 (0%)
 Frame = +3

Query  39   MDKKPCNSQDVEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLN  218
            MDK+ C+SQDVE+RKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLN
Sbjct  1    MDKRTCDSQDVEVRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLN  60

Query  219  YLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKH  326
            YLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKH
Sbjct  61   YLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKH  96



>ref|XP_007031495.1| Myb domain protein 21 [Theobroma cacao]
 gb|EOY02421.1| Myb domain protein 21 [Theobroma cacao]
Length=194

 Score =   197 bits (502),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 92/96 (96%), Positives = 95/96 (99%), Gaps = 0/96 (0%)
 Frame = +3

Query  39   MDKKPCNSQDVEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLN  218
            MDKKPC SQDVE+RKGPWTMEEDLILINYIANHGEGVWNSLA++AGLKRTGKSCRLRWLN
Sbjct  1    MDKKPCKSQDVEVRKGPWTMEEDLILINYIANHGEGVWNSLAKAAGLKRTGKSCRLRWLN  60

Query  219  YLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKH  326
            YLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKH
Sbjct  61   YLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKH  96



>ref|XP_009613846.1| PREDICTED: myb-related protein 305-like [Nicotiana tomentosiformis]
Length=199

 Score =   197 bits (501),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 91/96 (95%), Positives = 95/96 (99%), Gaps = 0/96 (0%)
 Frame = +3

Query  39   MDKKPCNSQDVEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLN  218
            MDK+ CNSQDVE+RKGPWTMEEDLILINYIANHG+GVWNSLARSAGLKRTGKSCRLRWLN
Sbjct  1    MDKRTCNSQDVEVRKGPWTMEEDLILINYIANHGDGVWNSLARSAGLKRTGKSCRLRWLN  60

Query  219  YLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKH  326
            YLRPDVRRGNITPEEQLLIMELHAKWGN+WSKIAKH
Sbjct  61   YLRPDVRRGNITPEEQLLIMELHAKWGNKWSKIAKH  96



>ref|XP_008341440.1| PREDICTED: myb-related protein 305-like [Malus domestica]
Length=195

 Score =   197 bits (500),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 94/98 (96%), Positives = 96/98 (98%), Gaps = 2/98 (2%)
 Frame = +3

Query  39   MDKKPCNS--QDVEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRW  212
            MDKKPCNS  QDVE+RKGPWTMEEDLILINYIANHGEGVWNSLA+SAGLKRTGKSCRLRW
Sbjct  1    MDKKPCNSSSQDVEVRKGPWTMEEDLILINYIANHGEGVWNSLAKSAGLKRTGKSCRLRW  60

Query  213  LNYLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKH  326
            LNYLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKH
Sbjct  61   LNYLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKH  98



>gb|AFJ21697.1| MYB24 [Gossypium hirsutum]
Length=210

 Score =   197 bits (501),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 91/96 (95%), Positives = 94/96 (98%), Gaps = 0/96 (0%)
 Frame = +3

Query  39   MDKKPCNSQDVEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLN  218
            MDKKPC SQ+VE+RKGPWTMEEDLILINYIANHGEGVWNSLAR+AGLKRTGKSCRLRWLN
Sbjct  1    MDKKPCKSQEVEVRKGPWTMEEDLILINYIANHGEGVWNSLARAAGLKRTGKSCRLRWLN  60

Query  219  YLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKH  326
            YLRPDVRRGNITPEEQ LIMELHAKWGNRWSKIAKH
Sbjct  61   YLRPDVRRGNITPEEQFLIMELHAKWGNRWSKIAKH  96



>ref|XP_008230585.1| PREDICTED: myb-related protein 305-like [Prunus mume]
Length=213

 Score =   197 bits (501),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 93/100 (93%), Positives = 98/100 (98%), Gaps = 2/100 (2%)
 Frame = +3

Query  33   KKMDKKPCNS--QDVEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRL  206
            ++MDKKPCNS  QDVE+RKGPWTMEEDLILINYIANHGEGVWNSLA++AGLKRTGKSCRL
Sbjct  14   QEMDKKPCNSSSQDVEVRKGPWTMEEDLILINYIANHGEGVWNSLAKAAGLKRTGKSCRL  73

Query  207  RWLNYLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKH  326
            RWLNYLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKH
Sbjct  74   RWLNYLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKH  113



>ref|XP_009375123.1| PREDICTED: myb-related protein 305-like [Pyrus x bretschneideri]
 ref|XP_009377203.1| PREDICTED: myb-related protein 305-like [Pyrus x bretschneideri]
Length=195

 Score =   196 bits (498),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 94/98 (96%), Positives = 96/98 (98%), Gaps = 2/98 (2%)
 Frame = +3

Query  39   MDKKPCNS--QDVEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRW  212
            MDKKPCNS  QDVE+RKGPWTMEEDLILINYIANHGEGVWNSLA+SAGLKRTGKSCRLRW
Sbjct  1    MDKKPCNSSSQDVEVRKGPWTMEEDLILINYIANHGEGVWNSLAKSAGLKRTGKSCRLRW  60

Query  213  LNYLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKH  326
            LNYLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKH
Sbjct  61   LNYLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKH  98



>ref|XP_007217766.1| hypothetical protein PRUPE_ppa011751mg [Prunus persica]
 gb|EMJ18965.1| hypothetical protein PRUPE_ppa011751mg [Prunus persica]
Length=198

 Score =   195 bits (496),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 93/98 (95%), Positives = 96/98 (98%), Gaps = 2/98 (2%)
 Frame = +3

Query  39   MDKKPCNS--QDVEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRW  212
            MDKKPCNS  QDVE+RKGPWTMEEDLILINYIANHGEGVWNSLA++AGLKRTGKSCRLRW
Sbjct  1    MDKKPCNSSSQDVEVRKGPWTMEEDLILINYIANHGEGVWNSLAKAAGLKRTGKSCRLRW  60

Query  213  LNYLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKH  326
            LNYLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKH
Sbjct  61   LNYLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKH  98



>sp|P81396.1|MYB40_ANTMA RecName: Full=Myb-related protein 340 [Antirrhinum majus]
Length=198

 Score =   195 bits (496),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 90/96 (94%), Positives = 95/96 (99%), Gaps = 0/96 (0%)
 Frame = +3

Query  39   MDKKPCNSQDVEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLN  218
            MDKKPCNS DVE+RKGPWTMEEDLILIN+I+NHGEGVWN++ARSAGLKRTGKSCRLRWLN
Sbjct  1    MDKKPCNSHDVEVRKGPWTMEEDLILINFISNHGEGVWNTIARSAGLKRTGKSCRLRWLN  60

Query  219  YLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKH  326
            YLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKH
Sbjct  61   YLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKH  96



>ref|XP_004304632.1| PREDICTED: myb-related protein 305-like [Fragaria vesca subsp. 
vesca]
Length=188

 Score =   195 bits (495),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 93/98 (95%), Positives = 95/98 (97%), Gaps = 2/98 (2%)
 Frame = +3

Query  39   MDKKPCNS--QDVEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRW  212
            MDKKPCNS  QD E+RKGPWTMEEDLILINYIANHGEGVWNSLA+SAGLKRTGKSCRLRW
Sbjct  1    MDKKPCNSSSQDAEVRKGPWTMEEDLILINYIANHGEGVWNSLAKSAGLKRTGKSCRLRW  60

Query  213  LNYLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKH  326
            LNYLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKH
Sbjct  61   LNYLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKH  98



>gb|KDP46431.1| hypothetical protein JCGZ_10271 [Jatropha curcas]
 gb|AIT52247.1| MYB family protein [Jatropha curcas]
Length=192

 Score =   195 bits (495),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 90/96 (94%), Positives = 94/96 (98%), Gaps = 0/96 (0%)
 Frame = +3

Query  39   MDKKPCNSQDVEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLN  218
            M+KKPCNSQD E+RKGPWTMEEDLILINYIANHGEGVWNSLA++AGLKRTGKSCRLRWLN
Sbjct  1    MEKKPCNSQDAEVRKGPWTMEEDLILINYIANHGEGVWNSLAKAAGLKRTGKSCRLRWLN  60

Query  219  YLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKH  326
            YLRPDVRRGNIT EEQLLIMELHAKWGNRWSKIAKH
Sbjct  61   YLRPDVRRGNITSEEQLLIMELHAKWGNRWSKIAKH  96



>gb|AGN52197.1| MYB-related transcription factor [Salvia miltiorrhiza]
Length=193

 Score =   194 bits (494),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 92/96 (96%), Positives = 94/96 (98%), Gaps = 0/96 (0%)
 Frame = +3

Query  39   MDKKPCNSQDVEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLN  218
            MDKKPC S DVE+RKGPWTMEEDLIL+NYIANHGEGVWNSLARSAGLKRTGKSCRLRWLN
Sbjct  1    MDKKPCKSIDVEVRKGPWTMEEDLILMNYIANHGEGVWNSLARSAGLKRTGKSCRLRWLN  60

Query  219  YLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKH  326
            YLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKH
Sbjct  61   YLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKH  96



>gb|AGN52087.1| MYB-related transcription factor [Salvia miltiorrhiza]
Length=193

 Score =   194 bits (494),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 92/96 (96%), Positives = 94/96 (98%), Gaps = 0/96 (0%)
 Frame = +3

Query  39   MDKKPCNSQDVEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLN  218
            MDKKPC S DVE+RKGPWTMEEDLIL+NYIANHGEGVWNSLARSAGLKRTGKSCRLRWLN
Sbjct  1    MDKKPCKSIDVEVRKGPWTMEEDLILMNYIANHGEGVWNSLARSAGLKRTGKSCRLRWLN  60

Query  219  YLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKH  326
            YLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKH
Sbjct  61   YLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKH  96



>gb|EYU44761.1| hypothetical protein MIMGU_mgv1a013642mg [Erythranthe guttata]
Length=214

 Score =   195 bits (496),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 92/96 (96%), Positives = 94/96 (98%), Gaps = 0/96 (0%)
 Frame = +3

Query  39   MDKKPCNSQDVEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLN  218
            MDKKPC SQDVE+RKGPWTMEEDLIL+NYIANHGEGVWNSLARSAGLKRTGKSCRLRWLN
Sbjct  1    MDKKPCISQDVEVRKGPWTMEEDLILMNYIANHGEGVWNSLARSAGLKRTGKSCRLRWLN  60

Query  219  YLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKH  326
            YLRPDVRRGNIT EEQLLIMELHAKWGNRWSKIAKH
Sbjct  61   YLRPDVRRGNITAEEQLLIMELHAKWGNRWSKIAKH  96



>ref|XP_006470308.1| PREDICTED: myb-related protein 305-like isoform X1 [Citrus sinensis]
Length=194

 Score =   194 bits (494),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 89/96 (93%), Positives = 94/96 (98%), Gaps = 0/96 (0%)
 Frame = +3

Query  39   MDKKPCNSQDVEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLN  218
            MDK PCNSQ+ E+RKGPWTMEEDLILINYIANHGEGVWNSLA++AGLKRTGKSCRLRWLN
Sbjct  1    MDKTPCNSQEAEVRKGPWTMEEDLILINYIANHGEGVWNSLAKAAGLKRTGKSCRLRWLN  60

Query  219  YLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKH  326
            YLRPDV+RGNITPEEQLLIMELHAKWGNRWSKIAKH
Sbjct  61   YLRPDVKRGNITPEEQLLIMELHAKWGNRWSKIAKH  96



>gb|KDO66125.1| hypothetical protein CISIN_1g045384mg [Citrus sinensis]
Length=194

 Score =   194 bits (493),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 89/96 (93%), Positives = 94/96 (98%), Gaps = 0/96 (0%)
 Frame = +3

Query  39   MDKKPCNSQDVEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLN  218
            MDK PCNSQ+ E+RKGPWTMEEDLILINYIANHGEGVWNSLA++AGLKRTGKSCRLRWLN
Sbjct  1    MDKTPCNSQEAEVRKGPWTMEEDLILINYIANHGEGVWNSLAKAAGLKRTGKSCRLRWLN  60

Query  219  YLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKH  326
            YLRPDV+RGNITPEEQLLIMELHAKWGNRWSKIAKH
Sbjct  61   YLRPDVKRGNITPEEQLLIMELHAKWGNRWSKIAKH  96



>ref|XP_006446527.1| hypothetical protein CICLE_v10016820mg [Citrus clementina]
 gb|ESR59767.1| hypothetical protein CICLE_v10016820mg [Citrus clementina]
Length=194

 Score =   194 bits (493),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 89/96 (93%), Positives = 94/96 (98%), Gaps = 0/96 (0%)
 Frame = +3

Query  39   MDKKPCNSQDVEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLN  218
            MDK PCNSQ+ E+RKGPWTMEEDLILINYIANHGEGVWNSLA++AGLKRTGKSCRLRWLN
Sbjct  1    MDKTPCNSQEAEVRKGPWTMEEDLILINYIANHGEGVWNSLAKAAGLKRTGKSCRLRWLN  60

Query  219  YLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKH  326
            YLRPDV+RGNITPEEQLLIMELHAKWGNRWSKIAKH
Sbjct  61   YLRPDVKRGNITPEEQLLIMELHAKWGNRWSKIAKH  96



>ref|XP_009783970.1| PREDICTED: myb-related protein 340-like [Nicotiana sylvestris]
Length=186

 Score =   194 bits (492),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 90/95 (95%), Positives = 93/95 (98%), Gaps = 0/95 (0%)
 Frame = +3

Query  42   DKKPCNSQDVEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLNY  221
            +K+ CNS DVE+RKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLNY
Sbjct  3    NKRTCNSHDVEVRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLNY  62

Query  222  LRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKH  326
            LRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKH
Sbjct  63   LRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKH  97



>emb|CAN77103.1| hypothetical protein VITISV_018445 [Vitis vinifera]
 emb|CBI34905.3| unnamed protein product [Vitis vinifera]
Length=189

 Score =   194 bits (492),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 90/96 (94%), Positives = 93/96 (97%), Gaps = 0/96 (0%)
 Frame = +3

Query  39   MDKKPCNSQDVEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLN  218
            MDKKPCNSQD E+RKGPWT+EEDLILINYIANHGEGVWNSLA+SAGLKRTGKSCRLRWLN
Sbjct  1    MDKKPCNSQDAEVRKGPWTLEEDLILINYIANHGEGVWNSLAKSAGLKRTGKSCRLRWLN  60

Query  219  YLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKH  326
            YLRPDVRRGNIT EEQ LIMELHAKWGNRWSKIAKH
Sbjct  61   YLRPDVRRGNITDEEQQLIMELHAKWGNRWSKIAKH  96



>ref|XP_009334094.1| PREDICTED: myb-related protein 305-like [Pyrus x bretschneideri]
Length=195

 Score =   194 bits (492),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 92/98 (94%), Positives = 95/98 (97%), Gaps = 2/98 (2%)
 Frame = +3

Query  39   MDKKPCNS--QDVEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRW  212
            MDK PCNS  QDVE+RKGPWTMEEDLILINYIANHGEGVWNSLA++AGLKRTGKSCRLRW
Sbjct  1    MDKNPCNSSSQDVEVRKGPWTMEEDLILINYIANHGEGVWNSLAKAAGLKRTGKSCRLRW  60

Query  213  LNYLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKH  326
            LNYLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKH
Sbjct  61   LNYLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKH  98



>gb|KHG20022.1| Myb-related protein [Gossypium arboreum]
Length=213

 Score =   193 bits (491),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 90/96 (94%), Positives = 94/96 (98%), Gaps = 0/96 (0%)
 Frame = +3

Query  39   MDKKPCNSQDVEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLN  218
            MDKKPC SQDVE+RKGPWTMEEDLILINYIA HGEGVWN+LA++AGLKRTGKSCRLRWLN
Sbjct  1    MDKKPCKSQDVEVRKGPWTMEEDLILINYIATHGEGVWNNLAKAAGLKRTGKSCRLRWLN  60

Query  219  YLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKH  326
            YLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKH
Sbjct  61   YLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKH  96



>ref|XP_006357153.1| PREDICTED: myb-related protein 305-like [Solanum tuberosum]
Length=195

 Score =   192 bits (487),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 89/93 (96%), Positives = 92/93 (99%), Gaps = 0/93 (0%)
 Frame = +3

Query  48   KPCNSQDVEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLNYLR  227
            K CNSQDVE+RKGPWTMEEDLILINYIANHGEGVWNSLA+SAGLKRTGKSCRLRWLNYLR
Sbjct  3    KTCNSQDVEVRKGPWTMEEDLILINYIANHGEGVWNSLAKSAGLKRTGKSCRLRWLNYLR  62

Query  228  PDVRRGNITPEEQLLIMELHAKWGNRWSKIAKH  326
            PDVRRGNITPEEQLLIMELHAKWGN+WSKIAKH
Sbjct  63   PDVRRGNITPEEQLLIMELHAKWGNKWSKIAKH  95



>ref|XP_004233330.1| PREDICTED: myb-related protein 305-like [Solanum lycopersicum]
Length=195

 Score =   191 bits (486),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 89/93 (96%), Positives = 92/93 (99%), Gaps = 0/93 (0%)
 Frame = +3

Query  48   KPCNSQDVEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLNYLR  227
            K CNSQDVE+RKGPWTMEEDLILINYIANHGEGVWNSLA+SAGLKRTGKSCRLRWLNYLR
Sbjct  3    KICNSQDVEVRKGPWTMEEDLILINYIANHGEGVWNSLAKSAGLKRTGKSCRLRWLNYLR  62

Query  228  PDVRRGNITPEEQLLIMELHAKWGNRWSKIAKH  326
            PDVRRGNITPEEQLLIMELHAKWGN+WSKIAKH
Sbjct  63   PDVRRGNITPEEQLLIMELHAKWGNKWSKIAKH  95



>ref|NP_001268062.1| R2R3 Myb24 transcription factor [Vitis vinifera]
 gb|ABW34394.1| R2R3 Myb24 transcription factor [Vitis vinifera]
Length=189

 Score =   191 bits (485),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 89/96 (93%), Positives = 92/96 (96%), Gaps = 0/96 (0%)
 Frame = +3

Query  39   MDKKPCNSQDVEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLN  218
            MDKKPCNSQD E+RKGPWT+ EDLILINYIANHGEGVWNSLA+SAGLKRTGKSCRLRWLN
Sbjct  1    MDKKPCNSQDAEVRKGPWTLGEDLILINYIANHGEGVWNSLAKSAGLKRTGKSCRLRWLN  60

Query  219  YLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKH  326
            YLRPDVRRGNIT EEQ LIMELHAKWGNRWSKIAKH
Sbjct  61   YLRPDVRRGNITDEEQQLIMELHAKWGNRWSKIAKH  96



>emb|CAD87008.1| MYB8 protein [Gerbera hybrid cultivar]
Length=190

 Score =   191 bits (485),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 92/97 (95%), Positives = 95/97 (98%), Gaps = 1/97 (1%)
 Frame = +3

Query  39   MDKKPCNS-QDVEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWL  215
            M+K+P NS QDVE+RKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWL
Sbjct  1    MEKRPNNSSQDVEVRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWL  60

Query  216  NYLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKH  326
            NYLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKH
Sbjct  61   NYLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKH  97



>gb|KEH24806.1| myb transcription factor [Medicago truncatula]
Length=209

 Score =   190 bits (483),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 92/97 (95%), Positives = 95/97 (98%), Gaps = 1/97 (1%)
 Frame = +3

Query  39   MDKKPCNS-QDVEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWL  215
            MDKKPCNS QD E+RKGPWTMEEDLILINYIANHGEGVWNSLA++AGLKRTGKSCRLRWL
Sbjct  1    MDKKPCNSSQDPEVRKGPWTMEEDLILINYIANHGEGVWNSLAKAAGLKRTGKSCRLRWL  60

Query  216  NYLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKH  326
            NYLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKH
Sbjct  61   NYLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKH  97



>emb|CAA71992.1| Myb26 [Pisum sativum]
Length=217

 Score =   191 bits (484),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 91/97 (94%), Positives = 95/97 (98%), Gaps = 1/97 (1%)
 Frame = +3

Query  39   MDKKPCNS-QDVEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWL  215
            MDKKPCNS QD E+RKGPWTMEEDLILINYIANHGEGVWNSLA++AGLKRTGKSCRLRWL
Sbjct  1    MDKKPCNSSQDPEVRKGPWTMEEDLILINYIANHGEGVWNSLAKAAGLKRTGKSCRLRWL  60

Query  216  NYLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKH  326
            NYLRPDVRRGNITPEEQLLIMELH+KWGNRWSKIAKH
Sbjct  61   NYLRPDVRRGNITPEEQLLIMELHSKWGNRWSKIAKH  97



>ref|XP_011005145.1| PREDICTED: myb-related protein 305 isoform X2 [Populus euphratica]
Length=190

 Score =   189 bits (481),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 88/96 (92%), Positives = 93/96 (97%), Gaps = 0/96 (0%)
 Frame = +3

Query  39   MDKKPCNSQDVEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLN  218
            MDK PCNSQDVE+RKGPWT+EEDLIL NYIANHGEGVWNSLA++AGLKRTGKSCRLRWLN
Sbjct  1    MDKSPCNSQDVEVRKGPWTLEEDLILTNYIANHGEGVWNSLAKAAGLKRTGKSCRLRWLN  60

Query  219  YLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKH  326
            YLRPD+RRGNITPEEQLLIMELHAK GNRWSKIAKH
Sbjct  61   YLRPDLRRGNITPEEQLLIMELHAKLGNRWSKIAKH  96



>ref|XP_002298534.1| Myb26 family protein [Populus trichocarpa]
 gb|EEE83339.1| Myb26 family protein [Populus trichocarpa]
Length=190

 Score =   189 bits (481),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 88/96 (92%), Positives = 93/96 (97%), Gaps = 0/96 (0%)
 Frame = +3

Query  39   MDKKPCNSQDVEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLN  218
            MDK PCNSQDVE+RKGPWT+EEDLIL NYIANHGEGVWNSLA++AGLKRTGKSCRLRWLN
Sbjct  1    MDKSPCNSQDVEVRKGPWTLEEDLILTNYIANHGEGVWNSLAKAAGLKRTGKSCRLRWLN  60

Query  219  YLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKH  326
            YLRPD+RRGNITPEEQLLIMELHAK GNRWSKIAKH
Sbjct  61   YLRPDLRRGNITPEEQLLIMELHAKLGNRWSKIAKH  96



>ref|XP_004489258.1| PREDICTED: myb-related protein 305-like [Cicer arietinum]
Length=210

 Score =   190 bits (482),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 91/97 (94%), Positives = 94/97 (97%), Gaps = 1/97 (1%)
 Frame = +3

Query  39   MDKKPCNS-QDVEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWL  215
            MDKKPCNS QD E+RKGPWTMEEDLILINYIANHGEGVWNSLA++AGLKRTGKSCRLRWL
Sbjct  1    MDKKPCNSSQDPEVRKGPWTMEEDLILINYIANHGEGVWNSLAKAAGLKRTGKSCRLRWL  60

Query  216  NYLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKH  326
            NYLRPDVRRGNITPEEQLLIMELH KWGNRWSKIAKH
Sbjct  61   NYLRPDVRRGNITPEEQLLIMELHEKWGNRWSKIAKH  97



>ref|XP_011013637.1| PREDICTED: myb-related protein 305-like isoform X1 [Populus euphratica]
Length=191

 Score =   189 bits (480),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 88/96 (92%), Positives = 92/96 (96%), Gaps = 0/96 (0%)
 Frame = +3

Query  39   MDKKPCNSQDVEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLN  218
            MDK P NSQDVEIRKGPWT+EEDLIL N+IANHGEGVWNSLA+ AGLKRTGKSCRLRWLN
Sbjct  1    MDKTPSNSQDVEIRKGPWTLEEDLILTNHIANHGEGVWNSLAKDAGLKRTGKSCRLRWLN  60

Query  219  YLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKH  326
            YLRPD+RRGNITPEEQLLIMELHAKWGNRWSKIAKH
Sbjct  61   YLRPDLRRGNITPEEQLLIMELHAKWGNRWSKIAKH  96



>dbj|BAF96931.1| R2R3-MYB transcriptional factor [Gentiana triflora]
Length=214

 Score =   189 bits (481),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 88/94 (94%), Positives = 91/94 (97%), Gaps = 0/94 (0%)
 Frame = +3

Query  45   KKPCNSQDVEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLNYL  224
            K  CNS DV++RKGPWTMEED+ILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLNYL
Sbjct  20   KAACNSGDVQVRKGPWTMEEDMILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLNYL  79

Query  225  RPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKH  326
            RPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKH
Sbjct  80   RPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKH  113



>ref|XP_002323803.1| Myb26 family protein [Populus trichocarpa]
 gb|EEF03936.1| Myb26 family protein [Populus trichocarpa]
Length=190

 Score =   187 bits (476),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 87/96 (91%), Positives = 93/96 (97%), Gaps = 0/96 (0%)
 Frame = +3

Query  39   MDKKPCNSQDVEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLN  218
            MDK P NSQDVE+RKGPWT+EEDLIL N+IANHGEGVWNSLA++AGLKRTGKSCRLRWLN
Sbjct  1    MDKTPSNSQDVEVRKGPWTLEEDLILTNHIANHGEGVWNSLAKAAGLKRTGKSCRLRWLN  60

Query  219  YLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKH  326
            YLRPD+RRGNITPEEQLLIMELHAKWGNRWSKIAKH
Sbjct  61   YLRPDLRRGNITPEEQLLIMELHAKWGNRWSKIAKH  96



>ref|NP_001235699.1| uncharacterized protein LOC100305972 [Glycine max]
 gb|ACU13920.1| unknown [Glycine max]
Length=206

 Score =   188 bits (477),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 89/98 (91%), Positives = 94/98 (96%), Gaps = 2/98 (2%)
 Frame = +3

Query  39   MDKKPCNS--QDVEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRW  212
            MDKKPCNS   D E+RKGPWTMEEDLILINYIANHGEGVWNSLA+++GLKRTGKSCRLRW
Sbjct  1    MDKKPCNSSSHDPEVRKGPWTMEEDLILINYIANHGEGVWNSLAKASGLKRTGKSCRLRW  60

Query  213  LNYLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKH  326
            LNYLRPDVRRGNITPEEQLLI+ELHAKWGNRWSKIAKH
Sbjct  61   LNYLRPDVRRGNITPEEQLLIIELHAKWGNRWSKIAKH  98



>ref|XP_011013294.1| PREDICTED: myb-related protein 305-like isoform X1 [Populus euphratica]
Length=191

 Score =   187 bits (474),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 87/96 (91%), Positives = 92/96 (96%), Gaps = 0/96 (0%)
 Frame = +3

Query  39   MDKKPCNSQDVEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLN  218
            MDK P NS+DVEIRKGPWT+EEDLIL N+IANHGEGVWNSLA+ AGLKRTGKSCRLRWLN
Sbjct  1    MDKTPSNSRDVEIRKGPWTLEEDLILTNHIANHGEGVWNSLAKDAGLKRTGKSCRLRWLN  60

Query  219  YLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKH  326
            YLRPD+RRGNITPEEQLLIMELHAKWGNRWSKIAKH
Sbjct  61   YLRPDLRRGNITPEEQLLIMELHAKWGNRWSKIAKH  96



>gb|AGN52062.1| MYB-related transcription factor [Salvia miltiorrhiza]
 gb|AGN52172.1| MYB-related transcription factor [Salvia miltiorrhiza]
Length=200

 Score =   187 bits (474),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 87/96 (91%), Positives = 92/96 (96%), Gaps = 0/96 (0%)
 Frame = +3

Query  39   MDKKPCNSQDVEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLN  218
            MDK+PCNS + E+RKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLN
Sbjct  1    MDKRPCNSHEPEVRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLN  60

Query  219  YLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKH  326
            YLRPDVRRGNIT +E LLI+ELHAKWGNRWSKIAKH
Sbjct  61   YLRPDVRRGNITADEHLLIIELHAKWGNRWSKIAKH  96



>ref|XP_004516766.1| PREDICTED: myb-related protein 305-like isoform X2 [Cicer arietinum]
Length=233

 Score =   187 bits (476),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 93/109 (85%), Positives = 98/109 (90%), Gaps = 2/109 (2%)
 Frame = +3

Query  6    FHPPPSLSLKKMDK-KPCNS-QDVEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGL  179
            F    SLS K MDK K CNS QD ++RKGPWTMEEDLILINYIANHGEGVWNSLA+SAGL
Sbjct  13   FSHSLSLSYKIMDKNKECNSSQDPDVRKGPWTMEEDLILINYIANHGEGVWNSLAKSAGL  72

Query  180  KRTGKSCRLRWLNYLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKH  326
            KRTGKSCR RWLNYLRPD+RRGNITPEEQLLIM+LHAKWGNRWSKIAKH
Sbjct  73   KRTGKSCRFRWLNYLRPDIRRGNITPEEQLLIMKLHAKWGNRWSKIAKH  121



>dbj|BAF96932.1| R2R3-MYB transcriptional factor [Gentiana triflora]
Length=200

 Score =   186 bits (472),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 91/100 (91%), Positives = 93/100 (93%), Gaps = 4/100 (4%)
 Frame = +3

Query  39   MDKKPCN----SQDVEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRL  206
            MDKK  N    S+D E+RKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRL
Sbjct  1    MDKKGSNINSSSKDPEVRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRL  60

Query  207  RWLNYLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKH  326
            RWLNYLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKH
Sbjct  61   RWLNYLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKH  100



>ref|XP_008443525.1| PREDICTED: myb-related protein 305 [Cucumis melo]
Length=218

 Score =   186 bits (472),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 88/101 (87%), Positives = 94/101 (93%), Gaps = 5/101 (5%)
 Frame = +3

Query  39   MDKKPCNS-----QDVEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCR  203
            MDK+ CN+     QDVE+RKGPWTMEEDLILINYIANHGEGVWNSLA+SAGLKRTGKSCR
Sbjct  1    MDKRACNNNNNSPQDVEVRKGPWTMEEDLILINYIANHGEGVWNSLAKSAGLKRTGKSCR  60

Query  204  LRWLNYLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKH  326
            LRWLNYLRPDVRRGNITP+EQLLIMELHAKWGN+WSKIAK 
Sbjct  61   LRWLNYLRPDVRRGNITPDEQLLIMELHAKWGNKWSKIAKQ  101



>ref|XP_007151019.1| hypothetical protein PHAVU_004G012000g [Phaseolus vulgaris]
 gb|ESW23013.1| hypothetical protein PHAVU_004G012000g [Phaseolus vulgaris]
Length=241

 Score =   186 bits (473),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 89/101 (88%), Positives = 93/101 (92%), Gaps = 3/101 (3%)
 Frame = +3

Query  33   KKMDKKPCNS---QDVEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCR  203
            K MDKKPCNS    D E+RKGPWTMEEDLILINYIANHGEGVWNSLA+++GLKRTGKSCR
Sbjct  25   KIMDKKPCNSSSSHDPEVRKGPWTMEEDLILINYIANHGEGVWNSLAKASGLKRTGKSCR  84

Query  204  LRWLNYLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKH  326
            LRWLNYLRPDVRRGNIT EEQLLI ELHAKWGNRWSKIAKH
Sbjct  85   LRWLNYLRPDVRRGNITTEEQLLIFELHAKWGNRWSKIAKH  125



>ref|XP_004141095.1| PREDICTED: myb-related protein 305-like [Cucumis sativus]
 ref|XP_004168850.1| PREDICTED: myb-related protein 305-like [Cucumis sativus]
Length=217

 Score =   186 bits (471),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 88/101 (87%), Positives = 94/101 (93%), Gaps = 5/101 (5%)
 Frame = +3

Query  39   MDKKPCNS-----QDVEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCR  203
            MDK+ CN+     QDVE+RKGPWTMEEDLILINYIANHGEGVWNSLA+SAGLKRTGKSCR
Sbjct  1    MDKRACNNNNNSPQDVEVRKGPWTMEEDLILINYIANHGEGVWNSLAKSAGLKRTGKSCR  60

Query  204  LRWLNYLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKH  326
            LRWLNYLRPDVRRGNITP+EQLLIMELHAKWGN+WSKIAK 
Sbjct  61   LRWLNYLRPDVRRGNITPDEQLLIMELHAKWGNKWSKIAKQ  101



>ref|XP_010677862.1| PREDICTED: myb-related protein 305-like [Beta vulgaris subsp. 
vulgaris]
Length=231

 Score =   186 bits (472),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 88/96 (92%), Positives = 92/96 (96%), Gaps = 0/96 (0%)
 Frame = +3

Query  39   MDKKPCNSQDVEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLN  218
            M+K+  NSQD E+RKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLN
Sbjct  1    MEKRQNNSQDNEVRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLN  60

Query  219  YLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKH  326
            YLRPDVRRGNIT EE+LLIMELHAKWGNRWSKIAKH
Sbjct  61   YLRPDVRRGNITAEEELLIMELHAKWGNRWSKIAKH  96



>gb|KEH22251.1| myb transcription factor [Medicago truncatula]
Length=208

 Score =   185 bits (470),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 89/97 (92%), Positives = 94/97 (97%), Gaps = 1/97 (1%)
 Frame = +3

Query  39   MDKKPCNS-QDVEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWL  215
            MDKK C+S QD ++RKGPWTMEEDLILINYIANHGEGVWNSLA+SAGLKRTGKSCRLRWL
Sbjct  1    MDKKECSSSQDPDVRKGPWTMEEDLILINYIANHGEGVWNSLAKSAGLKRTGKSCRLRWL  60

Query  216  NYLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKH  326
            NYLRPDVRRGNITPEEQLLI+ELHAKWGNRWSKIAKH
Sbjct  61   NYLRPDVRRGNITPEEQLLIIELHAKWGNRWSKIAKH  97



>gb|EPS65034.1| hypothetical protein M569_09745, partial [Genlisea aurea]
Length=207

 Score =   185 bits (469),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 87/96 (91%), Positives = 91/96 (95%), Gaps = 0/96 (0%)
 Frame = +3

Query  39   MDKKPCNSQDVEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLN  218
            MDK  C S + E+RKGPWTMEEDLIL+NYIANHGEGVWNSLA+SAGLKRTGKSCRLRWLN
Sbjct  1    MDKNICKSPEAEVRKGPWTMEEDLILMNYIANHGEGVWNSLAKSAGLKRTGKSCRLRWLN  60

Query  219  YLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKH  326
            YLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKH
Sbjct  61   YLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKH  96



>gb|ACR15115.1| MYBF1 [Populus x canadensis]
Length=190

 Score =   184 bits (467),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 85/96 (89%), Positives = 92/96 (96%), Gaps = 0/96 (0%)
 Frame = +3

Query  39   MDKKPCNSQDVEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLN  218
            MDK PCNSQDVE+RKGPWT+EEDLIL NYIANHGEGVWNSLA++AGLKRTGKSCRLRWLN
Sbjct  1    MDKSPCNSQDVEVRKGPWTLEEDLILTNYIANHGEGVWNSLAKAAGLKRTGKSCRLRWLN  60

Query  219  YLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKH  326
            YLRPD++RGNITP+ QLLIMELHAK GNRWSKIAKH
Sbjct  61   YLRPDLKRGNITPDGQLLIMELHAKLGNRWSKIAKH  96



>ref|NP_001235850.1| MYB transcription factor MYB181 [Glycine max]
 gb|ABH02847.1| MYB transcription factor MYB181 [Glycine max]
 gb|ACU14259.1| unknown [Glycine max]
Length=208

 Score =   185 bits (469),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 91/98 (93%), Positives = 94/98 (96%), Gaps = 2/98 (2%)
 Frame = +3

Query  39   MDKKP-CN-SQDVEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRW  212
            MDKK  CN SQD E+RKGPWTMEEDLILINYIANHGEGVWNSLA++AGLKRTGKSCRLRW
Sbjct  1    MDKKQLCNTSQDPEVRKGPWTMEEDLILINYIANHGEGVWNSLAKAAGLKRTGKSCRLRW  60

Query  213  LNYLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKH  326
            LNYLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKH
Sbjct  61   LNYLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKH  98



>ref|XP_003553814.1| PREDICTED: myb-related protein 305 [Glycine max]
Length=205

 Score =   184 bits (467),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 87/97 (90%), Positives = 93/97 (96%), Gaps = 1/97 (1%)
 Frame = +3

Query  39   MDKKPCNS-QDVEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWL  215
            MDKKPC+S  D E+RKGPW MEEDLILINYIANHGEGVWNSLA+++GLKRTGKSCRLRWL
Sbjct  1    MDKKPCDSSHDPEVRKGPWIMEEDLILINYIANHGEGVWNSLAKASGLKRTGKSCRLRWL  60

Query  216  NYLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKH  326
            NYLRPDVRRGNITPEEQLLI+ELHAKWGNRWSKIAKH
Sbjct  61   NYLRPDVRRGNITPEEQLLIIELHAKWGNRWSKIAKH  97



>ref|XP_010108787.1| Myb-related protein 305 [Morus notabilis]
 gb|EXC20302.1| Myb-related protein 305 [Morus notabilis]
Length=225

 Score =   185 bits (469),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 88/98 (90%), Positives = 93/98 (95%), Gaps = 3/98 (3%)
 Frame = +3

Query  42   DKKPCN---SQDVEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRW  212
            +KK  N   SQDVE+RKGPWTMEEDLILINYIANHGEGVWNSLA++AGLKRTGKSCRLRW
Sbjct  3    NKKASNINSSQDVEVRKGPWTMEEDLILINYIANHGEGVWNSLAKAAGLKRTGKSCRLRW  62

Query  213  LNYLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKH  326
            LNYLRPDVRRGNITPEEQL+IMELHAKWGNRWSKIAKH
Sbjct  63   LNYLRPDVRRGNITPEEQLIIMELHAKWGNRWSKIAKH  100



>ref|XP_010033288.1| PREDICTED: myb-related protein 305 [Eucalyptus grandis]
 gb|KCW52898.1| hypothetical protein EUGRSUZ_J02217 [Eucalyptus grandis]
Length=195

 Score =   184 bits (466),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 89/100 (89%), Positives = 93/100 (93%), Gaps = 4/100 (4%)
 Frame = +3

Query  39   MDKKPCN----SQDVEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRL  206
            MDKKP +    SQDVE+RKGPWTMEEDLILINYIANHGEG WNSLA++AGLKRTGKSCRL
Sbjct  1    MDKKPDDDNGKSQDVEVRKGPWTMEEDLILINYIANHGEGSWNSLAKAAGLKRTGKSCRL  60

Query  207  RWLNYLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKH  326
            RWLNYLRPDVRRGNIT EEQLLIMELHAKWGNRWSKIAKH
Sbjct  61   RWLNYLRPDVRRGNITTEEQLLIMELHAKWGNRWSKIAKH  100



>ref|XP_007140962.1| hypothetical protein PHAVU_008G155700g [Phaseolus vulgaris]
 gb|ESW12956.1| hypothetical protein PHAVU_008G155700g [Phaseolus vulgaris]
Length=200

 Score =   184 bits (466),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 88/97 (91%), Positives = 92/97 (95%), Gaps = 1/97 (1%)
 Frame = +3

Query  39   MDKKPCN-SQDVEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWL  215
            MDKK CN SQD E+RKGPWTMEEDLILINYI+NHGEGVWNSLA++AGLKRTGKSCRLRWL
Sbjct  1    MDKKQCNTSQDPEVRKGPWTMEEDLILINYISNHGEGVWNSLAKAAGLKRTGKSCRLRWL  60

Query  216  NYLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKH  326
            NYLRPDVRRGNIT EEQLLIMELHAKWGNRWSKIAK 
Sbjct  61   NYLRPDVRRGNITAEEQLLIMELHAKWGNRWSKIAKQ  97



>dbj|BAB40790.1| LhMyb [Lilium hybrid division I]
Length=184

 Score =   182 bits (463),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 84/96 (88%), Positives = 91/96 (95%), Gaps = 0/96 (0%)
 Frame = +3

Query  39   MDKKPCNSQDVEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLN  218
            MD+K   ++DVE+RKGPWTMEEDLILINYIANHG+GVWN+LARSAGLKRTGKSCRLRWLN
Sbjct  1    MDRKVGTNEDVEVRKGPWTMEEDLILINYIANHGDGVWNTLARSAGLKRTGKSCRLRWLN  60

Query  219  YLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKH  326
            YLRPDVRRGNITPEEQLLIMELH +WGNRWSKIAK 
Sbjct  61   YLRPDVRRGNITPEEQLLIMELHDRWGNRWSKIAKE  96



>ref|XP_008800726.1| PREDICTED: myb-related protein 305-like [Phoenix dactylifera]
Length=215

 Score =   182 bits (463),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 85/108 (79%), Positives = 93/108 (86%), Gaps = 0/108 (0%)
 Frame = +3

Query  3    PFHPPPSLSLKKMDKKPCNSQDVEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLK  182
            P   P       MDK+  +SQ+ E+RKGPWTMEEDLILINYIANHGEGVWN++ARSAGL 
Sbjct  13   PLFSPMVEEANSMDKRINSSQEAEVRKGPWTMEEDLILINYIANHGEGVWNNIARSAGLN  72

Query  183  RTGKSCRLRWLNYLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKH  326
            RTGKSCRLRWLNYLRPDVRRGNITPEEQLLIMELHA+WGNRWSKIA+ 
Sbjct  73   RTGKSCRLRWLNYLRPDVRRGNITPEEQLLIMELHARWGNRWSKIARQ  120



>ref|XP_006470309.1| PREDICTED: myb-related protein 305-like isoform X2 [Citrus sinensis]
Length=164

 Score =   181 bits (458),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 84/95 (88%), Positives = 89/95 (94%), Gaps = 0/95 (0%)
 Frame = +3

Query  39   MDKKPCNSQDVEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLN  218
            MDK PCNSQ+ E+RKGPWTMEEDLILINYIANHGEGVWNSLA++AGLKRTGKSCRLRWLN
Sbjct  1    MDKTPCNSQEAEVRKGPWTMEEDLILINYIANHGEGVWNSLAKAAGLKRTGKSCRLRWLN  60

Query  219  YLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAK  323
            YLRPDV+RGNITPEEQLLIMELHAKWGNR   I K
Sbjct  61   YLRPDVKRGNITPEEQLLIMELHAKWGNRLVYIYK  95



>ref|XP_008812482.1| PREDICTED: myb-related protein 305-like [Phoenix dactylifera]
Length=201

 Score =   182 bits (461),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 84/97 (87%), Positives = 91/97 (94%), Gaps = 0/97 (0%)
 Frame = +3

Query  36   KMDKKPCNSQDVEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWL  215
            +MDK   +SQ+ E+RKGPWTMEEDLILINYIANHGEGVWN+LARSAGL RTGKSCRLRWL
Sbjct  7    RMDKSINSSQETEVRKGPWTMEEDLILINYIANHGEGVWNNLARSAGLNRTGKSCRLRWL  66

Query  216  NYLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKH  326
            NYLRPDVRRGNITPEEQLLIM+LHA+WGNRWSKIAK 
Sbjct  67   NYLRPDVRRGNITPEEQLLIMDLHARWGNRWSKIAKQ  103



>ref|XP_006446526.1| hypothetical protein CICLE_v10016820mg [Citrus clementina]
 gb|ESR59766.1| hypothetical protein CICLE_v10016820mg [Citrus clementina]
Length=164

 Score =   180 bits (457),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 84/95 (88%), Positives = 89/95 (94%), Gaps = 0/95 (0%)
 Frame = +3

Query  39   MDKKPCNSQDVEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLN  218
            MDK PCNSQ+ E+RKGPWTMEEDLILINYIANHGEGVWNSLA++AGLKRTGKSCRLRWLN
Sbjct  1    MDKTPCNSQEAEVRKGPWTMEEDLILINYIANHGEGVWNSLAKAAGLKRTGKSCRLRWLN  60

Query  219  YLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAK  323
            YLRPDV+RGNITPEEQLLIMELHAKWGNR   I K
Sbjct  61   YLRPDVKRGNITPEEQLLIMELHAKWGNRLVYIYK  95



>gb|ACL81164.1| MYB transcription factor [Mirabilis jalapa]
Length=209

 Score =   181 bits (460),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 84/96 (88%), Positives = 91/96 (95%), Gaps = 0/96 (0%)
 Frame = +3

Query  39   MDKKPCNSQDVEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLN  218
            M+K+P  +Q+ E+RKGPWTMEEDLILINYI  HGEGVWNSLARSAGLKRTGKSCRLRWLN
Sbjct  1    MEKRPNTTQENEVRKGPWTMEEDLILINYIVTHGEGVWNSLARSAGLKRTGKSCRLRWLN  60

Query  219  YLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKH  326
            YLRPDVRRGNI+PEE+LLIMELHAKWGNRWSKIAKH
Sbjct  61   YLRPDVRRGNISPEEELLIMELHAKWGNRWSKIAKH  96



>ref|XP_010528247.1| PREDICTED: transcription factor MYB21 [Tarenaya hassleriana]
Length=204

 Score =   181 bits (459),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 85/97 (88%), Positives = 91/97 (94%), Gaps = 1/97 (1%)
 Frame = +3

Query  39   MDKKPCNSQ-DVEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWL  215
            M+KK  +S  D E+RKGPWTMEEDLILINYIANHGEGVWNSLA++AGLKRTGKSCRLRWL
Sbjct  3    MEKKGSSSSGDAEVRKGPWTMEEDLILINYIANHGEGVWNSLAKAAGLKRTGKSCRLRWL  62

Query  216  NYLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKH  326
            NYLRPDV+RGNITPEEQL IMELHAKWGNRWSKIAKH
Sbjct  63   NYLRPDVKRGNITPEEQLTIMELHAKWGNRWSKIAKH  99



>ref|XP_010251229.1| PREDICTED: myb-related protein 340-like [Nelumbo nucifera]
Length=184

 Score =   180 bits (456),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 85/96 (89%), Positives = 90/96 (94%), Gaps = 0/96 (0%)
 Frame = +3

Query  39   MDKKPCNSQDVEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLN  218
            MDKKP  SQ+ E+RKGPWTMEEDLIL+NYI NHGEG WNSLARSAGLKRTGKSCRLRWLN
Sbjct  1    MDKKPGRSQEPEVRKGPWTMEEDLILMNYIGNHGEGEWNSLARSAGLKRTGKSCRLRWLN  60

Query  219  YLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKH  326
            YL+PDVRRGNIT EEQLLIMELHA+WGNRWSKIAKH
Sbjct  61   YLKPDVRRGNITAEEQLLIMELHARWGNRWSKIAKH  96



>ref|XP_007140964.1| hypothetical protein PHAVU_008G155900g [Phaseolus vulgaris]
 gb|ESW12958.1| hypothetical protein PHAVU_008G155900g [Phaseolus vulgaris]
Length=199

 Score =   179 bits (455),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 87/97 (90%), Positives = 90/97 (93%), Gaps = 1/97 (1%)
 Frame = +3

Query  39   MDKKPCN-SQDVEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWL  215
            MDKK    S D E+RKGPWTMEEDLILINYIANHGEGVWNSLA++AGLKRTGKSCRLRWL
Sbjct  1    MDKKLSTMSHDPEVRKGPWTMEEDLILINYIANHGEGVWNSLAKAAGLKRTGKSCRLRWL  60

Query  216  NYLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKH  326
            NYLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAK 
Sbjct  61   NYLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKQ  97



>ref|NP_001235879.1| MYB transcription factor MYB182 [Glycine max]
 gb|ABH02849.1| MYB transcription factor MYB182 [Glycine max]
 gb|KHN24347.1| Myb-related protein 305 [Glycine soja]
Length=206

 Score =   180 bits (456),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 88/98 (90%), Positives = 92/98 (94%), Gaps = 2/98 (2%)
 Frame = +3

Query  39   MDKKP-C-NSQDVEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRW  212
            MDKK  C  SQD E+RKGPWTMEEDLIL+NYIANHGEGVWNSLA++AGLKR GKSCRLRW
Sbjct  1    MDKKQQCKTSQDPEVRKGPWTMEEDLILMNYIANHGEGVWNSLAKAAGLKRNGKSCRLRW  60

Query  213  LNYLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKH  326
            LNYLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKH
Sbjct  61   LNYLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKH  98



>gb|AAM63674.1| putative transcription factor MYB24 [Arabidopsis thaliana]
Length=214

 Score =   179 bits (455),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 83/87 (95%), Positives = 85/87 (98%), Gaps = 0/87 (0%)
 Frame = +3

Query  66   DVEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLNYLRPDVRRG  245
            D E+RKGPWTMEEDLILINYIANHGEGVWNSLA+SAGLKRTGKSCRLRWLNYLRPDVRRG
Sbjct  14   DAEVRKGPWTMEEDLILINYIANHGEGVWNSLAKSAGLKRTGKSCRLRWLNYLRPDVRRG  73

Query  246  NITPEEQLLIMELHAKWGNRWSKIAKH  326
            NITPEEQL IMELHAKWGNRWSKIAKH
Sbjct  74   NITPEEQLTIMELHAKWGNRWSKIAKH  100



>ref|XP_011005144.1| PREDICTED: myb-related protein 305 isoform X1 [Populus euphratica]
Length=201

 Score =   179 bits (454),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 87/107 (81%), Positives = 92/107 (86%), Gaps = 11/107 (10%)
 Frame = +3

Query  39   MDKKPCNSQDVEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLN  218
            MDK PCNSQDVE+RKGPWT+EEDLIL NYIANHGEGVWNSLA++AGLKRTGKSCRLRWLN
Sbjct  1    MDKSPCNSQDVEVRKGPWTLEEDLILTNYIANHGEGVWNSLAKAAGLKRTGKSCRLRWLN  60

Query  219  YLRPDVRRGNITPEEQLLIMELHAKWGNR-----------WSKIAKH  326
            YLRPD+RRGNITPEEQLLIMELHAK GN            WSKIAKH
Sbjct  61   YLRPDLRRGNITPEEQLLIMELHAKLGNSIKKYIHIYIYVWSKIAKH  107



>gb|AEE37094.1| MYB transcription factor [Crocus sativus]
Length=196

 Score =   179 bits (453),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 81/96 (84%), Positives = 90/96 (94%), Gaps = 0/96 (0%)
 Frame = +3

Query  39   MDKKPCNSQDVEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLN  218
            MD+   + +D E+RKGPWTMEEDLILINYIANHGEGVWN+LA+SAGLKRTGKSCRLRWLN
Sbjct  1    MDRGINSGEDTEVRKGPWTMEEDLILINYIANHGEGVWNTLAKSAGLKRTGKSCRLRWLN  60

Query  219  YLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKH  326
            YLRPDVRRGNITPEEQLLIMELH++WGNRWSKIA+ 
Sbjct  61   YLRPDVRRGNITPEEQLLIMELHSRWGNRWSKIARQ  96



>ref|NP_198851.1| myb domain protein 24 [Arabidopsis thaliana]
 sp|Q9SPG9.1|MYB24_ARATH RecName: Full=Transcription factor MYB24; AltName: Full=Myb-related 
protein 24; Short=AtMYB24 [Arabidopsis thaliana]
 gb|AAD53092.1|AF175987_1 putative transcription factor [Arabidopsis thaliana]
 dbj|BAB11590.1| transcription factor [Arabidopsis thaliana]
 gb|AAS10102.1| MYB transcription factor [Arabidopsis thaliana]
 gb|AED94536.1| myb domain protein 24 [Arabidopsis thaliana]
Length=214

 Score =   179 bits (455),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 83/87 (95%), Positives = 85/87 (98%), Gaps = 0/87 (0%)
 Frame = +3

Query  66   DVEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLNYLRPDVRRG  245
            D E+RKGPWTMEEDLILINYIANHGEGVWNSLA+SAGLKRTGKSCRLRWLNYLRPDVRRG
Sbjct  14   DAEVRKGPWTMEEDLILINYIANHGEGVWNSLAKSAGLKRTGKSCRLRWLNYLRPDVRRG  73

Query  246  NITPEEQLLIMELHAKWGNRWSKIAKH  326
            NITPEEQL IMELHAKWGNRWSKIAKH
Sbjct  74   NITPEEQLTIMELHAKWGNRWSKIAKH  100



>ref|NP_001238263.1| uncharacterized protein LOC100306400 [Glycine max]
 gb|ACU14553.1| unknown [Glycine max]
Length=204

 Score =   179 bits (454),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 88/97 (91%), Positives = 91/97 (94%), Gaps = 1/97 (1%)
 Frame = +3

Query  39   MDKKPCN-SQDVEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWL  215
            MDKK  N S D E+RKGPWTMEEDLILI YIANHGEGVWNSLA++AGLKRTGKSCRLRWL
Sbjct  1    MDKKLGNTSHDPEVRKGPWTMEEDLILITYIANHGEGVWNSLAKAAGLKRTGKSCRLRWL  60

Query  216  NYLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKH  326
            NYLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKH
Sbjct  61   NYLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKH  97



>ref|NP_001235865.1| MYB transcription factor MYB98 [Glycine max]
 gb|ABH02848.1| MYB transcription factor MYB98 [Glycine max]
 gb|KHN24348.1| Myb-related protein 305 [Glycine soja]
Length=204

 Score =   179 bits (453),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 88/97 (91%), Positives = 91/97 (94%), Gaps = 1/97 (1%)
 Frame = +3

Query  39   MDKKPCN-SQDVEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWL  215
            MDKK  N S D E+RKGPWTMEEDLILI YIANHGEGVWNSLA++AGLKRTGKSCRLRWL
Sbjct  1    MDKKLGNTSHDPEVRKGPWTMEEDLILITYIANHGEGVWNSLAKAAGLKRTGKSCRLRWL  60

Query  216  NYLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKH  326
            NYLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKH
Sbjct  61   NYLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKH  97



>gb|ACB59076.2| Myb-like transcription factor EOBI [Petunia x hybrida]
Length=105

 Score =   175 bits (444),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 84/85 (99%), Positives = 85/85 (100%), Gaps = 0/85 (0%)
 Frame = +3

Query  72   EIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLNYLRPDVRRGNI  251
            E+RKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLNYLRPDVRRGNI
Sbjct  1    EVRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLNYLRPDVRRGNI  60

Query  252  TPEEQLLIMELHAKWGNRWSKIAKH  326
            TPEEQLLIMELHAKWGNRWSKIAKH
Sbjct  61   TPEEQLLIMELHAKWGNRWSKIAKH  85



>ref|XP_009419837.1| PREDICTED: myb-related protein 305-like [Musa acuminata subsp. 
malaccensis]
Length=196

 Score =   178 bits (451),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 82/96 (85%), Positives = 89/96 (93%), Gaps = 0/96 (0%)
 Frame = +3

Query  39   MDKKPCNSQDVEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLN  218
            MDK+  NSQ+ E+RKGPWTMEEDLILINYI NHGEGVWN++ARSAGL RTGKSCRLRWLN
Sbjct  1    MDKRISNSQEAEVRKGPWTMEEDLILINYITNHGEGVWNNVARSAGLNRTGKSCRLRWLN  60

Query  219  YLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKH  326
            YLRPDVRRGNITPEEQ LIMELHA+WGNRWSKIA+ 
Sbjct  61   YLRPDVRRGNITPEEQHLIMELHARWGNRWSKIARQ  96



>dbj|BAA21618.1| ATMYB3 [Arabidopsis thaliana]
Length=226

 Score =   178 bits (452),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 81/87 (93%), Positives = 86/87 (99%), Gaps = 0/87 (0%)
 Frame = +3

Query  66   DVEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLNYLRPDVRRG  245
            + E+RKGPWTMEEDLILINYIANHG+GVWNSLA+SAGLKRTGKSCRLRWLNYLRPDVRRG
Sbjct  17   EAEVRKGPWTMEEDLILINYIANHGDGVWNSLAKSAGLKRTGKSCRLRWLNYLRPDVRRG  76

Query  246  NITPEEQLLIMELHAKWGNRWSKIAKH  326
            NITPEEQL+IMELHAKWGNRWSKIAKH
Sbjct  77   NITPEEQLIIMELHAKWGNRWSKIAKH  103



>ref|XP_010924268.1| PREDICTED: myb-related protein 305-like [Elaeis guineensis]
Length=198

 Score =   177 bits (449),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 83/96 (86%), Positives = 89/96 (93%), Gaps = 0/96 (0%)
 Frame = +3

Query  39   MDKKPCNSQDVEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLN  218
            MDK    S++ E+RKGPWTMEEDLILINYIANHGEGVWN+LARSAGL RTGKSCRLRWLN
Sbjct  8    MDKGINCSEEAEVRKGPWTMEEDLILINYIANHGEGVWNNLARSAGLNRTGKSCRLRWLN  67

Query  219  YLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKH  326
            YLRPDVRRGNITPEEQLLIMELHA+WGNRWSKIA+ 
Sbjct  68   YLRPDVRRGNITPEEQLLIMELHARWGNRWSKIARQ  103



>ref|XP_010425556.1| PREDICTED: transcription factor MYB21 isoform X1 [Camelina sativa]
Length=224

 Score =   178 bits (451),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 81/87 (93%), Positives = 86/87 (99%), Gaps = 0/87 (0%)
 Frame = +3

Query  66   DVEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLNYLRPDVRRG  245
            + E+RKGPWTMEEDLILINYIANHG+GVWNSLA+SAGLKRTGKSCRLRWLNYLRPDVRRG
Sbjct  16   EAEVRKGPWTMEEDLILINYIANHGDGVWNSLAKSAGLKRTGKSCRLRWLNYLRPDVRRG  75

Query  246  NITPEEQLLIMELHAKWGNRWSKIAKH  326
            NITPEEQL+IMELHAKWGNRWSKIAKH
Sbjct  76   NITPEEQLIIMELHAKWGNRWSKIAKH  102



>ref|NP_189418.2| transcription factor MYB21 [Arabidopsis thaliana]
 sp|Q9LK95.1|MYB21_ARATH RecName: Full=Transcription factor MYB21; AltName: Full=Myb homolog 
3; Short=AtMyb3; AltName: Full=Myb-related protein 21; 
Short=AtMYB21 [Arabidopsis thaliana]
 dbj|BAB02527.1| ATMYB3 [Arabidopsis thaliana]
 dbj|BAC43048.1| putative myb family transcription factor Atmyb3 [Arabidopsis 
thaliana]
 gb|AAS10059.1| MYB transcription factor [Arabidopsis thaliana]
 dbj|BAH30473.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE77366.1| transcription factor MYB21 [Arabidopsis thaliana]
Length=226

 Score =   178 bits (452),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 81/87 (93%), Positives = 86/87 (99%), Gaps = 0/87 (0%)
 Frame = +3

Query  66   DVEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLNYLRPDVRRG  245
            + E+RKGPWTMEEDLILINYIANHG+GVWNSLA+SAGLKRTGKSCRLRWLNYLRPDVRRG
Sbjct  17   EAEVRKGPWTMEEDLILINYIANHGDGVWNSLAKSAGLKRTGKSCRLRWLNYLRPDVRRG  76

Query  246  NITPEEQLLIMELHAKWGNRWSKIAKH  326
            NITPEEQL+IMELHAKWGNRWSKIAKH
Sbjct  77   NITPEEQLIIMELHAKWGNRWSKIAKH  103



>ref|XP_006395401.1| hypothetical protein EUTSA_v10004857mg [Eutrema salsugineum]
 gb|ESQ32687.1| hypothetical protein EUTSA_v10004857mg [Eutrema salsugineum]
Length=233

 Score =   178 bits (452),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 81/87 (93%), Positives = 86/87 (99%), Gaps = 0/87 (0%)
 Frame = +3

Query  66   DVEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLNYLRPDVRRG  245
            + E+RKGPWTMEEDLILINYIANHG+GVWNSLA+SAGLKRTGKSCRLRWLNYLRPDVRRG
Sbjct  17   EAEVRKGPWTMEEDLILINYIANHGDGVWNSLAKSAGLKRTGKSCRLRWLNYLRPDVRRG  76

Query  246  NITPEEQLLIMELHAKWGNRWSKIAKH  326
            NITPEEQL+IMELHAKWGNRWSKIAKH
Sbjct  77   NITPEEQLIIMELHAKWGNRWSKIAKH  103



>ref|XP_010514490.1| PREDICTED: transcription factor MYB21-like [Camelina sativa]
Length=224

 Score =   178 bits (451),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 81/87 (93%), Positives = 86/87 (99%), Gaps = 0/87 (0%)
 Frame = +3

Query  66   DVEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLNYLRPDVRRG  245
            + E+RKGPWTMEEDLILINYIANHG+GVWNSLA+SAGLKRTGKSCRLRWLNYLRPDVRRG
Sbjct  16   EAEVRKGPWTMEEDLILINYIANHGDGVWNSLAKSAGLKRTGKSCRLRWLNYLRPDVRRG  75

Query  246  NITPEEQLLIMELHAKWGNRWSKIAKH  326
            NITPEEQL+IMELHAKWGNRWSKIAKH
Sbjct  76   NITPEEQLIIMELHAKWGNRWSKIAKH  102



>ref|XP_006292470.1| hypothetical protein CARUB_v10018700mg [Capsella rubella]
 gb|EOA25368.1| hypothetical protein CARUB_v10018700mg [Capsella rubella]
Length=227

 Score =   178 bits (451),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 81/87 (93%), Positives = 86/87 (99%), Gaps = 0/87 (0%)
 Frame = +3

Query  66   DVEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLNYLRPDVRRG  245
            + E+RKGPWTMEEDLILINYIANHG+GVWNSLA+SAGLKRTGKSCRLRWLNYLRPDVRRG
Sbjct  16   EAEVRKGPWTMEEDLILINYIANHGDGVWNSLAKSAGLKRTGKSCRLRWLNYLRPDVRRG  75

Query  246  NITPEEQLLIMELHAKWGNRWSKIAKH  326
            NITPEEQL+IMELHAKWGNRWSKIAKH
Sbjct  76   NITPEEQLIIMELHAKWGNRWSKIAKH  102



>ref|XP_010425557.1| PREDICTED: transcription factor MYB21 isoform X2 [Camelina sativa]
Length=224

 Score =   178 bits (451),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 81/87 (93%), Positives = 86/87 (99%), Gaps = 0/87 (0%)
 Frame = +3

Query  66   DVEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLNYLRPDVRRG  245
            + E+RKGPWTMEEDLILINYIANHG+GVWNSLA+SAGLKRTGKSCRLRWLNYLRPDVRRG
Sbjct  16   EAEVRKGPWTMEEDLILINYIANHGDGVWNSLAKSAGLKRTGKSCRLRWLNYLRPDVRRG  75

Query  246  NITPEEQLLIMELHAKWGNRWSKIAKH  326
            NITPEEQL+IMELHAKWGNRWSKIAKH
Sbjct  76   NITPEEQLIIMELHAKWGNRWSKIAKH  102



>ref|XP_010502785.1| PREDICTED: transcription factor MYB21-like [Camelina sativa]
Length=224

 Score =   178 bits (451),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 81/87 (93%), Positives = 86/87 (99%), Gaps = 0/87 (0%)
 Frame = +3

Query  66   DVEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLNYLRPDVRRG  245
            + E+RKGPWTMEEDLILINYIANHG+GVWNSLA+SAGLKRTGKSCRLRWLNYLRPDVRRG
Sbjct  16   EAEVRKGPWTMEEDLILINYIANHGDGVWNSLAKSAGLKRTGKSCRLRWLNYLRPDVRRG  75

Query  246  NITPEEQLLIMELHAKWGNRWSKIAKH  326
            NITPEEQL+IMELHAKWGNRWSKIAKH
Sbjct  76   NITPEEQLIIMELHAKWGNRWSKIAKH  102



>ref|XP_006405505.1| hypothetical protein EUTSA_v10027930mg [Eutrema salsugineum]
 gb|ESQ46958.1| hypothetical protein EUTSA_v10027930mg [Eutrema salsugineum]
Length=214

 Score =   177 bits (450),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 82/87 (94%), Positives = 85/87 (98%), Gaps = 0/87 (0%)
 Frame = +3

Query  66   DVEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLNYLRPDVRRG  245
            D E+RKGPWTMEEDLILINYIANHGEGVWNSLA+SAGLKRTGKSCRLRWLNYLRPDVRRG
Sbjct  14   DAEVRKGPWTMEEDLILINYIANHGEGVWNSLAKSAGLKRTGKSCRLRWLNYLRPDVRRG  73

Query  246  NITPEEQLLIMELHAKWGNRWSKIAKH  326
            NIT EEQL+IMELHAKWGNRWSKIAKH
Sbjct  74   NITAEEQLIIMELHAKWGNRWSKIAKH  100



>ref|XP_002875402.1| ATMYB21 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH51661.1| ATMYB21 [Arabidopsis lyrata subsp. lyrata]
Length=226

 Score =   178 bits (451),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 81/87 (93%), Positives = 86/87 (99%), Gaps = 0/87 (0%)
 Frame = +3

Query  66   DVEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLNYLRPDVRRG  245
            + E+RKGPWTMEEDLILINYIANHG+GVWNSLA+SAGLKRTGKSCRLRWLNYLRPDVRRG
Sbjct  17   EAEVRKGPWTMEEDLILINYIANHGDGVWNSLAKSAGLKRTGKSCRLRWLNYLRPDVRRG  76

Query  246  NITPEEQLLIMELHAKWGNRWSKIAKH  326
            NITPEEQL+IMELHAKWGNRWSKIAKH
Sbjct  77   NITPEEQLIIMELHAKWGNRWSKIAKH  103



>ref|XP_009111584.1| PREDICTED: transcription factor MYB21 [Brassica rapa]
Length=232

 Score =   178 bits (451),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 81/87 (93%), Positives = 85/87 (98%), Gaps = 0/87 (0%)
 Frame = +3

Query  66   DVEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLNYLRPDVRRG  245
            + E+RKGPWTMEEDLILINYIANHG+GVWNSLA+SAGLKRTGKSCRLRWLNYLRPDVRRG
Sbjct  17   EAEVRKGPWTMEEDLILINYIANHGDGVWNSLAKSAGLKRTGKSCRLRWLNYLRPDVRRG  76

Query  246  NITPEEQLLIMELHAKWGNRWSKIAKH  326
            NITPEEQL IMELHAKWGNRWSKIAKH
Sbjct  77   NITPEEQLTIMELHAKWGNRWSKIAKH  103



>ref|XP_010435910.1| PREDICTED: transcription factor MYB24-like [Camelina sativa]
Length=211

 Score =   177 bits (449),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 82/89 (92%), Positives = 86/89 (97%), Gaps = 0/89 (0%)
 Frame = +3

Query  60   SQDVEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLNYLRPDVR  239
            S D ++RKGPWTMEEDLILINYIANHGEGVWNSLA+SAGLKRTGKSCRLRWLNYLRPDVR
Sbjct  13   SGDADVRKGPWTMEEDLILINYIANHGEGVWNSLAKSAGLKRTGKSCRLRWLNYLRPDVR  72

Query  240  RGNITPEEQLLIMELHAKWGNRWSKIAKH  326
            RGNIT EEQL+IMELHAKWGNRWSKIAKH
Sbjct  73   RGNITAEEQLIIMELHAKWGNRWSKIAKH  101



>ref|XP_010925776.1| PREDICTED: myb-related protein 305-like [Elaeis guineensis]
Length=195

 Score =   176 bits (447),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 82/96 (85%), Positives = 89/96 (93%), Gaps = 0/96 (0%)
 Frame = +3

Query  39   MDKKPCNSQDVEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLN  218
            MDK   +SQ+  +RKGPWTMEEDLILINYIANHGEGVWN+LARSAGL RTGKSCRLRWLN
Sbjct  1    MDKTINSSQEAAVRKGPWTMEEDLILINYIANHGEGVWNNLARSAGLNRTGKSCRLRWLN  60

Query  219  YLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKH  326
            YL+PDVRRGNITPEEQLLIM+LHA+WGNRWSKIAK 
Sbjct  61   YLKPDVRRGNITPEEQLLIMDLHARWGNRWSKIAKQ  96



>emb|CDY44433.1| BnaC07g24710D [Brassica napus]
Length=232

 Score =   177 bits (449),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 80/87 (92%), Positives = 86/87 (99%), Gaps = 0/87 (0%)
 Frame = +3

Query  66   DVEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLNYLRPDVRRG  245
            + E+RKGPWTMEEDLILINYIANHG+GVWN+LA+SAGLKRTGKSCRLRWLNYLRPDVRRG
Sbjct  17   ETEVRKGPWTMEEDLILINYIANHGDGVWNTLAKSAGLKRTGKSCRLRWLNYLRPDVRRG  76

Query  246  NITPEEQLLIMELHAKWGNRWSKIAKH  326
            NITPEEQL+IMELHAKWGNRWSKIAKH
Sbjct  77   NITPEEQLIIMELHAKWGNRWSKIAKH  103



>ref|XP_010925788.1| PREDICTED: myb-related protein 305-like [Elaeis guineensis]
Length=201

 Score =   176 bits (447),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 82/96 (85%), Positives = 89/96 (93%), Gaps = 0/96 (0%)
 Frame = +3

Query  39   MDKKPCNSQDVEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLN  218
            MDK+  +SQ+ E+RKGPWT EEDLILINYIANHGEG WN+LARSAGL RTGKSCRLRWLN
Sbjct  8    MDKRINSSQEAEVRKGPWTKEEDLILINYIANHGEGAWNNLARSAGLNRTGKSCRLRWLN  67

Query  219  YLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKH  326
            YLRPDVRRGNITPEEQLLIM+LHA+WGNRWSKIAK 
Sbjct  68   YLRPDVRRGNITPEEQLLIMDLHARWGNRWSKIAKQ  103



>gb|AET25524.1| MYB1 [Brassica oleracea]
Length=232

 Score =   177 bits (449),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 81/87 (93%), Positives = 85/87 (98%), Gaps = 0/87 (0%)
 Frame = +3

Query  66   DVEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLNYLRPDVRRG  245
            + E+RKGPWTMEEDLILINYIANHG+GVWNSLA+SAGLKRTGKSCRLRWLNYLRPDVRRG
Sbjct  17   EAEVRKGPWTMEEDLILINYIANHGDGVWNSLAKSAGLKRTGKSCRLRWLNYLRPDVRRG  76

Query  246  NITPEEQLLIMELHAKWGNRWSKIAKH  326
            NITPEEQL IMELHAKWGNRWSKIAKH
Sbjct  77   NITPEEQLTIMELHAKWGNRWSKIAKH  103



>emb|CDY20036.1| BnaA09g02150D [Brassica napus]
Length=232

 Score =   177 bits (449),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 81/87 (93%), Positives = 85/87 (98%), Gaps = 0/87 (0%)
 Frame = +3

Query  66   DVEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLNYLRPDVRRG  245
            + E+RKGPWTMEEDLILINYIANHG+GVWNSLA+SAGLKRTGKSCRLRWLNYLRPDVRRG
Sbjct  17   EAEVRKGPWTMEEDLILINYIANHGDGVWNSLAKSAGLKRTGKSCRLRWLNYLRPDVRRG  76

Query  246  NITPEEQLLIMELHAKWGNRWSKIAKH  326
            NITPEEQL IMELHAKWGNRWSKIAKH
Sbjct  77   NITPEEQLTIMELHAKWGNRWSKIAKH  103



>emb|CDX86471.1| BnaA06g31880D [Brassica napus]
Length=232

 Score =   177 bits (449),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 80/87 (92%), Positives = 86/87 (99%), Gaps = 0/87 (0%)
 Frame = +3

Query  66   DVEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLNYLRPDVRRG  245
            + E+RKGPWTMEEDLILINYIANHG+GVWN+LA+SAGLKRTGKSCRLRWLNYLRPDVRRG
Sbjct  17   ETEVRKGPWTMEEDLILINYIANHGDGVWNTLAKSAGLKRTGKSCRLRWLNYLRPDVRRG  76

Query  246  NITPEEQLLIMELHAKWGNRWSKIAKH  326
            NITPEEQL+IMELHAKWGNRWSKIAKH
Sbjct  77   NITPEEQLIIMELHAKWGNRWSKIAKH  103



>ref|XP_004142797.1| PREDICTED: myb-related protein 305-like [Cucumis sativus]
Length=209

 Score =   176 bits (445),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 83/97 (86%), Positives = 92/97 (95%), Gaps = 1/97 (1%)
 Frame = +3

Query  39   MDKKPCNSQDV-EIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWL  215
            MDK+  +SQD  E+RKGPWTMEED +L+NYIANHGEGVWNSLA++AGLKRTGKSCRLRWL
Sbjct  1    MDKRLSSSQDDDEVRKGPWTMEEDSMLMNYIANHGEGVWNSLAKAAGLKRTGKSCRLRWL  60

Query  216  NYLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKH  326
            NYLRPDVRRGNITPEEQLLIMELH+KWGNRWSKIA+H
Sbjct  61   NYLRPDVRRGNITPEEQLLIMELHSKWGNRWSKIARH  97



>ref|XP_006285780.1| hypothetical protein CARUB_v10007254mg [Capsella rubella]
 gb|EOA18678.1| hypothetical protein CARUB_v10007254mg [Capsella rubella]
Length=221

 Score =   176 bits (446),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 81/87 (93%), Positives = 85/87 (98%), Gaps = 0/87 (0%)
 Frame = +3

Query  66   DVEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLNYLRPDVRRG  245
            D ++RKGPWTMEEDLILINYIANHGEGVWNSLA+SAGLKRTGKSCRLRWLNYLRPDVRRG
Sbjct  17   DADVRKGPWTMEEDLILINYIANHGEGVWNSLAKSAGLKRTGKSCRLRWLNYLRPDVRRG  76

Query  246  NITPEEQLLIMELHAKWGNRWSKIAKH  326
            NIT EEQL+IMELHAKWGNRWSKIAKH
Sbjct  77   NITAEEQLIIMELHAKWGNRWSKIAKH  103



>gb|KFK33688.1| hypothetical protein AALP_AA5G046900 [Arabis alpina]
Length=228

 Score =   176 bits (446),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 81/87 (93%), Positives = 86/87 (99%), Gaps = 0/87 (0%)
 Frame = +3

Query  66   DVEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLNYLRPDVRRG  245
            + E+RKGPWTMEEDLILINYIANHG+GVWNSLA+SAGLKRTGKSCRLRWLNYLRPDVRRG
Sbjct  17   EAEVRKGPWTMEEDLILINYIANHGDGVWNSLAKSAGLKRTGKSCRLRWLNYLRPDVRRG  76

Query  246  NITPEEQLLIMELHAKWGNRWSKIAKH  326
            NITPEEQL+IMELHAKWGNRWSKIAKH
Sbjct  77   NITPEEQLIIMELHAKWGNRWSKIAKH  103



>ref|XP_009151925.1| PREDICTED: transcription factor MYB21 [Brassica rapa]
Length=232

 Score =   176 bits (447),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 80/87 (92%), Positives = 85/87 (98%), Gaps = 0/87 (0%)
 Frame = +3

Query  66   DVEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLNYLRPDVRRG  245
            + E+RKGPWTMEEDLILINYIANHG+GVWN+LA+SAGLKRTGKSCRLRWLNYLRPDVRRG
Sbjct  17   ETEVRKGPWTMEEDLILINYIANHGDGVWNTLAKSAGLKRTGKSCRLRWLNYLRPDVRRG  76

Query  246  NITPEEQLLIMELHAKWGNRWSKIAKH  326
            NITPEEQL IMELHAKWGNRWSKIAKH
Sbjct  77   NITPEEQLTIMELHAKWGNRWSKIAKH  103



>gb|AGO33165.1| MYB transcription factor [Narcissus tazetta var. chinensis]
Length=210

 Score =   175 bits (443),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 80/96 (83%), Positives = 90/96 (94%), Gaps = 0/96 (0%)
 Frame = +3

Query  39   MDKKPCNSQDVEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLN  218
            MD+   +SQD ++RKGPWT+EEDLIL+NYIANHGEGVWNSLA+SAGLKRTGKSCRLRWLN
Sbjct  8    MDRGVNSSQDADVRKGPWTLEEDLILVNYIANHGEGVWNSLAKSAGLKRTGKSCRLRWLN  67

Query  219  YLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKH  326
            YLRPDVRRGNIT EEQLLIMELH++WGNRWSKIA+ 
Sbjct  68   YLRPDVRRGNITLEEQLLIMELHSRWGNRWSKIARQ  103



>ref|XP_009416734.1| PREDICTED: myb-related protein 305-like [Musa acuminata subsp. 
malaccensis]
Length=204

 Score =   175 bits (443),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 79/95 (83%), Positives = 90/95 (95%), Gaps = 0/95 (0%)
 Frame = +3

Query  42   DKKPCNSQDVEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLNY  221
            DK+  +SQ+ E+RKGPWTMEEDLIL+NYIA+HGEGVWN+LARSAGL RTGKSCRLRWLNY
Sbjct  11   DKRVDSSQETEVRKGPWTMEEDLILVNYIAHHGEGVWNNLARSAGLNRTGKSCRLRWLNY  70

Query  222  LRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKH  326
            LRPD+RRGNITP+EQLLIMELHA+WGNRWSKIA+ 
Sbjct  71   LRPDLRRGNITPQEQLLIMELHARWGNRWSKIARQ  105



>ref|XP_011013638.1| PREDICTED: myb-related protein 305-like isoform X2 [Populus euphratica]
Length=186

 Score =   173 bits (439),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 83/96 (86%), Positives = 87/96 (91%), Gaps = 5/96 (5%)
 Frame = +3

Query  39   MDKKPCNSQDVEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLN  218
            MDK P NSQDVEIRKGPWT+EEDLIL N+IANHGEGVWNSLA+ AG     KSCRLRWLN
Sbjct  1    MDKTPSNSQDVEIRKGPWTLEEDLILTNHIANHGEGVWNSLAKDAG-----KSCRLRWLN  55

Query  219  YLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKH  326
            YLRPD+RRGNITPEEQLLIMELHAKWGNRWSKIAKH
Sbjct  56   YLRPDLRRGNITPEEQLLIMELHAKWGNRWSKIAKH  91



>ref|XP_004516765.1| PREDICTED: myb-related protein 305-like isoform X1 [Cicer arietinum]
Length=257

 Score =   175 bits (444),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 88/106 (83%), Positives = 93/106 (88%), Gaps = 2/106 (2%)
 Frame = +3

Query  6    FHPPPSLSLKKMDK-KPCNS-QDVEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGL  179
            F    SLS K MDK K CNS QD ++RKGPWTMEEDLILINYIANHGEGVWNSLA+SAGL
Sbjct  13   FSHSLSLSYKIMDKNKECNSSQDPDVRKGPWTMEEDLILINYIANHGEGVWNSLAKSAGL  72

Query  180  KRTGKSCRLRWLNYLRPDVRRGNITPEEQLLIMELHAKWGNRWSKI  317
            KRTGKSCR RWLNYLRPD+RRGNITPEEQLLIM+LHAKWGNR  KI
Sbjct  73   KRTGKSCRFRWLNYLRPDIRRGNITPEEQLLIMKLHAKWGNRGFKI  118



>ref|XP_010554050.1| PREDICTED: transcription factor MYB21-like [Tarenaya hassleriana]
Length=202

 Score =   173 bits (438),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 78/91 (86%), Positives = 86/91 (95%), Gaps = 0/91 (0%)
 Frame = +3

Query  54   CNSQDVEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLNYLRPD  233
              S++ E+RKGPWTMEEDLILINYI +HG+GVWNSLA++AGLKRTGKSCRLRWLNYLRPD
Sbjct  7    SGSEEAEVRKGPWTMEEDLILINYITHHGDGVWNSLAKAAGLKRTGKSCRLRWLNYLRPD  66

Query  234  VRRGNITPEEQLLIMELHAKWGNRWSKIAKH  326
            VRRGNIT EEQL+IMELHAKWGNRWSKIAKH
Sbjct  67   VRRGNITAEEQLIIMELHAKWGNRWSKIAKH  97



>ref|XP_008458780.1| PREDICTED: myb-related protein 340-like [Cucumis melo]
Length=210

 Score =   173 bits (438),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 79/87 (91%), Positives = 86/87 (99%), Gaps = 0/87 (0%)
 Frame = +3

Query  66   DVEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLNYLRPDVRRG  245
            D E+RKGPWTMEEDL+L+NYIANHGEGVWNSLA++AGLKRTGKSCRLRWLNYLRPDVRRG
Sbjct  12   DDEVRKGPWTMEEDLMLMNYIANHGEGVWNSLAKAAGLKRTGKSCRLRWLNYLRPDVRRG  71

Query  246  NITPEEQLLIMELHAKWGNRWSKIAKH  326
            NITPEEQLLIMELH+KWGNRWSKIA+H
Sbjct  72   NITPEEQLLIMELHSKWGNRWSKIARH  98



>gb|ABH02872.1| MYB transcription factor MYB99 [Glycine max]
Length=198

 Score =   172 bits (436),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 80/90 (89%), Positives = 86/90 (96%), Gaps = 0/90 (0%)
 Frame = +3

Query  57   NSQDVEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLNYLRPDV  236
            +S D E+RKGPWTMEEDLILINYIANHGEGVWNSLA+++GLKRTGKSCRLRWLNYLRPDV
Sbjct  1    SSHDPEVRKGPWTMEEDLILINYIANHGEGVWNSLAKASGLKRTGKSCRLRWLNYLRPDV  60

Query  237  RRGNITPEEQLLIMELHAKWGNRWSKIAKH  326
            RRG  TPEEQLLI+ELHAKWGNRWSKIAKH
Sbjct  61   RRGIFTPEEQLLIIELHAKWGNRWSKIAKH  90



>ref|XP_011013295.1| PREDICTED: myb-related protein 305-like isoform X2 [Populus euphratica]
Length=186

 Score =   171 bits (434),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 82/96 (85%), Positives = 87/96 (91%), Gaps = 5/96 (5%)
 Frame = +3

Query  39   MDKKPCNSQDVEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLN  218
            MDK P NS+DVEIRKGPWT+EEDLIL N+IANHGEGVWNSLA+ AG     KSCRLRWLN
Sbjct  1    MDKTPSNSRDVEIRKGPWTLEEDLILTNHIANHGEGVWNSLAKDAG-----KSCRLRWLN  55

Query  219  YLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKH  326
            YLRPD+RRGNITPEEQLLIMELHAKWGNRWSKIAKH
Sbjct  56   YLRPDLRRGNITPEEQLLIMELHAKWGNRWSKIAKH  91



>ref|XP_010029159.1| PREDICTED: myb-related protein 340-like [Eucalyptus grandis]
 gb|KCW56012.1| hypothetical protein EUGRSUZ_I01782 [Eucalyptus grandis]
Length=208

 Score =   171 bits (433),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 79/97 (81%), Positives = 91/97 (94%), Gaps = 1/97 (1%)
 Frame = +3

Query  39   MDKKPC-NSQDVEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWL  215
            MDKKPC  +QD ++RKGPWT+EEDLIL++YIANHGEGVWNSLA++AGL+RTGKSCRLRWL
Sbjct  1    MDKKPCYRTQDPQVRKGPWTLEEDLILMDYIANHGEGVWNSLAKAAGLQRTGKSCRLRWL  60

Query  216  NYLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKH  326
            NYLRPDVRRGNITPEEQLLI+ L + WGNRWS+IAKH
Sbjct  61   NYLRPDVRRGNITPEEQLLIIHLQSMWGNRWSEIAKH  97



>ref|XP_004156725.1| PREDICTED: LOW QUALITY PROTEIN: myb-related protein 305-like 
[Cucumis sativus]
Length=210

 Score =   171 bits (433),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 78/87 (90%), Positives = 85/87 (98%), Gaps = 0/87 (0%)
 Frame = +3

Query  66   DVEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLNYLRPDVRRG  245
            D E+RKGPWTMEED +L+NYIANHGEGVWNSLA++AGLKRTGKSCRLRWLNYLRPDVRRG
Sbjct  12   DDEVRKGPWTMEEDSMLMNYIANHGEGVWNSLAKAAGLKRTGKSCRLRWLNYLRPDVRRG  71

Query  246  NITPEEQLLIMELHAKWGNRWSKIAKH  326
            NITPEEQLLIMELH+KWGNRWSKIA+H
Sbjct  72   NITPEEQLLIMELHSKWGNRWSKIARH  98



>ref|XP_010555954.1| PREDICTED: transcription factor MYB21-like [Tarenaya hassleriana]
Length=207

 Score =   171 bits (432),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 78/89 (88%), Positives = 86/89 (97%), Gaps = 0/89 (0%)
 Frame = +3

Query  60   SQDVEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLNYLRPDVR  239
            S + ++RKGPWTMEEDLILINYI+NHGEGVWNSLA++AGLKRTGKSCRLRWLNYLRPD+R
Sbjct  10   SGEEDVRKGPWTMEEDLILINYISNHGEGVWNSLAKAAGLKRTGKSCRLRWLNYLRPDLR  69

Query  240  RGNITPEEQLLIMELHAKWGNRWSKIAKH  326
            RGNIT EEQL+IMELHAKWGNRWSKIAKH
Sbjct  70   RGNITSEEQLVIMELHAKWGNRWSKIAKH  98



>ref|XP_010450678.1| PREDICTED: transcription factor MYB24-like [Camelina sativa]
Length=211

 Score =   170 bits (431),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 79/87 (91%), Positives = 83/87 (95%), Gaps = 0/87 (0%)
 Frame = +3

Query  66   DVEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLNYLRPDVRRG  245
            D ++RKGP TMEEDLILINYI NHGEGVWNSLA+SAGLKRTGKSCRLRWLNYLRPDVRRG
Sbjct  15   DADVRKGPRTMEEDLILINYITNHGEGVWNSLAKSAGLKRTGKSCRLRWLNYLRPDVRRG  74

Query  246  NITPEEQLLIMELHAKWGNRWSKIAKH  326
            NIT EEQL+IMELHAKWGNRWSKIAKH
Sbjct  75   NITAEEQLIIMELHAKWGNRWSKIAKH  101



>ref|XP_010441167.1| PREDICTED: transcription factor MYB24-like [Camelina sativa]
Length=211

 Score =   170 bits (431),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 79/87 (91%), Positives = 83/87 (95%), Gaps = 0/87 (0%)
 Frame = +3

Query  66   DVEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLNYLRPDVRRG  245
            D ++RKGPWTMEEDLILIN IANHGEGVWNSLA+SAGLKRTGKSCRLRWLNYLRPDVRRG
Sbjct  15   DADVRKGPWTMEEDLILINCIANHGEGVWNSLAKSAGLKRTGKSCRLRWLNYLRPDVRRG  74

Query  246  NITPEEQLLIMELHAKWGNRWSKIAKH  326
            NIT EEQL IMELH+KWGNRWSKIAKH
Sbjct  75   NITAEEQLTIMELHSKWGNRWSKIAKH  101



>ref|XP_010555957.1| PREDICTED: transcription factor MYB21-like [Tarenaya hassleriana]
Length=206

 Score =   169 bits (428),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 77/89 (87%), Positives = 85/89 (96%), Gaps = 0/89 (0%)
 Frame = +3

Query  60   SQDVEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLNYLRPDVR  239
            S + ++RKGPWTMEEDLILINYI NHG+GVWNSLA++AGLKRTGKSCRLRWLNYLRPD+R
Sbjct  10   SGEEDVRKGPWTMEEDLILINYITNHGDGVWNSLAKAAGLKRTGKSCRLRWLNYLRPDLR  69

Query  240  RGNITPEEQLLIMELHAKWGNRWSKIAKH  326
            RGNIT EEQL+IMELHAKWGNRWSKIAKH
Sbjct  70   RGNITSEEQLVIMELHAKWGNRWSKIAKH  98



>ref|XP_006841613.1| hypothetical protein AMTR_s00003p00219710 [Amborella trichopoda]
 gb|ERN03288.1| hypothetical protein AMTR_s00003p00219710 [Amborella trichopoda]
Length=272

 Score =   171 bits (433),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 78/101 (77%), Positives = 90/101 (89%), Gaps = 5/101 (5%)
 Frame = +3

Query  39   MDKKPCNS-----QDVEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCR  203
               +PCNS     +D E+R+GPWT+EED+IL+NYIANHGEG WNSLAR AGLKRTGKSCR
Sbjct  3    FSNRPCNSSPHIDEDSELRRGPWTVEEDMILVNYIANHGEGRWNSLARCAGLKRTGKSCR  62

Query  204  LRWLNYLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKH  326
            LRWLNYLRPDVRRGNITPEEQL+I+ELH++WGNRWSKIA+H
Sbjct  63   LRWLNYLRPDVRRGNITPEEQLMILELHSRWGNRWSKIAQH  103



>ref|XP_009406298.1| PREDICTED: myb-related protein 305-like [Musa acuminata subsp. 
malaccensis]
Length=195

 Score =   168 bits (426),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 78/97 (80%), Positives = 87/97 (90%), Gaps = 1/97 (1%)
 Frame = +3

Query  39   MDKKPCNS-QDVEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWL  215
            M  K  NS ++ ++RKGPWTMEEDLIL+NYI NHGEGVWNSLARSAGLKRTGKSCRLRWL
Sbjct  9    MSNKSVNSGEEADVRKGPWTMEEDLILVNYIGNHGEGVWNSLARSAGLKRTGKSCRLRWL  68

Query  216  NYLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKH  326
            NYLRPD+RRGNIT +EQLLIMEL A+WGNRWSKIA+ 
Sbjct  69   NYLRPDLRRGNITAQEQLLIMELQARWGNRWSKIARQ  105



>dbj|BAL41446.1| transcription factor MYB21 [Linum grandiflorum]
Length=224

 Score =   168 bits (426),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 78/84 (93%), Positives = 82/84 (98%), Gaps = 0/84 (0%)
 Frame = +3

Query  75   IRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLNYLRPDVRRGNIT  254
            IRKGPWTMEEDLILINYIANHGEGVWNSLA SAGLKRTGKSCRLRWLNYLRPDVRRGNIT
Sbjct  24   IRKGPWTMEEDLILINYIANHGEGVWNSLALSAGLKRTGKSCRLRWLNYLRPDVRRGNIT  83

Query  255  PEEQLLIMELHAKWGNRWSKIAKH  326
             +EQ+LIM+LH+KWGNRWSKIAKH
Sbjct  84   LDEQILIMDLHSKWGNRWSKIAKH  107



>gb|ABC54967.1| MYB-like protein [Vitis vinifera]
Length=97

 Score =   162 bits (409),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 78/83 (94%), Positives = 80/83 (96%), Gaps = 0/83 (0%)
 Frame = +3

Query  78   RKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLNYLRPDVRRGNITP  257
            RKG WT+EEDLILINYIANHGEGVWNSLA+SAGLKRTGKSCRLRWLNYLRPDVRRGNIT 
Sbjct  1    RKGGWTLEEDLILINYIANHGEGVWNSLAKSAGLKRTGKSCRLRWLNYLRPDVRRGNITD  60

Query  258  EEQLLIMELHAKWGNRWSKIAKH  326
            EEQ LIMELHAKWGNRWSKIAKH
Sbjct  61   EEQQLIMELHAKWGNRWSKIAKH  83



>gb|ABC54957.1| MYB-like protein [Vitis vinifera]
Length=97

 Score =   162 bits (409),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 78/83 (94%), Positives = 80/83 (96%), Gaps = 0/83 (0%)
 Frame = +3

Query  78   RKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLNYLRPDVRRGNITP  257
            RKG WT+EEDLILINYIANHGEGVWNSLA+SAGLKRTGKSCRLRWLNYLRPDVRRGNIT 
Sbjct  1    RKGGWTLEEDLILINYIANHGEGVWNSLAKSAGLKRTGKSCRLRWLNYLRPDVRRGNITD  60

Query  258  EEQLLIMELHAKWGNRWSKIAKH  326
            EEQ LIMELHAKWGNRWSKIAKH
Sbjct  61   EEQQLIMELHAKWGNRWSKIAKH  83



>gb|KFK37619.1| hypothetical protein AALP_AA3G006700 [Arabis alpina]
Length=204

 Score =   165 bits (417),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 75/94 (80%), Positives = 85/94 (90%), Gaps = 0/94 (0%)
 Frame = +3

Query  45   KKPCNSQDVEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLNYL  224
            K+    ++V +RKGPWTMEEDLIL NYI NHGEG+WNS+A+S+GLKRTGKSCRLRWLNYL
Sbjct  12   KERVTEEEVTVRKGPWTMEEDLILFNYILNHGEGLWNSVAKSSGLKRTGKSCRLRWLNYL  71

Query  225  RPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKH  326
            RPDVRRGNIT EEQLLI++LHAK GNRWSKIAKH
Sbjct  72   RPDVRRGNITSEEQLLIIQLHAKLGNRWSKIAKH  105



>gb|ABC54969.1| MYB-like protein [Vitis vinifera]
 gb|ABC54978.1| MYB-like protein [Vitis vinifera]
Length=97

 Score =   161 bits (408),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 77/83 (93%), Positives = 80/83 (96%), Gaps = 0/83 (0%)
 Frame = +3

Query  78   RKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLNYLRPDVRRGNITP  257
            R+G WT+EEDLILINYIANHGEGVWNSLA+SAGLKRTGKSCRLRWLNYLRPDVRRGNIT 
Sbjct  1    RRGAWTLEEDLILINYIANHGEGVWNSLAKSAGLKRTGKSCRLRWLNYLRPDVRRGNITD  60

Query  258  EEQLLIMELHAKWGNRWSKIAKH  326
            EEQ LIMELHAKWGNRWSKIAKH
Sbjct  61   EEQQLIMELHAKWGNRWSKIAKH  83



>gb|ABC54983.1| MYB-like protein [Vitis vinifera]
Length=97

 Score =   160 bits (406),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 77/83 (93%), Positives = 80/83 (96%), Gaps = 0/83 (0%)
 Frame = +3

Query  78   RKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLNYLRPDVRRGNITP  257
            R+G WT+EEDLILINYIANHGEGVWNSLA+SAGLKRTGKSCRLRWLNYLRPDVRRGNIT 
Sbjct  1    RRGGWTLEEDLILINYIANHGEGVWNSLAKSAGLKRTGKSCRLRWLNYLRPDVRRGNITD  60

Query  258  EEQLLIMELHAKWGNRWSKIAKH  326
            EEQ LIMELHAKWGNRWSKIAKH
Sbjct  61   EEQQLIMELHAKWGNRWSKIAKH  83



>gb|ABC54973.1| MYB-like protein [Vitis vinifera]
Length=97

 Score =   160 bits (406),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 77/83 (93%), Positives = 80/83 (96%), Gaps = 0/83 (0%)
 Frame = +3

Query  78   RKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLNYLRPDVRRGNITP  257
            R+G WT+EEDLILINYIANHGEGVWNSLA+SAGLKRTGKSCRLRWLNYLRPDVRRGNIT 
Sbjct  1    RRGGWTLEEDLILINYIANHGEGVWNSLAKSAGLKRTGKSCRLRWLNYLRPDVRRGNITD  60

Query  258  EEQLLIMELHAKWGNRWSKIAKH  326
            EEQ LIMELHAKWGNRWSKIAKH
Sbjct  61   EEQQLIMELHAKWGNRWSKIAKH  83



>gb|ABC54986.1| MYB-like protein [Vitis vinifera]
Length=97

 Score =   160 bits (405),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 76/83 (92%), Positives = 80/83 (96%), Gaps = 0/83 (0%)
 Frame = +3

Query  78   RKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLNYLRPDVRRGNITP  257
            ++G WT+EEDLILINYIANHGEGVWNSLA+SAGLKRTGKSCRLRWLNYLRPDVRRGNIT 
Sbjct  1    KRGAWTLEEDLILINYIANHGEGVWNSLAKSAGLKRTGKSCRLRWLNYLRPDVRRGNITD  60

Query  258  EEQLLIMELHAKWGNRWSKIAKH  326
            EEQ LIMELHAKWGNRWSKIAKH
Sbjct  61   EEQQLIMELHAKWGNRWSKIAKH  83



>gb|ABC54990.1| MYB-like protein [Vitis vinifera]
Length=95

 Score =   159 bits (401),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 76/81 (94%), Positives = 78/81 (96%), Gaps = 0/81 (0%)
 Frame = +3

Query  84   GPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLNYLRPDVRRGNITPEE  263
            G WT+EEDLILINYIANHGEGVWNSLA+SAGLKRTGKSCRLRWLNYLRPDVRRGNIT EE
Sbjct  1    GAWTLEEDLILINYIANHGEGVWNSLAKSAGLKRTGKSCRLRWLNYLRPDVRRGNITDEE  60

Query  264  QLLIMELHAKWGNRWSKIAKH  326
            Q LIMELHAKWGNRWSKIAKH
Sbjct  61   QQLIMELHAKWGNRWSKIAKH  81



>ref|XP_008793362.1| PREDICTED: transcription factor MYB108-like [Phoenix dactylifera]
Length=291

 Score =   164 bits (415),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 75/92 (82%), Positives = 87/92 (95%), Gaps = 0/92 (0%)
 Frame = +3

Query  51   PCNSQDVEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLNYLRP  230
            P + +D+++R+GPWT+EEDLIL+NYIA HGEG WNSLAR AGLKRTGKSCRLRWLNYLRP
Sbjct  21   PPSEEDMDLRRGPWTVEEDLILMNYIAAHGEGRWNSLARCAGLKRTGKSCRLRWLNYLRP  80

Query  231  DVRRGNITPEEQLLIMELHAKWGNRWSKIAKH  326
            DVRRGNITPEEQLLI+ELH++WGNRWSKIA+H
Sbjct  81   DVRRGNITPEEQLLILELHSRWGNRWSKIAQH  112



>gb|ABC54966.1| MYB-like protein [Vitis vinifera]
Length=95

 Score =   158 bits (399),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 76/81 (94%), Positives = 78/81 (96%), Gaps = 0/81 (0%)
 Frame = +3

Query  84   GPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLNYLRPDVRRGNITPEE  263
            G WT+EEDLILINYIANHGEGVWNSLA+SAGLKRTGKSCRLRWLNYLRPDVRRGNIT EE
Sbjct  1    GGWTLEEDLILINYIANHGEGVWNSLAKSAGLKRTGKSCRLRWLNYLRPDVRRGNITDEE  60

Query  264  QLLIMELHAKWGNRWSKIAKH  326
            Q LIMELHAKWGNRWSKIAKH
Sbjct  61   QQLIMELHAKWGNRWSKIAKH  81



>gb|KHN27441.1| Myb-related protein 305 [Glycine soja]
Length=201

 Score =   161 bits (408),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 81/98 (83%), Positives = 84/98 (86%), Gaps = 7/98 (7%)
 Frame = +3

Query  39   MDKKPCNS--QDVEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRW  212
            MDKKPCNS   D E+RKGPWTMEEDLILINYIANHGEG      +  G  RTGKSCRLRW
Sbjct  1    MDKKPCNSSSHDPEVRKGPWTMEEDLILINYIANHGEG-----PKLLGDIRTGKSCRLRW  55

Query  213  LNYLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKH  326
            LNYLRPDVRRGNITPEEQLLI+ELHAKWGNRWSKIAKH
Sbjct  56   LNYLRPDVRRGNITPEEQLLIIELHAKWGNRWSKIAKH  93



>ref|XP_008781174.1| PREDICTED: transcription factor MYB108 [Phoenix dactylifera]
Length=292

 Score =   164 bits (415),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 75/92 (82%), Positives = 86/92 (93%), Gaps = 0/92 (0%)
 Frame = +3

Query  51   PCNSQDVEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLNYLRP  230
            P + +D+++R+GPWT EEDLIL+NYIA HGEG WNSLAR AGLKRTGKSCRLRWLNYLRP
Sbjct  21   PPSEEDMDLRRGPWTAEEDLILMNYIAAHGEGRWNSLARCAGLKRTGKSCRLRWLNYLRP  80

Query  231  DVRRGNITPEEQLLIMELHAKWGNRWSKIAKH  326
            DVRRGNITPEEQLLI+ELH++WGNRWSKIA+H
Sbjct  81   DVRRGNITPEEQLLILELHSRWGNRWSKIAQH  112



>ref|XP_009386341.1| PREDICTED: transcription factor MYB108-like [Musa acuminata subsp. 
malaccensis]
Length=281

 Score =   163 bits (412),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 73/95 (77%), Positives = 89/95 (94%), Gaps = 0/95 (0%)
 Frame = +3

Query  42   DKKPCNSQDVEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLNY  221
            +  P + +++++R+GPWT++EDLILINYIA HGEG WNSLARSAGL+RTGKSCRLRWLNY
Sbjct  5    ESTPQSEEELDLRRGPWTVDEDLILINYIAAHGEGQWNSLARSAGLRRTGKSCRLRWLNY  64

Query  222  LRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKH  326
            LRPDVRRGNITPEEQLLI+ELH++WGNRWSKIA++
Sbjct  65   LRPDVRRGNITPEEQLLILELHSRWGNRWSKIAQY  99



>gb|ABC54984.1| MYB-like protein [Vitis vinifera]
Length=97

 Score =   157 bits (397),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 75/83 (90%), Positives = 79/83 (95%), Gaps = 0/83 (0%)
 Frame = +3

Query  78   RKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLNYLRPDVRRGNITP  257
            ++G WT+EEDLILINYIANHGEGVWNSLA+SAGLKRTGKSCRLRWLNY RPDVRRGNIT 
Sbjct  1    KRGRWTLEEDLILINYIANHGEGVWNSLAKSAGLKRTGKSCRLRWLNYQRPDVRRGNITD  60

Query  258  EEQLLIMELHAKWGNRWSKIAKH  326
            EEQ LIMELHAKWGNRWSKIAKH
Sbjct  61   EEQQLIMELHAKWGNRWSKIAKH  83



>gb|KHN27530.1| Myb-related protein 305 [Glycine soja]
Length=187

 Score =   160 bits (404),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 75/77 (97%), Positives = 77/77 (100%), Gaps = 0/77 (0%)
 Frame = +3

Query  96   MEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLNYLRPDVRRGNITPEEQLLI  275
            MEEDLILINYIANHGEGVWNSLA++AGLKRTGKSCRLRWLNYLRPDVRRGNITPEEQLLI
Sbjct  1    MEEDLILINYIANHGEGVWNSLAKAAGLKRTGKSCRLRWLNYLRPDVRRGNITPEEQLLI  60

Query  276  MELHAKWGNRWSKIAKH  326
            MELHAKWGNRWSKIAKH
Sbjct  61   MELHAKWGNRWSKIAKH  77



>gb|AAL84762.1|AF474129_1 typical P-type R2R3 Myb protein [Sorghum bicolor]
Length=165

 Score =   159 bits (402),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 71/85 (84%), Positives = 83/85 (98%), Gaps = 0/85 (0%)
 Frame = +3

Query  72   EIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLNYLRPDVRRGNI  251
            E+R+GPWT+EEDL+L+NY+A HGEG WNSLARSAGLKRTGKSCRLRWLNYLRPD+RRGNI
Sbjct  4    ELRRGPWTVEEDLLLVNYVAAHGEGRWNSLARSAGLKRTGKSCRLRWLNYLRPDLRRGNI  63

Query  252  TPEEQLLIMELHAKWGNRWSKIAKH  326
            TP+EQLLI+ELH++WGNRWSKIA+H
Sbjct  64   TPQEQLLILELHSRWGNRWSKIAQH  88



>ref|XP_009402050.1| PREDICTED: transcription factor MYB108-like [Musa acuminata subsp. 
malaccensis]
Length=256

 Score =   161 bits (407),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 74/94 (79%), Positives = 86/94 (91%), Gaps = 1/94 (1%)
 Frame = +3

Query  48   KPCNSQD-VEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLNYL  224
            K C  ++ +++R+GPWT++EDLIL+NYIA HGEG WNSLAR AGLKRTGKSCRLRWLNYL
Sbjct  6    KSCGGEEELDLRRGPWTVDEDLILVNYIAVHGEGRWNSLARCAGLKRTGKSCRLRWLNYL  65

Query  225  RPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKH  326
            RPDVRRGNITPEEQLLI+ELH +WGNRWSKIA+H
Sbjct  66   RPDVRRGNITPEEQLLILELHCRWGNRWSKIAQH  99



>ref|XP_002882176.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH58435.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=202

 Score =   159 bits (402),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 76/106 (72%), Positives = 86/106 (81%), Gaps = 3/106 (3%)
 Frame = +3

Query  18   PSLSLKKMDKKPCNSQDVE---IRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRT  188
             ++  K   K    SQ  E   +RKGPWTMEED IL NYI NHGEG+WNS+A+++GLKRT
Sbjct  3    TTMKKKGRGKATITSQKEEEGTVRKGPWTMEEDFILFNYILNHGEGLWNSVAKASGLKRT  62

Query  189  GKSCRLRWLNYLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKH  326
            GKSCRLRWLNYLRPDVRRGNIT EEQLLI++LHAK GNRWSKIAKH
Sbjct  63   GKSCRLRWLNYLRPDVRRGNITAEEQLLIIQLHAKLGNRWSKIAKH  108



>gb|ABC54985.1| MYB-like protein [Vitis vinifera]
Length=80

 Score =   155 bits (392),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 74/80 (93%), Positives = 77/80 (96%), Gaps = 0/80 (0%)
 Frame = +3

Query  78   RKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLNYLRPDVRRGNITP  257
            +KG WT+EEDLILINYIANHGEGVWNSLA+SAGLKRTGKSCRLRWLNYLRPDVRRGNIT 
Sbjct  1    KKGGWTLEEDLILINYIANHGEGVWNSLAKSAGLKRTGKSCRLRWLNYLRPDVRRGNITD  60

Query  258  EEQLLIMELHAKWGNRWSKI  317
            EEQ LIMELHAKWGNRWSKI
Sbjct  61   EEQQLIMELHAKWGNRWSKI  80



>gb|AAM67076.1| putative transcription factor [Arabidopsis thaliana]
Length=206

 Score =   159 bits (402),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 75/97 (77%), Positives = 83/97 (86%), Gaps = 3/97 (3%)
 Frame = +3

Query  45   KKPCNSQDVE---IRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWL  215
            K    SQ  E   +RKGPWTMEED IL NYI NHGEG+WNS+A+++GLKRTGKSCRLRWL
Sbjct  12   KATITSQKEEEGTVRKGPWTMEEDFILFNYILNHGEGLWNSVAKASGLKRTGKSCRLRWL  71

Query  216  NYLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKH  326
            NYLRPDVRRGNIT EEQLLI++LHAK GNRWSKIAKH
Sbjct  72   NYLRPDVRRGNITTEEQLLIIQLHAKLGNRWSKIAKH  108



>ref|XP_010489626.1| PREDICTED: transcription factor MYB57-like [Camelina sativa]
Length=119

 Score =   156 bits (394),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 75/105 (71%), Positives = 86/105 (82%), Gaps = 3/105 (3%)
 Frame = +3

Query  21   SLSLKKMDKKPCNSQDVE---IRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTG  191
            ++  K   K    SQ  E   +RKGPWTMEED IL NYI NHGEG+WNS+A+++GLKRTG
Sbjct  3    TMKKKGRGKATITSQKEEEGTVRKGPWTMEEDFILFNYILNHGEGLWNSVAKASGLKRTG  62

Query  192  KSCRLRWLNYLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKH  326
            KSCRLRWLNYLRPDVRRGNIT EEQL+I++LHAK GNRWSKIAKH
Sbjct  63   KSCRLRWLNYLRPDVRRGNITAEEQLVIIQLHAKLGNRWSKIAKH  107



>ref|NP_186802.1| myb domain protein 57 [Arabidopsis thaliana]
 sp|Q9SSA1.1|MYB57_ARATH RecName: Full=Transcription factor MYB57; AltName: Full=Myb-related 
protein 57; Short=AtMYB57 [Arabidopsis thaliana]
 gb|AAF01538.1|AC009325_8 putative transcription factor [Arabidopsis thaliana]
 dbj|BAC42719.1| putative transcription factor [Arabidopsis thaliana]
 gb|AAO63994.1| putative myb family transcription factor [Arabidopsis thaliana]
 gb|AAS10052.1| MYB transcription factor [Arabidopsis thaliana]
 gb|AEE73682.1| myb domain protein 57 [Arabidopsis thaliana]
Length=206

 Score =   159 bits (401),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 71/84 (85%), Positives = 79/84 (94%), Gaps = 0/84 (0%)
 Frame = +3

Query  75   IRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLNYLRPDVRRGNIT  254
            +RKGPWTMEED IL NYI NHGEG+WNS+A+++GLKRTGKSCRLRWLNYLRPDVRRGNIT
Sbjct  25   VRKGPWTMEEDFILFNYILNHGEGLWNSVAKASGLKRTGKSCRLRWLNYLRPDVRRGNIT  84

Query  255  PEEQLLIMELHAKWGNRWSKIAKH  326
             EEQLLI++LHAK GNRWSKIAKH
Sbjct  85   EEEQLLIIQLHAKLGNRWSKIAKH  108



>gb|AFW82705.1| putative MYB DNA-binding domain superfamily protein [Zea mays]
Length=357

 Score =   163 bits (412),  Expect = 3e-46, Method: Composition-based stats.
 Identities = 70/85 (82%), Positives = 82/85 (96%), Gaps = 0/85 (0%)
 Frame = +3

Query  72   EIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLNYLRPDVRRGNI  251
            E+R+GPWT++ED++L+NYIA HGEG WNSLARSAGL+RTGKSCRLRWLNYLRPDVRRGNI
Sbjct  51   ELRRGPWTVDEDILLVNYIAAHGEGRWNSLARSAGLRRTGKSCRLRWLNYLRPDVRRGNI  110

Query  252  TPEEQLLIMELHAKWGNRWSKIAKH  326
            T EEQLLI+ELH++WGNRWSKIA+H
Sbjct  111  TVEEQLLILELHSRWGNRWSKIAQH  135



>ref|XP_004984581.1| PREDICTED: myb-related protein P-like [Setaria italica]
Length=318

 Score =   162 bits (409),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 71/85 (84%), Positives = 84/85 (99%), Gaps = 0/85 (0%)
 Frame = +3

Query  72   EIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLNYLRPDVRRGNI  251
            E+R+GPWT+EEDL+L+NY+A+HGEG WNSLARSAGLKRTGKSCRLRWLNYLRPD+RRGNI
Sbjct  19   ELRRGPWTVEEDLLLVNYVASHGEGRWNSLARSAGLKRTGKSCRLRWLNYLRPDLRRGNI  78

Query  252  TPEEQLLIMELHAKWGNRWSKIAKH  326
            TP+EQLLI+ELH++WGNRWSKIA+H
Sbjct  79   TPQEQLLILELHSRWGNRWSKIAQH  103



>ref|XP_010921398.1| PREDICTED: LOW QUALITY PROTEIN: transcription factor MYB108 [Elaeis 
guineensis]
Length=292

 Score =   161 bits (407),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 74/92 (80%), Positives = 86/92 (93%), Gaps = 0/92 (0%)
 Frame = +3

Query  51   PCNSQDVEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLNYLRP  230
            P + +D+++R+GPWT EEDLIL+NYIA HGEG WNSLAR AGLKRTGKSCRLRWLNYLRP
Sbjct  21   PPSEEDMDLRRGPWTAEEDLILMNYIAAHGEGRWNSLARCAGLKRTGKSCRLRWLNYLRP  80

Query  231  DVRRGNITPEEQLLIMELHAKWGNRWSKIAKH  326
            DVRRGNITPEEQLLI+ELH++WGNRWSKIA++
Sbjct  81   DVRRGNITPEEQLLILELHSRWGNRWSKIAQY  112



>gb|KHN23525.1| Transcription factor MYB21 [Glycine soja]
Length=185

 Score =   157 bits (398),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 73/77 (95%), Positives = 77/77 (100%), Gaps = 0/77 (0%)
 Frame = +3

Query  96   MEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLNYLRPDVRRGNITPEEQLLI  275
            MEEDLILINYIANHGEGVWNSLA+++GLKRTGKSCRLRWLNYLRPDVRRGNITPEEQLLI
Sbjct  1    MEEDLILINYIANHGEGVWNSLAKASGLKRTGKSCRLRWLNYLRPDVRRGNITPEEQLLI  60

Query  276  MELHAKWGNRWSKIAKH  326
            +ELHAKWGNRWSKIAKH
Sbjct  61   IELHAKWGNRWSKIAKH  77



>emb|CDX91944.1| BnaC03g32460D [Brassica napus]
Length=207

 Score =   158 bits (400),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 71/84 (85%), Positives = 79/84 (94%), Gaps = 0/84 (0%)
 Frame = +3

Query  75   IRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLNYLRPDVRRGNIT  254
            +RKGPWTMEEDLIL NYI NHGEG+WNS+A+++GLKRTGKSCRLRWLNYLRPDVRRGNIT
Sbjct  23   VRKGPWTMEEDLILFNYIFNHGEGLWNSVAKASGLKRTGKSCRLRWLNYLRPDVRRGNIT  82

Query  255  PEEQLLIMELHAKWGNRWSKIAKH  326
             EEQLLI++L AK GNRWSKIAKH
Sbjct  83   AEEQLLIIQLQAKLGNRWSKIAKH  106



>ref|XP_009385372.1| PREDICTED: transcription factor MYB108-like [Musa acuminata subsp. 
malaccensis]
Length=221

 Score =   159 bits (401),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 71/85 (84%), Positives = 82/85 (96%), Gaps = 0/85 (0%)
 Frame = +3

Query  69   VEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLNYLRPDVRRGN  248
            +E+RKG WT+EEDL+L+NYIA+HGEG WNSLAR AGL+RTGKSCRLRWLNYLRPDVRRGN
Sbjct  1    MEVRKGAWTVEEDLLLMNYIASHGEGQWNSLARCAGLRRTGKSCRLRWLNYLRPDVRRGN  60

Query  249  ITPEEQLLIMELHAKWGNRWSKIAK  323
            ITPEEQLLI+ELH++WGNRWSKIA+
Sbjct  61   ITPEEQLLILELHSRWGNRWSKIAQ  85



>ref|XP_010496298.1| PREDICTED: transcription factor MYB57-like [Camelina sativa]
Length=205

 Score =   158 bits (399),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 75/105 (71%), Positives = 86/105 (82%), Gaps = 3/105 (3%)
 Frame = +3

Query  21   SLSLKKMDKKPCNSQDVE---IRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTG  191
            ++  K   K    SQ  E   +RKGPWTMEED IL NYI NHGEG+WNS+A+++GLKRTG
Sbjct  3    TMKKKGRGKATITSQKEEEGTVRKGPWTMEEDFILFNYILNHGEGLWNSVAKASGLKRTG  62

Query  192  KSCRLRWLNYLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKH  326
            KSCRLRWLNYLRPDVRRGNIT EEQL+I++LHAK GNRWSKIAKH
Sbjct  63   KSCRLRWLNYLRPDVRRGNITAEEQLVIIQLHAKLGNRWSKIAKH  107



>ref|XP_009416464.1| PREDICTED: myb-related protein 305-like [Musa acuminata subsp. 
malaccensis]
Length=270

 Score =   160 bits (404),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 71/87 (82%), Positives = 83/87 (95%), Gaps = 0/87 (0%)
 Frame = +3

Query  66   DVEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLNYLRPDVRRG  245
            +VE+RKG WT+EEDL+L+NY+A HGEG W+SLAR AGLKRTGKSCRLRWLNYLRPD+RRG
Sbjct  12   EVELRKGSWTVEEDLLLVNYVAEHGEGRWDSLAREAGLKRTGKSCRLRWLNYLRPDLRRG  71

Query  246  NITPEEQLLIMELHAKWGNRWSKIAKH  326
            NITPEEQLLI+ELH++WGNRWSKIA+H
Sbjct  72   NITPEEQLLILELHSRWGNRWSKIAQH  98



>ref|XP_006300020.1| hypothetical protein CARUB_v10016245mg [Capsella rubella]
 gb|EOA32918.1| hypothetical protein CARUB_v10016245mg [Capsella rubella]
Length=203

 Score =   157 bits (398),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 76/105 (72%), Positives = 86/105 (82%), Gaps = 3/105 (3%)
 Frame = +3

Query  21   SLSLKKMDKKPCNSQDVE---IRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTG  191
            ++  K   K    SQ  E   +RKGPWTMEED IL NYI NHGEG+WNS+A+++GLKRTG
Sbjct  3    TMKKKGRGKATITSQKEEEGTVRKGPWTMEEDFILFNYILNHGEGLWNSVAKASGLKRTG  62

Query  192  KSCRLRWLNYLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKH  326
            KSCRLRWLNYLRPDVRRGNIT EEQLLI++LHAK GNRWSKIAKH
Sbjct  63   KSCRLRWLNYLRPDVRRGNITAEEQLLIIQLHAKLGNRWSKIAKH  107



>ref|XP_007223176.1| hypothetical protein PRUPE_ppa009143mg [Prunus persica]
 gb|EMJ24375.1| hypothetical protein PRUPE_ppa009143mg [Prunus persica]
Length=305

 Score =   160 bits (406),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 69/101 (68%), Positives = 90/101 (89%), Gaps = 2/101 (2%)
 Frame = +3

Query  30   LKKMDKKPCN--SQDVEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCR  203
            +  + K  CN   +++E+R+GPWT+EED +LI+YIA+HGEG WNSLA+ AGLKRTGKSCR
Sbjct  1    MAAVTKSACNPNEEEIELRRGPWTLEEDTLLIHYIASHGEGHWNSLAKCAGLKRTGKSCR  60

Query  204  LRWLNYLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKH  326
            LRWLNYL+PD++RGN+TP+EQL+I+ELH+KWGNRWSKIA+H
Sbjct  61   LRWLNYLKPDIKRGNLTPQEQLMILELHSKWGNRWSKIAQH  101



>ref|XP_010485409.1| PREDICTED: transcription factor MYB57-like [Camelina sativa]
Length=205

 Score =   157 bits (398),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 75/105 (71%), Positives = 86/105 (82%), Gaps = 3/105 (3%)
 Frame = +3

Query  21   SLSLKKMDKKPCNSQDVE---IRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTG  191
            ++  K   K    SQ  E   +RKGPWTMEED IL NYI NHGEG+WNS+A+++GLKRTG
Sbjct  3    TMKKKGRGKATITSQKEEEGTVRKGPWTMEEDFILFNYILNHGEGLWNSVAKASGLKRTG  62

Query  192  KSCRLRWLNYLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKH  326
            KSCRLRWLNYLRPDVRRGNIT EEQL+I++LHAK GNRWSKIAKH
Sbjct  63   KSCRLRWLNYLRPDVRRGNITAEEQLVIIQLHAKLGNRWSKIAKH  107



>ref|XP_010435630.1| PREDICTED: transcription factor MYB57 [Camelina sativa]
Length=202

 Score =   157 bits (397),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 75/105 (71%), Positives = 86/105 (82%), Gaps = 3/105 (3%)
 Frame = +3

Query  21   SLSLKKMDKKPCNSQDVE---IRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTG  191
            ++  K   K    SQ  E   +RKGPWTMEED IL NYI NHGEG+WNS+A+++GLKRTG
Sbjct  3    TMKKKGRGKATITSQKEEEGTVRKGPWTMEEDFILFNYILNHGEGLWNSVAKASGLKRTG  62

Query  192  KSCRLRWLNYLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKH  326
            KSCRLRWLNYLRPDVRRGNIT EEQL+I++LHAK GNRWSKIAKH
Sbjct  63   KSCRLRWLNYLRPDVRRGNITAEEQLVIIQLHAKLGNRWSKIAKH  107



>ref|XP_009612140.1| PREDICTED: transcription factor MYB108-like [Nicotiana tomentosiformis]
Length=295

 Score =   160 bits (404),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 72/98 (73%), Positives = 87/98 (89%), Gaps = 0/98 (0%)
 Frame = +3

Query  33   KKMDKKPCNSQDVEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRW  212
            K  + +  + +D+++R+GPWT+EED  LINYIA+HGEG WN LARSAGLKRTGKSCRLRW
Sbjct  18   KNNNHQQQHEEDMDLRQGPWTVEEDFTLINYIAHHGEGRWNFLARSAGLKRTGKSCRLRW  77

Query  213  LNYLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKH  326
            LNYLRPDVRRGNIT EEQL+I+ELH++WGNRWSKIA+H
Sbjct  78   LNYLRPDVRRGNITLEEQLVILELHSRWGNRWSKIAQH  115



>emb|CDY49063.1| BnaC05g48910D [Brassica napus]
Length=207

 Score =   157 bits (398),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 71/84 (85%), Positives = 80/84 (95%), Gaps = 0/84 (0%)
 Frame = +3

Query  75   IRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLNYLRPDVRRGNIT  254
            +RKGPWTMEEDLIL NYI NHGEG+WNS+A+++GLKRTGKSCRLRWLNYLRPDVRRGNIT
Sbjct  23   VRKGPWTMEEDLILFNYILNHGEGLWNSVAKASGLKRTGKSCRLRWLNYLRPDVRRGNIT  82

Query  255  PEEQLLIMELHAKWGNRWSKIAKH  326
             EEQLLI++LHAK GNRWSKIAK+
Sbjct  83   AEEQLLIIQLHAKLGNRWSKIAKY  106



>ref|XP_008243255.1| PREDICTED: transcription factor MYB21 [Prunus mume]
Length=305

 Score =   160 bits (405),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 68/101 (67%), Positives = 91/101 (90%), Gaps = 2/101 (2%)
 Frame = +3

Query  30   LKKMDKKPCN--SQDVEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCR  203
            +  + K+ CN   +++++R+GPWT+EED +LI+YIA+HGEG WNSLA+ AGLKRTGKSCR
Sbjct  1    MAAVTKRACNPNEEEIDLRRGPWTLEEDTLLIHYIASHGEGHWNSLAKCAGLKRTGKSCR  60

Query  204  LRWLNYLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKH  326
            LRWLNYL+PD++RGN+TP+EQL+I+ELH+KWGNRWSKIA+H
Sbjct  61   LRWLNYLKPDIKRGNLTPQEQLMILELHSKWGNRWSKIAQH  101



>ref|XP_010914654.1| PREDICTED: transcription factor MYB108-like [Elaeis guineensis]
Length=275

 Score =   159 bits (403),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 72/88 (82%), Positives = 84/88 (95%), Gaps = 0/88 (0%)
 Frame = +3

Query  63   QDVEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLNYLRPDVRR  242
            +++++R+GPWT+EEDL LINYIA HGEG WN+LAR AGLKRTGKSCRLRWLNYLRPDVRR
Sbjct  16   EEMDLRRGPWTVEEDLKLINYIAVHGEGRWNTLARCAGLKRTGKSCRLRWLNYLRPDVRR  75

Query  243  GNITPEEQLLIMELHAKWGNRWSKIAKH  326
            GNITPEEQLLI+ELH++WGNRWSKIA+H
Sbjct  76   GNITPEEQLLILELHSRWGNRWSKIAQH  103



>ref|XP_010024826.1| PREDICTED: transcription factor MYB108-like [Eucalyptus grandis]
Length=343

 Score =   161 bits (407),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 72/85 (85%), Positives = 82/85 (96%), Gaps = 0/85 (0%)
 Frame = +3

Query  72   EIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLNYLRPDVRRGNI  251
            ++R+GPWT+EEDL L+NYIANHGEG WNSLARSAGLKRTGKSCRLRWLNYLRPDVRRGNI
Sbjct  32   DLRRGPWTVEEDLTLVNYIANHGEGRWNSLARSAGLKRTGKSCRLRWLNYLRPDVRRGNI  91

Query  252  TPEEQLLIMELHAKWGNRWSKIAKH  326
            T EEQL+I+ELH++WGNRWSKIA+H
Sbjct  92   TLEEQLMILELHSRWGNRWSKIAQH  116



>gb|ADG56766.1| putative MYB transcription factor [Rosa rugosa]
Length=299

 Score =   160 bits (404),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 69/90 (77%), Positives = 85/90 (94%), Gaps = 0/90 (0%)
 Frame = +3

Query  57   NSQDVEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLNYLRPDV  236
            N ++ E+RKGPWT++ED +LI+YIANHGEG WN+LA+ AGLKRTGKSCRLRWLNYL+PD+
Sbjct  13   NEEENEMRKGPWTLDEDTLLIHYIANHGEGHWNALAKCAGLKRTGKSCRLRWLNYLKPDI  72

Query  237  RRGNITPEEQLLIMELHAKWGNRWSKIAKH  326
            +RGN+TP+EQLLI+ELHAKWGNRWSKIA+H
Sbjct  73   KRGNLTPQEQLLILELHAKWGNRWSKIAQH  102



>ref|XP_004963430.1| PREDICTED: transcription repressor MYB5-like [Setaria italica]
Length=326

 Score =   160 bits (406),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 72/85 (85%), Positives = 82/85 (96%), Gaps = 0/85 (0%)
 Frame = +3

Query  72   EIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLNYLRPDVRRGNI  251
            ++R+GPWT+EEDL+L+NYIA HGEG WNSLARSAGLKRTGKSCRLRWLNYLRPDVRRGNI
Sbjct  22   DLRRGPWTVEEDLLLVNYIAAHGEGRWNSLARSAGLKRTGKSCRLRWLNYLRPDVRRGNI  81

Query  252  TPEEQLLIMELHAKWGNRWSKIAKH  326
            T EEQLLI+ELH++WGNRWSKIA+H
Sbjct  82   TAEEQLLILELHSRWGNRWSKIAQH  106



>gb|KHN11407.1| Transcription factor MYB21 [Glycine soja]
Length=307

 Score =   160 bits (404),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 69/91 (76%), Positives = 85/91 (93%), Gaps = 0/91 (0%)
 Frame = +3

Query  54   CNSQDVEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLNYLRPD  233
            CN ++ E+R+GPWT+EED +LI+YIA HGEG WN LA+SAGLKRTGKSCRLRWLNYL+PD
Sbjct  11   CNEEESELRRGPWTLEEDSLLIHYIARHGEGRWNMLAKSAGLKRTGKSCRLRWLNYLKPD  70

Query  234  VRRGNITPEEQLLIMELHAKWGNRWSKIAKH  326
            ++RGN+TP+EQLLI+ELH+KWGNRWSKIA+H
Sbjct  71   IKRGNLTPQEQLLILELHSKWGNRWSKIAQH  101



>ref|NP_001049937.1| Os03g0315400 [Oryza sativa Japonica Group]
 gb|ABF95617.1| Myb-like DNA-binding domain containing protein, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF11851.1| Os03g0315400 [Oryza sativa Japonica Group]
 dbj|BAH00067.1| unnamed protein product [Oryza sativa Japonica Group]
Length=329

 Score =   160 bits (405),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 71/85 (84%), Positives = 83/85 (98%), Gaps = 0/85 (0%)
 Frame = +3

Query  72   EIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLNYLRPDVRRGNI  251
            ++R+GPWT+EEDL+L+NYIA HGEG WNSLARSAGLKRTGKSCRLRWLNYLRPD+RRGNI
Sbjct  19   DLRRGPWTVEEDLLLVNYIAAHGEGRWNSLARSAGLKRTGKSCRLRWLNYLRPDLRRGNI  78

Query  252  TPEEQLLIMELHAKWGNRWSKIAKH  326
            TP+EQLLI+ELH++WGNRWSKIA+H
Sbjct  79   TPQEQLLILELHSRWGNRWSKIAQH  103



>ref|XP_002465358.1| hypothetical protein SORBIDRAFT_01g037110 [Sorghum bicolor]
 gb|EER92356.1| hypothetical protein SORBIDRAFT_01g037110 [Sorghum bicolor]
Length=334

 Score =   160 bits (406),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 71/85 (84%), Positives = 83/85 (98%), Gaps = 0/85 (0%)
 Frame = +3

Query  72   EIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLNYLRPDVRRGNI  251
            E+R+GPWT+EEDL+L+NY+A HGEG WNSLARSAGLKRTGKSCRLRWLNYLRPD+RRGNI
Sbjct  17   ELRRGPWTVEEDLLLVNYVAAHGEGRWNSLARSAGLKRTGKSCRLRWLNYLRPDLRRGNI  76

Query  252  TPEEQLLIMELHAKWGNRWSKIAKH  326
            TP+EQLLI+ELH++WGNRWSKIA+H
Sbjct  77   TPQEQLLILELHSRWGNRWSKIAQH  101



>ref|XP_002440534.1| hypothetical protein SORBIDRAFT_09g002675 [Sorghum bicolor]
 gb|EES18964.1| hypothetical protein SORBIDRAFT_09g002675 [Sorghum bicolor]
Length=428

 Score =   162 bits (411),  Expect = 2e-45, Method: Composition-based stats.
 Identities = 69/85 (81%), Positives = 82/85 (96%), Gaps = 0/85 (0%)
 Frame = +3

Query  72   EIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLNYLRPDVRRGNI  251
            ++R+GPWT++ED++L+NYIA HGEG WNSLARSAGLKRTGKSCRLRWLNYLRPDVRRGNI
Sbjct  85   DLRRGPWTVDEDILLVNYIAAHGEGRWNSLARSAGLKRTGKSCRLRWLNYLRPDVRRGNI  144

Query  252  TPEEQLLIMELHAKWGNRWSKIAKH  326
            T EEQLLI++LH++WGNRWSKIA+H
Sbjct  145  TAEEQLLILDLHSRWGNRWSKIAQH  169



>gb|EAY89765.1| hypothetical protein OsI_11306 [Oryza sativa Indica Group]
Length=329

 Score =   160 bits (405),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 71/85 (84%), Positives = 83/85 (98%), Gaps = 0/85 (0%)
 Frame = +3

Query  72   EIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLNYLRPDVRRGNI  251
            ++R+GPWT+EEDL+L+NYIA HGEG WNSLARSAGLKRTGKSCRLRWLNYLRPD+RRGNI
Sbjct  19   DLRRGPWTVEEDLLLVNYIAAHGEGRWNSLARSAGLKRTGKSCRLRWLNYLRPDLRRGNI  78

Query  252  TPEEQLLIMELHAKWGNRWSKIAKH  326
            TP+EQLLI+ELH++WGNRWSKIA+H
Sbjct  79   TPQEQLLILELHSRWGNRWSKIAQH  103



>ref|XP_009392103.1| PREDICTED: protein ODORANT1-like [Musa acuminata subsp. malaccensis]
Length=348

 Score =   160 bits (406),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 75/108 (69%), Positives = 89/108 (82%), Gaps = 2/108 (2%)
 Frame = +3

Query  6    FHPPPSLSLKKMDKKPCNSQDV--EIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGL  179
            F PP S++      +   S++   EIR+GPWT EEDL+LI Y+A HGEG WN+LAR AGL
Sbjct  64   FLPPSSVTSATTRSQAAQSEEEMEEIRRGPWTTEEDLVLIKYVAQHGEGRWNALARCAGL  123

Query  180  KRTGKSCRLRWLNYLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAK  323
            KRTGKSCRLRWLNYLRPDVRRGNITPEEQLLI++LH++WGNRWSKIA+
Sbjct  124  KRTGKSCRLRWLNYLRPDVRRGNITPEEQLLILDLHSRWGNRWSKIAQ  171



>ref|XP_009134610.1| PREDICTED: transcription factor MYB57-like [Brassica rapa]
 emb|CDX74303.1| BnaA03g27440D [Brassica napus]
Length=208

 Score =   157 bits (396),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 70/84 (83%), Positives = 79/84 (94%), Gaps = 0/84 (0%)
 Frame = +3

Query  75   IRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLNYLRPDVRRGNIT  254
            +RKGPWTMEEDLIL NYI NHGEG+WNS+A+++GLKRTGKSCRLRWLNYLRPDVRRGNIT
Sbjct  22   VRKGPWTMEEDLILFNYILNHGEGLWNSVAKASGLKRTGKSCRLRWLNYLRPDVRRGNIT  81

Query  255  PEEQLLIMELHAKWGNRWSKIAKH  326
             EEQLLI++L AK GN+WSKIAKH
Sbjct  82   AEEQLLIIQLQAKLGNKWSKIAKH  105



>ref|XP_009791846.1| PREDICTED: transcription factor MYB108-like [Nicotiana sylvestris]
Length=282

 Score =   159 bits (402),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 72/98 (73%), Positives = 85/98 (87%), Gaps = 0/98 (0%)
 Frame = +3

Query  33   KKMDKKPCNSQDVEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRW  212
            K  + +  + +D+++R+GPWT EED  LINYIA HGEG WNSLAR AGLKRTGKSCRLRW
Sbjct  18   KNNNHQQQHEEDMDLRRGPWTAEEDFTLINYIAKHGEGRWNSLARCAGLKRTGKSCRLRW  77

Query  213  LNYLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKH  326
            LNYLRPDVRRGNIT EEQL+I+ELH++WGNRWSKIA+H
Sbjct  78   LNYLRPDVRRGNITLEEQLVILELHSRWGNRWSKIAQH  115



>ref|XP_003555909.1| PREDICTED: transcription factor MYB108-like [Glycine max]
Length=307

 Score =   159 bits (403),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 69/91 (76%), Positives = 85/91 (93%), Gaps = 0/91 (0%)
 Frame = +3

Query  54   CNSQDVEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLNYLRPD  233
            CN ++ E+R+GPWT+EED +LI+YIA HGEG WN LA+SAGLKRTGKSCRLRWLNYL+PD
Sbjct  11   CNEEESELRRGPWTLEEDSLLIHYIARHGEGRWNMLAKSAGLKRTGKSCRLRWLNYLKPD  70

Query  234  VRRGNITPEEQLLIMELHAKWGNRWSKIAKH  326
            ++RGN+TP+EQLLI+ELH+KWGNRWSKIA+H
Sbjct  71   IKRGNLTPQEQLLILELHSKWGNRWSKIAQH  101



>ref|XP_002440535.1| hypothetical protein SORBIDRAFT_09g002680 [Sorghum bicolor]
 gb|EES18965.1| hypothetical protein SORBIDRAFT_09g002680 [Sorghum bicolor]
Length=341

 Score =   160 bits (405),  Expect = 2e-45, Method: Composition-based stats.
 Identities = 69/85 (81%), Positives = 81/85 (95%), Gaps = 0/85 (0%)
 Frame = +3

Query  72   EIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLNYLRPDVRRGNI  251
            ++R+GPWT +ED++L+NYIA HGEG WNSLARSAGLKRTGKSCRLRWLNYLRPDVRRGNI
Sbjct  56   DLRRGPWTADEDILLVNYIAVHGEGRWNSLARSAGLKRTGKSCRLRWLNYLRPDVRRGNI  115

Query  252  TPEEQLLIMELHAKWGNRWSKIAKH  326
            T EEQLLI++LH++WGNRWSKIA+H
Sbjct  116  TAEEQLLILDLHSRWGNRWSKIAQH  140



>ref|XP_006649985.1| PREDICTED: myb-related protein MYBAS1-like [Oryza brachyantha]
Length=328

 Score =   160 bits (404),  Expect = 2e-45, Method: Composition-based stats.
 Identities = 71/85 (84%), Positives = 83/85 (98%), Gaps = 0/85 (0%)
 Frame = +3

Query  72   EIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLNYLRPDVRRGNI  251
            ++R+GPWT+EEDL+L+NYIA HGEG WNSLARSAGLKRTGKSCRLRWLNYLRPD+RRGNI
Sbjct  19   DLRRGPWTVEEDLLLVNYIAAHGEGRWNSLARSAGLKRTGKSCRLRWLNYLRPDLRRGNI  78

Query  252  TPEEQLLIMELHAKWGNRWSKIAKH  326
            TP+EQLLI+ELH++WGNRWSKIA+H
Sbjct  79   TPQEQLLILELHSRWGNRWSKIAQH  103



>gb|KDO72049.1| hypothetical protein CISIN_1g019911mg [Citrus sinensis]
Length=334

 Score =   160 bits (405),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 71/97 (73%), Positives = 84/97 (87%), Gaps = 0/97 (0%)
 Frame = +3

Query  36   KMDKKPCNSQDVEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWL  215
            K      + +D+++R+GPWT+EED  LINYI+NHGEG WN LAR AGLKRTGKSCRLRWL
Sbjct  15   KSSSTTISEEDLDLRRGPWTVEEDFKLINYISNHGEGRWNCLARCAGLKRTGKSCRLRWL  74

Query  216  NYLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKH  326
            NYLRPDVRRGNIT EEQL+I+ELH++WGNRWSKIA+H
Sbjct  75   NYLRPDVRRGNITLEEQLMILELHSRWGNRWSKIAQH  111



>ref|XP_010938192.1| PREDICTED: transcription factor MYB108-like [Elaeis guineensis]
Length=292

 Score =   159 bits (401),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 71/92 (77%), Positives = 84/92 (91%), Gaps = 0/92 (0%)
 Frame = +3

Query  51   PCNSQDVEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLNYLRP  230
            P   +D+++R+GPWT++EDL+L+NYIA HGEG WN LAR AGLKRTGKSCRLRWLNYLRP
Sbjct  21   PPTEEDMDLRRGPWTVDEDLVLMNYIAAHGEGRWNCLARCAGLKRTGKSCRLRWLNYLRP  80

Query  231  DVRRGNITPEEQLLIMELHAKWGNRWSKIAKH  326
            DVRRGNITPEEQLLI+ELH++WGNRWSKIA+ 
Sbjct  81   DVRRGNITPEEQLLILELHSRWGNRWSKIAQQ  112



>gb|EEE58945.1| hypothetical protein OsJ_10621 [Oryza sativa Japonica Group]
Length=310

 Score =   159 bits (403),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 71/85 (84%), Positives = 83/85 (98%), Gaps = 0/85 (0%)
 Frame = +3

Query  72   EIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLNYLRPDVRRGNI  251
            ++R+GPWT+EEDL+L+NYIA HGEG WNSLARSAGLKRTGKSCRLRWLNYLRPD+RRGNI
Sbjct  19   DLRRGPWTVEEDLLLVNYIAAHGEGRWNSLARSAGLKRTGKSCRLRWLNYLRPDLRRGNI  78

Query  252  TPEEQLLIMELHAKWGNRWSKIAKH  326
            TP+EQLLI+ELH++WGNRWSKIA+H
Sbjct  79   TPQEQLLILELHSRWGNRWSKIAQH  103



>ref|XP_006488792.1| PREDICTED: transcription factor MYB108-like [Citrus sinensis]
Length=334

 Score =   160 bits (404),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 71/97 (73%), Positives = 84/97 (87%), Gaps = 0/97 (0%)
 Frame = +3

Query  36   KMDKKPCNSQDVEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWL  215
            K      + +D+++R+GPWT+EED  LINYI+NHGEG WN LAR AGLKRTGKSCRLRWL
Sbjct  15   KSSSTTISEEDLDLRRGPWTVEEDFKLINYISNHGEGRWNCLARCAGLKRTGKSCRLRWL  74

Query  216  NYLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKH  326
            NYLRPDVRRGNIT EEQL+I+ELH++WGNRWSKIA+H
Sbjct  75   NYLRPDVRRGNITLEEQLMILELHSRWGNRWSKIAQH  111



>ref|XP_006419304.1| hypothetical protein CICLE_v10005387mg [Citrus clementina]
 gb|ESR32544.1| hypothetical protein CICLE_v10005387mg [Citrus clementina]
Length=334

 Score =   160 bits (404),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 71/97 (73%), Positives = 84/97 (87%), Gaps = 0/97 (0%)
 Frame = +3

Query  36   KMDKKPCNSQDVEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWL  215
            K      + +D+++R+GPWT+EED  LINYI+NHGEG WN LAR AGLKRTGKSCRLRWL
Sbjct  15   KSSSTTISEEDLDLRRGPWTVEEDFKLINYISNHGEGRWNCLARCAGLKRTGKSCRLRWL  74

Query  216  NYLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKH  326
            NYLRPDVRRGNIT EEQL+I+ELH++WGNRWSKIA+H
Sbjct  75   NYLRPDVRRGNITLEEQLMILELHSRWGNRWSKIAQH  111



>ref|NP_001140397.1| putative MYB DNA-binding domain superfamily protein [Zea mays]
 gb|ACF83741.1| unknown [Zea mays]
 gb|AFW88522.1| putative MYB DNA-binding domain superfamily protein [Zea mays]
Length=349

 Score =   160 bits (405),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 70/85 (82%), Positives = 83/85 (98%), Gaps = 0/85 (0%)
 Frame = +3

Query  72   EIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLNYLRPDVRRGNI  251
            E+R+GPWT+EEDL+L+NY+A HGEG WNSLARSAGL+RTGKSCRLRWLNYLRPD+RRGNI
Sbjct  19   ELRRGPWTVEEDLLLVNYVAAHGEGRWNSLARSAGLRRTGKSCRLRWLNYLRPDLRRGNI  78

Query  252  TPEEQLLIMELHAKWGNRWSKIAKH  326
            TP+EQLLI+ELH++WGNRWSKIA+H
Sbjct  79   TPQEQLLILELHSRWGNRWSKIAQH  103



>ref|XP_009384442.1| PREDICTED: transcription factor MYB108-like [Musa acuminata subsp. 
malaccensis]
Length=330

 Score =   159 bits (403),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 70/92 (76%), Positives = 87/92 (95%), Gaps = 0/92 (0%)
 Frame = +3

Query  51   PCNSQDVEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLNYLRP  230
            P + +++++R+GPWT+EED++L++YIA HGEG WNSLAR AGL+RTGKSCRLRWLNYLRP
Sbjct  13   PPSEEEMDLRRGPWTVEEDVVLVDYIAVHGEGRWNSLARCAGLRRTGKSCRLRWLNYLRP  72

Query  231  DVRRGNITPEEQLLIMELHAKWGNRWSKIAKH  326
            DVRRGNITPEEQLLI+ELH++WGNRWSKIA+H
Sbjct  73   DVRRGNITPEEQLLILELHSRWGNRWSKIAQH  104



>gb|EMT25040.1| Transcription factor MYB21 [Aegilops tauschii]
Length=267

 Score =   158 bits (399),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 70/94 (74%), Positives = 86/94 (91%), Gaps = 2/94 (2%)
 Frame = +3

Query  51   PCNSQDV--EIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLNYL  224
            PC+ ++   EIR+GPWT+EEDL L+NYIA+HG+G WNSLAR+AGLKRTGKSCRLRWLNYL
Sbjct  18   PCSVEEAAEEIRRGPWTVEEDLTLVNYIADHGDGRWNSLARAAGLKRTGKSCRLRWLNYL  77

Query  225  RPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKH  326
            RPDV+RGN T +EQLLI++LH++WGNRWSKIA+H
Sbjct  78   RPDVKRGNFTADEQLLILDLHSRWGNRWSKIAQH  111



>ref|XP_009383942.1| PREDICTED: transcription factor MYB108-like [Musa acuminata subsp. 
malaccensis]
Length=262

 Score =   157 bits (398),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 71/91 (78%), Positives = 86/91 (95%), Gaps = 0/91 (0%)
 Frame = +3

Query  51   PCNSQDVEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLNYLRP  230
            P + +++++R+GPWT+EEDL+L+NYIA HGEG WNSLAR AGL+RTGKSCRLRWLNYLRP
Sbjct  9    PQSVEEMDLRRGPWTVEEDLLLMNYIAAHGEGRWNSLARCAGLRRTGKSCRLRWLNYLRP  68

Query  231  DVRRGNITPEEQLLIMELHAKWGNRWSKIAK  323
            DVRRGNITPEEQLLI+ELH++WGNRWSKIA+
Sbjct  69   DVRRGNITPEEQLLILELHSRWGNRWSKIAQ  99



>gb|KCW61339.1| hypothetical protein EUGRSUZ_H04082 [Eucalyptus grandis]
Length=401

 Score =   161 bits (407),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 72/85 (85%), Positives = 82/85 (96%), Gaps = 0/85 (0%)
 Frame = +3

Query  72   EIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLNYLRPDVRRGNI  251
            ++R+GPWT+EEDL L+NYIANHGEG WNSLARSAGLKRTGKSCRLRWLNYLRPDVRRGNI
Sbjct  3    DLRRGPWTVEEDLTLVNYIANHGEGRWNSLARSAGLKRTGKSCRLRWLNYLRPDVRRGNI  62

Query  252  TPEEQLLIMELHAKWGNRWSKIAKH  326
            T EEQL+I+ELH++WGNRWSKIA+H
Sbjct  63   TLEEQLMILELHSRWGNRWSKIAQH  87



>gb|EAZ19253.1| hypothetical protein OsJ_34790 [Oryza sativa Japonica Group]
Length=184

 Score =   155 bits (391),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 70/106 (66%), Positives = 86/106 (81%), Gaps = 4/106 (4%)
 Frame = +3

Query  9    HPPPSLSLKKMDKKPCNSQDVEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRT  188
            HP P     +  +        E+R+GPWT++EDL LINYI++HGEG WN+LAR+AGLKRT
Sbjct  11   HPVPG----EQQEAAAELSSAELRRGPWTVDEDLTLINYISDHGEGRWNALARAAGLKRT  66

Query  189  GKSCRLRWLNYLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKH  326
            GKSCRLRWLNYLRPDV+RGN T EEQLLI++LH++WGNRWSKIA+H
Sbjct  67   GKSCRLRWLNYLRPDVKRGNFTAEEQLLILDLHSRWGNRWSKIAQH  112



>ref|NP_001060700.1| Os07g0688200 [Oryza sativa Japonica Group]
 dbj|BAF22614.1| Os07g0688200 [Oryza sativa Japonica Group]
 dbj|BAG96090.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|ADX60233.1| MYB transcription factor [Oryza sativa Japonica Group]
Length=300

 Score =   158 bits (399),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 70/85 (82%), Positives = 80/85 (94%), Gaps = 0/85 (0%)
 Frame = +3

Query  72   EIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLNYLRPDVRRGNI  251
            E+R+GPWT+EEDL+L+NYIA HGEG WN+LAR AGLKRTGKSCRLRWLNYLRPDVRRGN+
Sbjct  18   ELRRGPWTVEEDLLLVNYIAAHGEGRWNALARCAGLKRTGKSCRLRWLNYLRPDVRRGNM  77

Query  252  TPEEQLLIMELHAKWGNRWSKIAKH  326
            T EEQLLI+ELH +WGNRWSKIA+H
Sbjct  78   TAEEQLLILELHGRWGNRWSKIAQH  102



>ref|XP_004239882.1| PREDICTED: transcription factor MYB108-like [Solanum lycopersicum]
Length=318

 Score =   159 bits (401),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 70/86 (81%), Positives = 81/86 (94%), Gaps = 0/86 (0%)
 Frame = +3

Query  69   VEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLNYLRPDVRRGN  248
            +++R+GPWT+EED  LIN+IA+HGEG WNSLAR AGLKRTGKSCRLRWLNYLRPDVRRGN
Sbjct  34   MDLRRGPWTVEEDFTLINFIAHHGEGRWNSLARCAGLKRTGKSCRLRWLNYLRPDVRRGN  93

Query  249  ITPEEQLLIMELHAKWGNRWSKIAKH  326
            IT EEQLLI+ELH++WGNRWSKIA+H
Sbjct  94   ITVEEQLLILELHSRWGNRWSKIAQH  119



>dbj|BAC21351.1| putative typical P-type R2R3 Myb protein [Oryza sativa Japonica 
Group]
 dbj|BAD30303.1| putative typical P-type R2R3 Myb protein [Oryza sativa Japonica 
Group]
 gb|EAZ05206.1| hypothetical protein OsI_27405 [Oryza sativa Indica Group]
 gb|EAZ41155.1| hypothetical protein OsJ_25652 [Oryza sativa Japonica Group]
Length=298

 Score =   158 bits (399),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 70/85 (82%), Positives = 80/85 (94%), Gaps = 0/85 (0%)
 Frame = +3

Query  72   EIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLNYLRPDVRRGNI  251
            E+R+GPWT+EEDL+L+NYIA HGEG WN+LAR AGLKRTGKSCRLRWLNYLRPDVRRGN+
Sbjct  16   ELRRGPWTVEEDLLLVNYIAAHGEGRWNALARCAGLKRTGKSCRLRWLNYLRPDVRRGNM  75

Query  252  TPEEQLLIMELHAKWGNRWSKIAKH  326
            T EEQLLI+ELH +WGNRWSKIA+H
Sbjct  76   TAEEQLLILELHGRWGNRWSKIAQH  100



>emb|CDY37512.1| BnaA05g33770D [Brassica napus]
Length=201

 Score =   155 bits (391),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 70/84 (83%), Positives = 79/84 (94%), Gaps = 0/84 (0%)
 Frame = +3

Query  75   IRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLNYLRPDVRRGNIT  254
            +RKGPWTMEEDLIL NYI NHGEG+WNS+A+++GLKRTGKSCRLRWLNYLRPDVRRGNIT
Sbjct  23   VRKGPWTMEEDLILFNYILNHGEGLWNSVAKASGLKRTGKSCRLRWLNYLRPDVRRGNIT  82

Query  255  PEEQLLIMELHAKWGNRWSKIAKH  326
             EE LLI++LHAK GNRWSKIAK+
Sbjct  83   AEEHLLIIQLHAKLGNRWSKIAKY  106



>ref|XP_009415657.1| PREDICTED: transcription factor MYB108-like [Musa acuminata subsp. 
malaccensis]
Length=251

 Score =   156 bits (394),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 69/85 (81%), Positives = 82/85 (96%), Gaps = 0/85 (0%)
 Frame = +3

Query  69   VEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLNYLRPDVRRGN  248
            +++RKGPWT+EEDL+L+NYI +HGEG WNSLAR AGL+RTGKSCRLRW+NYLRPDVRRGN
Sbjct  1    MDLRKGPWTVEEDLVLMNYIGSHGEGKWNSLARCAGLRRTGKSCRLRWMNYLRPDVRRGN  60

Query  249  ITPEEQLLIMELHAKWGNRWSKIAK  323
            ITPEEQLLI+ELH++WGNRWSKIA+
Sbjct  61   ITPEEQLLILELHSRWGNRWSKIAQ  85



>ref|XP_009411608.1| PREDICTED: transcription factor MYB108 [Musa acuminata subsp. 
malaccensis]
Length=256

 Score =   156 bits (394),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 68/90 (76%), Positives = 84/90 (93%), Gaps = 0/90 (0%)
 Frame = +3

Query  57   NSQDVEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLNYLRPDV  236
            + ++V++R+GPWT EEDL+L+NY+A HGEG WNSLAR +GL+RTGKSCRLRWLNYLRPDV
Sbjct  15   SEEEVDLRRGPWTAEEDLVLMNYVAAHGEGRWNSLARCSGLRRTGKSCRLRWLNYLRPDV  74

Query  237  RRGNITPEEQLLIMELHAKWGNRWSKIAKH  326
            RRGNITPEEQLLI++LH +WGNRWSKIA++
Sbjct  75   RRGNITPEEQLLILQLHTRWGNRWSKIAQY  104



>ref|XP_010941513.1| PREDICTED: transcription factor MYB108-like [Elaeis guineensis]
Length=258

 Score =   156 bits (394),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 70/90 (78%), Positives = 86/90 (96%), Gaps = 0/90 (0%)
 Frame = +3

Query  57   NSQDVEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLNYLRPDV  236
            +++++++R+GPWT+EEDL LINYIA HGEG WN+LAR AGLKRTGKSCRLRWLNYLRPDV
Sbjct  15   SAEEMDLRRGPWTVEEDLKLINYIAIHGEGRWNTLARGAGLKRTGKSCRLRWLNYLRPDV  74

Query  237  RRGNITPEEQLLIMELHAKWGNRWSKIAKH  326
            RRGNI+PEEQLLI+ELH++WGNRWSKIA++
Sbjct  75   RRGNISPEEQLLILELHSRWGNRWSKIAQY  104



>ref|XP_010265100.1| PREDICTED: myb-related protein MYBAS2-like [Nelumbo nucifera]
Length=303

 Score =   157 bits (397),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 69/88 (78%), Positives = 84/88 (95%), Gaps = 0/88 (0%)
 Frame = +3

Query  63   QDVEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLNYLRPDVRR  242
            +DVE+R+GPWT+EED +LI+YIA HGEG WN LA+S+GLKRTGKSCRLRWLNYL+PDV+R
Sbjct  13   EDVELRRGPWTLEEDTLLIHYIACHGEGRWNLLAKSSGLKRTGKSCRLRWLNYLKPDVKR  72

Query  243  GNITPEEQLLIMELHAKWGNRWSKIAKH  326
            GN+TPEEQLLI+ELH++WGNRWSKIA+H
Sbjct  73   GNLTPEEQLLILELHSRWGNRWSKIAQH  100



>ref|XP_010264231.1| PREDICTED: transcription factor MYB108-like [Nelumbo nucifera]
Length=320

 Score =   157 bits (398),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 69/88 (78%), Positives = 83/88 (94%), Gaps = 0/88 (0%)
 Frame = +3

Query  63   QDVEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLNYLRPDVRR  242
            +D E+R+GPWT+EED +LI+YIA HGEG WN LA+S+GLKRTGKSCRLRWLNYL+PDV+R
Sbjct  14   EDAELRRGPWTVEEDTLLIHYIACHGEGRWNLLAKSSGLKRTGKSCRLRWLNYLKPDVKR  73

Query  243  GNITPEEQLLIMELHAKWGNRWSKIAKH  326
            GN+TPEEQLLI+ELH+KWGNRWSKIA+H
Sbjct  74   GNLTPEEQLLILELHSKWGNRWSKIAQH  101



>ref|XP_003561685.1| PREDICTED: myb-related protein P-like [Brachypodium distachyon]
Length=327

 Score =   157 bits (398),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 69/85 (81%), Positives = 83/85 (98%), Gaps = 0/85 (0%)
 Frame = +3

Query  72   EIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLNYLRPDVRRGNI  251
            ++R+GPWT+EED++L+NYIA HGEG WNSLARSAGLKRTGKSCRLRWLNYLRPD+RRG+I
Sbjct  19   DLRRGPWTVEEDILLVNYIAAHGEGRWNSLARSAGLKRTGKSCRLRWLNYLRPDLRRGSI  78

Query  252  TPEEQLLIMELHAKWGNRWSKIAKH  326
            TP+EQLLI+ELH++WGNRWSKIA+H
Sbjct  79   TPQEQLLILELHSRWGNRWSKIAQH  103



>ref|XP_009382479.1| PREDICTED: transcription factor MYB108-like [Musa acuminata subsp. 
malaccensis]
Length=264

 Score =   156 bits (394),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 71/96 (74%), Positives = 87/96 (91%), Gaps = 0/96 (0%)
 Frame = +3

Query  39   MDKKPCNSQDVEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLN  218
            M+  P + +++E+R+G WT EEDL+L+NYIA HGEG W+SLAR AGL+RTGKSCRLRWLN
Sbjct  1    MEFIPRSEEEMELRRGAWTAEEDLVLMNYIALHGEGRWSSLARRAGLRRTGKSCRLRWLN  60

Query  219  YLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKH  326
            YLRPDVRRGNITPEEQLLI+ELH++WGNRWSKIA++
Sbjct  61   YLRPDVRRGNITPEEQLLILELHSRWGNRWSKIAQY  96



>ref|XP_004299054.1| PREDICTED: transcription factor WER-like [Fragaria vesca subsp. 
vesca]
Length=283

 Score =   156 bits (394),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 67/90 (74%), Positives = 84/90 (93%), Gaps = 0/90 (0%)
 Frame = +3

Query  57   NSQDVEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLNYLRPDV  236
            N ++ E+RKGPWT++ED +LI+YI NHGEG WN+LA+ AGLKRTGKSCRLRWLNYL+PD+
Sbjct  13   NEEENELRKGPWTLDEDTLLIHYIENHGEGHWNALAKCAGLKRTGKSCRLRWLNYLKPDI  72

Query  237  RRGNITPEEQLLIMELHAKWGNRWSKIAKH  326
            +RGN+TP+EQLLI+ELH+KWGNRWSKIA+H
Sbjct  73   KRGNLTPQEQLLILELHSKWGNRWSKIAQH  102



>ref|XP_007142925.1| hypothetical protein PHAVU_007G028700g [Phaseolus vulgaris]
 gb|ESW14919.1| hypothetical protein PHAVU_007G028700g [Phaseolus vulgaris]
Length=305

 Score =   157 bits (396),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 68/91 (75%), Positives = 84/91 (92%), Gaps = 0/91 (0%)
 Frame = +3

Query  54   CNSQDVEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLNYLRPD  233
             N ++ E+R+GPWT+EED +LI+YIA HGEG WN LA+SAGLKRTGKSCRLRWLNYL+PD
Sbjct  11   SNEEESELRRGPWTLEEDSLLIHYIARHGEGRWNMLAKSAGLKRTGKSCRLRWLNYLKPD  70

Query  234  VRRGNITPEEQLLIMELHAKWGNRWSKIAKH  326
            ++RGN+TP+EQLLI+ELH+KWGNRWSKIA+H
Sbjct  71   IKRGNLTPQEQLLILELHSKWGNRWSKIAQH  101



>gb|EAY83532.1| hypothetical protein OsI_38744 [Oryza sativa Indica Group]
Length=300

 Score =   156 bits (395),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 67/86 (78%), Positives = 82/86 (95%), Gaps = 0/86 (0%)
 Frame = +3

Query  69   VEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLNYLRPDVRRGN  248
            +E+R+GPWT++EDL L+NYIA+HGEG WNSLAR+AGLKRTGKSCRLRWLNYLRPDV+RGN
Sbjct  55   LELRRGPWTVDEDLTLVNYIADHGEGRWNSLARAAGLKRTGKSCRLRWLNYLRPDVKRGN  114

Query  249  ITPEEQLLIMELHAKWGNRWSKIAKH  326
             T +EQLLI++LH++WGNRWSKIA+H
Sbjct  115  FTADEQLLILDLHSRWGNRWSKIAQH  140



>ref|XP_009417759.1| PREDICTED: transcription factor MYB108-like [Musa acuminata subsp. 
malaccensis]
Length=260

 Score =   155 bits (392),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 71/103 (69%), Positives = 89/103 (86%), Gaps = 6/103 (6%)
 Frame = +3

Query  36   KMDKKPCNS------QDVEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKS  197
            ++  +PC+S      + +++R+GPWT++EDLIL+NY+  HGEG WNSLAR AGL+RTGKS
Sbjct  2    ELHGRPCSSATRQSEEGMDLRRGPWTVDEDLILMNYVTTHGEGRWNSLARCAGLRRTGKS  61

Query  198  CRLRWLNYLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKH  326
            CRLRWLNYLRPDVRRGNITPEEQLLI+ELH++ GNRWSKIA+H
Sbjct  62   CRLRWLNYLRPDVRRGNITPEEQLLILELHSRLGNRWSKIAQH  104



>gb|ABA98967.1| Myb-like DNA-binding domain containing protein, expressed [Oryza 
sativa Japonica Group]
 gb|EAZ20885.1| hypothetical protein OsJ_36524 [Oryza sativa Japonica Group]
Length=300

 Score =   156 bits (395),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 67/86 (78%), Positives = 82/86 (95%), Gaps = 0/86 (0%)
 Frame = +3

Query  69   VEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLNYLRPDVRRGN  248
            +E+R+GPWT++EDL L+NYIA+HGEG WNSLAR+AGLKRTGKSCRLRWLNYLRPDV+RGN
Sbjct  55   LELRRGPWTVDEDLTLVNYIADHGEGRWNSLARAAGLKRTGKSCRLRWLNYLRPDVKRGN  114

Query  249  ITPEEQLLIMELHAKWGNRWSKIAKH  326
             T +EQLLI++LH++WGNRWSKIA+H
Sbjct  115  FTADEQLLILDLHSRWGNRWSKIAQH  140



>ref|XP_006658986.1| PREDICTED: transcription factor MYB108-like [Oryza brachyantha]
Length=187

 Score =   153 bits (386),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 69/88 (78%), Positives = 80/88 (91%), Gaps = 0/88 (0%)
 Frame = +3

Query  63   QDVEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLNYLRPDVRR  242
            +  ++R+GPWT+EEDL+L NYIA HGEG WN+LAR AGLKRTGKSCRLRWLNYLRPDVRR
Sbjct  11   ETADLRRGPWTVEEDLLLANYIALHGEGRWNALARCAGLKRTGKSCRLRWLNYLRPDVRR  70

Query  243  GNITPEEQLLIMELHAKWGNRWSKIAKH  326
            GN+T EEQLLI+ELH +WGNRWSKIA+H
Sbjct  71   GNMTAEEQLLILELHGRWGNRWSKIAQH  98



>ref|XP_009387805.1| PREDICTED: transcription factor MYB57-like [Musa acuminata subsp. 
malaccensis]
Length=267

 Score =   155 bits (392),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 70/84 (83%), Positives = 79/84 (94%), Gaps = 0/84 (0%)
 Frame = +3

Query  75   IRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLNYLRPDVRRGNIT  254
            +RKGPWT+EEDL+L+NYIA HGEG WNS+AR +GLKRTGKSCRLRWLNYLRPDVR GNIT
Sbjct  20   LRKGPWTVEEDLLLMNYIAVHGEGRWNSVARCSGLKRTGKSCRLRWLNYLRPDVRHGNIT  79

Query  255  PEEQLLIMELHAKWGNRWSKIAKH  326
            PEEQLLI+ELH+ WGNRWSKIA+H
Sbjct  80   PEEQLLILELHSSWGNRWSKIAQH  103



>ref|XP_009392050.1| PREDICTED: transcription factor MYB108-like [Musa acuminata subsp. 
malaccensis]
Length=262

 Score =   155 bits (392),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 70/92 (76%), Positives = 83/92 (90%), Gaps = 0/92 (0%)
 Frame = +3

Query  51   PCNSQDVEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLNYLRP  230
            P + +++E+R+GPWT +EDLIL+NY+  HGEG WNSLAR AGL+RTGKSCRLRWLNYLRP
Sbjct  13   PPSEEEMELRRGPWTADEDLILMNYVTAHGEGRWNSLARRAGLRRTGKSCRLRWLNYLRP  72

Query  231  DVRRGNITPEEQLLIMELHAKWGNRWSKIAKH  326
            DVRRGNITPEEQLLI+ELH + GNRWSKIA+H
Sbjct  73   DVRRGNITPEEQLLILELHFRLGNRWSKIARH  104



>emb|CAN76459.1| hypothetical protein VITISV_010827 [Vitis vinifera]
Length=249

 Score =   155 bits (391),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 66/90 (73%), Positives = 85/90 (94%), Gaps = 0/90 (0%)
 Frame = +3

Query  57   NSQDVEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLNYLRPDV  236
            +S+++E+R+GPWT+EED +LI+YIA HGEG WN LA+ AGLKRTGKSCRLRWLNYL+PD+
Sbjct  11   SSEEIELRRGPWTLEEDTLLIHYIACHGEGRWNLLAKCAGLKRTGKSCRLRWLNYLKPDI  70

Query  237  RRGNITPEEQLLIMELHAKWGNRWSKIAKH  326
            +RGN+TP+EQLLI+ELH+KWGNRWS+IA+H
Sbjct  71   KRGNLTPQEQLLILELHSKWGNRWSRIAQH  100



>gb|AAO49418.1|AF485900_1 MYB9 [Dendrobium sp. XMW-2002-9]
Length=151

 Score =   151 bits (382),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 71/77 (92%), Positives = 75/77 (97%), Gaps = 0/77 (0%)
 Frame = +3

Query  96   MEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLNYLRPDVRRGNITPEEQLLI  275
            MEED ILINYIANHGEGVWN+LA+SAGLKRTGKSCRLRWLNYLRPDVRRGNITPEEQLLI
Sbjct  1    MEEDGILINYIANHGEGVWNNLAKSAGLKRTGKSCRLRWLNYLRPDVRRGNITPEEQLLI  60

Query  276  MELHAKWGNRWSKIAKH  326
            MELHA+WGNRWSKIA+ 
Sbjct  61   MELHARWGNRWSKIARQ  77



>ref|XP_009390937.1| PREDICTED: myb-related protein 305-like [Musa acuminata subsp. 
malaccensis]
Length=279

 Score =   155 bits (392),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 68/88 (77%), Positives = 83/88 (94%), Gaps = 0/88 (0%)
 Frame = +3

Query  63   QDVEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLNYLRPDVRR  242
            +D+E+R+GPWT+EED +LI+YIA HGEG WN LAR +GLKRTGKSCRLRWLNYL+PDV+R
Sbjct  4    EDMELRRGPWTLEEDKLLIHYIACHGEGRWNLLARCSGLKRTGKSCRLRWLNYLKPDVKR  63

Query  243  GNITPEEQLLIMELHAKWGNRWSKIAKH  326
            GN++PEEQLLI+ELHAKWGNRWS+IA+H
Sbjct  64   GNLSPEEQLLILELHAKWGNRWSRIAQH  91



>ref|XP_003535723.1| PREDICTED: transcription factor MYB108-like [Glycine max]
 gb|KHN05558.1| Transcription factor MYB21 [Glycine soja]
Length=308

 Score =   156 bits (394),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 68/90 (76%), Positives = 84/90 (93%), Gaps = 0/90 (0%)
 Frame = +3

Query  57   NSQDVEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLNYLRPDV  236
            N ++ E+R+GPWT+EED +LI+YIA HGEG WN LA+SAGLKRTGKSCRLRWLNYL+PD+
Sbjct  12   NEEESELRRGPWTLEEDSLLIHYIARHGEGRWNMLAKSAGLKRTGKSCRLRWLNYLKPDI  71

Query  237  RRGNITPEEQLLIMELHAKWGNRWSKIAKH  326
            +RGN+TP+EQLLI+ELH+KWGNRWSKIA+H
Sbjct  72   KRGNLTPQEQLLILELHSKWGNRWSKIAQH  101



>ref|XP_003592641.1| R2R3-MYB transcription factor [Medicago truncatula]
 gb|AES62892.1| myb transcription factor [Medicago truncatula]
Length=311

 Score =   156 bits (394),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 67/88 (76%), Positives = 83/88 (94%), Gaps = 0/88 (0%)
 Frame = +3

Query  63   QDVEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLNYLRPDVRR  242
            ++ E+R+GPWT+EED +LI+YIA HGEG WN LA+SAGLKRTGKSCRLRWLNYL+PD++R
Sbjct  22   EENELRRGPWTLEEDSLLIHYIARHGEGRWNMLAKSAGLKRTGKSCRLRWLNYLKPDIKR  81

Query  243  GNITPEEQLLIMELHAKWGNRWSKIAKH  326
            GN+TP+EQLLI+ELH+KWGNRWSKIA+H
Sbjct  82   GNLTPQEQLLILELHSKWGNRWSKIAQH  109



>ref|XP_011027944.1| PREDICTED: transcription factor MYB108-like [Populus euphratica]
Length=312

 Score =   155 bits (393),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 70/85 (82%), Positives = 79/85 (93%), Gaps = 0/85 (0%)
 Frame = +3

Query  72   EIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLNYLRPDVRRGNI  251
            ++R+GPWT+EED  LINYIA HGEG WNSLAR AGLKRTGKSCRLRWLNYLRPDVRRGNI
Sbjct  26   DLRRGPWTVEEDFKLINYIATHGEGRWNSLARCAGLKRTGKSCRLRWLNYLRPDVRRGNI  85

Query  252  TPEEQLLIMELHAKWGNRWSKIAKH  326
            T EEQL+I+ELH++WGNRWSKIA+H
Sbjct  86   TLEEQLMILELHSRWGNRWSKIAQH  110



>ref|NP_001068466.2| Os11g0684000 [Oryza sativa Japonica Group]
 gb|AAK08983.1| Myb transcription factor JAMyb [Oryza sativa Japonica Group]
 gb|ABA95299.1| expressed protein [Oryza sativa Japonica Group]
 dbj|BAF28829.2| Os11g0684000 [Oryza sativa Japonica Group]
Length=285

 Score =   155 bits (391),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 70/106 (66%), Positives = 86/106 (81%), Gaps = 4/106 (4%)
 Frame = +3

Query  9    HPPPSLSLKKMDKKPCNSQDVEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRT  188
            HP P     +  +        E+R+GPWT++EDL LINYI++HGEG WN+LAR+AGLKRT
Sbjct  11   HPVPG----EQQEAAAELSSAELRRGPWTVDEDLTLINYISDHGEGRWNALARAAGLKRT  66

Query  189  GKSCRLRWLNYLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKH  326
            GKSCRLRWLNYLRPDV+RGN T EEQLLI++LH++WGNRWSKIA+H
Sbjct  67   GKSCRLRWLNYLRPDVKRGNFTAEEQLLILDLHSRWGNRWSKIAQH  112



>gb|AGL81356.1| R2R3 MYB transcription factor 3, partial [Pyrus communis]
Length=227

 Score =   153 bits (387),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 67/89 (75%), Positives = 83/89 (93%), Gaps = 0/89 (0%)
 Frame = +3

Query  60   SQDVEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLNYLRPDVR  239
            +++ E R+GPWT+EED +LI+YI NHGEG WNSLA+ AGLKRTGKSCRLRWLNYL+PD++
Sbjct  8    NEENEFRRGPWTLEEDNLLIHYIMNHGEGHWNSLAKLAGLKRTGKSCRLRWLNYLKPDIK  67

Query  240  RGNITPEEQLLIMELHAKWGNRWSKIAKH  326
            RGN+TP+EQL+I+ELHAKWGNRWSKIA+H
Sbjct  68   RGNLTPQEQLVILELHAKWGNRWSKIAQH  96



>ref|NP_001141891.1| putative MYB DNA-binding domain superfamily protein [Zea mays]
 gb|ACF87244.1| unknown [Zea mays]
 tpg|DAA45085.1| TPA: putative MYB DNA-binding domain superfamily protein [Zea 
mays]
Length=336

 Score =   156 bits (395),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 69/85 (81%), Positives = 81/85 (95%), Gaps = 0/85 (0%)
 Frame = +3

Query  72   EIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLNYLRPDVRRGNI  251
            E+R+GPWT+EEDL L+NY+  HGEG WNSLARSAGLKRTGKSCRLRWLNYLRPD+RRGNI
Sbjct  20   ELRRGPWTVEEDLQLVNYVDAHGEGRWNSLARSAGLKRTGKSCRLRWLNYLRPDLRRGNI  79

Query  252  TPEEQLLIMELHAKWGNRWSKIAKH  326
            TP+EQL+I+ELH++WGNRWSKIA+H
Sbjct  80   TPQEQLMILELHSRWGNRWSKIAQH  104



>gb|AIB05776.1| MYB transcription factor, partial [Zea mays]
Length=336

 Score =   156 bits (394),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 69/85 (81%), Positives = 81/85 (95%), Gaps = 0/85 (0%)
 Frame = +3

Query  72   EIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLNYLRPDVRRGNI  251
            E+R+GPWT+EEDL L+NY+  HGEG WNSLARSAGLKRTGKSCRLRWLNYLRPD+RRGNI
Sbjct  20   ELRRGPWTVEEDLQLVNYVDAHGEGRWNSLARSAGLKRTGKSCRLRWLNYLRPDLRRGNI  79

Query  252  TPEEQLLIMELHAKWGNRWSKIAKH  326
            TP+EQL+I+ELH++WGNRWSKIA+H
Sbjct  80   TPQEQLMILELHSRWGNRWSKIAQH  104



>ref|XP_006301020.1| hypothetical protein CARUB_v10021411mg [Capsella rubella]
 gb|EOA33918.1| hypothetical protein CARUB_v10021411mg [Capsella rubella]
Length=291

 Score =   155 bits (391),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 69/102 (68%), Positives = 88/102 (86%), Gaps = 0/102 (0%)
 Frame = +3

Query  21   SLSLKKMDKKPCNSQDVEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSC  200
            S+  KK   K  + QDVE+R+GPWT+EED +L NY+ ++GEG WN +A+ AGLKRTGKSC
Sbjct  4    SMKKKKSFIKESDHQDVELRRGPWTLEEDTLLTNYVLHNGEGRWNHVAKCAGLKRTGKSC  63

Query  201  RLRWLNYLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKH  326
            RLRWLNYL+PD+RRGN+TP+EQLLI+ELH+KWGNRWSKIA++
Sbjct  64   RLRWLNYLKPDIRRGNLTPQEQLLILELHSKWGNRWSKIAQY  105



>ref|XP_004497077.1| PREDICTED: transcription factor MYB21-like [Cicer arietinum]
Length=314

 Score =   155 bits (393),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 70/105 (67%), Positives = 90/105 (86%), Gaps = 3/105 (3%)
 Frame = +3

Query  21   SLSLKKMDKKPCNSQDVE---IRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTG  191
            +L++    K+   S  +E   +R+GPWT+EED +LI+YIA+HGEG WN LA+SAGLKRTG
Sbjct  6    TLAMSTSTKREFGSNKIEENELRRGPWTLEEDSLLIHYIAHHGEGRWNMLAKSAGLKRTG  65

Query  192  KSCRLRWLNYLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKH  326
            KSCRLRWLNYL+PD++RGN+TP+EQLLI+ELH+KWGNRWSKIA+H
Sbjct  66   KSCRLRWLNYLKPDIKRGNLTPQEQLLILELHSKWGNRWSKIAQH  110



>gb|ADF43752.1| MYB [Camellia sinensis]
Length=310

 Score =   155 bits (393),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 69/88 (78%), Positives = 83/88 (94%), Gaps = 0/88 (0%)
 Frame = +3

Query  63   QDVEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLNYLRPDVRR  242
            +DVE+R+GPWT+EED +LI+YIA HGEG WN LA+ +GLKRTGKSCRLRWLNYL+PDV+R
Sbjct  14   EDVELRRGPWTLEEDTLLIHYIACHGEGRWNLLAKRSGLKRTGKSCRLRWLNYLKPDVKR  73

Query  243  GNITPEEQLLIMELHAKWGNRWSKIAKH  326
            GN+TPEEQLLI+ELH+KWGNRWSKIA+H
Sbjct  74   GNLTPEEQLLILELHSKWGNRWSKIAQH  101



>ref|XP_008389270.1| PREDICTED: myb-related protein 305 [Malus domestica]
Length=296

 Score =   155 bits (391),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 68/89 (76%), Positives = 84/89 (94%), Gaps = 0/89 (0%)
 Frame = +3

Query  60   SQDVEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLNYLRPDVR  239
            +++ E+RKGPWT+EED +LI+YIANHGEG WN LA+ AGLKRTGKSCRLRWLNYL+PD++
Sbjct  8    NEENELRKGPWTLEEDNLLIHYIANHGEGHWNYLAKFAGLKRTGKSCRLRWLNYLKPDIK  67

Query  240  RGNITPEEQLLIMELHAKWGNRWSKIAKH  326
            RGN+TP+EQLLI+ELH+KWGNRWSKIA+H
Sbjct  68   RGNLTPQEQLLILELHSKWGNRWSKIAQH  96



>gb|AEV91149.1| R2R3-MYB protein [Triticum aestivum]
Length=319

 Score =   155 bits (393),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 68/85 (80%), Positives = 82/85 (96%), Gaps = 0/85 (0%)
 Frame = +3

Query  72   EIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLNYLRPDVRRGNI  251
            ++R+GPWT+EED++L+NYIA H EG WNSLARSAGLKRTGKSCRLRWLNYLRPD+RRG+I
Sbjct  19   DLRRGPWTVEEDILLVNYIAAHSEGRWNSLARSAGLKRTGKSCRLRWLNYLRPDLRRGSI  78

Query  252  TPEEQLLIMELHAKWGNRWSKIAKH  326
            TP+EQLLI+ELH++WGNRWSKIA+H
Sbjct  79   TPQEQLLILELHSRWGNRWSKIAQH  103



>ref|XP_002311369.1| GmMYB12 family protein [Populus trichocarpa]
 gb|EEE88736.1| GmMYB12 family protein [Populus trichocarpa]
Length=321

 Score =   155 bits (393),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 70/85 (82%), Positives = 79/85 (93%), Gaps = 0/85 (0%)
 Frame = +3

Query  72   EIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLNYLRPDVRRGNI  251
            ++R+GPWT+EED  LINYIA HGEG WNSLAR AGLKRTGKSCRLRWLNYLRPDVRRGNI
Sbjct  26   DLRRGPWTVEEDFKLINYIATHGEGRWNSLARCAGLKRTGKSCRLRWLNYLRPDVRRGNI  85

Query  252  TPEEQLLIMELHAKWGNRWSKIAKH  326
            T EEQL+I+ELH++WGNRWSKIA+H
Sbjct  86   TLEEQLMILELHSRWGNRWSKIAQH  110



>ref|XP_002316060.2| hypothetical protein POPTR_0010s15970g [Populus trichocarpa]
 gb|EEF02231.2| hypothetical protein POPTR_0010s15970g [Populus trichocarpa]
Length=317

 Score =   155 bits (392),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 70/86 (81%), Positives = 80/86 (93%), Gaps = 0/86 (0%)
 Frame = +3

Query  69   VEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLNYLRPDVRRGN  248
            V++R+GPWT+EED  LI+YIA HGEG WNSLAR AGLKRTGKSCRLRWLNYLRPDVRRGN
Sbjct  23   VDLRRGPWTVEEDFKLIDYIATHGEGRWNSLARCAGLKRTGKSCRLRWLNYLRPDVRRGN  82

Query  249  ITPEEQLLIMELHAKWGNRWSKIAKH  326
            IT EEQL+I+ELH++WGNRWSKIA+H
Sbjct  83   ITLEEQLMILELHSRWGNRWSKIAQH  108



>ref|NP_001056356.1| Os05g0568200 [Oryza sativa Japonica Group]
 dbj|BAF18270.1| Os05g0568200 [Oryza sativa Japonica Group]
 gb|EEE64730.1| hypothetical protein OsJ_19586 [Oryza sativa Japonica Group]
Length=249

 Score =   154 bits (388),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 68/87 (78%), Positives = 78/87 (90%), Gaps = 0/87 (0%)
 Frame = +3

Query  66   DVEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLNYLRPDVRRG  245
            +  +RKGPWTMEEDL L+NYIA +GEG WN+LAR+AGL RTGKSCRLRWLNYLRPDVRRG
Sbjct  17   EAAVRKGPWTMEEDLSLVNYIAANGEGAWNTLARAAGLNRTGKSCRLRWLNYLRPDVRRG  76

Query  246  NITPEEQLLIMELHAKWGNRWSKIAKH  326
            NITPEE  LI+EL A+WGNRWSKIA++
Sbjct  77   NITPEEHTLIVELQARWGNRWSKIARY  103



>ref|XP_009356251.1| PREDICTED: transcription factor MYB108-like [Pyrus x bretschneideri]
Length=296

 Score =   155 bits (391),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 68/84 (81%), Positives = 81/84 (96%), Gaps = 0/84 (0%)
 Frame = +3

Query  75   IRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLNYLRPDVRRGNIT  254
            +RKGPWT+EED +LI+YIANHGEG WNSLA+ AGLKRTGKSCRLRWLNYL+PD++RGN+T
Sbjct  13   LRKGPWTLEEDNLLIHYIANHGEGHWNSLAKFAGLKRTGKSCRLRWLNYLKPDIKRGNLT  72

Query  255  PEEQLLIMELHAKWGNRWSKIAKH  326
            P+EQLLI+ELH+KWGNRWSKIA+H
Sbjct  73   PQEQLLILELHSKWGNRWSKIAQH  96



>ref|XP_010470777.1| PREDICTED: myb-related protein 340-like [Camelina sativa]
Length=289

 Score =   154 bits (390),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 67/89 (75%), Positives = 83/89 (93%), Gaps = 0/89 (0%)
 Frame = +3

Query  60   SQDVEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLNYLRPDVR  239
            S+DVE+R+GPWT+EED +L NYI ++GEG WN +AR AGLKRTGKSCRLRWLNYL+PD+R
Sbjct  14   SEDVELRRGPWTLEEDTLLTNYILHNGEGRWNHVARCAGLKRTGKSCRLRWLNYLKPDIR  73

Query  240  RGNITPEEQLLIMELHAKWGNRWSKIAKH  326
            RGN+TP+EQLLI+ELH+KWGNRWSKIA++
Sbjct  74   RGNLTPQEQLLILELHSKWGNRWSKIAQY  102



>gb|ACP30364.1| MYB protein [Malus hybrid cultivar]
Length=303

 Score =   155 bits (391),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 67/92 (73%), Positives = 83/92 (90%), Gaps = 0/92 (0%)
 Frame = +3

Query  51   PCNSQDVEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLNYLRP  230
            P   ++ E R+GPWT+EED +LI+YI NHGEG WNSLA+ AGLKRTGKSCRLRWLNYL+P
Sbjct  10   PTTPEENEFRRGPWTLEEDNLLIHYIVNHGEGHWNSLAKLAGLKRTGKSCRLRWLNYLKP  69

Query  231  DVRRGNITPEEQLLIMELHAKWGNRWSKIAKH  326
            D++RGN+TP+EQL+I+ELH+KWGNRWSKIA+H
Sbjct  70   DIKRGNLTPQEQLMILELHSKWGNRWSKIAQH  101



>ref|XP_009147443.1| PREDICTED: transcription factor MYB57-like [Brassica rapa]
Length=205

 Score =   152 bits (384),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 69/84 (82%), Positives = 78/84 (93%), Gaps = 0/84 (0%)
 Frame = +3

Query  75   IRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLNYLRPDVRRGNIT  254
            +RKGPWTMEEDLIL NYI NHGEG+WNS+A+++GLKRT KSCRLRWLNYLRPDVRRGNIT
Sbjct  23   VRKGPWTMEEDLILFNYILNHGEGLWNSVAKASGLKRTEKSCRLRWLNYLRPDVRRGNIT  82

Query  255  PEEQLLIMELHAKWGNRWSKIAKH  326
             EE LLI++LHAK GNRWSKIAK+
Sbjct  83   AEEHLLIIQLHAKLGNRWSKIAKY  106



>gb|EAY99070.1| hypothetical protein OsI_21027 [Oryza sativa Indica Group]
Length=249

 Score =   153 bits (387),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 68/87 (78%), Positives = 78/87 (90%), Gaps = 0/87 (0%)
 Frame = +3

Query  66   DVEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLNYLRPDVRRG  245
            +  +RKGPWTMEEDL L+NYIA +GEG WN+LAR+AGL RTGKSCRLRWLNYLRPDVRRG
Sbjct  17   EAAVRKGPWTMEEDLSLVNYIAANGEGAWNTLARAAGLNRTGKSCRLRWLNYLRPDVRRG  76

Query  246  NITPEEQLLIMELHAKWGNRWSKIAKH  326
            NITPEE  LI+EL A+WGNRWSKIA++
Sbjct  77   NITPEEHTLIVELQARWGNRWSKIARY  103



>ref|XP_009587217.1| PREDICTED: transcription factor MYB24-like [Nicotiana tomentosiformis]
Length=303

 Score =   155 bits (391),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 67/99 (68%), Positives = 84/99 (85%), Gaps = 0/99 (0%)
 Frame = +3

Query  30   LKKMDKKPCNSQDVEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLR  209
            +K       N    E+RKGPWT EED +LIN++ +HGEG WN+LA+S+GLKRTGKSCRLR
Sbjct  7    VKSTSSNSSNEDAFELRKGPWTTEEDNLLINHVTSHGEGRWNALAKSSGLKRTGKSCRLR  66

Query  210  WLNYLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKH  326
            WLNYL+PDV+RGN++P+EQLLI+ELH+KWGNRWSKIA+H
Sbjct  67   WLNYLKPDVKRGNLSPQEQLLILELHSKWGNRWSKIAEH  105



>ref|XP_011016230.1| PREDICTED: transcription factor MYB108-like [Populus euphratica]
Length=321

 Score =   155 bits (392),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 70/85 (82%), Positives = 79/85 (93%), Gaps = 0/85 (0%)
 Frame = +3

Query  72   EIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLNYLRPDVRRGNI  251
            ++R+GPWT+EED  LINYIA HGEG WNSLAR AGLKRTGKSCRLRWLNYLRPDVRRGNI
Sbjct  26   DLRRGPWTVEEDFKLINYIATHGEGRWNSLARCAGLKRTGKSCRLRWLNYLRPDVRRGNI  85

Query  252  TPEEQLLIMELHAKWGNRWSKIAKH  326
            T EEQL+I+ELH++WGNRWSKIA+H
Sbjct  86   TLEEQLMILELHSRWGNRWSKIAQH  110



>ref|XP_002279433.1| PREDICTED: transcription factor MYB24 [Vitis vinifera]
Length=288

 Score =   154 bits (390),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 66/90 (73%), Positives = 85/90 (94%), Gaps = 0/90 (0%)
 Frame = +3

Query  57   NSQDVEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLNYLRPDV  236
            +S+++E+R+GPWT+EED +LI+YIA HGEG WN LA+ AGLKRTGKSCRLRWLNYL+PD+
Sbjct  11   SSEEIELRRGPWTLEEDTLLIHYIACHGEGRWNLLAKCAGLKRTGKSCRLRWLNYLKPDI  70

Query  237  RRGNITPEEQLLIMELHAKWGNRWSKIAKH  326
            +RGN+TP+EQLLI+ELH+KWGNRWS+IA+H
Sbjct  71   KRGNLTPQEQLLILELHSKWGNRWSRIAQH  100



>ref|XP_004962755.1| PREDICTED: transcription repressor MYB5-like [Setaria italica]
Length=294

 Score =   154 bits (389),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 67/88 (76%), Positives = 81/88 (92%), Gaps = 0/88 (0%)
 Frame = +3

Query  63   QDVEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLNYLRPDVRR  242
            Q  ++R+GPWT++EDL L+NYIA+HGEG WNSLAR+AGLKRTGKSCRLRWLNYLRPDV+R
Sbjct  30   QADQLRRGPWTVDEDLTLVNYIADHGEGRWNSLARAAGLKRTGKSCRLRWLNYLRPDVKR  89

Query  243  GNITPEEQLLIMELHAKWGNRWSKIAKH  326
            GN T +EQLLI++LH +WGNRWSKIA+H
Sbjct  90   GNFTADEQLLILDLHTRWGNRWSKIAQH  117



>ref|XP_010544950.1| PREDICTED: transcription factor MYB108-like [Tarenaya hassleriana]
Length=269

 Score =   153 bits (387),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 67/92 (73%), Positives = 81/92 (88%), Gaps = 0/92 (0%)
 Frame = +3

Query  51   PCNSQDVEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLNYLRP  230
            P N +D ++RKGPWT EED +LINY++ HGEG WN++AR +GLKRTGKSCRLRWLNYLRP
Sbjct  11   PTNDEDSDVRKGPWTEEEDAVLINYVSVHGEGRWNNIARFSGLKRTGKSCRLRWLNYLRP  70

Query  231  DVRRGNITPEEQLLIMELHAKWGNRWSKIAKH  326
            DVRRGNIT EEQ LI++LH+ WGNRWSKIA++
Sbjct  71   DVRRGNITLEEQFLILKLHSVWGNRWSKIAQY  102



>ref|NP_001182983.1| putative MYB DNA-binding domain superfamily protein [Zea mays]
 gb|ACR35333.1| unknown [Zea mays]
 gb|AFW57483.1| putative MYB DNA-binding domain superfamily protein [Zea mays]
 gb|AIB04393.1| MYB transcription factor, partial [Zea mays]
Length=359

 Score =   155 bits (393),  Expect = 2e-43, Method: Composition-based stats.
 Identities = 67/84 (80%), Positives = 80/84 (95%), Gaps = 0/84 (0%)
 Frame = +3

Query  75   IRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLNYLRPDVRRGNIT  254
            +R+GPWT++ED++L+NYIA HGEG WNSLARSAGLKRTGKSCRLRWLNYLRP+VRRGNIT
Sbjct  63   LRRGPWTVDEDILLVNYIAAHGEGRWNSLARSAGLKRTGKSCRLRWLNYLRPNVRRGNIT  122

Query  255  PEEQLLIMELHAKWGNRWSKIAKH  326
             EEQLLI++LH++WGNRWSKIA+ 
Sbjct  123  AEEQLLILDLHSRWGNRWSKIAQQ  146



>emb|CBI27001.3| unnamed protein product [Vitis vinifera]
Length=295

 Score =   154 bits (389),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 66/90 (73%), Positives = 85/90 (94%), Gaps = 0/90 (0%)
 Frame = +3

Query  57   NSQDVEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLNYLRPDV  236
            +S+++E+R+GPWT+EED +LI+YIA HGEG WN LA+ AGLKRTGKSCRLRWLNYL+PD+
Sbjct  11   SSEEIELRRGPWTLEEDTLLIHYIACHGEGRWNLLAKCAGLKRTGKSCRLRWLNYLKPDI  70

Query  237  RRGNITPEEQLLIMELHAKWGNRWSKIAKH  326
            +RGN+TP+EQLLI+ELH+KWGNRWS+IA+H
Sbjct  71   KRGNLTPQEQLLILELHSKWGNRWSRIAQH  100



>ref|XP_003579302.1| PREDICTED: transcription factor MYB108-like isoform X1 [Brachypodium 
distachyon]
Length=275

 Score =   153 bits (387),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 66/87 (76%), Positives = 79/87 (91%), Gaps = 0/87 (0%)
 Frame = +3

Query  66   DVEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLNYLRPDVRRG  245
            + E+R+GPWT++EDL L+NYIA HGEG WN LAR AGLKRTGKSCRLRWLNYLRPDV+RG
Sbjct  16   EAEVRRGPWTVDEDLTLVNYIAEHGEGRWNCLARGAGLKRTGKSCRLRWLNYLRPDVKRG  75

Query  246  NITPEEQLLIMELHAKWGNRWSKIAKH  326
            N T +EQLLI++LH++WGNRWSKIA+H
Sbjct  76   NFTADEQLLILDLHSRWGNRWSKIAQH  102



>ref|XP_010415449.1| PREDICTED: myb-related protein 305 [Camelina sativa]
Length=289

 Score =   154 bits (388),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 70/100 (70%), Positives = 87/100 (87%), Gaps = 2/100 (2%)
 Frame = +3

Query  33   KKMDKKPC--NSQDVEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRL  206
            K M KK     S+DVE+R+GPWT+EED +L NYI ++GEG WN +A+ AGLKRTGKSCRL
Sbjct  3    KSMKKKSFIKESEDVELRRGPWTLEEDTLLTNYILHNGEGRWNHVAKCAGLKRTGKSCRL  62

Query  207  RWLNYLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKH  326
            RWLNYL+PD+RRGN+TP+EQLLI+ELH+KWGNRWSKIA++
Sbjct  63   RWLNYLKPDIRRGNLTPQEQLLILELHSKWGNRWSKIAQY  102



>ref|XP_002463415.1| hypothetical protein SORBIDRAFT_02g043420 [Sorghum bicolor]
 gb|EER99936.1| hypothetical protein SORBIDRAFT_02g043420 [Sorghum bicolor]
Length=255

 Score =   153 bits (386),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 65/85 (76%), Positives = 81/85 (95%), Gaps = 0/85 (0%)
 Frame = +3

Query  72   EIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLNYLRPDVRRGNI  251
            ++R+GPWT+EED++L+NY+A HGEG WN+LAR AGL+RTGKSCRLRWLNYLRPD+RRGNI
Sbjct  22   DLRRGPWTVEEDMLLVNYVAAHGEGRWNALARCAGLRRTGKSCRLRWLNYLRPDLRRGNI  81

Query  252  TPEEQLLIMELHAKWGNRWSKIAKH  326
            T +EQLLI+ELH++WGNRWSKIA+H
Sbjct  82   TAQEQLLILELHSRWGNRWSKIAQH  106



>ref|XP_010237154.1| PREDICTED: transcription factor MYB108-like isoform X2 [Brachypodium 
distachyon]
Length=261

 Score =   153 bits (386),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 66/87 (76%), Positives = 79/87 (91%), Gaps = 0/87 (0%)
 Frame = +3

Query  66   DVEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLNYLRPDVRRG  245
            + E+R+GPWT++EDL L+NYIA HGEG WN LAR AGLKRTGKSCRLRWLNYLRPDV+RG
Sbjct  16   EAEVRRGPWTVDEDLTLVNYIAEHGEGRWNCLARGAGLKRTGKSCRLRWLNYLRPDVKRG  75

Query  246  NITPEEQLLIMELHAKWGNRWSKIAKH  326
            N T +EQLLI++LH++WGNRWSKIA+H
Sbjct  76   NFTADEQLLILDLHSRWGNRWSKIAQH  102



>dbj|BAJ91760.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=282

 Score =   153 bits (387),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 67/84 (80%), Positives = 79/84 (94%), Gaps = 0/84 (0%)
 Frame = +3

Query  75   IRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLNYLRPDVRRGNIT  254
            IR+GPWT+EEDL L+NYIA+HG+G WNSLAR AGLKRTGKSCRLRWLNYLRPDV+RGN T
Sbjct  43   IRRGPWTVEEDLTLVNYIADHGDGRWNSLARGAGLKRTGKSCRLRWLNYLRPDVKRGNFT  102

Query  255  PEEQLLIMELHAKWGNRWSKIAKH  326
             +EQLLI++LH++WGNRWSKIA+H
Sbjct  103  ADEQLLILDLHSRWGNRWSKIAQH  126



>ref|XP_006655601.1| PREDICTED: transcription factor MYB21-like [Oryza brachyantha]
Length=235

 Score =   152 bits (383),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 68/84 (81%), Positives = 76/84 (90%), Gaps = 0/84 (0%)
 Frame = +3

Query  75   IRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLNYLRPDVRRGNIT  254
            +RKGPWTMEEDL L NYIA +G+G WN+LAR+AGL RTGKSCRLRWLNYLRPDVRRGNIT
Sbjct  20   VRKGPWTMEEDLSLANYIAANGDGAWNALARAAGLSRTGKSCRLRWLNYLRPDVRRGNIT  79

Query  255  PEEQLLIMELHAKWGNRWSKIAKH  326
            PEE  LI+EL A+WGNRWSKIA+H
Sbjct  80   PEEHTLIVELQARWGNRWSKIARH  103



>gb|EAY96442.1| hypothetical protein OsI_18339 [Oryza sativa Indica Group]
Length=311

 Score =   154 bits (388),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 66/85 (78%), Positives = 82/85 (96%), Gaps = 0/85 (0%)
 Frame = +3

Query  72   EIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLNYLRPDVRRGNI  251
            ++R+GPWT+EED++L++YIANHGEG WNSLAR AGL+RTGKSCRLRWLNYLRPDVRRGNI
Sbjct  26   DLRRGPWTVEEDMLLVDYIANHGEGRWNSLARCAGLRRTGKSCRLRWLNYLRPDVRRGNI  85

Query  252  TPEEQLLIMELHAKWGNRWSKIAKH  326
            T +EQLLI++LH++WGNRWSKIA++
Sbjct  86   TADEQLLILDLHSRWGNRWSKIAQY  110



>ref|XP_006663109.1| PREDICTED: transcription factor MYB108-like [Oryza brachyantha]
Length=296

 Score =   153 bits (387),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 67/86 (78%), Positives = 81/86 (94%), Gaps = 0/86 (0%)
 Frame = +3

Query  69   VEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLNYLRPDVRRGN  248
             E+R+GPWT++EDL LINYI++HGEG WN+LAR+AGLKRTGKSCRLRWLNYLRPDV+RGN
Sbjct  30   AELRRGPWTVDEDLTLINYISDHGEGRWNALARAAGLKRTGKSCRLRWLNYLRPDVKRGN  89

Query  249  ITPEEQLLIMELHAKWGNRWSKIAKH  326
             T EEQLLI++LH++WGNRWSKIA+H
Sbjct  90   FTAEEQLLILDLHSRWGNRWSKIAQH  115



>gb|EEE62225.1| hypothetical protein OsJ_17012 [Oryza sativa Japonica Group]
Length=310

 Score =   154 bits (388),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 66/85 (78%), Positives = 82/85 (96%), Gaps = 0/85 (0%)
 Frame = +3

Query  72   EIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLNYLRPDVRRGNI  251
            ++R+GPWT+EED++L++YIANHGEG WNSLAR AGL+RTGKSCRLRWLNYLRPDVRRGNI
Sbjct  26   DLRRGPWTVEEDMLLVDYIANHGEGRWNSLARCAGLRRTGKSCRLRWLNYLRPDVRRGNI  85

Query  252  TPEEQLLIMELHAKWGNRWSKIAKH  326
            T +EQLLI++LH++WGNRWSKIA++
Sbjct  86   TADEQLLILDLHSRWGNRWSKIAQY  110



>gb|EMT01874.1| Myb-related protein 305 [Aegilops tauschii]
Length=319

 Score =   154 bits (389),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 67/84 (80%), Positives = 81/84 (96%), Gaps = 0/84 (0%)
 Frame = +3

Query  72   EIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLNYLRPDVRRGNI  251
            ++R+GPWT+EED++L+NYIA HGEG WNSLARSAGLKRTGKSCRLRWLNYLRPD+RRG+I
Sbjct  19   DLRRGPWTVEEDILLVNYIAAHGEGRWNSLARSAGLKRTGKSCRLRWLNYLRPDLRRGSI  78

Query  252  TPEEQLLIMELHAKWGNRWSKIAK  323
            TP+EQLLI+ELH++W NRWSKIA+
Sbjct  79   TPQEQLLILELHSRWANRWSKIAQ  102



>ref|XP_006664647.1| PREDICTED: transcription factor MYB108-like [Oryza brachyantha]
Length=307

 Score =   154 bits (388),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 66/84 (79%), Positives = 80/84 (95%), Gaps = 0/84 (0%)
 Frame = +3

Query  75   IRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLNYLRPDVRRGNIT  254
            +R+GPWT++EDL L+NYIA+HGEG WNSLAR+AGLKRTGKSCRLRWLNYLRPDV+RGN T
Sbjct  56   LRRGPWTVDEDLTLVNYIADHGEGRWNSLARAAGLKRTGKSCRLRWLNYLRPDVKRGNFT  115

Query  255  PEEQLLIMELHAKWGNRWSKIAKH  326
             +EQLLI++LH++WGNRWSKIA+H
Sbjct  116  ADEQLLILDLHSRWGNRWSKIAQH  139



>ref|XP_008662919.1| PREDICTED: myb-like protein AA [Zea mays]
 gb|AFW57482.1| putative MYB DNA-binding domain superfamily protein [Zea mays]
 gb|AIB05202.1| MYB transcription factor, partial [Zea mays]
Length=406

 Score =   155 bits (393),  Expect = 5e-43, Method: Composition-based stats.
 Identities = 68/85 (80%), Positives = 80/85 (94%), Gaps = 0/85 (0%)
 Frame = +3

Query  72   EIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLNYLRPDVRRGNI  251
            ++R+GPWT EED++L+NYIA HGEG WNSLA SAGLKRTGKSCRLRWLNYLRP+VRRGNI
Sbjct  61   DLRRGPWTAEEDILLVNYIAAHGEGRWNSLALSAGLKRTGKSCRLRWLNYLRPNVRRGNI  120

Query  252  TPEEQLLIMELHAKWGNRWSKIAKH  326
            T EEQLLI++LH++WGNRWSKIA+H
Sbjct  121  TAEEQLLILDLHSRWGNRWSKIAQH  145



>ref|XP_009380293.1| PREDICTED: myb-related protein P-like [Musa acuminata subsp. 
malaccensis]
Length=312

 Score =   154 bits (388),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 66/87 (76%), Positives = 82/87 (94%), Gaps = 0/87 (0%)
 Frame = +3

Query  66   DVEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLNYLRPDVRRG  245
            D+E+R+GPWT+EED +LI+YIA HGEG WN LAR +GLKRTGKSCRLRWLNYL+PD++RG
Sbjct  13   DMELRRGPWTLEEDTLLIHYIACHGEGRWNLLARCSGLKRTGKSCRLRWLNYLKPDIKRG  72

Query  246  NITPEEQLLIMELHAKWGNRWSKIAKH  326
            N+TPEEQL+I+ELH+KWGNRWS+IA+H
Sbjct  73   NLTPEEQLMILELHSKWGNRWSRIAQH  99



>emb|CBI15464.3| unnamed protein product [Vitis vinifera]
Length=328

 Score =   154 bits (388),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 66/88 (75%), Positives = 83/88 (94%), Gaps = 0/88 (0%)
 Frame = +3

Query  63   QDVEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLNYLRPDVRR  242
            +D E+R+GPWT+EED +LI+YIA+HGEG WN LA+ +GL+RTGKSCRLRWLNYL+PDV+R
Sbjct  14   EDAELRRGPWTLEEDTLLIHYIASHGEGRWNLLAKCSGLRRTGKSCRLRWLNYLKPDVKR  73

Query  243  GNITPEEQLLIMELHAKWGNRWSKIAKH  326
            GN+TP+EQLLI+ELH+KWGNRWSKIA+H
Sbjct  74   GNLTPQEQLLILELHSKWGNRWSKIAQH  101



>ref|XP_009356946.1| PREDICTED: transcription factor MYB21-like [Pyrus x bretschneideri]
Length=298

 Score =   153 bits (386),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 67/89 (75%), Positives = 83/89 (93%), Gaps = 0/89 (0%)
 Frame = +3

Query  60   SQDVEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLNYLRPDVR  239
            +++ E R+GPWT+EED +LI+YI NHGEG WNSLA+ AGLKRTGKSCRLRWLNYL+PD++
Sbjct  8    NEENEFRRGPWTLEEDNLLIHYIMNHGEGHWNSLAKLAGLKRTGKSCRLRWLNYLKPDIK  67

Query  240  RGNITPEEQLLIMELHAKWGNRWSKIAKH  326
            RGN+TP+EQL+I+ELHAKWGNRWSKIA+H
Sbjct  68   RGNLTPQEQLVILELHAKWGNRWSKIAQH  96



>ref|XP_004958743.1| PREDICTED: myb-related protein 330-like [Setaria italica]
Length=314

 Score =   153 bits (387),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 68/98 (69%), Positives = 86/98 (88%), Gaps = 0/98 (0%)
 Frame = +3

Query  33   KKMDKKPCNSQDVEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRW  212
            ++M     ++   ++R+GPWT+EEDL+L+NYIA HGEG WN+LAR AGL+RTGKSCRLRW
Sbjct  7    REMSSDEESAASGDLRRGPWTVEEDLLLVNYIAVHGEGRWNALARCAGLRRTGKSCRLRW  66

Query  213  LNYLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKH  326
            LNYLRPD+RRGNIT +EQLLI+ELH++WGNRWSKIA+H
Sbjct  67   LNYLRPDLRRGNITAQEQLLILELHSRWGNRWSKIAQH  104



>ref|XP_002276526.3| PREDICTED: transcription factor MYB108 [Vitis vinifera]
Length=332

 Score =   154 bits (388),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 66/88 (75%), Positives = 83/88 (94%), Gaps = 0/88 (0%)
 Frame = +3

Query  63   QDVEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLNYLRPDVRR  242
            +D E+R+GPWT+EED +LI+YIA+HGEG WN LA+ +GL+RTGKSCRLRWLNYL+PDV+R
Sbjct  18   EDAELRRGPWTLEEDTLLIHYIASHGEGRWNLLAKCSGLRRTGKSCRLRWLNYLKPDVKR  77

Query  243  GNITPEEQLLIMELHAKWGNRWSKIAKH  326
            GN+TP+EQLLI+ELH+KWGNRWSKIA+H
Sbjct  78   GNLTPQEQLLILELHSKWGNRWSKIAQH  105



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 534011108320