BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c636_g1_i1 len=603 path=[1:0-602]

Length=603
                                                                      Score     E

ref|XP_004233330.1|  PREDICTED: myb-related protein 305-like            111   1e-26   
gb|ABU97107.1|  MYB305 protein v1                                       110   4e-26   Nicotiana langsdorffii x Nicotiana sanderae
ref|XP_009618404.1|  PREDICTED: myb-related protein 305-like            110   4e-26   
ref|XP_006357153.1|  PREDICTED: myb-related protein 305-like            109   5e-26   
gb|ADT82939.1|  non-opening 1                                           108   9e-26   
gb|AGI60280.1|  transcription factor MYB305                             108   1e-25   
gb|ABU97106.1|  MYB305 protein v2                                       108   2e-25   Nicotiana langsdorffii x Nicotiana sanderae
emb|CDP02096.1|  unnamed protein product                                105   1e-24   
ref|XP_009791355.1|  PREDICTED: myb-related protein 305-like            105   2e-24   
gb|ACB12237.1|  MYB-like protein NON1                                   101   7e-23   
gb|AGN52197.1|  MYB-related transcription factor                        100   2e-22   
gb|AGN52087.1|  MYB-related transcription factor                      99.8    3e-22   
gb|AGC00814.1|  EOBI                                                  99.8    4e-22   
gb|AGC00813.1|  EOBI                                                  99.4    6e-22   
ref|XP_009613846.1|  PREDICTED: myb-related protein 305-like          98.2    1e-21   
ref|XP_011098762.1|  PREDICTED: myb-related protein 305               97.1    3e-21   
ref|XP_011097428.1|  PREDICTED: myb-related protein 305               97.1    3e-21   
ref|XP_008348196.1|  PREDICTED: myb-related protein 305-like          93.2    2e-20   
dbj|BAF96932.1|  R2R3-MYB transcriptional factor                      93.2    8e-20   Gentiana triflora
emb|CAN77103.1|  hypothetical protein VITISV_018445                   92.4    2e-19   Vitis vinifera
ref|NP_001268062.1|  R2R3 Myb24 transcription factor                  92.4    2e-19   
emb|CAD87008.1|  MYB8 protein                                         91.7    3e-19   Gerbera hybrid cultivar
ref|XP_009334094.1|  PREDICTED: myb-related protein 305-like          90.5    9e-19   
ref|XP_009375123.1|  PREDICTED: myb-related protein 305-like          89.0    3e-18   
gb|EYU44761.1|  hypothetical protein MIMGU_mgv1a013642mg              89.0    4e-18   
sp|P81391.1|MYB05_ANTMA  RecName: Full=Myb-related protein 305        89.0    4e-18   Antirrhinum majus [garden snapdragon]
ref|XP_002298534.1|  Myb26 family protein                             87.8    8e-18   Populus trichocarpa [western balsam poplar]
ref|XP_002521453.1|  r2r3-myb transcription factor, putative          86.7    1e-17   Ricinus communis
ref|XP_008341440.1|  PREDICTED: myb-related protein 305-like          87.0    1e-17   
ref|XP_004141095.1|  PREDICTED: myb-related protein 305-like          85.9    6e-17   
gb|ACR15115.1|  MYBF1                                                 85.1    7e-17   
ref|XP_011005145.1|  PREDICTED: myb-related protein 305 isoform X2    84.7    9e-17   
ref|XP_011005144.1|  PREDICTED: myb-related protein 305 isoform X1    84.7    9e-17   
ref|XP_008443525.1|  PREDICTED: myb-related protein 305               84.0    3e-16   
dbj|BAF96931.1|  R2R3-MYB transcriptional factor                      83.6    3e-16   Gentiana triflora
gb|EPS65034.1|  hypothetical protein M569_09745                       83.6    3e-16   
ref|XP_009783970.1|  PREDICTED: myb-related protein 340-like          82.0    7e-16   
gb|KHN27530.1|  Myb-related protein 305                               81.3    1e-15   
ref|XP_006338574.1|  PREDICTED: myb-related protein 340-like          81.6    1e-15   
ref|NP_001235850.1|  MYB transcription factor MYB181                  81.3    2e-15   
ref|XP_010033288.1|  PREDICTED: myb-related protein 305               80.9    2e-15   
ref|XP_004232307.1|  PREDICTED: myb-related protein 340               80.9    2e-15   
ref|XP_007031495.1|  Myb domain protein 21                            80.5    3e-15   
gb|AAC83614.1|  putative transcription factor                         78.6    4e-15   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007140962.1|  hypothetical protein PHAVU_008G155700g           79.7    6e-15   
ref|XP_010496298.1|  PREDICTED: transcription factor MYB57-like       79.0    1e-14   
ref|XP_008230585.1|  PREDICTED: myb-related protein 305-like          78.6    2e-14   
ref|XP_007217766.1|  hypothetical protein PRUPE_ppa011751mg           78.2    2e-14   
ref|XP_007140964.1|  hypothetical protein PHAVU_008G155900g           77.8    3e-14   
ref|XP_010485409.1|  PREDICTED: transcription factor MYB57-like       77.8    3e-14   
ref|NP_186802.1|  myb domain protein 57                               77.8    3e-14   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011013295.1|  PREDICTED: myb-related protein 305-like isof...  77.4    3e-14   
ref|XP_011013638.1|  PREDICTED: myb-related protein 305-like isof...  77.4    3e-14   
ref|NP_001235879.1|  MYB transcription factor MYB182                  77.8    3e-14   
ref|XP_011013637.1|  PREDICTED: myb-related protein 305-like isof...  77.4    4e-14   
ref|XP_011013294.1|  PREDICTED: myb-related protein 305-like isof...  77.4    4e-14   
ref|XP_004304632.1|  PREDICTED: myb-related protein 305-like          76.6    6e-14   
gb|AGN52062.1|  MYB-related transcription factor                      76.6    7e-14   
ref|XP_006300020.1|  hypothetical protein CARUB_v10016245mg           76.3    9e-14   
gb|KFK37619.1|  hypothetical protein AALP_AA3G006700                  76.3    1e-13   
gb|KDP46431.1|  hypothetical protein JCGZ_10271                       75.9    1e-13   
ref|XP_004489258.1|  PREDICTED: myb-related protein 305-like          75.5    2e-13   
ref|XP_010108787.1|  Myb-related protein 305                          75.1    3e-13   
gb|AAM67076.1|  putative transcription factor                         75.1    3e-13   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001238263.1|  uncharacterized protein LOC100306400             74.7    3e-13   
ref|NP_001235865.1|  MYB transcription factor MYB98                   74.7    4e-13   
ref|XP_010435630.1|  PREDICTED: transcription factor MYB57            74.7    4e-13   
ref|XP_002323803.1|  Myb26 family protein                             73.2    9e-13   Populus trichocarpa [western balsam poplar]
gb|KHN23525.1|  Transcription factor MYB21                            72.8    1e-12   
ref|XP_008458780.1|  PREDICTED: myb-related protein 340-like          73.2    1e-12   
sp|P81396.1|MYB40_ANTMA  RecName: Full=Myb-related protein 340        72.8    2e-12   Antirrhinum majus [garden snapdragon]
ref|XP_003553814.1|  PREDICTED: myb-related protein 305               72.8    2e-12   
ref|XP_010251229.1|  PREDICTED: myb-related protein 340-like          72.4    2e-12   
ref|XP_002882176.1|  predicted protein                                72.4    2e-12   
ref|XP_004142797.1|  PREDICTED: myb-related protein 305-like          72.4    2e-12   
ref|XP_004156725.1|  PREDICTED: LOW QUALITY PROTEIN: myb-related ...  72.4    2e-12   
ref|XP_004516766.1|  PREDICTED: myb-related protein 305-like isof...  72.0    4e-12   
ref|XP_006408520.1|  hypothetical protein EUTSA_v10022197mg           70.5    4e-12   
ref|XP_004516765.1|  PREDICTED: myb-related protein 305-like isof...  72.0    5e-12   
gb|KDO66125.1|  hypothetical protein CISIN_1g045384mg                 71.2    5e-12   
gb|AFJ21697.1|  MYB24                                                 71.2    6e-12   
ref|XP_006446527.1|  hypothetical protein CICLE_v10016820mg           70.1    1e-11   
ref|XP_006470308.1|  PREDICTED: myb-related protein 305-like isof...  69.7    2e-11   
ref|XP_007151019.1|  hypothetical protein PHAVU_004G012000g           70.1    2e-11   
gb|ABH02872.1|  MYB transcription factor MYB99                        69.7    2e-11   Glycine max [soybeans]
ref|NP_001235699.1|  uncharacterized protein LOC100305972             69.7    2e-11   
gb|KHN27441.1|  Myb-related protein 305                               69.3    2e-11   
ref|XP_006405505.1|  hypothetical protein EUTSA_v10027930mg           69.7    2e-11   
ref|XP_010924268.1|  PREDICTED: myb-related protein 305-like          68.2    5e-11   
ref|XP_010555957.1|  PREDICTED: transcription factor MYB21-like       68.2    5e-11   
emb|CAA71992.1|  Myb26                                                68.2    6e-11   Pisum sativum [garden pea]
ref|XP_010502785.1|  PREDICTED: transcription factor MYB21-like       68.6    6e-11   
ref|XP_010528247.1|  PREDICTED: transcription factor MYB21            68.2    6e-11   
gb|KHG20022.1|  Myb-related protein                                   68.2    6e-11   
gb|KEH22251.1|  myb transcription factor                              67.4    1e-10   
ref|XP_010425557.1|  PREDICTED: transcription factor MYB21 isofor...  67.0    2e-10   
ref|XP_010425556.1|  PREDICTED: transcription factor MYB21 isofor...  67.0    2e-10   
ref|XP_010514490.1|  PREDICTED: transcription factor MYB21-like       66.6    2e-10   
ref|XP_008800726.1|  PREDICTED: myb-related protein 305-like          66.6    2e-10   
emb|CDX91944.1|  BnaC03g32460D                                        66.2    3e-10   
gb|KEH24806.1|  myb transcription factor                              66.2    3e-10   
ref|XP_006285780.1|  hypothetical protein CARUB_v10007254mg           65.9    5e-10   
ref|XP_010925776.1|  PREDICTED: myb-related protein 305-like          65.5    5e-10   
ref|XP_002875402.1|  ATMYB21                                          65.9    5e-10   
gb|AEE37094.1|  MYB transcription factor                              65.5    5e-10   
ref|XP_010555954.1|  PREDICTED: transcription factor MYB21-like       65.1    7e-10   
ref|XP_009419837.1|  PREDICTED: myb-related protein 305-like          64.3    1e-09   
ref|XP_006292470.1|  hypothetical protein CARUB_v10018700mg           64.7    1e-09   
ref|XP_009134610.1|  PREDICTED: transcription factor MYB57-like       63.9    2e-09   
gb|AAC83592.1|  putative transcription factor                         63.2    2e-09   Arabidopsis thaliana [mouse-ear cress]
emb|CDY49063.1|  BnaC05g48910D                                        63.9    2e-09   
ref|XP_009111584.1|  PREDICTED: transcription factor MYB21            63.9    2e-09   
emb|CDY37512.1|  BnaA05g33770D                                        63.2    3e-09   
ref|XP_009147443.1|  PREDICTED: transcription factor MYB57-like       63.2    4e-09   
ref|XP_006395401.1|  hypothetical protein EUTSA_v10004857mg           63.5    4e-09   
gb|AAB23527.1|  Myb oncoprotein homolog {clone 305}                   61.2    4e-09   
emb|CDY20036.1|  BnaA09g02150D                                        63.2    4e-09   
ref|NP_189418.2|  transcription factor MYB21                          62.8    5e-09   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010554050.1|  PREDICTED: transcription factor MYB21-like       62.4    6e-09   
emb|CDX86471.1|  BnaA06g31880D                                        62.8    7e-09   
ref|XP_009151925.1|  PREDICTED: transcription factor MYB21            62.4    8e-09   
emb|CDY44433.1|  BnaC07g24710D                                        62.4    8e-09   
gb|AET25524.1|  MYB1                                                  62.0    1e-08   
gb|ACL81164.1|  MYB transcription factor                              61.6    1e-08   Mirabilis jalapa
ref|XP_010925788.1|  PREDICTED: myb-related protein 305-like          61.2    1e-08   
gb|AAM63674.1|  putative transcription factor MYB24                   61.2    2e-08   Arabidopsis thaliana [mouse-ear cress]
gb|KFK33688.1|  hypothetical protein AALP_AA5G046900                  61.6    2e-08   
ref|XP_010450678.1|  PREDICTED: transcription factor MYB24-like       61.2    2e-08   
ref|NP_198851.1|  myb domain protein 24                               61.2    2e-08   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008812482.1|  PREDICTED: myb-related protein 305-like          60.5    3e-08   
ref|XP_010029159.1|  PREDICTED: myb-related protein 340-like          60.1    4e-08   
ref|XP_009416734.1|  PREDICTED: myb-related protein 305-like          58.5    2e-07   
ref|XP_010435910.1|  PREDICTED: transcription factor MYB24-like       58.2    3e-07   
ref|XP_006655601.1|  PREDICTED: transcription factor MYB21-like       58.5    3e-07   
ref|XP_010441167.1|  PREDICTED: transcription factor MYB24-like       57.4    4e-07   
dbj|BAA21618.1|  ATMYB3                                               57.8    4e-07   Arabidopsis thaliana [mouse-ear cress]
dbj|BAB40790.1|  LhMyb                                                56.6    5e-07   Lilium hybrid division I
ref|XP_009406298.1|  PREDICTED: myb-related protein 305-like          57.0    6e-07   
ref|XP_010677862.1|  PREDICTED: myb-related protein 305-like          57.0    8e-07   
ref|XP_003618205.1|  MYB transcription factor                         55.8    1e-06   
ref|XP_009408723.1|  PREDICTED: anthocyanin regulatory C1 protein...  53.5    7e-06   
gb|AGO33165.1|  MYB transcription factor                              54.3    7e-06   
dbj|BAL41446.1|  transcription factor MYB21                           53.9    1e-05   
ref|XP_010243072.1|  PREDICTED: myb-related protein 305               51.6    3e-05   
gb|KGN59677.1|  hypothetical protein Csa_3G837580                     49.3    5e-05   
gb|AAB23524.1|  Myb oncoprotein homolog {clone 340}                   49.3    6e-05   
emb|CDY00146.1|  BnaC09g01550D                                        50.4    7e-05   
ref|XP_008662919.1|  PREDICTED: myb-like protein AA                   52.0    9e-05   
ref|XP_006349959.1|  PREDICTED: myb-related protein 315-like          48.9    3e-04   
gb|ACB59076.2|  Myb-like transcription factor EOBI                    47.4    4e-04   
gb|AAC83631.1|  putative transcription factor                         49.3    5e-04   Arabidopsis thaliana [mouse-ear cress]
gb|EMT01874.1|  Myb-related protein 305                               49.7    5e-04   
ref|XP_006649985.1|  PREDICTED: myb-related protein MYBAS1-like       49.7    5e-04   
gb|ABH02913.1|  MYB transcription factor MYB72                        48.1    5e-04   Glycine max [soybeans]
gb|EAZ19253.1|  hypothetical protein OsJ_34790                        48.5    6e-04   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006654961.1|  PREDICTED: transcription factor MYB108-like      49.3    6e-04   
gb|KDO86883.1|  hypothetical protein CISIN_1g043269mg                 48.5    6e-04   
ref|NP_001140397.1|  putative MYB DNA-binding domain superfamily ...  49.3    6e-04   Zea mays [maize]
tpg|DAA47022.1|  TPA: putative MYB DNA-binding domain superfamily...  49.3    6e-04   
gb|EMS64823.1|  Transcription factor MYB21                            49.3    6e-04   
ref|XP_006658986.1|  PREDICTED: transcription factor MYB108-like      48.5    6e-04   
ref|NP_001060700.1|  Os07g0688200                                     49.3    6e-04   Oryza sativa Japonica Group [Japonica rice]
dbj|BAC21351.1|  putative typical P-type R2R3 Myb protein             49.3    7e-04   Oryza sativa Japonica Group [Japonica rice]
gb|AEV91149.1|  R2R3-MYB protein                                      49.3    7e-04   
gb|AAL84762.1|AF474129_1  typical P-type R2R3 Myb protein             48.1    7e-04   Sorghum bicolor [broomcorn]
ref|XP_004984581.1|  PREDICTED: myb-related protein P-like            49.3    7e-04   
ref|XP_002465358.1|  hypothetical protein SORBIDRAFT_01g037110        49.3    7e-04   Sorghum bicolor [broomcorn]
ref|NP_001170329.1|  putative MYB DNA-binding domain superfamily ...  49.3    7e-04   Zea mays [maize]
ref|XP_004962755.1|  PREDICTED: transcription repressor MYB5-like     49.3    7e-04   
gb|EAY89765.1|  hypothetical protein OsI_11306                        49.3    7e-04   Oryza sativa Indica Group [Indian rice]
ref|NP_001049937.1|  Os03g0315400                                     49.3    7e-04   Oryza sativa Japonica Group [Japonica rice]
gb|AIS35932.1|  MYB transcription factor 15                           47.0    7e-04   
gb|EAY83532.1|  hypothetical protein OsI_38744                        48.9    8e-04   Oryza sativa Indica Group [Indian rice]
ref|XP_010237394.1|  PREDICTED: transcription factor MYB108           48.9    8e-04   
ref|XP_008674336.1|  PREDICTED: myb-related protein 305               48.9    8e-04   
gb|AFW60134.1|  putative MYB DNA-binding domain superfamily protein   49.3    8e-04   
dbj|BAJ61447.1|  R2R3-MYB transcription factor                        48.9    8e-04   
gb|KHG22187.1|  Myb-related protein                                   48.9    8e-04   
ref|XP_009416464.1|  PREDICTED: myb-related protein 305-like          48.9    8e-04   
ref|XP_003561685.1|  PREDICTED: myb-related protein P-like            48.9    8e-04   
ref|XP_008677864.1|  PREDICTED: transcription factor MYB108-like      49.3    8e-04   
emb|CBI22842.3|  unnamed protein product                              48.9    8e-04   
ref|NP_001141891.1|  putative MYB DNA-binding domain superfamily ...  48.9    8e-04   Zea mays [maize]
ref|NP_001267991.1|  R2R3 transcription factor MYB108-like protein 1  48.9    8e-04   
gb|ACF22737.1|  Myb                                                   48.9    8e-04   Brachypodium distachyon [annual false brome]
emb|CAN63179.1|  hypothetical protein VITISV_029107                   48.9    8e-04   Vitis vinifera
gb|EAY96442.1|  hypothetical protein OsI_18339                        48.9    8e-04   Oryza sativa Indica Group [Indian rice]
emb|CCA29096.1|  putative MYB transcription factor                    48.9    8e-04   
ref|XP_010666321.1|  PREDICTED: transcription factor MYB108-like      48.9    8e-04   
gb|ABA98967.1|  Myb-like DNA-binding domain containing protein, e...  48.9    8e-04   Oryza sativa Japonica Group [Japonica rice]
gb|EMS61349.1|  Transcription factor MYB21                            48.5    8e-04   
gb|EEE62225.1|  hypothetical protein OsJ_17012                        48.9    8e-04   Oryza sativa Japonica Group [Japonica rice]
emb|CBH32532.1|  Myb-like DNA-binding domain containing protein,e...  48.9    8e-04   
ref|XP_009151285.1|  PREDICTED: transcription factor MYB108-like      48.9    8e-04   
ref|XP_009392103.1|  PREDICTED: protein ODORANT1-like                 48.9    8e-04   
gb|AIB05776.1|  MYB transcription factor                              48.9    8e-04   
ref|XP_002451276.1|  hypothetical protein SORBIDRAFT_05g026820        48.9    9e-04   Sorghum bicolor [broomcorn]
gb|EMT25040.1|  Transcription factor MYB21                            48.9    9e-04   
ref|XP_007147396.1|  hypothetical protein PHAVU_006G120800g           48.9    9e-04   
ref|XP_004963430.1|  PREDICTED: transcription repressor MYB5-like     48.9    9e-04   
ref|XP_004295042.1|  PREDICTED: uncharacterized protein LOC101295899  48.9    9e-04   
gb|EMT04483.1|  Transcription factor MYB21                            48.9    9e-04   
dbj|BAJ91760.1|  predicted protein                                    48.9    9e-04   
ref|NP_001042810.1|  Os01g0298400                                     48.9    9e-04   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004967585.1|  PREDICTED: myb-related protein Myb4-like         48.9    0.001   
ref|XP_010544950.1|  PREDICTED: transcription factor MYB108-like      48.9    0.001   
ref|XP_008390410.1|  PREDICTED: transcription factor MYB108-like      48.9    0.001   
ref|XP_009382479.1|  PREDICTED: transcription factor MYB108-like      48.5    0.001   
ref|XP_009372081.1|  PREDICTED: transcription factor MYB108           48.9    0.001   
ref|XP_009799769.1|  PREDICTED: transcription factor MYB108-like      48.5    0.001   
ref|XP_010237154.1|  PREDICTED: transcription factor MYB108-like ...  48.5    0.001   
ref|XP_008340570.1|  PREDICTED: transcription factor MYB108           48.9    0.001   
ref|NP_001068466.2|  Os11g0684000                                     48.9    0.001   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010938192.1|  PREDICTED: transcription factor MYB108-like      48.9    0.001   
ref|XP_006488792.1|  PREDICTED: transcription factor MYB108-like      48.9    0.001   
ref|XP_010045365.1|  PREDICTED: transcription factor MYB108           48.9    0.001   
gb|KDO72049.1|  hypothetical protein CISIN_1g019911mg                 48.9    0.001   
gb|KGN57183.1|  hypothetical protein Csa_3G168940                     48.9    0.001   
emb|CDX85422.1|  BnaC07g27330D                                        47.8    0.001   
ref|XP_006644098.1|  PREDICTED: transcription factor MYB108-like      48.9    0.001   
ref|XP_006492457.1|  PREDICTED: transcription factor MYB108-like      48.5    0.001   
ref|XP_004979993.1|  PREDICTED: myb-related protein Zm38-like         48.9    0.001   
ref|XP_010314657.1|  PREDICTED: ABA-induced MYB transcription fac...  48.5    0.001   



>ref|XP_004233330.1| PREDICTED: myb-related protein 305-like [Solanum lycopersicum]
Length=195

 Score =   111 bits (278),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 60/108 (56%), Positives = 70/108 (65%), Gaps = 12/108 (11%)
 Frame = +2

Query  2    PGRTDNEIKNYWRTRIQKHMKPQAAGGENAATRQSSSSCCGGEQASTSQASA---PDTVE  172
            PGRTDNEIKNYWRTRIQKH+K     GEN   + SS      ++ S+SQ S+    D +E
Sbjct  97   PGRTDNEIKNYWRTRIQKHIKQ----GENMNGQGSSEQNIDHQEGSSSQISSVGQADNIE  152

Query  173  TYSPTSYASnnnnnnMDATFQQGPFATESNDNMWSMEDLWSMHLLNAD  316
            TYSPTSY  N     +D  FQ   F  E+NDNMWSMED+WSM LLN D
Sbjct  153  TYSPTSYNGN-----LDTNFQASNFLNETNDNMWSMEDIWSMQLLNGD  195



>gb|ABU97107.1| MYB305 protein v1 [Nicotiana langsdorffii x Nicotiana sanderae]
Length=192

 Score =   110 bits (274),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 59/105 (56%), Positives = 73/105 (70%), Gaps = 10/105 (10%)
 Frame = +2

Query  2    PGRTDNEIKNYWRTRIQKHMKPQAAGGENAATRQSSSSCCGGEQASTSQASAPDTVETYS  181
            PGRTDNEIKNYWRTRIQKH+K      EN   + ++S     ++ S+S  S+    ETYS
Sbjct  98   PGRTDNEIKNYWRTRIQKHIKQ----AENMNGQAANSEQNDHQEGSSSHMSSAGPTETYS  153

Query  182  PTSYASnnnnnnMDATFQQGPFATESNDNMWSMEDLWSMHLLNAD  316
            PTSY++N     +D TFQ GPF TE+NDN+WSMED+WSM LLN D
Sbjct  154  PTSYSAN-----IDTTFQ-GPFLTETNDNIWSMEDIWSMQLLNGD  192



>ref|XP_009618404.1| PREDICTED: myb-related protein 305-like [Nicotiana tomentosiformis]
Length=192

 Score =   110 bits (274),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 59/105 (56%), Positives = 73/105 (70%), Gaps = 10/105 (10%)
 Frame = +2

Query  2    PGRTDNEIKNYWRTRIQKHMKPQAAGGENAATRQSSSSCCGGEQASTSQASAPDTVETYS  181
            PGRTDNEIKNYWRTRIQKH+K      EN   + ++S     ++ S+S  S+    ETYS
Sbjct  98   PGRTDNEIKNYWRTRIQKHIKQ----AENMNGQAANSEQNDHQEGSSSHMSSAGPAETYS  153

Query  182  PTSYASnnnnnnMDATFQQGPFATESNDNMWSMEDLWSMHLLNAD  316
            PTSY++N     +D TFQ GPF TE+NDN+WSMED+WSM LLN D
Sbjct  154  PTSYSAN-----IDTTFQ-GPFLTETNDNIWSMEDIWSMQLLNGD  192



>ref|XP_006357153.1| PREDICTED: myb-related protein 305-like [Solanum tuberosum]
Length=195

 Score =   109 bits (273),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 59/108 (55%), Positives = 71/108 (66%), Gaps = 12/108 (11%)
 Frame = +2

Query  2    PGRTDNEIKNYWRTRIQKHMKPQAAGGENAATRQSSSSCCGGEQASTSQASA---PDTVE  172
            PGRTDNEIKNYWRTRIQKH+K     GEN   + +S      ++ S+SQ S+    D +E
Sbjct  97   PGRTDNEIKNYWRTRIQKHIKQ----GENMNGQGTSEQNIDHQEGSSSQISSVGQADNIE  152

Query  173  TYSPTSYASnnnnnnMDATFQQGPFATESNDNMWSMEDLWSMHLLNAD  316
            TYSPTSY  N     +D  FQ   F +E+NDNMWSMED+WSM LLN D
Sbjct  153  TYSPTSYNGN-----LDTNFQAPNFLSETNDNMWSMEDIWSMQLLNGD  195



>gb|ADT82939.1| non-opening 1 [Nicotiana attenuata]
Length=192

 Score =   108 bits (271),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 59/105 (56%), Positives = 72/105 (69%), Gaps = 10/105 (10%)
 Frame = +2

Query  2    PGRTDNEIKNYWRTRIQKHMKPQAAGGENAATRQSSSSCCGGEQASTSQASAPDTVETYS  181
            PGRTDNEIKNYWRTRIQKH+K      EN   + +S      ++ S+S  S+    ETYS
Sbjct  98   PGRTDNEIKNYWRTRIQKHIKQ----AENMNGQAASHEQNDHQEGSSSHMSSAGPTETYS  153

Query  182  PTSYASnnnnnnMDATFQQGPFATESNDNMWSMEDLWSMHLLNAD  316
            PTSY++N     +D TFQ GPF TE+NDN+WSMED+WSM LLN D
Sbjct  154  PTSYSAN-----IDNTFQ-GPFLTETNDNIWSMEDIWSMQLLNGD  192



>gb|AGI60280.1| transcription factor MYB305 [Nicotiana tabacum]
Length=192

 Score =   108 bits (270),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 58/105 (55%), Positives = 73/105 (70%), Gaps = 10/105 (10%)
 Frame = +2

Query  2    PGRTDNEIKNYWRTRIQKHMKPQAAGGENAATRQSSSSCCGGEQASTSQASAPDTVETYS  181
            PGRTDNEIKNYWRTRIQKH+K      EN   + ++S     ++ S+S  S+    ETYS
Sbjct  98   PGRTDNEIKNYWRTRIQKHIKQ----AENMNGQAANSEQNDHQEGSSSHMSSAGPAETYS  153

Query  182  PTSYASnnnnnnMDATFQQGPFATESNDNMWSMEDLWSMHLLNAD  316
            P+SY++N     +D TFQ GPF TE+NDN+WSMED+WSM LLN D
Sbjct  154  PSSYSAN-----IDTTFQ-GPFLTETNDNIWSMEDIWSMQLLNGD  192



>gb|ABU97106.1| MYB305 protein v2 [Nicotiana langsdorffii x Nicotiana sanderae]
Length=192

 Score =   108 bits (269),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 58/105 (55%), Positives = 72/105 (69%), Gaps = 10/105 (10%)
 Frame = +2

Query  2    PGRTDNEIKNYWRTRIQKHMKPQAAGGENAATRQSSSSCCGGEQASTSQASAPDTVETYS  181
            PGRTDNEIKNYWRTRIQKH+K      EN   + ++S     ++ S+S  S+    E YS
Sbjct  98   PGRTDNEIKNYWRTRIQKHIKQ----AENMNGQAANSEQNDHQEGSSSHMSSAGPTEAYS  153

Query  182  PTSYASnnnnnnMDATFQQGPFATESNDNMWSMEDLWSMHLLNAD  316
            PTSY++N     +D TFQ GPF TE+NDN+WSMED+WSM LLN D
Sbjct  154  PTSYSAN-----IDTTFQ-GPFLTETNDNIWSMEDIWSMQLLNGD  192



>emb|CDP02096.1| unnamed protein product [Coffea canephora]
Length=189

 Score =   105 bits (263),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 63/106 (59%), Positives = 68/106 (64%), Gaps = 15/106 (14%)
 Frame = +2

Query  2    PGRTDNEIKNYWRTRIQKHMKPQAAGGENAATRQSSSSCCGGEQASTSQASAP-DTVETY  178
            PGRTDNEIKNYWRTRIQKH+K        A T     S    +QASTSQ S   D  ETY
Sbjct  98   PGRTDNEIKNYWRTRIQKHIK-------QAETFAGQGSEHANDQASTSQISTTVDAAETY  150

Query  179  SPTSYASnnnnnnMDATFQQGPFATESNDNMWSMEDLWSMHLLNAD  316
            SP SY+ N        TFQ GPF TESN+N+WSMEDLWSM LLN D
Sbjct  151  SPPSYSGNME------TFQ-GPFPTESNENLWSMEDLWSMQLLNGD  189



>ref|XP_009791355.1| PREDICTED: myb-related protein 305-like [Nicotiana sylvestris]
Length=192

 Score =   105 bits (263),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 57/105 (54%), Positives = 71/105 (68%), Gaps = 10/105 (10%)
 Frame = +2

Query  2    PGRTDNEIKNYWRTRIQKHMKPQAAGGENAATRQSSSSCCGGEQASTSQASAPDTVETYS  181
            PGRTDNEIKNYWRTRIQKH+K      EN   + ++S     ++ S+S  S+    E YS
Sbjct  98   PGRTDNEIKNYWRTRIQKHIKQ----AENMNGQVANSEQNDHQEGSSSHMSSAGPAEAYS  153

Query  182  PTSYASnnnnnnMDATFQQGPFATESNDNMWSMEDLWSMHLLNAD  316
            PTSY++N     +D T Q GPF TE+NDN+WSMED+WSM LLN D
Sbjct  154  PTSYSAN-----IDTTLQ-GPFLTETNDNIWSMEDIWSMQLLNGD  192



>gb|ACB12237.1| MYB-like protein NON1 [Petunia x hybrida]
 gb|ACB59077.1| Myb-like transcription factor EOBII [Petunia x hybrida]
 gb|AEC11893.1| MYB transcription factor EOBII [Petunia axillaris]
 gb|AEC11894.1| MYB transcription factor EOBII [Petunia exserta]
Length=197

 Score =   101 bits (252),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 62/111 (56%), Positives = 77/111 (69%), Gaps = 17/111 (15%)
 Frame = +2

Query  2    PGRTDNEIKNYWRTRIQKHMK-PQAAGGENAATRQSSSSCCGGEQASTSQAS-AP--DTV  169
            PGRTDNEIKNYWRTRIQKH+K  +   G+ A++ Q+       ++A TSQ S  P  +T+
Sbjct  98   PGRTDNEIKNYWRTRIQKHIKQAETMNGQAASSEQNDH-----QEACTSQMSNGPNDNTI  152

Query  170  -ETYSPTSYASnnnnnnMDATFQQGP-FATESNDNMWSMEDLWSMHLLNAD  316
             +TYSPTSY+ N +      TFQ GP F TE+NDNMWSMED+WSM LLN D
Sbjct  153  DQTYSPTSYSGNVD------TFQAGPNFLTEANDNMWSMEDIWSMQLLNGD  197



>gb|AGN52197.1| MYB-related transcription factor [Salvia miltiorrhiza]
Length=193

 Score =   100 bits (248),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 62/109 (57%), Positives = 72/109 (66%), Gaps = 17/109 (16%)
 Frame = +2

Query  2    PGRTDNEIKNYWRTRIQKHMKPQAAGGENAATRQSSSSCCGGEQASTSQAS----APDTV  169
            PGRTDNEIKNYWRTRIQKH+K QA   EN   + + +S    +QASTSQ S    A  TV
Sbjct  98   PGRTDNEIKNYWRTRIQKHIK-QA---ENCTGQTAENS---NDQASTSQVSSSCPADHTV  150

Query  170  ETYSPTSYASnnnnnnMDATFQQGPFATESNDNMWSMEDLWSMHLLNAD  316
            E+YSP S+  NN           GPF TESN+N+WSMEDLWS+ LLN D
Sbjct  151  ESYSPPSFTGNNMEPF------HGPFPTESNENLWSMEDLWSLQLLNGD  193



>gb|AGN52087.1| MYB-related transcription factor [Salvia miltiorrhiza]
Length=193

 Score = 99.8 bits (247),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 62/109 (57%), Positives = 72/109 (66%), Gaps = 17/109 (16%)
 Frame = +2

Query  2    PGRTDNEIKNYWRTRIQKHMKPQAAGGENAATRQSSSSCCGGEQASTSQAS----APDTV  169
            PGRTDNEIKNYWRTRIQKH+K QA   EN   + + +S    +QASTSQ S    A  TV
Sbjct  98   PGRTDNEIKNYWRTRIQKHIK-QA---ENCTGQTAENS---DDQASTSQVSSSCPADHTV  150

Query  170  ETYSPTSYASnnnnnnMDATFQQGPFATESNDNMWSMEDLWSMHLLNAD  316
            E+YSP S+  NN           GPF TESN+N+WSMEDLWS+ LLN D
Sbjct  151  ESYSPPSFTGNNMEPF------HGPFPTESNENLWSMEDLWSLQLLNGD  193



>gb|AGC00814.1| EOBI [Petunia x hybrida]
Length=202

 Score = 99.8 bits (247),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 57/105 (54%), Positives = 71/105 (68%), Gaps = 6/105 (6%)
 Frame = +2

Query  2    PGRTDNEIKNYWRTRIQKHMKPQAAGGENAATRQSSSSCCGGEQASTSQASA--PDTVET  175
            PGRTDNEIKNYWRTRIQKH+  QA   +    +QS       +  STSQ S    DT+++
Sbjct  98   PGRTDNEIKNYWRTRIQKHINKQA---DQNMKKQSKCEHNDQQAISTSQVSTGPTDTIDS  154

Query  176  YSPTSYASnnnnnnMDATFQQGPFATESNDNMWSMEDLWSMHLLN  310
            YSP+SY  N NNN  + TF  G F TE+N+N+WS+EDLWS+ LLN
Sbjct  155  YSPSSYTGNTNNNMENITF-HGNFPTETNENIWSIEDLWSLQLLN  198



>gb|AGC00813.1| EOBI [Petunia x hybrida]
Length=201

 Score = 99.4 bits (246),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 60/107 (56%), Positives = 73/107 (68%), Gaps = 11/107 (10%)
 Frame = +2

Query  2    PGRTDNEIKNYWRTRIQKHMKPQAAGGENAATRQSSSSCCGGEQ--ASTSQASA--PDTV  169
            PGRTDNEIKNYWRTRIQKH+K      +     +  S C   +Q   STSQAS    DT+
Sbjct  98   PGRTDNEIKNYWRTRIQKHIK------QADQNMKKPSKCEQNDQKAISTSQASTGPTDTI  151

Query  170  ETYSPTSYASnnnnnnMDATFQQGPFATESNDNMWSMEDLWSMHLLN  310
            ++YSP+SY  N NNN  + TF QG F TE+N+N+WSMEDLWS+ LLN
Sbjct  152  DSYSPSSYTENTNNNMENITF-QGNFPTETNENIWSMEDLWSLQLLN  197



>ref|XP_009613846.1| PREDICTED: myb-related protein 305-like [Nicotiana tomentosiformis]
Length=199

 Score = 98.2 bits (243),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 62/104 (60%), Positives = 70/104 (67%), Gaps = 7/104 (7%)
 Frame = +2

Query  2    PGRTDNEIKNYWRTRIQKHMKPQAAGGENAATRQSSSSCCGGEQASTSQAS-APDTVETY  178
            PGRTDNEIKNYWRTRIQKH+K QA    N     S+S     +QASTSQAS   +T+ETY
Sbjct  98   PGRTDNEIKNYWRTRIQKHIK-QADQSMNIRP-SSNSEHNHHQQASTSQASTGNNTIETY  155

Query  179  SPTSYASnnnnnnMDATFQQGPFATESNDNMWSMEDLWSMHLLN  310
            SP SY      NNM  T  Q  F  E+N+N+WSMEDLWSM LLN
Sbjct  156  SPPSYNG----NNMGTTNFQANFPAETNENIWSMEDLWSMQLLN  195



>ref|XP_011098762.1| PREDICTED: myb-related protein 305 [Sesamum indicum]
Length=189

 Score = 97.1 bits (240),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 63/113 (56%), Positives = 70/113 (62%), Gaps = 20/113 (18%)
 Frame = +2

Query  2    PGRTDNEIKNYWRTRIQKHMKP------QAAGGENAATRQSSSSCCGGEQASTSQAS---  154
            PGRTDNEIKNYWRTRIQKH+K       Q A   +  T   +      +QASTSQ S   
Sbjct  87   PGRTDNEIKNYWRTRIQKHIKQAENFTGQPADHHHHHTNDQAKP---NDQASTSQLSSCG  143

Query  155  -APDTVETYSPTSYASnnnnnnMDATFQQGPFATESNDNMWSMEDLWSMHLLN  310
             A   VE+YSP S+     N NM+A   QGPF TESNDN WSMEDLWSM LLN
Sbjct  144  PADHAVESYSPPSF-----NPNMEAF--QGPFPTESNDNFWSMEDLWSMQLLN  189



>ref|XP_011097428.1| PREDICTED: myb-related protein 305 [Sesamum indicum]
Length=199

 Score = 97.1 bits (240),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 60/117 (51%), Positives = 71/117 (61%), Gaps = 27/117 (23%)
 Frame = +2

Query  2    PGRTDNEIKNYWRTRIQKHMK--------PQAA----GGENAATRQSSSSCCGGEQASTS  145
            PGRTDNEIKNYWRTRIQKH+K        P AA       +     S+SSCC  + A   
Sbjct  98   PGRTDNEIKNYWRTRIQKHIKQADHQSSFPAAAQNSEHSNDCTNHASTSSCCPTDHA---  154

Query  146  QASAPDTVETYSPTSYASnnnnnnMDATFQQGPFATESNDNMWSMEDLWSMHLLNAD  316
                   VE+YSPT+    + N NM+ TF Q PF TES+DN+WSMEDLWS+ LLN D
Sbjct  155  -------VESYSPTT----SFNGNMETTF-QSPFPTESHDNIWSMEDLWSLQLLNGD  199



>ref|XP_008348196.1| PREDICTED: myb-related protein 305-like [Malus domestica]
Length=125

 Score = 93.2 bits (230),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 58/105 (55%), Positives = 68/105 (65%), Gaps = 9/105 (9%)
 Frame = +2

Query  2    PGRTDNEIKNYWRTRIQKHMKPQAAGGENAATRQSSSSCCGGEQASTSQASAPDTVETYS  181
            PGRTDNEIKNYWRTRIQKH+K      EN    QSS      +QASTSQ S  +TV+T  
Sbjct  30   PGRTDNEIKNYWRTRIQKHIK----QAENITPGQSSEV---NDQASTSQVSISNTVDTMD  82

Query  182  PTSYASnnnnnnMDATFQQGPFATESNDNMWSMEDLWSMHLLNAD  316
              S+++  +  NMDA     P A +SNDN WSMEDLWSM LLN +
Sbjct  83   -ISHSAPTHQANMDAYPPPLP-ADQSNDNYWSMEDLWSMQLLNGE  125



>dbj|BAF96932.1| R2R3-MYB transcriptional factor [Gentiana triflora]
Length=200

 Score = 93.2 bits (230),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 52/103 (50%), Positives = 64/103 (62%), Gaps = 4/103 (4%)
 Frame = +2

Query  2    PGRTDNEIKNYWRTRIQKHMKPQAAGGENAATRQSSSSCCGGEQASTSQASAPDTVETYS  181
            PGRTDNEIKN+WRTRIQKHMK        +++ Q+        Q S + A     +ET S
Sbjct  102  PGRTDNEIKNFWRTRIQKHMKQAENYAGQSSSEQNERVASTSMQTSAATAPHELMMETQS  161

Query  182  PTSYASnnnnnnMDATFQQGPFATESNDNMWSMEDLWSMHLLN  310
            P    SN   +++   F Q PF TESNDN+WSMEDLWS+HLLN
Sbjct  162  P---PSNYTMDHLPEAF-QNPFPTESNDNLWSMEDLWSLHLLN  200



>emb|CAN77103.1| hypothetical protein VITISV_018445 [Vitis vinifera]
 emb|CBI34905.3| unnamed protein product [Vitis vinifera]
Length=189

 Score = 92.4 bits (228),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 54/106 (51%), Positives = 65/106 (61%), Gaps = 15/106 (14%)
 Frame = +2

Query  2    PGRTDNEIKNYWRTRIQKHMKPQAAGGENAATRQSSSSCCGGEQASTSQA-SAPDTVETY  178
            PGRTDNEIKN+WRTRIQKH+K       NA T  + SS    +QA+TSQ   A    ++Y
Sbjct  98   PGRTDNEIKNFWRTRIQKHIK-------NAETFTAQSSDQTHDQATTSQVMGAAHVADSY  150

Query  179  SPTSYASnnnnnnMDATFQQGPFATESNDNMWSMEDLWSMHLLNAD  316
            SP SY +N            GP + ESNDN W+MED+WSM LLN D
Sbjct  151  SPPSYPANLEAFP-------GPSSAESNDNFWTMEDIWSMQLLNGD  189



>ref|NP_001268062.1| R2R3 Myb24 transcription factor [Vitis vinifera]
 gb|ABW34394.1| R2R3 Myb24 transcription factor [Vitis vinifera]
Length=189

 Score = 92.4 bits (228),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 54/106 (51%), Positives = 65/106 (61%), Gaps = 15/106 (14%)
 Frame = +2

Query  2    PGRTDNEIKNYWRTRIQKHMKPQAAGGENAATRQSSSSCCGGEQASTSQA-SAPDTVETY  178
            PGRTDNEIKN+WRTRIQKH+K       NA T  + SS    +QA+TSQ   A    ++Y
Sbjct  98   PGRTDNEIKNFWRTRIQKHIK-------NAETFTAQSSDQTHDQATTSQVMGAAHVADSY  150

Query  179  SPTSYASnnnnnnMDATFQQGPFATESNDNMWSMEDLWSMHLLNAD  316
            SP SY +N            GP + ESNDN W+MED+WSM LLN D
Sbjct  151  SPPSYPANLEAFP-------GPSSAESNDNFWTMEDIWSMQLLNGD  189



>emb|CAD87008.1| MYB8 protein [Gerbera hybrid cultivar]
Length=190

 Score = 91.7 bits (226),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 53/107 (50%), Positives = 64/107 (60%), Gaps = 17/107 (16%)
 Frame = +2

Query  2    PGRTDNEIKNYWRTRIQKHMKPQAAGGENAATRQSSSSCCGGEQASTSQASAPDTVETYS  181
            PGRTDNEIKNYWRTRIQKH+K      EN + + SS        +ST   +  + +ETYS
Sbjct  99   PGRTDNEIKNYWRTRIQKHIKQV----ENFSGQTSSGQNDQATMSSTQTCNVVNPMETYS  154

Query  182  PTSYASnnnnnnMDATFQQ--GPFATESNDNMWSMEDLWSMHLLNAD  316
            P               FQ   GPF TE+N+NMWSMEDLWSM LLN++
Sbjct  155  PPY-----------DNFQNFSGPFPTETNENMWSMEDLWSMQLLNSE  190



>ref|XP_009334094.1| PREDICTED: myb-related protein 305-like [Pyrus x bretschneideri]
Length=195

 Score = 90.5 bits (223),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 57/105 (54%), Positives = 67/105 (64%), Gaps = 9/105 (9%)
 Frame = +2

Query  2    PGRTDNEIKNYWRTRIQKHMKPQAAGGENAATRQSSSSCCGGEQASTSQASAPDTVETYS  181
            PGRTDNEIKNYWRTRIQKH+K      EN    QSS      +QASTSQ S   T++T  
Sbjct  100  PGRTDNEIKNYWRTRIQKHIK----QAENITPGQSSEV---NDQASTSQVSISKTLDTMD  152

Query  182  PTSYASnnnnnnMDATFQQGPFATESNDNMWSMEDLWSMHLLNAD  316
              S+++  +  NMDA     P A +SNDN WSMEDLWSM LLN +
Sbjct  153  -ISHSAPTHQANMDAYPPPLP-ADQSNDNYWSMEDLWSMQLLNGE  195



>ref|XP_009375123.1| PREDICTED: myb-related protein 305-like [Pyrus x bretschneideri]
 ref|XP_009377203.1| PREDICTED: myb-related protein 305-like [Pyrus x bretschneideri]
Length=195

 Score = 89.0 bits (219),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 55/105 (52%), Positives = 67/105 (64%), Gaps = 9/105 (9%)
 Frame = +2

Query  2    PGRTDNEIKNYWRTRIQKHMKPQAAGGENAATRQSSSSCCGGEQASTSQASAPDTVETYS  181
            PGRTDNEIKNYWRTRIQKH+KP     EN    QSS      +QA TSQ S  +TV+T  
Sbjct  100  PGRTDNEIKNYWRTRIQKHIKP----AENITPGQSSEV---NDQAITSQVSISNTVDTMD  152

Query  182  PTSYASnnnnnnMDATFQQGPFATESNDNMWSMEDLWSMHLLNAD  316
              S+++     NMDA     P A +SN++ WSMEDLWS+ LLN +
Sbjct  153  -ISHSAPTYQANMDAYPPPLP-ADQSNESYWSMEDLWSLQLLNGE  195



>gb|EYU44761.1| hypothetical protein MIMGU_mgv1a013642mg [Erythranthe guttata]
Length=214

 Score = 89.0 bits (219),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 54/103 (52%), Positives = 66/103 (64%), Gaps = 17/103 (17%)
 Frame = +2

Query  2    PGRTDNEIKNYWRTRIQKHMKPQAAGGENAATRQSSSSCCGGEQASTSQASA-----PDT  166
            PGRTDNEIKNYWRTRIQKH+K      +N +T Q +      +QASTSQ S+       T
Sbjct  98   PGRTDNEIKNYWRTRIQKHIK---QADQNCSTGQLAD--VSNDQASTSQLSSCCPADNHT  152

Query  167  VETYSPTSYASnnnnnnMDATFQQGPFATESNDNMWSMEDLWS  295
            VE+YSP+S+ +N           Q PF TESN+N+WSMEDLWS
Sbjct  153  VESYSPSSFNANIEPF-------QPPFPTESNENLWSMEDLWS  188



>sp|P81391.1|MYB05_ANTMA RecName: Full=Myb-related protein 305 [Antirrhinum majus]
Length=205

 Score = 89.0 bits (219),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 60/117 (51%), Positives = 68/117 (58%), Gaps = 21/117 (18%)
 Frame = +2

Query  2    PGRTDNEIKNYWRTRIQKHMK---PQAAGGENAATRQSSSSCCGGEQASTSQASAPDTV-  169
            PGRTDNEIKNYWRTRIQKHM+     ++   N        SC   +QAS+SQ SA   V 
Sbjct  98   PGRTDNEIKNYWRTRIQKHMEQGDQSSSTTFNNGQMNLDHSC--NDQASSSQMSACGPVV  155

Query  170  -------ETYSPTSYASnnnnnnMDATFQQGPFAT-ESNDNMWSMEDLWSMHLLNAD  316
                    +YSP S+  N      D TF Q PF T +SNDNMWSMED WSM LLN D
Sbjct  156  DHTAVDQSSYSPHSFNGN------DHTF-QAPFPTDQSNDNMWSMEDFWSMQLLNGD  205



>ref|XP_002298534.1| Myb26 family protein [Populus trichocarpa]
 gb|EEE83339.1| Myb26 family protein [Populus trichocarpa]
Length=190

 Score = 87.8 bits (216),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 53/108 (49%), Positives = 61/108 (56%), Gaps = 18/108 (17%)
 Frame = +2

Query  2    PGRTDNEIKNYWRTRIQKHMK---PQAAGGENAATRQSSSSCCGGEQASTSQASAPDTVE  172
            PGRTDNEIKNYWRTRI+KH K   P AAG  ++ T +  SS C         +SA D +E
Sbjct  98   PGRTDNEIKNYWRTRIKKHTKQTEPFAAG--SSETNEHGSSTC-------QVSSATDQME  148

Query  173  TYSPTSYASnnnnnnMDATFQQGPFATESNDNMWSMEDLWSMHLLNAD  316
            TY P  Y  +         F  G    E N+N WSMEDLWSM LLN D
Sbjct  149  TYCPPFYQGDV------GAFSGGNIPQELNENYWSMEDLWSMQLLNGD  190



>ref|XP_002521453.1| r2r3-myb transcription factor, putative [Ricinus communis]
 gb|EEF40943.1| r2r3-myb transcription factor, putative [Ricinus communis]
Length=162

 Score = 86.7 bits (213),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 58/106 (55%), Positives = 61/106 (58%), Gaps = 13/106 (12%)
 Frame = +2

Query  2    PGRTDNEIKNYWRTRIQKHMKPQAAGGENAATRQSSSSCCGGEQASTS-QASAPDTVETY  178
            PGRTDNEIKNYWRTRIQKH+K        A     SSS    EQ STS Q SA   +ETY
Sbjct  69   PGRTDNEIKNYWRTRIQKHIK-------QAEACTGSSSSEMNEQGSTSNQISA--MMETY  119

Query  179  SPTSYASnnnnnnMDATFQQGPFATESNDNMWSMEDLWSMHLLNAD  316
            SP SY  N  +    A     P   E NDN WSMED WSM LLN D
Sbjct  120  SPQSYQGNVQDAFPGANCNLPP---EPNDNYWSMEDFWSMQLLNGD  162



>ref|XP_008341440.1| PREDICTED: myb-related protein 305-like [Malus domestica]
Length=195

 Score = 87.0 bits (214),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 55/105 (52%), Positives = 67/105 (64%), Gaps = 9/105 (9%)
 Frame = +2

Query  2    PGRTDNEIKNYWRTRIQKHMKPQAAGGENAATRQSSSSCCGGEQASTSQASAPDTVETYS  181
            PGRTDNEIKNYWRTRIQKH+K      EN    QSS      +QASTSQ S  +TV+T  
Sbjct  100  PGRTDNEIKNYWRTRIQKHIK----QAENITPGQSSEV---NDQASTSQVSISNTVDTMD  152

Query  182  PTSYASnnnnnnMDATFQQGPFATESNDNMWSMEDLWSMHLLNAD  316
              S+++     NMDA     P A +SN++ WSMEDLWS+ LLN +
Sbjct  153  -ISHSAPTYQANMDAYPPPLP-ADQSNESYWSMEDLWSLQLLNGE  195



>ref|XP_004141095.1| PREDICTED: myb-related protein 305-like [Cucumis sativus]
 ref|XP_004168850.1| PREDICTED: myb-related protein 305-like [Cucumis sativus]
Length=217

 Score = 85.9 bits (211),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 59/124 (48%), Positives = 70/124 (56%), Gaps = 28/124 (23%)
 Frame = +2

Query  2    PGRTDNEIKNYWRTRIQKHMKPQAAGGENAATRQSSSSCC---------------GGEQA  136
            PGRTDNEIKNYWRTRIQKH+K QA G     T QSS++                   EQA
Sbjct  103  PGRTDNEIKNYWRTRIQKHIK-QAHGFH---TPQSSTNILLSSQDHHHHHHHQIMNNEQA  158

Query  137  STSQASAP----DTVETYSPTSYASnnnnnnMDATFQQGPFATESNDNMWSMEDLWSMHL  304
            ++S +       D +ETYSP +Y+      N+DA     P    SNDN WSMEDLWSM L
Sbjct  159  ASSSSCQVSYTMDPMETYSPPTYSQ-----NIDAFSVPLPPTDNSNDNYWSMEDLWSMQL  213

Query  305  LNAD  316
            LNA+
Sbjct  214  LNAE  217



>gb|ACR15115.1| MYBF1 [Populus x canadensis]
Length=190

 Score = 85.1 bits (209),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 52/108 (48%), Positives = 60/108 (56%), Gaps = 18/108 (17%)
 Frame = +2

Query  2    PGRTDNEIKNYWRTRIQKHMK---PQAAGGENAATRQSSSSCCGGEQASTSQASAPDTVE  172
            PGRTDNEIKNYWRTRI+KH K   P AAG  ++ T +  SS C         +SA D +E
Sbjct  98   PGRTDNEIKNYWRTRIKKHTKQSEPFAAG--SSETNEHGSSTC-------QVSSATDQME  148

Query  173  TYSPTSYASnnnnnnMDATFQQGPFATESNDNMWSMEDLWSMHLLNAD  316
            TY P  Y  +         F  G    E N+N WSMEDLWSM L N D
Sbjct  149  TYCPPFYQGDV------GAFSGGNIPQELNENYWSMEDLWSMQLRNGD  190



>ref|XP_011005145.1| PREDICTED: myb-related protein 305 isoform X2 [Populus euphratica]
Length=190

 Score = 84.7 bits (208),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 51/108 (47%), Positives = 60/108 (56%), Gaps = 18/108 (17%)
 Frame = +2

Query  2    PGRTDNEIKNYWRTRIQKHMK---PQAAGGENAATRQSSSSCCGGEQASTSQASAPDTVE  172
            PGRTDNEIKNYWRTRI+KH K   P AAG  ++ T +  SS C         +SA D +E
Sbjct  98   PGRTDNEIKNYWRTRIKKHTKQTEPFAAG--SSETNEDGSSTC-------QVSSATDQME  148

Query  173  TYSPTSYASnnnnnnMDATFQQGPFATESNDNMWSMEDLWSMHLLNAD  316
             Y P  Y  +         F  G    E N+N WSM+DLWSM LLN D
Sbjct  149  AYCPPLYQGDV------GAFSGGNIPQELNENYWSMDDLWSMQLLNGD  190



>ref|XP_011005144.1| PREDICTED: myb-related protein 305 isoform X1 [Populus euphratica]
Length=201

 Score = 84.7 bits (208),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 51/108 (47%), Positives = 60/108 (56%), Gaps = 18/108 (17%)
 Frame = +2

Query  2    PGRTDNEIKNYWRTRIQKHMK---PQAAGGENAATRQSSSSCCGGEQASTSQASAPDTVE  172
            PGRTDNEIKNYWRTRI+KH K   P AAG  ++ T +  SS C         +SA D +E
Sbjct  109  PGRTDNEIKNYWRTRIKKHTKQTEPFAAG--SSETNEDGSSTC-------QVSSATDQME  159

Query  173  TYSPTSYASnnnnnnMDATFQQGPFATESNDNMWSMEDLWSMHLLNAD  316
             Y P  Y  +         F  G    E N+N WSM+DLWSM LLN D
Sbjct  160  AYCPPLYQGDV------GAFSGGNIPQELNENYWSMDDLWSMQLLNGD  201



>ref|XP_008443525.1| PREDICTED: myb-related protein 305 [Cucumis melo]
Length=218

 Score = 84.0 bits (206),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 59/125 (47%), Positives = 71/125 (57%), Gaps = 29/125 (23%)
 Frame = +2

Query  2    PGRTDNEIKNYWRTRIQKHMKPQAAGGENAATRQSSSSCC---------------GGEQA  136
            PGRTDNEIKNYWRTRIQKH+K QA G     T QSS++                   EQA
Sbjct  103  PGRTDNEIKNYWRTRIQKHIK-QAHGFH---TPQSSTNILLSSQDHHHHHHQIMNNNEQA  158

Query  137  STSQASAP----DTVETYSPTSYASnnnnnnMDA-TFQQGPFATESNDNMWSMEDLWSMH  301
            ++S +       D +ETYSP +Y+      N+DA +    P    SNDN WSMEDLWSM 
Sbjct  159  ASSSSCQVSYTMDPMETYSPPTYSQ-----NIDAFSVPLPPTDNNSNDNYWSMEDLWSMQ  213

Query  302  LLNAD  316
            LLNA+
Sbjct  214  LLNAE  218



>dbj|BAF96931.1| R2R3-MYB transcriptional factor [Gentiana triflora]
Length=214

 Score = 83.6 bits (205),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 53/107 (50%), Positives = 65/107 (61%), Gaps = 11/107 (10%)
 Frame = +2

Query  2    PGRTDNEIKNYWRTRIQKHMKP---QAAGGENAATRQSSSSCCGGEQASTSQASAPDTVE  172
            PGRTDNEIKN+WRTRIQK MK     + G  +  T   S+S      A+ +  +A D VE
Sbjct  115  PGRTDNEIKNFWRTRIQKQMKHVENSSVGQSSEQTEAPSTSHEASTAAAATATTAHDAVE  174

Query  173  TYSPTSYASnnnnnnMDATFQQGPF-ATESNDNMWSMEDLWSMHLLN  310
             YSP SY +N  +        Q PF   +SNDN+WSMEDLWSM+LLN
Sbjct  175  AYSPQSYTANMESF-------QNPFPPDQSNDNVWSMEDLWSMNLLN  214



>gb|EPS65034.1| hypothetical protein M569_09745, partial [Genlisea aurea]
Length=207

 Score = 83.6 bits (205),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 48/103 (47%), Positives = 61/103 (59%), Gaps = 15/103 (15%)
 Frame = +2

Query  2    PGRTDNEIKNYWRTRIQKHMKPQAAGGENAATRQSSSSCCGGEQASTSQASAPDTVETYS  181
            PGRTDNEIKNYWRTRIQKHMK       N  T   S +C     +S   +S P  +E+YS
Sbjct  98   PGRTDNEIKNYWRTRIQKHMKQTE---NNNGTELISDNCNDRASSSNLSSSGP-ALESYS  153

Query  182  PTSYASnnnnnnMDATFQQGPFATESNDNMWSMEDLWSMHLLN  310
            PTS+         +      PF  +SN+++W+M+D WSMHLLN
Sbjct  154  PTSF---------NTAIDAAPF--DSNEHLWNMDDFWSMHLLN  185



>ref|XP_009783970.1| PREDICTED: myb-related protein 340-like [Nicotiana sylvestris]
Length=186

 Score = 82.0 bits (201),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 53/94 (56%), Positives = 62/94 (66%), Gaps = 7/94 (7%)
 Frame = +2

Query  2    PGRTDNEIKNYWRTRIQKHMKPQAAGGENAATRQSSSSCCGGEQASTSQASAP-DTVETY  178
            PGRTDNEIKNYWRTRIQKH+K QA  G N     S+S     +QASTSQ S   +T+ETY
Sbjct  99   PGRTDNEIKNYWRTRIQKHIK-QADEGMNIRP-SSNSENNHHQQASTSQVSTENNTIETY  156

Query  179  SPTSYASnnnnnnMDATFQQGPFATESNDNMWSM  280
            SP+SY      NNM  T  Q  F  E+N+N+WSM
Sbjct  157  SPSSYNG----NNMGTTNFQANFPAETNENIWSM  186



>gb|KHN27530.1| Myb-related protein 305 [Glycine soja]
Length=187

 Score = 81.3 bits (199),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 54/119 (45%), Positives = 62/119 (52%), Gaps = 24/119 (20%)
 Frame = +2

Query  2    PGRTDNEIKNYWRTRIQKHMKPQAAGGENAATRQSSSSCCGGEQASTSQASA-PDTVETY  178
            PGRTDNEIKNYWRTRIQKH+K      EN   + S++S     QASTS  S   + +ETY
Sbjct  79   PGRTDNEIKNYWRTRIQKHIK----QAENFQQQISNNSEINDHQASTSHVSTMAEPMETY  134

Query  179  SPTSYASnnnnnnMDATFQQGPFATESND-------------NMWSMEDLWSMHLLNAD  316
            SP  Y        M   F    F T + D             N WSMED+WSM LLN D
Sbjct  135  SPPFYQG------MLEPFSSIQFPTINPDQSSCCTNDNNNSINYWSMEDIWSMQLLNGD  187



>ref|XP_006338574.1| PREDICTED: myb-related protein 340-like [Solanum tuberosum]
Length=207

 Score = 81.6 bits (200),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 60/112 (54%), Positives = 72/112 (64%), Gaps = 15/112 (13%)
 Frame = +2

Query  2    PGRTDNEIKNYWRTRIQKHMKPQAAGGENAATRQSSSSCCGGEQASTSQASA--PDTVET  175
            PGRTDNEIKN+WRTRIQKH+K QA      ++  S  +    +QASTSQ S    D++ET
Sbjct  98   PGRTDNEIKNFWRTRIQKHIK-QAENMNRISSNISEHNNI--QQASTSQTSTSLADSIET  154

Query  176  YS------PTSYASnnnnnnMDATF-QQGPFATESNDNMWSMEDLWSMHLLN  310
            YS        +  +NNNNNNM  TF  QG F    N+N+WSMEDLWSM LLN
Sbjct  155  YSGNNNNNNNNNNNNNNNNNMGTTFHHQGNFP---NENIWSMEDLWSMQLLN  203



>ref|NP_001235850.1| MYB transcription factor MYB181 [Glycine max]
 gb|ABH02847.1| MYB transcription factor MYB181 [Glycine max]
 gb|ACU14259.1| unknown [Glycine max]
Length=208

 Score = 81.3 bits (199),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 54/119 (45%), Positives = 62/119 (52%), Gaps = 24/119 (20%)
 Frame = +2

Query  2    PGRTDNEIKNYWRTRIQKHMKPQAAGGENAATRQSSSSCCGGEQASTSQASA-PDTVETY  178
            PGRTDNEIKNYWRTRIQKH+K      EN   + S++S     QASTS  S   + +ETY
Sbjct  100  PGRTDNEIKNYWRTRIQKHIK----QAENFQQQISNNSEINDHQASTSHVSTMAEPMETY  155

Query  179  SPTSYASnnnnnnMDATFQQGPFATESND-------------NMWSMEDLWSMHLLNAD  316
            SP  Y        M   F    F T + D             N WSMED+WSM LLN D
Sbjct  156  SPPFYQG------MLEPFSSIQFPTINPDQSSCCTNDNNNSINYWSMEDIWSMQLLNGD  208



>ref|XP_010033288.1| PREDICTED: myb-related protein 305 [Eucalyptus grandis]
 gb|KCW52898.1| hypothetical protein EUGRSUZ_J02217 [Eucalyptus grandis]
Length=195

 Score = 80.9 bits (198),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 53/107 (50%), Positives = 64/107 (60%), Gaps = 15/107 (14%)
 Frame = +2

Query  2    PGRTDNEIKNYWRTRIQKHMKPQAAGGENAATRQSSSSCCGGEQASTSQ-ASAPDTVETY  178
            PGRTDNEIKN+WRTRIQKH+K   A         S  S    +QASTS  +S P+ +ETY
Sbjct  102  PGRTDNEIKNFWRTRIQKHIKQAEAF--------SGQSSEMSDQASTSHMSSMPEPMETY  153

Query  179  -SPTSYASnnnnnnMDATFQQGPFATESNDNMWSMEDLWSMHLLNAD  316
             SP S+  NNN   +         + ESN+  WSM+DLWSM LLN D
Sbjct  154  DSPPSFQGNNNMEPLPVN-----LSVESNEAYWSMDDLWSMQLLNGD  195



>ref|XP_004232307.1| PREDICTED: myb-related protein 340 [Solanum lycopersicum]
Length=203

 Score = 80.9 bits (198),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 60/108 (56%), Positives = 72/108 (67%), Gaps = 11/108 (10%)
 Frame = +2

Query  2    PGRTDNEIKNYWRTRIQKHMKPQAAGGENAATRQSSSSCCGGEQASTSQASA--PDTVET  175
            PGRTDNEIKN WRTRIQKH+K QA      ++  S ++    +QASTSQ S    D++ET
Sbjct  98   PGRTDNEIKNLWRTRIQKHIK-QAENINRLSSNISENNNI--QQASTSQTSTSLADSMET  154

Query  176  YS--PTSYASnnnnnnMDATF-QQGPFATESNDNMWSMEDLWSMHLLN  310
            YS    +  +NNNNNNM  TF  QG F    N+N+WSMEDLWSM LLN
Sbjct  155  YSGNNNNNNNNNNNNNMGTTFHHQGNFP---NENIWSMEDLWSMQLLN  199



>ref|XP_007031495.1| Myb domain protein 21 [Theobroma cacao]
 gb|EOY02421.1| Myb domain protein 21 [Theobroma cacao]
Length=194

 Score = 80.5 bits (197),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 56/108 (52%), Positives = 67/108 (62%), Gaps = 14/108 (13%)
 Frame = +2

Query  2    PGRTDNEIKNYWRTRIQKHMKPQAAGGENAATRQSSSSCCGGEQASTSQASA-PDTVETY  178
            PGRTDNEIKNYWRTRIQKH+K QA       + Q  S     +QASTSQ     D +ETY
Sbjct  98   PGRTDNEIKNYWRTRIQKHIK-QA----EVCSSQIHSEL--HKQASTSQVPCNTDMMETY  150

Query  179  SPTSYASnnnnnnMDATFQQGP--FATESNDNMWSMEDLWSMHLLNAD  316
             P+S+    N+ NM+A   Q     A ESN++ WS+EDLWSM LL  D
Sbjct  151  PPSSF----NHCNMEAFPGQSAMSMAVESNESYWSIEDLWSMQLLTGD  194



>gb|AAC83614.1| putative transcription factor, partial [Arabidopsis thaliana]
Length=118

 Score = 78.6 bits (192),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 47/111 (42%), Positives = 61/111 (55%), Gaps = 16/111 (14%)
 Frame = +2

Query  2    PGRTDNEIKNYWRTRIQKHMKPQAAGGENAATRQSSSSCCGGEQAS--TSQASAPDTVET  175
            PGRTDNEIKN+WRT+IQ+HMK      EN    Q    C G  Q+S  T+Q S+   ++T
Sbjct  22   PGRTDNEIKNFWRTKIQRHMK---VSSENMMNHQ--HHCSGNSQSSGMTTQGSSGKAIDT  76

Query  176  YSPTSYASnnnnnnMDATFQQGPFATESNDNMWSMEDLWSMHLLNAD*TLI  328
                S A          TF       +SN+N W++EDLW +HLLN D  +I
Sbjct  77   AESFSQAKT-------TTF--NVVEQQSNENYWNVEDLWPVHLLNGDHHVI  118



>ref|XP_007140962.1| hypothetical protein PHAVU_008G155700g [Phaseolus vulgaris]
 gb|ESW12956.1| hypothetical protein PHAVU_008G155700g [Phaseolus vulgaris]
Length=200

 Score = 79.7 bits (195),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 52/109 (48%), Positives = 61/109 (56%), Gaps = 11/109 (10%)
 Frame = +2

Query  2    PGRTDNEIKNYWRTRIQKHMKPQAAGGENAATRQS-SSSCCGGEQASTSQASA-PDTVET  175
            PGRTDNEIKN+WRTRIQKH+K        A  +QS S+S     QASTSQ S   + +ET
Sbjct  99   PGRTDNEIKNFWRTRIQKHIK-------QADQQQSNSNSEINDHQASTSQVSTMAEPMET  151

Query  176  YSPTSYASnnn--nnnMDATFQQGPFATESNDNMWSMEDLWSMHLLNAD  316
            YS   Y       +  +     Q    T  N+N WSMED WSM LLN D
Sbjct  152  YSSPCYQGMLEPFSTQLPNIPDQSSCCTNDNNNYWSMEDFWSMQLLNGD  200



>ref|XP_010496298.1| PREDICTED: transcription factor MYB57-like [Camelina sativa]
Length=205

 Score = 79.0 bits (193),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 45/112 (40%), Positives = 61/112 (54%), Gaps = 18/112 (16%)
 Frame = +2

Query  2    PGRTDNEIKNYWRTRIQKHMKPQAAGGENAATRQSSSSCCGGEQASTSQAS---APDTVE  172
            PGRTDNEIKN+WRT+IQ+HMK + +  EN      S +       +T Q S   A D  E
Sbjct  109  PGRTDNEIKNFWRTKIQRHMKVKVS-SENMMNHHRSGNSQSSGMTTTDQGSSGKAIDMAE  167

Query  173  TYSPTSYASnnnnnnMDATFQQGPFATESNDNMWSMEDLWSMHLLNAD*TLI  328
            ++SP +            TF       +SN+N W++EDLW +HLLN D  +I
Sbjct  168  SFSPAT-----------TTFN---VVEQSNENYWNVEDLWPVHLLNGDHHVI  205



>ref|XP_008230585.1| PREDICTED: myb-related protein 305-like [Prunus mume]
Length=213

 Score = 78.6 bits (192),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 54/106 (51%), Positives = 62/106 (58%), Gaps = 8/106 (8%)
 Frame = +2

Query  2    PGRTDNEIKNYWRTRIQKHMKPQAAGGENAATRQSSSSCCGGEQASTSQASAPD-TVETY  178
            PGRTDNEIKNYWRTRIQKH+K      EN  T   +      +QASTSQ S     V+T 
Sbjct  115  PGRTDNEIKNYWRTRIQKHIK----QAENNITPGQNFEV--NDQASTSQVSISSAAVDTM  168

Query  179  SPTSYASnnnnnnMDATFQQGPFATESNDNMWSMEDLWSMHLLNAD  316
              T  A  N   NMDA     P A  S++N WS+EDLWSM LLN +
Sbjct  169  EITHAAPANYPPNMDAYPSSLP-ADHSHENYWSIEDLWSMQLLNGE  213



>ref|XP_007217766.1| hypothetical protein PRUPE_ppa011751mg [Prunus persica]
 gb|EMJ18965.1| hypothetical protein PRUPE_ppa011751mg [Prunus persica]
Length=198

 Score = 78.2 bits (191),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 54/106 (51%), Positives = 62/106 (58%), Gaps = 8/106 (8%)
 Frame = +2

Query  2    PGRTDNEIKNYWRTRIQKHMKPQAAGGENAATRQSSSSCCGGEQASTSQASAPD-TVETY  178
            PGRTDNEIKNYWRTRIQKH+K      EN  T    S     +QASTSQ S     V+T 
Sbjct  100  PGRTDNEIKNYWRTRIQKHIK----QAENNITPGQISEV--NDQASTSQVSISSAAVDTM  153

Query  179  SPTSYASnnnnnnMDATFQQGPFATESNDNMWSMEDLWSMHLLNAD  316
            + T  A  N   NMDA     P A  S++  WS+EDLWSM LLN +
Sbjct  154  AITHAAPANYPPNMDAYPSSLP-ADHSHEGYWSIEDLWSMQLLNGE  198



>ref|XP_007140964.1| hypothetical protein PHAVU_008G155900g [Phaseolus vulgaris]
 gb|ESW12958.1| hypothetical protein PHAVU_008G155900g [Phaseolus vulgaris]
Length=199

 Score = 77.8 bits (190),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 50/108 (46%), Positives = 59/108 (55%), Gaps = 13/108 (12%)
 Frame = +2

Query  2    PGRTDNEIKNYWRTRIQKHMKPQAAGGENAATRQSSSSCCGGEQASTSQAS-APDTVETY  178
            PGRTDNEIKN+WRTRIQKHMK      +  + +Q S+S     QA TSQ S   + +ETY
Sbjct  99   PGRTDNEIKNFWRTRIQKHMK------QTESFQQQSNSETNDHQACTSQVSTIAEPMETY  152

Query  179  SPTSYASnnnnnnMDATFQQGP----FATESNDNMWSMEDLWSMHLLN  310
            SP+ Y          A F   P      T  N N WSMED+ SM L N
Sbjct  153  SPSCYQG--MLEPFSAQFHTNPDHSSCCTNDNTNYWSMEDILSMQLAN  198



>ref|XP_010485409.1| PREDICTED: transcription factor MYB57-like [Camelina sativa]
Length=205

 Score = 77.8 bits (190),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 45/112 (40%), Positives = 62/112 (55%), Gaps = 18/112 (16%)
 Frame = +2

Query  2    PGRTDNEIKNYWRTRIQKHMKPQAAGGENAATRQSSSSCCGGEQASTSQAS---APDTVE  172
            PGRTDNEIKN+WRT+IQ+HMK + +  EN      S +       +T+Q S   A D  E
Sbjct  109  PGRTDNEIKNFWRTKIQRHMKVKVS-SENMMNHHCSGNSQSSGMTTTNQDSSGKAIDMAE  167

Query  173  TYSPTSYASnnnnnnMDATFQQGPFATESNDNMWSMEDLWSMHLLNAD*TLI  328
            ++SP +            TF       +SN+N W++EDLW +HLLN D  +I
Sbjct  168  SFSPAT-----------TTFN---VVEQSNENYWNVEDLWPVHLLNGDHHVI  205



>ref|NP_186802.1| myb domain protein 57 [Arabidopsis thaliana]
 sp|Q9SSA1.1|MYB57_ARATH RecName: Full=Transcription factor MYB57; AltName: Full=Myb-related 
protein 57; Short=AtMYB57 [Arabidopsis thaliana]
 gb|AAF01538.1|AC009325_8 putative transcription factor [Arabidopsis thaliana]
 dbj|BAC42719.1| putative transcription factor [Arabidopsis thaliana]
 gb|AAO63994.1| putative myb family transcription factor [Arabidopsis thaliana]
 gb|AAS10052.1| MYB transcription factor [Arabidopsis thaliana]
 gb|AEE73682.1| myb domain protein 57 [Arabidopsis thaliana]
Length=206

 Score = 77.8 bits (190),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 46/111 (41%), Positives = 62/111 (56%), Gaps = 16/111 (14%)
 Frame = +2

Query  2    PGRTDNEIKNYWRTRIQKHMKPQAAGGENAATRQSSSSCCGGEQAS--TSQASAPDTVET  175
            PGRTDNEIKN+WRT+IQ+HMK      EN    Q    C G  Q+S  T+Q S+   ++T
Sbjct  110  PGRTDNEIKNFWRTKIQRHMK---VSSENMMNHQ--HHCSGNSQSSGMTTQGSSGKAIDT  164

Query  176  YSPTSYASnnnnnnMDATFQQGPFATESNDNMWSMEDLWSMHLLNAD*TLI  328
                S A     N ++          +SN+N W++EDLW +HLLN D  +I
Sbjct  165  AESFSQAKTTTFNVVEQ---------QSNENYWNVEDLWPVHLLNGDHHVI  206



>ref|XP_011013295.1| PREDICTED: myb-related protein 305-like isoform X2 [Populus euphratica]
Length=186

 Score = 77.4 bits (189),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 47/105 (45%), Positives = 56/105 (53%), Gaps = 11/105 (10%)
 Frame = +2

Query  2    PGRTDNEIKNYWRTRIQKHMKPQAAGGENAATRQSSSSCCGGEQASTSQASAPDTVETYS  181
            PGRTDNEIKNYWRTRIQKH+K      E  A + SS +   G  +S   ++    V  Y 
Sbjct  93   PGRTDNEIKNYWRTRIQKHIKQ----AETFAAQVSSETNEHGSNSSQVSSTTELMVSNYL  148

Query  182  PTSYASnnnnnnMDATFQQGPFATESNDNMWSMEDLWSMHLLNAD  316
            P SY  +         F       E N+N WS+EDLWSM LLN D
Sbjct  149  P-SYQGDVE------AFSGANIPQELNENYWSIEDLWSMQLLNGD  186



>ref|XP_011013638.1| PREDICTED: myb-related protein 305-like isoform X2 [Populus euphratica]
Length=186

 Score = 77.4 bits (189),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 47/105 (45%), Positives = 56/105 (53%), Gaps = 11/105 (10%)
 Frame = +2

Query  2    PGRTDNEIKNYWRTRIQKHMKPQAAGGENAATRQSSSSCCGGEQASTSQASAPDTVETYS  181
            PGRTDNEIKNYWRTRIQKH+K      E  A + SS +   G  +S   ++    V  Y 
Sbjct  93   PGRTDNEIKNYWRTRIQKHIKQ----AETFAAQVSSETNEHGSNSSQVSSTTELMVSNYL  148

Query  182  PTSYASnnnnnnMDATFQQGPFATESNDNMWSMEDLWSMHLLNAD  316
            P SY  +         F       E N+N WS+EDLWSM LLN D
Sbjct  149  P-SYQGDVE------AFSGANIPQELNENYWSIEDLWSMQLLNGD  186



>ref|NP_001235879.1| MYB transcription factor MYB182 [Glycine max]
 gb|ABH02849.1| MYB transcription factor MYB182 [Glycine max]
 gb|KHN24347.1| Myb-related protein 305 [Glycine soja]
Length=206

 Score = 77.8 bits (190),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 52/122 (43%), Positives = 61/122 (50%), Gaps = 32/122 (26%)
 Frame = +2

Query  2    PGRTDNEIKNYWRTRIQKHMKPQAAGGENAATRQSSSSCCGGEQASTSQASA-PDTVETY  178
            PGRTDNEIKNYWRTRIQKH+K      EN   + S++S     QASTS  S   + +E Y
Sbjct  100  PGRTDNEIKNYWRTRIQKHIK----QAENFQQQSSNNSEINDHQASTSHVSTMAEPMEMY  155

Query  179  SPTSYASnnnnnnMDATFQQGPFATE----------------SNDNMWSMEDLWSMHLLN  310
            SP  Y                PF+T+                +N N WSMED WSM LLN
Sbjct  156  SPPCYQGMLE-----------PFSTQFPTINPDQSSCCTNDNNNINYWSMEDSWSMQLLN  204

Query  311  AD  316
             D
Sbjct  205  GD  206



>ref|XP_011013637.1| PREDICTED: myb-related protein 305-like isoform X1 [Populus euphratica]
Length=191

 Score = 77.4 bits (189),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 47/105 (45%), Positives = 56/105 (53%), Gaps = 11/105 (10%)
 Frame = +2

Query  2    PGRTDNEIKNYWRTRIQKHMKPQAAGGENAATRQSSSSCCGGEQASTSQASAPDTVETYS  181
            PGRTDNEIKNYWRTRIQKH+K      E  A + SS +   G  +S   ++    V  Y 
Sbjct  98   PGRTDNEIKNYWRTRIQKHIKQ----AETFAAQVSSETNEHGSNSSQVSSTTELMVSNYL  153

Query  182  PTSYASnnnnnnMDATFQQGPFATESNDNMWSMEDLWSMHLLNAD  316
            P SY  +         F       E N+N WS+EDLWSM LLN D
Sbjct  154  P-SYQGDVE------AFSGANIPQELNENYWSIEDLWSMQLLNGD  191



>ref|XP_011013294.1| PREDICTED: myb-related protein 305-like isoform X1 [Populus euphratica]
Length=191

 Score = 77.4 bits (189),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 47/105 (45%), Positives = 56/105 (53%), Gaps = 11/105 (10%)
 Frame = +2

Query  2    PGRTDNEIKNYWRTRIQKHMKPQAAGGENAATRQSSSSCCGGEQASTSQASAPDTVETYS  181
            PGRTDNEIKNYWRTRIQKH+K      E  A + SS +   G  +S   ++    V  Y 
Sbjct  98   PGRTDNEIKNYWRTRIQKHIKQ----AETFAAQVSSETNEHGSNSSQVSSTTELMVSNYL  153

Query  182  PTSYASnnnnnnMDATFQQGPFATESNDNMWSMEDLWSMHLLNAD  316
            P SY  +         F       E N+N WS+EDLWSM LLN D
Sbjct  154  P-SYQGDV------EAFSGANIPQELNENYWSIEDLWSMQLLNGD  191



>ref|XP_004304632.1| PREDICTED: myb-related protein 305-like [Fragaria vesca subsp. 
vesca]
Length=188

 Score = 76.6 bits (187),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 48/106 (45%), Positives = 60/106 (57%), Gaps = 18/106 (17%)
 Frame = +2

Query  2    PGRTDNEIKNYWRTRIQKHMKPQAAGGENAATRQSSSSCCGGEQASTSQASAPDTVETY-  178
            PGRTDNEIKNYWRTRIQKH+K    G ++ +  QSS      +QASTS+  +  TV T  
Sbjct  100  PGRTDNEIKNYWRTRIQKHIK---QGDQSNSQGQSSDGTA--DQASTSKVGSSSTVATLV  154

Query  179  SPTSYASnnnnnnMDATFQQGPFATESNDNMWSMEDLWSMHLLNAD  316
             P ++ +              P    + DN WSMEDLWSM LLN +
Sbjct  155  QPPAHPNVL------------PPGDSNQDNYWSMEDLWSMQLLNGE  188



>gb|AGN52062.1| MYB-related transcription factor [Salvia miltiorrhiza]
 gb|AGN52172.1| MYB-related transcription factor [Salvia miltiorrhiza]
Length=200

 Score = 76.6 bits (187),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 47/114 (41%), Positives = 63/114 (55%), Gaps = 20/114 (18%)
 Frame = +2

Query  2    PGRTDNEIKNYWRTRIQKHMK--------PQAAGGENAATRQSSSSCCGGEQASTSQASA  157
            PGRTDNEIKNYWRTRIQKH+K        P     ++  T Q+ S C   + A +     
Sbjct  98   PGRTDNEIKNYWRTRIQKHIKQSENFTTLPLNNMDQSTFTNQALSGCVPADYAIS-----  152

Query  158  PDTVETYSPTSYASnnnnnnMDATFQQGPFATESND-NMWSMEDLWSMHLLNAD  316
                ++Y+P    S+   +  +  FQ   F T+SND N+WSM+D WSM LL+ D
Sbjct  153  ----QSYTPNPATSSFQGSMQN--FQGSNFPTQSNDHNIWSMDDFWSMQLLHGD  200



>ref|XP_006300020.1| hypothetical protein CARUB_v10016245mg [Capsella rubella]
 gb|EOA32918.1| hypothetical protein CARUB_v10016245mg [Capsella rubella]
Length=203

 Score = 76.3 bits (186),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 44/111 (40%), Positives = 63/111 (57%), Gaps = 18/111 (16%)
 Frame = +2

Query  2    PGRTDNEIKNYWRTRIQKHMK--PQAAGGENAATRQSSSSCCGGEQASTSQASAPDTVET  175
            PGRTDNEIKN+WRT+IQ+HMK  P+    ++ +    SS     +Q S+ +A   D  E+
Sbjct  109  PGRTDNEIKNFWRTKIQRHMKVPPKNMMHQHCSGNSQSSGMTTTDQGSSGKAI--DMAES  166

Query  176  YSPTSYASnnnnnnMDATFQQGPFATESNDNMWSMEDLWSMHLLNAD*TLI  328
            +SP +            TF       +SN+N W++EDLW +HLLN D  +I
Sbjct  167  FSPAT-----------TTFN---VVEQSNENYWNVEDLWPVHLLNGDHHVI  203



>gb|KFK37619.1| hypothetical protein AALP_AA3G006700 [Arabis alpina]
Length=204

 Score = 76.3 bits (186),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 43/108 (40%), Positives = 59/108 (55%), Gaps = 18/108 (17%)
 Frame = +2

Query  2    PGRTDNEIKNYWRTRIQKHMKPQAAGGENAATRQSSSSCCGGEQASTSQASAP---DTVE  172
            PGRTDNEIKN+WRT+IQ+HMK   +  EN      S++    E  +T Q S+    D  E
Sbjct  107  PGRTDNEIKNFWRTKIQRHMK--VSSSENMKIHHCSANSQTSEMTTTDQGSSSKPFDMAE  164

Query  173  TYSPTSYASnnnnnnMDATFQQGPFATESNDNMWSMEDLWSMHLLNAD  316
            ++SP             AT        +SN+N W++EDLWS+ LLN +
Sbjct  165  SFSP-------------ATTTSFNLMEQSNENYWNVEDLWSVQLLNGE  199



>gb|KDP46431.1| hypothetical protein JCGZ_10271 [Jatropha curcas]
 gb|AIT52247.1| MYB family protein [Jatropha curcas]
Length=192

 Score = 75.9 bits (185),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 50/106 (47%), Positives = 62/106 (58%), Gaps = 12/106 (11%)
 Frame = +2

Query  2    PGRTDNEIKNYWRTRIQKHMK-PQAAGGENAATRQSSSSCCGGEQASTSQASAPDTVETY  178
            PGRTDNEIKNYWRTRIQKH+K  +A  G+N     ++S       +S+S   +   +ETY
Sbjct  98   PGRTDNEIKNYWRTRIQKHIKQAEAFAGQN-----TNSEINEHATSSSSSQFSSGMMETY  152

Query  179  SPTSYASnnnnnnMDATFQQGPFATESNDNMWSMEDLWSMHLLNAD  316
            S  SY        M+A F     A ES +  W+MEDLWSM LLN D
Sbjct  153  SAPSYQG-----TMEA-FTGPTLAPESTETYWTMEDLWSMQLLNDD  192



>ref|XP_004489258.1| PREDICTED: myb-related protein 305-like [Cicer arietinum]
Length=210

 Score = 75.5 bits (184),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 53/118 (45%), Positives = 64/118 (54%), Gaps = 19/118 (16%)
 Frame = +2

Query  2    PGRTDNEIKNYWRTRIQKHMKPQAAGGENAATRQSSSSCCGGEQASTSQASAPDTV---E  172
            PGRTDNEIKN+WRTRIQKH+K          ++Q  SS     Q +TSQAS    V   E
Sbjct  99   PGRTDNEIKNFWRTRIQKHIK--QVDHNQQNSQQQKSSSSDHHQTNTSQASNSTMVEPME  156

Query  173  TYSPTSYASnnnnnnMDATFQQGPFATESN----------DNMWSMEDLWSMHLLNAD  316
             YSPTSY +     N++    Q P   + N          +N WSMED+WSM LLN D
Sbjct  157  NYSPTSYQA----TNLEPFPTQFPTINDHNSSCCTNDHNTNNYWSMEDIWSMQLLNGD  210



>ref|XP_010108787.1| Myb-related protein 305 [Morus notabilis]
 gb|EXC20302.1| Myb-related protein 305 [Morus notabilis]
Length=225

 Score = 75.1 bits (183),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 55/126 (44%), Positives = 66/126 (52%), Gaps = 23/126 (18%)
 Frame = +2

Query  2    PGRTDNEIKNYWRTRIQKHMK-PQAAGGENAATRQSSSSCCGGEQASTSQASAPDTVE--  172
            PGRTDNEIKNYWRTRIQKH++        N   RQ+S       QASTSQASA +TV+  
Sbjct  102  PGRTDNEIKNYWRTRIQKHIRQADQHQSNNMIHRQNSEMMIINNQASTSQASACNTVDAM  161

Query  173  ----TYSPTSYASnnnnnnMDATFQQGPFAT--------------ESNDNMWSMEDLWSM  298
                TYSP  + S+  + N+D      P A                 N N  +MEDLWSM
Sbjct  162  EISNTYSP-PFISHQGSYNIDHQTNY-PLALPPTTTSTTSSSNIDHQNYNWSAMEDLWSM  219

Query  299  HLLNAD  316
             L N+D
Sbjct  220  QLFNSD  225



>gb|AAM67076.1| putative transcription factor [Arabidopsis thaliana]
Length=206

 Score = 75.1 bits (183),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 45/111 (41%), Positives = 62/111 (56%), Gaps = 16/111 (14%)
 Frame = +2

Query  2    PGRTDNEIKNYWRTRIQKHMKPQAAGGENAATRQSSSSCCGGEQAS--TSQASAPDTVET  175
            PGRTDNEIKN+WRT+IQ+HMK  +   EN    Q    C G  Q+S  T+Q S+   ++T
Sbjct  110  PGRTDNEIKNFWRTKIQRHMKVSS---ENMMNHQ--HHCSGNSQSSGMTTQGSSGKAIDT  164

Query  176  YSPTSYASnnnnnnMDATFQQGPFATESNDNMWSMEDLWSMHLLNAD*TLI  328
                S A     N ++          +SN+N W++ DLW +HLLN D  +I
Sbjct  165  AESFSQAKTTTFNVVEQ---------QSNENYWNVGDLWPVHLLNGDHHVI  206



>ref|NP_001238263.1| uncharacterized protein LOC100306400 [Glycine max]
 gb|ACU14553.1| unknown [Glycine max]
Length=204

 Score = 74.7 bits (182),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 49/110 (45%), Positives = 61/110 (55%), Gaps = 12/110 (11%)
 Frame = +2

Query  2    PGRTDNEIKNYWRTRIQKHMKPQAAGGENAATRQSSSSCCGGEQASTSQASA-PDTVETY  178
            PGRTDNEIKNYWRTRIQKH+K       +   + S+S      QA TSQ S     +ETY
Sbjct  99   PGRTDNEIKNYWRTRIQKHLK---QASSSFQQQSSNSEIIYHPQACTSQVSTMAQPIETY  155

Query  179  SPTSYASnnnnnnMDATFQQGPFAT------ESNDNMWSMEDLWSMHLLN  310
            SP SY    +  ++   F   P  +      + N+N WSMED+WSM L N
Sbjct  156  SPPSYQGMLDPYSIQ--FPTNPHHSSCCTNDDDNNNYWSMEDIWSMQLAN  203



>ref|NP_001235865.1| MYB transcription factor MYB98 [Glycine max]
 gb|ABH02848.1| MYB transcription factor MYB98 [Glycine max]
 gb|KHN24348.1| Myb-related protein 305 [Glycine soja]
Length=204

 Score = 74.7 bits (182),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 49/110 (45%), Positives = 61/110 (55%), Gaps = 12/110 (11%)
 Frame = +2

Query  2    PGRTDNEIKNYWRTRIQKHMKPQAAGGENAATRQSSSSCCGGEQASTSQASA-PDTVETY  178
            PGRTDNEIKNYWRTRIQKH+K       +   + S+S      QA TSQ S     +ETY
Sbjct  99   PGRTDNEIKNYWRTRIQKHLK---QASSSFQQQSSNSEIIYHPQACTSQVSTMAQPIETY  155

Query  179  SPTSYASnnnnnnMDATFQQGPFAT------ESNDNMWSMEDLWSMHLLN  310
            SP SY    +  ++   F   P  +      + N+N WSMED+WSM L N
Sbjct  156  SPPSYQGMLDPFSIQ--FPTNPHHSSCCTNDDDNNNYWSMEDIWSMQLAN  203



>ref|XP_010435630.1| PREDICTED: transcription factor MYB57 [Camelina sativa]
Length=202

 Score = 74.7 bits (182),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 44/112 (39%), Positives = 59/112 (53%), Gaps = 21/112 (19%)
 Frame = +2

Query  2    PGRTDNEIKNYWRTRIQKHMKPQAAGGENAATRQSSSSCCGGEQASTSQAS---APDTVE  172
            PGRTDNEIKN+WRT+IQ+HMK + +  EN      S +       +T Q S   A D  E
Sbjct  109  PGRTDNEIKNFWRTKIQRHMKVKVS-SENMMNHHCSGNSQSSGMTTTEQGSSGKAIDMAE  167

Query  173  TYSPTSYASnnnnnnMDATFQQGPFATESNDNMWSMEDLWSMHLLNAD*TLI  328
            ++SP +            TF         N+N W++EDLW +HLLN D  +I
Sbjct  168  SFSPAT-----------TTFNV------VNENYWNVEDLWPVHLLNGDHHVI  202



>ref|XP_002323803.1| Myb26 family protein [Populus trichocarpa]
 gb|EEF03936.1| Myb26 family protein [Populus trichocarpa]
Length=190

 Score = 73.2 bits (178),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 49/105 (47%), Positives = 56/105 (53%), Gaps = 12/105 (11%)
 Frame = +2

Query  2    PGRTDNEIKNYWRTRIQKHMKPQAAGGENAATRQSSSSCCGGEQASTSQASAPDTVETYS  181
            PGRTDNEIKNYWRTRIQKH+K      E  A  QSS +   G  +S   ++    V    
Sbjct  98   PGRTDNEIKNYWRTRIQKHIKQ----AETFAA-QSSETNEHGSSSSQVSSTTELMVSNCL  152

Query  182  PTSYASnnnnnnMDATFQQGPFATESNDNMWSMEDLWSMHLLNAD  316
            P SY  +         F  G    E N+N WSMEDLWSM LLN D
Sbjct  153  P-SYQGDVE------AFSGGNIPQELNENYWSMEDLWSMQLLNGD  190



>gb|KHN23525.1| Transcription factor MYB21 [Glycine soja]
Length=185

 Score = 72.8 bits (177),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 42/107 (39%), Positives = 61/107 (57%), Gaps = 2/107 (2%)
 Frame = +2

Query  2    PGRTDNEIKNYWRTRIQKHMKPQAAGGENAATRQSSSSCCGGEQASTSQASAPDTVETYS  181
            PGRTDNEIKN+WRTRIQKH+K      ++  + ++S++      +++  ++     ET+S
Sbjct  79   PGRTDNEIKNFWRTRIQKHIKQAETSQQHGNSSENSNNDHQASNSTSKVSTMAHPNETFS  138

Query  182  PTSY-ASnnnnnnMDATFQQGPFATESNDNMWSMEDLW-SMHLLNAD  316
            P SY A+         T         SN+N WS+ED+W SM LLN D
Sbjct  139  PPSYQATFEPFQPQFPTINDQSSCCTSNNNYWSIEDIWSSMQLLNGD  185



>ref|XP_008458780.1| PREDICTED: myb-related protein 340-like [Cucumis melo]
Length=210

 Score = 73.2 bits (178),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 45/114 (39%), Positives = 56/114 (49%), Gaps = 14/114 (12%)
 Frame = +2

Query  2    PGRTDNEIKNYWRTRIQKHMKPQ-----------AAGGENAATRQSSSSCCGGEQASTSQ  148
            PGRTDNEIKNYWRTRIQKH+K Q           + G  +      + S C    +  + 
Sbjct  100  PGRTDNEIKNYWRTRIQKHIKQQEEVERVRDQMISIGNCSETNDDCAISPCSQVSSFCNV  159

Query  149  ASAPDTVETYSPTSYASnnnnnnMDATFQQGPFATESNDNMWSMEDLWSMHLLN  310
            A   +    Y P+S            T+ +G  A   NDN WSMEDLWSM LL+
Sbjct  160  AEPMEISHDYFPSSQGDMEAMAYQHTTWDRGDGA---NDNYWSMEDLWSMQLLD  210



>sp|P81396.1|MYB40_ANTMA RecName: Full=Myb-related protein 340 [Antirrhinum majus]
Length=198

 Score = 72.8 bits (177),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 51/104 (49%), Positives = 61/104 (59%), Gaps = 7/104 (7%)
 Frame = +2

Query  2    PGRTDNEIKNYW-RTRIQKHMKPQAAGGENAATRQSSSSCCGGEQASTSQASAPDTVETY  178
            PGRTDNEIKNYW RTRIQKH+K   A        + S+     EQASTS  S+    + +
Sbjct  98   PGRTDNEIKNYWNRTRIQKHIKQAEASFIGHINPEHSN-----EQASTSLLSSSCHAD-H  151

Query  179  SPTSYASnnnnnnMDATFQQGPFATESNDNMWSMEDLWSMHLLN  310
            +  SY+S+ N N  +       F TESND  WSMEDLWSM L N
Sbjct  152  AVESYSSSFNGNMGNNVQYPNHFPTESNDYFWSMEDLWSMQLPN  195



>ref|XP_003553814.1| PREDICTED: myb-related protein 305 [Glycine max]
Length=205

 Score = 72.8 bits (177),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 42/107 (39%), Positives = 61/107 (57%), Gaps = 2/107 (2%)
 Frame = +2

Query  2    PGRTDNEIKNYWRTRIQKHMKPQAAGGENAATRQSSSSCCGGEQASTSQASAPDTVETYS  181
            PGRTDNEIKN+WRTRIQKH+K      ++  + ++S++      +++  ++     ET+S
Sbjct  99   PGRTDNEIKNFWRTRIQKHIKQAETSQQHGNSSENSNNDHQASNSTSKVSTMAHPNETFS  158

Query  182  PTSY-ASnnnnnnMDATFQQGPFATESNDNMWSMEDLW-SMHLLNAD  316
            P SY A+         T         SN+N WS+ED+W SM LLN D
Sbjct  159  PPSYQATFEPFQPQFPTINDQSSCCTSNNNYWSIEDIWSSMQLLNGD  205



>ref|XP_010251229.1| PREDICTED: myb-related protein 340-like [Nelumbo nucifera]
Length=184

 Score = 72.4 bits (176),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 48/100 (48%), Positives = 57/100 (57%), Gaps = 15/100 (15%)
 Frame = +2

Query  2    PGRTDNEIKNYWRTRIQKHMKPQAAGGENAATRQSSSSCCGGEQASTSQASA-PDTVETY  178
            PGRTDNEIKNYWRT+I+KH+K        A    S SS    EQ ++SQ S+  + VE  
Sbjct  98   PGRTDNEIKNYWRTKIRKHIK-------EAENNPSQSSEINPEQTTSSQVSSDANAVEPC  150

Query  179  SPTSYASnnnnnnMDATFQQGPFATESNDNMWSMEDLWSM  298
            SPT Y  N     M      G   TESND+ WS+EDLW M
Sbjct  151  SPT-YTGNLQEAWM------GALPTESNDSFWSVEDLWYM  183



>ref|XP_002882176.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH58435.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=202

 Score = 72.4 bits (176),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 42/109 (39%), Positives = 59/109 (54%), Gaps = 16/109 (15%)
 Frame = +2

Query  2    PGRTDNEIKNYWRTRIQKHMKPQAAGGENAATRQSSSSCCGGEQASTSQASAPDTVETYS  181
            PGRTDNEIKN+WRT+IQ+HMK  ++     +    SS     +Q S+ +  A D  E++S
Sbjct  110  PGRTDNEIKNFWRTKIQRHMKVMSSEHMICSGNSQSSGMTTTDQGSSGK--AIDMAESFS  167

Query  182  PTSYASnnnnnnMDATFQQGPFATESNDNMWSMEDLWSMHLLNAD*TLI  328
                           TF       +SN+N W++EDLW +HLLN D  +I
Sbjct  168  QAK-----------TTFN---VVEQSNENYWNVEDLWPVHLLNGDHHVI  202



>ref|XP_004142797.1| PREDICTED: myb-related protein 305-like [Cucumis sativus]
Length=209

 Score = 72.4 bits (176),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 47/114 (41%), Positives = 57/114 (50%), Gaps = 14/114 (12%)
 Frame = +2

Query  2    PGRTDNEIKNYWRTRIQKHMKPQAAGGENAATRQSSSSC------CG----GEQASTSQA  151
            PGRTDNEIKNYWRTRIQKH+K Q           S  SC      C      + +S S  
Sbjct  99   PGRTDNEIKNYWRTRIQKHIKQQEEVERVRDQMISIGSCSETNDDCAISPWSQVSSFSNV  158

Query  152  SAPDTV-ETYSPTSYASnnnnnnMDATFQQGPFATESNDNMWSMEDLWSMHLLN  310
            + P  +   Y P+S            ++ +G  A   NDN WSMEDLWSM LL+
Sbjct  159  AEPMEISHDYFPSSQGDMEAMGYQQTSWDRGDGA---NDNYWSMEDLWSMQLLD  209



>ref|XP_004156725.1| PREDICTED: LOW QUALITY PROTEIN: myb-related protein 305-like 
[Cucumis sativus]
Length=210

 Score = 72.4 bits (176),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 47/114 (41%), Positives = 57/114 (50%), Gaps = 14/114 (12%)
 Frame = +2

Query  2    PGRTDNEIKNYWRTRIQKHMKPQAAGGENAATRQSSSSC------CG----GEQASTSQA  151
            PGRTDNEIKNYWRTRIQKH+K Q           S  SC      C      + +S S  
Sbjct  100  PGRTDNEIKNYWRTRIQKHIKQQEEVERVRDQMISIGSCSETNDDCAISPWSQVSSFSNV  159

Query  152  SAPDTV-ETYSPTSYASnnnnnnMDATFQQGPFATESNDNMWSMEDLWSMHLLN  310
            + P  +   Y P+S            ++ +G  A   NDN WSMEDLWSM LL+
Sbjct  160  AEPMEISHDYFPSSQGDMEAMGYQQTSWDRGDGA---NDNYWSMEDLWSMQLLD  210



>ref|XP_004516766.1| PREDICTED: myb-related protein 305-like isoform X2 [Cicer arietinum]
Length=233

 Score = 72.0 bits (175),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 47/114 (41%), Positives = 65/114 (57%), Gaps = 12/114 (11%)
 Frame = +2

Query  2    PGRTDNEIKNYWRTRIQKHMKPQAAGGENAATRQSSSSCCGGEQASTSQAS--APDTVET  175
            PGRTDNEIKNYWRTRIQKH+K QA   +     Q + +    + AS+SQ S  AP+ ++ 
Sbjct  123  PGRTDNEIKNYWRTRIQKHIK-QAENSQQQNCDQINDN--NNQIASSSQVSNMAPEPMDI  179

Query  176  YSPT-------SYASnnnnnnMDATFQQGPFATESNDNMWSMEDLWSMHLLNAD  316
              P         ++S++++++      Q    T  N+N WSMED  SM LLN D
Sbjct  180  SPPCYQGGILEPFSSHDHHHHFPTISDQSSCCTNDNNNYWSMEDFLSMQLLNGD  233



>ref|XP_006408520.1| hypothetical protein EUTSA_v10022197mg, partial [Eutrema salsugineum]
 gb|ESQ49973.1| hypothetical protein EUTSA_v10022197mg, partial [Eutrema salsugineum]
Length=133

 Score = 70.5 bits (171),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 45/117 (38%), Positives = 62/117 (53%), Gaps = 24/117 (21%)
 Frame = +2

Query  2    PGRTDNEIKNYWRTRIQKHMKPQAAGGENAATRQSSSSCCGGEQAST-------SQASAP  160
            PGRTDNEIKN+WRT+IQ+HMK   +  E    RQ    C G  Q+S        S + A 
Sbjct  33   PGRTDNEIKNFWRTKIQRHMK--VSSSEKMDIRQ---YCSGNSQSSVMTTMDQSSSSKAL  87

Query  161  DTVETY-SPTSYASnnnnnnMDATFQQGPFATESNDNMWSMEDLWSMHLLNAD*TLI  328
            D  E+  SP +  +        ++F       +SND+ W++EDLW + LLN D  +I
Sbjct  88   DMAESLISPVTTTT--------SSFH---VLEQSNDSYWNVEDLWPVQLLNGDHQVI  133



>ref|XP_004516765.1| PREDICTED: myb-related protein 305-like isoform X1 [Cicer arietinum]
Length=257

 Score = 72.0 bits (175),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 47/114 (41%), Positives = 65/114 (57%), Gaps = 12/114 (11%)
 Frame = +2

Query  2    PGRTDNEIKNYWRTRIQKHMKPQAAGGENAATRQSSSSCCGGEQASTSQAS--APDTVET  175
            PGRTDNEIKNYWRTRIQKH+K QA   +     Q + +    + AS+SQ S  AP+ ++ 
Sbjct  147  PGRTDNEIKNYWRTRIQKHIK-QAENSQQQNCDQINDN--NNQIASSSQVSNMAPEPMDI  203

Query  176  YSPT-------SYASnnnnnnMDATFQQGPFATESNDNMWSMEDLWSMHLLNAD  316
              P         ++S++++++      Q    T  N+N WSMED  SM LLN D
Sbjct  204  SPPCYQGGILEPFSSHDHHHHFPTISDQSSCCTNDNNNYWSMEDFLSMQLLNGD  257



>gb|KDO66125.1| hypothetical protein CISIN_1g045384mg [Citrus sinensis]
Length=194

 Score = 71.2 bits (173),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 53/108 (49%), Positives = 59/108 (55%), Gaps = 14/108 (13%)
 Frame = +2

Query  2    PGRTDNEIKNYWRTRIQKHMKPQAAGGENAATRQSSSSCCGGEQASTSQAS-APDTVETY  178
            PGRTDNEIKN+WRTRIQK +K         A   S  S    EQAS+SQ S A  TVE Y
Sbjct  98   PGRTDNEIKNFWRTRIQKQIK--------QAETFSGQSSEANEQASSSQMSTAAYTVEDY  149

Query  179  SPTSYASnnnnnnMDA--TFQQGPFATESNDNMWSMEDLWSMHLLNAD  316
            S   Y  NNN +   A       P  +E N+N WSMEDLW   L N D
Sbjct  150  SAPQYPLNNNMDPHQAFPLDNMAPIPSEVNENYWSMEDLW---LYNGD  194



>gb|AFJ21697.1| MYB24 [Gossypium hirsutum]
Length=210

 Score = 71.2 bits (173),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 51/115 (44%), Positives = 63/115 (55%), Gaps = 12/115 (10%)
 Frame = +2

Query  2    PGRTDNEIKNYWRTRIQKHM-KPQAAGGENAA-----TRQSSSSCCGGEQASTSQASAPD  163
            PGRTDNEIKNYWRTRIQKHM KP      N +      +Q+SSS       +T+ A +  
Sbjct  98   PGRTDNEIKNYWRTRIQKHMNKPAEVCYSNQSDCELLDQQASSSQLPCNSTNTTNADSMG  157

Query  164  TVETYSPTSYASnnnnnnMDATFQQGPFATES----NDNMWSMEDLWSMHLLNAD  316
            T  +YSP S     NN    +  QQ     ES     DN W+MED+WSM +LN +
Sbjct  158  T--SYSPLSSFDYYNNIEAFSGQQQQQVMLESPSSQEDNYWNMEDIWSMQILNGN  210



>ref|XP_006446527.1| hypothetical protein CICLE_v10016820mg [Citrus clementina]
 gb|ESR59767.1| hypothetical protein CICLE_v10016820mg [Citrus clementina]
Length=194

 Score = 70.1 bits (170),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 52/108 (48%), Positives = 59/108 (55%), Gaps = 14/108 (13%)
 Frame = +2

Query  2    PGRTDNEIKNYWRTRIQKHMKPQAAGGENAATRQSSSSCCGGEQASTSQAS-APDTVETY  178
            PGRTDNEIKN+WRTRIQK +K         A   S  S    EQAS+SQ S A  TVE Y
Sbjct  98   PGRTDNEIKNFWRTRIQKQIK--------QAETFSGQSSEANEQASSSQMSTAAYTVEDY  149

Query  179  SPTSYASnnnnnnMDA--TFQQGPFATESNDNMWSMEDLWSMHLLNAD  316
            S   Y  NNN +   A       P  +E N+N W+MEDLW   L N D
Sbjct  150  SAPQYPLNNNMDPHQAFPLDNMAPIPSEVNENYWNMEDLW---LYNGD  194



>ref|XP_006470308.1| PREDICTED: myb-related protein 305-like isoform X1 [Citrus sinensis]
Length=194

 Score = 69.7 bits (169),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 52/108 (48%), Positives = 59/108 (55%), Gaps = 14/108 (13%)
 Frame = +2

Query  2    PGRTDNEIKNYWRTRIQKHMKPQAAGGENAATRQSSSSCCGGEQASTSQAS-APDTVETY  178
            PGRTDNEIKN+WRTRIQK +K         A   S  S    EQAS+SQ S A  T+E Y
Sbjct  98   PGRTDNEIKNFWRTRIQKQIK--------QAETFSGQSSEANEQASSSQMSTAAYTMEDY  149

Query  179  SPTSYASnnnnnnMDA--TFQQGPFATESNDNMWSMEDLWSMHLLNAD  316
            S   Y  NNN +   A       P  +E N+N WSMEDLW   L N D
Sbjct  150  SAPQYPLNNNMDPHQAFPLDNMAPIPSEVNENYWSMEDLW---LYNGD  194



>ref|XP_007151019.1| hypothetical protein PHAVU_004G012000g [Phaseolus vulgaris]
 gb|ESW23013.1| hypothetical protein PHAVU_004G012000g [Phaseolus vulgaris]
Length=241

 Score = 70.1 bits (170),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 50/121 (41%), Positives = 63/121 (52%), Gaps = 22/121 (18%)
 Frame = +2

Query  2    PGRTDNEIKNYWRTRIQKHMKPQAAG----GENAATRQSSSSCCGGEQASTSQAS-APDT  166
            PGRTDNEIKN+WRTRIQKHMK QA      G N+   +++        +STS  S     
Sbjct  127  PGRTDNEIKNFWRTRIQKHMK-QAENSQQQGNNSNISETNDHHHHQASSSTSLVSNMALQ  185

Query  167  VETYSPTSYASnnnnnnMDATFQQGPFATE-----------SNDNMWSMEDLWSMHLLNA  313
            +ETYS  SY       N+++   Q P  T+           SN N W++ED W M LLN 
Sbjct  186  IETYSAPSYQE-----NLESFPTQFPTITDQSSSCTNHNINSNHNYWNIEDFWPMQLLNG  240

Query  314  D  316
            D
Sbjct  241  D  241



>gb|ABH02872.1| MYB transcription factor MYB99 [Glycine max]
Length=198

 Score = 69.7 bits (169),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 50/124 (40%), Positives = 62/124 (50%), Gaps = 36/124 (29%)
 Frame = +2

Query  2    PGRTDNEIKNYWRTRIQKHMKPQAAGGENAATRQSSSSCCGGEQASTSQASAPDTV---E  172
            PGRTDNEIKN+WRTRIQKH+K      +   ++Q  +S     QASTS +         E
Sbjct  92   PGRTDNEIKNFWRTRIQKHIK------QAETSQQHGNSENNDHQASTSTSKVSTMAHPNE  145

Query  173  TYSPTSYASnnnnnnMDATFQQGPF---------------ATESNDNMWSMEDLW-SMHL  304
            T+SP SY           TF+  PF                T  N+N WS+ED+W SM L
Sbjct  146  TFSPPSY---------QGTFE--PFQPQFPTITDQSSCCTTTNDNNNYWSIEDIWSSMQL  194

Query  305  LNAD  316
            LN D
Sbjct  195  LNGD  198



>ref|NP_001235699.1| uncharacterized protein LOC100305972 [Glycine max]
 gb|ACU13920.1| unknown [Glycine max]
Length=206

 Score = 69.7 bits (169),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 50/124 (40%), Positives = 62/124 (50%), Gaps = 36/124 (29%)
 Frame = +2

Query  2    PGRTDNEIKNYWRTRIQKHMKPQAAGGENAATRQSSSSCCGGEQASTSQASAPDTV---E  172
            PGRTDNEIKN+WRTRIQKH+K      +   ++Q  +S     QASTS +         E
Sbjct  100  PGRTDNEIKNFWRTRIQKHIK------QAETSQQHGNSENNDHQASTSTSKVSTMAHPNE  153

Query  173  TYSPTSYASnnnnnnMDATFQQGPF---------------ATESNDNMWSMEDLW-SMHL  304
            T+SP SY           TF+  PF                T  N+N WS+ED+W SM L
Sbjct  154  TFSPPSY---------QGTFE--PFQPQFPTITDQSSCCTTTNDNNNYWSIEDIWSSMQL  202

Query  305  LNAD  316
            LN D
Sbjct  203  LNGD  206



>gb|KHN27441.1| Myb-related protein 305 [Glycine soja]
Length=201

 Score = 69.3 bits (168),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 50/124 (40%), Positives = 62/124 (50%), Gaps = 36/124 (29%)
 Frame = +2

Query  2    PGRTDNEIKNYWRTRIQKHMKPQAAGGENAATRQSSSSCCGGEQASTSQASAPDTV---E  172
            PGRTDNEIKN+WRTRIQKH+K      +   ++Q  +S     QASTS +         E
Sbjct  95   PGRTDNEIKNFWRTRIQKHIK------QAETSQQHGNSENNDHQASTSTSKVSTMAHPNE  148

Query  173  TYSPTSYASnnnnnnMDATFQQGPF---------------ATESNDNMWSMEDLW-SMHL  304
            T+SP SY           TF+  PF                T  N+N WS+ED+W SM L
Sbjct  149  TFSPPSYQ---------GTFE--PFQPQFPTITDQSSCCTTTNDNNNYWSIEDIWSSMQL  197

Query  305  LNAD  316
            LN D
Sbjct  198  LNGD  201



>ref|XP_006405505.1| hypothetical protein EUTSA_v10027930mg [Eutrema salsugineum]
 gb|ESQ46958.1| hypothetical protein EUTSA_v10027930mg [Eutrema salsugineum]
Length=214

 Score = 69.7 bits (169),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 49/119 (41%), Positives = 62/119 (52%), Gaps = 20/119 (17%)
 Frame = +2

Query  2    PGRTDNEIKNYWRTRIQKHMKPQAAGGENAATRQSSSSCCGGEQASTSQA-SAPDTVETY  178
            PGRTDNEIKN+WRT+IQK++  Q   GE       SS        STS   +A +T++ Y
Sbjct  102  PGRTDNEIKNFWRTKIQKYIIKQ---GETTNVGSQSSEMINDRATSTSHVLNAQETMDIY  158

Query  179  SP-TSYASnnnnnnMDATFQQG-----------PFAT-ESNDNMWSMEDLWSMHLLNAD  316
            SP TSY   NN    D  F  G           P A  +S +N WS++DLW MHL   +
Sbjct  159  SPLTSYQQTNNT---DHQFNYGNYVPSSDSIMMPLAVDQSEENCWSVDDLWPMHLFGGN  214



>ref|XP_010924268.1| PREDICTED: myb-related protein 305-like [Elaeis guineensis]
Length=198

 Score = 68.2 bits (165),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 46/114 (40%), Positives = 55/114 (48%), Gaps = 29/114 (25%)
 Frame = +2

Query  2    PGRTDNEIKNYWRTRIQKHMKPQAAGGENAA---------TRQSSSSCCGGEQASTSQAS  154
            PGRTDNEIKNYWRTRIQK +K   +     A         T Q++S   GG Q S +Q  
Sbjct  105  PGRTDNEIKNYWRTRIQKKVKHGESSDYQHAMLIDEASTTTSQTNSVEDGGAQPSYTQQR  164

Query  155  APDTVETYSPTSYASnnnnnnMDATFQQGPFATESNDNMWSMEDLWSMHLLNAD  316
              +      P + A               PF+TES DN WS+ED WSM   N D
Sbjct  165  ETN------PVALAP--------------PFSTESCDNFWSVEDFWSMQSFNGD  198



>ref|XP_010555957.1| PREDICTED: transcription factor MYB21-like [Tarenaya hassleriana]
Length=206

 Score = 68.2 bits (165),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 43/116 (37%), Positives = 63/116 (54%), Gaps = 20/116 (17%)
 Frame = +2

Query  2    PGRTDNEIKNYWRTRIQKHMKPQAAGGENAATRQSSSSCCGGEQASTSQASAPDTVETYS  181
            PGRTDNEIKN+WRTR+QK++K      E  +   S  S    + +S+   SA + +ETY 
Sbjct  100  PGRTDNEIKNFWRTRVQKYIKQ----SETTSAVGSQGSEINDQPSSSQIFSAQEAMETYF  155

Query  182  PTSYASnnnnnnMDATFQQGPFATE-----------SNDNMWSMEDLWSMHLLNAD  316
            PT+    N   N D+     P ++E           + +N W+M+D+WSM LLN +
Sbjct  156  PTTSYQANMEVNYDS-----PMSSEWLMPMPMQIDQTGENYWTMDDIWSMQLLNGN  206



>emb|CAA71992.1| Myb26 [Pisum sativum]
Length=217

 Score = 68.2 bits (165),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 48/130 (37%), Positives = 59/130 (45%), Gaps = 36/130 (28%)
 Frame = +2

Query  2    PGRTDNEIKNYWRTRIQKHMKPQAAGGENAATRQSSSSCCGGEQASTSQ--------ASA  157
            PGRTDNEIKN+WRTRIQKH+K       N    Q   S    +              ++ 
Sbjct  99   PGRTDNEIKNFWRTRIQKHIK--QVDNPNQQNFQQKMSLEINDHHHHHPHQPSSSQVSNL  156

Query  158  PDTVETYSPTSYASnnnnnnMDATFQQGP--FATESNDN---------------MWSMED  286
             + +ETYSPTSY           T +  P  F T +ND+                WSMED
Sbjct  157  VEPMETYSPTSYQ---------GTLEPFPTQFPTINNDHHQNSNCCANDNNNNNYWSMED  207

Query  287  LWSMHLLNAD  316
            +WSM LLN D
Sbjct  208  IWSMQLLNGD  217



>ref|XP_010502785.1| PREDICTED: transcription factor MYB21-like [Camelina sativa]
Length=224

 Score = 68.6 bits (166),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 48/126 (38%), Positives = 66/126 (52%), Gaps = 26/126 (21%)
 Frame = +2

Query  2    PGRTDNEIKNYWRTRIQKHMKPQAAGGENAATRQSSSSCCGGEQASTSQASAPDT----V  169
            PGRTDNEIKN+WRTRIQK++K QA     ++     SS    + ASTS  +   T    +
Sbjct  104  PGRTDNEIKNFWRTRIQKYIK-QADATTTSSVGSHHSSEINDQAASTSSHNVFCTQDQPM  162

Query  170  ETYSPTSYASnnnnnnMDATFQQGPFAT----------------ESNDNMWSMEDLW-SM  298
            ETYSPT      +   ++  F  G ++T                +S +N W M+D+W SM
Sbjct  163  ETYSPTP----TSYQQINMEFNYGNYSTAATATVDYPIPMTVDDQSGENYWGMDDIWSSM  218

Query  299  HLLNAD  316
            HLLN +
Sbjct  219  HLLNGN  224



>ref|XP_010528247.1| PREDICTED: transcription factor MYB21 [Tarenaya hassleriana]
Length=204

 Score = 68.2 bits (165),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 48/115 (42%), Positives = 63/115 (55%), Gaps = 21/115 (18%)
 Frame = +2

Query  2    PGRTDNEIKNYWRTRIQKHMKPQAAGGENAATRQSSSSCCGGE---QASTSQASAPDTVE  172
            PGRTDNEIKN+WRTR+QK++K         A   SS    G E   QAS++QA       
Sbjct  101  PGRTDNEIKNFWRTRVQKYIK--------QAETTSSVGSQGSEINDQASSNQAFGTQEA-  151

Query  173  TYSPTSYASnnnnnnMDATF-------QQGPFATESNDNMWSMEDLWSMHLLNAD  316
             YSPT+ AS   N  +D  +        Q P   ++ +N W+M+DLWSM LLN +
Sbjct  152  LYSPTT-ASYQANMGLDYNYPPSSASQMQLPI-DQTGENYWTMDDLWSMQLLNGN  204



>gb|KHG20022.1| Myb-related protein [Gossypium arboreum]
Length=213

 Score = 68.2 bits (165),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 49/120 (41%), Positives = 61/120 (51%), Gaps = 19/120 (16%)
 Frame = +2

Query  2    PGRTDNEIKNYWRTRIQKHMKPQAAGGENAATRQSSSSCCGGEQASTSQA---SAPDTVE  172
            PGRTDNEIKNYWRTRIQKH+  QA       +   S+      QASTSQ     +   +E
Sbjct  98   PGRTDNEIKNYWRTRIQKHINKQAE----MFSFNISTPELLDHQASTSQLPCNGSTSFME  153

Query  173  TYSPTSYASnnnnnnMDATFQQGPFATE------------SNDNMWSMEDLWSMHLLNAD  316
            TYSP S  ++ N        Q+     +            +N++ WSMED WSM LLN D
Sbjct  154  TYSPMSSFNHCNLEPFPGQQQEVQQQQQQQPQQQHIVDQPNNESYWSMEDFWSMQLLNGD  213



>gb|KEH22251.1| myb transcription factor [Medicago truncatula]
Length=208

 Score = 67.4 bits (163),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 44/115 (38%), Positives = 56/115 (49%), Gaps = 15/115 (13%)
 Frame = +2

Query  2    PGRTDNEIKNYWRTRIQKHMK------PQAAGGENAATRQSSSSCCGGEQASTSQASAPD  163
            PGRTDNEIKNYWRTRIQKH+K       Q  G +      ++++   G  +  S  + P 
Sbjct  99   PGRTDNEIKNYWRTRIQKHIKQAENSQSQEQGSDIQINDDNNNNQLIGSTSQISNIAEPM  158

Query  164  TVETYSPTSYASnnnnnnMDATFQQGPFATESND----NMWSMEDLWSMHLLNAD  316
                 SP SY        ++       F T S+     N WSMEDL S+ LLN D
Sbjct  159  DTNIISPPSYQG-----ILEPFPPHHQFPTISDQSGCSNYWSMEDLLSLQLLNGD  208



>ref|XP_010425557.1| PREDICTED: transcription factor MYB21 isoform X2 [Camelina sativa]
Length=224

 Score = 67.0 bits (162),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 48/126 (38%), Positives = 65/126 (52%), Gaps = 26/126 (21%)
 Frame = +2

Query  2    PGRTDNEIKNYWRTRIQKHMKPQAAGGENAATRQSSSSCCGGEQASTSQASAPDT----V  169
            PGRTDNEIKN+WRTRIQK++K QA     ++     SS    + ASTS  +   T    +
Sbjct  104  PGRTDNEIKNFWRTRIQKYIK-QADATTTSSVGSHHSSEINDQAASTSSHNVFCTQDQPM  162

Query  170  ETYSPTSYASnnnnnnMDATFQQGPFAT----------------ESNDNMWSMEDLW-SM  298
            ETYSPT      +    +  F  G ++T                +S +N W M+D+W SM
Sbjct  163  ETYSPTP----TSYQQTNMEFNYGNYSTAATXTVDYPIPMTVDDQSGENYWGMDDIWSSM  218

Query  299  HLLNAD  316
            HLLN +
Sbjct  219  HLLNGN  224



>ref|XP_010425556.1| PREDICTED: transcription factor MYB21 isoform X1 [Camelina sativa]
Length=224

 Score = 67.0 bits (162),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 48/126 (38%), Positives = 65/126 (52%), Gaps = 26/126 (21%)
 Frame = +2

Query  2    PGRTDNEIKNYWRTRIQKHMKPQAAGGENAATRQSSSSCCGGEQASTSQASAPDT----V  169
            PGRTDNEIKN+WRTRIQK++K QA     ++     SS    + ASTS  +   T    +
Sbjct  104  PGRTDNEIKNFWRTRIQKYIK-QADATTTSSVGSHHSSEINDQAASTSSHNVFCTQDQPM  162

Query  170  ETYSPTSYASnnnnnnMDATFQQGPFAT----------------ESNDNMWSMEDLW-SM  298
            ETYSPT      +    +  F  G ++T                +S +N W M+D+W SM
Sbjct  163  ETYSPTP----TSYQQTNMEFNYGNYSTAATATVDYPIPMTVDDQSGENYWGMDDIWSSM  218

Query  299  HLLNAD  316
            HLLN +
Sbjct  219  HLLNGN  224



>ref|XP_010514490.1| PREDICTED: transcription factor MYB21-like [Camelina sativa]
Length=224

 Score = 66.6 bits (161),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 48/125 (38%), Positives = 65/125 (52%), Gaps = 26/125 (21%)
 Frame = +2

Query  2    PGRTDNEIKNYWRTRIQKHMKPQAAGGENAATRQSSSSCCGGEQASTSQASAPDT----V  169
            PGRTDNEIKN+WRTRIQK++K QA     ++     SS    + ASTS  +   T    +
Sbjct  104  PGRTDNEIKNFWRTRIQKYIK-QADATTTSSVGSHHSSEINDQAASTSSHNVFCTQDQPM  162

Query  170  ETYSPTSYASnnnnnnMDATFQQGPFAT----------------ESNDNMWSMEDLW-SM  298
            ETYSPT      +  + +  F  G ++T                +S +N W M+D+W SM
Sbjct  163  ETYSPTP----TSYQHTNMEFNYGNYSTAATATVDYPIPMTVDDQSGENYWGMDDIWSSM  218

Query  299  HLLNA  313
            HLLN 
Sbjct  219  HLLNG  223



>ref|XP_008800726.1| PREDICTED: myb-related protein 305-like [Phoenix dactylifera]
Length=215

 Score = 66.6 bits (161),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 47/105 (45%), Positives = 58/105 (55%), Gaps = 11/105 (10%)
 Frame = +2

Query  2    PGRTDNEIKNYWRTRIQKHMKPQAAGGENAATRQSSSSCCGGEQASTSQASAPDTVETYS  181
            PGRTDNEIKNYWRTRIQK +K     GE+   +         ++ASTS +      +  S
Sbjct  122  PGRTDNEIKNYWRTRIQKKVK----HGESFDYQH----VMLTDEASTSTSQTNSVEDGGS  173

Query  182  PTSYASnnnnnnMDATFQQGPFATESNDNMWSMEDLWSMHLLNAD  316
              SY   +  N  DA   Q  F+TES+DN WS+ED W M  LN D
Sbjct  174  QPSYTEQHETNP-DALAPQ--FSTESSDNFWSVEDFWLMQSLNGD  215



>emb|CDX91944.1| BnaC03g32460D [Brassica napus]
Length=207

 Score = 66.2 bits (160),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 39/105 (37%), Positives = 55/105 (52%), Gaps = 10/105 (10%)
 Frame = +2

Query  2    PGRTDNEIKNYWRTRIQKHMKPQAAGGENAATRQSSSSCCGGEQASTSQASAPDTVETYS  181
            PGRTDNEIKN+WRT+IQ+HMK  ++  E   TR     C G  Q+S        T +  S
Sbjct  108  PGRTDNEIKNFWRTKIQRHMKLSSS--ETMNTRH----CLGSSQSSV----MTTTDQGSS  157

Query  182  PTSYASnnnnnnMDATFQQGPFATESNDNMWSMEDLWSMHLLNAD  316
              ++    +  + +          +SND+ WS+EDLW + L N D
Sbjct  158  SKAFHMAESLKSTETVTTSYNVMEQSNDSYWSVEDLWPVQLFNDD  202



>gb|KEH24806.1| myb transcription factor [Medicago truncatula]
Length=209

 Score = 66.2 bits (160),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 42/116 (36%), Positives = 60/116 (52%), Gaps = 16/116 (14%)
 Frame = +2

Query  2    PGRTDNEIKNYWRTRIQKHMKPQAAGGENAATRQSSSSCCGGEQASTSQASAPDTVETYS  181
            PGRTDNEIKN+WRTRIQKH+K      +N   + S       + +S+  ++  + +E+YS
Sbjct  99   PGRTDNEIKNFWRTRIQKHIKQVDHPHQNNFQQMSLEINDHHQSSSSQVSNIVEPMESYS  158

Query  182  PTSYASnnnnnnMDATFQQGPFATESNDN-----------MWSMEDLWSMHLLNAD  316
            P SY        ++    Q P   + + +            WSMED+WSM LLN D
Sbjct  159  PPSYQG-----TLEPFPAQFPTINDHHPSSCCTNDNNNNNYWSMEDIWSMQLLNGD  209



>ref|XP_006285780.1| hypothetical protein CARUB_v10007254mg [Capsella rubella]
 gb|EOA18678.1| hypothetical protein CARUB_v10007254mg [Capsella rubella]
Length=221

 Score = 65.9 bits (159),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 45/122 (37%), Positives = 63/122 (52%), Gaps = 22/122 (18%)
 Frame = +2

Query  2    PGRTDNEIKNYWRTRIQKHMKPQAAGGENAATRQSSSSCCGGEQASTSQASAPDTVE---  172
            PGRTDNEIKN+WRT+IQK++      GE   T    SS       +++     DT+E   
Sbjct  105  PGRTDNEIKNFWRTKIQKYI---IKNGETTTTAGLQSSEIMNHHVTSTSKVLNDTLEEPM  161

Query  173  -TYSP-TSYASnnnnnnMDATFQQGPFATESN------------DNMWSMEDLWSMHLLN  310
              YSP TSY   NN +++  ++  G +  ES+             N WS++DLW MHL N
Sbjct  162  DLYSPTTSYQYANNIDHLQLSY--GTYVPESDSIMMPLSIDQDVQNYWSVDDLWPMHLYN  219

Query  311  AD  316
             +
Sbjct  220  GN  221



>ref|XP_010925776.1| PREDICTED: myb-related protein 305-like [Elaeis guineensis]
Length=195

 Score = 65.5 bits (158),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 46/106 (43%), Positives = 59/106 (56%), Gaps = 9/106 (8%)
 Frame = +2

Query  2    PGRTDNEIKNYWRTRIQKHMKPQAAGGENAATRQSSSSCCGGEQASTSQASAPDTVETYS  181
            PGRTDNEIKNYWRTRIQK +K     GE+   +   +        ST+  S  ++VE  +
Sbjct  98   PGRTDNEIKNYWRTRIQKKVK----HGESFDYQH--AMVTDEASTSTTSTSQTNSVEDVA  151

Query  182  PTSYASnnnnnnMDATFQQGPF-ATESNDNMWSMEDLWSMHLLNAD  316
            P    S   +   D      PF +TES+DN W++ED WSMH LN D
Sbjct  152  PQ--PSYTEHQATDPHALAPPFSSTESSDNFWTVEDFWSMHSLNGD  195



>ref|XP_002875402.1| ATMYB21 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH51661.1| ATMYB21 [Arabidopsis lyrata subsp. lyrata]
Length=226

 Score = 65.9 bits (159),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 51/123 (41%), Positives = 65/123 (53%), Gaps = 19/123 (15%)
 Frame = +2

Query  2    PGRTDNEIKNYWRTRIQKHMKPQAAGGENAATRQSSSSCCGGEQASTSQASAPDT----V  169
            PGRTDNEIKN+WRTRIQK++K QA     ++     SS    + ASTS  +   T    +
Sbjct  105  PGRTDNEIKNFWRTRIQKYIK-QADVTTTSSVGSHHSSEINDQAASTSSHNVFCTQDQAM  163

Query  170  ETYS--PTSYASnnnnnnMDATFQQGPFAT-----------ESNDNMWSMEDLW-SMHLL  307
            ETYS  PTSY   N   N        P AT           ++ +N W M+D+W SMHLL
Sbjct  164  ETYSPTPTSYQHTNMEFNYGNYSAAAPTATVDYPIPMTVDDQTGENYWGMDDIWSSMHLL  223

Query  308  NAD  316
            N +
Sbjct  224  NGN  226



>gb|AEE37094.1| MYB transcription factor [Crocus sativus]
Length=196

 Score = 65.5 bits (158),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 41/110 (37%), Positives = 56/110 (51%), Gaps = 16/110 (15%)
 Frame = +2

Query  2    PGRTDNEIKNYWRTRIQKHMKPQAAGGENAATRQ-----SSSSCCGGEQASTSQASAPDT  166
            PGRTDNEIKNYWRTRIQK  K +    +N          +S S  G ++ +  Q+   D 
Sbjct  98   PGRTDNEIKNYWRTRIQKKTKSEPLDYQNQQMMMVDDASTSHSNNGIDEGNAQQSYQMDM  157

Query  167  VETYSPTSYASnnnnnnMDATFQQGPFATESNDNMWSMEDLWSMHLLNAD  316
                S ++ A           F    F+TES++N W++ED W+M  LN D
Sbjct  158  SNISSTSTDA-----------FAVPMFSTESSENFWTVEDFWTMQPLNGD  196



>ref|XP_010555954.1| PREDICTED: transcription factor MYB21-like [Tarenaya hassleriana]
Length=207

 Score = 65.1 bits (157),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 44/118 (37%), Positives = 66/118 (56%), Gaps = 23/118 (19%)
 Frame = +2

Query  2    PGRTDNEIKNYWRTRIQKHMKPQAAGGENAATRQSSSSCCGGEQASTSQ--ASAPDTVET  175
            PGRTDNEIKN+WRTR+QK++K QA    +  ++ S  +    +QA +SQ   +  +  ET
Sbjct  100  PGRTDNEIKNFWRTRVQKYIK-QAETTSSVGSQGSEIN----DQAGSSQIFGTQQEATET  154

Query  176  YSPTSYASnnnnnnMDATFQQGPFATE-----------SNDNMWSMEDLWSMHLLNAD  316
            Y PT+    N   N D+     P ++E           + +N W+M+D+WSM LLN +
Sbjct  155  YYPTTSYQGNMELNYDS-----PMSSEWLMPMPMQIDQTGENYWTMDDIWSMQLLNGN  207



>ref|XP_009419837.1| PREDICTED: myb-related protein 305-like [Musa acuminata subsp. 
malaccensis]
Length=196

 Score = 64.3 bits (155),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 41/113 (36%), Positives = 57/113 (50%), Gaps = 22/113 (19%)
 Frame = +2

Query  2    PGRTDNEIKNYWRTRIQKHMKP-QAAGGENAATRQSSSSCCGGEQASTSQASAP------  160
            PGRTDNEIKN+WRTRIQK +K  +  G +N      +S+       +T + + P      
Sbjct  98   PGRTDNEIKNFWRTRIQKKLKHGEPFGVQNVMLTDEASTSTTQVNTTTDEGAQPGAYTHM  157

Query  161  -DTVETYSPTSYASnnnnnnMDATFQQGPFATESNDNMWSMEDLWSMHLLNAD  316
             D  +T +P    S               F+TES+DN W+++D WSM  LN D
Sbjct  158  HDEQQTANPDGMISE--------------FSTESSDNFWTVDDFWSMPSLNGD  196



>ref|XP_006292470.1| hypothetical protein CARUB_v10018700mg [Capsella rubella]
 gb|EOA25368.1| hypothetical protein CARUB_v10018700mg [Capsella rubella]
Length=227

 Score = 64.7 bits (156),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 47/128 (37%), Positives = 65/128 (51%), Gaps = 27/128 (21%)
 Frame = +2

Query  2    PGRTDNEIKNYWRTRIQKHMKPQAAGGENAATRQSSSSCCGGEQASTSQASAPDT----V  169
            PGRTDNEIKN+WRTRIQK++K QA     ++     SS    + ASTS  +   T    +
Sbjct  104  PGRTDNEIKNFWRTRIQKYIK-QADATTTSSVGSHHSSEINDQAASTSSHNVFCTQDQAM  162

Query  170  ETYSPT----------------SYASnnnnnnMDATFQQGPFAT--ESNDNMWSMEDLW-  292
            ETYSPT                +Y++      +D      P     ++ +N W M+D+W 
Sbjct  163  ETYSPTPTSYQQHTNMEFNYGGNYSAAATTTTVDYPI---PMTVDDQTGENYWGMDDIWS  219

Query  293  SMHLLNAD  316
            SMHLLN +
Sbjct  220  SMHLLNGN  227



>ref|XP_009134610.1| PREDICTED: transcription factor MYB57-like [Brassica rapa]
 emb|CDX74303.1| BnaA03g27440D [Brassica napus]
Length=208

 Score = 63.9 bits (154),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 38/105 (36%), Positives = 54/105 (51%), Gaps = 10/105 (10%)
 Frame = +2

Query  2    PGRTDNEIKNYWRTRIQKHMKPQAAGGENAATRQSSSSCCGGEQASTSQASAPDTVETYS  181
            PGRTDNEIKN+WRT+IQ+HMK  ++   N      S  C G  Q+S    +   +    S
Sbjct  107  PGRTDNEIKNFWRTKIQRHMKLSSSKTMN------SRHCLGSSQSSVMTTTDQGSSSKAS  160

Query  182  PTSYASnnnnnnMDATFQQGPFATESNDNMWSMEDLWSMHLLNAD  316
              +  S  +   M  ++       + ND+ WS+EDLW + L N D
Sbjct  161  HMA-ESLKSTETMTTSYN---VMEQCNDSYWSVEDLWPVQLFNDD  201



>gb|AAC83592.1| putative transcription factor, partial [Arabidopsis thaliana]
Length=141

 Score = 63.2 bits (152),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 46/126 (37%), Positives = 65/126 (52%), Gaps = 25/126 (20%)
 Frame = +2

Query  2    PGRTDNEIKNYWRTRIQKHMKPQAAGGENAATRQSSSSCCGGEQASTSQASAPDT----V  169
            PGRTDNEIKN+WRTRIQK++K Q+     ++     SS    + ASTS  +   T    +
Sbjct  20   PGRTDNEIKNFWRTRIQKYIK-QSDVTTTSSVGSHHSSEINDQAASTSSHNVFCTQDQAM  78

Query  170  ETYSPT--------------SYASnnnnnnMDATFQQGPFAT--ESNDNMWSMEDLW-SM  298
            ETYSPT              +Y++      +D      P     ++ +N W M+D+W SM
Sbjct  79   ETYSPTPTSYQHTNMEFNYGNYSAAAVTATVDYPV---PMTVDDQTGENYWGMDDIWSSM  135

Query  299  HLLNAD  316
            HLLN +
Sbjct  136  HLLNGN  141



>emb|CDY49063.1| BnaC05g48910D [Brassica napus]
Length=207

 Score = 63.9 bits (154),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 38/109 (35%), Positives = 57/109 (52%), Gaps = 9/109 (8%)
 Frame = +2

Query  2    PGRTDNEIKNYWRTRIQKHMKPQAAGGENAATRQSSSSCCGGEQASTSQASAPDTVETYS  181
            PGRTDNEIKN+WRT+IQ+H+K  +     +    ++  C G  Q+S   A    T +  S
Sbjct  108  PGRTDNEIKNFWRTKIQRHVKFSS-----SVNTINTRHCSGNSQSSVITA----TDQGSS  158

Query  182  PTSYASnnnnnnMDATFQQGPFATESNDNMWSMEDLWSMHLLNAD*TLI  328
               +    +  +   T        +SND+ W++EDLW + LLN D  +I
Sbjct  159  SKGFDMAESLISPATTTTSFHMMEQSNDSYWNVEDLWPLQLLNGDHQVI  207



>ref|XP_009111584.1| PREDICTED: transcription factor MYB21 [Brassica rapa]
Length=232

 Score = 63.9 bits (154),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 49/130 (38%), Positives = 68/130 (52%), Gaps = 27/130 (21%)
 Frame = +2

Query  2    PGRTDNEIKNYWRTRIQKHMKPQAAGGENAATRQS-SSSCCGGEQASTSQASAPDT----  166
            PGRTDNEIKN+WRTRIQK++K         ++  S  SS    + ASTS  +   T    
Sbjct  105  PGRTDNEIKNFWRTRIQKYIKQTDVTATTTSSVGSHHSSEINDQVASTSNHNVFCTQDQA  164

Query  167  VETYSPTSYASnnnnnnMDATFQQ----GPFAT---------------ESNDNMWSMEDL  289
            +ETYSPT+  ++  + NMD  +      GP  T               ++ +N W M+D+
Sbjct  165  METYSPTT--TSYQHTNMDFNYGNFSAAGPTVTATTTADYSIPMTVDDQNGENYWGMDDI  222

Query  290  W-SMHLLNAD  316
            W SMHLLN +
Sbjct  223  WSSMHLLNGN  232



>emb|CDY37512.1| BnaA05g33770D [Brassica napus]
Length=201

 Score = 63.2 bits (152),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 40/113 (35%), Positives = 60/113 (53%), Gaps = 23/113 (20%)
 Frame = +2

Query  2    PGRTDNEIKNYWRTRIQKHMKPQAAGGENAATRQSSSSCCGGEQAS----TSQASAPDTV  169
            PGRTDNEIKN+WRT+IQ+H+K  ++   N     +   C G  Q+S    T Q S+   +
Sbjct  108  PGRTDNEIKNFWRTKIQRHVKMSSSKNTN-----NIRHCLGNSQSSVITATDQGSSSKGL  162

Query  170  ETYSPTSYASnnnnnnMDATFQQGPFATESNDNMWSMEDLWSMHLLNAD*TLI  328
               SP +  +         +F       +SND+ W++ED+W + LLN D  +I
Sbjct  163  --ISPATTTT---------SFH---VMEQSNDSYWNVEDIWPLQLLNDDHQVI  201



>ref|XP_009147443.1| PREDICTED: transcription factor MYB57-like [Brassica rapa]
Length=205

 Score = 63.2 bits (152),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 39/109 (36%), Positives = 58/109 (53%), Gaps = 23/109 (21%)
 Frame = +2

Query  2    PGRTDNEIKNYWRTRIQKHMKPQAAGGENAATRQSSSSCCGGEQAS----TSQASAPDTV  169
            PGRTDNEIKN+WRT+IQ+H+K  ++   N     +   C G  Q+S    T Q S+   +
Sbjct  108  PGRTDNEIKNFWRTKIQRHVKMSSSKNTN-----NIRHCLGNSQSSVITATDQGSSSKGL  162

Query  170  ETYSPTSYASnnnnnnMDATFQQGPFATESNDNMWSMEDLWSMHLLNAD  316
               SP +  +         +F       +SND+ W++ED+W + LLN D
Sbjct  163  --ISPATTTT---------SFH---VMEQSNDSYWNVEDIWPLQLLNDD  197



>ref|XP_006395401.1| hypothetical protein EUTSA_v10004857mg [Eutrema salsugineum]
 gb|ESQ32687.1| hypothetical protein EUTSA_v10004857mg [Eutrema salsugineum]
Length=233

 Score = 63.5 bits (153),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 42/129 (33%), Positives = 67/129 (52%), Gaps = 24/129 (19%)
 Frame = +2

Query  2    PGRTDNEIKNYWRTRIQKHMKPQAAGGENAATRQSSSSCCGGEQASTSQA-----SAPDT  166
            PGRTDNEIKN+WRTRIQK++K         ++  S  S    +QA+++ +     +    
Sbjct  105  PGRTDNEIKNFWRTRIQKYIKQTDVTTTTTSSVGSHQSSEINDQAASTTSHNVFCTQDQA  164

Query  167  VETYSPTSYASnnnnnnMD-ATFQQGPFAT-----------------ESNDNMWSMEDLW  292
            +ETYSPT+ +  + N   +   +  G ++T                 ++ +N W M+D+W
Sbjct  165  METYSPTTTSYQHTNMEFNYGNYSAGNYSTAGATATADYSVPMTVDDQTGENYWGMDDIW  224

Query  293  -SMHLLNAD  316
             SMHLLN +
Sbjct  225  SSMHLLNGN  233



>gb|AAB23527.1| Myb oncoprotein homolog {clone 305} [Antirrhinum majus]
Length=96

 Score = 61.2 bits (147),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 48/105 (46%), Positives = 56/105 (53%), Gaps = 21/105 (20%)
 Frame = +2

Query  38   RTRIQKHMKP---QAAGGENAATRQSSSSCCGGEQASTSQASAPDTV--------ETYSP  184
            RTRIQKHM+     ++   N        SC   +QAS+SQ SA   V         +YSP
Sbjct  1    RTRIQKHMEQGDQSSSTTFNNGQMNLDHSC--NDQASSSQMSACGPVVDHTAVDQSSYSP  58

Query  185  TSYASnnnnnnMDATFQQGPFATE-SNDNMWSMEDLWSMHLLNAD  316
             S+  N      D TFQ  PF T+ SNDNMWSMED WSM LLN D
Sbjct  59   HSFNGN------DHTFQ-APFPTDQSNDNMWSMEDFWSMQLLNGD  96



>emb|CDY20036.1| BnaA09g02150D [Brassica napus]
Length=232

 Score = 63.2 bits (152),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 49/132 (37%), Positives = 68/132 (52%), Gaps = 31/132 (23%)
 Frame = +2

Query  2    PGRTDNEIKNYWRTRIQKHMKPQAAGGENAATRQS-SSSCCGGEQASTSQASAPDT----  166
            PGRTDNEIKN+WRTRIQK++K         ++  S  SS    + ASTS  +   T    
Sbjct  105  PGRTDNEIKNFWRTRIQKYIKQTDVTATTTSSVGSHHSSEINDQVASTSNHNVFCTQDQA  164

Query  167  VETYSPTSYASnnnnnnMDATFQQGPFAT---------------------ESNDNMWSME  283
            +ETYSPT+  ++  + NMD  F  G F+                      ++ +N W M+
Sbjct  165  METYSPTT--TSYQHTNMD--FNYGNFSAAAATVTATTTADYSIPMTVDDQNGENYWGMD  220

Query  284  DLW-SMHLLNAD  316
            D+W SMHLLN +
Sbjct  221  DIWSSMHLLNGN  232



>ref|NP_189418.2| transcription factor MYB21 [Arabidopsis thaliana]
 sp|Q9LK95.1|MYB21_ARATH RecName: Full=Transcription factor MYB21; AltName: Full=Myb homolog 
3; Short=AtMyb3; AltName: Full=Myb-related protein 21; 
Short=AtMYB21 [Arabidopsis thaliana]
 dbj|BAB02527.1| ATMYB3 [Arabidopsis thaliana]
 dbj|BAC43048.1| putative myb family transcription factor Atmyb3 [Arabidopsis 
thaliana]
 gb|AAS10059.1| MYB transcription factor [Arabidopsis thaliana]
 dbj|BAH30473.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE77366.1| transcription factor MYB21 [Arabidopsis thaliana]
Length=226

 Score = 62.8 bits (151),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 46/126 (37%), Positives = 65/126 (52%), Gaps = 25/126 (20%)
 Frame = +2

Query  2    PGRTDNEIKNYWRTRIQKHMKPQAAGGENAATRQSSSSCCGGEQASTSQASAPDT----V  169
            PGRTDNEIKN+WRTRIQK++K Q+     ++     SS    + ASTS  +   T    +
Sbjct  105  PGRTDNEIKNFWRTRIQKYIK-QSDVTTTSSVGSHHSSEINDQAASTSSHNVFCTQDQAM  163

Query  170  ETYSPT--------------SYASnnnnnnMDATFQQGPFAT--ESNDNMWSMEDLW-SM  298
            ETYSPT              +Y++      +D      P     ++ +N W M+D+W SM
Sbjct  164  ETYSPTPTSYQHTNMEFNYGNYSAAAVTATVDYPV---PMTVDDQTGENYWGMDDIWSSM  220

Query  299  HLLNAD  316
            HLLN +
Sbjct  221  HLLNGN  226



>ref|XP_010554050.1| PREDICTED: transcription factor MYB21-like [Tarenaya hassleriana]
Length=202

 Score = 62.4 bits (150),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 43/116 (37%), Positives = 61/116 (53%), Gaps = 23/116 (20%)
 Frame = +2

Query  2    PGRTDNEIKNYWRTRIQKHMKPQAAGGENAATRQSSSSCCGGEQAS-------TSQASAP  160
            PGRTDNEIKN+WRTR+QK++K            QS ++   G Q S       +   SA 
Sbjct  99   PGRTDNEIKNFWRTRVQKYIK------------QSETTSSVGSQGSEINDQYPSHVFSAR  146

Query  161  DTVETYS-PTSYASnnnnnn---MDATFQQGPFATESNDNMWSMEDLWSMHLLNAD  316
            D +E YS  TSY  +   N+   M +         +  +N W+M+DLWSM LL+++
Sbjct  147  DAMEAYSTTTSYQGDMELNHSYPMSSVSPMSLTVDQPGENYWTMDDLWSMQLLDSN  202



>emb|CDX86471.1| BnaA06g31880D [Brassica napus]
Length=232

 Score = 62.8 bits (151),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 46/128 (36%), Positives = 61/128 (48%), Gaps = 23/128 (18%)
 Frame = +2

Query  2    PGRTDNEIKNYWRTRIQKHMKPQAAGGENAATRQSSSSCCGGEQASTSQASA----PDTV  169
            PGRTDNEIKN+WRTRIQK++K         ++  S SS      ASTS  +        +
Sbjct  105  PGRTDNEIKNFWRTRIQKYIKQTDVAATATSSVGSQSSEINDHAASTSAHNVFCAQDQAM  164

Query  170  ETYSPTS--------------YASnnnnnnMDATFQQGPFATESND----NMWSMEDLW-  292
            +TYSPT+              Y++        AT    P     +D    N W M+D+W 
Sbjct  165  DTYSPTTTSYQHTNMEFNYGNYSAPVAPVTTAATTADYPVPMTVDDQTGENYWGMDDIWS  224

Query  293  SMHLLNAD  316
            SMHLLN +
Sbjct  225  SMHLLNGN  232



>ref|XP_009151925.1| PREDICTED: transcription factor MYB21 [Brassica rapa]
Length=232

 Score = 62.4 bits (150),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 46/128 (36%), Positives = 61/128 (48%), Gaps = 23/128 (18%)
 Frame = +2

Query  2    PGRTDNEIKNYWRTRIQKHMKPQAAGGENAATRQSSSSCCGGEQASTSQASA----PDTV  169
            PGRTDNEIKN+WRTRIQK++K         ++  S SS      ASTS  +        +
Sbjct  105  PGRTDNEIKNFWRTRIQKYIKQTDVAATATSSVGSQSSEINDHAASTSAHNVFCAQDQAM  164

Query  170  ETYSPTS--------------YASnnnnnnMDATFQQGPFATESND----NMWSMEDLW-  292
            +TYSPT+              Y++        AT    P     +D    N W M+D+W 
Sbjct  165  DTYSPTTTSYQHTNMEFNYGNYSAPVAPVTTAATTADYPVPMTVDDQTGENYWGMDDIWS  224

Query  293  SMHLLNAD  316
            SMHLLN +
Sbjct  225  SMHLLNGN  232



>emb|CDY44433.1| BnaC07g24710D [Brassica napus]
Length=232

 Score = 62.4 bits (150),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 43/132 (33%), Positives = 63/132 (48%), Gaps = 31/132 (23%)
 Frame = +2

Query  2    PGRTDNEIKNYWRTRIQKHMKPQAAGGENAATRQSSSSCCGGEQASTSQASA----PDTV  169
            PGRTDNEIKN+WRTRIQK++K         ++  S SS      ASTS  +        +
Sbjct  105  PGRTDNEIKNFWRTRIQKYIKQTDVAATATSSVGSQSSEINDHAASTSAHNVFCAQDQAM  164

Query  170  ETYSPTSYASnnnnnnMDATFQQGPFAT----------------------ESNDNMWSME  283
            +TYSPT+     +  + +  F  G ++                       ++ +N W M+
Sbjct  165  DTYSPTT----TSYQHTNMEFNYGNYSAPVAPVTTAATTADYSVPMTVDDQTGENYWGMD  220

Query  284  DLW-SMHLLNAD  316
            D+W SMHLLN +
Sbjct  221  DIWSSMHLLNGN  232



>gb|AET25524.1| MYB1 [Brassica oleracea]
Length=232

 Score = 62.0 bits (149),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 44/132 (33%), Positives = 66/132 (50%), Gaps = 31/132 (23%)
 Frame = +2

Query  2    PGRTDNEIKNYWRTRIQKHMKPQAAGGENAATRQSSSSCCGGEQASTSQ-----ASAPDT  166
            PGRTDNEIKN+WRTRIQK++K         ++  S  S    +Q S++       +    
Sbjct  105  PGRTDNEIKNFWRTRIQKYIKQTDVTATTTSSVGSHHSSEINDQVSSTSNHNVFCTQDQA  164

Query  167  VETYSPTSYASnnnnnnMDATFQQGPFAT---------------------ESNDNMWSME  283
            +ETYSPT+  ++  + NMD  F  G ++                      ++ +N W M+
Sbjct  165  METYSPTT--TSYQHTNMD--FNYGNYSAAAATATATTTADYSIPMTVDDQTGENYWGMD  220

Query  284  DLW-SMHLLNAD  316
            D+W SMHLLN +
Sbjct  221  DIWSSMHLLNGN  232



>gb|ACL81164.1| MYB transcription factor [Mirabilis jalapa]
Length=209

 Score = 61.6 bits (148),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 40/112 (36%), Positives = 59/112 (53%), Gaps = 7/112 (6%)
 Frame = +2

Query  2    PGRTDNEIKNYWRTRIQKHMKP---QAAGGENAATRQSSSSCCGGEQASTSQASAPDTVE  172
            PGRTDNEIKNYWRTRIQKH+K     +  G+ +      +S    + ++ + +   D   
Sbjct  98   PGRTDNEIKNYWRTRIQKHLKRVENNSNSGQISPDHNDQASASHMQTSALTCSYTTDNDH  157

Query  173  TYSPTSYASnnnnnnMDATFQQG-PFATESNDNM-WSM--EDLWSMHLLNAD  316
             Y P    S+ +N  M+ ++        ++ND   W+   +DLWSM L NAD
Sbjct  158  AYMPCMSPSSYSNQAMEVSYMMNHHLQQDTNDQFCWTNPDQDLWSMQLFNAD  209



>ref|XP_010925788.1| PREDICTED: myb-related protein 305-like [Elaeis guineensis]
Length=201

 Score = 61.2 bits (147),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 40/105 (38%), Positives = 56/105 (53%), Gaps = 8/105 (8%)
 Frame = +2

Query  2    PGRTDNEIKNYWRTRIQKHMKPQAAGGENAATRQSSSSCCGGEQASTSQASAPDTVETYS  181
            PGRTD+EIKNYWRTRIQK +       E+  +     +    E ++++  S  ++VE   
Sbjct  105  PGRTDHEIKNYWRTRIQKRV-------EHGESFDYHQAMVIDEASASTITSQTNSVEDIG  157

Query  182  PTSYASnnnnnnMDATFQQGPFATESNDNMWSMEDLWSMHLLNAD  316
            P          N DA F     +TE ++N WS+EDLWSM  L+ D
Sbjct  158  PQPSYIERQAPNPDA-FAPHFSSTECSNNFWSVEDLWSMQSLSGD  201



>gb|AAM63674.1| putative transcription factor MYB24 [Arabidopsis thaliana]
Length=214

 Score = 61.2 bits (147),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 43/119 (36%), Positives = 63/119 (53%), Gaps = 20/119 (17%)
 Frame = +2

Query  2    PGRTDNEIKNYWRTRIQKHMKPQAAGGENAATRQSSSSCCGGEQASTSQA--SAPDTVET  175
            PGRTDNEIKN+WRT+IQK++      GE   T  S SS      A+TS       +T++ 
Sbjct  102  PGRTDNEIKNFWRTKIQKYI---IKSGE-TTTVGSQSSEFINHHATTSHVMNDTQETMDM  157

Query  176  YSPTSYASnnnnnnMDATFQQGPFATESN------------DNMWSMEDLWSMHLLNAD  316
            YSPT+  S  + +N++     G +  ES+             N WS++DLW M++ N +
Sbjct  158  YSPTT--SYQHASNINQQLNYGNYVPESSSIMMPLSVDQSEQNYWSVDDLWPMNIYNGN  214



>gb|KFK33688.1| hypothetical protein AALP_AA5G046900 [Arabis alpina]
Length=228

 Score = 61.6 bits (148),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 49/126 (39%), Positives = 65/126 (52%), Gaps = 23/126 (18%)
 Frame = +2

Query  2    PGRTDNEIKNYWRTRIQKHMKPQAAGGENAATRQSSSSCCGGEQASTSQASAPDT----V  169
            PGRTDNEIKN+WRTRIQK++K Q       ++  S  S    + ASTS  +   T    +
Sbjct  105  PGRTDNEIKNFWRTRIQKYIK-QDVTTTTTSSVGSGCSEINDQAASTSSHNVFCTQDQAM  163

Query  170  ETYSPTSYASnnnnnnMDATF------------QQGPFAT----ESNDNMWSMEDLW-SM  298
            ETYSPT+  S   + NMD  +               P       +S +N W M+D+W SM
Sbjct  164  ETYSPTT-TSYQQHPNMDFNYGNQYSAAATTATADYPIPMNVDDQSGENYWGMDDIWSSM  222

Query  299  HLLNAD  316
            HLLN +
Sbjct  223  HLLNGN  228



>ref|XP_010450678.1| PREDICTED: transcription factor MYB24-like [Camelina sativa]
Length=211

 Score = 61.2 bits (147),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 40/118 (34%), Positives = 55/118 (47%), Gaps = 22/118 (19%)
 Frame = +2

Query  2    PGRTDNEIKNYWRTRIQKHMKPQAAGGENAATRQSSSSCCGGEQASTSQA--SAPDTVET  175
            PGRTDNEIKN+WRT+IQK++      GE       SS        ST Q      + ++T
Sbjct  103  PGRTDNEIKNFWRTKIQKYI---IKNGETTTAGSQSSEIINHHATSTGQVLNDTQEPIDT  159

Query  176  YSP-----------TSYASnnnnnnMDATFQQGPFATESNDNMWSMEDLWSMHLLNAD  316
            YS             +Y   +++  M  +  Q      S  N WS++DLW MHL N +
Sbjct  160  YSQHANSIDHQLSYNTYVPESDSIMMPLSVDQ------SEQNYWSVDDLWPMHLYNGN  211



>ref|NP_198851.1| myb domain protein 24 [Arabidopsis thaliana]
 sp|Q9SPG9.1|MYB24_ARATH RecName: Full=Transcription factor MYB24; AltName: Full=Myb-related 
protein 24; Short=AtMYB24 [Arabidopsis thaliana]
 gb|AAD53092.1|AF175987_1 putative transcription factor [Arabidopsis thaliana]
 dbj|BAB11590.1| transcription factor [Arabidopsis thaliana]
 gb|AAS10102.1| MYB transcription factor [Arabidopsis thaliana]
 gb|AED94536.1| myb domain protein 24 [Arabidopsis thaliana]
Length=214

 Score = 61.2 bits (147),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 43/119 (36%), Positives = 62/119 (52%), Gaps = 20/119 (17%)
 Frame = +2

Query  2    PGRTDNEIKNYWRTRIQKHMKPQAAGGENAATRQSSSSCCGGEQASTSQA--SAPDTVET  175
            PGRTDNEIKN+WRT+IQK++      GE   T  S SS      A+TS       +T++ 
Sbjct  102  PGRTDNEIKNFWRTKIQKYI---IKSGE-TTTVGSQSSEFINHHATTSHVMNDTQETMDM  157

Query  176  YSPTSYASnnnnnnMDATFQQGPFATE------------SNDNMWSMEDLWSMHLLNAD  316
            YSPT+  S  + +N++     G +  E            S  N WS++DLW M++ N +
Sbjct  158  YSPTT--SYQHASNINQQLNYGNYVPESGSIMMPLSVDQSEQNYWSVDDLWPMNIYNGN  214



>ref|XP_008812482.1| PREDICTED: myb-related protein 305-like [Phoenix dactylifera]
Length=201

 Score = 60.5 bits (145),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 43/105 (41%), Positives = 57/105 (54%), Gaps = 8/105 (8%)
 Frame = +2

Query  2    PGRTDNEIKNYWRTRIQKHMKPQAAGGENAATRQSSSSCCGGEQASTSQASAPDTVETYS  181
            PGRTDNEIKNYWRTRIQK +K     GE+   +Q   +    E ++++  S  ++VE   
Sbjct  105  PGRTDNEIKNYWRTRIQKKVKQ----GESFDYQQ---AMVTDETSTSNSTSQTNSVEDVG  157

Query  182  PTSYASnnnnnnMDATFQQGPFATESNDNMWSMEDLWSMHLLNAD  316
                 +     N DA       +TES+DN WS+ED WSM   N D
Sbjct  158  LQPSYAQTQVTNPDALPPHFS-STESSDNFWSVEDFWSMQQFNGD  201



>ref|XP_010029159.1| PREDICTED: myb-related protein 340-like [Eucalyptus grandis]
 gb|KCW56012.1| hypothetical protein EUGRSUZ_I01782 [Eucalyptus grandis]
Length=208

 Score = 60.1 bits (144),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 44/105 (42%), Positives = 57/105 (54%), Gaps = 11/105 (10%)
 Frame = +2

Query  2    PGRTDNEIKNYWRTRIQKHMKPQAAGGENAATR-QSSSSCCGGEQASTSQASAPDTVETY  178
            PGRTDNEIKNYWRT+IQKH+  Q+    N  T   SS++ C   +      SA +T+E  
Sbjct  99   PGRTDNEIKNYWRTKIQKHIIKQSETEINDLTIPPSSANACTDHRG----VSAANTIEIA  154

Query  179  -SPTSYASnnnnnnMDATFQQGPFATESNDN-MWSMEDLWSMHLL  307
             SP S    +    + A     P A E ND+  WS+EDLW +  L
Sbjct  155  CSPPSDQGGSGETMLSAL----PPAQELNDSACWSVEDLWPIQSL  195



>ref|XP_009416734.1| PREDICTED: myb-related protein 305-like [Musa acuminata subsp. 
malaccensis]
Length=204

 Score = 58.5 bits (140),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 40/114 (35%), Positives = 49/114 (43%), Gaps = 28/114 (25%)
 Frame = +2

Query  2    PGRTDNEIKNYWRTRIQKHMKPQAAGG---------ENAATRQSSSSCCGGEQASTSQAS  154
            PGRTDNEIKNYWRTRIQK +K   +             A T Q++SS  G +Q S     
Sbjct  107  PGRTDNEIKNYWRTRIQKRVKRSESDDFQNAMLTDESGAGTSQTNSSNDGRDQPSHPDEQ  166

Query  155  APDTVETYSPTSYASnnnnnnMDATFQQGPFATESNDNMWSMEDLWSMHLLNAD  316
                 +   P                    F  ES+ N W+ ED WSM L + D
Sbjct  167  TATAADGVDPQ-------------------FPAESSYNFWTFEDFWSMQLPDDD  201



>ref|XP_010435910.1| PREDICTED: transcription factor MYB24-like [Camelina sativa]
Length=211

 Score = 58.2 bits (139),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 41/117 (35%), Positives = 53/117 (45%), Gaps = 20/117 (17%)
 Frame = +2

Query  2    PGRTDNEIKNYWRTRIQKHMKPQAAGGENAATRQSSSSCCGGEQASTSQASAPDTVETYS  181
            PGRTDNEIKN+WRT+IQK++      GE       SS        ST Q       +T  
Sbjct  103  PGRTDNEIKNFWRTKIQKYI---IKNGETTTAGSQSSEIINHHATSTGQV----LTDTQE  155

Query  182  PTSYASnnnnnnMDATFQQGPFATESN------------DNMWSMEDLWSMHLLNAD  316
            P    S  + NN+D       +  ES+             N WS++DLW MHL N +
Sbjct  156  PMDMYS-QHANNIDHQLSYDTYVPESDSIMMPLSVDQSEQNYWSVDDLWPMHLYNGN  211



>ref|XP_006655601.1| PREDICTED: transcription factor MYB21-like [Oryza brachyantha]
Length=235

 Score = 58.5 bits (140),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 46/129 (36%), Positives = 58/129 (45%), Gaps = 29/129 (22%)
 Frame = +2

Query  2    PGRTDNEIKNYWRTRIQKH---------------MKPQAAGGENA-ATRQSSSSCCGGEQ  133
            PGRTDNEIKN+WRT+IQK                ++P AAG   A A  Q SSS  G   
Sbjct  105  PGRTDNEIKNFWRTKIQKKHRRRTYGIHATTSESIRPAAAGYLTAVAEDQGSSSISGRTT  164

Query  134  ASTSQ---ASAPD--TVETYSPTSYASnnn----nnnMDATFQQGPFATESNDNMWSMED  286
               +Q    +AP   ++    P SY S  +     +          F   SNDN W +ED
Sbjct  165  VVVTQEYGIAAPQLGSLSLDHPASYPSAIHGGEGADAGGDIVVSEEFLAASNDNFWVLED  224

Query  287  LW----SMH  301
            LW    S+H
Sbjct  225  LWPTVQSLH  233



>ref|XP_010441167.1| PREDICTED: transcription factor MYB24-like [Camelina sativa]
Length=211

 Score = 57.4 bits (137),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 41/117 (35%), Positives = 53/117 (45%), Gaps = 20/117 (17%)
 Frame = +2

Query  2    PGRTDNEIKNYWRTRIQKHMKPQAAGGENAATRQSSSSCCGGEQASTSQASAPDTVETYS  181
            PGRTDNEIKN+WRT+IQK++      GE       SS        ST Q       +T  
Sbjct  103  PGRTDNEIKNFWRTKIQKYI---IKNGETTTAGSQSSEIINHHATSTGQVLN----DTQE  155

Query  182  PTSYASnnnnnnMDATFQQGPFATESNDNM------------WSMEDLWSMHLLNAD  316
            P    S  + NN+D       +  ES+  M            WS++DLW MHL N +
Sbjct  156  PMDMYS-QHANNIDHQLSYNTYVPESDSTMIPLSVDQSEQNYWSVDDLWPMHLYNGN  211



>dbj|BAA21618.1| ATMYB3 [Arabidopsis thaliana]
Length=226

 Score = 57.8 bits (138),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 45/126 (36%), Positives = 64/126 (51%), Gaps = 25/126 (20%)
 Frame = +2

Query  2    PGRTDNEIKNYWRTRIQKHMKPQAAGGENAATRQSSSSCCGGEQASTSQASAPDT----V  169
            PGRTDNEIKN+ RTRIQK++K Q+     ++     SS    + ASTS  +   T    +
Sbjct  105  PGRTDNEIKNFCRTRIQKYIK-QSDVTTTSSVGSHHSSEINDQAASTSSHNVFCTQDQAM  163

Query  170  ETYSPT--------------SYASnnnnnnMDATFQQGPFAT--ESNDNMWSMEDLW-SM  298
            ETYSPT              +Y++      +D      P     ++ +N W M+D+W SM
Sbjct  164  ETYSPTPTSYQHTNMEFNYGNYSAAAVTATVDYPV---PMTVDDQTGENYWGMDDIWSSM  220

Query  299  HLLNAD  316
            HLLN +
Sbjct  221  HLLNGN  226



>dbj|BAB40790.1| LhMyb [Lilium hybrid division I]
Length=184

 Score = 56.6 bits (135),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 41/100 (41%), Positives = 52/100 (52%), Gaps = 14/100 (14%)
 Frame = +2

Query  2    PGRTDNEIKNYWRTRIQKHMKPQAAGGENAATRQSSSSCCGGEQASTSQASAPDTVETYS  181
            PGRTDNEIKN+WRTR+QK  K       N  + +   S    E   TS     D     S
Sbjct  98   PGRTDNEIKNFWRTRVQKKSK-------NGESSEGQISMLSDE---TSAMQMEDVDVGVS  147

Query  182  PTSYASnnnnnnMDATFQQGPFATESNDNMWSMEDLWSMH  301
             TSY     +NN+DA   + PF  E  DN+ S+E+LW+M 
Sbjct  148  QTSYDQGQTSNNLDAF--EIPF--EPGDNLLSVEELWAMQ  183



>ref|XP_009406298.1| PREDICTED: myb-related protein 305-like [Musa acuminata subsp. 
malaccensis]
Length=195

 Score = 57.0 bits (136),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 39/103 (38%), Positives = 48/103 (47%), Gaps = 18/103 (17%)
 Frame = +2

Query  2    PGRTDNEIKNYWRTRIQKHMK----PQAAGGENAATRQSSSSCCGGEQASTSQASAPDTV  169
            PGRTDNEIKNYWRTRIQK +K    PQ           SS+S      A   Q S  D  
Sbjct  107  PGRTDNEIKNYWRTRIQKRVKQSDSPQFQNAILIDEANSSTSQTHIVDAGIVQPSLLD--  164

Query  170  ETYSPTSYASnnnnnnMDATFQQGPFATESNDNMWSMEDLWSM  298
                PT          M+    +  F  + +DN W+ ++LWSM
Sbjct  165  ---EPT---------IMNTDGIEPQFFIDFDDNFWTFDELWSM  195



>ref|XP_010677862.1| PREDICTED: myb-related protein 305-like [Beta vulgaris subsp. 
vulgaris]
Length=231

 Score = 57.0 bits (136),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 49/133 (37%), Positives = 65/133 (49%), Gaps = 30/133 (23%)
 Frame = +2

Query  2    PGRTDNEIKNYWRTRIQKHMK--PQAAGGENAATRQSSS-------SCCGGEQASTSQAS  154
            PGRTDNEIKNYWRTRIQKH+K    +       +RQ SS         C   Q ST+ AS
Sbjct  98   PGRTDNEIKNYWRTRIQKHLKQAESSTSTTTTTSRQMSSPDQNNHDQICAS-QMSTASAS  156

Query  155  APDT--------------VETYSPTSYASn-nnnnnMDAT-FQQGP--FATESNDNMWSM  280
             P T              + + S +SY    +++  M+AT +   P      +ND+ W  
Sbjct  157  TPSTHYISSSNNQNDPPYLPSISSSSYPHLDHHHQAMEATSYNIVPPQMHPVTNDHFWPT  216

Query  281  --EDLWSMHLLNA  313
              EDLW+M L N+
Sbjct  217  PDEDLWAMQLFNS  229



>ref|XP_003618205.1| MYB transcription factor, partial [Medicago truncatula]
Length=197

 Score = 55.8 bits (133),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 28/64 (44%), Positives = 40/64 (63%), Gaps = 0/64 (0%)
 Frame = +2

Query  2    PGRTDNEIKNYWRTRIQKHMKPQAAGGENAATRQSSSSCCGGEQASTSQASAPDTVETYS  181
            PGRTDNEIKN+WRTRIQKH+K      +N   + S       + +S+  ++  + +E+YS
Sbjct  120  PGRTDNEIKNFWRTRIQKHIKQVDHPHQNNFQQMSLEINDHHQSSSSQVSNIVEPMESYS  179

Query  182  PTSY  193
            P SY
Sbjct  180  PPSY  183



>ref|XP_009408723.1| PREDICTED: anthocyanin regulatory C1 protein-like [Musa acuminata 
subsp. malaccensis]
Length=179

 Score = 53.5 bits (127),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 25/39 (64%), Positives = 29/39 (74%), Gaps = 3/39 (8%)
 Frame = +2

Query  2    PGRTDNEIKNYWRTRIQKHMKPQAAGGENAATRQSSSSC  118
            PGRTDNEIKNYWRTR+QKH K + AGG   A R+  + C
Sbjct  17   PGRTDNEIKNYWRTRVQKHAKQRDAGG---AARRRWTPC  52



>gb|AGO33165.1| MYB transcription factor [Narcissus tazetta var. chinensis]
Length=210

 Score = 54.3 bits (129),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 39/105 (37%), Positives = 54/105 (51%), Gaps = 11/105 (10%)
 Frame = +2

Query  2    PGRTDNEIKNYWRTRIQKHMK---PQAAGGEN-AATRQSSSSCCGGEQASTSQASAPDTV  169
            PGRTDNEIKN+WRTRIQK  K   P    G+N   T +  +S   G      +   PD  
Sbjct  105  PGRTDNEIKNFWRTRIQKKTKQGEPFDQCGQNQMVTDEGGTSHSYGMDQDYGR---PDQQ  161

Query  170  ETYSPTSYASnnnnnnMDATFQQGPFAT-ESNDNMWSMEDLWSMH  301
            + Y      + ++    DA++     +T +S +N W+MED WSM 
Sbjct  162  QNYPMMDDGNTDSA---DASYSAPSLSTPDSTENFWTMEDFWSMQ  203



>dbj|BAL41446.1| transcription factor MYB21 [Linum grandiflorum]
Length=224

 Score = 53.9 bits (128),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 44/127 (35%), Positives = 56/127 (44%), Gaps = 35/127 (28%)
 Frame = +2

Query  2    PGRTDNEIKNYWRTRIQKHMKPQAAGGENAATRQSSSSCCGGEQ-----ASTSQASAPDT  166
            PGRTDNEIKNYWRTRIQKH+K      E  ++  SS    G +Q        +Q    + 
Sbjct  109  PGRTDNEIKNYWRTRIQKHLKQS----EQPSSSSSSPPGFGSDQYHQLETGHTQTQYHNN  164

Query  167  VETY--SPTSY----------------ASnnnnnnMDATFQQGPFATESNDNMWSMEDLW  292
            V T   S T Y                ++      MD +  +G          WSME+LW
Sbjct  165  VNTIDSSSTGYSHHYHGAGTMVAEASGSNTMTGMQMDQSSVEGRH--------WSMEELW  216

Query  293  SMHLLNA  313
            SM L N+
Sbjct  217  SMQLFNS  223



>ref|XP_010243072.1| PREDICTED: myb-related protein 305 [Nelumbo nucifera]
Length=150

 Score = 51.6 bits (122),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 20/21 (95%), Positives = 21/21 (100%), Gaps = 0/21 (0%)
 Frame = +2

Query  2   PGRTDNEIKNYWRTRIQKHMK  64
           PGRTDNEIKNYWRTRIQKH+K
Sbjct  71  PGRTDNEIKNYWRTRIQKHIK  91



>gb|KGN59677.1| hypothetical protein Csa_3G837580 [Cucumis sativus]
Length=65

 Score = 49.3 bits (116),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 28/52 (54%), Positives = 33/52 (63%), Gaps = 5/52 (10%)
 Frame = +2

Query  161  DTVETYSPTSYASnnnnnnMDATFQQGPFATESNDNMWSMEDLWSMHLLNAD  316
            D +ETYSP +Y+      N+DA     P    SNDN WSMEDLWSM LLNA+
Sbjct  19   DPMETYSPPTYS-----QNIDAFSVPLPPTDNSNDNYWSMEDLWSMQLLNAE  65



>gb|AAB23524.1| Myb oncoprotein homolog {clone 340} [Antirrhinum majus]
Length=88

 Score = 49.3 bits (116),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 39/91 (43%), Positives = 49/91 (54%), Gaps = 6/91 (7%)
 Frame = +2

Query  38   RTRIQKHMKPQAAGGENAATRQSSSSCCGGEQASTSQASAPDTVETYSPTSYASnnnnnn  217
            RTRIQKH+K   A        + S+     EQASTS  S+    + ++  SY+S+ N N 
Sbjct  1    RTRIQKHIKQAEASFIGHINPEHSN-----EQASTSLLSSSCHAD-HAVESYSSSFNGNM  54

Query  218  MDATFQQGPFATESNDNMWSMEDLWSMHLLN  310
             +       F TESND  WSMEDLWSM L N
Sbjct  55   GNNVQYPNHFPTESNDYFWSMEDLWSMQLPN  85



>emb|CDY00146.1| BnaC09g01550D [Brassica napus]
Length=166

 Score = 50.4 bits (119),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 37/107 (35%), Positives = 51/107 (48%), Gaps = 19/107 (18%)
 Frame = +2

Query  2    PGRTDNEIKNYWRTRIQKHMKPQAAGGENAATRQSSSSCCG-GEQASTSQASAPDTVETY  178
            PGRTDNEIKN+WRTRIQK++K          + Q ++     G  ++ +  +   T   Y
Sbjct  77   PGRTDNEIKNFWRTRIQKYIKQTDTYSPTTTSYQHTNMDFNYGNYSAAAATATATTTADY  136

Query  179  SPTSYASnnnnnnMDATFQQGPFATESNDNMWSMEDLW-SMHLLNAD  316
            S            M    Q G       +N W M+D+W SMHLLN +
Sbjct  137  S----------IPMTVDDQTG-------ENYWGMDDIWSSMHLLNGN  166



>ref|XP_008662919.1| PREDICTED: myb-like protein AA [Zea mays]
 gb|AFW57482.1| putative MYB DNA-binding domain superfamily protein [Zea mays]
 gb|AIB05202.1| MYB transcription factor, partial [Zea mays]
Length=406

 Score = 52.0 bits (123),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 32/74 (43%), Positives = 38/74 (51%), Gaps = 15/74 (20%)
 Frame = +2

Query  2    PGRTDNEIKNYWRTRIQKHMKPQAAGGENAATRQ--------------SSSSCCGGEQA-  136
            PGRTDNEIKNYWRTR+QKH K       +A  R                + + CGG QA 
Sbjct  147  PGRTDNEIKNYWRTRVQKHAKQLRCDVNSAHFRHIVRHVWMPRLLERAQADARCGGVQAP  206

Query  137  STSQASAPDTVETY  178
            +T+ ASAP     Y
Sbjct  207  ATTTASAPPACYNY  220



>ref|XP_006349959.1| PREDICTED: myb-related protein 315-like [Solanum tuberosum]
Length=175

 Score = 48.9 bits (115),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 19/21 (90%), Positives = 20/21 (95%), Gaps = 0/21 (0%)
 Frame = +2

Query  2   PGRTDNEIKNYWRTRIQKHMK  64
           PGRTDNEIKNYWRTR+QKH K
Sbjct  17  PGRTDNEIKNYWRTRVQKHAK  37



>gb|ACB59076.2| Myb-like transcription factor EOBI [Petunia x hybrida]
Length=105

 Score = 47.4 bits (111),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 19/19 (100%), Positives = 19/19 (100%), Gaps = 0/19 (0%)
 Frame = +2

Query  2    PGRTDNEIKNYWRTRIQKH  58
            PGRTDNEIKNYWRTRIQKH
Sbjct  87   PGRTDNEIKNYWRTRIQKH  105



>gb|AAC83631.1| putative transcription factor, partial [Arabidopsis thaliana]
Length=218

 Score = 49.3 bits (116),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 19/21 (90%), Positives = 20/21 (95%), Gaps = 0/21 (0%)
 Frame = +2

Query  2   PGRTDNEIKNYWRTRIQKHMK  64
           PGRTDNEIKNYWRTR+QKH K
Sbjct  22  PGRTDNEIKNYWRTRVQKHAK  42



>gb|EMT01874.1| Myb-related protein 305 [Aegilops tauschii]
Length=319

 Score = 49.7 bits (117),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 19/21 (90%), Positives = 20/21 (95%), Gaps = 0/21 (0%)
 Frame = +2

Query  2    PGRTDNEIKNYWRTRIQKHMK  64
            PGRTDNEIKNYWRTR+QKH K
Sbjct  105  PGRTDNEIKNYWRTRVQKHAK  125



>ref|XP_006649985.1| PREDICTED: myb-related protein MYBAS1-like [Oryza brachyantha]
Length=328

 Score = 49.7 bits (117),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 19/21 (90%), Positives = 20/21 (95%), Gaps = 0/21 (0%)
 Frame = +2

Query  2    PGRTDNEIKNYWRTRIQKHMK  64
            PGRTDNEIKNYWRTR+QKH K
Sbjct  105  PGRTDNEIKNYWRTRVQKHAK  125



>gb|ABH02913.1| MYB transcription factor MYB72 [Glycine max]
Length=153

 Score = 48.1 bits (113),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 19/21 (90%), Positives = 20/21 (95%), Gaps = 0/21 (0%)
 Frame = +2

Query  2    PGRTDNEIKNYWRTRIQKHMK  64
            PGRTDNEIKNYWRTR+QKH K
Sbjct  106  PGRTDNEIKNYWRTRVQKHAK  126



>gb|EAZ19253.1| hypothetical protein OsJ_34790 [Oryza sativa Japonica Group]
Length=184

 Score = 48.5 bits (114),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 19/21 (90%), Positives = 20/21 (95%), Gaps = 0/21 (0%)
 Frame = +2

Query  2    PGRTDNEIKNYWRTRIQKHMK  64
            PGRTDNEIKNYWRTR+QKH K
Sbjct  114  PGRTDNEIKNYWRTRVQKHAK  134



>ref|XP_006654961.1| PREDICTED: transcription factor MYB108-like [Oryza brachyantha]
Length=277

 Score = 49.3 bits (116),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 19/21 (90%), Positives = 20/21 (95%), Gaps = 0/21 (0%)
 Frame = +2

Query  2    PGRTDNEIKNYWRTRIQKHMK  64
            PGRTDNEIKNYWRTR+QKH K
Sbjct  116  PGRTDNEIKNYWRTRVQKHAK  136



>gb|KDO86883.1| hypothetical protein CISIN_1g043269mg, partial [Citrus sinensis]
Length=191

 Score = 48.5 bits (114),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 19/21 (90%), Positives = 20/21 (95%), Gaps = 0/21 (0%)
 Frame = +2

Query  2    PGRTDNEIKNYWRTRIQKHMK  64
            PGRTDNEIKNYWRTR+QKH K
Sbjct  109  PGRTDNEIKNYWRTRVQKHAK  129



>ref|NP_001140397.1| putative MYB DNA-binding domain superfamily protein [Zea mays]
 gb|ACF83741.1| unknown [Zea mays]
 gb|AFW88522.1| putative MYB DNA-binding domain superfamily protein [Zea mays]
Length=349

 Score = 49.3 bits (116),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 19/21 (90%), Positives = 20/21 (95%), Gaps = 0/21 (0%)
 Frame = +2

Query  2    PGRTDNEIKNYWRTRIQKHMK  64
            PGRTDNEIKNYWRTR+QKH K
Sbjct  105  PGRTDNEIKNYWRTRVQKHAK  125



>tpg|DAA47022.1| TPA: putative MYB DNA-binding domain superfamily protein [Zea 
mays]
Length=336

 Score = 49.3 bits (116),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 19/21 (90%), Positives = 20/21 (95%), Gaps = 0/21 (0%)
 Frame = +2

Query  2    PGRTDNEIKNYWRTRIQKHMK  64
            PGRTDNEIKNYWRTR+QKH K
Sbjct  125  PGRTDNEIKNYWRTRVQKHAK  145



>gb|EMS64823.1| Transcription factor MYB21 [Triticum urartu]
Length=300

 Score = 49.3 bits (116),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 19/21 (90%), Positives = 20/21 (95%), Gaps = 0/21 (0%)
 Frame = +2

Query  2    PGRTDNEIKNYWRTRIQKHMK  64
            PGRTDNEIKNYWRTR+QKH K
Sbjct  115  PGRTDNEIKNYWRTRVQKHAK  135



>ref|XP_006658986.1| PREDICTED: transcription factor MYB108-like [Oryza brachyantha]
Length=187

 Score = 48.5 bits (114),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 19/21 (90%), Positives = 20/21 (95%), Gaps = 0/21 (0%)
 Frame = +2

Query  2    PGRTDNEIKNYWRTRIQKHMK  64
            PGRTDNEIKNYWRTR+QKH K
Sbjct  100  PGRTDNEIKNYWRTRVQKHAK  120



>ref|NP_001060700.1| Os07g0688200 [Oryza sativa Japonica Group]
 dbj|BAF22614.1| Os07g0688200 [Oryza sativa Japonica Group]
 dbj|BAG96090.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|ADX60233.1| MYB transcription factor [Oryza sativa Japonica Group]
Length=300

 Score = 49.3 bits (116),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 19/21 (90%), Positives = 20/21 (95%), Gaps = 0/21 (0%)
 Frame = +2

Query  2    PGRTDNEIKNYWRTRIQKHMK  64
            PGRTDNEIKNYWRTR+QKH K
Sbjct  104  PGRTDNEIKNYWRTRVQKHAK  124



>dbj|BAC21351.1| putative typical P-type R2R3 Myb protein [Oryza sativa Japonica 
Group]
 dbj|BAD30303.1| putative typical P-type R2R3 Myb protein [Oryza sativa Japonica 
Group]
 gb|EAZ05206.1| hypothetical protein OsI_27405 [Oryza sativa Indica Group]
 gb|EAZ41155.1| hypothetical protein OsJ_25652 [Oryza sativa Japonica Group]
Length=298

 Score = 49.3 bits (116),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 19/21 (90%), Positives = 20/21 (95%), Gaps = 0/21 (0%)
 Frame = +2

Query  2    PGRTDNEIKNYWRTRIQKHMK  64
            PGRTDNEIKNYWRTR+QKH K
Sbjct  102  PGRTDNEIKNYWRTRVQKHAK  122



>gb|AEV91149.1| R2R3-MYB protein [Triticum aestivum]
Length=319

 Score = 49.3 bits (116),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 19/21 (90%), Positives = 20/21 (95%), Gaps = 0/21 (0%)
 Frame = +2

Query  2    PGRTDNEIKNYWRTRIQKHMK  64
            PGRTDNEIKNYWRTR+QKH K
Sbjct  105  PGRTDNEIKNYWRTRVQKHAK  125



>gb|AAL84762.1|AF474129_1 typical P-type R2R3 Myb protein [Sorghum bicolor]
Length=165

 Score = 48.1 bits (113),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 19/21 (90%), Positives = 20/21 (95%), Gaps = 0/21 (0%)
 Frame = +2

Query  2    PGRTDNEIKNYWRTRIQKHMK  64
            PGRTDNEIKNYWRTR+QKH K
Sbjct  90   PGRTDNEIKNYWRTRVQKHAK  110



>ref|XP_004984581.1| PREDICTED: myb-related protein P-like [Setaria italica]
Length=318

 Score = 49.3 bits (116),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 19/21 (90%), Positives = 20/21 (95%), Gaps = 0/21 (0%)
 Frame = +2

Query  2    PGRTDNEIKNYWRTRIQKHMK  64
            PGRTDNEIKNYWRTR+QKH K
Sbjct  105  PGRTDNEIKNYWRTRVQKHAK  125



>ref|XP_002465358.1| hypothetical protein SORBIDRAFT_01g037110 [Sorghum bicolor]
 gb|EER92356.1| hypothetical protein SORBIDRAFT_01g037110 [Sorghum bicolor]
Length=334

 Score = 49.3 bits (116),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 19/21 (90%), Positives = 20/21 (95%), Gaps = 0/21 (0%)
 Frame = +2

Query  2    PGRTDNEIKNYWRTRIQKHMK  64
            PGRTDNEIKNYWRTR+QKH K
Sbjct  103  PGRTDNEIKNYWRTRVQKHAK  123



>ref|NP_001170329.1| putative MYB DNA-binding domain superfamily protein [Zea mays]
 gb|ACN36641.1| unknown [Zea mays]
 tpg|DAA47021.1| TPA: putative MYB DNA-binding domain superfamily protein [Zea 
mays]
 gb|AIB05129.1| MYB transcription factor, partial [Zea mays]
Length=351

 Score = 49.3 bits (116),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 19/21 (90%), Positives = 20/21 (95%), Gaps = 0/21 (0%)
 Frame = +2

Query  2    PGRTDNEIKNYWRTRIQKHMK  64
            PGRTDNEIKNYWRTR+QKH K
Sbjct  140  PGRTDNEIKNYWRTRVQKHAK  160



>ref|XP_004962755.1| PREDICTED: transcription repressor MYB5-like [Setaria italica]
Length=294

 Score = 49.3 bits (116),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 19/21 (90%), Positives = 20/21 (95%), Gaps = 0/21 (0%)
 Frame = +2

Query  2    PGRTDNEIKNYWRTRIQKHMK  64
            PGRTDNEIKNYWRTR+QKH K
Sbjct  119  PGRTDNEIKNYWRTRVQKHAK  139



>gb|EAY89765.1| hypothetical protein OsI_11306 [Oryza sativa Indica Group]
Length=329

 Score = 49.3 bits (116),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 19/21 (90%), Positives = 20/21 (95%), Gaps = 0/21 (0%)
 Frame = +2

Query  2    PGRTDNEIKNYWRTRIQKHMK  64
            PGRTDNEIKNYWRTR+QKH K
Sbjct  105  PGRTDNEIKNYWRTRVQKHAK  125



>ref|NP_001049937.1| Os03g0315400 [Oryza sativa Japonica Group]
 gb|ABF95617.1| Myb-like DNA-binding domain containing protein, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF11851.1| Os03g0315400 [Oryza sativa Japonica Group]
 dbj|BAH00067.1| unnamed protein product [Oryza sativa Japonica Group]
Length=329

 Score = 49.3 bits (116),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 19/21 (90%), Positives = 20/21 (95%), Gaps = 0/21 (0%)
 Frame = +2

Query  2    PGRTDNEIKNYWRTRIQKHMK  64
            PGRTDNEIKNYWRTR+QKH K
Sbjct  105  PGRTDNEIKNYWRTRVQKHAK  125



>gb|AIS35932.1| MYB transcription factor 15, partial [Phalaenopsis equestris]
Length=126

 Score = 47.0 bits (110),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 19/21 (90%), Positives = 20/21 (95%), Gaps = 0/21 (0%)
 Frame = +2

Query  2   PGRTDNEIKNYWRTRIQKHMK  64
           PGRTDNEIKNYWRTRIQK +K
Sbjct  12  PGRTDNEIKNYWRTRIQKKVK  32



>gb|EAY83532.1| hypothetical protein OsI_38744 [Oryza sativa Indica Group]
Length=300

 Score = 48.9 bits (115),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 19/21 (90%), Positives = 20/21 (95%), Gaps = 0/21 (0%)
 Frame = +2

Query  2    PGRTDNEIKNYWRTRIQKHMK  64
            PGRTDNEIKNYWRTR+QKH K
Sbjct  142  PGRTDNEIKNYWRTRVQKHAK  162



>ref|XP_010237394.1| PREDICTED: transcription factor MYB108, partial [Brachypodium 
distachyon]
Length=228

 Score = 48.9 bits (115),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 19/21 (90%), Positives = 20/21 (95%), Gaps = 0/21 (0%)
 Frame = +2

Query  2    PGRTDNEIKNYWRTRIQKHMK  64
            PGRTDNEIKNYWRTR+QKH K
Sbjct  100  PGRTDNEIKNYWRTRVQKHAK  120



>ref|XP_008674336.1| PREDICTED: myb-related protein 305 [Zea mays]
 tpg|DAA55216.1| TPA: putative MYB DNA-binding domain superfamily protein [Zea 
mays]
 gb|AIB04809.1| MYB transcription factor, partial [Zea mays]
Length=324

 Score = 48.9 bits (115),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 19/21 (90%), Positives = 20/21 (95%), Gaps = 0/21 (0%)
 Frame = +2

Query  2    PGRTDNEIKNYWRTRIQKHMK  64
            PGRTDNEIKNYWRTR+QKH K
Sbjct  129  PGRTDNEIKNYWRTRVQKHAK  149



>gb|AFW60134.1| putative MYB DNA-binding domain superfamily protein [Zea mays]
Length=347

 Score = 49.3 bits (116),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 19/21 (90%), Positives = 20/21 (95%), Gaps = 0/21 (0%)
 Frame = +2

Query  2    PGRTDNEIKNYWRTRIQKHMK  64
            PGRTDNEIKNYWRTR+QKH K
Sbjct  138  PGRTDNEIKNYWRTRVQKHAK  158



>dbj|BAJ61447.1| R2R3-MYB transcription factor [Lupinus albus]
Length=250

 Score = 48.9 bits (115),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 19/21 (90%), Positives = 20/21 (95%), Gaps = 0/21 (0%)
 Frame = +2

Query  2   PGRTDNEIKNYWRTRIQKHMK  64
           PGRTDNEIKNYWRTR+QKH K
Sbjct  40  PGRTDNEIKNYWRTRVQKHAK  60



>gb|KHG22187.1| Myb-related protein [Gossypium arboreum]
Length=282

 Score = 48.9 bits (115),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 19/21 (90%), Positives = 20/21 (95%), Gaps = 0/21 (0%)
 Frame = +2

Query  2    PGRTDNEIKNYWRTRIQKHMK  64
            PGRTDNEIKNYWRTR+QKH K
Sbjct  88   PGRTDNEIKNYWRTRVQKHAK  108



>ref|XP_009416464.1| PREDICTED: myb-related protein 305-like [Musa acuminata subsp. 
malaccensis]
Length=270

 Score = 48.9 bits (115),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 19/21 (90%), Positives = 20/21 (95%), Gaps = 0/21 (0%)
 Frame = +2

Query  2    PGRTDNEIKNYWRTRIQKHMK  64
            PGRTDNEIKNYWRTR+QKH K
Sbjct  100  PGRTDNEIKNYWRTRVQKHAK  120



>ref|XP_003561685.1| PREDICTED: myb-related protein P-like [Brachypodium distachyon]
Length=327

 Score = 48.9 bits (115),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 19/21 (90%), Positives = 20/21 (95%), Gaps = 0/21 (0%)
 Frame = +2

Query  2    PGRTDNEIKNYWRTRIQKHMK  64
            PGRTDNEIKNYWRTR+QKH K
Sbjct  105  PGRTDNEIKNYWRTRVQKHAK  125



>ref|XP_008677864.1| PREDICTED: transcription factor MYB108-like [Zea mays]
 ref|XP_008677865.1| PREDICTED: transcription factor MYB108-like [Zea mays]
 gb|AFW60135.1| putative MYB DNA-binding domain superfamily protein [Zea mays]
 gb|AIB05905.1| MYB transcription factor, partial [Zea mays]
Length=352

 Score = 49.3 bits (116),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 19/21 (90%), Positives = 20/21 (95%), Gaps = 0/21 (0%)
 Frame = +2

Query  2    PGRTDNEIKNYWRTRIQKHMK  64
            PGRTDNEIKNYWRTR+QKH K
Sbjct  143  PGRTDNEIKNYWRTRVQKHAK  163



>emb|CBI22842.3| unnamed protein product [Vitis vinifera]
Length=306

 Score = 48.9 bits (115),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 19/21 (90%), Positives = 20/21 (95%), Gaps = 0/21 (0%)
 Frame = +2

Query  2    PGRTDNEIKNYWRTRIQKHMK  64
            PGRTDNEIKNYWRTR+QKH K
Sbjct  105  PGRTDNEIKNYWRTRVQKHAK  125



>ref|NP_001141891.1| putative MYB DNA-binding domain superfamily protein [Zea mays]
 gb|ACF87244.1| unknown [Zea mays]
 tpg|DAA45085.1| TPA: putative MYB DNA-binding domain superfamily protein [Zea 
mays]
Length=336

 Score = 48.9 bits (115),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 19/21 (90%), Positives = 20/21 (95%), Gaps = 0/21 (0%)
 Frame = +2

Query  2    PGRTDNEIKNYWRTRIQKHMK  64
            PGRTDNEIKNYWRTR+QKH K
Sbjct  106  PGRTDNEIKNYWRTRVQKHAK  126



>ref|NP_001267991.1| R2R3 transcription factor MYB108-like protein 1 [Vitis vinifera]
 gb|ACQ42220.1| R2R3 transcription factor MYB108-like protein 1 [Vitis vinifera]
Length=306

 Score = 48.9 bits (115),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 19/21 (90%), Positives = 20/21 (95%), Gaps = 0/21 (0%)
 Frame = +2

Query  2    PGRTDNEIKNYWRTRIQKHMK  64
            PGRTDNEIKNYWRTR+QKH K
Sbjct  105  PGRTDNEIKNYWRTRVQKHAK  125



>gb|ACF22737.1| Myb [Brachypodium distachyon]
Length=311

 Score = 48.9 bits (115),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 19/21 (90%), Positives = 20/21 (95%), Gaps = 0/21 (0%)
 Frame = +2

Query  2    PGRTDNEIKNYWRTRIQKHMK  64
            PGRTDNEIKNYWRTR+QKH K
Sbjct  96   PGRTDNEIKNYWRTRVQKHAK  116



>emb|CAN63179.1| hypothetical protein VITISV_029107 [Vitis vinifera]
Length=306

 Score = 48.9 bits (115),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 19/21 (90%), Positives = 20/21 (95%), Gaps = 0/21 (0%)
 Frame = +2

Query  2    PGRTDNEIKNYWRTRIQKHMK  64
            PGRTDNEIKNYWRTR+QKH K
Sbjct  105  PGRTDNEIKNYWRTRVQKHAK  125



>gb|EAY96442.1| hypothetical protein OsI_18339 [Oryza sativa Indica Group]
Length=311

 Score = 48.9 bits (115),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 19/21 (90%), Positives = 20/21 (95%), Gaps = 0/21 (0%)
 Frame = +2

Query  2    PGRTDNEIKNYWRTRIQKHMK  64
            PGRTDNEIKNYWRTR+QKH K
Sbjct  112  PGRTDNEIKNYWRTRVQKHAK  132



>emb|CCA29096.1| putative MYB transcription factor [Rosa rugosa]
Length=343

 Score = 48.9 bits (115),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 19/21 (90%), Positives = 20/21 (95%), Gaps = 0/21 (0%)
 Frame = +2

Query  2    PGRTDNEIKNYWRTRIQKHMK  64
            PGRTDNEIKNYWRTR+QKH K
Sbjct  112  PGRTDNEIKNYWRTRVQKHAK  132



>ref|XP_010666321.1| PREDICTED: transcription factor MYB108-like [Beta vulgaris subsp. 
vulgaris]
Length=310

 Score = 48.9 bits (115),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 19/21 (90%), Positives = 20/21 (95%), Gaps = 0/21 (0%)
 Frame = +2

Query  2    PGRTDNEIKNYWRTRIQKHMK  64
            PGRTDNEIKNYWRTR+QKH K
Sbjct  111  PGRTDNEIKNYWRTRVQKHAK  131



>gb|ABA98967.1| Myb-like DNA-binding domain containing protein, expressed [Oryza 
sativa Japonica Group]
 gb|EAZ20885.1| hypothetical protein OsJ_36524 [Oryza sativa Japonica Group]
Length=300

 Score = 48.9 bits (115),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 19/21 (90%), Positives = 20/21 (95%), Gaps = 0/21 (0%)
 Frame = +2

Query  2    PGRTDNEIKNYWRTRIQKHMK  64
            PGRTDNEIKNYWRTR+QKH K
Sbjct  142  PGRTDNEIKNYWRTRVQKHAK  162



>gb|EMS61349.1| Transcription factor MYB21 [Triticum urartu]
Length=225

 Score = 48.5 bits (114),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 19/21 (90%), Positives = 20/21 (95%), Gaps = 0/21 (0%)
 Frame = +2

Query  2   PGRTDNEIKNYWRTRIQKHMK  64
           PGRTDNEIKNYWRTR+QKH K
Sbjct  71  PGRTDNEIKNYWRTRVQKHAK  91



>gb|EEE62225.1| hypothetical protein OsJ_17012 [Oryza sativa Japonica Group]
Length=310

 Score = 48.9 bits (115),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 19/21 (90%), Positives = 20/21 (95%), Gaps = 0/21 (0%)
 Frame = +2

Query  2    PGRTDNEIKNYWRTRIQKHMK  64
            PGRTDNEIKNYWRTR+QKH K
Sbjct  112  PGRTDNEIKNYWRTRVQKHAK  132



>emb|CBH32532.1| Myb-like DNA-binding domain containing protein,expressed [Triticum 
aestivum]
 emb|CDM85577.1| unnamed protein product [Triticum aestivum]
Length=296

 Score = 48.9 bits (115),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 19/21 (90%), Positives = 20/21 (95%), Gaps = 0/21 (0%)
 Frame = +2

Query  2    PGRTDNEIKNYWRTRIQKHMK  64
            PGRTDNEIKNYWRTR+QKH K
Sbjct  112  PGRTDNEIKNYWRTRVQKHAK  132



>ref|XP_009151285.1| PREDICTED: transcription factor MYB108-like [Brassica rapa]
 ref|XP_009151286.1| PREDICTED: transcription factor MYB108-like [Brassica rapa]
Length=323

 Score = 48.9 bits (115),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 19/21 (90%), Positives = 20/21 (95%), Gaps = 0/21 (0%)
 Frame = +2

Query  2    PGRTDNEIKNYWRTRIQKHMK  64
            PGRTDNEIKNYWRTR+QKH K
Sbjct  111  PGRTDNEIKNYWRTRVQKHAK  131



>ref|XP_009392103.1| PREDICTED: protein ODORANT1-like [Musa acuminata subsp. malaccensis]
Length=348

 Score = 48.9 bits (115),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 19/21 (90%), Positives = 20/21 (95%), Gaps = 0/21 (0%)
 Frame = +2

Query  2    PGRTDNEIKNYWRTRIQKHMK  64
            PGRTDNEIKNYWRTR+QKH K
Sbjct  174  PGRTDNEIKNYWRTRVQKHAK  194



>gb|AIB05776.1| MYB transcription factor, partial [Zea mays]
Length=336

 Score = 48.9 bits (115),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 19/21 (90%), Positives = 20/21 (95%), Gaps = 0/21 (0%)
 Frame = +2

Query  2    PGRTDNEIKNYWRTRIQKHMK  64
            PGRTDNEIKNYWRTR+QKH K
Sbjct  106  PGRTDNEIKNYWRTRVQKHAK  126



>ref|XP_002451276.1| hypothetical protein SORBIDRAFT_05g026820 [Sorghum bicolor]
 gb|EES10264.1| hypothetical protein SORBIDRAFT_05g026820 [Sorghum bicolor]
Length=362

 Score = 48.9 bits (115),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 19/21 (90%), Positives = 20/21 (95%), Gaps = 0/21 (0%)
 Frame = +2

Query  2    PGRTDNEIKNYWRTRIQKHMK  64
            PGRTDNEIKNYWRTR+QKH K
Sbjct  150  PGRTDNEIKNYWRTRVQKHAK  170



>gb|EMT25040.1| Transcription factor MYB21 [Aegilops tauschii]
Length=267

 Score = 48.9 bits (115),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 19/21 (90%), Positives = 20/21 (95%), Gaps = 0/21 (0%)
 Frame = +2

Query  2    PGRTDNEIKNYWRTRIQKHMK  64
            PGRTDNEIKNYWRTR+QKH K
Sbjct  113  PGRTDNEIKNYWRTRVQKHAK  133



>ref|XP_007147396.1| hypothetical protein PHAVU_006G120800g [Phaseolus vulgaris]
 gb|ESW19390.1| hypothetical protein PHAVU_006G120800g [Phaseolus vulgaris]
Length=329

 Score = 48.9 bits (115),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 19/21 (90%), Positives = 20/21 (95%), Gaps = 0/21 (0%)
 Frame = +2

Query  2    PGRTDNEIKNYWRTRIQKHMK  64
            PGRTDNEIKNYWRTR+QKH K
Sbjct  108  PGRTDNEIKNYWRTRVQKHAK  128



>ref|XP_004963430.1| PREDICTED: transcription repressor MYB5-like [Setaria italica]
Length=326

 Score = 48.9 bits (115),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 19/21 (90%), Positives = 20/21 (95%), Gaps = 0/21 (0%)
 Frame = +2

Query  2    PGRTDNEIKNYWRTRIQKHMK  64
            PGRTDNEIKNYWRTR+QKH K
Sbjct  108  PGRTDNEIKNYWRTRVQKHAK  128



>ref|XP_004295042.1| PREDICTED: uncharacterized protein LOC101295899 [Fragaria vesca 
subsp. vesca]
Length=340

 Score = 48.9 bits (115),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 19/21 (90%), Positives = 20/21 (95%), Gaps = 0/21 (0%)
 Frame = +2

Query  2    PGRTDNEIKNYWRTRIQKHMK  64
            PGRTDNEIKNYWRTR+QKH K
Sbjct  114  PGRTDNEIKNYWRTRVQKHAK  134



>gb|EMT04483.1| Transcription factor MYB21 [Aegilops tauschii]
Length=281

 Score = 48.9 bits (115),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 19/21 (90%), Positives = 20/21 (95%), Gaps = 0/21 (0%)
 Frame = +2

Query  2    PGRTDNEIKNYWRTRIQKHMK  64
            PGRTDNEIKNYWRTR+QKH K
Sbjct  96   PGRTDNEIKNYWRTRVQKHAK  116



>dbj|BAJ91760.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=282

 Score = 48.9 bits (115),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 19/21 (90%), Positives = 20/21 (95%), Gaps = 0/21 (0%)
 Frame = +2

Query  2    PGRTDNEIKNYWRTRIQKHMK  64
            PGRTDNEIKNYWRTR+QKH K
Sbjct  128  PGRTDNEIKNYWRTRVQKHAK  148



>ref|NP_001042810.1| Os01g0298400 [Oryza sativa Japonica Group]
 dbj|BAB55768.1| putative typical P-type R2R3 Myb protein [Oryza sativa Japonica 
Group]
 dbj|BAB67851.1| putative typical P-type R2R3 Myb protein [Oryza sativa Japonica 
Group]
 dbj|BAF04724.1| Os01g0298400 [Oryza sativa Japonica Group]
 gb|EAZ11558.1| hypothetical protein OsJ_01424 [Oryza sativa Japonica Group]
 dbj|BAH01066.1| unnamed protein product [Oryza sativa Japonica Group]
Length=293

 Score = 48.9 bits (115),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 19/21 (90%), Positives = 20/21 (95%), Gaps = 0/21 (0%)
 Frame = +2

Query  2    PGRTDNEIKNYWRTRIQKHMK  64
            PGRTDNEIKNYWRTR+QKH K
Sbjct  106  PGRTDNEIKNYWRTRVQKHAK  126



>ref|XP_004967585.1| PREDICTED: myb-related protein Myb4-like [Setaria italica]
Length=291

 Score = 48.9 bits (115),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 18/21 (86%), Positives = 20/21 (95%), Gaps = 0/21 (0%)
 Frame = +2

Query  2    PGRTDNEIKNYWRTRIQKHMK  64
            PGRTDNE+KNYWRTR+QKH K
Sbjct  105  PGRTDNEVKNYWRTRVQKHAK  125



>ref|XP_010544950.1| PREDICTED: transcription factor MYB108-like [Tarenaya hassleriana]
Length=269

 Score = 48.9 bits (115),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 33/107 (31%), Positives = 52/107 (49%), Gaps = 21/107 (20%)
 Frame = +2

Query  2    PGRTDNEIKNYWRTRIQ---KHMKPQAAGGENAATR--------------QSSSSCCGGE  130
            PGRTDNEIKNYWRTR+Q   KH++ +        T               QSS+S C   
Sbjct  104  PGRTDNEIKNYWRTRVQKQAKHLRCEVDSSLFKETMRNVWMPRLLERIHAQSSASTCQTG  163

Query  131  QASTSQASAPDTVETYSPTSYASnnnnnnMDATFQQGPFATESNDNM  271
            +++ ++ S P     ++PTS    +   + D  F    F+  S++++
Sbjct  164  ESAVTEPSRP----VFAPTSEPGLDQFMSADQQFMASEFSAASSNSL  206



>ref|XP_008390410.1| PREDICTED: transcription factor MYB108-like [Malus domestica]
Length=353

 Score = 48.9 bits (115),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 19/21 (90%), Positives = 20/21 (95%), Gaps = 0/21 (0%)
 Frame = +2

Query  2    PGRTDNEIKNYWRTRIQKHMK  64
            PGRTDNEIKNYWRTR+QKH K
Sbjct  125  PGRTDNEIKNYWRTRVQKHAK  145



>ref|XP_009382479.1| PREDICTED: transcription factor MYB108-like [Musa acuminata subsp. 
malaccensis]
Length=264

 Score = 48.5 bits (114),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 19/21 (90%), Positives = 20/21 (95%), Gaps = 0/21 (0%)
 Frame = +2

Query  2    PGRTDNEIKNYWRTRIQKHMK  64
            PGRTDNEIKNYWRTR+QKH K
Sbjct  98   PGRTDNEIKNYWRTRVQKHAK  118



>ref|XP_009372081.1| PREDICTED: transcription factor MYB108 [Pyrus x bretschneideri]
Length=354

 Score = 48.9 bits (115),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 19/21 (90%), Positives = 20/21 (95%), Gaps = 0/21 (0%)
 Frame = +2

Query  2    PGRTDNEIKNYWRTRIQKHMK  64
            PGRTDNEIKNYWRTR+QKH K
Sbjct  125  PGRTDNEIKNYWRTRVQKHAK  145



>ref|XP_009799769.1| PREDICTED: transcription factor MYB108-like, partial [Nicotiana 
sylvestris]
Length=233

 Score = 48.5 bits (114),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 19/21 (90%), Positives = 20/21 (95%), Gaps = 0/21 (0%)
 Frame = +2

Query  2   PGRTDNEIKNYWRTRIQKHMK  64
           PGRTDNEIKNYWRTR+QKH K
Sbjct  56  PGRTDNEIKNYWRTRVQKHAK  76



>ref|XP_010237154.1| PREDICTED: transcription factor MYB108-like isoform X2 [Brachypodium 
distachyon]
Length=261

 Score = 48.5 bits (114),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 19/21 (90%), Positives = 20/21 (95%), Gaps = 0/21 (0%)
 Frame = +2

Query  2    PGRTDNEIKNYWRTRIQKHMK  64
            PGRTDNEIKNYWRTR+QKH K
Sbjct  104  PGRTDNEIKNYWRTRVQKHAK  124



>ref|XP_008340570.1| PREDICTED: transcription factor MYB108 [Malus domestica]
Length=296

 Score = 48.9 bits (115),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 19/21 (90%), Positives = 20/21 (95%), Gaps = 0/21 (0%)
 Frame = +2

Query  2   PGRTDNEIKNYWRTRIQKHMK  64
           PGRTDNEIKNYWRTR+QKH K
Sbjct  72  PGRTDNEIKNYWRTRVQKHAK  92



>ref|NP_001068466.2| Os11g0684000 [Oryza sativa Japonica Group]
 gb|AAK08983.1| Myb transcription factor JAMyb [Oryza sativa Japonica Group]
 gb|ABA95299.1| expressed protein [Oryza sativa Japonica Group]
 dbj|BAF28829.2| Os11g0684000 [Oryza sativa Japonica Group]
Length=285

 Score = 48.9 bits (115),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 19/21 (90%), Positives = 20/21 (95%), Gaps = 0/21 (0%)
 Frame = +2

Query  2    PGRTDNEIKNYWRTRIQKHMK  64
            PGRTDNEIKNYWRTR+QKH K
Sbjct  114  PGRTDNEIKNYWRTRVQKHAK  134



>ref|XP_010938192.1| PREDICTED: transcription factor MYB108-like [Elaeis guineensis]
Length=292

 Score = 48.9 bits (115),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 19/21 (90%), Positives = 20/21 (95%), Gaps = 0/21 (0%)
 Frame = +2

Query  2    PGRTDNEIKNYWRTRIQKHMK  64
            PGRTDNEIKNYWRTR+QKH K
Sbjct  114  PGRTDNEIKNYWRTRVQKHAK  134



>ref|XP_006488792.1| PREDICTED: transcription factor MYB108-like [Citrus sinensis]
Length=334

 Score = 48.9 bits (115),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 19/21 (90%), Positives = 20/21 (95%), Gaps = 0/21 (0%)
 Frame = +2

Query  2    PGRTDNEIKNYWRTRIQKHMK  64
            PGRTDNEIKNYWRTR+QKH K
Sbjct  113  PGRTDNEIKNYWRTRVQKHAK  133



>ref|XP_010045365.1| PREDICTED: transcription factor MYB108 [Eucalyptus grandis]
 gb|KCW87539.1| hypothetical protein EUGRSUZ_B03985 [Eucalyptus grandis]
Length=343

 Score = 48.9 bits (115),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 19/21 (90%), Positives = 20/21 (95%), Gaps = 0/21 (0%)
 Frame = +2

Query  2    PGRTDNEIKNYWRTRIQKHMK  64
            PGRTDNEIKNYWRTR+QKH K
Sbjct  107  PGRTDNEIKNYWRTRVQKHAK  127



>gb|KDO72049.1| hypothetical protein CISIN_1g019911mg [Citrus sinensis]
Length=334

 Score = 48.9 bits (115),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 19/21 (90%), Positives = 20/21 (95%), Gaps = 0/21 (0%)
 Frame = +2

Query  2    PGRTDNEIKNYWRTRIQKHMK  64
            PGRTDNEIKNYWRTR+QKH K
Sbjct  113  PGRTDNEIKNYWRTRVQKHAK  133



>gb|KGN57183.1| hypothetical protein Csa_3G168940 [Cucumis sativus]
Length=305

 Score = 48.9 bits (115),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 19/21 (90%), Positives = 20/21 (95%), Gaps = 0/21 (0%)
 Frame = +2

Query  2    PGRTDNEIKNYWRTRIQKHMK  64
            PGRTDNEIKNYWRTR+QKH K
Sbjct  108  PGRTDNEIKNYWRTRVQKHAK  128



>emb|CDX85422.1| BnaC07g27330D [Brassica napus]
Length=183

 Score = 47.8 bits (112),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 19/21 (90%), Positives = 20/21 (95%), Gaps = 0/21 (0%)
 Frame = +2

Query  2    PGRTDNEIKNYWRTRIQKHMK  64
            PGRTDNEIKNYWRTR+QKH K
Sbjct  111  PGRTDNEIKNYWRTRVQKHAK  131



>ref|XP_006644098.1| PREDICTED: transcription factor MYB108-like [Oryza brachyantha]
Length=306

 Score = 48.9 bits (115),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 19/21 (90%), Positives = 20/21 (95%), Gaps = 0/21 (0%)
 Frame = +2

Query  2    PGRTDNEIKNYWRTRIQKHMK  64
            PGRTDNEIKNYWRTR+QKH K
Sbjct  107  PGRTDNEIKNYWRTRVQKHAK  127



>ref|XP_006492457.1| PREDICTED: transcription factor MYB108-like [Citrus sinensis]
Length=289

 Score = 48.5 bits (114),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 19/21 (90%), Positives = 20/21 (95%), Gaps = 0/21 (0%)
 Frame = +2

Query  2    PGRTDNEIKNYWRTRIQKHMK  64
            PGRTDNEIKNYWRTR+QKH K
Sbjct  109  PGRTDNEIKNYWRTRVQKHAK  129



>ref|XP_004979993.1| PREDICTED: myb-related protein Zm38-like [Setaria italica]
Length=352

 Score = 48.9 bits (115),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 19/21 (90%), Positives = 20/21 (95%), Gaps = 0/21 (0%)
 Frame = +2

Query  2    PGRTDNEIKNYWRTRIQKHMK  64
            PGRTDNEIKNYWRTR+QKH K
Sbjct  150  PGRTDNEIKNYWRTRVQKHAK  170



>ref|XP_010314657.1| PREDICTED: ABA-induced MYB transcription factor isoform X2 [Solanum 
lycopersicum]
Length=235

 Score = 48.5 bits (114),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 19/21 (90%), Positives = 20/21 (95%), Gaps = 0/21 (0%)
 Frame = +2

Query  2    PGRTDNEIKNYWRTRIQKHMK  64
            PGRTDNEIKNYWRTR+QKH K
Sbjct  103  PGRTDNEIKNYWRTRVQKHAK  123



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 772903297860