BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c63613_g1_i1 len=325 path=[1:0-324]

Length=325
                                                                      Score     E

ref|XP_011099238.1|  PREDICTED: putative B3 domain-containing pro...  59.7    2e-08   
ref|XP_011099239.1|  PREDICTED: B3 domain-containing protein At1g...  56.6    2e-07   
emb|CDP02444.1|  unnamed protein product                              54.7    1e-06   
ref|XP_007047117.1|  Uncharacterized protein TCM_000520               53.9    3e-06   
ref|XP_011099307.1|  PREDICTED: B3 domain-containing protein Os08...  53.5    4e-06   
emb|CAN64872.1|  hypothetical protein VITISV_026093                   51.2    2e-05   Vitis vinifera
emb|CDP09639.1|  unnamed protein product                              48.5    5e-05   
gb|EYU45442.1|  hypothetical protein MIMGU_mgv11b014940mg             49.7    7e-05   
gb|EYU44339.1|  hypothetical protein MIMGU_mgv1a026884mg              48.9    8e-05   
emb|CDP02443.1|  unnamed protein product                              48.5    2e-04   
ref|XP_011099240.1|  PREDICTED: B3 domain-containing protein At3g...  48.1    3e-04   
ref|XP_010255061.1|  PREDICTED: B3 domain-containing protein Os01...  48.5    3e-04   
ref|XP_011085518.1|  PREDICTED: B3 domain-containing protein REM5...  47.4    4e-04   



>ref|XP_011099238.1| PREDICTED: putative B3 domain-containing protein At5g66980 [Sesamum 
indicum]
Length=265

 Score = 59.7 bits (143),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 29/62 (47%), Positives = 39/62 (63%), Gaps = 0/62 (0%)
 Frame = +1

Query  139  MASPPERRPSFFKVLNEDFSTLLRLPLLFTANYGKHLPEYPVLAIESGESWRVKIEEADE  318
            M+  P +RPSFFK+L  DF+  LRLPL+F+  YG  L     L   SG+ W VK+E+ DE
Sbjct  1    MSVKPNQRPSFFKILITDFTRRLRLPLVFSERYGSALRGSVRLRTSSGKIWFVKLEQKDE  60

Query  319  HQ  324
             +
Sbjct  61   KE  62



>ref|XP_011099239.1| PREDICTED: B3 domain-containing protein At1g49475-like [Sesamum 
indicum]
Length=246

 Score = 56.6 bits (135),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 28/61 (46%), Positives = 36/61 (59%), Gaps = 0/61 (0%)
 Frame = +1

Query  139  MASPPERRPSFFKVLNEDFSTLLRLPLLFTANYGKHLPEYPVLAIESGESWRVKIEEADE  318
            M   P+ +PSFFKVL +DF+  L LP +F   YG+ LP    L    GE+W VK+E  DE
Sbjct  1    MGRKPKAKPSFFKVLIKDFAQKLNLPPVFVQKYGRMLPGTAELRTSFGETWSVKLEIEDE  60

Query  319  H  321
             
Sbjct  61   K  61



>emb|CDP02444.1| unnamed protein product [Coffea canephora]
Length=258

 Score = 54.7 bits (130),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 25/53 (47%), Positives = 36/53 (68%), Gaps = 0/53 (0%)
 Frame = +1

Query  163  PSFFKVLNEDFSTLLRLPLLFTANYGKHLPEYPVLAIESGESWRVKIEEADEH  321
            PSFFKVL  D  ++LR+P LF + + + LP++ +L  +SGE+W VKI   DE 
Sbjct  4    PSFFKVLVHDSKSILRIPTLFVSRFEEILPQHALLKTKSGETWPVKIVRIDER  56



>ref|XP_007047117.1| Uncharacterized protein TCM_000520 [Theobroma cacao]
 gb|EOX91274.1| Uncharacterized protein TCM_000520 [Theobroma cacao]
Length=278

 Score = 53.9 bits (128),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 25/59 (42%), Positives = 34/59 (58%), Gaps = 0/59 (0%)
 Frame = +1

Query  139  MASPPERRPSFFKVLNEDFSTLLRLPLLFTANYGKHLPEYPVLAIESGESWRVKIEEAD  315
            MA  P++ PSFFKVL  DF   LR+P  F  N+  ++P    L   SG SWRV ++  +
Sbjct  6    MARKPKQNPSFFKVLIGDFVNKLRIPPAFVKNFQGNVPTNFTLKSNSGSSWRVTVQNTE  64



>ref|XP_011099307.1| PREDICTED: B3 domain-containing protein Os08g0324300-like [Sesamum 
indicum]
Length=308

 Score = 53.5 bits (127),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 27/62 (44%), Positives = 38/62 (61%), Gaps = 0/62 (0%)
 Frame = +1

Query  139  MASPPERRPSFFKVLNEDFSTLLRLPLLFTANYGKHLPEYPVLAIESGESWRVKIEEADE  318
            M+  P +RPSFFK+L  DF+  LR+P +F+  YG  L     L   SG+ W VK+E+ DE
Sbjct  59   MSLKPNQRPSFFKILIVDFTRRLRVPPVFSQRYGSALGGSVRLRNSSGKIWFVKLEQMDE  118

Query  319  HQ  324
             +
Sbjct  119  DE  120



>emb|CAN64872.1| hypothetical protein VITISV_026093 [Vitis vinifera]
Length=262

 Score = 51.2 bits (121),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/59 (42%), Positives = 33/59 (56%), Gaps = 0/59 (0%)
 Frame = +1

Query  139  MASPPERRPSFFKVLNEDFSTLLRLPLLFTANYGKHLPEYPVLAIESGESWRVKIEEAD  315
            MA  P R PSFFKVL  DF+  LR+P  F   + +      VL   +GESW V +++ D
Sbjct  1    MARGPRRNPSFFKVLIGDFTNKLRIPPAFMKKFRRMTFNNAVLKTVTGESWMVSVKQED  59



>emb|CDP09639.1| unnamed protein product [Coffea canephora]
Length=152

 Score = 48.5 bits (114),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 27/61 (44%), Positives = 34/61 (56%), Gaps = 0/61 (0%)
 Frame = +1

Query  139  MASPPERRPSFFKVLNEDFSTLLRLPLLFTANYGKHLPEYPVLAIESGESWRVKIEEADE  318
            M S  +  PSFFKVL   F + L +P LF   +   L E  +L I+SGE+W VKIE   E
Sbjct  1    MTSKAKASPSFFKVLVPGFYSKLSMPPLFWKTFEHLLAESALLQIKSGETWSVKIERIGE  60

Query  319  H  321
             
Sbjct  61   Q  61



>gb|EYU45442.1| hypothetical protein MIMGU_mgv11b014940mg [Erythranthe guttata]
Length=270

 Score = 49.7 bits (117),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 26/63 (41%), Positives = 38/63 (60%), Gaps = 1/63 (2%)
 Frame = +1

Query  133  TLMASPPERRPSFFKVL-NEDFSTLLRLPLLFTANYGKHLPEYPVLAIESGESWRVKIEE  309
            T M      +PSFF++L + DF+  L++PL F   +   L E   L I SGE+W VK+E+
Sbjct  58   TTMERKSTTKPSFFQILIHNDFTRSLKVPLAFGQKHKNILTENMRLRIGSGETWDVKVEQ  117

Query  310  ADE  318
            AD+
Sbjct  118  ADD  120



>gb|EYU44339.1| hypothetical protein MIMGU_mgv1a026884mg [Erythranthe guttata]
Length=228

 Score = 48.9 bits (115),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 26/62 (42%), Positives = 34/62 (55%), Gaps = 0/62 (0%)
 Frame = +1

Query  139  MASPPERRPSFFKVLNEDFSTLLRLPLLFTANYGKHLPEYPVLAIESGESWRVKIEEADE  318
            MA   + RPSFF VL +D+   L++P  F    G + PE   L    GE W VKIEE +E
Sbjct  1    MAMKKKNRPSFFAVLVQDYINKLQVPPAFVRKCGFNWPENAQLRTSCGEIWDVKIEEFNE  60

Query  319  HQ  324
             +
Sbjct  61   CK  62



>emb|CDP02443.1| unnamed protein product [Coffea canephora]
Length=265

 Score = 48.5 bits (114),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 27/61 (44%), Positives = 34/61 (56%), Gaps = 0/61 (0%)
 Frame = +1

Query  139  MASPPERRPSFFKVLNEDFSTLLRLPLLFTANYGKHLPEYPVLAIESGESWRVKIEEADE  318
            M S  +  PSFFKVL   F + L +P LF   +   L E  +L I+SGE+W VKIE   E
Sbjct  1    MTSKAKASPSFFKVLVPGFYSKLSMPPLFWKTFEHLLAESALLQIKSGETWSVKIERIGE  60

Query  319  H  321
             
Sbjct  61   Q  61



>ref|XP_011099240.1| PREDICTED: B3 domain-containing protein At3g17010-like [Sesamum 
indicum]
Length=263

 Score = 48.1 bits (113),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 26/64 (41%), Positives = 36/64 (56%), Gaps = 2/64 (3%)
 Frame = +1

Query  139  MASPPERRPSFFKV-LNEDFSTLLRLPLLFTANYGKHLPEYPV-LAIESGESWRVKIEEA  312
            M   P   PSFFK+ + +DF+  LR+P +F   +G  L    V L I SGE+W VK+E  
Sbjct  1    MGRKPNCMPSFFKIFITDDFTRQLRVPPVFVQKHGGCLTAENVKLRISSGETWDVKLERM  60

Query  313  DEHQ  324
            +  Q
Sbjct  61   NNEQ  64



>ref|XP_010255061.1| PREDICTED: B3 domain-containing protein Os01g0723500-like [Nelumbo 
nucifera]
Length=419

 Score = 48.5 bits (114),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 25/54 (46%), Positives = 35/54 (65%), Gaps = 1/54 (2%)
 Frame = +1

Query  160  RPSFFKVL-NEDFSTLLRLPLLFTANYGKHLPEYPVLAIESGESWRVKIEEADE  318
            RPSFFKVL   DFS LL +P LF  ++   +P+   L   +G+SW VK+++ DE
Sbjct  49   RPSFFKVLVAPDFSKLLGIPPLFIKHFNGSVPKRLTLRSPTGKSWPVKVKKIDE  102



>ref|XP_011085518.1| PREDICTED: B3 domain-containing protein REM5-like [Sesamum indicum]
Length=262

 Score = 47.4 bits (111),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 26/54 (48%), Positives = 31/54 (57%), Gaps = 0/54 (0%)
 Frame = +1

Query  160  RPSFFKVLNEDFSTLLRLPLLFTANYGKHLPEYPVLAIESGESWRVKIEEADEH  321
            RPSFFK L  DFST L +P+ F   +   L     L  ES ESW VKIE+ +E 
Sbjct  7    RPSFFKPLIGDFSTQLSIPVEFARRHKDMLHGKVCLVTESQESWAVKIEQVNER  60



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 522986485888