BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c6360_g2_i1 len=755 path=[735:0-754]

Length=755
                                                                      Score     E

ref|XP_009610044.1|  PREDICTED: uncharacterized protein LOC104103814    126   3e-32   
ref|XP_009612829.1|  PREDICTED: uncharacterized protein LOC104106054    117   1e-28   
ref|XP_009796302.1|  PREDICTED: uncharacterized protein LOC104242882    115   7e-28   
gb|EYU34447.1|  hypothetical protein MIMGU_mgv1a023553mg                114   9e-28   
ref|XP_011094663.1|  PREDICTED: uncharacterized protein LOC105174308    114   1e-27   
ref|XP_006354325.1|  PREDICTED: uncharacterized protein LOC102591579    112   8e-27   
ref|XP_003543482.1|  PREDICTED: uncharacterized protein LOC100814909    111   2e-26   
gb|ACJ83912.1|  unknown                                                 110   5e-26   Medicago truncatula
ref|XP_003606376.1|  hypothetical protein MTR_4g059320                  110   5e-26   
ref|XP_007150200.1|  hypothetical protein PHAVU_005G134900g             108   3e-25   
ref|XP_004487109.1|  PREDICTED: uncharacterized protein LOC101512341    107   5e-25   
ref|XP_003597242.1|  hypothetical protein MTR_2g094410                  107   5e-25   
ref|XP_003539761.1|  PREDICTED: uncharacterized protein LOC100812183    106   1e-24   
ref|XP_010689547.1|  PREDICTED: uncharacterized protein LOC104903237    106   2e-24   
gb|EYU36187.1|  hypothetical protein MIMGU_mgv1a015493mg                105   3e-24   
ref|XP_009597452.1|  PREDICTED: uncharacterized protein LOC104093419    105   3e-24   
ref|XP_010107536.1|  hypothetical protein L484_024389                   105   3e-24   
ref|XP_004241275.1|  PREDICTED: uncharacterized protein LOC101262623    105   3e-24   
ref|XP_002281329.1|  PREDICTED: uncharacterized protein LOC100258555    105   3e-24   Vitis vinifera
ref|XP_004246659.1|  PREDICTED: uncharacterized protein LOC101246954    105   4e-24   
ref|XP_009767681.1|  PREDICTED: uncharacterized protein LOC104218792    105   4e-24   
emb|CAN66257.1|  hypothetical protein VITISV_001236                     105   4e-24   Vitis vinifera
ref|XP_003540175.1|  PREDICTED: uncharacterized protein LOC100817341    104   5e-24   
ref|XP_007027332.1|  Uncharacterized protein TCM_022158                 104   8e-24   
gb|AFK43089.1|  unknown                                                 103   1e-23   
ref|XP_008391399.1|  PREDICTED: uncharacterized protein LOC103453622    103   2e-23   
ref|XP_006363694.1|  PREDICTED: uncharacterized protein LOC102595296    102   2e-23   
ref|XP_006365734.1|  PREDICTED: uncharacterized protein LOC102600128    103   2e-23   
gb|KDP44049.1|  hypothetical protein JCGZ_05516                         102   6e-23   
ref|XP_008243937.1|  PREDICTED: uncharacterized protein LOC103342133    102   6e-23   
ref|XP_008462513.1|  PREDICTED: uncharacterized protein LOC103500846    102   6e-23   
ref|XP_004139450.1|  PREDICTED: uncharacterized protein LOC101217269    102   7e-23   
ref|XP_004145741.1|  PREDICTED: uncharacterized protein LOC101215539    101   9e-23   
gb|KHN48294.1|  hypothetical protein glysoja_007963                     101   9e-23   
ref|XP_003542516.1|  PREDICTED: uncharacterized protein LOC100790091    102   1e-22   
ref|XP_008463944.1|  PREDICTED: uncharacterized protein LOC103501949    101   1e-22   
ref|XP_003537294.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    101   2e-22   
ref|XP_008225670.1|  PREDICTED: uncharacterized protein LOC103325290    100   2e-22   
ref|XP_008385317.1|  PREDICTED: uncharacterized protein LOC103447887    100   2e-22   
gb|KHN39078.1|  hypothetical protein glysoja_017372                     101   2e-22   
ref|XP_009593461.1|  PREDICTED: uncharacterized protein LOC104090119    100   2e-22   
ref|XP_010098187.1|  hypothetical protein L484_007649                   100   3e-22   
ref|XP_007207567.1|  hypothetical protein PRUPE_ppa016754mg             100   4e-22   
ref|XP_003538194.2|  PREDICTED: uncharacterized protein LOC100782946    100   4e-22   
gb|AFK48660.1|  unknown                                                 100   4e-22   
ref|XP_011044356.1|  PREDICTED: uncharacterized protein LOC105139576    100   5e-22   
gb|EYU38536.1|  hypothetical protein MIMGU_mgv1a018290mg              99.4    6e-22   
ref|XP_007206026.1|  hypothetical protein PRUPE_ppa012473mg           99.4    7e-22   
ref|XP_009787318.1|  PREDICTED: uncharacterized protein LOC104235292  99.0    1e-21   
ref|XP_011089296.1|  PREDICTED: uncharacterized protein LOC105170296  99.0    1e-21   
ref|XP_010483718.1|  PREDICTED: uncharacterized protein LOC104762175  99.0    1e-21   
gb|AFK46583.1|  unknown                                               99.0    1e-21   
ref|XP_004976251.1|  PREDICTED: uncharacterized protein LOC101760473  98.6    2e-21   
ref|XP_006428783.1|  hypothetical protein CICLE_v10012912mg           98.6    2e-21   
ref|XP_007016742.1|  Uncharacterized protein TCM_042056               98.6    2e-21   
ref|XP_009786538.1|  PREDICTED: uncharacterized protein LOC104234640  97.8    2e-21   
ref|XP_004291575.1|  PREDICTED: uncharacterized protein LOC101299444  98.2    2e-21   
ref|XP_008359263.1|  PREDICTED: uncharacterized protein LOC103422971  98.2    2e-21   
dbj|BAJ92790.1|  predicted protein                                    98.2    2e-21   
ref|XP_006481461.1|  PREDICTED: uncharacterized protein LOC102610402  98.2    3e-21   
ref|XP_007145215.1|  hypothetical protein PHAVU_007G220200g           98.2    3e-21   
ref|XP_004304430.1|  PREDICTED: uncharacterized protein LOC101312271  97.4    3e-21   
ref|XP_002314267.1|  hypothetical protein POPTR_0009s01960g           97.8    3e-21   Populus trichocarpa [western balsam poplar]
ref|XP_003625632.1|  hypothetical protein MTR_7g101250                97.4    3e-21   
ref|XP_010456667.1|  PREDICTED: transcription initiation factor T...  97.4    4e-21   
gb|AFK35468.1|  unknown                                               97.4    4e-21   
gb|KFK27594.1|  hypothetical protein AALP_AA8G404000                  97.1    4e-21   
gb|EPS62644.1|  hypothetical protein M569_12146                       96.7    5e-21   
ref|XP_006340195.1|  PREDICTED: uncharacterized protein LOC102589274  97.1    5e-21   
ref|XP_010043750.1|  PREDICTED: uncharacterized protein LOC104432877  97.4    5e-21   
ref|XP_006384902.1|  hypothetical protein POPTR_0004s22060g           96.3    6e-21   
gb|KDO73285.1|  hypothetical protein CISIN_1g031000mg                 96.7    6e-21   
ref|XP_010425942.1|  PREDICTED: uncharacterized protein LOC104710...  96.3    7e-21   
gb|KCW85739.1|  hypothetical protein EUGRSUZ_B02501                   98.2    7e-21   
gb|KDO45145.1|  hypothetical protein CISIN_1g030317mg                 97.1    7e-21   
ref|XP_010443870.1|  PREDICTED: transcription initiation factor T...  96.7    7e-21   
ref|XP_006281214.1|  hypothetical protein CARUB_v10027254mg           96.7    8e-21   
ref|XP_010503169.1|  PREDICTED: uncharacterized protein LOC104780370  96.3    8e-21   
ref|XP_010264683.1|  PREDICTED: uncharacterized protein LOC104602622  96.3    9e-21   
ref|XP_010514861.1|  PREDICTED: uncharacterized protein LOC104790774  95.9    1e-20   
ref|XP_010253678.1|  PREDICTED: uncharacterized protein LOC104594856  96.3    1e-20   
ref|XP_007162749.1|  hypothetical protein PHAVU_001G177200g           95.9    1e-20   
ref|XP_010046638.1|  PREDICTED: uncharacterized protein LOC104435621  95.9    1e-20   
ref|XP_011040881.1|  PREDICTED: uncharacterized protein LOC105137020  96.3    1e-20   
ref|XP_009400822.1|  PREDICTED: uncharacterized protein LOC103984958  95.9    1e-20   
emb|CDP06741.1|  unnamed protein product                              96.3    2e-20   
ref|XP_003580155.1|  PREDICTED: uncharacterized protein LOC100822702  95.9    2e-20   
gb|EYU18831.1|  hypothetical protein MIMGU_mgv1a015289mg              95.5    2e-20   
ref|XP_006424568.1|  hypothetical protein CICLE_v10029410mg           95.5    2e-20   
ref|XP_002877392.1|  hypothetical protein ARALYDRAFT_484911           94.7    2e-20   
ref|NP_001053333.1|  Os04g0520700                                     95.5    2e-20   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006292450.1|  hypothetical protein CARUB_v10018671mg           95.1    2e-20   
ref|XP_009381973.1|  PREDICTED: uncharacterized protein LOC103970065  95.1    3e-20   
gb|EPS60592.1|  hypothetical protein M569_14211                       94.7    3e-20   
gb|KFK33927.1|  hypothetical protein AALP_AA5G079000                  94.4    3e-20   
ref|XP_008387660.1|  PREDICTED: uncharacterized protein LOC103450120  95.1    3e-20   
ref|XP_010535607.1|  PREDICTED: uncharacterized protein LOC104810859  94.7    3e-20   
gb|EPS70245.1|  hypothetical protein M569_04515                       94.4    4e-20   
ref|XP_004251136.1|  PREDICTED: uncharacterized protein LOC101259309  94.7    4e-20   
ref|NP_200876.1|  uncharacterized protein                             94.4    4e-20   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002864697.1|  hypothetical protein ARALYDRAFT_496217           94.0    5e-20   
ref|XP_004493973.1|  PREDICTED: uncharacterized protein LOC101494881  94.0    5e-20   
ref|XP_010934341.1|  PREDICTED: uncharacterized protein LOC105054512  94.0    6e-20   
ref|XP_002519536.1|  conserved hypothetical protein                   94.0    7e-20   Ricinus communis
gb|AFW58878.1|  hypothetical protein ZEAMMB73_952839                  94.0    7e-20   
ref|XP_011007679.1|  PREDICTED: uncharacterized protein LOC105113274  94.0    8e-20   
gb|KHN02339.1|  hypothetical protein glysoja_002363                   92.8    9e-20   
ref|XP_003554378.1|  PREDICTED: uncharacterized protein LOC100808952  92.8    1e-19   
ref|NP_001144899.1|  uncharacterized protein LOC100278004             93.6    1e-19   Zea mays [maize]
ref|XP_008785283.1|  PREDICTED: uncharacterized protein LOC103703964  92.8    1e-19   
ref|XP_010543396.1|  PREDICTED: uncharacterized protein LOC104816337  93.2    1e-19   
gb|ACU21467.1|  unknown                                               92.8    1e-19   Glycine max [soybeans]
ref|NP_001144115.1|  uncharacterized protein LOC100276955             93.6    1e-19   Zea mays [maize]
tpg|DAA36906.1|  TPA: hypothetical protein ZEAMMB73_312513            93.2    2e-19   
ref|XP_007132259.1|  hypothetical protein PHAVU_011G079500g           92.8    2e-19   
ref|NP_001146522.1|  uncharacterized protein LOC100280113             92.8    2e-19   Zea mays [maize]
ref|XP_002285165.1|  PREDICTED: uncharacterized protein LOC100253658  92.4    2e-19   Vitis vinifera
emb|CAN61164.1|  hypothetical protein VITISV_001394                   92.4    2e-19   Vitis vinifera
ref|XP_010553009.1|  PREDICTED: uncharacterized protein LOC104823238  92.4    3e-19   
ref|XP_009367072.1|  PREDICTED: uncharacterized protein LOC103956768  92.4    3e-19   
ref|XP_008442681.1|  PREDICTED: uncharacterized protein LOC103486480  92.4    3e-19   
ref|XP_009126590.1|  PREDICTED: uncharacterized protein LOC103851491  91.7    4e-19   
ref|XP_004137823.1|  PREDICTED: uncharacterized protein LOC101217342  92.0    4e-19   
ref|XP_010037963.1|  PREDICTED: uncharacterized protein LOC104426559  92.0    4e-19   
ref|XP_008791539.1|  PREDICTED: uncharacterized protein LOC103708409  91.7    4e-19   
ref|XP_002322879.1|  hypothetical protein POPTR_0016s09110g           91.7    4e-19   Populus trichocarpa [western balsam poplar]
ref|XP_010920416.1|  PREDICTED: uncharacterized protein LOC105044291  91.3    5e-19   
ref|XP_009342883.1|  PREDICTED: uncharacterized protein LOC103934848  91.7    6e-19   
ref|XP_009120602.1|  PREDICTED: uncharacterized protein LOC103845482  91.3    6e-19   
emb|CDY65979.1|  BnaCnng49210D                                        90.9    7e-19   
ref|XP_004497503.1|  PREDICTED: uncharacterized protein LOC101503850  90.9    7e-19   
ref|XP_011048547.1|  PREDICTED: uncharacterized protein LOC105142559  90.9    1e-18   
ref|XP_009413717.1|  PREDICTED: uncharacterized protein LOC103994969  90.5    1e-18   
ref|XP_006381452.1|  hypothetical protein POPTR_0006s12970g           90.5    1e-18   
ref|XP_011089908.1|  PREDICTED: uncharacterized protein LOC105170718  90.1    1e-18   
ref|NP_190107.1|  uncharacterized protein                             89.7    1e-18   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002448198.1|  hypothetical protein SORBIDRAFT_06g022820        90.9    1e-18   Sorghum bicolor [broomcorn]
ref|XP_011089909.1|  PREDICTED: uncharacterized protein LOC105170719  89.4    2e-18   
ref|XP_003521393.2|  PREDICTED: uncharacterized protein LOC100786301  90.1    2e-18   
ref|XP_010520370.1|  PREDICTED: uncharacterized protein LOC104799504  89.4    3e-18   
gb|KDP29113.1|  hypothetical protein JCGZ_16502                       89.7    3e-18   
ref|XP_006400822.1|  hypothetical protein EUTSA_v10015882mg           89.4    3e-18   
gb|KFK24774.1|  hypothetical protein AALP_AA8G023000                  89.0    4e-18   
gb|KHN09502.1|  hypothetical protein glysoja_016601                   88.6    5e-18   
ref|XP_006295161.1|  hypothetical protein CARUB_v10024237mg           88.2    7e-18   
ref|XP_010510626.1|  PREDICTED: uncharacterized protein LOC104786871  88.2    7e-18   
ref|XP_010414527.1|  PREDICTED: uncharacterized protein LOC104700687  88.2    7e-18   
ref|XP_010470084.1|  PREDICTED: uncharacterized protein LOC104750056  87.4    1e-17   
ref|XP_006846774.1|  hypothetical protein AMTR_s00148p00028850        87.0    2e-17   
ref|XP_006288791.1|  hypothetical protein CARUB_v10002114mg           87.0    2e-17   
ref|NP_195943.1|  uncharacterized protein                             86.7    2e-17   Arabidopsis thaliana [mouse-ear cress]
gb|AAM62875.1|  unknown                                               86.7    2e-17   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004249833.1|  PREDICTED: uncharacterized protein LOC101261979  86.7    2e-17   
ref|XP_009387245.1|  PREDICTED: uncharacterized protein LOC103974208  86.7    3e-17   
ref|NP_180407.1|  uncharacterized protein                             86.7    3e-17   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010452194.1|  PREDICTED: uncharacterized protein LOC104734339  86.7    3e-17   
ref|XP_002871018.1|  hypothetical protein ARALYDRAFT_908188           86.7    3e-17   
ref|XP_010490791.1|  PREDICTED: uncharacterized protein LOC104768490  86.7    3e-17   
ref|XP_009140901.1|  PREDICTED: uncharacterized protein LOC103864886  86.3    3e-17   
ref|XP_004486158.1|  PREDICTED: uncharacterized protein LOC101500992  86.7    6e-17   
ref|XP_006398768.1|  hypothetical protein EUTSA_v10014814mg           85.9    6e-17   
emb|CDX77180.1|  BnaC04g39750D                                        85.5    7e-17   
ref|XP_010423745.1|  PREDICTED: uncharacterized protein LOC104708816  85.1    9e-17   
ref|XP_010521764.1|  PREDICTED: uncharacterized protein LOC104800605  84.7    1e-16   
ref|XP_006409865.1|  hypothetical protein EUTSA_v10017334mg           84.7    1e-16   
emb|CDY62461.1|  BnaA04g28420D                                        84.3    2e-16   
ref|XP_004982836.1|  PREDICTED: uncharacterized protein LOC101784168  84.7    2e-16   
ref|XP_002879098.1|  hypothetical protein ARALYDRAFT_481665           84.3    2e-16   
ref|XP_006653605.1|  PREDICTED: uncharacterized protein LOC102711064  83.2    2e-16   
ref|XP_001765057.1|  predicted protein                                83.6    3e-16   
ref|NP_001064875.2|  Os10g0481000                                     83.6    4e-16   Oryza sativa Japonica Group [Japonica rice]
gb|AFW68567.1|  hypothetical protein ZEAMMB73_025917                  83.6    4e-16   
ref|XP_010557316.1|  PREDICTED: uncharacterized protein LOC104826363  82.8    6e-16   
gb|AFK48551.1|  unknown                                               82.8    1e-15   
gb|KEH36847.1|  senescence regulator                                  82.8    1e-15   
ref|XP_008441099.1|  PREDICTED: uncharacterized protein LOC103485322  82.0    2e-15   
emb|CDX70321.1|  BnaA10g26700D                                        81.3    3e-15   
ref|XP_003610423.1|  hypothetical protein MTR_4g132020                81.3    3e-15   
ref|NP_001144892.1|  uncharacterized protein LOC100277997             81.3    3e-15   Zea mays [maize]
ref|XP_009122724.1|  PREDICTED: uncharacterized protein LOC103847398  81.3    4e-15   
ref|XP_007153942.1|  hypothetical protein PHAVU_003G078300g           81.6    4e-15   
ref|XP_006413702.1|  hypothetical protein EUTSA_v10027246mg           80.1    4e-15   
ref|XP_009614259.1|  PREDICTED: uncharacterized protein LOC104107229  81.3    4e-15   
ref|XP_003571889.1|  PREDICTED: uncharacterized protein LOC100830832  80.5    5e-15   
ref|XP_003529631.2|  PREDICTED: uncharacterized protein LOC100815796  81.3    5e-15   
ref|XP_006419060.1|  hypothetical protein EUTSA_v10002696mg           80.1    5e-15   
emb|CDY10396.1|  BnaCnng02970D                                        80.5    5e-15   
ref|XP_001783393.1|  predicted protein                                81.3    6e-15   
ref|XP_009785363.1|  PREDICTED: uncharacterized protein LOC104233638  80.5    6e-15   
ref|XP_011096069.1|  PREDICTED: uncharacterized protein LOC105175348  80.5    7e-15   
ref|XP_002464477.1|  hypothetical protein SORBIDRAFT_01g019100        80.1    7e-15   Sorghum bicolor [broomcorn]
ref|XP_010686848.1|  PREDICTED: uncharacterized protein LOC104901003  80.5    7e-15   
ref|XP_003550491.2|  PREDICTED: uncharacterized protein LOC100813375  80.5    8e-15   
ref|XP_006594426.1|  PREDICTED: uncharacterized protein LOC100798894  80.1    9e-15   
gb|EPS57709.1|  hypothetical protein M569_17108                       79.7    9e-15   
ref|XP_004507692.1|  PREDICTED: uncharacterized protein LOC101501221  79.3    1e-14   
ref|XP_004145178.1|  PREDICTED: uncharacterized protein LOC101209631  79.7    1e-14   
ref|XP_010425943.1|  PREDICTED: uncharacterized protein LOC104710...  78.2    2e-14   
ref|XP_003546150.1|  PREDICTED: uncharacterized protein LOC100796798  79.0    2e-14   
gb|ABK22020.1|  unknown                                               80.1    2e-14   Picea sitchensis
gb|ABK25188.1|  unknown                                               79.7    2e-14   Picea sitchensis
ref|XP_010093287.1|  hypothetical protein L484_006301                 79.3    2e-14   
gb|ABK26775.1|  unknown                                               80.1    2e-14   Picea sitchensis
ref|XP_010455755.1|  PREDICTED: uncharacterized protein LOC104737310  78.6    2e-14   
ref|XP_011086185.1|  PREDICTED: uncharacterized protein LOC105167985  79.0    3e-14   
ref|XP_004232713.1|  PREDICTED: uncharacterized protein LOC101253959  78.2    5e-14   
ref|XP_009130722.1|  PREDICTED: uncharacterized protein LOC103855485  77.4    5e-14   
emb|CDY11244.1|  BnaA03g00800D                                        77.4    5e-14   
ref|XP_006348114.1|  PREDICTED: uncharacterized protein LOC102595538  77.8    5e-14   
ref|NP_193928.2|  uncharacterized protein                             76.6    7e-14   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008806403.1|  PREDICTED: uncharacterized protein LOC103719105  77.0    8e-14   
ref|XP_006352633.1|  PREDICTED: SUN domain-containing protein 2-like  76.3    1e-13   
ref|XP_002274403.1|  PREDICTED: uncharacterized protein LOC100246942  77.0    1e-13   Vitis vinifera
ref|XP_003632945.1|  PREDICTED: uncharacterized protein LOC100855186  77.0    1e-13   
ref|XP_010432523.1|  PREDICTED: uncharacterized protein LOC104716776  76.3    1e-13   
gb|EYU27783.1|  hypothetical protein MIMGU_mgv1a024298mg              75.9    1e-13   
gb|KDP20752.1|  hypothetical protein JCGZ_21223                       77.0    1e-13   
ref|XP_011097873.1|  PREDICTED: uncharacterized protein LOC105176685  76.3    1e-13   
emb|CAA17164.1|  putative protein                                     77.0    2e-13   Arabidopsis thaliana [mouse-ear cress]
emb|CAA18100.1|  hypothetical protein                                 75.9    2e-13   Arabidopsis thaliana [mouse-ear cress]
emb|CDX80857.1|  BnaC03g01110D                                        75.9    2e-13   
ref|XP_002518486.1|  conserved hypothetical protein                   76.3    2e-13   Ricinus communis
ref|XP_010422288.1|  PREDICTED: uncharacterized protein LOC104707610  75.5    2e-13   
ref|NP_001144407.1|  uncharacterized protein LOC100277341             75.5    2e-13   Zea mays [maize]
ref|XP_009137232.1|  PREDICTED: uncharacterized protein LOC103861270  74.7    3e-13   
ref|XP_006285893.1|  hypothetical protein CARUB_v10007405mg           75.1    3e-13   
ref|XP_010276081.1|  PREDICTED: uncharacterized protein LOC104610921  75.9    3e-13   
ref|XP_002305577.1|  hypothetical protein POPTR_0004s01560g           75.9    3e-13   Populus trichocarpa [western balsam poplar]
ref|XP_007147731.1|  hypothetical protein PHAVU_006G150000g           76.3    3e-13   
ref|XP_006855856.1|  hypothetical protein AMTR_s00037p00097690        75.5    4e-13   
ref|XP_006288768.1|  hypothetical protein CARUB_v10002087mg           75.1    4e-13   
ref|XP_011037653.1|  PREDICTED: uncharacterized protein LOC105134801  75.5    4e-13   
ref|XP_004153812.1|  PREDICTED: uncharacterized protein LOC101208118  74.7    4e-13   
ref|XP_009597345.1|  PREDICTED: uncharacterized protein LOC104093319  75.1    4e-13   
ref|XP_004158009.1|  PREDICTED: uncharacterized protein LOC101225374  74.7    4e-13   
ref|XP_008441031.1|  PREDICTED: uncharacterized protein LOC103485264  74.7    5e-13   
emb|CDX94069.1|  BnaC07g37030D                                        74.3    5e-13   
ref|XP_007133098.1|  hypothetical protein PHAVU_011G151500g           73.9    5e-13   
emb|CDY16655.1|  BnaA09g20330D                                        74.3    6e-13   
ref|XP_002869851.1|  hypothetical protein ARALYDRAFT_492672           73.9    7e-13   
emb|CDX94568.1|  BnaC09g22680D                                        73.6    8e-13   
ref|XP_009114555.1|  PREDICTED: uncharacterized protein LOC103839822  73.9    8e-13   
ref|XP_006363108.1|  PREDICTED: uncharacterized protein LOC102599...  74.3    8e-13   
emb|CDY29096.1|  BnaC09g18220D                                        73.6    8e-13   
gb|KEH36866.1|  senescence regulator                                  73.6    9e-13   
ref|XP_008371092.1|  PREDICTED: uncharacterized protein LOC103434506  73.9    1e-12   
ref|XP_006449722.1|  hypothetical protein CICLE_v10016695mg           73.9    1e-12   
ref|XP_006389614.1|  hypothetical protein POPTR_0021s00640g           73.2    1e-12   
ref|XP_004231609.1|  PREDICTED: uncharacterized protein LOC101255844  73.9    1e-12   
ref|XP_006467441.1|  PREDICTED: uncharacterized protein LOC102607295  73.9    1e-12   
ref|XP_009780570.1|  PREDICTED: uncharacterized protein LOC104229610  73.9    1e-12   
ref|XP_008224827.1|  PREDICTED: uncharacterized protein LOC103324534  73.9    1e-12   
gb|KFK30976.1|  hypothetical protein AALP_AA6G052500                  73.2    1e-12   
ref|XP_004293285.1|  PREDICTED: uncharacterized protein LOC101291898  73.6    1e-12   
ref|XP_008439981.1|  PREDICTED: uncharacterized protein LOC103484606  73.6    2e-12   
ref|XP_004134758.1|  PREDICTED: uncharacterized protein LOC101218032  73.6    2e-12   
ref|XP_009357584.1|  PREDICTED: uncharacterized protein LOC103948301  73.6    2e-12   
ref|XP_004486164.1|  PREDICTED: uncharacterized protein LOC101503430  72.8    2e-12   
ref|XP_004155601.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  73.6    2e-12   
ref|XP_008384072.1|  PREDICTED: uncharacterized protein LOC103446718  73.6    2e-12   
ref|XP_010327173.1|  PREDICTED: uncharacterized protein LOC104649489  72.8    2e-12   
gb|EYU27793.1|  hypothetical protein MIMGU_mgv1a027068mg              73.6    2e-12   
ref|XP_007026065.1|  Uncharacterized protein TCM_030219               73.6    2e-12   
ref|XP_010057926.1|  PREDICTED: uncharacterized protein LOC104445711  73.6    2e-12   
emb|CBI26645.3|  unnamed protein product                              73.6    2e-12   
ref|XP_010923895.1|  PREDICTED: uncharacterized protein LOC105046857  73.2    2e-12   
gb|KHN37606.1|  hypothetical protein glysoja_007309                   72.8    2e-12   
ref|XP_003542862.1|  PREDICTED: uncharacterized protein LOC100796...  72.8    2e-12   
ref|XP_010436451.1|  PREDICTED: uncharacterized protein LOC104720202  72.8    2e-12   
ref|XP_006389626.1|  hypothetical protein POPTR_0021s00760g           73.2    2e-12   
gb|EYU33892.1|  hypothetical protein MIMGU_mgv1a013450mg              72.8    3e-12   
ref|XP_010538971.1|  PREDICTED: uncharacterized protein LOC104813134  72.0    4e-12   
ref|XP_006449732.1|  hypothetical protein CICLE_v10017735mg           72.0    4e-12   
ref|XP_002988196.1|  hypothetical protein SELMODRAFT_426954           72.8    5e-12   
ref|NP_567264.1|  uncharacterized protein                             71.6    5e-12   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010451289.1|  PREDICTED: uncharacterized protein LOC104733411  72.0    5e-12   
dbj|BAC43196.1|  unknown protein                                      71.6    5e-12   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002963487.1|  hypothetical protein SELMODRAFT_405391           72.8    5e-12   
ref|XP_004134973.1|  PREDICTED: uncharacterized protein LOC101209587  71.6    5e-12   
ref|XP_009135481.1|  PREDICTED: uncharacterized protein LOC103859660  71.2    5e-12   
gb|AAD29777.1|AF074021_9  hypothetical protein                        72.0    6e-12   
ref|XP_009360958.1|  PREDICTED: uncharacterized protein LOC103951301  71.6    6e-12   
ref|XP_011047992.1|  PREDICTED: uncharacterized protein LOC105142178  72.0    6e-12   
ref|XP_011047979.1|  PREDICTED: uncharacterized protein LOC105142...  71.6    7e-12   
ref|XP_011047980.1|  PREDICTED: uncharacterized protein LOC105142...  71.2    7e-12   
ref|XP_004155672.1|  PREDICTED: uncharacterized LOC101209587          71.2    9e-12   
ref|XP_003575409.1|  PREDICTED: uncharacterized protein LOC100843189  70.9    9e-12   
ref|XP_006413710.1|  hypothetical protein EUTSA_v10026386mg           70.9    1e-11   
ref|XP_006396678.1|  hypothetical protein EUTSA_v10029023mg           70.5    1e-11   
emb|CDX82889.1|  BnaC01g13390D                                        70.1    1e-11   
ref|XP_002874806.1|  hypothetical protein ARALYDRAFT_911721           70.1    1e-11   
ref|XP_008812625.1|  PREDICTED: uncharacterized protein LOC103723486  70.5    2e-11   
ref|XP_010278697.1|  PREDICTED: uncharacterized protein LOC104612810  70.9    2e-11   
ref|XP_008439987.1|  PREDICTED: uncharacterized protein LOC103484...  70.5    2e-11   
ref|XP_011037628.1|  PREDICTED: uncharacterized protein LOC105134789  70.5    2e-11   
gb|ABK21985.1|  unknown                                               70.1    2e-11   
gb|KDP20742.1|  hypothetical protein JCGZ_21213                       70.1    2e-11   
ref|XP_008439986.1|  PREDICTED: uncharacterized protein LOC103484...  70.1    2e-11   
ref|XP_010092201.1|  hypothetical protein L484_013519                 70.1    2e-11   
ref|NP_001047490.1|  Os02g0629000                                     69.7    2e-11   
gb|EAY86776.1|  hypothetical protein OsI_08156                        69.7    2e-11   
gb|ABR17234.1|  unknown                                               69.7    2e-11   
ref|XP_011075923.1|  PREDICTED: uncharacterized protein LOC105160301  70.1    2e-11   
ref|XP_010439392.1|  PREDICTED: uncharacterized protein LOC104722843  69.3    3e-11   
ref|XP_006647550.1|  PREDICTED: uncharacterized protein LOC102719835  69.3    3e-11   
gb|ABK26383.1|  unknown                                               68.9    4e-11   
ref|XP_010052849.1|  PREDICTED: ATPase family AAA domain-containi...  68.9    5e-11   
ref|XP_002305570.1|  hypothetical protein POPTR_0004s01400g           68.9    5e-11   
ref|XP_009388876.1|  PREDICTED: uncharacterized protein LOC103975590  67.8    9e-11   
ref|XP_009588594.1|  PREDICTED: uncharacterized protein LOC104086119  68.9    9e-11   
gb|EMS62714.1|  hypothetical protein TRIUR3_31419                     66.2    1e-10   
gb|AEW08416.1|  hypothetical protein 2_9289_01                        65.9    1e-10   
ref|XP_010933792.1|  PREDICTED: uncharacterized protein LOC105054085  68.2    1e-10   
ref|XP_010052839.1|  PREDICTED: uncharacterized protein LOC104441399  68.2    1e-10   
ref|XP_009389297.1|  PREDICTED: uncharacterized protein LOC103975895  68.9    2e-10   
ref|XP_011096060.1|  PREDICTED: uncharacterized protein LOC105175340  67.4    2e-10   
emb|CDX79110.1|  BnaA01g11770D                                        67.4    2e-10   
emb|CDP05737.1|  unnamed protein product                              67.4    2e-10   
ref|XP_004293291.1|  PREDICTED: uncharacterized protein LOC101293662  67.0    2e-10   
emb|CDY34631.1|  BnaC08g41900D                                        67.8    2e-10   
emb|CDX82885.1|  BnaC01g13350D                                        67.0    2e-10   
ref|XP_004957861.1|  PREDICTED: uncharacterized protein LOC101756704  67.4    2e-10   
ref|XP_009769824.1|  PREDICTED: uncharacterized protein LOC104220620  66.2    2e-10   
ref|XP_010675727.1|  PREDICTED: uncharacterized protein LOC104891692  67.0    3e-10   
ref|XP_010545225.1|  PREDICTED: uncharacterized protein LOC104817669  66.2    3e-10   
ref|XP_009113110.1|  PREDICTED: uncharacterized protein LOC103838426  67.0    3e-10   
emb|CDY12918.1|  BnaA09g13560D                                        67.0    3e-10   
ref|XP_006849119.1|  hypothetical protein AMTR_s00027p00044330        67.0    3e-10   
ref|NP_172635.1|  uncharacterized protein                             67.0    3e-10   
emb|CBI23059.3|  unnamed protein product                              66.2    3e-10   
ref|XP_009599011.1|  PREDICTED: uncharacterized protein LOC104094737  65.9    3e-10   
gb|AFG68833.1|  hypothetical protein 2_9289_01                        64.7    4e-10   
gb|AEW08415.1|  hypothetical protein 2_9289_01                        64.7    4e-10   
ref|XP_002889889.1|  hypothetical protein ARALYDRAFT_471309           66.6    4e-10   
ref|XP_008224856.1|  PREDICTED: uncharacterized protein LOC103324562  63.5    4e-10   
ref|XP_009389746.1|  PREDICTED: uncharacterized protein LOC103976267  66.2    5e-10   
ref|XP_010438678.1|  PREDICTED: uncharacterized protein LOC104722238  65.5    5e-10   
dbj|BAJ96673.1|  predicted protein                                    65.9    5e-10   
tpg|DAA40985.1|  TPA: hypothetical protein ZEAMMB73_135782            66.2    5e-10   
ref|XP_004244111.1|  PREDICTED: phospholipase D C-like                66.2    5e-10   
ref|XP_002971509.1|  hypothetical protein SELMODRAFT_95729            65.1    5e-10   
ref|XP_010644457.1|  PREDICTED: uncharacterized protein LOC104877592  66.2    5e-10   
gb|KFK28777.1|  hypothetical protein AALP_AA7G046300                  65.9    5e-10   
ref|XP_006346209.1|  PREDICTED: uncharacterized protein LOC102579297  66.2    5e-10   
ref|XP_010448192.1|  PREDICTED: uncharacterized protein LOC104730697  65.5    5e-10   
gb|AFG64465.1|  hypothetical protein 2_9187_01                        64.3    5e-10   
ref|XP_010929998.1|  PREDICTED: uncharacterized protein LOC105051322  66.2    5e-10   
ref|NP_001168585.1|  hypothetical protein                             65.9    6e-10   
ref|XP_009382720.1|  PREDICTED: uncharacterized protein LOC103970604  65.5    6e-10   
ref|XP_010686835.1|  PREDICTED: probable serine/threonine-protein...  66.2    6e-10   
ref|XP_002462928.1|  hypothetical protein SORBIDRAFT_02g034690        65.9    6e-10   
ref|XP_010458577.1|  PREDICTED: uncharacterized protein LOC104739816  65.9    6e-10   
gb|ABK21247.1|  unknown                                               65.9    6e-10   
gb|KHN35738.1|  hypothetical protein glysoja_039524                   65.5    7e-10   
ref|XP_006305623.1|  hypothetical protein CARUB_v10010311mg           66.2    7e-10   
ref|XP_010493172.1|  PREDICTED: uncharacterized protein LOC104770441  65.9    7e-10   
gb|EAZ40012.1|  hypothetical protein OsJ_24450                        65.5    7e-10   
ref|XP_003563024.1|  PREDICTED: uncharacterized protein LOC100822827  65.5    7e-10   
gb|KFK40634.1|  hypothetical protein AALP_AA2G022100                  65.9    7e-10   
ref|XP_009780243.1|  PREDICTED: uncharacterized protein LOC104229316  65.9    7e-10   
gb|AFG64475.1|  hypothetical protein 2_9187_01                        64.3    7e-10   
ref|XP_010476104.1|  PREDICTED: uncharacterized protein LOC104755423  65.9    7e-10   
gb|EYU33646.1|  hypothetical protein MIMGU_mgv1a022006mg              65.1    8e-10   
ref|XP_006468189.1|  PREDICTED: uncharacterized protein LOC102613705  65.5    8e-10   
ref|XP_002987983.1|  hypothetical protein SELMODRAFT_426737           65.9    8e-10   
gb|KDO78234.1|  hypothetical protein CISIN_1g029439mg                 65.5    8e-10   
emb|CDY19509.1|  BnaC09g13940D                                        65.5    9e-10   
gb|EAZ04057.1|  hypothetical protein OsI_26194                        65.5    9e-10   
emb|CAN77892.1|  hypothetical protein VITISV_016272                   65.9    9e-10   
ref|XP_009357457.1|  PREDICTED: uncharacterized protein LOC103948180  65.5    9e-10   
ref|XP_010473412.1|  PREDICTED: uncharacterized protein LOC104752848  65.5    9e-10   
ref|XP_003544880.1|  PREDICTED: uncharacterized protein LOC100790...  65.5    9e-10   
ref|XP_010662913.1|  PREDICTED: uncharacterized protein LOC104882243  65.5    1e-09   
ref|NP_001059782.1|  Os07g0516300                                     65.5    1e-09   
ref|XP_003528686.1|  PREDICTED: uncharacterized protein LOC100791...  65.1    1e-09   
ref|XP_011095405.1|  PREDICTED: uncharacterized protein LOC105174872  65.5    1e-09   
ref|XP_009594932.1|  PREDICTED: uncharacterized protein LOC104091320  64.7    1e-09   
ref|XP_010278674.1|  PREDICTED: uncharacterized protein LOC104612795  65.5    1e-09   
ref|XP_009148499.1|  PREDICTED: uncharacterized protein LOC103871920  65.5    1e-09   
ref|XP_009781859.1|  PREDICTED: uncharacterized protein LOC104230693  64.7    1e-09   
ref|XP_002991623.1|  hypothetical protein SELMODRAFT_429904           65.1    1e-09   
gb|AAM64551.1|  unknown                                               65.1    1e-09   
ref|NP_564788.1|  uncharacterized protein                             65.1    1e-09   
ref|XP_009387201.1|  PREDICTED: uncharacterized protein LOC103974165  64.7    1e-09   
gb|AEW08411.1|  hypothetical protein 2_9187_01                        63.5    1e-09   
emb|CDX97979.1|  BnaA06g07300D                                        65.1    1e-09   
emb|CDY49797.1|  BnaCnng18100D                                        65.1    1e-09   
ref|XP_007153950.1|  hypothetical protein PHAVU_003G079000g           64.7    1e-09   
ref|XP_009398796.1|  PREDICTED: uncharacterized protein LOC103983291  64.7    2e-09   
ref|XP_006302821.1|  hypothetical protein CARUB_v10020952mg           65.1    2e-09   
gb|KFK43441.1|  hypothetical protein AALP_AA1G125700                  65.1    2e-09   
ref|XP_010430218.1|  PREDICTED: uncharacterized protein LOC104714523  65.1    2e-09   
gb|EEE58201.1|  hypothetical protein OsJ_09154                        63.2    2e-09   
ref|XP_002869857.1|  hypothetical protein ARALYDRAFT_492675           64.3    2e-09   
ref|XP_004953173.1|  PREDICTED: uncharacterized protein LOC101753430  64.3    2e-09   
gb|ABF50106.1|  prolyl 4-hydroxylase alpha subunit-like               61.6    2e-09   
ref|XP_009400634.1|  PREDICTED: uncharacterized protein LOC103984799  65.1    2e-09   
ref|XP_002972949.1|  hypothetical protein SELMODRAFT_413288           64.7    2e-09   
gb|AAK21349.1|AC024594_13  hypothetical protein                       63.9    3e-09   
ref|XP_010418168.1|  PREDICTED: uncharacterized protein LOC104703794  64.3    3e-09   
ref|XP_008226887.1|  PREDICTED: uncharacterized protein LOC103326...  64.3    3e-09   
ref|XP_008364111.1|  PREDICTED: uncharacterized protein LOC103427808  63.9    3e-09   
ref|XP_006417325.1|  hypothetical protein EUTSA_v10008790mg           63.9    3e-09   
ref|NP_193924.2|  uncharacterized protein                             63.5    4e-09   
gb|EMT20885.1|  hypothetical protein F775_09195                       63.5    4e-09   
ref|XP_008371174.1|  PREDICTED: uncharacterized protein LOC103434595  63.5    4e-09   
gb|KHG00713.1|  hypothetical protein F383_23596                       63.5    4e-09   
emb|CAA17160.1|  putative protein                                     63.5    4e-09   
gb|ADE76487.1|  unknown                                               63.5    4e-09   
ref|XP_003561535.1|  PREDICTED: uncharacterized protein LOC100839665  63.5    4e-09   
ref|XP_010031997.1|  PREDICTED: uncharacterized protein LOC104421661  63.5    5e-09   
gb|EPS65354.1|  hypothetical protein M569_09423                       60.8    5e-09   
ref|XP_008226886.1|  PREDICTED: uncharacterized protein LOC103326...  63.9    5e-09   
ref|XP_006391948.1|  hypothetical protein EUTSA_v10023699mg           63.5    5e-09   
ref|XP_009398093.1|  PREDICTED: uncharacterized protein LOC103982790  64.3    5e-09   
ref|XP_003558985.1|  PREDICTED: uncharacterized protein LOC100828029  63.2    6e-09   
ref|XP_003550488.1|  PREDICTED: uncharacterized protein LOC100810...  63.2    6e-09   
ref|XP_003600119.1|  hypothetical protein MTR_3g052330                62.4    6e-09   
gb|ABR16960.1|  unknown                                               63.2    7e-09   
ref|XP_010267462.1|  PREDICTED: uncharacterized protein LOC104604...  63.5    7e-09   
ref|XP_003632958.1|  PREDICTED: uncharacterized protein LOC100854465  62.8    8e-09   
ref|XP_010538927.1|  PREDICTED: uncharacterized protein LOC104813102  62.8    8e-09   
emb|CDP05013.1|  unnamed protein product                              63.2    9e-09   
ref|XP_009352744.1|  PREDICTED: uncharacterized protein LOC103944073  62.8    9e-09   
ref|NP_001240052.1|  uncharacterized protein LOC100796494             62.8    9e-09   
ref|XP_009398222.1|  PREDICTED: uncharacterized protein LOC103982883  62.8    1e-08   
ref|XP_006284630.1|  hypothetical protein CARUB_v10005873mg           62.4    1e-08   
ref|XP_010318049.1|  PREDICTED: uncharacterized protein LOC104646389  62.8    1e-08   
ref|XP_009392755.1|  PREDICTED: uncharacterized protein LOC103978629  62.0    1e-08   
ref|XP_010276118.1|  PREDICTED: uncharacterized protein LOC104610944  62.4    1e-08   
ref|XP_004232709.1|  PREDICTED: uncharacterized protein LOC101252739  61.6    1e-08   
ref|XP_006350496.1|  PREDICTED: uncharacterized protein LOC102587607  62.4    1e-08   
ref|XP_002468654.1|  hypothetical protein SORBIDRAFT_01g049730        62.4    1e-08   
gb|ABK22988.1|  unknown                                               61.6    1e-08   
gb|EAY88262.1|  hypothetical protein OsI_09715                        62.4    1e-08   
gb|KDO62349.1|  hypothetical protein CISIN_1g031154mg                 61.6    1e-08   
ref|XP_009135451.1|  PREDICTED: uncharacterized protein LOC103859632  62.0    1e-08   
ref|NP_001048739.1|  Os03g0113900                                     62.4    1e-08   
ref|XP_006453504.1|  hypothetical protein CICLE_v10009734mg           61.6    2e-08   
ref|XP_010497951.1|  PREDICTED: uncharacterized protein LOC104775719  59.7    2e-08   
dbj|BAK04510.1|  predicted protein                                    62.0    2e-08   
gb|AFW72772.1|  hypothetical protein ZEAMMB73_494344                  61.6    2e-08   
ref|XP_010546875.1|  PREDICTED: uncharacterized protein LOC104818811  62.4    2e-08   
ref|XP_003600118.1|  hypothetical protein MTR_3g052330                62.0    2e-08   
ref|XP_004986011.1|  PREDICTED: uncharacterized protein LOC101778132  61.6    2e-08   
ref|XP_010448966.1|  PREDICTED: uncharacterized protein LOC104731330  61.2    2e-08   
ref|XP_009408805.1|  PREDICTED: uncharacterized protein LOC103991172  61.6    2e-08   
ref|XP_010538729.1|  PREDICTED: uncharacterized protein LOC104812972  60.8    2e-08   
ref|XP_002518475.1|  hypothetical protein RCOM_0904330                62.0    2e-08   
ref|XP_006855891.1|  hypothetical protein AMTR_s00037p00153530        61.2    2e-08   
gb|KHN31614.1|  hypothetical protein glysoja_050191                   58.9    3e-08   
ref|XP_007142288.1|  hypothetical protein PHAVU_008G268000g           61.2    3e-08   
ref|XP_002975647.1|  hypothetical protein SELMODRAFT_442846           62.8    3e-08   
ref|XP_010647511.1|  PREDICTED: uncharacterized protein LOC100853717  59.7    3e-08   
ref|XP_010434102.1|  PREDICTED: uncharacterized protein LOC104718126  61.2    3e-08   
ref|XP_008646048.1|  PREDICTED: uncharacterized protein LOC103627537  61.6    4e-08   
ref|XP_003596839.1|  hypothetical protein MTR_2g086660                62.0    4e-08   
ref|XP_004249432.1|  PREDICTED: uncharacterized protein LOC101255845  61.6    4e-08   
ref|XP_007015777.1|  Uncharacterized protein TCM_041373               62.0    4e-08   
ref|XP_007207481.1|  hypothetical protein PRUPE_ppa011154mg           61.2    5e-08   
ref|XP_006452380.1|  hypothetical protein CICLE_v10009529mg           60.8    5e-08   
gb|KDP34425.1|  hypothetical protein JCGZ_12706                       61.6    5e-08   
ref|XP_006859004.1|  hypothetical protein AMTR_s00068p00151940        59.7    5e-08   
ref|XP_007146487.1|  hypothetical protein PHAVU_006G044700g           60.8    5e-08   
ref|XP_010425944.1|  PREDICTED: uncharacterized protein LOC104710...  59.7    5e-08   
ref|XP_008804302.1|  PREDICTED: pre-rRNA-processing protein esf2-...  60.1    6e-08   
ref|XP_006339317.1|  PREDICTED: uncharacterized protein LOC102585652  61.6    6e-08   
gb|EYU45296.1|  hypothetical protein MIMGU_mgv1a022945mg              60.1    7e-08   
ref|XP_007143956.1|  hypothetical protein PHAVU_007G116700g           58.2    7e-08   
ref|NP_001143312.1|  uncharacterized protein LOC100275875             60.1    7e-08   
ref|NP_001266292.1|  hypothetical protein                             60.5    7e-08   
ref|XP_006607037.1|  PREDICTED: uncharacterized protein LOC102668618  58.9    7e-08   
ref|XP_006487906.1|  PREDICTED: uncharacterized protein LOC102622...  60.5    8e-08   
ref|XP_002454206.1|  hypothetical protein SORBIDRAFT_04g026640        59.7    8e-08   
ref|XP_002867533.1|  hypothetical protein ARALYDRAFT_492103           59.3    9e-08   
ref|XP_006424207.1|  hypothetical protein CICLE_v10030109mg           60.1    9e-08   
ref|XP_003539161.1|  PREDICTED: uncharacterized protein LOC100779194  60.5    9e-08   
gb|KDO58130.1|  hypothetical protein CISIN_1g044526mg                 60.1    9e-08   
gb|AFW56076.1|  hypothetical protein ZEAMMB73_748138                  59.7    1e-07   
ref|NP_001066195.1|  Os12g0156000                                     59.3    1e-07   
ref|XP_010683677.1|  PREDICTED: uncharacterized protein LOC104898320  60.1    1e-07   
ref|XP_009601006.1|  PREDICTED: uncharacterized protein LOC104096348  60.5    1e-07   
ref|XP_009789987.1|  PREDICTED: uncharacterized protein LOC104237521  60.5    1e-07   
ref|XP_002309418.2|  hypothetical protein POPTR_0006s22610g           60.1    1e-07   
ref|XP_011077840.1|  PREDICTED: uncharacterized protein LOC105161740  60.1    1e-07   
gb|KHN02845.1|  hypothetical protein glysoja_009711                   59.7    1e-07   
ref|NP_001143292.1|  hypothetical protein                             59.3    1e-07   
gb|AFK35467.1|  unknown                                               59.7    1e-07   
ref|XP_010655596.1|  PREDICTED: uncharacterized protein LOC104880497  58.2    1e-07   
ref|XP_010439399.1|  PREDICTED: uncharacterized protein LOC104722848  59.3    1e-07   
ref|XP_010063013.1|  PREDICTED: uncharacterized protein LOC104450244  59.7    1e-07   
ref|XP_003541967.1|  PREDICTED: rho GTPase-activating protein gac...  60.5    1e-07   
ref|XP_009360999.1|  PREDICTED: nucleomorphin-like                    58.5    1e-07   
ref|XP_003578892.1|  PREDICTED: uncharacterized protein LOC100841480  58.9    2e-07   
dbj|BAJ99982.1|  predicted protein                                    57.8    2e-07   
ref|XP_003532131.1|  PREDICTED: uncharacterized protein LOC100788...  59.3    2e-07   
tpg|DAA57796.1|  TPA: hypothetical protein ZEAMMB73_265438            57.4    2e-07   
ref|XP_006662742.1|  PREDICTED: uncharacterized protein LOC102722151  58.5    2e-07   
ref|XP_009385100.1|  PREDICTED: uncharacterized protein LOC103972471  59.7    2e-07   
ref|XP_004970671.1|  PREDICTED: vegetative cell wall protein gp1-...  59.7    2e-07   



>ref|XP_009610044.1| PREDICTED: uncharacterized protein LOC104103814 [Nicotiana tomentosiformis]
Length=159

 Score =   126 bits (317),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 87/167 (52%), Positives = 107/167 (64%), Gaps = 9/167 (5%)
 Frame = -3

Query  612  MAARKSFLFFGVPESITPMTPSGAPQFEFEEsdvwsnnssssvvndgvsssdNTrrssip  433
            MA RK+FLF G  + ITP+ PS + QFEF+E+++W NN+SS+      S +  +  +S  
Sbjct  1    MATRKNFLFLGGKDRITPL-PSSSLQFEFDEAEIWCNNTSSNENVVHNSEAKISIPNSRF  59

Query  432  ssraaaakkssaaavkaRGVDRPASLPVNIPDWSKILGGEYKdr-rresdeeeeddgdgd  256
              +     + S             SLPVNIPDWSKILG EY+   +   D    +D D +
Sbjct  60   LKKPGKKSERSRTISS-------TSLPVNIPDWSKILGDEYRSCPKEIDDNNVVEDFDYE  112

Query  255  dRVPPHVYLARTRVASLSVHEGIGRTLKGRDLSRVRNAIWKQTGFED  115
              +PPH YLARTRVAS SVHEGIGRTLKGRDLSRVRNAIWKQTGFED
Sbjct  113  SGIPPHEYLARTRVASFSVHEGIGRTLKGRDLSRVRNAIWKQTGFED  159



>ref|XP_009612829.1| PREDICTED: uncharacterized protein LOC104106054 [Nicotiana tomentosiformis]
Length=157

 Score =   117 bits (293),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 84/167 (50%), Positives = 103/167 (62%), Gaps = 11/167 (7%)
 Frame = -3

Query  612  MAARKSFLFFGVPESITPMTPSGAP-QFEFEEsdvwsnnssssvvndgvsssdNTrrssi  436
            MA RKS+LF G  E I+PM  S +  QFEF+ESD+W N+++   +    S  ++      
Sbjct  1    MAMRKSYLFLGGKERISPMPCSASTLQFEFDESDIWCNSNNPDEILPQKSIPNSRFLKKS  60

Query  435  pssraaaakkssaaavkaRGVDRPASLPVNIPDWSKILGGEYKdrrresdeeeeddgdgd  256
                   A  S+AA           SLPVNIPDWSKILG +YK+       +++DD    
Sbjct  61   AKKSGGRAISSAAAT---------TSLPVNIPDWSKILGNDYKNNCLRERNDDDDDDVDC  111

Query  255  dRVPPHVYLARTRVASLSVHEGIGRTLKGRDLSRVRNAIWKQTGFED  115
              +PPH  LARTRVAS SV EG+GRTLKGRDLSRVRNAIWKQTGFED
Sbjct  112  R-IPPHELLARTRVASFSVQEGMGRTLKGRDLSRVRNAIWKQTGFED  157



>ref|XP_009796302.1| PREDICTED: uncharacterized protein LOC104242882 [Nicotiana sylvestris]
Length=158

 Score =   115 bits (287),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 88/169 (52%), Positives = 108/169 (64%), Gaps = 14/169 (8%)
 Frame = -3

Query  612  MAARKSFLFFGVPESITPMTPSGAP-QFEFEEsdvwsnnssssvvndgvsssdNTrrssi  436
            MA RKS+LF G  E ++PM  S +  QFEF+ESD+W+N +SS  V    S  ++      
Sbjct  1    MAMRKSYLFLGGKERVSPMPSSASSLQFEFDESDIWNNTNSSDEVLPQKSIPNSRFLKKS  60

Query  435  pssraaaakkssaaavkaRGVDRPASLPVNIPDWSKILGGEYKdrr--resdeeeeddgd  262
                   A  ++A            SLPVNIPDWSKILG +YK+      +D E++DD D
Sbjct  61   AKKSGGRAISAAA-----------TSLPVNIPDWSKILGNDYKNNCLRERNDNEDDDDDD  109

Query  261  gddRVPPHVYLARTRVASLSVHEGIGRTLKGRDLSRVRNAIWKQTGFED  115
             D R+PPH  LARTRVAS S+ EG+GRTLKGRDLSRVRNAIWKQTGFED
Sbjct  110  VDSRIPPHELLARTRVASFSMQEGMGRTLKGRDLSRVRNAIWKQTGFED  158



>gb|EYU34447.1| hypothetical protein MIMGU_mgv1a023553mg [Erythranthe guttata]
Length=152

 Score =   114 bits (286),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 61/84 (73%), Positives = 68/84 (81%), Gaps = 2/84 (2%)
 Frame = -3

Query  366  PASLPVNIPDWSKILGGEYKdrrresdeeeeddgdgddRVPPHVYLARTRVASLSVHEGI  187
            P S+PVN+PDWSKILGGEYK R      ++E+ G+    +PPH YLARTRVAS SVHEG 
Sbjct  71   PRSVPVNVPDWSKILGGEYKKRAGGEYVDDEEGGNDK--IPPHEYLARTRVASFSVHEGA  128

Query  186  GRTLKGRDLSRVRNAIWKQTGFED  115
            GRTLKGRDLSRVRNAIWKQTGFED
Sbjct  129  GRTLKGRDLSRVRNAIWKQTGFED  152



>ref|XP_011094663.1| PREDICTED: uncharacterized protein LOC105174308 [Sesamum indicum]
Length=160

 Score =   114 bits (285),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 65/88 (74%), Positives = 73/88 (83%), Gaps = 4/88 (5%)
 Frame = -3

Query  366  PASLPVNIPDWSKILGGEYKdrrresde----eeeddgdgddRVPPHVYLARTRVASLSV  199
            P SLPVNIPDWS+IL GEY+    E  +    +EE+D  G+DR+PPH YLARTRVASLSV
Sbjct  73   PRSLPVNIPDWSQILRGEYRKHAGELTDVDYGDEEEDDGGNDRIPPHEYLARTRVASLSV  132

Query  198  HEGIGRTLKGRDLSRVRNAIWKQTGFED  115
            HEG+GRTLKGRDLSRVRNAIWKQTGFED
Sbjct  133  HEGVGRTLKGRDLSRVRNAIWKQTGFED  160



>ref|XP_006354325.1| PREDICTED: uncharacterized protein LOC102591579 [Solanum tuberosum]
Length=160

 Score =   112 bits (280),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 76/163 (47%), Positives = 97/163 (60%), Gaps = 14/163 (9%)
 Frame = -3

Query  600  KSFLFFGVPESITPM-TPSGAPQFEFEEsdvwsnnssssvvndgvsssdNTrrssipssr  424
            K+FLF G  + ITP+ + +   QFEF+E+++WSN+                       S 
Sbjct  11   KNFLFLGGKDRITPLPSSTNTLQFEFDEAEMWSNSEE-------------INSFEPKLSI  57

Query  423  aaaakkssaaavkaRGVDRPASLPVNIPDWSKILGGEYKdrrresdeeeeddgdgddRVP  244
             ++           R      SLPVNIPDWSKILG E  +  +    +++ D D ++R+P
Sbjct  58   PSSRFSKKTTKKGERKASNATSLPVNIPDWSKILGDEKGNLGKNIMFDDDGDSDNENRIP  117

Query  243  PHVYLARTRVASLSVHEGIGRTLKGRDLSRVRNAIWKQTGFED  115
            PH YLARTRVAS SVHEGIGRTLKGRDLSRVRNAIWK+ GFED
Sbjct  118  PHEYLARTRVASFSVHEGIGRTLKGRDLSRVRNAIWKKIGFED  160



>ref|XP_003543482.1| PREDICTED: uncharacterized protein LOC100814909 [Glycine max]
Length=154

 Score =   111 bits (277),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 60/88 (68%), Positives = 69/88 (78%), Gaps = 4/88 (5%)
 Frame = -3

Query  366  PASLPVNIPDWSKILGGEY----KdrrresdeeeeddgdgddRVPPHVYLARTRVASLSV  199
            PASLPVN+PDWSKILG EY    +    + DE   D+ DG  RVPPH +LARTR+AS SV
Sbjct  67   PASLPVNVPDWSKILGDEYGRNQRRNYDDDDEARSDEEDGVGRVPPHEFLARTRIASFSV  126

Query  198  HEGIGRTLKGRDLSRVRNAIWKQTGFED  115
            HEG+GRTLKGRDLSRVRNAIW +TGF+D
Sbjct  127  HEGVGRTLKGRDLSRVRNAIWAKTGFQD  154



>gb|ACJ83912.1| unknown [Medicago truncatula]
Length=158

 Score =   110 bits (274),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 56/83 (67%), Positives = 68/83 (82%), Gaps = 0/83 (0%)
 Frame = -3

Query  366  PASLPVNIPDWSKILGGEYKdrrresdeeeeddgdgddRVPPHVYLARTRVASLSVHEGI  187
            PAS+PV IPDWSKILG EYK+   + +  EE+  D D+ +PPH +LARTRVAS SVHEG+
Sbjct  76   PASMPVKIPDWSKILGDEYKNNYTKRNYVEEEGEDDDEWLPPHEFLARTRVASFSVHEGV  135

Query  186  GRTLKGRDLSRVRNAIWKQTGFE  118
            GRTLKGRDLSR+RNAIW +TGF+
Sbjct  136  GRTLKGRDLSRLRNAIWAKTGFQ  158



>ref|XP_003606376.1| hypothetical protein MTR_4g059320 [Medicago truncatula]
 gb|AES88573.1| senescence regulator [Medicago truncatula]
 gb|AFK35484.1| unknown [Medicago truncatula]
Length=158

 Score =   110 bits (274),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 57/83 (69%), Positives = 69/83 (83%), Gaps = 0/83 (0%)
 Frame = -3

Query  366  PASLPVNIPDWSKILGGEYKdrrresdeeeeddgdgddRVPPHVYLARTRVASLSVHEGI  187
            PAS+PV IPDWSKILG EYK+   + +  EE+D D D+ +PPH +LARTRVAS SVHEG+
Sbjct  76   PASMPVKIPDWSKILGDEYKNNYTKRNYVEEEDEDDDEWLPPHEFLARTRVASFSVHEGV  135

Query  186  GRTLKGRDLSRVRNAIWKQTGFE  118
            GRTLKGRDLSR+RNAIW +TGF+
Sbjct  136  GRTLKGRDLSRLRNAIWAKTGFQ  158



>ref|XP_007150200.1| hypothetical protein PHAVU_005G134900g [Phaseolus vulgaris]
 gb|ESW22194.1| hypothetical protein PHAVU_005G134900g [Phaseolus vulgaris]
Length=153

 Score =   108 bits (269),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 57/85 (67%), Positives = 70/85 (82%), Gaps = 3/85 (4%)
 Frame = -3

Query  360  SLPVNIPDWSKILGGEY---KdrrresdeeeeddgdgddRVPPHVYLARTRVASLSVHEG  190
            SLPVN+PDWSKILG EY   + R  + +E + D+ +G  RVPPH +LA+TR+ASLSVHEG
Sbjct  69   SLPVNVPDWSKILGNEYGQNRRRNCDYEEAQSDEEEGGGRVPPHEFLAKTRIASLSVHEG  128

Query  189  IGRTLKGRDLSRVRNAIWKQTGFED  115
            +GRTLKGRDLSRVRNAIW +TGF+D
Sbjct  129  VGRTLKGRDLSRVRNAIWAKTGFQD  153



>ref|XP_004487109.1| PREDICTED: uncharacterized protein LOC101512341 [Cicer arietinum]
Length=166

 Score =   107 bits (268),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 55/88 (63%), Positives = 69/88 (78%), Gaps = 1/88 (1%)
 Frame = -3

Query  375  VDRPASLPVNIPDWSKILGGEYKdrrr-esdeeeeddgdgddRVPPHVYLARTRVASLSV  199
            V  P+SLPVN+PDWSKILG EY+   R   D++ +++      +PPH +LARTR+AS SV
Sbjct  79   VGDPSSLPVNVPDWSKILGEEYRQNLRWNGDDDVDEEDGNGRVIPPHEFLARTRIASFSV  138

Query  198  HEGIGRTLKGRDLSRVRNAIWKQTGFED  115
            HEG+GRTLKGRDLSRVRNAIW +TGF+D
Sbjct  139  HEGVGRTLKGRDLSRVRNAIWAKTGFQD  166



>ref|XP_003597242.1| hypothetical protein MTR_2g094410 [Medicago truncatula]
 gb|AES67493.1| senescence regulator [Medicago truncatula]
Length=156

 Score =   107 bits (267),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 57/86 (66%), Positives = 73/86 (85%), Gaps = 1/86 (1%)
 Frame = -3

Query  369  RPASLPVNIPDWSKILGGEYKdrrres-deeeeddgdgddRVPPHVYLARTRVASLSVHE  193
            R +SLPVN+PDWSKILG +Y+  RR + D+ +E+D   D+++PPH +LARTR+AS SVHE
Sbjct  71   RVSSLPVNVPDWSKILGEDYRHNRRRNYDDVDEEDEGDDEKIPPHEFLARTRMASFSVHE  130

Query  192  GIGRTLKGRDLSRVRNAIWKQTGFED  115
            G+GRTLKGRDLSRVRNAIW +TGF+D
Sbjct  131  GVGRTLKGRDLSRVRNAIWAKTGFQD  156



>ref|XP_003539761.1| PREDICTED: uncharacterized protein LOC100812183 [Glycine max]
Length=170

 Score =   106 bits (265),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 54/88 (61%), Positives = 67/88 (76%), Gaps = 4/88 (5%)
 Frame = -3

Query  366  PASLPVNIPDWSKILGGEYKdrrresdeeeeddgdgddR----VPPHVYLARTRVASLSV  199
            PAS+PVNIPDWSKILG EY+ +     + ++D+   +D     VPPH +LAR RVAS SV
Sbjct  83   PASVPVNIPDWSKILGDEYRRKNNFHSDNDDDNESYNDERSGRVPPHEFLARNRVASFSV  142

Query  198  HEGIGRTLKGRDLSRVRNAIWKQTGFED  115
            HEG+GRTLKGRDLS +RNAIW +TGF+D
Sbjct  143  HEGVGRTLKGRDLSTLRNAIWAKTGFQD  170



>ref|XP_010689547.1| PREDICTED: uncharacterized protein LOC104903237 [Beta vulgaris 
subsp. vulgaris]
Length=163

 Score =   106 bits (264),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 58/89 (65%), Positives = 71/89 (80%), Gaps = 3/89 (3%)
 Frame = -3

Query  372  DRPASLPVNIPDWSKILGGEYKdrrr---esdeeeeddgdgddRVPPHVYLARTRVASLS  202
            D  ASLPVNIPDWSKIL  EYK   +   +  +   D+G+G++ VPPH YLARTR+AS S
Sbjct  75   DTAASLPVNIPDWSKILRDEYKVDEKWSFDGGDNGGDNGNGEEWVPPHEYLARTRMASFS  134

Query  201  VHEGIGRTLKGRDLSRVRNAIWKQTGFED  115
            VHEGIGRTLKGRDL++VRNAIW++TGF+D
Sbjct  135  VHEGIGRTLKGRDLNKVRNAIWEKTGFQD  163



>gb|EYU36187.1| hypothetical protein MIMGU_mgv1a015493mg [Erythranthe guttata]
Length=156

 Score =   105 bits (262),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 59/93 (63%), Positives = 74/93 (80%), Gaps = 5/93 (5%)
 Frame = -3

Query  378  GVDRPASLPVNIPDWSKILGGEYKdrrresdeeeeddgdgddRV-----PPHVYLARTRV  214
            G+DRPASLPVN+PDWSKIL  EY++ RR   ++E+ D    + +     PPH +LAR R+
Sbjct  64   GMDRPASLPVNVPDWSKILKEEYRENRRRESDDEDCDEAEAEEINGEWIPPHEFLARNRI  123

Query  213  ASLSVHEGIGRTLKGRDLSRVRNAIWKQTGFED  115
            ASLSVHEGIGRTLKGRDLSR+RNAIW++TGF+D
Sbjct  124  ASLSVHEGIGRTLKGRDLSRLRNAIWQKTGFQD  156



>ref|XP_009597452.1| PREDICTED: uncharacterized protein LOC104093419 [Nicotiana tomentosiformis]
Length=162

 Score =   105 bits (263),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 58/92 (63%), Positives = 74/92 (80%), Gaps = 4/92 (4%)
 Frame = -3

Query  378  GVDRPASLPVNIPDWSKILGGEYKdrrresdeeeeddgdgddRVPPHVYLAR----TRVA  211
            GV   ASLPVN+PDWSKIL  EY++ RR   +++ D  DG++R+PPH +LAR    TR+A
Sbjct  71   GVTAAASLPVNVPDWSKILKDEYRENRRSDSDDDFDGDDGENRIPPHEFLARQLARTRIA  130

Query  210  SLSVHEGIGRTLKGRDLSRVRNAIWKQTGFED  115
            S SVHEG+GRTLKGRDLSRVRNAI+++TGF+D
Sbjct  131  SFSVHEGVGRTLKGRDLSRVRNAIFEKTGFQD  162



>ref|XP_010107536.1| hypothetical protein L484_024389 [Morus notabilis]
 gb|EXC16218.1| hypothetical protein L484_024389 [Morus notabilis]
Length=165

 Score =   105 bits (263),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 61/86 (71%), Positives = 68/86 (79%), Gaps = 3/86 (3%)
 Frame = -3

Query  363  ASLPVNIPDWSKILGGEYKdrrr---esdeeeeddgdgddRVPPHVYLARTRVASLSVHE  193
            ASLPVNIPDWSKIL  +YKD R+     D  +  +GD  DR+PPH YLARTR ASLSVHE
Sbjct  80   ASLPVNIPDWSKILKDDYKDHRKIDDGDDGGDGGNGDLGDRIPPHEYLARTRGASLSVHE  139

Query  192  GIGRTLKGRDLSRVRNAIWKQTGFED  115
            G+GRTLKGRDL RVRNAIWK+ GFED
Sbjct  140  GVGRTLKGRDLRRVRNAIWKKVGFED  165



>ref|XP_004241275.1| PREDICTED: uncharacterized protein LOC101262623 [Solanum lycopersicum]
Length=163

 Score =   105 bits (262),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 57/87 (66%), Positives = 71/87 (82%), Gaps = 4/87 (5%)
 Frame = -3

Query  363  ASLPVNIPDWSKILGGEYKdrrresdeeeeddgdgddRVPPHVYLA----RTRVASLSVH  196
            ASLPVN+PDWSKIL  EY++  R   +++ DD D D+R+PPH +LA    RTR+AS SVH
Sbjct  77   ASLPVNVPDWSKILKDEYREYGRRDSDDDVDDDDLDNRIPPHEFLAKQLERTRIASFSVH  136

Query  195  EGIGRTLKGRDLSRVRNAIWKQTGFED  115
            EG+GRTLKGRDLSRVRNAIW++TGF+D
Sbjct  137  EGVGRTLKGRDLSRVRNAIWEKTGFQD  163



>ref|XP_002281329.1| PREDICTED: uncharacterized protein LOC100258555 [Vitis vinifera]
Length=163

 Score =   105 bits (262),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 61/86 (71%), Positives = 70/86 (81%), Gaps = 4/86 (5%)
 Frame = -3

Query  360  SLPVNIPDWSKILGGEYKdrrresdeeeeddgdgdd----RVPPHVYLARTRVASLSVHE  193
            SLPVNIPDWSKIL  +Y+  +R+  +E+ DD + DD    R+PPH YLARTRVAS SVHE
Sbjct  78   SLPVNIPDWSKILRDDYRLSQRKESDEDVDDVEEDDDHDSRIPPHEYLARTRVASFSVHE  137

Query  192  GIGRTLKGRDLSRVRNAIWKQTGFED  115
            GIGRTLKGRDLSRVRNAIWK+ GFED
Sbjct  138  GIGRTLKGRDLSRVRNAIWKKVGFED  163



>ref|XP_004246659.1| PREDICTED: uncharacterized protein LOC101246954 [Solanum lycopersicum]
Length=158

 Score =   105 bits (261),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 76/164 (46%), Positives = 99/164 (60%), Gaps = 15/164 (9%)
 Frame = -3

Query  600  KSFLFFGVPESITPM-TPSGAPQFEFEEsdvwsnnssssvvndgvsssdNTrrssipssr  424
            K+FLF G  + ITP+ + +   QFEF+E+++WSN+   + V   +S   +     +    
Sbjct  8    KNFLFLGGKDKITPLPSSTNTLQFEFDEAEMWSNSEEINNVEPKLSIPSSRLSKKMTKKG  67

Query  423  aaaakkssaaavkaRGVDRPASLPVNIPDWSKILGGEYKdrr-resdeeeeddgdgddRV  247
               A                 SLPVNIPDWSKILG + K    +    +++ D D ++R+
Sbjct  68   ERKAI-------------NATSLPVNIPDWSKILGDDEKGILGKNIMFDDDGDFDDENRI  114

Query  246  PPHVYLARTRVASLSVHEGIGRTLKGRDLSRVRNAIWKQTGFED  115
            PPH YLARTRVAS SVHEGIGRTLKGRDLS VRNAIWK+ GFED
Sbjct  115  PPHEYLARTRVASFSVHEGIGRTLKGRDLSIVRNAIWKKIGFED  158



>ref|XP_009767681.1| PREDICTED: uncharacterized protein LOC104218792 [Nicotiana sylvestris]
Length=162

 Score =   105 bits (262),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 58/92 (63%), Positives = 74/92 (80%), Gaps = 4/92 (4%)
 Frame = -3

Query  378  GVDRPASLPVNIPDWSKILGGEYKdrrresdeeeeddgdgddRVPPHVYLAR----TRVA  211
            GV   ASLPVN+PDWSKIL  EY++ RR   +++ D  DG++R+PPH +LAR    TR+A
Sbjct  71   GVTTAASLPVNVPDWSKILKDEYRENRRSDSDDDFDGEDGENRIPPHEFLARQLARTRIA  130

Query  210  SLSVHEGIGRTLKGRDLSRVRNAIWKQTGFED  115
            S SVHEG+GRTLKGRDLSRVRNAI+++TGF+D
Sbjct  131  SFSVHEGVGRTLKGRDLSRVRNAIFEKTGFQD  162



>emb|CAN66257.1| hypothetical protein VITISV_001236 [Vitis vinifera]
Length=163

 Score =   105 bits (261),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 61/87 (70%), Positives = 70/87 (80%), Gaps = 4/87 (5%)
 Frame = -3

Query  363  ASLPVNIPDWSKILGGEYKdrrresdeeeeddgdgdd----RVPPHVYLARTRVASLSVH  196
             SLPVNIPDWSKIL  +Y+  +R+  +E+ DD + DD    R+PPH YLARTRVAS SVH
Sbjct  77   TSLPVNIPDWSKILRDDYRLSQRKESDEDVDDVEEDDDHDSRIPPHEYLARTRVASFSVH  136

Query  195  EGIGRTLKGRDLSRVRNAIWKQTGFED  115
            EGIGRTLKGRDLSRVRNAIWK+ GFED
Sbjct  137  EGIGRTLKGRDLSRVRNAIWKKVGFED  163



>ref|XP_003540175.1| PREDICTED: uncharacterized protein LOC100817341 [Glycine max]
Length=149

 Score =   104 bits (260),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 60/88 (68%), Positives = 73/88 (83%), Gaps = 1/88 (1%)
 Frame = -3

Query  375  VDRPASLPVNIPDWSKILGGEY-KdrrresdeeeeddgdgddRVPPHVYLARTRVASLSV  199
            V  P SLPVN+PDWSKILG E+ +++RR  DE + D+ DGD RVPPH +LA+T +AS SV
Sbjct  62   VGTPVSLPVNVPDWSKILGDEFGRNQRRNYDEAQSDEEDGDGRVPPHEFLAKTGIASFSV  121

Query  198  HEGIGRTLKGRDLSRVRNAIWKQTGFED  115
            HEG+GRTLKGRDLSRVRNAIW +TGF+D
Sbjct  122  HEGVGRTLKGRDLSRVRNAIWAKTGFQD  149



>ref|XP_007027332.1| Uncharacterized protein TCM_022158 [Theobroma cacao]
 gb|EOY07834.1| Uncharacterized protein TCM_022158 [Theobroma cacao]
Length=173

 Score =   104 bits (260),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 61/87 (70%), Positives = 66/87 (76%), Gaps = 4/87 (5%)
 Frame = -3

Query  363  ASLPVNIPDWSKILGGEY----KdrrresdeeeeddgdgddRVPPHVYLARTRVASLSVH  196
            ASLPVNIPDWSKIL  EY    K      D++++ D D D RVPPH YLAR R AS SVH
Sbjct  87   ASLPVNIPDWSKILKDEYREHGKSDEDVEDDDDDVDHDHDGRVPPHEYLARRRGASFSVH  146

Query  195  EGIGRTLKGRDLSRVRNAIWKQTGFED  115
            EGIGRTLKGRDL RVRNAIWK+TGFED
Sbjct  147  EGIGRTLKGRDLRRVRNAIWKKTGFED  173



>gb|AFK43089.1| unknown [Medicago truncatula]
Length=156

 Score =   103 bits (258),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 56/86 (65%), Positives = 72/86 (84%), Gaps = 1/86 (1%)
 Frame = -3

Query  369  RPASLPVNIPDWSKILGGEYKdrrres-deeeeddgdgddRVPPHVYLARTRVASLSVHE  193
            R +SLPVN+PDWSKILG +Y+  RR + D+ +E+D   D+++PPH +LARTR+AS SVHE
Sbjct  71   RVSSLPVNVPDWSKILGEDYRHNRRRNYDDVDEEDEGDDEKIPPHEFLARTRMASFSVHE  130

Query  192  GIGRTLKGRDLSRVRNAIWKQTGFED  115
            G+G TLKGRDLSRVRNAIW +TGF+D
Sbjct  131  GVGGTLKGRDLSRVRNAIWAKTGFQD  156



>ref|XP_008391399.1| PREDICTED: uncharacterized protein LOC103453622 [Malus domestica]
 ref|XP_008344939.1| PREDICTED: uncharacterized protein LOC103407844 [Malus domestica]
Length=178

 Score =   103 bits (257),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 61/93 (66%), Positives = 68/93 (73%), Gaps = 9/93 (10%)
 Frame = -3

Query  366  PASLPVNIPDWSKILGGEYKdrrresdeeee---------ddgdgddRVPPHVYLARTRV  214
            P+SLPVNIPDWSKIL   YK++R+   +E           +D  GD RVPPH YLARTR 
Sbjct  86   PSSLPVNIPDWSKILKDGYKEQRKLDSDEHCGGEFYGDDEEDDGGDGRVPPHEYLARTRG  145

Query  213  ASLSVHEGIGRTLKGRDLSRVRNAIWKQTGFED  115
            AS SVHEGIGRTLKGRDL RVRNAIWK+ GFED
Sbjct  146  ASFSVHEGIGRTLKGRDLRRVRNAIWKKVGFED  178



>ref|XP_006363694.1| PREDICTED: uncharacterized protein LOC102595296 [Solanum tuberosum]
Length=147

 Score =   102 bits (255),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 54/82 (66%), Positives = 62/82 (76%), Gaps = 4/82 (5%)
 Frame = -3

Query  360  SLPVNIPDWSKILGGEYKdrrresdeeeeddgdgddRVPPHVYLARTRVASLSVHEGIGR  181
            SLP+NIPDWSKILG + K+      EE + D      +PPH YLA+ R AS SVHEG+GR
Sbjct  70   SLPINIPDWSKILGDKKKNDDIRDKEEVDADTW----IPPHEYLAKKRGASFSVHEGVGR  125

Query  180  TLKGRDLSRVRNAIWKQTGFED  115
            TLKGRDLSRVR+AIWKQTGFED
Sbjct  126  TLKGRDLSRVRDAIWKQTGFED  147



>ref|XP_006365734.1| PREDICTED: uncharacterized protein LOC102600128 [Solanum tuberosum]
Length=171

 Score =   103 bits (257),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 56/86 (65%), Positives = 70/86 (81%), Gaps = 4/86 (5%)
 Frame = -3

Query  360  SLPVNIPDWSKILGGEYKdrrresdeeeeddgdgddRVPPHVYLA----RTRVASLSVHE  193
            SLPVN+PDWSKIL  EY++  R   +++ DD D D+R+PPH +LA    RTR+AS SVHE
Sbjct  86   SLPVNVPDWSKILKDEYREYGRRDSDDDLDDDDLDNRIPPHEFLAKQLERTRIASFSVHE  145

Query  192  GIGRTLKGRDLSRVRNAIWKQTGFED  115
            G+GRTLKGRDLSRVRNAIW++TGF+D
Sbjct  146  GVGRTLKGRDLSRVRNAIWEKTGFQD  171



>gb|KDP44049.1| hypothetical protein JCGZ_05516 [Jatropha curcas]
Length=177

 Score =   102 bits (254),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 60/94 (64%), Positives = 74/94 (79%), Gaps = 10/94 (11%)
 Frame = -3

Query  366  PASLPVNIPDWSKILGGEYKdrrresdeeeeddgdgd------dRVPPHVYLA----RTR  217
            P+SLPVNIPDWSKIL  EY++ RR   ++++DD DG+       RVPPH +LA    RTR
Sbjct  84   PSSLPVNIPDWSKILKDEYRENRRRDVDDDDDDVDGEDYFDGGSRVPPHEFLAKQMARTR  143

Query  216  VASLSVHEGIGRTLKGRDLSRVRNAIWKQTGFED  115
            +AS SVHEG+GRTLKGRDLSRVRNAIW++TGF+D
Sbjct  144  IASFSVHEGVGRTLKGRDLSRVRNAIWEKTGFQD  177



>ref|XP_008243937.1| PREDICTED: uncharacterized protein LOC103342133 [Prunus mume]
Length=169

 Score =   102 bits (254),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 62/93 (67%), Positives = 68/93 (73%), Gaps = 10/93 (11%)
 Frame = -3

Query  363  ASLPVNIPDWSKILGGEYKdrrresdeeeeddgd----------gddRVPPHVYLARTRV  214
            ASLPVNIPDWS IL   YKD+R+   +E+  + D          GD RVPPH YLARTR 
Sbjct  77   ASLPVNIPDWSNILKEAYKDQRQRDSDEDRREEDFDGGDDDDDGGDGRVPPHEYLARTRG  136

Query  213  ASLSVHEGIGRTLKGRDLSRVRNAIWKQTGFED  115
            ASLSVHEGIGRTLKGRDL RVRNAIWK+ GFED
Sbjct  137  ASLSVHEGIGRTLKGRDLRRVRNAIWKKVGFED  169



>ref|XP_008462513.1| PREDICTED: uncharacterized protein LOC103500846 [Cucumis melo]
Length=167

 Score =   102 bits (253),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 55/89 (62%), Positives = 67/89 (75%), Gaps = 6/89 (7%)
 Frame = -3

Query  363  ASLPVNIPDWSKILGGEY------KdrrresdeeeeddgdgddRVPPHVYLARTRVASLS  202
            ASLPVNIPDWSKIL  EY           + D++ ++  +   RVPPH +LA+TR+AS S
Sbjct  79   ASLPVNIPDWSKILRNEYIENRRDDFEDEDGDDDGDEFEEKRFRVPPHEFLAKTRIASFS  138

Query  201  VHEGIGRTLKGRDLSRVRNAIWKQTGFED  115
            VHEGIGRTLKGRDLSRVR+AIW++TGFED
Sbjct  139  VHEGIGRTLKGRDLSRVRDAIWQKTGFED  167



>ref|XP_004139450.1| PREDICTED: uncharacterized protein LOC101217269 [Cucumis sativus]
 ref|XP_004160905.1| PREDICTED: uncharacterized LOC101217269 [Cucumis sativus]
 gb|KGN64850.1| hypothetical protein Csa_1G132110 [Cucumis sativus]
Length=167

 Score =   102 bits (253),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 56/89 (63%), Positives = 67/89 (75%), Gaps = 6/89 (7%)
 Frame = -3

Query  363  ASLPVNIPDWSKILGGEY------KdrrresdeeeeddgdgddRVPPHVYLARTRVASLS  202
            ASLPVNIPDWSKIL  EY           + D+E ++  +   RVPPH +LA+TR+AS S
Sbjct  79   ASLPVNIPDWSKILRNEYIDNRRDDFEDEDGDDEGDEVEEKRFRVPPHEFLAKTRIASFS  138

Query  201  VHEGIGRTLKGRDLSRVRNAIWKQTGFED  115
            VHEGIGRTLKGRDLSRVR+AIW++TGFED
Sbjct  139  VHEGIGRTLKGRDLSRVRDAIWQKTGFED  167



>ref|XP_004145741.1| PREDICTED: uncharacterized protein LOC101215539 [Cucumis sativus]
 ref|XP_004165435.1| PREDICTED: uncharacterized protein LOC101231271 [Cucumis sativus]
 gb|KGN46838.1| hypothetical protein Csa_6G141350 [Cucumis sativus]
Length=165

 Score =   101 bits (252),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 59/90 (66%), Positives = 72/90 (80%), Gaps = 7/90 (8%)
 Frame = -3

Query  363  ASLPVNIPDWSKILGGEYKdrrr---esdeeeeddgdgddRVPPHVYLAR----TRVASL  205
            +SLPVNIPDWSKIL  EY+++R      D EE+++ + + RVPPH +LAR    TR+AS 
Sbjct  76   SSLPVNIPDWSKILKEEYREKRSLEYADDMEEDEEEEEEMRVPPHEFLARQMARTRIASF  135

Query  204  SVHEGIGRTLKGRDLSRVRNAIWKQTGFED  115
            SVHEGIGRTLKGRDLSRVRNAIW++TGFED
Sbjct  136  SVHEGIGRTLKGRDLSRVRNAIWEKTGFED  165



>gb|KHN48294.1| hypothetical protein glysoja_007963 [Glycine soja]
Length=149

 Score =   101 bits (251),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 58/98 (59%), Positives = 67/98 (68%), Gaps = 14/98 (14%)
 Frame = -3

Query  366  PASLPVNIPDWSKILGGEYKdr--------------rresdeeeeddgdgddRVPPHVYL  229
            PASLPVNIPDWSKIL  +YK+                  +  +E++ G  + +VPPH YL
Sbjct  52   PASLPVNIPDWSKILKEDYKEHPKWEEEEEEEEEEEEDNNVRDEQNHGLRNIKVPPHEYL  111

Query  228  ARTRVASLSVHEGIGRTLKGRDLSRVRNAIWKQTGFED  115
            ARTR ASLSVHEGIGRTLKGRDL  VRNAIWK+ GFED
Sbjct  112  ARTRGASLSVHEGIGRTLKGRDLRSVRNAIWKKVGFED  149



>ref|XP_003542516.1| PREDICTED: uncharacterized protein LOC100790091 [Glycine max]
Length=180

 Score =   102 bits (253),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 58/97 (60%), Positives = 67/97 (69%), Gaps = 13/97 (13%)
 Frame = -3

Query  366  PASLPVNIPDWSKILGGEYKdr-------------rresdeeeeddgdgddRVPPHVYLA  226
            PASLPVNIPDWSKIL  +YK+                 +  +E++ G  + +VPPH YLA
Sbjct  84   PASLPVNIPDWSKILKEDYKEHPKWESEEEEEEEEEDNNVRDEQNHGLRNIKVPPHEYLA  143

Query  225  RTRVASLSVHEGIGRTLKGRDLSRVRNAIWKQTGFED  115
            RTR ASLSVHEGIGRTLKGRDL  VRNAIWK+ GFED
Sbjct  144  RTRGASLSVHEGIGRTLKGRDLRSVRNAIWKKVGFED  180



>ref|XP_008463944.1| PREDICTED: uncharacterized protein LOC103501949 [Cucumis melo]
Length=162

 Score =   101 bits (251),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 57/90 (63%), Positives = 71/90 (79%), Gaps = 7/90 (8%)
 Frame = -3

Query  363  ASLPVNIPDWSKILGGEYKdrrresdeeeeddgdgdd---RVPPHVYLAR----TRVASL  205
            +SLPVNIPDWSKIL  EY+++R     ++ +D + ++   RVPPH +LAR    TR+AS 
Sbjct  73   SSLPVNIPDWSKILKEEYREKRSSEYADDMEDDEDEEEEMRVPPHEFLARQMARTRIASF  132

Query  204  SVHEGIGRTLKGRDLSRVRNAIWKQTGFED  115
            SVHEGIGRTLKGRDLSRVRNAIW++TGFED
Sbjct  133  SVHEGIGRTLKGRDLSRVRNAIWEKTGFED  162



>ref|XP_003537294.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 34-like [Glycine 
max]
Length=188

 Score =   101 bits (252),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 63/110 (57%), Positives = 70/110 (64%), Gaps = 22/110 (20%)
 Frame = -3

Query  378  GVDR---PASLPVNIPDWSKILGGEYKdr-------------------rresdeeeeddg  265
            G DR   PASLPVNIPDWSKIL  +YK+                       +   E++ G
Sbjct  79   GRDRITTPASLPVNIPDWSKILKEDYKEHPKYWESEDEKEEEDDDDDEEHNNVVGEQNHG  138

Query  264  dgddRVPPHVYLARTRVASLSVHEGIGRTLKGRDLSRVRNAIWKQTGFED  115
              + RVPPHVYLARTR ASLSVHEGIGRTLKGRDL  VRNAIWK+ GFED
Sbjct  139  FRNIRVPPHVYLARTRGASLSVHEGIGRTLKGRDLRSVRNAIWKKVGFED  188



>ref|XP_008225670.1| PREDICTED: uncharacterized protein LOC103325290 [Prunus mume]
Length=166

 Score =   100 bits (250),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 56/87 (64%), Positives = 69/87 (79%), Gaps = 5/87 (6%)
 Frame = -3

Query  363  ASLPVNIPDWSKILGGEYKdrrresdeeeeddgdgddRVPPHVYLAR----TRVASLSVH  196
            ASLPV IPDWSKIL  EY++ ++  D++++D   G   VPPH +LAR    TR+AS SVH
Sbjct  81   ASLPVGIPDWSKILRDEYRENQKSDDDDDDDVDGGVR-VPPHEFLARQMARTRIASFSVH  139

Query  195  EGIGRTLKGRDLSRVRNAIWKQTGFED  115
            EG+GRTLKGRDLSRVRNAIW++TGFED
Sbjct  140  EGVGRTLKGRDLSRVRNAIWEKTGFED  166



>ref|XP_008385317.1| PREDICTED: uncharacterized protein LOC103447887 [Malus domestica]
 ref|XP_008349750.1| PREDICTED: uncharacterized protein LOC103413031 [Malus domestica]
Length=169

 Score =   100 bits (250),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 60/91 (66%), Positives = 71/91 (78%), Gaps = 6/91 (7%)
 Frame = -3

Query  369  RPASLPVNIPDWSKILGGEYKdrrresdeeeeddgdgddRV--PPHVYLAR----TRVAS  208
            + ASLPV IPDWSKIL GEY++ RR  D+E + D D +  V  PPH +LAR    TR+AS
Sbjct  79   KAASLPVGIPDWSKILRGEYRENRRCDDDEADGDNDVEGGVRIPPHEFLARQMARTRIAS  138

Query  207  LSVHEGIGRTLKGRDLSRVRNAIWKQTGFED  115
             SVHEG+GRTLKGRDLSRVRNAIW++TGFED
Sbjct  139  FSVHEGVGRTLKGRDLSRVRNAIWEKTGFED  169



>gb|KHN39078.1| hypothetical protein glysoja_017372 [Glycine soja]
Length=189

 Score =   101 bits (251),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 63/111 (57%), Positives = 70/111 (63%), Gaps = 23/111 (21%)
 Frame = -3

Query  378  GVDR---PASLPVNIPDWSKILGGEYKdr--------------------rresdeeeedd  268
            G DR   PASLPVNIPDWSKIL  +YK+                        +   E++ 
Sbjct  79   GRDRITTPASLPVNIPDWSKILKEDYKEHPKYWESEDEKEEEEDDDDDEEHNNVVGEQNH  138

Query  267  gdgddRVPPHVYLARTRVASLSVHEGIGRTLKGRDLSRVRNAIWKQTGFED  115
            G  + RVPPHVYLARTR ASLSVHEGIGRTLKGRDL  VRNAIWK+ GFED
Sbjct  139  GFRNIRVPPHVYLARTRGASLSVHEGIGRTLKGRDLRSVRNAIWKKVGFED  189



>ref|XP_009593461.1| PREDICTED: uncharacterized protein LOC104090119 [Nicotiana tomentosiformis]
Length=167

 Score =   100 bits (249),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 57/96 (59%), Positives = 71/96 (74%), Gaps = 8/96 (8%)
 Frame = -3

Query  378  GVDRPASLPVNIPDWSKILGGEYKd----rrresdeeeeddgdgddRVPPHVYLA----R  223
             V   ASLPVN+PDWSKIL  EY++       + D  +ED  D ++R+PPH +LA    R
Sbjct  72   SVASAASLPVNVPDWSKILKDEYREYGRRDSDDDDFNDEDGDDLENRIPPHEFLAKQLER  131

Query  222  TRVASLSVHEGIGRTLKGRDLSRVRNAIWKQTGFED  115
            TR+AS SVHEG+GRTLKGRDLSRVRNAIW++TGF+D
Sbjct  132  TRIASFSVHEGVGRTLKGRDLSRVRNAIWEKTGFQD  167



>ref|XP_010098187.1| hypothetical protein L484_007649 [Morus notabilis]
 gb|EXB74643.1| hypothetical protein L484_007649 [Morus notabilis]
Length=181

 Score =   100 bits (249),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 60/94 (64%), Positives = 68/94 (72%), Gaps = 11/94 (12%)
 Frame = -3

Query  363  ASLPVNIPDWSKILGGEYKdrrresdeeeeddgdgdd-------RVPPHVYLAR----TR  217
            ASLPVNIPDWSKIL  EY+D R     +++DD            RVPPH +LAR    TR
Sbjct  88   ASLPVNIPDWSKILRDEYRDNRTRDSIDDDDDDFNGGGDCDEGVRVPPHEFLARQMARTR  147

Query  216  VASLSVHEGIGRTLKGRDLSRVRNAIWKQTGFED  115
            +AS SVHEGIGRTLKGRDLSRVRNAIW++TGFED
Sbjct  148  IASFSVHEGIGRTLKGRDLSRVRNAIWEKTGFED  181



>ref|XP_007207567.1| hypothetical protein PRUPE_ppa016754mg [Prunus persica]
 gb|EMJ08766.1| hypothetical protein PRUPE_ppa016754mg [Prunus persica]
Length=169

 Score =   100 bits (248),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 61/93 (66%), Positives = 66/93 (71%), Gaps = 10/93 (11%)
 Frame = -3

Query  363  ASLPVNIPDWSKILGGEYKdrrresdeeeeddgd----------gddRVPPHVYLARTRV  214
            ASLPVNIPDWS IL   YKD+R+   +E+    D          GD RVPPH YLARTR 
Sbjct  77   ASLPVNIPDWSNILKEAYKDQRQRDSDEDRGKEDFDGGDDDDDGGDGRVPPHEYLARTRG  136

Query  213  ASLSVHEGIGRTLKGRDLSRVRNAIWKQTGFED  115
            AS SVHEGIGRTLKGRDL RVRNAIWK+ GFED
Sbjct  137  ASFSVHEGIGRTLKGRDLRRVRNAIWKKVGFED  169



>ref|XP_003538194.2| PREDICTED: uncharacterized protein LOC100782946 [Glycine max]
 gb|KHN38764.1| hypothetical protein glysoja_008313 [Glycine soja]
Length=171

 Score =   100 bits (248),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 54/86 (63%), Positives = 65/86 (76%), Gaps = 5/86 (6%)
 Frame = -3

Query  357  LPVNIPDWSKILGGEYKdrrresdeeeed-----dgdgddRVPPHVYLARTRVASLSVHE  193
            +PVNIPDWSKILG EY+ R    D++ +D     D +   RVPPH +LAR RVAS SVHE
Sbjct  86   MPVNIPDWSKILGDEYRRRNSFDDDDNDDNNEGYDDERSGRVPPHEFLARNRVASFSVHE  145

Query  192  GIGRTLKGRDLSRVRNAIWKQTGFED  115
            G+GRTLKGRDLS +RNAIW +TGF+D
Sbjct  146  GVGRTLKGRDLSTLRNAIWAKTGFQD  171



>gb|AFK48660.1| unknown [Lotus japonicus]
Length=167

 Score =   100 bits (248),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 57/86 (66%), Positives = 69/86 (80%), Gaps = 2/86 (2%)
 Frame = -3

Query  366  PASLPVNIPDWSKILGGEYKdrrr--esdeeeeddgdgddRVPPHVYLARTRVASLSVHE  193
            P SLPV+IPDWSKIL  +YK+ R+    DE+++D+   ++ +PPH YLARTR ASLSVHE
Sbjct  82   PGSLPVSIPDWSKILKQDYKEHRKWNSDDEDDDDEDGDEEHLPPHEYLARTRGASLSVHE  141

Query  192  GIGRTLKGRDLSRVRNAIWKQTGFED  115
            GIGRTLKGRDL  VRNAIWK+ GFED
Sbjct  142  GIGRTLKGRDLRSVRNAIWKKVGFED  167



>ref|XP_011044356.1| PREDICTED: uncharacterized protein LOC105139576 [Populus euphratica]
Length=179

 Score =   100 bits (248),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 60/95 (63%), Positives = 68/95 (72%), Gaps = 11/95 (12%)
 Frame = -3

Query  366  PASLPVNIPDWSKILGGEYKd-------rrresdeeeeddgdgddRVPPHVYLAR----T  220
            P+SLPVNIPDWSKIL  EY+           + D + +D  DG  RVPPH  LAR    T
Sbjct  85   PSSLPVNIPDWSKILKDEYRRGPDVVDGEVDDDDMDGDDCFDGGVRVPPHELLARQMART  144

Query  219  RVASLSVHEGIGRTLKGRDLSRVRNAIWKQTGFED  115
            R+AS SVHEGIGRTLKGRDLSRVRNAIW++TGFED
Sbjct  145  RIASFSVHEGIGRTLKGRDLSRVRNAIWEKTGFED  179



>gb|EYU38536.1| hypothetical protein MIMGU_mgv1a018290mg [Erythranthe guttata]
Length=158

 Score = 99.4 bits (246),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 57/82 (70%), Positives = 65/82 (79%), Gaps = 1/82 (1%)
 Frame = -3

Query  360  SLPVNIPDWSKILGGEYKdrrresdeeeeddgdgddRVPPHVYLARTRVASLSVHEGIGR  181
            SLPVN+PDWSKILG EYK R     +EEE DG  D  +PPH YLA+ R ASLSVHEG GR
Sbjct  78   SLPVNVPDWSKILGSEYKGRGPRELKEEEGDGGNDR-IPPHEYLAKKRGASLSVHEGRGR  136

Query  180  TLKGRDLSRVRNAIWKQTGFED  115
            TLKGRDLSRVR+A+WK+ GF+D
Sbjct  137  TLKGRDLSRVRDAVWKKFGFQD  158



>ref|XP_007206026.1| hypothetical protein PRUPE_ppa012473mg [Prunus persica]
 gb|EMJ07225.1| hypothetical protein PRUPE_ppa012473mg [Prunus persica]
Length=168

 Score = 99.4 bits (246),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 58/88 (66%), Positives = 69/88 (78%), Gaps = 5/88 (6%)
 Frame = -3

Query  363  ASLPVNIPDWSKILGGEYKdrrresdeeeeddgdgd-dRVPPHVYLAR----TRVASLSV  199
            ASLPV IPDWSKIL  EY++ R+  D+++ DD      RVPPH +LAR    TR+AS SV
Sbjct  81   ASLPVGIPDWSKILRDEYRENRKSDDDDDGDDDVEGGVRVPPHEFLARQMARTRIASFSV  140

Query  198  HEGIGRTLKGRDLSRVRNAIWKQTGFED  115
            HEG+GRTLKGRDLSRVRNAIW++TGFED
Sbjct  141  HEGVGRTLKGRDLSRVRNAIWEKTGFED  168



>ref|XP_009787318.1| PREDICTED: uncharacterized protein LOC104235292 [Nicotiana sylvestris]
Length=168

 Score = 99.0 bits (245),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 55/91 (60%), Positives = 70/91 (77%), Gaps = 8/91 (9%)
 Frame = -3

Query  363  ASLPVNIPDWSKILGGEYKd----rrresdeeeeddgdgddRVPPHVYLA----RTRVAS  208
            ASLPVN+PDWSKIL  EY++       + D  +ED  D ++R+PPH +LA    RTR+AS
Sbjct  78   ASLPVNVPDWSKILKDEYREYGRRDSDDDDFNDEDGDDLENRIPPHEFLAKQLERTRIAS  137

Query  207  LSVHEGIGRTLKGRDLSRVRNAIWKQTGFED  115
             SVH+G+GRTLKGRDLSRVRNAIW++TGF+D
Sbjct  138  FSVHDGVGRTLKGRDLSRVRNAIWEKTGFQD  168



>ref|XP_011089296.1| PREDICTED: uncharacterized protein LOC105170296 [Sesamum indicum]
Length=162

 Score = 99.0 bits (245),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 56/89 (63%), Positives = 71/89 (80%), Gaps = 7/89 (8%)
 Frame = -3

Query  360  SLPVNIPDWSKILGGEYKdrrresdeeeeddgdgd---dRVPPHVYLAR----TRVASLS  202
            SLPVN+PDWSKIL  EY++ RR   +++ D+ + +   +R+PPH +LAR    TR+AS S
Sbjct  74   SLPVNVPDWSKILKEEYRENRRRDSDDDYDEDEAEEEGNRIPPHEFLARQMARTRIASFS  133

Query  201  VHEGIGRTLKGRDLSRVRNAIWKQTGFED  115
            VHEGIGRTLKGRDLSRVRNAIW++TGFED
Sbjct  134  VHEGIGRTLKGRDLSRVRNAIWQKTGFED  162



>ref|XP_010483718.1| PREDICTED: uncharacterized protein LOC104762175 [Camelina sativa]
Length=163

 Score = 99.0 bits (245),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 55/84 (65%), Positives = 70/84 (83%), Gaps = 1/84 (1%)
 Frame = -3

Query  363  ASLPVNIPDWSKILGGEYKdrrresdeeeeddgdgddR-VPPHVYLARTRVASLSVHEGI  187
            +SLPVN+PDWSKIL GEY+D RR S E+ +DD +     +PPH +LA+TR+AS SVHEG+
Sbjct  80   SSLPVNVPDWSKILRGEYRDNRRRSIEDNDDDCEDGGGWLPPHEFLAKTRMASFSVHEGV  139

Query  186  GRTLKGRDLSRVRNAIWKQTGFED  115
            GRTLKGRDLSRVRNAI+++ GF+D
Sbjct  140  GRTLKGRDLSRVRNAIFEKIGFQD  163



>gb|AFK46583.1| unknown [Lotus japonicus]
Length=166

 Score = 99.0 bits (245),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 55/83 (66%), Positives = 61/83 (73%), Gaps = 0/83 (0%)
 Frame = -3

Query  363  ASLPVNIPDWSKILGGEYKdrrresdeeeeddgdgddRVPPHVYLARTRVASLSVHEGIG  184
            +SLPVNIPDWSKIL   YK+ R   +    DD DG  ++PPH YLAR R AS SVHEG G
Sbjct  84   SSLPVNIPDWSKILKQGYKENRGIDEYAVGDDQDGGSQLPPHEYLARARGASFSVHEGKG  143

Query  183  RTLKGRDLSRVRNAIWKQTGFED  115
            RTLKGRDL  VRNAIWK+ GFED
Sbjct  144  RTLKGRDLRSVRNAIWKKVGFED  166



>ref|XP_004976251.1| PREDICTED: uncharacterized protein LOC101760473 [Setaria italica]
Length=176

 Score = 98.6 bits (244),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 52/92 (57%), Positives = 61/92 (66%), Gaps = 8/92 (9%)
 Frame = -3

Query  366  PASLPVNIPDWSKILG--------GEYKdrrresdeeeeddgdgddRVPPHVYLARTRVA  211
            P SLP+NIPDW KILG        GE++    +          G + VPPH    R+R A
Sbjct  85   PGSLPMNIPDWQKILGVEYRDHHAGEWELDGEDDGGYGRVGSGGSEMVPPHELAWRSRAA  144

Query  210  SLSVHEGIGRTLKGRDLSRVRNAIWKQTGFED  115
            SLSVHEGIGRTLKGRDLSRVR+A+WK+TGFED
Sbjct  145  SLSVHEGIGRTLKGRDLSRVRDAVWKRTGFED  176



>ref|XP_006428783.1| hypothetical protein CICLE_v10012912mg [Citrus clementina]
 gb|ESR42023.1| hypothetical protein CICLE_v10012912mg [Citrus clementina]
Length=175

 Score = 98.6 bits (244),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 58/92 (63%), Positives = 64/92 (70%), Gaps = 9/92 (10%)
 Frame = -3

Query  363  ASLPVNIPDWSKILGGEYKdrrresdeeeeddgdgddR---------VPPHVYLARTRVA  211
            ASLPVNIPDWSKIL  EY++  +   +E+   GD DD          VPPH YLA  R A
Sbjct  84   ASLPVNIPDWSKILKDEYREHSKRESDEDGGGGDDDDEDKEEEYYGLVPPHEYLAMRRGA  143

Query  210  SLSVHEGIGRTLKGRDLSRVRNAIWKQTGFED  115
            S SVHEGIGRTLKGRDL RVRNAIWK+ GFED
Sbjct  144  SFSVHEGIGRTLKGRDLRRVRNAIWKKVGFED  175



>ref|XP_007016742.1| Uncharacterized protein TCM_042056 [Theobroma cacao]
 gb|EOY34361.1| Uncharacterized protein TCM_042056 [Theobroma cacao]
Length=179

 Score = 98.6 bits (244),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 59/93 (63%), Positives = 71/93 (76%), Gaps = 9/93 (10%)
 Frame = -3

Query  366  PASLPVNIPDWSKILGGEYKdrrresdeeeeddgdgd-----dRVPPHVYLA----RTRV  214
            P+SLPVNIPDWSKIL  EY+D RR S+ +++D    D      R+PPH +LA    RTR+
Sbjct  87   PSSLPVNIPDWSKILREEYRDNRRRSESDDDDVEGDDWSEGGVRIPPHEFLAKQMARTRI  146

Query  213  ASLSVHEGIGRTLKGRDLSRVRNAIWKQTGFED  115
            AS SVHEGIGRTLKGRDL RVRNAI+++TGFED
Sbjct  147  ASFSVHEGIGRTLKGRDLRRVRNAIFEKTGFED  179



>ref|XP_009786538.1| PREDICTED: uncharacterized protein LOC104234640 [Nicotiana sylvestris]
Length=162

 Score = 97.8 bits (242),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 73/155 (47%), Positives = 93/155 (60%), Gaps = 9/155 (6%)
 Frame = -3

Query  612  MAARKSFLFFGVPESITPMTPSGAPQFEFEEsdvwsnnssssvvndgvsssdNTrrssip  433
            MA RK+FLF    + ITP+ PS + QFEF+E+++W NN+SS+      S +  +  +S  
Sbjct  1    MATRKNFLFLERKDRITPL-PSSSLQFEFDEAEIWCNNTSSNENVVHNSEAKISIPNSRF  59

Query  432  ssraaaakkssaaavkaRGVDRPASLPVNIPDWSKILGGEYKdr-rresdeeeeddgdgd  256
              +     + S A           SLPVNIPDWSKILG EY+   +   D     +   +
Sbjct  60   LKKPGKKSERSRAISS-------TSLPVNIPDWSKILGDEYRSCPKEIDDNYNVVEDFDE  112

Query  255  dRVPPHVYLARTRVASLSVHEGIGRTLKGRDLSRV  151
              +PPH YLARTRVAS SVHEGIGRTLKGRDLSRV
Sbjct  113  IGIPPHEYLARTRVASFSVHEGIGRTLKGRDLSRV  147



>ref|XP_004291575.1| PREDICTED: uncharacterized protein LOC101299444 [Fragaria vesca 
subsp. vesca]
Length=171

 Score = 98.2 bits (243),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 59/90 (66%), Positives = 70/90 (78%), Gaps = 7/90 (8%)
 Frame = -3

Query  363  ASLPVNIPDWSKILGGEYKdrrresdeeeedd---gdgddRVPPHVYLAR----TRVASL  205
            ASLPV IPDWSKIL  EY++ RR  D+++ D+     G  RVPPH +LAR    TR+AS 
Sbjct  82   ASLPVGIPDWSKILRDEYRENRRSDDDDDVDEDEWSAGSVRVPPHEFLARQMARTRIASF  141

Query  204  SVHEGIGRTLKGRDLSRVRNAIWKQTGFED  115
            SVHEG+GRTLKGRDLSRVRNAIW++TGFED
Sbjct  142  SVHEGVGRTLKGRDLSRVRNAIWEKTGFED  171



>ref|XP_008359263.1| PREDICTED: uncharacterized protein LOC103422971 [Malus domestica]
Length=165

 Score = 98.2 bits (243),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 59/91 (65%), Positives = 71/91 (78%), Gaps = 7/91 (8%)
 Frame = -3

Query  366  PASLPVNIPDWSKILGGEYKdrrresdeeeeddgdgdd---RVPPHVYLAR----TRVAS  208
            P+SLPV IPDWSKIL  EY+++RR  D++E D  D  +   R+PPH  LAR    TR+AS
Sbjct  75   PSSLPVGIPDWSKILRDEYREKRRSEDDDEADGEDDVEGGVRIPPHELLARQMARTRIAS  134

Query  207  LSVHEGIGRTLKGRDLSRVRNAIWKQTGFED  115
             SVHEG+GRTLKGRDLSRVRNAIW++TGFED
Sbjct  135  FSVHEGVGRTLKGRDLSRVRNAIWEKTGFED  165



>dbj|BAJ92790.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK05208.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=171

 Score = 98.2 bits (243),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 51/93 (55%), Positives = 61/93 (66%), Gaps = 9/93 (10%)
 Frame = -3

Query  366  PASLPVNIPDWSKILGGEYKdrrr---------esdeeeeddgdgddRVPPHVYLARTRV  214
            P SLP++IPDW KILGGEY+D            +   +          VPPH    R+R 
Sbjct  79   PGSLPMSIPDWQKILGGEYRDHYAGEWELDGDDDDYSKLGAGCRSGSVVPPHELAWRSRA  138

Query  213  ASLSVHEGIGRTLKGRDLSRVRNAIWKQTGFED  115
            ASLSVHEG+GRTLKGRDLSRVR+A+WK+TGFED
Sbjct  139  ASLSVHEGVGRTLKGRDLSRVRDAVWKRTGFED  171



>ref|XP_006481461.1| PREDICTED: uncharacterized protein LOC102610402 [Citrus sinensis]
Length=176

 Score = 98.2 bits (243),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 58/93 (62%), Positives = 64/93 (69%), Gaps = 10/93 (11%)
 Frame = -3

Query  363  ASLPVNIPDWSKILGGEYKdrrresdeeeeddgdgddR----------VPPHVYLARTRV  214
            ASLPVNIPDWSKIL  EY++  +   +E+   G GDD           VPPH YLA  R 
Sbjct  84   ASLPVNIPDWSKILKDEYREHSKRESDEDRGGGGGDDDEDKEEEYYGLVPPHEYLAMRRG  143

Query  213  ASLSVHEGIGRTLKGRDLSRVRNAIWKQTGFED  115
            AS SVHEGIGRTLKGRDL RVRNAIWK+ GFED
Sbjct  144  ASFSVHEGIGRTLKGRDLRRVRNAIWKKVGFED  176



>ref|XP_007145215.1| hypothetical protein PHAVU_007G220200g [Phaseolus vulgaris]
 gb|ESW17209.1| hypothetical protein PHAVU_007G220200g [Phaseolus vulgaris]
Length=180

 Score = 98.2 bits (243),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 60/103 (58%), Positives = 64/103 (62%), Gaps = 15/103 (15%)
 Frame = -3

Query  378  GVDR---PASLPVNIPDWSKILGGEYKdr------------rresdeeeeddgdgddRVP  244
            G DR    +SLPVNIPDWSKIL  +YKD                  +E         RVP
Sbjct  78   GRDRVPSASSLPVNIPDWSKILKEDYKDHPRWESDDEEEEEENFDGDERNQGQGLRTRVP  137

Query  243  PHVYLARTRVASLSVHEGIGRTLKGRDLSRVRNAIWKQTGFED  115
            PH YLARTR ASLSVHEGIGRTLKGRDL  VRNAIWK+ GFED
Sbjct  138  PHEYLARTRGASLSVHEGIGRTLKGRDLRSVRNAIWKKVGFED  180



>ref|XP_004304430.1| PREDICTED: uncharacterized protein LOC101312271 [Fragaria vesca 
subsp. vesca]
Length=162

 Score = 97.4 bits (241),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 57/85 (67%), Positives = 66/85 (78%), Gaps = 2/85 (2%)
 Frame = -3

Query  363  ASLPVNIPDWSKILGGE--YKdrrresdeeeeddgdgddRVPPHVYLARTRVASLSVHEG  190
            +S+PVNIPDWSKIL  +   +D   E   E+ +DGD D+R+PPH YLAR R AS SVHEG
Sbjct  78   SSVPVNIPDWSKILKEQRQQRDTSDEDVNEDYEDGDADERLPPHEYLARNRGASFSVHEG  137

Query  189  IGRTLKGRDLSRVRNAIWKQTGFED  115
            +GRTLKGRDL RVRNAIWKQ GFED
Sbjct  138  VGRTLKGRDLRRVRNAIWKQVGFED  162



>ref|XP_002314267.1| hypothetical protein POPTR_0009s01960g [Populus trichocarpa]
 gb|EEE88222.1| hypothetical protein POPTR_0009s01960g [Populus trichocarpa]
Length=182

 Score = 97.8 bits (242),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 59/98 (60%), Positives = 66/98 (67%), Gaps = 14/98 (14%)
 Frame = -3

Query  366  PASLPVNIPDWSKILGGEYKdrrresdeeeeddgdgdd----------RVPPHVYLAR--  223
            P+SLPVNIPDWSKIL  EY+      D    D+ D D           RVPPH  LAR  
Sbjct  85   PSSLPVNIPDWSKILKDEYRRGPDVVDGGGGDEDDDDMDGDDCFDGGVRVPPHELLARQM  144

Query  222  --TRVASLSVHEGIGRTLKGRDLSRVRNAIWKQTGFED  115
              TR+AS SVHEGIGRTLKGRDLSRVRNAIW++TGF+D
Sbjct  145  ARTRIASFSVHEGIGRTLKGRDLSRVRNAIWEKTGFQD  182



>ref|XP_003625632.1| hypothetical protein MTR_7g101250 [Medicago truncatula]
 gb|ABD32800.1| Protein of unknown function DUF584 [Medicago truncatula]
 gb|AES81850.1| senescence regulator [Medicago truncatula]
 gb|AFK45848.1| unknown [Medicago truncatula]
Length=160

 Score = 97.4 bits (241),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 59/83 (71%), Positives = 68/83 (82%), Gaps = 0/83 (0%)
 Frame = -3

Query  363  ASLPVNIPDWSKILGGEYKdrrresdeeeeddgdgddRVPPHVYLARTRVASLSVHEGIG  184
            +SLP+NIPDWSKIL  EYK ++  SD+E+E D DG  ++PPH YLARTR ASLSVHEG G
Sbjct  78   SSLPMNIPDWSKILKEEYKKKKESSDDEDEGDYDGVVQLPPHEYLARTRGASLSVHEGKG  137

Query  183  RTLKGRDLSRVRNAIWKQTGFED  115
            RTLKGRDL  VRNAIWK+ GFED
Sbjct  138  RTLKGRDLRSVRNAIWKKVGFED  160



>ref|XP_010456667.1| PREDICTED: transcription initiation factor TFIID subunit 11 [Camelina 
sativa]
Length=170

 Score = 97.4 bits (241),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 60/94 (64%), Positives = 73/94 (78%), Gaps = 6/94 (6%)
 Frame = -3

Query  378  GVDRPASLPVNIPDWSKILGGEYKdrrresdeeeeddgdgddR------VPPHVYLARTR  217
             V   +SLPVN+PDWSKIL GEY+D RR S E+ +DD D DD       +PPH +LA+TR
Sbjct  77   AVTAASSLPVNVPDWSKILRGEYRDNRRRSIEDNDDDEDDDDCEDGGGWLPPHEFLAKTR  136

Query  216  VASLSVHEGIGRTLKGRDLSRVRNAIWKQTGFED  115
            +AS SVHEGIGRTLKGRDLSRVRNAI+++ GF+D
Sbjct  137  MASFSVHEGIGRTLKGRDLSRVRNAIFEKIGFQD  170



>gb|AFK35468.1| unknown [Lotus japonicus]
Length=166

 Score = 97.4 bits (241),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 54/83 (65%), Positives = 61/83 (73%), Gaps = 0/83 (0%)
 Frame = -3

Query  363  ASLPVNIPDWSKILGGEYKdrrresdeeeeddgdgddRVPPHVYLARTRVASLSVHEGIG  184
            +SLPVNIPDWSKIL   +K+ R   +    DD DG  ++PPH YLAR R AS SVHEG G
Sbjct  84   SSLPVNIPDWSKILKQGHKENRGIDEYAVGDDQDGGSQLPPHEYLARARGASFSVHEGKG  143

Query  183  RTLKGRDLSRVRNAIWKQTGFED  115
            RTLKGRDL  VRNAIWK+ GFED
Sbjct  144  RTLKGRDLRSVRNAIWKKVGFED  166



>gb|KFK27594.1| hypothetical protein AALP_AA8G404000 [Arabis alpina]
Length=165

 Score = 97.1 bits (240),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 53/83 (64%), Positives = 67/83 (81%), Gaps = 2/83 (2%)
 Frame = -3

Query  357  LPVNIPDWSKILGGEYKdrrresdeeeeddgdgddR--VPPHVYLARTRVASLSVHEGIG  184
            LP+N+PDWSKILG E+++ RR S E ++D    D    VPPH +LARTR+AS SVHEG+G
Sbjct  83   LPINVPDWSKILGQEHRNSRRRSIEVDDDGDSDDGGDWVPPHEFLARTRMASFSVHEGVG  142

Query  183  RTLKGRDLSRVRNAIWKQTGFED  115
            RTLKGRDLSRVRNAI+++ GF+D
Sbjct  143  RTLKGRDLSRVRNAIFEKIGFQD  165



>gb|EPS62644.1| hypothetical protein M569_12146, partial [Genlisea aurea]
Length=150

 Score = 96.7 bits (239),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 54/84 (64%), Positives = 66/84 (79%), Gaps = 1/84 (1%)
 Frame = -3

Query  363  ASLPVNIPDWSKILGGEYKdrrresdeeeeddgdg-ddRVPPHVYLARTRVASLSVHEGI  187
            ASLPVN+PDWSKIL  EY   +R  D E+ +D D  ++++PPH +LAR R+ S SVHEGI
Sbjct  67   ASLPVNVPDWSKILKEEYYTEKRCGDGEDVEDVDYGEEKLPPHEFLARARITSFSVHEGI  126

Query  186  GRTLKGRDLSRVRNAIWKQTGFED  115
            GRTLKGRDL RVRNAIW++TGF D
Sbjct  127  GRTLKGRDLRRVRNAIWQKTGFLD  150



>ref|XP_006340195.1| PREDICTED: uncharacterized protein LOC102589274 [Solanum tuberosum]
Length=170

 Score = 97.1 bits (240),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 54/88 (61%), Positives = 71/88 (81%), Gaps = 5/88 (6%)
 Frame = -3

Query  363  ASLPVNIPDWSKILGGEYKdrrresdeeeeddgdgd-dRVPPHVYLAR----TRVASLSV  199
            +S+PVN+PDWSKIL  EY++ RR   +++ +D D   +R+PPH +LAR    TR+AS SV
Sbjct  83   SSMPVNVPDWSKILKDEYRENRRRDSDDDGEDDDDAENRIPPHEFLARQFARTRIASFSV  142

Query  198  HEGIGRTLKGRDLSRVRNAIWKQTGFED  115
            HEG+GRTLKGRDLSRVRNAI+++TGFED
Sbjct  143  HEGVGRTLKGRDLSRVRNAIFEKTGFED  170



>ref|XP_010043750.1| PREDICTED: uncharacterized protein LOC104432877 [Eucalyptus grandis]
Length=185

 Score = 97.4 bits (241),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 59/98 (60%), Positives = 69/98 (70%), Gaps = 15/98 (15%)
 Frame = -3

Query  366  PASLPVNIPDWSKILGGEYKdrrresdeeeeddgdgddR----------VPPHVYLAR--  223
            P+SLPVNIPDWSKIL GEY++ RR     +    D D+           VPPH +LAR  
Sbjct  89   PSSLPVNIPDWSKILRGEYRENRRRDSLGDTCYSDDDEDACGGGEDGGRVPPHEFLARQM  148

Query  222  --TRVASLSVHEGIGRTLKGRDLSRVRNAIWKQTGFED  115
              TR+AS SVHEG+GRTLKGRDLSRVRNAIW++TGFED
Sbjct  149  ARTRIAS-SVHEGVGRTLKGRDLSRVRNAIWEKTGFED  185



>ref|XP_006384902.1| hypothetical protein POPTR_0004s22060g [Populus trichocarpa]
 gb|ERP62699.1| hypothetical protein POPTR_0004s22060g [Populus trichocarpa]
Length=151

 Score = 96.3 bits (238),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 51/88 (58%), Positives = 58/88 (66%), Gaps = 25/88 (28%)
 Frame = -3

Query  366  PASLPVNIPDWSKILGGEYKdrrresdeeeeddgdgddRVPPHVYL----ARTRVASLSV  199
            P+SLPVNIPDWS+IL  E                     VPPH  L    AR+R+AS SV
Sbjct  85   PSSLPVNIPDWSRILKNE---------------------VPPHELLVRQMARSRIASFSV  123

Query  198  HEGIGRTLKGRDLSRVRNAIWKQTGFED  115
            HEGIGRTLKGRDLSRVRNAIW++TGF+D
Sbjct  124  HEGIGRTLKGRDLSRVRNAIWEKTGFQD  151



>gb|KDO73285.1| hypothetical protein CISIN_1g031000mg [Citrus sinensis]
Length=167

 Score = 96.7 bits (239),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 56/93 (60%), Positives = 71/93 (76%), Gaps = 9/93 (10%)
 Frame = -3

Query  366  PASLPVNIPDWSKILGGEYKdrrresdeeeeddg-----dgddRVPPHVYLAR----TRV  214
            PAS+PVNIPDWSKIL  EY+D RR + E+ +D+      +  +RVPPH +LAR    TR+
Sbjct  75   PASVPVNIPDWSKILKDEYRDSRRRAAEDSDDEDGYGGGEDSERVPPHEFLARQMARTRI  134

Query  213  ASLSVHEGIGRTLKGRDLSRVRNAIWKQTGFED  115
             S SVHEG+GRTLKG DL+RVRNAIW++TGF+D
Sbjct  135  VSFSVHEGVGRTLKGGDLTRVRNAIWEKTGFQD  167



>ref|XP_010425942.1| PREDICTED: uncharacterized protein LOC104710977 isoform X1 [Camelina 
sativa]
Length=155

 Score = 96.3 bits (238),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 53/84 (63%), Positives = 66/84 (79%), Gaps = 1/84 (1%)
 Frame = -3

Query  363  ASLPVNIPDWSKILGGE-YKdrrresdeeeeddgdgddRVPPHVYLARTRVASLSVHEGI  187
            +SLPVN+PDWSKILG E +    R    E ++DG G + +PPH YLA+TR+AS SVHEG+
Sbjct  72   SSLPVNVPDWSKILGKENHNRHVRRRSIENDEDGGGGELLPPHEYLAKTRMASFSVHEGV  131

Query  186  GRTLKGRDLSRVRNAIWKQTGFED  115
            GRTLKGRD+SRVRNAI ++TGF D
Sbjct  132  GRTLKGRDMSRVRNAILEKTGFLD  155



>gb|KCW85739.1| hypothetical protein EUGRSUZ_B02501, partial [Eucalyptus grandis]
Length=236

 Score = 98.2 bits (243),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 59/98 (60%), Positives = 69/98 (70%), Gaps = 15/98 (15%)
 Frame = -3

Query  366  PASLPVNIPDWSKILGGEYKdrrresdeeeeddgdgddR----------VPPHVYLAR--  223
            P+SLPVNIPDWSKIL GEY++ RR     +    D D+           VPPH +LAR  
Sbjct  140  PSSLPVNIPDWSKILRGEYRENRRRDSLGDTCYSDDDEDACGGGEDGGRVPPHEFLARQM  199

Query  222  --TRVASLSVHEGIGRTLKGRDLSRVRNAIWKQTGFED  115
              TR+AS SVHEG+GRTLKGRDLSRVRNAIW++TGFED
Sbjct  200  ARTRIAS-SVHEGVGRTLKGRDLSRVRNAIWEKTGFED  236



>gb|KDO45145.1| hypothetical protein CISIN_1g030317mg [Citrus sinensis]
Length=179

 Score = 97.1 bits (240),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 56/96 (58%), Positives = 62/96 (65%), Gaps = 13/96 (14%)
 Frame = -3

Query  363  ASLPVNIPDWSKILGGEYKdrrresdeeeeddgdgddR-------------VPPHVYLAR  223
            ASLPVNIPDWSKIL  EY++  +   +E+   G G                VPPH YLA 
Sbjct  84   ASLPVNIPDWSKILKDEYREHSKRESDEDGGGGGGGGDDDDEDKEEEYYGLVPPHEYLAM  143

Query  222  TRVASLSVHEGIGRTLKGRDLSRVRNAIWKQTGFED  115
             R AS SVHEGIGRTLKGRDL RVRNAIWK+ GFED
Sbjct  144  RRGASFSVHEGIGRTLKGRDLRRVRNAIWKKVGFED  179



>ref|XP_010443870.1| PREDICTED: transcription initiation factor TFIID subunit 11-like 
[Camelina sativa]
Length=168

 Score = 96.7 bits (239),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 59/94 (63%), Positives = 74/94 (79%), Gaps = 6/94 (6%)
 Frame = -3

Query  378  GVDRPASLPVNIPDWSKILGGEYKdrrresdeeeeddgdgddR------VPPHVYLARTR  217
             V   +SLPVN+PDWSKIL GEY+D RR S E+++DD D DD       +PPH +LA+TR
Sbjct  75   AVTAASSLPVNVPDWSKILRGEYRDNRRRSIEDDDDDEDDDDCEDGGGWLPPHEFLAKTR  134

Query  216  VASLSVHEGIGRTLKGRDLSRVRNAIWKQTGFED  115
            +AS SVHEG+GRTLKGRDLSRVRNAI+++ GF+D
Sbjct  135  MASFSVHEGVGRTLKGRDLSRVRNAIFEKIGFQD  168



>ref|XP_006281214.1| hypothetical protein CARUB_v10027254mg [Capsella rubella]
 gb|EOA14112.1| hypothetical protein CARUB_v10027254mg [Capsella rubella]
Length=168

 Score = 96.7 bits (239),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 56/93 (60%), Positives = 70/93 (75%), Gaps = 5/93 (5%)
 Frame = -3

Query  378  GVDRPASLPVNIPDWSKILGGEYKdrrresdeeeeddgdgddR-----VPPHVYLARTRV  214
             V   +SLPVN+PDWSKIL GEY+D RR   E+ +D+   D       +PPH +LA+TR+
Sbjct  76   AVTTASSLPVNVPDWSKILRGEYRDNRRRIIEDNDDEDGDDCEDGGDWLPPHEFLAKTRM  135

Query  213  ASLSVHEGIGRTLKGRDLSRVRNAIWKQTGFED  115
            AS SVHEGIGRTLKGRDLSRVRNAI+++ GF+D
Sbjct  136  ASFSVHEGIGRTLKGRDLSRVRNAIFEKIGFQD  168



>ref|XP_010503169.1| PREDICTED: uncharacterized protein LOC104780370 [Camelina sativa]
Length=157

 Score = 96.3 bits (238),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 53/84 (63%), Positives = 66/84 (79%), Gaps = 1/84 (1%)
 Frame = -3

Query  363  ASLPVNIPDWSKILGGE-YKdrrresdeeeeddgdgddRVPPHVYLARTRVASLSVHEGI  187
            +SLPVN+PDWSKILG E +    R    E ++DG G + +PPH YLA+TR+AS SVHEG+
Sbjct  74   SSLPVNVPDWSKILGKENHNRHVRRRSIENDEDGGGGELLPPHEYLAKTRMASFSVHEGV  133

Query  186  GRTLKGRDLSRVRNAIWKQTGFED  115
            GRTLKGRD+SRVRNAI ++TGF D
Sbjct  134  GRTLKGRDMSRVRNAILEKTGFLD  157



>ref|XP_010264683.1| PREDICTED: uncharacterized protein LOC104602622 [Nelumbo nucifera]
Length=168

 Score = 96.3 bits (238),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 58/95 (61%), Positives = 71/95 (75%), Gaps = 7/95 (7%)
 Frame = -3

Query  378  GVDRPASLPVNIPDWSKILGGEYKdrrresdeeeeddgdgdd---RVPPHVYLAR----T  220
            G     SLPVNIPDWSKIL  +Y+  RR  ++E+ DD D D    ++PPH +LAR    T
Sbjct  74   GTTTAMSLPVNIPDWSKILREDYRASRRAENDEDFDDDDNDSEDNKIPPHEFLARQFART  133

Query  219  RVASLSVHEGIGRTLKGRDLSRVRNAIWKQTGFED  115
            ++AS SVHEGIGRTLKGRDLSRVRNAIW++TGF+D
Sbjct  134  QIASFSVHEGIGRTLKGRDLSRVRNAIWEKTGFQD  168



>ref|XP_010514861.1| PREDICTED: uncharacterized protein LOC104790774 [Camelina sativa]
Length=152

 Score = 95.9 bits (237),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 52/84 (62%), Positives = 66/84 (79%), Gaps = 1/84 (1%)
 Frame = -3

Query  363  ASLPVNIPDWSKILGGE-YKdrrresdeeeeddgdgddRVPPHVYLARTRVASLSVHEGI  187
            +SLP+N+PDWSKILG E +    R    E ++DG G + +PPH YLA+TR+AS SVHEG+
Sbjct  69   SSLPMNVPDWSKILGKENHSHHVRRKSIENDEDGGGGELLPPHEYLAKTRMASFSVHEGV  128

Query  186  GRTLKGRDLSRVRNAIWKQTGFED  115
            GRTLKGRD+SRVRNAI ++TGF D
Sbjct  129  GRTLKGRDMSRVRNAILEKTGFLD  152



>ref|XP_010253678.1| PREDICTED: uncharacterized protein LOC104594856 [Nelumbo nucifera]
Length=168

 Score = 96.3 bits (238),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 59/89 (66%), Positives = 68/89 (76%), Gaps = 7/89 (8%)
 Frame = -3

Query  360  SLPVNIPDWSKILGGEYKdrrresdeeeeddgdgdd---RVPPHVYLAR----TRVASLS  202
            SLPVNIPDWSKIL  +Y+D RR  + +  DD D D    R+PPH +LAR    TR AS S
Sbjct  80   SLPVNIPDWSKILREDYRDTRRRENNDNFDDEDEDSEDSRIPPHEFLARQFARTRTASFS  139

Query  201  VHEGIGRTLKGRDLSRVRNAIWKQTGFED  115
            VHEGIGRTLKGRDLSRVRNAIW++TGF+D
Sbjct  140  VHEGIGRTLKGRDLSRVRNAIWEKTGFQD  168



>ref|XP_007162749.1| hypothetical protein PHAVU_001G177200g [Phaseolus vulgaris]
 gb|ESW34743.1| hypothetical protein PHAVU_001G177200g [Phaseolus vulgaris]
Length=162

 Score = 95.9 bits (237),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 52/84 (62%), Positives = 64/84 (76%), Gaps = 1/84 (1%)
 Frame = -3

Query  363  ASLPVNIPDWSKILGGEYKdrrresdeeeeddgdgd-dRVPPHVYLARTRVASLSVHEGI  187
            +S+PVNIPDWSKIL   Y++  + +   ++DD +   +R+PPH YLAR R ASLSVHEG 
Sbjct  79   SSMPVNIPDWSKILKENYEEHDKRNCVSDDDDDNDGGERIPPHEYLARNRGASLSVHEGK  138

Query  186  GRTLKGRDLSRVRNAIWKQTGFED  115
            GRTLKGRDL  VRNAIWK+ GFED
Sbjct  139  GRTLKGRDLRSVRNAIWKKIGFED  162



>ref|XP_010046638.1| PREDICTED: uncharacterized protein LOC104435621 [Eucalyptus grandis]
 gb|KCW88812.1| hypothetical protein EUGRSUZ_A01148 [Eucalyptus grandis]
Length=167

 Score = 95.9 bits (237),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 53/87 (61%), Positives = 62/87 (71%), Gaps = 6/87 (7%)
 Frame = -3

Query  357  LPVNIPDWSKILGGEY------KdrrresdeeeeddgdgddRVPPHVYLARTRVASLSVH  196
            LPVNIPDW+KIL G+Y      ++        + +  D  DRVPPH +LAR R ASLSVH
Sbjct  81   LPVNIPDWAKILQGDYGEHQRGREGAEVFGGSDGEVEDDGDRVPPHEFLARRRGASLSVH  140

Query  195  EGIGRTLKGRDLSRVRNAIWKQTGFED  115
            EG+GRTLKGRDL RVRNAIWK+ GFED
Sbjct  141  EGVGRTLKGRDLRRVRNAIWKKVGFED  167



>ref|XP_011040881.1| PREDICTED: uncharacterized protein LOC105137020 [Populus euphratica]
Length=183

 Score = 96.3 bits (238),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 58/100 (58%), Positives = 69/100 (69%), Gaps = 15/100 (15%)
 Frame = -3

Query  369  RPASLPVNIPDWSKILGGEYKdrrresdeeeeddgdgdd-----------RVPPHVYL--  229
            +P+SLPVNIPDWS+IL  EY+      D+  + D D DD           RVPPH  L  
Sbjct  84   KPSSLPVNIPDWSRILKNEYRRGSAVVDDRGDVDDDEDDVDGDDCFDRGVRVPPHELLVR  143

Query  228  --ARTRVASLSVHEGIGRTLKGRDLSRVRNAIWKQTGFED  115
              AR+R+AS SVHEGIGRTLKGRDLSRVRNAIW++TGF+D
Sbjct  144  QMARSRIASFSVHEGIGRTLKGRDLSRVRNAIWEKTGFQD  183



>ref|XP_009400822.1| PREDICTED: uncharacterized protein LOC103984958 [Musa acuminata 
subsp. malaccensis]
Length=172

 Score = 95.9 bits (237),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 57/95 (60%), Positives = 66/95 (69%), Gaps = 11/95 (12%)
 Frame = -3

Query  366  PASLPVNIPDWSKILG-----------GEYKdrrresdeeeeddgdgddRVPPHVYLART  220
            PASLPVNIPDWSKILG           G + +   E +  + D+ DG   VPPH  L R+
Sbjct  78   PASLPVNIPDWSKILGNCANSHGKNSSGFWGEEEEEEEVIDGDELDGRRMVPPHELLWRS  137

Query  219  RVASLSVHEGIGRTLKGRDLSRVRNAIWKQTGFED  115
            R AS+SVHEGIGRTLKGRDLSRVRNA+W+ TGFED
Sbjct  138  RAASMSVHEGIGRTLKGRDLSRVRNAVWQITGFED  172



>emb|CDP06741.1| unnamed protein product [Coffea canephora]
Length=192

 Score = 96.3 bits (238),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 60/86 (70%), Positives = 66/86 (77%), Gaps = 4/86 (5%)
 Frame = -3

Query  360  SLPVNIPDWSKILGGEYKdrrre--sdeeeeddgdgddRVPPHVYLA-RTRVA-SLSVHE  193
            SLPVN+PDWS+ILG EYK R       E+ EDD D D ++PPH YLA RTR   S SV E
Sbjct  107  SLPVNVPDWSRILGDEYKSRGSNGREHEDGEDDKDEDGKLPPHEYLAARTRSGWSFSVQE  166

Query  192  GIGRTLKGRDLSRVRNAIWKQTGFED  115
            GIGRTLKGRDLSRVRNA+WKQTGFED
Sbjct  167  GIGRTLKGRDLSRVRNAVWKQTGFED  192



>ref|XP_003580155.1| PREDICTED: uncharacterized protein LOC100822702 [Brachypodium 
distachyon]
Length=175

 Score = 95.9 bits (237),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 56/93 (60%), Positives = 67/93 (72%), Gaps = 6/93 (6%)
 Frame = -3

Query  375  VDRPA---SLPVNIPDWSKILGGEYKdrrre---sdeeeeddgdgddRVPPHVYLARTRV  214
            +DRPA   SLP++IPDW KILG EY+D  R         +DD  G   +PPH    R+R 
Sbjct  83   LDRPAVRGSLPMSIPDWQKILGVEYRDHYRAGEWEVNGGDDDDYGKVMIPPHELAWRSRA  142

Query  213  ASLSVHEGIGRTLKGRDLSRVRNAIWKQTGFED  115
            AS+SVHEGIGRTLKGRDLSRVR+A+WK+TGFED
Sbjct  143  ASMSVHEGIGRTLKGRDLSRVRDAVWKKTGFED  175



>gb|EYU18831.1| hypothetical protein MIMGU_mgv1a015289mg [Erythranthe guttata]
Length=162

 Score = 95.5 bits (236),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 56/92 (61%), Positives = 70/92 (76%), Gaps = 5/92 (5%)
 Frame = -3

Query  375  VDRPASLPVNIPDWSKILGGEYKdrrresdeeeeddgdgdd-RVPPHVYLAR----TRVA  211
            VD   SLPVN+PDWSKIL  EY++ RR   +++ ++ DG   R+PPH +LAR    TR+A
Sbjct  71   VDGAGSLPVNVPDWSKILKEEYRENRRTEIDDDYEEEDGGGIRIPPHEFLARQMARTRIA  130

Query  210  SLSVHEGIGRTLKGRDLSRVRNAIWKQTGFED  115
            S SVHEG GRTLKGRDLSRVR +IW++TGFED
Sbjct  131  SFSVHEGRGRTLKGRDLSRVRGSIWQKTGFED  162



>ref|XP_006424568.1| hypothetical protein CICLE_v10029410mg [Citrus clementina]
 ref|XP_006488088.1| PREDICTED: uncharacterized protein LOC102625771 [Citrus sinensis]
 gb|ESR37808.1| hypothetical protein CICLE_v10029410mg [Citrus clementina]
Length=167

 Score = 95.5 bits (236),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 57/93 (61%), Positives = 69/93 (74%), Gaps = 9/93 (10%)
 Frame = -3

Query  366  PASLPVNIPDWSKILGGEYKdrrresdeeeeddgdgdd-----RVPPHVYLAR----TRV  214
            PAS+PVNIPDWSKIL  EY+D RR + E+ +DD          RVPPH +LAR    TR+
Sbjct  75   PASVPVNIPDWSKILKDEYRDSRRRAAEDSDDDDGYGGGEDSVRVPPHEFLARQMARTRI  134

Query  213  ASLSVHEGIGRTLKGRDLSRVRNAIWKQTGFED  115
             S SVHEG+GRTLKG DL+RVRNAIW++TGF+D
Sbjct  135  VSFSVHEGVGRTLKGGDLTRVRNAIWEKTGFQD  167



>ref|XP_002877392.1| hypothetical protein ARALYDRAFT_484911 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH53651.1| hypothetical protein ARALYDRAFT_484911 [Arabidopsis lyrata subsp. 
lyrata]
Length=148

 Score = 94.7 bits (234),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 48/81 (59%), Positives = 59/81 (73%), Gaps = 6/81 (7%)
 Frame = -3

Query  357  LPVNIPDWSKILGGEYKdrrresdeeeeddgdgddRVPPHVYLARTRVASLSVHEGIGRT  178
            LP+N+PDWSKILG E +      D+ +         +PPH YLA+TR+AS SVHEGIGRT
Sbjct  74   LPMNVPDWSKILGKENRKSIDNDDDGDGGK------LPPHEYLAKTRMASFSVHEGIGRT  127

Query  177  LKGRDLSRVRNAIWKQTGFED  115
            LKGRD+SRVRNAI ++TGF D
Sbjct  128  LKGRDMSRVRNAILEKTGFLD  148



>ref|NP_001053333.1| Os04g0520700 [Oryza sativa Japonica Group]
 emb|CAD41447.1| OSJNBa0019D11.12 [Oryza sativa Japonica Group]
 dbj|BAF15247.1| Os04g0520700 [Oryza sativa Japonica Group]
 emb|CAH67522.1| OSIGBa0131L05.3 [Oryza sativa Indica Group]
 gb|EAZ13689.1| hypothetical protein OsJ_03611 [Oryza sativa Japonica Group]
 dbj|BAG89696.1| unnamed protein product [Oryza sativa Japonica Group]
Length=174

 Score = 95.5 bits (236),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 57/100 (57%), Positives = 66/100 (66%), Gaps = 13/100 (13%)
 Frame = -3

Query  375  VDRPA-SLPVNIPDWSKILGGEYKdrrresde------------eeeddgdgddRVPPHV  235
            +DR A SLPVNIPDW KILG EY+D +  + E              +  G G   +PPH 
Sbjct  75   LDRAAGSLPVNIPDWQKILGVEYRDHQAAAAEWELQGDGDDDYEYGKVAGVGGVVIPPHE  134

Query  234  YLARTRVASLSVHEGIGRTLKGRDLSRVRNAIWKQTGFED  115
               R R ASLSVHEGIGRTLKGRDLSRVR+A+WK+TGFED
Sbjct  135  LAWRGRAASLSVHEGIGRTLKGRDLSRVRDAVWKKTGFED  174



>ref|XP_006292450.1| hypothetical protein CARUB_v10018671mg [Capsella rubella]
 gb|EOA25348.1| hypothetical protein CARUB_v10018671mg [Capsella rubella]
Length=168

 Score = 95.1 bits (235),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 54/90 (60%), Positives = 64/90 (71%), Gaps = 7/90 (8%)
 Frame = -3

Query  363  ASLPVNIPDWSKILGGEYKdrrresdeeeeddgdgddR-------VPPHVYLARTRVASL  205
            +SLPVN+PDWSKILG E     R    E +DDG G          +PPH YLA+TR+AS 
Sbjct  79   SSLPVNVPDWSKILGKENNRHVRRKSIENDDDGGGYGGVGGGGEVLPPHEYLAKTRMASF  138

Query  204  SVHEGIGRTLKGRDLSRVRNAIWKQTGFED  115
            SVHEG+GRTLKGRD+SRVRNAI ++TGF D
Sbjct  139  SVHEGVGRTLKGRDMSRVRNAILEKTGFLD  168



>ref|XP_009381973.1| PREDICTED: uncharacterized protein LOC103970065 [Musa acuminata 
subsp. malaccensis]
Length=167

 Score = 95.1 bits (235),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 57/98 (58%), Positives = 65/98 (66%), Gaps = 12/98 (12%)
 Frame = -3

Query  372  DRPA---SLPVNIPDWSKILGGEYKdrrresdeeeeddgdgddRV---------PPHVYL  229
            DRPA   SLPVNIPDWSKILG  Y      S +  E+D D D  V         PPH  L
Sbjct  70   DRPAAASSLPVNIPDWSKILGNCYGGSNSSSRDWWEEDDDEDGGVGGSVAGPVIPPHELL  129

Query  228  ARTRVASLSVHEGIGRTLKGRDLSRVRNAIWKQTGFED  115
             R+R AS SVHEG+G TLKGRDL+RVRNAIW++TGF+D
Sbjct  130  CRSRAASFSVHEGVGCTLKGRDLNRVRNAIWEKTGFQD  167



>gb|EPS60592.1| hypothetical protein M569_14211 [Genlisea aurea]
Length=162

 Score = 94.7 bits (234),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 54/93 (58%), Positives = 68/93 (73%), Gaps = 5/93 (5%)
 Frame = -3

Query  378  GVDRPASLPVNIPDWSKILGGEYKdrrresdeeeeddgdgd-dRVPPHVYLARTR----V  214
            G  RPASLP+N+PDWSKIL  EY++ R   + E  ++ DG   R+PPH  +AR      +
Sbjct  70   GKGRPASLPMNVPDWSKILKDEYRENRHRDEGEGWEEEDGVGRRIPPHEMVARQTARAGI  129

Query  213  ASLSVHEGIGRTLKGRDLSRVRNAIWKQTGFED  115
            AS SVHEG+GRTLKGRDLSRVRNA+W++ GFED
Sbjct  130  ASFSVHEGVGRTLKGRDLSRVRNAVWQKIGFED  162



>gb|KFK33927.1| hypothetical protein AALP_AA5G079000 [Arabis alpina]
Length=152

 Score = 94.4 bits (233),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 56/85 (66%), Positives = 66/85 (78%), Gaps = 2/85 (2%)
 Frame = -3

Query  363  ASLPVNIPDWSKILGGEYKdrrresdeeeeddgdgdd--RVPPHVYLARTRVASLSVHEG  190
             SLP+N+PDWSKIL  E +  RR S E  +D  D  D  R+PPH YLARTR+AS SVHEG
Sbjct  68   GSLPMNVPDWSKILREENRHSRRRSIENNDDGEDCIDGGRLPPHEYLARTRMASFSVHEG  127

Query  189  IGRTLKGRDLSRVRNAIWKQTGFED  115
            +GRTLKGRDLSRVRNAI+++TGF D
Sbjct  128  VGRTLKGRDLSRVRNAIFEKTGFLD  152



>ref|XP_008387660.1| PREDICTED: uncharacterized protein LOC103450120 [Malus domestica]
Length=179

 Score = 95.1 bits (235),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 55/92 (60%), Positives = 65/92 (71%), Gaps = 9/92 (10%)
 Frame = -3

Query  363  ASLPVNIPDWSKILGGEYKdrrresde---------eeeddgdgddRVPPHVYLARTRVA  211
            +SLPVNIPDWS+IL   YK++R+              ++D+  G  RVPPH YLAR R A
Sbjct  88   SSLPVNIPDWSEILKEGYKEQRKLESGEDGGGDFYGADDDNDSGYGRVPPHEYLARMRGA  147

Query  210  SLSVHEGIGRTLKGRDLSRVRNAIWKQTGFED  115
            S SVHEGIGRTLKGRDL RVRNAIW++ GFED
Sbjct  148  SFSVHEGIGRTLKGRDLRRVRNAIWEKVGFED  179



>ref|XP_010535607.1| PREDICTED: uncharacterized protein LOC104810859 [Tarenaya hassleriana]
Length=163

 Score = 94.7 bits (234),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 55/86 (64%), Positives = 66/86 (77%), Gaps = 5/86 (6%)
 Frame = -3

Query  357  LPVNIPDWSKILGGEYKdrrresdeeeed-----dgdgddRVPPHVYLARTRVASLSVHE  193
            LPVN+PDWSKIL  EY+D RR S + ++         G  RVPPH +LARTR+AS SVHE
Sbjct  78   LPVNVPDWSKILREEYRDNRRGSGDYDDGDGNDWSDAGGGRVPPHEFLARTRMASFSVHE  137

Query  192  GIGRTLKGRDLSRVRNAIWKQTGFED  115
            G+GRTLKGRDLSRVRNAI+++ GFED
Sbjct  138  GVGRTLKGRDLSRVRNAIFEKIGFED  163



>gb|EPS70245.1| hypothetical protein M569_04515 [Genlisea aurea]
Length=159

 Score = 94.4 bits (233),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 57/89 (64%), Positives = 68/89 (76%), Gaps = 5/89 (6%)
 Frame = -3

Query  366  PASLPVNIPDWSKILGGEYKdrrresdeeeeddgdgd-dRVPPHVY----LARTRVASLS  202
            PASLPVN+PDWSKIL  EY+D RR   EEEE++ D    R+PPH      +AR R+ S S
Sbjct  71   PASLPVNVPDWSKILKQEYRDHRRREIEEEEEEEDDVGRRIPPHELIARQMARARITSFS  130

Query  201  VHEGIGRTLKGRDLSRVRNAIWKQTGFED  115
            VHEG+GRTLKGRDLSRVRNA+W++ GFED
Sbjct  131  VHEGVGRTLKGRDLSRVRNAVWQKIGFED  159



>ref|XP_004251136.1| PREDICTED: uncharacterized protein LOC101259309 [Solanum lycopersicum]
Length=173

 Score = 94.7 bits (234),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 53/86 (62%), Positives = 69/86 (80%), Gaps = 5/86 (6%)
 Frame = -3

Query  357  LPVNIPDWSKILGGEYKdrrresdeeeeddgdgd-dRVPPHVYLAR----TRVASLSVHE  193
            +PVN+PDWSKIL  EY++ RR   +++ +D D   +R+PPH +LAR    TR+AS SVHE
Sbjct  88   MPVNVPDWSKILKDEYRENRRRDSDDDGEDDDDAENRIPPHEFLARQFARTRIASFSVHE  147

Query  192  GIGRTLKGRDLSRVRNAIWKQTGFED  115
            G+GRTLKGRDLSRVRNAI+++TGFED
Sbjct  148  GVGRTLKGRDLSRVRNAIFEKTGFED  173



>ref|NP_200876.1| uncharacterized protein [Arabidopsis thaliana]
 dbj|BAB09841.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAL36227.1| unknown protein [Arabidopsis thaliana]
 gb|AAM14170.1| unknown protein [Arabidopsis thaliana]
 gb|AED97366.1| uncharacterized protein AT5G60680 [Arabidopsis thaliana]
Length=163

 Score = 94.4 bits (233),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 55/85 (65%), Positives = 70/85 (82%), Gaps = 4/85 (5%)
 Frame = -3

Query  357  LPVNIPDWSKILGGEYKdrrresdeeeeddgdgddR----VPPHVYLARTRVASLSVHEG  190
            LPVN+PDWSKIL GEY+D RR S E+ +DD D ++     +PPH +LA+TR+AS SVHEG
Sbjct  79   LPVNVPDWSKILRGEYRDNRRRSIEDNDDDDDDNEDGGDWLPPHEFLAKTRMASFSVHEG  138

Query  189  IGRTLKGRDLSRVRNAIWKQTGFED  115
            +GRTLKGRDLSRVRNAI+++ GF+D
Sbjct  139  VGRTLKGRDLSRVRNAIFEKFGFQD  163



>ref|XP_002864697.1| hypothetical protein ARALYDRAFT_496217 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH40956.1| hypothetical protein ARALYDRAFT_496217 [Arabidopsis lyrata subsp. 
lyrata]
Length=158

 Score = 94.0 bits (232),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 55/86 (64%), Positives = 71/86 (83%), Gaps = 3/86 (3%)
 Frame = -3

Query  363  ASLPVNIPDWSKILGGEYKdrrresdeeeeddgdgddR---VPPHVYLARTRVASLSVHE  193
            +SLP+N+PDWSKIL  EY+D RR S E+ +DD D +D    +PPH +LA+TR+AS SVHE
Sbjct  73   SSLPINVPDWSKILREEYRDNRRRSIEDNDDDDDNEDGGGWLPPHEFLAKTRMASFSVHE  132

Query  192  GIGRTLKGRDLSRVRNAIWKQTGFED  115
            G+GRTLKGRDLSRVRNAI+++ GF+D
Sbjct  133  GVGRTLKGRDLSRVRNAIFEKIGFQD  158



>ref|XP_004493973.1| PREDICTED: uncharacterized protein LOC101494881 [Cicer arietinum]
Length=162

 Score = 94.0 bits (232),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 55/83 (66%), Positives = 65/83 (78%), Gaps = 3/83 (4%)
 Frame = -3

Query  363  ASLPVNIPDWSKILGGEYKdrrresdeeeeddgdgddRVPPHVYLARTRVASLSVHEGIG  184
            +SLP+NIPDWSK L  +YK ++  SD+E++D G     +PPH YLARTR ASLSVHEG G
Sbjct  83   SSLPMNIPDWSKNLKEDYKKKKESSDDEDDDGGIR---LPPHEYLARTRGASLSVHEGKG  139

Query  183  RTLKGRDLSRVRNAIWKQTGFED  115
            RTLKGRDL  VRNAIWK+ GFED
Sbjct  140  RTLKGRDLCSVRNAIWKKVGFED  162



>ref|XP_010934341.1| PREDICTED: uncharacterized protein LOC105054512 [Elaeis guineensis]
Length=156

 Score = 94.0 bits (232),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 54/89 (61%), Positives = 65/89 (73%), Gaps = 5/89 (6%)
 Frame = -3

Query  366  PASLPVNIPDWSKILGGEY-----KdrrresdeeeeddgdgddRVPPHVYLARTRVASLS  202
            P+SLPVNIPDWSKIL  EY     K RR   D+ +++   G   +PPH  L R+R AS S
Sbjct  68   PSSLPVNIPDWSKILREEYRGDNSKSRRDFEDDGDDEGVGGGPLIPPHELLWRSRGASFS  127

Query  201  VHEGIGRTLKGRDLSRVRNAIWKQTGFED  115
            VHEGIGRTLKGRDLSRVRNA+W++ GF+D
Sbjct  128  VHEGIGRTLKGRDLSRVRNAVWEKIGFQD  156



>ref|XP_002519536.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF42950.1| conserved hypothetical protein [Ricinus communis]
Length=176

 Score = 94.0 bits (232),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 52/90 (58%), Positives = 62/90 (69%), Gaps = 7/90 (8%)
 Frame = -3

Query  363  ASLPVNIPDWSKILGGEYKdrrresdeeeeddgdgddR-------VPPHVYLARTRVASL  205
            +SLPVNIPDWSKI   +++ +    D+++ D    +         VPPH YLAR R AS 
Sbjct  87   SSLPVNIPDWSKIYRVDHRGQSNNLDDQDSDYDILNHDDDAYDGRVPPHEYLARRRGASF  146

Query  204  SVHEGIGRTLKGRDLSRVRNAIWKQTGFED  115
            SVHEGIGRTLKGRDL +VRNAIWKQ GFED
Sbjct  147  SVHEGIGRTLKGRDLRQVRNAIWKQVGFED  176



>gb|AFW58878.1| hypothetical protein ZEAMMB73_952839 [Zea mays]
Length=180

 Score = 94.0 bits (232),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 51/90 (57%), Positives = 61/90 (68%), Gaps = 8/90 (9%)
 Frame = -3

Query  360  SLPVNIPDWSKILGGEYKdrrresd--------eeeeddgdgddRVPPHVYLARTRVASL  205
            SLP+NIPDW KILG EY+D +   +                G + VPPH    R+R ASL
Sbjct  91   SLPMNIPDWQKILGVEYRDHQHAGEWEADADDGGGGGGSYGGAEMVPPHELAWRSRAASL  150

Query  204  SVHEGIGRTLKGRDLSRVRNAIWKQTGFED  115
            SVHEG+GRTLKGRDLSRVR+A+WK+TGFED
Sbjct  151  SVHEGVGRTLKGRDLSRVRDAVWKRTGFED  180



>ref|XP_011007679.1| PREDICTED: uncharacterized protein LOC105113274 [Populus euphratica]
Length=168

 Score = 94.0 bits (232),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 59/97 (61%), Positives = 64/97 (66%), Gaps = 11/97 (11%)
 Frame = -3

Query  372  DRP----ASLPVNIPDWSKILGGEYKdrrresdeeeeddgdgdd-------RVPPHVYLA  226
            DRP    ASLPVNIPDWSKI     +     S    +DD D DD       RVPPH YLA
Sbjct  72   DRPPVTCASLPVNIPDWSKIYSDHQRTENENSIYRLDDDSDHDDDDDDQDGRVPPHEYLA  131

Query  225  RTRVASLSVHEGIGRTLKGRDLSRVRNAIWKQTGFED  115
            R R AS SVHEGIGRTLKGRDL +VRNA+WK+ GFED
Sbjct  132  RRRGASFSVHEGIGRTLKGRDLRQVRNAVWKRVGFED  168



>gb|KHN02339.1| hypothetical protein glysoja_002363 [Glycine soja]
Length=139

 Score = 92.8 bits (229),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 49/83 (59%), Positives = 59/83 (71%), Gaps = 4/83 (5%)
 Frame = -3

Query  363  ASLPVNIPDWSKILGGEYKdrrresdeeeeddgdgddRVPPHVYLARTRVASLSVHEGIG  184
            +S+PV IPDWSKIL  ++K+ ++     + D       VPPH YLARTR AS SVHEG G
Sbjct  61   SSMPVAIPDWSKILKEDFKEHKKREFVSDHDYDR----VPPHEYLARTREASHSVHEGKG  116

Query  183  RTLKGRDLSRVRNAIWKQTGFED  115
            RTLKGRDL  VRN+IWK+ GFED
Sbjct  117  RTLKGRDLRSVRNSIWKKLGFED  139



>ref|XP_003554378.1| PREDICTED: uncharacterized protein LOC100808952 [Glycine max]
Length=152

 Score = 92.8 bits (229),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 49/83 (59%), Positives = 59/83 (71%), Gaps = 4/83 (5%)
 Frame = -3

Query  363  ASLPVNIPDWSKILGGEYKdrrresdeeeeddgdgddRVPPHVYLARTRVASLSVHEGIG  184
            +S+PV IPDWSKIL  ++K+ ++     + D       VPPH YLARTR AS SVHEG G
Sbjct  74   SSMPVAIPDWSKILKEDFKEHKKREFVSDHDYDR----VPPHEYLARTREASHSVHEGKG  129

Query  183  RTLKGRDLSRVRNAIWKQTGFED  115
            RTLKGRDL  VRN+IWK+ GFED
Sbjct  130  RTLKGRDLRSVRNSIWKKLGFED  152



>ref|NP_001144899.1| uncharacterized protein LOC100278004 [Zea mays]
 gb|ACG43745.1| hypothetical protein [Zea mays]
Length=178

 Score = 93.6 bits (231),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 51/89 (57%), Positives = 62/89 (70%), Gaps = 7/89 (8%)
 Frame = -3

Query  360  SLPVNIPDWSKILGGEYKdrrresdeeeeddgdg-------ddRVPPHVYLARTRVASLS  202
            SLP+NIPDW KILG EY+D     + E + +  G        + VPPH    R+R ASLS
Sbjct  90   SLPMNIPDWQKILGVEYRDHHHAGEWEADANDGGGGGSYGGAEMVPPHELAWRSRAASLS  149

Query  201  VHEGIGRTLKGRDLSRVRNAIWKQTGFED  115
            VHEG+GRTLKGRDLSRVR+ +WK+TGFED
Sbjct  150  VHEGVGRTLKGRDLSRVRDXVWKRTGFED  178



>ref|XP_008785283.1| PREDICTED: uncharacterized protein LOC103703964 [Phoenix dactylifera]
Length=157

 Score = 92.8 bits (229),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 54/93 (58%), Positives = 64/93 (69%), Gaps = 6/93 (6%)
 Frame = -3

Query  375  VDRPASLPVNIPDWSKILGGEYKdrrresdeeeeddgdgddRV------PPHVYLARTRV  214
            V  PASLPVNIPDWSKIL  E++     S   + +D   D+ V      PPH  L R+R 
Sbjct  65   VTAPASLPVNIPDWSKILREEHRGNSSSSSRRDFEDDADDEGVGGGPVIPPHELLWRSRG  124

Query  213  ASLSVHEGIGRTLKGRDLSRVRNAIWKQTGFED  115
            AS SVHEGIGRTLKGRDLSRVRNA+W++ GF+D
Sbjct  125  ASFSVHEGIGRTLKGRDLSRVRNAVWEKIGFQD  157



>ref|XP_010543396.1| PREDICTED: uncharacterized protein LOC104816337 [Tarenaya hassleriana]
Length=162

 Score = 93.2 bits (230),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 51/82 (62%), Positives = 62/82 (76%), Gaps = 1/82 (1%)
 Frame = -3

Query  360  SLPVNIPDWSKILGGEYKdrrresdeeeeddgdgddRVPPHVYLARTRVASLSVHEGIGR  181
            SLPVN+PDWSKIL  EYK R +   ++++D G  +   PPH YLAR R  S SVHEG GR
Sbjct  82   SLPVNVPDWSKILKSEYKCRCKRDSDDDDDGGGWER-TPPHEYLARRRGWSFSVHEGNGR  140

Query  180  TLKGRDLSRVRNAIWKQTGFED  115
            TLKGRDL R+RNAIW++TGF+D
Sbjct  141  TLKGRDLWRLRNAIWEKTGFQD  162



>gb|ACU21467.1| unknown [Glycine max]
Length=152

 Score = 92.8 bits (229),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 49/83 (59%), Positives = 59/83 (71%), Gaps = 4/83 (5%)
 Frame = -3

Query  363  ASLPVNIPDWSKILGGEYKdrrresdeeeeddgdgddRVPPHVYLARTRVASLSVHEGIG  184
            +S+PV IPDWSKIL  ++K+ ++     + D       VPPH YLARTR AS SVHEG G
Sbjct  74   SSMPVAIPDWSKILKEDFKEHKKREFVSDHDYDR----VPPHEYLARTREASHSVHEGKG  129

Query  183  RTLKGRDLSRVRNAIWKQTGFED  115
            RTLKGRDL  VRN+IWK+ GFED
Sbjct  130  RTLKGRDLRSVRNSIWKKLGFED  152



>ref|NP_001144115.1| uncharacterized protein LOC100276955 [Zea mays]
 gb|ACG38011.1| hypothetical protein [Zea mays]
Length=182

 Score = 93.6 bits (231),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 53/95 (56%), Positives = 61/95 (64%), Gaps = 13/95 (14%)
 Frame = -3

Query  360  SLPVNIPDWSKILGGEYKdrrresd-------------eeeeddgdgddRVPPHVYLART  220
            SLP+NIPDW KILG EY+D  R  +                     G + VPPH    R+
Sbjct  88   SLPMNIPDWQKILGVEYRDHHRAGEWEPVADDDDDDDGSSYGRARGGAEMVPPHELAWRS  147

Query  219  RVASLSVHEGIGRTLKGRDLSRVRNAIWKQTGFED  115
            R ASLSVHEGIGRTLKGRDLSRVR+A+WK+TGFED
Sbjct  148  RAASLSVHEGIGRTLKGRDLSRVRDAVWKKTGFED  182



>tpg|DAA36906.1| TPA: hypothetical protein ZEAMMB73_312513 [Zea mays]
Length=184

 Score = 93.2 bits (230),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 53/95 (56%), Positives = 61/95 (64%), Gaps = 13/95 (14%)
 Frame = -3

Query  360  SLPVNIPDWSKILGGEYKdrrresd-------------eeeeddgdgddRVPPHVYLART  220
            SLP+NIPDW KILG EY+D  R  +                     G + VPPH    R+
Sbjct  90   SLPMNIPDWQKILGVEYRDHHRAGEWEPGADDDDDDDGSSYGRARGGAEMVPPHELAWRS  149

Query  219  RVASLSVHEGIGRTLKGRDLSRVRNAIWKQTGFED  115
            R ASLSVHEGIGRTLKGRDLSRVR+A+WK+TGFED
Sbjct  150  RAASLSVHEGIGRTLKGRDLSRVRDAVWKKTGFED  184



>ref|XP_007132259.1| hypothetical protein PHAVU_011G079500g [Phaseolus vulgaris]
 gb|ESW04253.1| hypothetical protein PHAVU_011G079500g [Phaseolus vulgaris]
Length=168

 Score = 92.8 bits (229),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 51/88 (58%), Positives = 61/88 (69%), Gaps = 10/88 (11%)
 Frame = -3

Query  348  NIPDWSKILGGEYKdrrresdeeeeddg----------dgddRVPPHVYLARTRVASLSV  199
            NIPDWSKILG EY  R    +  +++D           +   RVPPH +LARTRVAS SV
Sbjct  81   NIPDWSKILGHEYTQRNHNHNHNDDNDDEDHYEGYDEFERSVRVPPHEFLARTRVASFSV  140

Query  198  HEGIGRTLKGRDLSRVRNAIWKQTGFED  115
            HEG+GRTLKGRDLS +RNAIW +TGF+D
Sbjct  141  HEGVGRTLKGRDLSTLRNAIWAKTGFQD  168



>ref|NP_001146522.1| uncharacterized protein LOC100280113 [Zea mays]
 gb|ACL54204.1| unknown [Zea mays]
Length=169

 Score = 92.8 bits (229),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 53/95 (56%), Positives = 61/95 (64%), Gaps = 13/95 (14%)
 Frame = -3

Query  360  SLPVNIPDWSKILGGEYKdrrresd-------------eeeeddgdgddRVPPHVYLART  220
            SLP+NIPDW KILG EY+D  R  +                     G + VPPH    R+
Sbjct  75   SLPMNIPDWQKILGVEYRDHHRAGEWEPGADDDDDDDGSSYGRARGGAEMVPPHELAWRS  134

Query  219  RVASLSVHEGIGRTLKGRDLSRVRNAIWKQTGFED  115
            R ASLSVHEGIGRTLKGRDLSRVR+A+WK+TGFED
Sbjct  135  RAASLSVHEGIGRTLKGRDLSRVRDAVWKKTGFED  169



>ref|XP_002285165.1| PREDICTED: uncharacterized protein LOC100253658 [Vitis vinifera]
Length=167

 Score = 92.4 bits (228),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 58/90 (64%), Positives = 70/90 (78%), Gaps = 8/90 (9%)
 Frame = -3

Query  360  SLPVNIPDWSKILGGEYKdrrresdeeeeddgdgddR----VPPHVYLAR----TRVASL  205
            SLPVNIPDWSKIL  +Y+D RR   ++++DD D D      VPPH +LAR    TR+AS 
Sbjct  78   SLPVNIPDWSKILREDYRDNRRREADDDDDDEDDDGDSSSRVPPHEFLARQFARTRIASF  137

Query  204  SVHEGIGRTLKGRDLSRVRNAIWKQTGFED  115
            SV+EGIGRTLKGRDLSRVRNAIW++TGF+D
Sbjct  138  SVYEGIGRTLKGRDLSRVRNAIWEKTGFQD  167



>emb|CAN61164.1| hypothetical protein VITISV_001394 [Vitis vinifera]
Length=167

 Score = 92.4 bits (228),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 58/90 (64%), Positives = 70/90 (78%), Gaps = 8/90 (9%)
 Frame = -3

Query  360  SLPVNIPDWSKILGGEYKdrrresdeeeeddgdgddR----VPPHVYLAR----TRVASL  205
            SLPVNIPDWSKIL  +Y+D RR   ++++DD D D      VPPH +LAR    TR+AS 
Sbjct  78   SLPVNIPDWSKILREDYRDNRRREADDDDDDEDDDGDSSSRVPPHEFLARQFARTRIASF  137

Query  204  SVHEGIGRTLKGRDLSRVRNAIWKQTGFED  115
            SV+EGIGRTLKGRDLSRVRNAIW++TGF+D
Sbjct  138  SVYEGIGRTLKGRDLSRVRNAIWEKTGFQD  167



>ref|XP_010553009.1| PREDICTED: uncharacterized protein LOC104823238 [Tarenaya hassleriana]
Length=169

 Score = 92.4 bits (228),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 54/88 (61%), Positives = 64/88 (73%), Gaps = 6/88 (7%)
 Frame = -3

Query  360  SLPVNIPDWSKILGGEYKdrrresdeeeeddgdgdd------RVPPHVYLARTRVASLSV  199
            SLPVN+PDWSKIL  EY+ R +   ++ +DD D D       R PPH YLAR R +S SV
Sbjct  82   SLPVNVPDWSKILKSEYRCRCKRDGDDYDDDDDEDGGGGGRVRTPPHEYLARRRGSSFSV  141

Query  198  HEGIGRTLKGRDLSRVRNAIWKQTGFED  115
            HEG GRTLKGRDL RVRNAIW++TGF+D
Sbjct  142  HEGNGRTLKGRDLWRVRNAIWEKTGFQD  169



>ref|XP_009367072.1| PREDICTED: uncharacterized protein LOC103956768 [Pyrus x bretschneideri]
Length=166

 Score = 92.4 bits (228),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 58/90 (64%), Positives = 68/90 (76%), Gaps = 7/90 (8%)
 Frame = -3

Query  366  PASLPVNIPDWSKILGGEY--KdrrresdeeeeddgdgddRVPPHVYLAR----TRVASL  205
            P+SLP  IPDWSKIL  EY  K R  + + + EDD +G  R+PPH  LAR    TR+AS 
Sbjct  78   PSSLP-GIPDWSKILRDEYREKRRSEDDEADGEDDVEGGMRIPPHELLARQMARTRIASF  136

Query  204  SVHEGIGRTLKGRDLSRVRNAIWKQTGFED  115
            SVHEG+GRTLKGRDLSRVRNAIW++TGFED
Sbjct  137  SVHEGVGRTLKGRDLSRVRNAIWEKTGFED  166



>ref|XP_008442681.1| PREDICTED: uncharacterized protein LOC103486480 [Cucumis melo]
Length=178

 Score = 92.4 bits (228),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 54/93 (58%), Positives = 62/93 (67%), Gaps = 5/93 (5%)
 Frame = -3

Query  378  GVDRPASLPVNIPDWSKILGGEY-----KdrrresdeeeeddgdgddRVPPHVYLARTRV  214
             V   +SLPVNIPDWSKIL  +      +    E  ++ +D+ D   R PPH YLAR R 
Sbjct  86   AVKASSSLPVNIPDWSKILQKDQNKHGRRAVAEEDFDDSDDEDDDIRRAPPHEYLARRRG  145

Query  213  ASLSVHEGIGRTLKGRDLSRVRNAIWKQTGFED  115
             S SVHEGIGRTLKGRDL  VRNAIWK+TGFED
Sbjct  146  DSFSVHEGIGRTLKGRDLRMVRNAIWKKTGFED  178



>ref|XP_009126590.1| PREDICTED: uncharacterized protein LOC103851491 [Brassica rapa]
Length=166

 Score = 91.7 bits (226),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 50/90 (56%), Positives = 68/90 (76%), Gaps = 8/90 (9%)
 Frame = -3

Query  360  SLPVNIPDWSKILGGEYKdrrresdeeeeddgdgddR--------VPPHVYLARTRVASL  205
            SLP+N+PDWSKIL  E++D RR   E+++ + +  +         +PPH +LARTR+AS 
Sbjct  77   SLPINVPDWSKILREEHRDNRRRRIEDDDGESEDGEEWLDGSGGRLPPHEFLARTRMASF  136

Query  204  SVHEGIGRTLKGRDLSRVRNAIWKQTGFED  115
            SVHEG+GRTLKGRDLSRVRNAI+++ GF+D
Sbjct  137  SVHEGVGRTLKGRDLSRVRNAIFEKIGFQD  166



>ref|XP_004137823.1| PREDICTED: uncharacterized protein LOC101217342 [Cucumis sativus]
 ref|XP_004164382.1| PREDICTED: uncharacterized protein LOC101230143 [Cucumis sativus]
 gb|KGN58959.1| hypothetical protein Csa_3G739050 [Cucumis sativus]
Length=179

 Score = 92.0 bits (227),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 55/94 (59%), Positives = 61/94 (65%), Gaps = 6/94 (6%)
 Frame = -3

Query  378  GVDRPASLPVNIPDWSKILG------GEYKdrrresdeeeeddgdgddRVPPHVYLARTR  217
             V   +SLPVNIPDWSKIL       G       + D+ ++ D D   R PPH YLAR R
Sbjct  86   AVKASSSLPVNIPDWSKILQKDQNKHGRRAVADEDFDDSDDGDDDDIRRAPPHEYLARRR  145

Query  216  VASLSVHEGIGRTLKGRDLSRVRNAIWKQTGFED  115
              S SVHEGIGRTLKGRDL  VRNAIWK+TGFED
Sbjct  146  GDSFSVHEGIGRTLKGRDLRMVRNAIWKKTGFED  179



>ref|XP_010037963.1| PREDICTED: uncharacterized protein LOC104426559 [Eucalyptus grandis]
 gb|KCW49755.1| hypothetical protein EUGRSUZ_K03248 [Eucalyptus grandis]
Length=176

 Score = 92.0 bits (227),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 57/85 (67%), Positives = 62/85 (73%), Gaps = 2/85 (2%)
 Frame = -3

Query  363  ASLPVNIPDWSKI--LGGEYKdrrresdeeeeddgdgddRVPPHVYLARTRVASLSVHEG  190
            +SLPVNIPDWSKI  L    K   R   ++EE + D D RVPPH YLAR R ASLSVHEG
Sbjct  92   SSLPVNIPDWSKINMLRDRRKGGGRVESDDEEGEDDRDSRVPPHEYLARRRGASLSVHEG  151

Query  189  IGRTLKGRDLSRVRNAIWKQTGFED  115
            IGRTLKGRDLSRVR+AIWK  G  D
Sbjct  152  IGRTLKGRDLSRVRDAIWKTVGLAD  176



>ref|XP_008791539.1| PREDICTED: uncharacterized protein LOC103708409 [Phoenix dactylifera]
Length=162

 Score = 91.7 bits (226),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 52/93 (56%), Positives = 63/93 (68%), Gaps = 9/93 (10%)
 Frame = -3

Query  366  PASLPVNIPDWSKILGGEYKdrrresdeeeeddgdgddR---------VPPHVYLARTRV  214
            PASLP+ IPDWSKIL  EY+     S+   + + D DD          +PPH  L R RV
Sbjct  70   PASLPMGIPDWSKILREEYRGSNSHSNSGRDLEDDDDDDDEGVGSGPVIPPHELLWRNRV  129

Query  213  ASLSVHEGIGRTLKGRDLSRVRNAIWKQTGFED  115
            AS SVHEGIGRTLKGRDLSR+RNA+W++ GF+D
Sbjct  130  ASFSVHEGIGRTLKGRDLSRLRNAVWEKVGFQD  162



>ref|XP_002322879.1| hypothetical protein POPTR_0016s09110g [Populus trichocarpa]
 gb|EEF04640.1| hypothetical protein POPTR_0016s09110g [Populus trichocarpa]
Length=167

 Score = 91.7 bits (226),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 55/89 (62%), Positives = 62/89 (70%), Gaps = 6/89 (7%)
 Frame = -3

Query  363  ASLPVNIPDWSKILGGEYKdrrresdeeeeddgdgdd------RVPPHVYLARTRVASLS  202
            ASLPVNIPDWSKI     +     S  + +DD D DD      RVPPH YLAR R AS S
Sbjct  79   ASLPVNIPDWSKIYSDHQRKENENSIYQLDDDSDHDDDDDLDGRVPPHEYLARRRGASFS  138

Query  201  VHEGIGRTLKGRDLSRVRNAIWKQTGFED  115
            VHEGIGRTLKGRDL +VRNA+W++ GFED
Sbjct  139  VHEGIGRTLKGRDLRQVRNAVWERVGFED  167



>ref|XP_010920416.1| PREDICTED: uncharacterized protein LOC105044291 [Elaeis guineensis]
Length=152

 Score = 91.3 bits (225),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 47/84 (56%), Positives = 60/84 (71%), Gaps = 1/84 (1%)
 Frame = -3

Query  366  PASLPVNIPDWSKILGGEYKdrrresdeeeeddgdgddRVPPHVYLARTRVASLSVHEGI  187
            PAS+P+NIP+WSKIL  EY        + +++       +PPH  L R+R AS SVHEGI
Sbjct  70   PASIPMNIPEWSKILREEY-IGNNSWRDLDDEGEGSGPVIPPHELLWRSRGASFSVHEGI  128

Query  186  GRTLKGRDLSRVRNAIWKQTGFED  115
            GRTLKGRDLSR+RNA+W++ GFED
Sbjct  129  GRTLKGRDLSRLRNAVWEKVGFED  152



>ref|XP_009342883.1| PREDICTED: uncharacterized protein LOC103934848 [Pyrus x bretschneideri]
 ref|XP_009345756.1| PREDICTED: uncharacterized protein LOC103937534 [Pyrus x bretschneideri]
 ref|XP_009345768.1| PREDICTED: uncharacterized protein LOC103937544 [Pyrus x bretschneideri]
Length=179

 Score = 91.7 bits (226),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 55/92 (60%), Positives = 63/92 (68%), Gaps = 9/92 (10%)
 Frame = -3

Query  363  ASLPVNIPDWSKILGGEYKdrrresde---------eeeddgdgddRVPPHVYLARTRVA  211
            +SLPVNIPD SKIL   YK+ R+              ++D+  G  RVPPH YLAR R A
Sbjct  88   SSLPVNIPDCSKILKEGYKEHRKLESGEGGGGDFYGADDDNDGGYGRVPPHEYLARMRGA  147

Query  210  SLSVHEGIGRTLKGRDLSRVRNAIWKQTGFED  115
            S SVHEGIGRTLKGRDL RVRNAIW++ GFED
Sbjct  148  SFSVHEGIGRTLKGRDLRRVRNAIWEKVGFED  179



>ref|XP_009120602.1| PREDICTED: uncharacterized protein LOC103845482 [Brassica rapa]
Length=160

 Score = 91.3 bits (225),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 51/83 (61%), Positives = 66/83 (80%), Gaps = 2/83 (2%)
 Frame = -3

Query  357  LPVNIPDWSKILGGEYKdrrresdeeeedd--gdgddRVPPHVYLARTRVASLSVHEGIG  184
            LPVN+PDWSKIL  E++D RR S  +++ D       R+PPH +LA+TR+AS SVHEG+G
Sbjct  78   LPVNVPDWSKILREEHRDNRRRSIVDDDGDWLDASGGRLPPHEFLAKTRMASFSVHEGVG  137

Query  183  RTLKGRDLSRVRNAIWKQTGFED  115
            RTLKGRDLSRVRNAI+++ GF+D
Sbjct  138  RTLKGRDLSRVRNAIFEKIGFQD  160



>emb|CDY65979.1| BnaCnng49210D [Brassica napus]
Length=159

 Score = 90.9 bits (224),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 51/83 (61%), Positives = 66/83 (80%), Gaps = 2/83 (2%)
 Frame = -3

Query  357  LPVNIPDWSKILGGEYKdrrresdeeeedd--gdgddRVPPHVYLARTRVASLSVHEGIG  184
            LPVN+PDWSKIL  E++D RR S  +++ D       R+PPH +LA+TR+AS SVHEG+G
Sbjct  77   LPVNVPDWSKILREEHRDNRRRSIVDDDGDWLDASGGRLPPHEFLAKTRMASFSVHEGLG  136

Query  183  RTLKGRDLSRVRNAIWKQTGFED  115
            RTLKGRDLSRVRNAI+++ GF+D
Sbjct  137  RTLKGRDLSRVRNAIFEKIGFQD  159



>ref|XP_004497503.1| PREDICTED: uncharacterized protein LOC101503850 [Cicer arietinum]
Length=157

 Score = 90.9 bits (224),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 57/90 (63%), Positives = 63/90 (70%), Gaps = 9/90 (10%)
 Frame = -3

Query  366  PASLPVNIPDWSKILGGEYK------drrresdeeeeddgdgddRVPPHVYLARTRVASL  205
            PASLPVNIP   KIL  E+K          + D+E+E    G  +VPPH YLARTR ASL
Sbjct  71   PASLPVNIP---KILKEEHKGYKKWESDDDDDDDEDERHQYGGIKVPPHEYLARTRSASL  127

Query  204  SVHEGIGRTLKGRDLSRVRNAIWKQTGFED  115
            SVHEGIGRTLKGRDL  VRNAIWK+ GFED
Sbjct  128  SVHEGIGRTLKGRDLCSVRNAIWKKVGFED  157



>ref|XP_011048547.1| PREDICTED: uncharacterized protein LOC105142559 [Populus euphratica]
 ref|XP_011048548.1| PREDICTED: uncharacterized protein LOC105142559 [Populus euphratica]
Length=173

 Score = 90.9 bits (224),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 57/94 (61%), Positives = 59/94 (63%), Gaps = 11/94 (12%)
 Frame = -3

Query  363  ASLPVNIPDWSKILGGEYKdrrresdee-----------eeddgdgddRVPPHVYLARTR  217
            ASLPVNIPDWSKI     K    E                EDD D   RVPPH YLAR R
Sbjct  80   ASLPVNIPDWSKIYSDHQKKEDIEGSVHPVDDDTDYDNDGEDDDDQVGRVPPHEYLARRR  139

Query  216  VASLSVHEGIGRTLKGRDLSRVRNAIWKQTGFED  115
             AS SVHEGIGRTLKGRDL +VRNAIWK+ GFED
Sbjct  140  GASFSVHEGIGRTLKGRDLRQVRNAIWKRVGFED  173



>ref|XP_009413717.1| PREDICTED: uncharacterized protein LOC103994969 [Musa acuminata 
subsp. malaccensis]
Length=162

 Score = 90.5 bits (223),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 53/87 (61%), Positives = 61/87 (70%), Gaps = 5/87 (6%)
 Frame = -3

Query  360  SLPVNIPDWSKILGGEY-----KdrrresdeeeeddgdgddRVPPHVYLARTRVASLSVH  196
            SLPVNIPDWSKILG  Y        R   +EE E+ G G   +PPH  L R+R AS SVH
Sbjct  76   SLPVNIPDWSKILGSYYGGGSSNSARGWWEEEGEEGGAGGPMIPPHELLWRSRAASFSVH  135

Query  195  EGIGRTLKGRDLSRVRNAIWKQTGFED  115
            EG+G TLKGRDL RVRNAIW++TGF+D
Sbjct  136  EGVGCTLKGRDLRRVRNAIWEKTGFQD  162



>ref|XP_006381452.1| hypothetical protein POPTR_0006s12970g [Populus trichocarpa]
 gb|ERP59249.1| hypothetical protein POPTR_0006s12970g [Populus trichocarpa]
Length=174

 Score = 90.5 bits (223),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 56/95 (59%), Positives = 62/95 (65%), Gaps = 12/95 (13%)
 Frame = -3

Query  363  ASLPVNIPDWSKILGGEYKdrr------------resdeeeeddgdgddRVPPHVYLART  220
            ASLPVNIPDWSKI     K                  ++ ++DD D D RVPPH YLAR 
Sbjct  80   ASLPVNIPDWSKIYNDHQKKEDIEGSVHPVNDDTDYDNDGDDDDDDQDGRVPPHEYLARR  139

Query  219  RVASLSVHEGIGRTLKGRDLSRVRNAIWKQTGFED  115
            R AS SVHEGIGRTLKGRDL +VRNAIWK+ GFED
Sbjct  140  RGASFSVHEGIGRTLKGRDLRQVRNAIWKRVGFED  174



>ref|XP_011089908.1| PREDICTED: uncharacterized protein LOC105170718 [Sesamum indicum]
Length=151

 Score = 90.1 bits (222),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 50/82 (61%), Positives = 65/82 (79%), Gaps = 1/82 (1%)
 Frame = -3

Query  357  LPVNIPDWSKILGGEYKdrrres-deeeeddgdgddRVPPHVYLARTRVASLSVHEGIGR  181
            LPVN+PDW KIL  EY++ R    D+ EE+  + ++R+PPH +LARTR+ASLSV +G GR
Sbjct  70   LPVNVPDWPKILKEEYRENRSREGDDYEEEAEENENRIPPHEFLARTRMASLSVQDGRGR  129

Query  180  TLKGRDLSRVRNAIWKQTGFED  115
            TLKGRDL RVRNAIW++ GF+D
Sbjct  130  TLKGRDLRRVRNAIWQRIGFQD  151



>ref|NP_190107.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AAL06540.1|AF412087_1 AT3g45210/T14D3_150 [Arabidopsis thaliana]
 emb|CAB72159.1| putative protein [Arabidopsis thaliana]
 gb|AAM16233.1| AT3g45210/T14D3_150 [Arabidopsis thaliana]
 gb|AEE78004.1| uncharacterized protein AT3G45210 [Arabidopsis thaliana]
Length=148

 Score = 89.7 bits (221),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 47/81 (58%), Positives = 58/81 (72%), Gaps = 6/81 (7%)
 Frame = -3

Query  357  LPVNIPDWSKILGGEYKdrrresdeeeeddgdgddRVPPHVYLARTRVASLSVHEGIGRT  178
            LP+N+ +WSKILG E +      D+  E        +PPH YLA+TR+AS SVHEGIGRT
Sbjct  74   LPMNVQNWSKILGKENRKSIENDDDGGEGK------LPPHEYLAKTRMASFSVHEGIGRT  127

Query  177  LKGRDLSRVRNAIWKQTGFED  115
            LKGRD+SRVRNAI ++TGF D
Sbjct  128  LKGRDMSRVRNAILEKTGFLD  148



>ref|XP_002448198.1| hypothetical protein SORBIDRAFT_06g022820 [Sorghum bicolor]
 gb|EES12526.1| hypothetical protein SORBIDRAFT_06g022820 [Sorghum bicolor]
Length=189

 Score = 90.9 bits (224),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 50/92 (54%), Positives = 59/92 (64%), Gaps = 11/92 (12%)
 Frame = -3

Query  360  SLPVNIPDWSKILGGEYK-----------drrresdeeeeddgdgddRVPPHVYLARTRV  214
            SLP+NIPDW KILG EY+               +        G G + VPPH    R+R 
Sbjct  96   SLPMNIPDWQKILGVEYRDHYRAGEWEPDADDDDHGRARGGGGAGAEMVPPHELAWRSRA  155

Query  213  ASLSVHEGIGRTLKGRDLSRVRNAIWKQTGFE  118
            AS+SVHEGIGRTLKGRDLSRVR+A+WK+TGFE
Sbjct  156  ASMSVHEGIGRTLKGRDLSRVRDAVWKKTGFE  187



>ref|XP_011089909.1| PREDICTED: uncharacterized protein LOC105170719 [Sesamum indicum]
Length=149

 Score = 89.4 bits (220),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 49/86 (57%), Positives = 65/86 (76%), Gaps = 3/86 (3%)
 Frame = -3

Query  363  ASLPVNIPDWSKILGGEYKdrrres---deeeeddgdgddRVPPHVYLARTRVASLSVHE  193
            ASLPVN+PDWSKIL  EY++ RR     D+ +E+  +  +RVPPH +LAR R+A+ SVH+
Sbjct  64   ASLPVNVPDWSKILKEEYRESRRRDLDGDDYDEEAEEHGNRVPPHEFLARARIAASSVHQ  123

Query  192  GIGRTLKGRDLSRVRNAIWKQTGFED  115
            G GR L GR+L RVRNAIW++ GF+D
Sbjct  124  GRGRNLNGRELRRVRNAIWQRIGFQD  149



>ref|XP_003521393.2| PREDICTED: uncharacterized protein LOC100786301 [Glycine max]
Length=183

 Score = 90.1 bits (222),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 51/86 (59%), Positives = 64/86 (74%), Gaps = 3/86 (3%)
 Frame = -3

Query  363  ASLPVNIPDWSKILGGEYKdrrre---sdeeeeddgdgddRVPPHVYLARTRVASLSVHE  193
            +S+PV IPDWSKIL  ++K+  +    SD++++ D D  + VPPH YLARTR AS SV E
Sbjct  98   SSMPVAIPDWSKILKEDFKEHEKRDFVSDDDDDHDDDRREPVPPHEYLARTREASHSVQE  157

Query  192  GIGRTLKGRDLSRVRNAIWKQTGFED  115
            G GRTLKGRDL  VRN+IWK+ GFED
Sbjct  158  GKGRTLKGRDLRSVRNSIWKKLGFED  183



>ref|XP_010520370.1| PREDICTED: uncharacterized protein LOC104799504 [Tarenaya hassleriana]
Length=160

 Score = 89.4 bits (220),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 50/85 (59%), Positives = 66/85 (78%), Gaps = 2/85 (2%)
 Frame = -3

Query  363  ASLPVNIPDWSKILGGEYKdrrresdeeeed--dgdgddRVPPHVYLARTRVASLSVHEG  190
            +SLPVN+PDWSKIL  + + R R+ D+ +       G  R+PPH +LARTR+AS SVHEG
Sbjct  76   SSLPVNVPDWSKILREDNRRRIRDYDDGDGVDWSESGGGRLPPHEFLARTRMASSSVHEG  135

Query  189  IGRTLKGRDLSRVRNAIWKQTGFED  115
            +GRTLKGRDLSR+RNAI+++ GF+D
Sbjct  136  VGRTLKGRDLSRIRNAIFEKIGFQD  160



>gb|KDP29113.1| hypothetical protein JCGZ_16502 [Jatropha curcas]
Length=176

 Score = 89.7 bits (221),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 52/93 (56%), Positives = 62/93 (67%), Gaps = 10/93 (11%)
 Frame = -3

Query  363  ASLPVNIPDWSKILGGEYKdrrresdeeeeddgdg----------ddRVPPHVYLARTRV  214
            +S+PVNIPDWSKI   +   R  +  ++ + + D           D RVPPH YLAR R 
Sbjct  84   SSVPVNIPDWSKIYKEDQYTRHNKDQDDLDQESDHYGDDRDDDDRDGRVPPHEYLARKRG  143

Query  213  ASLSVHEGIGRTLKGRDLSRVRNAIWKQTGFED  115
            AS SVHEGIGRTLKGRDL +VRNAIWK+ GFED
Sbjct  144  ASFSVHEGIGRTLKGRDLRQVRNAIWKKVGFED  176



>ref|XP_006400822.1| hypothetical protein EUTSA_v10015882mg [Eutrema salsugineum]
 gb|ESQ42275.1| hypothetical protein EUTSA_v10015882mg [Eutrema salsugineum]
Length=168

 Score = 89.4 bits (220),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 51/89 (57%), Positives = 66/89 (74%), Gaps = 8/89 (9%)
 Frame = -3

Query  357  LPVNIPDWSKILGGEYKdrrresdeeeedd--------gdgddRVPPHVYLARTRVASLS  202
            LP+N+PDWSKIL  E++D RR   E+++ D             R+PPH +LARTR+AS S
Sbjct  80   LPINVPDWSKILREEHRDNRRRGIEDDDGDYEDGGDWLDASGGRLPPHEFLARTRMASFS  139

Query  201  VHEGIGRTLKGRDLSRVRNAIWKQTGFED  115
            VHEG+GRTLKGRDLSRVRNAI+++ GF+D
Sbjct  140  VHEGVGRTLKGRDLSRVRNAIFEKIGFQD  168



>gb|KFK24774.1| hypothetical protein AALP_AA8G023000 [Arabis alpina]
Length=169

 Score = 89.0 bits (219),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 50/92 (54%), Positives = 64/92 (70%), Gaps = 7/92 (8%)
 Frame = -3

Query  369  RPASLPVNIPDWSKILGGEYKdr-------rresdeeeeddgdgddRVPPHVYLARTRVA  211
            +  SLPVNIPDWSKIL GEY+           + +E+++ DG G   +PPH YLAR R +
Sbjct  78   KTGSLPVNIPDWSKILRGEYRSHVVPEDDSDDDDEEDDDGDGGGRRIIPPHEYLARRRGS  137

Query  210  SLSVHEGIGRTLKGRDLSRVRNAIWKQTGFED  115
            S SVHEGIG T KGRDL R+RNA+W++ GF+D
Sbjct  138  SFSVHEGIGGTAKGRDLRRLRNAVWEKIGFQD  169



>gb|KHN09502.1| hypothetical protein glysoja_016601 [Glycine soja]
Length=166

 Score = 88.6 bits (218),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 51/86 (59%), Positives = 61/86 (71%), Gaps = 3/86 (3%)
 Frame = -3

Query  363  ASLPVNIPDWSKILGGEYKdrrresdeeeeddgdgddR---VPPHVYLARTRVASLSVHE  193
            +S+PV IPDWSKIL  ++K+  +     ++DD    DR   VPPH YLARTR AS SV E
Sbjct  81   SSMPVAIPDWSKILKEDFKEHEKRDFVSDDDDDHDHDRREPVPPHEYLARTREASHSVQE  140

Query  192  GIGRTLKGRDLSRVRNAIWKQTGFED  115
            G GRTLKGRDL  VRN+IWK+ GFED
Sbjct  141  GKGRTLKGRDLRSVRNSIWKKLGFED  166



>ref|XP_006295161.1| hypothetical protein CARUB_v10024237mg [Capsella rubella]
 gb|EOA28059.1| hypothetical protein CARUB_v10024237mg [Capsella rubella]
Length=155

 Score = 88.2 bits (217),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 53/84 (63%), Positives = 63/84 (75%), Gaps = 1/84 (1%)
 Frame = -3

Query  363  ASLPVNIPDWSKILGGEYKdrrresdeeeeddgd-gddRVPPHVYLARTRVASLSVHEGI  187
            +SLPVN+PDWSKILG E K +  E +EEEE++ +    RVPPH  +A  R+AS SVHEG 
Sbjct  72   SSLPVNVPDWSKILGEESKRQSHEEEEEEEEEEEGCARRVPPHELIANRRMASFSVHEGA  131

Query  186  GRTLKGRDLSRVRNAIWKQTGFED  115
            GRTLKGRDLSRVRN I+K  G ED
Sbjct  132  GRTLKGRDLSRVRNTIFKIRGIED  155



>ref|XP_010510626.1| PREDICTED: uncharacterized protein LOC104786871 [Camelina sativa]
Length=155

 Score = 88.2 bits (217),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 53/84 (63%), Positives = 62/84 (74%), Gaps = 1/84 (1%)
 Frame = -3

Query  363  ASLPVNIPDWSKILGGE-YKdrrresdeeeeddgdgddRVPPHVYLARTRVASLSVHEGI  187
            +SLPVN+PDWSKILG E  +  +  ++EEEE+   G  RVPPH  LA  R+AS SVHEG 
Sbjct  72   SSLPVNVPDWSKILGEESQRQSQVSNEEEEEEVDGGARRVPPHELLANRRMASFSVHEGA  131

Query  186  GRTLKGRDLSRVRNAIWKQTGFED  115
            GRTLKGRDLSRVRN I+K  G ED
Sbjct  132  GRTLKGRDLSRVRNTIFKIRGIED  155



>ref|XP_010414527.1| PREDICTED: uncharacterized protein LOC104700687 [Camelina sativa]
Length=155

 Score = 88.2 bits (217),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 53/84 (63%), Positives = 62/84 (74%), Gaps = 1/84 (1%)
 Frame = -3

Query  363  ASLPVNIPDWSKILGGE-YKdrrresdeeeeddgdgddRVPPHVYLARTRVASLSVHEGI  187
            +SLPVN+PDWSKILG E  +  +  ++EEEE+   G  RVPPH  LA  R+AS SVHEG 
Sbjct  72   SSLPVNVPDWSKILGEESQRQSQVSNEEEEEEVEGGARRVPPHELLANRRMASFSVHEGA  131

Query  186  GRTLKGRDLSRVRNAIWKQTGFED  115
            GRTLKGRDLSRVRN I+K  G ED
Sbjct  132  GRTLKGRDLSRVRNTIFKIRGIED  155



>ref|XP_010470084.1| PREDICTED: uncharacterized protein LOC104750056 [Camelina sativa]
Length=156

 Score = 87.4 bits (215),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 52/85 (61%), Positives = 62/85 (73%), Gaps = 2/85 (2%)
 Frame = -3

Query  363  ASLPVNIPDWSKILGGEYKdrrresdeeeeddgdg--ddRVPPHVYLARTRVASLSVHEG  190
            +SLPVN+PDWSKILG E + +   ++EEEE++       RVPPH  LA  R+AS SVHEG
Sbjct  72   SSLPVNVPDWSKILGEESQRQSHVTNEEEEEEEVDGGARRVPPHELLANRRMASFSVHEG  131

Query  189  IGRTLKGRDLSRVRNAIWKQTGFED  115
             GRTLKGRDLSRVRN I+K  G ED
Sbjct  132  AGRTLKGRDLSRVRNTIFKIRGIED  156



>ref|XP_006846774.1| hypothetical protein AMTR_s00148p00028850 [Amborella trichopoda]
 gb|ERN08355.1| hypothetical protein AMTR_s00148p00028850 [Amborella trichopoda]
Length=156

 Score = 87.0 bits (214),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 52/88 (59%), Positives = 64/88 (73%), Gaps = 6/88 (7%)
 Frame = -3

Query  360  SLPVNIPDWSKILGGEYKdrrresdeeeeddgdgdd--RVPPHVYLAR----TRVASLSV  199
            S PVNIPDWSKIL  E++DR  E + +EE + +  +   VPPH+ +AR      + S SV
Sbjct  69   SAPVNIPDWSKILREEFRDRHLERESDEEREYEEREGEMVPPHLLIARQFARANIVSFSV  128

Query  198  HEGIGRTLKGRDLSRVRNAIWKQTGFED  115
            HEG GRTLKGRDLSRVRNAIWK+TGF+D
Sbjct  129  HEGAGRTLKGRDLSRVRNAIWKKTGFQD  156



>ref|XP_006288791.1| hypothetical protein CARUB_v10002114mg [Capsella rubella]
 gb|EOA21689.1| hypothetical protein CARUB_v10002114mg [Capsella rubella]
Length=169

 Score = 87.0 bits (214),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 48/94 (51%), Positives = 63/94 (67%), Gaps = 7/94 (7%)
 Frame = -3

Query  375  VDRPASLPVNIPDWSKILGGEYKdrr-------resdeeeeddgdgddRVPPHVYLARTR  217
            + +  SLPVNIPDWSKIL  EY+           E +E+++ +  G   +PPH YLAR R
Sbjct  76   ITKTGSLPVNIPDWSKILKSEYRGHAIPDDDSDDEDEEDDDSNDGGRRIIPPHEYLARRR  135

Query  216  VASLSVHEGIGRTLKGRDLSRVRNAIWKQTGFED  115
             +S +VHEGIG T KGRDL R+RNAIW++ GF+D
Sbjct  136  GSSFTVHEGIGGTAKGRDLRRLRNAIWEKIGFQD  169



>ref|NP_195943.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AAK44090.1|AF370275_1 unknown protein [Arabidopsis thaliana]
 emb|CAB86090.1| putative protein [Arabidopsis thaliana]
 dbj|BAB08383.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAN13121.1| unknown protein [Arabidopsis thaliana]
 gb|AED90573.1| uncharacterized protein AT5G03230 [Arabidopsis thaliana]
Length=166

 Score = 86.7 bits (213),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 46/94 (49%), Positives = 63/94 (67%), Gaps = 7/94 (7%)
 Frame = -3

Query  375  VDRPASLPVNIPDWSKILGGEYKdrr-------resdeeeeddgdgddRVPPHVYLARTR  217
            + +  SLPVNIPDWSKIL  EY+           + +++++ +  G   +PPH YLAR R
Sbjct  73   ITKTGSLPVNIPDWSKILKSEYRGHAIPDDDSDDDDEDDDDSNDGGRRMIPPHEYLARRR  132

Query  216  VASLSVHEGIGRTLKGRDLSRVRNAIWKQTGFED  115
             +S +VHEGIG T KGRDL R+RNAIW++ GF+D
Sbjct  133  GSSFTVHEGIGGTAKGRDLRRLRNAIWEKIGFQD  166



>gb|AAM62875.1| unknown [Arabidopsis thaliana]
Length=163

 Score = 86.7 bits (213),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 52/85 (61%), Positives = 66/85 (78%), Gaps = 4/85 (5%)
 Frame = -3

Query  357  LPVNIPDWSKILGGEYKdrrresdeeeeddgdgddR----VPPHVYLARTRVASLSVHEG  190
            LPVN+PDWSK L GEY+D RR S E+ +DD D ++     +PPH +LA+TR+AS SVHEG
Sbjct  79   LPVNVPDWSKXLRGEYRDNRRRSIEDNDDDDDDNEDGGDWLPPHEFLAKTRMASFSVHEG  138

Query  189  IGRTLKGRDLSRVRNAIWKQTGFED  115
            +GRTLKGRDLSRVR A + + GF+D
Sbjct  139  VGRTLKGRDLSRVRXAXFXKFGFQD  163



>ref|XP_004249833.1| PREDICTED: uncharacterized protein LOC101261979 [Solanum lycopersicum]
Length=158

 Score = 86.7 bits (213),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 48/88 (55%), Positives = 59/88 (67%), Gaps = 6/88 (7%)
 Frame = -3

Query  360  SLPVNIPDWSKILGGEYKdrrresdeeeeddgdgddR------VPPHVYLARTRVASLSV  199
            SLPVNIPDWSK+ G + K+   +  EE +     +        +PPH YLA+ R AS SV
Sbjct  71   SLPVNIPDWSKVQGDKNKNEAIQDKEEVDIQDKEEVDADDDTWIPPHEYLAKKRGASFSV  130

Query  198  HEGIGRTLKGRDLSRVRNAIWKQTGFED  115
             EG+GRTLKGRDLSR+R+AI KQTGF D
Sbjct  131  CEGVGRTLKGRDLSRLRDAILKQTGFID  158



>ref|XP_009387245.1| PREDICTED: uncharacterized protein LOC103974208 [Musa acuminata 
subsp. malaccensis]
Length=164

 Score = 86.7 bits (213),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 52/98 (53%), Positives = 62/98 (63%), Gaps = 10/98 (10%)
 Frame = -3

Query  378  GVDRPA--SLPVNIPDWSKILGGEYKdrrre--------sdeeeeddgdgddRVPPHVYL  229
            G DR A  SLPV IPDW KILG   +             +D+++E        VPPH  L
Sbjct  67   GGDRTAASSLPVEIPDWPKILGNCTRSSHSSTRGWWEEQADDDDEGSAAAGQVVPPHELL  126

Query  228  ARTRVASLSVHEGIGRTLKGRDLSRVRNAIWKQTGFED  115
             R  VAS SVHEG+GRTLKGRDLSRVR+AIW++TGF+D
Sbjct  127  RRGLVASFSVHEGVGRTLKGRDLSRVRDAIWEKTGFQD  164



>ref|NP_180407.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AAD20686.1| hypothetical protein [Arabidopsis thaliana]
 gb|AAL49884.1| unknown protein [Arabidopsis thaliana]
 gb|AAM67487.1| unknown protein [Arabidopsis thaliana]
 gb|AEC08116.1| uncharacterized protein AT2G28400 [Arabidopsis thaliana]
Length=162

 Score = 86.7 bits (213),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 56/88 (64%), Positives = 65/88 (74%), Gaps = 5/88 (6%)
 Frame = -3

Query  363  ASLPVNIPDWSKILGGEYKdrrresdeeeed-----dgdgddRVPPHVYLARTRVASLSV  199
            +SLPVN+PDWSKILG E + +R+ S+EEE D      G+G  RVPPH  LA  R+AS SV
Sbjct  75   SSLPVNVPDWSKILGDESRRQRKISNEEEVDGDEILCGEGTRRVPPHELLANRRMASFSV  134

Query  198  HEGIGRTLKGRDLSRVRNAIWKQTGFED  115
            HEG GRTLKGRDLSRVRN I+K  G ED
Sbjct  135  HEGAGRTLKGRDLSRVRNTIFKIRGIED  162



>ref|XP_010452194.1| PREDICTED: uncharacterized protein LOC104734339 [Camelina sativa]
Length=170

 Score = 86.7 bits (213),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 47/96 (49%), Positives = 62/96 (65%), Gaps = 8/96 (8%)
 Frame = -3

Query  378  GVDRPASLPVNIPDWSKILGGEYKdrr--------resdeeeeddgdgddRVPPHVYLAR  223
             + +  SLPVNIPDWSKIL  EY+            E +++++    G   +PPH YLAR
Sbjct  75   NITKTGSLPVNIPDWSKILKSEYRGHAIPDDDSDDDEDEDDDDVQEGGRRIIPPHEYLAR  134

Query  222  TRVASLSVHEGIGRTLKGRDLSRVRNAIWKQTGFED  115
             R +S +VHEGIG T KGRDL R+RNAIW++ GF+D
Sbjct  135  RRGSSFTVHEGIGGTAKGRDLRRLRNAIWEKIGFQD  170



>ref|XP_002871018.1| hypothetical protein ARALYDRAFT_908188 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH47277.1| hypothetical protein ARALYDRAFT_908188 [Arabidopsis lyrata subsp. 
lyrata]
Length=169

 Score = 86.7 bits (213),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 47/94 (50%), Positives = 63/94 (67%), Gaps = 7/94 (7%)
 Frame = -3

Query  375  VDRPASLPVNIPDWSKILGGEYKdrr-------resdeeeeddgdgddRVPPHVYLARTR  217
            + +  SLPVNIPDWSKIL  EY+           + +E+++ +  G   +PPH YLAR R
Sbjct  76   ITKTGSLPVNIPDWSKILKSEYRGHAIPDDDSDDDDEEDDDINDGGRRIIPPHEYLARRR  135

Query  216  VASLSVHEGIGRTLKGRDLSRVRNAIWKQTGFED  115
             +S +VHEGIG T KGRDL R+RNAIW++ GF+D
Sbjct  136  GSSFTVHEGIGGTAKGRDLRRLRNAIWEKIGFQD  169



>ref|XP_010490791.1| PREDICTED: uncharacterized protein LOC104768490 [Camelina sativa]
Length=170

 Score = 86.7 bits (213),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 47/96 (49%), Positives = 63/96 (66%), Gaps = 8/96 (8%)
 Frame = -3

Query  378  GVDRPASLPVNIPDWSKILGGEYKdrr--------resdeeeeddgdgddRVPPHVYLAR  223
             + +  SLPVNIPDWSKIL  EY+            E +++++ +  G   +PPH YLAR
Sbjct  75   NITKTGSLPVNIPDWSKILKSEYRGHAIPDDDSDDDEEEDDDDVNEGGRRIIPPHEYLAR  134

Query  222  TRVASLSVHEGIGRTLKGRDLSRVRNAIWKQTGFED  115
             R +S +VHEGIG T KGRDL R+RNAIW++ GF+D
Sbjct  135  RRGSSFTVHEGIGGTAKGRDLRRLRNAIWEKIGFQD  170



>ref|XP_009140901.1| PREDICTED: uncharacterized protein LOC103864886 [Brassica rapa]
Length=155

 Score = 86.3 bits (212),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 49/84 (58%), Positives = 57/84 (68%), Gaps = 1/84 (1%)
 Frame = -3

Query  363  ASLPVNIPDWSKILGGEY-KdrrresdeeeeddgdgddRVPPHVYLARTRVASLSVHEGI  187
            +SLPVN+PDWSKILG E  + +     +E    G    RVPPH  +A  R+AS SVHEG 
Sbjct  72   SSLPVNVPDWSKILGEESPRRQTSYDGDEVAACGGETRRVPPHELIASRRMASFSVHEGA  131

Query  186  GRTLKGRDLSRVRNAIWKQTGFED  115
            GRTLKGRDLSRVRN I+K  G ED
Sbjct  132  GRTLKGRDLSRVRNTIFKIRGIED  155



>ref|XP_004486158.1| PREDICTED: uncharacterized protein LOC101500992 [Cicer arietinum]
Length=211

 Score = 86.7 bits (213),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 49/83 (59%), Positives = 63/83 (76%), Gaps = 5/83 (6%)
 Frame = -3

Query  363  ASLPVNIPDWSKILGGEYKdrrresdeeeeddgdgddRVPPHVYLARTR-VASLSVHEGI  187
            +SLPVN+PDWSKIL    +    ES  +++ D D  + VPPH YLAR+R +A+ SV EG+
Sbjct  132  SSLPVNVPDWSKIL----RVDSVESLHDDDVDDDDLEMVPPHEYLARSRKMAAKSVFEGV  187

Query  186  GRTLKGRDLSRVRNAIWKQTGFE  118
            GRTLKGRDLSRVR+A+W QTGF+
Sbjct  188  GRTLKGRDLSRVRDAVWSQTGFD  210



>ref|XP_006398768.1| hypothetical protein EUTSA_v10014814mg [Eutrema salsugineum]
 gb|ESQ40221.1| hypothetical protein EUTSA_v10014814mg [Eutrema salsugineum]
Length=178

 Score = 85.9 bits (211),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 47/99 (47%), Positives = 59/99 (60%), Gaps = 14/99 (14%)
 Frame = -3

Query  369  RPASLPVNIPDWSKILGGEYKdr--------------rresdeeeeddgdgddRVPPHVY  232
            +  SLPVNIPDWSKIL  EY+                  + ++ +     G   +PPH Y
Sbjct  80   KTGSLPVNIPDWSKILKSEYRSHVIPYDDDSDEDDEDDDDINDGDTAATGGRRMIPPHEY  139

Query  231  LARTRVASLSVHEGIGRTLKGRDLSRVRNAIWKQTGFED  115
            LAR R +S SVHEGIG T KGRDL R+RNAIW++ GF+D
Sbjct  140  LARRRGSSFSVHEGIGGTAKGRDLRRLRNAIWEKIGFQD  178



>emb|CDX77180.1| BnaC04g39750D [Brassica napus]
Length=165

 Score = 85.5 bits (210),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 50/87 (57%), Positives = 55/87 (63%), Gaps = 4/87 (5%)
 Frame = -3

Query  363  ASLPVNIPDWSKILGGE----YKdrrresdeeeeddgdgddRVPPHVYLARTRVASLSVH  196
            +SLPVN+PDWSKILG E             +E    G    RVPPH  LA  R+AS SVH
Sbjct  79   SSLPVNVPDWSKILGEESPRRQTSNEEYDGDEVAACGGETRRVPPHELLASRRMASFSVH  138

Query  195  EGIGRTLKGRDLSRVRNAIWKQTGFED  115
            EG GRTLKGRDLSRVRN I+K  G ED
Sbjct  139  EGAGRTLKGRDLSRVRNTIFKIRGIED  165



>ref|XP_010423745.1| PREDICTED: uncharacterized protein LOC104708816 [Camelina sativa]
Length=170

 Score = 85.1 bits (209),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 47/96 (49%), Positives = 64/96 (67%), Gaps = 8/96 (8%)
 Frame = -3

Query  378  GVDRPASLPVNIPDWSKILGGEYKdrrresdeeeeddgdgddRV--------PPHVYLAR  223
             + +  SLPVNIPDWSKIL  EY+      D+ ++++ + D+ V        PPH YLAR
Sbjct  75   NITKTGSLPVNIPDWSKILKSEYRGHAIPDDDSDDEEDEDDEDVNDGGRRIIPPHEYLAR  134

Query  222  TRVASLSVHEGIGRTLKGRDLSRVRNAIWKQTGFED  115
             R +S +VH+GIG T KGRDL R+RNAIW++ GF+D
Sbjct  135  RRGSSFTVHDGIGGTAKGRDLRRLRNAIWEKIGFQD  170



>ref|XP_010521764.1| PREDICTED: uncharacterized protein LOC104800605 [Tarenaya hassleriana]
Length=159

 Score = 84.7 bits (208),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 49/86 (57%), Positives = 61/86 (71%), Gaps = 3/86 (3%)
 Frame = -3

Query  363  ASLPVNIPDWSKILGGE---YKdrrresdeeeeddgdgddRVPPHVYLARTRVASLSVHE  193
            +++PVN+PDWSKILG E    + R  E D  ++  G    R+PPH  +AR R+AS SVHE
Sbjct  74   STVPVNVPDWSKILGEEKSDRRKRAVEEDGGDDVSGGEGRRLPPHEIMARRRMASFSVHE  133

Query  192  GIGRTLKGRDLSRVRNAIWKQTGFED  115
            G GRTLKGRDL RVRNAI++ TGF D
Sbjct  134  GAGRTLKGRDLRRVRNAIFEITGFHD  159



>ref|XP_006409865.1| hypothetical protein EUTSA_v10017334mg [Eutrema salsugineum]
 gb|ESQ51318.1| hypothetical protein EUTSA_v10017334mg [Eutrema salsugineum]
Length=165

 Score = 84.7 bits (208),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 49/87 (56%), Positives = 61/87 (70%), Gaps = 4/87 (5%)
 Frame = -3

Query  363  ASLPVNIPDWSKILGGEYKdrrresdeeeeddgdg----ddRVPPHVYLARTRVASLSVH  196
            +S+PVN+PDWSKILG E + R+  ++E + D+         R+PPH  LA  R+AS SVH
Sbjct  79   SSVPVNVPDWSKILGEESRRRQVSNEEVDGDEIASCGGGTRRIPPHELLASRRMASFSVH  138

Query  195  EGIGRTLKGRDLSRVRNAIWKQTGFED  115
            EG GRTLKGRDLSRVRN I+K  G ED
Sbjct  139  EGAGRTLKGRDLSRVRNTIFKIRGIED  165



>emb|CDY62461.1| BnaA04g28420D [Brassica napus]
Length=158

 Score = 84.3 bits (207),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 49/87 (56%), Positives = 55/87 (63%), Gaps = 4/87 (5%)
 Frame = -3

Query  363  ASLPVNIPDWSKILGGE----YKdrrresdeeeeddgdgddRVPPHVYLARTRVASLSVH  196
            +SLPVN+PDWSKILG E             +E    G    RVPPH  +A  R+AS SVH
Sbjct  72   SSLPVNVPDWSKILGEESPRRQTSNEEYDGDEVAACGGETRRVPPHELIASRRMASFSVH  131

Query  195  EGIGRTLKGRDLSRVRNAIWKQTGFED  115
            EG GRTLKGRDLSRVRN I+K  G ED
Sbjct  132  EGAGRTLKGRDLSRVRNTIFKIRGIED  158



>ref|XP_004982836.1| PREDICTED: uncharacterized protein LOC101784168 [Setaria italica]
Length=177

 Score = 84.7 bits (208),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 52/96 (54%), Positives = 58/96 (60%), Gaps = 12/96 (13%)
 Frame = -3

Query  366  PASLPVNIPDWSKILGGEYKdrrresdeeeeddgdgddR----------VPPHVYL-ART  220
            PAS+PVNIPDWSKILG EY      +      D   +D           VPPH  L  R 
Sbjct  82   PASVPVNIPDWSKILGAEYAGSCAGARRWAAHDDLAEDVAGCGSGGRRWVPPHEMLQCRE  141

Query  219  RVA-SLSVHEGIGRTLKGRDLSRVRNAIWKQTGFED  115
            R A S SV EG GRTLKGRDL RVRNAIW++TGF+D
Sbjct  142  RAAASFSVREGAGRTLKGRDLRRVRNAIWEKTGFQD  177



>ref|XP_002879098.1| hypothetical protein ARALYDRAFT_481665 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH55357.1| hypothetical protein ARALYDRAFT_481665 [Arabidopsis lyrata subsp. 
lyrata]
Length=164

 Score = 84.3 bits (207),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 52/86 (60%), Positives = 60/86 (70%), Gaps = 5/86 (6%)
 Frame = -3

Query  357  LPVNIPDWSKILGGEYKdrrresdeeeeddgdgdd-----RVPPHVYLARTRVASLSVHE  193
            LPVN+PDWSKILG E + +R+  +EEE D  +        RVPPH  LA  R+AS SVHE
Sbjct  79   LPVNVPDWSKILGDESRRQRQIYNEEEVDGDEISCGGGTRRVPPHELLANRRMASFSVHE  138

Query  192  GIGRTLKGRDLSRVRNAIWKQTGFED  115
            G GRTLKGRDLSRVRN I+K  G ED
Sbjct  139  GAGRTLKGRDLSRVRNTIFKIRGIED  164



>ref|XP_006653605.1| PREDICTED: uncharacterized protein LOC102711064 [Oryza brachyantha]
Length=137

 Score = 83.2 bits (204),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 53/93 (57%), Positives = 61/93 (66%), Gaps = 11/93 (12%)
 Frame = -3

Query  360  SLPVNIPDWSKILGGEYKdrrresdeeeeddgdgddRVPPHVYLA-----------RTRV  214
            SLPVNIPDW KILG EY+D +  ++ E   DGD D        +            R R 
Sbjct  45   SLPVNIPDWQKILGVEYRDHQAAAEWELHGDGDDDYEYGKVAGVGGAGVPPAGLAWRGRA  104

Query  213  ASLSVHEGIGRTLKGRDLSRVRNAIWKQTGFED  115
            ASLSVHEGIGRTLKGRDLSRVR+A+WK+TGFED
Sbjct  105  ASLSVHEGIGRTLKGRDLSRVRDAVWKKTGFED  137



>ref|XP_001765057.1| predicted protein [Physcomitrella patens]
 gb|EDQ70052.1| predicted protein [Physcomitrella patens]
Length=160

 Score = 83.6 bits (205),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 44/86 (51%), Positives = 64/86 (74%), Gaps = 4/86 (5%)
 Frame = -3

Query  360  SLPVNIPDWSKILGGEYKdrrresdeeeeddgdgddRVPPHVYL----ARTRVASLSVHE  193
            S PVN+PDWSKILG E K +  + D + + + + ++R+PPH+++    A++++ + SV E
Sbjct  75   SAPVNVPDWSKILGAEKKHKWADEDVDSDKEDEQEERLPPHLHIQREYAQSQMTTFSVCE  134

Query  192  GIGRTLKGRDLSRVRNAIWKQTGFED  115
            G GRTLKGRDLSRVRNA+ +QTGF D
Sbjct  135  GAGRTLKGRDLSRVRNAVLRQTGFLD  160



>ref|NP_001064875.2| Os10g0481000 [Oryza sativa Japonica Group]
 dbj|BAF26789.2| Os10g0481000 [Oryza sativa Japonica Group]
Length=174

 Score = 83.6 bits (205),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 49/84 (58%), Positives = 57/84 (68%), Gaps = 2/84 (2%)
 Frame = -3

Query  360  SLPVNIPDWSKILGGEYKdrrresdeeeeddgdgddRVPPH-VYLARTRVA-SLSVHEGI  187
            SLPVNIPDWSKILG +      +    +E+   G   VPPH + L R R A S SV EG 
Sbjct  91   SLPVNIPDWSKILGTDAARWPSDERGGDEECRGGLGWVPPHELLLCRERAAASFSVREGA  150

Query  186  GRTLKGRDLSRVRNAIWKQTGFED  115
            GRTLKGRDL RVRNAIW++TGF+D
Sbjct  151  GRTLKGRDLRRVRNAIWEKTGFQD  174



>gb|AFW68567.1| hypothetical protein ZEAMMB73_025917 [Zea mays]
Length=179

 Score = 83.6 bits (205),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 53/97 (55%), Positives = 60/97 (62%), Gaps = 9/97 (9%)
 Frame = -3

Query  378  GVDRPASLPVNIPDWSKILGGEYKdrrresdeeeeddgdgddR-------VPPH-VYLAR  223
            G   PAS+PVNIPDWSKILG EY      + ++  DD             VPPH V   R
Sbjct  83   GAPGPASVPVNIPDWSKILGAEYAGSGWAAHDDRADDDAAAFGGAGGRRWVPPHEVLQGR  142

Query  222  TRVA-SLSVHEGIGRTLKGRDLSRVRNAIWKQTGFED  115
             R A S SV EG GRTLKGRDL RVRNAIW++TGF+D
Sbjct  143  ERAAASFSVREGAGRTLKGRDLRRVRNAIWEKTGFQD  179



>ref|XP_010557316.1| PREDICTED: uncharacterized protein LOC104826363 [Tarenaya hassleriana]
Length=162

 Score = 82.8 bits (203),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 51/89 (57%), Positives = 59/89 (66%), Gaps = 6/89 (7%)
 Frame = -3

Query  363  ASLPVNIPDWSKILGGEYKdrrresdeeeeddgdgddR------VPPHVYLARTRVASLS  202
             + PVN+PDWS ILG E + RR     EE D  D          +PPH  LAR R+AS S
Sbjct  74   GTAPVNVPDWSTILGEESRRRRVAGSYEEGDGRDDVSGGGGGRWLPPHELLARRRMASFS  133

Query  201  VHEGIGRTLKGRDLSRVRNAIWKQTGFED  115
            VHEG GRTLKGRDLSRVRNAI++ TGF+D
Sbjct  134  VHEGSGRTLKGRDLSRVRNAIFEITGFQD  162



>gb|AFK48551.1| unknown [Medicago truncatula]
Length=218

 Score = 82.8 bits (203),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 49/82 (60%), Positives = 59/82 (72%), Gaps = 4/82 (5%)
 Frame = -3

Query  360  SLPVNIPDWSKILGGEYKdrrresdeeeeddgdgddRVPPHVYLARTRV-ASLSVHEGIG  184
            SLPVN+PDWSKIL     D      ++  DD D  + VPPH YLAR+R  A+ SV EG+G
Sbjct  139  SLPVNVPDWSKIL---RVDSVESLHDDSFDDDDESEMVPPHEYLARSRKNAAKSVFEGVG  195

Query  183  RTLKGRDLSRVRNAIWKQTGFE  118
            RTLKGRDLSRVR+A+W QTGF+
Sbjct  196  RTLKGRDLSRVRDAVWSQTGFD  217



>gb|KEH36847.1| senescence regulator [Medicago truncatula]
Length=218

 Score = 82.8 bits (203),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 49/82 (60%), Positives = 59/82 (72%), Gaps = 4/82 (5%)
 Frame = -3

Query  360  SLPVNIPDWSKILGGEYKdrrresdeeeeddgdgddRVPPHVYLARTRV-ASLSVHEGIG  184
            SLPVN+PDWSKIL     D      ++  DD D  + VPPH YLAR+R  A+ SV EG+G
Sbjct  139  SLPVNVPDWSKIL---RVDSVESLHDDSFDDDDESEMVPPHEYLARSRKNAAKSVFEGVG  195

Query  183  RTLKGRDLSRVRNAIWKQTGFE  118
            RTLKGRDLSRVR+A+W QTGF+
Sbjct  196  RTLKGRDLSRVRDAVWSQTGFD  217



>ref|XP_008441099.1| PREDICTED: uncharacterized protein LOC103485322 [Cucumis melo]
Length=197

 Score = 82.0 bits (201),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 47/88 (53%), Positives = 58/88 (66%), Gaps = 6/88 (7%)
 Frame = -3

Query  363  ASLPVNIPDWSKILGGEYKdrrresdeeeeddgdgddRVPPHVYLAR------TRVASLS  202
            AS PVN+PDWSKIL  E  +  RE D+    + D  + VPPH YLAR         A+ S
Sbjct  109  ASAPVNVPDWSKILWAESVESLREMDDGGYYNNDETEMVPPHEYLAREYARSRNTAAATS  168

Query  201  VHEGIGRTLKGRDLSRVRNAIWKQTGFE  118
            V EG+GRTLKGRD+ RVR+A+W QTGF+
Sbjct  169  VFEGVGRTLKGRDMRRVRDAVWSQTGFD  196



>emb|CDX70321.1| BnaA10g26700D [Brassica napus]
Length=176

 Score = 81.3 bits (199),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 45/97 (46%), Positives = 58/97 (60%), Gaps = 12/97 (12%)
 Frame = -3

Query  369  RPASLPVNIPDWSKILGGEYKdr------------rresdeeeeddgdgddRVPPHVYLA  226
            +  S+PVNIPDWSKIL  EY+                + +  + D   G   +PPH YLA
Sbjct  80   KTGSVPVNIPDWSKILKSEYRSHVVIPDYDSDEDDEDDEEINDGDTTGGRRMIPPHEYLA  139

Query  225  RTRVASLSVHEGIGRTLKGRDLSRVRNAIWKQTGFED  115
            R R +S +VHEGIG T KGRDL  +RNAIW++ GF+D
Sbjct  140  RRRGSSFTVHEGIGGTAKGRDLRLLRNAIWEKIGFQD  176



>ref|XP_003610423.1| hypothetical protein MTR_4g132020 [Medicago truncatula]
 gb|AES92620.1| senescence regulator [Medicago truncatula]
Length=176

 Score = 81.3 bits (199),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 46/83 (55%), Positives = 56/83 (67%), Gaps = 6/83 (7%)
 Frame = -3

Query  363  ASLPVNIPDWSKILGGEYKdrrresdeeeeddgdgddRVPPHVYLARTR-VASLSVHEGI  187
             S PVN+PDWSKIL  E           + DD +  + VPPH YLAR R +A+ SV EG+
Sbjct  98   TSAPVNVPDWSKILRVE-----SVESLHDMDDDNESEMVPPHEYLARGRKMAANSVFEGV  152

Query  186  GRTLKGRDLSRVRNAIWKQTGFE  118
            GRTLKGRDL RVR+A+W QTGF+
Sbjct  153  GRTLKGRDLRRVRDAVWNQTGFD  175



>ref|NP_001144892.1| uncharacterized protein LOC100277997 [Zea mays]
 gb|ACG43727.1| hypothetical protein [Zea mays]
Length=182

 Score = 81.3 bits (199),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 53/97 (55%), Positives = 58/97 (60%), Gaps = 9/97 (9%)
 Frame = -3

Query  378  GVDRPASLPVNIPDWSKILGGEYKdr-------rresdeeeeddgdgddRVPPH-VYLAR  223
            G   PAS+PVNIPDWSKILG EY          R + D        G   VPPH V   R
Sbjct  86   GAPGPASVPVNIPDWSKILGAEYAGSGWAAHDDRADDDAAGCGGAGGRRWVPPHEVLQGR  145

Query  222  TRVA-SLSVHEGIGRTLKGRDLSRVRNAIWKQTGFED  115
             R A S SV EG GRTL GRDL RVRNAIW++TGF+D
Sbjct  146  ERAAASFSVREGAGRTLMGRDLRRVRNAIWEKTGFQD  182



>ref|XP_009122724.1| PREDICTED: uncharacterized protein LOC103847398 [Brassica rapa]
Length=206

 Score = 81.3 bits (199),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 45/97 (46%), Positives = 58/97 (60%), Gaps = 12/97 (12%)
 Frame = -3

Query  369  RPASLPVNIPDWSKILGGEYKdr------------rresdeeeeddgdgddRVPPHVYLA  226
            +  S+PVNIPDWSKIL  EY+                + +  + D   G   +PPH YLA
Sbjct  110  KTGSVPVNIPDWSKILKSEYRSHVVIPDYDSDEDDEDDEEINDGDTTGGRRMIPPHEYLA  169

Query  225  RTRVASLSVHEGIGRTLKGRDLSRVRNAIWKQTGFED  115
            R R +S +VHEGIG T KGRDL  +RNAIW++ GF+D
Sbjct  170  RRRGSSFTVHEGIGGTAKGRDLRLLRNAIWEKIGFQD  206



>ref|XP_007153942.1| hypothetical protein PHAVU_003G078300g [Phaseolus vulgaris]
 gb|ESW25936.1| hypothetical protein PHAVU_003G078300g [Phaseolus vulgaris]
Length=225

 Score = 81.6 bits (200),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 43/82 (52%), Positives = 57/82 (70%), Gaps = 3/82 (4%)
 Frame = -3

Query  360  SLPVNIPDWSKILGGEYKdrrresdeeeeddgdgddRVPPHVYLARTR-VASLSVHEGIG  184
            S PVN+PDWSKIL  +        + +   D +  + VPPH YLAR+R +A+ SV EG+G
Sbjct  145  SAPVNVPDWSKILRAD--SVESLHEMDVAFDDNDSEMVPPHEYLARSRQMAANSVFEGVG  202

Query  183  RTLKGRDLSRVRNAIWKQTGFE  118
            RTLKGRD+ RVR+A+W QTGF+
Sbjct  203  RTLKGRDMRRVRDAVWSQTGFD  224



>ref|XP_006413702.1| hypothetical protein EUTSA_v10027246mg [Eutrema salsugineum]
 gb|ESQ55155.1| hypothetical protein EUTSA_v10027246mg [Eutrema salsugineum]
Length=156

 Score = 80.1 bits (196),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 47/87 (54%), Positives = 58/87 (67%), Gaps = 4/87 (5%)
 Frame = -3

Query  369  RPASLPVNIPDWSKILGGEYKdrrresdeeeeddgdgddRVPPHVY----LARTRVASLS  202
            + +S P+N+PDWSKI G   K+ R       +DD D D  VPPH      LART+++S S
Sbjct  56   KQSSAPMNVPDWSKIYGNTKKNTRSSHLLIHDDDDDEDAMVPPHELVARRLARTQISSFS  115

Query  201  VHEGIGRTLKGRDLSRVRNAIWKQTGF  121
            + EGIGRTLKGRDLS+ RNAI  QTGF
Sbjct  116  MCEGIGRTLKGRDLSKTRNAILTQTGF  142



>ref|XP_009614259.1| PREDICTED: uncharacterized protein LOC104107229 [Nicotiana tomentosiformis]
Length=210

 Score = 81.3 bits (199),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 44/82 (54%), Positives = 55/82 (67%), Gaps = 3/82 (4%)
 Frame = -3

Query  360  SLPVNIPDWSKILGGEYKdrrresdeeeeddgdgddRVPPHVYLARTR-VASLSVHEGIG  184
            S PVN+PDWSKI            D ++  +    + VPPH Y+AR+R  AS SV EG+G
Sbjct  130  SAPVNVPDWSKIY--RVNSVESLHDSDDGVNDHDSEIVPPHEYIARSRNSASHSVFEGVG  187

Query  183  RTLKGRDLSRVRNAIWKQTGFE  118
            RTLKGRDLSRVR+A+W QTGF+
Sbjct  188  RTLKGRDLSRVRDAVWSQTGFD  209



>ref|XP_003571889.1| PREDICTED: uncharacterized protein LOC100830832 [Brachypodium 
distachyon]
Length=183

 Score = 80.5 bits (197),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 53/98 (54%), Positives = 59/98 (60%), Gaps = 14/98 (14%)
 Frame = -3

Query  366  PASLPVNIPDWSKILGGEYKdrrresdeeeeddgdgddR------------VPPHVYL-A  226
            PASLPV+IPDWSKILG EY      +     D+  GD              VPPH  L  
Sbjct  86   PASLPVDIPDWSKILGPEYTGGGSSAGRWPSDERGGDAYLDRGEGGGGRQWVPPHEQLMC  145

Query  225  RTRVA-SLSVHEGIGRTLKGRDLSRVRNAIWKQTGFED  115
            R R A S SV EG GRTLKGRDL RVRNAIW++TGF+D
Sbjct  146  RERAAASFSVREGAGRTLKGRDLRRVRNAIWEKTGFQD  183



>ref|XP_003529631.2| PREDICTED: uncharacterized protein LOC100815796 [Glycine max]
Length=231

 Score = 81.3 bits (199),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 43/82 (52%), Positives = 58/82 (71%), Gaps = 2/82 (2%)
 Frame = -3

Query  360  SLPVNIPDWSKILGGEYKdrrresdeeeeddgdgddRVPPHVYLARTR-VASLSVHEGIG  184
            S PVN+PDWSKIL  +         ++  D+ +  + VPPH YLAR+R +A+ SV EG+G
Sbjct  150  SAPVNVPDWSKILRAD-SVESLHGMDDGFDENNESEMVPPHEYLARSRKMAANSVFEGVG  208

Query  183  RTLKGRDLSRVRNAIWKQTGFE  118
            RTLKGRD+ RVR+A+W QTGF+
Sbjct  209  RTLKGRDMRRVRDAVWSQTGFD  230



>ref|XP_006419060.1| hypothetical protein EUTSA_v10002696mg [Eutrema salsugineum]
 gb|ESQ37496.1| hypothetical protein EUTSA_v10002696mg [Eutrema salsugineum]
Length=157

 Score = 80.1 bits (196),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 47/84 (56%), Positives = 55/84 (65%), Gaps = 1/84 (1%)
 Frame = -3

Query  363  ASLPVNIPDWSKILGGEYKdrrresdeeeeddgdgdd-RVPPHVYLARTRVASLSVHEGI  187
             SLP+N+PD SK           + D   +     D  R PPH YLARTR+AS SVHEG+
Sbjct  74   GSLPMNVPDQSKNCHRRRTSIEIDEDGLIDGGDRLDGGRFPPHEYLARTRIASFSVHEGV  133

Query  186  GRTLKGRDLSRVRNAIWKQTGFED  115
            GRTLKGRDLSRVRNAI+K+TG  D
Sbjct  134  GRTLKGRDLSRVRNAIFKKTGVLD  157



>emb|CDY10396.1| BnaCnng02970D [Brassica napus]
Length=176

 Score = 80.5 bits (197),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 45/97 (46%), Positives = 57/97 (59%), Gaps = 12/97 (12%)
 Frame = -3

Query  369  RPASLPVNIPDWSKILGGEYKdrrre------------sdeeeeddgdgddRVPPHVYLA  226
            +  S+PVNIPDWSKIL  EY+                  +  + D   G   +PPH YLA
Sbjct  80   KTGSVPVNIPDWSKILKSEYRSHVVMPDYDSDEDDEDDEEINDGDTTGGRRMIPPHEYLA  139

Query  225  RTRVASLSVHEGIGRTLKGRDLSRVRNAIWKQTGFED  115
            R R +S +VHEGIG T KGRDL  +RNAIW++ GF+D
Sbjct  140  RRRGSSFTVHEGIGGTDKGRDLRLLRNAIWEKIGFQD  176



>ref|XP_001783393.1| predicted protein [Physcomitrella patens]
 gb|EDQ51787.1| predicted protein [Physcomitrella patens]
Length=237

 Score = 81.3 bits (199),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 45/86 (52%), Positives = 63/86 (73%), Gaps = 4/86 (5%)
 Frame = -3

Query  360  SLPVNIPDWSKILGGEYKdrrresdeeeeddgdgddRVPPHVYL----ARTRVASLSVHE  193
            S PVN+PDWSKILG E K R  + D + + + + ++R+PPH+++    A+++  + SV E
Sbjct  152  SAPVNVPDWSKILGAEKKHRWADDDVDSDKEDEQEERLPPHLHIQREYAQSQQTTFSVCE  211

Query  192  GIGRTLKGRDLSRVRNAIWKQTGFED  115
            G GRTLKGRDLSRVRNA+ +QTGF D
Sbjct  212  GAGRTLKGRDLSRVRNAVLRQTGFLD  237



>ref|XP_009785363.1| PREDICTED: uncharacterized protein LOC104233638 [Nicotiana sylvestris]
Length=210

 Score = 80.5 bits (197),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 45/82 (55%), Positives = 56/82 (68%), Gaps = 3/82 (4%)
 Frame = -3

Query  360  SLPVNIPDWSKILGGEYKdrrresdeeeeddgdgddRVPPHVYLARTR-VASLSVHEGIG  184
            S PVN+PDWSKI            D ++  D    + VPPH Y+AR+R +AS SV EG+G
Sbjct  130  SAPVNVPDWSKIY--RVNSVESLHDSDDCVDDHDSEMVPPHEYVARSRNLASHSVFEGVG  187

Query  183  RTLKGRDLSRVRNAIWKQTGFE  118
            RTLKGRDLSRVR+A+W QTGF+
Sbjct  188  RTLKGRDLSRVRDAVWSQTGFD  209



>ref|XP_011096069.1| PREDICTED: uncharacterized protein LOC105175348 [Sesamum indicum]
Length=206

 Score = 80.5 bits (197),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 45/86 (52%), Positives = 58/86 (67%), Gaps = 9/86 (10%)
 Frame = -3

Query  360  SLPVNIPDWSKILGGEYKdrrresdeeeeddgdgddRVPPHVYLART-----RVASLSVH  196
            S PVN+PDWSKI    Y+    ES  + +D  +  + VPPH YLAR      + A+ SV 
Sbjct  124  SAPVNVPDWSKI----YRVNSVESLHDLDDSFNDSELVPPHEYLAREYARSRKTAANSVF  179

Query  195  EGIGRTLKGRDLSRVRNAIWKQTGFE  118
            EG+GRTLKGRD+SRVR+A+W QTGF+
Sbjct  180  EGVGRTLKGRDMSRVRDAVWSQTGFD  205



>ref|XP_002464477.1| hypothetical protein SORBIDRAFT_01g019100 [Sorghum bicolor]
 gb|EER91475.1| hypothetical protein SORBIDRAFT_01g019100 [Sorghum bicolor]
Length=190

 Score = 80.1 bits (196),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 49/97 (51%), Positives = 55/97 (57%), Gaps = 15/97 (15%)
 Frame = -3

Query  360  SLPVNIPDWSKILGGEYKdrrresdeeeeddgdgddR-------------VPPH-VYLAR  223
            S+PVNIPDWSKILG EY      +        D                 VPPH V   R
Sbjct  94   SVPVNIPDWSKILGAEYAGSCAAARAAGWAAHDDRADFFTDDCGTGGRRWVPPHEVVQGR  153

Query  222  TRVA-SLSVHEGIGRTLKGRDLSRVRNAIWKQTGFED  115
             R A S SV EG+GRTLKGRDL RVRNAIW++TGF+D
Sbjct  154  DRAAASFSVREGVGRTLKGRDLRRVRNAIWEKTGFQD  190



>ref|XP_010686848.1| PREDICTED: uncharacterized protein LOC104901003 [Beta vulgaris 
subsp. vulgaris]
Length=225

 Score = 80.5 bits (197),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 45/82 (55%), Positives = 54/82 (66%), Gaps = 3/82 (4%)
 Frame = -3

Query  360  SLPVNIPDWSKILGGEYKdrrresdeeeeddgdgddRVPPHVYLARTRVA-SLSVHEGIG  184
            S PVN+PDWSKIL           D +E+D        PPH YLAR+R   + SV EG+G
Sbjct  145  SAPVNVPDWSKIL--RVNSVESMHDSDEDDRVSDSAMEPPHEYLARSRQKNAFSVFEGVG  202

Query  183  RTLKGRDLSRVRNAIWKQTGFE  118
            RTLKGRD+SRVR+A+W QTGFE
Sbjct  203  RTLKGRDMSRVRDAVWSQTGFE  224



>ref|XP_003550491.2| PREDICTED: uncharacterized protein LOC100813375 [Glycine max]
Length=213

 Score = 80.5 bits (197),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 45/82 (55%), Positives = 60/82 (73%), Gaps = 4/82 (5%)
 Frame = -3

Query  360  SLPVNIPDWSKILGGEYKdrrresdeeeeddgdgddRVPPHVYLARTR-VASLSVHEGIG  184
            S PVN+PDWSKIL  +      E D+  +D+ +  + VPPH YLAR+R +A+ SV EG+G
Sbjct  134  SAPVNVPDWSKILRVD---SLHEMDDVFDDNNNESEMVPPHEYLARSRKMAANSVFEGVG  190

Query  183  RTLKGRDLSRVRNAIWKQTGFE  118
            RTLKGRD+ RVR+A+W QTGF+
Sbjct  191  RTLKGRDMRRVRDAVWSQTGFD  212



>ref|XP_006594426.1| PREDICTED: uncharacterized protein LOC100798894 [Glycine max]
Length=195

 Score = 80.1 bits (196),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 44/82 (54%), Positives = 60/82 (73%), Gaps = 5/82 (6%)
 Frame = -3

Query  360  SLPVNIPDWSKILGGEYKdrrresdeeeeddgdgddRVPPHVYLARTR-VASLSVHEGIG  184
            S P+N+PDWSKIL    +    +S  ++ +D D  + VPPH YLAR++ + + SV EG+G
Sbjct  117  SAPMNVPDWSKIL----RVDSVDSLNDDYNDEDESEMVPPHEYLARSQTMVANSVFEGVG  172

Query  183  RTLKGRDLSRVRNAIWKQTGFE  118
            RTLKGRDLSRVR+A+W QTGF+
Sbjct  173  RTLKGRDLSRVRDAVWSQTGFD  194



>gb|EPS57709.1| hypothetical protein M569_17108 [Genlisea aurea]
Length=187

 Score = 79.7 bits (195),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 44/86 (51%), Positives = 57/86 (66%), Gaps = 9/86 (10%)
 Frame = -3

Query  360  SLPVNIPDWSKILGGEYKdrrresdeeeeddgdgddRVPPHVYLART-----RVASLSVH  196
            S PVN+PDWSK+    Y+    ES  + +   +  + VPPH YLAR      R A+ SV 
Sbjct  105  SAPVNVPDWSKV----YRVDCLESLPDSDYTLNVSEIVPPHEYLAREYARSRRTAANSVF  160

Query  195  EGIGRTLKGRDLSRVRNAIWKQTGFE  118
            EG+GRTLKGRD+SRVR+A+W QTGF+
Sbjct  161  EGVGRTLKGRDMSRVRDAVWSQTGFD  186



>ref|XP_004507692.1| PREDICTED: uncharacterized protein LOC101501221 [Cicer arietinum]
Length=182

 Score = 79.3 bits (194),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 45/82 (55%), Positives = 56/82 (68%), Gaps = 3/82 (4%)
 Frame = -3

Query  360  SLPVNIPDWSKILGGEYKdrrresdeeeeddgdgddRVPPHVYLARTR-VASLSVHEGIG  184
            S PVN+PDWSKIL           D ++  D +  + VPPH YLAR R +A+ SV EG+G
Sbjct  102  SAPVNVPDWSKIL--RVDSVGSLHDLDDGFDVNDSEMVPPHEYLARGRKMAANSVFEGVG  159

Query  183  RTLKGRDLSRVRNAIWKQTGFE  118
            RTLKGRDL RVR+A+W QTGF+
Sbjct  160  RTLKGRDLRRVRDAVWNQTGFD  181



>ref|XP_004145178.1| PREDICTED: uncharacterized protein LOC101209631 [Cucumis sativus]
 ref|XP_004153103.1| PREDICTED: uncharacterized protein LOC101212597 [Cucumis sativus]
 ref|XP_004165388.1| PREDICTED: uncharacterized LOC101212597 [Cucumis sativus]
 gb|KGN64524.1| hypothetical protein Csa_1G063480 [Cucumis sativus]
Length=194

 Score = 79.7 bits (195),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 47/88 (53%), Positives = 57/88 (65%), Gaps = 8/88 (9%)
 Frame = -3

Query  363  ASLPVNIPDWSKILGGEYKdrrresdeeeeddgdgddRVPPHVYLAR------TRVASLS  202
            AS PVN+PDWSKIL  E     RE D+    + D  + VPPH YLAR         A+ S
Sbjct  108  ASAPVNVPDWSKILWAE--SSLREMDDGGYYNNDETEMVPPHEYLAREYARSRNTAAATS  165

Query  201  VHEGIGRTLKGRDLSRVRNAIWKQTGFE  118
            V EG+GRTLKGRD+ RVR+A+W QTGF+
Sbjct  166  VFEGVGRTLKGRDMRRVRDAVWSQTGFD  193



>ref|XP_010425943.1| PREDICTED: uncharacterized protein LOC104710977 isoform X2 [Camelina 
sativa]
Length=147

 Score = 78.2 bits (191),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 44/71 (62%), Positives = 55/71 (77%), Gaps = 1/71 (1%)
 Frame = -3

Query  363  ASLPVNIPDWSKILGGE-YKdrrresdeeeeddgdgddRVPPHVYLARTRVASLSVHEGI  187
            +SLPVN+PDWSKILG E +    R    E ++DG G + +PPH YLA+TR+AS SVHEG+
Sbjct  72   SSLPVNVPDWSKILGKENHNRHVRRRSIENDEDGGGGELLPPHEYLAKTRMASFSVHEGV  131

Query  186  GRTLKGRDLSR  154
            GRTLKGRD+SR
Sbjct  132  GRTLKGRDMSR  142



>ref|XP_003546150.1| PREDICTED: uncharacterized protein LOC100796798 [Glycine max]
Length=193

 Score = 79.0 bits (193),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 45/82 (55%), Positives = 59/82 (72%), Gaps = 7/82 (9%)
 Frame = -3

Query  360  SLPVNIPDWSKILGGEYKdrrresdeeeeddgdgddRVPPHVYLART-RVASLSVHEGIG  184
            S PVN+PDWSKIL      R    +   ++DGD  + +PPH YLAR+ ++ + SV EG+G
Sbjct  117  SAPVNVPDWSKIL------RVDSVESINDEDGDESEMMPPHEYLARSQKMVANSVFEGVG  170

Query  183  RTLKGRDLSRVRNAIWKQTGFE  118
            RTLKGRDLSRVR+A+W QTGF+
Sbjct  171  RTLKGRDLSRVRDAVWNQTGFD  192



>gb|ABK22020.1| unknown [Picea sitchensis]
 gb|ACN40387.1| unknown [Picea sitchensis]
 gb|ACN40869.1| unknown [Picea sitchensis]
Length=276

 Score = 80.1 bits (196),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 46/89 (52%), Positives = 60/89 (67%), Gaps = 9/89 (10%)
 Frame = -3

Query  360  SLPVNIPDWSKILGGEYKdrrres-----deeeeddgdgddRVPPHVYLAR----TRVAS  208
            S PVN+PDWSKILG      +  +         ++D DG D +PPH YLAR    +++ +
Sbjct  186  SAPVNVPDWSKILGVGMDRLKENNPNLLFSAAADEDEDGGDMLPPHEYLAREQARSQMTT  245

Query  207  LSVHEGIGRTLKGRDLSRVRNAIWKQTGF  121
             SV EG+GRTLKGRD+SRVRNA+W+QTGF
Sbjct  246  TSVFEGVGRTLKGRDMSRVRNAVWRQTGF  274



>gb|ABK25188.1| unknown [Picea sitchensis]
Length=241

 Score = 79.7 bits (195),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 46/89 (52%), Positives = 60/89 (67%), Gaps = 9/89 (10%)
 Frame = -3

Query  360  SLPVNIPDWSKILGGEYKdrrres-----deeeeddgdgddRVPPHVYLAR----TRVAS  208
            S PVN+PDWSKILG      +  +         ++D DG D +PPH YLAR    +++ +
Sbjct  151  SAPVNVPDWSKILGVGMDRLKENNPNLFFSAAADEDEDGGDMLPPHEYLAREQARSQMTT  210

Query  207  LSVHEGIGRTLKGRDLSRVRNAIWKQTGF  121
             SV EG+GRTLKGRD+SRVRNA+W+QTGF
Sbjct  211  TSVFEGVGRTLKGRDMSRVRNAVWRQTGF  239



>ref|XP_010093287.1| hypothetical protein L484_006301 [Morus notabilis]
 gb|EXB53812.1| hypothetical protein L484_006301 [Morus notabilis]
Length=211

 Score = 79.3 bits (194),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 48/86 (56%), Positives = 60/86 (70%), Gaps = 5/86 (6%)
 Frame = -3

Query  360  SLPVNIPDWSKILGGEYKdrrresdeeeeddgdgddRVPPHVYLART-----RVASLSVH  196
            S PVN+PDWSKIL  +  D   E DE+  D G   + VPPH YLAR      + A+ SV 
Sbjct  125  SAPVNVPDWSKILRVDSVDSLPELDEDFGDYGGDSEIVPPHEYLAREYAHSRKTAANSVF  184

Query  195  EGIGRTLKGRDLSRVRNAIWKQTGFE  118
            EG+GRTLKGRD+SRVR+A+W+QTGF+
Sbjct  185  EGVGRTLKGRDMSRVRDAVWRQTGFD  210



>gb|ABK26775.1| unknown [Picea sitchensis]
Length=276

 Score = 80.1 bits (196),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 46/89 (52%), Positives = 60/89 (67%), Gaps = 9/89 (10%)
 Frame = -3

Query  360  SLPVNIPDWSKILGGEYKdrrres-----deeeeddgdgddRVPPHVYLAR----TRVAS  208
            S PVN+PDWSKILG      +  +         ++D DG D +PPH YLAR    +++ +
Sbjct  186  SAPVNVPDWSKILGVGMDRLKENNPNLFFSAAADEDEDGGDMLPPHEYLAREQARSQMTT  245

Query  207  LSVHEGIGRTLKGRDLSRVRNAIWKQTGF  121
             SV EG+GRTLKGRD+SRVRNA+W+QTGF
Sbjct  246  TSVFEGVGRTLKGRDMSRVRNAVWRQTGF  274



>ref|XP_010455755.1| PREDICTED: uncharacterized protein LOC104737310 [Camelina sativa]
Length=165

 Score = 78.6 bits (192),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 42/89 (47%), Positives = 59/89 (66%), Gaps = 6/89 (7%)
 Frame = -3

Query  369  RPASLPVNIPDWSKILGGEYKdr--rresdeeeeddgdgddRVPPHVY----LARTRVAS  208
            + +S P+N+PDWSK+ GG+ K            +D+ D    VPPH +    LART+++S
Sbjct  75   KQSSAPMNVPDWSKVYGGDSKSSRWSSHLCSHGDDEDDDGCMVPPHEWVARKLARTQISS  134

Query  207  LSVHEGIGRTLKGRDLSRVRNAIWKQTGF  121
             S+ EG+GRTLKGRDLS+VRNA+  +TGF
Sbjct  135  FSMCEGVGRTLKGRDLSKVRNAVLSKTGF  163



>ref|XP_011086185.1| PREDICTED: uncharacterized protein LOC105167985 [Sesamum indicum]
Length=214

 Score = 79.0 bits (193),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 47/93 (51%), Positives = 61/93 (66%), Gaps = 10/93 (11%)
 Frame = -3

Query  378  GVDRPASLPVNIPDWSKILGGEYKdrrresdeeeedd-gdgddRVPPHVYLART-----R  217
            G +   S PVN+PDWSKI    Y+    ES  + +D   +  + VPPH YLAR      R
Sbjct  125  GRNMATSAPVNVPDWSKI----YRVDSVESLHDSDDGWNEDSELVPPHEYLAREYARSRR  180

Query  216  VASLSVHEGIGRTLKGRDLSRVRNAIWKQTGFE  118
            +A+ SV EG+GRTLKGRD+SRVR+A+W QTGF+
Sbjct  181  IAANSVFEGVGRTLKGRDMSRVRDAVWSQTGFD  213



>ref|XP_004232713.1| PREDICTED: uncharacterized protein LOC101253959 [Solanum lycopersicum]
Length=206

 Score = 78.2 bits (191),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 43/82 (52%), Positives = 55/82 (67%), Gaps = 3/82 (4%)
 Frame = -3

Query  360  SLPVNIPDWSKILGGEYKdrrresdeeeeddgdgddRVPPHVYLARTRVASL-SVHEGIG  184
            S PVN+PDWSKI            D ++  D    + VPPH Y+AR+R ++  SV EG+G
Sbjct  126  SAPVNVPDWSKIY--RVNSVESLHDSDDGVDDHDSEMVPPHEYIARSRNSNAHSVFEGVG  183

Query  183  RTLKGRDLSRVRNAIWKQTGFE  118
            RTLKGRDLSRVR+A+W QTGF+
Sbjct  184  RTLKGRDLSRVRDAVWSQTGFD  205



>ref|XP_009130722.1| PREDICTED: uncharacterized protein LOC103855485 [Brassica rapa]
Length=178

 Score = 77.4 bits (189),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 45/99 (45%), Positives = 55/99 (56%), Gaps = 14/99 (14%)
 Frame = -3

Query  369  RPASLPVNIPDWSKILGGEYKdr--------------rresdeeeeddgdgddRVPPHVY  232
            +  SLPVNIPDWSKIL  EYK                   +D +      G   +PPH Y
Sbjct  80   KTGSLPVNIPDWSKILKSEYKSHVVPDDDTDEDDEDEEDTNDGDTAAATGGRRIIPPHEY  139

Query  231  LARTRVASLSVHEGIGRTLKGRDLSRVRNAIWKQTGFED  115
            LAR R +S ++HEGIG T KGRDL  +RN IW++ GF D
Sbjct  140  LARRRGSSFTMHEGIGGTAKGRDLRILRNVIWEKIGFLD  178



>emb|CDY11244.1| BnaA03g00800D [Brassica napus]
Length=178

 Score = 77.4 bits (189),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 45/99 (45%), Positives = 55/99 (56%), Gaps = 14/99 (14%)
 Frame = -3

Query  369  RPASLPVNIPDWSKILGGEYKdr--------------rresdeeeeddgdgddRVPPHVY  232
            +  SLPVNIPDWSKIL  EYK                   +D +      G   +PPH Y
Sbjct  80   KTGSLPVNIPDWSKILKSEYKSHVVPDDDTDEDDEDEEDTNDGDTAAATGGRRIIPPHEY  139

Query  231  LARTRVASLSVHEGIGRTLKGRDLSRVRNAIWKQTGFED  115
            LAR R +S ++HEGIG T KGRDL  +RN IW++ GF D
Sbjct  140  LARRRGSSFTMHEGIGGTAKGRDLRILRNVIWEKIGFLD  178



>ref|XP_006348114.1| PREDICTED: uncharacterized protein LOC102595538 [Solanum tuberosum]
Length=207

 Score = 77.8 bits (190),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 43/82 (52%), Positives = 55/82 (67%), Gaps = 3/82 (4%)
 Frame = -3

Query  360  SLPVNIPDWSKILGGEYKdrrresdeeeeddgdgddRVPPHVYLARTRVASL-SVHEGIG  184
            S PVN+PDWSKI            D ++  D    + VPPH Y+AR+R ++  SV EG+G
Sbjct  127  SAPVNVPDWSKIY--RVNSVESLHDSDDGVDDHDSEMVPPHEYIARSRNSNARSVFEGVG  184

Query  183  RTLKGRDLSRVRNAIWKQTGFE  118
            RTLKGRDLSRVR+A+W QTGF+
Sbjct  185  RTLKGRDLSRVRDAVWSQTGFD  206



>ref|NP_193928.2| uncharacterized protein [Arabidopsis thaliana]
 gb|AEE84536.1| uncharacterized protein AT4G21970 [Arabidopsis thaliana]
Length=157

 Score = 76.6 bits (187),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 44/90 (49%), Positives = 56/90 (62%), Gaps = 4/90 (4%)
 Frame = -3

Query  378  GVDRPASLPVNIPDWSKILGGEYKdrrresdeeeeddgdgddRVPPHVY----LARTRVA  211
            G  + +S P+NIPDWSK+ G   K+          DD D    VPPH      LART+++
Sbjct  54   GGAKQSSAPMNIPDWSKVYGYSKKNTSSHLHSWAIDDDDEGSMVPPHELVAKRLARTQIS  113

Query  210  SLSVHEGIGRTLKGRDLSRVRNAIWKQTGF  121
            S S+ EGIGRTLKGRDLS+ RNA+  +TGF
Sbjct  114  SFSMCEGIGRTLKGRDLSKTRNAVLTRTGF  143



>ref|XP_008806403.1| PREDICTED: uncharacterized protein LOC103719105 [Phoenix dactylifera]
Length=195

 Score = 77.0 bits (188),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 45/83 (54%), Positives = 54/83 (65%), Gaps = 6/83 (7%)
 Frame = -3

Query  363  ASLPVNIPDWSKILGGEYKdrrresdeeeeddgdgddRVPPHVYLART--RVASLSVHEG  190
            AS PVN+PDW + L    +        E   D D  +RVPPH YLAR   R+ + SV EG
Sbjct  115  ASAPVNVPDWPRFL----RVESMHGGGEAGADWDDGERVPPHEYLAREQGRMVAASVFEG  170

Query  189  IGRTLKGRDLSRVRNAIWKQTGF  121
            +GRTLKGRD+SRVRNA+W QTGF
Sbjct  171  VGRTLKGRDMSRVRNAVWSQTGF  193



>ref|XP_006352633.1| PREDICTED: SUN domain-containing protein 2-like [Solanum tuberosum]
Length=161

 Score = 76.3 bits (186),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 42/84 (50%), Positives = 56/84 (67%), Gaps = 4/84 (5%)
 Frame = -3

Query  360  SLPVNIPDWSKILGGEYKdrrresdeeeeddgdgddRVPPHVYLA----RTRVASLSVHE  193
            S PV IPDWSKI G + K        +++D+   ++ +PPH +LA    R  ++S SV E
Sbjct  76   SAPVKIPDWSKIYGTKLKKEINNFGSDDDDEEIEENVMPPHEWLAKRIDRREISSFSVCE  135

Query  192  GIGRTLKGRDLSRVRNAIWKQTGF  121
            G+GRTLKGRDLSRVRNA+  +TGF
Sbjct  136  GVGRTLKGRDLSRVRNAVLTKTGF  159



>ref|XP_002274403.1| PREDICTED: uncharacterized protein LOC100246942 [Vitis vinifera]
Length=213

 Score = 77.0 bits (188),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 43/86 (50%), Positives = 54/86 (63%), Gaps = 10/86 (12%)
 Frame = -3

Query  360  SLPVNIPDWSKILGGEYKdrrresdeeeeddgdgddRVPPHVYLART-----RVASLSVH  196
            S PVN+PDW KIL              + DD    + VPPH YLAR      ++A+ SV 
Sbjct  132  SAPVNVPDWHKIL-----RVDSVESLHDSDDDRELEMVPPHEYLAREYAASRKMAATSVL  186

Query  195  EGIGRTLKGRDLSRVRNAIWKQTGFE  118
            EG+GRTLKGRD+SRVR+A+W QTGF+
Sbjct  187  EGVGRTLKGRDMSRVRDAVWSQTGFD  212



>ref|XP_003632945.1| PREDICTED: uncharacterized protein LOC100855186 [Vitis vinifera]
Length=213

 Score = 77.0 bits (188),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 43/86 (50%), Positives = 54/86 (63%), Gaps = 10/86 (12%)
 Frame = -3

Query  360  SLPVNIPDWSKILGGEYKdrrresdeeeeddgdgddRVPPHVYLART-----RVASLSVH  196
            S PVN+PDW KIL              + DD    + VPPH YLAR      ++A+ SV 
Sbjct  132  SAPVNVPDWHKIL-----RVDSVESLHDSDDDRELEMVPPHEYLAREYAASRKMAATSVL  186

Query  195  EGIGRTLKGRDLSRVRNAIWKQTGFE  118
            EG+GRTLKGRD+SRVR+A+W QTGF+
Sbjct  187  EGVGRTLKGRDMSRVRDAVWSQTGFD  212



>ref|XP_010432523.1| PREDICTED: uncharacterized protein LOC104716776 [Camelina sativa]
Length=169

 Score = 76.3 bits (186),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 45/93 (48%), Positives = 62/93 (67%), Gaps = 10/93 (11%)
 Frame = -3

Query  369  RPASLPVNIPDWSKILGGEYKdrrresdee------eeddgdgddRVPPHVY----LART  220
            + +S P+N+PDWSK+ GG+ K  RR S         + D+ D    VPPH +    LART
Sbjct  75   KQSSAPMNVPDWSKVYGGDSKSSRRSSHLCFHGDDEDGDEDDDGCMVPPHEWVARKLART  134

Query  219  RVASLSVHEGIGRTLKGRDLSRVRNAIWKQTGF  121
            +++S S+ EG+GRTLKGRDLS+VRNA+  +TGF
Sbjct  135  QISSFSMCEGVGRTLKGRDLSKVRNAVLSKTGF  167



>gb|EYU27783.1| hypothetical protein MIMGU_mgv1a024298mg [Erythranthe guttata]
Length=155

 Score = 75.9 bits (185),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 47/85 (55%), Positives = 60/85 (71%), Gaps = 4/85 (5%)
 Frame = -3

Query  363  ASLPVNIPDWSKILGGEYKdrrresdeeeeddgdgddRVPPHVYLAR----TRVASLSVH  196
            +S PVN+PDWSKIL      +R     +++DD D + RVPPH YLAR    T++AS S+ 
Sbjct  69   SSAPVNVPDWSKILKKPAPVKRNPRGGDDDDDEDDETRVPPHEYLARRLASTQIASYSMC  128

Query  195  EGIGRTLKGRDLSRVRNAIWKQTGF  121
            EG+GRTLKGRDLS +RNAI  +TGF
Sbjct  129  EGVGRTLKGRDLSNLRNAILTKTGF  153



>gb|KDP20752.1| hypothetical protein JCGZ_21223 [Jatropha curcas]
Length=215

 Score = 77.0 bits (188),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 42/86 (49%), Positives = 53/86 (62%), Gaps = 7/86 (8%)
 Frame = -3

Query  360  SLPVNIPDWSKILGGEYKdrrresdeeeeddgdgddRVPPHVYLAR-----TRVASLSVH  196
            S PVN+PDWSKIL           + ++  D    + VPPH YLAR      ++   SV 
Sbjct  131  SAPVNVPDWSKIL--RVDSVESLHESDDGFDDRDSEMVPPHEYLAREYARSKKMGGASVF  188

Query  195  EGIGRTLKGRDLSRVRNAIWKQTGFE  118
            EG+GRTLKGRDL RVR+A+W QTGF+
Sbjct  189  EGVGRTLKGRDLRRVRDAVWSQTGFD  214



>ref|XP_011097873.1| PREDICTED: uncharacterized protein LOC105176685 [Sesamum indicum]
 ref|XP_011097874.1| PREDICTED: uncharacterized protein LOC105176685 [Sesamum indicum]
Length=186

 Score = 76.3 bits (186),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 42/91 (46%), Positives = 60/91 (66%), Gaps = 11/91 (12%)
 Frame = -3

Query  360  SLPVNIPDWSKILGGEYKdrrres-----------deeeeddgdgddRVPPHVYLARTRV  214
            S P+NIPDWSKI G   K   +             +++++ DG+  + +PPH ++AR R+
Sbjct  88   SAPLNIPDWSKIYGTTSKTTSKNDDGFPGSGWERDEDDKDVDGEDGNVIPPHEWIARNRI  147

Query  213  ASLSVHEGIGRTLKGRDLSRVRNAIWKQTGF  121
            +S S+ EG+GRTLKGRDLSRVRNA+  +TGF
Sbjct  148  SSFSMCEGVGRTLKGRDLSRVRNAVLTKTGF  178



>emb|CAA17164.1| putative protein [Arabidopsis thaliana]
Length=241

 Score = 77.0 bits (188),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 44/90 (49%), Positives = 56/90 (62%), Gaps = 4/90 (4%)
 Frame = -3

Query  378  GVDRPASLPVNIPDWSKILGGEYKdrrresdeeeeddgdgddRVPPHVY----LARTRVA  211
            G  + +S P+NIPDWSK+ G   K+          DD D    VPPH      LART+++
Sbjct  54   GGAKQSSAPMNIPDWSKVYGYSKKNTSSHLHSWAIDDDDEGSMVPPHELVAKRLARTQIS  113

Query  210  SLSVHEGIGRTLKGRDLSRVRNAIWKQTGF  121
            S S+ EGIGRTLKGRDLS+ RNA+  +TGF
Sbjct  114  SFSMCEGIGRTLKGRDLSKTRNAVLTRTGF  143



>emb|CAA18100.1| hypothetical protein [Arabidopsis thaliana]
 emb|CAB79152.1| hypothetical protein [Arabidopsis thaliana]
Length=181

 Score = 75.9 bits (185),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 44/90 (49%), Positives = 56/90 (62%), Gaps = 4/90 (4%)
 Frame = -3

Query  378  GVDRPASLPVNIPDWSKILGGEYKdrrresdeeeeddgdgddRVPPHVY----LARTRVA  211
            G  + +S P+NIPDWSK+ G   K+          DD D    VPPH      LART+++
Sbjct  54   GGAKQSSAPMNIPDWSKVYGYSKKNTSSHLHSWAIDDDDEGSMVPPHELVAKRLARTQIS  113

Query  210  SLSVHEGIGRTLKGRDLSRVRNAIWKQTGF  121
            S S+ EGIGRTLKGRDLS+ RNA+  +TGF
Sbjct  114  SFSMCEGIGRTLKGRDLSKTRNAVLTRTGF  143



>emb|CDX80857.1| BnaC03g01110D [Brassica napus]
Length=179

 Score = 75.9 bits (185),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 43/98 (44%), Positives = 53/98 (54%), Gaps = 15/98 (15%)
 Frame = -3

Query  363  ASLPVNIPDWSKILGGEYKdr---------------rresdeeeeddgdgddRVPPHVYL  229
             SLPVNIPDWSKIL  EY+                    +  +      G   +PPH YL
Sbjct  82   GSLPVNIPDWSKILKSEYRSHVVVPDDDTDEDDEDEEDTNGGDTAAAAGGRRIIPPHEYL  141

Query  228  ARTRVASLSVHEGIGRTLKGRDLSRVRNAIWKQTGFED  115
            AR R +S ++HEGIG T KGRDL  +RN IW++ GF D
Sbjct  142  ARRRGSSFTMHEGIGGTAKGRDLKILRNVIWEKIGFLD  179



>ref|XP_002518486.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF43873.1| conserved hypothetical protein [Ricinus communis]
Length=221

 Score = 76.3 bits (186),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 43/86 (50%), Positives = 54/86 (63%), Gaps = 7/86 (8%)
 Frame = -3

Query  360  SLPVNIPDWSKILGGEYKdrrresdeeeeddgdgddRVPPHVYLART-----RVASLSVH  196
            S PVN+PDWSKIL           D ++  D    + VPPH YLAR      ++ + SV 
Sbjct  137  SAPVNVPDWSKIL--RVDSVESLHDLDDGFDEGDSEMVPPHEYLARVYARSRKMGNASVF  194

Query  195  EGIGRTLKGRDLSRVRNAIWKQTGFE  118
            EG+GRTLKGRDL RVR+A+W QTGF+
Sbjct  195  EGVGRTLKGRDLRRVRDAVWNQTGFD  220



>ref|XP_010422288.1| PREDICTED: uncharacterized protein LOC104707610 [Camelina sativa]
Length=165

 Score = 75.5 bits (184),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 43/89 (48%), Positives = 62/89 (70%), Gaps = 6/89 (7%)
 Frame = -3

Query  369  RPASLPVNIPDWSKILGGEYKdrrresdeee--eddgdgddRVPPHVY----LARTRVAS  208
            + +S P+N+PDWSK+ GG+ K  ++ S      +D+ D    VPPH +    LART+++S
Sbjct  75   KQSSAPMNVPDWSKVYGGDSKSSKKSSHLCSHGDDEDDDGCMVPPHEWVARKLARTQISS  134

Query  207  LSVHEGIGRTLKGRDLSRVRNAIWKQTGF  121
             S+ EG+GRTLKGRDLS+VRNA+  +TGF
Sbjct  135  FSMCEGVGRTLKGRDLSKVRNAVLSKTGF  163



>ref|NP_001144407.1| uncharacterized protein LOC100277341 [Zea mays]
 gb|ACG40291.1| hypothetical protein [Zea mays]
Length=181

 Score = 75.5 bits (184),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 50/99 (51%), Positives = 56/99 (57%), Gaps = 11/99 (11%)
 Frame = -3

Query  378  GVDRPASLPVNIPDWSKILGGEYKdrrresdeeeeddgdgddR---------VPPH-VYL  229
            G   PAS+PVNIPDWSKILG EY      + +   DD               VPPH V  
Sbjct  83   GAPGPASVPVNIPDWSKILGAEYAGSGWAAHDXRADDDAAACCGGGAGGRRWVPPHEVLQ  142

Query  228  ARTRVA-SLSVHEGIGRTLKGRDLSRVRNAIWKQTGFED  115
             R R A S SV EG GRTLKGRDL RV   IW++TGF+D
Sbjct  143  GRERAAASFSVREGAGRTLKGRDLRRVXXXIWEKTGFQD  181



>ref|XP_009137232.1| PREDICTED: uncharacterized protein LOC103861270 [Brassica rapa]
 emb|CDX98721.1| BnaA03g45060D [Brassica napus]
Length=157

 Score = 74.7 bits (182),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 44/91 (48%), Positives = 58/91 (64%), Gaps = 7/91 (8%)
 Frame = -3

Query  372  DRPASLPVNIPDWSKILGGEYKdrrresd---eeeeddgdgddRVPPHVY----LARTRV  214
            ++ +S P+N+PDWSKI G   K  R          ++D D D  VPPH      LART++
Sbjct  55   EKQSSAPMNVPDWSKIYGNTKKSTRSNHLHSWATHDEDDDEDSMVPPHELVAKRLARTQI  114

Query  213  ASLSVHEGIGRTLKGRDLSRVRNAIWKQTGF  121
            +S S+ EGIGRTLKGRDLS+ RNA+  +TGF
Sbjct  115  SSFSMCEGIGRTLKGRDLSKTRNAVLTKTGF  145



>ref|XP_006285893.1| hypothetical protein CARUB_v10007405mg [Capsella rubella]
 gb|EOA18791.1| hypothetical protein CARUB_v10007405mg [Capsella rubella]
Length=168

 Score = 75.1 bits (183),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 43/90 (48%), Positives = 55/90 (61%), Gaps = 4/90 (4%)
 Frame = -3

Query  378  GVDRPASLPVNIPDWSKILGGEYKdrrresdeeeeddgdgddRVPPHVY----LARTRVA  211
            G  + +S P+NIPDWSK+ G   K           D+ D    VPPH      LART+++
Sbjct  63   GGAKQSSAPMNIPDWSKVYGYPKKSTSSHLHPWATDEDDEGSMVPPHELVAKRLARTQIS  122

Query  210  SLSVHEGIGRTLKGRDLSRVRNAIWKQTGF  121
            S S+ EGIGRTLKGRDLS+ RNA+  +TGF
Sbjct  123  SFSMCEGIGRTLKGRDLSKTRNAVLTRTGF  152



>ref|XP_010276081.1| PREDICTED: uncharacterized protein LOC104610921 [Nelumbo nucifera]
Length=211

 Score = 75.9 bits (185),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 41/87 (47%), Positives = 55/87 (63%), Gaps = 7/87 (8%)
 Frame = -3

Query  363  ASLPVNIPDWSKILGGEYKdrrresdeeeeddgdgddRVPPHVYLART-----RVASLSV  199
            AS PVN+PDW KIL           D ++  +    + +PPH YLAR      ++ + SV
Sbjct  126  ASAPVNVPDWPKIL--RVDSVESLQDSDDGIEDHDAEWIPPHEYLAREYARTRKMTATSV  183

Query  198  HEGIGRTLKGRDLSRVRNAIWKQTGFE  118
             EG+GRTLKGRD+SRVR+A+W QTGF+
Sbjct  184  FEGVGRTLKGRDMSRVRDAVWSQTGFD  210



>ref|XP_002305577.1| hypothetical protein POPTR_0004s01560g [Populus trichocarpa]
 gb|EEE86088.1| hypothetical protein POPTR_0004s01560g [Populus trichocarpa]
Length=217

 Score = 75.9 bits (185),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 42/85 (49%), Positives = 53/85 (62%), Gaps = 7/85 (8%)
 Frame = -3

Query  360  SLPVNIPDWSKILGGEYKdrrresdeeeeddgdgddRVPPHVYLAR-----TRVASLSVH  196
            S PVN+PDWSKI           +D ++  D    + VPPH YLAR      ++   SV 
Sbjct  133  SAPVNVPDWSKIY--RVNSVESCNDSDDGLDDQESEMVPPHEYLAREYAQSQKMGGASVV  190

Query  195  EGIGRTLKGRDLSRVRNAIWKQTGF  121
            EG+GRTLKGRD+SRVR+A+W QTGF
Sbjct  191  EGVGRTLKGRDMSRVRDAVWSQTGF  215



>ref|XP_007147731.1| hypothetical protein PHAVU_006G150000g [Phaseolus vulgaris]
 gb|ESW19725.1| hypothetical protein PHAVU_006G150000g [Phaseolus vulgaris]
Length=255

 Score = 76.3 bits (186),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 43/82 (52%), Positives = 56/82 (68%), Gaps = 6/82 (7%)
 Frame = -3

Query  360  SLPVNIPDWSKILGGEYKdrrresdeeeeddgdgddRVPPHVYLART-RVASLSVHEGIG  184
            S PVN+PDWSKIL              +E++ D  +  PPH YLAR+ ++ + SV EG+G
Sbjct  178  SAPVNVPDWSKIL-----RVDSVESMNDEEEDDESEMEPPHEYLARSQKMVANSVFEGVG  232

Query  183  RTLKGRDLSRVRNAIWKQTGFE  118
            RTLKGRDLSRVR+A+W QTGF+
Sbjct  233  RTLKGRDLSRVRDAVWSQTGFD  254



>ref|XP_006855856.1| hypothetical protein AMTR_s00037p00097690 [Amborella trichopoda]
 gb|ERN17323.1| hypothetical protein AMTR_s00037p00097690 [Amborella trichopoda]
Length=205

 Score = 75.5 bits (184),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 39/83 (47%), Positives = 57/83 (69%), Gaps = 14/83 (17%)
 Frame = -3

Query  360  SLPVNIPDWSKILGGEYKdrrresdeeeeddgdgddRVPPHVYLARTR---VASLSVHEG  190
            S P+N+PDWS+++            + E++  +  + +PPH YLAR+R   V + SV EG
Sbjct  132  SAPMNVPDWSRVM-----------GDAEDEGEEEGEWLPPHEYLARSRDNTVTATSVFEG  180

Query  189  IGRTLKGRDLSRVRNAIWKQTGF  121
            +GRTLKGRD+SRVRNA+W++TGF
Sbjct  181  VGRTLKGRDMSRVRNAVWRRTGF  203



>ref|XP_006288768.1| hypothetical protein CARUB_v10002087mg [Capsella rubella]
 gb|EOA21666.1| hypothetical protein CARUB_v10002087mg [Capsella rubella]
Length=177

 Score = 75.1 bits (183),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 43/95 (45%), Positives = 61/95 (64%), Gaps = 12/95 (13%)
 Frame = -3

Query  369  RPASLPVNIPDWSKILGGEYKdrrresde--------eeeddgdgddRVPPHVY----LA  226
            + +S P+N+PDWSK+ GG+ K   R S          ++  + D    VPPH +    LA
Sbjct  81   KQSSAPMNVPDWSKVYGGDSKSTSRRSSHLRFHHGDDKDGGEDDDGCMVPPHEWVARKLA  140

Query  225  RTRVASLSVHEGIGRTLKGRDLSRVRNAIWKQTGF  121
            RT+++S S+ EG+GRTLKGRDLS+VRNA+  +TGF
Sbjct  141  RTQISSFSMCEGVGRTLKGRDLSKVRNAVLSKTGF  175



>ref|XP_011037653.1| PREDICTED: uncharacterized protein LOC105134801 [Populus euphratica]
Length=217

 Score = 75.5 bits (184),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 42/85 (49%), Positives = 53/85 (62%), Gaps = 7/85 (8%)
 Frame = -3

Query  360  SLPVNIPDWSKILGGEYKdrrresdeeeeddgdgddRVPPHVYLAR-----TRVASLSVH  196
            S PVN+PDWSKI           +D ++  D    + VPPH YLAR      ++   SV 
Sbjct  133  SAPVNVPDWSKIY--RVNSVDSCNDSDDGLDNHESEMVPPHEYLAREYAQTQKMGGASVV  190

Query  195  EGIGRTLKGRDLSRVRNAIWKQTGF  121
            EG+GRTLKGRD+SRVR+A+W QTGF
Sbjct  191  EGVGRTLKGRDMSRVRDAVWSQTGF  215



>ref|XP_004153812.1| PREDICTED: uncharacterized protein LOC101208118 [Cucumis sativus]
 gb|KGN64516.1| hypothetical protein Csa_1G062910 [Cucumis sativus]
Length=177

 Score = 74.7 bits (182),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 46/86 (53%), Positives = 61/86 (71%), Gaps = 5/86 (6%)
 Frame = -3

Query  363  ASLPVNIPDWSKILGGE-YKdrrresdeeeeddgdgddRVPPHVY----LARTRVASLSV  199
            +S PV+IPDWSKI G         + D  +++DG+ +D VPPH +    LAR+R++S SV
Sbjct  90   SSAPVDIPDWSKIYGKMGSSSTGDKDDVRDQEDGEDEDMVPPHEWIAQKLARSRISSFSV  149

Query  198  HEGIGRTLKGRDLSRVRNAIWKQTGF  121
             EG+GRTLKGRDLS+VRNAI  +TGF
Sbjct  150  CEGVGRTLKGRDLSKVRNAILTKTGF  175



>ref|XP_009597345.1| PREDICTED: uncharacterized protein LOC104093319 [Nicotiana tomentosiformis]
Length=201

 Score = 75.1 bits (183),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 43/85 (51%), Positives = 52/85 (61%), Gaps = 7/85 (8%)
 Frame = -3

Query  360  SLPVNIPDWSKILGGEYKdrrresdeeeeddgdgddRVPPHVYLAR-----TRVASLSVH  196
            S PVN+PDWSKI            D ++  D    + VPPH YLAR      +  + SV 
Sbjct  117  SAPVNVPDWSKIY--RVDSVESFHDSDDGVDDHELEIVPPHEYLARGHGRSRKSTTNSVF  174

Query  195  EGIGRTLKGRDLSRVRNAIWKQTGF  121
            EG+GRTLKGRD+SRVRNA+W QTGF
Sbjct  175  EGVGRTLKGRDMSRVRNAVWSQTGF  199



>ref|XP_004158009.1| PREDICTED: uncharacterized protein LOC101225374 [Cucumis sativus]
Length=178

 Score = 74.7 bits (182),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 46/86 (53%), Positives = 61/86 (71%), Gaps = 5/86 (6%)
 Frame = -3

Query  363  ASLPVNIPDWSKILGGE-YKdrrresdeeeeddgdgddRVPPHVY----LARTRVASLSV  199
            +S PV+IPDWSKI G         + D  +++DG+ +D VPPH +    LAR+R++S SV
Sbjct  91   SSAPVDIPDWSKIYGKMGSSSTGDKDDVRDQEDGEDEDMVPPHEWIAQKLARSRISSFSV  150

Query  198  HEGIGRTLKGRDLSRVRNAIWKQTGF  121
             EG+GRTLKGRDLS+VRNAI  +TGF
Sbjct  151  CEGVGRTLKGRDLSKVRNAILTKTGF  176



>ref|XP_008441031.1| PREDICTED: uncharacterized protein LOC103485264 [Cucumis melo]
 gb|ADN34054.1| hypothetical protein [Cucumis melo subsp. melo]
Length=174

 Score = 74.7 bits (182),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 47/86 (55%), Positives = 62/86 (72%), Gaps = 5/86 (6%)
 Frame = -3

Query  363  ASLPVNIPDWSKILGGE-YKdrrresdeeeeddgdgddRVPPHVY----LARTRVASLSV  199
            +S PV+IPDWSKI G         ++D  +++DG+ DD VPPH +    LAR+R++S SV
Sbjct  87   SSAPVDIPDWSKIYGKMGSSSAGEKTDVRDQEDGEDDDMVPPHEWIAQKLARSRISSFSV  146

Query  198  HEGIGRTLKGRDLSRVRNAIWKQTGF  121
             EG+GRTLKGRDLS+VRNAI  +TGF
Sbjct  147  CEGVGRTLKGRDLSKVRNAILTKTGF  172



>emb|CDX94069.1| BnaC07g37030D [Brassica napus]
Length=157

 Score = 74.3 bits (181),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 44/91 (48%), Positives = 58/91 (64%), Gaps = 7/91 (8%)
 Frame = -3

Query  372  DRPASLPVNIPDWSKILGGEYKdrrresd---eeeeddgdgddRVPPHVY----LARTRV  214
            ++ +S P+N+PDWSKI G   K  R          ++D D D  VPPH      LART++
Sbjct  55   EKQSSAPMNVPDWSKIYGNTKKSTRSNHLHSWATHDEDDDEDSMVPPHELVAKRLARTQI  114

Query  213  ASLSVHEGIGRTLKGRDLSRVRNAIWKQTGF  121
            +S S+ EGIGRTLKGRDLS+ RNA+  +TGF
Sbjct  115  SSFSMCEGIGRTLKGRDLSKTRNAVLTKTGF  145



>ref|XP_007133098.1| hypothetical protein PHAVU_011G151500g [Phaseolus vulgaris]
 gb|ESW05092.1| hypothetical protein PHAVU_011G151500g [Phaseolus vulgaris]
Length=153

 Score = 73.9 bits (180),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 44/86 (51%), Positives = 58/86 (67%), Gaps = 5/86 (6%)
 Frame = -3

Query  363  ASLPVNIPDWSKILGGEY-KdrrresdeeeeddgdgddRVPPHVY----LARTRVASLSV  199
            +S P+++PDWSKI G    K  R      +  D + DD VPPH +    LAR++++S SV
Sbjct  66   SSEPMDVPDWSKIYGKSCTKGSRDAGACNKGGDDEDDDMVPPHEWIARKLARSQISSFSV  125

Query  198  HEGIGRTLKGRDLSRVRNAIWKQTGF  121
             EG+GRTLKGRDLS+VRNAI  +TGF
Sbjct  126  CEGMGRTLKGRDLSKVRNAILAKTGF  151



>emb|CDY16655.1| BnaA09g20330D [Brassica napus]
Length=167

 Score = 74.3 bits (181),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 41/89 (46%), Positives = 61/89 (69%), Gaps = 5/89 (6%)
 Frame = -3

Query  372  DRPASLPVNIPDWSKILG-GEYKdrrresdeeeeddgdgddRVPPHVY----LARTRVAS  208
            ++ +S P+N+PDWSKI G    K+R   +    ++D D    VPPH +    LA+T+++S
Sbjct  77   EKQSSAPMNVPDWSKIYGNARNKERSIHNLHSHDEDDDDGCMVPPHEWVARKLAKTQISS  136

Query  207  LSVHEGIGRTLKGRDLSRVRNAIWKQTGF  121
             S+ EG+GRTLKGRDLS++RNA+  +TGF
Sbjct  137  FSMCEGVGRTLKGRDLSKMRNAVLTKTGF  165



>ref|XP_002869851.1| hypothetical protein ARALYDRAFT_492672 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH46110.1| hypothetical protein ARALYDRAFT_492672 [Arabidopsis lyrata subsp. 
lyrata]
Length=158

 Score = 73.9 bits (180),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 45/88 (51%), Positives = 58/88 (66%), Gaps = 5/88 (6%)
 Frame = -3

Query  369  RPASLPVNIPDWSKILGGEYKdrrresde-eeeddgdgddRVPPHVY----LARTRVASL  205
            + +S P+NIPDWSK+ G   K+ R        +DD D    VPPH      LART+++S 
Sbjct  57   KQSSAPMNIPDWSKVYGFSKKNTRSHLHSWAIDDDDDEGSMVPPHELVAKRLARTQISSF  116

Query  204  SVHEGIGRTLKGRDLSRVRNAIWKQTGF  121
            S+ EGIGRTLKGRDLS+ RNAI ++TGF
Sbjct  117  SMCEGIGRTLKGRDLSKTRNAILRRTGF  144



>emb|CDX94568.1| BnaC09g22680D [Brassica napus]
Length=150

 Score = 73.6 bits (179),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 40/89 (45%), Positives = 62/89 (70%), Gaps = 5/89 (6%)
 Frame = -3

Query  372  DRPASLPVNIPDWSKILG-GEYKdrrresdeeeeddgdgddRVPPHVY----LARTRVAS  208
            ++ +S P+N+PDWSK+ G  + K+R   +    ++D D    VPPH +    LA+T+++S
Sbjct  60   EKQSSAPMNVPDWSKVYGNAKSKERTIHNLHSRDEDDDDGCMVPPHEWVARKLAKTQISS  119

Query  207  LSVHEGIGRTLKGRDLSRVRNAIWKQTGF  121
             S+ EG+GRTLKGRDLS++RNA+  +TGF
Sbjct  120  FSMCEGVGRTLKGRDLSKMRNAVLTKTGF  148



>ref|XP_009114555.1| PREDICTED: uncharacterized protein LOC103839822 [Brassica rapa]
Length=166

 Score = 73.9 bits (180),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 41/89 (46%), Positives = 61/89 (69%), Gaps = 5/89 (6%)
 Frame = -3

Query  372  DRPASLPVNIPDWSKILG-GEYKdrrresdeeeeddgdgddRVPPHVY----LARTRVAS  208
            ++ +S P+N+PDWSKI G    K+R   +    ++D D    VPPH +    LA+T+++S
Sbjct  76   EKQSSAPMNVPDWSKIYGNARSKERSIHNLHSHDEDDDDGCMVPPHEWVARKLAKTQISS  135

Query  207  LSVHEGIGRTLKGRDLSRVRNAIWKQTGF  121
             S+ EG+GRTLKGRDLS++RNA+  +TGF
Sbjct  136  FSMCEGVGRTLKGRDLSKMRNAVLTKTGF  164



>ref|XP_006363108.1| PREDICTED: uncharacterized protein LOC102599997 isoform X1 [Solanum 
tuberosum]
 ref|XP_006363109.1| PREDICTED: uncharacterized protein LOC102599997 isoform X2 [Solanum 
tuberosum]
Length=212

 Score = 74.3 bits (181),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 42/88 (48%), Positives = 54/88 (61%), Gaps = 7/88 (8%)
 Frame = -3

Query  366  PASLPVNIPDWSKILGGEYKdrrresdeeeeddgdgddRVPPHVYLAR-----TRVASLS  202
             +S PVN+PDWSKI            D ++  D    D VPPH YLAR      +  + S
Sbjct  126  ASSAPVNVPDWSKIY--RVDSVESFHDSDDGVDDHELDMVPPHEYLARGYGRSRKSTTDS  183

Query  201  VHEGIGRTLKGRDLSRVRNAIWKQTGFE  118
            + EG+GRTLKGRD+SRVR+A+W QTGF+
Sbjct  184  MFEGVGRTLKGRDMSRVRDAVWSQTGFD  211



>emb|CDY29096.1| BnaC09g18220D [Brassica napus]
Length=150

 Score = 73.6 bits (179),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 40/89 (45%), Positives = 62/89 (70%), Gaps = 5/89 (6%)
 Frame = -3

Query  372  DRPASLPVNIPDWSKILG-GEYKdrrresdeeeeddgdgddRVPPHVY----LARTRVAS  208
            ++ +S P+N+PDWSK+ G  + K+R   +    ++D D    VPPH +    LA+T+++S
Sbjct  60   EKQSSAPMNVPDWSKVYGNAKSKERTIHNLHSRDEDDDDGCMVPPHEWVARKLAKTQISS  119

Query  207  LSVHEGIGRTLKGRDLSRVRNAIWKQTGF  121
             S+ EG+GRTLKGRDLS++RNA+  +TGF
Sbjct  120  FSMCEGVGRTLKGRDLSKMRNAVLTKTGF  148



>gb|KEH36866.1| senescence regulator [Medicago truncatula]
Length=156

 Score = 73.6 bits (179),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 44/87 (51%), Positives = 61/87 (70%), Gaps = 7/87 (8%)
 Frame = -3

Query  369  RPASLPVNIPDWSKILGGEYKdrrresdeeeeddgdgddRVPPHVY----LARTRVASLS  202
            + +S P+NIPDWSK+ G   K+ +     ++ED  +  D VPPH +    LAR++++S S
Sbjct  71   KGSSAPMNIPDWSKVYG---KNSKNGGLHDDEDGDEDGDMVPPHEWIARKLARSQISSFS  127

Query  201  VHEGIGRTLKGRDLSRVRNAIWKQTGF  121
            V EG+GRTLKGRDLS+VRNAI  +TGF
Sbjct  128  VCEGMGRTLKGRDLSKVRNAILTKTGF  154



>ref|XP_008371092.1| PREDICTED: uncharacterized protein LOC103434506 [Malus domestica]
Length=205

 Score = 73.9 bits (180),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 44/83 (53%), Positives = 58/83 (70%), Gaps = 5/83 (6%)
 Frame = -3

Query  360  SLPVNIPDWSKILGGEYKdrrresdeeeeddgdgddRVPPHVYLAR--TRVASLSVHEGI  187
            S P+N+PDWSKIL           D ++  DG+  + +PPH YLAR  TR A+ SV EG+
Sbjct  125  SAPMNVPDWSKIL--RVDSVDSLYDXDDGLDGNNSEIIPPHEYLAREYTRGAT-SVFEGV  181

Query  186  GRTLKGRDLSRVRNAIWKQTGFE  118
            GRTLKGRD+SRVR+A+W +TGF+
Sbjct  182  GRTLKGRDMSRVRDAVWSRTGFD  204



>ref|XP_006449722.1| hypothetical protein CICLE_v10016695mg [Citrus clementina]
 gb|ESR62962.1| hypothetical protein CICLE_v10016695mg [Citrus clementina]
Length=210

 Score = 73.9 bits (180),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 41/86 (48%), Positives = 50/86 (58%), Gaps = 10/86 (12%)
 Frame = -3

Query  360  SLPVNIPDWSKILGGEYKdrrresdeeeeddgdgddRVPPHVYLAR-----TRVASLSVH  196
            S PVN+PDWSKI               + DD    + +PPH YLAR      +    SV 
Sbjct  129  SAPVNVPDWSKIY-----RVDSVDSMHDSDDERDMEMIPPHEYLAREYARSKKTGGASVF  183

Query  195  EGIGRTLKGRDLSRVRNAIWKQTGFE  118
            EG+GRTLKGRDL RVR+A+W QTGF+
Sbjct  184  EGVGRTLKGRDLRRVRDAVWSQTGFD  209



>ref|XP_006389614.1| hypothetical protein POPTR_0021s00640g [Populus trichocarpa]
 gb|ERP48528.1| hypothetical protein POPTR_0021s00640g [Populus trichocarpa]
Length=151

 Score = 73.2 bits (178),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 49/100 (49%), Positives = 63/100 (63%), Gaps = 15/100 (15%)
 Frame = -3

Query  375  VDRPASLPVNIPDWSKILGGEYKdrrresdee-----------eeddgdgddRVPPHVYL  229
            V + +S PVNIPDWSKI G   ++    +D              +D+G  DD VPPH +L
Sbjct  50   VQQQSSAPVNIPDWSKIYGKNSRNMGSWADHNGIAYDDGDYHVNDDEGGDDDIVPPHEWL  109

Query  228  AR----TRVASLSVHEGIGRTLKGRDLSRVRNAIWKQTGF  121
            AR    ++++S SV EGIGRTLKGRDLS+VRNAI  +TGF
Sbjct  110  ARKLARSQISSFSVCEGIGRTLKGRDLSKVRNAILTKTGF  149



>ref|XP_004231609.1| PREDICTED: uncharacterized protein LOC101255844 [Solanum lycopersicum]
Length=215

 Score = 73.9 bits (180),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 41/88 (47%), Positives = 54/88 (61%), Gaps = 7/88 (8%)
 Frame = -3

Query  366  PASLPVNIPDWSKILGGEYKdrrresdeeeeddgdgddRVPPHVYLAR-----TRVASLS  202
             +S PVN+PDWSKI            D ++  D    D +PPH YLAR      +  + S
Sbjct  129  ASSAPVNVPDWSKIY--RVDSVESFHDSDDGADDHELDMIPPHEYLARGYGRSRKSTTDS  186

Query  201  VHEGIGRTLKGRDLSRVRNAIWKQTGFE  118
            + EG+GRTLKGRD+SRVR+A+W QTGF+
Sbjct  187  MFEGVGRTLKGRDMSRVRDAVWSQTGFD  214



>ref|XP_006467441.1| PREDICTED: uncharacterized protein LOC102607295 [Citrus sinensis]
 gb|KDO78216.1| hypothetical protein CISIN_1g028358mg [Citrus sinensis]
Length=210

 Score = 73.9 bits (180),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 41/86 (48%), Positives = 50/86 (58%), Gaps = 10/86 (12%)
 Frame = -3

Query  360  SLPVNIPDWSKILGGEYKdrrresdeeeeddgdgddRVPPHVYLAR-----TRVASLSVH  196
            S PVN+PDWSKI               + DD    + +PPH YLAR      +    SV 
Sbjct  129  SAPVNVPDWSKIY-----RVDSVDSMHDSDDERDMEMIPPHEYLAREYARSKKTGGASVF  183

Query  195  EGIGRTLKGRDLSRVRNAIWKQTGFE  118
            EG+GRTLKGRDL RVR+A+W QTGF+
Sbjct  184  EGVGRTLKGRDLRRVRDAVWSQTGFD  209



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1309270154804