BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c6355_g2_i1 len=534 path=[1436:0-533]

Length=534
                                                                      Score     E

gb|KDO35932.1|  hypothetical protein CISIN_1g048189mg                   233   2e-73   
ref|XP_003589394.1|  Cytochrome P450                                    239   4e-72   
gb|KDO39631.1|  hypothetical protein CISIN_1g035827mg                   236   1e-71   
gb|AES59645.2|  cytochrome P450 family 71 protein                       233   1e-70   
emb|CDP16101.1|  unnamed protein product                                233   1e-70   
ref|XP_006427939.1|  hypothetical protein CICLE_v10027382mg             233   1e-70   
ref|XP_009622691.1|  PREDICTED: cytochrome P450 83B1-like               232   2e-70   
ref|XP_006443324.1|  hypothetical protein CICLE_v10023683mg             231   3e-70   
ref|XP_006445533.1|  hypothetical protein CICLE_v10004104mg             232   5e-70   
ref|XP_002280472.1|  PREDICTED: cytochrome P450 71A1                    231   6e-70   Vitis vinifera
ref|XP_006445535.1|  hypothetical protein CICLE_v10004103mg             231   6e-70   
gb|KDO39891.1|  hypothetical protein CISIN_1g013651mg                   228   5e-69   
ref|XP_006479041.1|  PREDICTED: cytochrome P450 83B1-like               229   7e-69   
ref|XP_002280438.1|  PREDICTED: cytochrome P450 71A1                    227   2e-68   Vitis vinifera
ref|XP_006358825.1|  PREDICTED: cytochrome P450 83B1-like               226   7e-68   
ref|XP_002278300.1|  PREDICTED: cytochrome P450 71A1                    226   7e-68   Vitis vinifera
ref|XP_006443326.1|  hypothetical protein CICLE_v10023966mg             226   9e-68   
emb|CBI19823.3|  unnamed protein product                                232   1e-67   
gb|EYU34271.1|  hypothetical protein MIMGU_mgv1a020847mg                224   1e-67   
ref|XP_006479002.1|  PREDICTED: cytochrome P450 71A1-like               226   1e-67   
ref|XP_006479316.1|  PREDICTED: cytochrome P450 83B1-like               224   3e-67   
ref|XP_006445534.1|  hypothetical protein CICLE_v10004105mg             224   3e-67   
ref|XP_006443319.1|  hypothetical protein CICLE_v10019709mg             225   3e-67   
gb|KDO47250.1|  hypothetical protein CISIN_1g010479mg                   224   4e-67   
gb|KDO38362.1|  hypothetical protein CISIN_1g009872mg                   224   5e-67   
ref|XP_006358765.1|  PREDICTED: cytochrome P450 83B1-like               224   5e-67   
ref|XP_004247903.2|  PREDICTED: cytochrome P450 83B1-like               224   5e-67   
ref|XP_006358767.1|  PREDICTED: cytochrome P450 83B1-like               219   7e-67   
gb|AJD25156.1|  cytochrome P450 CYP71AT92                               223   1e-66   
ref|XP_006443222.1|  hypothetical protein CICLE_v10019775mg             223   1e-66   
ref|XP_002278372.1|  PREDICTED: cytochrome P450 71A1-like               223   1e-66   Vitis vinifera
emb|CDP16102.1|  unnamed protein product                                222   2e-66   
gb|KDO39228.1|  hypothetical protein CISIN_1g038171mg                   222   2e-66   
ref|XP_006443223.1|  hypothetical protein CICLE_v10023326mg             222   3e-66   
gb|KHN19810.1|  Cytochrome P450 83B1                                    219   5e-66   
emb|CDP16103.1|  unnamed protein product                                221   6e-66   
ref|XP_006358823.1|  PREDICTED: cytochrome P450 83B1-like               221   8e-66   
ref|XP_009769778.1|  PREDICTED: cytochrome P450 71A1-like isoform X2    213   9e-66   
ref|XP_006577403.1|  PREDICTED: cytochrome P450 71A1-like               215   1e-65   
ref|XP_006358766.1|  PREDICTED: cytochrome P450 83B1-like               220   1e-65   
ref|XP_004247904.1|  PREDICTED: cytochrome P450 83B1-like               220   1e-65   
ref|XP_011091358.1|  PREDICTED: cytochrome P450 71A1-like               219   2e-65   
ref|XP_006479001.1|  PREDICTED: cytochrome P450 71A1-like               221   2e-65   
gb|AJD25157.1|  cytochrome P450 CYP71AT93                               219   2e-65   
ref|XP_003551894.1|  PREDICTED: cytochrome P450 83B1-like               219   2e-65   
ref|XP_004247900.1|  PREDICTED: cytochrome P450 83B1-like               219   3e-65   
ref|XP_002312665.2|  hypothetical protein POPTR_0008s18870g             218   1e-64   Populus trichocarpa [western balsam poplar]
gb|AIU56747.1|  cytochrome P450 CYP71B41v2                              218   1e-64   
gb|KDP36955.1|  hypothetical protein JCGZ_08246                         215   2e-64   
ref|XP_002312659.2|  hypothetical protein POPTR_0008s18790g             217   3e-64   Populus trichocarpa [western balsam poplar]
gb|ABK94709.1|  unknown                                                 216   5e-64   Populus trichocarpa [western balsam poplar]
ref|XP_011091673.1|  PREDICTED: cytochrome P450 71A1-like               215   6e-64   
ref|XP_009601421.1|  PREDICTED: cytochrome P450 83B1-like               216   6e-64   
ref|XP_006479317.1|  PREDICTED: cytochrome P450 71B23-like              207   7e-64   
emb|CDP18845.1|  unnamed protein product                                215   1e-63   
gb|KHN35607.1|  Cytochrome P450 83B1                                    215   1e-63   
ref|XP_002278387.1|  PREDICTED: cytochrome P450 71A1                    215   1e-63   Vitis vinifera
ref|XP_009591953.1|  PREDICTED: cytochrome P450 83B1-like               209   1e-63   
gb|AIU56749.1|  cytochrome P450 CYP71B63v2                              215   1e-63   
ref|XP_004247901.1|  PREDICTED: cytochrome P450 83B1-like               215   1e-63   
ref|XP_009618532.1|  PREDICTED: cytochrome P450 83B1-like               214   1e-63   
ref|XP_003589391.1|  Cytochrome P450                                    215   2e-63   
ref|XP_009769777.1|  PREDICTED: cytochrome P450 83B1-like isoform X1    214   2e-63   
ref|XP_007010977.1|  Cytochrome P450                                    214   2e-63   
ref|XP_009121542.1|  PREDICTED: cytochrome P450 71B9-like               207   2e-63   
ref|XP_002280459.1|  PREDICTED: cytochrome P450 71A1                    214   3e-63   Vitis vinifera
ref|XP_006358810.1|  PREDICTED: cytochrome P450 83B1-like               214   4e-63   
ref|XP_006435134.1|  hypothetical protein CICLE_v10000924mg             214   4e-63   
ref|XP_006365696.1|  PREDICTED: cytochrome P450 83B1-like               212   4e-63   
emb|CDP16106.1|  unnamed protein product                                213   4e-63   
gb|AIU56748.1|  cytochrome P450 CYP71B40v3                              214   4e-63   
gb|EYU38763.1|  hypothetical protein MIMGU_mgv1a004763mg                214   5e-63   
ref|XP_004490658.1|  PREDICTED: cytochrome P450 83B1-like               213   5e-63   
ref|XP_006358824.1|  PREDICTED: cytochrome P450 83B1-like               213   5e-63   
ref|XP_002312660.2|  hypothetical protein POPTR_0008s18810g             213   5e-63   Populus trichocarpa [western balsam poplar]
ref|XP_006473617.1|  PREDICTED: cytochrome P450 71B35-like isofor...    211   6e-63   
gb|AES59642.2|  cytochrome P450 family 71 protein                       213   6e-63   
ref|XP_004490657.1|  PREDICTED: cytochrome P450 83B1-like               213   6e-63   
ref|XP_006473616.1|  PREDICTED: cytochrome P450 71B35-like isofor...    213   9e-63   
ref|XP_004247905.1|  PREDICTED: cytochrome P450 83B1-like               212   1e-62   
ref|XP_003516815.1|  PREDICTED: cytochrome P450 83B1-like               213   1e-62   
gb|KHN02071.1|  Cytochrome P450 83B1                                    213   1e-62   
ref|XP_006386181.1|  hypothetical protein POPTR_0002s02690g             213   1e-62   
ref|XP_002307703.2|  hypothetical protein POPTR_0005s25740g             212   1e-62   Populus trichocarpa [western balsam poplar]
ref|XP_011045132.1|  PREDICTED: cytochrome P450 83B1-like               212   1e-62   
ref|XP_011074242.1|  PREDICTED: cytochrome P450 71B36-like              212   1e-62   
gb|ABC69410.1|  CYP71AT2v3                                              212   2e-62   Nicotiana tabacum [American tobacco]
ref|XP_004247902.2|  PREDICTED: cytochrome P450 71A1-like               212   2e-62   
ref|XP_004249946.1|  PREDICTED: cytochrome P450 83B1-like               212   2e-62   
gb|ABC69409.1|  CYP71AT2v2                                              212   2e-62   Nicotiana tabacum [American tobacco]
ref|XP_002301993.2|  Cytochrome P450 83A1 family protein                212   2e-62   Populus trichocarpa [western balsam poplar]
ref|XP_006365688.1|  PREDICTED: cytochrome P450 83B1-like               211   2e-62   
ref|XP_007134003.1|  hypothetical protein PHAVU_010G010900g             211   2e-62   
ref|XP_007017736.1|  Cytochrome P450                                    211   2e-62   
ref|XP_002510498.1|  cytochrome P450, putative                          211   2e-62   Ricinus communis
ref|XP_003589393.1|  Cytochrome P450                                    212   3e-62   
ref|XP_006386182.1|  hypothetical protein POPTR_0002s02700g             211   3e-62   
gb|AET50435.1|  putative cytochrome P450                                202   4e-62   
ref|XP_006358769.1|  PREDICTED: cytochrome P450 83B1-like               211   4e-62   
ref|XP_007146429.1|  hypothetical protein PHAVU_006G039800g             211   5e-62   
ref|XP_006358770.1|  PREDICTED: cytochrome P450 83B1-like               211   5e-62   
ref|XP_002535120.1|  cytochrome P450, putative                          204   6e-62   Ricinus communis
ref|XP_007017731.1|  Cytochrome P450                                    210   7e-62   
gb|KEH29139.1|  cytochrome P450 family 71 protein                       206   8e-62   
ref|XP_011034037.1|  PREDICTED: cytochrome P450 71B10-like              210   8e-62   
ref|XP_003615846.1|  Cytochrome P450 71B35                              210   8e-62   
gb|ABC69408.1|  CYP71AT2v1                                              210   9e-62   Nicotiana tabacum [American tobacco]
gb|AES98804.2|  cytochrome P450 family 71 protein                       210   1e-61   
ref|XP_011028970.1|  PREDICTED: cytochrome P450 83B1-like               210   1e-61   
ref|XP_009591952.1|  PREDICTED: cytochrome P450 83B1-like               209   2e-61   
ref|XP_006358768.1|  PREDICTED: cytochrome P450 83B1-like               209   2e-61   
ref|XP_006367342.1|  PREDICTED: cytochrome P450 83B1-like               208   4e-61   
gb|KDP34566.1|  hypothetical protein JCGZ_11116                         208   5e-61   
emb|CDY56372.1|  BnaAnng14250D                                          208   5e-61   
emb|CDY48995.1|  BnaA02g28010D                                          207   5e-61   
ref|XP_007017732.1|  Cytochrome P450, putative                          209   6e-61   
emb|CDX99716.1|  BnaC02g36040D                                          206   6e-61   
ref|XP_010256342.1|  PREDICTED: cytochrome P450 71A1-like               208   7e-61   
gb|ABD97102.1|  cytochrome P450 monooxygenase CYP83G2                   207   8e-61   Medicago truncatula
emb|CDP21727.1|  unnamed protein product                                208   8e-61   
ref|XP_004499226.1|  PREDICTED: cytochrome P450 71B37-like              207   1e-60   
ref|XP_004228400.1|  PREDICTED: cytochrome P450 71A1-like               207   1e-60   
ref|XP_003521971.1|  PREDICTED: cytochrome P450 71A1-like               207   1e-60   
gb|KDP36954.1|  hypothetical protein JCGZ_08245                         207   2e-60   
ref|XP_007044858.1|  Cytochrome P450, family 71, subfamily B, pol...    207   2e-60   
gb|EYU31746.1|  hypothetical protein MIMGU_mgv1a022569mg                207   2e-60   
ref|XP_004247907.1|  PREDICTED: cytochrome P450 83B1-like               206   2e-60   
ref|XP_006367992.1|  PREDICTED: cytochrome P450 83B1-like               206   2e-60   
ref|XP_009802554.1|  PREDICTED: cytochrome P450 83B1-like               206   3e-60   
ref|XP_006358771.1|  PREDICTED: cytochrome P450 83B1-like isoform X1    206   3e-60   
ref|XP_007017733.1|  Cytochrome P450, putative                          204   3e-60   
ref|XP_011028965.1|  PREDICTED: cytochrome P450 83B1-like               206   4e-60   
gb|EYU29507.1|  hypothetical protein MIMGU_mgv1a005223mg                206   4e-60   
ref|XP_011085392.1|  PREDICTED: cytochrome P450 83B1-like               206   4e-60   
emb|CBI19817.3|  unnamed protein product                                202   5e-60   
gb|EYU38764.1|  hypothetical protein MIMGU_mgv1a004668mg                206   5e-60   
ref|XP_007010975.1|  Cytochrome P450, putative                          206   5e-60   
ref|NP_001240228.1|  cytochrome P450 83B1-like precursor                205   5e-60   
ref|XP_010670952.1|  PREDICTED: cytochrome P450 83B1-like               205   7e-60   
ref|XP_011077701.1|  PREDICTED: cytochrome P450 71A1-like               204   1e-59   
ref|XP_002300724.2|  hypothetical protein POPTR_0002s02740g             204   1e-59   Populus trichocarpa [western balsam poplar]
gb|AHI49893.1|  cytochrome P450                                         196   1e-59   
ref|XP_010272816.1|  PREDICTED: cytochrome P450 71A1-like               204   1e-59   
ref|XP_010687582.1|  PREDICTED: cytochrome P450 71D10-like              204   1e-59   
ref|XP_007017735.1|  Cytochrome P450, putative                          205   2e-59   
ref|XP_011091688.1|  PREDICTED: cytochrome P450 71A1-like               204   2e-59   
ref|XP_003522006.2|  PREDICTED: cytochrome P450 83B1-like isoform X1    204   2e-59   
ref|XP_004491826.1|  PREDICTED: cytochrome P450 71A1-like               203   3e-59   
ref|XP_010674264.1|  PREDICTED: cytochrome P450 71A1-like               198   3e-59   
ref|XP_007134823.1|  hypothetical protein PHAVU_010G079100g             203   3e-59   
ref|XP_006438217.1|  hypothetical protein CICLE_v10033591mg             203   5e-59   
ref|XP_002300723.2|  hypothetical protein POPTR_0002s02800g             202   8e-59   Populus trichocarpa [western balsam poplar]
dbj|BAF98468.1|  cytochrome P450                                        202   9e-59   Coptis japonica var. dissecta
gb|AAL24049.1|AF426451_1  cytochrome P450                               202   9e-59   Citrus sinensis [apfelsine]
ref|XP_003521997.1|  PREDICTED: cytochrome P450 83B1-like               202   1e-58   
gb|ACU18750.1|  unknown                                                 202   1e-58   Glycine max [soybeans]
ref|XP_010502533.1|  PREDICTED: cytochrome P450 71B25-like              202   1e-58   
ref|XP_010670964.1|  PREDICTED: cytochrome P450 71B9-like               202   1e-58   
gb|KHN38814.1|  Cytochrome P450 83B1                                    202   1e-58   
ref|XP_006483977.1|  PREDICTED: cytochrome P450 71B35-like              202   1e-58   
ref|XP_010670930.1|  PREDICTED: cytochrome P450 71A1-like               202   1e-58   
ref|XP_002510500.1|  cytochrome P450, putative                          201   2e-58   Ricinus communis
gb|KDO82173.1|  hypothetical protein CISIN_1g010614mg                   201   2e-58   
ref|XP_007134004.1|  hypothetical protein PHAVU_010G011000g             201   2e-58   
ref|XP_010671012.1|  PREDICTED: cytochrome P450 83B1-like               201   2e-58   
ref|XP_006483976.1|  PREDICTED: cytochrome P450 71B37-like              201   2e-58   
ref|XP_006438218.1|  hypothetical protein CICLE_v10031247mg             201   2e-58   
gb|KHG17560.1|  Cytochrome P450 protein                                 201   2e-58   
ref|XP_010514265.1|  PREDICTED: cytochrome P450 71B23-like              201   3e-58   
ref|XP_010670999.1|  PREDICTED: cytochrome P450 83B1-like               201   3e-58   
gb|KDO62263.1|  hypothetical protein CISIN_1g0110962mg                  194   3e-58   
ref|XP_010502547.1|  PREDICTED: cytochrome P450 71B37-like              201   3e-58   
ref|XP_011077693.1|  PREDICTED: cytochrome P450 83B1-like               201   3e-58   
ref|XP_003538072.1|  PREDICTED: cytochrome P450 83B1                    201   4e-58   
ref|XP_010912890.1|  PREDICTED: cytochrome P450 71A9-like               200   4e-58   
gb|KDP34534.1|  hypothetical protein JCGZ_11084                         201   4e-58   
gb|KHN09046.1|  Cytochrome P450 83B1                                    200   4e-58   
ref|XP_010425326.1|  PREDICTED: cytochrome P450 71B25                   200   4e-58   
gb|KFK27280.1|  hypothetical protein AALP_AA8G361500                    200   5e-58   
ref|XP_010450434.1|  PREDICTED: cytochrome P450 71B17-like              197   5e-58   
ref|XP_010670976.1|  PREDICTED: cytochrome P450 83B1-like               200   5e-58   
ref|XP_010270695.1|  PREDICTED: cytochrome P450 71A9-like               200   6e-58   
ref|XP_010911404.1|  PREDICTED: cytochrome P450 71A1-like               200   6e-58   
gb|KEH29148.1|  cytochrome P450 family 71 protein                       200   7e-58   
emb|CDY51225.1|  BnaC09g09800D                                          192   8e-58   
gb|KDP26674.1|  hypothetical protein JCGZ_17832                         199   9e-58   
ref|XP_006290954.1|  hypothetical protein CARUB_v10017070mg             199   9e-58   
ref|XP_004516029.1|  PREDICTED: cytochrome P450 83B1-like               199   1e-57   
ref|XP_010430758.1|  PREDICTED: cytochrome P450 71B3-like               193   1e-57   
ref|XP_004506482.1|  PREDICTED: cytochrome P450 83B1-like               199   1e-57   
ref|XP_010514268.1|  PREDICTED: cytochrome P450 71B25-like              199   1e-57   
ref|XP_010494965.1|  PREDICTED: cytochrome P450 71B28-like              199   1e-57   
ref|XP_006290953.1|  hypothetical protein CARUB_v10017069mg             199   1e-57   
gb|KEH34014.1|  cytochrome P450 family 71 protein                       199   2e-57   
ref|XP_010514290.1|  PREDICTED: cytochrome P450 71B37-like              199   2e-57   
ref|XP_003614173.1|  Cytochrome P450 71B10                              199   2e-57   
ref|XP_010458752.1|  PREDICTED: cytochrome P450 71B28-like              198   2e-57   
emb|CDY13616.1|  BnaA06g33070D                                          199   2e-57   
ref|NP_189264.3|  cytochrome P450 71B37                                 198   2e-57   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010931872.1|  PREDICTED: cytochrome P450 71A9-like               198   2e-57   
emb|CDP16099.1|  unnamed protein product                                199   2e-57   
ref|XP_006395573.1|  hypothetical protein EUTSA_v10005389mg             198   3e-57   
ref|XP_008779115.1|  PREDICTED: cytochrome P450 71A1-like               192   3e-57   
ref|XP_006292275.1|  hypothetical protein CARUB_v10018485mg             198   3e-57   
ref|XP_004309995.1|  PREDICTED: cytochrome P450 71B34-like isoform 3    196   3e-57   
dbj|BAB02193.1|  cytochrome p450                                        198   3e-57   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010425289.1|  PREDICTED: cytochrome P450 71B17-like              198   3e-57   
emb|CDX99721.1|  BnaC02g35990D                                          192   4e-57   
ref|XP_010502525.1|  PREDICTED: cytochrome P450 71B17-like              198   4e-57   
gb|KEH16181.1|  cytochrome P450 family 71 protein                       198   4e-57   
ref|XP_011074244.1|  PREDICTED: cytochrome P450 83B1-like               195   4e-57   
ref|XP_006401223.1|  hypothetical protein EUTSA_v10013314mg             198   4e-57   
ref|XP_002876964.1|  CYP71B37                                           197   4e-57   
ref|XP_011087181.1|  PREDICTED: cytochrome P450 71A9-like               197   5e-57   
ref|XP_010425348.1|  PREDICTED: cytochrome P450 71B37                   197   5e-57   
ref|XP_004309994.1|  PREDICTED: cytochrome P450 71B34-like isoform 2    196   5e-57   
ref|XP_010502530.1|  PREDICTED: cytochrome P450 71B23-like              197   5e-57   
ref|XP_002300725.2|  hypothetical protein POPTR_0002s02730g             198   5e-57   Populus trichocarpa [western balsam poplar]
ref|XP_002876954.1|  CYP71B23                                           197   5e-57   
ref|XP_006432552.1|  hypothetical protein CICLE_v10000886mg             198   5e-57   
ref|NP_189252.1|  cytochrome P450 71B23                                 197   5e-57   Arabidopsis thaliana [mouse-ear cress]
emb|CAN60733.1|  hypothetical protein VITISV_023587                     197   5e-57   Vitis vinifera
ref|XP_008778632.1|  PREDICTED: cytochrome P450 71A1-like               197   5e-57   
gb|KDO50377.1|  hypothetical protein CISIN_1g010151mg                   197   6e-57   
emb|CDX83607.1|  BnaC07g23470D                                          199   7e-57   
emb|CDY40993.1|  BnaA02g27830D                                          194   7e-57   
emb|CDX83603.1|  BnaC07g23430D                                          197   7e-57   
gb|ACJ86287.1|  unknown                                                 192   7e-57   Medicago truncatula
ref|XP_002530056.1|  cytochrome P450, putative                          197   7e-57   Ricinus communis
ref|XP_006395567.1|  hypothetical protein EUTSA_v10004067mg             197   7e-57   
gb|KFK33564.1|  hypothetical protein AALP_AA5G029900                    202   8e-57   
ref|XP_010514269.1|  PREDICTED: cytochrome P450 71B3-like               192   9e-57   
ref|XP_002523238.1|  cytochrome P450, putative                          197   9e-57   Ricinus communis
gb|KFK33574.1|  hypothetical protein AALP_AA5G031500                    195   9e-57   
ref|XP_009152074.1|  PREDICTED: cytochrome P450 71B17-like              197   1e-56   
ref|XP_002285456.1|  PREDICTED: cytochrome P450 71B34-like              196   1e-56   Vitis vinifera
ref|XP_010425328.1|  PREDICTED: cytochrome P450 71B3-like               196   1e-56   
ref|XP_010677521.1|  PREDICTED: cytochrome P450 71A1-like               196   1e-56   
ref|XP_009152184.1|  PREDICTED: cytochrome P450 71B34                   197   1e-56   
ref|XP_002523235.1|  cytochrome P450, putative                          196   2e-56   Ricinus communis
ref|XP_010425292.1|  PREDICTED: cytochrome P450 71B23                   196   2e-56   
ref|XP_010476300.1|  PREDICTED: cytochrome P450 71B28-like              196   2e-56   
gb|KDP36616.1|  hypothetical protein JCGZ_08432                         193   2e-56   
gb|KEH29137.1|  cytochrome P450 family 71 protein                       196   2e-56   
ref|XP_008221936.1|  PREDICTED: cytochrome P450 71B37-like              196   2e-56   
emb|CDY13622.1|  BnaA06g33010D                                          195   2e-56   
ref|XP_010514261.1|  PREDICTED: cytochrome P450 71B17-like              196   2e-56   
emb|CDY13621.1|  BnaA06g33020D                                          196   2e-56   
gb|ABC59084.1|  cytochrome P450 monooxygenase CYP83G1                   196   3e-56   Medicago truncatula
ref|XP_009152069.1|  PREDICTED: cytochrome P450 71B23                   196   3e-56   
ref|XP_006452556.1|  hypothetical protein CICLE_v10008047mg             196   3e-56   
ref|XP_003615837.1|  Cytochrome P450 71B37                              196   3e-56   
ref|XP_008367043.1|  PREDICTED: cytochrome P450 71B26-like              196   3e-56   
ref|XP_009112493.1|  PREDICTED: cytochrome P450 71B2-like               196   3e-56   
ref|XP_010644548.1|  PREDICTED: premnaspirodiene oxygenase-like         196   3e-56   
ref|XP_004309993.1|  PREDICTED: cytochrome P450 71B34-like isoform 1    196   3e-56   
ref|XP_006395572.1|  hypothetical protein EUTSA_v10004070mg             195   3e-56   
gb|EPS69225.1|  hypothetical protein M569_05542                         195   3e-56   
ref|XP_006290945.1|  hypothetical protein CARUB_v10017061mg             195   4e-56   
ref|NP_189258.1|  cytochrome P450 71B25                                 195   4e-56   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010670941.1|  PREDICTED: cytochrome P450 83B1-like               192   4e-56   
ref|NP_189259.1|  cytochrome P450 71B4                                  195   4e-56   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002866197.1|  CYP71B10                                           195   5e-56   
ref|XP_009123565.1|  PREDICTED: cytochrome P450 71B37-like              195   5e-56   
ref|XP_006395575.1|  hypothetical protein EUTSA_v10003650mg             199   5e-56   
gb|KDP34533.1|  hypothetical protein JCGZ_11083                         196   5e-56   
emb|CDY65175.1|  BnaCnng45890D                                          195   5e-56   
emb|CDY13626.1|  BnaA06g32970D                                          195   5e-56   
ref|XP_010064675.1|  PREDICTED: cytochrome P450 71A1-like               195   5e-56   
ref|XP_006291162.1|  hypothetical protein CARUB_v10017280mg             193   5e-56   
ref|XP_011087278.1|  PREDICTED: cytochrome P450 71A9-like               195   6e-56   
ref|XP_007225745.1|  hypothetical protein PRUPE_ppa004343mg             195   6e-56   
ref|XP_006292809.1|  hypothetical protein CARUB_v10019060mg             195   6e-56   
gb|KFK33573.1|  hypothetical protein AALP_AA5G031400                    194   6e-56   
emb|CDX99726.1|  BnaC02g35940D                                          192   7e-56   
ref|XP_006293198.1|  hypothetical protein CARUB_v10019518mg             194   7e-56   
ref|XP_002512136.1|  cytochrome P450, putative                          193   7e-56   Ricinus communis
ref|NP_189254.1|  cytochrome P450 71B24                                 194   7e-56   Arabidopsis thaliana [mouse-ear cress]
gb|KEH29140.1|  cytochrome P450 family 71 protein                       194   7e-56   
ref|XP_009129563.1|  PREDICTED: LOW QUALITY PROTEIN: cytochrome P...    194   8e-56   
ref|XP_010931871.1|  PREDICTED: cytochrome P450 71A9-like               194   8e-56   
ref|XP_010440788.1|  PREDICTED: cytochrome P450 71B17-like              194   9e-56   
ref|XP_009619520.1|  PREDICTED: cytochrome P450 83B1-like               190   9e-56   
gb|KDP42338.1|  hypothetical protein JCGZ_02811                         194   1e-55   
gb|KDO50397.1|  hypothetical protein CISIN_1g020458mg                   190   1e-55   
ref|XP_010910372.1|  PREDICTED: cytochrome P450 71A1-like               194   1e-55   
ref|XP_004135500.1|  PREDICTED: cytochrome P450 71B37-like              194   1e-55   
ref|XP_010272814.1|  PREDICTED: cytochrome P450 71A1-like               194   1e-55   
ref|XP_006292803.1|  hypothetical protein CARUB_v10019054mg             194   1e-55   
emb|CDY66133.1|  BnaCnng49630D                                          194   1e-55   
ref|XP_010425290.1|  PREDICTED: cytochrome P450 71B17-like              194   1e-55   
ref|XP_006386188.1|  hypothetical protein POPTR_0002s02790g             194   1e-55   
emb|CDY40997.1|  BnaA02g27870D                                          192   1e-55   
ref|XP_010100350.1|  Cytochrome P450                                    194   1e-55   
gb|KDO62262.1|  hypothetical protein CISIN_1g0110962mg                  187   1e-55   
ref|XP_003621357.1|  Cytochrome P450 71B37                              194   2e-55   
ref|XP_007022289.1|  Cytochrome P450, family 71, subfamily B, pol...    194   2e-55   
emb|CDX99722.1|  BnaC02g35980D                                          192   2e-55   
gb|KDP39255.1|  hypothetical protein JCGZ_01012                         193   2e-55   
gb|KFK33558.1|  hypothetical protein AALP_AA5G029200                    193   2e-55   
ref|XP_004135495.1|  PREDICTED: cytochrome P450 71B37-like              194   2e-55   
emb|CDY34589.1|  BnaC03g56890D                                          193   2e-55   
gb|KDP36617.1|  hypothetical protein JCGZ_08433                         193   2e-55   
gb|KEH34023.1|  cytochrome P450 family 71 protein                       191   2e-55   
ref|XP_002876956.1|  CYP71B4                                            193   2e-55   
ref|XP_010519644.1|  PREDICTED: cytochrome P450 71B11-like              193   2e-55   
ref|XP_010910121.1|  PREDICTED: cytochrome P450 71A1-like               193   2e-55   
ref|XP_007048751.1|  4-hydroxyphenylacetaldehyde oxime monooxygen...    194   3e-55   
ref|XP_010514262.1|  PREDICTED: cytochrome P450 71B17-like isofor...    193   3e-55   
gb|KFK33565.1|  hypothetical protein AALP_AA5G030000                    193   3e-55   
ref|XP_003593442.1|  Cytochrome P450                                    191   3e-55   
ref|XP_010502526.1|  PREDICTED: cytochrome P450 71B17-like isofor...    193   3e-55   
gb|AAO42072.1|  putative cytochrome p450                                193   3e-55   
ref|NP_200536.3|  cytochrome P450 71B10                                 192   3e-55   
ref|NP_189263.1|  cytochrome P450 71B36                                 192   4e-55   
gb|KHN38812.1|  Cytochrome P450 83B1                                    192   4e-55   
ref|XP_010909221.1|  PREDICTED: cytochrome P450 71A1-like               192   4e-55   
emb|CBI19821.3|  unnamed protein product                                188   4e-55   
emb|CAN83446.1|  hypothetical protein VITISV_019663                     197   4e-55   
ref|XP_009129560.1|  PREDICTED: cytochrome P450 71B23-like              192   5e-55   
gb|AFK47273.1|  unknown                                                 192   5e-55   
ref|XP_006576430.1|  PREDICTED: cytochrome P450 83B1-like               192   5e-55   
ref|XP_010502536.1|  PREDICTED: cytochrome P450 71B3-like               191   6e-55   
ref|XP_007223157.1|  hypothetical protein PRUPE_ppa004390mg             192   6e-55   
emb|CDY21997.1|  BnaC09g01030D                                          192   8e-55   
emb|CDY21085.1|  BnaA08g24400D                                          192   8e-55   
ref|XP_007146604.1|  hypothetical protein PHAVU_006G054100g             192   8e-55   
ref|XP_007160690.1|  hypothetical protein PHAVU_001G008900g             192   9e-55   
dbj|BAA28535.1|  cytochrome P450 monooxygenase                          192   9e-55   
ref|XP_003521973.1|  PREDICTED: cytochrome P450 83B1-like               191   1e-54   
ref|XP_002279272.2|  PREDICTED: 2-methylbutanal oxime monooxygena...    192   1e-54   
emb|CAN80448.1|  hypothetical protein VITISV_039229                     192   1e-54   
gb|AFK34313.1|  unknown                                                 191   1e-54   
ref|XP_008778727.1|  PREDICTED: cytochrome P450 71A1-like               192   1e-54   
ref|XP_008221935.1|  PREDICTED: cytochrome P450 71B36-like              191   1e-54   
ref|XP_003600339.1|  Cytochrome P450                                    191   1e-54   
gb|EYU24240.1|  hypothetical protein MIMGU_mgv1a022835mg                186   1e-54   
ref|NP_974364.1|  cytochrome P450 71B20                                 188   2e-54   
ref|XP_006409146.1|  hypothetical protein EUTSA_v10023132mg             191   2e-54   
ref|XP_006290955.1|  hypothetical protein CARUB_v10017071mg             191   2e-54   
ref|XP_008777462.1|  PREDICTED: cytochrome P450 71A1-like               190   2e-54   
ref|XP_007213422.1|  hypothetical protein PRUPE_ppa025696mg             190   2e-54   
gb|KFK43574.1|  hypothetical protein AALP_AA1G144100                    191   2e-54   
ref|XP_006299708.1|  hypothetical protein CARUB_v10015900mg             191   2e-54   
ref|XP_008809621.1|  PREDICTED: cytochrome P450 71A1-like               191   2e-54   
gb|KEH25844.1|  cytochrome P450 family 71 protein                       191   3e-54   
gb|KHN27239.1|  Cytochrome P450 71D11                                   189   3e-54   
ref|XP_007017738.1|  Cytochrome P450, putative                          189   3e-54   
emb|CDY40998.1|  BnaA02g27880D                                          191   3e-54   
emb|CDP12691.1|  unnamed protein product                                190   3e-54   
ref|XP_009129559.1|  PREDICTED: cytochrome P450 71B3-like               190   3e-54   
ref|XP_009148546.1|  PREDICTED: cytochrome P450 71B7-like               190   3e-54   
ref|XP_009152073.1|  PREDICTED: cytochrome P450 71B19-like              190   3e-54   
gb|KFK33576.1|  hypothetical protein AALP_AA5G031700                    190   4e-54   
gb|KDO62257.1|  hypothetical protein CISIN_1g038414mg                   189   4e-54   
emb|CDX89503.1|  BnaC04g35220D                                          188   4e-54   
ref|XP_006493509.1|  PREDICTED: cytochrome P450 71D11-like              190   5e-54   
ref|XP_006282010.1|  hypothetical protein CARUB_v10028238mg             190   5e-54   
ref|XP_004295869.1|  PREDICTED: cytochrome P450 71D11-like              190   5e-54   
ref|XP_002889988.1|  CYP71B7                                            189   5e-54   
ref|XP_003529194.2|  PREDICTED: cytochrome P450 71D11-like              190   6e-54   
ref|NP_172768.1|  cytochrome P450 71B28                                 189   6e-54   
gb|ABO32529.1|  cytochrome P450-dependent monooxygenase-like protein    189   6e-54   
ref|XP_010519601.1|  PREDICTED: cytochrome P450 71B11-like              189   6e-54   
ref|XP_006417157.1|  hypothetical protein EUTSA_v10007422mg             189   7e-54   
gb|AAM67328.1|  putative cytochrome P450 monooxygenase                  189   7e-54   
ref|XP_007140954.1|  hypothetical protein PHAVU_008G155000g             189   7e-54   
ref|XP_007044859.1|  Cytochrome P450, family 71, subfamily B, pol...    185   8e-54   
ref|XP_010481068.1|  PREDICTED: cytochrome P450 71B28-like              184   8e-54   
ref|XP_009118025.1|  PREDICTED: cytochrome P450 71B7                    189   8e-54   
ref|XP_002515065.1|  cytochrome P450, putative                          181   8e-54   
ref|XP_009152068.1|  PREDICTED: cytochrome P450 71B3-like               189   8e-54   
gb|KDP46807.1|  hypothetical protein JCGZ_24016                         184   8e-54   
emb|CDY19401.1|  BnaC05g09100D                                          189   9e-54   
gb|AFK33605.1|  unknown                                                 181   9e-54   
ref|XP_002876952.1|  CYP71B19                                           189   9e-54   
emb|CDY26619.1|  BnaA09g46580D                                          189   9e-54   
ref|XP_010644547.1|  PREDICTED: premnaspirodiene oxygenase-like         189   1e-53   
gb|KDP39284.1|  hypothetical protein JCGZ_01041                         188   1e-53   
ref|XP_006297910.1|  hypothetical protein CARUB_v10013952mg             186   1e-53   
ref|XP_004295868.1|  PREDICTED: cytochrome P450 71D11-like              189   1e-53   
emb|CDY56376.1|  BnaAnng14280D                                          189   1e-53   
emb|CDY26612.1|  BnaA09g46650D                                          188   1e-53   
ref|XP_010100351.1|  Cytochrome P450                                    189   1e-53   
ref|XP_010650914.1|  PREDICTED: 2-methylbutanal oxime monooxygena...    189   1e-53   
ref|XP_011091687.1|  PREDICTED: cytochrome P450 71A1-like               188   1e-53   
gb|AJD25155.1|  cytochrome P450 CYP71AT91                               189   1e-53   
emb|CAN72169.1|  hypothetical protein VITISV_001525                     189   1e-53   
ref|XP_006474921.1|  PREDICTED: cytochrome P450 71D11-like isofor...    189   1e-53   
emb|CDX98012.1|  BnaA06g07630D                                          188   1e-53   
ref|XP_004171949.1|  PREDICTED: LOW QUALITY PROTEIN: cytochrome P...    188   2e-53   
gb|KDP34572.1|  hypothetical protein JCGZ_11122                         188   2e-53   
ref|XP_009345818.1|  PREDICTED: cytochrome P450 71D9-like               188   2e-53   
emb|CDY16056.1|  BnaC08g40670D                                          188   2e-53   
ref|XP_010500513.1|  PREDICTED: cytochrome P450 71B28-like              188   2e-53   
gb|KEH29143.1|  cytochrome P450 family 71 protein                       180   2e-53   
ref|XP_007146291.1|  hypothetical protein PHAVU_006G028100g             188   2e-53   
gb|KDP36606.1|  hypothetical protein JCGZ_08422                         185   2e-53   
ref|XP_007148448.1|  hypothetical protein PHAVU_006G209700g             188   2e-53   
ref|XP_007148446.1|  hypothetical protein PHAVU_006G209500g             188   2e-53   
ref|XP_010670987.1|  PREDICTED: cytochrome P450 83B1-like               188   2e-53   
ref|XP_007134796.1|  hypothetical protein PHAVU_010G077000g             188   2e-53   
ref|XP_010458749.1|  PREDICTED: cytochrome P450 71B2-like               186   2e-53   
gb|KDP34567.1|  hypothetical protein JCGZ_11117                         186   2e-53   
gb|KDP39016.1|  hypothetical protein JCGZ_00773                         187   2e-53   
ref|XP_006417153.1|  hypothetical protein EUTSA_v10007425mg             188   2e-53   
ref|XP_006421138.1|  hypothetical protein CICLE_v10004785mg             188   2e-53   
ref|XP_007148447.1|  hypothetical protein PHAVU_006G209600g             188   2e-53   
ref|XP_002889987.1|  CYP71B29                                           187   2e-53   
ref|XP_009350171.1|  PREDICTED: cytochrome P450 71A26-like              188   2e-53   
ref|XP_006290957.1|  hypothetical protein CARUB_v10017073mg             187   3e-53   
gb|KFK33560.1|  hypothetical protein AALP_AA5G029400                    187   3e-53   
ref|XP_010483230.1|  PREDICTED: cytochrome P450 71B10-like              187   3e-53   
gb|KEH34013.1|  cytochrome P450 family 71 protein                       187   3e-53   
ref|XP_010929928.1|  PREDICTED: cytochrome P450 71A1-like               187   3e-53   
ref|XP_004135281.1|  PREDICTED: cytochrome P450 71B34-like              188   3e-53   
ref|XP_006359799.1|  PREDICTED: cytochrome P450 71A1-like               187   3e-53   
ref|XP_010461811.1|  PREDICTED: cytochrome P450 71B28-like              187   3e-53   
ref|XP_008464513.1|  PREDICTED: cytochrome P450 71A22-like              187   3e-53   
ref|XP_004138089.1|  PREDICTED: cytochrome P450 71A22-like              187   3e-53   
ref|XP_006358826.1|  PREDICTED: cytochrome P450 71B37-like              179   3e-53   
emb|CDY29236.1|  BnaA06g25210D                                          187   3e-53   
ref|XP_009140378.1|  PREDICTED: cytochrome P450 71B2-like               187   4e-53   
ref|XP_006417154.1|  hypothetical protein EUTSA_v10007439mg             187   4e-53   
ref|XP_004168107.1|  PREDICTED: LOW QUALITY PROTEIN: cytochrome P...    187   4e-53   
ref|XP_009150729.1|  PREDICTED: cytochrome P450 71B7-like               187   4e-53   
gb|KDP29691.1|  hypothetical protein JCGZ_18626                         186   4e-53   
gb|KDP30978.1|  hypothetical protein JCGZ_11354                         187   4e-53   
ref|XP_010494931.1|  PREDICTED: cytochrome P450 71B2-like               187   5e-53   
emb|CDX83611.1|  BnaC07g23510D                                          187   5e-53   
ref|NP_189249.1|  cytochrome P450 71B20                                 187   5e-53   
ref|XP_010514266.1|  PREDICTED: cytochrome P450 71B3-like               187   5e-53   
gb|AAL16177.1|AF428409_1  AT3g26180/MTC11_8                             187   5e-53   
ref|XP_006473076.1|  PREDICTED: cytochrome P450 83B1-like               187   5e-53   
ref|XP_009118031.1|  PREDICTED: cytochrome P450 71B28 isoform X2        187   5e-53   
ref|XP_010556347.1|  PREDICTED: cytochrome P450 71B10-like              187   5e-53   
ref|XP_006841385.1|  hypothetical protein AMTR_s00181p00057690          187   6e-53   
ref|XP_006292481.1|  hypothetical protein CARUB_v10018710mg             187   7e-53   
ref|XP_006452552.1|  hypothetical protein CICLE_v10010406mg             186   7e-53   
dbj|BAB02437.1|  cytochrome P450                                        185   7e-53   
gb|KDP35270.1|  hypothetical protein JCGZ_09429                         186   7e-53   
ref|XP_010502529.1|  PREDICTED: cytochrome P450 71B19                   186   7e-53   
emb|CDY26611.1|  BnaA09g46660D                                          186   7e-53   
ref|XP_002880872.1|  CYP71B7                                            186   8e-53   
ref|XP_010472422.1|  PREDICTED: cytochrome P450 71B6                    186   8e-53   
gb|EYU17608.1|  hypothetical protein MIMGU_mgv1a022583mg                180   8e-53   
ref|XP_010248827.1|  PREDICTED: cytochrome P450 71A1-like               187   8e-53   
ref|XP_006306033.1|  hypothetical protein CARUB_v10011330mg             186   8e-53   
ref|XP_002876950.1|  predicted protein                                  186   8e-53   
emb|CDY13625.1|  BnaA06g32980D                                          186   8e-53   
ref|XP_002513345.1|  cytochrome P450, putative                          186   8e-53   
ref|XP_008340362.1|  PREDICTED: cytochrome P450 71B37-like              187   8e-53   
ref|XP_004152574.1|  PREDICTED: cytochrome P450 71A1-like               186   9e-53   
ref|XP_004135498.1|  PREDICTED: cytochrome P450 71B10-like              186   9e-53   
gb|EYU22204.1|  hypothetical protein MIMGU_mgv1a004806mg                186   1e-52   
ref|XP_010451917.1|  PREDICTED: cytochrome P450 71B10                   186   1e-52   
emb|CDY36484.1|  BnaC03g48430D                                          186   1e-52   
ref|NP_189247.1|  cytochrome P450 71B17                                 186   1e-52   
gb|KDP27300.1|  hypothetical protein JCGZ_20288                         185   1e-52   
ref|XP_009118033.1|  PREDICTED: cytochrome P450 71B2-like               186   1e-52   
gb|KDP27295.1|  hypothetical protein JCGZ_20283                         186   1e-52   
ref|XP_002876961.1|  CYP71B34                                           186   1e-52   
ref|XP_007156881.1|  hypothetical protein PHAVU_002G025000g             186   1e-52   
gb|AFK39905.1|  unknown                                                 186   1e-52   
ref|XP_010102938.1|  Cytochrome P450 71A1                               186   1e-52   
ref|XP_004166781.1|  PREDICTED: LOW QUALITY PROTEIN: cytochrome P...    186   1e-52   
ref|XP_004159702.1|  PREDICTED: LOW QUALITY PROTEIN: cytochrome P...    186   1e-52   
ref|XP_006576431.1|  PREDICTED: cytochrome P450 71B37-like              179   1e-52   
ref|NP_849653.1|  cytochrome P450 71B2                                  183   1e-52   
ref|XP_009121600.1|  PREDICTED: cytochrome P450 71B4-like               186   1e-52   
ref|XP_004981040.1|  PREDICTED: 4-hydroxyphenylacetaldehyde oxime...    186   1e-52   
ref|XP_010696004.1|  PREDICTED: cytochrome P450 71A8-like               182   1e-52   
ref|XP_009110600.1|  PREDICTED: cytochrome P450 71B2-like               186   1e-52   
ref|XP_010429385.1|  PREDICTED: cytochrome P450 71B6-like               186   1e-52   
ref|XP_010528976.1|  PREDICTED: cytochrome P450 71B19-like              185   1e-52   
gb|KCW68417.1|  hypothetical protein EUGRSUZ_F02067                     185   1e-52   
ref|XP_011094079.1|  PREDICTED: cytochrome P450 71A1-like               186   1e-52   
gb|EMT29843.1|  Cytochrome P450 71D8                                    181   2e-52   
ref|XP_010695999.1|  PREDICTED: cytochrome P450 71A1-like               186   2e-52   
ref|XP_010425291.1|  PREDICTED: cytochrome P450 71B19-like              186   2e-52   
ref|XP_004981041.1|  PREDICTED: 4-hydroxyphenylacetaldehyde oxime...    186   2e-52   
ref|XP_004506687.1|  PREDICTED: cytochrome P450 71D11-like              186   2e-52   
ref|XP_009148545.1|  PREDICTED: cytochrome P450 71B7-like               186   2e-52   
ref|XP_010476295.1|  PREDICTED: cytochrome P450 71B2-like               186   2e-52   
gb|KHN43883.1|  Cytochrome P450 71D10                                   185   2e-52   
ref|XP_007153130.1|  hypothetical protein PHAVU_003G009200g             186   2e-52   
ref|XP_004304107.1|  PREDICTED: cytochrome P450 71D11-like              184   2e-52   
ref|XP_004135282.1|  PREDICTED: cytochrome P450 71B37-like              186   2e-52   
ref|XP_010528082.1|  PREDICTED: cytochrome P450 71B20-like              186   2e-52   
ref|XP_009152065.1|  PREDICTED: cytochrome P450 71B26-like              185   2e-52   
emb|CBI39705.3|  unnamed protein product                                191   2e-52   
emb|CDY16055.1|  BnaC08g40680D                                          185   2e-52   
gb|AGC29947.1|  CYP71BE30                                               185   2e-52   
ref|NP_172770.1|  cytochrome P450 71B7                                  185   2e-52   
emb|CDY16063.1|  BnaC08g40600D                                          186   2e-52   
ref|XP_006841384.1|  hypothetical protein AMTR_s00181p00056510          185   2e-52   
ref|XP_002889986.1|  hypothetical protein ARALYDRAFT_471462             187   2e-52   
ref|XP_002876949.1|  CYP71B16                                           185   2e-52   
gb|EYU25650.1|  hypothetical protein MIMGU_mgv1a005161mg                185   2e-52   
ref|XP_010064672.1|  PREDICTED: cytochrome P450 71D11-like              185   2e-52   



>gb|KDO35932.1| hypothetical protein CISIN_1g048189mg, partial [Citrus sinensis]
Length=252

 Score =   233 bits (594),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 108/159 (68%), Positives = 127/159 (80%), Gaps = 0/159 (0%)
 Frame = -1

Query  534  LTWDHIKAVLMNVFVGGTDTSAVVIIWAMTALMKDPRVMNKVQKEIRELIGEKAGKVYED  355
            LT DHIKAVLMNVFV GTDTSA  ++WAMT LMK+PR M KVQ+EIR LIG   G V ED
Sbjct  39   LTLDHIKAVLMNVFVAGTDTSAATVVWAMTYLMKNPRAMKKVQQEIRSLIGGNKGFVNED  98

Query  354  DIKQLPYFRAVIKETLRLYTPIPLLVTREIISKCTIDEYEIKPKMIVVINAWAIARDPEY  175
            D+++L Y +AV+KET+RL   +PLLV RE I KC ID YEI  K +V +NAWAI RDPE 
Sbjct  99   DVQELHYLKAVVKETMRLQPTVPLLVPRETIEKCVIDGYEIPAKTLVFVNAWAIGRDPEA  158

Query  174  WKAPEEFYPERFLDCNIDYKGQNFELIPFGAGRRMCPGM  58
            W+ PEEFYPERF+D  ID+KGQ+FELIPFGAGRR+CPG+
Sbjct  159  WENPEEFYPERFVDSCIDFKGQHFELIPFGAGRRICPGL  197



>ref|XP_003589394.1| Cytochrome P450 [Medicago truncatula]
Length=591

 Score =   239 bits (611),  Expect = 4e-72, Method: Composition-based stats.
 Identities = 106/159 (67%), Positives = 129/159 (81%), Gaps = 1/159 (1%)
 Frame = -1

Query  534  LTWDHIKAVLMNVFVGGTDTSAVVIIWAMTALMKDPRVMNKVQKEIRELIGEKAGKVYED  355
            LT DHIKAVLMN+F+ GTDTS+ +++WAMT LM +PRVMNKVQ EIR L  +K   + ED
Sbjct  300  LTLDHIKAVLMNIFIAGTDTSSAIVVWAMTTLMNNPRVMNKVQMEIRNLYEDKY-FINED  358

Query  354  DIKQLPYFRAVIKETLRLYTPIPLLVTREIISKCTIDEYEIKPKMIVVINAWAIARDPEY  175
            DI++LPY +AV+KET+RL+ P PLLV RE I  C ID YEIKPK +V +NAWAI RDPE 
Sbjct  359  DIEKLPYLKAVVKETMRLFPPSPLLVPRETIENCNIDGYEIKPKTLVYVNAWAIGRDPEN  418

Query  174  WKAPEEFYPERFLDCNIDYKGQNFELIPFGAGRRMCPGM  58
            WK PEEFYPERF+  ++D+KG+NFELIPFG+GRRMCP M
Sbjct  419  WKDPEEFYPERFIMSSVDFKGKNFELIPFGSGRRMCPAM  457



>gb|KDO39631.1| hypothetical protein CISIN_1g035827mg [Citrus sinensis]
Length=507

 Score =   236 bits (602),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 109/159 (69%), Positives = 129/159 (81%), Gaps = 0/159 (0%)
 Frame = -1

Query  534  LTWDHIKAVLMNVFVGGTDTSAVVIIWAMTALMKDPRVMNKVQKEIRELIGEKAGKVYED  355
            LT DHIKAVLMN+FV GTDTSA  ++WAMT LMK PRVM KVQ+EIR L+G K   V ED
Sbjct  291  LTLDHIKAVLMNIFVAGTDTSAATLVWAMTYLMKHPRVMKKVQEEIRSLVGGKKSFVDED  350

Query  354  DIKQLPYFRAVIKETLRLYTPIPLLVTREIISKCTIDEYEIKPKMIVVINAWAIARDPEY  175
            D+++L Y +AV+KET+RL  P+PLLV +E I KCTID YEI  K +V +NAWAI RDPE 
Sbjct  351  DVQELHYHKAVVKETMRLQPPVPLLVPKETIEKCTIDGYEIPAKTLVYVNAWAIGRDPEA  410

Query  174  WKAPEEFYPERFLDCNIDYKGQNFELIPFGAGRRMCPGM  58
            W+ PEEF PERF+D +ID+KGQNFELIPFGAGRR+CPGM
Sbjct  411  WENPEEFNPERFIDRSIDFKGQNFELIPFGAGRRICPGM  449



>gb|AES59645.2| cytochrome P450 family 71 protein [Medicago truncatula]
Length=514

 Score =   233 bits (595),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 106/159 (67%), Positives = 129/159 (81%), Gaps = 1/159 (1%)
 Frame = -1

Query  534  LTWDHIKAVLMNVFVGGTDTSAVVIIWAMTALMKDPRVMNKVQKEIRELIGEKAGKVYED  355
            LT DHIKAVLMN+F+ GTDTS+ +++WAMT LM +PRVMNKVQ EIR L  +K   + ED
Sbjct  300  LTLDHIKAVLMNIFIAGTDTSSAIVVWAMTTLMNNPRVMNKVQMEIRNLYEDKYF-INED  358

Query  354  DIKQLPYFRAVIKETLRLYTPIPLLVTREIISKCTIDEYEIKPKMIVVINAWAIARDPEY  175
            DI++LPY +AV+KET+RL+ P PLLV RE I  C ID YEIKPK +V +NAWAI RDPE 
Sbjct  359  DIEKLPYLKAVVKETMRLFPPSPLLVPRETIENCNIDGYEIKPKTLVYVNAWAIGRDPEN  418

Query  174  WKAPEEFYPERFLDCNIDYKGQNFELIPFGAGRRMCPGM  58
            WK PEEFYPERF+  ++D+KG+NFELIPFG+GRRMCP M
Sbjct  419  WKDPEEFYPERFIMSSVDFKGKNFELIPFGSGRRMCPAM  457



>emb|CDP16101.1| unnamed protein product [Coffea canephora]
Length=496

 Score =   233 bits (594),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 105/158 (66%), Positives = 131/158 (83%), Gaps = 1/158 (1%)
 Frame = -1

Query  534  LTWDHIKAVLMNVFVGGTDTSAVVIIWAMTALMKDPRVMNKVQKEIRELIGEKAGKVYED  355
            L+WDHIKA+LM++F+ GTDT+A  IIWAMTALMK P  + KVQ E+R+L+GEK G+V E+
Sbjct  284  LSWDHIKAILMDIFIAGTDTAAAAIIWAMTALMKSPSALKKVQAEVRKLVGEK-GRVDEE  342

Query  354  DIKQLPYFRAVIKETLRLYTPIPLLVTREIISKCTIDEYEIKPKMIVVINAWAIARDPEY  175
            DI++LPY +AVIKETLRLY P PLL  RE   +CTI+ YEIK K +V INAWAI RDPE 
Sbjct  343  DIQELPYLKAVIKETLRLYPPAPLLGPRETTQECTIEGYEIKYKTLVYINAWAIGRDPEC  402

Query  174  WKAPEEFYPERFLDCNIDYKGQNFELIPFGAGRRMCPG  61
            WK+P++F PERFL+ NID++GQ+FE+IPFGAGRR CPG
Sbjct  403  WKSPDDFIPERFLNSNIDFRGQDFEMIPFGAGRRGCPG  440



>ref|XP_006427939.1| hypothetical protein CICLE_v10027382mg [Citrus clementina]
 ref|XP_006464855.1| PREDICTED: cytochrome P450 71A1-like [Citrus sinensis]
 gb|ESR41179.1| hypothetical protein CICLE_v10027382mg [Citrus clementina]
Length=507

 Score =   233 bits (594),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 108/159 (68%), Positives = 128/159 (81%), Gaps = 0/159 (0%)
 Frame = -1

Query  534  LTWDHIKAVLMNVFVGGTDTSAVVIIWAMTALMKDPRVMNKVQKEIRELIGEKAGKVYED  355
            LT DHIKAVLMN+FV GTDTSA  ++W MT LMK PRVM KVQ+EIR L+G K   V ED
Sbjct  291  LTLDHIKAVLMNIFVAGTDTSAATLVWVMTYLMKHPRVMKKVQEEIRSLVGGKKSFVDED  350

Query  354  DIKQLPYFRAVIKETLRLYTPIPLLVTREIISKCTIDEYEIKPKMIVVINAWAIARDPEY  175
            D+++L Y +AV+KET+RL  P+PLLV +E I KCTID YEI  K +V +NAWAI RDPE 
Sbjct  351  DVQELHYQKAVVKETMRLQPPVPLLVPKETIEKCTIDGYEIPAKTLVYVNAWAIGRDPEA  410

Query  174  WKAPEEFYPERFLDCNIDYKGQNFELIPFGAGRRMCPGM  58
            W+ PEEF PERF+D +ID+KGQNFELIPFGAGRR+CPGM
Sbjct  411  WENPEEFNPERFIDRSIDFKGQNFELIPFGAGRRICPGM  449



>ref|XP_009622691.1| PREDICTED: cytochrome P450 83B1-like, partial [Nicotiana tomentosiformis]
Length=489

 Score =   232 bits (592),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 103/159 (65%), Positives = 128/159 (81%), Gaps = 0/159 (0%)
 Frame = -1

Query  534  LTWDHIKAVLMNVFVGGTDTSAVVIIWAMTALMKDPRVMNKVQKEIRELIGEKAGKVYED  355
            LT D+IKA+LMN+ VGGTDT A  I+W MTAL+K+P+ M +VQ EIRE +G K G V ED
Sbjct  276  LTLDNIKAILMNILVGGTDTGAAAIVWGMTALIKNPKAMKQVQTEIRESVGSKKGMVNED  335

Query  354  DIKQLPYFRAVIKETLRLYTPIPLLVTREIISKCTIDEYEIKPKMIVVINAWAIARDPEY  175
            DI+ LPY +AVIKET RLY P+PLLV RE + K  ++ YEI+PK I+ +N+WAIARDPEY
Sbjct  336  DIQNLPYLKAVIKETFRLYPPVPLLVPRETMHKSILEGYEIQPKTIIHVNSWAIARDPEY  395

Query  174  WKAPEEFYPERFLDCNIDYKGQNFELIPFGAGRRMCPGM  58
            W+ PEEF PERF + NID+KGQ+FEL+PFGAGRR CPG+
Sbjct  396  WENPEEFIPERFFNSNIDFKGQDFELLPFGAGRRGCPGI  434



>ref|XP_006443324.1| hypothetical protein CICLE_v10023683mg [Citrus clementina]
 gb|ESR56564.1| hypothetical protein CICLE_v10023683mg [Citrus clementina]
Length=468

 Score =   231 bits (590),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 107/159 (67%), Positives = 126/159 (79%), Gaps = 0/159 (0%)
 Frame = -1

Query  534  LTWDHIKAVLMNVFVGGTDTSAVVIIWAMTALMKDPRVMNKVQKEIRELIGEKAGKVYED  355
            LT DHIKAVLMNV V GTDTSA  ++WAMT LMK+PR M KVQ+EIR LIG   G V ED
Sbjct  252  LTLDHIKAVLMNVLVAGTDTSAATVVWAMTYLMKNPRAMKKVQQEIRLLIGANKGFVNED  311

Query  354  DIKQLPYFRAVIKETLRLYTPIPLLVTREIISKCTIDEYEIKPKMIVVINAWAIARDPEY  175
            D+++L Y +AV+KET+RL   +PLLV RE I KC ID YEI  K +V +NAWAI RDPE 
Sbjct  312  DVQELHYLKAVVKETMRLQPTVPLLVPRETIEKCVIDGYEIPAKTLVFVNAWAIGRDPEA  371

Query  174  WKAPEEFYPERFLDCNIDYKGQNFELIPFGAGRRMCPGM  58
            W+ PEEFYPERF+D  ID+KGQ+FELIPFGAGRR+CPG+
Sbjct  372  WENPEEFYPERFVDSIIDFKGQHFELIPFGAGRRICPGL  410



>ref|XP_006445533.1| hypothetical protein CICLE_v10004104mg [Citrus clementina]
 gb|ESR58773.1| hypothetical protein CICLE_v10004104mg [Citrus clementina]
Length=507

 Score =   232 bits (591),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 107/159 (67%), Positives = 126/159 (79%), Gaps = 0/159 (0%)
 Frame = -1

Query  534  LTWDHIKAVLMNVFVGGTDTSAVVIIWAMTALMKDPRVMNKVQKEIRELIGEKAGKVYED  355
            LT DHIKAVLMNVFV GTDT A  ++WAMT LMK+PR M KVQ+EIR LIG   G V ED
Sbjct  294  LTLDHIKAVLMNVFVAGTDTRAATVVWAMTYLMKNPRAMKKVQQEIRSLIGGNKGFVNED  353

Query  354  DIKQLPYFRAVIKETLRLYTPIPLLVTREIISKCTIDEYEIKPKMIVVINAWAIARDPEY  175
            D+++L Y +AV+KET+RL   +PLLV RE I KC ID YEI  K +V +NAWAI RDPE 
Sbjct  354  DVQELHYLKAVVKETMRLQPTVPLLVPRETIEKCVIDGYEIPAKTLVFVNAWAIGRDPEA  413

Query  174  WKAPEEFYPERFLDCNIDYKGQNFELIPFGAGRRMCPGM  58
            W+ PEEFYPERF+D  ID+KGQ+FELIPFGAGRR+CPG+
Sbjct  414  WENPEEFYPERFVDSFIDFKGQHFELIPFGAGRRICPGL  452



>ref|XP_002280472.1| PREDICTED: cytochrome P450 71A1 [Vitis vinifera]
 emb|CAN64422.1| hypothetical protein VITISV_032274 [Vitis vinifera]
Length=498

 Score =   231 bits (590),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 101/159 (64%), Positives = 130/159 (82%), Gaps = 1/159 (1%)
 Frame = -1

Query  534  LTWDHIKAVLMNVFVGGTDTSAVVIIWAMTALMKDPRVMNKVQKEIRELIGEKAGKVYED  355
            +TWDHIK VLMN+FVGGTDT A  +IWAMTALMK+PRVM K Q+E+R   G+K G + ED
Sbjct  286  ITWDHIKGVLMNIFVGGTDTGAATVIWAMTALMKNPRVMKKAQEEVRNTFGKK-GFIGED  344

Query  354  DIKQLPYFRAVIKETLRLYTPIPLLVTREIISKCTIDEYEIKPKMIVVINAWAIARDPEY  175
            D+++LPY +AV+KET+RL   +PLL+ RE + KC+ID YEI PK +V +NAWAI RDPE 
Sbjct  345  DVEKLPYLKAVVKETMRLLPAVPLLIPRETLQKCSIDGYEIPPKTLVFVNAWAIGRDPEA  404

Query  174  WKAPEEFYPERFLDCNIDYKGQNFELIPFGAGRRMCPGM  58
            W+ PEEF PERFL  ++D++GQN++LIPFGAGRR+CPG+
Sbjct  405  WENPEEFIPERFLGSSVDFRGQNYKLIPFGAGRRVCPGI  443



>ref|XP_006445535.1| hypothetical protein CICLE_v10004103mg [Citrus clementina]
 gb|ESR58775.1| hypothetical protein CICLE_v10004103mg [Citrus clementina]
Length=507

 Score =   231 bits (590),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 106/159 (67%), Positives = 126/159 (79%), Gaps = 0/159 (0%)
 Frame = -1

Query  534  LTWDHIKAVLMNVFVGGTDTSAVVIIWAMTALMKDPRVMNKVQKEIRELIGEKAGKVYED  355
            LT DHIKAVLMNVFV GTDT A  ++WAMT LMK+PR M KVQ+EIR LIG   G V ED
Sbjct  294  LTLDHIKAVLMNVFVAGTDTRAATVVWAMTYLMKNPRAMKKVQQEIRSLIGGNKGFVNED  353

Query  354  DIKQLPYFRAVIKETLRLYTPIPLLVTREIISKCTIDEYEIKPKMIVVINAWAIARDPEY  175
            D+++L Y +AV+KET+RL   +PLL+ RE I KC ID YEI  K +V +NAWAI RDPE 
Sbjct  354  DVQELHYLKAVVKETMRLQPTVPLLIPRETIQKCVIDGYEIPAKTLVFVNAWAIGRDPEA  413

Query  174  WKAPEEFYPERFLDCNIDYKGQNFELIPFGAGRRMCPGM  58
            W+ PEEFYPERF+D  ID+KGQ+FELIPFGAGRR+CPG+
Sbjct  414  WENPEEFYPERFVDSCIDFKGQHFELIPFGAGRRICPGL  452



>gb|KDO39891.1| hypothetical protein CISIN_1g013651mg [Citrus sinensis]
Length=439

 Score =   228 bits (580),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 105/159 (66%), Positives = 123/159 (77%), Gaps = 0/159 (0%)
 Frame = -1

Query  534  LTWDHIKAVLMNVFVGGTDTSAVVIIWAMTALMKDPRVMNKVQKEIRELIGEKAGKVYED  355
            LT DHIKAVLMNVFV G DTSA  ++WAMT LMK+PR M KVQ EIR LIG   G V ED
Sbjct  222  LTLDHIKAVLMNVFVAGADTSAATVVWAMTYLMKNPRAMKKVQLEIRSLIGGNKGFVNED  281

Query  354  DIKQLPYFRAVIKETLRLYTPIPLLVTREIISKCTIDEYEIKPKMIVVINAWAIARDPEY  175
            D+++L Y +AV+KET+RL   +PLL+ RE I KC ID Y I  K  V +NAWAI RDPE 
Sbjct  282  DVQELHYLKAVVKETMRLQPTVPLLIPRETIQKCVIDGYAIPAKTRVFVNAWAIGRDPEA  341

Query  174  WKAPEEFYPERFLDCNIDYKGQNFELIPFGAGRRMCPGM  58
            W+ PEEFYPERF+D  ID+KGQ+FELIPFGAGRR+CPG+
Sbjct  342  WENPEEFYPERFIDSCIDFKGQHFELIPFGAGRRICPGL  380



>ref|XP_006479041.1| PREDICTED: cytochrome P450 83B1-like [Citrus sinensis]
Length=507

 Score =   229 bits (583),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 106/159 (67%), Positives = 125/159 (79%), Gaps = 0/159 (0%)
 Frame = -1

Query  534  LTWDHIKAVLMNVFVGGTDTSAVVIIWAMTALMKDPRVMNKVQKEIRELIGEKAGKVYED  355
            LT DHIKAVLMNV V GTDTSA  ++WAMT LMK+PR M KVQ EIR LIG   G V ED
Sbjct  294  LTLDHIKAVLMNVLVAGTDTSAATVVWAMTYLMKNPRAMKKVQLEIRSLIGCNKGFVNED  353

Query  354  DIKQLPYFRAVIKETLRLYTPIPLLVTREIISKCTIDEYEIKPKMIVVINAWAIARDPEY  175
            D+++L Y +AV+KET+RL   +PLL+ RE I KC ID YEI  K +V +NAWAI RDPE 
Sbjct  354  DVQELHYLKAVVKETMRLQPTVPLLIPRETIQKCVIDGYEIPAKTLVFVNAWAIGRDPEA  413

Query  174  WKAPEEFYPERFLDCNIDYKGQNFELIPFGAGRRMCPGM  58
            W+ PEEFYPERF+D  ID+KGQ+FELIPFGAGRR+CPG+
Sbjct  414  WENPEEFYPERFVDSCIDFKGQHFELIPFGAGRRICPGL  452



>ref|XP_002280438.1| PREDICTED: cytochrome P450 71A1 [Vitis vinifera]
Length=496

 Score =   227 bits (579),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 98/159 (62%), Positives = 129/159 (81%), Gaps = 1/159 (1%)
 Frame = -1

Query  534  LTWDHIKAVLMNVFVGGTDTSAVVIIWAMTALMKDPRVMNKVQKEIRELIGEKAGKVYED  355
            +TWDHIK VLMN+F+GGTDT A  + WAMTALMK+PRVM K Q+E+R   G+K G + ED
Sbjct  284  ITWDHIKGVLMNIFLGGTDTGAATVTWAMTALMKNPRVMKKAQEEVRNTFGKK-GFIGED  342

Query  354  DIKQLPYFRAVIKETLRLYTPIPLLVTREIISKCTIDEYEIKPKMIVVINAWAIARDPEY  175
            D+++LPY +AV+KET+RL   +PLLV RE + KC++D YEI PK +V +NAWAI RDPE 
Sbjct  343  DVEKLPYLKAVVKETMRLLPSVPLLVPRETLQKCSLDGYEIPPKTLVFVNAWAIGRDPEA  402

Query  174  WKAPEEFYPERFLDCNIDYKGQNFELIPFGAGRRMCPGM  58
            W+ PEEF PERFL  ++D++GQ+++LIPFGAGRR+CPG+
Sbjct  403  WENPEEFMPERFLGSSVDFRGQHYKLIPFGAGRRVCPGL  441



>ref|XP_006358825.1| PREDICTED: cytochrome P450 83B1-like [Solanum tuberosum]
Length=518

 Score =   226 bits (577),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 103/159 (65%), Positives = 132/159 (83%), Gaps = 1/159 (1%)
 Frame = -1

Query  534  LTWDHIKAVLMNVFVGGTDTSAVVIIWAMTALMKDPRVMNKVQKEIRELIGEKAGKVYED  355
            LT D+IKA+LMN+FVGGTDTSA  ++WAMTAL+K+P+VM KVQ+EIR+ IG K G V ED
Sbjct  283  LTLDNIKAILMNIFVGGTDTSAATVVWAMTALIKNPKVMKKVQEEIRKSIGTK-GFVNED  341

Query  354  DIKQLPYFRAVIKETLRLYTPIPLLVTREIISKCTIDEYEIKPKMIVVINAWAIARDPEY  175
            D++ +PY +AVIKET RLY P PLLV RE + K T++ YEI+P  I+ +N+WAIARDPE 
Sbjct  342  DVQNMPYLKAVIKETFRLYPPAPLLVPRETMKKSTLEGYEIQPGTIIHVNSWAIARDPEI  401

Query  174  WKAPEEFYPERFLDCNIDYKGQNFELIPFGAGRRMCPGM  58
            W+ P+EF PERFL+ +ID+KGQ+FEL+PFGAGRR CPG+
Sbjct  402  WENPKEFMPERFLNSDIDFKGQDFELLPFGAGRRGCPGI  440



>ref|XP_002278300.1| PREDICTED: cytochrome P450 71A1 [Vitis vinifera]
Length=495

 Score =   226 bits (575),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 101/159 (64%), Positives = 129/159 (81%), Gaps = 1/159 (1%)
 Frame = -1

Query  534  LTWDHIKAVLMNVFVGGTDTSAVVIIWAMTALMKDPRVMNKVQKEIRELIGEKAGKVYED  355
            LT+DHIKAVLMN+F+ GTDTSA  ++WAMT LMK+PR M K Q+E+R LIG+K G V ED
Sbjct  282  LTFDHIKAVLMNIFLAGTDTSAATLVWAMTMLMKNPRTMTKAQEELRNLIGKK-GFVDED  340

Query  354  DIKQLPYFRAVIKETLRLYTPIPLLVTREIISKCTIDEYEIKPKMIVVINAWAIARDPEY  175
            D+++LPY +A++KET+RL+   PLLV RE + KC ID YEI PK +V +NAWAI RDPE 
Sbjct  341  DLQKLPYLKAIVKETMRLHPASPLLVPRETLEKCVIDGYEIPPKTLVYVNAWAIGRDPES  400

Query  174  WKAPEEFYPERFLDCNIDYKGQNFELIPFGAGRRMCPGM  58
            W+ PEEF PERFL  +ID+KGQ+++LIPFG GRR+CPG+
Sbjct  401  WENPEEFMPERFLGTSIDFKGQDYQLIPFGGGRRICPGL  439



>ref|XP_006443326.1| hypothetical protein CICLE_v10023966mg [Citrus clementina]
 gb|ESR56566.1| hypothetical protein CICLE_v10023966mg [Citrus clementina]
Length=490

 Score =   226 bits (575),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 104/159 (65%), Positives = 123/159 (77%), Gaps = 0/159 (0%)
 Frame = -1

Query  534  LTWDHIKAVLMNVFVGGTDTSAVVIIWAMTALMKDPRVMNKVQKEIRELIGEKAGKVYED  355
            LT DHIKAVLMNVFV GTDTSA  ++WAMT LMK+PR M K Q EIR LIG   G V ED
Sbjct  273  LTLDHIKAVLMNVFVAGTDTSAATVVWAMTYLMKNPRAMKKAQLEIRSLIGGNKGFVNED  332

Query  354  DIKQLPYFRAVIKETLRLYTPIPLLVTREIISKCTIDEYEIKPKMIVVINAWAIARDPEY  175
            D+++L Y +A++KET+RL    PLL+ RE I KC I+ YEI  K +V +NAWAI RDPE 
Sbjct  333  DVQELHYLKAIVKETMRLQPTGPLLIPRESIQKCVIEGYEIPAKTLVFVNAWAIGRDPEV  392

Query  174  WKAPEEFYPERFLDCNIDYKGQNFELIPFGAGRRMCPGM  58
            W+ PEEFYPERF D +ID KGQ+FELIPFGAGRR+CPG+
Sbjct  393  WENPEEFYPERFADSSIDLKGQHFELIPFGAGRRICPGL  431



>emb|CBI19823.3| unnamed protein product [Vitis vinifera]
Length=912

 Score =   232 bits (592),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 101/159 (64%), Positives = 130/159 (82%), Gaps = 1/159 (1%)
 Frame = -1

Query  534  LTWDHIKAVLMNVFVGGTDTSAVVIIWAMTALMKDPRVMNKVQKEIRELIGEKAGKVYED  355
            +TWDHIK VLMN+FVGGTDT A  +IWAMTALMK+PRVM K Q+E+R   G+K G + ED
Sbjct  700  ITWDHIKGVLMNIFVGGTDTGAATVIWAMTALMKNPRVMKKAQEEVRNTFGKK-GFIGED  758

Query  354  DIKQLPYFRAVIKETLRLYTPIPLLVTREIISKCTIDEYEIKPKMIVVINAWAIARDPEY  175
            D+++LPY +AV+KET+RL   +PLL+ RE + KC+ID YEI PK +V +NAWAI RDPE 
Sbjct  759  DVEKLPYLKAVVKETMRLLPAVPLLIPRETLQKCSIDGYEIPPKTLVFVNAWAIGRDPEA  818

Query  174  WKAPEEFYPERFLDCNIDYKGQNFELIPFGAGRRMCPGM  58
            W+ PEEF PERFL  ++D++GQN++LIPFGAGRR+CPG+
Sbjct  819  WENPEEFIPERFLGSSVDFRGQNYKLIPFGAGRRVCPGI  857


 Score =   129 bits (324),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 63/108 (58%), Positives = 82/108 (76%), Gaps = 1/108 (1%)
 Frame = -1

Query  534  LTWDHIKAVLMNVFVGGTDTSAVVIIWAMTALMKDPRVMNKVQKEIRELIGEKAGKVYED  355
            +TWDHIK VLMN+FVGGTD     +IWAMTALMK+PRVM K Q+E+R   G+K G + ED
Sbjct  286  ITWDHIKGVLMNIFVGGTDAGTATVIWAMTALMKNPRVMKKAQEEVRNTFGKK-GFIGED  344

Query  354  DIKQLPYFRAVIKETLRLYTPIPLLVTREIISKCTIDEYEIKPKMIVV  211
            D+++LPY +AV+KET+RL    PLL+ RE + KC+ID YEI PK + +
Sbjct  345  DVEKLPYLKAVVKETMRLLPAAPLLLPRETLQKCSIDGYEIPPKTLTM  392



>gb|EYU34271.1| hypothetical protein MIMGU_mgv1a020847mg [Erythranthe guttata]
Length=446

 Score =   224 bits (571),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 102/159 (64%), Positives = 127/159 (80%), Gaps = 1/159 (1%)
 Frame = -1

Query  534  LTWDHIKAVLMNVFVGGTDTSAVVIIWAMTALMKDPRVMNKVQKEIRELIGEKAGKVYED  355
            L WDHIKA+LMN+F+  TDTSA   +W MTALMK PRVM KVQ EIR  I +K GKV E+
Sbjct  233  LNWDHIKALLMNIFIAATDTSAASTVWTMTALMKAPRVMEKVQAEIRNSIAKK-GKVDEN  291

Query  354  DIKQLPYFRAVIKETLRLYTPIPLLVTREIISKCTIDEYEIKPKMIVVINAWAIARDPEY  175
            D+ +LPY +AVI ETLRLY P PLLV R+ I KCT++ Y I+P+ +V +NAWAIARDP+Y
Sbjct  292  DLPKLPYLKAVISETLRLYPPAPLLVPRQTIEKCTLEGYVIEPRTLVYVNAWAIARDPDY  351

Query  174  WKAPEEFYPERFLDCNIDYKGQNFELIPFGAGRRMCPGM  58
            W+ P+EF PERFL+ NID KGQ++ +IPFG+GRR+CPGM
Sbjct  352  WENPDEFLPERFLNSNIDIKGQDYGVIPFGSGRRICPGM  390



>ref|XP_006479002.1| PREDICTED: cytochrome P450 71A1-like [Citrus sinensis]
Length=509

 Score =   226 bits (575),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 102/159 (64%), Positives = 123/159 (77%), Gaps = 0/159 (0%)
 Frame = -1

Query  534  LTWDHIKAVLMNVFVGGTDTSAVVIIWAMTALMKDPRVMNKVQKEIRELIGEKAGKVYED  355
            LT DHIKAVLMN+FV GTDTSA  ++W MT LMK PRVM KVQ+EIR L+G     V ED
Sbjct  293  LTLDHIKAVLMNIFVAGTDTSAATLVWTMTYLMKHPRVMKKVQEEIRSLVGGNKSFVDED  352

Query  354  DIKQLPYFRAVIKETLRLYTPIPLLVTREIISKCTIDEYEIKPKMIVVINAWAIARDPEY  175
            D+++L Y +AV+KE +RL  P+PLLV RE   KC +D YEI  K IV +NAWAI RDPE 
Sbjct  353  DVQELHYLKAVVKEAMRLQPPVPLLVPRETTEKCIVDGYEIPAKTIVYVNAWAIGRDPEA  412

Query  174  WKAPEEFYPERFLDCNIDYKGQNFELIPFGAGRRMCPGM  58
            W+ PEEF PERF+D ++D+KG+NFE IPFGAGRR+CPGM
Sbjct  413  WENPEEFNPERFIDRSVDFKGKNFEFIPFGAGRRICPGM  451



>ref|XP_006479316.1| PREDICTED: cytochrome P450 83B1-like [Citrus sinensis]
Length=506

 Score =   224 bits (572),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 104/159 (65%), Positives = 124/159 (78%), Gaps = 0/159 (0%)
 Frame = -1

Query  534  LTWDHIKAVLMNVFVGGTDTSAVVIIWAMTALMKDPRVMNKVQKEIRELIGEKAGKVYED  355
            LT D+IKAVLMNVFV GTDTSA  ++WAMT L K+PR M KVQ EIR LIG   G V ED
Sbjct  294  LTLDNIKAVLMNVFVAGTDTSAATVVWAMTYLTKNPRAMKKVQLEIRSLIGGNKGFVNED  353

Query  354  DIKQLPYFRAVIKETLRLYTPIPLLVTREIISKCTIDEYEIKPKMIVVINAWAIARDPEY  175
            D+++L Y +AV+KET+RL   +PLL+ RE I KC ++ YEI  K  V +NAWAI RDPE 
Sbjct  354  DVQELHYLKAVVKETMRLQPTVPLLLPREAIQKCIVEGYEIPAKTRVFVNAWAIGRDPEA  413

Query  174  WKAPEEFYPERFLDCNIDYKGQNFELIPFGAGRRMCPGM  58
            W+ PEEFYPERF+D  ID+KGQNFELIPFGAGRR+CPG+
Sbjct  414  WQNPEEFYPERFVDSCIDFKGQNFELIPFGAGRRICPGL  452



>ref|XP_006445534.1| hypothetical protein CICLE_v10004105mg [Citrus clementina]
 gb|ESR58774.1| hypothetical protein CICLE_v10004105mg [Citrus clementina]
Length=506

 Score =   224 bits (572),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 104/159 (65%), Positives = 124/159 (78%), Gaps = 0/159 (0%)
 Frame = -1

Query  534  LTWDHIKAVLMNVFVGGTDTSAVVIIWAMTALMKDPRVMNKVQKEIRELIGEKAGKVYED  355
            LT D+IKAVLMNVFV GTDTSA  ++WAMT L K+PR M KVQ EIR LIG   G V ED
Sbjct  294  LTLDNIKAVLMNVFVAGTDTSAATVVWAMTYLTKNPRAMKKVQLEIRSLIGGNKGFVNED  353

Query  354  DIKQLPYFRAVIKETLRLYTPIPLLVTREIISKCTIDEYEIKPKMIVVINAWAIARDPEY  175
            D+++L Y +AV+KET+RL   +PLL+ RE I KC ++ YEI  K  V +NAWAI RDPE 
Sbjct  354  DVQELHYLKAVVKETMRLQPTVPLLLPREAIQKCIVEGYEIPAKTRVFVNAWAIGRDPEA  413

Query  174  WKAPEEFYPERFLDCNIDYKGQNFELIPFGAGRRMCPGM  58
            W+ PEEFYPERF+D  ID+KGQNFELIPFGAGRR+CPG+
Sbjct  414  WQNPEEFYPERFVDSCIDFKGQNFELIPFGAGRRICPGL  452



>ref|XP_006443319.1| hypothetical protein CICLE_v10019709mg [Citrus clementina]
 gb|ESR56559.1| hypothetical protein CICLE_v10019709mg [Citrus clementina]
Length=525

 Score =   225 bits (573),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 104/159 (65%), Positives = 124/159 (78%), Gaps = 0/159 (0%)
 Frame = -1

Query  534  LTWDHIKAVLMNVFVGGTDTSAVVIIWAMTALMKDPRVMNKVQKEIRELIGEKAGKVYED  355
            LT D+IKAVLMNVFV GTDTSA  ++WAMT L K+PR M KVQ EIR LIG   G V ED
Sbjct  311  LTLDNIKAVLMNVFVAGTDTSAATVVWAMTYLTKNPRAMKKVQLEIRSLIGGNKGFVNED  370

Query  354  DIKQLPYFRAVIKETLRLYTPIPLLVTREIISKCTIDEYEIKPKMIVVINAWAIARDPEY  175
            D+++L Y +AV+KET+RL   +PLL+ RE I KC ++ YEI  K  V +NAWAI RDPE 
Sbjct  371  DVQELHYLKAVVKETMRLQPTVPLLLPREAIQKCIVEGYEIPAKTRVFVNAWAIGRDPEA  430

Query  174  WKAPEEFYPERFLDCNIDYKGQNFELIPFGAGRRMCPGM  58
            W+ PEEFYPERF+D  ID+KGQNFELIPFGAGRR+CPG+
Sbjct  431  WQNPEEFYPERFVDSCIDFKGQNFELIPFGAGRRICPGL  469



>gb|KDO47250.1| hypothetical protein CISIN_1g010479mg [Citrus sinensis]
Length=509

 Score =   224 bits (571),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 103/159 (65%), Positives = 123/159 (77%), Gaps = 0/159 (0%)
 Frame = -1

Query  534  LTWDHIKAVLMNVFVGGTDTSAVVIIWAMTALMKDPRVMNKVQKEIRELIGEKAGKVYED  355
            LT DHIKAVLM++FV GTDTSA  ++W MT LMK PRVM KVQ+EIR L+G     V ED
Sbjct  293  LTLDHIKAVLMDIFVAGTDTSAATMVWTMTYLMKYPRVMKKVQEEIRSLVGGNKSFVDED  352

Query  354  DIKQLPYFRAVIKETLRLYTPIPLLVTREIISKCTIDEYEIKPKMIVVINAWAIARDPEY  175
            D+++L Y +AV+KE +RL  P+PLLV RE   KC +D YEI  K IV +NAWAI RDPE 
Sbjct  353  DVQELHYLKAVVKEAMRLQPPVPLLVPRETTEKCIVDGYEIPAKTIVYVNAWAIGRDPEA  412

Query  174  WKAPEEFYPERFLDCNIDYKGQNFELIPFGAGRRMCPGM  58
            W+ PEEF PERF+D +ID+KGQNFE IPFGAGRR+CPGM
Sbjct  413  WENPEEFNPERFIDRSIDFKGQNFEFIPFGAGRRICPGM  451



>gb|KDO38362.1| hypothetical protein CISIN_1g009872mg [Citrus sinensis]
Length=523

 Score =   224 bits (572),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 104/159 (65%), Positives = 124/159 (78%), Gaps = 0/159 (0%)
 Frame = -1

Query  534  LTWDHIKAVLMNVFVGGTDTSAVVIIWAMTALMKDPRVMNKVQKEIRELIGEKAGKVYED  355
            LT D+IKAVLMNVFV GTDTSA  ++WAMT L K+PR M KVQ EIR LIG   G V ED
Sbjct  311  LTLDNIKAVLMNVFVAGTDTSAATVVWAMTYLTKNPRAMKKVQLEIRSLIGGNKGFVNED  370

Query  354  DIKQLPYFRAVIKETLRLYTPIPLLVTREIISKCTIDEYEIKPKMIVVINAWAIARDPEY  175
            D+++L Y +AV+KET+RL   +PLL+ RE I KC ++ YEI  K  V +NAWAI RDPE 
Sbjct  371  DVQELHYLKAVVKETMRLQPTVPLLLPREAIQKCIVEGYEIPAKTRVFVNAWAIGRDPEA  430

Query  174  WKAPEEFYPERFLDCNIDYKGQNFELIPFGAGRRMCPGM  58
            W+ PEEFYPERF+D  ID+KGQNFELIPFGAGRR+CPG+
Sbjct  431  WQNPEEFYPERFVDSCIDFKGQNFELIPFGAGRRICPGL  469



>ref|XP_006358765.1| PREDICTED: cytochrome P450 83B1-like [Solanum tuberosum]
Length=497

 Score =   224 bits (570),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 105/159 (66%), Positives = 128/159 (81%), Gaps = 1/159 (1%)
 Frame = -1

Query  534  LTWDHIKAVLMNVFVGGTDTSAVVIIWAMTALMKDPRVMNKVQKEIRELIGEKAGKVYED  355
            LT D+IKA++MN+ VGGT+TSA  IIWAMTAL+ +P  M KVQ EIRE +G+K+  V ED
Sbjct  285  LTLDNIKAIIMNMLVGGTNTSAATIIWAMTALIANPNAMKKVQAEIRESVGKKS-MVNED  343

Query  354  DIKQLPYFRAVIKETLRLYTPIPLLVTREIISKCTIDEYEIKPKMIVVINAWAIARDPEY  175
            D++ LPYF+AVIKETLRLY P PLLV RE +    ++ YEIKPK I+ +NAWAIARDPE 
Sbjct  344  DVQTLPYFKAVIKETLRLYPPAPLLVPRETMENSILEGYEIKPKTIIYVNAWAIARDPEI  403

Query  174  WKAPEEFYPERFLDCNIDYKGQNFELIPFGAGRRMCPGM  58
            W+ PEEF PERFL+ +ID+KGQ+FELIPFGAGRR CP M
Sbjct  404  WENPEEFIPERFLNSDIDFKGQHFELIPFGAGRRGCPAM  442



>ref|XP_004247903.2| PREDICTED: cytochrome P450 83B1-like [Solanum lycopersicum]
Length=495

 Score =   224 bits (570),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 103/159 (65%), Positives = 131/159 (82%), Gaps = 1/159 (1%)
 Frame = -1

Query  534  LTWDHIKAVLMNVFVGGTDTSAVVIIWAMTALMKDPRVMNKVQKEIRELIGEKAGKVYED  355
            LT D+IKA+LMN+FVGGTDTSA  ++WAMTALMK+P+VM KVQ+EIR+ IG K G V ED
Sbjct  283  LTLDNIKAILMNIFVGGTDTSAATVVWAMTALMKNPKVMKKVQEEIRKSIGTK-GFVNED  341

Query  354  DIKQLPYFRAVIKETLRLYTPIPLLVTREIISKCTIDEYEIKPKMIVVINAWAIARDPEY  175
            D++ + YF+AVIKET RLY P P+LV RE + K T++ YEI+   I+ +N+WAIARDPE 
Sbjct  342  DVQNMSYFKAVIKETFRLYPPAPILVPRETMKKSTLEGYEIQLGTIIHVNSWAIARDPEV  401

Query  174  WKAPEEFYPERFLDCNIDYKGQNFELIPFGAGRRMCPGM  58
            W+ PEEF PERFL+ +ID+KGQ+FEL+PFGAGRR CPG+
Sbjct  402  WENPEEFMPERFLNSDIDFKGQDFELLPFGAGRRGCPGI  440



>ref|XP_006358767.1| PREDICTED: cytochrome P450 83B1-like [Solanum tuberosum]
Length=344

 Score =   219 bits (558),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 102/159 (64%), Positives = 126/159 (79%), Gaps = 1/159 (1%)
 Frame = -1

Query  534  LTWDHIKAVLMNVFVGGTDTSAVVIIWAMTALMKDPRVMNKVQKEIRELIGEKAGKVYED  355
            LT D IK +LM+VFV G+DTSA  + WAMTAL+K+P++M KVQKEIRE IG K G V ED
Sbjct  132  LTLDDIKGILMDVFVAGSDTSAAAVEWAMTALIKNPKIMKKVQKEIRETIGTK-GIVNED  190

Query  354  DIKQLPYFRAVIKETLRLYTPIPLLVTREIISKCTIDEYEIKPKMIVVINAWAIARDPEY  175
            DI+ + YF++VIKET RLY P PLL+ RE + K T++ YEI P  I+ +N+WAIARDPE 
Sbjct  191  DIQNMSYFKSVIKETFRLYPPAPLLIPRETMKKSTLEGYEIHPGTIIHVNSWAIARDPEI  250

Query  174  WKAPEEFYPERFLDCNIDYKGQNFELIPFGAGRRMCPGM  58
            W+  EEF PERFL+ +ID+KGQNFELIPFGAGRR CPG+
Sbjct  251  WENSEEFIPERFLNSDIDFKGQNFELIPFGAGRRGCPGI  289



>gb|AJD25156.1| cytochrome P450 CYP71AT92 [Salvia miltiorrhiza]
Length=506

 Score =   223 bits (569),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 101/157 (64%), Positives = 126/157 (80%), Gaps = 1/157 (1%)
 Frame = -1

Query  528  WDHIKAVLMNVFVGGTDTSAVVIIWAMTALMKDPRVMNKVQKEIRELIGEKAGKVYEDDI  349
            WD +KA+L ++F+  TDTSA   +W MTAL+K P+VM KVQ EIR L+G+K GKV EDD 
Sbjct  295  WDRVKALLADIFIAATDTSAASSVWTMTALIKAPKVMQKVQAEIRNLVGKK-GKVDEDDF  353

Query  348  KQLPYFRAVIKETLRLYTPIPLLVTREIISKCTIDEYEIKPKMIVVINAWAIARDPEYWK  169
              LPY +AVIKET RLY P PLLV R+ I KCT++ YEI+P+ +V +NAWAIARDPEYW+
Sbjct  354  VNLPYLKAVIKETFRLYPPAPLLVPRQTIEKCTLEGYEIQPETVVYVNAWAIARDPEYWE  413

Query  168  APEEFYPERFLDCNIDYKGQNFELIPFGAGRRMCPGM  58
             P+EF PERFL+ NID KG++FELIPFG+GRR+CPGM
Sbjct  414  NPDEFVPERFLNSNIDVKGKDFELIPFGSGRRICPGM  450



>ref|XP_006443222.1| hypothetical protein CICLE_v10019775mg [Citrus clementina]
 ref|XP_006478925.1| PREDICTED: cytochrome P450 71A1-like [Citrus sinensis]
 gb|ESR56462.1| hypothetical protein CICLE_v10019775mg [Citrus clementina]
Length=509

 Score =   223 bits (569),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 102/159 (64%), Positives = 122/159 (77%), Gaps = 0/159 (0%)
 Frame = -1

Query  534  LTWDHIKAVLMNVFVGGTDTSAVVIIWAMTALMKDPRVMNKVQKEIRELIGEKAGKVYED  355
            LT DHIKAVLM++FV GTDTSA  ++W MT LM  PRVM KVQ+EIR L+G     V ED
Sbjct  293  LTLDHIKAVLMDIFVAGTDTSAATMVWTMTYLMMHPRVMKKVQEEIRSLVGGNKSFVDED  352

Query  354  DIKQLPYFRAVIKETLRLYTPIPLLVTREIISKCTIDEYEIKPKMIVVINAWAIARDPEY  175
            D+++L Y +AV+KE +RL  P+PLLV RE   KC +D YEI  K IV +NAWAI RDPE 
Sbjct  353  DVQELHYLKAVVKEAMRLQPPVPLLVPRETTEKCIVDGYEIPAKTIVYVNAWAIGRDPEA  412

Query  174  WKAPEEFYPERFLDCNIDYKGQNFELIPFGAGRRMCPGM  58
            W+ PEEF PERF+D +ID+KGQNFE IPFGAGRR+CPGM
Sbjct  413  WENPEEFNPERFIDRSIDFKGQNFEFIPFGAGRRICPGM  451



>ref|XP_002278372.1| PREDICTED: cytochrome P450 71A1-like [Vitis vinifera]
Length=496

 Score =   223 bits (567),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 98/159 (62%), Positives = 128/159 (81%), Gaps = 1/159 (1%)
 Frame = -1

Query  534  LTWDHIKAVLMNVFVGGTDTSAVVIIWAMTALMKDPRVMNKVQKEIRELIGEKAGKVYED  355
            LTWDHIKA+ +++FV GTDTSA  ++WAMT LMK+P VM K Q+E+R LIG+K G V ED
Sbjct  284  LTWDHIKAMFVDIFVAGTDTSAATVVWAMTELMKNPIVMKKAQEELRNLIGKK-GFVDED  342

Query  354  DIKQLPYFRAVIKETLRLYTPIPLLVTREIISKCTIDEYEIKPKMIVVINAWAIARDPEY  175
            D+++L Y +A++KET+RL+   PLLV RE + KC ID YEI PK +V +NAWAI RDPE+
Sbjct  343  DLQKLSYLKALVKETMRLHPAAPLLVPRETLEKCVIDGYEIAPKTLVFVNAWAIGRDPEF  402

Query  174  WKAPEEFYPERFLDCNIDYKGQNFELIPFGAGRRMCPGM  58
            W+ PEEF PERFL  +ID+KGQ+++LIPFG GRR+CPG+
Sbjct  403  WENPEEFMPERFLGSSIDFKGQDYQLIPFGGGRRVCPGL  441



>emb|CDP16102.1| unnamed protein product [Coffea canephora]
Length=500

 Score =   222 bits (566),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 100/158 (63%), Positives = 127/158 (80%), Gaps = 1/158 (1%)
 Frame = -1

Query  534  LTWDHIKAVLMNVFVGGTDTSAVVIIWAMTALMKDPRVMNKVQKEIRELIGEKAGKVYED  355
            +T DHIKA+LMNVF   TDTS V +IWAMTA+M+ P VM K+Q EIRE++G+K   + ED
Sbjct  288  ITMDHIKAMLMNVFFAATDTSTVTVIWAMTAMMQKPTVMKKLQAEIREIMGKKQ-MLDED  346

Query  354  DIKQLPYFRAVIKETLRLYTPIPLLVTREIISKCTIDEYEIKPKMIVVINAWAIARDPEY  175
            D++ LPY +AV+KET RLY  +PLLV RE I KCTID Y+I+PK +V +NAW IARDPEY
Sbjct  347  DVQMLPYLKAVVKETFRLYLAVPLLVPRETIGKCTIDGYDIQPKTLVYVNAWGIARDPEY  406

Query  174  WKAPEEFYPERFLDCNIDYKGQNFELIPFGAGRRMCPG  61
            W+ P+EF PERFL+ ++D +GQ+F+LIPFGAGRR CPG
Sbjct  407  WENPDEFLPERFLNSSVDVRGQDFQLIPFGAGRRGCPG  444



>gb|KDO39228.1| hypothetical protein CISIN_1g038171mg [Citrus sinensis]
Length=509

 Score =   222 bits (566),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 102/159 (64%), Positives = 122/159 (77%), Gaps = 0/159 (0%)
 Frame = -1

Query  534  LTWDHIKAVLMNVFVGGTDTSAVVIIWAMTALMKDPRVMNKVQKEIRELIGEKAGKVYED  355
            LT DHIKAVLMN+FV GTDTSA  ++W MT LMK PRVM KVQ+EIR L+G     V ED
Sbjct  293  LTLDHIKAVLMNIFVAGTDTSAATLVWTMTYLMKHPRVMKKVQEEIRSLVGGNKSFVDED  352

Query  354  DIKQLPYFRAVIKETLRLYTPIPLLVTREIISKCTIDEYEIKPKMIVVINAWAIARDPEY  175
            D+++L Y +AV+KET+RL  P PLLV RE   K  ID YEI  K +V +NAWAI RDPE 
Sbjct  353  DVQELHYLKAVVKETMRLQPPAPLLVPRETTEKSIIDGYEIPAKTLVYVNAWAIGRDPEA  412

Query  174  WKAPEEFYPERFLDCNIDYKGQNFELIPFGAGRRMCPGM  58
            W+ PEEF PERF+D ++D+KG+NFE IPFGAGRR+CPGM
Sbjct  413  WENPEEFNPERFIDRSVDFKGKNFEFIPFGAGRRICPGM  451



>ref|XP_006443223.1| hypothetical protein CICLE_v10023326mg, partial [Citrus clementina]
 gb|ESR56463.1| hypothetical protein CICLE_v10023326mg, partial [Citrus clementina]
Length=511

 Score =   222 bits (566),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 102/159 (64%), Positives = 122/159 (77%), Gaps = 0/159 (0%)
 Frame = -1

Query  534  LTWDHIKAVLMNVFVGGTDTSAVVIIWAMTALMKDPRVMNKVQKEIRELIGEKAGKVYED  355
            LT DHIKAVLMN+FV GTDTSA  ++W MT LMK PRVM KVQ+EIR L+G     V ED
Sbjct  295  LTLDHIKAVLMNIFVAGTDTSAATLVWTMTYLMKHPRVMKKVQEEIRSLVGGNKSFVDED  354

Query  354  DIKQLPYFRAVIKETLRLYTPIPLLVTREIISKCTIDEYEIKPKMIVVINAWAIARDPEY  175
            D+++L Y +AV+KET+RL  P PLLV RE   K  ID YEI  K +V +NAWAI RDPE 
Sbjct  355  DVQELHYLKAVVKETMRLQPPAPLLVPRETTEKSIIDGYEIPAKTLVYVNAWAIGRDPEA  414

Query  174  WKAPEEFYPERFLDCNIDYKGQNFELIPFGAGRRMCPGM  58
            W+ PEEF PERF+D ++D+KG+NFE IPFGAGRR+CPGM
Sbjct  415  WENPEEFNPERFIDRSVDFKGKNFEFIPFGAGRRICPGM  453



>gb|KHN19810.1| Cytochrome P450 83B1 [Glycine soja]
Length=412

 Score =   219 bits (558),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 99/159 (62%), Positives = 125/159 (79%), Gaps = 1/159 (1%)
 Frame = -1

Query  534  LTWDHIKAVLMNVFVGGTDTSAVVIIWAMTALMKDPRVMNKVQKEIRELIGEKAGKVYED  355
            LT  HIK ++MN+ + GTDTSA  ++WAMTALMK PRVM K Q+EIR + GEK   + ED
Sbjct  200  LTPAHIKPLMMNIILAGTDTSAAAVVWAMTALMKSPRVMKKAQEEIRNVFGEK-DFIGED  258

Query  354  DIKQLPYFRAVIKETLRLYTPIPLLVTREIISKCTIDEYEIKPKMIVVINAWAIARDPEY  175
            DI++LPY +AVIKET+R+Y P+PLL+ RE I KC+I+ YEI  K +V +NAWA+ RDPE 
Sbjct  259  DIQKLPYLKAVIKETMRMYPPLPLLIHRETIKKCSIEGYEIPEKTLVYVNAWAVHRDPET  318

Query  174  WKAPEEFYPERFLDCNIDYKGQNFELIPFGAGRRMCPGM  58
            WK PEEFYPERFLD  ID++G +FE IPFG GRR+CPG+
Sbjct  319  WKKPEEFYPERFLDSKIDFRGYDFEFIPFGTGRRICPGI  357



>emb|CDP16103.1| unnamed protein product [Coffea canephora]
Length=500

 Score =   221 bits (563),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 101/158 (64%), Positives = 125/158 (79%), Gaps = 1/158 (1%)
 Frame = -1

Query  534  LTWDHIKAVLMNVFVGGTDTSAVVIIWAMTALMKDPRVMNKVQKEIRELIGEKAGKVYED  355
            +T DHIKA+LMNVF+ GTD SAV +IWAMTA++K P V+ K+Q EIRE++G+K   + ED
Sbjct  288  ITMDHIKAMLMNVFIAGTDRSAVTVIWAMTAMIKIPTVLKKLQAEIREIMGKKQ-MLDED  346

Query  354  DIKQLPYFRAVIKETLRLYTPIPLLVTREIISKCTIDEYEIKPKMIVVINAWAIARDPEY  175
            D++ LPY +AV+KET RLY  +PLLV RE + KCTID YEI+PK +V +NAW IARDPEY
Sbjct  347  DVQMLPYLKAVVKETFRLYPAVPLLVPRETMGKCTIDGYEIQPKTLVYVNAWGIARDPEY  406

Query  174  WKAPEEFYPERFLDCNIDYKGQNFELIPFGAGRRMCPG  61
            W  P+EF PERFL+  ID KGQ+F L PFGAGRR CPG
Sbjct  407  WGNPDEFLPERFLNSTIDLKGQDFHLTPFGAGRRGCPG  444



>ref|XP_006358823.1| PREDICTED: cytochrome P450 83B1-like [Solanum tuberosum]
Length=498

 Score =   221 bits (562),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 103/159 (65%), Positives = 127/159 (80%), Gaps = 1/159 (1%)
 Frame = -1

Query  534  LTWDHIKAVLMNVFVGGTDTSAVVIIWAMTALMKDPRVMNKVQKEIRELIGEKAGKVYED  355
            LT D+IK +LM++  GGTDT+AV +IW+MTALMK+P VM KVQ+EIR+ I  K G V ED
Sbjct  284  LTLDNIKGILMDILTGGTDTNAVAVIWSMTALMKNPEVMKKVQEEIRKSIRIK-GIVNED  342

Query  354  DIKQLPYFRAVIKETLRLYTPIPLLVTREIISKCTIDEYEIKPKMIVVINAWAIARDPEY  175
            DI+ +PYF AVIKE  RLY P PLLV RE + K  ++ YEI+P  I+ +N+WAIARDPE 
Sbjct  343  DIQNMPYFNAVIKEIFRLYPPAPLLVPREAMEKSILEGYEIQPGTIIHVNSWAIARDPEI  402

Query  174  WKAPEEFYPERFLDCNIDYKGQNFELIPFGAGRRMCPGM  58
            W+ PEEF PERFL+C+ID+KGQNFELIPFGAGRR CPG+
Sbjct  403  WENPEEFIPERFLNCDIDFKGQNFELIPFGAGRRGCPGI  441



>ref|XP_009769778.1| PREDICTED: cytochrome P450 71A1-like isoform X2 [Nicotiana sylvestris]
Length=234

 Score =   213 bits (541),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 99/159 (62%), Positives = 123/159 (77%), Gaps = 1/159 (1%)
 Frame = -1

Query  534  LTWDHIKAVLMNVFVGGTDTSAVVIIWAMTALMKDPRVMNKVQKEIRELIGEKAGKVYED  355
            +T D+IKA+LMN+FV GTDT A+ ++W MTAL+ +P+ M KVQ+EIR+ +G+K G V ED
Sbjct  22   ITLDNIKAILMNIFVAGTDTVAISLVWTMTALIMNPKAMKKVQEEIRKSVGKK-GMVNED  80

Query  354  DIKQLPYFRAVIKETLRLYTPIPLLVTREIISKCTIDEYEIKPKMIVVINAWAIARDPEY  175
            DI+   Y +AVIKET RLY P P LV RE I    ++ Y+I PK IV +N WAIARDPEY
Sbjct  81   DIQNFHYLKAVIKETFRLYPPAPTLVARETIQNSILEGYKIPPKTIVYVNYWAIARDPEY  140

Query  174  WKAPEEFYPERFLDCNIDYKGQNFELIPFGAGRRMCPGM  58
            W+ PEEF PERFL+ NIDYKGQ+FE IPFGAGRR CPG+
Sbjct  141  WENPEEFIPERFLNSNIDYKGQDFEFIPFGAGRRGCPGI  179



>ref|XP_006577403.1| PREDICTED: cytochrome P450 71A1-like, partial [Glycine max]
Length=309

 Score =   215 bits (547),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 101/159 (64%), Positives = 124/159 (78%), Gaps = 0/159 (0%)
 Frame = -1

Query  534  LTWDHIKAVLMNVFVGGTDTSAVVIIWAMTALMKDPRVMNKVQKEIRELIGEKAGKVYED  355
            L+ DHIKAVLM++ VG TDT+  + +WAMTAL+K+PRVM KVQ+EIR L G+K     ED
Sbjct  96   LSNDHIKAVLMDMLVGATDTATAMTVWAMTALLKNPRVMKKVQEEIRNLGGKKDFLGEED  155

Query  354  DIKQLPYFRAVIKETLRLYTPIPLLVTREIISKCTIDEYEIKPKMIVVINAWAIARDPEY  175
            DI++ PYF+AV+KE +RL+ P PLL  REI   C ID YEI  K IV +NAWAI RDP+ 
Sbjct  156  DIQKFPYFKAVLKEVMRLHLPAPLLAPREINEACIIDGYEIPAKTIVYVNAWAIHRDPKA  215

Query  174  WKAPEEFYPERFLDCNIDYKGQNFELIPFGAGRRMCPGM  58
            WK PEEF PERFLD  ID++GQ+FELIPFGAGRR+CPG+
Sbjct  216  WKDPEEFLPERFLDNTIDFRGQDFELIPFGAGRRICPGV  254



>ref|XP_006358766.1| PREDICTED: cytochrome P450 83B1-like [Solanum tuberosum]
Length=496

 Score =   220 bits (561),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 103/159 (65%), Positives = 127/159 (80%), Gaps = 1/159 (1%)
 Frame = -1

Query  534  LTWDHIKAVLMNVFVGGTDTSAVVIIWAMTALMKDPRVMNKVQKEIRELIGEKAGKVYED  355
            LT + IK +LM+V V G+DTSA  I+W MTALMK+P+ M KVQ+EIR+ IG K G V ED
Sbjct  284  LTLEDIKGLLMDVLVAGSDTSAAGIVWTMTALMKNPKAMKKVQEEIRKSIGNK-GIVNED  342

Query  354  DIKQLPYFRAVIKETLRLYTPIPLLVTREIISKCTIDEYEIKPKMIVVINAWAIARDPEY  175
            DI+ +PYF+AVIKE  RLY P+PLLV RE + K T++ YEI+ + IV +N+WAIARDPE 
Sbjct  343  DIQNMPYFKAVIKEAFRLYPPVPLLVQRESMKKSTLEGYEIQARTIVHVNSWAIARDPEI  402

Query  174  WKAPEEFYPERFLDCNIDYKGQNFELIPFGAGRRMCPGM  58
            W+ PEEF PERFL+ +IDYKGQN+ELIPFGAGRR CPGM
Sbjct  403  WENPEEFIPERFLNSDIDYKGQNYELIPFGAGRRGCPGM  441



>ref|XP_004247904.1| PREDICTED: cytochrome P450 83B1-like [Solanum lycopersicum]
Length=496

 Score =   220 bits (560),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 103/158 (65%), Positives = 125/158 (79%), Gaps = 1/158 (1%)
 Frame = -1

Query  534  LTWDHIKAVLMNVFVGGTDTSAVVIIWAMTALMKDPRVMNKVQKEIRELIGEKAGKVYED  355
            LT + IK +LMNV V G+DTSA  ++W MTALMK+P+ M KVQ+EIRE IG K G V ED
Sbjct  284  LTLEDIKGLLMNVLVAGSDTSAAGVVWTMTALMKNPKAMKKVQQEIRESIGNK-GIVNED  342

Query  354  DIKQLPYFRAVIKETLRLYTPIPLLVTREIISKCTIDEYEIKPKMIVVINAWAIARDPEY  175
            D++ +PYF+AVIKET RLY PIPLLV RE +   T++ YEI+   IV +N+WAIARDPE 
Sbjct  343  DVQNMPYFKAVIKETFRLYPPIPLLVPRESMKNSTLEGYEIQAGTIVHVNSWAIARDPEI  402

Query  174  WKAPEEFYPERFLDCNIDYKGQNFELIPFGAGRRMCPG  61
            W+ PEEF PERFL+ +IDYKGQN+ELIPFGAGRR CPG
Sbjct  403  WENPEEFIPERFLNSDIDYKGQNYELIPFGAGRRGCPG  440



>ref|XP_011091358.1| PREDICTED: cytochrome P450 71A1-like [Sesamum indicum]
Length=501

 Score =   219 bits (559),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 96/159 (60%), Positives = 127/159 (80%), Gaps = 1/159 (1%)
 Frame = -1

Query  534  LTWDHIKAVLMNVFVGGTDTSAVVIIWAMTALMKDPRVMNKVQKEIRELIGEKAGKVYED  355
            + WDHIK VLMN+FV GTDT+A  I WAMTAL+K P+V+NKVQ+EIR ++G+K G V ED
Sbjct  289  IDWDHIKGVLMNMFVAGTDTTAATITWAMTALIKKPQVLNKVQQEIRSVVGKK-GSVAED  347

Query  354  DIKQLPYFRAVIKETLRLYTPIPLLVTREIISKCTIDEYEIKPKMIVVINAWAIARDPEY  175
            DI++LPYF+AV+KETLRLY P PL + R  I    ID Y+I+P  IV +N WAI+RD ++
Sbjct  348  DIQKLPYFKAVVKETLRLYAPAPLSLPRLTIKSSVIDGYDIEPNTIVYVNVWAISRDKDF  407

Query  174  WKAPEEFYPERFLDCNIDYKGQNFELIPFGAGRRMCPGM  58
            W+ P+EF PERFL+ ++D+KGQ+F  +PFG+GRR+CPGM
Sbjct  408  WENPDEFLPERFLNSSVDFKGQDFGFLPFGSGRRVCPGM  446



>ref|XP_006479001.1| PREDICTED: cytochrome P450 71A1-like [Citrus sinensis]
Length=553

 Score =   221 bits (562),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 100/159 (63%), Positives = 122/159 (77%), Gaps = 0/159 (0%)
 Frame = -1

Query  534  LTWDHIKAVLMNVFVGGTDTSAVVIIWAMTALMKDPRVMNKVQKEIRELIGEKAGKVYED  355
            LT DHIKAVLM++FV GTDTSA  ++W MT LM  PRVM KVQ+EIR L+G     V ED
Sbjct  293  LTLDHIKAVLMDIFVAGTDTSAATMVWTMTYLMMHPRVMKKVQEEIRSLVGGNKSFVDED  352

Query  354  DIKQLPYFRAVIKETLRLYTPIPLLVTREIISKCTIDEYEIKPKMIVVINAWAIARDPEY  175
            D+++L Y +AV+KE +RL  P+PLLV RE   KC +D YEI  K IV +NAWAI RDPE 
Sbjct  353  DVQELHYLKAVVKEAMRLQPPVPLLVPRETTEKCIVDGYEIPAKTIVYVNAWAIGRDPEA  412

Query  174  WKAPEEFYPERFLDCNIDYKGQNFELIPFGAGRRMCPGM  58
            W+ PEEF PERF+D ++D+KG+NFE IPFGAGRR+CPGM
Sbjct  413  WENPEEFNPERFIDRSVDFKGKNFEFIPFGAGRRICPGM  451



>gb|AJD25157.1| cytochrome P450 CYP71AT93 [Salvia miltiorrhiza]
Length=491

 Score =   219 bits (558),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 97/159 (61%), Positives = 124/159 (78%), Gaps = 2/159 (1%)
 Frame = -1

Query  531  TWDHIKAVLMNVFVGGTDTSAVVIIWAMTALMKDPRVMNKVQKEIRELIGEKAGKVYEDD  352
             WD +KA+LMN+F+GGTD+SA  I+W MTALMK P +M KVQ EIR ++G K GKV +DD
Sbjct  281  NWDRVKALLMNLFIGGTDSSAAAIVWNMTALMKAPHIMKKVQTEIRNVVGNK-GKVDDDD  339

Query  351  IKQLPYFRAVIKETLRLYTPIPLLVTREIISKCTIDEYEIKPKMIVVINAWAIARDPEYW  172
            + +LPY +A++ ET RLYTP+PLLV R+   KC +D YEI+P   V +N WAIARD EYW
Sbjct  340  LPKLPYLKAILNETFRLYTPVPLLVPRQTTEKCVLDGYEIQPNTTVYVNVWAIARDSEYW  399

Query  171  K-APEEFYPERFLDCNIDYKGQNFELIPFGAGRRMCPGM  58
            K +PEEF PERF+  N+D KGQ+F +IPFG+GRR+CPGM
Sbjct  400  KISPEEFLPERFIGSNMDVKGQDFGVIPFGSGRRICPGM  438



>ref|XP_003551894.1| PREDICTED: cytochrome P450 83B1-like [Glycine max]
Length=501

 Score =   219 bits (559),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 99/159 (62%), Positives = 125/159 (79%), Gaps = 1/159 (1%)
 Frame = -1

Query  534  LTWDHIKAVLMNVFVGGTDTSAVVIIWAMTALMKDPRVMNKVQKEIRELIGEKAGKVYED  355
            LT  HIK ++MN+ + GTDTSA  ++WAMTALMK PRVM K Q+EIR + GEK   + ED
Sbjct  289  LTPAHIKPLMMNIILAGTDTSAAAVVWAMTALMKSPRVMKKAQEEIRNVFGEK-DFIGED  347

Query  354  DIKQLPYFRAVIKETLRLYTPIPLLVTREIISKCTIDEYEIKPKMIVVINAWAIARDPEY  175
            DI++LPY +AVIKET+R+Y P+PLL+ RE I KC+I+ YEI  K +V +NAWA+ RDPE 
Sbjct  348  DIQKLPYLKAVIKETMRMYPPLPLLIHRETIKKCSIEGYEIPEKTLVYVNAWAVHRDPET  407

Query  174  WKAPEEFYPERFLDCNIDYKGQNFELIPFGAGRRMCPGM  58
            WK PEEFYPERFLD  ID++G +FE IPFG GRR+CPG+
Sbjct  408  WKKPEEFYPERFLDSKIDFRGYDFEFIPFGTGRRICPGI  446



>ref|XP_004247900.1| PREDICTED: cytochrome P450 83B1-like [Solanum lycopersicum]
Length=498

 Score =   219 bits (558),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 102/159 (64%), Positives = 127/159 (80%), Gaps = 1/159 (1%)
 Frame = -1

Query  534  LTWDHIKAVLMNVFVGGTDTSAVVIIWAMTALMKDPRVMNKVQKEIRELIGEKAGKVYED  355
            LT D+IKA++MN+ VGGT+TSA  IIWAMT+L+ +P  M KVQ+EIRE +G+K+  V ED
Sbjct  286  LTLDNIKAIIMNMLVGGTNTSAATIIWAMTSLIANPNAMKKVQEEIRESVGKKS-IVSED  344

Query  354  DIKQLPYFRAVIKETLRLYTPIPLLVTREIISKCTIDEYEIKPKMIVVINAWAIARDPEY  175
            D++ LPYF+AVIKET RLY P PLLV RE +    ++ YEIK K I+ +NAWAIARDPE 
Sbjct  345  DVQNLPYFKAVIKETFRLYPPAPLLVPRETMRNSVLEGYEIKAKSIIYVNAWAIARDPEI  404

Query  174  WKAPEEFYPERFLDCNIDYKGQNFELIPFGAGRRMCPGM  58
            W+ PE+F PERFL+ +ID+KGQNFELIPFGAGRR CP M
Sbjct  405  WENPEKFIPERFLNSDIDFKGQNFELIPFGAGRRGCPAM  443



>ref|XP_002312665.2| hypothetical protein POPTR_0008s18870g [Populus trichocarpa]
 gb|EEE90032.2| hypothetical protein POPTR_0008s18870g [Populus trichocarpa]
Length=507

 Score =   218 bits (555),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 97/159 (61%), Positives = 124/159 (78%), Gaps = 1/159 (1%)
 Frame = -1

Query  534  LTWDHIKAVLMNVFVGGTDTSAVVIIWAMTALMKDPRVMNKVQKEIRELIGEKAGKVYED  355
             T D+IKA+L+N+F+GG DT ++ + WAM  L+++PRVM KVQ E+R+ +G K G+V E 
Sbjct  292  FTKDNIKAILLNLFLGGVDTISLTVNWAMAELVRNPRVMKKVQDEVRKCVGNK-GRVTES  350

Query  354  DIKQLPYFRAVIKETLRLYTPIPLLVTREIISKCTIDEYEIKPKMIVVINAWAIARDPEY  175
            DI QL Y R VIKETLRL+ P PLL+TRE +S C +  + I PKM+V IN WAI RDP Y
Sbjct  351  DIDQLEYLRMVIKETLRLHPPAPLLITRETMSHCKVSGHNIYPKMLVQINVWAIGRDPRY  410

Query  174  WKAPEEFYPERFLDCNIDYKGQNFELIPFGAGRRMCPGM  58
            WK PEEF+PERFLD +IDYKGQ+FE +PFG+GRR+CPGM
Sbjct  411  WKDPEEFFPERFLDSSIDYKGQSFEYLPFGSGRRICPGM  449



>gb|AIU56747.1| cytochrome P450 CYP71B41v2 [Populus trichocarpa]
Length=507

 Score =   218 bits (554),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 97/159 (61%), Positives = 124/159 (78%), Gaps = 1/159 (1%)
 Frame = -1

Query  534  LTWDHIKAVLMNVFVGGTDTSAVVIIWAMTALMKDPRVMNKVQKEIRELIGEKAGKVYED  355
             T D+IKA+L+N+F+GG DTS++ + WAM  L+++PRVM KVQ E+R+ +G K G+V E 
Sbjct  292  FTKDNIKAILLNLFLGGVDTSSLTVNWAMAELVRNPRVMKKVQDEVRKCVGNK-GRVTES  350

Query  354  DIKQLPYFRAVIKETLRLYTPIPLLVTREIISKCTIDEYEIKPKMIVVINAWAIARDPEY  175
            DI QL Y R VIKETLRL+ P PLL+ RE +S C +  + I PKM+V IN WAI RDP Y
Sbjct  351  DIDQLEYLRMVIKETLRLHPPAPLLIPRETMSHCKVSGHNIYPKMLVQINVWAIGRDPTY  410

Query  174  WKAPEEFYPERFLDCNIDYKGQNFELIPFGAGRRMCPGM  58
            WK PEEF+PERFLD +IDYKGQ+FE +PFG+GRR+CPGM
Sbjct  411  WKDPEEFFPERFLDSSIDYKGQSFEYLPFGSGRRICPGM  449



>gb|KDP36955.1| hypothetical protein JCGZ_08246 [Jatropha curcas]
Length=417

 Score =   215 bits (547),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 97/159 (61%), Positives = 123/159 (77%), Gaps = 1/159 (1%)
 Frame = -1

Query  534  LTWDHIKAVLMNVFVGGTDTSAVVIIWAMTALMKDPRVMNKVQKEIRELIGEKAGKVYED  355
            L++DHIKA+LMNVFV GTDTSA  +IWAM  LM++P  M K QKEIR  IGEK G V ED
Sbjct  204  LSFDHIKAILMNVFVAGTDTSAATVIWAMGFLMRNPEAMRKAQKEIRNTIGEK-GFVNED  262

Query  354  DIKQLPYFRAVIKETLRLYTPIPLLVTREIISKCTIDEYEIKPKMIVVINAWAIARDPEY  175
            D++Q+PY +AV+KET+RL   +PLLV RE +  CT+  + I  K +V +NAWAI RDPE 
Sbjct  263  DVQQMPYLKAVVKETMRLQPTVPLLVPRETVQDCTLGGFHIPAKSLVHVNAWAIGRDPEV  322

Query  174  WKAPEEFYPERFLDCNIDYKGQNFELIPFGAGRRMCPGM  58
            W+ P EFYP+RFL+ N+D KGQ++ELIPFG GRR+CPG+
Sbjct  323  WEKPLEFYPDRFLNSNVDMKGQDYELIPFGGGRRICPGI  361



>ref|XP_002312659.2| hypothetical protein POPTR_0008s18790g [Populus trichocarpa]
 gb|EEE90026.2| hypothetical protein POPTR_0008s18790g [Populus trichocarpa]
Length=507

 Score =   217 bits (552),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 97/159 (61%), Positives = 124/159 (78%), Gaps = 1/159 (1%)
 Frame = -1

Query  534  LTWDHIKAVLMNVFVGGTDTSAVVIIWAMTALMKDPRVMNKVQKEIRELIGEKAGKVYED  355
             T D+IKA+L+N+F+GG DTS++ + WAM  L+++PRVM KVQ E+R+ +G K G+V E 
Sbjct  292  FTKDNIKAILLNLFLGGVDTSSLTVNWAMAELVRNPRVMKKVQDEVRKCVGNK-GRVTES  350

Query  354  DIKQLPYFRAVIKETLRLYTPIPLLVTREIISKCTIDEYEIKPKMIVVINAWAIARDPEY  175
            DI QL Y R VIKETLRL+ P PLL+ RE +S C +  + I PKM+V IN WAI RDP Y
Sbjct  351  DIDQLEYLRMVIKETLRLHPPAPLLIPRENMSHCKVSGHNIYPKMLVQINVWAIGRDPTY  410

Query  174  WKAPEEFYPERFLDCNIDYKGQNFELIPFGAGRRMCPGM  58
            WK PEEF+PERFLD +IDYKGQ+FE +PFG+GRR+CPGM
Sbjct  411  WKDPEEFFPERFLDSSIDYKGQSFEYLPFGSGRRICPGM  449



>gb|ABK94709.1| unknown [Populus trichocarpa]
Length=507

 Score =   216 bits (550),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 96/159 (60%), Positives = 124/159 (78%), Gaps = 1/159 (1%)
 Frame = -1

Query  534  LTWDHIKAVLMNVFVGGTDTSAVVIIWAMTALMKDPRVMNKVQKEIRELIGEKAGKVYED  355
             T D+IKA+L+N+F+GG DT ++ + WAM  L+++PRVM KVQ E+R+ +G K G+V E 
Sbjct  292  FTKDNIKAILLNLFLGGVDTISLTVNWAMAELVRNPRVMKKVQDEVRKCVGNK-GRVTES  350

Query  354  DIKQLPYFRAVIKETLRLYTPIPLLVTREIISKCTIDEYEIKPKMIVVINAWAIARDPEY  175
            DI QL Y R VIKETLRL+ P PLL+TRE +S C +  + I PKM+V IN WAI RDP Y
Sbjct  351  DIDQLEYLRMVIKETLRLHPPAPLLITRETMSHCKVSGHNIYPKMLVQINVWAIGRDPRY  410

Query  174  WKAPEEFYPERFLDCNIDYKGQNFELIPFGAGRRMCPGM  58
            WK PEEF+PERFLD +IDYKGQ+FE +PFG+GRR+CPG+
Sbjct  411  WKDPEEFFPERFLDSSIDYKGQSFEYLPFGSGRRICPGI  449



>ref|XP_011091673.1| PREDICTED: cytochrome P450 71A1-like [Sesamum indicum]
Length=465

 Score =   215 bits (547),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 95/159 (60%), Positives = 123/159 (77%), Gaps = 1/159 (1%)
 Frame = -1

Query  534  LTWDHIKAVLMNVFVGGTDTSAVVIIWAMTALMKDPRVMNKVQKEIRELIGEKAGKVYED  355
            + W+H+K VL+++FV GT+TSA  I WAMTAL+K P+V+NKVQ+EIR L+ EK G V E+
Sbjct  253  INWEHVKGVLLDIFVAGTETSATTITWAMTALIKKPQVLNKVQQEIRTLVREK-GSVAEE  311

Query  354  DIKQLPYFRAVIKETLRLYTPIPLLVTREIISKCTIDEYEIKPKMIVVINAWAIARDPEY  175
            DI +LPY +AV+KETLRLY P PL + R       ID YEI+P  IV +N W IARDP +
Sbjct  312  DILKLPYLKAVVKETLRLYPPSPLALPRLTTKTSIIDGYEIEPNTIVYVNVWKIARDPNF  371

Query  174  WKAPEEFYPERFLDCNIDYKGQNFELIPFGAGRRMCPGM  58
            W+ P+EF PERFL+ N+DYKGQ+FE +PFG+GRR+CPGM
Sbjct  372  WENPDEFLPERFLNSNVDYKGQDFEFLPFGSGRRVCPGM  410



>ref|XP_009601421.1| PREDICTED: cytochrome P450 83B1-like [Nicotiana tomentosiformis]
Length=496

 Score =   216 bits (549),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 98/159 (62%), Positives = 125/159 (79%), Gaps = 1/159 (1%)
 Frame = -1

Query  534  LTWDHIKAVLMNVFVGGTDTSAVVIIWAMTALMKDPRVMNKVQKEIRELIGEKAGKVYED  355
            +T D+IKA+LMN+FV GTDT A+ ++WAMTAL+ +P+ M KVQ+EIR+ +G+K G V ED
Sbjct  284  ITLDNIKAILMNIFVAGTDTVAISLVWAMTALIMNPKAMKKVQEEIRKSVGKK-GMVNED  342

Query  354  DIKQLPYFRAVIKETLRLYTPIPLLVTREIISKCTIDEYEIKPKMIVVINAWAIARDPEY  175
            DI+   Y +AVIKET RLY P P L+ RE I    ++ Y+I PK I+ +N WAIARDPEY
Sbjct  343  DIQNFHYLKAVIKETFRLYPPAPTLLARETIQNSILEGYKIPPKTIIYVNYWAIARDPEY  402

Query  174  WKAPEEFYPERFLDCNIDYKGQNFELIPFGAGRRMCPGM  58
            W+ PEEF PERFL+ NIDYKGQ+FE IPFGAGRR+CPG+
Sbjct  403  WENPEEFIPERFLNSNIDYKGQDFEFIPFGAGRRVCPGI  441



>ref|XP_006479317.1| PREDICTED: cytochrome P450 71B23-like [Citrus sinensis]
Length=210

 Score =   207 bits (527),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 94/148 (64%), Positives = 114/148 (77%), Gaps = 0/148 (0%)
 Frame = -1

Query  501  NVFVGGTDTSAVVIIWAMTALMKDPRVMNKVQKEIRELIGEKAGKVYEDDIKQLPYFRAV  322
            NV V GTDTSA  ++WA+T LM++PR M KVQ EIR LIG   G V EDD+++L Y  AV
Sbjct  6    NVLVAGTDTSAATVVWAITYLMQNPRAMKKVQLEIRSLIGGNKGFVNEDDVQELHYLMAV  65

Query  321  IKETLRLYTPIPLLVTREIISKCTIDEYEIKPKMIVVINAWAIARDPEYWKAPEEFYPER  142
            +KET+RL   +PLL+ RE I KC ID YEI  K +V +NAWAI RDPE W+ PEEFYPER
Sbjct  66   VKETMRLQPTVPLLIPRETIQKCVIDGYEIPAKTLVFVNAWAIGRDPEAWENPEEFYPER  125

Query  141  FLDCNIDYKGQNFELIPFGAGRRMCPGM  58
            F+D  ID+KGQ+FELIPFGAGRR+CPG+
Sbjct  126  FVDSCIDFKGQHFELIPFGAGRRICPGL  153



>emb|CDP18845.1| unnamed protein product [Coffea canephora]
Length=500

 Score =   215 bits (548),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 99/158 (63%), Positives = 125/158 (79%), Gaps = 1/158 (1%)
 Frame = -1

Query  534  LTWDHIKAVLMNVFVGGTDTSAVVIIWAMTALMKDPRVMNKVQKEIRELIGEKAGKVYED  355
            +T  +IKA+LM+VF  GTDTSAV IIWAMTA+MK P VM KVQ EIR +IG+K   + ED
Sbjct  288  ITMGNIKAMLMDVFFAGTDTSAVTIIWAMTAMMKKPTVMRKVQAEIRGIIGKKQ-MLDED  346

Query  354  DIKQLPYFRAVIKETLRLYTPIPLLVTREIISKCTIDEYEIKPKMIVVINAWAIARDPEY  175
            D++ LPY +AV++ET RLY  +PLLV R+ I+KCT+D YEI+P+ +V +NAW IARDPEY
Sbjct  347  DVQNLPYLKAVVEETFRLYPALPLLVPRQTIAKCTVDGYEIQPETLVYVNAWGIARDPEY  406

Query  174  WKAPEEFYPERFLDCNIDYKGQNFELIPFGAGRRMCPG  61
            W+ P+EF PERFL+  +D  GQ+F LIPFGAGRR CPG
Sbjct  407  WENPDEFLPERFLNSTLDVNGQDFHLIPFGAGRRGCPG  444



>gb|KHN35607.1| Cytochrome P450 83B1 [Glycine soja]
Length=501

 Score =   215 bits (548),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 100/159 (63%), Positives = 123/159 (77%), Gaps = 0/159 (0%)
 Frame = -1

Query  534  LTWDHIKAVLMNVFVGGTDTSAVVIIWAMTALMKDPRVMNKVQKEIRELIGEKAGKVYED  355
            L+ DHIKAVLM++ VG TDT+  + +WAMTAL+K+PRVM KVQ+EIR L G+K     ED
Sbjct  288  LSNDHIKAVLMDMLVGATDTATAMTVWAMTALLKNPRVMKKVQEEIRNLGGKKDFLGEED  347

Query  354  DIKQLPYFRAVIKETLRLYTPIPLLVTREIISKCTIDEYEIKPKMIVVINAWAIARDPEY  175
            DI++ PYF+AV+KE +RL+ P PLL  RE    C ID YEI  K IV +NAWAI RDP+ 
Sbjct  348  DIQKFPYFKAVLKEVMRLHLPAPLLSPRETNEACIIDGYEIPAKTIVYVNAWAIHRDPKA  407

Query  174  WKAPEEFYPERFLDCNIDYKGQNFELIPFGAGRRMCPGM  58
            WK PEEF PERFLD  ID++GQ+FELIPFGAGRR+CPG+
Sbjct  408  WKDPEEFLPERFLDNTIDFRGQDFELIPFGAGRRICPGV  446



>ref|XP_002278387.1| PREDICTED: cytochrome P450 71A1 [Vitis vinifera]
Length=494

 Score =   215 bits (547),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 97/158 (61%), Positives = 122/158 (77%), Gaps = 1/158 (1%)
 Frame = -1

Query  534  LTWDHIKAVLMNVFVGGTDTSAVVIIWAMTALMKDPRVMNKVQKEIRELIGEKAGKVYED  355
            LTWDHIKA+LM++F+ GTDTSA  ++WAMT LMK+P VM K Q+E R  IG+K G V ED
Sbjct  282  LTWDHIKAILMDIFIAGTDTSAATLVWAMTELMKNPIVMKKAQEEFRNSIGKK-GFVDED  340

Query  354  DIKQLPYFRAVIKETLRLYTPIPLLVTREIISKCTIDEYEIKPKMIVVINAWAIARDPEY  175
            D++ L Y +A++KET+RL+   PLLV RE   KC ID YEI PK +V +NAWAI RDPE+
Sbjct  341  DLQMLCYLKALVKETMRLHPAAPLLVPRETREKCVIDGYEIAPKTLVFVNAWAIGRDPEF  400

Query  174  WKAPEEFYPERFLDCNIDYKGQNFELIPFGAGRRMCPG  61
            W+ PEEF PERFL  +ID+KGQ+++ IPFG GRR CPG
Sbjct  401  WENPEEFMPERFLGSSIDFKGQDYQFIPFGGGRRACPG  438



>ref|XP_009591953.1| PREDICTED: cytochrome P450 83B1-like [Nicotiana tomentosiformis]
Length=288

 Score =   209 bits (531),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 91/159 (57%), Positives = 126/159 (79%), Gaps = 0/159 (0%)
 Frame = -1

Query  534  LTWDHIKAVLMNVFVGGTDTSAVVIIWAMTALMKDPRVMNKVQKEIRELIGEKAGKVYED  355
            LT + IKA++MNV + G+DTSA  ++W MTALMK+P+ M KVQ+EIR+ +G+K+  V ED
Sbjct  75   LTLEDIKALVMNVLLAGSDTSAAAVVWTMTALMKNPKAMKKVQEEIRKSVGKKSNIVTED  134

Query  354  DIKQLPYFRAVIKETLRLYTPIPLLVTREIISKCTIDEYEIKPKMIVVINAWAIARDPEY  175
            DI+ LPYF+AVIKE+ RLY P+P+L+ RE + K T+++YEI+P  I+ +N+WAI RDPE 
Sbjct  135  DIQNLPYFKAVIKESFRLYPPVPVLLPRESMEKSTLEQYEIQPGTIIHVNSWAILRDPEI  194

Query  174  WKAPEEFYPERFLDCNIDYKGQNFELIPFGAGRRMCPGM  58
            W+  E+F  ERFL+ NID+KG +F+ IPFGAGRR CPG+
Sbjct  195  WENSEQFIAERFLNSNIDFKGHDFDYIPFGAGRRGCPGI  233



>gb|AIU56749.1| cytochrome P450 CYP71B63v2 [Populus trichocarpa]
Length=507

 Score =   215 bits (547),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 96/159 (60%), Positives = 123/159 (77%), Gaps = 1/159 (1%)
 Frame = -1

Query  534  LTWDHIKAVLMNVFVGGTDTSAVVIIWAMTALMKDPRVMNKVQKEIRELIGEKAGKVYED  355
             T D+IKA+L+N+F+GG DT ++ + WAM  L+++PRVM KVQ E+R+ +G K G+V E 
Sbjct  292  FTKDNIKAILLNLFLGGVDTISLTVNWAMAELVRNPRVMKKVQDEVRKCVGNK-GRVTES  350

Query  354  DIKQLPYFRAVIKETLRLYTPIPLLVTREIISKCTIDEYEIKPKMIVVINAWAIARDPEY  175
            DI QL Y R VIKETLRL+ P PLL+ RE +S C +  + I PKM+V IN WAI RDP Y
Sbjct  351  DIDQLEYLRMVIKETLRLHPPAPLLIPRETMSHCKVSGHNIYPKMLVQINVWAIGRDPTY  410

Query  174  WKAPEEFYPERFLDCNIDYKGQNFELIPFGAGRRMCPGM  58
            WK PEEF+PERFLD +IDYKGQ+FE +PFG+GRR+CPGM
Sbjct  411  WKDPEEFFPERFLDSSIDYKGQSFEYLPFGSGRRICPGM  449



>ref|XP_004247901.1| PREDICTED: cytochrome P450 83B1-like [Solanum lycopersicum]
Length=502

 Score =   215 bits (547),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 100/159 (63%), Positives = 124/159 (78%), Gaps = 1/159 (1%)
 Frame = -1

Query  534  LTWDHIKAVLMNVFVGGTDTSAVVIIWAMTALMKDPRVMNKVQKEIRELIGEKAGKVYED  355
            LT ++IKA++MN+ VGGT+TSA  ++WAMTAL+  P  M KVQ EIRE++G+K+  V ED
Sbjct  286  LTLENIKAIIMNMLVGGTNTSAAAVVWAMTALISKPNAMKKVQAEIREMVGKKS-IVNED  344

Query  354  DIKQLPYFRAVIKETLRLYTPIPLLVTREIISKCTIDEYEIKPKMIVVINAWAIARDPEY  175
            DI+ LPYF+AVIKET RLY P PLL+ RE +    ++ YEIK K IV +N WAIARDPE 
Sbjct  345  DIRNLPYFKAVIKETFRLYPPGPLLIARETMQNSILEGYEIKAKTIVHVNIWAIARDPEI  404

Query  174  WKAPEEFYPERFLDCNIDYKGQNFELIPFGAGRRMCPGM  58
            W+ PEEF PERFL+ +ID KGQNFELIPFGAGRR CP +
Sbjct  405  WENPEEFIPERFLNSDIDLKGQNFELIPFGAGRRGCPAV  443



>ref|XP_009618532.1| PREDICTED: cytochrome P450 83B1-like [Nicotiana tomentosiformis]
Length=497

 Score =   214 bits (546),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 100/159 (63%), Positives = 125/159 (79%), Gaps = 1/159 (1%)
 Frame = -1

Query  534  LTWDHIKAVLMNVFVGGTDTSAVVIIWAMTALMKDPRVMNKVQKEIRELIGEKAGKVYED  355
            LT + IK +LMNV V G+DTSA   +WAMTAL+K+P+ M KVQ EIR+ IG+K G V E+
Sbjct  285  LTLEDIKGILMNVLVAGSDTSAAATVWAMTALIKNPKTMKKVQSEIRKSIGKK-GIVNEE  343

Query  354  DIKQLPYFRAVIKETLRLYTPIPLLVTREIISKCTIDEYEIKPKMIVVINAWAIARDPEY  175
            D++ +PY +AVIKE  RLY P+PLLV RE + K  ++ YEI+P  IV +NAWAIARDPE 
Sbjct  344  DVQNMPYLKAVIKEIFRLYPPVPLLVPRESMEKIILEGYEIRPGTIVHVNAWAIARDPEI  403

Query  174  WKAPEEFYPERFLDCNIDYKGQNFELIPFGAGRRMCPGM  58
            W+ PEEF PERFL+ NIDYKG++FELIPFGAGRR CPG+
Sbjct  404  WENPEEFIPERFLNSNIDYKGKDFELIPFGAGRRGCPGI  442



>ref|XP_003589391.1| Cytochrome P450 [Medicago truncatula]
Length=538

 Score =   215 bits (548),  Expect = 2e-63, Method: Composition-based stats.
 Identities = 106/159 (67%), Positives = 130/159 (82%), Gaps = 1/159 (1%)
 Frame = -1

Query  534  LTWDHIKAVLMNVFVGGTDTSAVVIIWAMTALMKDPRVMNKVQKEIRELIGEKAGKVYED  355
            LT DH+KAVLMN+F+ GTDTS+ V++WAMTALM +PRVMNKVQ EIR L  +K   + ED
Sbjct  324  LTLDHVKAVLMNIFIAGTDTSSAVVVWAMTALMNNPRVMNKVQMEIRNLYEDK-DFINED  382

Query  354  DIKQLPYFRAVIKETLRLYTPIPLLVTREIISKCTIDEYEIKPKMIVVINAWAIARDPEY  175
            DI++LPY ++V+KETLRL+ P PLL+ RE I  C ID YEIKPK +V +NAWAIARDPE 
Sbjct  383  DIEKLPYLKSVVKETLRLFPPSPLLLPRETIESCNIDGYEIKPKTLVYVNAWAIARDPEN  442

Query  174  WKAPEEFYPERFLDCNIDYKGQNFELIPFGAGRRMCPGM  58
            W  PEEFYPERF+  ++D+KG+NFELIPFG+GRRMCP M
Sbjct  443  WNDPEEFYPERFIISSVDFKGKNFELIPFGSGRRMCPAM  481



>ref|XP_009769777.1| PREDICTED: cytochrome P450 83B1-like isoform X1 [Nicotiana sylvestris]
Length=496

 Score =   214 bits (545),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 99/159 (62%), Positives = 123/159 (77%), Gaps = 1/159 (1%)
 Frame = -1

Query  534  LTWDHIKAVLMNVFVGGTDTSAVVIIWAMTALMKDPRVMNKVQKEIRELIGEKAGKVYED  355
            +T D+IKA+LMN+FV GTDT A+ ++W MTAL+ +P+ M KVQ+EIR+ +G+K G V ED
Sbjct  284  ITLDNIKAILMNIFVAGTDTVAISLVWTMTALIMNPKAMKKVQEEIRKSVGKK-GMVNED  342

Query  354  DIKQLPYFRAVIKETLRLYTPIPLLVTREIISKCTIDEYEIKPKMIVVINAWAIARDPEY  175
            DI+   Y +AVIKET RLY P P LV RE I    ++ Y+I PK IV +N WAIARDPEY
Sbjct  343  DIQNFHYLKAVIKETFRLYPPAPTLVARETIQNSILEGYKIPPKTIVYVNYWAIARDPEY  402

Query  174  WKAPEEFYPERFLDCNIDYKGQNFELIPFGAGRRMCPGM  58
            W+ PEEF PERFL+ NIDYKGQ+FE IPFGAGRR CPG+
Sbjct  403  WENPEEFIPERFLNSNIDYKGQDFEFIPFGAGRRGCPGI  441



>ref|XP_007010977.1| Cytochrome P450 [Theobroma cacao]
 gb|EOY19787.1| Cytochrome P450 [Theobroma cacao]
Length=502

 Score =   214 bits (546),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 103/159 (65%), Positives = 122/159 (77%), Gaps = 1/159 (1%)
 Frame = -1

Query  534  LTWDHIKAVLMNVFVGGTDTSAVVIIWAMTALMKDPRVMNKVQKEIRELIGEKAGKVYED  355
            LT+DHIKAVLMN+FV GTDTSA  +IWAMT L+K+PR M KVQ+E+R LIG     V ED
Sbjct  287  LTFDHIKAVLMNMFVAGTDTSAATVIWAMTFLLKNPRSMKKVQEEVRNLIGNN-DFVNED  345

Query  354  DIKQLPYFRAVIKETLRLYTPIPLLVTREIISKCTIDEYEIKPKMIVVINAWAIARDPEY  175
            DI+ LPY +AVIKET RL    PLL+ RE I KC ID YEI  + +V +NAWAI +DPE 
Sbjct  346  DIQDLPYLKAVIKETFRLQPIAPLLLPRETIRKCDIDGYEIPAQTLVFVNAWAIGKDPEA  405

Query  174  WKAPEEFYPERFLDCNIDYKGQNFELIPFGAGRRMCPGM  58
            W+ P EFYPERF+  +IDYKG +FELIPFGAGRR CPG+
Sbjct  406  WENPNEFYPERFIGSSIDYKGLDFELIPFGAGRRGCPGI  444



>ref|XP_009121542.1| PREDICTED: cytochrome P450 71B9-like [Brassica rapa]
Length=247

 Score =   207 bits (527),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 94/159 (59%), Positives = 121/159 (76%), Gaps = 0/159 (0%)
 Frame = -1

Query  534  LTWDHIKAVLMNVFVGGTDTSAVVIIWAMTALMKDPRVMNKVQKEIRELIGEKAGKVYED  355
            LT +HIKA+LMNV +G  +TSA+ + WAM  LM++PR MNKVQ EIR  +G     +  D
Sbjct  35   LTRNHIKAILMNVLLGAINTSAITMTWAMAELMRNPRAMNKVQTEIRNQMGNNRSVITLD  94

Query  354  DIKQLPYFRAVIKETLRLYTPIPLLVTREIISKCTIDEYEIKPKMIVVINAWAIARDPEY  175
            DI QL Y + VIKET RL+ P PLLV RE+IS+  I+ Y+I+PK ++ +NAWAI RDP+ 
Sbjct  95   DIDQLHYLKMVIKETWRLHPPAPLLVPREVISEFEINGYKIQPKTLLHVNAWAIGRDPDT  154

Query  174  WKAPEEFYPERFLDCNIDYKGQNFELIPFGAGRRMCPGM  58
            WK PE F+PERF+D +ID KGQNFEL+PFG+GRR+CPGM
Sbjct  155  WKDPEVFFPERFMDNDIDAKGQNFELLPFGSGRRICPGM  193



>ref|XP_002280459.1| PREDICTED: cytochrome P450 71A1 [Vitis vinifera]
Length=498

 Score =   214 bits (545),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 98/159 (62%), Positives = 126/159 (79%), Gaps = 1/159 (1%)
 Frame = -1

Query  534  LTWDHIKAVLMNVFVGGTDTSAVVIIWAMTALMKDPRVMNKVQKEIRELIGEKAGKVYED  355
            +TWDHIK VLMN+FVGGTD     +IWAMTALMK+PRVM K Q+E+R   G+K G + ED
Sbjct  286  ITWDHIKGVLMNIFVGGTDAGTATVIWAMTALMKNPRVMKKAQEEVRNTFGKK-GFIGED  344

Query  354  DIKQLPYFRAVIKETLRLYTPIPLLVTREIISKCTIDEYEIKPKMIVVINAWAIARDPEY  175
            D+++LPY +AV+KET+RL    PLL+ RE + KC+ID YEI PK +V +NAWAI RDPE 
Sbjct  345  DVEKLPYLKAVVKETMRLLPAAPLLLPRETLQKCSIDGYEIPPKTLVFVNAWAIGRDPEA  404

Query  174  WKAPEEFYPERFLDCNIDYKGQNFELIPFGAGRRMCPGM  58
            W+ PEEF PERFL  ++D++GQN++LIPFGAGRR+CP +
Sbjct  405  WENPEEFIPERFLGSSVDFRGQNYKLIPFGAGRRVCPAI  443



>ref|XP_006358810.1| PREDICTED: cytochrome P450 83B1-like [Solanum tuberosum]
Length=495

 Score =   214 bits (544),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 102/159 (64%), Positives = 124/159 (78%), Gaps = 1/159 (1%)
 Frame = -1

Query  534  LTWDHIKAVLMNVFVGGTDTSAVVIIWAMTALMKDPRVMNKVQKEIRELIGEKAGKVYED  355
            LT + IK +LMNV V G DTSA  I+W MTALMK+P+ M KVQ+EIR+ IG K G V ED
Sbjct  283  LTLEDIKGLLMNVLVAGLDTSAAGIVWTMTALMKNPKAMKKVQEEIRKSIGNK-GIVNED  341

Query  354  DIKQLPYFRAVIKETLRLYTPIPLLVTREIISKCTIDEYEIKPKMIVVINAWAIARDPEY  175
            DI+ +PYF+AVIKE+ RLY P+PLLV RE + K TI+ YEI+   IV +N+WAIARDP  
Sbjct  342  DIQNMPYFKAVIKESFRLYPPVPLLVPRESMKKSTIEGYEIQAGTIVHVNSWAIARDPGI  401

Query  174  WKAPEEFYPERFLDCNIDYKGQNFELIPFGAGRRMCPGM  58
            W+  EEF PERFL+ +IDYKGQN+ELIPFGAGRR CPG+
Sbjct  402  WENSEEFIPERFLNSDIDYKGQNYELIPFGAGRRGCPGI  440



>ref|XP_006435134.1| hypothetical protein CICLE_v10000924mg [Citrus clementina]
 gb|ESR48374.1| hypothetical protein CICLE_v10000924mg [Citrus clementina]
Length=504

 Score =   214 bits (544),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 103/159 (65%), Positives = 122/159 (77%), Gaps = 1/159 (1%)
 Frame = -1

Query  534  LTWDHIKAVLMNVFVGGTDTSAVVIIWAMTALMKDPRVMNKVQKEIRELIGEKAGKVYED  355
            LTWDHIKAVLM+V + GTDTSA  +IWA+T LMK+ RVM KVQ+EIR LI  K   V ED
Sbjct  290  LTWDHIKAVLMDVLIAGTDTSAATLIWALTYLMKNCRVMKKVQEEIRSLIRNK-DFVDED  348

Query  354  DIKQLPYFRAVIKETLRLYTPIPLLVTREIISKCTIDEYEIKPKMIVVINAWAIARDPEY  175
            D+++L Y RAV+KETLR+    PLL+ RE   KC ID YEI  K  V +NAWAI RDPE 
Sbjct  349  DVEKLSYLRAVVKETLRMQPVAPLLIPRETTEKCKIDRYEIPQKTRVFVNAWAIGRDPET  408

Query  174  WKAPEEFYPERFLDCNIDYKGQNFELIPFGAGRRMCPGM  58
            W+ P EFYPERF+D  ID+KGQ+FELIPFGAGRR+CPG+
Sbjct  409  WENPNEFYPERFIDSPIDFKGQHFELIPFGAGRRICPGI  447



>ref|XP_006365696.1| PREDICTED: cytochrome P450 83B1-like [Solanum tuberosum]
Length=449

 Score =   212 bits (540),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 97/159 (61%), Positives = 126/159 (79%), Gaps = 1/159 (1%)
 Frame = -1

Query  534  LTWDHIKAVLMNVFVGGTDTSAVVIIWAMTALMKDPRVMNKVQKEIRELIGEKAGKVYED  355
            L+ + IK +LMNV + G+DTSA V++WAMT L+K+P+ M KVQ+EIR LIG K G V ED
Sbjct  285  LSLEDIKGILMNVLIAGSDTSAAVVVWAMTILIKNPKTMKKVQEEIRNLIGNK-GIVNED  343

Query  354  DIKQLPYFRAVIKETLRLYTPIPLLVTREIISKCTIDEYEIKPKMIVVINAWAIARDPEY  175
            DI+ + Y +AVIKETLRL+ P PLL+ RE +   T++ YE +P+ IV +NAWAIARDPE 
Sbjct  344  DIQNMSYLKAVIKETLRLFPPAPLLIPRESMKISTLEGYEFQPRTIVYVNAWAIARDPEI  403

Query  174  WKAPEEFYPERFLDCNIDYKGQNFELIPFGAGRRMCPGM  58
            W+ PEEF PERFL+ +ID+KGQ++ELIPFGAGRR CPG+
Sbjct  404  WENPEEFMPERFLNSDIDFKGQDYELIPFGAGRRGCPGL  442



>emb|CDP16106.1| unnamed protein product [Coffea canephora]
Length=474

 Score =   213 bits (542),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 97/159 (61%), Positives = 121/159 (76%), Gaps = 1/159 (1%)
 Frame = -1

Query  534  LTWDHIKAVLMNVFVGGTDTSAVVIIWAMTALMKDPRVMNKVQKEIRELIGEKAGKVYED  355
            LTWDHIKA+LMN+F+ GTDTSA  ++WAMTALMK+P  + KVQ EIR+L+G+K G V  +
Sbjct  258  LTWDHIKALLMNIFIAGTDTSAATVVWAMTALMKNPSALKKVQAEIRDLVGQK-GAVVGE  316

Query  354  DIKQLPYFRAVIKETLRLYTPIPLLVTREIISKCTIDEYEIKPKMIVVINAWAIARDPEY  175
             ++QL Y  AVIKE LRLY P P+LV RE    C I+ YEI  K +V IN WAI+RDPE 
Sbjct  317  KLQQLRYLDAVIKEALRLYPPAPVLVARETTQSCNIEGYEIGSKTLVYINDWAISRDPES  376

Query  174  WKAPEEFYPERFLDCNIDYKGQNFELIPFGAGRRMCPGM  58
            W+ P+EF PERFL+  ID +G +FE+IPFGAGRR CPG+
Sbjct  377  WERPDEFIPERFLNNAIDVRGNDFEVIPFGAGRRGCPGI  415



>gb|AIU56748.1| cytochrome P450 CYP71B40v3 [Populus trichocarpa]
Length=507

 Score =   214 bits (544),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 96/159 (60%), Positives = 123/159 (77%), Gaps = 1/159 (1%)
 Frame = -1

Query  534  LTWDHIKAVLMNVFVGGTDTSAVVIIWAMTALMKDPRVMNKVQKEIRELIGEKAGKVYED  355
             T D+IKA+L+N+F+ G DTS++ + WAM  L+++PRVM KVQ E+R+ +G K G+V E 
Sbjct  292  FTKDNIKAILLNLFMAGVDTSSLTVNWAMAELVRNPRVMKKVQDEVRKCVGNK-GRVTES  350

Query  354  DIKQLPYFRAVIKETLRLYTPIPLLVTREIISKCTIDEYEIKPKMIVVINAWAIARDPEY  175
            DI QL Y R VIKETLRL+ P PLL+ RE +S C +  + I PKM+V IN WAI RDP Y
Sbjct  351  DIDQLEYLRMVIKETLRLHPPGPLLIPRETMSHCKVSGHNIYPKMLVQINVWAIGRDPRY  410

Query  174  WKAPEEFYPERFLDCNIDYKGQNFELIPFGAGRRMCPGM  58
            WK PEEF+PERFLD +IDYKGQ+FE +PFG+GRR+CPGM
Sbjct  411  WKDPEEFFPERFLDRSIDYKGQSFEYLPFGSGRRICPGM  449



>gb|EYU38763.1| hypothetical protein MIMGU_mgv1a004763mg [Erythranthe guttata]
Length=511

 Score =   214 bits (544),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 94/159 (59%), Positives = 124/159 (78%), Gaps = 1/159 (1%)
 Frame = -1

Query  534  LTWDHIKAVLMNVFVGGTDTSAVVIIWAMTALMKDPRVMNKVQKEIRELIGEKAGKVYED  355
            LTWDH+KA +M++FV GTDT A  IIW MTALM++P+ M K+Q EIR+ IG K G+V ED
Sbjct  293  LTWDHVKATIMDIFVAGTDTGAATIIWTMTALMQNPKSMKKLQNEIRDSIGGK-GRVDED  351

Query  354  DIKQLPYFRAVIKETLRLYTPIPLLVTREIISKCTIDEYEIKPKMIVVINAWAIARDPEY  175
            D+  LPY +A +KE LRLY P PLL+ RE I +C I+ + I PK +V INAWAIARDP++
Sbjct  352  DLHNLPYLKATVKEALRLYPPAPLLIPRETIEECEIEGHVIHPKTLVYINAWAIARDPDH  411

Query  174  WKAPEEFYPERFLDCNIDYKGQNFELIPFGAGRRMCPGM  58
            W+ P+EF PERFL+ ++D  GQ+F++IPFG+GRR CPG+
Sbjct  412  WERPDEFAPERFLNSSVDIVGQDFQVIPFGSGRRGCPGI  450



>ref|XP_004490658.1| PREDICTED: cytochrome P450 83B1-like [Cicer arietinum]
Length=503

 Score =   213 bits (543),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 97/159 (61%), Positives = 126/159 (79%), Gaps = 1/159 (1%)
 Frame = -1

Query  534  LTWDHIKAVLMNVFVGGTDTSAVVIIWAMTALMKDPRVMNKVQKEIRELIGEKAGKVYED  355
            LT +HIK ++MN+ + GTDT A  ++WAMTALMK+PRVM KVQ EIR+    K G + E+
Sbjct  286  LTSEHIKPLIMNMLLAGTDTIAAAVVWAMTALMKNPRVMQKVQDEIRKAFKGK-GFIEEE  344

Query  354  DIKQLPYFRAVIKETLRLYTPIPLLVTREIISKCTIDEYEIKPKMIVVINAWAIARDPEY  175
            D+++LPY +AVIKE++RLY  +P+L+ RE + KC ID YEI  K +V +NAWAI RDPE 
Sbjct  345  DVQKLPYLKAVIKESMRLYPTLPILLPRETMKKCNIDGYEIPDKTLVFVNAWAIHRDPEA  404

Query  174  WKAPEEFYPERFLDCNIDYKGQNFELIPFGAGRRMCPGM  58
            WK PEEFYPERFL+ +ID KGQ+FELIPFG+GRR+CPG+
Sbjct  405  WKNPEEFYPERFLNSDIDLKGQDFELIPFGSGRRVCPGL  443



>ref|XP_006358824.1| PREDICTED: cytochrome P450 83B1-like [Solanum tuberosum]
Length=494

 Score =   213 bits (542),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 103/159 (65%), Positives = 123/159 (77%), Gaps = 5/159 (3%)
 Frame = -1

Query  534  LTWDHIKAVLMNVFVGGTDTSAVVIIWAMTALMKDPRVMNKVQKEIRELIGEKAGKVYED  355
            LT D+IK    N+ V GTDTSA  +IWAMTALM +P  MNKVQ EIRE +GEK+  V ED
Sbjct  286  LTLDNIK----NMLVAGTDTSAATVIWAMTALMANPNSMNKVQAEIRESVGEKS-IVNED  340

Query  354  DIKQLPYFRAVIKETLRLYTPIPLLVTREIISKCTIDEYEIKPKMIVVINAWAIARDPEY  175
            +++ LPYF+AVIKET RLY  +PLLV RE +    ++ YEIKPK IV +NAWAI RDPE 
Sbjct  341  NVQNLPYFKAVIKETFRLYPAVPLLVARETMQNSILEGYEIKPKTIVYVNAWAIGRDPEI  400

Query  174  WKAPEEFYPERFLDCNIDYKGQNFELIPFGAGRRMCPGM  58
            WK PEEF PERFL+ +ID+KGQ+FELIPFGAGRR CPG+
Sbjct  401  WKNPEEFIPERFLNNDIDFKGQDFELIPFGAGRRGCPGI  439



>ref|XP_002312660.2| hypothetical protein POPTR_0008s18810g [Populus trichocarpa]
 gb|EEE90027.2| hypothetical protein POPTR_0008s18810g [Populus trichocarpa]
Length=507

 Score =   213 bits (543),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 96/159 (60%), Positives = 123/159 (77%), Gaps = 1/159 (1%)
 Frame = -1

Query  534  LTWDHIKAVLMNVFVGGTDTSAVVIIWAMTALMKDPRVMNKVQKEIRELIGEKAGKVYED  355
             T D+IKA+L+N+F+ G DTS++ + WAM  L+++PRVM KVQ E+R+ +G K G+V E 
Sbjct  292  FTKDNIKAILLNLFMAGVDTSSLTVNWAMAELVRNPRVMKKVQDEVRKCVGNK-GRVTES  350

Query  354  DIKQLPYFRAVIKETLRLYTPIPLLVTREIISKCTIDEYEIKPKMIVVINAWAIARDPEY  175
            DI QL Y R VIKETLRL+ P PLL+ RE +S C +  + I PKM+V IN WAI RDP Y
Sbjct  351  DIDQLEYLRMVIKETLRLHPPGPLLIPRETMSHCKVSGHNIYPKMLVQINVWAIGRDPRY  410

Query  174  WKAPEEFYPERFLDCNIDYKGQNFELIPFGAGRRMCPGM  58
            WK PEEF+PERFLD +IDYKGQ+FE +PFG+GRR+CPGM
Sbjct  411  WKDPEEFFPERFLDRSIDYKGQSFEYLPFGSGRRICPGM  449



>ref|XP_006473617.1| PREDICTED: cytochrome P450 71B35-like isoform X2 [Citrus sinensis]
Length=431

 Score =   211 bits (538),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 101/159 (64%), Positives = 123/159 (77%), Gaps = 1/159 (1%)
 Frame = -1

Query  534  LTWDHIKAVLMNVFVGGTDTSAVVIIWAMTALMKDPRVMNKVQKEIRELIGEKAGKVYED  355
            +TWDHIKAVLM+V + GTDT+A  +IWA+T LMK+ RVM KVQ+EIR LI  K   V ED
Sbjct  217  ITWDHIKAVLMDVLIAGTDTTAATLIWALTYLMKNCRVMKKVQEEIRSLIRNK-DFVDED  275

Query  354  DIKQLPYFRAVIKETLRLYTPIPLLVTREIISKCTIDEYEIKPKMIVVINAWAIARDPEY  175
            D+++L Y RAV+KETLR+    PLL+ RE   KC ID YEI  K  V++NAWAI RDPE 
Sbjct  276  DVEKLSYLRAVVKETLRMQPVAPLLIPRETTEKCKIDRYEIPQKTRVLVNAWAIGRDPEA  335

Query  174  WKAPEEFYPERFLDCNIDYKGQNFELIPFGAGRRMCPGM  58
            W+ P EFYPERF+D  ID+KGQ+FELIPFGAGRR+CPG+
Sbjct  336  WENPNEFYPERFIDSPIDFKGQHFELIPFGAGRRICPGL  374



>gb|AES59642.2| cytochrome P450 family 71 protein [Medicago truncatula]
Length=515

 Score =   213 bits (543),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 106/159 (67%), Positives = 130/159 (82%), Gaps = 1/159 (1%)
 Frame = -1

Query  534  LTWDHIKAVLMNVFVGGTDTSAVVIIWAMTALMKDPRVMNKVQKEIRELIGEKAGKVYED  355
            LT DH+KAVLMN+F+ GTDTS+ V++WAMTALM +PRVMNKVQ EIR L  +K   + ED
Sbjct  301  LTLDHVKAVLMNIFIAGTDTSSAVVVWAMTALMNNPRVMNKVQMEIRNLYEDKDF-INED  359

Query  354  DIKQLPYFRAVIKETLRLYTPIPLLVTREIISKCTIDEYEIKPKMIVVINAWAIARDPEY  175
            DI++LPY ++V+KETLRL+ P PLL+ RE I  C ID YEIKPK +V +NAWAIARDPE 
Sbjct  360  DIEKLPYLKSVVKETLRLFPPSPLLLPRETIESCNIDGYEIKPKTLVYVNAWAIARDPEN  419

Query  174  WKAPEEFYPERFLDCNIDYKGQNFELIPFGAGRRMCPGM  58
            W  PEEFYPERF+  ++D+KG+NFELIPFG+GRRMCP M
Sbjct  420  WNDPEEFYPERFIISSVDFKGKNFELIPFGSGRRMCPAM  458



>ref|XP_004490657.1| PREDICTED: cytochrome P450 83B1-like [Cicer arietinum]
Length=501

 Score =   213 bits (542),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 99/159 (62%), Positives = 123/159 (77%), Gaps = 1/159 (1%)
 Frame = -1

Query  534  LTWDHIKAVLMNVFVGGTDTSAVVIIWAMTALMKDPRVMNKVQKEIRELIGEKAGKVYED  355
            LT DHIK ++MN+    TDT A V++W MTALMK+PRVM KVQ EIR+    K G + E+
Sbjct  286  LTSDHIKPLIMNMLFAATDTIAAVVVWTMTALMKNPRVMQKVQDEIRKAYKGK-GFIEEE  344

Query  354  DIKQLPYFRAVIKETLRLYTPIPLLVTREIISKCTIDEYEIKPKMIVVINAWAIARDPEY  175
            D K+LPY  AVIKE++RLY  +P+L+ RE + KC ID YEI  K +V +NAWAI RDPE 
Sbjct  345  DAKKLPYLNAVIKESMRLYPILPILLPRETMKKCNIDGYEIPDKTLVFVNAWAIHRDPET  404

Query  174  WKAPEEFYPERFLDCNIDYKGQNFELIPFGAGRRMCPGM  58
            WK PEEFYPERFLD +ID+KGQ+FELIPFG+GRR+CPG+
Sbjct  405  WKNPEEFYPERFLDSHIDFKGQDFELIPFGSGRRICPGL  443



>ref|XP_006473616.1| PREDICTED: cytochrome P450 71B35-like isoform X1 [Citrus sinensis]
Length=504

 Score =   213 bits (542),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 101/159 (64%), Positives = 123/159 (77%), Gaps = 1/159 (1%)
 Frame = -1

Query  534  LTWDHIKAVLMNVFVGGTDTSAVVIIWAMTALMKDPRVMNKVQKEIRELIGEKAGKVYED  355
            +TWDHIKAVLM+V + GTDT+A  +IWA+T LMK+ RVM KVQ+EIR LI  K   V ED
Sbjct  290  ITWDHIKAVLMDVLIAGTDTTAATLIWALTYLMKNCRVMKKVQEEIRSLIRNK-DFVDED  348

Query  354  DIKQLPYFRAVIKETLRLYTPIPLLVTREIISKCTIDEYEIKPKMIVVINAWAIARDPEY  175
            D+++L Y RAV+KETLR+    PLL+ RE   KC ID YEI  K  V++NAWAI RDPE 
Sbjct  349  DVEKLSYLRAVVKETLRMQPVAPLLIPRETTEKCKIDRYEIPQKTRVLVNAWAIGRDPEA  408

Query  174  WKAPEEFYPERFLDCNIDYKGQNFELIPFGAGRRMCPGM  58
            W+ P EFYPERF+D  ID+KGQ+FELIPFGAGRR+CPG+
Sbjct  409  WENPNEFYPERFIDSPIDFKGQHFELIPFGAGRRICPGL  447



>ref|XP_004247905.1| PREDICTED: cytochrome P450 83B1-like [Solanum lycopersicum]
Length=491

 Score =   212 bits (540),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 100/159 (63%), Positives = 128/159 (81%), Gaps = 1/159 (1%)
 Frame = -1

Query  534  LTWDHIKAVLMNVFVGGTDTSAVVIIWAMTALMKDPRVMNKVQKEIRELIGEKAGKVYED  355
            LT + IK +LMNV V G+DTSA V++WAMTAL+K+P+VM KVQ+EIR+ IG K G V ED
Sbjct  279  LTLEDIKGLLMNVLVAGSDTSAAVVVWAMTALIKNPKVMKKVQEEIRKSIGTK-GVVNED  337

Query  354  DIKQLPYFRAVIKETLRLYTPIPLLVTREIISKCTIDEYEIKPKMIVVINAWAIARDPEY  175
            DI+ + Y +AVIKET RLY P PLL+ RE + K T++ YEI+PK IV INAWAIARDPE 
Sbjct  338  DIQNMSYLKAVIKETFRLYPPDPLLIPRESMKKSTLEGYEIQPKTIVHINAWAIARDPEI  397

Query  174  WKAPEEFYPERFLDCNIDYKGQNFELIPFGAGRRMCPGM  58
            W+ P+EF PERFL+ ++D+K +++ELIPFGAGRR CPG+
Sbjct  398  WENPKEFIPERFLNSDVDFKKEDYELIPFGAGRRGCPGI  436



>ref|XP_003516815.1| PREDICTED: cytochrome P450 83B1-like [Glycine max]
Length=501

 Score =   213 bits (541),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 98/159 (62%), Positives = 124/159 (78%), Gaps = 1/159 (1%)
 Frame = -1

Query  534  LTWDHIKAVLMNVFVGGTDTSAVVIIWAMTALMKDPRVMNKVQKEIRELIGEKAGKVYED  355
            LT  HIK ++MN+ + GTDTSA  ++WAMTALMK P VM K Q+EIR + G K   + ED
Sbjct  289  LTPAHIKPLMMNIILAGTDTSAAAVVWAMTALMKSPIVMKKAQEEIRNIFGGK-DFIEED  347

Query  354  DIKQLPYFRAVIKETLRLYTPIPLLVTREIISKCTIDEYEIKPKMIVVINAWAIARDPEY  175
            DI++LPY +AVIKET+R+Y P+PLL+ RE I KC+I  YEI  K +V +NAWA+ RDPE 
Sbjct  348  DIQKLPYVQAVIKETMRIYPPLPLLLQRETIKKCSIAGYEIPEKTLVYVNAWAVHRDPET  407

Query  174  WKAPEEFYPERFLDCNIDYKGQNFELIPFGAGRRMCPGM  58
            W+ PEEFYPERFLD  ID++G +FELIPFGAGRR+CPG+
Sbjct  408  WEEPEEFYPERFLDSKIDFRGYDFELIPFGAGRRICPGI  446



>gb|KHN02071.1| Cytochrome P450 83B1 [Glycine soja]
Length=497

 Score =   213 bits (541),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 98/159 (62%), Positives = 124/159 (78%), Gaps = 1/159 (1%)
 Frame = -1

Query  534  LTWDHIKAVLMNVFVGGTDTSAVVIIWAMTALMKDPRVMNKVQKEIRELIGEKAGKVYED  355
            LT  HIK ++MN+ + GTDTSA  ++WAMTALMK P VM K Q+EIR + G K   + ED
Sbjct  285  LTPAHIKPLMMNIILAGTDTSAAAVVWAMTALMKSPIVMKKAQEEIRNIFGGK-DFIEED  343

Query  354  DIKQLPYFRAVIKETLRLYTPIPLLVTREIISKCTIDEYEIKPKMIVVINAWAIARDPEY  175
            DI++LPY +AVIKET+R+Y P+PLL+ RE I KC+I  YEI  K +V +NAWA+ RDPE 
Sbjct  344  DIQKLPYVQAVIKETMRIYPPLPLLLQRETIKKCSIAGYEIPEKTLVYVNAWAVHRDPET  403

Query  174  WKAPEEFYPERFLDCNIDYKGQNFELIPFGAGRRMCPGM  58
            W+ PEEFYPERFLD  ID++G +FELIPFGAGRR+CPG+
Sbjct  404  WEEPEEFYPERFLDSKIDFRGYDFELIPFGAGRRICPGI  442



>ref|XP_006386181.1| hypothetical protein POPTR_0002s02690g [Populus trichocarpa]
 gb|ERP63978.1| hypothetical protein POPTR_0002s02690g [Populus trichocarpa]
Length=504

 Score =   213 bits (541),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 97/159 (61%), Positives = 124/159 (78%), Gaps = 1/159 (1%)
 Frame = -1

Query  534  LTWDHIKAVLMNVFVGGTDTSAVVIIWAMTALMKDPRVMNKVQKEIRELIGEKAGKVYED  355
            LT DHIKA+LMN+FVGGTDT+A  +IWAM+ LMK+P  M K Q+E+R++IG+K G VYED
Sbjct  285  LTLDHIKAILMNIFVGGTDTAAATVIWAMSLLMKNPEAMRKAQEEVRKVIGDK-GFVYED  343

Query  354  DIKQLPYFRAVIKETLRLYTPIPLLVTREIISKCTIDEYEIKPKMIVVINAWAIARDPEY  175
            D++QLPY +AV+KET+RL    PLL+ RE  ++C I  YEI  K +V +NAWAI RD E 
Sbjct  344  DVQQLPYLKAVVKETMRLQPTAPLLIPRETTTECNIGGYEIPAKTLVYVNAWAIGRDTEV  403

Query  174  WKAPEEFYPERFLDCNIDYKGQNFELIPFGAGRRMCPGM  58
            W+ P  F P+RFL  +ID KGQ+FELIPFGAGRR+CPG+
Sbjct  404  WENPYVFIPDRFLGSSIDLKGQDFELIPFGAGRRICPGI  442



>ref|XP_002307703.2| hypothetical protein POPTR_0005s25740g [Populus trichocarpa]
 gb|EEE94699.2| hypothetical protein POPTR_0005s25740g [Populus trichocarpa]
Length=482

 Score =   212 bits (539),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 99/159 (62%), Positives = 123/159 (77%), Gaps = 1/159 (1%)
 Frame = -1

Query  534  LTWDHIKAVLMNVFVGGTDTSAVVIIWAMTALMKDPRVMNKVQKEIRELIGEKAGKVYED  355
            L  DHIKAVLMN+FV GTDTSA  + WAMTALMK+PRVMNKVQ+E+R L+G++   V ED
Sbjct  265  LNRDHIKAVLMNIFVAGTDTSAGTLEWAMTALMKEPRVMNKVQEEVRNLVGDRK-LVKED  323

Query  354  DIKQLPYFRAVIKETLRLYTPIPLLVTREIISKCTIDEYEIKPKMIVVINAWAIARDPEY  175
            D+ +LPY +AV+KET RL    PLL+ RE I  C ID Y+I  + +V +NAWAI RDPE 
Sbjct  324  DLLRLPYLKAVVKETWRLRPVAPLLLPRETIQNCNIDGYDIPARTLVFVNAWAIGRDPEA  383

Query  174  WKAPEEFYPERFLDCNIDYKGQNFELIPFGAGRRMCPGM  58
            W+ PEEFYPERF   ++D+KGQ++ELIPFG GRR CPG+
Sbjct  384  WEIPEEFYPERFFGKSVDFKGQDYELIPFGTGRRGCPGI  422



>ref|XP_011045132.1| PREDICTED: cytochrome P450 83B1-like [Populus euphratica]
Length=503

 Score =   212 bits (540),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 98/159 (62%), Positives = 124/159 (78%), Gaps = 1/159 (1%)
 Frame = -1

Query  534  LTWDHIKAVLMNVFVGGTDTSAVVIIWAMTALMKDPRVMNKVQKEIRELIGEKAGKVYED  355
            LT DHIKAVLMN+F+ GTDT+A  + WAMTALMK+PRVM KVQ+E+R L+G++   V ED
Sbjct  286  LTRDHIKAVLMNIFIAGTDTTAGTLEWAMTALMKEPRVMKKVQEEVRNLVGDRK-LVKED  344

Query  354  DIKQLPYFRAVIKETLRLYTPIPLLVTREIISKCTIDEYEIKPKMIVVINAWAIARDPEY  175
            D+ +LPY +AV+KET RL+   PLL+ RE I  C ID Y+I  + +V +NAWAI RDPE 
Sbjct  345  DLLRLPYLKAVVKETWRLHPVAPLLLPRETIQNCNIDGYDIPARTLVYVNAWAIGRDPEA  404

Query  174  WKAPEEFYPERFLDCNIDYKGQNFELIPFGAGRRMCPGM  58
            W+ PEEFYPERF   +ID+KGQ++ELIPFG GRR CPG+
Sbjct  405  WEIPEEFYPERFFGKSIDFKGQDYELIPFGTGRRGCPGI  443



>ref|XP_011074242.1| PREDICTED: cytochrome P450 71B36-like [Sesamum indicum]
Length=502

 Score =   212 bits (540),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 96/159 (60%), Positives = 126/159 (79%), Gaps = 2/159 (1%)
 Frame = -1

Query  534  LTWDHIKAVLMNVFVGGTDTSAVVIIWAMTALMKDPRVMNKVQKEIRELIGEKAGKVYED  355
            LTWDH+KA+LM++F+ G DTS   IIW MTALMK P VM KVQ EIREL+G K GKV E 
Sbjct  291  LTWDHVKAMLMDIFIAGIDTSTASIIWTMTALMKAPDVMKKVQIEIRELVGRK-GKVDEV  349

Query  354  DIKQLPYFRAVIKETLRLYTPIPLLVTREIISKCTIDEYEIKPKMIVVINAWAIARDPEY  175
             I+ LPY RAVI E+LRLY PIPL + RE +  C +++Y+I+ K +V +NAWAIARDPEY
Sbjct  350  YIQNLPYLRAVINESLRLYPPIPL-IPRETMEDCILEDYKIQAKSMVYVNAWAIARDPEY  408

Query  174  WKAPEEFYPERFLDCNIDYKGQNFELIPFGAGRRMCPGM  58
            W+ P+ F+P+RFL+C++D KG +F ++PFG+GRR+CPG+
Sbjct  409  WEDPDTFFPDRFLNCDVDIKGHHFGVLPFGSGRRICPGI  447



>gb|ABC69410.1| CYP71AT2v3 [Nicotiana tabacum]
Length=492

 Score =   212 bits (539),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 98/159 (62%), Positives = 126/159 (79%), Gaps = 1/159 (1%)
 Frame = -1

Query  534  LTWDHIKAVLMNVFVGGTDTSAVVIIWAMTALMKDPRVMNKVQKEIRELIGEKAGKVYED  355
            LT + IK +LMNV V G+DTSA   +WAMTAL+K+P+ M KVQ EIR+ +G+K G V E+
Sbjct  280  LTMEDIKGILMNVLVAGSDTSAAATVWAMTALIKNPKAMEKVQLEIRKSVGKK-GIVNEE  338

Query  354  DIKQLPYFRAVIKETLRLYTPIPLLVTREIISKCTIDEYEIKPKMIVVINAWAIARDPEY  175
            D++ +PYF+AVIKE  RLY P PLLV RE + K  ++ YEI+P+ IV +NAWAIARDPE 
Sbjct  339  DVQNIPYFKAVIKEIFRLYPPAPLLVPRESMEKTILEGYEIRPRTIVHVNAWAIARDPEI  398

Query  174  WKAPEEFYPERFLDCNIDYKGQNFELIPFGAGRRMCPGM  58
            W+ P+EF PERFL+ +IDYKGQ+FEL+PFGAGRR CPG+
Sbjct  399  WENPDEFIPERFLNSSIDYKGQDFELLPFGAGRRGCPGI  437



>ref|XP_004247902.2| PREDICTED: cytochrome P450 71A1-like [Solanum lycopersicum]
Length=497

 Score =   212 bits (539),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 96/159 (60%), Positives = 123/159 (77%), Gaps = 1/159 (1%)
 Frame = -1

Query  534  LTWDHIKAVLMNVFVGGTDTSAVVIIWAMTALMKDPRVMNKVQKEIRELIGEKAGKVYED  355
            LT D+IKA+LMN+F+ GTDTSA+ +IWAMTALMK+P+ M KVQ+E+R+ +G+K G V ED
Sbjct  285  LTLDNIKAILMNLFLAGTDTSAITVIWAMTALMKNPKAMKKVQEEVRKTMGKK-GIVNED  343

Query  354  DIKQLPYFRAVIKETLRLYTPIPLLVTREIISKCTIDEYEIKPKMIVVINAWAIARDPEY  175
            D + + Y +AVIKET RLY P P+LV RE +    +  Y I PK  + +N WAIARDPEY
Sbjct  344  DTQNMSYLKAVIKETFRLYPPAPILVARETMQNSILAGYNIPPKTTIRVNYWAIARDPEY  403

Query  174  WKAPEEFYPERFLDCNIDYKGQNFELIPFGAGRRMCPGM  58
            W+  EEF PERFL+ NID+KGQ++E IPFGAGRR CPG+
Sbjct  404  WENSEEFIPERFLNNNIDFKGQDYEFIPFGAGRRGCPGL  442



>ref|XP_004249946.1| PREDICTED: cytochrome P450 83B1-like [Solanum lycopersicum]
Length=497

 Score =   212 bits (539),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 99/159 (62%), Positives = 126/159 (79%), Gaps = 1/159 (1%)
 Frame = -1

Query  534  LTWDHIKAVLMNVFVGGTDTSAVVIIWAMTALMKDPRVMNKVQKEIRELIGEKAGKVYED  355
            L+ + IK +LMNV + G+DTS+ VIIWAMT L+K+P+ M KVQ+EIR LIG K G V ED
Sbjct  285  LSLEDIKGILMNVLLAGSDTSSSVIIWAMTILIKNPKAMKKVQEEIRNLIGNK-GIVNED  343

Query  354  DIKQLPYFRAVIKETLRLYTPIPLLVTREIISKCTIDEYEIKPKMIVVINAWAIARDPEY  175
            DI+ + Y +AVIKETLRL+ P PLL+ RE +   T++ YE +P+ IV +NAWAIARDPE 
Sbjct  344  DIQNMHYLKAVIKETLRLFPPAPLLIPRESMKISTLEGYEFQPRTIVYVNAWAIARDPEI  403

Query  174  WKAPEEFYPERFLDCNIDYKGQNFELIPFGAGRRMCPGM  58
            W+ PEEF PERFL+ NID+KGQ++ELIPFGAGRR CPG+
Sbjct  404  WENPEEFMPERFLNSNIDFKGQDYELIPFGAGRRGCPGL  442



>gb|ABC69409.1| CYP71AT2v2 [Nicotiana tabacum]
Length=495

 Score =   212 bits (539),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 98/159 (62%), Positives = 126/159 (79%), Gaps = 1/159 (1%)
 Frame = -1

Query  534  LTWDHIKAVLMNVFVGGTDTSAVVIIWAMTALMKDPRVMNKVQKEIRELIGEKAGKVYED  355
            LT + IK +LMNV V G+DTSA   +WAMTAL+K+P+ M KVQ EIR+ +G+K G V E+
Sbjct  283  LTMEDIKGILMNVLVAGSDTSAAATVWAMTALIKNPKAMEKVQLEIRKSVGKK-GIVNEE  341

Query  354  DIKQLPYFRAVIKETLRLYTPIPLLVTREIISKCTIDEYEIKPKMIVVINAWAIARDPEY  175
            D++ +PYF+AVIKE  RLY P PLLV RE + K  ++ YEI+P+ IV +NAWAIARDPE 
Sbjct  342  DVQNIPYFKAVIKEIFRLYPPAPLLVPRESMEKTILEGYEIRPRTIVHVNAWAIARDPEI  401

Query  174  WKAPEEFYPERFLDCNIDYKGQNFELIPFGAGRRMCPGM  58
            W+ P+EF PERFL+ +IDYKGQ+FEL+PFGAGRR CPG+
Sbjct  402  WENPDEFIPERFLNSSIDYKGQDFELLPFGAGRRGCPGI  440



>ref|XP_002301993.2| Cytochrome P450 83A1 family protein [Populus trichocarpa]
 gb|EEE81266.2| Cytochrome P450 83A1 family protein [Populus trichocarpa]
Length=504

 Score =   212 bits (539),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 98/159 (62%), Positives = 123/159 (77%), Gaps = 1/159 (1%)
 Frame = -1

Query  534  LTWDHIKAVLMNVFVGGTDTSAVVIIWAMTALMKDPRVMNKVQKEIRELIGEKAGKVYED  355
            LT DHIKA+LMN+FVGGTDT+A  +IWAM+ LMK P  M K Q+E+R++IG+K G VYED
Sbjct  285  LTLDHIKAILMNIFVGGTDTAAATVIWAMSLLMKKPEAMRKAQEEVRKVIGDK-GFVYED  343

Query  354  DIKQLPYFRAVIKETLRLYTPIPLLVTREIISKCTIDEYEIKPKMIVVINAWAIARDPEY  175
            D++QLPY +AV+KET+RL    PLLV RE  ++C I  YEI  K +V +NAWAI RD E 
Sbjct  344  DVQQLPYLKAVVKETMRLQPTAPLLVPRETTTECNIGGYEIPAKTLVYVNAWAIGRDTEV  403

Query  174  WKAPEEFYPERFLDCNIDYKGQNFELIPFGAGRRMCPGM  58
            W+ P  F P+RFL  +ID KGQ+FELIPFGAGRR+CPG+
Sbjct  404  WENPYVFIPDRFLGSSIDLKGQDFELIPFGAGRRICPGI  442



>ref|XP_006365688.1| PREDICTED: cytochrome P450 83B1-like [Solanum tuberosum]
Length=495

 Score =   211 bits (538),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 98/159 (62%), Positives = 126/159 (79%), Gaps = 1/159 (1%)
 Frame = -1

Query  534  LTWDHIKAVLMNVFVGGTDTSAVVIIWAMTALMKDPRVMNKVQKEIRELIGEKAGKVYED  355
            L+ + IK +LMNV + G+DTSA VIIWAMT L+K+P+ + +VQ+EIR LIG K G V ED
Sbjct  283  LSLEDIKGILMNVLLAGSDTSASVIIWAMTILIKNPKAVKRVQEEIRNLIGNK-GIVNED  341

Query  354  DIKQLPYFRAVIKETLRLYTPIPLLVTREIISKCTIDEYEIKPKMIVVINAWAIARDPEY  175
            DI+ +PYF+AVIKETLRL+ P PLL+ RE +   T++ YE +P+ IV +NAWAIARDPE 
Sbjct  342  DIQNMPYFKAVIKETLRLFPPAPLLIPRESMKISTLEGYEFQPRTIVYVNAWAIARDPEI  401

Query  174  WKAPEEFYPERFLDCNIDYKGQNFELIPFGAGRRMCPGM  58
            W+ PEEF PERFL+ +ID+KGQ++E IPFGAGRR CP M
Sbjct  402  WENPEEFMPERFLNSDIDFKGQDYEFIPFGAGRRRCPAM  440



>ref|XP_007134003.1| hypothetical protein PHAVU_010G010900g [Phaseolus vulgaris]
 gb|ESW05997.1| hypothetical protein PHAVU_010G010900g [Phaseolus vulgaris]
Length=497

 Score =   211 bits (538),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 97/159 (61%), Positives = 121/159 (76%), Gaps = 1/159 (1%)
 Frame = -1

Query  534  LTWDHIKAVLMNVFVGGTDTSAVVIIWAMTALMKDPRVMNKVQKEIRELIGEKAGKVYED  355
            L  DHIKAV MN+ +G TDT++   +WAMTAL+K+PRVM KVQ+E+R L G +   ++ED
Sbjct  285  LQNDHIKAVFMNMLIGATDTTSATTVWAMTALLKNPRVMKKVQEELRNL-GNEKDFLHED  343

Query  354  DIKQLPYFRAVIKETLRLYTPIPLLVTREIISKCTIDEYEIKPKMIVVINAWAIARDPEY  175
            DI++LPY +AVIKETLRL+ P PLLV RE    C ++ YEI  K IV +NAWAI RDP  
Sbjct  344  DIQKLPYLKAVIKETLRLHLPAPLLVQRETNEPCILEGYEIPAKTIVYVNAWAIHRDPNT  403

Query  174  WKAPEEFYPERFLDCNIDYKGQNFELIPFGAGRRMCPGM  58
            WK PEEF PERFLD   D++GQ+FE IPFGAGRR+CPG+
Sbjct  404  WKDPEEFLPERFLDSTTDFRGQDFEFIPFGAGRRICPGI  442



>ref|XP_007017736.1| Cytochrome P450 [Theobroma cacao]
 gb|EOY14961.1| Cytochrome P450 [Theobroma cacao]
Length=500

 Score =   211 bits (538),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 101/159 (64%), Positives = 122/159 (77%), Gaps = 1/159 (1%)
 Frame = -1

Query  534  LTWDHIKAVLMNVFVGGTDTSAVVIIWAMTALMKDPRVMNKVQKEIRELIGEKAGKVYED  355
            LT DHIKAVLM+VF+ GTDTSA  +IW MT LMK+PR M KVQ+E+R LIG+K   V ED
Sbjct  287  LTMDHIKAVLMDVFIAGTDTSAATVIWVMTFLMKNPRCMKKVQEEVRSLIGKK-DFVSED  345

Query  354  DIKQLPYFRAVIKETLRLYTPIPLLVTREIISKCTIDEYEIKPKMIVVINAWAIARDPEY  175
            D + L Y +AVIKET RL   +PLLV RE + KC+I  Y+I  K +V +NAWA+ RDPE 
Sbjct  346  DAQGLTYLKAVIKETFRLQPIVPLLVPRETMRKCSIGGYDIPAKTLVYVNAWAVGRDPEA  405

Query  174  WKAPEEFYPERFLDCNIDYKGQNFELIPFGAGRRMCPGM  58
            W+ PEEFYPERF+  +IDYKG +FELIPFGAGRR CPG+
Sbjct  406  WENPEEFYPERFIGSSIDYKGLDFELIPFGAGRRGCPGI  444



>ref|XP_002510498.1| cytochrome P450, putative [Ricinus communis]
 gb|EEF52685.1| cytochrome P450, putative [Ricinus communis]
Length=496

 Score =   211 bits (538),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 97/159 (61%), Positives = 124/159 (78%), Gaps = 1/159 (1%)
 Frame = -1

Query  534  LTWDHIKAVLMNVFVGGTDTSAVVIIWAMTALMKDPRVMNKVQKEIRELIGEKAGKVYED  355
            LT+DHIKA+LMN+FV GTDTSA  +IWA++ LMK+P  M + Q EIR+L G+K G V ED
Sbjct  283  LTFDHIKAILMNIFVAGTDTSAAAVIWALSFLMKNPEAMRRAQDEIRKLTGKK-GFVNED  341

Query  354  DIKQLPYFRAVIKETLRLYTPIPLLVTREIISKCTIDEYEIKPKMIVVINAWAIARDPEY  175
            +I+QLPY +AV+KET+RL   +PLLV RE I KC +  Y+I P  +V +NAWAI RD E 
Sbjct  342  NIQQLPYLKAVVKETMRLQPAVPLLVPRETIGKCNLGGYDIIPSTLVYVNAWAIGRDTEV  401

Query  174  WKAPEEFYPERFLDCNIDYKGQNFELIPFGAGRRMCPGM  58
            W+ P EF PERFL+ +ID KGQ++ELIPFGAGRR+CPG+
Sbjct  402  WEKPLEFCPERFLESDIDMKGQDYELIPFGAGRRICPGI  440



>ref|XP_003589393.1| Cytochrome P450 [Medicago truncatula]
 gb|AES59644.1| cytochrome P450 family 71 protein [Medicago truncatula]
Length=514

 Score =   212 bits (539),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 106/159 (67%), Positives = 129/159 (81%), Gaps = 1/159 (1%)
 Frame = -1

Query  534  LTWDHIKAVLMNVFVGGTDTSAVVIIWAMTALMKDPRVMNKVQKEIRELIGEKAGKVYED  355
            LT DHIKAVLMN+F+ GTDTS+  ++WAMTALM +PRVMNKVQ EIR L  +K   + ED
Sbjct  300  LTLDHIKAVLMNIFIAGTDTSSAAVVWAMTALMNNPRVMNKVQMEIRNLYEDK-DFINED  358

Query  354  DIKQLPYFRAVIKETLRLYTPIPLLVTREIISKCTIDEYEIKPKMIVVINAWAIARDPEY  175
            DI++LPY ++V+KETLRL+ P PLL+ RE I  C ID YEIKPK +V +NAWAIARDPE 
Sbjct  359  DIEKLPYLKSVVKETLRLFPPSPLLLPRETIESCNIDGYEIKPKTLVYVNAWAIARDPEN  418

Query  174  WKAPEEFYPERFLDCNIDYKGQNFELIPFGAGRRMCPGM  58
            W  PEEFYPERF+  ++D+KG+NFELIPFG+GRRMCP M
Sbjct  419  WNDPEEFYPERFIISSVDFKGKNFELIPFGSGRRMCPAM  457



>ref|XP_006386182.1| hypothetical protein POPTR_0002s02700g [Populus trichocarpa]
 gb|ERP63979.1| hypothetical protein POPTR_0002s02700g [Populus trichocarpa]
Length=470

 Score =   211 bits (536),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 97/159 (61%), Positives = 123/159 (77%), Gaps = 1/159 (1%)
 Frame = -1

Query  534  LTWDHIKAVLMNVFVGGTDTSAVVIIWAMTALMKDPRVMNKVQKEIRELIGEKAGKVYED  355
            LT DHIKA+LMN+FVGGTDT+A  +IWAM+ LMK+P  M K Q+E+R++I +K G VYED
Sbjct  256  LTLDHIKAILMNIFVGGTDTAAATVIWAMSLLMKNPEAMRKAQEEVRKVIADK-GFVYED  314

Query  354  DIKQLPYFRAVIKETLRLYTPIPLLVTREIISKCTIDEYEIKPKMIVVINAWAIARDPEY  175
            D++QLPY +AV+KET+RL    PLLV RE  ++C I  YEI  K +V +NAWAI RD E 
Sbjct  315  DVQQLPYLKAVVKETMRLQPTAPLLVPRETTTECNIGGYEIPAKTLVYVNAWAIGRDTEV  374

Query  174  WKAPEEFYPERFLDCNIDYKGQNFELIPFGAGRRMCPGM  58
            W+ P  F P+RFL  +ID KGQ+FELIPFGAGRR+CPG+
Sbjct  375  WENPYVFIPDRFLGSSIDLKGQDFELIPFGAGRRICPGI  413



>gb|AET50435.1| putative cytochrome P450 [Citrus sinensis]
Length=209

 Score =   202 bits (515),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 92/148 (62%), Positives = 112/148 (76%), Gaps = 0/148 (0%)
 Frame = -1

Query  501  NVFVGGTDTSAVVIIWAMTALMKDPRVMNKVQKEIRELIGEKAGKVYEDDIKQLPYFRAV  322
            ++FV GTDTSA  ++W MT LM  PRVM KVQ+EIR L+G     V EDD+++L Y +AV
Sbjct  1    DIFVAGTDTSAATMVWTMTYLMMHPRVMKKVQEEIRSLVGGNKSFVDEDDVQELHYLKAV  60

Query  321  IKETLRLYTPIPLLVTREIISKCTIDEYEIKPKMIVVINAWAIARDPEYWKAPEEFYPER  142
            +KE +RL  P+PLLV RE   KC +D YEI  K IV +NAWAI RDPE W+ PEEF PER
Sbjct  61   VKEAMRLQPPVPLLVPRETTEKCIVDGYEIPAKTIVYVNAWAIGRDPEAWENPEEFNPER  120

Query  141  FLDCNIDYKGQNFELIPFGAGRRMCPGM  58
            F+D +ID+KGQNFE IPFGAGRR+CPGM
Sbjct  121  FIDRSIDFKGQNFEFIPFGAGRRICPGM  148



>ref|XP_006358769.1| PREDICTED: cytochrome P450 83B1-like [Solanum tuberosum]
Length=495

 Score =   211 bits (536),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 98/159 (62%), Positives = 125/159 (79%), Gaps = 1/159 (1%)
 Frame = -1

Query  534  LTWDHIKAVLMNVFVGGTDTSAVVIIWAMTALMKDPRVMNKVQKEIRELIGEKAGKVYED  355
            LT + IKA++MNV + G++TSA  +IW MTALMK+P+ M KVQ+EIR+ IG K G V ED
Sbjct  283  LTMEDIKAIVMNVLLAGSETSAATVIWTMTALMKNPKAMKKVQEEIRKSIGNK-GIVNED  341

Query  354  DIKQLPYFRAVIKETLRLYTPIPLLVTREIISKCTIDEYEIKPKMIVVINAWAIARDPEY  175
            DI+ + YF+AVIKET RLY  +P L+ RE + K T++ YEI+PK IV +N+WAIARDPE 
Sbjct  342  DIQNMSYFKAVIKETFRLYPSVPTLIPRESMKKSTLEGYEIQPKTIVHVNSWAIARDPEI  401

Query  174  WKAPEEFYPERFLDCNIDYKGQNFELIPFGAGRRMCPGM  58
            W+ PEEF  ERFL+ +ID+KGQ+FELIPFGA RR CPGM
Sbjct  402  WENPEEFMSERFLNSDIDFKGQDFELIPFGARRRGCPGM  440



>ref|XP_007146429.1| hypothetical protein PHAVU_006G039800g [Phaseolus vulgaris]
 gb|ESW18423.1| hypothetical protein PHAVU_006G039800g [Phaseolus vulgaris]
Length=500

 Score =   211 bits (536),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 96/159 (60%), Positives = 124/159 (78%), Gaps = 1/159 (1%)
 Frame = -1

Query  534  LTWDHIKAVLMNVFVGGTDTSAVVIIWAMTALMKDPRVMNKVQKEIRELIGEKAGKVYED  355
            LT  HIK ++MNV + G+DT A  ++WAMTALMK+PRVM K Q+EIR + G K   + E+
Sbjct  288  LTPAHIKPLMMNVILAGSDTIAAAVVWAMTALMKNPRVMKKAQEEIRNVFGGK-DMIEEE  346

Query  354  DIKQLPYFRAVIKETLRLYTPIPLLVTREIISKCTIDEYEIKPKMIVVINAWAIARDPEY  175
            +I++LPY +AVIKETLRLY P+PLLV RE I +C+I+ YEI  K +V +NAWA+ RDPE 
Sbjct  347  EIEKLPYLKAVIKETLRLYPPVPLLVQRETIKECSIEGYEIPEKTLVYVNAWAVHRDPET  406

Query  174  WKAPEEFYPERFLDCNIDYKGQNFELIPFGAGRRMCPGM  58
            W  PEEFYPERFLD  +D++G + ELIPFGAGRR+CPG+
Sbjct  407  WNDPEEFYPERFLDSKVDFRGYDMELIPFGAGRRVCPGI  445



>ref|XP_006358770.1| PREDICTED: cytochrome P450 83B1-like [Solanum tuberosum]
Length=497

 Score =   211 bits (536),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 95/159 (60%), Positives = 125/159 (79%), Gaps = 0/159 (0%)
 Frame = -1

Query  534  LTWDHIKAVLMNVFVGGTDTSAVVIIWAMTALMKDPRVMNKVQKEIRELIGEKAGKVYED  355
            LT + IKA++MNV + G+DTSA  +IW MTALMK+P+ M KVQ+E+R+   +K   + ED
Sbjct  284  LTLEDIKAIVMNVLLAGSDTSAAAVIWTMTALMKNPKAMKKVQEEMRKSFKKKRDILNED  343

Query  354  DIKQLPYFRAVIKETLRLYTPIPLLVTREIISKCTIDEYEIKPKMIVVINAWAIARDPEY  175
            DI+ LPYF+AVIKE+ RLY  +PLL+ RE + K  ++ YEI+P  I+ +NAWAIARDPE 
Sbjct  344  DIQNLPYFKAVIKESFRLYPSVPLLLPRESMEKSILEGYEIQPGTIINVNAWAIARDPEI  403

Query  174  WKAPEEFYPERFLDCNIDYKGQNFELIPFGAGRRMCPGM  58
            W+ PEEF PERFL+ +ID+KGQ+FELIPFGAGRR CPG+
Sbjct  404  WENPEEFIPERFLNSDIDFKGQDFELIPFGAGRRGCPGI  442



>ref|XP_002535120.1| cytochrome P450, putative [Ricinus communis]
 gb|EEF27263.1| cytochrome P450, putative [Ricinus communis]
Length=267

 Score =   204 bits (519),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 101/159 (64%), Positives = 120/159 (75%), Gaps = 1/159 (1%)
 Frame = -1

Query  534  LTWDHIKAVLMNVFVGGTDTSAVVIIWAMTALMKDPRVMNKVQKEIRELIGEKAGKVYED  355
            LT DHIKAVLMNVFVGGTDTSA  ++WAMT LMK+P  M K Q+E+R +IG+K G V E+
Sbjct  55   LTPDHIKAVLMNVFVGGTDTSAATVVWAMTFLMKNPIAMKKAQEEVRHIIGKK-GFVDEE  113

Query  354  DIKQLPYFRAVIKETLRLYTPIPLLVTREIISKCTIDEYEIKPKMIVVINAWAIARDPEY  175
            D +QL Y +AVIKETLRL   IPLLV R+    C +   EI    +V +NAWAI RDPE 
Sbjct  114  DTQQLVYLKAVIKETLRLQPTIPLLVPRKSTQDCNLGGCEIPAHTVVYVNAWAIGRDPEV  173

Query  174  WKAPEEFYPERFLDCNIDYKGQNFELIPFGAGRRMCPGM  58
            W+ PEEF PERF+D  ID KGQ+FELIPFGAGRR+CPG+
Sbjct  174  WENPEEFCPERFIDNPIDLKGQDFELIPFGAGRRICPGI  212



>ref|XP_007017731.1| Cytochrome P450 [Theobroma cacao]
 gb|EOY14956.1| Cytochrome P450 [Theobroma cacao]
Length=500

 Score =   210 bits (535),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 101/159 (64%), Positives = 119/159 (75%), Gaps = 1/159 (1%)
 Frame = -1

Query  534  LTWDHIKAVLMNVFVGGTDTSAVVIIWAMTALMKDPRVMNKVQKEIRELIGEKAGKVYED  355
            LT DHIKAVLMNVF+ GTDTSA  +IW MT L+++PR + KVQ+EIR L G K   V ED
Sbjct  287  LTMDHIKAVLMNVFIAGTDTSAATVIWVMTFLIRNPRCLKKVQEEIRSLTG-KTSFVNED  345

Query  354  DIKQLPYFRAVIKETLRLYTPIPLLVTREIISKCTIDEYEIKPKMIVVINAWAIARDPEY  175
            D++ L Y +AVIKET RL    PLL+ RE   KC I EYEI  K +V +NAWAI RDPE 
Sbjct  346  DVQGLIYLKAVIKETFRLQPVTPLLLPRETKRKCNIGEYEIPSKTLVHVNAWAIGRDPEA  405

Query  174  WKAPEEFYPERFLDCNIDYKGQNFELIPFGAGRRMCPGM  58
            W+ PEEFYPERF+  +IDYKG +FELIPFGAGRR CPG+
Sbjct  406  WENPEEFYPERFIGSSIDYKGLDFELIPFGAGRRGCPGI  444



>gb|KEH29139.1| cytochrome P450 family 71 protein [Medicago truncatula]
Length=345

 Score =   206 bits (524),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 94/159 (59%), Positives = 123/159 (77%), Gaps = 1/159 (1%)
 Frame = -1

Query  534  LTWDHIKAVLMNVFVGGTDTSAVVIIWAMTALMKDPRVMNKVQKEIRELIGEKAGKVYED  355
            + +DHIK +LM++ V  TDT++   +WAMTAL+K+PRVM+KV++EIR L G K   +YED
Sbjct  133  INFDHIKGILMDMLVAATDTTSAASVWAMTALIKNPRVMSKVKEEIRNL-GVKKDFLYED  191

Query  354  DIKQLPYFRAVIKETLRLYTPIPLLVTREIISKCTIDEYEIKPKMIVVINAWAIARDPEY  175
            DI+  PY +A++KETLRL+ P PLLV RE I  CTI  Y I  K I+ +NAWAI RDP+ 
Sbjct  192  DIQNCPYLKAIVKETLRLHLPAPLLVPRESIENCTISGYNIPAKTILYVNAWAIQRDPDI  251

Query  174  WKAPEEFYPERFLDCNIDYKGQNFELIPFGAGRRMCPGM  58
            W  PEEFYPERFL+ +I++ GQ+FELIPFGAGRR+CPG+
Sbjct  252  WINPEEFYPERFLESSINFIGQDFELIPFGAGRRICPGI  290



>ref|XP_011034037.1| PREDICTED: cytochrome P450 71B10-like [Populus euphratica]
Length=507

 Score =   210 bits (535),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 95/159 (60%), Positives = 121/159 (76%), Gaps = 1/159 (1%)
 Frame = -1

Query  534  LTWDHIKAVLMNVFVGGTDTSAVVIIWAMTALMKDPRVMNKVQKEIRELIGEKAGKVYED  355
             T D+IKA+L+N+F+ G DT ++ + WAM  L+++PRVM  VQ E+R+ +G K G+V E 
Sbjct  292  FTKDNIKAILLNLFLAGVDTISLTVNWAMAELVRNPRVMKTVQDEVRKCVGNK-GRVTES  350

Query  354  DIKQLPYFRAVIKETLRLYTPIPLLVTREIISKCTIDEYEIKPKMIVVINAWAIARDPEY  175
            DI QL Y R VIKETLRL+ P PLLV RE +S C +  + I PKM+V IN WAI RDP Y
Sbjct  351  DIDQLEYLRMVIKETLRLHPPGPLLVPRETMSHCKVSGHNIYPKMLVQINVWAIGRDPRY  410

Query  174  WKAPEEFYPERFLDCNIDYKGQNFELIPFGAGRRMCPGM  58
            WK PEEF+PERFLD +IDYKGQ+FE +PFG+GRR+CPGM
Sbjct  411  WKDPEEFFPERFLDSSIDYKGQSFEYLPFGSGRRICPGM  449



>ref|XP_003615846.1| Cytochrome P450 71B35 [Medicago truncatula]
Length=502

 Score =   210 bits (535),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 96/159 (60%), Positives = 127/159 (80%), Gaps = 1/159 (1%)
 Frame = -1

Query  534  LTWDHIKAVLMNVFVGGTDTSAVVIIWAMTALMKDPRVMNKVQKEIRELIGEKAGKVYED  355
            L+ +HIK ++MN+ + GTDT A  ++WAMTALMK+PRVM KVQ+EIR+   E  G + E+
Sbjct  287  LSAEHIKPLIMNMLLAGTDTIAAAVVWAMTALMKNPRVMQKVQEEIRKAY-EGKGFIEEE  345

Query  354  DIKQLPYFRAVIKETLRLYTPIPLLVTREIISKCTIDEYEIKPKMIVVINAWAIARDPEY  175
            D+++LPYF+AVIKE++RLY  +P+L+ RE + KC I+ YEI  K +V INAWAI RDPE 
Sbjct  346  DVQKLPYFKAVIKESMRLYPSLPVLLPRETMKKCDIEGYEIPDKTLVYINAWAIHRDPEA  405

Query  174  WKAPEEFYPERFLDCNIDYKGQNFELIPFGAGRRMCPGM  58
            WK PEEFYPERF+  +ID KGQ+FELIPFG+GRR+CPG+
Sbjct  406  WKDPEEFYPERFIGSDIDLKGQDFELIPFGSGRRVCPGL  444



>gb|ABC69408.1| CYP71AT2v1 [Nicotiana tabacum]
Length=495

 Score =   210 bits (534),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 97/159 (61%), Positives = 125/159 (79%), Gaps = 1/159 (1%)
 Frame = -1

Query  534  LTWDHIKAVLMNVFVGGTDTSAVVIIWAMTALMKDPRVMNKVQKEIRELIGEKAGKVYED  355
            LT + IK +LMNV V G+DTSA   +WAMTAL+K+P+ M KVQ EIR+ +G+K G V E+
Sbjct  283  LTMEDIKGILMNVLVAGSDTSAAATVWAMTALIKNPKAMEKVQLEIRKSVGKK-GIVNEE  341

Query  354  DIKQLPYFRAVIKETLRLYTPIPLLVTREIISKCTIDEYEIKPKMIVVINAWAIARDPEY  175
            D++ +PYF+AVIKE  RLY P PLLV RE + K  ++ YEI+P+ IV +NAWAIARDPE 
Sbjct  342  DVQNIPYFKAVIKEIFRLYPPAPLLVPRESMEKTILEGYEIRPRTIVHVNAWAIARDPEI  401

Query  174  WKAPEEFYPERFLDCNIDYKGQNFELIPFGAGRRMCPGM  58
            W+ P+EF PERFL+ + DYKGQ+FEL+PFGAGRR CPG+
Sbjct  402  WENPDEFIPERFLNSSTDYKGQDFELLPFGAGRRGCPGI  440



>gb|AES98804.2| cytochrome P450 family 71 protein [Medicago truncatula]
Length=506

 Score =   210 bits (535),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 96/159 (60%), Positives = 127/159 (80%), Gaps = 1/159 (1%)
 Frame = -1

Query  534  LTWDHIKAVLMNVFVGGTDTSAVVIIWAMTALMKDPRVMNKVQKEIRELIGEKAGKVYED  355
            L+ +HIK ++MN+ + GTDT A  ++WAMTALMK+PRVM KVQ+EIR+   E  G + E+
Sbjct  291  LSAEHIKPLIMNMLLAGTDTIAAAVVWAMTALMKNPRVMQKVQEEIRKAY-EGKGFIEEE  349

Query  354  DIKQLPYFRAVIKETLRLYTPIPLLVTREIISKCTIDEYEIKPKMIVVINAWAIARDPEY  175
            D+++LPYF+AVIKE++RLY  +P+L+ RE + KC I+ YEI  K +V INAWAI RDPE 
Sbjct  350  DVQKLPYFKAVIKESMRLYPSLPVLLPRETMKKCDIEGYEIPDKTLVYINAWAIHRDPEA  409

Query  174  WKAPEEFYPERFLDCNIDYKGQNFELIPFGAGRRMCPGM  58
            WK PEEFYPERF+  +ID KGQ+FELIPFG+GRR+CPG+
Sbjct  410  WKDPEEFYPERFIGSDIDLKGQDFELIPFGSGRRVCPGL  448



>ref|XP_011028970.1| PREDICTED: cytochrome P450 83B1-like [Populus euphratica]
Length=504

 Score =   210 bits (534),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 97/159 (61%), Positives = 122/159 (77%), Gaps = 1/159 (1%)
 Frame = -1

Query  534  LTWDHIKAVLMNVFVGGTDTSAVVIIWAMTALMKDPRVMNKVQKEIRELIGEKAGKVYED  355
            LT DHIKA+LMN+FVGGTDT+A  +IWAM+ LMK+P  M K Q+E+R++IG+K G VYED
Sbjct  285  LTLDHIKAILMNIFVGGTDTAAAAVIWAMSLLMKNPEAMRKAQEEVRKVIGDK-GFVYED  343

Query  354  DIKQLPYFRAVIKETLRLYTPIPLLVTREIISKCTIDEYEIKPKMIVVINAWAIARDPEY  175
            D+KQLPY +AV+KET+RL    PLL+ RE   +C I  YEI  K +V +NAWAI RD E 
Sbjct  344  DVKQLPYLKAVVKETMRLQPTAPLLIPRETTKECYIGGYEIPAKTLVYVNAWAIGRDTEV  403

Query  174  WKAPEEFYPERFLDCNIDYKGQNFELIPFGAGRRMCPGM  58
            W+ P  F P+RFL  +ID KG +FELIPFGAGRR+CPG+
Sbjct  404  WENPYVFIPDRFLGSSIDLKGNDFELIPFGAGRRICPGI  442



>ref|XP_009591952.1| PREDICTED: cytochrome P450 83B1-like [Nicotiana tomentosiformis]
Length=497

 Score =   209 bits (533),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 91/159 (57%), Positives = 126/159 (79%), Gaps = 0/159 (0%)
 Frame = -1

Query  534  LTWDHIKAVLMNVFVGGTDTSAVVIIWAMTALMKDPRVMNKVQKEIRELIGEKAGKVYED  355
            LT + IKA++MNV + G+DTSA  ++W MTALMK+P+ M KVQ+EIR+ +G+K+  V ED
Sbjct  284  LTLEDIKALVMNVLLAGSDTSAAAVVWTMTALMKNPKAMKKVQEEIRKSVGKKSNIVTED  343

Query  354  DIKQLPYFRAVIKETLRLYTPIPLLVTREIISKCTIDEYEIKPKMIVVINAWAIARDPEY  175
            DI+ LPYF+AVIKE+ RLY P+P+L+ RE + K T+++YEI+P  I+ +N+WAI RDPE 
Sbjct  344  DIQNLPYFKAVIKESFRLYPPVPVLLPRESMEKSTLEQYEIQPGTIIHVNSWAILRDPEI  403

Query  174  WKAPEEFYPERFLDCNIDYKGQNFELIPFGAGRRMCPGM  58
            W+  E+F  ERFL+ NID+KG +F+ IPFGAGRR CPG+
Sbjct  404  WENSEQFIAERFLNSNIDFKGHDFDYIPFGAGRRGCPGI  442



>ref|XP_006358768.1| PREDICTED: cytochrome P450 83B1-like [Solanum tuberosum]
Length=491

 Score =   209 bits (531),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 99/159 (62%), Positives = 126/159 (79%), Gaps = 1/159 (1%)
 Frame = -1

Query  534  LTWDHIKAVLMNVFVGGTDTSAVVIIWAMTALMKDPRVMNKVQKEIRELIGEKAGKVYED  355
            LT + IK +LMNV V G+DTSA V++WAMTALMK+P+VM KVQ+EIR+ IG K G V ED
Sbjct  279  LTMEDIKGLLMNVLVAGSDTSAAVVVWAMTALMKNPKVMKKVQEEIRKSIGTK-GIVNED  337

Query  354  DIKQLPYFRAVIKETLRLYTPIPLLVTREIISKCTIDEYEIKPKMIVVINAWAIARDPEY  175
            DI+ + Y +AVIKET RLY P PLL+ RE + K T++ YEI+   IV INAWAIARDPE 
Sbjct  338  DIQNMSYLKAVIKETFRLYPPDPLLIPRESMKKSTLEGYEIQQGTIVHINAWAIARDPEI  397

Query  174  WKAPEEFYPERFLDCNIDYKGQNFELIPFGAGRRMCPGM  58
            W+ P+EF PERFL+ +ID+K ++++LIPFGAGRR CPG+
Sbjct  398  WENPKEFIPERFLNSDIDFKKEDYQLIPFGAGRRGCPGI  436



>ref|XP_006367342.1| PREDICTED: cytochrome P450 83B1-like [Solanum tuberosum]
Length=503

 Score =   208 bits (530),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 103/164 (63%), Positives = 124/164 (76%), Gaps = 7/164 (4%)
 Frame = -1

Query  534  LTWDHIKAVLMNVFVGGTDTSAVVIIWAMTALMKDP-RVMNKVQKEIRELIGEKAGKVYE  358
            LTWDHIKAVLM++F+ GTDT+A  ++WAMTALMK+    M K+Q+ IREL+G+K G+V E
Sbjct  284  LTWDHIKAVLMDIFIAGTDTNAAALVWAMTALMKEGGSAMRKLQEGIRELVGKK-GRVDE  342

Query  357  DDIKQLPYFRAVIKETLRLYTPIPLLVTREIISKCTIDEYEIKPKMIVVINAWAIARDPE  178
            DDI+ LPY RAVIKETLRLY P PL + RE I KC+ID YEIK    + INAWAI RDPE
Sbjct  343  DDIQNLPYLRAVIKETLRLYPPTPL-IPRETIEKCSIDGYEIKQNTPISINAWAIGRDPE  401

Query  177  YWKAPEEFYPERFLDCN----IDYKGQNFELIPFGAGRRMCPGM  58
             W+ P+EF PERF + N    IDYK   FE+IPFG GRR CPG+
Sbjct  402  CWENPDEFIPERFCNVNNKDIIDYKSGEFEMIPFGGGRRGCPGI  445



>gb|KDP34566.1| hypothetical protein JCGZ_11116 [Jatropha curcas]
Length=506

 Score =   208 bits (530),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 93/156 (60%), Positives = 123/156 (79%), Gaps = 1/156 (1%)
 Frame = -1

Query  525  DHIKAVLMNVFVGGTDTSAVVIIWAMTALMKDPRVMNKVQKEIRELIGEKAGKVYEDDIK  346
             HIKA++MN+F+GG DT A+V++WAM  L+++PRVM K Q+EIR LIG+K  KV E DI 
Sbjct  293  SHIKAIIMNIFLGGVDTGAIVLVWAMAELVRNPRVMRKAQEEIRRLIGDKT-KVSERDIN  351

Query  345  QLPYFRAVIKETLRLYTPIPLLVTREIISKCTIDEYEIKPKMIVVINAWAIARDPEYWKA  166
            +L Y + V+KETLRL+ P  LL+TRE +S+ +I+ YEI PK  V +NAWAI RDP+ WK 
Sbjct  352  KLEYLKMVVKETLRLHPPGTLLITRETMSQFSINGYEIYPKTRVHVNAWAIGRDPKTWKN  411

Query  165  PEEFYPERFLDCNIDYKGQNFELIPFGAGRRMCPGM  58
            PEEF+PERF+D +ID+KGQ++E +PFG GRR CPGM
Sbjct  412  PEEFFPERFIDNSIDFKGQHYEFLPFGGGRRGCPGM  447



>emb|CDY56372.1| BnaAnng14250D [Brassica napus]
Length=495

 Score =   208 bits (529),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 94/159 (59%), Positives = 121/159 (76%), Gaps = 0/159 (0%)
 Frame = -1

Query  534  LTWDHIKAVLMNVFVGGTDTSAVVIIWAMTALMKDPRVMNKVQKEIRELIGEKAGKVYED  355
            LT +HIKA+LMNV +G  +TSA+ + WAM  LM++PR MNKVQ EIR  +G     +  D
Sbjct  283  LTRNHIKAILMNVLLGAINTSAITMTWAMAELMRNPRAMNKVQTEIRNQMGNNRSAITLD  342

Query  354  DIKQLPYFRAVIKETLRLYTPIPLLVTREIISKCTIDEYEIKPKMIVVINAWAIARDPEY  175
            DI QL Y + VIKET RL+ P PLLV RE+IS+  I+ Y+I+PK ++ +NAWAI RDP+ 
Sbjct  343  DIDQLHYLKMVIKETWRLHPPAPLLVPREVISEFEINGYKIQPKTLLHVNAWAIGRDPDT  402

Query  174  WKAPEEFYPERFLDCNIDYKGQNFELIPFGAGRRMCPGM  58
            WK PE F+PERF+D +ID KGQNFEL+PFG+GRR+CPGM
Sbjct  403  WKDPEVFFPERFMDNDIDAKGQNFELLPFGSGRRICPGM  441



>emb|CDY48995.1| BnaA02g28010D [Brassica napus]
Length=457

 Score =   207 bits (526),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 97/159 (61%), Positives = 120/159 (75%), Gaps = 1/159 (1%)
 Frame = -1

Query  534  LTWDHIKAVLMNVFVGGTDTSAVVIIWAMTALMKDPRVMNKVQKEIRELIGEKAGKVYED  355
            LT +HIKA+LMNV +G   TSA+ + WAM  LM++PR M KVQ EIR  IG K+  +  D
Sbjct  243  LTRNHIKAILMNVLLGAISTSAITMTWAMAELMRNPRAMKKVQSEIRNQIGNKS-MITLD  301

Query  354  DIKQLPYFRAVIKETLRLYTPIPLLVTREIISKCTIDEYEIKPKMIVVINAWAIARDPEY  175
            DI+QL Y + VIKET RL+ P PLLV RE++SK  I+ Y I+PK ++ +NAWAI RDPE 
Sbjct  302  DIEQLHYLKMVIKETWRLHPPAPLLVPREVMSKFEINGYMIQPKTLLYVNAWAIGRDPET  361

Query  174  WKAPEEFYPERFLDCNIDYKGQNFELIPFGAGRRMCPGM  58
            WK PE F PERF+D NID KGQNFEL+PFG+GRR+CPGM
Sbjct  362  WKDPEMFLPERFMDNNIDAKGQNFELLPFGSGRRICPGM  400



>ref|XP_007017732.1| Cytochrome P450, putative [Theobroma cacao]
 gb|EOY14957.1| Cytochrome P450, putative [Theobroma cacao]
Length=537

 Score =   209 bits (531),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 101/159 (64%), Positives = 119/159 (75%), Gaps = 1/159 (1%)
 Frame = -1

Query  534  LTWDHIKAVLMNVFVGGTDTSAVVIIWAMTALMKDPRVMNKVQKEIRELIGEKAGKVYED  355
            LT DHIKAVLMNVFV GTDTSA  +IW MT LMK+PR + K Q+E+R L+G+K   V ED
Sbjct  287  LTIDHIKAVLMNVFVAGTDTSAASVIWVMTFLMKNPRCLKKAQEEVRSLMGKK-DFVNED  345

Query  354  DIKQLPYFRAVIKETLRLYTPIPLLVTREIISKCTIDEYEIKPKMIVVINAWAIARDPEY  175
            D + L Y +AVIKET RL   +PLLV RE + K  I  YEI  K +V +NAWAI RDPE 
Sbjct  346  DTQALTYLKAVIKETFRLQAIVPLLVPRETMRKSNISGYEIPAKTLVYVNAWAIGRDPEA  405

Query  174  WKAPEEFYPERFLDCNIDYKGQNFELIPFGAGRRMCPGM  58
            W+ PEEFYPERF+  +IDYKG +FELIPFGAGRR CPG+
Sbjct  406  WENPEEFYPERFIGSSIDYKGLDFELIPFGAGRRGCPGI  444



>emb|CDX99716.1| BnaC02g36040D [Brassica napus]
Length=447

 Score =   206 bits (525),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 96/159 (60%), Positives = 121/159 (76%), Gaps = 1/159 (1%)
 Frame = -1

Query  534  LTWDHIKAVLMNVFVGGTDTSAVVIIWAMTALMKDPRVMNKVQKEIRELIGEKAGKVYED  355
            LT +HIKA+LMNV +G   TSA+ + WAM  LM++PR M KVQ EIR  +G K+  +  D
Sbjct  236  LTRNHIKAILMNVLLGAISTSAITMTWAMAELMRNPRAMKKVQSEIRNQMGNKS-VITLD  294

Query  354  DIKQLPYFRAVIKETLRLYTPIPLLVTREIISKCTIDEYEIKPKMIVVINAWAIARDPEY  175
            DI+QL Y + VIKET RL+TP PLLV RE++S+  I+ Y I+PK ++ +NAWAI RDPE 
Sbjct  295  DIEQLHYLKMVIKETWRLHTPAPLLVPREVMSEFEINGYMIQPKTLLYVNAWAIGRDPET  354

Query  174  WKAPEEFYPERFLDCNIDYKGQNFELIPFGAGRRMCPGM  58
            WK PE F PERF+D NID KGQNFEL+PFG+GRR+CPGM
Sbjct  355  WKDPEMFLPERFMDNNIDAKGQNFELLPFGSGRRICPGM  393



>ref|XP_010256342.1| PREDICTED: cytochrome P450 71A1-like [Nelumbo nucifera]
Length=506

 Score =   208 bits (529),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 98/159 (62%), Positives = 120/159 (75%), Gaps = 1/159 (1%)
 Frame = -1

Query  534  LTWDHIKAVLMNVFVGGTDTSAVVIIWAMTALMKDPRVMNKVQKEIRELIGEKAGKVYED  355
            L  + IKA++MN+F  GTDTS+ V+IWAMT L K+P+VM K Q EIR LIG K G V ED
Sbjct  292  LNMNDIKAMIMNIFFAGTDTSSAVVIWAMTELSKNPKVMQKAQDEIRGLIGNK-GYVDED  350

Query  354  DIKQLPYFRAVIKETLRLYTPIPLLVTREIISKCTIDEYEIKPKMIVVINAWAIARDPEY  175
            D+ Q  Y + VIKETLRL+ P PLLV RE  + CTID ++I PK  V+INAWAI  DPE 
Sbjct  351  DLHQFHYLKCVIKETLRLHPPGPLLVQREARNHCTIDGFDIYPKTRVIINAWAIGMDPET  410

Query  174  WKAPEEFYPERFLDCNIDYKGQNFELIPFGAGRRMCPGM  58
            W+ PEEF PERF D ++D+KGQ++E IPFG+GRRMCPGM
Sbjct  411  WENPEEFLPERFSDGSVDFKGQHYEYIPFGSGRRMCPGM  449



>gb|ABD97102.1| cytochrome P450 monooxygenase CYP83G2 [Medicago truncatula]
Length=502

 Score =   207 bits (528),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 96/159 (60%), Positives = 126/159 (79%), Gaps = 1/159 (1%)
 Frame = -1

Query  534  LTWDHIKAVLMNVFVGGTDTSAVVIIWAMTALMKDPRVMNKVQKEIRELIGEKAGKVYED  355
            L+ +HIK ++MN+ + GTDT A  ++WAMTALMK+PRVM KVQ+EIR+   E  G + E+
Sbjct  287  LSAEHIKPLIMNMLLAGTDTIAAAVVWAMTALMKNPRVMQKVQEEIRKAY-EGKGFIEEE  345

Query  354  DIKQLPYFRAVIKETLRLYTPIPLLVTREIISKCTIDEYEIKPKMIVVINAWAIARDPEY  175
            D+++LPYF+AVIKE++RLY  +P+L+ RE + KC I+ YEI  K I V NAWAI RDPE 
Sbjct  346  DVQKLPYFKAVIKESMRLYPSLPVLLPRETMKKCDIEGYEIPDKNIGVHNAWAIHRDPEA  405

Query  174  WKAPEEFYPERFLDCNIDYKGQNFELIPFGAGRRMCPGM  58
            WK PEEFYPERF+  +ID KGQ+FELIPFG+GRR+CPG+
Sbjct  406  WKDPEEFYPERFIGSDIDLKGQDFELIPFGSGRRVCPGL  444



>emb|CDP21727.1| unnamed protein product, partial [Coffea canephora]
Length=519

 Score =   208 bits (529),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 95/158 (60%), Positives = 120/158 (76%), Gaps = 1/158 (1%)
 Frame = -1

Query  534  LTWDHIKAVLMNVFVGGTDTSAVVIIWAMTALMKDPRVMNKVQKEIRELIGEKAGKVYED  355
            LT +HIKA LMNVF  G++TSA  +IWAMTAL+K+P  + K Q EI+E++GEK   + ED
Sbjct  305  LTVNHIKATLMNVFFAGSETSAGTVIWAMTALIKNPTALEKAQNEIQEVLGEKK-MIDED  363

Query  354  DIKQLPYFRAVIKETLRLYTPIPLLVTREIISKCTIDEYEIKPKMIVVINAWAIARDPEY  175
            DI++LPY +A+IKET+RLY   PLLV R  +  C +D YEI+PK  V +NAWAI RDPEY
Sbjct  364  DIQKLPYLKAIIKETMRLYPVAPLLVPRYTMESCILDGYEIQPKTTVYVNAWAIGRDPEY  423

Query  174  WKAPEEFYPERFLDCNIDYKGQNFELIPFGAGRRMCPG  61
            W+ P EF PERFL+  ID  G++F+LIPFGAGRR CPG
Sbjct  424  WENPHEFLPERFLNSTIDATGKHFQLIPFGAGRRGCPG  461



>ref|XP_004499226.1| PREDICTED: cytochrome P450 71B37-like [Cicer arietinum]
Length=513

 Score =   207 bits (528),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 105/160 (66%), Positives = 131/160 (82%), Gaps = 2/160 (1%)
 Frame = -1

Query  534  LTWDHIKAVLMNVFVGGTDTSAVVIIWAMTALMKDPRVMNKVQKEIRELIGEKAGKVYED  355
            LT DHIKAVLMN+F+ GTDTS+ +++WAMTALM +PRVM KVQ EIR L  +K   + ED
Sbjct  296  LTLDHIKAVLMNIFIAGTDTSSAIVVWAMTALMNNPRVMEKVQAEIRNLYKDKDF-INED  354

Query  354  DIKQLPYFRAVIKETLRLYTPIPLLVTREIISKCTIDEYEIKPKMIVVINAWAIARDPEY  175
            DI++LPY ++VIKETLRL+ P PLL+ RE I  C I+ YEI+PK +V +NAWAIARDPE 
Sbjct  355  DIEKLPYLKSVIKETLRLFPPSPLLLPRETIESCNIEGYEIQPKTLVYVNAWAIARDPEN  414

Query  174  WKAPEEFYPER-FLDCNIDYKGQNFELIPFGAGRRMCPGM  58
            WK PEEFYPER F++ ++D+KG+NFELIPFG+GRRMCP M
Sbjct  415  WKDPEEFYPERFFMNSSVDFKGKNFELIPFGSGRRMCPAM  454



>ref|XP_004228400.1| PREDICTED: cytochrome P450 71A1-like [Solanum lycopersicum]
Length=504

 Score =   207 bits (527),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 102/164 (62%), Positives = 123/164 (75%), Gaps = 7/164 (4%)
 Frame = -1

Query  534  LTWDHIKAVLMNVFVGGTDTSAVVIIWAMTALMKDP-RVMNKVQKEIRELIGEKAGKVYE  358
            LTWDHIKAVLM++F+ GTDT+A  ++WAMTALMK+      K+Q+ IREL+G+K G+VYE
Sbjct  286  LTWDHIKAVLMDIFIAGTDTNAAALVWAMTALMKEGGSARRKLQQGIRELVGKK-GRVYE  344

Query  357  DDIKQLPYFRAVIKETLRLYTPIPLLVTREIISKCTIDEYEIKPKMIVVINAWAIARDPE  178
            DDI+ LPY RAVIKETL+LY P PL + RE + KC ID YEIK    V INAWAI RDPE
Sbjct  345  DDIQNLPYLRAVIKETLKLYPPAPL-IPRETMEKCIIDGYEIKQNTPVSINAWAIGRDPE  403

Query  177  YWKAPEEFYPERFLDCN----IDYKGQNFELIPFGAGRRMCPGM  58
             W+ P+EF PERF D N    +DYK   FE+IPFG GRR CPG+
Sbjct  404  CWENPDEFIPERFCDVNNNGIVDYKSGEFEMIPFGGGRRGCPGI  447



>ref|XP_003521971.1| PREDICTED: cytochrome P450 71A1-like [Glycine max]
Length=498

 Score =   207 bits (526),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 104/159 (65%), Positives = 123/159 (77%), Gaps = 1/159 (1%)
 Frame = -1

Query  534  LTWDHIKAVLMNVFVGGTDTSAVVIIWAMTALMKDPRVMNKVQKEIRELIGEKAGKVYED  355
            LT DHIKAVLM++ V  TDT++   +WAM AL+K+PRVM KVQ+EIR L G K   + ED
Sbjct  286  LTNDHIKAVLMDMLVAATDTTSTTTVWAMVALLKNPRVMKKVQEEIRTL-GGKKDFLDED  344

Query  354  DIKQLPYFRAVIKETLRLYTPIPLLVTREIISKCTIDEYEIKPKMIVVINAWAIARDPEY  175
            DI++ PYF+AVIKETLRLY P PLLV RE    C ID YEI  K IV +NAWAI RDP+ 
Sbjct  345  DIQKFPYFKAVIKETLRLYLPAPLLVQRETNEACIIDGYEIPAKTIVYVNAWAIHRDPKV  404

Query  174  WKAPEEFYPERFLDCNIDYKGQNFELIPFGAGRRMCPGM  58
            WK P+EF PERFLD  ID++GQ+FELIPFGAGRR+CPGM
Sbjct  405  WKDPDEFLPERFLDNTIDFRGQDFELIPFGAGRRICPGM  443



>gb|KDP36954.1| hypothetical protein JCGZ_08245 [Jatropha curcas]
Length=503

 Score =   207 bits (526),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 96/159 (60%), Positives = 120/159 (75%), Gaps = 1/159 (1%)
 Frame = -1

Query  534  LTWDHIKAVLMNVFVGGTDTSAVVIIWAMTALMKDPRVMNKVQKEIRELIGEKAGKVYED  355
            LT DHIKA+LMNVFVGGTDTSA  ++WAMT LMK+P  M K Q+E+R ++G K G V E+
Sbjct  291  LTLDHIKALLMNVFVGGTDTSAATVVWAMTFLMKNPLAMKKAQEEVRSVVGNK-GFVNEE  349

Query  354  DIKQLPYFRAVIKETLRLYTPIPLLVTREIISKCTIDEYEIKPKMIVVINAWAIARDPEY  175
            D + L Y +AVIKET+RL   +PLL+ RE    C +D ++I  K  V +NAWAI RDPE 
Sbjct  350  DTQHLSYMKAVIKETMRLQPTVPLLIARESSQYCCLDGHDIPAKTAVYVNAWAIGRDPEV  409

Query  174  WKAPEEFYPERFLDCNIDYKGQNFELIPFGAGRRMCPGM  58
            W+ PEEF PERF+  +ID KGQ++ELIPFGAGRR+CPGM
Sbjct  410  WENPEEFCPERFVGNSIDLKGQDYELIPFGAGRRICPGM  448



>ref|XP_007044858.1| Cytochrome P450, family 71, subfamily B, polypeptide 36, putative 
[Theobroma cacao]
 gb|EOY00690.1| Cytochrome P450, family 71, subfamily B, polypeptide 36, putative 
[Theobroma cacao]
Length=511

 Score =   207 bits (526),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 91/159 (57%), Positives = 122/159 (77%), Gaps = 1/159 (1%)
 Frame = -1

Query  534  LTWDHIKAVLMNVFVGGTDTSAVVIIWAMTALMKDPRVMNKVQKEIRELIGEKAGKVYED  355
            LT +HIKAVL+N+F+GG DTSA+ + WAM  L + PR+M K Q E+R ++G+K G+V E 
Sbjct  291  LTKNHIKAVLLNMFLGGVDTSALTVNWAMAELSRKPRLMKKAQDEVRSIVGKK-GRVTET  349

Query  354  DIKQLPYFRAVIKETLRLYTPIPLLVTREIISKCTIDEYEIKPKMIVVINAWAIARDPEY  175
            D+ QL Y + V+KETLRL+ P PLL+ RE +S   I++Y I PK ++ INAWAI RDP+Y
Sbjct  350  DLDQLQYLKMVVKETLRLHPPAPLLIARETMSHFKINDYNIYPKTLIQINAWAIGRDPKY  409

Query  174  WKAPEEFYPERFLDCNIDYKGQNFELIPFGAGRRMCPGM  58
            W+ PEEF PERF+D  +D+KGQ+FE +PFGAGRR CPG+
Sbjct  410  WENPEEFSPERFIDSTVDFKGQHFEFLPFGAGRRGCPGL  448



>gb|EYU31746.1| hypothetical protein MIMGU_mgv1a022569mg [Erythranthe guttata]
Length=503

 Score =   207 bits (526),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 98/162 (60%), Positives = 127/162 (78%), Gaps = 5/162 (3%)
 Frame = -1

Query  528  WDHIKAVLMNVFVGGTDTSAVVIIWAMTALMKDPRVMNKVQKEIRELIGEKAGKVYEDDI  349
            W++IKA+LMN+FVGGTDTSA  I+WA+TALMK+P  M K Q+EI+ LI  K   + EDDI
Sbjct  288  WNNIKAILMNIFVGGTDTSASTIVWALTALMKNPSAMKKAQQEIKTLISNKKSSINEDDI  347

Query  348  KQLPYFRAVIKETLRLYTPIPLLVTREIISKCTIDEYEIKPKMIVVINAWAIARDPEYWK  169
            ++LPY +AVIKET+RLY P+PLL+ +E + KCTI+ YEI+PK I  +N WAI RDPEYW+
Sbjct  348  EKLPYLKAVIKETMRLYPPLPLLIPKETMEKCTINGYEIEPKTITFVNVWAIGRDPEYWE  407

Query  168  APEEFYPERFLDCN-----IDYKGQNFELIPFGAGRRMCPGM  58
            +P EF PERFL+ N     ID+KG++F  IPFG+GRR CPG+
Sbjct  408  SPNEFLPERFLNNNNDEKIIDFKGRDFGYIPFGSGRRSCPGL  449



>ref|XP_004247907.1| PREDICTED: cytochrome P450 83B1-like [Solanum lycopersicum]
Length=496

 Score =   206 bits (525),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 93/159 (58%), Positives = 122/159 (77%), Gaps = 1/159 (1%)
 Frame = -1

Query  534  LTWDHIKAVLMNVFVGGTDTSAVVIIWAMTALMKDPRVMNKVQKEIRELIGEKAGKVYED  355
            LT + IKA++MNV + G++TSA  ++W +TALMK+P+ M KVQ+E+R+ IG K G V ED
Sbjct  284  LTLEDIKAIVMNVLLAGSETSAAAVVWTITALMKNPKAMKKVQQELRKSIGNK-GTVNED  342

Query  354  DIKQLPYFRAVIKETLRLYTPIPLLVTREIISKCTIDEYEIKPKMIVVINAWAIARDPEY  175
            DI+ LPYF+AVI E  RLY P PLL+ RE + K T++ YEI+P  IV +NAWAIARD + 
Sbjct  343  DIQNLPYFKAVINEAFRLYPPAPLLIPRETMKKSTLEGYEIQPGTIVHVNAWAIARDSDV  402

Query  174  WKAPEEFYPERFLDCNIDYKGQNFELIPFGAGRRMCPGM  58
            W+  EEF PERF + +ID+KGQ+FE IPFGAGRR CPG+
Sbjct  403  WENSEEFIPERFFNSDIDFKGQDFEFIPFGAGRRGCPGI  441



>ref|XP_006367992.1| PREDICTED: cytochrome P450 83B1-like [Solanum tuberosum]
Length=494

 Score =   206 bits (525),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 96/159 (60%), Positives = 124/159 (78%), Gaps = 2/159 (1%)
 Frame = -1

Query  534  LTWDHIKAVLMNVFVGGTDTSAVVIIWAMTALMKDPRVMNKVQKEIRELIGEKAGKVYED  355
            LT ++IKA++MN+ VGGTDTSA  ++WAMTAL+  P  M KVQ EIRE++G+K+  V E+
Sbjct  285  LTLENIKAIIMNMLVGGTDTSAAAVVWAMTALIAKPNAMKKVQAEIREIVGKKS-IVNEE  343

Query  354  DIKQLPYFRAVIKETLRLYTPIPLLVTREIISKCTIDEYEIKPKMIVVINAWAIARDPEY  175
            DI+ LPYF+AVIKET RL+ P PLL+ RE +    ++ YEI  + I+ +N WAIARDPE 
Sbjct  344  DIQNLPYFKAVIKETFRLFPPGPLLIARETMQNSILEGYEIN-QNIIHVNVWAIARDPEI  402

Query  174  WKAPEEFYPERFLDCNIDYKGQNFELIPFGAGRRMCPGM  58
            W+ PEEF PERFL+ +ID+KGQNFELIPFG+GRR CP M
Sbjct  403  WENPEEFIPERFLNSDIDFKGQNFELIPFGSGRRGCPAM  441



>ref|XP_009802554.1| PREDICTED: cytochrome P450 83B1-like [Nicotiana sylvestris]
Length=495

 Score =   206 bits (524),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 98/159 (62%), Positives = 122/159 (77%), Gaps = 1/159 (1%)
 Frame = -1

Query  534  LTWDHIKAVLMNVFVGGTDTSAVVIIWAMTALMKDPRVMNKVQKEIRELIGEKAGKVYED  355
            LT + IK +LMNV V G+DTSA   +WAMTAL+K+P+ M KVQ EIR+ +G+K G V E+
Sbjct  283  LTMEDIKGLLMNVLVAGSDTSAAATVWAMTALIKNPKAMEKVQTEIRKSVGKK-GIVNEE  341

Query  354  DIKQLPYFRAVIKETLRLYTPIPLLVTREIISKCTIDEYEIKPKMIVVINAWAIARDPEY  175
            D++ +PY +AVIKE  RLY P PLLV RE + K  I+ YEI P  IV +NAWAIARDPE 
Sbjct  342  DVQNMPYLKAVIKEIFRLYPPAPLLVPRESMEKTIIEAYEIWPGTIVYVNAWAIARDPEI  401

Query  174  WKAPEEFYPERFLDCNIDYKGQNFELIPFGAGRRMCPGM  58
            W+  EEF PERFL+ +IDYKGQ+FEL+PFGAGRR CPG+
Sbjct  402  WENSEEFIPERFLNSDIDYKGQDFELLPFGAGRRGCPGI  440



>ref|XP_006358771.1| PREDICTED: cytochrome P450 83B1-like isoform X1 [Solanum tuberosum]
 ref|XP_006358772.1| PREDICTED: cytochrome P450 83B1-like isoform X2 [Solanum tuberosum]
Length=496

 Score =   206 bits (524),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 96/159 (60%), Positives = 122/159 (77%), Gaps = 1/159 (1%)
 Frame = -1

Query  534  LTWDHIKAVLMNVFVGGTDTSAVVIIWAMTALMKDPRVMNKVQKEIRELIGEKAGKVYED  355
            LT + IKA++MNV + G++TSA  ++W MTAL+K+P+ M KVQ+EIR+ IG K G V ED
Sbjct  284  LTLEDIKAIVMNVLLAGSETSAAAVVWTMTALIKNPKAMKKVQEEIRKSIGNK-GIVNED  342

Query  354  DIKQLPYFRAVIKETLRLYTPIPLLVTREIISKCTIDEYEIKPKMIVVINAWAIARDPEY  175
            DI+ +PYF+AVIKE  RLY   PLL+ RE + K T++ YEI+   IV +NAWAIARD E 
Sbjct  343  DIQNMPYFKAVIKEAFRLYPSSPLLLPRETMKKSTLEGYEIQRGTIVQVNAWAIARDSEI  402

Query  174  WKAPEEFYPERFLDCNIDYKGQNFELIPFGAGRRMCPGM  58
            WK  EEF PERFL+ NID+KGQ+FE IPFGAGR+ CPGM
Sbjct  403  WKNSEEFIPERFLNSNIDFKGQDFEFIPFGAGRKGCPGM  441



>ref|XP_007017733.1| Cytochrome P450, putative [Theobroma cacao]
 gb|EOY14958.1| Cytochrome P450, putative [Theobroma cacao]
Length=406

 Score =   204 bits (518),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 100/159 (63%), Positives = 118/159 (74%), Gaps = 1/159 (1%)
 Frame = -1

Query  534  LTWDHIKAVLMNVFVGGTDTSAVVIIWAMTALMKDPRVMNKVQKEIRELIGEKAGKVYED  355
            LT DHIKAVLMNVFV GTDTSA  +IW MT LMK+PR + K Q+E+R L+G+K   V ED
Sbjct  164  LTIDHIKAVLMNVFVAGTDTSAASVIWVMTFLMKNPRCLKKAQEEVRSLMGKK-DFVNED  222

Query  354  DIKQLPYFRAVIKETLRLYTPIPLLVTREIISKCTIDEYEIKPKMIVVINAWAIARDPEY  175
            D + L Y +AVIKET RL   +PLLV RE + K  I  YEI  K +V +NAWAI RDPE 
Sbjct  223  DTQALTYLKAVIKETFRLQAIVPLLVPRETMRKSNISGYEIPAKTLVYVNAWAIGRDPEA  282

Query  174  WKAPEEFYPERFLDCNIDYKGQNFELIPFGAGRRMCPGM  58
            W+ PEEFYPERF+  +IDYKG +FELIPFGAGRR C G+
Sbjct  283  WENPEEFYPERFIGSSIDYKGLDFELIPFGAGRRGCLGI  321



>ref|XP_011028965.1| PREDICTED: cytochrome P450 83B1-like [Populus euphratica]
Length=511

 Score =   206 bits (524),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 94/159 (59%), Positives = 120/159 (75%), Gaps = 1/159 (1%)
 Frame = -1

Query  534  LTWDHIKAVLMNVFVGGTDTSAVVIIWAMTALMKDPRVMNKVQKEIRELIGEKAGKVYED  355
            LT DHIKA+L ++FV GTDT AV +IWAMT LMK+P+ M K Q+E+R L G K G V+ED
Sbjct  288  LTLDHIKAILTDIFVAGTDTGAVTVIWAMTFLMKNPKAMRKAQEEVRNLFGNK-GFVHED  346

Query  354  DIKQLPYFRAVIKETLRLYTPIPLLVTREIISKCTIDEYEIKPKMIVVINAWAIARDPEY  175
            D++QLPY +AV+KET+RL    PLL+ RE   +C +  YEI  K +V +NAWA+ RDPE 
Sbjct  347  DVQQLPYLKAVVKETMRLQPTAPLLIPRETTKECYVAGYEIPTKTLVYVNAWAVGRDPEA  406

Query  174  WKAPEEFYPERFLDCNIDYKGQNFELIPFGAGRRMCPGM  58
            W+ P EF P+RFL  +ID KG +FELIPFGAGRR+CPG+
Sbjct  407  WENPYEFDPDRFLGSSIDLKGNDFELIPFGAGRRICPGI  445



>gb|EYU29507.1| hypothetical protein MIMGU_mgv1a005223mg [Erythranthe guttata]
Length=493

 Score =   206 bits (523),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 94/160 (59%), Positives = 120/160 (75%), Gaps = 1/160 (1%)
 Frame = -1

Query  534  LTWDHIKAVLMNVFVGGTDTSAVVIIWAMTALMKDPRVMNKVQKEIRELIG-EKAGKVYE  358
            +T+DHIKA+LMN+   GTDT++ +++WAMTAL+K+P +M KVQ E+R+L   +    + E
Sbjct  278  ITFDHIKALLMNILTAGTDTTSALLVWAMTALIKNPLIMKKVQTEVRQLATIDNKDLLDE  337

Query  357  DDIKQLPYFRAVIKETLRLYTPIPLLVTREIISKCTIDEYEIKPKMIVVINAWAIARDPE  178
            DDI  LPY RAVIKET RLY P PLL  RE I KC I+ YEI+P  +V +NAWAI RDP+
Sbjct  338  DDISNLPYLRAVIKETFRLYPPAPLLSPRETIQKCRINGYEIEPGTLVYLNAWAIGRDPQ  397

Query  177  YWKAPEEFYPERFLDCNIDYKGQNFELIPFGAGRRMCPGM  58
             W+ P EF PERFL C+ID KG++ ELIPFG GRR CPG+
Sbjct  398  TWENPNEFLPERFLKCDIDLKGKDPELIPFGIGRRRCPGI  437



>ref|XP_011085392.1| PREDICTED: cytochrome P450 83B1-like [Sesamum indicum]
Length=505

 Score =   206 bits (523),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 100/165 (61%), Positives = 118/165 (72%), Gaps = 7/165 (4%)
 Frame = -1

Query  534  LTWDHIKAVLMNVFVGGTDTSAVVIIWAMTALMKDPRVMNKVQKEIRELIGEKAGKVYED  355
            L+WDHIKA+LMN+FV GTDT A  +IWAMT LM +P VM K Q EIR+ IGEK GKV ED
Sbjct  283  LSWDHIKALLMNLFVAGTDTVAAAVIWAMTGLMLNPAVMKKAQTEIRQFIGEK-GKVDED  341

Query  354  DIKQLPYFRAVIKETLRLYTPIPLLVTREIISK-CTIDEYEIKPKMIVVINAWAIARDPE  178
            DIK LPY +AV+ ETLRLY P PLL   +I+ + C +D Y+IKP   V+IN WAI RDPE
Sbjct  342  DIKNLPYLKAVVLETLRLYPPAPLLFRTQILDEDCVVDGYKIKPGTSVIINGWAIGRDPE  401

Query  177  YWKAPEEFYPERFLDCN-----IDYKGQNFELIPFGAGRRMCPGM  58
             W+ PEEF PERF+  N     +  K   FE+IPFG GRR CPGM
Sbjct  402  TWQDPEEFQPERFMTSNGGVVDVSDKTGEFEMIPFGGGRRGCPGM  446



>emb|CBI19817.3| unnamed protein product [Vitis vinifera]
Length=381

 Score =   202 bits (515),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 90/159 (57%), Positives = 118/159 (74%), Gaps = 1/159 (1%)
 Frame = -1

Query  534  LTWDHIKAVLMNVFVGGTDTSAVVIIWAMTALMKDPRVMNKVQKEIRELIGEKAGKVYED  355
            LTWDHIKAVLM+VFV GTD  A  ++WAM  + K+P    K Q+E+R + G K G V ED
Sbjct  205  LTWDHIKAVLMDVFVAGTDPGAATLVWAMAEVTKNPGGKKKAQEELRTVFGRK-GFVDED  263

Query  354  DIKQLPYFRAVIKETLRLYTPIPLLVTREIISKCTIDEYEIKPKMIVVINAWAIARDPEY  175
            D+ +LPY +A++KETLR++ P PLL+T+E +  CTID Y+I PK +V +NAWAI RDPE 
Sbjct  264  DLHKLPYLKALVKETLRVHPPAPLLLTKETLENCTIDAYDIPPKTLVFVNAWAIGRDPEA  323

Query  174  WKAPEEFYPERFLDCNIDYKGQNFELIPFGAGRRMCPGM  58
            W+ PEE  PERFL  ++D+KGQ++ELI F  GRR CPG+
Sbjct  324  WENPEEILPERFLSSSVDFKGQDYELISFSVGRRGCPGI  362



>gb|EYU38764.1| hypothetical protein MIMGU_mgv1a004668mg [Erythranthe guttata]
Length=516

 Score =   206 bits (523),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 98/160 (61%), Positives = 120/160 (75%), Gaps = 3/160 (2%)
 Frame = -1

Query  534  LTWDHIKAVLMNVFVGGTDTSAVVIIWAMTALMKDPRVMNKVQKEIRELIGEKAGKVYED  355
            LTWD++KA LM++FV GTDT    I+W MTALM++P  M K+QKEIR+LIG K GKV ED
Sbjct  301  LTWDNVKATLMDIFVAGTDTGTATIVWTMTALMQNPTAMKKLQKEIRDLIGGK-GKVNED  359

Query  354  DIKQLPYFRAVIKETLRLYTPIPLLVTREIISKCTIDEYEIKPKMIVVINAWAIARDPEY  175
            DI  +PY +AVIKE LRLY P PLL+ R+ + K  I+ Y I PK  + INAWAIARDPEY
Sbjct  360  DIPNIPYLKAVIKEALRLYPPAPLLL-RQTLEKLNIEGYTIPPKTSIFINAWAIARDPEY  418

Query  174  WKAPEEFYPERFLDCN-IDYKGQNFELIPFGAGRRMCPGM  58
            W+ P EF PERFL+ +  D  GQ+F +IPFG+GRR CPGM
Sbjct  419  WENPNEFSPERFLNSDAADVTGQDFRVIPFGSGRRGCPGM  458



>ref|XP_007010975.1| Cytochrome P450, putative [Theobroma cacao]
 gb|EOY19785.1| Cytochrome P450, putative [Theobroma cacao]
Length=509

 Score =   206 bits (523),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 103/173 (60%), Positives = 125/173 (72%), Gaps = 15/173 (9%)
 Frame = -1

Query  534  LTWDHIKAVLM--------------NVFVGGTDTSAVVIIWAMTALMKDPRVMNKVQKEI  397
            LT+DHIKAVLM              N+FVGGTDTSAV++IWAMT L+K+PR M KVQ+E+
Sbjct  282  LTFDHIKAVLMTKSITLCNFFPFMQNMFVGGTDTSAVMVIWAMTFLLKNPRSMKKVQEEV  341

Query  396  RELIGEKAGKVYEDDIKQLPYFRAVIKETLRLYTPIPLLVTREIISKCTIDEYEIKPKMI  217
            R LIG   G V  DDI+ LPY +AVIKET RL    PLL++RE I KC I  +EI  K +
Sbjct  342  RNLIGNN-GFVNADDIQGLPYLKAVIKETFRLQPAAPLLLSRETIRKCDIGGHEIPAKTL  400

Query  216  VVINAWAIARDPEYWKAPEEFYPERFLDCNIDYKGQNFELIPFGAGRRMCPGM  58
            V++NAWAI RDPE  + P+EFYP RF+  +IDYKG +FELIPFGAGRR CPG+
Sbjct  401  VIVNAWAIGRDPEARENPKEFYPARFIGSSIDYKGLDFELIPFGAGRRGCPGL  453



>ref|NP_001240228.1| cytochrome P450 83B1-like precursor [Glycine max]
 gb|ABC68397.1| cytochrome P450 monooxygenase CYP83E8 [Glycine max]
 gb|KHN35611.1| Cytochrome P450 83B1 [Glycine soja]
Length=499

 Score =   205 bits (522),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 98/159 (62%), Positives = 121/159 (76%), Gaps = 1/159 (1%)
 Frame = -1

Query  534  LTWDHIKAVLMNVFVGGTDTSAVVIIWAMTALMKDPRVMNKVQKEIRELIGEKAGKVYED  355
            LT D+IKAVL+N+ VG T T+ V  IWAMT L+K+P +M KVQ+EIR L G+K   + ED
Sbjct  287  LTNDNIKAVLLNLLVGATGTTEVTTIWAMTELIKNPSIMKKVQEEIRGLSGKKDF-LDED  345

Query  354  DIKQLPYFRAVIKETLRLYTPIPLLVTREIISKCTIDEYEIKPKMIVVINAWAIARDPEY  175
            DI++  Y RAVIKETLRL+ P PLL+ RE   KC +D YEI  K ++ +NAWAI RDP+ 
Sbjct  346  DIQKFSYLRAVIKETLRLHLPAPLLIPRETNKKCMLDGYEIPAKTLLYVNAWAIHRDPKA  405

Query  174  WKAPEEFYPERFLDCNIDYKGQNFELIPFGAGRRMCPGM  58
            WK PEEF PERFL+C+ID  GQ+FE IPFGAGRR+CPGM
Sbjct  406  WKDPEEFIPERFLNCDIDLYGQDFEFIPFGAGRRLCPGM  444



>ref|XP_010670952.1| PREDICTED: cytochrome P450 83B1-like [Beta vulgaris subsp. vulgaris]
Length=498

 Score =   205 bits (521),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 93/159 (58%), Positives = 121/159 (76%), Gaps = 1/159 (1%)
 Frame = -1

Query  534  LTWDHIKAVLMNVFVGGTDTSAVVIIWAMTALMKDPRVMNKVQKEIRELIGEKAGKVYED  355
            LT DHIKA+LMN+F+GGTDTS+V+++WAMT L+K+P  M KVQ+EIR  I  K   V + 
Sbjct  286  LTLDHIKALLMNIFIGGTDTSSVMVVWAMTELVKNPHAMKKVQEEIRNGIQNK-DFVEKH  344

Query  354  DIKQLPYFRAVIKETLRLYTPIPLLVTREIISKCTIDEYEIKPKMIVVINAWAIARDPEY  175
            D+ +  YF+AV+KET RL+   PLLV+ E + + TID Y+I PK +V IN WAI RDP+ 
Sbjct  345  DLSKFKYFKAVVKETFRLHPAAPLLVSHEAVKRTTIDGYDILPKTLVYINVWAIGRDPKL  404

Query  174  WKAPEEFYPERFLDCNIDYKGQNFELIPFGAGRRMCPGM  58
            WK PE+F PERF +  ID+KG +FEL+PFGAGRRMCPG+
Sbjct  405  WKDPEKFMPERFFETLIDFKGNDFELLPFGAGRRMCPGL  443



>ref|XP_011077701.1| PREDICTED: cytochrome P450 71A1-like [Sesamum indicum]
Length=501

 Score =   204 bits (520),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 106/159 (67%), Positives = 126/159 (79%), Gaps = 1/159 (1%)
 Frame = -1

Query  534  LTWDHIKAVLMNVFVGGTDTSAVVIIWAMTALMKDPRVMNKVQKEIRELIGEKAGKVYED  355
            LTW+HIKA+LMN+F+ GTDT A  IIWAMTAL+K+P  M KVQ+EIRE IGEK GKV ED
Sbjct  285  LTWNHIKAILMNIFIAGTDTGAAAIIWAMTALIKNPTTMKKVQREIREAIGEK-GKVTED  343

Query  354  DIKQLPYFRAVIKETLRLYTPIPLLVTREIISKCTIDEYEIKPKMIVVINAWAIARDPEY  175
            D+ +L Y  AVIKETLRLY P PLL+ RE + KC I+ Y I PK +V INAWAIARDPEY
Sbjct  344  DLPKLSYLNAVIKETLRLYPPTPLLLPRETLEKCNIEGYIIPPKTLVYINAWAIARDPEY  403

Query  174  WKAPEEFYPERFLDCNIDYKGQNFELIPFGAGRRMCPGM  58
            W  P+EF PERFL+  +D  GQ+F++IPFGAGRR CPG+
Sbjct  404  WDCPDEFVPERFLNTKVDIIGQDFQVIPFGAGRRGCPGI  442



>ref|XP_002300724.2| hypothetical protein POPTR_0002s02740g [Populus trichocarpa]
 gb|EEE79997.2| hypothetical protein POPTR_0002s02740g [Populus trichocarpa]
Length=503

 Score =   204 bits (520),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 93/159 (58%), Positives = 121/159 (76%), Gaps = 1/159 (1%)
 Frame = -1

Query  534  LTWDHIKAVLMNVFVGGTDTSAVVIIWAMTALMKDPRVMNKVQKEIRELIGEKAGKVYED  355
            LT DHIKA+LM++F+ GTDTSAV + WAMT LMK+P+ M K Q+E+R L G K G V+ED
Sbjct  288  LTLDHIKAILMDIFLAGTDTSAVTMNWAMTFLMKNPKAMRKAQEEVRNLFGNK-GFVHED  346

Query  354  DIKQLPYFRAVIKETLRLYTPIPLLVTREIISKCTIDEYEIKPKMIVVINAWAIARDPEY  175
            D++QLPY +AV+KET+RL    PLL+ RE   +C +  YEI  K +V ++AWA+ RDPE 
Sbjct  347  DVQQLPYLKAVVKETMRLQPTAPLLIPRETTKECCVGGYEIPAKTLVYVSAWAVGRDPEA  406

Query  174  WKAPEEFYPERFLDCNIDYKGQNFELIPFGAGRRMCPGM  58
            W+ P EF P+RFL  +ID KG +FELIPFGAGRR+CPG+
Sbjct  407  WENPYEFNPDRFLGSSIDLKGNDFELIPFGAGRRICPGI  445



>gb|AHI49893.1| cytochrome P450, partial [Lavandula angustifolia]
Length=201

 Score =   196 bits (497),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 92/148 (62%), Positives = 111/148 (75%), Gaps = 1/148 (1%)
 Frame = -1

Query  534  LTWDHIKAVLMNVFVGGTDTSAVVIIWAMTALMKDPRVMNKVQKEIRELIGEKAGKVYED  355
            L WDHIKA+LMN+FV  TDTS+  I+W MTALMK P+VM KVQ EIR L+G+K GKV ED
Sbjct  55   LGWDHIKALLMNIFVAATDTSSATIVWTMTALMKSPKVMLKVQSEIRNLVGKK-GKVDED  113

Query  354  DIKQLPYFRAVIKETLRLYTPIPLLVTREIISKCTIDEYEIKPKMIVVINAWAIARDPEY  175
            D+ +LPY +AV KE LRLY P PLLV RE   +CT+D Y+I+PK +V +NAWA+ARD E 
Sbjct  114  DVAKLPYLKAVTKEGLRLYPPAPLLVPRETTERCTLDGYQIQPKTLVHVNAWAVARDSEC  173

Query  174  WKAPEEFYPERFLDCNIDYKGQNFELIP  91
            W+ P EF PERFL  NID  GQ+F   P
Sbjct  174  WEDPNEFIPERFLHNNIDAMGQDFGATP  201



>ref|XP_010272816.1| PREDICTED: cytochrome P450 71A1-like [Nelumbo nucifera]
Length=501

 Score =   204 bits (519),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 91/159 (57%), Positives = 114/159 (72%), Gaps = 1/159 (1%)
 Frame = -1

Query  534  LTWDHIKAVLMNVFVGGTDTSAVVIIWAMTALMKDPRVMNKVQKEIRELIGEKAGKVYED  355
             T D IKA+LM++ + G DT+   ++WAMT L K+P VM K Q E+R LIG K GK+ ED
Sbjct  286  FTLDTIKAILMDILIAGADTTTSTLVWAMTLLAKNPTVMKKAQNEVRSLIGNK-GKITED  344

Query  354  DIKQLPYFRAVIKETLRLYTPIPLLVTREIISKCTIDEYEIKPKMIVVINAWAIARDPEY  175
            D+ Q  Y + VIKETLRL  P PLLV RE +  C ID Y I PK  +++NAW I RDPEY
Sbjct  345  DLHQFHYLKCVIKETLRLQPPAPLLVPRETMKHCIIDGYHIYPKTQLLVNAWTIGRDPEY  404

Query  174  WKAPEEFYPERFLDCNIDYKGQNFELIPFGAGRRMCPGM  58
            W+ PEEF PERF   +ID++GQ+FE IPFG+GRR+CPGM
Sbjct  405  WENPEEFIPERFTKSSIDFRGQHFEFIPFGSGRRICPGM  443



>ref|XP_010687582.1| PREDICTED: cytochrome P450 71D10-like [Beta vulgaris subsp. vulgaris]
Length=496

 Score =   204 bits (519),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 90/159 (57%), Positives = 118/159 (74%), Gaps = 0/159 (0%)
 Frame = -1

Query  534  LTWDHIKAVLMNVFVGGTDTSAVVIIWAMTALMKDPRVMNKVQKEIRELIGEKAGKVYED  355
            LT D+IK V++ +  GG++ S+  + W M+ L+K+PRVM K Q E+RE++ +  G V E 
Sbjct  283  LTTDNIKGVILELLGGGSENSSATLEWTMSELLKNPRVMEKAQIEVREVLCQDKGLVNES  342

Query  354  DIKQLPYFRAVIKETLRLYTPIPLLVTREIISKCTIDEYEIKPKMIVVINAWAIARDPEY  175
             + +L Y + V+KE LRL+ P+PLLV RE + +C I  Y+I PK  VV+NAWAIARDPEY
Sbjct  343  KLHELKYLKLVVKEALRLHPPVPLLVPRESMERCQIYSYDIPPKTRVVVNAWAIARDPEY  402

Query  174  WKAPEEFYPERFLDCNIDYKGQNFELIPFGAGRRMCPGM  58
            W  PEEFYPERF DC++D+KG NFELIPFGAGRR CPGM
Sbjct  403  WTNPEEFYPERFEDCSVDFKGNNFELIPFGAGRRRCPGM  441



>ref|XP_007017735.1| Cytochrome P450, putative [Theobroma cacao]
 gb|EOY14960.1| Cytochrome P450, putative [Theobroma cacao]
Length=526

 Score =   205 bits (521),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 97/159 (61%), Positives = 121/159 (76%), Gaps = 1/159 (1%)
 Frame = -1

Query  534  LTWDHIKAVLMNVFVGGTDTSAVVIIWAMTALMKDPRVMNKVQKEIRELIGEKAGKVYED  355
            L+ DHIKA+L +VF+ GTD+SA V+IW MT LMK+PR + K+Q+E+  LIG+K G V ED
Sbjct  313  LSMDHIKAILKDVFIAGTDSSAAVVIWVMTYLMKNPRCLKKIQEEVISLIGKK-GFVNED  371

Query  354  DIKQLPYFRAVIKETLRLYTPIPLLVTREIISKCTIDEYEIKPKMIVVINAWAIARDPEY  175
            DI+ L Y +AVIKET RL    PLL+ RE I KC I  +EI  K +V +NAWAI RDPE 
Sbjct  372  DIQNLTYLKAVIKETFRLQPIAPLLIPRETIRKCNIGGFEIPTKTLVYVNAWAIGRDPEA  431

Query  174  WKAPEEFYPERFLDCNIDYKGQNFELIPFGAGRRMCPGM  58
            W+ P+EFYPERF+  +IDYKG +FELIPFGAGRR CPG+
Sbjct  432  WENPKEFYPERFIGSSIDYKGLDFELIPFGAGRRGCPGI  470



>ref|XP_011091688.1| PREDICTED: cytochrome P450 71A1-like [Sesamum indicum]
Length=502

 Score =   204 bits (519),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 93/159 (58%), Positives = 117/159 (74%), Gaps = 2/159 (1%)
 Frame = -1

Query  534  LTWDHIKAVLMNVFVGGTDTSAVVIIWAMTALMKDPRVMNKVQKEIRELIGEKAGKVYED  355
            + WDHIK VLMNVFVGGT+TSAV I WAM A++K P+V+ KVQ+EIR L+ EK G + ED
Sbjct  291  IGWDHIKGVLMNVFVGGTETSAVTITWAMAAMIKKPKVLKKVQQEIRTLV-EKKGSIDED  349

Query  354  DIKQLPYFRAVIKETLRLYTPIPLLVTREIISKCTIDEYEIKPKMIVVINAWAIARDPEY  175
            DI  L YF+AV+KETLRLY P PL   R     C +D Y ++P  IV +N WAI RD  +
Sbjct  350  DIHTLAYFKAVVKETLRLYPPAPL-SARVTTKACVVDGYHVEPDTIVYVNLWAIGRDRNF  408

Query  174  WKAPEEFYPERFLDCNIDYKGQNFELIPFGAGRRMCPGM  58
            W+ P EF PERFL+ ++D+KGQ+F  +PFG GRR+CPGM
Sbjct  409  WENPYEFLPERFLNSDVDFKGQDFGFLPFGTGRRVCPGM  447



>ref|XP_003522006.2| PREDICTED: cytochrome P450 83B1-like isoform X1 [Glycine max]
 gb|KHN38816.1| Cytochrome P450 83B1 [Glycine soja]
Length=503

 Score =   204 bits (518),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 94/159 (59%), Positives = 120/159 (75%), Gaps = 1/159 (1%)
 Frame = -1

Query  534  LTWDHIKAVLMNVFVGGTDTSAVVIIWAMTALMKDPRVMNKVQKEIRELIGEKAGKVYED  355
            LT+DHIK VLM++ V GTDT+A   +WAMTAL+K+PRVM KVQ+EIR + G K   + ED
Sbjct  289  LTYDHIKGVLMDILVAGTDTTAATSVWAMTALIKNPRVMKKVQEEIRNVGGTK-DFLDED  347

Query  354  DIKQLPYFRAVIKETLRLYTPIPLLVTREIISKCTIDEYEIKPKMIVVINAWAIARDPEY  175
            D+++L YF+A+IKET RLY P  LLV RE   +C I  Y I  K I+ +NAW I RDPE 
Sbjct  348  DVQKLSYFKAMIKETFRLYPPATLLVPRESNEECIIHGYRIPAKTILYVNAWVIHRDPES  407

Query  174  WKAPEEFYPERFLDCNIDYKGQNFELIPFGAGRRMCPGM  58
            WK P+EF PERFLD ++D++GQ+F+LIPFG GRR CPG+
Sbjct  408  WKNPQEFIPERFLDSDVDFRGQDFQLIPFGTGRRSCPGL  446



>ref|XP_004491826.1| PREDICTED: cytochrome P450 71A1-like [Cicer arietinum]
Length=499

 Score =   203 bits (517),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 96/159 (60%), Positives = 120/159 (75%), Gaps = 2/159 (1%)
 Frame = -1

Query  534  LTWDHIKAVLMNVFVGGTDTSAVVIIWAMTALMKDPRVMNKVQKEIRELIGEKAGKVYED  355
            LT DHIKAV+M++ V  TDTSA   +W MT LMK+PRVM K Q+EIR L G K   + ED
Sbjct  288  LTNDHIKAVVMDLLVAATDTSAATSVWVMTGLMKNPRVMKKAQEEIRNLCGNKEF-IDED  346

Query  354  DIKQLPYFRAVIKETLRLYTPIPLLVTREIISKCTIDEYEIKPKMIVVINAWAIARDPEY  175
            DI++L YF+A+IKETLR Y P PL V RE      ++ Y+I+PK +V +N WAI RDPE 
Sbjct  347  DIQKLVYFKAIIKETLRFYAPAPL-VPRETNKNLNLNGYKIEPKTLVYVNVWAIHRDPET  405

Query  174  WKAPEEFYPERFLDCNIDYKGQNFELIPFGAGRRMCPGM  58
            WK PEEFYPERFL+ ++D+KGQ+FE IPFGAGRR+CPG+
Sbjct  406  WKDPEEFYPERFLNNDVDFKGQDFEFIPFGAGRRICPGI  444



>ref|XP_010674264.1| PREDICTED: cytochrome P450 71A1-like [Beta vulgaris subsp. vulgaris]
Length=312

 Score =   198 bits (504),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 88/159 (55%), Positives = 120/159 (75%), Gaps = 1/159 (1%)
 Frame = -1

Query  534  LTWDHIKAVLMNVFVGGTDTSAVVIIWAMTALMKDPRVMNKVQKEIRELIGEKAGKVYED  355
            LT +HIKAVLM++F+ GTDT++ +++W MT L+K P +M +VQ+E+R+ +  K   +  +
Sbjct  99   LTLEHIKAVLMDIFLAGTDTTSTMVVWTMTELIKHPNIMKRVQEELRKAVQNKE-YINNN  157

Query  354  DIKQLPYFRAVIKETLRLYTPIPLLVTREIISKCTIDEYEIKPKMIVVINAWAIARDPEY  175
            D+K+L YF+AV+KET RL+   PLL+ RE I K TI+ Y+I PK +V +N WAI RDP  
Sbjct  158  DLKELEYFKAVVKETFRLHPATPLLIVRETIRKSTIEGYDILPKTLVYVNVWAIGRDPNS  217

Query  174  WKAPEEFYPERFLDCNIDYKGQNFELIPFGAGRRMCPGM  58
            WK PE F PERFL  +ID+KG +FELIPFGAGRR+CPGM
Sbjct  218  WKDPENFMPERFLGSSIDFKGNDFELIPFGAGRRICPGM  256



>ref|XP_007134823.1| hypothetical protein PHAVU_010G079100g [Phaseolus vulgaris]
 gb|ESW06817.1| hypothetical protein PHAVU_010G079100g [Phaseolus vulgaris]
Length=496

 Score =   203 bits (517),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 98/159 (62%), Positives = 120/159 (75%), Gaps = 1/159 (1%)
 Frame = -1

Query  534  LTWDHIKAVLMNVFVGGTDTSAVVIIWAMTALMKDPRVMNKVQKEIRELIGEKAGKVYED  355
            LT D IKAVLMN+ VG TDT+AV  +W MT+L+K PRVM KVQ+EIR L G+K   + ED
Sbjct  284  LTNDSIKAVLMNILVGATDTTAVTSVWVMTSLLKHPRVMKKVQEEIRSLSGKKPF-LEED  342

Query  354  DIKQLPYFRAVIKETLRLYTPIPLLVTREIISKCTIDEYEIKPKMIVVINAWAIARDPEY  175
            D+++ PY +AVIKETLRL+ P PLLV RE   K  ID YEI  K I+ +NAWAI RDPE 
Sbjct  343  DVQKFPYLQAVIKETLRLHLPAPLLVPRESSKKYMIDGYEIPAKTIIYVNAWAIHRDPEA  402

Query  174  WKAPEEFYPERFLDCNIDYKGQNFELIPFGAGRRMCPGM  58
            W+  EEF PERFL+  ID++GQ+F  IPFGAGR++CPGM
Sbjct  403  WEDAEEFKPERFLNSTIDHRGQDFCFIPFGAGRKICPGM  441



>ref|XP_006438217.1| hypothetical protein CICLE_v10033591mg [Citrus clementina]
 gb|ESR51457.1| hypothetical protein CICLE_v10033591mg [Citrus clementina]
Length=509

 Score =   203 bits (516),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 86/159 (54%), Positives = 122/159 (77%), Gaps = 1/159 (1%)
 Frame = -1

Query  534  LTWDHIKAVLMNVFVGGTDTSAVVIIWAMTALMKDPRVMNKVQKEIRELIGEKAGKVYED  355
            LT DHIKAVL+++ + G DTSAV +IWAM+ L ++PRVM+K Q E+R+ IG K G + ED
Sbjct  292  LTTDHIKAVLVDLLLAGVDTSAVTVIWAMSELARNPRVMSKAQDEVRKCIG-KNGSITED  350

Query  354  DIKQLPYFRAVIKETLRLYTPIPLLVTREIISKCTIDEYEIKPKMIVVINAWAIARDPEY  175
            +++QL Y + +IKET RL+ P P+L+ R+ IS C I+ Y++ P+ ++ +N WAI RD  Y
Sbjct  351  NMEQLQYLKMIIKETFRLHPPGPMLLPRQTISHCKINGYDVNPETLLQVNVWAIGRDSRY  410

Query  174  WKAPEEFYPERFLDCNIDYKGQNFELIPFGAGRRMCPGM  58
            W   EEF+PERF+D ++D+KGQNFEL+PFG GRR+CPG+
Sbjct  411  WSKAEEFFPERFIDNSVDFKGQNFELLPFGGGRRICPGI  449



>ref|XP_002300723.2| hypothetical protein POPTR_0002s02800g [Populus trichocarpa]
 gb|EEE79996.2| hypothetical protein POPTR_0002s02800g [Populus trichocarpa]
Length=513

 Score =   202 bits (515),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 93/159 (58%), Positives = 120/159 (75%), Gaps = 1/159 (1%)
 Frame = -1

Query  534  LTWDHIKAVLMNVFVGGTDTSAVVIIWAMTALMKDPRVMNKVQKEIRELIGEKAGKVYED  355
            LT DHIKA+LM++F+ GTDTSAV + WAMT LMK+P+ M K Q+E+R L G K G V ED
Sbjct  288  LTLDHIKAILMDIFLAGTDTSAVTMNWAMTFLMKNPKAMRKAQEEVRNLFGNK-GFVDED  346

Query  354  DIKQLPYFRAVIKETLRLYTPIPLLVTREIISKCTIDEYEIKPKMIVVINAWAIARDPEY  175
            D++QLPY +AV+KET+RL    PLL+ RE   +C +  YEI  K +V ++AWA+ RDPE 
Sbjct  347  DVQQLPYLKAVVKETMRLQPTAPLLIPRETTKECCVGGYEIPAKTLVYVSAWAVGRDPEA  406

Query  174  WKAPEEFYPERFLDCNIDYKGQNFELIPFGAGRRMCPGM  58
            W+ P EF P+RFL  +ID KG +FELIPFGAGRR+CPG+
Sbjct  407  WENPYEFNPDRFLGSSIDLKGNDFELIPFGAGRRICPGI  445



>dbj|BAF98468.1| cytochrome P450 [Coptis japonica var. dissecta]
Length=499

 Score =   202 bits (514),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 90/159 (57%), Positives = 122/159 (77%), Gaps = 1/159 (1%)
 Frame = -1

Query  534  LTWDHIKAVLMNVFVGGTDTSAVVIIWAMTALMKDPRVMNKVQKEIRELIGEKAGKVYED  355
            LT   +K +LMNVF+GG +TSA+ ++W MT L ++P+VM KVQ+EIR  +G+K G+V E 
Sbjct  285  LTISQVKGILMNVFIGGVETSALTMVWTMTELARNPKVMKKVQEEIRNCVGKK-GRVEEI  343

Query  354  DIKQLPYFRAVIKETLRLYTPIPLLVTREIISKCTIDEYEIKPKMIVVINAWAIARDPEY  175
             I QLPYF+ V+KETLRL+ P PLLV RE +S C I+ Y++ PK  V++NAW IAR  EY
Sbjct  344  YINQLPYFKMVVKETLRLHPPGPLLVPRECMSHCKINGYDVYPKTRVLVNAWGIARSSEY  403

Query  174  WKAPEEFYPERFLDCNIDYKGQNFELIPFGAGRRMCPGM  58
            W+ P+EF PERF + ++D+KGQ+FE +PFG+GRR CPGM
Sbjct  404  WEKPDEFIPERFQNSSVDFKGQDFEYLPFGSGRRACPGM  442



>gb|AAL24049.1|AF426451_1 cytochrome P450 [Citrus sinensis]
Length=500

 Score =   202 bits (514),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 91/159 (57%), Positives = 122/159 (77%), Gaps = 1/159 (1%)
 Frame = -1

Query  534  LTWDHIKAVLMNVFVGGTDTSAVVIIWAMTALMKDPRVMNKVQKEIRELIGEKAGKVYED  355
            LT +HIKAVL+N+F+GG DTSA+ +IWAM  L K+PR+M K Q EIR  IG K G+V E 
Sbjct  283  LTKNHIKAVLLNIFLGGVDTSAITVIWAMAELCKNPRLMKKAQAEIRNHIGNK-GRVTEA  341

Query  354  DIKQLPYFRAVIKETLRLYTPIPLLVTREIISKCTIDEYEIKPKMIVVINAWAIARDPEY  175
            DI QL Y + VIKETLRL+ P PLL+ R+ + +  ++ Y+I PK ++ +NAWAI RD +Y
Sbjct  342  DIDQLQYLKMVIKETLRLHPPAPLLIARDTLYRFKVNGYDIYPKTLIQVNAWAIGRDSKY  401

Query  174  WKAPEEFYPERFLDCNIDYKGQNFELIPFGAGRRMCPGM  58
            W++PEEF PERF+D  +D KGQ+FE +PFG+GRR+CPG+
Sbjct  402  WESPEEFIPERFIDKPVDVKGQDFEYLPFGSGRRICPGI  440



>ref|XP_003521997.1| PREDICTED: cytochrome P450 83B1-like [Glycine max]
Length=502

 Score =   202 bits (514),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 102/159 (64%), Positives = 124/159 (78%), Gaps = 1/159 (1%)
 Frame = -1

Query  534  LTWDHIKAVLMNVFVGGTDTSAVVIIWAMTALMKDPRVMNKVQKEIRELIGEKAGKVYED  355
            LT+DHIK VLMN+   GTDT+A   +WAMTAL+K+PRVM KVQ+E+R + G K   + ED
Sbjct  288  LTYDHIKGVLMNILAAGTDTTAATSVWAMTALVKNPRVMKKVQEEVRNVGGTKDF-LDED  346

Query  354  DIKQLPYFRAVIKETLRLYTPIPLLVTREIISKCTIDEYEIKPKMIVVINAWAIARDPEY  175
            DI++LPYF+A+IKETLRL+ P PLLV RE   +C +D Y I  K IV +NAW I RDPE 
Sbjct  347  DIQKLPYFKAMIKETLRLHLPGPLLVPRESTEECIVDGYRIPAKTIVYVNAWVIQRDPEV  406

Query  174  WKAPEEFYPERFLDCNIDYKGQNFELIPFGAGRRMCPGM  58
            WK PEEF PERFLD  IDY+GQ+FELIPFGAGRR+CPG+
Sbjct  407  WKNPEEFCPERFLDSAIDYRGQDFELIPFGAGRRICPGI  445



>gb|ACU18750.1| unknown [Glycine max]
Length=502

 Score =   202 bits (514),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 102/159 (64%), Positives = 124/159 (78%), Gaps = 1/159 (1%)
 Frame = -1

Query  534  LTWDHIKAVLMNVFVGGTDTSAVVIIWAMTALMKDPRVMNKVQKEIRELIGEKAGKVYED  355
            LT+DHIK VLMN+   GTDT+A   +WAMTAL+K+PRVM KVQ+E+R + G K   + ED
Sbjct  288  LTYDHIKGVLMNILAAGTDTTAATSVWAMTALVKNPRVMKKVQEEVRNVGGTKDF-LDED  346

Query  354  DIKQLPYFRAVIKETLRLYTPIPLLVTREIISKCTIDEYEIKPKMIVVINAWAIARDPEY  175
            DI++LPYF+A+IKETLRL+ P PLLV RE   +C +D Y I  K IV +NAW I RDPE 
Sbjct  347  DIQKLPYFKAMIKETLRLHLPGPLLVPRESTEECIVDGYRIPAKTIVYVNAWVIQRDPEV  406

Query  174  WKAPEEFYPERFLDCNIDYKGQNFELIPFGAGRRMCPGM  58
            WK PEEF PERFLD  IDY+GQ+FELIPFGAGRR+CPG+
Sbjct  407  WKNPEEFCPERFLDSAIDYRGQDFELIPFGAGRRICPGI  445



>ref|XP_010502533.1| PREDICTED: cytochrome P450 71B25-like [Camelina sativa]
Length=495

 Score =   202 bits (513),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 90/159 (57%), Positives = 121/159 (76%), Gaps = 1/159 (1%)
 Frame = -1

Query  534  LTWDHIKAVLMNVFVGGTDTSAVVIIWAMTALMKDPRVMNKVQKEIRELIGEKAGKVYED  355
            LT DH+K +  ++F+ G DTSA+ +IWAM  L+++PRVM K Q+EIR  IG KA ++ E+
Sbjct  285  LTIDHLKGISQDIFLAGIDTSAITMIWAMAELVRNPRVMKKAQEEIRNCIGIKA-RIEEE  343

Query  354  DIKQLPYFRAVIKETLRLYTPIPLLVTREIISKCTIDEYEIKPKMIVVINAWAIARDPEY  175
            D+ +L Y + VIKETLRL+   PLL+ RE ++   I  Y+I  K +V++NAW+I RDP+Y
Sbjct  344  DVNKLEYLKLVIKETLRLHPAAPLLLPRETMADIKIQGYDIPRKTLVLVNAWSIGRDPKY  403

Query  174  WKAPEEFYPERFLDCNIDYKGQNFELIPFGAGRRMCPGM  58
            WK PEEF PERF+DC +DYKGQNFE IPFG+GRR+CPGM
Sbjct  404  WKNPEEFNPERFIDCPVDYKGQNFEFIPFGSGRRICPGM  442



>ref|XP_010670964.1| PREDICTED: cytochrome P450 71B9-like [Beta vulgaris subsp. vulgaris]
Length=496

 Score =   202 bits (513),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 93/159 (58%), Positives = 119/159 (75%), Gaps = 1/159 (1%)
 Frame = -1

Query  534  LTWDHIKAVLMNVFVGGTDTSAVVIIWAMTALMKDPRVMNKVQKEIRELIGEKAGKVYED  355
            LT DHIKA+LMN+F+GGTDTS+V+++WAMT L+K+P  M KVQ EIR  I  K G V   
Sbjct  285  LTLDHIKALLMNIFIGGTDTSSVMVVWAMTELVKNPHAMKKVQDEIRNAIQNK-GFVERY  343

Query  354  DIKQLPYFRAVIKETLRLYTPIPLLVTREIISKCTIDEYEIKPKMIVVINAWAIARDPEY  175
            D+ +  YF+AV+KET RL+   PLLV  E + + TI  Y+I PK +V IN WAI RDP+ 
Sbjct  344  DLPKFKYFKAVVKETFRLHPAAPLLVPHEAVKRTTIYGYDILPKTLVYINVWAIGRDPKL  403

Query  174  WKAPEEFYPERFLDCNIDYKGQNFELIPFGAGRRMCPGM  58
            WK PE+F PERF + +ID+KG +FEL+PFGAGRRMCPG+
Sbjct  404  WKDPEKFMPERFFETSIDFKGNDFELLPFGAGRRMCPGL  442



>gb|KHN38814.1| Cytochrome P450 83B1 [Glycine soja]
Length=499

 Score =   202 bits (513),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 102/159 (64%), Positives = 124/159 (78%), Gaps = 1/159 (1%)
 Frame = -1

Query  534  LTWDHIKAVLMNVFVGGTDTSAVVIIWAMTALMKDPRVMNKVQKEIRELIGEKAGKVYED  355
            LT+DHIK VLMN+   GTDT+A   +WAMTAL+K+PRVM KVQ+E+R + G K   + ED
Sbjct  285  LTYDHIKGVLMNILAAGTDTTAATSVWAMTALVKNPRVMKKVQEEVRNVGGTKDF-LDED  343

Query  354  DIKQLPYFRAVIKETLRLYTPIPLLVTREIISKCTIDEYEIKPKMIVVINAWAIARDPEY  175
            DI++LPYF+A+IKETLRL+ P PLLV RE   +C +D Y I  K IV +NAW I RDPE 
Sbjct  344  DIQKLPYFKAMIKETLRLHLPGPLLVPRESTEECIVDGYRIPAKTIVYVNAWVIQRDPEV  403

Query  174  WKAPEEFYPERFLDCNIDYKGQNFELIPFGAGRRMCPGM  58
            WK PEEF PERFLD  IDY+GQ+FELIPFGAGRR+CPG+
Sbjct  404  WKNPEEFCPERFLDSAIDYRGQDFELIPFGAGRRICPGI  442



>ref|XP_006483977.1| PREDICTED: cytochrome P450 71B35-like [Citrus sinensis]
Length=509

 Score =   202 bits (514),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 86/159 (54%), Positives = 121/159 (76%), Gaps = 1/159 (1%)
 Frame = -1

Query  534  LTWDHIKAVLMNVFVGGTDTSAVVIIWAMTALMKDPRVMNKVQKEIRELIGEKAGKVYED  355
            LT DHIKAVL+++ + G DTSAV +IWAM+ L ++PRVM+K Q E+R+ IG K G + ED
Sbjct  292  LTTDHIKAVLVDLLLAGVDTSAVTVIWAMSELARNPRVMSKAQDEVRKCIG-KNGSITED  350

Query  354  DIKQLPYFRAVIKETLRLYTPIPLLVTREIISKCTIDEYEIKPKMIVVINAWAIARDPEY  175
             ++QL Y + +IKET RL+ P P+L+ R+ IS C I+ Y++ P+ ++ +N WAI RD  Y
Sbjct  351  GMEQLQYLKMIIKETFRLHPPGPMLLPRQTISHCKINGYDVNPETLLQVNVWAIGRDSRY  410

Query  174  WKAPEEFYPERFLDCNIDYKGQNFELIPFGAGRRMCPGM  58
            W   EEF+PERF+D ++D+KGQNFEL+PFG GRR+CPG+
Sbjct  411  WSKAEEFFPERFIDNSVDFKGQNFELLPFGGGRRICPGI  449



>ref|XP_010670930.1| PREDICTED: cytochrome P450 71A1-like [Beta vulgaris subsp. vulgaris]
Length=523

 Score =   202 bits (514),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 91/159 (57%), Positives = 119/159 (75%), Gaps = 1/159 (1%)
 Frame = -1

Query  534  LTWDHIKAVLMNVFVGGTDTSAVVIIWAMTALMKDPRVMNKVQKEIRELIGEKAGKVYED  355
            LT DHIKAVLMN+FV GTDT+A  +IWAMT L+K+P  M KVQ+E+R ++ + +  + E 
Sbjct  301  LTLDHIKAVLMNIFVAGTDTTAATVIWAMTELIKNPNAMKKVQEEVRSMV-KNSTFIQEQ  359

Query  354  DIKQLPYFRAVIKETLRLYTPIPLLVTREIISKCTIDEYEIKPKMIVVINAWAIARDPEY  175
             +  L Y +AV+KET RL+   PLL+ R+ + KCT+  Y+IK   +V INAWAI RDPE 
Sbjct  360  QLHHLKYLKAVVKETFRLHPVSPLLLPRQTMQKCTLGGYQIKRGTLVYINAWAIGRDPES  419

Query  174  WKAPEEFYPERFLDCNIDYKGQNFELIPFGAGRRMCPGM  58
            W+ PE+F+PERFL   ID+KGQ+FELIPFGAGRR CPG+
Sbjct  420  WENPEKFFPERFLGSTIDFKGQDFELIPFGAGRRGCPGL  458



>ref|XP_002510500.1| cytochrome P450, putative [Ricinus communis]
 gb|EEF52687.1| cytochrome P450, putative [Ricinus communis]
Length=497

 Score =   201 bits (512),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 95/159 (60%), Positives = 119/159 (75%), Gaps = 1/159 (1%)
 Frame = -1

Query  534  LTWDHIKAVLMNVFVGGTDTSAVVIIWAMTALMKDPRVMNKVQKEIRELIGEKAGKVYED  355
            LT DHIKA+LMNVFVGGTDTSA  ++WAMT LMK+   M K Q+E+R + G+K G V ED
Sbjct  285  LTPDHIKAILMNVFVGGTDTSAAAVVWAMTFLMKNSIAMKKAQEEVRHIFGKK-GFVDED  343

Query  354  DIKQLPYFRAVIKETLRLYTPIPLLVTREIISKCTIDEYEIKPKMIVVINAWAIARDPEY  175
            D +QL Y +AVIKET+RL   +PLL+ RE    C +  YEI  K +V +NA AI RDPE 
Sbjct  344  DTQQLVYLKAVIKETMRLQPTVPLLIPRESTQDCNLSGYEIPAKTVVYVNALAIGRDPEV  403

Query  174  WKAPEEFYPERFLDCNIDYKGQNFELIPFGAGRRMCPGM  58
            W+ PEEF PERF+  ++D KGQ+FEL+PFGAGRR+CPG+
Sbjct  404  WENPEEFCPERFIGKSVDLKGQDFELVPFGAGRRICPGI  442



>gb|KDO82173.1| hypothetical protein CISIN_1g010614mg [Citrus sinensis]
Length=506

 Score =   201 bits (512),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 91/159 (57%), Positives = 122/159 (77%), Gaps = 1/159 (1%)
 Frame = -1

Query  534  LTWDHIKAVLMNVFVGGTDTSAVVIIWAMTALMKDPRVMNKVQKEIRELIGEKAGKVYED  355
            LT +HIKAVL+N+F+GG DTSA+ +IWAM  L K+PR+M K Q EIR  IG K G+V E 
Sbjct  289  LTKNHIKAVLLNIFLGGVDTSAITVIWAMAELCKNPRLMKKAQAEIRNHIGNK-GRVTEA  347

Query  354  DIKQLPYFRAVIKETLRLYTPIPLLVTREIISKCTIDEYEIKPKMIVVINAWAIARDPEY  175
            DI QL Y + VIKETLRL+ P PLL+ R+ + +  ++ Y+I PK ++ +NAWAI RD +Y
Sbjct  348  DIDQLQYLKMVIKETLRLHPPAPLLIARDTMYRFKVNGYDIYPKTLIQVNAWAIGRDSKY  407

Query  174  WKAPEEFYPERFLDCNIDYKGQNFELIPFGAGRRMCPGM  58
            W++PEEF PERF+D  +D KGQ+FE +PFG+GRR+CPG+
Sbjct  408  WESPEEFIPERFIDKPVDVKGQDFEYLPFGSGRRICPGI  446



>ref|XP_007134004.1| hypothetical protein PHAVU_010G011000g [Phaseolus vulgaris]
 gb|ESW05998.1| hypothetical protein PHAVU_010G011000g [Phaseolus vulgaris]
Length=502

 Score =   201 bits (512),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 99/156 (63%), Positives = 120/156 (77%), Gaps = 1/156 (1%)
 Frame = -1

Query  525  DHIKAVLMNVFVGGTDTSAVVIIWAMTALMKDPRVMNKVQKEIRELIGEKAGKVYEDDIK  346
            DHIKAV MN+ V  TDT++   IWAMTAL+K+PRVM KVQ+E+R L GEK   ++EDDI+
Sbjct  293  DHIKAVFMNMLVAATDTTSATTIWAMTALLKNPRVMKKVQEELRNLGGEK-DFLHEDDIQ  351

Query  345  QLPYFRAVIKETLRLYTPIPLLVTREIISKCTIDEYEIKPKMIVVINAWAIARDPEYWKA  166
            + PYF+A+IKETLRL+ P PLLV RE    C ++ YEI  K IV +NAWAI RDP  WK 
Sbjct  352  KFPYFKAMIKETLRLHLPAPLLVPRETNEPCILEGYEIPAKTIVYVNAWAIHRDPNTWKD  411

Query  165  PEEFYPERFLDCNIDYKGQNFELIPFGAGRRMCPGM  58
            PEEF PERFLD   D++GQ+FE IPFGAGRR+CPGM
Sbjct  412  PEEFLPERFLDSTTDFRGQDFEFIPFGAGRRICPGM  447



>ref|XP_010671012.1| PREDICTED: cytochrome P450 83B1-like [Beta vulgaris subsp. vulgaris]
Length=495

 Score =   201 bits (511),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 92/159 (58%), Positives = 120/159 (75%), Gaps = 1/159 (1%)
 Frame = -1

Query  534  LTWDHIKAVLMNVFVGGTDTSAVVIIWAMTALMKDPRVMNKVQKEIRELIGEKAGKVYED  355
            LT DHIKA+L+N+FV GTDTSA +++WAMT L+K+P VM KVQ+EIR   G K G V  +
Sbjct  283  LTIDHIKALLLNIFVAGTDTSAAMVVWAMTELIKNPTVMKKVQEEIRNSAGNK-GYVTVE  341

Query  354  DIKQLPYFRAVIKETLRLYTPIPLLVTREIISKCTIDEYEIKPKMIVVINAWAIARDPEY  175
            D+ +L Y +AVIKETLR     P+L+ RE + KC+I+ Y+I PK +V +N W I RDPE+
Sbjct  342  DLTKLEYLKAVIKETLRFRPAAPVLLVRETLKKCSIEGYDILPKTLVFVNIWTIGRDPEF  401

Query  174  WKAPEEFYPERFLDCNIDYKGQNFELIPFGAGRRMCPGM  58
            W  P+ F PERFL  +ID+KGQ+FE +PFGAGR+MCPGM
Sbjct  402  WIDPDIFKPERFLGSSIDFKGQDFEFLPFGAGRKMCPGM  440



>ref|XP_006483976.1| PREDICTED: cytochrome P450 71B37-like [Citrus sinensis]
Length=518

 Score =   201 bits (512),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 91/159 (57%), Positives = 122/159 (77%), Gaps = 1/159 (1%)
 Frame = -1

Query  534  LTWDHIKAVLMNVFVGGTDTSAVVIIWAMTALMKDPRVMNKVQKEIRELIGEKAGKVYED  355
            LT +HIKAVL+N+F+GG DTSA+ +IWAM  L K+PR+M K Q EIR  IG K G+V E 
Sbjct  301  LTKNHIKAVLLNIFLGGVDTSAITVIWAMAELCKNPRLMKKAQAEIRNHIGNK-GRVTEA  359

Query  354  DIKQLPYFRAVIKETLRLYTPIPLLVTREIISKCTIDEYEIKPKMIVVINAWAIARDPEY  175
            DI QL Y + VIKETLRL+ P PLL+ R+ + +  ++ Y+I PK ++ +NAWAI RD +Y
Sbjct  360  DIDQLQYLKMVIKETLRLHPPAPLLIARDTLYRFKVNGYDIYPKTLIQVNAWAIGRDSKY  419

Query  174  WKAPEEFYPERFLDCNIDYKGQNFELIPFGAGRRMCPGM  58
            W++PEEF PERF+D  +D KGQ+FE +PFG+GRR+CPG+
Sbjct  420  WESPEEFIPERFIDKPVDVKGQDFEYLPFGSGRRICPGI  458



>ref|XP_006438218.1| hypothetical protein CICLE_v10031247mg [Citrus clementina]
 gb|ESR51458.1| hypothetical protein CICLE_v10031247mg [Citrus clementina]
Length=518

 Score =   201 bits (512),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 91/159 (57%), Positives = 122/159 (77%), Gaps = 1/159 (1%)
 Frame = -1

Query  534  LTWDHIKAVLMNVFVGGTDTSAVVIIWAMTALMKDPRVMNKVQKEIRELIGEKAGKVYED  355
            LT +HIKAVL+N+F+GG DTSA+ +IWAM  L K+PR+M K Q EIR  IG K G+V E 
Sbjct  301  LTKNHIKAVLLNIFLGGVDTSAITVIWAMAELCKNPRLMKKAQAEIRNHIGNK-GRVTEA  359

Query  354  DIKQLPYFRAVIKETLRLYTPIPLLVTREIISKCTIDEYEIKPKMIVVINAWAIARDPEY  175
            DI QL Y + VIKETLRL+ P PLL+ R+ + +  ++ Y+I PK ++ +NAWAI RD +Y
Sbjct  360  DIDQLQYLKMVIKETLRLHPPAPLLIARDTLYRFKVNGYDIYPKTLIQVNAWAIGRDSKY  419

Query  174  WKAPEEFYPERFLDCNIDYKGQNFELIPFGAGRRMCPGM  58
            W++PEEF PERF+D  +D KGQ+FE +PFG+GRR+CPG+
Sbjct  420  WESPEEFIPERFIDKPVDVKGQDFEYLPFGSGRRICPGI  458



>gb|KHG17560.1| Cytochrome P450 protein [Gossypium arboreum]
Length=514

 Score =   201 bits (512),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 89/159 (56%), Positives = 120/159 (75%), Gaps = 1/159 (1%)
 Frame = -1

Query  534  LTWDHIKAVLMNVFVGGTDTSAVVIIWAMTALMKDPRVMNKVQKEIRELIGEKAGKVYED  355
            LT +HIKAVL+N+F+GG DTSA+++IWAM  L + P  M K Q E+R ++G+K G+V E 
Sbjct  294  LTKNHIKAVLLNMFLGGVDTSALIVIWAMAELARKPTFMKKAQDEVRGVVGKK-GRVTET  352

Query  354  DIKQLPYFRAVIKETLRLYTPIPLLVTREIISKCTIDEYEIKPKMIVVINAWAIARDPEY  175
            D+ QL Y + V+KETLRL+ P P+L+ RE IS   I+ Y I P  ++ IN WAIARDP+Y
Sbjct  353  DLDQLQYLKMVLKETLRLHPPAPMLIAREAISHFNINGYHIYPNTLIQINVWAIARDPKY  412

Query  174  WKAPEEFYPERFLDCNIDYKGQNFELIPFGAGRRMCPGM  58
            W+ P+EF PERF+D  +D+KGQ+FEL+PFG GRR CPG+
Sbjct  413  WENPQEFSPERFIDNAVDFKGQHFELLPFGGGRRGCPGL  451



>ref|XP_010514265.1| PREDICTED: cytochrome P450 71B23-like [Camelina sativa]
Length=501

 Score =   201 bits (511),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 87/159 (55%), Positives = 120/159 (75%), Gaps = 0/159 (0%)
 Frame = -1

Query  534  LTWDHIKAVLMNVFVGGTDTSAVVIIWAMTALMKDPRVMNKVQKEIRELIGEKAGKVYED  355
            LT DHIK V+ ++F+ G +TSA  I+WAMT LM+ PRVM KVQ E+R ++GEK  +V E 
Sbjct  288  LTTDHIKGVISDIFLAGVNTSATTILWAMTELMRSPRVMKKVQDEVRTVLGEKRERVTEQ  347

Query  354  DIKQLPYFRAVIKETLRLYTPIPLLVTREIISKCTIDEYEIKPKMIVVINAWAIARDPEY  175
            D+ QL YF+ VIKET RL+   PLL+ RE++S+  I +Y+I  K  +++N +AI RDP  
Sbjct  348  DLNQLNYFKLVIKETFRLHPAAPLLLPREVMSQIKIQDYDIPEKTQIMVNVYAIGRDPNL  407

Query  174  WKAPEEFYPERFLDCNIDYKGQNFELIPFGAGRRMCPGM  58
            W+ P+EF PERF+D ++DY+G NFEL+PFG+GRR+CPGM
Sbjct  408  WENPDEFKPERFVDSSVDYRGLNFELLPFGSGRRICPGM  446



>ref|XP_010670999.1| PREDICTED: cytochrome P450 83B1-like [Beta vulgaris subsp. vulgaris]
Length=500

 Score =   201 bits (510),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 93/159 (58%), Positives = 115/159 (72%), Gaps = 1/159 (1%)
 Frame = -1

Query  534  LTWDHIKAVLMNVFVGGTDTSAVVIIWAMTALMKDPRVMNKVQKEIRELIGEKAGKVYED  355
            LT DH+KAVLM +F+ G DTS+ ++IW MT LMK+P  M KVQ E+RE I  K   +  +
Sbjct  281  LTLDHVKAVLMIIFIAGADTSSAMVIWTMTELMKNPHSMKKVQDELREAIQNKVS-INNN  339

Query  354  DIKQLPYFRAVIKETLRLYTPIPLLVTREIISKCTIDEYEIKPKMIVVINAWAIARDPEY  175
            D+ +L YF+AV+KET RL    PLLV  E I K TI+ Y+I PK +V +NAWAI RDP  
Sbjct  340  DLVKLEYFKAVVKETFRLQPATPLLVVHETIRKSTIEGYDILPKTLVYVNAWAIGRDPNS  399

Query  174  WKAPEEFYPERFLDCNIDYKGQNFELIPFGAGRRMCPGM  58
            WK PE F PERFL  +ID+KG +FELIPFGAGRR+CPGM
Sbjct  400  WKEPENFMPERFLGSSIDFKGNDFELIPFGAGRRICPGM  438



>gb|KDO62263.1| hypothetical protein CISIN_1g0110962mg, partial [Citrus sinensis]
Length=271

 Score =   194 bits (494),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 88/159 (55%), Positives = 115/159 (72%), Gaps = 1/159 (1%)
 Frame = -1

Query  534  LTWDHIKAVLMNVFVGGTDTSAVVIIWAMTALMKDPRVMNKVQKEIRELIGEKAGKVYED  355
            LT DHIKAV+ ++F  G++TSA  + WAM  +MK+PRVM K Q E+RE+   + GKV E 
Sbjct  54   LTTDHIKAVISDIFAAGSETSATTVDWAMCEMMKNPRVMKKAQAEVREVF-HRTGKVNET  112

Query  354  DIKQLPYFRAVIKETLRLYTPIPLLVTREIISKCTIDEYEIKPKMIVVINAWAIARDPEY  175
             I ++ + + V+KETLRL+   PLL+ RE   +C I+ ++I  K  V++NAWAI RDPEY
Sbjct  113  SIDEMKFLKLVVKETLRLHPAAPLLIPRECGQRCQINGFDIPVKARVIVNAWAIGRDPEY  172

Query  174  WKAPEEFYPERFLDCNIDYKGQNFELIPFGAGRRMCPGM  58
            W  PE F PERFLD ++DYKG NFE IPFGAGRR+CPGM
Sbjct  173  WTEPESFIPERFLDHSVDYKGTNFEYIPFGAGRRICPGM  211



>ref|XP_010502547.1| PREDICTED: cytochrome P450 71B37-like [Camelina sativa]
Length=501

 Score =   201 bits (510),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 96/159 (60%), Positives = 117/159 (74%), Gaps = 1/159 (1%)
 Frame = -1

Query  534  LTWDHIKAVLMNVFVGGTDTSAVVIIWAMTALMKDPRVMNKVQKEIRELIGEKAGKVYED  355
            LT +HIKAVLMNV +GG  TSA+ + WAMT LM++PRVM KVQ EIR  IG K+  +  D
Sbjct  287  LTRNHIKAVLMNVLLGGIGTSAITMTWAMTELMRNPRVMKKVQSEIRNQIGNKS-VISLD  345

Query  354  DIKQLPYFRAVIKETLRLYTPIPLLVTREIISKCTIDEYEIKPKMIVVINAWAIARDPEY  175
            DI QL Y + VI ET RL+ P PLLV RE++S+  I+ Y I  K  + +N WAI RDP+ 
Sbjct  346  DIDQLHYLKMVINETWRLHPPAPLLVPREVMSEFEINGYTIPAKTRLYVNVWAIGRDPDT  405

Query  174  WKAPEEFYPERFLDCNIDYKGQNFELIPFGAGRRMCPGM  58
            WK PEEF PERF++ NID KGQNFEL+PFG+GRRMCP M
Sbjct  406  WKDPEEFLPERFINSNIDAKGQNFELLPFGSGRRMCPAM  444



>ref|XP_011077693.1| PREDICTED: cytochrome P450 83B1-like [Sesamum indicum]
Length=511

 Score =   201 bits (511),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 104/159 (65%), Positives = 126/159 (79%), Gaps = 1/159 (1%)
 Frame = -1

Query  534  LTWDHIKAVLMNVFVGGTDTSAVVIIWAMTALMKDPRVMNKVQKEIRELIGEKAGKVYED  355
            LTW+HIKA+LM++FV GTDT A  IIWAMTAL+K+P  M K+Q+EIRE IGEK GKV ED
Sbjct  297  LTWNHIKAILMDIFVAGTDTGAAAIIWAMTALIKNPTTMKKLQREIREAIGEK-GKVTED  355

Query  354  DIKQLPYFRAVIKETLRLYTPIPLLVTREIISKCTIDEYEIKPKMIVVINAWAIARDPEY  175
            D+ +L Y  AVIKETLRLY P PLL+ RE + KC ++ Y I PK +V INAWAIARDPEY
Sbjct  356  DLPKLSYLNAVIKETLRLYPPAPLLLPRETLEKCNLEGYIIPPKTVVYINAWAIARDPEY  415

Query  174  WKAPEEFYPERFLDCNIDYKGQNFELIPFGAGRRMCPGM  58
            W  P+EF PERFL+  +D  GQ+F++IPFGAGRR CPG+
Sbjct  416  WDRPDEFVPERFLNTKVDIIGQDFQVIPFGAGRRGCPGI  454



>ref|XP_003538072.1| PREDICTED: cytochrome P450 83B1 [Glycine max]
Length=499

 Score =   201 bits (510),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 93/159 (58%), Positives = 120/159 (75%), Gaps = 2/159 (1%)
 Frame = -1

Query  534  LTWDHIKAVLMNVFVGGTDTSAVVIIWAMTALMKDPRVMNKVQKEIRELIGEKAGKVYED  355
            LT D IKA+++++ + GTDT+A   +W MT L+K+PR M K Q+EIR L G K   + E+
Sbjct  288  LTDDQIKAIILDILIAGTDTTAATSVWVMTGLIKNPRAMGKAQEEIRNLSGNKE-LIEEE  346

Query  354  DIKQLPYFRAVIKETLRLYTPIPLLVTREIISKCTIDEYEIKPKMIVVINAWAIARDPEY  175
            D+++L Y +AVIKETLR+Y P PL V RE I   TI+ YEI+PK IV +N W+I RDPE 
Sbjct  347  DVQKLVYLKAVIKETLRVYAPTPL-VPREAIRSFTIEGYEIQPKTIVYVNGWSIQRDPEA  405

Query  174  WKAPEEFYPERFLDCNIDYKGQNFELIPFGAGRRMCPGM  58
            WK PEEFYPERFL+  ID+KGQ+FE IPFGAGRR+CPG+
Sbjct  406  WKDPEEFYPERFLNNEIDFKGQDFEFIPFGAGRRICPGI  444



>ref|XP_010912890.1| PREDICTED: cytochrome P450 71A9-like [Elaeis guineensis]
Length=496

 Score =   200 bits (509),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 91/159 (57%), Positives = 117/159 (74%), Gaps = 1/159 (1%)
 Frame = -1

Query  534  LTWDHIKAVLMNVFVGGTDTSAVVIIWAMTALMKDPRVMNKVQKEIRELIGEKAGKVYED  355
            LT DHIKAVLM++F+ GTDT++  + WAM  L + PR+M K Q+EIR  +G K GKV E 
Sbjct  281  LTKDHIKAVLMDIFIAGTDTASATLEWAMAELARHPRLMKKAQEEIRASLGTK-GKVEEG  339

Query  354  DIKQLPYFRAVIKETLRLYTPIPLLVTREIISKCTIDEYEIKPKMIVVINAWAIARDPEY  175
            D+ QL Y ++V+KET RL++P+PLL+ RE I    I  Y+I P   V +NAW IA+DP+ 
Sbjct  340  DLHQLQYLKSVVKETWRLHSPVPLLLPRESIRHSRIHGYDILPNTRVYVNAWGIAKDPKS  399

Query  174  WKAPEEFYPERFLDCNIDYKGQNFELIPFGAGRRMCPGM  58
            W  PEEF PERF+D +IDYKG NFE IPFG+GRR+CPGM
Sbjct  400  WDDPEEFIPERFMDSSIDYKGHNFEFIPFGSGRRICPGM  438



>gb|KDP34534.1| hypothetical protein JCGZ_11084 [Jatropha curcas]
Length=507

 Score =   201 bits (510),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 89/159 (56%), Positives = 120/159 (75%), Gaps = 1/159 (1%)
 Frame = -1

Query  534  LTWDHIKAVLMNVFVGGTDTSAVVIIWAMTALMKDPRVMNKVQKEIRELIGEKAGKVYED  355
             + +HIKA+LMN+F+ G DT A+V+IWAM  L++D RVM K Q EIR LIG+K   V E 
Sbjct  293  FSQNHIKAMLMNIFLAGVDTGAIVLIWAMAELIRDSRVMRKAQLEIRSLIGDKR-NVSES  351

Query  354  DIKQLPYFRAVIKETLRLYTPIPLLVTREIISKCTIDEYEIKPKMIVVINAWAIARDPEY  175
            D  +L Y + V+KET+RL+ P+PLLV RE IS+ +I+ YE+ PK  + +N WAI RDP+ 
Sbjct  352  DTGKLDYLKLVLKETMRLHPPVPLLVPREAISQFSINGYEVYPKTQIRVNVWAIGRDPKI  411

Query  174  WKAPEEFYPERFLDCNIDYKGQNFELIPFGAGRRMCPGM  58
            WK PEEF PERF++ +ID++GQN+E +PFG GRR+CPGM
Sbjct  412  WKNPEEFSPERFINSSIDFRGQNYEFLPFGGGRRICPGM  450



>gb|KHN09046.1| Cytochrome P450 83B1 [Glycine soja]
Length=499

 Score =   200 bits (509),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 93/159 (58%), Positives = 120/159 (75%), Gaps = 2/159 (1%)
 Frame = -1

Query  534  LTWDHIKAVLMNVFVGGTDTSAVVIIWAMTALMKDPRVMNKVQKEIRELIGEKAGKVYED  355
            LT D IKA+++++ + GTDT+A   +W MT L+K+PR M K Q+EIR L G K   + E+
Sbjct  288  LTDDQIKAIILDILIAGTDTTAATSVWVMTGLIKNPRAMGKAQEEIRNLSGNKE-LIEEE  346

Query  354  DIKQLPYFRAVIKETLRLYTPIPLLVTREIISKCTIDEYEIKPKMIVVINAWAIARDPEY  175
            D+++L Y +AVIKETLR+Y P PL V RE I   TI+ YEI+PK IV +N W+I RDPE 
Sbjct  347  DVQKLVYLKAVIKETLRVYAPTPL-VPREAIRSFTIEGYEIQPKTIVYVNGWSIQRDPEA  405

Query  174  WKAPEEFYPERFLDCNIDYKGQNFELIPFGAGRRMCPGM  58
            WK PEEFYPERFL+  ID+KGQ+FE IPFGAGRR+CPG+
Sbjct  406  WKDPEEFYPERFLNNEIDFKGQDFEFIPFGAGRRICPGI  444



>ref|XP_010425326.1| PREDICTED: cytochrome P450 71B25 [Camelina sativa]
Length=480

 Score =   200 bits (508),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 89/159 (56%), Positives = 119/159 (75%), Gaps = 1/159 (1%)
 Frame = -1

Query  534  LTWDHIKAVLMNVFVGGTDTSAVVIIWAMTALMKDPRVMNKVQKEIRELIGEKAGKVYED  355
            LT DH+K +  ++F+ G DTSA+ +IWAM  L+++PRVM K Q EIR  IG KA ++ E+
Sbjct  270  LTIDHLKGISQDIFLAGIDTSAITMIWAMAELVRNPRVMKKAQDEIRNCIGIKA-RIEEE  328

Query  354  DIKQLPYFRAVIKETLRLYTPIPLLVTREIISKCTIDEYEIKPKMIVVINAWAIARDPEY  175
            D+ +L Y + VIKETLRL+   PLL+ RE ++   I  Y+I  K ++++NAW+I RDP Y
Sbjct  329  DVNKLEYLKLVIKETLRLHPAAPLLLPRETMADIKIQGYDIPRKTLLLVNAWSIGRDPNY  388

Query  174  WKAPEEFYPERFLDCNIDYKGQNFELIPFGAGRRMCPGM  58
            WK PEEF PERF+DC +DYKGQNFE IPFG+GRR+CPGM
Sbjct  389  WKNPEEFNPERFIDCPVDYKGQNFEFIPFGSGRRICPGM  427



>gb|KFK27280.1| hypothetical protein AALP_AA8G361500 [Arabis alpina]
Length=503

 Score =   200 bits (509),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 90/161 (56%), Positives = 124/161 (77%), Gaps = 2/161 (1%)
 Frame = -1

Query  534  LTWDHIKAVLMNVFVGGTDTSAVVIIWAMTALMKDPRVMNKVQKEIRELIGEKA-GKVYE  358
            LT +HIKA+LMN+ +GG +TS++ + WAM  L ++PRVM KVQ EIR++IGE + G++  
Sbjct  286  LTRNHIKAILMNILLGGINTSSITMTWAMAELARNPRVMKKVQFEIRDIIGENSKGRIIS  345

Query  357  -DDIKQLPYFRAVIKETLRLYTPIPLLVTREIISKCTIDEYEIKPKMIVVINAWAIARDP  181
             D+I QL Y + V+KET RL+ P PLLV RE++S+  I+ Y I+PK  + +N WAI RDP
Sbjct  346  FDEIDQLSYLKMVVKETFRLHPPSPLLVPREVLSEFQINGYTIQPKTRLHVNVWAIGRDP  405

Query  180  EYWKAPEEFYPERFLDCNIDYKGQNFELIPFGAGRRMCPGM  58
            E WK P+EF PERF+DC+ID KGQ+FEL+PFG+GRR+CP +
Sbjct  406  EIWKDPDEFIPERFMDCDIDVKGQHFELLPFGSGRRICPAL  446



>ref|XP_010450434.1| PREDICTED: cytochrome P450 71B17-like [Camelina sativa]
Length=369

 Score =   197 bits (500),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 84/159 (53%), Positives = 119/159 (75%), Gaps = 0/159 (0%)
 Frame = -1

Query  534  LTWDHIKAVLMNVFVGGTDTSAVVIIWAMTALMKDPRVMNKVQKEIRELIGEKAGKVYED  355
            LT DHIKA+L N+ +GG +T A+ +IWAMT L+K P+VM KVQ EIR+ +G    ++ E+
Sbjct  156  LTLDHIKALLTNILLGGVETGAITMIWAMTELVKTPQVMKKVQSEIRDRLGNNKERITEE  215

Query  354  DIKQLPYFRAVIKETLRLYTPIPLLVTREIISKCTIDEYEIKPKMIVVINAWAIARDPEY  175
            D+ ++P+   VIKET RL+   PLL+ RE ++   +  Y+I PK  +++NAWAI RDP+Y
Sbjct  216  DLDKVPFLNMVIKETFRLHPAAPLLLPRETMAHIKVQGYDIPPKRQILVNAWAIGRDPKY  275

Query  174  WKAPEEFYPERFLDCNIDYKGQNFELIPFGAGRRMCPGM  58
            W  PEEF PERF+D  +DYKG++FEL+PFG+GRR+CPG+
Sbjct  276  WTNPEEFNPERFMDSPVDYKGRHFELLPFGSGRRICPGI  314



>ref|XP_010670976.1| PREDICTED: cytochrome P450 83B1-like [Beta vulgaris subsp. vulgaris]
Length=495

 Score =   200 bits (508),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 92/159 (58%), Positives = 120/159 (75%), Gaps = 1/159 (1%)
 Frame = -1

Query  534  LTWDHIKAVLMNVFVGGTDTSAVVIIWAMTALMKDPRVMNKVQKEIRELIGEKAGKVYED  355
            LT DHIKA+LMN+FV GTDTS+V+++WAMT L+K+P  M KVQ+EIR ++  K   V ++
Sbjct  284  LTLDHIKALLMNIFVAGTDTSSVMVVWAMTELVKNPHTMKKVQEEIRNVVQNK-DFVDKN  342

Query  354  DIKQLPYFRAVIKETLRLYTPIPLLVTREIISKCTIDEYEIKPKMIVVINAWAIARDPEY  175
            D+ +  YF+AV+KET RL+   PLLV  E + K TID Y+I PK +V IN WAI RDP+ 
Sbjct  343  DLPKFKYFKAVVKETFRLHPAAPLLVAHESVKKTTIDGYDILPKTLVHINIWAIGRDPKL  402

Query  174  WKAPEEFYPERFLDCNIDYKGQNFELIPFGAGRRMCPGM  58
            WK PE+F PERF + +ID KG +FEL+PFGAG RMCPG+
Sbjct  403  WKDPEKFMPERFFETSIDLKGSDFELLPFGAGTRMCPGL  441



>ref|XP_010270695.1| PREDICTED: cytochrome P450 71A9-like [Nelumbo nucifera]
 ref|XP_010246210.1| PREDICTED: cytochrome P450 71A9-like [Nelumbo nucifera]
Length=509

 Score =   200 bits (509),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 93/159 (58%), Positives = 117/159 (74%), Gaps = 1/159 (1%)
 Frame = -1

Query  534  LTWDHIKAVLMNVFVGGTDTSAVVIIWAMTALMKDPRVMNKVQKEIRELIGEKAGKVYED  355
            LT DHIKA LM++FV GTDTS   ++W MT LMK+PRVM K Q EIR  I +K   V E 
Sbjct  294  LTIDHIKAALMDIFVAGTDTSTAALVWGMTELMKNPRVMRKAQDEIRNAIRKKR-MVEES  352

Query  354  DIKQLPYFRAVIKETLRLYTPIPLLVTREIISKCTIDEYEIKPKMIVVINAWAIARDPEY  175
            D++QL Y RAV+KE LR++ P PLL  RE + +C I  Y I PK  V+++ WAI RDP+ 
Sbjct  353  DLEQLQYLRAVVKEILRMHPPGPLLAPRETMEECKISGYNIFPKTRVIVSPWAIGRDPKC  412

Query  174  WKAPEEFYPERFLDCNIDYKGQNFELIPFGAGRRMCPGM  58
            W+ PEEFYPERF+D +ID+KG +FEL+PFGAGRR CPG+
Sbjct  413  WENPEEFYPERFMDGSIDFKGLHFELVPFGAGRRHCPGI  451



>ref|XP_010911404.1| PREDICTED: cytochrome P450 71A1-like [Elaeis guineensis]
Length=498

 Score =   200 bits (508),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 89/159 (56%), Positives = 118/159 (74%), Gaps = 1/159 (1%)
 Frame = -1

Query  534  LTWDHIKAVLMNVFVGGTDTSAVVIIWAMTALMKDPRVMNKVQKEIRELIGEKAGKVYED  355
            LT DHIKAVLM++F+ GT+T++  ++WAM  L + PR+M K Q+EIR  +G K GKV E 
Sbjct  285  LTKDHIKAVLMDIFMAGTETASATLVWAMAELARHPRLMKKAQEEIRASLGTK-GKVEEG  343

Query  354  DIKQLPYFRAVIKETLRLYTPIPLLVTREIISKCTIDEYEIKPKMIVVINAWAIARDPEY  175
            D+ QL Y ++V+KETLRL++P+PLL+ RE I    I  Y+I P   V +NAW I +DP+ 
Sbjct  344  DLHQLRYLKSVVKETLRLHSPVPLLLPRESIRHSRIHGYDIPPNTRVFVNAWGIGKDPKS  403

Query  174  WKAPEEFYPERFLDCNIDYKGQNFELIPFGAGRRMCPGM  58
            W  PEEF PERF+D +IDYKG NFELIPFG+GRR+CP +
Sbjct  404  WDDPEEFIPERFMDSSIDYKGHNFELIPFGSGRRICPAL  442



>gb|KEH29148.1| cytochrome P450 family 71 protein [Medicago truncatula]
Length=497

 Score =   200 bits (508),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 92/159 (58%), Positives = 121/159 (76%), Gaps = 1/159 (1%)
 Frame = -1

Query  534  LTWDHIKAVLMNVFVGGTDTSAVVIIWAMTALMKDPRVMNKVQKEIRELIGEKAGKVYED  355
            LT++HIKAVL++  V  TDT++   +WAMTALMK+PRV++KVQ+EIR L G K   + E 
Sbjct  285  LTFNHIKAVLVDTIVAATDTTSAASVWAMTALMKNPRVLDKVQEEIRNLGGAK-DYLDEG  343

Query  354  DIKQLPYFRAVIKETLRLYTPIPLLVTREIISKCTIDEYEIKPKMIVVINAWAIARDPEY  175
            D++ LPY  AVIKETLRL+ P PLL++RE    CTI+ Y I  + I+ +NAWAI RD   
Sbjct  344  DLQNLPYLNAVIKETLRLHLPAPLLLSRESRENCTINGYNIPARTILYVNAWAIQRDHNV  403

Query  174  WKAPEEFYPERFLDCNIDYKGQNFELIPFGAGRRMCPGM  58
            W+  EEFYPERFL+ +I++ GQ+FELIPFGAGRR+CPG+
Sbjct  404  WENAEEFYPERFLESSINFTGQDFELIPFGAGRRICPGL  442



>emb|CDY51225.1| BnaC09g09800D, partial [Brassica napus]
Length=231

 Score =   192 bits (488),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 80/159 (50%), Positives = 119/159 (75%), Gaps = 0/159 (0%)
 Frame = -1

Query  534  LTWDHIKAVLMNVFVGGTDTSAVVIIWAMTALMKDPRVMNKVQKEIRELIGEKAGKVYED  355
            L  D++KA+LMNVF+GG DTS++++IWAMT L+++PRVM K Q+ IR ++G K  ++ ED
Sbjct  20   LNMDNLKAILMNVFLGGIDTSSIIMIWAMTELVRNPRVMKKAQENIRTILGAKRERITED  79

Query  354  DIKQLPYFRAVIKETLRLYTPIPLLVTREIISKCTIDEYEIKPKMIVVINAWAIARDPEY  175
            D+ ++ Y + +IKET RL+ P+P +V RE +S   I  Y+I P+  + IN W I RDP+ 
Sbjct  80   DLYKVDYLKLIIKETFRLHPPVPFIVPRETMSHIKIKGYDIPPRTQIQINVWTIGRDPKR  139

Query  174  WKAPEEFYPERFLDCNIDYKGQNFELIPFGAGRRMCPGM  58
            W  PE+F PERF + ++D++GQ+F+L+PFG+GRRMCP M
Sbjct  140  WTDPEDFIPERFTNSSVDFRGQHFDLLPFGSGRRMCPAM  178



>gb|KDP26674.1| hypothetical protein JCGZ_17832 [Jatropha curcas]
Length=505

 Score =   199 bits (507),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 88/159 (55%), Positives = 119/159 (75%), Gaps = 1/159 (1%)
 Frame = -1

Query  534  LTWDHIKAVLMNVFVGGTDTSAVVIIWAMTALMKDPRVMNKVQKEIRELIGEKAGKVYED  355
             T D+IK VL+N+F+ G DTSA+ + WAM  L ++P VM K Q E+R ++G+K G++ E 
Sbjct  291  FTNDNIKGVLLNLFLAGVDTSAITVNWAMAELSRNPSVMKKAQDEVRNVVGKK-GRITEG  349

Query  354  DIKQLPYFRAVIKETLRLYTPIPLLVTREIISKCTIDEYEIKPKMIVVINAWAIARDPEY  175
            D+ QL Y + VIKET RL+   PLL+ RE IS   I+ Y+I PK ++ +NAWAI RDP+Y
Sbjct  350  DLDQLEYLKMVIKETFRLHPAAPLLLPRETISHFKINGYDIYPKTLIQVNAWAIGRDPKY  409

Query  174  WKAPEEFYPERFLDCNIDYKGQNFELIPFGAGRRMCPGM  58
            WK PE+F+PERF D +ID+KGQNFE +PFGAGRR+CPG+
Sbjct  410  WKDPEQFFPERFADSDIDFKGQNFEFLPFGAGRRICPGI  448



>ref|XP_006290954.1| hypothetical protein CARUB_v10017070mg [Capsella rubella]
 gb|EOA23852.1| hypothetical protein CARUB_v10017070mg [Capsella rubella]
Length=500

 Score =   199 bits (507),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 91/159 (57%), Positives = 121/159 (76%), Gaps = 1/159 (1%)
 Frame = -1

Query  534  LTWDHIKAVLMNVFVGGTDTSAVVIIWAMTALMKDPRVMNKVQKEIRELIGEKAGKVYED  355
            LT +HIKA+LMNV +G  +TSA+ + WAMT L+++PRVM KVQ EIR  +  K+  +  D
Sbjct  285  LTRNHIKAILMNVLLGAINTSAITMTWAMTELIRNPRVMKKVQSEIRNQMRNKS-VITLD  343

Query  354  DIKQLPYFRAVIKETLRLYTPIPLLVTREIISKCTIDEYEIKPKMIVVINAWAIARDPEY  175
            DI  LPY   VIKET RL+ P+PLLV RE++S+  I+ Y+I+PK ++ +N WA+ RDP+ 
Sbjct  344  DIDHLPYLNMVIKETWRLHPPVPLLVPREVMSEFEINGYKIQPKTLLYVNVWAMGRDPDI  403

Query  174  WKAPEEFYPERFLDCNIDYKGQNFELIPFGAGRRMCPGM  58
            WK  E F PERF+D NID+KGQNFEL+PFG+GRR+CPGM
Sbjct  404  WKDAETFLPERFVDNNIDFKGQNFELLPFGSGRRICPGM  442



>ref|XP_004516029.1| PREDICTED: cytochrome P450 83B1-like [Cicer arietinum]
Length=496

 Score =   199 bits (506),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 93/159 (58%), Positives = 121/159 (76%), Gaps = 2/159 (1%)
 Frame = -1

Query  534  LTWDHIKAVLMNVFVGGTDTSAVVIIWAMTALMKDPRVMNKVQKEIRELIGEKAGKVYED  355
            LT+DHIK VLMN+ V GTDT++  +++AMTAL+K+PRVM KVQ+E+R         + ED
Sbjct  285  LTFDHIKGVLMNMLVAGTDTTSATVVFAMTALIKNPRVMKKVQEEVRS--SRVKDFLDED  342

Query  354  DIKQLPYFRAVIKETLRLYTPIPLLVTREIISKCTIDEYEIKPKMIVVINAWAIARDPEY  175
            DI+   Y +AVIKETLRL+ P PLLV RE   KCTI  YEI  + I+ +NAWAI RDP+ 
Sbjct  343  DIQNFSYLKAVIKETLRLHLPAPLLVPRESREKCTIAGYEIPARTILFVNAWAIHRDPDI  402

Query  174  WKAPEEFYPERFLDCNIDYKGQNFELIPFGAGRRMCPGM  58
            WK PEEFYPERFL+ +I++ G++FEL+PFGAGRR+C G+
Sbjct  403  WKDPEEFYPERFLENSINFLGKDFELMPFGAGRRICAGL  441



>ref|XP_010430758.1| PREDICTED: cytochrome P450 71B3-like [Camelina sativa]
Length=263

 Score =   193 bits (490),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 86/159 (54%), Positives = 119/159 (75%), Gaps = 1/159 (1%)
 Frame = -1

Query  534  LTWDHIKAVLMNVFVGGTDTSAVVIIWAMTALMKDPRVMNKVQKEIRELIGEKAG-KVYE  358
            LT DH+  V+ N+F+ G DTSAV +IWAM  L+K+PRVM KVQ EIR  IG K   ++ E
Sbjct  87   LTVDHLHGVISNIFLAGVDTSAVTMIWAMAELIKNPRVMKKVQDEIRSCIGIKQNERIDE  146

Query  357  DDIKQLPYFRAVIKETLRLYTPIPLLVTREIISKCTIDEYEIKPKMIVVINAWAIARDPE  178
            + + +L Y + VIKETLRL+ P PLL+ RE +S+  I  Y I PK ++++NAW+I ++P 
Sbjct  147  EGVDKLQYLKLVIKETLRLHPPAPLLIPRETMSQINIQGYNIPPKTLILVNAWSIGQNPY  206

Query  177  YWKAPEEFYPERFLDCNIDYKGQNFELIPFGAGRRMCPG  61
             W++PEEF PERF+D  +DY+GQ+FE++PFG+GRRMCPG
Sbjct  207  RWESPEEFIPERFIDFPVDYRGQSFEMLPFGSGRRMCPG  245



>ref|XP_004506482.1| PREDICTED: cytochrome P450 83B1-like [Cicer arietinum]
Length=497

 Score =   199 bits (506),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 94/159 (59%), Positives = 119/159 (75%), Gaps = 1/159 (1%)
 Frame = -1

Query  534  LTWDHIKAVLMNVFVGGTDTSAVVIIWAMTALMKDPRVMNKVQKEIRELIGEKAGKVYED  355
            LT+DH+K V+ ++ V  TDT++   +WAMTAL+K+PRVM  VQ+EIR    +K   + ED
Sbjct  285  LTFDHVKGVITDILVAATDTTSATSVWAMTALIKNPRVMKIVQEEIRSSRVKKY-ILDED  343

Query  354  DIKQLPYFRAVIKETLRLYTPIPLLVTREIISKCTIDEYEIKPKMIVVINAWAIARDPEY  175
            DI+  PY +AVIKETLRLY P PLLV RE   KCTI  Y+I  + IV +NAW + RDP  
Sbjct  344  DIRNFPYLKAVIKETLRLYLPAPLLVPRESSEKCTIGGYQIPARTIVYVNAWTLQRDPNI  403

Query  174  WKAPEEFYPERFLDCNIDYKGQNFELIPFGAGRRMCPGM  58
            WK PEEFYPERFLD +I++ GQ+FELIPFGAGRR+CPG+
Sbjct  404  WKNPEEFYPERFLDNSINFLGQDFELIPFGAGRRICPGI  442



>ref|XP_010514268.1| PREDICTED: cytochrome P450 71B25-like [Camelina sativa]
Length=496

 Score =   199 bits (506),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 88/159 (55%), Positives = 120/159 (75%), Gaps = 1/159 (1%)
 Frame = -1

Query  534  LTWDHIKAVLMNVFVGGTDTSAVVIIWAMTALMKDPRVMNKVQKEIRELIGEKAGKVYED  355
            LT DH+K +  ++F+ G DTSA+ +IWAM  L+++PRVM K Q EIR  IG KA ++ ++
Sbjct  286  LTIDHLKGISQDIFLAGIDTSAITMIWAMAELVRNPRVMKKAQDEIRNCIGIKA-RIEDE  344

Query  354  DIKQLPYFRAVIKETLRLYTPIPLLVTREIISKCTIDEYEIKPKMIVVINAWAIARDPEY  175
            D+ +L Y + VIKETLRL+   PLL+ RE ++   I  Y+I  K ++++NAW+I RDP+Y
Sbjct  345  DVNKLQYLKLVIKETLRLHPAAPLLLPRETMADIKIQGYDIPRKTLLLVNAWSIGRDPKY  404

Query  174  WKAPEEFYPERFLDCNIDYKGQNFELIPFGAGRRMCPGM  58
            WK PEEF PERF+DC +DYKGQNFE IPFG+GRR+CPGM
Sbjct  405  WKNPEEFNPERFIDCPVDYKGQNFEFIPFGSGRRICPGM  443



>ref|XP_010494965.1| PREDICTED: cytochrome P450 71B28-like [Camelina sativa]
Length=489

 Score =   199 bits (505),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 86/159 (54%), Positives = 122/159 (77%), Gaps = 0/159 (0%)
 Frame = -1

Query  534  LTWDHIKAVLMNVFVGGTDTSAVVIIWAMTALMKDPRVMNKVQKEIRELIGEKAGKVYED  355
            LT DH+K ++ ++F+ G +TSA  ++WAMT L+++PRVM KVQ EIR  +G+K  ++ E+
Sbjct  284  LTTDHLKGMISDIFLAGVNTSASTLVWAMTELIRNPRVMKKVQDEIRTTLGDKKERITEE  343

Query  354  DIKQLPYFRAVIKETLRLYTPIPLLVTREIISKCTIDEYEIKPKMIVVINAWAIARDPEY  175
            D+ QL YF+ ++KE  RL+   PLL+ RE +S   I  Y+I PK  ++INA+AIARDP+ 
Sbjct  344  DLSQLDYFKLMVKEIYRLHPAAPLLLPREALSHIKIQGYDIPPKTHIIINAYAIARDPKL  403

Query  174  WKAPEEFYPERFLDCNIDYKGQNFELIPFGAGRRMCPGM  58
            W+ P+EF P+RFL+C+IDY+G NFELIPFG+GRRMCPGM
Sbjct  404  WENPDEFNPDRFLNCSIDYRGLNFELIPFGSGRRMCPGM  442



>ref|XP_006290953.1| hypothetical protein CARUB_v10017069mg [Capsella rubella]
 gb|EOA23851.1| hypothetical protein CARUB_v10017069mg [Capsella rubella]
Length=501

 Score =   199 bits (506),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 95/159 (60%), Positives = 116/159 (73%), Gaps = 1/159 (1%)
 Frame = -1

Query  534  LTWDHIKAVLMNVFVGGTDTSAVVIIWAMTALMKDPRVMNKVQKEIRELIGEKAGKVYED  355
            LT +HIKAVLMNV +GG  TSA+ + WAMT LM++PRVM KVQ EIR  IG K+  +  +
Sbjct  287  LTRNHIKAVLMNVLLGGIGTSAITMTWAMTELMRNPRVMKKVQSEIRNQIGNKS-MISLE  345

Query  354  DIKQLPYFRAVIKETLRLYTPIPLLVTREIISKCTIDEYEIKPKMIVVINAWAIARDPEY  175
            DI QL Y + VI ET RL+ P PLLV RE++S   I+ Y I  K  + +N WAI RDP+ 
Sbjct  346  DIDQLHYMKMVINETWRLHPPAPLLVPREVMSDFEINGYTIPAKTRLYVNVWAIGRDPDT  405

Query  174  WKAPEEFYPERFLDCNIDYKGQNFELIPFGAGRRMCPGM  58
            WK PEEF PERF++ NID KGQNFEL+PFG+GRRMCP M
Sbjct  406  WKDPEEFLPERFINSNIDAKGQNFELLPFGSGRRMCPAM  444



>gb|KEH34014.1| cytochrome P450 family 71 protein [Medicago truncatula]
Length=507

 Score =   199 bits (506),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 90/158 (57%), Positives = 117/158 (74%), Gaps = 1/158 (1%)
 Frame = -1

Query  534  LTWDHIKAVLMNVFVGGTDTSAVVIIWAMTALMKDPRVMNKVQKEIRELIGEKAGKVYED  355
            LT D+IKA++M++F  G +TSA  I WAM  ++K+PR+M K Q E+RE+   K G+V E+
Sbjct  290  LTIDNIKAIIMDIFGAGGETSASTIDWAMAEMVKNPRIMKKAQAEVREIFNMK-GRVEEN  348

Query  354  DIKQLPYFRAVIKETLRLYTPIPLLVTREIISKCTIDEYEIKPKMIVVINAWAIARDPEY  175
             I +L Y ++++KETLRL+ P PLL+ RE    C ID Y+I  K  V++NAWAIARDP Y
Sbjct  349  CINELNYLKSIVKETLRLHPPAPLLIPRECAQSCKIDGYDIPTKTKVIVNAWAIARDPNY  408

Query  174  WKAPEEFYPERFLDCNIDYKGQNFELIPFGAGRRMCPG  61
            W  PE FYPERF+D +IDYKG NFE IPFGAGRR+CPG
Sbjct  409  WTEPERFYPERFIDSDIDYKGSNFEYIPFGAGRRICPG  446



>ref|XP_010514290.1| PREDICTED: cytochrome P450 71B37-like [Camelina sativa]
Length=501

 Score =   199 bits (505),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 95/159 (60%), Positives = 116/159 (73%), Gaps = 1/159 (1%)
 Frame = -1

Query  534  LTWDHIKAVLMNVFVGGTDTSAVVIIWAMTALMKDPRVMNKVQKEIRELIGEKAGKVYED  355
            LT +HIKAVLMNV +GG  TSA+ + WAMT LM++PRVM KVQ EIR  IG K+  +  +
Sbjct  287  LTRNHIKAVLMNVLLGGIGTSAITMTWAMTELMRNPRVMKKVQSEIRNQIGNKS-VISLN  345

Query  354  DIKQLPYFRAVIKETLRLYTPIPLLVTREIISKCTIDEYEIKPKMIVVINAWAIARDPEY  175
            DI QL Y + VI ET RL+ P PLLV RE++S   I+ Y I  K  + +N WAI RDP+ 
Sbjct  346  DIDQLHYLKMVINETWRLHPPAPLLVPREVMSDFEINGYTIPAKTRLYVNVWAIGRDPDT  405

Query  174  WKAPEEFYPERFLDCNIDYKGQNFELIPFGAGRRMCPGM  58
            WK PEEF PERF++ NID KGQNFEL+PFG+GRRMCP M
Sbjct  406  WKDPEEFLPERFINSNIDAKGQNFELLPFGSGRRMCPAM  444



>ref|XP_003614173.1| Cytochrome P450 71B10 [Medicago truncatula]
 gb|AES97131.1| cytochrome P450 family 71 protein [Medicago truncatula]
Length=497

 Score =   199 bits (505),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 100/161 (62%), Positives = 120/161 (75%), Gaps = 5/161 (3%)
 Frame = -1

Query  534  LTWDHIKAVLMNVFVGGTDTSAVVIIWAMTALMKDPRVMNKVQKEIRELIGEKAGKVY--  361
            LT+DHIK VLMN+ V  TDT++   +WAMTAL+K+PRVM KVQ+EIR     K  K +  
Sbjct  285  LTFDHIKGVLMNMLVAATDTTSATTVWAMTALIKNPRVMKKVQQEIR---NSKVKKEFID  341

Query  360  EDDIKQLPYFRAVIKETLRLYTPIPLLVTREIISKCTIDEYEIKPKMIVVINAWAIARDP  181
            EDDI+   Y +AVIKETLRLY P PLLV RE   KCTI  Y+I  K +V +NAWAI  DP
Sbjct  342  EDDIQNFSYLKAVIKETLRLYLPAPLLVPRETREKCTIGGYQIPAKAVVFVNAWAIHTDP  401

Query  180  EYWKAPEEFYPERFLDCNIDYKGQNFELIPFGAGRRMCPGM  58
              WK PEEFYPERFL+ +I++ GQ+FELIPFGAGRR+CPGM
Sbjct  402  NVWKNPEEFYPERFLESSINFHGQDFELIPFGAGRRICPGM  442



>ref|XP_010458752.1| PREDICTED: cytochrome P450 71B28-like [Camelina sativa]
Length=491

 Score =   198 bits (504),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 86/159 (54%), Positives = 120/159 (75%), Gaps = 0/159 (0%)
 Frame = -1

Query  534  LTWDHIKAVLMNVFVGGTDTSAVVIIWAMTALMKDPRVMNKVQKEIRELIGEKAGKVYED  355
            LT DH+K ++ ++F+ G  TSA  ++WAMT L++ PRVM KVQ EIR  +G+K  ++ E+
Sbjct  286  LTIDHLKGMISDIFLAGVSTSATTLVWAMTELIRSPRVMKKVQDEIRTTLGDKKERITEE  345

Query  354  DIKQLPYFRAVIKETLRLYTPIPLLVTREIISKCTIDEYEIKPKMIVVINAWAIARDPEY  175
            D+ QL YF+ ++KE  RL+   PLL+ RE +S   I  Y+I PK  ++INA+AIARDP+ 
Sbjct  346  DLSQLDYFKLMVKEIYRLHPAAPLLLPREALSHIKIQGYDIPPKTHIIINAYAIARDPKL  405

Query  174  WKAPEEFYPERFLDCNIDYKGQNFELIPFGAGRRMCPGM  58
            W+ P+EF P+RFL+C+IDY+G NFELIPFG+GRRMCPGM
Sbjct  406  WENPDEFNPDRFLNCSIDYRGLNFELIPFGSGRRMCPGM  444



>emb|CDY13616.1| BnaA06g33070D [Brassica napus]
Length=533

 Score =   199 bits (506),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 86/159 (54%), Positives = 118/159 (74%), Gaps = 0/159 (0%)
 Frame = -1

Query  534  LTWDHIKAVLMNVFVGGTDTSAVVIIWAMTALMKDPRVMNKVQKEIRELIGEKAGKVYED  355
            LT DHIK  L N+F+ G DT A+ +IWAMT L ++P+VM K+Q +IR+  G    ++ E+
Sbjct  320  LTLDHIKGFLTNIFIAGIDTGALTMIWAMTELARNPKVMKKLQGQIRDHFGNNKERITEE  379

Query  354  DIKQLPYFRAVIKETLRLYTPIPLLVTREIISKCTIDEYEIKPKMIVVINAWAIARDPEY  175
            DI ++PY   VIKET RL+  +PLL+ RE ++   +  Y+I PK  ++INAWAIARDP+ 
Sbjct  380  DIGKVPYLNLVIKETFRLHPVVPLLLPRETMAHIKVQGYDIPPKRRILINAWAIARDPKL  439

Query  174  WKAPEEFYPERFLDCNIDYKGQNFELIPFGAGRRMCPGM  58
            W  PEEF PERF+D ++DY+GQ+FEL+PFG+GRRMCPGM
Sbjct  440  WTNPEEFIPERFIDSHVDYRGQHFELLPFGSGRRMCPGM  478



>ref|NP_189264.3| cytochrome P450 71B37 [Arabidopsis thaliana]
 sp|Q9LIP3.2|C71BY_ARATH RecName: Full=Cytochrome P450 71B37 [Arabidopsis thaliana]
 gb|AEE77146.1| cytochrome P450 71B37 [Arabidopsis thaliana]
Length=500

 Score =   198 bits (504),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 95/159 (60%), Positives = 116/159 (73%), Gaps = 1/159 (1%)
 Frame = -1

Query  534  LTWDHIKAVLMNVFVGGTDTSAVVIIWAMTALMKDPRVMNKVQKEIRELIGEKAGKVYED  355
            LT +HIKAVLMNV +GG  TSA+ + WAMT LM++PRVM KVQ EIR  IG K+  +  D
Sbjct  286  LTRNHIKAVLMNVLLGGIGTSAITMTWAMTELMRNPRVMKKVQSEIRNQIGGKS-MICLD  344

Query  354  DIKQLPYFRAVIKETLRLYTPIPLLVTREIISKCTIDEYEIKPKMIVVINAWAIARDPEY  175
            DI QL Y + VI ET RL+ P PLLV RE++S+  I+ Y I  K  + +N W I RDP+ 
Sbjct  345  DIDQLHYLKMVINETWRLHPPAPLLVPREVMSEFEINGYTIPAKTRLYVNVWGIGRDPDT  404

Query  174  WKAPEEFYPERFLDCNIDYKGQNFELIPFGAGRRMCPGM  58
            WK PEEF PERF++ NID KGQNFEL+PFG+GRRMCP M
Sbjct  405  WKDPEEFLPERFVNSNIDAKGQNFELLPFGSGRRMCPAM  443



>ref|XP_010931872.1| PREDICTED: cytochrome P450 71A9-like [Elaeis guineensis]
Length=499

 Score =   198 bits (504),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 92/159 (58%), Positives = 117/159 (74%), Gaps = 1/159 (1%)
 Frame = -1

Query  534  LTWDHIKAVLMNVFVGGTDTSAVVIIWAMTALMKDPRVMNKVQKEIRELIGEKAGKVYED  355
            LT DHIKAV+MNVFV G+DTSA +++W MT LM++P VM K Q E+R LIG K GKV E 
Sbjct  284  LTRDHIKAVVMNVFVAGSDTSASILVWGMTELMRNPMVMKKAQDEVRGLIGNK-GKVEES  342

Query  354  DIKQLPYFRAVIKETLRLYTPIPLLVTREIISKCTIDEYEIKPKMIVVINAWAIARDPEY  175
            DI++L Y + V+KE LRL+ P PLL+ RE    C I+ ++I  K  V INAWAI RD  +
Sbjct  343  DIQRLHYLKLVVKEVLRLHPPGPLLIPRECTQHCKINGFDIPKKTRVYINAWAINRDSRH  402

Query  174  WKAPEEFYPERFLDCNIDYKGQNFELIPFGAGRRMCPGM  58
            W+  E F PERF D +IDYKGQ+F+ +PFG+GRR+CPGM
Sbjct  403  WQGAEVFMPERFKDNDIDYKGQHFQFLPFGSGRRICPGM  441



>emb|CDP16099.1| unnamed protein product [Coffea canephora]
Length=510

 Score =   199 bits (505),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 91/159 (57%), Positives = 117/159 (74%), Gaps = 2/159 (1%)
 Frame = -1

Query  534  LTWDHIKAVLMNVFVGGTDTSAVVIIWAMTALMKDPR-VMNKVQKEIRELIGEKAGKVYE  358
            LT DHIKA+LM+VF  G+DT+A  IIWAM ALMK P  ++ K Q EIR  +G K   V E
Sbjct  288  LTQDHIKAMLMDVFSAGSDTTAATIIWAMAALMKSPEAILKKAQAEIRGALGNK-DIVNE  346

Query  357  DDIKQLPYFRAVIKETLRLYTPIPLLVTREIISKCTIDEYEIKPKMIVVINAWAIARDPE  178
            DDI++LPY +A++KET RLY P PLLV R+ ++ C I+ +EI+   IV  N WAI RDP+
Sbjct  347  DDIQKLPYLKAIVKETFRLYPPTPLLVPRQTLANCIINGHEIQSNSIVYTNVWAIGRDPD  406

Query  177  YWKAPEEFYPERFLDCNIDYKGQNFELIPFGAGRRMCPG  61
             W+ P EF PERFL+ ++D KG++F+LIPFGAGRR CPG
Sbjct  407  NWENPNEFLPERFLNSSVDMKGKDFQLIPFGAGRRGCPG  445



>ref|XP_006395573.1| hypothetical protein EUTSA_v10005389mg [Eutrema salsugineum]
 gb|ESQ32859.1| hypothetical protein EUTSA_v10005389mg [Eutrema salsugineum]
Length=490

 Score =   198 bits (503),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 86/160 (54%), Positives = 122/160 (76%), Gaps = 1/160 (1%)
 Frame = -1

Query  534  LTWDHIKAVLMNVFVGGTDTSAVVIIWAMTALMKDPRVMNKVQKEIRELIGEKAGK-VYE  358
            LT DH+  V+ ++F+ G DTS++++IWAM  LM++PRVM K Q EIR  I  K  + + E
Sbjct  279  LTIDHLHGVISDIFLAGVDTSSIIMIWAMAELMRNPRVMKKAQDEIRTSIRIKPKENISE  338

Query  357  DDIKQLPYFRAVIKETLRLYTPIPLLVTREIISKCTIDEYEIKPKMIVVINAWAIARDPE  178
            +D+ +L Y + V+KETLRL+ P P+L+ RE +S   I  Y+I PK ++VINAW+I RDP+
Sbjct  339  EDLDKLQYLKLVVKETLRLHPPAPMLLPRETMSHIKIQGYDIPPKTMLVINAWSIGRDPK  398

Query  177  YWKAPEEFYPERFLDCNIDYKGQNFELIPFGAGRRMCPGM  58
            +W+ PEEF PERF++C +DYKGQ+FE++PFG+GRRMCPGM
Sbjct  399  HWENPEEFIPERFMNCPVDYKGQSFEMLPFGSGRRMCPGM  438



>ref|XP_008779115.1| PREDICTED: cytochrome P450 71A1-like [Phoenix dactylifera]
Length=274

 Score =   192 bits (488),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 91/159 (57%), Positives = 116/159 (73%), Gaps = 1/159 (1%)
 Frame = -1

Query  534  LTWDHIKAVLMNVFVGGTDTSAVVIIWAMTALMKDPRVMNKVQKEIRELIGEKAGKVYED  355
            LT DHIK + M+VFVGG+DTSA ++   MT LM++  VM K Q E+R L+G K GKV E 
Sbjct  59   LTRDHIKGIAMDVFVGGSDTSASILESGMTELMRNSIVMKKAQDEVRGLLGNK-GKVEEG  117

Query  354  DIKQLPYFRAVIKETLRLYTPIPLLVTREIISKCTIDEYEIKPKMIVVINAWAIARDPEY  175
            DI+QL Y + VIKE LRL+ P PLL  RE +  C I+ Y I  K+ V INAWAI+RDP +
Sbjct  118  DIQQLHYLKLVIKEILRLHPPAPLLAPRECMQDCKINGYNIPKKVRVYINAWAISRDPRH  177

Query  174  WKAPEEFYPERFLDCNIDYKGQNFELIPFGAGRRMCPGM  58
            W+ PE F PERF + +I++KGQ+F+ IPFG+GRRMCPGM
Sbjct  178  WQDPEAFIPERFENNDINFKGQHFQFIPFGSGRRMCPGM  216



>ref|XP_006292275.1| hypothetical protein CARUB_v10018485mg [Capsella rubella]
 gb|EOA25173.1| hypothetical protein CARUB_v10018485mg [Capsella rubella]
Length=499

 Score =   198 bits (503),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 92/159 (58%), Positives = 119/159 (75%), Gaps = 1/159 (1%)
 Frame = -1

Query  534  LTWDHIKAVLMNVFVGGTDTSAVVIIWAMTALMKDPRVMNKVQKEIRELIGEKAGKVYED  355
            LT +HIKA+LMNV +G  +TSA+ + WAMT L+++PRVM KVQ EIR  +  K+  +  D
Sbjct  285  LTRNHIKAILMNVLLGAINTSAITMTWAMTELIRNPRVMKKVQSEIRNQMRNKS-VITLD  343

Query  354  DIKQLPYFRAVIKETLRLYTPIPLLVTREIISKCTIDEYEIKPKMIVVINAWAIARDPEY  175
            DI  LPY   VIKET RL+ P PLLV RE++S+  I+ Y+I+PK ++ +N WAI RDP+ 
Sbjct  344  DIDHLPYLNMVIKETWRLHPPAPLLVPREVMSEFEINGYKIQPKTLLYVNVWAIGRDPDT  403

Query  174  WKAPEEFYPERFLDCNIDYKGQNFELIPFGAGRRMCPGM  58
            WK  E F PERF+D NID KGQNFEL+PFG+GRR+CPGM
Sbjct  404  WKDAETFLPERFMDNNIDAKGQNFELLPFGSGRRICPGM  442



>ref|XP_004309995.1| PREDICTED: cytochrome P450 71B34-like isoform 3 [Fragaria vesca 
subsp. vesca]
Length=401

 Score =   196 bits (497),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 83/159 (52%), Positives = 122/159 (77%), Gaps = 1/159 (1%)
 Frame = -1

Query  534  LTWDHIKAVLMNVFVGGTDTSAVVIIWAMTALMKDPRVMNKVQKEIRELIGEKAGKVYED  355
            L  D+IKA+L+N+F+GG DT A+ ++WAM  L K+PR+M K Q E+R ++G K G V E 
Sbjct  185  LGHDNIKALLVNLFLGGIDTGAITMLWAMAELAKNPRLMKKAQDEVRSVVGNK-GNVSES  243

Query  354  DIKQLPYFRAVIKETLRLYTPIPLLVTREIISKCTIDEYEIKPKMIVVINAWAIARDPEY  175
            D ++LPY + ++KE+LRL+ P PL++ RE ++   +  Y+++PK +V+IN WAI+RDPE+
Sbjct  244  DTEELPYLKMIVKESLRLHPPAPLILPRETMAPFKVLGYDVEPKTLVMINDWAISRDPEF  303

Query  174  WKAPEEFYPERFLDCNIDYKGQNFELIPFGAGRRMCPGM  58
            WK PEEF PERF   ++D+KGQ+FE +PFGAGRR+CPG+
Sbjct  304  WKDPEEFIPERFDGSSVDFKGQHFEFLPFGAGRRVCPGI  342



>dbj|BAB02193.1| cytochrome p450 [Arabidopsis thaliana]
Length=510

 Score =   198 bits (504),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 95/159 (60%), Positives = 116/159 (73%), Gaps = 1/159 (1%)
 Frame = -1

Query  534  LTWDHIKAVLMNVFVGGTDTSAVVIIWAMTALMKDPRVMNKVQKEIRELIGEKAGKVYED  355
            LT +HIKAVLMNV +GG  TSA+ + WAMT LM++PRVM KVQ EIR  IG K+  +  D
Sbjct  296  LTRNHIKAVLMNVLLGGIGTSAITMTWAMTELMRNPRVMKKVQSEIRNQIGGKS-MICLD  354

Query  354  DIKQLPYFRAVIKETLRLYTPIPLLVTREIISKCTIDEYEIKPKMIVVINAWAIARDPEY  175
            DI QL Y + VI ET RL+ P PLLV RE++S+  I+ Y I  K  + +N W I RDP+ 
Sbjct  355  DIDQLHYLKMVINETWRLHPPAPLLVPREVMSEFEINGYTIPAKTRLYVNVWGIGRDPDT  414

Query  174  WKAPEEFYPERFLDCNIDYKGQNFELIPFGAGRRMCPGM  58
            WK PEEF PERF++ NID KGQNFEL+PFG+GRRMCP M
Sbjct  415  WKDPEEFLPERFVNSNIDAKGQNFELLPFGSGRRMCPAM  453



>ref|XP_010425289.1| PREDICTED: cytochrome P450 71B17-like [Camelina sativa]
Length=505

 Score =   198 bits (504),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 86/159 (54%), Positives = 119/159 (75%), Gaps = 0/159 (0%)
 Frame = -1

Query  534  LTWDHIKAVLMNVFVGGTDTSAVVIIWAMTALMKDPRVMNKVQKEIRELIGEKAGKVYED  355
            LT DHIKA+L N+F+GG DT A+ +IWAMT L+K P VM KVQ EIR+ +G    ++ E+
Sbjct  292  LTIDHIKALLTNLFLGGVDTGAITMIWAMTELVKTPEVMKKVQGEIRDRLGNNKERITEE  351

Query  354  DIKQLPYFRAVIKETLRLYTPIPLLVTREIISKCTIDEYEIKPKMIVVINAWAIARDPEY  175
            D++++PY   VIKET RL+   PLL+ RE ++   +  Y+I PK  +++NAW I RDP+Y
Sbjct  352  DLEKIPYLNMVIKETFRLHPAAPLLLPRETMAHIKVQGYDIPPKTQILVNAWVIGRDPKY  411

Query  174  WKAPEEFYPERFLDCNIDYKGQNFELIPFGAGRRMCPGM  58
            W  PEEF PERF+D  +DYKG++FEL+PFG+GRR+CPG+
Sbjct  412  WTNPEEFNPERFIDSPVDYKGRHFELLPFGSGRRICPGI  450



>emb|CDX99721.1| BnaC02g35990D [Brassica napus]
Length=298

 Score =   192 bits (489),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 86/160 (54%), Positives = 118/160 (74%), Gaps = 1/160 (1%)
 Frame = -1

Query  534  LTWDHIKAVLMNVFVGGTDTSAVVIIWAMTALMKDPRVMNKVQKEIRELIGEKAG-KVYE  358
            LT DH+K ++ N+++ G DTSA+ +IWAM  L+++PRVM K Q+EIR  I  K   K+ E
Sbjct  86   LTIDHLKGIIQNIYLAGVDTSAITMIWAMAELVRNPRVMKKAQEEIRTCIRVKQNEKIDE  145

Query  357  DDIKQLPYFRAVIKETLRLYTPIPLLVTREIISKCTIDEYEIKPKMIVVINAWAIARDPE  178
            +D+ +L Y + VIKETLRL+   PLL+ RE +S+  I  Y I PK  +V+N W+I RDP+
Sbjct  146  EDVDKLQYLKLVIKETLRLHPAAPLLLPRETMSQIKIQGYNIPPKTFLVVNTWSIGRDPK  205

Query  177  YWKAPEEFYPERFLDCNIDYKGQNFELIPFGAGRRMCPGM  58
            +W+ PEEF PERF+D   DYKGQ+FE++PFG+GRRMCPGM
Sbjct  206  HWEDPEEFIPERFIDSPADYKGQSFEMLPFGSGRRMCPGM  245



>ref|XP_010502525.1| PREDICTED: cytochrome P450 71B17-like [Camelina sativa]
Length=505

 Score =   198 bits (503),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 86/159 (54%), Positives = 120/159 (75%), Gaps = 0/159 (0%)
 Frame = -1

Query  534  LTWDHIKAVLMNVFVGGTDTSAVVIIWAMTALMKDPRVMNKVQKEIRELIGEKAGKVYED  355
            LT DHIKA+L N+F+GG DT+A+ +IWAMT L+K P VM KVQ EIR+ +G    ++ E+
Sbjct  292  LTIDHIKALLTNLFLGGVDTAAITMIWAMTELVKTPEVMKKVQGEIRDRLGNNRERITEE  351

Query  354  DIKQLPYFRAVIKETLRLYTPIPLLVTREIISKCTIDEYEIKPKMIVVINAWAIARDPEY  175
            D+ ++P+   VIKET RL+   PLL+ RE ++   +  Y+I PK  +++NAWAI RDP+Y
Sbjct  352  DLDKVPFLNMVIKETFRLHPAAPLLLPRETMAHIKVQGYDIPPKRQILVNAWAIGRDPKY  411

Query  174  WKAPEEFYPERFLDCNIDYKGQNFELIPFGAGRRMCPGM  58
            W  PEEF PERF+D  +DYKG++FEL+PFG+GRR+CPG+
Sbjct  412  WTNPEEFNPERFIDSPVDYKGRHFELLPFGSGRRICPGI  450



>gb|KEH16181.1| cytochrome P450 family 71 protein [Medicago truncatula]
 gb|AES77612.2| cytochrome P450 family 71 protein [Medicago truncatula]
Length=501

 Score =   198 bits (503),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 93/159 (58%), Positives = 119/159 (75%), Gaps = 2/159 (1%)
 Frame = -1

Query  534  LTWDHIKAVLMNVFVGGTDTSAVVIIWAMTALMKDPRVMNKVQKEIRELIGEKAGKVYED  355
            LT DHIK+VLMN+ V  TDT++   +WAMT LMK+PR M K Q+EIR + G+K   + ED
Sbjct  290  LTNDHIKSVLMNLLVAATDTTSATSVWAMTGLMKNPRAMKKAQEEIRNICGKKEF-IDED  348

Query  354  DIKQLPYFRAVIKETLRLYTPIPLLVTREIISKCTIDEYEIKPKMIVVINAWAIARDPEY  175
            DI++L Y +AVIKETLR Y P PL   RE      ++ ++I+PK  V +N WAI RDPE 
Sbjct  349  DIQKLVYLKAVIKETLRFYAPAPL-APRETSKSFILNGHKIEPKTSVFVNIWAIHRDPEA  407

Query  174  WKAPEEFYPERFLDCNIDYKGQNFELIPFGAGRRMCPGM  58
            WK P+EFYPERFL+ +ID+KG++FELIPFGAGRR+CPGM
Sbjct  408  WKDPDEFYPERFLNNDIDFKGRDFELIPFGAGRRICPGM  446



>ref|XP_011074244.1| PREDICTED: cytochrome P450 83B1-like [Sesamum indicum]
Length=374

 Score =   195 bits (495),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 101/159 (64%), Positives = 122/159 (77%), Gaps = 1/159 (1%)
 Frame = -1

Query  534  LTWDHIKAVLMNVFVGGTDTSAVVIIWAMTALMKDPRVMNKVQKEIRELIGEKAGKVYED  355
            LTWDHIKA+LMN+F+ GTDT+    IW MTALMK P VM KVQ EIRELIG K  KV E 
Sbjct  162  LTWDHIKAMLMNIFIAGTDTAITSTIWTMTALMKAPDVMKKVQAEIRELIGIKC-KVDEA  220

Query  354  DIKQLPYFRAVIKETLRLYTPIPLLVTREIISKCTIDEYEIKPKMIVVINAWAIARDPEY  175
            DI+ L Y RA+I ETLRLY P PLL+ RE I KC +D YEI+PK +V +NAWAI+RDPEY
Sbjct  221  DIQNLSYMRAIISETLRLYPPGPLLLPRETIEKCILDGYEIQPKTMVYVNAWAISRDPEY  280

Query  174  WKAPEEFYPERFLDCNIDYKGQNFELIPFGAGRRMCPGM  58
            W+ P  F PERFL+  ++ KG +F+++PFG+GRR CPGM
Sbjct  281  WEDPLAFLPERFLNNGVNMKGNDFKVVPFGSGRRSCPGM  319



>ref|XP_006401223.1| hypothetical protein EUTSA_v10013314mg [Eutrema salsugineum]
 gb|ESQ42676.1| hypothetical protein EUTSA_v10013314mg [Eutrema salsugineum]
Length=503

 Score =   198 bits (503),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 93/161 (58%), Positives = 120/161 (75%), Gaps = 2/161 (1%)
 Frame = -1

Query  534  LTWDHIKAVLMNVFVGGTDTSAVVIIWAMTALMKDPRVMNKVQKEIRELIGEKAGK--VY  361
            LT +HIKA+LMNV +GG ++SA+ + WAM+ L ++PRVM KVQ EIR+ IG+K     V 
Sbjct  286  LTRNHIKAILMNVLLGGINSSAITMTWAMSELTRNPRVMKKVQSEIRDQIGKKNKTRIVS  345

Query  360  EDDIKQLPYFRAVIKETLRLYTPIPLLVTREIISKCTIDEYEIKPKMIVVINAWAIARDP  181
             D+  QL Y + VIKET RL+   PLLV RE+IS+  ++ Y I+PK  V +N WAI RDP
Sbjct  346  LDETDQLKYLKMVIKETWRLHPVSPLLVPREVISEFKVNGYTIQPKTRVHVNTWAIGRDP  405

Query  180  EYWKAPEEFYPERFLDCNIDYKGQNFELIPFGAGRRMCPGM  58
            E WK PEEF PERF+DC+ID KGQ+FEL+PFG+GRR+CP M
Sbjct  406  EVWKDPEEFLPERFMDCDIDAKGQHFELLPFGSGRRICPAM  446



>ref|XP_002876964.1| CYP71B37 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH53223.1| CYP71B37 [Arabidopsis lyrata subsp. lyrata]
Length=500

 Score =   197 bits (502),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 95/159 (60%), Positives = 116/159 (73%), Gaps = 1/159 (1%)
 Frame = -1

Query  534  LTWDHIKAVLMNVFVGGTDTSAVVIIWAMTALMKDPRVMNKVQKEIRELIGEKAGKVYED  355
            LT +HIKAVLMNV +GG  TSA+ + WAMT LM++PRVM KVQ EIR  IG K+  +  D
Sbjct  286  LTRNHIKAVLMNVLLGGIGTSAITMTWAMTELMRNPRVMKKVQSEIRNQIGGKS-MITLD  344

Query  354  DIKQLPYFRAVIKETLRLYTPIPLLVTREIISKCTIDEYEIKPKMIVVINAWAIARDPEY  175
            DI QL Y + VI ET RL+ P PLLV RE++S+  I+ Y I  K  + +N WAI RDP+ 
Sbjct  345  DIDQLHYLKMVINETWRLHPPAPLLVPREVMSEFEINGYTIPAKTRLYVNVWAIGRDPDT  404

Query  174  WKAPEEFYPERFLDCNIDYKGQNFELIPFGAGRRMCPGM  58
            WK PEEF PERF + +ID KGQNFEL+PFG+GRRMCP M
Sbjct  405  WKDPEEFLPERFANSSIDAKGQNFELLPFGSGRRMCPAM  443



>ref|XP_011087181.1| PREDICTED: cytochrome P450 71A9-like [Sesamum indicum]
Length=496

 Score =   197 bits (502),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 93/159 (58%), Positives = 116/159 (73%), Gaps = 2/159 (1%)
 Frame = -1

Query  534  LTWDHIKAVLMNVFVGGTDTSAVVIIWAMTALMKDPRVMNKVQKEIRELIGEKAGKVYED  355
            LT DH+KAV+MN+ VGGTD +A + +WAMTALMK P  M + Q EIR L   K   + E+
Sbjct  284  LTVDHVKAVIMNILVGGTDANAAITVWAMTALMKSPIPMKRAQTEIRNL--GKKDLIDEN  341

Query  354  DIKQLPYFRAVIKETLRLYTPIPLLVTREIISKCTIDEYEIKPKMIVVINAWAIARDPEY  175
            +I  LPY RAVIKE  RLY P PLLV RE + +CTI+ YEI+PK +V INAWAIARDP++
Sbjct  342  EIASLPYLRAVIKEIFRLYPPAPLLVPRETLQECTINGYEIQPKTLVYINAWAIARDPQF  401

Query  174  WKAPEEFYPERFLDCNIDYKGQNFELIPFGAGRRMCPGM  58
            W   +EF PERFL+  ID +G + E+IPFG GRR CPG+
Sbjct  402  WNDADEFVPERFLESEIDVRGHDPEVIPFGIGRRGCPGI  440



>ref|XP_010425348.1| PREDICTED: cytochrome P450 71B37 [Camelina sativa]
Length=501

 Score =   197 bits (502),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 95/159 (60%), Positives = 116/159 (73%), Gaps = 1/159 (1%)
 Frame = -1

Query  534  LTWDHIKAVLMNVFVGGTDTSAVVIIWAMTALMKDPRVMNKVQKEIRELIGEKAGKVYED  355
            LT +HIKAVLMNV +GG  TSA+ + WAMT LM++PRVM KVQ EIR  IG K+  +  D
Sbjct  287  LTRNHIKAVLMNVLLGGIGTSAITMTWAMTELMRNPRVMKKVQSEIRNQIGNKS-VISLD  345

Query  354  DIKQLPYFRAVIKETLRLYTPIPLLVTREIISKCTIDEYEIKPKMIVVINAWAIARDPEY  175
            DI QL Y + VI ET RL+ P PLLV RE++S+  I+ Y I  K  + +N WAI RD + 
Sbjct  346  DIDQLHYLKMVINETWRLHPPAPLLVPREVMSEFEINGYTIPAKTRLYVNVWAIGRDADT  405

Query  174  WKAPEEFYPERFLDCNIDYKGQNFELIPFGAGRRMCPGM  58
            WK PEEF PERF++ NID KGQNFEL+PFG+GRRMCP M
Sbjct  406  WKYPEEFLPERFINSNIDAKGQNFELLPFGSGRRMCPAM  444



>ref|XP_004309994.1| PREDICTED: cytochrome P450 71B34-like isoform 2 [Fragaria vesca 
subsp. vesca]
Length=413

 Score =   196 bits (497),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 83/159 (52%), Positives = 122/159 (77%), Gaps = 1/159 (1%)
 Frame = -1

Query  534  LTWDHIKAVLMNVFVGGTDTSAVVIIWAMTALMKDPRVMNKVQKEIRELIGEKAGKVYED  355
            L  D+IKA+L+N+F+GG DT A+ ++WAM  L K+PR+M K Q E+R ++G K G V E 
Sbjct  197  LGHDNIKALLVNLFLGGIDTGAITMLWAMAELAKNPRLMKKAQDEVRSVVGNK-GNVSES  255

Query  354  DIKQLPYFRAVIKETLRLYTPIPLLVTREIISKCTIDEYEIKPKMIVVINAWAIARDPEY  175
            D ++LPY + ++KE+LRL+ P PL++ RE ++   +  Y+++PK +V+IN WAI+RDPE+
Sbjct  256  DTEELPYLKMIVKESLRLHPPAPLILPRETMAPFKVLGYDVEPKTLVMINDWAISRDPEF  315

Query  174  WKAPEEFYPERFLDCNIDYKGQNFELIPFGAGRRMCPGM  58
            WK PEEF PERF   ++D+KGQ+FE +PFGAGRR+CPG+
Sbjct  316  WKDPEEFIPERFDGSSVDFKGQHFEFLPFGAGRRVCPGI  354



>ref|XP_010502530.1| PREDICTED: cytochrome P450 71B23-like [Camelina sativa]
Length=501

 Score =   197 bits (502),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 84/159 (53%), Positives = 119/159 (75%), Gaps = 0/159 (0%)
 Frame = -1

Query  534  LTWDHIKAVLMNVFVGGTDTSAVVIIWAMTALMKDPRVMNKVQKEIRELIGEKAGKVYED  355
            LT DHIK V+ ++F+ G +TS+  I+WAMT LM+ PRVM KVQ E+R L+G K  ++ E 
Sbjct  288  LTTDHIKGVISDIFLAGVNTSSTTILWAMTELMRSPRVMKKVQDEVRTLLGGKRERITEQ  347

Query  354  DIKQLPYFRAVIKETLRLYTPIPLLVTREIISKCTIDEYEIKPKMIVVINAWAIARDPEY  175
            D+ QL YF+ VI+ET RL+   PLL+ RE++S+  I +Y+I  K  +++N +AI RDP  
Sbjct  348  DLNQLNYFKLVIRETFRLHPAAPLLLPREVLSQIKIQDYDIPEKTQIMVNVYAIGRDPNL  407

Query  174  WKAPEEFYPERFLDCNIDYKGQNFELIPFGAGRRMCPGM  58
            W+ P+EF PERF+D ++DY+G NFEL+PFG+GRR+CPGM
Sbjct  408  WENPDEFKPERFVDSSVDYRGLNFELLPFGSGRRICPGM  446



>ref|XP_002300725.2| hypothetical protein POPTR_0002s02730g [Populus trichocarpa]
 gb|EEE79998.2| hypothetical protein POPTR_0002s02730g [Populus trichocarpa]
Length=513

 Score =   198 bits (503),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 90/159 (57%), Positives = 119/159 (75%), Gaps = 1/159 (1%)
 Frame = -1

Query  534  LTWDHIKAVLMNVFVGGTDTSAVVIIWAMTALMKDPRVMNKVQKEIRELIGEKAGKVYED  355
            LT DHIKA+L ++F+ GTDT AV +IWAMT LMK+P+ M K Q+E+R L G K G V +D
Sbjct  288  LTLDHIKAILTDIFLAGTDTGAVTVIWAMTFLMKNPKAMRKAQEEVRNLFGNK-GFVDDD  346

Query  354  DIKQLPYFRAVIKETLRLYTPIPLLVTREIISKCTIDEYEIKPKMIVVINAWAIARDPEY  175
            D++QLPY +AV+KET+RL    PLL+ RE   +C +  YEI  K +V ++AWA+ RDP+ 
Sbjct  347  DVQQLPYLKAVVKETMRLQPTAPLLLPRETTKECYLGGYEIPAKTLVYVSAWAVGRDPKA  406

Query  174  WKAPEEFYPERFLDCNIDYKGQNFELIPFGAGRRMCPGM  58
            W+ P EF P+RFL  +ID KG +FELIPFGAGRR+CPG+
Sbjct  407  WENPYEFNPDRFLGSSIDLKGNDFELIPFGAGRRICPGI  445



>ref|XP_002876954.1| CYP71B23 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH53213.1| CYP71B23 [Arabidopsis lyrata subsp. lyrata]
Length=501

 Score =   197 bits (502),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 85/159 (53%), Positives = 119/159 (75%), Gaps = 0/159 (0%)
 Frame = -1

Query  534  LTWDHIKAVLMNVFVGGTDTSAVVIIWAMTALMKDPRVMNKVQKEIRELIGEKAGKVYED  355
            LT DHIK ++ ++F+ G +TSA  I+WAMT L+++PRVM KVQ E+R ++GEK  ++ E 
Sbjct  288  LTTDHIKGIISDIFLAGVNTSATTILWAMTELIRNPRVMKKVQDEVRTVLGEKRERITEQ  347

Query  354  DIKQLPYFRAVIKETLRLYTPIPLLVTREIISKCTIDEYEIKPKMIVVINAWAIARDPEY  175
            D+ QL YF+ VIKET RL+   PLL+ RE ++K  I  Y+I  K  +++N +AI RDP  
Sbjct  348  DLNQLNYFKLVIKETFRLHPAAPLLLPREAMAKIKIQGYDIPQKTQIMVNVYAIGRDPNL  407

Query  174  WKAPEEFYPERFLDCNIDYKGQNFELIPFGAGRRMCPGM  58
            W+ PEEF PERF+D ++DY+G NFEL+PFG+GRR+CPGM
Sbjct  408  WENPEEFKPERFVDSSVDYRGLNFELLPFGSGRRICPGM  446



>ref|XP_006432552.1| hypothetical protein CICLE_v10000886mg [Citrus clementina]
 ref|XP_006471349.1| PREDICTED: cytochrome P450 83B1-like [Citrus sinensis]
 gb|ESR45792.1| hypothetical protein CICLE_v10000886mg [Citrus clementina]
Length=516

 Score =   198 bits (503),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 93/163 (57%), Positives = 124/163 (76%), Gaps = 6/163 (4%)
 Frame = -1

Query  534  LTWDHIKAVLMNVFVGGTDTSAVVIIWAMTALMKDPRVMNKVQKEIRELIGEKAGKVYED  355
             TWD+IKAVLMNVFVG TDTSA ++ WAMT ++K+PRVM K QKE+R+LIG+K G V ED
Sbjct  301  FTWDNIKAVLMNVFVGATDTSAALMTWAMTNVVKNPRVMEKAQKEVRDLIGDK-GFVDED  359

Query  354  DIKQLPYFRAVIKETLRLYTPIPLLVTREIISKCTIDEYEIKPKMIVVINAWAIARDPEY  175
            D+++LPY +A++KET RLY P+P ++ RE    C ID Y++  K +V +N WAI+RDPE 
Sbjct  360  DLEKLPYIKAILKETFRLYPPVP-IIPRETTKSCVIDGYQVPAKTLVYLNGWAISRDPEV  418

Query  174  WKAPEEFYPERFL---DCNIDYKGQ-NFELIPFGAGRRMCPGM  58
            W+ P++F P+RF+     NI+  GQ N+ELIPFG GRR CPG+
Sbjct  419  WERPDDFDPDRFIIGDKSNIELTGQNNYELIPFGGGRRFCPGI  461



>ref|NP_189252.1| cytochrome P450 71B23 [Arabidopsis thaliana]
 sp|Q9LTM0.1|C71BN_ARATH RecName: Full=Cytochrome P450 71B23 [Arabidopsis thaliana]
 dbj|BAB02442.1| cytochrome P450 [Arabidopsis thaliana]
 gb|AAT85757.1| At3g26210 [Arabidopsis thaliana]
 gb|AEE77134.1| cytochrome P450 71B23 [Arabidopsis thaliana]
Length=501

 Score =   197 bits (502),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 85/159 (53%), Positives = 120/159 (75%), Gaps = 0/159 (0%)
 Frame = -1

Query  534  LTWDHIKAVLMNVFVGGTDTSAVVIIWAMTALMKDPRVMNKVQKEIRELIGEKAGKVYED  355
            LT DHIK ++ ++F+ G +TSA  I+WAMT L+++PRVM KVQ E+R ++GEK  ++ E 
Sbjct  288  LTTDHIKGIISDIFLAGVNTSATTILWAMTELIRNPRVMKKVQDEVRTVLGEKRDRITEQ  347

Query  354  DIKQLPYFRAVIKETLRLYTPIPLLVTREIISKCTIDEYEIKPKMIVVINAWAIARDPEY  175
            D+ QL YF+ VIKET RL+   PLL+ RE ++K  I  Y+I  K  +++N +AI RDP+ 
Sbjct  348  DLNQLNYFKLVIKETFRLHPAAPLLLPREAMAKIKIQGYDIPEKTQIMVNVYAIGRDPDL  407

Query  174  WKAPEEFYPERFLDCNIDYKGQNFELIPFGAGRRMCPGM  58
            W+ PEEF PERF+D ++DY+G NFEL+PFG+GRR+CPGM
Sbjct  408  WENPEEFKPERFVDSSVDYRGLNFELLPFGSGRRICPGM  446



>emb|CAN60733.1| hypothetical protein VITISV_023587 [Vitis vinifera]
Length=505

 Score =   197 bits (502),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 90/159 (57%), Positives = 115/159 (72%), Gaps = 1/159 (1%)
 Frame = -1

Query  534  LTWDHIKAVLMNVFVGGTDTSAVVIIWAMTALMKDPRVMNKVQKEIRELIGEKAGKVYED  355
             T D  KA+LM++F+ G DT A+ + WAMT L ++PR+M K Q E+R  IG K GKV E 
Sbjct  292  FTKDSAKAILMDLFLAGVDTGAITLTWAMTELARNPRIMKKAQVEVRNSIGNK-GKVTEG  350

Query  354  DIKQLPYFRAVIKETLRLYTPIPLLVTREIISKCTIDEYEIKPKMIVVINAWAIARDPEY  175
            D+ QL Y + V+KETLRL+ P PLLV RE +S   I+ Y I PK  V +N WAI RDP  
Sbjct  351  DVDQLHYLKMVVKETLRLHPPAPLLVPRETMSHFEINGYHIYPKTQVXVNVWAIGRDPNL  410

Query  174  WKAPEEFYPERFLDCNIDYKGQNFELIPFGAGRRMCPGM  58
            WK PEEF PERF+D ++D++GQ+FEL+PFGAGRR+CPGM
Sbjct  411  WKNPEEFLPERFMDNSVDFRGQHFELLPFGAGRRICPGM  449



>ref|XP_008778632.1| PREDICTED: cytochrome P450 71A1-like [Phoenix dactylifera]
Length=499

 Score =   197 bits (502),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 89/159 (56%), Positives = 115/159 (72%), Gaps = 1/159 (1%)
 Frame = -1

Query  534  LTWDHIKAVLMNVFVGGTDTSAVVIIWAMTALMKDPRVMNKVQKEIRELIGEKAGKVYED  355
            LT DHIK + MNVF+GG+DTSA  + W MT LM++P V+ K Q E+R L+G K GKV ED
Sbjct  284  LTRDHIKGIAMNVFIGGSDTSASTLEWGMTELMRNPMVLKKAQDEVRGLLGNK-GKVEED  342

Query  354  DIKQLPYFRAVIKETLRLYTPIPLLVTREIISKCTIDEYEIKPKMIVVINAWAIARDPEY  175
            D++QL Y + +IKE LRL++P+PLLV  E +  C I  Y I  K    IN WAI+RDP Y
Sbjct  343  DVQQLRYLKLIIKEVLRLHSPVPLLVPHECMQDCKITGYNIPKKTRAYINVWAISRDPRY  402

Query  174  WKAPEEFYPERFLDCNIDYKGQNFELIPFGAGRRMCPGM  58
            W+  E F PERF D +I++KGQ+FE +PFG+GRR+CPGM
Sbjct  403  WQDAEAFIPERFEDNDINFKGQHFEFVPFGSGRRICPGM  441



>gb|KDO50377.1| hypothetical protein CISIN_1g010151mg [Citrus sinensis]
Length=516

 Score =   197 bits (502),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 93/163 (57%), Positives = 124/163 (76%), Gaps = 6/163 (4%)
 Frame = -1

Query  534  LTWDHIKAVLMNVFVGGTDTSAVVIIWAMTALMKDPRVMNKVQKEIRELIGEKAGKVYED  355
             TWD+IKAVLMNVFVG TDTSA ++ WAMT ++K+PRVM K QKE+R+LIG+K G V ED
Sbjct  301  FTWDNIKAVLMNVFVGATDTSAALMTWAMTNVVKNPRVMEKAQKEVRDLIGDK-GFVDED  359

Query  354  DIKQLPYFRAVIKETLRLYTPIPLLVTREIISKCTIDEYEIKPKMIVVINAWAIARDPEY  175
            D+++LPY +A++KET RLY P+P ++ RE    C ID Y++  K +V +N WAI+RDPE 
Sbjct  360  DLEKLPYIKAILKETFRLYPPVP-IIPRETTKSCVIDGYQVPAKTLVYLNGWAISRDPEV  418

Query  174  WKAPEEFYPERFL---DCNIDYKGQ-NFELIPFGAGRRMCPGM  58
            W+ P++F P+RF+     NI+  GQ N+ELIPFG GRR CPG+
Sbjct  419  WERPDDFDPDRFIIGDKSNIELTGQNNYELIPFGGGRRFCPGI  461



>emb|CDX83607.1| BnaC07g23470D [Brassica napus]
Length=622

 Score =   199 bits (507),  Expect = 7e-57, Method: Composition-based stats.
 Identities = 84/160 (53%), Positives = 124/160 (78%), Gaps = 1/160 (1%)
 Frame = -1

Query  534  LTWDHIKAVLMNVFVGGTDTSAVVIIWAMTALMKDPRVMNKVQKEIRELIG-EKAGKVYE  358
            L +D++K ++ ++++GG DTSA+ +IWAM  L+++PRVM K Q EIR   G ++  ++ E
Sbjct  410  LNFDNLKGIMQDIYLGGVDTSAITMIWAMAELVRNPRVMKKAQDEIRTCFGIKQKERIEE  469

Query  357  DDIKQLPYFRAVIKETLRLYTPIPLLVTREIISKCTIDEYEIKPKMIVVINAWAIARDPE  178
            +D+ +L Y + VIKETLRL+   PLL+ RE +S+  I  Y+I PK ++V+NAW+I RDP+
Sbjct  470  EDLDKLQYLKLVIKETLRLHPAGPLLLPRETMSQIKIQGYDIPPKTLLVVNAWSIGRDPK  529

Query  177  YWKAPEEFYPERFLDCNIDYKGQNFELIPFGAGRRMCPGM  58
            +W+ PEEF PERF+DC +DYKGQ+FE++PFG+GRRMCPGM
Sbjct  530  HWEDPEEFIPERFIDCPVDYKGQSFEMLPFGSGRRMCPGM  569



>emb|CDY40993.1| BnaA02g27830D [Brassica napus]
Length=379

 Score =   194 bits (494),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 83/159 (52%), Positives = 115/159 (72%), Gaps = 0/159 (0%)
 Frame = -1

Query  534  LTWDHIKAVLMNVFVGGTDTSAVVIIWAMTALMKDPRVMNKVQKEIRELIGEKAGKVYED  355
            LT DHIK  L N+F+ G DT A+ +IWAMT L K P++M KVQ EIR+ +G     + E+
Sbjct  166  LTVDHIKGFLANIFLAGIDTGAITMIWAMTELAKKPKLMKKVQDEIRDCLGNNKETITEE  225

Query  354  DIKQLPYFRAVIKETLRLYTPIPLLVTREIISKCTIDEYEIKPKMIVVINAWAIARDPEY  175
            D+ ++PY + VIKET RL+   PL++ RE +S   +  Y+I PK  +++N WAI RDP+ 
Sbjct  226  DVDKVPYLKLVIKETFRLHPAAPLILPRETMSHMKVQGYDILPKTRILVNTWAIGRDPKL  285

Query  174  WKAPEEFYPERFLDCNIDYKGQNFELIPFGAGRRMCPGM  58
            W  PEEF PERF+D ++DY+GQ++EL+PFG+GRRMCPGM
Sbjct  286  WTEPEEFNPERFIDSHVDYRGQHYELLPFGSGRRMCPGM  324



>emb|CDX83603.1| BnaC07g23430D [Brassica napus]
Length=501

 Score =   197 bits (501),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 91/159 (57%), Positives = 119/159 (75%), Gaps = 0/159 (0%)
 Frame = -1

Query  534  LTWDHIKAVLMNVFVGGTDTSAVVIIWAMTALMKDPRVMNKVQKEIRELIGEKAGKVYED  355
            LT DHIK V+ ++F+ G +TSA  I+WAMT L+K+P VM KVQ+E+R +IGEK  K+ E 
Sbjct  288  LTTDHIKGVISDIFLAGVNTSATTILWAMTELIKNPTVMKKVQEEVRTVIGEKKEKITEQ  347

Query  354  DIKQLPYFRAVIKETLRLYTPIPLLVTREIISKCTIDEYEIKPKMIVVINAWAIARDPEY  175
            D+ QL YF+ VIKET RL+   PLLV RE +S   I  Y+I  K  ++IN +AIARDP+ 
Sbjct  348  DLNQLSYFKLVIKETFRLHPTAPLLVLRETMSPFKIQGYDILKKNQIMINVYAIARDPKI  407

Query  174  WKAPEEFYPERFLDCNIDYKGQNFELIPFGAGRRMCPGM  58
            W+ P+EF PERF+D  IDY+G NFEL+PFG+GRR+CPGM
Sbjct  408  WENPDEFKPERFVDSCIDYRGLNFELLPFGSGRRICPGM  446



>gb|ACJ86287.1| unknown [Medicago truncatula]
Length=295

 Score =   192 bits (487),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 90/159 (57%), Positives = 118/159 (74%), Gaps = 1/159 (1%)
 Frame = -1

Query  534  LTWDHIKAVLMNVFVGGTDTSAVVIIWAMTALMKDPRVMNKVQKEIRELIGEKAGKVYED  355
            LT++HIKAVL++  V  TDT++   +WAMTALMK+PRV++K Q+EIR L G K   + E 
Sbjct  83   LTFNHIKAVLVDTIVAATDTTSAASVWAMTALMKNPRVLDKAQEEIRNLGGAK-DYLDEG  141

Query  354  DIKQLPYFRAVIKETLRLYTPIPLLVTREIISKCTIDEYEIKPKMIVVINAWAIARDPEY  175
            D++ LPY  AVIKETLRL+ P PLL+ RE    CTI+ Y I  + I+ +NAWAI RD   
Sbjct  142  DLQNLPYLNAVIKETLRLHLPAPLLLFRESRENCTINGYNIPARTILYVNAWAIQRDHNV  201

Query  174  WKAPEEFYPERFLDCNIDYKGQNFELIPFGAGRRMCPGM  58
            W+  EEFYPERFL+ +I++ GQ+FELI FGAGRR+CPG+
Sbjct  202  WENAEEFYPERFLESSINFTGQDFELILFGAGRRICPGL  240



>ref|XP_002530056.1| cytochrome P450, putative [Ricinus communis]
 gb|EEF32356.1| cytochrome P450, putative [Ricinus communis]
Length=507

 Score =   197 bits (501),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 86/159 (54%), Positives = 121/159 (76%), Gaps = 1/159 (1%)
 Frame = -1

Query  534  LTWDHIKAVLMNVFVGGTDTSAVVIIWAMTALMKDPRVMNKVQKEIRELIGEKAGKVYED  355
             T D+IK VL+N+F+GG DTSA+ + WAM   +++PRVM K+Q+E+R  +G+K G+V E 
Sbjct  292  FTKDNIKGVLLNLFLGGVDTSAITLNWAMAEFVRNPRVMKKLQEEVRNSVGKK-GRVTEA  350

Query  354  DIKQLPYFRAVIKETLRLYTPIPLLVTREIISKCTIDEYEIKPKMIVVINAWAIARDPEY  175
            DI +L Y + V+KET RL+   PLL+ RE +S   ++ Y+IKPK ++ +NAWAI RDP+Y
Sbjct  351  DINKLEYLKMVVKETFRLHPAAPLLIPRETLSHIKVNGYDIKPKTMIQVNAWAIGRDPKY  410

Query  174  WKAPEEFYPERFLDCNIDYKGQNFELIPFGAGRRMCPGM  58
            WK PEEF+PERF D + D+KG+++E +PFGAGRRMC GM
Sbjct  411  WKDPEEFFPERFADGSPDFKGKDYEFLPFGAGRRMCVGM  449



>ref|XP_006395567.1| hypothetical protein EUTSA_v10004067mg [Eutrema salsugineum]
 gb|ESQ32853.1| hypothetical protein EUTSA_v10004067mg [Eutrema salsugineum]
Length=497

 Score =   197 bits (501),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 89/159 (56%), Positives = 117/159 (74%), Gaps = 1/159 (1%)
 Frame = -1

Query  534  LTWDHIKAVLMNVFVGGTDTSAVVIIWAMTALMKDPRVMNKVQKEIRELIGEKAGKVYED  355
            LT +H KA+LMNV +G   TSA+ + WAM  LM++PR M KVQ E+R  +G K+   + D
Sbjct  283  LTRNHCKAILMNVLLGAISTSAITMTWAMAELMRNPRAMKKVQSEVRNQMGNKSMITF-D  341

Query  354  DIKQLPYFRAVIKETLRLYTPIPLLVTREIISKCTIDEYEIKPKMIVVINAWAIARDPEY  175
            D  QL Y + V KET RL+ P+PLLV RE++S+  I+ Y+I+PK ++ +N WAI RDP+ 
Sbjct  342  DTDQLNYLKMVTKETWRLHPPVPLLVPREVMSEFEINGYKIQPKTLLYVNTWAIGRDPDT  401

Query  174  WKAPEEFYPERFLDCNIDYKGQNFELIPFGAGRRMCPGM  58
            WK PE F PERF+D NID KGQNFEL+PFG+GRR+CPGM
Sbjct  402  WKDPEVFLPERFMDNNIDAKGQNFELLPFGSGRRICPGM  440



>gb|KFK33564.1| hypothetical protein AALP_AA5G029900 [Arabis alpina]
Length=1003

 Score =   202 bits (514),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 93/159 (58%), Positives = 120/159 (75%), Gaps = 1/159 (1%)
 Frame = -1

Query  534  LTWDHIKAVLMNVFVGGTDTSAVVIIWAMTALMKDPRVMNKVQKEIRELIGEKAGKVYED  355
            LT +HIKA+LMNV +GG DT+A+ +IWAM  LM++PRVM KVQ EIR  +G +   +  D
Sbjct  285  LTTNHIKAILMNVLLGGIDTTAITMIWAMAELMRNPRVMKKVQSEIRNQMGNRT-MITLD  343

Query  354  DIKQLPYFRAVIKETLRLYTPIPLLVTREIISKCTIDEYEIKPKMIVVINAWAIARDPEY  175
            D  QL Y + VIKET RL+ P PLLV RE++S+  I+ Y+I+PK  + +N WAI RDP+ 
Sbjct  344  DTAQLHYLKMVIKETWRLHPPAPLLVPREVMSEFEINGYKIQPKTQLYVNVWAIGRDPDT  403

Query  174  WKAPEEFYPERFLDCNIDYKGQNFELIPFGAGRRMCPGM  58
            WK PE F PERF+D +ID KGQNFEL+PFG+GRR+CPGM
Sbjct  404  WKDPEVFLPERFMDSDIDAKGQNFELLPFGSGRRICPGM  442


 Score =   184 bits (467),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 87/159 (55%), Positives = 112/159 (70%), Gaps = 1/159 (1%)
 Frame = -1

Query  534  LTWDHIKAVLMNVFVGGTDTSAVVIIWAMTALMKDPRVMNKVQKEIRELIGEKAGKVYED  355
            LT +HIKA+LMNV + G DTSA+ + WAMT L ++PRVM KVQ EIR  +G +  K+  D
Sbjct  789  LTRNHIKAILMNVLLAGIDTSAITMTWAMTELARNPRVMKKVQYEIRNQMGNRK-KISLD  847

Query  354  DIKQLPYFRAVIKETLRLYTPIPLLVTREIISKCTIDEYEIKPKMIVVINAWAIARDPEY  175
            DI    Y + VIKET RL+   P+L+ RE++S+  I+ Y I  K  + +N WAI RDP+ 
Sbjct  848  DIDHFKYLKMVIKETWRLHPTTPILLPREVMSEFEINGYTIPVKTRLHVNVWAIGRDPDT  907

Query  174  WKAPEEFYPERFLDCNIDYKGQNFELIPFGAGRRMCPGM  58
            WK PE F PERF+D +ID KGQNFEL+PFG GRRMCP +
Sbjct  908  WKDPEVFLPERFIDSDIDAKGQNFELLPFGGGRRMCPAV  946



>ref|XP_010514269.1| PREDICTED: cytochrome P450 71B3-like [Camelina sativa]
Length=304

 Score =   192 bits (487),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 83/160 (52%), Positives = 121/160 (76%), Gaps = 1/160 (1%)
 Frame = -1

Query  534  LTWDHIKAVLMNVFVGGTDTSAVVIIWAMTALMKDPRVMNKVQKEIRELIGEKAG-KVYE  358
            LT DH+  V+ N+F+ G DTSA+ +IWAMT L+++PRVM K Q+EIR  IG K   ++ E
Sbjct  87   LTIDHLHGVISNIFLAGADTSAITMIWAMTELVRNPRVMKKTQEEIRSCIGIKQNERIDE  146

Query  357  DDIKQLPYFRAVIKETLRLYTPIPLLVTREIISKCTIDEYEIKPKMIVVINAWAIARDPE  178
            +D+ +L Y + VIKETLRL+ P P+++ RE +S+  I  Y I PK ++++NAW+I ++P 
Sbjct  147  EDVDKLQYLKLVIKETLRLHPPAPVIIPRETMSQINIQGYNIPPKTLILVNAWSIGQNPY  206

Query  177  YWKAPEEFYPERFLDCNIDYKGQNFELIPFGAGRRMCPGM  58
             W+ PEEF PERF+D  +DY+GQ+FE++PFG+GRR+CPGM
Sbjct  207  RWECPEEFIPERFIDFPVDYRGQSFEMLPFGSGRRICPGM  246



>ref|XP_002523238.1| cytochrome P450, putative [Ricinus communis]
 gb|EEF39159.1| cytochrome P450, putative [Ricinus communis]
Length=509

 Score =   197 bits (501),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 88/156 (56%), Positives = 121/156 (78%), Gaps = 1/156 (1%)
 Frame = -1

Query  525  DHIKAVLMNVFVGGTDTSAVVIIWAMTALMKDPRVMNKVQKEIRELIGEKAGKVYEDDIK  346
            DHIKA+LMN+F+ G DT A+ ++WAMT L+++PRVM K Q+EIR  IG+K  KV E DI+
Sbjct  295  DHIKAILMNIFLAGVDTGAITLVWAMTELIRNPRVMKKAQEEIRSCIGDKR-KVSEIDIE  353

Query  345  QLPYFRAVIKETLRLYTPIPLLVTREIISKCTIDEYEIKPKMIVVINAWAIARDPEYWKA  166
            +L Y + V+KETLR++ P  LL+ RE +++ +I+ Y+I PK  + +N WA+ RDP+ WK 
Sbjct  354  KLGYLKIVLKETLRIHPPGVLLIPRETMAQFSINGYDIYPKTRIQVNVWAMGRDPKIWKN  413

Query  165  PEEFYPERFLDCNIDYKGQNFELIPFGAGRRMCPGM  58
            P+EFYPERFLD +IDYKG N+EL+PFG GRR CPG+
Sbjct  414  PQEFYPERFLDSSIDYKGMNYELLPFGGGRRGCPGI  449



>gb|KFK33574.1| hypothetical protein AALP_AA5G031500 [Arabis alpina]
Length=434

 Score =   195 bits (496),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 90/159 (57%), Positives = 115/159 (72%), Gaps = 2/159 (1%)
 Frame = -1

Query  534  LTWDHIKAVLMNVFVGGTDTSAVVIIWAMTALMKDPRVMNKVQKEIRELIGEKAGKVYED  355
             T +HIKA+LMN+ + G DTS++ + WAM  L K+PRVMNKVQ EIR  +  K+      
Sbjct  221  FTRNHIKAILMNILLAGIDTSSISMTWAMAELAKNPRVMNKVQSEIRNQMANKSSISL--  278

Query  354  DIKQLPYFRAVIKETLRLYTPIPLLVTREIISKCTIDEYEIKPKMIVVINAWAIARDPEY  175
            DI QL Y + VIKET RL+ P PLLV RE++S+  I+ Y+I+PK  + +N WAI  DP+ 
Sbjct  279  DIDQLHYLKMVIKETWRLHPPAPLLVPREVMSEFEINGYKIEPKTQLYVNVWAIGHDPDT  338

Query  174  WKAPEEFYPERFLDCNIDYKGQNFELIPFGAGRRMCPGM  58
            WK PE F+PERF+D NID KG NFEL+PFGAGRR+CPGM
Sbjct  339  WKDPEMFFPERFMDSNIDAKGNNFELLPFGAGRRICPGM  377



>ref|XP_009152074.1| PREDICTED: cytochrome P450 71B17-like [Brassica rapa]
Length=500

 Score =   197 bits (500),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 85/159 (53%), Positives = 117/159 (74%), Gaps = 0/159 (0%)
 Frame = -1

Query  534  LTWDHIKAVLMNVFVGGTDTSAVVIIWAMTALMKDPRVMNKVQKEIRELIGEKAGKVYED  355
            LT DHIK  L N+F+ G DT A+ +IWAMT L ++P+VM K+Q +IR+  G    ++ E 
Sbjct  287  LTLDHIKGFLTNIFIAGIDTGALTMIWAMTELARNPKVMKKLQGQIRDHFGNNKERITEK  346

Query  354  DIKQLPYFRAVIKETLRLYTPIPLLVTREIISKCTIDEYEIKPKMIVVINAWAIARDPEY  175
            DI ++PY   VIKET RL+  +PLL+ +E ++   +  Y+I PK  ++INAWAIARDP+ 
Sbjct  347  DIGKVPYLNLVIKETFRLHPVVPLLLPKETMAHIKVQGYDIPPKRRILINAWAIARDPKL  406

Query  174  WKAPEEFYPERFLDCNIDYKGQNFELIPFGAGRRMCPGM  58
            W  PEEF PERF+D ++DY+GQ+FEL+PFG+GRRMCPGM
Sbjct  407  WTNPEEFIPERFIDSHVDYRGQHFELLPFGSGRRMCPGM  445



>ref|XP_002285456.1| PREDICTED: cytochrome P450 71B34-like [Vitis vinifera]
Length=505

 Score =   196 bits (499),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 88/159 (55%), Positives = 117/159 (74%), Gaps = 1/159 (1%)
 Frame = -1

Query  534  LTWDHIKAVLMNVFVGGTDTSAVVIIWAMTALMKDPRVMNKVQKEIRELIGEKAGKVYED  355
             T D  KA++M++F+ G DT A+ + WAMT L ++PR+M K Q E+R  IG+K GKV + 
Sbjct  292  FTKDSAKAIIMDLFLAGVDTGAITLTWAMTELARNPRIMKKAQVEVRSSIGKK-GKVTKG  350

Query  354  DIKQLPYFRAVIKETLRLYTPIPLLVTREIISKCTIDEYEIKPKMIVVINAWAIARDPEY  175
            D+ QL Y + V+KETLRL+ P+PLLV RE +S   I+ Y I PK  V +N WAI RDP  
Sbjct  351  DVDQLHYLKMVVKETLRLHPPVPLLVPRETMSHFEINGYHIYPKTQVHVNVWAIGRDPNL  410

Query  174  WKAPEEFYPERFLDCNIDYKGQNFELIPFGAGRRMCPGM  58
            WK PEEF PERF+D ++D++GQ+FEL+PFGAGRR+CPGM
Sbjct  411  WKNPEEFLPERFMDNSVDFRGQHFELLPFGAGRRICPGM  449



>ref|XP_010425328.1| PREDICTED: cytochrome P450 71B3-like [Camelina sativa]
Length=505

 Score =   196 bits (499),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 87/160 (54%), Positives = 120/160 (75%), Gaps = 1/160 (1%)
 Frame = -1

Query  534  LTWDHIKAVLMNVFVGGTDTSAVVIIWAMTALMKDPRVMNKVQKEIRELIGEKAG-KVYE  358
            LT DH+  V+ N+F+ G DTSAV +IWAM  L+K+PRVM KVQ EIR  IG K   ++ E
Sbjct  293  LTVDHLHGVISNIFLAGVDTSAVTMIWAMAELIKNPRVMKKVQDEIRSCIGIKQNERIDE  352

Query  357  DDIKQLPYFRAVIKETLRLYTPIPLLVTREIISKCTIDEYEIKPKMIVVINAWAIARDPE  178
            + + +L Y + VIKETLRL+ P PLL+ RE +S+  I  Y I PK ++++NAW+I ++P 
Sbjct  353  EGVDKLQYLKLVIKETLRLHPPAPLLIPRETMSQINIQGYNIPPKTLILVNAWSIGQNPY  412

Query  177  YWKAPEEFYPERFLDCNIDYKGQNFELIPFGAGRRMCPGM  58
             W++PEEF PERF+D  +DY+GQ+FE++PFG+GRRMCPGM
Sbjct  413  RWESPEEFIPERFIDFPVDYRGQSFEMLPFGSGRRMCPGM  452



>ref|XP_010677521.1| PREDICTED: cytochrome P450 71A1-like [Beta vulgaris subsp. vulgaris]
Length=495

 Score =   196 bits (499),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 89/159 (56%), Positives = 119/159 (75%), Gaps = 1/159 (1%)
 Frame = -1

Query  534  LTWDHIKAVLMNVFVGGTDTSAVVIIWAMTALMKDPRVMNKVQKEIRELIGEKAGKVYED  355
            LT DHIKA+LMN+FV GTDTS+V+++WAM  L+K+P  M KVQ+EIR ++  K   V ++
Sbjct  284  LTLDHIKALLMNIFVAGTDTSSVMVVWAMMELVKNPHTMTKVQEEIRNVVRNK-DFVEKN  342

Query  354  DIKQLPYFRAVIKETLRLYTPIPLLVTREIISKCTIDEYEIKPKMIVVINAWAIARDPEY  175
            D+ +  YF+AV+KET RL+   PLL+  E + + TID Y+I PK +V IN WAI RD + 
Sbjct  343  DLPKFKYFKAVVKETFRLHPAAPLLIPHEAVKRTTIDGYDILPKTLVYINIWAIGRDSKL  402

Query  174  WKAPEEFYPERFLDCNIDYKGQNFELIPFGAGRRMCPGM  58
            WK PE+F PERF + +ID KG +FEL+PFGAGRRMCPG+
Sbjct  403  WKDPEKFMPERFFETSIDLKGNDFELLPFGAGRRMCPGL  441



>ref|XP_009152184.1| PREDICTED: cytochrome P450 71B34 [Brassica rapa]
Length=520

 Score =   197 bits (500),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 92/159 (58%), Positives = 117/159 (74%), Gaps = 1/159 (1%)
 Frame = -1

Query  534  LTWDHIKAVLMNVFVGGTDTSAVVIIWAMTALMKDPRVMNKVQKEIRELIGEKAGKVYED  355
            LT +HIKA+LMNV + G DTSAV ++W M  L+++PRVM KVQ EIR+ +  K G +  D
Sbjct  306  LTRNHIKAILMNVLLAGIDTSAVSMVWTMAELVRNPRVMKKVQSEIRDHVKHK-GSITFD  364

Query  354  DIKQLPYFRAVIKETLRLYTPIPLLVTREIISKCTIDEYEIKPKMIVVINAWAIARDPEY  175
             I QLPY + VIKET RL+   PLL+ RE+IS+  I+ Y I+PK  + +N WAI RDP+ 
Sbjct  365  SIDQLPYLKMVIKETWRLHPVAPLLLPREVISEFQINGYTIQPKTHLHVNVWAIGRDPDT  424

Query  174  WKAPEEFYPERFLDCNIDYKGQNFELIPFGAGRRMCPGM  58
            WK PE F PERF+D NID KGQNFEL+ FG+GRRMCPG+
Sbjct  425  WKDPETFLPERFMDSNIDAKGQNFELLTFGSGRRMCPGV  463



>ref|XP_002523235.1| cytochrome P450, putative [Ricinus communis]
 gb|EEF39156.1| cytochrome P450, putative [Ricinus communis]
Length=509

 Score =   196 bits (499),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 87/156 (56%), Positives = 120/156 (77%), Gaps = 1/156 (1%)
 Frame = -1

Query  525  DHIKAVLMNVFVGGTDTSAVVIIWAMTALMKDPRVMNKVQKEIRELIGEKAGKVYEDDIK  346
            DHIKA+LMN+F+ G DT A+ ++WAMT L+++PRVM K Q+EIR  IG+K  KV E DI+
Sbjct  295  DHIKAILMNIFLAGVDTGAITLVWAMTELIRNPRVMKKAQEEIRSCIGDKR-KVSEIDIE  353

Query  345  QLPYFRAVIKETLRLYTPIPLLVTREIISKCTIDEYEIKPKMIVVINAWAIARDPEYWKA  166
            +  Y + V+KETLR++ P  LL+ RE +++ +I+ Y+I PK  + +N WA+ RDP+ WK 
Sbjct  354  KFGYLKIVLKETLRIHPPSVLLIPRETMAQFSINGYDIYPKTRIQVNVWAMGRDPKIWKN  413

Query  165  PEEFYPERFLDCNIDYKGQNFELIPFGAGRRMCPGM  58
            P+EFYPERFLD +IDYKG N+EL+PFG GRR CPG+
Sbjct  414  PQEFYPERFLDSSIDYKGMNYELLPFGGGRRGCPGI  449



>ref|XP_010425292.1| PREDICTED: cytochrome P450 71B23 [Camelina sativa]
Length=501

 Score =   196 bits (498),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 84/159 (53%), Positives = 118/159 (74%), Gaps = 0/159 (0%)
 Frame = -1

Query  534  LTWDHIKAVLMNVFVGGTDTSAVVIIWAMTALMKDPRVMNKVQKEIRELIGEKAGKVYED  355
            LT DHIK V+ ++F+ G +TS+  I+WAMT LM+ PRVM KVQ E+R ++G K  ++ E 
Sbjct  288  LTTDHIKGVISDIFLAGVNTSSTTILWAMTELMRSPRVMKKVQDEVRTVLGGKRERITEQ  347

Query  354  DIKQLPYFRAVIKETLRLYTPIPLLVTREIISKCTIDEYEIKPKMIVVINAWAIARDPEY  175
            D+ QL YF+ VIKET RL+   PLL+ RE++S+  I +Y+I  K  +++N +AI RDP  
Sbjct  348  DLNQLNYFKLVIKETFRLHPAAPLLLPREVMSQIKIQDYDIPEKTQIMVNVYAIGRDPNL  407

Query  174  WKAPEEFYPERFLDCNIDYKGQNFELIPFGAGRRMCPGM  58
            W+ P+EF PERF D ++DY+G NFEL+PFG+GRR+CPGM
Sbjct  408  WENPDEFKPERFADSSVDYRGLNFELLPFGSGRRICPGM  446



>ref|XP_010476300.1| PREDICTED: cytochrome P450 71B28-like [Camelina sativa]
Length=489

 Score =   196 bits (498),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 84/159 (53%), Positives = 121/159 (76%), Gaps = 0/159 (0%)
 Frame = -1

Query  534  LTWDHIKAVLMNVFVGGTDTSAVVIIWAMTALMKDPRVMNKVQKEIRELIGEKAGKVYED  355
            LT DH+K ++ ++F+ G  TSA  ++WAMT L+++PRVM KVQ EIR  +G+K  ++ E+
Sbjct  284  LTTDHLKGMISDIFLAGVSTSATTLVWAMTELIRNPRVMKKVQDEIRTTLGDKKERITEE  343

Query  354  DIKQLPYFRAVIKETLRLYTPIPLLVTREIISKCTIDEYEIKPKMIVVINAWAIARDPEY  175
            D+ QL YF+ ++KE  RL+   PLL+ RE +S   +  Y+I PK  ++INA+AIARDP+ 
Sbjct  344  DLSQLDYFKLMVKEIYRLHPAAPLLLPREALSHIKVQGYDIPPKTRIIINAYAIARDPKQ  403

Query  174  WKAPEEFYPERFLDCNIDYKGQNFELIPFGAGRRMCPGM  58
            W+ P+EF P+RFL+C+IDY+G NFELIPFG+GRR+CPGM
Sbjct  404  WENPDEFNPDRFLNCSIDYRGLNFELIPFGSGRRICPGM  442



>gb|KDP36616.1| hypothetical protein JCGZ_08432 [Jatropha curcas]
Length=373

 Score =   193 bits (490),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 86/159 (54%), Positives = 121/159 (76%), Gaps = 1/159 (1%)
 Frame = -1

Query  534  LTWDHIKAVLMNVFVGGTDTSAVVIIWAMTALMKDPRVMNKVQKEIRELIGEKAGKVYED  355
            L+ DHIKA+LM++F+ G DT+A++++WAM  L+K+PR+M K Q+EIR LIG K  +  + 
Sbjct  160  LSQDHIKAILMDIFLAGVDTAAIILVWAMAELIKNPRIMKKAQEEIRTLIGNKR-EFSKS  218

Query  354  DIKQLPYFRAVIKETLRLYTPIPLLVTREIISKCTIDEYEIKPKMIVVINAWAIARDPEY  175
            +I +L Y + ++KETLRL++   LL+ RE ISK  I  YE+ PK  + +NAWAI RDP+ 
Sbjct  219  NIDKLDYLKLILKETLRLHSSGALLIPRESISKFNIGGYEVYPKTRIEVNAWAIGRDPKV  278

Query  174  WKAPEEFYPERFLDCNIDYKGQNFELIPFGAGRRMCPGM  58
            WK  E+F+PERF+D +IDYKGQ++E +PFGAGRR CPGM
Sbjct  279  WKDAEKFFPERFVDKDIDYKGQHYEFLPFGAGRRSCPGM  317



>gb|KEH29137.1| cytochrome P450 family 71 protein [Medicago truncatula]
Length=498

 Score =   196 bits (498),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 96/159 (60%), Positives = 119/159 (75%), Gaps = 1/159 (1%)
 Frame = -1

Query  534  LTWDHIKAVLMNVFVGGTDTSAVVIIWAMTALMKDPRVMNKVQKEIRELIGEKAGKVYED  355
            LT+DHIK VLMN+ V  T T++   +WAMTAL+K+PRVM KVQ+EIR    +K   + ED
Sbjct  286  LTFDHIKGVLMNMLVAATGTTSATAVWAMTALIKNPRVMKKVQQEIRNSRVKKEF-IDED  344

Query  354  DIKQLPYFRAVIKETLRLYTPIPLLVTREIISKCTIDEYEIKPKMIVVINAWAIARDPEY  175
            DI+ L Y +AVIKETLRLY P PLL  RE   KCTI+ ++I  K IV +NAWAI  D   
Sbjct  345  DIRNLSYLKAVIKETLRLYLPAPLLAPRETTEKCTINGFQIPAKAIVFVNAWAIHTDSNV  404

Query  174  WKAPEEFYPERFLDCNIDYKGQNFELIPFGAGRRMCPGM  58
            WK PEEFYPERFL+ ++++ GQ+FELIPFGAGRR+CPGM
Sbjct  405  WKNPEEFYPERFLESSLNFHGQDFELIPFGAGRRICPGM  443



>ref|XP_008221936.1| PREDICTED: cytochrome P450 71B37-like [Prunus mume]
Length=512

 Score =   196 bits (498),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 90/159 (57%), Positives = 117/159 (74%), Gaps = 1/159 (1%)
 Frame = -1

Query  534  LTWDHIKAVLMNVFVGGTDTSAVVIIWAMTALMKDPRVMNKVQKEIRELIGEKAGKVYED  355
            L  ++IKAVLMN+F+GG DTSA+ + WAM  L + P++M K Q+E+R  IG K GK+ E 
Sbjct  292  LGHNNIKAVLMNLFLGGIDTSAITMTWAMAELARKPKLMKKAQEEVRRCIGNK-GKIREG  350

Query  354  DIKQLPYFRAVIKETLRLYTPIPLLVTREIISKCTIDEYEIKPKMIVVINAWAIARDPEY  175
            D  +L Y + +IKETLRL+ P PL++ RE +S   I  Y++ PK +V +N WAIARDPE 
Sbjct  351  DTDELEYLKMIIKETLRLHPPAPLILPREAMSHFKIQGYDVDPKTLVFVNDWAIARDPES  410

Query  174  WKAPEEFYPERFLDCNIDYKGQNFELIPFGAGRRMCPGM  58
            WK PEEF PERF   +IDYKGQ+FE +PFGAGRR+CPGM
Sbjct  411  WKDPEEFIPERFDGSSIDYKGQHFEFLPFGAGRRVCPGM  449



>emb|CDY13622.1| BnaA06g33010D [Brassica napus]
Length=464

 Score =   195 bits (495),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 82/160 (51%), Positives = 123/160 (77%), Gaps = 1/160 (1%)
 Frame = -1

Query  534  LTWDHIKAVLMNVFVGGTDTSAVVIIWAMTALMKDPRVMNKVQKEIRELIG-EKAGKVYE  358
            + +D++K ++ ++++ G DTSA+ +IWAM  L+++PRVM K Q EIR   G ++  ++ E
Sbjct  252  INFDNLKGIMQDIYLAGVDTSAITMIWAMAELVRNPRVMKKAQDEIRTCFGIKQKERIEE  311

Query  357  DDIKQLPYFRAVIKETLRLYTPIPLLVTREIISKCTIDEYEIKPKMIVVINAWAIARDPE  178
            +D+ +L Y + VIKETLRL+   PLL+ RE +S+  I  Y+I PK ++V+NAW+I RDP+
Sbjct  312  EDVDKLQYLKLVIKETLRLHPAAPLLLPRETMSQIKIQGYDIPPKTLLVVNAWSIGRDPK  371

Query  177  YWKAPEEFYPERFLDCNIDYKGQNFELIPFGAGRRMCPGM  58
            +W+ PEEF PERF+DC +DYKGQ+FE++PFG+GRRMCPGM
Sbjct  372  HWEDPEEFIPERFIDCPVDYKGQSFEMLPFGSGRRMCPGM  411



>ref|XP_010514261.1| PREDICTED: cytochrome P450 71B17-like [Camelina sativa]
Length=505

 Score =   196 bits (498),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 85/159 (53%), Positives = 119/159 (75%), Gaps = 0/159 (0%)
 Frame = -1

Query  534  LTWDHIKAVLMNVFVGGTDTSAVVIIWAMTALMKDPRVMNKVQKEIRELIGEKAGKVYED  355
            LT DHIKA+L N+F+GG DT A+ +IWAMT L+K P VM KVQ EIR+ +G    ++ E+
Sbjct  292  LTTDHIKALLSNLFLGGVDTGAITMIWAMTELVKTPEVMKKVQGEIRDRLGNNRERITEE  351

Query  354  DIKQLPYFRAVIKETLRLYTPIPLLVTREIISKCTIDEYEIKPKMIVVINAWAIARDPEY  175
            D+ ++P+   VIKET RL+   PLL+ RE ++   +  Y+I PK  +++NAWAI RD +Y
Sbjct  352  DVDKVPFLNMVIKETFRLHPAAPLLLPRETMAHIKVQGYDIPPKTQILVNAWAIGRDQKY  411

Query  174  WKAPEEFYPERFLDCNIDYKGQNFELIPFGAGRRMCPGM  58
            W +PEEF PERF+D  +DYKG++FEL+PFG+GRR+CPG+
Sbjct  412  WTSPEEFNPERFIDSPVDYKGRHFELLPFGSGRRICPGI  450



>emb|CDY13621.1| BnaA06g33020D [Brassica napus]
Length=501

 Score =   196 bits (497),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 90/159 (57%), Positives = 118/159 (74%), Gaps = 0/159 (0%)
 Frame = -1

Query  534  LTWDHIKAVLMNVFVGGTDTSAVVIIWAMTALMKDPRVMNKVQKEIRELIGEKAGKVYED  355
            LT DHIK V+ ++F+ G +TSA  I+WAMT L+K+P VM KVQ+E+R ++GEK  K+ E 
Sbjct  288  LTTDHIKGVISDIFLAGVNTSATTILWAMTELIKNPSVMKKVQEEVRTVLGEKKEKITEQ  347

Query  354  DIKQLPYFRAVIKETLRLYTPIPLLVTREIISKCTIDEYEIKPKMIVVINAWAIARDPEY  175
            D+ QL YF+ VIKET RL+   PLLV RE +S   I  Y+I  K  ++IN +AIARDP+ 
Sbjct  348  DLNQLSYFKLVIKETFRLHPTAPLLVPRETMSPIKIQGYDILKKNQIMINVYAIARDPKT  407

Query  174  WKAPEEFYPERFLDCNIDYKGQNFELIPFGAGRRMCPGM  58
            W+ P+EF PERF D  IDY+G NFEL+PFG+GRR+CPGM
Sbjct  408  WENPDEFKPERFADSCIDYRGLNFELLPFGSGRRICPGM  446



>gb|ABC59084.1| cytochrome P450 monooxygenase CYP83G1 [Medicago truncatula]
 gb|AES98795.2| cytochrome P450 family 71 protein [Medicago truncatula]
 gb|AES98800.2| cytochrome P450 family 71 protein [Medicago truncatula]
Length=506

 Score =   196 bits (497),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 90/159 (57%), Positives = 123/159 (77%), Gaps = 1/159 (1%)
 Frame = -1

Query  534  LTWDHIKAVLMNVFVGGTDTSAVVIIWAMTALMKDPRVMNKVQKEIRELIGEKAGKVYED  355
            LT +HIK ++MN+    T+T A  ++WAMTALMK+PR M KVQ+EIR++   K G + E+
Sbjct  291  LTAEHIKPLIMNMSFAVTETIAAAVVWAMTALMKNPRAMQKVQEEIRKVCAGK-GFIEEE  349

Query  354  DIKQLPYFRAVIKETLRLYTPIPLLVTREIISKCTIDEYEIKPKMIVVINAWAIARDPEY  175
            D+++LPYF+AVIKE++RLY  +P+L+ RE ++ C I  Y+I  K +V +NA AI RDPE 
Sbjct  350  DVEKLPYFKAVIKESMRLYPILPILLPRETMTNCNIAGYDIPDKTLVYVNALAIHRDPEV  409

Query  174  WKAPEEFYPERFLDCNIDYKGQNFELIPFGAGRRMCPGM  58
            WK PEEFYPERF+  +ID KGQ+FELIPFG+GRR+CPG+
Sbjct  410  WKDPEEFYPERFIGSDIDLKGQDFELIPFGSGRRICPGL  448



>ref|XP_009152069.1| PREDICTED: cytochrome P450 71B23 [Brassica rapa]
Length=501

 Score =   196 bits (497),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 90/159 (57%), Positives = 118/159 (74%), Gaps = 0/159 (0%)
 Frame = -1

Query  534  LTWDHIKAVLMNVFVGGTDTSAVVIIWAMTALMKDPRVMNKVQKEIRELIGEKAGKVYED  355
            LT DHIK V+ ++F+ G +TSA  I+WAMT L+K+P VM KVQ+E+R ++GEK  K+ E 
Sbjct  288  LTTDHIKGVISDIFLAGVNTSATTILWAMTELIKNPSVMKKVQEEVRTVLGEKKEKITEQ  347

Query  354  DIKQLPYFRAVIKETLRLYTPIPLLVTREIISKCTIDEYEIKPKMIVVINAWAIARDPEY  175
            D+ QL YF+ VIKET RL+   PLLV RE +S   I  Y+I  K  ++IN +AIARDP+ 
Sbjct  348  DLNQLSYFKLVIKETFRLHPTAPLLVPRETMSPIKIQGYDILKKNQIMINVYAIARDPKT  407

Query  174  WKAPEEFYPERFLDCNIDYKGQNFELIPFGAGRRMCPGM  58
            W+ P+EF PERF D  IDY+G NFEL+PFG+GRR+CPGM
Sbjct  408  WENPDEFKPERFADSCIDYRGLNFELLPFGSGRRICPGM  446



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 510262503360