BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c6298_g1_i1 len=1416 path=[1394:0-566 1961:567-1415]

Length=1416
                                                                      Score     E

ref|XP_004247709.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    455   5e-154   
ref|XP_006379886.1|  hypothetical protein POPTR_0008s16530g             450   5e-152   
ref|XP_009768587.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    449   6e-152   
ref|XP_002284582.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    447   3e-151   Vitis vinifera
ref|XP_009761530.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    448   3e-151   
ref|XP_010650056.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    446   8e-151   
ref|XP_007035066.1|  2-oxoglutarate (2OG) and Fe(II)-dependent ox...    446   1e-150   
ref|XP_006420907.1|  hypothetical protein CICLE_v10005201mg             446   2e-150   
ref|XP_009600230.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    445   2e-150   
ref|XP_011029845.1|  PREDICTED: LOW QUALITY PROTEIN: 1-aminocyclo...    445   5e-150   
gb|KDP40307.1|  hypothetical protein JCGZ_02305                         444   7e-150   
ref|XP_002284663.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    444   8e-150   Vitis vinifera
emb|CAN66006.1|  hypothetical protein VITISV_042886                     443   2e-149   Vitis vinifera
ref|XP_004246496.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    441   1e-148   
emb|CAN66433.1|  hypothetical protein VITISV_027452                     441   1e-148   Vitis vinifera
emb|CAN67227.1|  hypothetical protein VITISV_000872                     441   2e-148   Vitis vinifera
ref|XP_006493816.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    440   3e-148   
ref|XP_010650061.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    440   4e-148   
ref|XP_010262283.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    439   1e-147   
ref|XP_006420181.1|  hypothetical protein CICLE_v10005008mg             440   2e-147   
emb|CAN80594.1|  hypothetical protein VITISV_017626                     437   5e-147   Vitis vinifera
ref|XP_002284638.2|  PREDICTED: LOW QUALITY PROTEIN: 1-aminocyclo...    447   1e-146   Vitis vinifera
ref|XP_010650057.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    436   1e-146   
ref|XP_010650062.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    435   4e-146   
ref|XP_011040547.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    434   9e-146   
ref|XP_008222546.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    434   9e-146   
ref|XP_010262281.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    434   1e-145   
ref|XP_009379005.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    433   2e-145   
ref|XP_006341094.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    432   3e-145   
ref|XP_008222545.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    432   3e-145   
ref|XP_002317688.1|  hypothetical protein POPTR_0011s15970g             432   4e-145   Populus trichocarpa [western balsam poplar]
ref|XP_002529300.1|  Desacetoxyvindoline 4-hydroxylase, putative        431   1e-144   Ricinus communis
ref|XP_008391709.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    429   7e-144   
ref|XP_010262287.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    429   7e-144   
ref|XP_003632020.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    439   2e-143   
ref|XP_010672757.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    427   3e-143   
ref|XP_007226473.1|  hypothetical protein PRUPE_ppa027196mg             426   1e-142   
ref|NP_001234624.1|  2-oxoglutarate-dependent dioxygenase               426   1e-142   
ref|XP_011073515.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    426   2e-142   
ref|XP_008365367.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    425   3e-142   
ref|XP_002529305.1|  Desacetoxyvindoline 4-hydroxylase, putative        424   4e-142   Ricinus communis
ref|XP_004246497.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    424   4e-142   
ref|XP_002315713.1|  hypothetical protein POPTR_0010s08410g             424   5e-142   Populus trichocarpa [western balsam poplar]
ref|NP_001241230.1|  uncharacterized protein LOC100790198               423   1e-141   
gb|KHN28456.1|  1-aminocyclopropane-1-carboxylate oxidase like 12       422   2e-141   
ref|XP_002529304.1|  Desacetoxyvindoline 4-hydroxylase, putative        422   3e-141   Ricinus communis
ref|XP_008224381.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    422   4e-141   
ref|XP_007035064.1|  2-oxoglutarate (2OG) and Fe(II)-dependent ox...    421   5e-141   
ref|XP_002529299.1|  Desacetoxyvindoline 4-hydroxylase, putative        431   7e-141   Ricinus communis
ref|XP_006586237.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    421   1e-140   
ref|XP_011091186.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    420   2e-140   
ref|XP_002315712.2|  hypothetical protein POPTR_0010s08390g             420   2e-140   Populus trichocarpa [western balsam poplar]
ref|XP_008222541.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    421   2e-140   
ref|XP_003521041.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    420   3e-140   
gb|KDO44343.1|  hypothetical protein CISIN_1g017182mg                   420   3e-140   
ref|XP_006489566.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    419   4e-140   
ref|XP_007223295.1|  hypothetical protein PRUPE_ppa007267mg             419   5e-140   
ref|XP_006351987.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    419   5e-140   
ref|XP_010026849.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    422   5e-140   
ref|XP_003628028.1|  1-aminocyclopropane-1-carboxylate oxidase-li...    419   8e-140   
ref|XP_004511093.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    419   9e-140   
ref|XP_009379006.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    418   1e-139   
ref|XP_007035068.1|  2-oxoglutarate (2OG) and Fe(II)-dependent ox...    418   1e-139   
ref|XP_006354515.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    418   1e-139   
ref|XP_007035062.1|  2-oxoglutarate (2OG) and Fe(II)-dependent ox...    418   1e-139   
ref|XP_011030520.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    417   2e-139   
ref|XP_007223277.1|  hypothetical protein PRUPE_ppa007265mg             417   3e-139   
gb|KHN10894.1|  1-aminocyclopropane-1-carboxylate oxidase like 1        417   3e-139   
ref|XP_008222547.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    417   4e-139   
ref|XP_008224382.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    417   4e-139   
ref|XP_007223369.1|  hypothetical protein PRUPE_ppa007487mg             416   5e-139   
ref|XP_009591157.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    416   6e-139   
ref|XP_006352055.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    415   2e-138   
ref|XP_006341092.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    415   2e-138   
ref|XP_006489565.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    414   3e-138   
gb|KDO44340.1|  hypothetical protein CISIN_1g017376mg                   415   3e-138   
ref|XP_010274816.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    416   4e-138   
gb|KDP40308.1|  hypothetical protein JCGZ_02306                         414   4e-138   
ref|XP_009599435.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    414   4e-138   
ref|XP_006341091.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    414   5e-138   
gb|KDP40305.1|  hypothetical protein JCGZ_02303                         414   5e-138   
ref|XP_011091187.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    414   5e-138   
ref|XP_006420179.1|  hypothetical protein CICLE_v10005202mg             414   5e-138   
ref|XP_009626886.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    414   7e-138   
ref|XP_010093417.1|  Deacetoxyvindoline 4-hydroxylase                   413   1e-137   
gb|AAD38147.1|AF139500_1  unknown                                       413   1e-137   Prunus armeniaca
ref|XP_010650059.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    412   2e-137   
ref|XP_004247920.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    413   2e-137   
ref|XP_010262288.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    413   2e-137   
ref|XP_004299419.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    412   3e-137   
ref|XP_007035060.1|  2-oxoglutarate (2OG) and Fe(II)-dependent ox...    412   4e-137   
ref|XP_008224380.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    411   5e-137   
ref|XP_004246493.2|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    411   5e-137   
ref|XP_009347727.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    411   7e-137   
ref|XP_006341093.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    411   7e-137   
ref|XP_008338503.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    411   9e-137   
ref|XP_007035061.1|  2-oxoglutarate (2OG) and Fe(II)-dependent ox...    410   1e-136   
ref|XP_006354512.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    410   2e-136   
gb|AFK38092.1|  unknown                                                 409   5e-136   
ref|XP_009784072.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    409   5e-136   
ref|XP_007035057.1|  2-oxoglutarate (2OG) and Fe(II)-dependent ox...    409   6e-136   
ref|XP_010104048.1|  1-aminocyclopropane-1-carboxylate oxidase-3-...    409   6e-136   
ref|XP_011091183.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    409   1e-135   
ref|XP_004491714.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    408   1e-135   
ref|NP_172147.2|  2-oxoglutarate-dependent dioxygenase-like protein     407   1e-135   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011091188.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    407   2e-135   
ref|XP_010326756.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    407   2e-135   
ref|XP_010510283.1|  PREDICTED: probable 2-oxoacid dependent diox...    407   2e-135   
ref|XP_003635549.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    407   3e-135   
ref|XP_011091184.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    407   3e-135   
emb|CBI23594.3|  unnamed protein product                                405   3e-135   
ref|XP_003628030.1|  1-aminocyclopropane-1-carboxylate oxidase-li...    407   4e-135   
ref|XP_006354513.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    406   6e-135   
ref|XP_011073514.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    406   6e-135   
ref|XP_009119045.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    405   8e-135   
ref|XP_003591799.1|  1-aminocyclopropane-1-carboxylate oxidase-li...    405   2e-134   
emb|CBI23590.3|  unnamed protein product                                405   2e-134   
ref|XP_006354516.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    405   2e-134   
ref|XP_003532286.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    404   3e-134   
gb|AET01263.2|  1-aminocyclopropane-1-carboxylate oxidase-like pr...    405   3e-134   
ref|XP_003596176.1|  1-aminocyclopropane-1-carboxylate oxidase-li...    404   4e-134   
ref|XP_006598206.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    404   4e-134   
emb|CBI23596.3|  unnamed protein product                                403   4e-134   
ref|XP_003626787.1|  1-aminocyclopropane-1-carboxylate oxidase-li...    404   4e-134   
ref|NP_180641.1|  2-oxoglutarate dependent oxygenase-like protein       403   5e-134   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009379007.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    403   5e-134   
ref|XP_010023986.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    404   6e-134   
ref|XP_010023982.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    404   7e-134   
ref|XP_004296613.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    403   8e-134   
gb|KDP40304.1|  hypothetical protein JCGZ_02302                         403   1e-133   
ref|XP_004247708.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    403   1e-133   
ref|XP_010093410.1|  1-aminocyclopropane-1-carboxylate oxidase-3-...    402   2e-133   
ref|XP_010023987.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    402   3e-133   
gb|KCW60387.1|  hypothetical protein EUGRSUZ_H03103                     400   3e-133   
gb|EYU42211.1|  hypothetical protein MIMGU_mgv1a008992mg                401   4e-133   
gb|EYU32968.1|  hypothetical protein MIMGU_mgv1a008832mg                401   4e-133   
ref|XP_010274803.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    401   5e-133   
ref|XP_009347725.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    400   9e-133   
ref|XP_007226673.1|  hypothetical protein PRUPE_ppa021125mg             399   1e-132   
ref|XP_006350684.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    400   1e-132   
ref|XP_009796112.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    400   1e-132   
gb|KEH22659.1|  2OG-Fe(II) oxygenase family oxidoreductase              400   1e-132   
ref|XP_008438545.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    400   2e-132   
ref|XP_011091222.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    399   2e-132   
ref|XP_007149297.1|  hypothetical protein PHAVU_005G058400g             399   3e-132   
ref|XP_010414213.1|  PREDICTED: probable 2-oxoacid dependent diox...    399   3e-132   
ref|XP_004513523.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    399   4e-132   
ref|XP_007140617.1|  hypothetical protein PHAVU_008G127200g             399   6e-132   
ref|XP_010023981.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    398   7e-132   
ref|XP_010469792.1|  PREDICTED: probable 2-oxoacid dependent diox...    398   8e-132   
ref|XP_009802074.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    397   2e-131   
ref|XP_011029844.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    396   3e-131   
gb|EYU32538.1|  hypothetical protein MIMGU_mgv1a008409mg                397   3e-131   
ref|XP_008224379.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    396   4e-131   
ref|XP_004171996.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    396   6e-131   
ref|XP_003609637.1|  1-aminocyclopropane-1-carboxylate oxidase-li...    396   7e-131   
ref|XP_006587351.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    395   8e-131   
ref|XP_003596185.1|  1-aminocyclopropane-1-carboxylate oxidase-li...    395   9e-131   
ref|XP_006586236.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    395   1e-130   
ref|XP_010026850.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    395   1e-130   
ref|XP_007140619.1|  hypothetical protein PHAVU_008G127400g             395   1e-130   
ref|XP_010457801.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    395   1e-130   
ref|XP_010557155.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    395   1e-130   
ref|XP_010457800.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    394   2e-130   
gb|AES62052.2|  2OG-Fe(II) oxygenase family oxidoreductase              394   3e-130   
ref|XP_004309371.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    395   3e-130   
ref|XP_003534012.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    394   3e-130   
gb|AES66420.2|  2OG-Fe(II) oxygenase family oxidoreductase              394   3e-130   
ref|XP_006598208.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    394   3e-130   
ref|XP_004134416.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    394   3e-130   
gb|AAC49827.1|  desacetoxyvindoline 4-hydroxylase                       394   3e-130   Catharanthus roseus [chatas]
ref|XP_010556890.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    394   4e-130   
ref|XP_007152330.1|  hypothetical protein PHAVU_004G120800g             394   4e-130   
ref|XP_008367169.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    394   4e-130   
gb|AAC49826.1|  desacetoxyvindoline 4-hydroxylase                       394   4e-130   Catharanthus roseus [chatas]
ref|XP_004134072.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    394   4e-130   
gb|KFK31257.1|  hypothetical protein AALP_AA6G088800                    393   5e-130   
gb|ACU19421.1|  unknown                                                 394   5e-130   Glycine max [soybeans]
ref|XP_003591798.1|  1-aminocyclopropane-1-carboxylate oxidase-li...    393   7e-130   
ref|XP_004134415.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    394   7e-130   
ref|XP_004167607.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    393   8e-130   
ref|XP_010025844.1|  PREDICTED: LOW QUALITY PROTEIN: 1-aminocyclo...    392   1e-129   
ref|XP_008779114.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    392   1e-129   
ref|XP_010102247.1|  1-aminocyclopropane-1-carboxylate oxidase-1-...    392   1e-129   
ref|XP_004309351.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    395   1e-129   
ref|XP_004247706.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    392   1e-129   
ref|XP_004296614.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    392   1e-129   
sp|O04847.2|DV4H_CATRO  RecName: Full=Deacetoxyvindoline 4-hydrox...    393   2e-129   Catharanthus roseus [chatas]
ref|XP_003596162.1|  1-aminocyclopropane-1-carboxylate oxidase-li...    392   2e-129   
ref|XP_010475402.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    392   2e-129   
gb|KHN22506.1|  1-aminocyclopropane-1-carboxylate oxidase like 1        392   2e-129   
ref|XP_007149300.1|  hypothetical protein PHAVU_005G058700g             392   2e-129   
ref|XP_008438542.1|  PREDICTED: LOW QUALITY PROTEIN: 1-aminocyclo...    392   3e-129   
ref|XP_003628651.1|  1-aminocyclopropane-1-carboxylate oxidase-li...    392   3e-129   
ref|XP_007149298.1|  hypothetical protein PHAVU_005G058500g             391   3e-129   
ref|XP_004510134.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    391   4e-129   
ref|XP_006304979.1|  hypothetical protein CARUB_v10011473mg             391   4e-129   
ref|XP_002276308.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    390   4e-129   Vitis vinifera
gb|KEH18776.1|  1-aminocyclopropane-1-carboxylate oxidase-like pr...    390   6e-129   
ref|XP_003534014.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    391   6e-129   
emb|CDO99204.1|  unnamed protein product                                399   1e-128   
emb|CBI23588.3|  unnamed protein product                                387   1e-128   
ref|XP_008367206.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    390   1e-128   
ref|XP_004247710.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    390   1e-128   
ref|XP_008438543.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    390   1e-128   
ref|XP_003626795.1|  1-aminocyclopropane-1-carboxylate oxidase-li...    390   1e-128   
ref|XP_010475401.1|  PREDICTED: LOW QUALITY PROTEIN: 1-aminocyclo...    390   2e-128   
ref|XP_008380113.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    389   2e-128   
ref|XP_010475400.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    389   2e-128   
ref|XP_006367031.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    389   3e-128   
ref|XP_007140620.1|  hypothetical protein PHAVU_008G127500g             389   3e-128   
ref|XP_008438546.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    389   4e-128   
ref|XP_006598207.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    389   4e-128   
ref|XP_002529306.1|  Desacetoxyvindoline 4-hydroxylase, putative        389   5e-128   Ricinus communis
gb|AFK35571.1|  unknown                                                 388   5e-128   
ref|XP_010023989.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    388   6e-128   
ref|XP_009347731.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    388   6e-128   
ref|XP_006588550.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    388   6e-128   
ref|XP_004488811.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    388   6e-128   
ref|XP_002529301.1|  Desacetoxyvindoline 4-hydroxylase, putative        387   7e-128   Ricinus communis
ref|XP_006283978.1|  hypothetical protein CARUB_v10005101mg             388   7e-128   
ref|XP_003626788.1|  1-aminocyclopropane-1-carboxylate oxidase-li...    388   7e-128   
ref|XP_002276339.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    387   7e-128   Vitis vinifera
dbj|BAB68392.1|  CmE8                                                   387   1e-127   Cucumis melo [Oriental melon]
ref|XP_006354514.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    387   1e-127   
emb|CBI23601.3|  unnamed protein product                                388   1e-127   
gb|KFK42977.1|  hypothetical protein AALP_AA1G063700                    387   1e-127   
gb|KFK31253.1|  hypothetical protein AALP_AA6G088500                    387   1e-127   
ref|XP_009347730.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    387   2e-127   
ref|XP_006489612.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    388   2e-127   
ref|XP_002315711.2|  hypothetical protein POPTR_0010s08380g             387   2e-127   Populus trichocarpa [western balsam poplar]
ref|XP_004236794.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    386   2e-127   
ref|XP_003596174.1|  1-aminocyclopropane-1-carboxylate oxidase-li...    387   3e-127   
ref|XP_010026859.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    386   3e-127   
ref|XP_011030519.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    386   3e-127   
gb|KHG16548.1|  hypothetical protein F383_20832                         386   4e-127   
gb|ABK96309.1|  unknown                                                 386   4e-127   Populus trichocarpa x Populus deltoides
ref|XP_006367030.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    386   5e-127   
ref|XP_006417896.1|  hypothetical protein EUTSA_v10009596mg             389   5e-127   
gb|KHN22504.1|  1-aminocyclopropane-1-carboxylate oxidase like 1        386   5e-127   
gb|AAK44137.1|AF370322_1  putative oxidoreductase                       385   5e-127   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009765554.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    385   7e-127   
ref|XP_010457799.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    385   8e-127   
ref|XP_010671066.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    385   8e-127   
ref|XP_010486415.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    385   9e-127   
ref|XP_004297996.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    394   9e-127   
ref|XP_002889610.1|  predicted protein                                  385   1e-126   
ref|XP_008224378.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    385   1e-126   
ref|NP_172150.1|  2-oxoglutarate-dependent dioxygenase-like protein     385   1e-126   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002889612.1|  hypothetical protein ARALYDRAFT_470684             385   1e-126   
ref|XP_009802072.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    385   1e-126   
ref|XP_004134074.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    384   2e-126   
ref|XP_010556889.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    384   2e-126   
ref|XP_010326755.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    385   2e-126   
gb|KFK42981.1|  hypothetical protein AALP_AA1G064100                    384   2e-126   
gb|AET03089.2|  2OG-Fe(II) oxygenase family oxidoreductase              384   3e-126   
ref|XP_003633274.2|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    384   3e-126   
gb|KEH17852.1|  2OG-Fe(II) oxygenase family oxidoreductase              384   3e-126   
gb|ABV25958.1|  D4H-like protein                                        384   3e-126   Catharanthus roseus [chatas]
gb|EYU32539.1|  hypothetical protein MIMGU_mgv1a008275mg                384   3e-126   
gb|KHN11000.1|  1-aminocyclopropane-1-carboxylate oxidase like 12       382   4e-126   
ref|XP_010483594.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    383   4e-126   
ref|XP_009119044.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    383   4e-126   
gb|AFK38415.1|  unknown                                                 383   4e-126   
ref|XP_009141104.1|  PREDICTED: probable 2-oxoacid dependent diox...    383   5e-126   
ref|XP_004236795.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    383   6e-126   
ref|XP_004495381.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    382   7e-126   
ref|XP_004299418.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    382   7e-126   
gb|KFK42982.1|  hypothetical protein AALP_AA1G064200                    382   8e-126   
ref|XP_002881136.1|  hypothetical protein ARALYDRAFT_482001             382   9e-126   
ref|XP_007035072.1|  2-oxoglutarate and Fe(II)-dependent oxygenas...    382   9e-126   
ref|XP_006378347.1|  hypothetical protein POPTR_0010s08400g             382   1e-125   
ref|XP_006587350.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    382   1e-125   
ref|XP_008354408.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    382   1e-125   
ref|XP_003626790.1|  1-aminocyclopropane-1-carboxylate oxidase-li...    382   1e-125   
emb|CBI21960.3|  unnamed protein product                                392   2e-125   
emb|CDO99213.1|  unnamed protein product                                381   3e-125   
ref|XP_003626775.1|  1-aminocyclopropane-1-carboxylate oxidase-li...    381   3e-125   
ref|XP_010671067.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    381   4e-125   
ref|XP_008224374.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    381   9e-125   
ref|XP_006420182.1|  hypothetical protein CICLE_v10006571mg             380   1e-124   
gb|AES87341.2|  2OG-Fe(II) oxygenase family oxidoreductase              380   1e-124   
gb|KDO44344.1|  hypothetical protein CISIN_1g017697mg                   380   1e-124   
gb|KEH22669.1|  2OG-Fe(II) oxygenase family oxidoreductase              380   1e-124   
ref|XP_009119046.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    379   1e-124   
ref|XP_007099680.1|  2-oxoglutarate (2OG) and Fe(II)-dependent ox...    380   1e-124   
ref|XP_010450550.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    379   1e-124   
gb|KCW60386.1|  hypothetical protein EUGRSUZ_H03102                     376   2e-124   
ref|XP_010435699.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    379   2e-124   
gb|AFK46776.1|  unknown                                                 379   2e-124   
ref|XP_006296340.1|  hypothetical protein CARUB_v10025512mg             379   2e-124   
ref|XP_003548216.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    379   2e-124   
emb|CDX71105.1|  BnaC03g11890D                                          378   3e-124   
ref|XP_009119310.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    378   4e-124   
ref|XP_003596167.1|  1-aminocyclopropane-1-carboxylate oxidase-li...    377   5e-124   
ref|XP_002889611.1|  predicted protein                                  378   7e-124   
ref|XP_007149301.1|  hypothetical protein PHAVU_005G058800g             378   7e-124   
ref|XP_006489571.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    377   7e-124   
ref|XP_009141108.1|  PREDICTED: probable 2-oxoacid dependent diox...    377   7e-124   
gb|KHN22503.1|  1-aminocyclopropane-1-carboxylate oxidase like 1        382   8e-124   
gb|KFK42979.1|  hypothetical protein AALP_AA1G063900                    377   8e-124   
emb|CDX97789.1|  BnaC04g41500D                                          377   1e-123   
ref|NP_001241514.1|  uncharacterized protein LOC100792296               377   1e-123   
gb|AES66414.2|  2OG-Fe(II) oxygenase family oxidoreductase              377   2e-123   
ref|XP_006356486.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    377   2e-123   
ref|XP_003623991.1|  1-aminocyclopropane-1-carboxylate oxidase-li...    377   2e-123   
ref|XP_010457797.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    376   2e-123   
ref|XP_006294352.1|  hypothetical protein CARUB_v10023369mg             377   2e-123   
ref|XP_004134073.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    378   2e-123   
gb|KEH38331.1|  2OG-Fe(II) oxygenase family oxidoreductase              376   2e-123   
emb|CDX88705.1|  BnaA03g09440D                                          376   4e-123   
ref|XP_003596163.1|  1-aminocyclopropane-1-carboxylate oxidase-li...    377   4e-123   
ref|XP_009619591.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    375   4e-123   
ref|XP_010672098.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    375   4e-123   
ref|XP_009131992.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    375   5e-123   
emb|CDY06221.1|  BnaA09g49820D                                          375   5e-123   
ref|XP_009118492.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    375   7e-123   
gb|AFK38250.1|  unknown                                                 375   7e-123   
ref|NP_172149.1|  2-oxoglutarate-dependent dioxygenase-like protein     375   9e-123   
emb|CDY10161.1|  BnaC05g04040D                                          374   9e-123   
ref|XP_007223357.1|  hypothetical protein PRUPE_ppa007457mg             375   1e-122   
ref|XP_007221652.1|  hypothetical protein PRUPE_ppb006192mg             374   1e-122   
ref|XP_003596158.1|  1-aminocyclopropane-1-carboxylate oxidase-li...    374   1e-122   
ref|XP_010457795.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    374   2e-122   
emb|CDO99192.1|  unnamed protein product                                374   2e-122   
emb|CAN82828.1|  hypothetical protein VITISV_043897                     386   2e-122   
ref|XP_008438548.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    374   2e-122   
ref|XP_010557154.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    373   3e-122   
ref|XP_004134077.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    374   3e-122   
ref|XP_004167606.1|  PREDICTED: LOW QUALITY PROTEIN: 1-aminocyclo...    374   3e-122   
ref|XP_010904576.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    373   4e-122   
ref|XP_010457796.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    373   4e-122   
emb|CDY09965.1|  BnaC08g44860D                                          373   5e-122   
ref|XP_009118490.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    372   7e-122   
ref|XP_007149296.1|  hypothetical protein PHAVU_005G058300g             372   1e-121   
ref|XP_010486403.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    372   1e-121   
ref|NP_180642.1|  2-oxoglutarate dependent oxygenase-like protein       372   1e-121   
ref|XP_008438549.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    373   1e-121   
gb|AES60333.2|  aminocyclopropanecarboxylate oxidase                    371   2e-121   
ref|XP_010650055.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    370   2e-121   
ref|XP_010440899.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    371   2e-121   
ref|XP_009626185.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    372   2e-121   
ref|XP_007152329.1|  hypothetical protein PHAVU_004G120700g             371   3e-121   
gb|AFK45613.1|  unknown                                                 370   4e-121   
ref|XP_007152331.1|  hypothetical protein PHAVU_004G120900g             370   4e-121   
ref|XP_007152328.1|  hypothetical protein PHAVU_004G120600g             372   4e-121   
ref|XP_010680231.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    370   5e-121   
ref|XP_009118527.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    370   5e-121   
ref|XP_004979105.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    370   6e-121   
ref|XP_004142180.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    370   1e-120   
ref|XP_003596159.1|  1-aminocyclopropane-1-carboxylate oxidase-li...    369   1e-120   
ref|XP_010475404.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    369   1e-120   
ref|XP_008460628.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    369   1e-120   
ref|NP_200762.1|  oxidoreductase, 2OG-Fe(II) oxygenase family pro...    369   2e-120   
gb|KCW60401.1|  hypothetical protein EUGRSUZ_H03119                     369   2e-120   
emb|CBI23597.3|  unnamed protein product                                369   2e-120   
ref|XP_003626796.1|  1-aminocyclopropane-1-carboxylate oxidase-li...    369   2e-120   
ref|XP_004247712.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    368   3e-120   
gb|KFK27480.1|  hypothetical protein AALP_AA8G389000                    368   3e-120   
ref|XP_008460629.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    369   3e-120   
ref|XP_010483596.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    368   4e-120   
emb|CDX71101.1|  BnaC03g11850D                                          367   6e-120   
ref|XP_007227098.1|  hypothetical protein PRUPE_ppa025648mg             366   7e-120   
gb|KFK42774.1|  hypothetical protein AALP_AA1G037800                    367   7e-120   
gb|KFK42978.1|  hypothetical protein AALP_AA1G063800                    367   1e-119   
ref|XP_010650060.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    366   1e-119   
ref|XP_007134370.1|  hypothetical protein PHAVU_010G042000g             367   1e-119   
ref|XP_003590082.1|  1-aminocyclopropane-1-carboxylate oxidase-li...    368   2e-119   
ref|XP_010556891.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    367   2e-119   
ref|XP_007152332.1|  hypothetical protein PHAVU_004G121000g             366   3e-119   
ref|XP_006305137.1|  hypothetical protein CARUB_v10009503mg             366   3e-119   
ref|XP_010904577.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    365   4e-119   
emb|CAN65048.1|  hypothetical protein VITISV_026363                     365   4e-119   
ref|XP_010026853.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    374   4e-119   
ref|XP_009619590.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    366   4e-119   
ref|XP_010093411.1|  1-aminocyclopropane-1-carboxylate oxidase-1-...    365   4e-119   
ref|XP_004134076.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    366   5e-119   
ref|XP_002866335.1|  predicted protein                                  365   5e-119   
ref|XP_010457793.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    365   5e-119   
ref|XP_004491807.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    365   8e-119   
ref|XP_006418138.1|  hypothetical protein EUTSA_v10008015mg             364   8e-119   
ref|NP_200761.1|  1-aminocyclopropane-1-carboxylate oxidase-like ...    364   8e-119   
ref|XP_009610251.1|  PREDICTED: deacetoxyvindoline 4-hydroxylase-...    364   1e-118   
ref|XP_008224473.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    365   1e-118   
gb|AFK44876.1|  unknown                                                 364   2e-118   
ref|XP_010652359.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    364   2e-118   
ref|XP_003529012.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    363   2e-118   
gb|KHN10999.1|  1-aminocyclopropane-1-carboxylate oxidase like 12       362   3e-118   
ref|XP_006494130.1|  PREDICTED: deacetoxyvindoline 4-hydroxylase-...    363   4e-118   
gb|KDO43657.1|  hypothetical protein CISIN_1g017838mg                   363   4e-118   
emb|CBI37091.3|  unnamed protein product                                363   5e-118   
ref|XP_007035063.1|  2-oxoglutarate (2OG) and Fe(II)-dependent ox...    362   5e-118   
ref|XP_006294467.1|  hypothetical protein CARUB_v10023479mg             362   6e-118   
ref|XP_010457792.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    362   1e-117   
gb|KFK42773.1|  hypothetical protein AALP_AA1G037700                    361   1e-117   
gb|EYU32967.1|  hypothetical protein MIMGU_mgv1a008912mg                361   1e-117   
emb|CDY60666.1|  BnaA10g27780D                                          361   1e-117   
ref|XP_002889500.1|  hypothetical protein ARALYDRAFT_470412             361   1e-117   
ref|XP_006279819.1|  hypothetical protein CARUB_v10028097mg             361   2e-117   
ref|XP_010455136.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    361   2e-117   
ref|XP_002319097.2|  hypothetical protein POPTR_0013s04220g             363   2e-117   
ref|XP_004499952.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    360   3e-117   
ref|XP_009119312.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    360   3e-117   
ref|XP_009118653.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    360   3e-117   
ref|XP_002866336.1|  oxidoreductase                                     360   4e-117   
ref|XP_008224375.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    370   6e-117   
emb|CDY32542.1|  BnaA09g50540D                                          359   6e-117   
ref|XP_006420488.1|  hypothetical protein CICLE_v10005226mg             360   7e-117   
ref|XP_010483593.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    359   9e-117   
ref|XP_010435700.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    359   1e-116   
ref|XP_010692988.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    360   1e-116   
gb|KFK37031.1|  hypothetical protein AALP_AA4G203100                    359   1e-116   
ref|XP_009761509.1|  PREDICTED: deacetoxyvindoline 4-hydroxylase-...    359   1e-116   
ref|XP_006354507.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    359   1e-116   
emb|CDX88706.1|  BnaA03g09430D                                          358   3e-116   
ref|XP_011038526.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    358   3e-116   
ref|XP_007223367.1|  hypothetical protein PRUPE_ppa007477mg             358   4e-116   
ref|XP_010413414.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    358   4e-116   
ref|XP_009379001.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    358   4e-116   
ref|XP_008372316.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    358   5e-116   
ref|XP_007030469.1|  2-oxoglutarate (2OG) and Fe(II)-dependent ox...    358   5e-116   
ref|XP_011091190.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    358   7e-116   
ref|XP_006379885.1|  hypothetical protein POPTR_0008s16530g             354   7e-116   
ref|XP_009141105.1|  PREDICTED: probable 2-oxoacid dependent diox...    357   8e-116   
ref|XP_006379884.1|  hypothetical protein POPTR_0008s16530g             354   9e-116   
emb|CDX86638.1|  BnaC08g00650D                                          356   1e-115   
gb|KFK42980.1|  hypothetical protein AALP_AA1G064000                    356   1e-115   
ref|XP_003590085.1|  1-aminocyclopropane-1-carboxylate oxidase-li...    356   1e-115   
emb|CDX71103.1|  BnaC03g11870D                                          356   2e-115   
ref|XP_006292553.1|  hypothetical protein CARUB_v10018789mg             356   2e-115   
ref|XP_009132898.1|  PREDICTED: probable 2-oxoacid dependent diox...    355   2e-115   
ref|NP_171930.1|  1-aminocyclopropane-1-carboxylate oxidase-like 6      355   2e-115   
gb|ACR10277.1|  2-oxoacid-dependent dioxygenase                         355   3e-115   
gb|KEH17198.1|  2OG-Fe(II) oxygenase family oxidoreductase              356   3e-115   
ref|XP_007035074.1|  2-oxoglutarate and Fe(II)-dependent oxygenas...    356   4e-115   
emb|CDY06654.1|  BnaA10g04330D                                          365   4e-115   
gb|KDO44349.1|  hypothetical protein CISIN_1g017500mg                   355   5e-115   
ref|XP_010037991.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    355   6e-115   
ref|XP_010111898.1|  1-aminocyclopropane-1-carboxylate oxidase-1-...    355   6e-115   
gb|KEH32248.1|  1-aminocyclopropane-1-carboxylate oxidase-like pr...    354   8e-115   
ref|XP_010486383.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    354   8e-115   
gb|KCW88505.1|  hypothetical protein EUGRSUZ_A00890                     354   9e-115   
ref|XP_004495113.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    353   1e-114   
gb|AES60332.2|  1-aminocyclopropane-1-carboxylate oxidase               353   1e-114   
ref|XP_006420908.1|  hypothetical protein CICLE_v10005201mg             351   1e-114   
ref|XP_006420483.1|  hypothetical protein CICLE_v10005223mg             353   1e-114   
ref|XP_009111110.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    353   2e-114   
ref|XP_006489570.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    353   2e-114   
ref|XP_010455168.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    353   2e-114   
ref|XP_009141107.1|  PREDICTED: probable 2-oxoacid dependent diox...    353   2e-114   
ref|NP_001154315.1|  2-oxoglutarate (2OG) and Fe(II)-dependent ox...    353   2e-114   
ref|XP_006282023.1|  hypothetical protein CARUB_v10028262mg             353   2e-114   
gb|KEH19847.1|  2OG-Fe(II) oxygenase family oxidoreductase              353   3e-114   
gb|KEH42564.1|  desacetoxyvindoline 4-hydroxylase, putative             353   3e-114   
gb|KCW57395.1|  hypothetical protein EUGRSUZ_H00181                     352   3e-114   
ref|XP_006420188.1|  hypothetical protein CICLE_v10005208mg             353   4e-114   
gb|KHN27717.1|  1-aminocyclopropane-1-carboxylate oxidase like 1        352   4e-114   
ref|NP_191699.1|  1-aminocyclopropane-1-carboxylate oxidase-like 8      352   5e-114   
ref|XP_006420186.1|  hypothetical protein CICLE_v10005211mg             352   6e-114   
ref|XP_010443713.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    352   7e-114   
ref|XP_010668102.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    351   8e-114   
gb|AES60336.2|  2OG-Fe(II) oxygenase family oxidoreductase              351   1e-113   
ref|XP_006494133.1|  PREDICTED: deacetoxyvindoline 4-hydroxylase-...    351   2e-113   
ref|XP_009116811.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    351   2e-113   
ref|XP_004247921.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    350   2e-113   
emb|CDY18221.1|  BnaC05g02440D                                          350   2e-113   
ref|XP_010044588.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    351   3e-113   
ref|XP_009131991.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    350   3e-113   
ref|XP_010023980.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    350   3e-113   
ref|XP_008391183.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    350   4e-113   
gb|EYU25983.1|  hypothetical protein MIMGU_mgv1a020816mg                350   4e-113   
gb|KDO61181.1|  hypothetical protein CISIN_1g046780mg                   347   5e-113   
emb|CAN63810.1|  hypothetical protein VITISV_030070                     348   5e-113   
ref|NP_001233961.1|  E8 protein homolog                                 350   5e-113   
ref|XP_008391186.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    350   5e-113   
ref|XP_009626186.1|  PREDICTED: deacetoxyvindoline 4-hydroxylase-...    349   8e-113   
emb|CDO99215.1|  unnamed protein product                                349   9e-113   
ref|XP_008373909.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    349   9e-113   
gb|EYU32964.1|  hypothetical protein MIMGU_mgv1a025231mg                349   1e-112   
gb|EPS65191.1|  hypothetical protein M569_09587                         347   1e-112   
gb|KCW49783.1|  hypothetical protein EUGRSUZ_K03274                     349   2e-112   
ref|XP_003590081.1|  1-aminocyclopropane-1-carboxylate oxidase-li...    355   3e-112   
ref|XP_010037988.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    348   3e-112   
ref|XP_009761521.1|  PREDICTED: deacetoxyvindoline 4-hydroxylase-...    347   4e-112   
ref|XP_004134075.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    348   4e-112   
ref|XP_010455146.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    347   4e-112   
ref|XP_006354506.1|  PREDICTED: deacetoxyvindoline 4-hydroxylase-...    347   4e-112   
ref|XP_008438547.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    347   5e-112   
ref|XP_006489569.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    347   5e-112   
ref|XP_006489568.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    347   5e-112   
ref|XP_010481858.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    347   5e-112   
ref|XP_006420455.1|  hypothetical protein CICLE_v10006569mg             346   9e-112   
emb|CDP15734.1|  unnamed protein product                                347   1e-111   
ref|XP_008235705.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    346   1e-111   
ref|XP_006354508.1|  PREDICTED: deacetoxyvindoline 4-hydroxylase-...    346   1e-111   
gb|KEH41138.1|  2OG-Fe(II) oxygenase family oxidoreductase              346   1e-111   
emb|CDO99214.1|  unnamed protein product                                347   1e-111   
emb|CDY60668.1|  BnaA10g27790D                                          345   1e-111   
emb|CDY09963.1|  BnaC08g44880D                                          346   2e-111   
ref|XP_004247700.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    345   2e-111   



>ref|XP_004247709.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1-like [Solanum lycopersicum]
Length=376

 Score =   455 bits (1170),  Expect = 5e-154, Method: Compositional matrix adjust.
 Identities = 212/368 (58%), Positives = 283/368 (77%), Gaps = 4/368 (1%)
 Frame = +1

Query  49    DSGDYDRKSELKAFDDMKTGVKGHVDSGIMKIPRIFIHDeikkeekeklkPAMASTYKVP  228
             DS +YDRKSE+  FDD K GVKG +D+G+ K+PRIF+H+E   E+K    P + S + +P
Sbjct  13    DSSEYDRKSEVHLFDDSKMGVKGLLDAGVTKLPRIFLHNEYVSEKKSD--PDVTSKFSIP  70

Query  229   IIDMEGLHTDHTTRRSEIIKEIRDACQTWGFFQIINHGIPTQVLDEMIDGVRQFHELDSE  408
             ++D +GL  +    R++I++EI++AC+ WGFFQI++H IP+ + +++++GVR FHE DSE
Sbjct  71    VVDFQGLE-NSAAERADIVREIKNACENWGFFQIVHHEIPSSIKEKVLEGVRHFHEQDSE  129

Query  409   VKKQFYSRDLTRKVVYNTNFDFHTSPAATWRDTLYFIMAPHPPTPQELPQVCRDILIKYS  588
             VKK+FYSRD+TRKV YN+NFD   SP A WRDTLY +M P+PP P+E+P VCR++LI+Y+
Sbjct  130   VKKEFYSRDVTRKVTYNSNFDLLKSPTANWRDTLYCVMDPNPPDPEEIPNVCREVLIEYT  189

Query  589   NSVQKLGLCLLELFSESLGLHKNHLEKLGCAVGLSIFGQYYPACPEPELTFALRDHSDSG  768
               + KLGL L EL SE+L L  +HL+ + CA GL I G YYPACPEPELT  L  H+DSG
Sbjct  190   KYIMKLGLTLFELLSEALQLKSDHLKDMECAEGLFITGHYYPACPEPELTLGLSGHTDSG  249

Query  769   FFTVLNQDTQIGGLQVLHENQWVDVPPLHGALVVNVADLLQLITNDKFKSVVHRVIAQKI  948
             F T++ QD QIGGLQV H++QWVDVP L GAL+VN+ DL+QLITNDKFKSV+HRV+A+ +
Sbjct  250   FLTIVLQD-QIGGLQVFHKDQWVDVPFLPGALIVNIGDLMQLITNDKFKSVLHRVLAKNV  308

Query  949   APRVSVASFFRTIPGDVDAKKVYGPIKELVSDENPPLYRETTTEEYLMHFQKKGLDGTSG  1128
              PR+SVASFFR    +    ++YGPIKEL+S+ENPP+YRET+ +EY+M    KGLDGTS 
Sbjct  309   GPRISVASFFRMHFQEGSESRLYGPIKELLSEENPPIYRETSRKEYVMRLYNKGLDGTSL  368

Query  1129  LLRFRLQK  1152
             L  F+LQK
Sbjct  369   LSPFKLQK  376



>ref|XP_006379886.1| hypothetical protein POPTR_0008s16530g [Populus trichocarpa]
 gb|ERP57683.1| hypothetical protein POPTR_0008s16530g [Populus trichocarpa]
Length=372

 Score =   450 bits (1157),  Expect = 5e-152, Method: Compositional matrix adjust.
 Identities = 210/376 (56%), Positives = 278/376 (74%), Gaps = 9/376 (2%)
 Frame = +1

Query  28    ASTGGKADS---GDYDRKSELKAFDDMKTGVKGHVDSGIMKIPRIFIHDeikkeekeklk  198
             +++ GK +S    DYDR+SELKAFDD K GVKG VDSG+  IP+IFIH+    ++     
Sbjct  3     STSSGKTESELKSDYDRRSELKAFDDSKAGVKGLVDSGVANIPQIFIHESSTNDKLS---  59

Query  199   PAMASTYKVPIIDMEGLHTDHTTRRSEIIKEIRDACQTWGFFQIINHGIPTQVLDEMIDG  378
              +    + VP+ID  G+H D  + R +I++E+R+AC+ WGFFQ+INHGI + VLD+MI+G
Sbjct  60    -SGHHNFTVPVIDFNGIHED-ASLRGKIVEELREACKKWGFFQVINHGISSSVLDDMING  117

Query  379   VRQFHELDSEVKKQFYSRDLTRKVVYNTNFDFHTSPAATWRDTLYFIMAPHPPTPQELPQ  558
             VR+FHE D+EVKK+F++RD  RKV YNTNFDF+ +PAA WRD+LY ++APHPP P+ELP 
Sbjct  118   VRRFHEQDTEVKKEFHTRDEMRKVAYNTNFDFYQAPAANWRDSLYCLVAPHPPRPEELPA  177

Query  559   VCRDILIKYSNSVQKLGLCLLELFSESLGLHKNHLEKLGCAVGLSIFGQYYPACPEPELT  738
             VCRDI+I Y+N V  LGL + EL SE+LGL  +HL+ +GCA GL   G YYPACP+P+LT
Sbjct  178   VCRDIMIDYTNKVMSLGLIIFELLSEALGLKPSHLKDMGCAEGLYFIGHYYPACPQPDLT  237

Query  739   FALRDHSDSGFFTVLNQDTQIGGLQVLHENQWVDVPPLHGALVVNVADLLQLITNDKFKS  918
               L  H+DS F  V+ QD  +GGLQVLHE+QW+DV P+ GAL+VN+ D+ QLITN KFKS
Sbjct  238   LGLSKHTDSAFLAVVLQD-HLGGLQVLHEDQWIDVTPIPGALIVNLGDMTQLITNGKFKS  296

Query  919   VVHRVIAQKIAPRVSVASFFRTIPGDVDAKKVYGPIKELVSDENPPLYRETTTEEYLMHF  1098
             V HRV+A+   PR+S A FFRT      + +VYGPIKEL+S+ENPP+YR+TT ++Y+ + 
Sbjct  297   VYHRVVAKNTGPRISSACFFRTHLQQESSSRVYGPIKELLSEENPPVYRQTTIKDYVSYT  356

Query  1099  QKKGLDGTSGLLRFRL  1146
               KGLDG   L  F+L
Sbjct  357   YSKGLDGNPRLEHFKL  372



>ref|XP_009768587.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1-like [Nicotiana sylvestris]
Length=362

 Score =   449 bits (1155),  Expect = 6e-152, Method: Compositional matrix adjust.
 Identities = 210/362 (58%), Positives = 270/362 (75%), Gaps = 7/362 (2%)
 Frame = +1

Query  61    YDRKSELKAFDDMKTGVKGHVDSGIMKIPRIFIHDeikkeekeklkPAMASTYKVPIIDM  240
             YDRK+ELKAFDD K GVKG VD+G+ KIP+IFI      +       +    +  P+ID+
Sbjct  8     YDRKTELKAFDDTKAGVKGLVDAGVCKIPQIFISPPDSTKNSN----SSTEQFIFPVIDL  63

Query  241   EGLHTDHTTRRSEIIKEIRDACQTWGFFQIINHGIPTQVLDEMIDGVRQFHELDSEVKKQ  420
             +G+      +R E++++ RDA +TWGFFQ++NHGIP  VL+EMI GVR FHE D+E+KKQ
Sbjct  64    QGIIDGDQIKRKEVVEKARDASETWGFFQVVNHGIPNDVLEEMIRGVRGFHEQDTEIKKQ  123

Query  421   FYSRDLTRKVVYNTNFDFHTSPAATWRDTLYFIMAPHPPTPQELPQVCRDILIKYSNSVQ  600
             +Y+R+ T+KVVYN+NFD +++PA  WRDT + IMAP+PP+P+ELP +CRDI+IKYS  V+
Sbjct  124   WYTREFTKKVVYNSNFDLYSAPATNWRDTFFCIMAPNPPSPEELPPICRDIIIKYSQEVK  183

Query  601   KLGLCLLELFSESLGLHKNHLEKLGCAVGLSIFGQYYPACPEPELTFALRDHSDSGFFTV  780
             KLG  L EL +E+LGL++NHL  + C  GLS+   YYPACPEPELT     H+D GF T+
Sbjct  184   KLGSSLFELLAEALGLNRNHLTDMDCDKGLSVVCHYYPACPEPELTLGASKHADDGFITL  243

Query  781   LNQDTQIGGLQVLHENQWVDVPPLHGALVVNVADLLQLITNDKFKSVVHRVIAQKIAPRV  960
             L QD  IGGLQVLH+N WVDVPP  GALVVN+ADLLQLI+NDKFKSV HRV+A  I PR+
Sbjct  244   LLQD-NIGGLQVLHQNHWVDVPPTPGALVVNIADLLQLISNDKFKSVEHRVLANHIGPRI  302

Query  961   SVASFFRTIPGDVDAKKVYGPIKELVSDENPPLYRETTTEEYLMHFQKKGLDGTSGLLRF  1140
             S+A FF T    + + ++YGPIKEL+S++NPP YRETT +EY  +F  KGLDGTS L  F
Sbjct  303   SIACFFSTF--FLASSRLYGPIKELLSEDNPPKYRETTIQEYAAYFTAKGLDGTSALHHF  360

Query  1141  RL  1146
             RL
Sbjct  361   RL  362



>ref|XP_002284582.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1 [Vitis vinifera]
Length=364

 Score =   447 bits (1151),  Expect = 3e-151, Method: Compositional matrix adjust.
 Identities = 209/364 (57%), Positives = 277/364 (76%), Gaps = 10/364 (3%)
 Frame = +1

Query  55    GDYDRKSELKAFDDMKTGVKGHVDSGIMKIPRIFIHDeikkeekeklkPAMASTYKVPII  234
             GDYDR SELKAFD+ K GVKG VD+G+ ++PRIFI    K          + + +K P+I
Sbjct  11    GDYDRASELKAFDESKAGVKGLVDAGVSQVPRIFIQPLEKSRAN------VNTQFKFPVI  64

Query  235   DMEGLHTDHTTRRSEIIKEIRDACQTWGFFQIINHGIPTQVLDEMIDGVRQFHELDSEVK  414
             D++G+ TD   R+ +I+ ++R+A +TWGFF ++NHGIP  VL+EM++GVR+F+E D+E+K
Sbjct  65    DLQGMDTDRVQRK-QIVDKVREASETWGFFNVLNHGIPVTVLEEMMNGVRRFYEQDTELK  123

Query  415   KQFYSRDLTRKVVYNTNFDFHTSPAATWRDTLYFIMAPHPPTPQELPQVCRDILIKYSNS  594
             ++FY+RD++RK+VYN+NFD +T+ AA+WRDT Y +MAPHPP PQ+LP  CRDIL++Y   
Sbjct  124   QEFYTRDVSRKLVYNSNFDLYTAKAASWRDTFYCLMAPHPPNPQDLPAACRDILMEYKEQ  183

Query  595   VQKLGLCLLELFSESLGLHKNHLEKLGCAVGLSIFGQYYPACPEPELTFALRDHSDSGFF  774
             V KLG  LLEL SE+LGL+ NHL+ + CA GL++   YYPACP+PELT     H+D+ F 
Sbjct  184   VMKLGFKLLELMSEALGLNPNHLKGMDCAEGLAMVCHYYPACPQPELTLGTGFHTDNDFL  243

Query  775   TVLNQDTQIGGLQVLHENQWVDVPPLHGALVVNVADLLQLITNDKFKSVVHRVIAQKIAP  954
             TVL QD QIGGLQVLH++QWVDVPP+ GALV+NV DLLQLITND+FKSV HRV+A    P
Sbjct  244   TVLLQD-QIGGLQVLHQDQWVDVPPMPGALVINVGDLLQLITNDRFKSVEHRVLANHTGP  302

Query  955   RVSVASFFRTIPGDVDAKKVYGPIKELVSDENPPLYRETTTEEYLMHFQKKGLDGTSGLL  1134
             RVS+A FF T      + K+YGPIKEL+S+ENP  YRETT  +Y+ HFQ+KGL+G++ L 
Sbjct  303   RVSIACFFST--SVQPSSKLYGPIKELLSEENPARYRETTVSDYVAHFQEKGLEGSTALQ  360

Query  1135  RFRL  1146
              FRL
Sbjct  361   LFRL  364



>ref|XP_009761530.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1-like [Nicotiana sylvestris]
Length=377

 Score =   448 bits (1152),  Expect = 3e-151, Method: Compositional matrix adjust.
 Identities = 207/378 (55%), Positives = 285/378 (75%), Gaps = 7/378 (2%)
 Frame = +1

Query  31    STGGKADSGD---YDRKSELKAFDDMKTGVKGHVDSGIMKIPRIFIHDeikkeekeklkP  201
             S  G+ D  +   YDRKSE+++FDD K GVKG +D+G+ K+PRIF+H++   E+K     
Sbjct  4     SNNGRTDQNECSEYDRKSEVQSFDDSKVGVKGLLDAGVTKLPRIFLHNQPVIEKKSDSD-  62

Query  202   AMASTYKVPIIDMEGLHTDHTTRRSEIIKEIRDACQTWGFFQIINHGIPTQVLDEMIDGV  381
              +A+ + +P+ID+ G       +R++I++EI+DAC+ WGFFQI+NH IP+ V++++++GV
Sbjct  63    -VATKFSLPVIDL-GNSGKSAAQRADIVREIKDACENWGFFQIVNHEIPSSVMEKVLEGV  120

Query  382   RQFHELDSEVKKQFYSRDLTRKVVYNTNFDFHTSPAATWRDTLYFIMAPHPPTPQELPQV  561
             R FHE DSEVKK+FYSRD+TRK  YNTNFD H +  A WRDT Y +MAP+PP P+E+P+V
Sbjct  121   RHFHEQDSEVKKEFYSRDVTRKFTYNTNFDLHKAKTANWRDTFYCVMAPNPPRPEEIPEV  180

Query  562   CRDILIKYSNSVQKLGLCLLELFSESLGLHKNHLEKLGCAVGLSIFGQYYPACPEPELTF  741
             CRD+++KY++ V KLGL L +L SE+LGL+ NHL  + CA GL + G YYPACPEP+ T 
Sbjct  181   CRDVVVKYTDYVMKLGLTLCDLLSEALGLNPNHLNDIECAEGLLVVGHYYPACPEPDFTL  240

Query  742   ALRDHSDSGFFTVLNQDTQIGGLQVLHENQWVDVPPLHGALVVNVADLLQLITNDKFKSV  921
              L  H+DSGF T++ QD +IGGLQV H+NQWVDV  + GAL+VN+ DL+QLITNDKF+SV
Sbjct  241   GLTGHTDSGFLTIVLQD-RIGGLQVFHKNQWVDVAFMPGALIVNIGDLMQLITNDKFRSV  299

Query  922   VHRVIAQKIAPRVSVASFFRTIPGDVDAKKVYGPIKELVSDENPPLYRETTTEEYLMHFQ  1101
             +HRV+A+ I PR+SVAS FR    +    ++YGPIKEL+ +ENPP+YRET+ +E+  +  
Sbjct  300   LHRVLAKNIGPRISVASLFRMHFQERSESRLYGPIKELLLEENPPIYRETSRKEFFTYLY  359

Query  1102  KKGLDGTSGLLRFRLQKE  1155
              KGLDGTS L  F+LQKE
Sbjct  360   NKGLDGTSLLSHFKLQKE  377



>ref|XP_010650056.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1 [Vitis vinifera]
Length=365

 Score =   446 bits (1148),  Expect = 8e-151, Method: Compositional matrix adjust.
 Identities = 214/364 (59%), Positives = 268/364 (74%), Gaps = 12/364 (3%)
 Frame = +1

Query  58    DYDRKSELKAFDDMKTGVKGHVDSGIMKIPRIFIHDeikkeekeklkPAMASTYKVPIID  237
             DYDR SELKAFD+ KTGVKG  D+G+ K+PR+FI                 + +  P++D
Sbjct  13    DYDRASELKAFDESKTGVKGLADAGVSKVPRMFIQPPDNLR-------TYTTQFNFPVVD  65

Query  238   MEGLHTDHTTRRSEIIKEIRDACQTWGFFQIINHGIPTQVLDEMIDGVRQFHELDSEVKK  417
             ++G+  D   RR++I+  +RDA +TWGFF ++NHGIP  VL+EM++GVR+FHE D+EVKK
Sbjct  66    LQGMDND-PIRRNKIVDMVRDASETWGFFNVVNHGIPVSVLEEMMEGVRRFHEQDTEVKK  124

Query  418   QFYSRDLTRK-VVYNTNFDFHTSPAATWRDTLYFIMAPHPPTPQELPQVCRDILIKYSNS  594
             QFY+RD +RK V+YN+NFD +T+PAA WRDT Y +MAPHPP P+ELP  CRDIL++Y + 
Sbjct  125   QFYTRDASRKKVMYNSNFDLYTAPAANWRDTFYCLMAPHPPNPEELPASCRDILMEYKDQ  184

Query  595   VQKLGLCLLELFSESLGLHKNHLEKLGCAVGLSIFGQYYPACPEPELTFALRDHSDSGFF  774
             V +LG  L EL SE+LGL+ NHL+ + CA GLSI   YYP+CP+PELT     H+D+ F 
Sbjct  185   VMRLGFKLFELISEALGLNPNHLKDMDCAEGLSILCHYYPSCPQPELTMGTTKHADNDFL  244

Query  775   TVLNQDTQIGGLQVLHENQWVDVPPLHGALVVNVADLLQLITNDKFKSVVHRVIAQKIAP  954
             TVL QD QIGGLQVLH+ QW+DVPP  GALV+NV DLLQLITND+FKSV HRV A  I P
Sbjct  245   TVLLQD-QIGGLQVLHQGQWIDVPPRLGALVINVGDLLQLITNDRFKSVKHRVPANHIGP  303

Query  955   RVSVASFFRTIPGDVDAKKVYGPIKELVSDENPPLYRETTTEEYLMHFQKKGLDGTSGLL  1134
             RVSVA FFRT      + K+YGPIKEL S+ENPP YRETT  +Y+ +F  KGLDGTS L 
Sbjct  304   RVSVACFFRT--SIQPSSKLYGPIKELSSEENPPKYRETTVGDYVAYFNSKGLDGTSALP  361

Query  1135  RFRL  1146
              FRL
Sbjct  362   HFRL  365



>ref|XP_007035066.1| 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily 
protein, putative [Theobroma cacao]
 gb|EOY05992.1| 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily 
protein, putative [Theobroma cacao]
Length=371

 Score =   446 bits (1148),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 218/369 (59%), Positives = 270/369 (73%), Gaps = 4/369 (1%)
 Frame = +1

Query  40    GKADSGDYDRKSELKAFDDMKTGVKGHVDSGIMKIPRIFIHDeikkeekeklkPAMASTY  219
             G+     YDRKSEL+AFDD K GVKG VD G+ K+PRIFIH+E K E       A  S  
Sbjct  7     GRIQESSYDRKSELRAFDDTKAGVKGLVDCGMAKVPRIFIHEEYKLERNRNQD-AGNSNI  65

Query  220   KVPIIDMEGLHTDHTTRRSEIIKEIRDACQTWGFFQIINHGIPTQVLDEMIDGVRQFHEL  399
              +PIID+ G+  D + RR E +KE+ +AC+ WGFFQ +NHGI    LD+MI+G+R+FHE 
Sbjct  66    GIPIIDLTGISEDTSLRR-EAVKEVGEACEKWGFFQAVNHGIAATTLDDMIEGIRRFHEQ  124

Query  400   DSEVKKQFYSRDLTRKVVYNTNFDFHTSPAATWRDTLYFIMAPHPPTPQELPQVCRDILI  579
             DSEVK++ YSRD TR+V YN+NFD + + A  WRD+L  +MAP  P P+ELP VCRDILI
Sbjct  125   DSEVKREIYSRDYTREVNYNSNFDLYGAEATNWRDSLTCVMAPRQPHPEELPTVCRDILI  184

Query  580   KYSNSVQKLGLCLLELFSESLGLHKNHLEKLGCAVGLSIFGQYYPACPEPELTFALRDHS  759
             +YS  V K G  L EL SE+LGL ++HL+ +GC  GL + G YYP CPEP+LT     H+
Sbjct  185   EYSKKVMKFGDTLFELLSEALGLSRSHLKDIGCGEGLFVLGHYYPPCPEPDLTLGTSSHT  244

Query  760   DSGFFTVLNQDTQIGGLQVLHENQWVDVPPLHGALVVNVADLLQLITNDKFKSVVHRVIA  939
             DS FFTVL QD QIGGLQVLHENQWVDV P+HGALVVN+ D+LQLITNDKFKSV HRV+A
Sbjct  245   DSSFFTVLLQD-QIGGLQVLHENQWVDVTPIHGALVVNLGDMLQLITNDKFKSVHHRVLA  303

Query  940   QKIAPRVSVASFFRTIPGDVDAKKVYGPIKELVSDENPPLYRETTTEEYLMHFQKKGLDG  1119
               I PR+S+ASFFRT     +A + YGPIKEL+S+ENPP+YRETT ++Y+ H+  KGLD 
Sbjct  304   STIGPRISIASFFRTHLPPENASRQYGPIKELLSEENPPIYRETTVKDYVSHYHSKGLDC  363

Query  1120  TSGLLRFRL  1146
              + L  FRL
Sbjct  364   RT-LEHFRL  371



>ref|XP_006420907.1| hypothetical protein CICLE_v10005201mg [Citrus clementina]
 gb|ESR34147.1| hypothetical protein CICLE_v10005201mg [Citrus clementina]
Length=372

 Score =   446 bits (1146),  Expect = 2e-150, Method: Compositional matrix adjust.
 Identities = 214/363 (59%), Positives = 277/363 (76%), Gaps = 8/363 (2%)
 Frame = +1

Query  61    YDRKSELKAFDDMKTGVKGHVDSGIMKIPRIFIHDeikkeekeklkPAMASTYKVPIIDM  240
             YDRKSELKAFDD K GVKG VD+GI KIPRIFIHD++K         +  S + +PI+D+
Sbjct  17    YDRKSELKAFDDTKAGVKGLVDAGITKIPRIFIHDQLKLSNSR----SGDSEFIIPILDL  72

Query  241   EGLHTDHTTRRSEIIKEIRDACQTWGFFQIINHGIPTQVLDEMIDGVRQFHELDSEVKKQ  420
             +G++ D  +R ++I+K++++ACQ WGFFQI+NHGIP  +LDEMIDGV  FHE D+EVKK+
Sbjct  73    DGVNKDAISR-AKIVKQVQNACQNWGFFQIVNHGIPVSMLDEMIDGVIGFHEQDTEVKKK  131

Query  421   FYSRDL-TRKVVYNTNFDFHTSPAATWRDTLYFIMAPHPPTPQELPQVCRDILIKYSNSV  597
             FY+RD   RKV+YNTNFDF+ +PAA WRDTL  +MAP+PP P+ELP+VCRDI++ Y+   
Sbjct  132   FYTRDYQKRKVLYNTNFDFYAAPAANWRDTLSCVMAPNPPDPEELPEVCRDIIVDYAKKT  191

Query  598   QKLGLCLLELFSESLGLHKNHLEKLGCAVGLSIFGQYYPACPEPELTFALRDHSDSGFFT  777
              +L L L EL SE+LGL+ N L+ + CA GL + G YYP CPEPELT     H+DS F T
Sbjct  192   TELALTLFELISEALGLNANRLKDMDCAEGLFLLGHYYPTCPEPELTMGTDSHADSSFLT  251

Query  778   VLNQDTQIGGLQVLHENQWVDVPPLHGALVVNVADLLQLITNDKFKSVVHRVIAQKIAPR  957
             VL QD ++GGLQVLHEN+WV+V P++GALVVN+ D++QLI+NDKFKSV HRV+A+ + PR
Sbjct  252   VLLQD-RLGGLQVLHENEWVNVTPIYGALVVNLGDMMQLISNDKFKSVNHRVLAKDVGPR  310

Query  958   VSVASFFRTIPGDVDAKKVYGPIKELVSDENPPLYRETTTEEYLMHFQKKGLDGTSGLLR  1137
             VSVA FFR+      A++ YGPI EL+S+ENPP+Y+E T +EYL H    GLDGTS L  
Sbjct  311   VSVACFFRSHFQSEKARR-YGPINELLSEENPPIYKEITVKEYLSHSYSIGLDGTSPLDH  369

Query  1138  FRL  1146
             F+L
Sbjct  370   FKL  372



>ref|XP_009600230.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1-like [Nicotiana tomentosiformis]
Length=371

 Score =   445 bits (1145),  Expect = 2e-150, Method: Compositional matrix adjust.
 Identities = 204/362 (56%), Positives = 273/362 (75%), Gaps = 7/362 (2%)
 Frame = +1

Query  61    YDRKSELKAFDDMKTGVKGHVDSGIMKIPRIFIHDeikkeekeklkPAMASTYKVPIIDM  240
             YDRK ELKAFDD K GVKG VD+G+ K+P+IFI      ++      +    +  P+ ++
Sbjct  17    YDRKRELKAFDDTKAGVKGLVDAGVSKVPKIFISPSDTTKKSN----SSTEQFIFPVTNL  72

Query  241   EGLHTDHTTRRSEIIKEIRDACQTWGFFQIINHGIPTQVLDEMIDGVRQFHELDSEVKKQ  420
             +G+      +R E+++++RDA +TWGFFQ++NHGIP+ VL+EMI GVR FHE D+E+KKQ
Sbjct  73    QGIIDGDQIKRKEVVEKVRDASETWGFFQVVNHGIPSDVLEEMIRGVRSFHEQDTEIKKQ  132

Query  421   FYSRDLTRKVVYNTNFDFHTSPAATWRDTLYFIMAPHPPTPQELPQVCRDILIKYSNSVQ  600
             +Y+R LT++VVYN+NFD +++PA  WRDT + IMAP+PP+P++LP +CRDI+IKYS  V+
Sbjct  133   WYTRQLTKRVVYNSNFDLYSAPATNWRDTFFCIMAPNPPSPEQLPPICRDIIIKYSEEVK  192

Query  601   KLGLCLLELFSESLGLHKNHLEKLGCAVGLSIFGQYYPACPEPELTFALRDHSDSGFFTV  780
             KLG  L EL +E+LGL++NHL ++ C  GLS+   YYPACPEP+LT     H+D GF T+
Sbjct  193   KLGSYLFELLAEALGLNRNHLSEMDCDKGLSVVCHYYPACPEPQLTLGASKHADDGFITL  252

Query  781   LNQDTQIGGLQVLHENQWVDVPPLHGALVVNVADLLQLITNDKFKSVVHRVIAQKIAPRV  960
             L QD  IGGLQVLH+N WVDVP   GALVVN+ADLLQLI+NDKFKSV HRV+A  I PR+
Sbjct  253   LLQD-NIGGLQVLHQNHWVDVPLTLGALVVNIADLLQLISNDKFKSVEHRVLANHIGPRI  311

Query  961   SVASFFRTIPGDVDAKKVYGPIKELVSDENPPLYRETTTEEYLMHFQKKGLDGTSGLLRF  1140
             S+A FF T    +++ ++YGPIKEL+S++NPP YRETT +EY  +F +KGLDGTS L  F
Sbjct  312   SIACFFSTF--SLESSRLYGPIKELLSEDNPPKYRETTIQEYAAYFTEKGLDGTSALHHF  369

Query  1141  RL  1146
             RL
Sbjct  370   RL  371



>ref|XP_011029845.1| PREDICTED: LOW QUALITY PROTEIN: 1-aminocyclopropane-1-carboxylate 
oxidase homolog 1 [Populus euphratica]
Length=372

 Score =   445 bits (1144),  Expect = 5e-150, Method: Compositional matrix adjust.
 Identities = 208/376 (55%), Positives = 278/376 (74%), Gaps = 9/376 (2%)
 Frame = +1

Query  28    ASTGGKADS---GDYDRKSELKAFDDMKTGVKGHVDSGIMKIPRIFIHDeikkeekeklk  198
             +++ GK +S    DYDR+SELKAFDD K GVKG VDSG+  IP++FIH+    ++     
Sbjct  3     STSSGKTESELKSDYDRRSELKAFDDSKAGVKGLVDSGVANIPQMFIHESSTNDKSS---  59

Query  199   PAMASTYKVPIIDMEGLHTDHTTRRSEIIKEIRDACQTWGFFQIINHGIPTQVLDEMIDG  378
              +    + VP+ID +G+  D  + R +I+KE+++AC+ WGFFQ+INHGI + VLD+MI+G
Sbjct  60    -SGHHNFTVPVIDFDGIQED-ASLRGKIVKELKEACKNWGFFQVINHGISSSVLDDMING  117

Query  379   VRQFHELDSEVKKQFYSRDLTRKVVYNTNFDFHTSPAATWRDTLYFIMAPHPPTPQELPQ  558
             VR+FHE D+EVKK+FY+RD  R+V YNTNFDF+ +PAA WRD+LY ++APHPP P+ELP 
Sbjct  118   VRRFHEQDTEVKKEFYTRDEMRRVAYNTNFDFYQAPAANWRDSLYCLVAPHPPRPEELPA  177

Query  559   VCRDILIKYSNSVQKLGLCLLELFSESLGLHKNHLEKLGCAVGLSIFGQYYPACPEPELT  738
             V RDI+I Y+N V  LGL + EL SE+LGL  +HL+ +GCA GL   G YYPACP+P+LT
Sbjct  178   VXRDIMIDYTNKVMSLGLIIFELLSEALGLKPSHLKDMGCAEGLYFIGHYYPACPQPDLT  237

Query  739   FALRDHSDSGFFTVLNQDTQIGGLQVLHENQWVDVPPLHGALVVNVADLLQLITNDKFKS  918
               L  H+DS F TV+ QD Q+GGLQVLHE+QW+DV P+ GAL+VN+ D+ QLITN KFKS
Sbjct  238   LGLSKHADSAFLTVVLQD-QLGGLQVLHEDQWIDVTPIPGALIVNLGDMTQLITNGKFKS  296

Query  919   VVHRVIAQKIAPRVSVASFFRTIPGDVDAKKVYGPIKELVSDENPPLYRETTTEEYLMHF  1098
             V HRV+A+   PR+S A FFRT      + +VYGPIKEL+S+EN P+YR+TT ++Y+ + 
Sbjct  297   VYHRVMAKNTGPRISSACFFRTHLQQESSSRVYGPIKELLSEENQPIYRQTTIKDYVSYT  356

Query  1099  QKKGLDGTSGLLRFRL  1146
               KGLDG   L  F+L
Sbjct  357   YSKGLDGNPRLEHFKL  372



>gb|KDP40307.1| hypothetical protein JCGZ_02305 [Jatropha curcas]
Length=374

 Score =   444 bits (1143),  Expect = 7e-150, Method: Compositional matrix adjust.
 Identities = 217/378 (57%), Positives = 275/378 (73%), Gaps = 7/378 (2%)
 Frame = +1

Query  19    MATASTGGKADSGDY-DRKSELKAFDDMKTGVKGHVDSGIMKIPRIFIHDeikkeekekl  195
             +AT S   +ADSG   DRKS+LKAFDD K+GVKG VD+G+ KIPRIFIHD+ + ++K   
Sbjct  2     LATDSVTVEADSGSTNDRKSQLKAFDDTKSGVKGLVDAGVSKIPRIFIHDQTQIKDKSNS  61

Query  196   kPAMASTYKVPIIDMEGLHTDHTTRRSEIIKEIRDACQTWGFFQIINHGIPTQVLDEMID  375
                    Y +PIID+EG+      RR++II ++ DAC+ WGFFQ+++HGIP  VLDEMID
Sbjct  62    ----TDKYSIPIIDLEGVDNKDLIRRADIIDKVGDACRKWGFFQVVDHGIPVSVLDEMID  117

Query  376   GVRQFHELDSEVKKQFYSRDLTRKVVY-NTNFDFHTSPAATWRDTLYFIMAPHPPTPQEL  552
             G+R+FHE D EVKK+ YSRD   K +Y N+NFD +++PAA WRDTL  +MAP PP P+EL
Sbjct  118   GIRKFHEQDDEVKKELYSRDFANKKIYFNSNFDLYSAPAANWRDTLSCVMAPCPPKPEEL  177

Query  553   PQVCRDILIKYSNSVQKLGLCLLELFSESLGLHKNHLEKLGCAVGLSIFGQYYPACPEPE  732
             P VCR+I++ YSN V  L   L EL SE+LGL++ +L ++GCA GL   G YYPACPEPE
Sbjct  178   PHVCREIMMNYSNKVIALAHTLFELLSEALGLNRKYLNEMGCAEGLFFLGHYYPACPEPE  237

Query  733   LTFALRDHSDSGFFTVLNQDTQIGGLQVLHENQWVDVPPLHGALVVNVADLLQLITNDKF  912
             LT     HSDS F TVL QD QIGGLQVL E+QWVDV P  GALV+N+ DLLQLI+ND F
Sbjct  238   LTMGTSSHSDSSFLTVLLQD-QIGGLQVLCEDQWVDVTPTPGALVINLGDLLQLISNDTF  296

Query  913   KSVVHRVIAQKIAPRVSVASFFRTIPGDVDAKKVYGPIKELVSDENPPLYRETTTEEYLM  1092
             KS  HRVIA+ + PR+SVA F R      +  +VYGPIKEL+S+ENPP+++ETT ++YL 
Sbjct  297   KSSQHRVIAKTVGPRISVACFCRHHGPSQNVPRVYGPIKELLSEENPPVFKETTLKDYLA  356

Query  1093  HFQKKGLDGTSGLLRFRL  1146
              +  KGLDG S L  F+L
Sbjct  357   RYYAKGLDGISALEHFKL  374



>ref|XP_002284663.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1-like [Vitis vinifera]
Length=373

 Score =   444 bits (1142),  Expect = 8e-150, Method: Compositional matrix adjust.
 Identities = 208/370 (56%), Positives = 284/370 (77%), Gaps = 7/370 (2%)
 Frame = +1

Query  37    GGKADSGDYDRKSELKAFDDMKTGVKGHVDSGIMKIPRIFIHDeikkeekeklkPAMAST  216
              GKA   DYDRKSELK+FDD K GVKG +D+G+ +IPR+FI+++ K +     + +  S 
Sbjct  11    AGKA--SDYDRKSELKSFDDSKLGVKGLLDAGLTQIPRMFINEQHKTDMTWGSRES--SP  66

Query  217   YKVPIIDMEGLHTDHTTRRSEIIKEIRDACQTWGFFQIINHGIPTQVLDEMIDGVRQFHE  396
               VPI+D +G+  D    R++IIK++ +AC+ WGFFQ++NHGIP  VL++MIDG+R+FHE
Sbjct  67    ESVPILDFKGMDKD-AALRTQIIKKVGEACEKWGFFQVVNHGIPESVLNDMIDGIRRFHE  125

Query  397   LDSEVKKQFYSRDLTRKVVYNTNFDFHTSPAATWRDTLYFIMAPHPPTPQELPQVCRDIL  576
              D+E KK++YSRD  +KV +N+NFD + +  A WRD+L  +MAP+PP P++LP VCRDI+
Sbjct  126   QDAETKKEYYSRDFQKKVRFNSNFDLYQARMANWRDSLACVMAPNPPLPEQLPAVCRDIV  185

Query  577   IKYSNSVQKLGLCLLELFSESLGLHKNHLEKLGCAVGLSIFGQYYPACPEPELTFALRDH  756
             ++YS  V KLGL L EL SE+LGL+ NHL+ + CA GL + G YYPACPEPELT     H
Sbjct  186   MEYSEQVMKLGLTLFELLSEALGLNPNHLKDMECAEGLFLLGHYYPACPEPELTLGTSSH  245

Query  757   SDSGFFTVLNQDTQIGGLQVLHENQWVDVPPLHGALVVNVADLLQLITNDKFKSVVHRVI  936
             +DS FFT+L QD Q+GGLQVLHE+QWVDVPP+ GALV+N+ DLLQL++ND+FKS+ HRV+
Sbjct  246   TDSDFFTILLQD-QMGGLQVLHEDQWVDVPPIPGALVINMGDLLQLVSNDRFKSIFHRVL  304

Query  937   AQKIAPRVSVASFFRTIPGDVDAKKVYGPIKELVSDENPPLYRETTTEEYLMHFQKKGLD  1116
             A+ + PR+SVASFFR    + ++ ++YGPIKEL+S+ENPP+YRETT +E+L ++  KGLD
Sbjct  305   AKNVGPRISVASFFRKSHRENNS-RLYGPIKELLSEENPPIYRETTVDEFLTYYFSKGLD  363

Query  1117  GTSGLLRFRL  1146
             G S L  F+L
Sbjct  364   GNSSLPHFKL  373



>emb|CAN66006.1| hypothetical protein VITISV_042886 [Vitis vinifera]
Length=373

 Score =   443 bits (1139),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 208/370 (56%), Positives = 284/370 (77%), Gaps = 7/370 (2%)
 Frame = +1

Query  37    GGKADSGDYDRKSELKAFDDMKTGVKGHVDSGIMKIPRIFIHDeikkeekeklkPAMAST  216
              GKA   DYDRKSELK+FDD K GVKG +D+G+ +IPR+FI+++ K +     + +  S 
Sbjct  11    AGKA--SDYDRKSELKSFDDSKLGVKGLLDAGLTQIPRMFINEQHKTDMTWGSRES--SP  66

Query  217   YKVPIIDMEGLHTDHTTRRSEIIKEIRDACQTWGFFQIINHGIPTQVLDEMIDGVRQFHE  396
               VPI+D +G+  D    R++IIK++ +AC+ WGFFQ++NHGIP  VL++MIDG+R+FHE
Sbjct  67    ESVPILDFKGMDKD-AALRTQIIKKVGEACEKWGFFQVVNHGIPESVLNDMIDGIRRFHE  125

Query  397   LDSEVKKQFYSRDLTRKVVYNTNFDFHTSPAATWRDTLYFIMAPHPPTPQELPQVCRDIL  576
              D+E KK++YSRD  +KV +N+NFD + +  A WRD+L  +MAP+PP P++LP VCRDI+
Sbjct  126   QDAETKKEYYSRDSQKKVRFNSNFDLYQARMANWRDSLACVMAPNPPLPEQLPAVCRDIV  185

Query  577   IKYSNSVQKLGLCLLELFSESLGLHKNHLEKLGCAVGLSIFGQYYPACPEPELTFALRDH  756
             ++YS  V KLGL L EL SE+LGL+ NHL+ + CA GL + G YYPACPEPELT     H
Sbjct  186   MEYSEQVMKLGLTLFELLSEALGLNPNHLKDMECAEGLFLLGHYYPACPEPELTLGTSSH  245

Query  757   SDSGFFTVLNQDTQIGGLQVLHENQWVDVPPLHGALVVNVADLLQLITNDKFKSVVHRVI  936
             +DS FFT+L QD Q+GGLQVLHE+QWVDVPP+ GALV+N+ DLLQL++ND+FKS+ HRV+
Sbjct  246   TDSDFFTILLQD-QMGGLQVLHEDQWVDVPPIPGALVINMGDLLQLVSNDRFKSIFHRVL  304

Query  937   AQKIAPRVSVASFFRTIPGDVDAKKVYGPIKELVSDENPPLYRETTTEEYLMHFQKKGLD  1116
             A+ + PR+SVASFFR    + ++ ++YGPIKEL+S+ENPP+YRETT +E+L ++  KGLD
Sbjct  305   AKNVGPRISVASFFRKSHRENNS-RLYGPIKELLSEENPPIYRETTVDEFLTYYFSKGLD  363

Query  1117  GTSGLLRFRL  1146
             G S L  F+L
Sbjct  364   GNSSLPHFKL  373



>ref|XP_004246496.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1-like [Solanum lycopersicum]
Length=370

 Score =   441 bits (1134),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 203/367 (55%), Positives = 271/367 (74%), Gaps = 9/367 (2%)
 Frame = +1

Query  46    ADSGDYDRKSELKAFDDMKTGVKGHVDSGIMKIPRIFIHDeikkeekeklkPAMASTYKV  225
              +   +DRKSELKAFDD K+GVKG VD+G+ K+P+IFI              +    +  
Sbjct  13    TNESKHDRKSELKAFDDTKSGVKGLVDAGVSKVPQIFISPPDTYSN------SNTGQFIF  66

Query  226   PIIDMEGLHTDHTTRRSEIIKEIRDACQTWGFFQIINHGIPTQVLDEMIDGVRQFHELDS  405
             P+ID++ + +     R ++I+++RDA +TWGFFQ+INHG+P  V++EMI GV  FHE D+
Sbjct  67    PVIDLQDMDSHDQINRKKVIEKVRDASETWGFFQVINHGVPCDVMEEMIRGVCSFHEQDT  126

Query  406   EVKKQFYSRDLTRKVVYNTNFDFHTSPAATWRDTLYFIMAPHPPTPQELPQVCRDILIKY  585
             ++KKQ+Y+R+LT++VVYN+NFD + +PA  WRDT + IMAP+PP+P+ELP +CRDI++KY
Sbjct  127   DIKKQWYTRELTKRVVYNSNFDLYNAPATNWRDTFFCIMAPNPPSPEELPPICRDIIVKY  186

Query  586   SNSVQKLGLCLLELFSESLGLHKNHLEKLGCAVGLSIFGQYYPACPEPELTFALRDHSDS  765
             S  V+KLG  L EL +E+LGL++N+L ++ C  GLS+   YYPACPEPELT     H+D 
Sbjct  187   SEEVKKLGRSLFELLAEALGLNRNYLNEMDCGEGLSVVCHYYPACPEPELTLGASKHADD  246

Query  766   GFFTVLNQDTQIGGLQVLHENQWVDVPPLHGALVVNVADLLQLITNDKFKSVVHRVIAQK  945
             GF T+L QD  IGGLQVLH N WVDVPP  GALVVN+ADLLQLI+NDKFKSV HRV+A +
Sbjct  247   GFLTLLLQD-HIGGLQVLHRNHWVDVPPTPGALVVNIADLLQLISNDKFKSVEHRVLANR  305

Query  946   IAPRVSVASFFRTIPGDVDAKKVYGPIKELVSDENPPLYRETTTEEYLMHFQKKGLDGTS  1125
             + PR+S+A FF T    ++A ++YGPIKEL+S+ENP  YRETT +EY  +F  KGLDGTS
Sbjct  306   VGPRISIACFFSTF--FLEASRLYGPIKELLSEENPSKYRETTIQEYAAYFTAKGLDGTS  363

Query  1126  GLLRFRL  1146
              L  FRL
Sbjct  364   ALQHFRL  370



>emb|CAN66433.1| hypothetical protein VITISV_027452 [Vitis vinifera]
Length=365

 Score =   441 bits (1133),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 208/364 (57%), Positives = 269/364 (74%), Gaps = 12/364 (3%)
 Frame = +1

Query  58    DYDRKSELKAFDDMKTGVKGHVDSGIMKIPRIFIHDeikkeekeklkPAMASTYKVPIID  237
             DYDR SELKAFD+ KTGVKG VD+G+ K+PR+FI                 + +  P++D
Sbjct  13    DYDRASELKAFDESKTGVKGLVDAGVSKVPRMFIQPPDNLR-------TYTTQFNFPVVD  65

Query  238   MEGLHTDHTTRRSEIIKEIRDACQTWGFFQIINHGIPTQVLDEMIDGVRQFHELDSEVKK  417
             ++G+  D   RR++I+  ++DA +TWGFF ++NHGIP  VL+EM++GV +F+E D+EVKK
Sbjct  66    LQGMDND-PIRRNKIVDMVKDASETWGFFNVVNHGIPVSVLEEMMEGVLRFYEQDTEVKK  124

Query  418   QFYSRDLTRK-VVYNTNFDFHTSPAATWRDTLYFIMAPHPPTPQELPQVCRDILIKYSNS  594
             QFY+RD +RK +VYN+NFD +T+PAA WRDT Y +MAPHPP P+ELP  CRDIL++Y + 
Sbjct  125   QFYTRDASRKKMVYNSNFDLYTAPAANWRDTFYCLMAPHPPNPEELPAACRDILMEYKDQ  184

Query  595   VQKLGLCLLELFSESLGLHKNHLEKLGCAVGLSIFGQYYPACPEPELTFALRDHSDSGFF  774
             + +LG  L EL SE+LGL+ NHL+ + C  GLSI   YYP+CP+PELT     H+D+ F 
Sbjct  185   IMRLGFKLFELISEALGLNPNHLKDMDCTEGLSILCHYYPSCPQPELTMGTTKHADNDFL  244

Query  775   TVLNQDTQIGGLQVLHENQWVDVPPLHGALVVNVADLLQLITNDKFKSVVHRVIAQKIAP  954
             TVL QD QIGGLQVLH+ QW+DVPP+ GALV+NV DLLQLITND+FKSV HRV+A  I P
Sbjct  245   TVLLQD-QIGGLQVLHQGQWIDVPPMPGALVINVGDLLQLITNDRFKSVEHRVLANHIGP  303

Query  955   RVSVASFFRTIPGDVDAKKVYGPIKELVSDENPPLYRETTTEEYLMHFQKKGLDGTSGLL  1134
             RVSVA FF T      + K+YGPIKEL+S+ENPP Y+ETT  +Y+ +F  KGLDGTS L 
Sbjct  304   RVSVACFFST--SIQPSSKLYGPIKELLSEENPPKYKETTVGDYVAYFNSKGLDGTSALP  361

Query  1135  RFRL  1146
              FRL
Sbjct  362   HFRL  365



>emb|CAN67227.1| hypothetical protein VITISV_000872 [Vitis vinifera]
Length=373

 Score =   441 bits (1133),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 207/377 (55%), Positives = 286/377 (76%), Gaps = 8/377 (2%)
 Frame = +1

Query  25    TASTGGKADSG---DYDRKSELKAFDDMKTGVKGHVDSGIMKIPRIFIHDeikkeekekl  195
              +S+G +  +G   DYDRKSELK+FDD K GVKG +D+G+ KIPR+FI+D+ K +     
Sbjct  2     VSSSGDEIQAGKVYDYDRKSELKSFDDSKLGVKGLLDAGLTKIPRMFINDQHKTDMTWGS  61

Query  196   kPAMASTYKVPIIDMEGLHTDHTTRRSEIIKEIRDACQTWGFFQIINHGIPTQVLDEMID  375
             + +  S   VPIID +G+  D    R++I+K++ +AC+ WGFFQ++NHGIP  VL++MID
Sbjct  62    RES--SPESVPIIDFKGVDKD-AALRTQIVKKVGEACEKWGFFQVVNHGIPESVLNDMID  118

Query  376   GVRQFHELDSEVKKQFYSRDLTRKVVYNTNFDFHTSPAATWRDTLYFIMAPHPPTPQELP  555
             G+R+FHE D+E KK++YSRD   KV +++NFD + +  A WRD+L  +MAP+PP P++LP
Sbjct  119   GIRRFHEQDAETKKEYYSRDSQNKVRFSSNFDLYQARMANWRDSLSCVMAPNPPLPEQLP  178

Query  556   QVCRDILIKYSNSVQKLGLCLLELFSESLGLHKNHLEKLGCAVGLSIFGQYYPACPEPEL  735
              VCRDI+++YS  V KLGL L EL SE+LGL+ NHL+ + CA GL + G YYPACPEPEL
Sbjct  179   AVCRDIVMEYSGQVMKLGLTLFELLSEALGLNPNHLKDMECAEGLFLLGHYYPACPEPEL  238

Query  736   TFALRDHSDSGFFTVLNQDTQIGGLQVLHENQWVDVPPLHGALVVNVADLLQLITNDKFK  915
             T     H+D  FFT+L QD Q+GGLQVLHE+QWVDVPP+ GALV+N+ DLLQL++ND+FK
Sbjct  239   TLGTSSHTDPDFFTILLQD-QMGGLQVLHEDQWVDVPPIPGALVINMGDLLQLVSNDRFK  297

Query  916   SVVHRVIAQKIAPRVSVASFFRTIPGDVDAKKVYGPIKELVSDENPPLYRETTTEEYLMH  1095
             S+ HRV+A+ + PR+SVASFFR    + ++ ++YGP+KEL+S+ENPP+YRETT +E+L +
Sbjct  298   SIFHRVLAKNVGPRISVASFFRKSHAENNS-RLYGPVKELLSEENPPIYRETTLDEFLTY  356

Query  1096  FQKKGLDGTSGLLRFRL  1146
             +  KGLDG S L  F+L
Sbjct  357   YFSKGLDGNSSLPHFKL  373



>ref|XP_006493816.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1-like [Citrus sinensis]
Length=372

 Score =   440 bits (1132),  Expect = 3e-148, Method: Compositional matrix adjust.
 Identities = 211/363 (58%), Positives = 275/363 (76%), Gaps = 8/363 (2%)
 Frame = +1

Query  61    YDRKSELKAFDDMKTGVKGHVDSGIMKIPRIFIHDeikkeekeklkPAMASTYKVPIIDM  240
             YDRKSELKAFDD K GVKG VD+GI KIPRIFIHD++K         +  S + +PIID+
Sbjct  17    YDRKSELKAFDDTKAGVKGLVDAGITKIPRIFIHDQLKLSNSR----SGDSEFIIPIIDL  72

Query  241   EGLHTDHTTRRSEIIKEIRDACQTWGFFQIINHGIPTQVLDEMIDGVRQFHELDSEVKKQ  420
             +G++ D  +R ++I+K++++ACQ WGFFQI+NHGIP  +LDEMIDGV  FHE D+EVKK+
Sbjct  73    DGVNKDAISR-AKIVKQVQNACQNWGFFQIVNHGIPVSILDEMIDGVIGFHEQDTEVKKK  131

Query  421   FYSRDL-TRKVVYNTNFDFHTSPAATWRDTLYFIMAPHPPTPQELPQVCRDILIKYSNSV  597
             FY+RD   R V+YNTNFDF+ +P A WRDTL  +MAP+PP P+ELP+VCRDI++ ++   
Sbjct  132   FYTRDYQKRMVLYNTNFDFYVAPEANWRDTLSCVMAPNPPDPEELPEVCRDIIVDHAKKT  191

Query  598   QKLGLCLLELFSESLGLHKNHLEKLGCAVGLSIFGQYYPACPEPELTFALRDHSDSGFFT  777
              +L L L EL SE+LGL+ N L+ + CA GL + G YYPACPEPELT     H+D+ F T
Sbjct  192   TELALTLFELISEALGLNANRLKDMDCAEGLFLLGHYYPACPEPELTMGTDSHADTSFLT  251

Query  778   VLNQDTQIGGLQVLHENQWVDVPPLHGALVVNVADLLQLITNDKFKSVVHRVIAQKIAPR  957
             VL QD ++GGLQVLHEN+WV+V P+HGALVVN+ D++QLI+N KFKSV HRV+A+ + PR
Sbjct  252   VLLQD-RLGGLQVLHENEWVNVTPIHGALVVNLGDMMQLISNGKFKSVNHRVLAKDVGPR  310

Query  958   VSVASFFRTIPGDVDAKKVYGPIKELVSDENPPLYRETTTEEYLMHFQKKGLDGTSGLLR  1137
             VSVA FFR+     +  ++YGPI EL+S+ENPP+Y+E T +EYL H    GLDGTS L  
Sbjct  311   VSVACFFRS-HFQSEKARLYGPINELLSEENPPIYKEITVKEYLSHSYSIGLDGTSPLDH  369

Query  1138  FRL  1146
             F+L
Sbjct  370   FKL  372



>ref|XP_010650061.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1-like [Vitis vinifera]
Length=373

 Score =   440 bits (1131),  Expect = 4e-148, Method: Compositional matrix adjust.
 Identities = 206/377 (55%), Positives = 286/377 (76%), Gaps = 8/377 (2%)
 Frame = +1

Query  25    TASTGGKADSG---DYDRKSELKAFDDMKTGVKGHVDSGIMKIPRIFIHDeikkeekekl  195
              +S+G +  +G   DYDRKSELK+FDD K GVKG +D+G+ KIPR+FI+D+ K +     
Sbjct  2     VSSSGDEIQAGKVYDYDRKSELKSFDDSKLGVKGLLDAGLTKIPRMFINDQHKTDMTWGS  61

Query  196   kPAMASTYKVPIIDMEGLHTDHTTRRSEIIKEIRDACQTWGFFQIINHGIPTQVLDEMID  375
             + +  S   VPIID +G+  D    R++I+K++ +AC+ WGFFQ++NHGIP  VL++MID
Sbjct  62    RES--SPESVPIIDFKGVDKD-AALRTQIVKKVGEACEKWGFFQVVNHGIPESVLNDMID  118

Query  376   GVRQFHELDSEVKKQFYSRDLTRKVVYNTNFDFHTSPAATWRDTLYFIMAPHPPTPQELP  555
             G+R+FHE D+E KK++YSRD   KV +++NFD + +  A WRD+L  +MAP+PP P++LP
Sbjct  119   GIRRFHEQDAETKKEYYSRDSQNKVRFSSNFDLYQARTANWRDSLSCVMAPNPPLPEQLP  178

Query  556   QVCRDILIKYSNSVQKLGLCLLELFSESLGLHKNHLEKLGCAVGLSIFGQYYPACPEPEL  735
              VCRDI+++YS  V KLGL L EL SE+LGL+ NHL+ + CA GL + G YYPACPEPEL
Sbjct  179   AVCRDIVMEYSGQVMKLGLTLFELLSEALGLNPNHLKDMECAEGLFLLGHYYPACPEPEL  238

Query  736   TFALRDHSDSGFFTVLNQDTQIGGLQVLHENQWVDVPPLHGALVVNVADLLQLITNDKFK  915
             T     H+D  FFT+L QD Q+GGLQVLHE+QWVDVPP+ GAL++N+ DLLQL++ND+FK
Sbjct  239   TLGTSSHTDPDFFTILLQD-QMGGLQVLHEDQWVDVPPIPGALLINMGDLLQLVSNDRFK  297

Query  916   SVVHRVIAQKIAPRVSVASFFRTIPGDVDAKKVYGPIKELVSDENPPLYRETTTEEYLMH  1095
             S+ HRV+A+ + PR+SVASFFR    + ++ ++YGP+KEL+S+ENPP+YRETT +E+L +
Sbjct  298   SIFHRVLAKNVGPRISVASFFRKSHAENNS-RLYGPVKELLSEENPPIYRETTLDEFLTY  356

Query  1096  FQKKGLDGTSGLLRFRL  1146
             +  KGLDG S L  F+L
Sbjct  357   YFSKGLDGNSSLPHFKL  373



>ref|XP_010262283.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1-like [Nelumbo nucifera]
 ref|XP_010262284.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1-like [Nelumbo nucifera]
 ref|XP_010262285.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1-like [Nelumbo nucifera]
 ref|XP_010262286.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1-like [Nelumbo nucifera]
Length=374

 Score =   439 bits (1128),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 212/380 (56%), Positives = 272/380 (72%), Gaps = 10/380 (3%)
 Frame = +1

Query  19    MATASTGGKADS----GDYDRKSELKAFDDMKTGVKGHVDSGIMKIPRIFIHDeikkeek  186
             M  +  GG +       DYDR  EL  FDD K GVKG VDSG++K+PRIFIH   + + +
Sbjct  1     MVVSGDGGDSSGVLIKSDYDRMKELMEFDDSKAGVKGLVDSGLVKVPRIFIHPPEEYDGR  60

Query  187   eklkPAMASTYKVPIIDMEGLHTDHTTRRSEIIKEIRDACQTWGFFQIINHGIPTQVLDE  366
                  +  + + +P+ID++G+  D   RR EI++E+R+A + WGFFQ++NHGIP  VLDE
Sbjct  61    SV---SNQTHFTIPVIDLDGIGED-AIRRREIVEEVRNASEMWGFFQVVNHGIPVNVLDE  116

Query  367   MIDGVRQFHELDSEVKKQFYSRDLTRKVVYNTNFDFHTSPAATWRDTLYFIMAPHPPTPQ  546
             M+ GVR F+E D EVKK+FY+RDL R++VYN+N   + SPAA WRD+ Y  MAP PP P+
Sbjct  117   MLQGVRGFYEQDIEVKKKFYTRDLRRRLVYNSNNQLYQSPAANWRDSFYCFMAPEPPQPE  176

Query  547   ELPQVCRDILIKYSNSVQKLGLCLLELFSESLGLHKNHLEKLGCAVGLSIFGQYYPACPE  726
             +LP VCRDI+++YS  V+KLG+ L EL SE+L L   HL  +GCA G ++   YYP+CPE
Sbjct  177   DLPAVCRDIMMEYSKQVKKLGIFLFELLSEALTLKSEHLVDIGCAEGHALLTHYYPSCPE  236

Query  727   PELTFALRDHSDSGFFTVLNQDTQIGGLQVLHENQWVDVPPLHGALVVNVADLLQLITND  906
             PELT     H+D+ F TVL QD  IGGLQVL E QWVDV P+ GAL+VNV DLLQLI+ND
Sbjct  237   PELTMGTSKHADNDFLTVLLQDN-IGGLQVLREKQWVDVLPMPGALIVNVGDLLQLISND  295

Query  907   KFKSVVHRVIAQKIAPRVSVASFFRTIPGDVDAKKVYGPIKELVSDENPPLYRETTTEEY  1086
             +FKSV HRV+A +I PRVSVA FF T P +  + K+YGPIKEL+S+ENPP+YRETT +EY
Sbjct  296   RFKSVEHRVLANRIGPRVSVACFF-TTPVNQASGKLYGPIKELLSEENPPIYRETTVQEY  354

Query  1087  LMHFQKKGLDGTSGLLRFRL  1146
               HF  KGLDG S L RF+L
Sbjct  355   TKHFVAKGLDGNSALTRFKL  374



>ref|XP_006420181.1| hypothetical protein CICLE_v10005008mg [Citrus clementina]
 gb|ESR33421.1| hypothetical protein CICLE_v10005008mg [Citrus clementina]
Length=432

 Score =   440 bits (1132),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 210/371 (57%), Positives = 275/371 (74%), Gaps = 5/371 (1%)
 Frame = +1

Query  40    GKADSGDYDRKSELKAFDDMKTGVKGHVDSGIMKIPRIFIHDeikkeekeklkPAMASTY  219
              + DS D DRKSEL+AFDD KTGVKG VDSG  K+PRIFIH++ K E K          +
Sbjct  67    SEKDSND-DRKSELEAFDDSKTGVKGLVDSGAAKVPRIFIHEQNKLEHKSGS--GNCQNF  123

Query  220   KVPIIDMEGLHTDHTTRRSEIIKEIRDACQTWGFFQIINHGIPTQVLDEMIDGVRQFHEL  399
              +PIID + +  D  + R EII ++R AC+ WGFFQ++NHGIP  +L+E+I+ VR+FHEL
Sbjct  124   TIPIIDFQDIDRD-ASARCEIIDKVRKACEKWGFFQVVNHGIPLNILEEIINAVRKFHEL  182

Query  400   DSEVKKQFYSRDLTRKVVYNTNFDFHTSPAATWRDTLYFIMAPHPPTPQELPQVCRDILI  579
             D++VKK+FYSRD TR ++YNTNF F+ +PAA WRD LY +MAP PP P+ELP VCR +++
Sbjct  183   DADVKKEFYSRDETRSMIYNTNFYFYQAPAANWRDFLYCVMAPRPPNPEELPAVCRSVMM  242

Query  580   KYSNSVQKLGLCLLELFSESLGLHKNHLEKLGCAVGLSIFGQYYPACPEPELTFALRDHS  759
              YS  V K GL + EL SE+LGL+ +HL+ LGCA  L + G YYPACPEPELT  L  H+
Sbjct  243   DYSKEVMKFGLTVFELMSEALGLNSSHLKDLGCAERLYLIGHYYPACPEPELTLGLSKHT  302

Query  760   DSGFFTVLNQDTQIGGLQVLHENQWVDVPPLHGALVVNVADLLQLITNDKFKSVVHRVIA  939
             DSGF TV+ QD Q+GGLQVLHE+ WVDV P+ G+L++NV D+ QLI+NDKFKSV HRV+A
Sbjct  303   DSGFLTVVLQD-QMGGLQVLHEDDWVDVEPVSGSLILNVGDMTQLISNDKFKSVYHRVLA  361

Query  940   QKIAPRVSVASFFRTIPGDVDAKKVYGPIKELVSDENPPLYRETTTEEYLMHFQKKGLDG  1119
             +   PR+SVA FFRT   + +  ++YGPI++L+S  +PP+YRETT ++Y+ +   KGLDG
Sbjct  362   KNNGPRISVACFFRTHLEEGNDSRLYGPIEQLLSQISPPIYRETTAKDYVKYIDSKGLDG  421

Query  1120  TSGLLRFRLQK  1152
             TSGL   +L K
Sbjct  422   TSGLQHLKLSK  432



>emb|CAN80594.1| hypothetical protein VITISV_017626 [Vitis vinifera]
Length=373

 Score =   437 bits (1124),  Expect = 5e-147, Method: Compositional matrix adjust.
 Identities = 205/363 (56%), Positives = 278/363 (77%), Gaps = 5/363 (1%)
 Frame = +1

Query  58    DYDRKSELKAFDDMKTGVKGHVDSGIMKIPRIFIHDeikkeekeklkPAMASTYKVPIID  237
             DYDRKSELK+FDD K GVKG +D+G+ KIPR+FI+++ K +     + +  S   VPIID
Sbjct  16    DYDRKSELKSFDDSKLGVKGLLDAGLTKIPRMFINEQHKTDMTWGSRES--SPESVPIID  73

Query  238   MEGLHTDHTTRRSEIIKEIRDACQTWGFFQIINHGIPTQVLDEMIDGVRQFHELDSEVKK  417
              +G+  D    R++IIK++ +AC+ WGFFQ++NHGIP  VL++MIDG+R+FHE D+E KK
Sbjct  74    FKGMDKD-AALRTQIIKKVGEACEKWGFFQVVNHGIPESVLNDMIDGIRRFHEQDAETKK  132

Query  418   QFYSRDLTRKVVYNTNFDFHTSPAATWRDTLYFIMAPHPPTPQELPQVCRDILIKYSNSV  597
             ++YSRD  +KV + +NFD + +  A WRD+L  +MAP+PP P++LP VCRDI+++YS  V
Sbjct  133   EYYSRDSQKKVRFISNFDLYQARMANWRDSLSCVMAPNPPLPEQLPAVCRDIVMEYSGQV  192

Query  598   QKLGLCLLELFSESLGLHKNHLEKLGCAVGLSIFGQYYPACPEPELTFALRDHSDSGFFT  777
              KLGL L EL SE+LGL+ NHL+ + CA GL + G YYPACPEPELT     H+DS FFT
Sbjct  193   MKLGLTLFELLSEALGLNPNHLKDMECAEGLFLSGHYYPACPEPELTLGTSSHTDSDFFT  252

Query  778   VLNQDTQIGGLQVLHENQWVDVPPLHGALVVNVADLLQLITNDKFKSVVHRVIAQKIAPR  957
             +L QD Q+GGLQVLHE+QWVDVPP+ GALV+N+ DLLQL++ND+FKS+ HRV+A+ + PR
Sbjct  253   ILLQD-QMGGLQVLHEDQWVDVPPIPGALVINMGDLLQLVSNDRFKSIFHRVLAKNVGPR  311

Query  958   VSVASFFRTIPGDVDAKKVYGPIKELVSDENPPLYRETTTEEYLMHFQKKGLDGTSGLLR  1137
             +S+ASFF T     +  ++YGPIKEL+S+ENPP+YRETT +E+L ++  KGLDG S L  
Sbjct  312   ISLASFFNT-SHPQNNSRLYGPIKELLSEENPPIYRETTVDEFLAYYFSKGLDGNSSLPH  370

Query  1138  FRL  1146
             F+L
Sbjct  371   FKL  373



>ref|XP_002284638.2| PREDICTED: LOW QUALITY PROTEIN: 1-aminocyclopropane-1-carboxylate 
oxidase homolog 1 [Vitis vinifera]
Length=681

 Score =   447 bits (1150),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 214/365 (59%), Positives = 273/365 (75%), Gaps = 11/365 (3%)
 Frame = +1

Query  52    SGDYDRKSELKAFDDMKTGVKGHVDSGIMKIPRIFIHDeikkeekeklkPAMASTYKVPI  231
             S DYDR SELKAFD+ K GVKG VD+G+ K+PR+FI       +         + +K P+
Sbjct  10    SEDYDRASELKAFDESKEGVKGLVDAGVSKVPRMFIRPPDNSRD-------CNTQFKFPV  62

Query  232   IDMEGLHTDHTTRRSEIIKEIRDACQTWGFFQIINHGIPTQVLDEMIDGVRQFHELDSEV  411
             ID+ G+ +D   RR +I++ +R+A +TWG F ++NHGIP  VL+EM+DGV +F+E D+EV
Sbjct  63    IDLHGMDSD-PIRRKKIVEMVREASETWGLFTVVNHGIPVSVLEEMMDGVHRFYEQDNEV  121

Query  412   KKQFYSRDLTRKVVYNTNFDFHTSPAATWRDTLYFIMAPHPPTPQELPQVCRDILIKYSN  591
             KK+FY+RDLTRKV+YN+NFD + S AA WRDT Y +MAPHP  PQELP  CRDIL++Y  
Sbjct  122   KKEFYTRDLTRKVIYNSNFDLYVSKAANWRDTFYCLMAPHPLNPQELPATCRDILMEYKE  181

Query  592   SVQKLGLCLLELFSESLGLHKNHLEKLGCAVGLSIFGQYYPACPEPELTFALRDHSDSGF  771
              V +LGL LLEL SE++GL+ NHL+ + CA GL+I   YYPACP+PELT     HSD+ F
Sbjct  182   QVMRLGLKLLELMSEAIGLNPNHLKDMDCAEGLAILCHYYPACPQPELTMGTTKHSDNDF  241

Query  772   FTVLNQDTQIGGLQVLHENQWVDVPPLHGALVVNVADLLQLITNDKFKSVVHRVIAQKIA  951
              T+L QD QIGGLQVLH++QWVDVPP  GALV+NV DLLQLITND+FKSV HRV+A +  
Sbjct  242   LTILLQD-QIGGLQVLHQDQWVDVPPEPGALVINVGDLLQLITNDRFKSVEHRVLANRRG  300

Query  952   PRVSVASFFRTIPGDVDAKKVYGPIKELVSDENPPLYRETTTEEYLMHFQKKGLDGTSGL  1131
             PRVSVA FF T    + + K+YGPIKEL+S ENPP YRETT  +Y++HF+ KGLDGTS L
Sbjct  301   PRVSVACFFST--SHLPSSKLYGPIKELLSKENPPKYRETTVRDYVLHFRSKGLDGTSAL  358

Query  1132  LRFRL  1146
              +F+L
Sbjct  359   PQFKL  363


 Score =   397 bits (1021),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 183/314 (58%), Positives = 239/314 (76%), Gaps = 5/314 (2%)
 Frame = +1

Query  208   ASTYKVPIIDMEGLHTDHTTRRSEIIKEIRDACQTWGFFQIINHGIPTQVLDEMIDGVRQ  387
              + +  P++D++G+  D   RR++I+  ++DA +TWGFF ++NHGIP  VL+EM++GV +
Sbjct  372   TTQFNFPVVDLQGMDND-PIRRNKIVDMVKDASETWGFFNVVNHGIPVSVLEEMMEGVLR  430

Query  388   FHELDSEVKKQFYSRDLTRK-VVYNTNFDFHTSPAATWRDTLYFIMAPHPPTPQELPQVC  564
             F+E D+EVKKQFY+RD +RK +VYN+NFD +T+PAA WRDT Y +MAPHPP P+ELP  C
Sbjct  431   FYEQDTEVKKQFYTRDASRKKMVYNSNFDLYTAPAANWRDTFYCLMAPHPPNPEELPAAC  490

Query  565   RDILIKYSNSVQKLGLCLLELFSESLGLHKNHLEKLGCAVGLSIFGQYYPACPEPELTFA  744
             RDIL++Y + + +LG  L EL SE+LGL+ NHL+ + C  GLSI   YYP+CP+PELT  
Sbjct  491   RDILMEYKDQIMRLGFKLFELISEALGLNPNHLKDMDCTEGLSILCHYYPSCPQPELTMG  550

Query  745   LRDHSDSGFFTVLNQDTQIGGLQVLHENQWVDVPPLHGALVVNVADLLQLITNDKFKSVV  924
                H+D+ F TVL QD QIGGLQVLH+ QW+DVPP+ GALV+NV DLLQLITND+FKSV 
Sbjct  551   TTKHADNDFLTVLLQD-QIGGLQVLHQGQWIDVPPMPGALVINVGDLLQLITNDRFKSVE  609

Query  925   HRVIAQKIAPRVSVASFFRTIPGDVDAKKVYGPIKELVSDENPPLYRETTTEEYLMHFQK  1104
             HRV+A  I PRVSVA FF T      + K+YGPIKEL+S+ENPP Y+ETT  +Y+ +F  
Sbjct  610   HRVLANHIGPRVSVACFFST--SIQPSSKLYGPIKELLSEENPPKYKETTVGDYVAYFNS  667

Query  1105  KGLDGTSGLLRFRL  1146
             KGLDGTS L  FRL
Sbjct  668   KGLDGTSALPHFRL  681



>ref|XP_010650057.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1-like [Vitis vinifera]
 emb|CAN62402.1| hypothetical protein VITISV_000986 [Vitis vinifera]
Length=367

 Score =   436 bits (1120),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 212/372 (57%), Positives = 267/372 (72%), Gaps = 11/372 (3%)
 Frame = +1

Query  31    STGGKADSGDYDRKSELKAFDDMKTGVKGHVDSGIMKIPRIFIHDeikkeekeklkPAMA  210
             S    A   D DR  ELKAFD+ K GVKG VD+G+ ++PRIFI         +       
Sbjct  7     SESPMATQADCDRLGELKAFDETKAGVKGLVDAGVSQVPRIFIQPPDDFTTGD-------  59

Query  211   STYKVPIIDMEGLHTDHTTRRSEIIKEIRDACQTWGFFQIINHGIPTQVLDEMIDGVRQF  390
             + +  P+ID++ ++TD   RR EI+  +RDA +TWGFF ++NHGI   VL+EM DGVR+F
Sbjct  60    TKFSFPVIDLQDMNTD-PARRKEIVDMVRDASETWGFFNVVNHGISVTVLEEMKDGVRRF  118

Query  391   HELDSEVKKQFYSRDLTRKVVYNTNFDFHTSPAATWRDTLYFIMAPHPPTPQELPQVCRD  570
             +E D+EVKKQ+YSRDL RKVVYN+NFD + +PAA WRDT YF+MAP PP PQELP   RD
Sbjct  119   YEQDTEVKKQYYSRDLERKVVYNSNFDLYKAPAANWRDTFYFLMAPQPPDPQELPPAFRD  178

Query  571   ILIKYSNSVQKLGLCLLELFSESLGLHKNHLEKLGCAVGLSIFGQYYPACPEPELTFALR  750
             ILI+Y + V KLG  LLEL SE+LGL  NHL+ + CA GL++   YYPACP+PELT    
Sbjct  179   ILIEYKDEVMKLGFKLLELISEALGLKANHLKDMDCAEGLAMLCHYYPACPQPELTMGTT  238

Query  751   DHSDSGFFTVLNQDTQIGGLQVLHENQWVDVPPLHGALVVNVADLLQLITNDKFKSVVHR  930
              H+D+ F TVL QD +IGGLQVLH++QWVDVPP+ GALV+N+ DLLQLITND+FKSV HR
Sbjct  239   KHADNDFLTVLLQD-EIGGLQVLHQDQWVDVPPMPGALVINIGDLLQLITNDRFKSVEHR  297

Query  931   VIAQKIAPRVSVASFFRTIPGDVDAKKVYGPIKELVSDENPPLYRETTTEEYLMHFQKKG  1110
             V+A    PRVSVA FF T    + + K+YGPIKEL+S+ENPP YRE T  +++ +F  KG
Sbjct  298   VLASHKGPRVSVACFFST--ALLPSLKLYGPIKELLSEENPPKYREITVRDFVAYFNAKG  355

Query  1111  LDGTSGLLRFRL  1146
             LDGTS L  F+L
Sbjct  356   LDGTSALEHFKL  367



>ref|XP_010650062.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1 [Vitis vinifera]
Length=373

 Score =   435 bits (1118),  Expect = 4e-146, Method: Compositional matrix adjust.
 Identities = 204/363 (56%), Positives = 277/363 (76%), Gaps = 5/363 (1%)
 Frame = +1

Query  58    DYDRKSELKAFDDMKTGVKGHVDSGIMKIPRIFIHDeikkeekeklkPAMASTYKVPIID  237
             DYDRKSELK+FDD K GVKG +D+G+ KIPR+FI+++ K +     + +  S   VPIID
Sbjct  16    DYDRKSELKSFDDSKLGVKGLLDAGLTKIPRMFINEQHKTDMTWGSRES--SPESVPIID  73

Query  238   MEGLHTDHTTRRSEIIKEIRDACQTWGFFQIINHGIPTQVLDEMIDGVRQFHELDSEVKK  417
              +G+  D    R++IIK++ +AC+ WGFFQ++NHGIP  VL++MIDG+R+FHE D+E KK
Sbjct  74    FKGMDKD-AALRTQIIKKVGEACEKWGFFQVVNHGIPESVLNDMIDGIRRFHEQDAETKK  132

Query  418   QFYSRDLTRKVVYNTNFDFHTSPAATWRDTLYFIMAPHPPTPQELPQVCRDILIKYSNSV  597
             ++YSRD  +KV + +NFD + +  A WRD+L  +MAP+PP P++LP VCRDI+++YS  V
Sbjct  133   EYYSRDSQKKVRFISNFDLYQARMANWRDSLSCVMAPNPPLPEQLPAVCRDIVMEYSGQV  192

Query  598   QKLGLCLLELFSESLGLHKNHLEKLGCAVGLSIFGQYYPACPEPELTFALRDHSDSGFFT  777
              KLGL L EL SE+LGL+ NHL+ + CA GL + G YYPACPEPELT     H+D  FFT
Sbjct  193   MKLGLTLFELLSEALGLNPNHLKDMECAEGLFLSGHYYPACPEPELTLGTSSHTDPDFFT  252

Query  778   VLNQDTQIGGLQVLHENQWVDVPPLHGALVVNVADLLQLITNDKFKSVVHRVIAQKIAPR  957
             +L QD Q+GGLQVLHE+QWVDVPP+ GALV+N+ DLLQL++ND+FKS+ HRV+A+ + PR
Sbjct  253   ILLQD-QMGGLQVLHEDQWVDVPPIPGALVINMGDLLQLVSNDRFKSIFHRVLAKNVGPR  311

Query  958   VSVASFFRTIPGDVDAKKVYGPIKELVSDENPPLYRETTTEEYLMHFQKKGLDGTSGLLR  1137
             +S+ASFF T     +  ++YGPIKEL+S+ENPP+YRETT +E+L ++  KGLDG S L  
Sbjct  312   ISLASFFNT-SHPQNNSRLYGPIKELLSEENPPIYRETTVDEFLAYYFSKGLDGNSSLPH  370

Query  1138  FRL  1146
             F+L
Sbjct  371   FKL  373



>ref|XP_011040547.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1-like [Populus euphratica]
Length=368

 Score =   434 bits (1115),  Expect = 9e-146, Method: Compositional matrix adjust.
 Identities = 204/372 (55%), Positives = 269/372 (72%), Gaps = 7/372 (2%)
 Frame = +1

Query  31    STGGKADSGDYDRKSELKAFDDMKTGVKGHVDSGIMKIPRIFIHDeikkeekeklkPAMA  210
             ++  +    +YD+K +LKAFDD + GVKG +D+G+ KIP+IF+HD+      +  + A  
Sbjct  4     TSSAEVQESNYDKKKQLKAFDDTRAGVKGLIDNGMTKIPKIFVHDKRSDVSSDSDQNA--  61

Query  211   STYKVPIIDMEGLHTDHTTRRSEIIKEIRDACQTWGFFQIINHGIPTQVLDEMIDGVRQF  390
                 VP+ID EG+  D + +R+++++ IRDAC  WGFFQ++NHGIP  VL+EMI GV +F
Sbjct  62    ---AVPLIDFEGIDEDRS-QRAKVVEGIRDACAEWGFFQVVNHGIPVSVLEEMISGVARF  117

Query  391   HELDSEVKKQFYSRDLTRKVVYNTNFDFHTSPAATWRDTLYFIMAPHPPTPQELPQVCRD  570
             HE +SEVKK++YSRD TRKV+YN+NFD + +PAA WRDTL  +MAP  P PQ+LP  CRD
Sbjct  118   HEQESEVKKEWYSRDYTRKVLYNSNFDLYQAPAANWRDTLSCVMAPRQPNPQDLPHACRD  177

Query  571   ILIKYSNSVQKLGLCLLELFSESLGLHKNHLEKLGCAVGLSIFGQYYPACPEPELTFALR  750
             I+I YSN V  L   L EL SE+LGL  N+L+ + CA GL   G YYPACPEP+LTF   
Sbjct  178   IMIDYSNKVMVLAQRLFELLSEALGLDPNYLKDIHCAEGLFFLGHYYPACPEPDLTFGTS  237

Query  751   DHSDSGFFTVLNQDTQIGGLQVLHENQWVDVPPLHGALVVNVADLLQLITNDKFKSVVHR  930
              HSDS F TVL QD QIGGLQVLHENQWVDV P+ GALV+N+ D+ QLI+ND+F SV HR
Sbjct  238   SHSDSSFLTVLLQD-QIGGLQVLHENQWVDVNPIPGALVINLGDMFQLISNDRFISVQHR  296

Query  931   VIAQKIAPRVSVASFFRTIPGDVDAKKVYGPIKELVSDENPPLYRETTTEEYLMHFQKKG  1110
             V+A+ + PR+SVA F R      +A ++YGPIKEL+S+E+P +YRETT ++ + H+  KG
Sbjct  297   VLAKTVGPRISVACFIRQHLPPENASRLYGPIKELLSEESPAIYRETTVKDLVTHYYAKG  356

Query  1111  LDGTSGLLRFRL  1146
             LDG S L  F+L
Sbjct  357   LDGISALEHFKL  368



>ref|XP_008222546.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1-like isoform X2 [Prunus mume]
Length=370

 Score =   434 bits (1115),  Expect = 9e-146, Method: Compositional matrix adjust.
 Identities = 209/363 (58%), Positives = 265/363 (73%), Gaps = 4/363 (1%)
 Frame = +1

Query  58    DYDRKSELKAFDDMKTGVKGHVDSGIMKIPRIFIHDeikkeekeklkPAMASTYKVPIID  237
             +YDRKSELKAFDD K GVKG VD+GI  +P IF H    +        + A+ + VP+ID
Sbjct  12    NYDRKSELKAFDDTKEGVKGLVDAGITVVPTIF-HQPPDQYSINNNFDSEATQFSVPVID  70

Query  238   MEGLHTDHTTRRSEIIKEIRDACQTWGFFQIINHGIPTQVLDEMIDGVRQFHELDSEVKK  417
             +EGL  D  T+R EI+ ++ +A +TWGFFQI NHGIP  VL+E+ DGVR FHE D++VKK
Sbjct  71    LEGLEFDRPTKRKEIVTKVGEASETWGFFQIANHGIPIDVLEEIKDGVRGFHEQDTQVKK  130

Query  418   QFYSRDLTRKVVYNTNFDFHTSPAATWRDTLYFIMAPHPPTPQELPQVCRDILIKYSNSV  597
             QFY+RD  + VVYN+NFD H +PA+ WRDT    MAP+P  P+++P+V RDILI+YS  V
Sbjct  131   QFYTRDHFKPVVYNSNFDLHRAPASNWRDTFMCYMAPNPTKPEDMPEVFRDILIEYSKQV  190

Query  598   QKLGLCLLELFSESLGLHKNHLEKLGCAVGLSIFGQYYPACPEPELTFALRDHSDSGFFT  777
              KLG  L EL SE+LGL  +H+  + C++GL + G YYP+CP+PELT     H+DS F T
Sbjct  191   MKLGKLLFELLSEALGLKPSHMNDIDCSLGLVLVGHYYPSCPQPELTLGTSKHADSDFIT  250

Query  778   VLNQDTQIGGLQVLHENQWVDVPPLHGALVVNVADLLQLITNDKFKSVVHRVIAQKIAPR  957
             VL QD  IGGLQVLH+N+W+DVPP+ GALVVN+ DLLQLI+N++FKSV HRV+A  + PR
Sbjct  251   VLLQD-HIGGLQVLHQNKWIDVPPVPGALVVNIGDLLQLISNERFKSVQHRVLANHVGPR  309

Query  958   VSVASFFRTIPGDVDAKKVYGPIKELVSDENPPLYRETTTEEYLMHFQKKGLDGTSGLLR  1137
             VSVASFF T  G +   ++YGPIKEL+S++NPP YRETT  EY  HF  KGLDGTS L  
Sbjct  310   VSVASFFST--GMLPLGRLYGPIKELLSEDNPPKYRETTIREYNAHFNDKGLDGTSALTH  367

Query  1138  FRL  1146
             F L
Sbjct  368   FEL  370



>ref|XP_010262281.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1-like [Nelumbo nucifera]
 ref|XP_010262282.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1-like [Nelumbo nucifera]
Length=382

 Score =   434 bits (1115),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 212/384 (55%), Positives = 274/384 (71%), Gaps = 11/384 (3%)
 Frame = +1

Query  19    MATASTGGKADS----GDYDRKSELKAFDDMKTGVKGHVDSGIMKIPRIFIHDeikkeek  186
             M  +  GG +       DYDR  ELK FDD K GVKG VDSG++K+PRIFIH   + + +
Sbjct  1     MVVSGDGGDSSGILIKSDYDRMKELKEFDDSKAGVKGLVDSGLVKVPRIFIHPPEEYDGR  60

Query  187   eklkPAMASTYKVPIIDMEGLHTDHTTRRSEIIKEIRDACQTWGFFQIINHGIPTQVLDE  366
                  +  + + +P+ID++G+  D   RR EI++E+R+A + WGFFQ++NHGIP  VLDE
Sbjct  61    SV---SNQTHFTIPVIDLDGIGKD-AIRRREIVEEVRNASEMWGFFQVVNHGIPVNVLDE  116

Query  367   MIDGVRQFHELDSEVKKQFYSRDLTRKVVYNTNFDFHTSPAATWRDTLYFIMAPHPPTPQ  546
             M+ GVR F+E D EVKK+FY+RDL R++VYN+N   + SPAA WRD+ Y  MAP PP P+
Sbjct  117   MLQGVRGFYEQDIEVKKKFYTRDLRRRLVYNSNNQLYQSPAANWRDSFYCFMAPEPPQPE  176

Query  547   ELPQVCRDILIKYSNSVQKLGLCLLELFSESLGLHKNHLEKLGCAVGLSIFGQYYPACPE  726
             +LP VCRDI+++YS  V+KLG+ L EL SE+L L   HL  +GCA G ++   YYP+CPE
Sbjct  177   DLPAVCRDIMMEYSKQVKKLGIFLFELLSEALTLKSEHLVDIGCAEGHALLTHYYPSCPE  236

Query  727   PELTFALRDHSDSGFFTVLNQDTQIGGLQVLHENQWVDVPPLHGALVVNVADLLQLITND  906
             PELT     H+D+ F TVL QD  IGGLQVL E QWVDV P+ GAL+VNV DLLQLI+ND
Sbjct  237   PELTMGTSKHADNDFLTVLLQDN-IGGLQVLREKQWVDVLPMPGALIVNVGDLLQLISND  295

Query  907   KFKSVVHRVIAQKIAPRVSVASFFRTIPGDVDAKKVYGPIKELVSDENPPLYRETTTEEY  1086
             +FKSV HRV+A +I PRVSVA FF T P +  + K+YGPIKEL+S+ENPP+YRE T +EY
Sbjct  296   RFKSVEHRVLANRIGPRVSVACFF-TTPVNQASGKLYGPIKELLSEENPPIYREITVQEY  354

Query  1087  LMHFQKKGLDGTSGLLRFRLQKEG  1158
             + H   KGLDG S L RF+L+  G
Sbjct  355   IQHIIAKGLDGNS-LTRFKLKMFG  377



>ref|XP_009379005.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1-like [Pyrus x bretschneideri]
Length=374

 Score =   433 bits (1113),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 203/371 (55%), Positives = 271/371 (73%), Gaps = 7/371 (2%)
 Frame = +1

Query  52    SGDYDRKSELKAFDDMKTGVKGHVDSGIMKIPRIFIHDeikkeek---eklkPAMA-STY  219
             S  YDRK+ELKAFDD K GVKG VD+G+ KIPRIFIH++ K           P+   S++
Sbjct  5     SSKYDRKTELKAFDDSKAGVKGLVDAGLAKIPRIFIHEQNKIINNHHPIGNSPSCDDSSF  64

Query  220   KVPIIDMEGLHT--DHTTRRSEIIKEIRDACQTWGFFQIINHGIPTQVLDEMIDGVRQFH  393
               P+I ++G+ +  +  T+R ++I ++R AC+ WGFFQ+++HG+P  VL EMIDG+R+FH
Sbjct  65    STPVISLKGIVSGEEDATQRRQVIDQVRHACEKWGFFQVVDHGVPVHVLGEMIDGIRRFH  124

Query  394   ELDSEVKKQFYSRDLTRKVVYNTNFDFHTSPAATWRDTLYFIMAPHPPTPQELPQVCRDI  573
             E D  VK+Q YSRD  +KV YN+NFD + +PAA WRDTL  +MAP  P   ELP VCRD+
Sbjct  125   EQDQVVKEQIYSRDYAKKVYYNSNFDLYQAPAANWRDTLSCVMAPRAPDLGELPSVCRDV  184

Query  574   LIKYSNSVQKLGLCLLELFSESLGLHKNHLEKLGCAVGLSIFGQYYPACPEPELTFALRD  753
             +I YS  V+ LG+ L EL S++LGL+ NHL+++GCA GL +FG YYP CPEPELT     
Sbjct  185   VIDYSEKVKALGVALFELLSQALGLNPNHLKEVGCAEGLVLFGHYYPTCPEPELTMGTSQ  244

Query  754   HSDSGFFTVLNQDTQIGGLQVLHENQWVDVPPLHGALVVNVADLLQLITNDKFKSVVHRV  933
             H+DS F TVL QD QIGGLQVLHENQWVDV P+HGALV+N+ D+LQLI+NDKF S  HRV
Sbjct  245   HTDSSFLTVLLQD-QIGGLQVLHENQWVDVTPIHGALVMNLGDMLQLISNDKFMSANHRV  303

Query  934   IAQKIAPRVSVASFFRTIPGDVDAKKVYGPIKELVSDENPPLYRETTTEEYLMHFQKKGL  1113
             +A+ + PR+SVA FFR      ++ ++Y PIKEL+S+ENPPLYRETT ++++ H+ +KGL
Sbjct  304   LAKNVGPRISVACFFRQHFPPENSSRLYAPIKELLSEENPPLYRETTVKDFVAHYYRKGL  363

Query  1114  DGTSGLLRFRL  1146
             +G   L   ++
Sbjct  364   NGIPSLEYLKI  374



>ref|XP_006341094.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1-like [Solanum tuberosum]
Length=370

 Score =   432 bits (1112),  Expect = 3e-145, Method: Compositional matrix adjust.
 Identities = 204/381 (54%), Positives = 272/381 (71%), Gaps = 13/381 (3%)
 Frame = +1

Query  4     EREREMATASTGGKADSGDYDRKSELKAFDDMKTGVKGHVDSGIMKIPRIFIHDeikkee  183
             +R R++    T    +   +DRKSELKAFDD K+GVKG VD+G+ K+P+IFI        
Sbjct  3     KRTRDIKKMDT----NESKHDRKSELKAFDDTKSGVKGLVDAGVNKVPQIFISPPDTHSN  58

Query  184   keklkPAMASTYKVPIIDMEGLHTDHTTRRSEIIKEIRDACQTWGFFQIINHGIPTQVLD  363
                   +    +  P+ID++ + +     R E+I+++RDA +TWGFFQ+INHG+P  V+ 
Sbjct  59    ------STTGQFIFPVIDLQDIDSHDQINRKELIEKVRDASETWGFFQVINHGVPCDVMA  112

Query  364   EMIDGVRQFHELDSEVKKQFYSRDLTRKVVYNTNFDFHTSPAATWRDTLYFIMAPHPPTP  543
             EMI GV  FHE D+++KKQ+Y+R+ T++VVYN+NFD +++PA  WRDT   IMAP+PP+P
Sbjct  113   EMIRGVCSFHEQDNDIKKQWYTREFTKRVVYNSNFDLYSAPATNWRDTFSCIMAPNPPSP  172

Query  544   QELPQVCRDILIKYSNSVQKLGLCLLELFSESLGLHKNHLEKLGCAVGLSIFGQYYPACP  723
             +E P +CRDI++KYS  V+KLG  L EL +E+LGL++N+L  + C  GLS+   YYPACP
Sbjct  173   EEWPPICRDIIVKYSEEVKKLGRSLFELLAEALGLNRNYLNDMDCDKGLSVACHYYPACP  232

Query  724   EPELTFALRDHSDSGFFTVLNQDTQIGGLQVLHENQWVDVPPLHGALVVNVADLLQLITN  903
             EPELT     H+D GF T+L QD  IGGLQVLH N WVDVPP  GALVVN+ADLLQLI+N
Sbjct  233   EPELTLGASKHADDGFLTLLLQD-HIGGLQVLHRNHWVDVPPTPGALVVNIADLLQLISN  291

Query  904   DKFKSVVHRVIAQKIAPRVSVASFFRTIPGDVDAKKVYGPIKELVSDENPPLYRETTTEE  1083
             DKFKSV HRV+A ++ PR+S+A FF T    + + ++YGPIKEL+S+ENP  YRETT +E
Sbjct  292   DKFKSVEHRVLANRVGPRISIACFFSTF--FLASSRLYGPIKELLSEENPSKYRETTIQE  349

Query  1084  YLMHFQKKGLDGTSGLLRFRL  1146
             Y  +F  KGLDGTS L  FRL
Sbjct  350   YAAYFTAKGLDGTSALQHFRL  370



>ref|XP_008222545.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1-like isoform X1 [Prunus mume]
Length=370

 Score =   432 bits (1112),  Expect = 3e-145, Method: Compositional matrix adjust.
 Identities = 209/363 (58%), Positives = 264/363 (73%), Gaps = 4/363 (1%)
 Frame = +1

Query  58    DYDRKSELKAFDDMKTGVKGHVDSGIMKIPRIFIHDeikkeekeklkPAMASTYKVPIID  237
             +YDRKSELKAFDD K GVKG VD+GI  +P IF H    +        + A+ + VP+ID
Sbjct  12    NYDRKSELKAFDDTKEGVKGLVDAGITVVPTIF-HQPPDQYSINNNFDSEATQFSVPVID  70

Query  238   MEGLHTDHTTRRSEIIKEIRDACQTWGFFQIINHGIPTQVLDEMIDGVRQFHELDSEVKK  417
             +EGL  D  T+R EI+ ++ +A +TWGFFQI NHGIP  VL+E+ DGVR FHE D++VKK
Sbjct  71    LEGLEFDRPTKRKEIVTKVGEASETWGFFQIANHGIPIDVLEEIKDGVRGFHEQDTQVKK  130

Query  418   QFYSRDLTRKVVYNTNFDFHTSPAATWRDTLYFIMAPHPPTPQELPQVCRDILIKYSNSV  597
             QFY+RD  + VVYN+NFD H +PA+ WRDT    MAP+P  P+++P+V RDILI+YS  V
Sbjct  131   QFYTRDHFKPVVYNSNFDLHRAPASNWRDTFMCYMAPNPTKPEDMPEVFRDILIEYSKQV  190

Query  598   QKLGLCLLELFSESLGLHKNHLEKLGCAVGLSIFGQYYPACPEPELTFALRDHSDSGFFT  777
              KLG  L EL SE+LGL  +H+  + C++GL + G YYP+CP+PELT     H+DS F T
Sbjct  191   MKLGKLLFELLSEALGLKPSHMNDIDCSLGLVLVGHYYPSCPQPELTLGTSKHADSDFIT  250

Query  778   VLNQDTQIGGLQVLHENQWVDVPPLHGALVVNVADLLQLITNDKFKSVVHRVIAQKIAPR  957
             VL QD  IGGLQVLH+N+W+DVPP+ GALVVN+ DLLQLI+N++FKSV HRV+A  + PR
Sbjct  251   VLLQD-HIGGLQVLHQNKWIDVPPVPGALVVNIGDLLQLISNERFKSVQHRVLANHVGPR  309

Query  958   VSVASFFRTIPGDVDAKKVYGPIKELVSDENPPLYRETTTEEYLMHFQKKGLDGTSGLLR  1137
             VSVASFF T  G     ++YGPIKEL+S++NPP YRETT  EY  HF  KGLDGTS L  
Sbjct  310   VSVASFFTT--GMQPLGRLYGPIKELLSEDNPPKYRETTIREYNAHFNDKGLDGTSALTH  367

Query  1138  FRL  1146
             F L
Sbjct  368   FEL  370



>ref|XP_002317688.1| hypothetical protein POPTR_0011s15970g [Populus trichocarpa]
 gb|EEE98300.1| hypothetical protein POPTR_0011s15970g [Populus trichocarpa]
Length=368

 Score =   432 bits (1110),  Expect = 4e-145, Method: Compositional matrix adjust.
 Identities = 205/371 (55%), Positives = 270/371 (73%), Gaps = 7/371 (2%)
 Frame = +1

Query  34    TGGKADSGDYDRKSELKAFDDMKTGVKGHVDSGIMKIPRIFIHDeikkeekeklkPAMAS  213
             +  +    +YD++S+LKAFDD +TGVKG +D+GI KIP+IF+HD+      +  + A   
Sbjct  5     SSAEVQESNYDKESQLKAFDDTRTGVKGLIDNGITKIPKIFVHDKRSDVSSDSDQSA---  61

Query  214   TYKVPIIDMEGLHTDHTTRRSEIIKEIRDACQTWGFFQIINHGIPTQVLDEMIDGVRQFH  393
                VP+ID EG+  D + +R+++++ +RDAC  WGFFQ++NHGIP  VL+EMI GV +FH
Sbjct  62    --AVPLIDFEGIDEDRS-QRAKVVEGVRDACAEWGFFQVVNHGIPVSVLEEMIGGVARFH  118

Query  394   ELDSEVKKQFYSRDLTRKVVYNTNFDFHTSPAATWRDTLYFIMAPHPPTPQELPQVCRDI  573
             E DSEVKK++YSRD TRKV+YN+NFD + +PAA WRDTL  +MAP  P P +LP VCRDI
Sbjct  119   EQDSEVKKEWYSRDYTRKVLYNSNFDLYQAPAANWRDTLSCVMAPRQPNPHDLPDVCRDI  178

Query  574   LIKYSNSVQKLGLCLLELFSESLGLHKNHLEKLGCAVGLSIFGQYYPACPEPELTFALRD  753
             +  YSN V  L   L EL SE+LGL  N+L+ + CA GL   G YYPACPEP+LTF    
Sbjct  179   MNDYSNKVMVLAQRLFELLSEALGLDPNYLKDIHCAEGLFFLGHYYPACPEPDLTFGTSS  238

Query  754   HSDSGFFTVLNQDTQIGGLQVLHENQWVDVPPLHGALVVNVADLLQLITNDKFKSVVHRV  933
             HSDS F TVL QD QIGGLQVLHENQWVD+ P+ GALV+N+ D+LQLI+ND+F SV HRV
Sbjct  239   HSDSSFLTVLVQD-QIGGLQVLHENQWVDLNPIPGALVINLGDMLQLISNDRFISVQHRV  297

Query  934   IAQKIAPRVSVASFFRTIPGDVDAKKVYGPIKELVSDENPPLYRETTTEEYLMHFQKKGL  1113
             +A+ + PR+SVA F R      +A ++YGPIKEL+S+E+P +YRETT ++ + H+  KGL
Sbjct  298   LARTVGPRISVACFIRQHLPPENASRLYGPIKELLSEESPAIYRETTVKDLVTHYYAKGL  357

Query  1114  DGTSGLLRFRL  1146
             DG S L  F+L
Sbjct  358   DGISALEHFKL  368



>ref|XP_002529300.1| Desacetoxyvindoline 4-hydroxylase, putative [Ricinus communis]
 gb|EEF33069.1| Desacetoxyvindoline 4-hydroxylase, putative [Ricinus communis]
Length=364

 Score =   431 bits (1107),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 211/365 (58%), Positives = 266/365 (73%), Gaps = 8/365 (2%)
 Frame = +1

Query  61    YDRKSELKAFDDMKTGVKGHVDSGIMKIPRIFIHDeikkeekeklkPAMASTYKVPIIDM  240
             YDR+SELKAFDD K GVKG VD G+ KIPRIFIHD+ K   K     +  S + +PIID 
Sbjct  5     YDRQSELKAFDDTKAGVKGLVDGGLTKIPRIFIHDQSKINNKSS---SGDSIHSIPIIDF  61

Query  241   EGLHTDHTTRRSEIIKEIRDACQTWGFFQIINHGIPTQVLDEMIDGVRQFHELDSEVKKQ  420
              G+ +D + R  +II ++RDAC+ WGFFQ+INHGIP  +LD++IDGVR+FHE D+EVKK+
Sbjct  62    NGIDSDSSVRI-DIINKVRDACKKWGFFQVINHGIPAAILDDIIDGVRKFHEQDTEVKKR  120

Query  421   FYSRDLT--RKVVYNTNFDFHTSPAATWRDTLYFIMAPHPPTPQELPQVCRDILIKYSNS  594
             FYSR+     K  +NTNFDF+ SPAA WRD++Y IMAP PP+ +ELP VCRDILI YSN 
Sbjct  121   FYSREQAGIAKFKFNTNFDFYQSPAANWRDSMYCIMAPDPPSSEELPDVCRDILIDYSNK  180

Query  595   VQKLGLCLLELFSESLGLHKNHLEKLGCAVGLSIFGQYYPACPEPELTFALRDHSDSGFF  774
             V  L   L EL SE+LGL+ N+L+ +GC+ GL   G YYP CPEPELT     HSD+ F 
Sbjct  181   VAALSNILFELLSEALGLNANYLKDIGCSEGLLFLGHYYPVCPEPELTMGTSSHSDNSFL  240

Query  775   TVLNQDTQIGGLQVLH-ENQWVDVPPLHGALVVNVADLLQLITNDKFKSVVHRVIAQKIA  951
             TVL QD Q GGLQVL  +NQWVDV P  GALV+N+ D+LQLI+NDKFKS  HRV+A+ + 
Sbjct  241   TVLLQD-QSGGLQVLSCKNQWVDVNPTPGALVINLGDMLQLISNDKFKSSEHRVLAKSVG  299

Query  952   PRVSVASFFRTIPGDVDAKKVYGPIKELVSDENPPLYRETTTEEYLMHFQKKGLDGTSGL  1131
             PR+SVA F   +    +A ++YGPIKEL+S+E PP+Y ETT +EYL ++  KGL+G S L
Sbjct  300   PRISVACFNIQLTHSKNASRLYGPIKELLSEETPPVYLETTIKEYLTYYYSKGLNGISAL  359

Query  1132  LRFRL  1146
               F+L
Sbjct  360   EHFKL  364



>ref|XP_008391709.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1-like [Malus domestica]
Length=374

 Score =   429 bits (1103),  Expect = 7e-144, Method: Compositional matrix adjust.
 Identities = 201/371 (54%), Positives = 269/371 (73%), Gaps = 7/371 (2%)
 Frame = +1

Query  52    SGDYDRKSELKAFDDMKTGVKGHVDSGIMKIPRIFIHDeikkeek---eklkPAMA-STY  219
             S  YDRK+ELKAFDD K GVKG VD+G+ KIPRIFIH++ K           P+   S++
Sbjct  5     SSKYDRKTELKAFDDSKAGVKGLVDAGLAKIPRIFIHEQNKIINNHHPIGHSPSCDDSSF  64

Query  220   KVPIIDMEGLHT--DHTTRRSEIIKEIRDACQTWGFFQIINHGIPTQVLDEMIDGVRQFH  393
               P+I ++G+ +  +  ++R ++I ++R AC+ WGFFQ+++HG+P  VL+EMIDG+R+FH
Sbjct  65    STPVISLKGIVSGEEDASQRRQVIDQVRHACEKWGFFQVVDHGVPVHVLEEMIDGIRRFH  124

Query  394   ELDSEVKKQFYSRDLTRKVVYNTNFDFHTSPAATWRDTLYFIMAPHPPTPQELPQVCRDI  573
             E D  VK++ YSRD  +KV YNTNFD + +PAA WRDTL  +MAP  P   ELP VCRD+
Sbjct  125   EQDQVVKEEIYSRDYAKKVYYNTNFDLYQAPAANWRDTLSCVMAPRAPDLGELPSVCRDV  184

Query  574   LIKYSNSVQKLGLCLLELFSESLGLHKNHLEKLGCAVGLSIFGQYYPACPEPELTFALRD  753
             +I YS  V+  G  L EL S++LGL+ NHL++LGCA GL +FG YYP CPEPELT     
Sbjct  185   VIDYSEKVKAXGXALFELLSQALGLNPNHLKELGCAEGLVLFGHYYPTCPEPELTMGTSQ  244

Query  754   HSDSGFFTVLNQDTQIGGLQVLHENQWVDVPPLHGALVVNVADLLQLITNDKFKSVVHRV  933
             H+DS F TVL QD QIGGLQVLHENQWVDV P+HGALV+N+ D+ QLI+NDKF S  HRV
Sbjct  245   HTDSSFLTVLLQD-QIGGLQVLHENQWVDVTPIHGALVINLGDMSQLISNDKFISANHRV  303

Query  934   IAQKIAPRVSVASFFRTIPGDVDAKKVYGPIKELVSDENPPLYRETTTEEYLMHFQKKGL  1113
             +A+ + PR+SVA FFR      ++ ++Y PIKEL+S+ENPP+YRETT ++++ H+  KGL
Sbjct  304   LAKNVGPRISVACFFRQHLPPENSSRLYAPIKELLSEENPPVYRETTVKDFVAHYYSKGL  363

Query  1114  DGTSGLLRFRL  1146
             +G S L   ++
Sbjct  364   NGISALEYLKI  374



>ref|XP_010262287.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
[Nelumbo nucifera]
Length=372

 Score =   429 bits (1103),  Expect = 7e-144, Method: Compositional matrix adjust.
 Identities = 209/376 (56%), Positives = 273/376 (73%), Gaps = 6/376 (2%)
 Frame = +1

Query  19    MATASTGGKADSGDYDRKSELKAFDDMKTGVKGHVDSGIMKIPRIFIHDeikkeekeklk  198
             ++ A       + D+DR  ELK FDD K GVKG VDSGI+K+PRIFI   +K +EK  + 
Sbjct  3     ISGAGEVSTKSASDFDRMKELKEFDDSKAGVKGLVDSGIVKVPRIFIDPSLKSDEKLVIS  62

Query  199   PAMASTYKVPIIDMEGLHTDHTTRRSEIIKEIRDACQTWGFFQIINHGIPTQVLDEMIDG  378
                 ST  +P+ID+ G+H D   RR +++ ++R A  TWGFFQ++NHGIPT VLDE++ G
Sbjct  63    SEKRST--IPVIDLSGIHED-AVRRKDVVDQVRHASGTWGFFQVVNHGIPTSVLDEILQG  119

Query  379   VRQFHELDSEVKKQFYSRDLTRKVVYNTNFDFHTSPAATWRDTLYFIMAPHPPTPQELPQ  558
             VR+F+E D +V+K+FYSRD  +KVVYN+NF  + S AA WRDTLY +M+P+PP+P+E+PQ
Sbjct  120   VRRFNEQDVDVRKRFYSRDTKKKVVYNSNFVLYQSAAANWRDTLYCVMSPNPPSPEEIPQ  179

Query  559   VCRDILIKYSNSVQKLGLCLLELFSESLGLHKNHLEKLGCAVGLSIFGQYYPACPEPELT  738
             VCRDI+I+YS  V++L + LLEL SE+L L  +HL  +GCA   +I   YYPACPEPELT
Sbjct  180   VCRDIMIQYSGQVERLAVTLLELLSEALMLKPSHLVDMGCAESHAILCHYYPACPEPELT  239

Query  739   FALRDHSDSGFFTVLNQDTQIGGLQVLHENQWVDVPPLHGALVVNVADLLQLITNDKFKS  918
                  H+D+ F T+L QD QIGGLQVLH+N WVDVPPL GALVVN+ DLLQLI+ND+ +S
Sbjct  240   MGTSKHADNDFMTILLQD-QIGGLQVLHQNHWVDVPPLRGALVVNIGDLLQLISNDRLRS  298

Query  919   VVHRVIAQKIAPRVSVASFFRTIPGDVDAKKVYGPIKELVSDENPPLYRETTTEEYLMHF  1098
             V HRV+A  + PRVSVA FF T     ++ K YGPIKEL+S+ENPP+YRE T  E+  +F
Sbjct  299   VEHRVVANNVGPRVSVACFFPT--SVQESIKRYGPIKELLSEENPPIYREITIPEFSSYF  356

Query  1099  QKKGLDGTSGLLRFRL  1146
               KGLDG+  L  F+L
Sbjct  357   YSKGLDGSPMLDHFKL  372



>ref|XP_003632020.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1 [Vitis vinifera]
Length=680

 Score =   439 bits (1129),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 212/380 (56%), Positives = 273/380 (72%), Gaps = 10/380 (3%)
 Frame = +1

Query  19    MATASTGGKADSGD--YDRKSELKAFDDMKTGVKGHVDSGIMKIPRIFIHDeikkeekek  192
             M TAST    + G+  YDRKSELKAFDD   GVKG VD+GI KIPRIFI+++ K +    
Sbjct  1     MVTASTKEAQEGGESSYDRKSELKAFDDSNLGVKGLVDAGITKIPRIFINEQNKLDMSSN  60

Query  193   lkPAMASTYKVPIIDMEGLHTDHTTRRSEIIKEIRDACQTWGFFQIINHGIPTQVLDEMI  372
               P ++    VPIID+E    D   R +EII +IRDAC+ WGFF +INH IP  VL EMI
Sbjct  61    N-PHLS----VPIIDLESFDKDAVVR-AEIINQIRDACKKWGFFLVINHEIPESVLSEMI  114

Query  373   DGVRQFHELDSEVKKQFYSRDLTRKVVYNTNFDFHTSPAATWRDTLYFIMAPHPPTPQEL  552
             DG+R+FHE D E KK++Y+RD +RKV Y++NFD + + +  WRDT    +AP PP P++L
Sbjct  115   DGIRRFHEQDGEAKKEWYTRDYSRKVTYSSNFDLYQASSTNWRDTFACTLAPDPPQPEQL  174

Query  553   PQVCRDILIKYSNSVQKLGLCLLELFSESLGLHKNHLEKLGCAVGLSIFGQYYPACPEPE  732
             P VCRDIL++Y   V++LG  L EL SE+LGLH NHL+ + CA G+ + G YYPACPEPE
Sbjct  175   PAVCRDILMEYLKHVRRLGFSLFELLSEALGLHPNHLKNMECAEGILLLGHYYPACPEPE  234

Query  733   LTFALRDHSDSGFFTVLNQDTQIGGLQVLHENQWVDVPPLHGALVVNVADLLQLITNDKF  912
             LT     H+D+ F T+L QD Q+GGLQVLHE+QWV++PP+ GALV+NV DLLQ ++N  F
Sbjct  235   LTLGTSSHTDADFITILIQD-QMGGLQVLHEDQWVNIPPISGALVINVGDLLQFVSNGNF  293

Query  913   KSVVHRVIAQKIAPRVSVASFFRTIPGDVDAKKVYGPIKELVSDENPPLYR-ETTTEEYL  1089
             KS  HRV+A+ + PR+SVA FFR I    +  ++YGPIKEL+S++NPP+YR E    EYL
Sbjct  294   KSSEHRVLAKNVGPRISVACFFRKIIPVENTTRLYGPIKELLSEDNPPIYRQENFPNEYL  353

Query  1090  MHFQKKGLDGTSGLLRFRLQ  1149
             MH+  KGLDGTS LLRF+L 
Sbjct  354   MHYDSKGLDGTSSLLRFKLN  373


 Score =   323 bits (827),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 159/313 (51%), Positives = 209/313 (67%), Gaps = 12/313 (4%)
 Frame = +1

Query  220   KVPIIDMEGLHTDHTTRRSEIIKEIRDACQTWGFFQIINHGIPTQVLDEMIDGVRQFHEL  399
             KVP++DM G+      R  EI++E+R A + WGFFQ++NHGIP+ VL+EM++G+R F+E 
Sbjct  376   KVPVVDMSGVQKG--DRHREIVEEVRIASEEWGFFQVVNHGIPSNVLEEMVNGIRVFNEQ  433

Query  400   DSEVKKQFYSRDLTRKVVYNTNFDFHTSPAATWRDTLYFIMAPHPPTPQELPQVCRDILI  579
             D EVKK++YSRD+ RKV +N+N+D   S AA WRDTL   +      PQELP +CR+   
Sbjct  434   DPEVKKEYYSRDMMRKVKFNSNYDLFHSRAANWRDTLTISLTSDGLDPQELPAICREATT  493

Query  580   KYSNSVQKLGLCLLELFSESLGLHKNHLEKLGCAVGLS-IFGQYYPACPEPELTFALRDH  756
             +Y   V KLG  L EL SE+LGL  +HL  +G   G S +   YYPACPEPELT     H
Sbjct  494   EYIKHVMKLGDVLFELLSEALGLKPDHLRAMGYTEGSSTMVCHYYPACPEPELTMGTSKH  553

Query  757   SDSGFFTVLNQDTQIGGLQVLHENQWVDVPPLHGALVVNVADLLQLITNDKFKSVVHRVI  936
             +D    T+L QD QIGGLQV HENQW +V P+ G+LV+N+ D LQ+++N K KSV HRV+
Sbjct  554   TDPATLTILLQD-QIGGLQVFHENQWAEVHPIAGSLVINIGDFLQVMSNGKLKSVYHRVV  612

Query  937   AQKIAPRVSVASFF---RTIPGDVDAKKVYGPIKELVSDENPPLYRETTTEEYLMHFQKK  1107
             A  + PR+S A FF   RT P      K+ GP+KEL+S+ENPP+YR+    EY+  F  K
Sbjct  613   ANHVGPRISTAYFFSGARTEPA-----KLCGPLKELISEENPPVYRDFLVAEYIGKFMSK  667

Query  1108  GLDGTSGLLRFRL  1146
             GLD  SGL  F+L
Sbjct  668   GLDDDSGLDYFKL  680



>ref|XP_010672757.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1-like [Beta vulgaris subsp. vulgaris]
Length=359

 Score =   427 bits (1097),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 201/362 (56%), Positives = 259/362 (72%), Gaps = 10/362 (3%)
 Frame = +1

Query  61    YDRKSELKAFDDMKTGVKGHVDSGIMKIPRIFIHDeikkeekeklkPAMASTYKVPIIDM  240
             Y+R +ELK+FD+ K GVKG VD+G+  IPR+FIH                    +PIID+
Sbjct  8     YNRTAELKSFDESKAGVKGLVDAGLSTIPRMFIHPTDPSSSPP------KHDVSIPIIDL  61

Query  241   EGLHTDHTTRRSEIIKEIRDACQTWGFFQIINHGIPTQVLDEMIDGVRQFHELDSEVKKQ  420
              G+  D   R+  I++ IR+A +TWGFFQ++NH IP  VL+EM++GV++F+E D EVKK 
Sbjct  62    TGMTNDPVLRKV-IVERIREASETWGFFQVVNHSIPIMVLEEMLEGVKRFYEQDVEVKKG  120

Query  421   FYSRDLTRKVVYNTNFDFHTSPAATWRDTLYFIMAPHPPTPQELPQVCRDILIKYSNSVQ  600
             +Y+RD+ +KVVYN+N+D +T PAA WRDT Y  MAP PP+PQ+LP  CR+IL++Y+  V 
Sbjct  121   YYTRDVAKKVVYNSNYDLYTGPAANWRDTFYCFMAPQPPSPQDLPNTCREILMEYTKEVM  180

Query  601   KLGLCLLELFSESLGLHKNHLEKLGCAVGLSIFGQYYPACPEPELTFALRDHSDSGFFTV  780
             KLG  L+EL SE+LGL  NHL  + C+ GL + G YYPACP+PELT     H+D GF T+
Sbjct  181   KLGRVLMELLSEALGLSANHLNDIDCSEGLVVVGHYYPACPQPELTLGTSKHADDGFLTL  240

Query  781   LNQDTQIGGLQVLHENQWVDVPPLHGALVVNVADLLQLITNDKFKSVVHRVIAQKIAPRV  960
             L QD QIGGLQ+LHE++W DVPP+ GALVVN+ DLLQLI+ND FKSV HRV+A +I PRV
Sbjct  241   LLQD-QIGGLQILHEDKWFDVPPVPGALVVNIGDLLQLISNDTFKSVEHRVLANRIGPRV  299

Query  961   SVASFFRTIPGDVDAKKVYGPIKELVSDENPPLYRETTTEEYLMHFQKKGLDGTSGLLRF  1140
             SVASFF T        K+YGPIK+LVS++NPP YRE T  EY+ +   KGLDG S LL F
Sbjct  300   SVASFFTT--SFQGTSKIYGPIKDLVSEDNPPRYREVTVSEYVTYALAKGLDGVSSLLNF  357

Query  1141  RL  1146
             RL
Sbjct  358   RL  359



>ref|XP_007226473.1| hypothetical protein PRUPE_ppa027196mg [Prunus persica]
 gb|EMJ27672.1| hypothetical protein PRUPE_ppa027196mg [Prunus persica]
Length=369

 Score =   426 bits (1095),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 206/363 (57%), Positives = 266/363 (73%), Gaps = 5/363 (1%)
 Frame = +1

Query  58    DYDRKSELKAFDDMKTGVKGHVDSGIMKIPRIFIHDeikkeekeklkPAMASTYKVPIID  237
             +YDRKSELKAFDD K GVKG VD+GI  +PRIF   +   +       + A+ + VP+ID
Sbjct  12    NYDRKSELKAFDDTKEGVKGLVDAGITVVPRIF--HQPPDQYSINNFDSEATQFSVPVID  69

Query  238   MEGLHTDHTTRRSEIIKEIRDACQTWGFFQIINHGIPTQVLDEMIDGVRQFHELDSEVKK  417
             +EGL     T+R EI+ ++ +A +TWGFFQI+NHGIP  VL+E+ DGVR F+E D++VKK
Sbjct  70    LEGLEFGRPTKRKEIVTKVGEASETWGFFQIVNHGIPIDVLEEIKDGVRGFYEQDTQVKK  129

Query  418   QFYSRDLTRKVVYNTNFDFHTSPAATWRDTLYFIMAPHPPTPQELPQVCRDILIKYSNSV  597
             QFY+RD  + VVYN+NFD H +PA  WRDT    MAP+P   +++P+V RDILI+YS  V
Sbjct  130   QFYTRDHFKPVVYNSNFDLHRAPACNWRDTFMCYMAPNPTKAEDMPEVFRDILIEYSKQV  189

Query  598   QKLGLCLLELFSESLGLHKNHLEKLGCAVGLSIFGQYYPACPEPELTFALRDHSDSGFFT  777
              KLG  L EL SE+LGL  +HL  + C++GL + G YYP+CP+PELT     H+DS F T
Sbjct  190   MKLGKLLFELLSEALGLKPSHLNDIDCSLGLVLVGHYYPSCPQPELTLGTSKHADSDFIT  249

Query  778   VLNQDTQIGGLQVLHENQWVDVPPLHGALVVNVADLLQLITNDKFKSVVHRVIAQKIAPR  957
             VL QD  IGGLQVLH+N+W+DVPP+ GALVVN+ DLLQLI+N++FKSV HRV+A ++ PR
Sbjct  250   VLLQD-HIGGLQVLHQNKWIDVPPVPGALVVNIGDLLQLISNERFKSVEHRVLANRVGPR  308

Query  958   VSVASFFRTIPGDVDAKKVYGPIKELVSDENPPLYRETTTEEYLMHFQKKGLDGTSGLLR  1137
             VSVASFF T  G    +++YGPIKEL+S++NPP YR+TT  EY  HF +KGLDGTS L  
Sbjct  309   VSVASFFTT--GMQPLERLYGPIKELLSEDNPPKYRDTTIREYNAHFNEKGLDGTSALTH  366

Query  1138  FRL  1146
             F L
Sbjct  367   FEL  369



>ref|NP_001234624.1| 2-oxoglutarate-dependent dioxygenase [Solanum lycopersicum]
 dbj|BAD98961.1| 2-oxoglutarate-dependent dioxygenase [Solanum lycopersicum]
Length=364

 Score =   426 bits (1094),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 203/364 (56%), Positives = 265/364 (73%), Gaps = 12/364 (3%)
 Frame = +1

Query  61    YDRKSELKAFDDMKTGVKGHVDSGIMKIPRIFIHDeikkeekeklkPAMASTYKVPIIDM  240
             YD+ SELKAFDD K GVKG +DSGI K+P+IFIH E  + +         + +  P+ID+
Sbjct  10    YDKTSELKAFDDTKAGVKGLIDSGITKVPQIFIHPEALENKTTN---PKNTHFIFPLIDL  66

Query  241   EGLHTDHTTRRSEIIKEIRDACQTWGFFQIINHGIPTQVLDEMIDGVRQFHELDSEVKKQ  420
             + +    +    EI+K+I++A +TWGFFQ+INHGIP  VLDEM+ G R+FH+ D +VKK 
Sbjct  67    QNI----SINNKEIVKQIQEASETWGFFQVINHGIPVPVLDEMLRGARRFHDQDIDVKKP  122

Query  421   FYSRDLTRKVVYNTNFDFHT--SPAATWRDTLYFIMAPHPPTPQELPQVCRDILIKYSNS  594
             +YSRD+ RKV+YN NFD  +  S AA WRD+LY +MAP+P TP+E+P+ CR+I I+YSN 
Sbjct  123   YYSRDIARKVMYNCNFDLFSEKSLAANWRDSLYSVMAPNPATPEEIPETCREITIEYSNY  182

Query  595   VQKLGLCLLELFSESLGLHKNHLEKLGCAVGLSIFGQYYPACPEPELTFALRDHSDSGFF  774
             V  LG  LLELFSE LGL  NHL+++GCA GL I   YYP CP+PE+      H+D+ FF
Sbjct  183   VMNLGYTLLELFSEGLGLKPNHLKEMGCAEGLGILCNYYPKCPQPEIAIGTSRHADNDFF  242

Query  775   TVLNQDTQIGGLQVLHENQWVDVPPLHGALVVNVADLLQLITNDKFKSVVHRVIAQKIAP  954
             TVL QD  IGGLQVLH+NQWVDVPP HGALVVN+ D+LQLI+NDK+KSVVHRV+A  I P
Sbjct  243   TVLLQD-DIGGLQVLHKNQWVDVPPTHGALVVNIGDILQLISNDKYKSVVHRVLANTIGP  301

Query  955   RVSVASFFRTIPGDVDAKKVYGPIKELVSDENPPLYRETTTEEYLMHFQKKGLDGTSGLL  1134
             R+S+ASFF T  G     ++YGPI+EL+S +NPP YR TT +++  +  KKGLDG S L 
Sbjct  302   RISIASFFST--GPFSTSRIYGPIEELLSKDNPPKYRSTTMKDFFEYSNKKGLDGNSNLS  359

Query  1135  RFRL  1146
              +++
Sbjct  360   HYKI  363



>ref|XP_011073515.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1-like [Sesamum indicum]
Length=372

 Score =   426 bits (1094),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 201/362 (56%), Positives = 265/362 (73%), Gaps = 7/362 (2%)
 Frame = +1

Query  61    YDRKSELKAFDDMKTGVKGHVDSGIMKIPRIFIHDeikkeekeklkPAMASTYKVPIIDM  240
             YDR+SEL+AF+D K GVKG VD+G+ K+PRIFIH      + +       + +  P+ID+
Sbjct  18    YDRQSELQAFEDTKAGVKGLVDAGVTKLPRIFIHPPENLRDIKN---PTRNLFDFPLIDL  74

Query  241   EGLHTDHTTRRSEIIKEIRDACQTWGFFQIINHGIPTQVLDEMIDGVRQFHELDSEVKKQ  420
             +G+  D   R  +I+  +R+A +TWGFFQI+NHG+P  +L+EM+DGVR+F+E ++E+KKQ
Sbjct  75    DGVDEDAGVRE-KIVDRVREASETWGFFQIVNHGVPVSMLEEMLDGVRRFNEQETEIKKQ  133

Query  421   FYSRDLTRKVVYNTNFDFHTSPAATWRDTLYFIMAPHPPTPQELPQVCRDILIKYSNSVQ  600
             FYSRD T+KV +N NFD  +SPAA WRDT+Y +++P+P  P+ELP VCRDI+I+YS  V 
Sbjct  134   FYSRDSTKKVTFNCNFDLFSSPAANWRDTIYCVISPNPAQPEELPTVCRDIIIEYSKQVI  193

Query  601   KLGLCLLELFSESLGLHKNHLEKLGCAVGLSIFGQYYPACPEPELTFALRDHSDSGFFTV  780
             +LG CL +L SESLGL  +HL ++ CA  L++ G YYP CPEP+LTF +  HSD+ F TV
Sbjct  194   RLGRCLFKLMSESLGLSPDHLIEMECAESLALIGHYYPPCPEPDLTFGISKHSDNNFITV  253

Query  781   LNQDTQIGGLQVLHENQWVDVPPLHGALVVNVADLLQLITNDKFKSVVHRVIAQKIAPRV  960
             L QD  +GGLQV H+NQWVDVPPL GALVVN+ DL QL++NDK KSV HRV+A    PR+
Sbjct  254   LLQD-NLGGLQVRHQNQWVDVPPLPGALVVNIGDLFQLVSNDKLKSVEHRVLASNAGPRI  312

Query  961   SVASFFRTIPGDVDAKKVYGPIKELVSDENPPLYRETTTEEYLMHFQKKGLDGTSGLLRF  1140
             SVASFF    G   + KVY P+KEL+S+++PP YR TT  EY   F+ KGL GTS LL F
Sbjct  313   SVASFFGRDSG--PSSKVYAPMKELLSEDDPPKYRPTTANEYTEFFRAKGLGGTSALLHF  370

Query  1141  RL  1146
             RL
Sbjct  371   RL  372



>ref|XP_008365367.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1-like [Malus domestica]
Length=370

 Score =   425 bits (1092),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 203/371 (55%), Positives = 270/371 (73%), Gaps = 7/371 (2%)
 Frame = +1

Query  46    ADSGDYDRKSELKAFDDMKTGVKGHVDSGIMKIPRIFIHDeikkeekeklkPAM---AST  216
             A + +YDRKSE+ AFD+ K GVKG VD+GI +IPRIF       +      P+    A+ 
Sbjct  3     ATNTNYDRKSEVNAFDETKEGVKGLVDAGITEIPRIFHRPPESDDHYHINSPSSDSEATR  62

Query  217   YKVPIIDMEGL-HTDHTTRRSEIIKEIRDACQTWGFFQIINHGIPTQVLDEMIDGVRQFH  393
             + +P+ID++GL   D  T+R EI+ ++ +A +TWGFFQI+NHGIP  VL+E+ DGVR F 
Sbjct  63    FSIPVIDLQGLDRFDSPTKRKEIVAKVGEASETWGFFQIVNHGIPVGVLEEIKDGVRGFF  122

Query  394   ELDSEVKKQFYSRDLTRKVVYNTNFDFHTSPAATWRDTLYFIMAPHPPTPQELPQVCRDI  573
             ELD++VKK+ Y+RD  + V+YN+NFD +++P   WRDT    +AP+P  P++LPQVCRDI
Sbjct  123   ELDTQVKKELYTRDPFKPVIYNSNFDLYSAPVTNWRDTFMCYVAPNPTKPEDLPQVCRDI  182

Query  574   LIKYSNSVQKLGLCLLELFSESLGLHKNHLEKLGCAVGLSIFGQYYPACPEPELTFALRD  753
             L++YS  V KLG  L EL SE+LGL  +HL  + C+ GL I G YYPACP+PELT    +
Sbjct  183   LVEYSMQVMKLGRLLFELLSEALGLKPSHLNDIDCSEGLVILGHYYPACPQPELTMGTSN  242

Query  754   HSDSGFFTVLNQDTQIGGLQVLHENQWVDVPPLHGALVVNVADLLQLITNDKFKSVVHRV  933
             H+D+ F T+L QD  IGGLQVLH+ +WVD+PP+ GALVVN+ DLLQLI+NDKFKS+ HRV
Sbjct  243   HADNDFLTILLQD-HIGGLQVLHQGKWVDIPPVPGALVVNIGDLLQLISNDKFKSIQHRV  301

Query  934   IAQKIAPRVSVASFFRTIPGDVDAKKVYGPIKELVSDENPPLYRETTTEEYLMHFQKKGL  1113
             +A  + PR+SVASFF T  G + + K+YGPIKEL+S++NPP YRETT  +Y+ HF  KGL
Sbjct  302   LANYVGPRISVASFFCT--GMLPSTKLYGPIKELLSEDNPPKYRETTVRDYVAHFNDKGL  359

Query  1114  DGTSGLLRFRL  1146
             DGTS L  F+L
Sbjct  360   DGTSALXDFKL  370



>ref|XP_002529305.1| Desacetoxyvindoline 4-hydroxylase, putative [Ricinus communis]
 gb|EEF33074.1| Desacetoxyvindoline 4-hydroxylase, putative [Ricinus communis]
Length=363

 Score =   424 bits (1090),  Expect = 4e-142, Method: Compositional matrix adjust.
 Identities = 206/364 (57%), Positives = 265/364 (73%), Gaps = 7/364 (2%)
 Frame = +1

Query  55    GDYDRKSELKAFDDMKTGVKGHVDSGIMKIPRIFIHDeikkeekeklkPAMASTYKVPII  234
              +Y R SELKAFDD K GVKG VD+GI+++PRIF       +        M   +  P I
Sbjct  7     SEYCRTSELKAFDDTKAGVKGLVDAGIIEVPRIFHLSSDHLDNISHTVDPM---FNFPRI  63

Query  235   DMEGLHTDHTTRRSEIIKEIRDACQTWGFFQIINHGIPTQVLDEMIDGVRQFHELDSEVK  414
             D+EG++ D   R+ EI+ ++R A +TWGFF+++NHGIP  VL+EM +GV++FHE D E+K
Sbjct  64    DLEGVNKDSILRK-EIVDKVRHASETWGFFEVVNHGIPVSVLEEMKEGVKRFHEQDVELK  122

Query  415   KQFYSRDLTRKVVYNTNFDFHTSPAATWRDTLYFIMAPHPPTPQELPQVCRDILIKYSNS  594
             K+FYSRD T+KV+YN+NFD ++SP A WRD+++F M P PP P+ELP  CRDIL++YS  
Sbjct  123   KEFYSRDYTKKVLYNSNFDLYSSPFANWRDSIFFQMIPDPPKPEELPAACRDILMEYSKE  182

Query  595   VQKLGLCLLELFSESLGLHKNHLEKLGCAVGLSIFGQYYPACPEPELTFALRDHSDSGFF  774
             V+KLG  LLELFSE+LGL  NHL+ + C  GL I G YYPAC +PE+T     H+DS FF
Sbjct  183   VRKLGDLLLELFSEALGLSPNHLKDMECNEGLLIVGNYYPACRQPEITLGASGHADSDFF  242

Query  775   TVLNQDTQIGGLQVLHENQWVDVPPLHGALVVNVADLLQLITNDKFKSVVHRVIAQKIAP  954
             TVL QD  IGGLQVLH+N+W++VP    ALVVN+ DL+QLITNDKF SV HRV+A  + P
Sbjct  243   TVLLQD-HIGGLQVLHQNEWINVPSTPDALVVNIGDLIQLITNDKFISVEHRVLANCVGP  301

Query  955   RVSVASFFRTIPGDVDAKKVYGPIKELVSDENPPLYRETTTEEYLMHFQKKGLDGTSGLL  1134
             R+SVASFF T    +   ++YGPIKEL+S+ENPP YRETT  EY  H++ KGLDGTS LL
Sbjct  302   RISVASFFTTTL--ISTSRLYGPIKELLSEENPPKYRETTVREYSDHYKGKGLDGTSALL  359

Query  1135  RFRL  1146
              F+L
Sbjct  360   HFKL  363



>ref|XP_004246497.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1-like [Solanum lycopersicum]
Length=370

 Score =   424 bits (1091),  Expect = 4e-142, Method: Compositional matrix adjust.
 Identities = 200/362 (55%), Positives = 261/362 (72%), Gaps = 8/362 (2%)
 Frame = +1

Query  61    YDRKSELKAFDDMKTGVKGHVDSGIMKIPRIFIHDeikkeekeklkPAMASTYKVPIIDM  240
             YDRK+EL+AFD+ KTGVKG VD+GI K+PR+F+     ++            +  PIID+
Sbjct  17    YDRKAELQAFDETKTGVKGLVDTGITKVPRMFVQPSRIEDSTIHSN----KKFSFPIIDL  72

Query  241   EGLHTDHTTRRSEIIKEIRDACQTWGFFQIINHGIPTQVLDEMIDGVRQFHELDSEVKKQ  420
             +G+  +++ +R  I++E+  A +TWGFFQ+INHGIP+ +L+EM DGV  F E D+E KKQ
Sbjct  73    DGIK-ENSIKRKNIVQEVGQASETWGFFQVINHGIPSHLLEEMKDGVLSFFEQDTEEKKQ  131

Query  421   FYSRDLTRKVVYNTNFDFHTSPAATWRDTLYFIMAPHPPTPQELPQVCRDILIKYSNSVQ  600
             +Y+RDLT+   +N+NFD   +P   WRDT     AP PP P+ELP VCRD+L++Y+N V 
Sbjct  132   WYTRDLTKVFTFNSNFDLFGAPVTNWRDTFTATTAPIPPKPEELPSVCRDVLLEYTNQVM  191

Query  601   KLGLCLLELFSESLGLHKNHLEKLGCAVGLSIFGQYYPACPEPELTFALRDHSDSGFFTV  780
             KLG  L E+ +E++GL  NHL+ +GCA GL   G YYPACP+PELT     H+D+ F TV
Sbjct  192   KLGDTLFEILAEAIGLEPNHLKDMGCAEGLMALGHYYPACPQPELTLGTSKHADNDFLTV  251

Query  781   LNQDTQIGGLQVLHENQWVDVPPLHGALVVNVADLLQLITNDKFKSVVHRVIAQKIAPRV  960
             L QD  +GGLQVLH+N WVDVPP  GALVVN+ D+LQLITNDKFKSV HRV+A K+ PRV
Sbjct  252   LLQD-NVGGLQVLHQNHWVDVPPTPGALVVNIGDILQLITNDKFKSVDHRVLANKVGPRV  310

Query  961   SVASFFRTIPGDVDAKKVYGPIKELVSDENPPLYRETTTEEYLMHFQKKGLDGTSGLLRF  1140
             S+A FF T    V  +++YGPIKEL+S++NPP YRETT +E+  HF  KGLDGTS LL F
Sbjct  311   SLACFFMT--NFVATQRLYGPIKELISEQNPPNYRETTIKEFTTHFNNKGLDGTSTLLHF  368

Query  1141  RL  1146
             RL
Sbjct  369   RL  370



>ref|XP_002315713.1| hypothetical protein POPTR_0010s08410g [Populus trichocarpa]
 gb|EEF01884.1| hypothetical protein POPTR_0010s08410g [Populus trichocarpa]
Length=379

 Score =   424 bits (1091),  Expect = 5e-142, Method: Compositional matrix adjust.
 Identities = 205/369 (56%), Positives = 266/369 (72%), Gaps = 13/369 (4%)
 Frame = +1

Query  61    YDRKSELKAFDDMKTGVKGHVDSGIMKIPRIFIHDeikkeekeklkPAMASTYKVPIIDM  240
             YDR SELKAFD+ K GVKG VD+G+ K+P+IFIH   + E +        +   V +ID+
Sbjct  17    YDRGSELKAFDETKAGVKGLVDAGVSKVPQIFIHPSERLEHRTLS--TSKNPVNVTVIDL  74

Query  241   EGLHTDHTTRRSEIIKEIRDACQTWGFFQIINHGIPTQVLDEMIDGVRQFHELDSEVKKQ  420
             E +  D   RR  I+ ++RDA +TWGFFQ++NHGIP  VL+EM  GVR+F E D EVKK+
Sbjct  75    EAIDKD-PIRRKGIVDKVRDASETWGFFQVVNHGIPVGVLEEMDAGVRRFFEQDVEVKKK  133

Query  421   FYSRDLTRKVVYNTNFDFHTSPAATWRDTLYFIMAPHPPTPQELPQVCRDILIKYSNSVQ  600
             FY+RD+T++ VYN+NFD HT+P A WRDT +  MAP+PP P+ELP  CRDI++++S  V 
Sbjct  134   FYTRDVTKRFVYNSNFDLHTAPVANWRDTFFSYMAPYPPKPEELPGACRDIMMEFSKQVT  193

Query  601   KLGLCLLELFSESLGLHKNHLEKLGCAVGLSIFGQYYPACPEPELTFALRDHSDSGFFTV  780
              LG+ L  L SE+LGL  +HLEK+ CA GL++   YYPACPEPELT     HSD+ F TV
Sbjct  194   SLGISLFGLLSEALGLKTDHLEKMDCAEGLALISHYYPACPEPELTLGTSKHSDNDFLTV  253

Query  781   LNQDTQIGGLQVLHENQWVDVPPLHGALVVNVADLLQ-------LITNDKFKSVVHRVIA  939
             L QD QIGGLQ+LH++QWVD+PP+ GALV+N+ DL+Q       LI+NDKFKSV HRV+A
Sbjct  254   LLQD-QIGGLQMLHQDQWVDIPPVPGALVINIGDLMQASFSFISLISNDKFKSVEHRVLA  312

Query  940   QKIAPRVSVASFFRTIPGDVDAKKVYGPIKELVSDENPPLYRETTTEEYLMHFQKKGLDG  1119
              ++ PR+SVA FF T      + K+YGPIKEL+S+ NPP+YRETT  EYL +F   GLDG
Sbjct  313   NRVGPRISVACFFST--SFQPSSKLYGPIKELLSEYNPPIYRETTVNEYLSYFYDHGLDG  370

Query  1120  TSGLLRFRL  1146
             TS L+ F+L
Sbjct  371   TSPLIHFKL  379



>ref|NP_001241230.1| uncharacterized protein LOC100790198 [Glycine max]
 gb|ACU24062.1| unknown [Glycine max]
Length=375

 Score =   423 bits (1088),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 201/363 (55%), Positives = 261/363 (72%), Gaps = 7/363 (2%)
 Frame = +1

Query  61    YDRKSELKAFDDMKTGVKGHVDSGIMKIPRIFIHDeikkeekeklkPAMASTYKVPIIDM  240
             YDRK+E+KAFDD K GVKG V+SG+ KIPR+F                  S + +PIID+
Sbjct  19    YDRKAEVKAFDDSKAGVKGLVESGLTKIPRMF----HSGRLDIIETSVSDSKFGIPIIDL  74

Query  241   EGLHTDHTTRRSEIIKEIRDACQTWGFFQIINHGIPTQVLDEMIDGVRQFHELDSEVKKQ  420
             + +H+ +    SE+I ++R AC  WGFFQ+INHGIP  VLDEMIDG+R+FHE D++V+K+
Sbjct  75    QNIHS-YPALHSEVIGKVRSACHDWGFFQVINHGIPISVLDEMIDGIRRFHEQDTKVRKE  133

Query  421   FYSRDLTRKVVYNTNFDFHTSPAATWRDTLYFIMAPHPPTPQELPQVCRDILIKYSNSVQ  600
             FYSRD+ +KV Y +N++ +    A WRDT  F++AP PP P+E+  VCRDI+I+YS  ++
Sbjct  134   FYSRDIKKKVSYYSNYNLYHDNPANWRDTFGFVVAPDPPKPEEISSVCRDIVIEYSKKIR  193

Query  601   KLGLCLLELFSESLGLHKNHLEKLGCAVGLSIFGQYYPACPEPELTFALRDHSDSGFFTV  780
              LG  + EL SE+LGL+ ++L++  C  GL I G YYP CPEP LT     H+DS F T+
Sbjct  194   DLGFTIFELLSEALGLNPSYLKEFNCGEGLFILGHYYPTCPEPGLTMGTTKHTDSNFMTL  253

Query  781   LNQDTQIGGLQVLHENQWVDVPPLHGALVVNVADLLQLITNDKFKSVVHRVIAQKIAPRV  960
             L QD QIGGLQVLH+NQWV+VPPLHGALVVN+ DLLQLITNDKF SV HRV++Q   PR+
Sbjct  254   LLQD-QIGGLQVLHQNQWVNVPPLHGALVVNIGDLLQLITNDKFVSVYHRVLSQNTGPRI  312

Query  961   SVASFFRTIPGDVDA-KKVYGPIKELVSDENPPLYRETTTEEYLMHFQKKGLDGTSGLLR  1137
             SVASFF       +   KVYGPIKEL+S+ENPP+YR+TT +E+L ++  KGLDG S L  
Sbjct  313   SVASFFVNSHDPAEGTSKVYGPIKELLSEENPPIYRDTTLKEFLAYYYAKGLDGNSSLGP  372

Query  1138  FRL  1146
             FRL
Sbjct  373   FRL  375



>gb|KHN28456.1| 1-aminocyclopropane-1-carboxylate oxidase like 12 [Glycine soja]
Length=373

 Score =   422 bits (1086),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 201/363 (55%), Positives = 261/363 (72%), Gaps = 7/363 (2%)
 Frame = +1

Query  61    YDRKSELKAFDDMKTGVKGHVDSGIMKIPRIFIHDeikkeekeklkPAMASTYKVPIIDM  240
             YDRK+E+KAFDD K GVKG V+SG+ KIPR+F                  S + +PIID+
Sbjct  17    YDRKAEVKAFDDSKAGVKGLVESGLTKIPRMF----HSGRLDIIETSVSDSKFGIPIIDL  72

Query  241   EGLHTDHTTRRSEIIKEIRDACQTWGFFQIINHGIPTQVLDEMIDGVRQFHELDSEVKKQ  420
             + +H+ +    SE+I ++R AC  WGFFQ+INHGIP  VLDEMIDG+R+FHE D++V+K+
Sbjct  73    QNIHS-YPALHSEVIGKVRSACHDWGFFQVINHGIPISVLDEMIDGIRRFHEQDTKVRKE  131

Query  421   FYSRDLTRKVVYNTNFDFHTSPAATWRDTLYFIMAPHPPTPQELPQVCRDILIKYSNSVQ  600
             FYSRD+ +KV Y +N++ +    A WRDT  F++AP PP P+E+  VCRDI+I+YS  ++
Sbjct  132   FYSRDIKKKVSYYSNYNLYHDNPANWRDTFGFVVAPDPPKPEEISSVCRDIVIEYSKKIR  191

Query  601   KLGLCLLELFSESLGLHKNHLEKLGCAVGLSIFGQYYPACPEPELTFALRDHSDSGFFTV  780
              LG  + EL SE+LGL+ ++L++  C  GL I G YYP CPEP LT     H+DS F T+
Sbjct  192   DLGFTIFELLSEALGLNPSYLKEFNCGEGLFILGHYYPTCPEPGLTMGTTKHTDSNFMTL  251

Query  781   LNQDTQIGGLQVLHENQWVDVPPLHGALVVNVADLLQLITNDKFKSVVHRVIAQKIAPRV  960
             L QD QIGGLQVLH+NQWV+VPPLHGALVVN+ DLLQLITNDKF SV HRV++Q   PR+
Sbjct  252   LLQD-QIGGLQVLHQNQWVNVPPLHGALVVNIGDLLQLITNDKFVSVYHRVLSQNTGPRI  310

Query  961   SVASFFRTIPGDVDA-KKVYGPIKELVSDENPPLYRETTTEEYLMHFQKKGLDGTSGLLR  1137
             SVASFF       +   KVYGPIKEL+S+ENPP+YR+TT +E+L ++  KGLDG S L  
Sbjct  311   SVASFFVNSHDPAEGTSKVYGPIKELLSEENPPIYRDTTLKEFLSYYYAKGLDGNSSLGP  370

Query  1138  FRL  1146
             FRL
Sbjct  371   FRL  373



>ref|XP_002529304.1| Desacetoxyvindoline 4-hydroxylase, putative [Ricinus communis]
 gb|EEF33073.1| Desacetoxyvindoline 4-hydroxylase, putative [Ricinus communis]
Length=363

 Score =   422 bits (1084),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 209/363 (58%), Positives = 259/363 (71%), Gaps = 7/363 (2%)
 Frame = +1

Query  58    DYDRKSELKAFDDMKTGVKGHVDSGIMKIPRIFIHDeikkeekeklkPAMASTYKVPIID  237
             +Y R SELKAFDD K GVKG VD+GI KIPRIF       +  EK  P   + ++ P+ID
Sbjct  8     EYCRSSELKAFDDTKAGVKGLVDAGITKIPRIFYQ---SPDSLEKNSPTPDTKFRFPVID  64

Query  238   MEGLHTDHTTRRSEIIKEIRDACQTWGFFQIINHGIPTQVLDEMIDGVRQFHELDSEVKK  417
             ++ +  D    R EI+  +R+A +TWGFFQ++NHGIP  VL+EM DG+ +F E D+E+KK
Sbjct  65    LKDVE-DGAVSRKEIVDGVRNASETWGFFQVVNHGIPASVLEEMKDGLLKFFEQDTELKK  123

Query  418   QFYSRDLTRKVVYNTNFDFHTSPAATWRDTLYFIMAPHPPTPQELPQVCRDILIKYSNSV  597
              FYSRDLT+KV YN+NFD +++PAA WRDT+ F M P PP P+E+P   R IL++YS  V
Sbjct  124   GFYSRDLTKKVGYNSNFDLYSAPAANWRDTIAFQMVPDPPKPEEMPAAFRHILVEYSKEV  183

Query  598   QKLGLCLLELFSESLGLHKNHLEKLGCAVGLSIFGQYYPACPEPELTFALRDHSDSGFFT  777
             +KLG  L +L SE+LGL  NHL+ + C  GL I G YYPACPEPELT     H+D+ F T
Sbjct  184   RKLGSVLFDLLSEALGLKPNHLKDMDCDKGLFILGHYYPACPEPELTLGTSKHADNDFLT  243

Query  778   VLNQDTQIGGLQVLHENQWVDVPPLHGALVVNVADLLQLITNDKFKSVVHRVIAQKIAPR  957
             VL QD  IGGLQVLH+NQW DVPP  GALVVN+ DLLQLI+NDKF S  HRV+A    PR
Sbjct  244   VLLQD-DIGGLQVLHQNQWTDVPPTPGALVVNIGDLLQLISNDKFISAEHRVLANYKGPR  302

Query  958   VSVASFFRTIPGDVDAKKVYGPIKELVSDENPPLYRETTTEEYLMHFQKKGLDGTSGLLR  1137
             VSVA FF T    V   ++YGPIKEL+S+ENPP YRETT +E++ HF  KGLDGTS LL 
Sbjct  303   VSVACFFSTALFPV--SRLYGPIKELLSEENPPKYRETTVKEFVSHFNAKGLDGTSALLH  360

Query  1138  FRL  1146
             F+L
Sbjct  361   FKL  363



>ref|XP_008224381.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1-like [Prunus mume]
Length=370

 Score =   422 bits (1084),  Expect = 4e-141, Method: Compositional matrix adjust.
 Identities = 204/363 (56%), Positives = 263/363 (72%), Gaps = 4/363 (1%)
 Frame = +1

Query  58    DYDRKSELKAFDDMKTGVKGHVDSGIMKIPRIFIHDeikkeekeklkPAMASTYKVPIID  237
             +YDRK EL+AFDD K GVKG VD+GI  +P IF H    +        + A+ + VP+ID
Sbjct  12    NYDRKRELRAFDDTKEGVKGLVDAGITVVPIIF-HQPPDQYSTNNNFDSEATQFSVPVID  70

Query  238   MEGLHTDHTTRRSEIIKEIRDACQTWGFFQIINHGIPTQVLDEMIDGVRQFHELDSEVKK  417
             +EGL  D  T+R EI+ ++ +A +TWGFFQI+NHGIP  VL E+ DGVR F+E D++VKK
Sbjct  71    LEGLEFDRPTKRKEIVTKVGEASETWGFFQIVNHGIPIDVLGEIKDGVRGFYEQDTQVKK  130

Query  418   QFYSRDLTRKVVYNTNFDFHTSPAATWRDTLYFIMAPHPPTPQELPQVCRDILIKYSNSV  597
             QFY+RD  + VVYN+NFD H +PA  WRD+    MAP+P  P+++P+V RDILI+YS  V
Sbjct  131   QFYTRDHFKPVVYNSNFDLHRAPATNWRDSFMCYMAPNPTEPEDMPEVFRDILIEYSKQV  190

Query  598   QKLGLCLLELFSESLGLHKNHLEKLGCAVGLSIFGQYYPACPEPELTFALRDHSDSGFFT  777
              KLG  L EL SE+LGL  +HL  + C++GL   G YYP+CP+PELT     H+D+ F T
Sbjct  191   MKLGKLLFELLSEALGLKPSHLNDIDCSLGLVHVGHYYPSCPQPELTLGTSKHADNDFIT  250

Query  778   VLNQDTQIGGLQVLHENQWVDVPPLHGALVVNVADLLQLITNDKFKSVVHRVIAQKIAPR  957
             VL QD  IGGLQVLH+N+W+DVPP+ GALVVN+ DLLQLI+N++FKSV HRV+A ++ PR
Sbjct  251   VLLQD-HIGGLQVLHQNKWIDVPPVPGALVVNIGDLLQLISNERFKSVEHRVLANRVGPR  309

Query  958   VSVASFFRTIPGDVDAKKVYGPIKELVSDENPPLYRETTTEEYLMHFQKKGLDGTSGLLR  1137
             VSVASFF T  G +   ++YGPIKEL+S++NPP YRETT  EY  +F  KGLDGTS L  
Sbjct  310   VSVASFFST--GMLPLGRLYGPIKELLSEDNPPKYRETTIREYNAYFIDKGLDGTSALTH  367

Query  1138  FRL  1146
             F L
Sbjct  368   FEL  370



>ref|XP_007035064.1| 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily 
protein, putative isoform 1 [Theobroma cacao]
 gb|EOY05990.1| 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily 
protein, putative isoform 1 [Theobroma cacao]
Length=369

 Score =   421 bits (1083),  Expect = 5e-141, Method: Compositional matrix adjust.
 Identities = 206/376 (55%), Positives = 265/376 (70%), Gaps = 7/376 (2%)
 Frame = +1

Query  19    MATASTGGKADSGDYDRKSELKAFDDMKTGVKGHVDSGIMKIPRIFIHDeikkeekeklk  198
             M  A      D  +YDRK ELKAFDD K GVKG VD+G+ K+PR+FI       +     
Sbjct  1     MVVAGGVEVCDDSNYDRKRELKAFDDSKAGVKGLVDAGVTKVPRMFIRPPDNLRDASD--  58

Query  199   PAMASTYKVPIIDMEGLHTDHTTRRSEIIKEIRDACQTWGFFQIINHGIPTQVLDEMIDG  378
                   + +P+ID+EG+  ++  RR EII E+R A +TWGFFQ++NHGIP+ +L+EM DG
Sbjct  59    -TKKIQFSIPVIDLEGIE-NNPVRRKEIIDEVRHASETWGFFQVVNHGIPSSILEEMKDG  116

Query  379   VRQFHELDSEVKKQFYSRDLTRKVVYNTNFDFHTSPAATWRDTLYFIMAPHPPTPQELPQ  558
             V++F E D EVKK+FY+RD  R+  Y +NFD +TSP A WRDT + +MAP PP P+ELP 
Sbjct  117   VQRFFEQDIEVKKEFYARDRVRRYRYTSNFDLYTSPFANWRDTCFCVMAPDPPKPEELPA  176

Query  559   VCRDILIKYSNSVQKLGLCLLELFSESLGLHKNHLEKLGCAVGLSIFGQYYPACPEPELT  738
             V RDI ++Y   V +LG  L +L SE+LGL  +HLE++GCA GLS    YYP CPEPELT
Sbjct  177   VLRDIQLEYRKQVIRLGSSLFKLLSEALGLKPSHLEEMGCAEGLSALCHYYPPCPEPELT  236

Query  739   FALRDHSDSGFFTVLNQDTQIGGLQVLHENQWVDVPPLHGALVVNVADLLQLITNDKFKS  918
                  HSD+ F TVL QD QIGGLQVLH++QWVDVPP+ GALVVN+ DLLQLITNDKFKS
Sbjct  237   LGTSKHSDNDFLTVLLQD-QIGGLQVLHQDQWVDVPPVPGALVVNIGDLLQLITNDKFKS  295

Query  919   VVHRVIAQKIAPRVSVASFFRTIPGDVDAKKVYGPIKELVSDENPPLYRETTTEEYLMHF  1098
             V HRV+A +  PR+SVA FF T  G + + ++YGPI+EL+ + NPP+YRETT  +++ + 
Sbjct  296   VEHRVLANREGPRISVACFFTT--GLLPSSRLYGPIEELLLENNPPIYRETTVRDFVSYI  353

Query  1099  QKKGLDGTSGLLRFRL  1146
              + GLDGTS L  FRL
Sbjct  354   YEHGLDGTSPLHLFRL  369



>ref|XP_002529299.1| Desacetoxyvindoline 4-hydroxylase, putative [Ricinus communis]
 gb|EEF33068.1| Desacetoxyvindoline 4-hydroxylase, putative [Ricinus communis]
Length=652

 Score =   431 bits (1108),  Expect = 7e-141, Method: Compositional matrix adjust.
 Identities = 215/362 (59%), Positives = 272/362 (75%), Gaps = 7/362 (2%)
 Frame = +1

Query  61    YDRKSELKAFDDMKTGVKGHVDSGIMKIPRIFIHDeikkeekeklkPAMASTYKVPIIDM  240
             YDRKSELK FDD K GVKG VD+G+ KIPRIFIHD+I     E         + +PIID+
Sbjct  14    YDRKSELKIFDDTKAGVKGLVDAGVTKIPRIFIHDKITDTPFEGN-----DKHTIPIIDL  68

Query  241   EGLHTDHTTRRSEIIKEIRDACQTWGFFQIINHGIPTQVLDEMIDGVRQFHELDSEVKKQ  420
             +G+  D + RR E+I ++R+AC+ WGFFQ+INHGIP  V+DEMIDG+R+FHE ++EVKK 
Sbjct  69    KGIDKDPSLRR-EVIDKLREACEKWGFFQLINHGIPATVMDEMIDGMRRFHEQETEVKKH  127

Query  421   FYSRDLTRKVVYNTNFDFHTSPAATWRDTLYFIMAPHPPTPQELPQVCRDILIKYSNSVQ  600
             F++RD TRKV+YNTNFDF+ + AA WRD+LY  MAP+PP P+ELP VCRDI++ YSN V 
Sbjct  128   FFTRDETRKVIYNTNFDFYQAKAANWRDSLYCSMAPNPPNPEELPPVCRDIMMDYSNKVM  187

Query  601   KLGLCLLELFSESLGLHKNHLEKLGCAVGLSIFGQYYPACPEPELTFALRDHSDSGFFTV  780
              LGL L EL SE+LGL  NHL+ +GCA GL   G YYPACPEP LT     H+DS F T+
Sbjct  188   SLGLKLFELLSEALGLRPNHLKDMGCAEGLYFIGHYYPACPEPGLTLGATKHTDSAFLTI  247

Query  781   LNQDTQIGGLQVLHENQWVDVPPLHGALVVNVADLLQLITNDKFKSVVHRVIAQKIAPRV  960
             L QD  +GGLQVLHE+QW DV P+ G LVVN+ DL QLI+NDKFKSV HRV+A+ + PR+
Sbjct  248   LLQDI-LGGLQVLHEDQWFDVTPVAGGLVVNLGDLSQLISNDKFKSVYHRVLAKDVGPRI  306

Query  961   SVASFFRTIPGDVDAKKVYGPIKELVSDENPPLYRETTTEEYLMHFQKKGLDGTSGLLRF  1140
             S+A FFRT   +  + +++ PIK+L+S +NPP+YRETT EEY+     KGLDGTSGL+ F
Sbjct  307   SIACFFRTHFAERTSSRIFAPIKQLLSKDNPPVYRETTMEEYVTRIYSKGLDGTSGLMYF  366

Query  1141  RL  1146
             +L
Sbjct  367   KL  368


 Score =   295 bits (755),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 144/286 (50%), Positives = 198/286 (69%), Gaps = 12/286 (4%)
 Frame = +1

Query  223   VPIIDMEGLHTDHTTRRSEIIKEIRDACQTWGFFQIINHGIPTQVLDEMIDGVRQFHELD  402
             +P+ID++GL TD   +R +I+ ++R+A + WGFF ++NHGIP+ +L  MID VR+F+E D
Sbjct  373   LPVIDLDGLLTD---QRRKIVDQVRNASEEWGFFHVVNHGIPSSLLSNMIDAVRKFNEQD  429

Query  403   SEVKKQFYSRDLTRKVVYNTNFDFHTSPAATWRDTLYFIMAPHPPT-PQELPQVCRDILI  579
              +VKK+FYSRD +R+V +N+N+D   S  A WRDTL   M       P ELP +CRD  +
Sbjct  430   IDVKKEFYSRDTSRRVRFNSNYDLFQSERADWRDTLSVSMLRSDHIDPNELPAICRDEAL  489

Query  580   KYSNSVQKLGLCLLELFSESLGLHKNHLEKLGCAVGLSIFGQYYPACPEPELTFALRDHS  759
             ++   + K+G  L EL SE+LGL  NHL  + C  G ++   YYPACPEPEL   +  H+
Sbjct  490   EFIEQIGKIGDTLFELLSEALGLKPNHLNSIECHKGRTLVCHYYPACPEPELAMGVTKHT  549

Query  760   DSGFFTVLNQDTQIGGLQVLHENQWVDVPPLHGALVVNVADLLQLITNDKFKSVVHRVIA  939
             D+ F TVL +D + GGLQVLH+NQWVDV P+ G+LVVN+ DLLQ+++NDKFKS VHRV+ 
Sbjct  550   DNTFLTVLVED-ETGGLQVLHDNQWVDVQPIPGSLVVNIGDLLQIVSNDKFKSNVHRVLP  608

Query  940   QKIAPRVSVASFF--RTIPGDVDAKKVYGPIKELVSDENPPLYRET  1071
              K+ PR+SV  FF  R  P      ++YGPIKEL+S+ENP  Y+E 
Sbjct  609   SKV-PRISVIGFFAGRVAP----PARLYGPIKELLSEENPAKYKEV  649



>ref|XP_006586237.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
12-like [Glycine max]
Length=379

 Score =   421 bits (1081),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 201/367 (55%), Positives = 263/367 (72%), Gaps = 9/367 (2%)
 Frame = +1

Query  61    YDRKSELKAFDDMKTGVKGHVDSGIMKIPRIFIHDeikkeekeklkPAMASTYKVPIIDM  240
             YDRK+E+KAFDD K GVKG V+SG+ KIPR+F     K +          S   +PIID 
Sbjct  17    YDRKAEVKAFDDSKAGVKGLVESGVTKIPRMF--HSGKLDLDIIETSGGDSKLIIPIIDF  74

Query  241   EGLHTDHTTRRSEIIKEIRDACQTWGFFQIINHGIPTQVLDEMIDGVRQFHELDSEVKKQ  420
             + +H++    RSE+I +IR AC  WGFFQ+INHGIP  VLDEMIDG+R+FHE D+E +K+
Sbjct  75    KDIHSN-PALRSEVIGKIRSACHEWGFFQVINHGIPISVLDEMIDGIRRFHEQDTEARKE  133

Query  421   FYSRDLTRKVVYNTNFDFHTSPAATWRDTLYFIMAPHPPTPQELPQVCRDILIKYSNSVQ  600
             FY+RD  +KVVY +N   H+     WRDT+ F ++P PP P+ +P VCRDI+I+Y+  ++
Sbjct  134   FYTRDSKKKVVYFSNLGLHSGNPVNWRDTIGFAVSPDPPKPEHIPSVCRDIVIEYTKKIR  193

Query  601   KLGLCLLELFSESLGLHKNHLEKLGCAVGLSIFGQYYPACPEPELTFALRDHSDSGFFTV  780
              +G  + EL SE+LGL+ ++L +L C  GL   G YYPACPEPELT     H+D  F T+
Sbjct  194   DVGFTIFELLSEALGLNSSYLNELSCGEGLFTVGNYYPACPEPELTMGAAKHTDGNFMTL  253

Query  781   LNQDTQIGGLQVLHENQWVDVPPLHGALVVNVADLLQLITNDKFKSVVHRVIAQKIAPRV  960
             L QD QIGGLQVLH+NQWV++PP+HGALVVNV DLLQLITNDKF SV HRV+++K  PR+
Sbjct  254   LLQD-QIGGLQVLHQNQWVNLPPVHGALVVNVGDLLQLITNDKFVSVCHRVLSKKTCPRI  312

Query  961   SVASFFRTIPGDVD-----AKKVYGPIKELVSDENPPLYRETTTEEYLMHFQKKGLDGTS  1125
             SVASFF T  G  D      +K+YGPIKEL+S+ENPP+YR+TT ++++ ++  K LDG S
Sbjct  313   SVASFFGTFFGHSDDPVEGLQKLYGPIKELISEENPPIYRDTTIKDFVAYYYAKALDGKS  372

Query  1126  GLLRFRL  1146
              L RFRL
Sbjct  373   SLNRFRL  379



>ref|XP_011091186.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1-like [Sesamum indicum]
Length=374

 Score =   420 bits (1080),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 208/369 (56%), Positives = 268/369 (73%), Gaps = 10/369 (3%)
 Frame = +1

Query  46    ADSGDYDRKSELKAFDDMKTGVKGHVDSGIMKIPRIFIHDeikkeekeklkPAMASTYKV  225
             A   +YDR+SELKAFDD K GVKG VD+GI ++PRIF H     E          S ++ 
Sbjct  14    ATEPNYDRQSELKAFDDTKAGVKGLVDAGITRVPRIFHHPPQNLENI-----TKKSEFRF  68

Query  226   PIIDMEGLHTDHTTRRSEIIKEIRDACQTWGFFQIINHGIPTQVLDEMIDGVRQFHELDS  405
             P+ID++G++ D   +R EII  I DA +TWGFFQ+INHGI    L+EM+DGVR+FHE D+
Sbjct  69    PVIDLDGVNHD-CLKRKEIIDRILDASETWGFFQVINHGIDVSTLEEMVDGVRRFHE-DT  126

Query  406   EVKKQFYSRDLTRKVVYNTNFDFHTSPAATWRDTLYFIMAPHPPTPQELPQVCRDILIKY  585
             E KKQ++SRD T+K++YN+NFD  +SPAA+WRD+   IMAP PP P ELP  CR+IL+KY
Sbjct  127   ETKKQYHSRDFTKKMIYNSNFDLFSSPAASWRDSFNCIMAPDPPQPDELPSSCREILMKY  186

Query  586   SNSVQKLGLCLLELFSESLGLHKNHLEKLGCAVGLSIFGQYYPACPEPELTFALRDHSDS  765
             S+ V +LG+ L +L SE+LGLH +HL  + CA  L++FG YYP CPEP+LT     HSD 
Sbjct  187   SDQVMELGITLFKLLSEALGLHPDHLIDIDCAQTLAVFGHYYPPCPEPQLTLGTPKHSDY  246

Query  766   GFFTVLNQDTQIGGLQVLHENQWVDVPPLHGALVVNVADLLQLITNDKFKSVVHRVIAQK  945
             GF TVL QD  +GGLQVLH+NQWVDVPPL GALVVN+ADLLQLI+NDK KSV HRV+  +
Sbjct  247   GFLTVLLQDN-LGGLQVLHQNQWVDVPPLPGALVVNIADLLQLISNDKLKSVEHRVLVSR  305

Query  946   IAPRVSVASFFRTIPGDVDAKKVYGPIKELVSDENPPLYRETTTEEYLMHFQKKGLDG-T  1122
               PR+SVA+FF      V++++ YGPIKEL+SD+NPP YR TT + Y  + + +G+DG T
Sbjct  306   SGPRISVAAFFGRDTCGVNSRE-YGPIKELLSDKNPPKYRPTTIKGYTSYVRARGVDGRT  364

Query  1123  SGLLRFRLQ  1149
             S L   +LQ
Sbjct  365   SALQSLQLQ  373



>ref|XP_002315712.2| hypothetical protein POPTR_0010s08390g [Populus trichocarpa]
 gb|EEF01883.2| hypothetical protein POPTR_0010s08390g [Populus trichocarpa]
Length=364

 Score =   420 bits (1079),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 207/362 (57%), Positives = 265/362 (73%), Gaps = 6/362 (2%)
 Frame = +1

Query  61    YDRKSELKAFDDMKTGVKGHVDSGIMKIPRIFIHDeikkeekeklkPAMASTYKVPIIDM  240
             YDR SELKAFDD K GVKG VD+GI K+PRIF H  ++ +    L  A    +++P+ID+
Sbjct  9     YDRISELKAFDDTKAGVKGLVDAGITKVPRIFHH--LRDDSDNTLLVAAEGKFRIPMIDL  66

Query  241   EGLHTDHTTRRSEIIKEIRDACQTWGFFQIINHGIPTQVLDEMIDGVRQFHELDSEVKKQ  420
             E +H     +R EI+  +R+A +TWGFF+++NHGIP  VL+EM DGVR+F+E D E+KK+
Sbjct  67    EDVHKG-PPQRKEIVDRVRNASETWGFFEVVNHGIPVDVLEEMKDGVRRFYEQDVELKKE  125

Query  421   FYSRDLTRKVVYNTNFDFHTSPAATWRDTLYFIMAPHPPTPQELPQVCRDILIKYSNSVQ  600
             ++SRD TRKV YN+NFD  +SP+A WRDT   +MAP  P P+ELP   RDILI+Y+  V 
Sbjct  126   YFSRDHTRKVGYNSNFDLFSSPSANWRDTFTCVMAPISPRPEELPAAFRDILIEYTKEVM  185

Query  601   KLGLCLLELFSESLGLHKNHLEKLGCAVGLSIFGQYYPACPEPELTFALRDHSDSGFFTV  780
             KLG  L EL SE+LGL+ NHL+ + C+ GL+I G YYPACP+PELT     HSD+ F TV
Sbjct  186   KLGNSLFELLSEALGLNPNHLKDIDCSKGLTILGHYYPACPQPELTLGTTKHSDNDFLTV  245

Query  781   LNQDTQIGGLQVLHENQWVDVPPLHGALVVNVADLLQLITNDKFKSVVHRVIAQKIAPRV  960
             L QD  IGGLQV+++N WVDVPP  GAL++N+ DLLQLI+NDKF SV HRV+A +I PRV
Sbjct  246   LLQD-HIGGLQVMYQNHWVDVPPTPGALLINIGDLLQLISNDKFISVEHRVLANRIGPRV  304

Query  961   SVASFFRTIPGDVDAKKVYGPIKELVSDENPPLYRETTTEEYLMHFQKKGLDGTSGLLRF  1140
             SVASFF T        + YGPIKEL+S+E+PP YRETT  +Y+ +F  KGLDGTS LL F
Sbjct  305   SVASFFSTNLN--PNSRPYGPIKELLSEESPPKYRETTVRDYVAYFIHKGLDGTSALLHF  362

Query  1141  RL  1146
             +L
Sbjct  363   KL  364



>ref|XP_008222541.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1-like [Prunus mume]
 ref|XP_008222544.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1-like [Prunus mume]
Length=411

 Score =   421 bits (1083),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 206/385 (54%), Positives = 273/385 (71%), Gaps = 9/385 (2%)
 Frame = +1

Query  4     EREREMATASTGGKADSGDYDRKSELKAFDDMKTGVKGHVDSGIMKIPRIFIH---Deik  174
             + + +M    T       +YDRKSE+K FDD K GVKG VD+GI K+PRIF H   D+  
Sbjct  32    QTQTKMVATGTNEVPSIANYDRKSEVKTFDDTKEGVKGLVDAGITKVPRIF-HLPVDQYP  90

Query  175   keekeklkPAMASTYKVPIIDMEGLHTDHT-TRRSEIIKEIRDACQTWGFFQIINHGIPT  351
                    +P   +  ++P+ID+EGL  D++ T+R E + ++ +A +TWGFFQI NHGIP 
Sbjct  91    INNTCDSEPT-KTQLRIPVIDLEGLEYDNSPTKRKETVAKVGEASETWGFFQIANHGIPV  149

Query  352   QVLDEMIDGVRQFHELDSEVKKQFYSRDLTRKVVYNTNFDFHTSPAATWRDTLYFIMAPH  531
              VL+E+ +GVR F E D+EVKK++Y+RD  R V+YN+NFD +++PA  WRDT    MAP+
Sbjct  150   DVLEEIKNGVRGFFEQDTEVKKKYYTRDRFRPVIYNSNFDLYSAPATNWRDTFLCNMAPN  209

Query  532   PPTPQELPQVCRDILIKYSNSVQKLGLCLLELFSESLGLHKNHLEKLGCAVGLSIFGQYY  711
             PP P++LPQVCRDIL++YS  V KLG  L EL SE+LGL  +HL  + C++GL I G YY
Sbjct  210   PPKPEDLPQVCRDILVEYSKQVMKLGKLLFELLSEALGLKPSHLNDMDCSLGLRILGHYY  269

Query  712   PACPEPELTFALRDHSDSGFFTVLNQDTQIGGLQVLHENQWVDVPPLHGALVVNVADLLQ  891
             P CP+PELT     H+D+ F TVL QD  IGGLQVLH+N+W+DV P+ GALVVN+ DLLQ
Sbjct  270   PPCPQPELTLGSSKHADNDFITVLLQD-HIGGLQVLHQNKWIDVLPVPGALVVNIGDLLQ  328

Query  892   LITNDKFKSVVHRVIAQKIAPRVSVASFFRTIPGDVDAKKVYGPIKELVSDENPPLYRET  1071
             LI+ND+F+SV HRV+A +  PRVSVASFF T  G +   ++YGPIKEL+S++N P YRET
Sbjct  329   LISNDRFRSVEHRVLANRACPRVSVASFFST--GFLALPRIYGPIKELLSEDNLPKYRET  386

Query  1072  TTEEYLMHFQKKGLDGTSGLLRFRL  1146
             T +++  HF  KGLDGTS L  F+L
Sbjct  387   TEKDFNSHFHNKGLDGTSALTHFKL  411



>ref|XP_003521041.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1 [Glycine max]
Length=378

 Score =   420 bits (1079),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 206/364 (57%), Positives = 263/364 (72%), Gaps = 5/364 (1%)
 Frame = +1

Query  58    DYDRKSELKAFDDMKTGVKGHVDSGIMKIPRIFIHDeikkeekeklkPAMASTYKVPIID  237
             DYDR SELKAFDD + GV G  D+G+ KIP IF H+       E    + ++   VP ID
Sbjct  18    DYDRASELKAFDDTQDGVMGLTDAGVTKIPLIF-HNPKNSHHDESDDGSGSTQLSVPSID  76

Query  238   MEGLHTDHTTRRSEIIKEIRDACQTWGFFQIINHGIPTQVLDEMIDGVRQFHELDSEVKK  417
             + G+  D  TR+  ++++IR AC+TWGFFQ++NHGIP  VL+EM  GV +F+E DSEVK+
Sbjct  77    LVGVAEDPATRKV-VVEKIRQACETWGFFQVVNHGIPLSVLEEMKSGVNRFYEQDSEVKR  135

Query  418   QFYSRDLTRKVVYNTNFDFHTSPAATWRDTLYFIMAPHPPTPQELPQVCRDILIKYSNSV  597
             + Y+RD  R +VYN+NFD  TSPAA WRDT Y  MAPHPP P++LP VCRDIL++Y+  V
Sbjct  136   ELYTRDPLRPLVYNSNFDLFTSPAANWRDTFYCFMAPHPPKPEDLPSVCRDILLEYAKEV  195

Query  598   QKLGLCLLELFSESLGLHKNHLEKLGCAVGLSIFGQYYPACPEPELTFALRDHSDSGFFT  777
             +KLG  L EL SE+L L+ N+L  +GC  GL++    YPACPEPELT     H+D+ F T
Sbjct  196   KKLGSVLFELLSEALELNPNYLNDIGCNEGLTLVCHCYPACPEPELTLGATKHTDNDFIT  255

Query  778   VLNQDTQIGGLQVLHENQWVDVPPLHGALVVNVADLLQLITNDKFKSVVHRVIAQKIAPR  957
             VL QD  IGGLQVLHEN+WVDV P+ GALV+N+ DLLQLITNDKFKSV HRV+A ++ PR
Sbjct  256   VLLQD-HIGGLQVLHENRWVDVSPVPGALVINIGDLLQLITNDKFKSVEHRVVANRVGPR  314

Query  958   VSVASFFRTIPGDVDAKKVYGPIKELVSDENPPLYRETTTEEYLMHFQKKGLDGTSGLLR  1137
             VSVASFF T      + K+YGPIK+LVS++NPP YRETT + Y+ +   +GLDGTS L  
Sbjct  315   VSVASFFST--SLQPSTKLYGPIKDLVSEDNPPKYRETTVQGYVSYSLGRGLDGTSPLPH  372

Query  1138  FRLQ  1149
             FR++
Sbjct  373   FRIK  376



>gb|KDO44343.1| hypothetical protein CISIN_1g017182mg [Citrus sinensis]
Length=376

 Score =   420 bits (1079),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 209/371 (56%), Positives = 275/371 (74%), Gaps = 5/371 (1%)
 Frame = +1

Query  40    GKADSGDYDRKSELKAFDDMKTGVKGHVDSGIMKIPRIFIHDeikkeekeklkPAMASTY  219
              + DS D DRKSEL+AFDD KTGVKG VDSG  K+PRIFIH++ K E K          +
Sbjct  11    AEKDSND-DRKSELEAFDDSKTGVKGLVDSGAAKVPRIFIHEQNKLEHKSD--SGNCQNF  67

Query  220   KVPIIDMEGLHTDHTTRRSEIIKEIRDACQTWGFFQIINHGIPTQVLDEMIDGVRQFHEL  399
              +PIID + +  D  + R EII ++R AC+ WGFFQ++N GIP  +L+E+I+ VR+FHEL
Sbjct  68    TIPIIDFQDIDRD-ASARCEIIDKVRKACEKWGFFQVVNRGIPLNILEEIINAVRKFHEL  126

Query  400   DSEVKKQFYSRDLTRKVVYNTNFDFHTSPAATWRDTLYFIMAPHPPTPQELPQVCRDILI  579
             D++VKK+FYSRD TR ++YNTNFDF+ + AA WRD+LY +MAP PP P+ELP VCR +++
Sbjct  127   DADVKKEFYSRDETRSMIYNTNFDFYQASAANWRDSLYCVMAPPPPNPEELPAVCRSVMM  186

Query  580   KYSNSVQKLGLCLLELFSESLGLHKNHLEKLGCAVGLSIFGQYYPACPEPELTFALRDHS  759
              YS  V K GL + EL SE+LGL+ +HL+ LGCA  L + G YYPACPEPELT  L  H+
Sbjct  187   DYSKEVMKFGLTVFELMSEALGLNSSHLKDLGCAERLYLIGHYYPACPEPELTLGLSKHT  246

Query  760   DSGFFTVLNQDTQIGGLQVLHENQWVDVPPLHGALVVNVADLLQLITNDKFKSVVHRVIA  939
             DSGF TV+ QD Q+GGLQVLHE+ WVDV P+ G+L++NV D+ QLI+NDKFKSV HRV+A
Sbjct  247   DSGFLTVVLQD-QMGGLQVLHEDDWVDVEPVSGSLILNVGDMTQLISNDKFKSVYHRVLA  305

Query  940   QKIAPRVSVASFFRTIPGDVDAKKVYGPIKELVSDENPPLYRETTTEEYLMHFQKKGLDG  1119
             +   PR+SVA FFRT   + +  ++YGPI++L+S  +PP+YRETT ++Y+ +   KGLDG
Sbjct  306   KNNGPRISVACFFRTHLEEGNDSRLYGPIEQLLSQISPPIYRETTAKDYVKYIYSKGLDG  365

Query  1120  TSGLLRFRLQK  1152
             TSGL   +L K
Sbjct  366   TSGLQHLKLSK  376



>ref|XP_006489566.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1-like [Citrus sinensis]
Length=367

 Score =   419 bits (1077),  Expect = 4e-140, Method: Compositional matrix adjust.
 Identities = 208/371 (56%), Positives = 276/371 (74%), Gaps = 5/371 (1%)
 Frame = +1

Query  40    GKADSGDYDRKSELKAFDDMKTGVKGHVDSGIMKIPRIFIHDeikkeekeklkPAMASTY  219
              + DS D DRKSEL+AFDD KTGVKG VDSG  K+PRIFIH++ K E K          +
Sbjct  2     AEKDSND-DRKSELEAFDDSKTGVKGLVDSGAAKVPRIFIHEQNKLEHKSD--SGNCQNF  58

Query  220   KVPIIDMEGLHTDHTTRRSEIIKEIRDACQTWGFFQIINHGIPTQVLDEMIDGVRQFHEL  399
              +PIID + +  D  + R EII ++R AC+ WGFFQ++N GIP  +L+E+I+ VR+FHEL
Sbjct  59    TIPIIDFQDIDRD-ASARCEIIDKVRKACEKWGFFQVVNRGIPLNILEEIINAVRKFHEL  117

Query  400   DSEVKKQFYSRDLTRKVVYNTNFDFHTSPAATWRDTLYFIMAPHPPTPQELPQVCRDILI  579
             D++VKK+FYSRD TR ++YNTNFDF+ + AA WRD+LY +MAP PP P+ELP VCR +++
Sbjct  118   DADVKKEFYSRDETRSMIYNTNFDFYQASAANWRDSLYCVMAPPPPNPEELPAVCRSVMM  177

Query  580   KYSNSVQKLGLCLLELFSESLGLHKNHLEKLGCAVGLSIFGQYYPACPEPELTFALRDHS  759
              YS  V K GL + EL SE+LGL+ +HL+ LGCA  L + G YYPACPEPELT  L  H+
Sbjct  178   DYSKEVMKFGLTVFELMSEALGLNSSHLKDLGCAERLYLIGHYYPACPEPELTLGLSKHT  237

Query  760   DSGFFTVLNQDTQIGGLQVLHENQWVDVPPLHGALVVNVADLLQLITNDKFKSVVHRVIA  939
             DSGF TV+ QD Q+GGLQVLHE+ WVDV P+ G+L++NV D+ QLI+NDKFKSV HRV+A
Sbjct  238   DSGFLTVVLQD-QMGGLQVLHEDDWVDVEPVSGSLILNVGDMTQLISNDKFKSVYHRVLA  296

Query  940   QKIAPRVSVASFFRTIPGDVDAKKVYGPIKELVSDENPPLYRETTTEEYLMHFQKKGLDG  1119
             +   PR+SVA FFRT   + +  +++GPI+EL+S+++PP+YRETT ++Y+ +   KGLDG
Sbjct  297   KNNGPRISVACFFRTHLEEGNDSRLHGPIEELLSEDSPPIYRETTAKDYVKYIYSKGLDG  356

Query  1120  TSGLLRFRLQK  1152
             T GL   +L K
Sbjct  357   TCGLQHLKLSK  367



>ref|XP_007223295.1| hypothetical protein PRUPE_ppa007267mg [Prunus persica]
 gb|EMJ24494.1| hypothetical protein PRUPE_ppa007267mg [Prunus persica]
Length=375

 Score =   419 bits (1078),  Expect = 5e-140, Method: Compositional matrix adjust.
 Identities = 203/379 (54%), Positives = 268/379 (71%), Gaps = 7/379 (2%)
 Frame = +1

Query  19    MATASTGGKADSGDYDRKSELKAFDDMKTGVKGHVDSGIMKIPRIFIH--Deikkeekek  192
             M   ST       +YDRKSE+K FDD K GVKG VD+GI ++PRIF    D+        
Sbjct  1     MVATSTSKVPSITNYDRKSEVKTFDDTKEGVKGLVDAGITQVPRIFHQPVDQYPINNTCD  60

Query  193   lkPAMASTYKVPIIDMEGLHTDHT-TRRSEIIKEIRDACQTWGFFQIINHGIPTQVLDEM  369
              +P   +  ++P+ID+EGL  D+  T+R EI+ ++R+A +TWGFFQI NHGIP  VL+E+
Sbjct  61    SEPT-KTQLRIPVIDLEGLEYDNNPTKRKEIVAKVREASETWGFFQIANHGIPVDVLEEI  119

Query  370   IDGVRQFHELDSEVKKQFYSRDLTRKVVYNTNFDFHTSPAATWRDTLYFIMAPHPPTPQE  549
              +GVR F E D+EVKK+ Y+RD  R V+YN+NFD +++PA  WRD+    MAP+PP P++
Sbjct  120   TNGVRGFFEQDTEVKKELYTRDYFRPVIYNSNFDLYSAPATNWRDSFLCNMAPNPPKPED  179

Query  550   LPQVCRDILIKYSNSVQKLGLCLLELFSESLGLHKNHLEKLGCAVGLSIFGQYYPACPEP  729
             LPQVCRDIL++YS  V KLG  L +L SE+LGL  +HL  + C++GL +   YYP CP+P
Sbjct  180   LPQVCRDILVEYSKQVMKLGKLLFQLLSEALGLKPSHLNDMDCSLGLQVLCNYYPPCPQP  239

Query  730   ELTFALRDHSDSGFFTVLNQDTQIGGLQVLHENQWVDVPPLHGALVVNVADLLQLITNDK  909
             ELT     H+D  F TV+ QD  IGGLQVLH+N+W+DV P+ GALVVN+ DLLQLI+ND+
Sbjct  240   ELTLGASKHADDDFITVVLQD-HIGGLQVLHQNKWIDVLPVPGALVVNIGDLLQLISNDR  298

Query  910   FKSVVHRVIAQKIAPRVSVASFFRTIPGDVDAKKVYGPIKELVSDENPPLYRETTTEEYL  1089
             F+SV HRV+A +  PRVSVASFF T  G +   ++YGPIKEL+S++N P YRETT +EY 
Sbjct  299   FRSVEHRVLANRAGPRVSVASFFTT--GFLALPQIYGPIKELLSEDNLPKYRETTVKEYN  356

Query  1090  MHFQKKGLDGTSGLLRFRL  1146
              +F  KGLDGTS L  F+L
Sbjct  357   AYFFNKGLDGTSALTHFKL  375



>ref|XP_006351987.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
[Solanum tuberosum]
Length=364

 Score =   419 bits (1076),  Expect = 5e-140, Method: Compositional matrix adjust.
 Identities = 201/365 (55%), Positives = 266/365 (73%), Gaps = 12/365 (3%)
 Frame = +1

Query  58    DYDRKSELKAFDDMKTGVKGHVDSGIMKIPRIFIHDeikkeekeklkPAMASTYKVPIID  237
             +YD+ SELKAFDD K GVKG +D GI K+P+IFIH E  +++         + +  P+ID
Sbjct  9     NYDKISELKAFDDTKAGVKGLIDGGITKVPQIFIHPEALEKKTIN---PKNTHFIFPLID  65

Query  238   MEGLHTDHTTRRSEIIKEIRDACQTWGFFQIINHGIPTQVLDEMIDGVRQFHELDSEVKK  417
             ++ ++ ++     EI+K+I++A +TWGFFQ+INHGIP  VLDEM+ G  +FHE D +VKK
Sbjct  66    LQNINLNN----KEIVKQIQEASETWGFFQVINHGIPVPVLDEMLRGSLRFHEQDIDVKK  121

Query  418   QFYSRDLTRKVVYNTNFDFHT--SPAATWRDTLYFIMAPHPPTPQELPQVCRDILIKYSN  591
              +YSRD+ RKV+YN NFD  +  S AA WRD+LY +MAP+P  P+E+P+ CR+I I+YSN
Sbjct  122   PYYSRDVARKVMYNCNFDLFSEKSLAANWRDSLYSVMAPNPANPEEIPETCREITIEYSN  181

Query  592   SVQKLGLCLLELFSESLGLHKNHLEKLGCAVGLSIFGQYYPACPEPELTFALRDHSDSGF  771
              V  LG  LLELFSE LGL  NHL+++GCA GL I   YYP CP+PE+      H+D+ F
Sbjct  182   YVMNLGYTLLELFSEGLGLKPNHLKEMGCAEGLGILCNYYPKCPQPEVAIGTSRHADNDF  241

Query  772   FTVLNQDTQIGGLQVLHENQWVDVPPLHGALVVNVADLLQLITNDKFKSVVHRVIAQKIA  951
             FTVL QD  IGGLQV H+NQWVDVPP HGALVVN+ D+LQLI+NDK+KSVVHRV+A KI 
Sbjct  242   FTVLLQD-DIGGLQVFHKNQWVDVPPTHGALVVNIGDILQLISNDKYKSVVHRVLANKIG  300

Query  952   PRVSVASFFRTIPGDVDAKKVYGPIKELVSDENPPLYRETTTEEYLMHFQKKGLDGTSGL  1131
             PR+S+ASFF T  G     ++YGPI+EL+S +NPP YR TT +++  +  KKGLDG S L
Sbjct  301   PRISIASFFST--GPFATSRIYGPIEELLSKDNPPKYRATTMKDFFEYSNKKGLDGNSNL  358

Query  1132  LRFRL  1146
               +++
Sbjct  359   SHYKI  363



>ref|XP_010026849.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1-like [Eucalyptus grandis]
Length=447

 Score =   422 bits (1084),  Expect = 5e-140, Method: Compositional matrix adjust.
 Identities = 199/363 (55%), Positives = 271/363 (75%), Gaps = 5/363 (1%)
 Frame = +1

Query  58    DYDRKSELKAFDDMKTGVKGHVDSGIMKIPRIFIHDeikkeekeklkPAMASTYKVPIID  237
             +YDR+SELKAFD   TGVKG VDSG+ K+P IF+  + + +  +   PA  S + +PI+D
Sbjct  90    EYDRESELKAFDASMTGVKGLVDSGVSKLPCIFV--DHRPQSPDCSDPAETS-FSIPIVD  146

Query  238   MEGLHTDHTTRRSEIIKEIRDACQTWGFFQIINHGIPTQVLDEMIDGVRQFHELDSEVKK  417
             ++G+H D +++R EI+  +  AC+ WGFFQ++NHGI   +L  +IDG+R+FHE +S++K+
Sbjct  147   LQGVHED-SSKRKEIVCRVGHACEDWGFFQVVNHGIGHGILSGIIDGMRRFHEQESKLKE  205

Query  418   QFYSRDLTRKVVYNTNFDFHTSPAATWRDTLYFIMAPHPPTPQELPQVCRDILIKYSNSV  597
             + YSRD ++KV++NTNFDFH++P A WRD+LY  MAPHPP+P+ELPQVCRDI+ +YS+ V
Sbjct  206   ELYSRDQSKKVIFNTNFDFHSAPVANWRDSLYCAMAPHPPSPEELPQVCRDIVREYSDKV  265

Query  598   QKLGLCLLELFSESLGLHKNHLEKLGCAVGLSIFGQYYPACPEPELTFALRDHSDSGFFT  777
              +LGL + +L SE+LGL+  HL+ +GCA GL + G YYP CPEP+LT     H+DS F T
Sbjct  266   MRLGLTIFKLLSEALGLNPKHLQDMGCAEGLYLIGHYYPICPEPDLTQGHTKHTDSSFLT  325

Query  778   VLNQDTQIGGLQVLHENQWVDVPPLHGALVVNVADLLQLITNDKFKSVVHRVIAQKIAPR  957
             VL QD Q GGLQVLHEN WVDV P+ GALVVN+ D+LQLITN KFKSV HRV A+ + PR
Sbjct  326   VLLQD-QTGGLQVLHENHWVDVKPVQGALVVNLGDMLQLITNGKFKSVYHRVQAKNVGPR  384

Query  958   VSVASFFRTIPGDVDAKKVYGPIKELVSDENPPLYRETTTEEYLMHFQKKGLDGTSGLLR  1137
             +SVA FFR      ++ + YGPIKEL+S+ENPPLYRET+ ++Y+ +   KGLDG   +  
Sbjct  385   ISVACFFRRHFEQEESPRKYGPIKELLSEENPPLYRETSVKDYVKYIYSKGLDGVPAIDH  444

Query  1138  FRL  1146
              +L
Sbjct  445   LKL  447



>ref|XP_003628028.1| 1-aminocyclopropane-1-carboxylate oxidase-like protein [Medicago 
truncatula]
 gb|AET02504.1| 2OG-Fe(II) oxygenase family oxidoreductase [Medicago truncatula]
Length=381

 Score =   419 bits (1077),  Expect = 8e-140, Method: Compositional matrix adjust.
 Identities = 202/365 (55%), Positives = 269/365 (74%), Gaps = 8/365 (2%)
 Frame = +1

Query  61    YDRKSELKAFDDMKTGVKGHVDSGIMKIPRIFIHDeikkeekeklkPAMASTYKVPIIDM  240
             YDR+ ELK  D+ K GVKG VD+G+ K+P+IFIHD+I +   ++     ++   +PIID 
Sbjct  17    YDRQKELKLLDESKEGVKGLVDAGLTKVPKIFIHDKIHEHNNKQTS---STNLSIPIIDF  73

Query  241   EGLHTD-HTTRRSEIIKEIRDACQTWGFFQIINHGIPTQVLDEMIDGVRQFHELDSEVKK  417
               L T+  ++ R EII++++ A + WGFFQ++NHGIP+ VLDEMIDGV +FHE D+E+KK
Sbjct  74    GPLFTNTSSSSRLEIIEKVKHASEKWGFFQVVNHGIPSTVLDEMIDGVVRFHEQDTEMKK  133

Query  418   QFYSRDLTRKVVYNTNFDFHTSPAATWRDTLYFIMAPHPPTPQELPQVCRDILIKYSNSV  597
             +FYSRD+T++  +NTNFD + +PA  WRD+L  +M P P  PQ+LP VCRDI +KYS+ V
Sbjct  134   KFYSRDITKRAYFNTNFDLYVTPAVNWRDSLSCVMGPQPLDPQDLPTVCRDITVKYSDYV  193

Query  598   QKLGLCLLELFSESLGLHKNHLEKLGCAVGLSIFGQYYPACPEPELTFALRDHSDSGFFT  777
              K+G+ LLEL SE+LGL+ N+L+ + CA GL +   YYP CPEPELTF    HSDS FFT
Sbjct  194   NKVGMILLELLSEALGLNSNYLKDIDCAEGLFLISHYYPPCPEPELTFGTSAHSDSSFFT  253

Query  778   VLNQDTQIGGLQVLHENQWVDVPPLHGALVVNVADLLQLITNDKFKSVVHRVIAQKIAPR  957
             VL QD Q+GGLQV H NQWVDV P+ GALV+N+ D++QLITNDKF SV HRV+A KI PR
Sbjct  254   VLLQD-QLGGLQVFHGNQWVDVTPIPGALVINLGDMMQLITNDKFLSVKHRVLAPKIGPR  312

Query  958   VSVASFFRT-IPGDVDAKKVYGPIKELVSDENPPLYRETTTEEYLMHFQKKGLDGTSGLL  1134
             +SVA FFR  +P   +  K+YGPI EL++ ENPP+Y+ET+ +  + H+  KGLDG S L 
Sbjct  313   ISVACFFRQHLPP--ENSKLYGPITELLTPENPPVYKETSVKGLVSHYYGKGLDGNSALD  370

Query  1135  RFRLQ  1149
              FR+Q
Sbjct  371   HFRIQ  375



>ref|XP_004511093.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
11-like [Cicer arietinum]
Length=377

 Score =   419 bits (1076),  Expect = 9e-140, Method: Compositional matrix adjust.
 Identities = 204/363 (56%), Positives = 268/363 (74%), Gaps = 9/363 (2%)
 Frame = +1

Query  61    YDRKSELKAFDDMKTGVKGHVDSGIMKIPRIFIHDeikkeekeklkPAMASTYKVPIIDM  240
             YDR  ELK  D+ K+GVKG VDSG+ K+P+IFIHD+I +   +      ++   +PIID 
Sbjct  23    YDRYKELKLLDESKSGVKGLVDSGLSKVPKIFIHDKIHEHNNQ----ITSTNLNIPIIDF  78

Query  241   EGLHTDHTTRRSEIIKEIRDACQTWGFFQIINHGIPTQVLDEMIDGVRQFHELDSEVKKQ  420
               L T  ++ R +II++++ A + WGFFQ+INHGIP+ VLD+M+ GV +FHE D+E KK+
Sbjct  79    GPLLTS-SSSRFDIIEKVKYASENWGFFQVINHGIPSTVLDDMLHGVLRFHEQDTETKKE  137

Query  421   FYSRDLTRKVVYNTNFDFHTSPAATWRDTLYFIMAPHPPTPQELPQVCRDILIKYSNSVQ  600
             FYSRD+T++  +NTNFDF+ +PA  WRDTL  +MAP P  PQELP +CRDI I+YS  V+
Sbjct  138   FYSRDITKRAYFNTNFDFYVTPAVNWRDTLSCVMAPQPLDPQELPSICRDITIEYSEYVK  197

Query  601   KLGLCLLELFSESLGLHKNHLEKLGCAVGLSIFGQYYPACPEPELTFALRDHSDSGFFTV  780
             K+G+ L EL SE+LGL+ ++L+ + CA GL +   YYP CPEPELTF    HSDS F TV
Sbjct  198   KVGMLLFELLSEALGLNSSYLKDIDCAEGLFVISHYYPPCPEPELTFGTSAHSDSSFLTV  257

Query  781   LNQDTQIGGLQVLHENQWVDVPPLHGALVVNVADLLQLITNDKFKSVVHRVIAQKIAPRV  960
             L QD QIGGLQV HE+QWVDV P+ GALVVN+ D++QLITNDKF SV HRV+AQK+ PRV
Sbjct  258   LLQD-QIGGLQVFHEDQWVDVTPIPGALVVNLGDMMQLITNDKFISVKHRVLAQKLGPRV  316

Query  961   SVASFFRT-IPGDVDAKKVYGPIKELVSDENPPLYRETTTEEYLMHFQKKGLDGTSGLLR  1137
             SVA FFR  +P   +  K+YGPI EL++ ENPP+Y+ET+ ++ + H+  KGLDGTS L  
Sbjct  317   SVACFFRQHLPP--ENSKLYGPISELLTPENPPVYKETSVKDLVSHYYGKGLDGTSALEH  374

Query  1138  FRL  1146
             FRL
Sbjct  375   FRL  377



>ref|XP_009379006.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1-like [Pyrus x bretschneideri]
Length=368

 Score =   418 bits (1074),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 201/369 (54%), Positives = 266/369 (72%), Gaps = 5/369 (1%)
 Frame = +1

Query  46    ADSGDYDRKSELKAFDDMKTGVKGHVDSGIMKIPRIFIH--DeikkeekeklkPAMASTY  219
             A + + DRKSE+KAFDD K GVKG VD+GI ++PRIF    +      K     + A  +
Sbjct  3     ATNTNDDRKSEVKAFDDTKEGVKGLVDAGITEVPRIFHQPPELDDHYIKNSSSDSEARQF  62

Query  220   KVPIIDMEGLHTDHTTRRSEIIKEIRDACQTWGFFQIINHGIPTQVLDEMIDGVRQFHEL  399
              +P+ID++GL     T+R+EI+ ++ +A +TWGFFQI+NHGIP  VL+E+ DGVR F E 
Sbjct  63    SIPVIDLQGLELGSPTKRNEIVAKVGEASETWGFFQIVNHGIPVDVLEEIKDGVRGFFEQ  122

Query  400   DSEVKKQFYSRDLTRKVVYNTNFDFHTSPAATWRDTLYFIMAPHPPTPQELPQVCRDILI  579
             D++VKK+ Y+RD  + +VYN+NFD +++PA  WRDT    +AP+P  P++LPQVCRDIL+
Sbjct  123   DTQVKKELYTRDPLKPLVYNSNFDLYSAPATNWRDTFLCYVAPNPTKPEDLPQVCRDILV  182

Query  580   KYSNSVQKLGLCLLELFSESLGLHKNHLEKLGCAVGLSIFGQYYPACPEPELTFALRDHS  759
             +YS  V KLG  L EL SE+LGL  +HL  + C  GL I G YYP+CP+PELT     H+
Sbjct  183   EYSKHVMKLGKLLFELLSEALGLKPSHLNDMDCNEGLLILGHYYPSCPQPELTMGTSKHA  242

Query  760   DSGFFTVLNQDTQIGGLQVLHENQWVDVPPLHGALVVNVADLLQLITNDKFKSVVHRVIA  939
             D+ F TVL QD  IGGLQVLH+ +WVDVPP+ GALVVN+ DLLQLI+ND+FKS+ HRV+A
Sbjct  243   DNDFITVLLQD-HIGGLQVLHQRKWVDVPPVPGALVVNIGDLLQLISNDRFKSIQHRVLA  301

Query  940   QKIAPRVSVASFFRTIPGDVDAKKVYGPIKELVSDENPPLYRETTTEEYLMHFQKKGLDG  1119
               + PR+SVASFF T  G + + K+YGPIKELVS +NPP Y+ETT  +Y+ +F  KGLDG
Sbjct  302   NCVGPRISVASFFCT--GMLPSTKLYGPIKELVSKDNPPKYKETTVRDYVAYFNNKGLDG  359

Query  1120  TSGLLRFRL  1146
             TS L  F+L
Sbjct  360   TSALSHFKL  368



>ref|XP_007035068.1| 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily 
protein, putative [Theobroma cacao]
 gb|EOY05994.1| 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily 
protein, putative [Theobroma cacao]
Length=371

 Score =   418 bits (1075),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 204/374 (55%), Positives = 265/374 (71%), Gaps = 5/374 (1%)
 Frame = +1

Query  28    ASTGGKADSGDYDRKSELKAFDDMKTGVKGHVDSGIMKIPRIFIHDeikkeekeklkPAM  207
             A+  GK    ++DRK ELKAFDD KTGVKG  D+G+  IPRIF+ +++++E   +  P  
Sbjct  2     AAEIGKIQESNFDRKKELKAFDDTKTGVKGLADAGLANIPRIFVTEQLRQENNSE--PRH  59

Query  208   ASTYKVPIIDMEGLHTDHTTRRSEIIKEIRDACQTWGFFQIINHGIPTQVLDEMIDGVRQ  387
              S + +PIID+ G+  D +  R EII ++RDAC+ WGFFQ++NHGIP   LD+MIDG+R+
Sbjct  60    GSDFCIPIIDLTGVDEDASLHR-EIINKVRDACEKWGFFQVVNHGIPLNTLDDMIDGIRR  118

Query  388   FHELDSEVKKQFYSRDLTRKVVYNTNFDFH-TSPAATWRDTLYFIMAPHPPTPQELPQVC  564
             FHE D EVKK  Y+RD T+KV+YN+N D H    AA WRD+L F MAP  P P+ELP VC
Sbjct  119   FHEQDPEVKKGIYTRDYTKKVLYNSNPDLHRKKTAANWRDSLTFHMAPKQPDPEELPAVC  178

Query  565   RDILIKYSNSVQKLGLCLLELFSESLGLHKNHLEKLGCAVGLSIFGQYYPACPEPELTFA  744
             RDI+  Y+N V  LG  L +L SE+LGLH  +LE+ GC      FG YYPACPEP+L   
Sbjct  179   RDIIFDYTNKVTTLGRTLFKLLSEALGLHPTYLEESGCMEATFCFGHYYPACPEPDLALG  238

Query  745   LRDHSDSGFFTVLNQDTQIGGLQVLHENQWVDVPPLHGALVVNVADLLQLITNDKFKSVV  924
                H+DS F TVL Q+ QIGGLQVLHENQW+D+P + GALVVN+ D+LQLI+N KF SV 
Sbjct  239   TASHADSSFLTVLLQN-QIGGLQVLHENQWIDIPSVRGALVVNLGDMLQLISNGKFVSVY  297

Query  925   HRVIAQKIAPRVSVASFFRTIPGDVDAKKVYGPIKELVSDENPPLYRETTTEEYLMHFQK  1104
             HRV+A+ I PRVSVA FFR      +  +VYGPIK+L+S+ENPP+YR+ T ++++ H+  
Sbjct  298   HRVLAKAIGPRVSVAYFFRIHLPPANPLRVYGPIKKLLSEENPPIYRDITIKDFVYHYYG  357

Query  1105  KGLDGTSGLLRFRL  1146
             +GLDG   L  FRL
Sbjct  358   EGLDGRRSLEHFRL  371



>ref|XP_006354515.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
[Solanum tuberosum]
Length=373

 Score =   418 bits (1075),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 198/364 (54%), Positives = 267/364 (73%), Gaps = 9/364 (2%)
 Frame = +1

Query  61    YDRKSELKAFDDMKTGVKGHVDSGIMKIPRIFIHDeikkeekeklkPAMASTYKVPIIDM  240
             YD+ SELKAFDD K G+KG VD+GI K+PRIF+   +  +++ +      + +  P+ID+
Sbjct  17    YDKMSELKAFDDTKAGIKGLVDAGITKVPRIFM---LPPKDRLESSDTCETQFIFPVIDL  73

Query  241   EGLHTDHTTRRSEIIKEIRDACQTWGFFQIINHGIPTQVLDEMIDGVRQFHELDSEVKKQ  420
             EG+  D   +  EI+ ++RDA +TWGFFQ++NHGIP  VL+EM+ G R+F E D EVK Q
Sbjct  74    EGISKD-PIKHKEIVDKVRDASETWGFFQVVNHGIPVSVLEEMLQGTRRFFEQDIEVKNQ  132

Query  421   FYSRDLTRKVVYNTNFDFHTS--PAATWRDTLYFIMAPHPPTPQELPQVCRDILIKYSNS  594
             +Y+RD+T+KVV++ NFD ++   PAA WRDTL  +MAP+PP+P+E P  CR+ILI++S+ 
Sbjct  133   YYTRDITKKVVHSCNFDLYSPSVPAANWRDTLSCLMAPNPPSPEEFPAACREILIEFSDH  192

Query  595   VQKLGLCLLELFSESLGLHKNHLEKLGCAVGLSIFGQYYPACPEPELTFALRDHSDSGFF  774
             + KLG  + EL SE LGL+ +HL  +GCA GL++ G YYPACP+PELT     HSD+GF 
Sbjct  193   IMKLGKSVFELLSEGLGLNPSHLNDIGCAEGLAVLGHYYPACPQPELTMGTSKHSDNGFI  252

Query  775   TVLNQDTQIGGLQVLHENQWVDVPPLHGALVVNVADLLQLITNDKFKSVVHRVIAQKIAP  954
             TVL QD  IGGLQVLH+NQWVDVPP  GA+VVN+ DLLQLI+NDK+ SV HRV+  K++ 
Sbjct  253   TVLLQD-HIGGLQVLHQNQWVDVPPTPGAIVVNIGDLLQLISNDKYISVEHRVLTNKLSS  311

Query  955   RVSVASFFRTIPGDVDAKKVYGPIKELVSDENPPLYRETTTEEYLMHFQKKGLDGTSGLL  1134
             R+SVA FF T  G + +   YGPI EL+S++NPP YR TT  +Y  +F KKGLDGTS LL
Sbjct  312   RISVACFFGT--GPLPSSNFYGPITELLSEDNPPKYRVTTVNDYTGYFSKKGLDGTSALL  369

Query  1135  RFRL  1146
              +++
Sbjct  370   HYKI  373



>ref|XP_007035062.1| 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily 
protein, putative [Theobroma cacao]
 gb|EOY05988.1| 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily 
protein, putative [Theobroma cacao]
Length=374

 Score =   418 bits (1074),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 206/379 (54%), Positives = 270/379 (71%), Gaps = 8/379 (2%)
 Frame = +1

Query  19    MATASTGG-KADSG-DYDRKSELKAFDDMKTGVKGHVDSGIMKIPRIFIHDeikkeekek  192
             M    TG   AD+  DYDR+SE+KAFDD K GVKG VDS + KIPRIF+   +  E+   
Sbjct  1     MVETKTGEVHADTNPDYDRQSEVKAFDDTKAGVKGLVDSVVTKIPRIFVDQNLVLEKNSS  60

Query  193   lkPAMASTYKVPIIDMEGLHTDHTTRRSEIIKEIRDACQTWGFFQIINHGIPTQVLDEMI  372
                 +   + VPIID++G+ T+ +T R+E+I++++ AC+ WGFFQ++NH IP  VLDEMI
Sbjct  61    ---CVNYQFSVPIIDLQGI-TEDSTMRAEVIEQVQIACEKWGFFQVVNHEIPGSVLDEMI  116

Query  373   DGVRQFHELDSEVKKQFYSRDLTR-KVVYNTNFDFHTSPAATWRDTLYFIMAPHPPTPQE  549
             DG+R+FHE D+EVKK+FY+RD TR KV+Y +N D + S AA WRDTL  +MAP PP P E
Sbjct  117   DGIRRFHEQDTEVKKEFYTRDTTRRKVLYLSNVDLYRSKAANWRDTLGCLMAPDPPDPTE  176

Query  550   LPQVCRDILIKYSNSVQKLGLCLLELFSESLGLHKNHLEKLGCAVGLSIFGQYYPACPEP  729
             LP+VC DI++ YSN V   G  L EL SE+LGL+ ++L+ + C  GL + G YYP CPEP
Sbjct  177   LPEVCTDIVMDYSNRVVTFGFTLFELLSEALGLNPSYLKDMDCTEGLLLMGHYYPKCPEP  236

Query  730   ELTFALRDHSDSGFFTVLNQDTQIGGLQVLHENQWVDVPPLHGALVVNVADLLQLITNDK  909
             ELT    +H DS   T+L QD Q+GGLQVLHENQWVDVP + GAL+VNV D LQL++NDK
Sbjct  237   ELTMGTTNHRDSSIITILLQD-QMGGLQVLHENQWVDVPCIPGALIVNVGDFLQLLSNDK  295

Query  910   FKSVVHRVIAQKIAPRVSVASFFRTIPGDVDAKKVYGPIKELVSDENPPLYRETTTEEYL  1089
             FKSV HRV+A+ + PR+SVA F R      +A ++ GPIKE++S+ENPP+YRE   ++YL
Sbjct  296   FKSVNHRVLAKHVGPRISVACFLRMQANTGNASRLCGPIKEMLSEENPPIYREILVQDYL  355

Query  1090  MHFQKKGLDGTSGLLRFRL  1146
               +  KGLDGT  L  F+L
Sbjct  356   SLYYSKGLDGTPSLSHFKL  374



>ref|XP_011030520.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1-like [Populus euphratica]
Length=364

 Score =   417 bits (1072),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 205/362 (57%), Positives = 262/362 (72%), Gaps = 6/362 (2%)
 Frame = +1

Query  61    YDRKSELKAFDDMKTGVKGHVDSGIMKIPRIFIHDeikkeekeklkPAMASTYKVPIIDM  240
             YDR SELKAFDD K GVKG VD+GI K+PRIF H  ++ +    L  A    +++P+ID+
Sbjct  9     YDRISELKAFDDTKAGVKGLVDAGITKVPRIFQH--LRDDSDNTLLVAAEGKFRIPMIDL  66

Query  241   EGLHTDHTTRRSEIIKEIRDACQTWGFFQIINHGIPTQVLDEMIDGVRQFHELDSEVKKQ  420
             E +H     +R EI+  +R+A +TWGFF+++NHGIP  VL EM DGVR+FHE D E+KK+
Sbjct  67    EDVHKG-PPQRKEIVDRVRNASETWGFFEVVNHGIPVDVLQEMKDGVRRFHEQDVELKKE  125

Query  421   FYSRDLTRKVVYNTNFDFHTSPAATWRDTLYFIMAPHPPTPQELPQVCRDILIKYSNSVQ  600
             ++SRD TRKV YN+NFD  +SP+A WRDT   +MAP  P P+ELP   RDILI+Y+  V 
Sbjct  126   YFSRDYTRKVGYNSNFDLFSSPSANWRDTFTCVMAPISPRPEELPATFRDILIEYTKEVM  185

Query  601   KLGLCLLELFSESLGLHKNHLEKLGCAVGLSIFGQYYPACPEPELTFALRDHSDSGFFTV  780
             KLG  L +L SE+LGL+ NHL+ + C+ G +I G YYPACP+PELT     HSD+ F TV
Sbjct  186   KLGNLLFDLLSEALGLNPNHLKDIDCSKGHTILGHYYPACPQPELTLGTTKHSDNDFLTV  245

Query  781   LNQDTQIGGLQVLHENQWVDVPPLHGALVVNVADLLQLITNDKFKSVVHRVIAQKIAPRV  960
             L QD  IGGLQV+H+N WVDV P  GAL++N+ DLLQLI+NDKF SV HRV+A +I PR+
Sbjct  246   LLQD-HIGGLQVMHQNHWVDVSPTPGALLINIGDLLQLISNDKFISVEHRVLANRIGPRI  304

Query  961   SVASFFRTIPGDVDAKKVYGPIKELVSDENPPLYRETTTEEYLMHFQKKGLDGTSGLLRF  1140
             SVASFF T        + YGPIKEL+S+E+PP YRETT  +Y+ +F  KGLDGTS LL F
Sbjct  305   SVASFFSTNLN--PNSRTYGPIKELLSEESPPKYRETTVRDYVTYFIHKGLDGTSALLHF  362

Query  1141  RL  1146
             +L
Sbjct  363   KL  364



>ref|XP_007223277.1| hypothetical protein PRUPE_ppa007265mg [Prunus persica]
 gb|EMJ24476.1| hypothetical protein PRUPE_ppa007265mg [Prunus persica]
Length=375

 Score =   417 bits (1073),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 207/380 (54%), Positives = 268/380 (71%), Gaps = 9/380 (2%)
 Frame = +1

Query  19    MATASTGGKADSGDYDRKSELKAFDDMKTGVKGHVDSGIMKIPRIFIH---Deikkeeke  189
             M   ST       +YDRKSE+K FDD K GVKG VD+GI K+PRIF H   D+       
Sbjct  1     MVATSTNEVPSIANYDRKSEVKTFDDTKEGVKGLVDAGITKVPRIF-HLPVDQYPINNTC  59

Query  190   klkPAMASTYKVPIIDMEGLHTDHT-TRRSEIIKEIRDACQTWGFFQIINHGIPTQVLDE  366
               +P   +  ++P+ID+EGL  D+  T+R EI+ ++ +A +TWGFFQI NH IP  VL+E
Sbjct  60    DSEPT-KTQLRIPVIDLEGLEYDYNPTKRKEIVAKVGEASETWGFFQIANHDIPVDVLEE  118

Query  367   MIDGVRQFHELDSEVKKQFYSRDLTRKVVYNTNFDFHTSPAATWRDTLYFIMAPHPPTPQ  546
             + +GVR F E D+EVKK+ Y+RD  R V+YN+NFD +++PA  WRDT    MAP+PP P+
Sbjct  119   IKNGVRGFFEQDTEVKKEHYTRDRFRPVIYNSNFDLYSAPATNWRDTFLCNMAPNPPKPE  178

Query  547   ELPQVCRDILIKYSNSVQKLGLCLLELFSESLGLHKNHLEKLGCAVGLSIFGQYYPACPE  726
             +LPQVCRDIL++YS  V KLG  L EL SE+LGL  +HL  + C++GL I G YYP CP+
Sbjct  179   DLPQVCRDILVEYSKHVMKLGKLLFELLSEALGLKPSHLNDMDCSLGLQILGHYYPPCPQ  238

Query  727   PELTFALRDHSDSGFFTVLNQDTQIGGLQVLHENQWVDVPPLHGALVVNVADLLQLITND  906
             PELT     H+D+ F TVL QD  IGGLQVLH+N W+DV P+ GALVVN+ DLLQLI+ND
Sbjct  239   PELTLGTSKHADNDFITVLLQD-HIGGLQVLHQNNWIDVLPVPGALVVNIGDLLQLISND  297

Query  907   KFKSVVHRVIAQKIAPRVSVASFFRTIPGDVDAKKVYGPIKELVSDENPPLYRETTTEEY  1086
             +F+SV HRV+A +  PRVSVASFF T  G +   ++YGPIKEL+S++N P YRETT +++
Sbjct  298   RFRSVQHRVLANRSDPRVSVASFFST--GFLALPRIYGPIKELLSEDNLPKYRETTLKDF  355

Query  1087  LMHFQKKGLDGTSGLLRFRL  1146
               HF  KGLDGTS L  F+L
Sbjct  356   NAHFHNKGLDGTSALTHFKL  375



>gb|KHN10894.1| 1-aminocyclopropane-1-carboxylate oxidase like 1 [Glycine soja]
Length=378

 Score =   417 bits (1073),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 205/364 (56%), Positives = 262/364 (72%), Gaps = 5/364 (1%)
 Frame = +1

Query  58    DYDRKSELKAFDDMKTGVKGHVDSGIMKIPRIFIHDeikkeekeklkPAMASTYKVPIID  237
             DYDR SELKAFDD + GV G  D+G+ KIP IF H+       E    + ++   VP ID
Sbjct  18    DYDRASELKAFDDTQDGVMGLTDAGVTKIPLIF-HNPKNSHHDESDDGSGSTQLSVPSID  76

Query  238   MEGLHTDHTTRRSEIIKEIRDACQTWGFFQIINHGIPTQVLDEMIDGVRQFHELDSEVKK  417
             + G+  D  TR+  ++++IR AC+TWGFFQ++NHGIP  VL+EM  GV +F+E DSEVK+
Sbjct  77    LVGVAEDPATRKV-VVEKIRQACETWGFFQVVNHGIPLSVLEEMKSGVNRFYEQDSEVKR  135

Query  418   QFYSRDLTRKVVYNTNFDFHTSPAATWRDTLYFIMAPHPPTPQELPQVCRDILIKYSNSV  597
             + Y+RD  R +VYN+NFD  TSPAA WRDT Y  MAPHPP P++LP VCRDIL++Y+  V
Sbjct  136   ELYTRDPLRPLVYNSNFDLFTSPAANWRDTFYCFMAPHPPKPEDLPSVCRDILLEYAKEV  195

Query  598   QKLGLCLLELFSESLGLHKNHLEKLGCAVGLSIFGQYYPACPEPELTFALRDHSDSGFFT  777
             +KLG  L EL SE+L L+ N+L  +GC  GL++    YPACPEPELT     H+D+ F T
Sbjct  196   KKLGSVLFELLSEALELNPNYLNDIGCNEGLTLVCHCYPACPEPELTLGATKHTDNDFIT  255

Query  778   VLNQDTQIGGLQVLHENQWVDVPPLHGALVVNVADLLQLITNDKFKSVVHRVIAQKIAPR  957
             VL QD  IGGLQVLHEN+WVDV P+ GALV+N+ DLLQLITNDKFKSV HRV+A ++ PR
Sbjct  256   VLLQD-HIGGLQVLHENRWVDVSPVPGALVINIGDLLQLITNDKFKSVEHRVVANRVGPR  314

Query  958   VSVASFFRTIPGDVDAKKVYGPIKELVSDENPPLYRETTTEEYLMHFQKKGLDGTSGLLR  1137
             VSVASF  T      + K+YGPIK+LVS++NPP YRETT + Y+ +   +GLDGTS L  
Sbjct  315   VSVASFVST--SLQPSTKLYGPIKDLVSEDNPPKYRETTVQGYVSYSLGRGLDGTSPLPH  372

Query  1138  FRLQ  1149
             FR++
Sbjct  373   FRIK  376



>ref|XP_008222547.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1-like [Prunus mume]
Length=375

 Score =   417 bits (1071),  Expect = 4e-139, Method: Compositional matrix adjust.
 Identities = 204/379 (54%), Positives = 265/379 (70%), Gaps = 7/379 (2%)
 Frame = +1

Query  19    MATASTGGKADSGDYDRKSELKAFDDMKTGVKGHVDSGIMKIPRIFIH--Deikkeekek  192
             M    T       +YDRKSE+K FDD K GVKG VD+GI K+PRIF H  D+        
Sbjct  1     MVATGTNEVPSIANYDRKSEVKTFDDTKEGVKGLVDAGITKVPRIFHHPVDQYPINNTCD  60

Query  193   lkPAMASTYKVPIIDMEGLHTDHT-TRRSEIIKEIRDACQTWGFFQIINHGIPTQVLDEM  369
              +P      ++P+ID+EGL  D+  T+R EI+ ++ +A +TWGFFQI NHGIP  VL+E+
Sbjct  61    SEPTKTRP-RIPVIDLEGLEYDNNPTKRKEIVAKVGEASETWGFFQIANHGIPVDVLEEI  119

Query  370   IDGVRQFHELDSEVKKQFYSRDLTRKVVYNTNFDFHTSPAATWRDTLYFIMAPHPPTPQE  549
              +GVR F E D+EVKK+ Y+RD +R V+YN+NFD +++ A  WRDT    MAP+PP P++
Sbjct  120   KNGVRGFFEQDTEVKKELYTRDYSRPVIYNSNFDLYSALATNWRDTFLCNMAPNPPKPED  179

Query  550   LPQVCRDILIKYSNSVQKLGLCLLELFSESLGLHKNHLEKLGCAVGLSIFGQYYPACPEP  729
             LPQVCRDIL++YS  V KLG  L EL SE+LGL  +HL  + C++GL I G YYP CP+P
Sbjct  180   LPQVCRDILVEYSKQVMKLGKLLFELLSEALGLKPSHLNDMDCSLGLQILGHYYPPCPQP  239

Query  730   ELTFALRDHSDSGFFTVLNQDTQIGGLQVLHENQWVDVPPLHGALVVNVADLLQLITNDK  909
             ELT     H+D  F TV+ QD  IGGLQVLH+N+W+DV P+ GALVVN+ DLLQLI+ND+
Sbjct  240   ELTLGASKHTDDDFITVVLQD-HIGGLQVLHQNKWIDVLPVPGALVVNIGDLLQLISNDR  298

Query  910   FKSVVHRVIAQKIAPRVSVASFFRTIPGDVDAKKVYGPIKELVSDENPPLYRETTTEEYL  1089
             F+SV HRV+A +  PRVSVA FF T  G +   ++ GPIKEL+S++N P YRETT ++Y 
Sbjct  299   FRSVEHRVLANRAGPRVSVACFFNT--GFLALPRICGPIKELLSEDNLPKYRETTVKDYN  356

Query  1090  MHFQKKGLDGTSGLLRFRL  1146
              HF  KGLDGTS L  F+L
Sbjct  357   AHFYNKGLDGTSALTHFKL  375



>ref|XP_008224382.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1-like [Prunus mume]
Length=375

 Score =   417 bits (1071),  Expect = 4e-139, Method: Compositional matrix adjust.
 Identities = 203/379 (54%), Positives = 267/379 (70%), Gaps = 7/379 (2%)
 Frame = +1

Query  19    MATASTGGKADSGDYDRKSELKAFDDMKTGVKGHVDSGIMKIPRIFIH--Deikkeekek  192
             M   ST       +YDRKSE+K FDD K GVKG VD+ I ++PRIF    D+        
Sbjct  1     MVATSTNEVPSITNYDRKSEVKTFDDTKEGVKGLVDARITQVPRIFHQPVDQYPINNTCD  60

Query  193   lkPAMASTYKVPIIDMEGLHTDHT-TRRSEIIKEIRDACQTWGFFQIINHGIPTQVLDEM  369
              +P   +  K+P+ID+EGL  D+  T+R EI+ ++ +A +TWGFFQI NHGIP  VL+E+
Sbjct  61    SEPT-KTQLKIPVIDLEGLEYDNNPTKRKEIVAKVGEASETWGFFQIANHGIPVDVLEEI  119

Query  370   IDGVRQFHELDSEVKKQFYSRDLTRKVVYNTNFDFHTSPAATWRDTLYFIMAPHPPTPQE  549
              +GVR F E D+EVKK+ Y+RD  R V+YN+NFD +++PA  WRD+    MAP+PP P++
Sbjct  120   KNGVRGFFEQDTEVKKELYTRDYFRPVIYNSNFDLYSAPATNWRDSFLCNMAPNPPKPED  179

Query  550   LPQVCRDILIKYSNSVQKLGLCLLELFSESLGLHKNHLEKLGCAVGLSIFGQYYPACPEP  729
             LPQVCRDIL++YSN V KLG  L +L SE+LGL  +HL  + C++GL +   YYP CP+P
Sbjct  180   LPQVCRDILVEYSNQVMKLGKLLFQLLSEALGLKPSHLNDMDCSLGLQVLCNYYPPCPQP  239

Query  730   ELTFALRDHSDSGFFTVLNQDTQIGGLQVLHENQWVDVPPLHGALVVNVADLLQLITNDK  909
             ELT     H+D  F TV+ QD  IGGLQVLH+N+W+DV P+ GALVVN+ DLLQLI+ND+
Sbjct  240   ELTLGASKHTDDDFITVVLQD-HIGGLQVLHQNKWIDVLPVPGALVVNIGDLLQLISNDR  298

Query  910   FKSVVHRVIAQKIAPRVSVASFFRTIPGDVDAKKVYGPIKELVSDENPPLYRETTTEEYL  1089
             F+SV HRV+A +  PRVSVASFF T  G +   ++YGPIKEL+S++N P YRET+ +EY 
Sbjct  299   FRSVEHRVLANRAGPRVSVASFFTT--GFLALPQIYGPIKELLSEDNLPKYRETSVKEYN  356

Query  1090  MHFQKKGLDGTSGLLRFRL  1146
              HF  KGLDGTS L  F+L
Sbjct  357   AHFYNKGLDGTSALTHFKL  375



>ref|XP_007223369.1| hypothetical protein PRUPE_ppa007487mg [Prunus persica]
 gb|EMJ24568.1| hypothetical protein PRUPE_ppa007487mg [Prunus persica]
Length=366

 Score =   416 bits (1070),  Expect = 5e-139, Method: Compositional matrix adjust.
 Identities = 199/367 (54%), Positives = 264/367 (72%), Gaps = 4/367 (1%)
 Frame = +1

Query  46    ADSGDYDRKSELKAFDDMKTGVKGHVDSGIMKIPRIFIHDeikkeekeklkPAMASTYKV  225
              ++ +YDR+SELKAFDD K GVKG VD+ I ++PRIF H    +        + A+ + +
Sbjct  4     TNNTNYDRQSELKAFDDTKEGVKGLVDARITEVPRIF-HQPPDQYIINSNFDSEATQFSI  62

Query  226   PIIDMEGLHTDHTTRRSEIIKEIRDACQTWGFFQIINHGIPTQVLDEMIDGVRQFHELDS  405
             P+ID+EGL  D  T+R+EI+ ++ +A +TWGFFQI NHGIP  VL+EM D VR F E D+
Sbjct  63    PLIDLEGLEFDSPTKRNEIVAKVGEASETWGFFQISNHGIPVGVLEEMKDSVRGFFEQDT  122

Query  406   EVKKQFYSRDLTRKVVYNTNFDFHTSPAATWRDTLYFIMAPHPPTPQELPQVCRDILIKY  585
              VKKQFY+RD  + V YN+NFD + +PA  WRDT    MAP+P  P+++P+V RDILI+Y
Sbjct  123   HVKKQFYNRDPLKPVGYNSNFDLYRAPATNWRDTFRCYMAPNPAKPEDMPEVFRDILIEY  182

Query  586   SNSVQKLGLCLLELFSESLGLHKNHLEKLGCAVGLSIFGQYYPACPEPELTFALRDHSDS  765
             S  V KLG  L EL SE+LGL  ++L  + C++GL + G YYP+CP+PELT     H+D+
Sbjct  183   SKQVMKLGKLLFELLSEALGLKPSYLNDIDCSLGLLLGGHYYPSCPQPELTMGASKHADN  242

Query  766   GFFTVLNQDTQIGGLQVLHENQWVDVPPLHGALVVNVADLLQLITNDKFKSVVHRVIAQK  945
              F TVL QD  IGGLQVLH+N+W+DVPP+ GALVVN+ DLLQ+++ND+FKS  HRV+A +
Sbjct  243   DFLTVLLQD-HIGGLQVLHQNKWIDVPPMPGALVVNIGDLLQVLSNDRFKSAEHRVLANR  301

Query  946   IAPRVSVASFFRTIPGDVDAKKVYGPIKELVSDENPPLYRETTTEEYLMHFQKKGLDGTS  1125
             + PRVSV  FF T  G +  +++YGPIKEL+S++NPP YRETT  EY  HF  KGLDGTS
Sbjct  302   VGPRVSVPCFFTT--GMLPLERLYGPIKELLSEDNPPKYRETTIREYTAHFNDKGLDGTS  359

Query  1126  GLLRFRL  1146
              L  F+L
Sbjct  360   ALTHFKL  366



>ref|XP_009591157.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1-like [Nicotiana tomentosiformis]
Length=365

 Score =   416 bits (1069),  Expect = 6e-139, Method: Compositional matrix adjust.
 Identities = 198/362 (55%), Positives = 262/362 (72%), Gaps = 6/362 (2%)
 Frame = +1

Query  61    YDRKSELKAFDDMKTGVKGHVDSGIMKIPRIFIHDeikkeekeklkPAMASTYKVPIIDM  240
             YDR SEL  FD  K GVKG VD+G+ ++PRIF +       +    P   S   +P+ID+
Sbjct  10    YDRTSELIVFDSTKAGVKGLVDAGVTRVPRIF-YTAEDAYTEASNDPE-KSQINIPVIDL  67

Query  241   EGLHTDHTTRRSEIIKEIRDACQTWGFFQIINHGIPTQVLDEMIDGVRQFHELDSEVKKQ  420
             +G+  D   +RS I+++IRDA + WGFFQ++NHGIP  VL+EM++GVR+F+E D+EVKKQ
Sbjct  68    DGISKD-PIKRSAIVEKIRDASEVWGFFQVVNHGIPESVLEEMLNGVRRFYEQDTEVKKQ  126

Query  421   FYSRDLTRKVVYNTNFDFHTSPAATWRDTLYFIMAPHPPTPQELPQVCRDILIKYSNSVQ  600
             +Y+RD +++VVYN+NFD   + +A WRDT Y  M+P+PPT  ELP+ CRDILI+YS  ++
Sbjct  127   WYTRDNSKRVVYNSNFDLFGAASANWRDTTYCSMSPNPPTADELPEACRDILIEYSEHIK  186

Query  601   KLGLCLLELFSESLGLHKNHLEKLGCAVGLSIFGQYYPACPEPELTFALRDHSDSGFFTV  780
             KLG  L EL SE+LGL+ ++L  +GC+ GL++   YYPACPEPELT     HSDS FFTV
Sbjct  187   KLGCSLFELLSEALGLNPSYLNDIGCSEGLAVLYHYYPACPEPELTLGTSKHSDSDFFTV  246

Query  781   LNQDTQIGGLQVLHENQWVDVPPLHGALVVNVADLLQLITNDKFKSVVHRVIAQKIAPRV  960
             L QD   GGLQVLH+N WVDV PL GALVVN  +LLQLI+NDKFKS+ HRV+A ++ PRV
Sbjct  247   LLQDNS-GGLQVLHDNYWVDVHPLSGALVVNFGELLQLISNDKFKSIAHRVLASRVGPRV  305

Query  961   SVASFFRTIPGDVDAKKVYGPIKELVSDENPPLYRETTTEEYLMHFQKKGLDGTSGLLRF  1140
             SVA FF T  G   + +VYGPIKEL+S++NP  YRETT +++ +H+   GL G S LL F
Sbjct  306   SVACFFTT--GHSLSSRVYGPIKELLSEDNPARYRETTVKDFSVHYNATGLGGKSSLLDF  363

Query  1141  RL  1146
              +
Sbjct  364   MI  365



>ref|XP_006352055.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
[Solanum tuberosum]
Length=362

 Score =   415 bits (1066),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 203/378 (54%), Positives = 272/378 (72%), Gaps = 18/378 (5%)
 Frame = +1

Query  19    MATASTGGKADSGDYDRKSELKAFDDMKTGVKGHVDSGIMKIPRIFIHDeikkeekeklk  198
             MAT++   +     YD+ SELKAFDD K GVKG +D GI K+P+IFIH     E+     
Sbjct  1     MATSNNTQQK----YDKISELKAFDDTKGGVKGLIDGGITKLPQIFIHPHDSLEKI----  52

Query  199   PAMASTYKVPIIDMEGLHTDHTTRRSEIIKEIRDACQTWGFFQIINHGIPTQVLDEMIDG  378
                 S +  P+ID++ ++ ++     EI+K+I++A +TWGFFQ+INHGIP  VLDEM+ G
Sbjct  53    -PKNSNFIFPLIDLQNININN----KEIVKQIQEASETWGFFQVINHGIPIPVLDEMLRG  107

Query  379   VRQFHELDSEVKKQFYSRDLTRKVVYNTNFDFHT--SPAATWRDTLYFIMAPHPPTPQEL  552
              R+FHE   +VKK +YSRD+ RKV+YN NF+  +  S AA WRD+LY +MAP+P  P EL
Sbjct  108   TRRFHEQAIDVKKPYYSRDVARKVMYNCNFELFSEKSFAADWRDSLYSVMAPNPAKPDEL  167

Query  553   PQVCRDILIKYSNSVQKLGLCLLELFSESLGLHKNHLEKLGCAVGLSIFGQYYPACPEPE  732
             P+ CR+I+I+YSN V KLG  L+ELFSE LGL +NHL+++GCA GL I   YYP CP+PE
Sbjct  168   PETCREIIIEYSNHVMKLGYTLVELFSEGLGLKQNHLKEMGCAEGLGILCNYYPKCPQPE  227

Query  733   LTFALRDHSDSGFFTVLNQDTQIGGLQVLHENQWVDVPPLHGALVVNVADLLQLITNDKF  912
             L      H+DS FFTVL QD  IGGLQVLH+NQWVDVPP+HGAL++N+ D+LQLI+NDK+
Sbjct  228   LALGSSRHADSDFFTVLLQD-DIGGLQVLHKNQWVDVPPIHGALIINIGDILQLISNDKY  286

Query  913   KSVVHRVIAQKIAPRVSVASFFRTIPGDVDAKKVYGPIKELVSDENPPLYRETTTEEYLM  1092
             KSV HRV+A  I PR+SVASFF T  G +++ ++YGPI+EL+S +NPP YR TT +++  
Sbjct  287   KSVDHRVLANTIGPRISVASFFST--GLLESSRIYGPIEELLSKDNPPKYRATTLKDFFE  344

Query  1093  HFQKKGLDGTSGLLRFRL  1146
             +  KKG D  S L  +++
Sbjct  345   YSSKKGFDNNSNLSHYKI  362



>ref|XP_006341092.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1-like isoform X2 [Solanum tuberosum]
Length=364

 Score =   415 bits (1066),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 199/368 (54%), Positives = 257/368 (70%), Gaps = 8/368 (2%)
 Frame = +1

Query  43    KADSGDYDRKSELKAFDDMKTGVKGHVDSGIMKIPRIFIHDeikkeekeklkPAMASTYK  222
               +   YDRK+EL+AFD+ K GVKG VD+GI K+PRIF+     ++            + 
Sbjct  5     NTNEAKYDRKAELQAFDETKAGVKGLVDAGITKVPRIFVQPSTIEDSTIHSN----KKFS  60

Query  223   VPIIDMEGLHTDHTTRRSEIIKEIRDACQTWGFFQIINHGIPTQVLDEMIDGVRQFHELD  402
              PIID +G+  D   +R +I++E+  A +TWGFFQ+INHGIP+ V++EM DGV +F E D
Sbjct  61    FPIIDFDGIKED-LIKRKKIVQEVGQASETWGFFQVINHGIPSHVMEEMKDGVIRFFEQD  119

Query  403   SEVKKQFYSRDLTRKVVYNTNFDFHTSPAATWRDTLYFIMAPHPPTPQELPQVCRDILIK  582
             +EVKKQ+Y+RD  +   YN+NFD   +P   WRDT   I+AP PP P+ LP VCRD+L++
Sbjct  120   TEVKKQWYTRDFIKVFQYNSNFDLFGAPVTNWRDTFTAIIAPTPPNPEILPSVCRDVLLE  179

Query  583   YSNSVQKLGLCLLELFSESLGLHKNHLEKLGCAVGLSIFGQYYPACPEPELTFALRDHSD  762
             Y+N V KLG  L  + SE++GL  NHL+ +GCA GL   G YYP CP+PELT     H+D
Sbjct  180   YTNQVIKLGDTLFGILSEAIGLEPNHLKDMGCAEGLMALGHYYPECPQPELTLGTSKHAD  239

Query  763   SGFFTVLNQDTQIGGLQVLHENQWVDVPPLHGALVVNVADLLQLITNDKFKSVVHRVIAQ  942
             + F TVL QD  IGGLQVLH+N WVDVPP  GALVVN+ D+LQLI+NDKFKSV HRV+A 
Sbjct  240   NDFLTVLLQD-NIGGLQVLHQNHWVDVPPTPGALVVNIGDILQLISNDKFKSVDHRVLAN  298

Query  943   KIAPRVSVASFFRTIPGDVDAKKVYGPIKELVSDENPPLYRETTTEEYLMHFQKKGLDGT  1122
             K+ PRVS+A FF T    V  +++YGPIKEL+S+ NPP YRETT +E+  +F  KGLDGT
Sbjct  299   KVGPRVSLACFFMT--NFVPTQRLYGPIKELISEHNPPKYRETTIKEFTTYFNNKGLDGT  356

Query  1123  SGLLRFRL  1146
             S LL FRL
Sbjct  357   STLLHFRL  364



>ref|XP_006489565.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1-like [Citrus sinensis]
Length=360

 Score =   414 bits (1065),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 198/362 (55%), Positives = 263/362 (73%), Gaps = 7/362 (2%)
 Frame = +1

Query  61    YDRKSELKAFDDMKTGVKGHVDSGIMKIPRIFIHDeikkeekeklkPAMASTYKVPIIDM  240
             YDR+SELKAFDD K GVKG VD+GI +IPRIF       ++    +      Y  P +D+
Sbjct  6     YDRESELKAFDDTKAGVKGLVDAGIDRIPRIFYQPTDSLDKTPVPRDVQ---YTFPTVDL  62

Query  241   EGLHTDHTTRRSEIIKEIRDACQTWGFFQIINHGIPTQVLDEMIDGVRQFHELDSEVKKQ  420
             +G+  D   +R EI++ +R A +T GFFQ+INHGIP   L+E+ +GVR+F E D E+KK+
Sbjct  63    QGVDKD-PIQRKEIVERVRKASETSGFFQVINHGIPVSFLEELKEGVRRFFEQDFELKKE  121

Query  421   FYSRDLTRKVVYNTNFDFHTSPAATWRDTLYFIMAPHPPTPQELPQVCRDILIKYSNSVQ  600
             FY+RD+T+ V YN+NFD +++PAA WRDT+ F MAP+PP P+E+P  CRDI+++Y+ SV 
Sbjct  122   FYTRDITKMVGYNSNFDLYSAPAANWRDTILFNMAPNPPKPEEMPAACRDIVMEYTKSVM  181

Query  601   KLGLCLLELFSESLGLHKNHLEKLGCAVGLSIFGQYYPACPEPELTFALRDHSDSGFFTV  780
             KLG  L EL SE+LGL+ N+L+ + CA GL + G YYPACP+PELT    +H+D  F TV
Sbjct  182   KLGHLLFELLSEALGLNPNYLKGMDCAEGLMLLGHYYPACPQPELTMGATEHADDDFVTV  241

Query  781   LNQDTQIGGLQVLHENQWVDVPPLHGALVVNVADLLQLITNDKFKSVVHRVIAQKIAPRV  960
             L QD  IGGLQV ++N W+DVPP  GALV+N+ DLLQLI+NDKF S  HRV+A ++ PR+
Sbjct  242   LLQD-HIGGLQVRYQNHWIDVPPSPGALVINIGDLLQLISNDKFISAEHRVLANRVGPRI  300

Query  961   SVASFFRTIPGDVDAKKVYGPIKELVSDENPPLYRETTTEEYLMHFQKKGLDGTSGLLRF  1140
             SVASFF   P    + K+YGPIKEL+S+ENPP YRETT  ++++H  KKGLDGTS L  F
Sbjct  301   SVASFFS--PKRQPSSKLYGPIKELLSEENPPKYRETTVRDFVLHLHKKGLDGTSALEHF  358

Query  1141  RL  1146
             +L
Sbjct  359   KL  360



>gb|KDO44340.1| hypothetical protein CISIN_1g017376mg [Citrus sinensis]
Length=372

 Score =   415 bits (1066),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 199/375 (53%), Positives = 269/375 (72%), Gaps = 7/375 (2%)
 Frame = +1

Query  22    ATASTGGKADSGDYDRKSELKAFDDMKTGVKGHVDSGIMKIPRIFIHDeikkeekeklkP  201
             +T+ T    +   YDR+SELKAFD+ K GVKG VD+GI +IPRIF       ++    + 
Sbjct  5     STSETQATMELNHYDRESELKAFDNTKAGVKGLVDAGIDRIPRIFYLPTDCLDKTPVPRD  64

Query  202   AMASTYKVPIIDMEGLHTDHTTRRSEIIKEIRDACQTWGFFQIINHGIPTQVLDEMIDGV  381
                  Y  P +D++G+  D   +R EI++ +R A +T GFFQ+INHGIP  +L+E+ +GV
Sbjct  65    VQ---YIFPTVDLQGVDKD-PIQRKEIVERVRKASETSGFFQVINHGIPVSILEELKEGV  120

Query  382   RQFHELDSEVKKQFYSRDLTRKVVYNTNFDFHTSPAATWRDTLYFIMAPHPPTPQELPQV  561
             R+F E D E+KK+FY+RD+T+ V YN+NFD +++PAA WRDT+ F MAP+PP P+E+P  
Sbjct  121   RRFFEQDFELKKEFYTRDITKMVGYNSNFDLYSAPAANWRDTILFNMAPNPPKPEEMPAA  180

Query  562   CRDILIKYSNSVQKLGLCLLELFSESLGLHKNHLEKLGCAVGLSIFGQYYPACPEPELTF  741
             CRDI+++Y+ SV KLG  L EL SE+LGL+ N+L+ + CA GL + G YYPACP+PELT 
Sbjct  181   CRDIVMEYTKSVMKLGPLLFELLSEALGLNPNYLKGMDCAEGLLLLGHYYPACPQPELTM  240

Query  742   ALRDHSDSGFFTVLNQDTQIGGLQVLHENQWVDVPPLHGALVVNVADLLQLITNDKFKSV  921
                +H+D  F TVL QD  IGGLQV ++N W+DVPP  GALV+N+ DLLQLI+NDKF S 
Sbjct  241   GATEHADDDFVTVLLQD-HIGGLQVCYQNHWIDVPPSPGALVINIGDLLQLISNDKFISA  299

Query  922   VHRVIAQKIAPRVSVASFFRTIPGDVDAKKVYGPIKELVSDENPPLYRETTTEEYLMHFQ  1101
              HRV+A ++ PR+SVASFF   P    + K+YGPIKEL+S+ENPP YRETT  ++++H  
Sbjct  300   EHRVLANRVGPRISVASFFS--PKRQPSSKLYGPIKELLSEENPPKYRETTVRDFVLHLH  357

Query  1102  KKGLDGTSGLLRFRL  1146
             KKGLDGTS L  F+L
Sbjct  358   KKGLDGTSALEHFKL  372



>ref|XP_010274816.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1-like [Nelumbo nucifera]
Length=411

 Score =   416 bits (1068),  Expect = 4e-138, Method: Compositional matrix adjust.
 Identities = 203/362 (56%), Positives = 267/362 (74%), Gaps = 5/362 (1%)
 Frame = +1

Query  61    YDRKSELKAFDDMKTGVKGHVDSGIMKIPRIFIHDeikkeekeklkPAMASTYKVPIIDM  240
             YDR  EL+ FDD K+GVKG VD+G+ KIPRIF+      +EK            VP+IDM
Sbjct  55    YDRTKELREFDDTKSGVKGLVDTGVAKIPRIFLSPPDDLKEKVVSDRTHVDV-GVPVIDM  113

Query  241   EGLHTDHTTRRSEIIKEIRDACQTWGFFQIINHGIPTQVLDEMIDGVRQFHELDSEVKKQ  420
             +G+  ++   R EI++++R A +TWGFFQ++NHGIP  VL EMI+G+R+FHE D EVKK+
Sbjct  114   KGVR-ENPLLREEIVEKVRHASETWGFFQVVNHGIPLSVLHEMIEGIRRFHEQDIEVKKE  172

Query  421   FYSRDLTRKVVYNTNFDFHTSPAATWRDTLYFIMAPHPPTPQELPQVCRDILIKYSNSVQ  600
             FY RD TRKV +N+NFD + S AA WRDTL  +MAPHPP+ +ELP VCRD +++YS  V 
Sbjct  173   FYIRDPTRKVRFNSNFDLYRSRAANWRDTLLCVMAPHPPSLEELPLVCRDAVMEYSKQVA  232

Query  601   KLGLCLLELFSESLGLHKNHLEKLGCAVGLSIFGQYYPACPEPELTFALRDHSDSGFFTV  780
              LGL L EL SE+LGL+KN+L  +GCA G  +   YYPACPEP+LT  +  HSDS FFT+
Sbjct  233   SLGLTLFELLSEALGLNKNYLRDIGCAEGHVLINHYYPACPEPDLTLGISKHSDSDFFTL  292

Query  781   LNQDTQIGGLQVLHENQWVDVPPLHGALVVNVADLLQLITNDKFKSVVHRVIAQKIAPRV  960
             L QD+ IGGLQV HE+QWVDV P+ GALV+N+ DLLQLI+ND+FKSV HRV+A+++ PR+
Sbjct  293   LLQDS-IGGLQVRHEDQWVDVLPIPGALVINMGDLLQLISNDRFKSVEHRVVAKRVGPRI  351

Query  961   SVASFFRTIPGDVDAKKVYGPIKELVSDENPPLYRETTTEEYLMHFQKKGLDGTSGLLRF  1140
             SVA FF T      + ++YGPIKEL+S+ENPP+YRETT ++Y+ ++  KGL G + L  F
Sbjct  352   SVACFFGT--HLQPSTRIYGPIKELLSEENPPVYRETTVQDYVEYYNSKGLGGGTALSHF  409

Query  1141  RL  1146
             +L
Sbjct  410   KL  411



>gb|KDP40308.1| hypothetical protein JCGZ_02306 [Jatropha curcas]
Length=362

 Score =   414 bits (1063),  Expect = 4e-138, Method: Compositional matrix adjust.
 Identities = 207/363 (57%), Positives = 269/363 (74%), Gaps = 6/363 (2%)
 Frame = +1

Query  61    YDRKSELKAFDDMKTGVKGHVDSGIMKIPRIFIHDeikkeekeklkPAMASTYKVPIIDM  240
             Y RKSELKAFDD K GVKG  D+G+ KIPRIFIHD  K  +K      M S   +P+ID+
Sbjct  5     YARKSELKAFDDTKAGVKGLADAGVAKIPRIFIHDPSKINDKPFSGNDMHS---IPMIDL  61

Query  241   EGLHTDHTTRRSEIIKEIRDACQTWGFFQIINHGIPTQVLDEMIDGVRQFHELDSEVKKQ  420
              G+HT+ + RR ++I ++ +AC+ WGFFQ+INHGIP  +LD M+DG+R+FHE D+EVKKQ
Sbjct  62    GGIHTNASLRR-QVINKLGEACEKWGFFQMINHGIPETLLDGMLDGIRRFHEQDTEVKKQ  120

Query  421   FYSRDLTRKVVYNTNFDFHTSPAATWRDTLYFIMAPHPPTPQELPQVCRDILIKYSNSVQ  600
             F+SRD  +KV YNTNFDF+ +  A WRD+LY  MAP+PP P+ELP VCRD +I+YS+ V 
Sbjct  121   FFSRDEKKKVFYNTNFDFYRAKEANWRDSLYCAMAPNPPNPEELPAVCRDTMIEYSSKVM  180

Query  601   KLGLCLLELFSESLGLHKNHLEKLGCAVGLSIFGQYYPACPEPELTFALRDHSDSGFFTV  780
              LGL L EL SE+LGL+ NHL+ LGCA GL   G YYPACPEP LT  +  H+DSGF T+
Sbjct  181   DLGLTLFELLSEALGLNLNHLQDLGCAEGLYFIGHYYPACPEPNLTLGVGKHTDSGFLTI  240

Query  781   LNQDTQIGGLQVLHENQWVDVPPLHGALVVNVADLLQLITNDKFKSVVHRVIAQKIAPRV  960
             L QD Q+GGLQVLH+++W DV P+ GALVVNV D+ Q+++NDKFKSV HRV+A+ + PR+
Sbjct  241   LLQD-QLGGLQVLHDDKWFDVTPIPGALVVNVGDMSQILSNDKFKSVYHRVLAKNVGPRI  299

Query  961   SVASFFRT-IPGDVDAKKVYGPIKELVSDENPPLYRETTTEEYLMHFQKKGLDGTSGLLR  1137
             SVA F R+ +     + ++YGPIK+L+S ENPP Y+ETT  +Y+     KG+DG SGL  
Sbjct  300   SVACFLRSHLEQGTTSSRLYGPIKQLLSKENPPKYKETTMSDYVAKIYSKGIDGNSGLHY  359

Query  1138  FRL  1146
              +L
Sbjct  360   LKL  362



>ref|XP_009599435.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
[Nicotiana tomentosiformis]
Length=384

 Score =   414 bits (1065),  Expect = 4e-138, Method: Compositional matrix adjust.
 Identities = 199/366 (54%), Positives = 270/366 (74%), Gaps = 12/366 (3%)
 Frame = +1

Query  58    DYDRKSELKAFDDMKTGVKGHVDSGIMKIPRIFIHDeikkeekeklkPAMASTYKV-PII  234
             +YD+ SELKAFDD K GVKG VD+GI ++PRIFIH      E     P++   + + P+I
Sbjct  28    NYDKNSELKAFDDTKAGVKGLVDAGITEVPRIFIH-----PEGSGKSPSLEEKHFIFPLI  82

Query  235   DMEGLHTDHTTRRSEIIKEIRDACQTWGFFQIINHGIPTQVLDEMIDGVRQFHELDSEVK  414
             D+E ++ D   +  EI+++I DA +TWGFFQ+INHGIP  VLDEM+ G R+F E D EVK
Sbjct  83    DLENMNND-PVKHKEIVQKIGDASETWGFFQVINHGIPVSVLDEMLRGSRRFFEQDIEVK  141

Query  415   KQFYSRDLTRKVVYNTNFDFHT--SPAATWRDTLYFIMAPHPPTPQELPQVCRDILIKYS  588
             KQ+Y RD T++VVYN+NFD ++  + A  W D+LY  M P P  P+ELP+ CR+I+++YS
Sbjct  142   KQYYHRDYTQRVVYNSNFDLYSPKAIAVNWSDSLYSTMGPAPLDPEELPEACREIIMEYS  201

Query  589   NSVQKLGLCLLELFSESLGLHKNHLEKLGCAVGLSIFGQYYPACPEPELTFALRDHSDSG  768
             + V K+G  LLEL SE LGL  +HL+++GC+ GLSI   YYPACP+PEL   L  H+D+ 
Sbjct  202   HHVMKMGCTLLELLSECLGLKPSHLKEMGCSEGLSILCNYYPACPQPELAVGLSKHTDND  261

Query  769   FFTVLNQDTQIGGLQVLHENQWVDVPPLHGALVVNVADLLQLITNDKFKSVVHRVIAQKI  948
             FFTVL QD  +GGLQVLH+NQWVDVPP  GALV+N+ D+LQLI+NDK+KSV HR +++K+
Sbjct  262   FFTVLLQD-DLGGLQVLHQNQWVDVPPTPGALVINIGDVLQLISNDKYKSVEHRALSKKV  320

Query  949   APRVSVASFFRTIPGDVDAKKVYGPIKELVSDENPPLYRETTTEEYLMHFQKKGLDGTSG  1128
              PR+S+ASFF +  G + + K+YGPI+EL+S++NPP YR TT +++  +F KKGLDGTS 
Sbjct  321   GPRISIASFFSS--GPLPSSKLYGPIEELLSEDNPPKYRATTLKDFYDYFSKKGLDGTSN  378

Query  1129  LLRFRL  1146
             L   R+
Sbjct  379   LSHLRI  384



>ref|XP_006341091.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1-like isoform X1 [Solanum tuberosum]
Length=370

 Score =   414 bits (1064),  Expect = 5e-138, Method: Compositional matrix adjust.
 Identities = 200/362 (55%), Positives = 255/362 (70%), Gaps = 8/362 (2%)
 Frame = +1

Query  61    YDRKSELKAFDDMKTGVKGHVDSGIMKIPRIFIHDeikkeekeklkPAMASTYKVPIIDM  240
             YDRK+EL+AFD+ K GVKG VD+GI K+PR+F+     ++ K          +  PIID 
Sbjct  17    YDRKAELQAFDETKAGVKGLVDTGITKVPRMFVQPSNIEDSKIHSN----KKFSFPIIDF  72

Query  241   EGLHTDHTTRRSEIIKEIRDACQTWGFFQIINHGIPTQVLDEMIDGVRQFHELDSEVKKQ  420
             +G+  D   +R  I++E+  A +TWGFFQ+INHGIP+ VL+EM DGV  F E D+E KKQ
Sbjct  73    DGIKED-PIKRKNIVQEVSQASETWGFFQVINHGIPSHVLEEMKDGVISFFEQDTEEKKQ  131

Query  421   FYSRDLTRKVVYNTNFDFHTSPAATWRDTLYFIMAPHPPTPQELPQVCRDILIKYSNSVQ  600
             +Y+RDLT+   +N+NFD   +P   WRDT     AP PP P+ELP VCRD+L++Y+N V 
Sbjct  132   WYTRDLTKVFTFNSNFDLFGAPVTNWRDTFTATTAPIPPKPEELPSVCRDVLLEYTNQVI  191

Query  601   KLGLCLLELFSESLGLHKNHLEKLGCAVGLSIFGQYYPACPEPELTFALRDHSDSGFFTV  780
             KLG  L  + SE++GL  NHL+ +GCA GL   G YYP CP+PELT     H+D+ F TV
Sbjct  192   KLGDTLFGILSEAIGLEPNHLKDMGCAEGLMALGHYYPECPQPELTLGTSKHADNDFLTV  251

Query  781   LNQDTQIGGLQVLHENQWVDVPPLHGALVVNVADLLQLITNDKFKSVVHRVIAQKIAPRV  960
             L QD  IGGLQVLH+N WVDVPP  GALVVN+ D+LQLI+NDKFKSV HRV+A K+ PRV
Sbjct  252   LLQD-NIGGLQVLHQNHWVDVPPTPGALVVNIGDILQLISNDKFKSVDHRVLANKVGPRV  310

Query  961   SVASFFRTIPGDVDAKKVYGPIKELVSDENPPLYRETTTEEYLMHFQKKGLDGTSGLLRF  1140
             S+A FF T    V  +++YGPIKEL+S+ NPP YRETT +E+  +F  KGLDGTS LL F
Sbjct  311   SLACFFMT--NFVPTQRLYGPIKELISEHNPPKYRETTIKEFTTYFNNKGLDGTSTLLHF  368

Query  1141  RL  1146
             RL
Sbjct  369   RL  370



>gb|KDP40305.1| hypothetical protein JCGZ_02303 [Jatropha curcas]
Length=372

 Score =   414 bits (1064),  Expect = 5e-138, Method: Compositional matrix adjust.
 Identities = 204/365 (56%), Positives = 259/365 (71%), Gaps = 6/365 (2%)
 Frame = +1

Query  58    DYDRKSELKAFDDMKTGVKGHVDSGIMKIPRIFIHDeikkeekeklkPAMASTYKVPIID  237
             +Y R SELKAFD+ K GVKG VD+GI  +PRIF H+      K     A A  +  PI+D
Sbjct  8     EYCRTSELKAFDETKAGVKGLVDAGITVVPRIF-HNPPDDSHKISHTAADAK-FTFPIVD  65

Query  238   MEGLHTDHTTRRSEIIKEIRDACQTWGFFQIINHGIPTQVLDEMIDGVRQFHELDSEVKK  417
             +EG+H    +R+ EI+  +R+A +TWGFFQ+INHGIP  +++ M DG+R+F+E D ++KK
Sbjct  66    LEGVHKGLASRK-EIVDRLRNASETWGFFQVINHGIPMSLMEHMKDGIRRFYEQDIDLKK  124

Query  418   QFYSRDLTRKVVYNTNFDFHTSPAATWRDTLYFIMAPHPPTPQELPQVCRDILIKYSNSV  597
             +F+SRDLTRKVVYN+N   + SP+  WRD+  F MAP  P P+ELP VCRDIL+++S  V
Sbjct  125   EFFSRDLTRKVVYNSNLHLYASPSVNWRDSTLFRMAPDTPIPEELPAVCRDILMEFSMEV  184

Query  598   QKLGLCLLELFSESLGLHKNHLEKLGCAVGLSIFGQYYPACPEPELTFALRDHSDSGFFT  777
              KLG  LLEL SE+LGL  +HL+ + C  G  I G YYPACP+PELT     H+DSGFFT
Sbjct  185   MKLGNLLLELMSEALGLDPSHLKDMNCNEGFVIMGHYYPACPQPELTMGASKHADSGFFT  244

Query  778   VLNQDTQIGGLQVLHENQWVDVPPLHGALVVNVADLLQLITNDKFKSVVHRVIAQKIAPR  957
             VL QD  +GGLQVLH+NQW DVPP+ GALVVN+ D LQLITNDKF SV HRV+A ++ PR
Sbjct  245   VLLQD-HVGGLQVLHQNQWTDVPPVPGALVVNIGDFLQLITNDKFVSVEHRVLANRVGPR  303

Query  958   VSVASFFRTIPGDVDAKKVYGPIKELVSDENPPLYRETTTEEYLMHFQKKGLDGTSGLLR  1137
             +S A FF   P  +   +VYGPIKEL+S ENP  YRE T +EY  +F  KGLDGTS LL 
Sbjct  304   ISAACFF--TPTIMQKPRVYGPIKELLSAENPANYREATWKEYADYFNAKGLDGTSVLLP  361

Query  1138  FRLQK  1152
             F++  
Sbjct  362   FKISN  366



>ref|XP_011091187.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
3-like [Sesamum indicum]
Length=365

 Score =   414 bits (1063),  Expect = 5e-138, Method: Compositional matrix adjust.
 Identities = 204/365 (56%), Positives = 266/365 (73%), Gaps = 9/365 (2%)
 Frame = +1

Query  55    GDYDRKSELKAFDDMKTGVKGHVDSGIMKIPRIFIHDeikkeekeklkPAMASTYKVPII  234
              +YDR SELKAFDD KTGVKG VDSGI ++PRIFI    + +  + LKP+  S  K PII
Sbjct  9     ANYDRASELKAFDDTKTGVKGLVDSGITQVPRIFI--TPRNDSDKNLKPS-DSQLKFPII  65

Query  235   DMEGLHTDHTTRRSEIIKEIRDACQTWGFFQIINHGIPTQVLDEMIDGVRQFHELDSEVK  414
             D+E +  D   R  +++ E+RDA  TWGFFQ+INHGIP  VL+EM+DGVR+F+E D E +
Sbjct  66    DLENIDED-PIRHKKVVDEVRDASGTWGFFQVINHGIPGSVLEEMLDGVRKFYEQDPEER  124

Query  415   KQFYSRDLTRKVVYNTNFDFHTSPAATWRDTLYFIMAPHPPTPQELPQVCRDILIKYSNS  594
             K++Y+RD  R VVYN+NFD +++PAA WRDT +  MAPHPP+P+ELP VCRDI+ +Y+  
Sbjct  125   KKWYTRDRKRSVVYNSNFDLYSAPAANWRDTFFCKMAPHPPSPEELPAVCRDIMFEYTKQ  184

Query  595   VQKLGLCLLELFSESLGLHKNHLEKLGCAVGLSIFGQYYPACPEPELTFALRDHSDSGFF  774
             V KLG  L +L SE+LGL  NHL  + CA GL++   YYP CP+PELT     H+DS F 
Sbjct  185   VLKLGTSLFKLLSEALGLDANHLGDMKCADGLALLCHYYPFCPQPELTMGASQHADSDFL  244

Query  775   TVLNQDTQIGGLQVLHENQWVDVPPLHGALVVNVADLLQLITNDKFKSVVHRVIAQKIAP  954
             TVL  D  + GLQVL++NQW DVP + G+LVVNV DLLQLI+ND+  S  HRV+A  +  
Sbjct  245   TVLLNDN-VTGLQVLYQNQWFDVPSVPGSLVVNVGDLLQLISNDRLISSEHRVLANNVRS  303

Query  955   RVSVASFFRTIPGDVD-AKKVYGPIKELVSDENPPLYRETTTEEYLMHFQKKGLDGTSGL  1131
             RVSVA FFR+   D+D + ++YGPI+EL+S++NPP YR TT +EY+ ++  KGLDGTS L
Sbjct  304   RVSVACFFRS---DIDKSDELYGPIQELLSEDNPPKYRATTMKEYVNYYNAKGLDGTSAL  360

Query  1132  LRFRL  1146
             L FR+
Sbjct  361   LHFRV  365



>ref|XP_006420179.1| hypothetical protein CICLE_v10005202mg [Citrus clementina]
 gb|ESR33419.1| hypothetical protein CICLE_v10005202mg [Citrus clementina]
Length=372

 Score =   414 bits (1064),  Expect = 5e-138, Method: Compositional matrix adjust.
 Identities = 199/375 (53%), Positives = 269/375 (72%), Gaps = 7/375 (2%)
 Frame = +1

Query  22    ATASTGGKADSGDYDRKSELKAFDDMKTGVKGHVDSGIMKIPRIFIHDeikkeekeklkP  201
             +T+ T    +   YDR+SELKAFD+ K GVKG VD+GI +IPRIF       ++    + 
Sbjct  5     STSETQATMELNHYDRESELKAFDNTKAGVKGLVDAGIDRIPRIFYLPTDCLDKTPVPRD  64

Query  202   AMASTYKVPIIDMEGLHTDHTTRRSEIIKEIRDACQTWGFFQIINHGIPTQVLDEMIDGV  381
                  Y  P +D++G+  D   +R EI++ +R A +T GFFQ+INHGIP  +L+E+ +GV
Sbjct  65    VQ---YIFPTVDLQGVDKD-PIQRKEIVERVRKASETSGFFQVINHGIPVSILEEVKEGV  120

Query  382   RQFHELDSEVKKQFYSRDLTRKVVYNTNFDFHTSPAATWRDTLYFIMAPHPPTPQELPQV  561
             R+F E D E+KK+FY+RD+T+ V YN+NFD +++PAA WRDT+ F MAP+PP P+E+P  
Sbjct  121   RRFFEQDFELKKEFYTRDITKMVGYNSNFDLYSAPAANWRDTILFNMAPNPPKPEEMPAA  180

Query  562   CRDILIKYSNSVQKLGLCLLELFSESLGLHKNHLEKLGCAVGLSIFGQYYPACPEPELTF  741
             CRDI+++Y+ SV KLG  L EL SE+LGL+ N+L+ + CA GL + G YYPACP+PELT 
Sbjct  181   CRDIVMEYTKSVMKLGPLLFELLSEALGLNPNYLKGMDCAEGLLLLGHYYPACPQPELTM  240

Query  742   ALRDHSDSGFFTVLNQDTQIGGLQVLHENQWVDVPPLHGALVVNVADLLQLITNDKFKSV  921
                +H+D  F TVL QD  IGGLQV ++N W+DVPP  GALV+N+ DLLQLI+NDKF S 
Sbjct  241   GATEHADDDFVTVLLQD-HIGGLQVCYQNHWIDVPPSPGALVINIGDLLQLISNDKFISA  299

Query  922   VHRVIAQKIAPRVSVASFFRTIPGDVDAKKVYGPIKELVSDENPPLYRETTTEEYLMHFQ  1101
              HRV+A ++ PR+SVASFF   P    + K+YGPIKEL+S+ENPP YRETT  ++++H  
Sbjct  300   EHRVLANRVGPRISVASFFS--PKRQPSSKLYGPIKELLSEENPPKYRETTVRDFVLHLH  357

Query  1102  KKGLDGTSGLLRFRL  1146
             KKGLDGTS L  F+L
Sbjct  358   KKGLDGTSALEHFKL  372



>ref|XP_009626886.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
[Nicotiana tomentosiformis]
Length=372

 Score =   414 bits (1063),  Expect = 7e-138, Method: Compositional matrix adjust.
 Identities = 196/365 (54%), Positives = 264/365 (72%), Gaps = 10/365 (3%)
 Frame = +1

Query  58    DYDRKSELKAFDDMKTGVKGHVDSGIMKIPRIFIHDeikkeekeklkPAMASTYKVPIID  237
             +YD++SELKAFDD K GVKG +D GI K+PRIFIH    +  +    P + S +  P+ID
Sbjct  16    NYDKQSELKAFDDTKAGVKGLIDVGITKVPRIFIH---PEALENPSSPKITS-FIFPLID  71

Query  238   MEGLHTDHTTRRSEIIKEIRDACQTWGFFQIINHGIPTQVLDEMIDGVRQFHELDSEVKK  417
             ++ ++ D   +  EI+ +IRDA +TWGFFQ+INHGIP  VLDEM+ G R+FHE + +VKK
Sbjct  72    LQNMNKD-PIKHKEIVSKIRDAAETWGFFQVINHGIPVSVLDEMLRGARRFHEQEIDVKK  130

Query  418   QFYSRDLTRKVVYNTNFDFHTSPA--ATWRDTLYFIMAPHPPTPQELPQVCRDILIKYSN  591
              +YSRD+ RKV+YN NFD  +  A  A WRD+LY +MAP P  P+ELP+ CR+I+I+YS+
Sbjct  131   PYYSRDVARKVMYNCNFDLFSEKALAANWRDSLYSVMAPTPAKPEELPETCREIVIEYSD  190

Query  592   SVQKLGLCLLELFSESLGLHKNHLEKLGCAVGLSIFGQYYPACPEPELTFALRDHSDSGF  771
              V KLG  LLEL SE +GL  NHL+++ CA GL I   YYPACP+PEL      H+D+ F
Sbjct  191   HVMKLGCNLLELLSEGVGLKPNHLKEMDCAEGLGILCNYYPACPQPELAIGTSRHADNDF  250

Query  772   FTVLNQDTQIGGLQVLHENQWVDVPPLHGALVVNVADLLQLITNDKFKSVVHRVIAQKIA  951
             FTVL QD   GGLQV H+N WVDVPP  GALV+N+ D+LQLI+NDK+KS+ HRV+  K+ 
Sbjct  251   FTVLLQD-DFGGLQVFHQNHWVDVPPTPGALVINIGDILQLISNDKYKSIEHRVLTNKVG  309

Query  952   PRVSVASFFRTIPGDVDAKKVYGPIKELVSDENPPLYRETTTEEYLMHFQKKGLDGTSGL  1131
             PR+S+ASFF T  G + + ++YGPI+EL+S++NPP YR TT +++  +  +KGLDG S L
Sbjct  310   PRISIASFFGT--GPLASSRIYGPIEELLSEDNPPKYRATTLKDFFEYSSQKGLDGNSNL  367

Query  1132  LRFRL  1146
               +R+
Sbjct  368   SHYRI  372



>ref|XP_010093417.1| Deacetoxyvindoline 4-hydroxylase [Morus notabilis]
 gb|EXB54023.1| Deacetoxyvindoline 4-hydroxylase [Morus notabilis]
Length=366

 Score =   413 bits (1061),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 198/363 (55%), Positives = 266/363 (73%), Gaps = 13/363 (4%)
 Frame = +1

Query  61    YDRKSELKAFDDMKTGVKGHVDSGIMKIPRIFIHDeikkeekeklkPAMASTYKVPIIDM  240
             YDR+SEL+AFDD KTGVKG V++G+ +IPR+FIHD+ K  E +    +  S Y +PII++
Sbjct  16    YDRESELRAFDDAKTGVKGLVEAGVSRIPRVFIHDKDKLGEIKLA--SGDSKYSIPIINI  73

Query  241   EGLHTDHTTRRSEIIKEIRDACQTWGFFQIINHGIPTQVLDEMIDGVRQFHELDSEVKKQ  420
             EG++   T R+ EI+ E+R+AC+ WG FQ+INHGI +  LDEMI+G+R+FHE D E++K+
Sbjct  74    EGVNKSATIRK-EIVDEVREACEKWGCFQVINHGISSNTLDEMIEGIRRFHEQDPEIRKK  132

Query  421   FYSRDLTRKVVYNTNFDFHTSPAATWRDTLYFIMAPHPPTPQELPQVCRDILIKYSNSVQ  600
             FY+R+ T K  YNTNFDF+ S AATWRDT+Y  MAP+PP P++LPQ+CRDI++ YS  ++
Sbjct  133   FYTREYTEKFSYNTNFDFYRSSAATWRDTIYCSMAPNPPNPEDLPQLCRDIMMAYSEKIR  192

Query  601   KLGLCLLELFSESLGLHKNHLEKLGCAVGLSIFGQYYPACPEPELTFALRDHSDSGFFTV  780
              LG  LLEL SE+LGL+ NHL  + CA G    G YYPACP+P+LT  +  H+DS F  V
Sbjct  193   SLGFTLLELLSEALGLNPNHLGDMDCAKGQFFAGNYYPACPQPDLTLGIAKHTDSAFMNV  252

Query  781   LNQDTQIGGLQVLHENQWVDVPPLHGALVVNVADLLQLITNDKFKSVVHRVIAQKIAPRV  960
             L QD QIGGLQVLH++QWV+V P  G+L++        I+N KFKSV HRV+AQ   PR+
Sbjct  253   LLQD-QIGGLQVLHQHQWVNVTPTPGSLII--------ISNGKFKSVCHRVLAQNGGPRI  303

Query  961   SVASFFRTIPGDVDAK-KVYGPIKELVSDENPPLYRETTTEEYLMHFQKKGLDGTSGLLR  1137
             SVAS FR    D ++  +VYGPIKEL+S+E PP+Y+ETT ++Y+ +   KGLDG  GL +
Sbjct  304   SVASVFRNTEHDQESGPRVYGPIKELLSEEYPPIYKETTMQDYISYIYTKGLDGKPGLDQ  363

Query  1138  FRL  1146
             F L
Sbjct  364   FML  366



>gb|AAD38147.1|AF139500_1 unknown [Prunus armeniaca]
Length=370

 Score =   413 bits (1061),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 202/368 (55%), Positives = 264/368 (72%), Gaps = 9/368 (2%)
 Frame = +1

Query  55    GDYDRKSELKAFDDMKTGVKGHVDSGIMKIPRIFIH---DeikkeekeklkPAMASTYKV  225
              +YDRKSE+K FDD K GVKG VD+GI K+PRIF H   D+         +P   +  ++
Sbjct  8     ANYDRKSEVKTFDDTKEGVKGLVDAGITKVPRIF-HLPVDQYPINNTCDSEPT-KTQLRI  65

Query  226   PIIDMEGLHTDHT-TRRSEIIKEIRDACQTWGFFQIINHGIPTQVLDEMIDGVRQFHELD  402
             P+ID+EGL  D++ T+R E + ++ +A +TWGFFQI NHGIP  VL+E+ +GVR F E D
Sbjct  66    PVIDLEGLEYDNSPTKRKETVAKVGEASETWGFFQIANHGIPVDVLEEIKNGVRGFFEQD  125

Query  403   SEVKKQFYSRDLTRKVVYNTNFDFHTSPAATWRDTLYFIMAPHPPTPQELPQVCRDILIK  582
             +EVKK++Y+RD  R V+YN+NFD +++PA  WRDT    MAP+PP P++LPQVCRDIL++
Sbjct  126   TEVKKKYYTRDRFRPVIYNSNFDLYSAPATNWRDTFLCNMAPNPPKPEDLPQVCRDILVE  185

Query  583   YSNSVQKLGLCLLELFSESLGLHKNHLEKLGCAVGLSIFGQYYPACPEPELTFALRDHSD  762
             YS  V KLG  L EL SE+LGL  +HL  + C++GL I G YYP CP+PELT     H+D
Sbjct  186   YSKQVMKLGKLLFELLSEALGLKPSHLNDMDCSLGLQILGHYYPPCPQPELTLGTSKHAD  245

Query  763   SGFFTVLNQDTQIGGLQVLHENQWVDVPPLHGALVVNVADLLQLITNDKFKSVVHRVIAQ  942
             + F TVL QD  IGGLQVLH+N W+DV P+ GALVVN+ DLLQLI+ND+F+SV HRV+A 
Sbjct  246   NDFITVLLQD-HIGGLQVLHQNTWIDVLPVPGALVVNIGDLLQLISNDRFRSVEHRVLAN  304

Query  943   KIAPRVSVASFFRTIPGDVDAKKVYGPIKELVSDENPPLYRETTTEEYLMHFQKKGLDGT  1122
             +  PRVSVA FF T  G +   ++YGPIKEL+S++N P YRETT ++Y  H   KGLDGT
Sbjct  305   RACPRVSVACFFST--GFLALPRIYGPIKELLSEDNLPKYRETTVKDYNAHHYNKGLDGT  362

Query  1123  SGLLRFRL  1146
               L  F+L
Sbjct  363   CALTHFKL  370



>ref|XP_010650059.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1-like [Vitis vinifera]
Length=368

 Score =   412 bits (1060),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 206/364 (57%), Positives = 262/364 (72%), Gaps = 11/364 (3%)
 Frame = +1

Query  64    DRKSELKAFDDMKTGVKGHVDSGIMKIPRIFIHDeikkeekeklkPAMASTYKVPIIDME  243
             D  SE KAFDD K GVKG VD+G+ KIPRIFIH +   ++K        S + +P ID++
Sbjct  13    DWNSETKAFDDTKLGVKGLVDAGVTKIPRIFIHPQHYLQDKLV---CEDSQFSIPTIDLQ  69

Query  244   GLHTDHTTRRSEIIKEIRDACQTWGFFQIINHGIPTQVLDEMIDGVRQFHELDSEVKKQF  423
             G+ +D    R++ I++I++AC+ WGFFQI+NHGIP   L+EM+ GVR+FHE D+EVKK+F
Sbjct  70    GVTSD-AILRAKAIEKIQNACEKWGFFQIVNHGIPKSDLEEMLAGVRRFHEQDAEVKKEF  128

Query  424   YSRDLTRKVVYNTNFDFHTSPAATWRDTLYFIMAPHPPTPQELPQVCRDILIKYSNSVQK  603
             Y+RDL +KV++ +NFD   +P ATWRDTL  +M P  P P+ LP VCRDI + YS  VQ+
Sbjct  129   YTRDLRKKVLFLSNFDLFQAPTATWRDTLALVMYPILPEPESLPTVCRDIALAYSKQVQR  188

Query  604   LGLCLLELFSESLGLHKNHLEKLGCAVGLSIFGQYYPACPEPELTFALRDHSDSGFFTVL  783
             LG+ L EL S  LGL+ NHL+ + CA  LS  G YYPACPEPELT     HSD+ F T+L
Sbjct  189   LGITLFELLSVGLGLNPNHLKDMECAERLSFLGHYYPACPEPELTLGTSIHSDADFMTIL  248

Query  784   NQDTQIGGLQVLHENQWVDVPPLHGALVVNVADLLQLITNDKFKSVVHRVIAQKIAPRVS  963
              QD Q+GGLQV HENQWVDVPP+ GAL+VNV D LQL+TNDK KSV HRVIA++  PR+S
Sbjct  249   LQD-QLGGLQVFHENQWVDVPPIPGALIVNVGDFLQLLTNDKLKSVHHRVIAKQKGPRIS  307

Query  964   VASFFRT---IPGDVDAKKVYGPIKELVSDENPPLYRETTTEEYLMHFQKKGLDGTSGLL  1134
             VA FFRT    PG  D  + YGPI+EL+S+ENPP+Y+ETT  +YL H+  KG  GTS LL
Sbjct  308   VACFFRTEFFEPG--DNLRSYGPIQELLSEENPPVYKETTANDYLKHYYSKG-SGTSSLL  364

Query  1135  RFRL  1146
               +L
Sbjct  365   HLKL  368



>ref|XP_004247920.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
isoform X2 [Solanum lycopersicum]
Length=375

 Score =   413 bits (1061),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 197/367 (54%), Positives = 265/367 (72%), Gaps = 10/367 (3%)
 Frame = +1

Query  55    GDYDRKSELKAFDDMKTGVKGHVDSGIMKIPRIFIHDeikkeekeklkPAMASTYKVPII  234
             G YDR SELKAFDD K GVKG VD+GI ++PRIF+     +E          + +  P+I
Sbjct  16    GSYDRMSELKAFDDTKAGVKGIVDAGITEVPRIFVQPTKIEECVRN----CETKFIFPVI  71

Query  235   DMEGLHTDHTTRRSEIIKEIRDACQTWGFFQIINHGIPTQVLDEMIDGVRQFHELDSEVK  414
             D+EG+  D   +  EI+  +RDA +TWGFFQ++NHGIP  V++EM+ G R+F E   ++K
Sbjct  72    DLEGIDKD-PIKHKEIVDRVRDASETWGFFQVVNHGIPLSVMEEMLQGTRRFFEQHVDIK  130

Query  415   KQFYSRDLTRKVVYNTNFDFHTS--PAATWRDTLYFIMAPHPPTPQELPQVCRDILIKYS  588
             KQ+Y+RD T+K+V+ +NFD ++   PA  WRD+++ +MAP+ P+P+ELP  CR+IL+++S
Sbjct  131   KQYYTRDNTKKIVHVSNFDLYSPSVPATNWRDSIFCLMAPNHPSPEELPTACREILMEFS  190

Query  589   NSVQKLGLCLLELFSESLGLHKNHLEKLGCAVGLSIFGQYYPACPEPELTFALRDHSDSG  768
             N V  LG  L EL SE LGL+ +HL  + CA GL + G YYPACP+PELT     HSD+ 
Sbjct  191   NHVMTLGKSLFELLSEGLGLNPSHLNDIDCAEGLRVLGHYYPACPQPELTIGTNKHSDND  250

Query  769   FFTVLNQDTQIGGLQVLHENQWVDVPPLHGALVVNVADLLQLITNDKFKSVVHRVIAQKI  948
             F TVL QD QIGGLQVLHE QW+DVPP  GALVVN+ DLLQLI+NDK+ SV HRV++ K+
Sbjct  251   FITVLLQD-QIGGLQVLHETQWIDVPPTPGALVVNIGDLLQLISNDKYLSVEHRVLSNKV  309

Query  949   APRVSVASFFRTIPGDVDAKKVYGPIKELVSDENPPLYRETTTEEYLMHFQKKGLDGTSG  1128
              PR+SVA FF T  G +   K+YGPIKEL+SD++PP YR TT ++Y  +F++KGLDGTS 
Sbjct  310   GPRISVACFFYT--GSLPTTKLYGPIKELLSDDSPPKYRATTVKDYADYFREKGLDGTSA  367

Query  1129  LLRFRLQ  1149
             LL +++Q
Sbjct  368   LLHYKIQ  374



>ref|XP_010262288.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
[Nelumbo nucifera]
Length=375

 Score =   413 bits (1061),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 201/364 (55%), Positives = 266/364 (73%), Gaps = 6/364 (2%)
 Frame = +1

Query  52    SGDYDRKSELKAFDDMKTGVKGHVDSGIMKIPRIFIHDeikkeekeklkPAMASTYKVPI  231
             + DYDR  ELK FDD K GVKG VDSGI+K+PRIFI D   K +++ +  +      VP+
Sbjct  14    ASDYDRMKELKEFDDTKAGVKGLVDSGIVKVPRIFI-DPSLKSDEKLVISSDEKRSTVPV  72

Query  232   IDMEGLHTDHTTRRSEIIKEIRDACQTWGFFQIINHGIPTQVLDEMIDGVRQFHELDSEV  411
             ID+ G+H D   RR +++ ++R A +TWGFFQ++NHGIPT VLDEM+ GVR+F+E D EV
Sbjct  73    IDLNGIHED-AVRRKDVVDQVRHASETWGFFQVVNHGIPTSVLDEMLQGVRRFNEQDVEV  131

Query  412   KKQFYSRDLTRKVVYNTNFDFHTSPAATWRDTLYFIMAPHPPTPQELPQVCRDILIKYSN  591
             +K+FYSRD  +KVVYN+NF  + S A  WRDT + +M+P+PP+P+E+PQVCRDI+IKYS 
Sbjct  132   RKRFYSRDTNKKVVYNSNFVLYQSAAVNWRDTFHCLMSPNPPSPEEIPQVCRDIMIKYSG  191

Query  592   SVQKLGLCLLELFSESLGLHKNHLEKLGCAVGLSIFGQYYPACPEPELTFALRDHSDSGF  771
              V++L + LL L SE+L L  +HL  +GCA   +I   YYPACP+PELT     H+D+ F
Sbjct  192   QVERLAVTLLALLSEALMLKPSHLVDIGCAESHAIACHYYPACPQPELTLGTSKHADNDF  251

Query  772   FTVLNQDTQIGGLQVLHENQWVDVPPLHGALVVNVADLLQLITNDKFKSVVHRVIAQKIA  951
              T+L QD  IGGLQVLH+N W+DV PL GALVVN+  +LQ+I+ND+FKSV HRV+A+ I 
Sbjct  252   ITILLQDL-IGGLQVLHQNHWLDVTPLRGALVVNIGCVLQIISNDRFKSVEHRVVAKNIG  310

Query  952   PRVSVASFFRTIPGDVDAKKVYGPIKELVSDENPPLYRETTTEEYLMH-FQKKGLDGTSG  1128
             PRVSVA FF T     ++ K YGPIKEL+S+ENPP+YRETT  E+  + F K G DG+S 
Sbjct  311   PRVSVACFFPTTIQ--ESIKKYGPIKELLSEENPPIYRETTIPEFNSYFFSKGGFDGSSP  368

Query  1129  LLRF  1140
             +L +
Sbjct  369   VLDY  372



>ref|XP_004299419.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1-like [Fragaria vesca subsp. vesca]
Length=369

 Score =   412 bits (1058),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 199/364 (55%), Positives = 264/364 (73%), Gaps = 7/364 (2%)
 Frame = +1

Query  58    DYDRKSELKAFDDMKTGVKGHVDSGIMKIPRIFIHDeikkeekeklkPAMASTYKVPIID  237
             +YDRKSELKAFDD K GVKG VD+G+ ++PRIF H   +    +   P   +   +P+ID
Sbjct  12    NYDRKSELKAFDDTKEGVKGLVDAGVTEVPRIFHHQPDEYSIYDFNDPE-ETQISIPVID  70

Query  238   MEGLHTDHTTRRSEIIKEIRDACQTWGFFQIINHGIPTQVLDEMIDGVRQFHELDSEVKK  417
             ++GL    +T++ EI+ ++ +A +TWGFFQI+NHGIP  VL+E+ +GVR+F E D+EVKK
Sbjct  71    LDGLL--DSTKQKEIVAKVGEASETWGFFQIVNHGIPVDVLEEVKNGVRRFFEQDTEVKK  128

Query  418   QFYSRDLTRK-VVYNTNFDFHTSPAATWRDTLYFIMAPHPPTPQELPQVCRDILIKYSNS  594
             Q Y RD  R  V+YN+NFD +++PA  WRDT    MAP P  P++LP+VCRDIL++YS+ 
Sbjct  129   QLYGRDHFRNPVIYNSNFDLYSAPATNWRDTFMCYMAPTPTKPEDLPEVCRDILVEYSDQ  188

Query  595   VQKLGLCLLELFSESLGLHKNHLEKLGCAVGLSIFGQYYPACPEPELTFALRDHSDSGFF  774
             V KLG  L EL SE+LGL   +L  + C  G+   G YYP CP+PELT     H+D+ F 
Sbjct  189   VMKLGKLLFELLSEALGLKPTYLNDIDCTEGILFLGHYYPPCPQPELTLGATKHADNAFL  248

Query  775   TVLNQDTQIGGLQVLHENQWVDVPPLHGALVVNVADLLQLITNDKFKSVVHRVIAQKIAP  954
             TVL QD  IGGLQVLH+N+W+DVPP+ GALVVN+ DLLQLI+ND+FKSV H+V+A +  P
Sbjct  249   TVLLQD-HIGGLQVLHQNKWIDVPPVPGALVVNIGDLLQLISNDRFKSVEHKVLANRRGP  307

Query  955   RVSVASFFRTIPGDVDAKKVYGPIKELVSDENPPLYRETTTEEYLMHFQKKGLDGTSGLL  1134
             RVS+ASFF T  G +   K+YGPIKEL+S+ENPP YRETT  +Y+ +F +KGLDGTS L 
Sbjct  308   RVSIASFFCT--GMLPLPKLYGPIKELLSEENPPKYRETTVRDYVAYFNEKGLDGTSALS  365

Query  1135  RFRL  1146
              F++
Sbjct  366   HFKV  369



>ref|XP_007035060.1| 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily 
protein, putative [Theobroma cacao]
 gb|EOY05986.1| 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily 
protein, putative [Theobroma cacao]
Length=374

 Score =   412 bits (1058),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 197/363 (54%), Positives = 261/363 (72%), Gaps = 7/363 (2%)
 Frame = +1

Query  58    DYDRKSELKAFDDMKTGVKGHVDSGIMKIPRIFIHDeikkeekeklkPAMASTYKVPIID  237
             +YDR SELKAFD+ K GVKG VD+GI ++PRIF     + E+         S   +P+ID
Sbjct  19    EYDRASELKAFDETKAGVKGLVDAGIKEVPRIFYQPRDQFEKDSVSGGTQVS---IPVID  75

Query  238   MEGLHTDHTTRRSEIIKEIRDACQTWGFFQIINHGIPTQVLDEMIDGVRQFHELDSEVKK  417
             +EG+  +  TR+ EI+++++ A +TWGFFQ++NHGIP  V++EM+DGVR+F E D E KK
Sbjct  76    LEGVEKNPITRK-EIVQKVQIASKTWGFFQVLNHGIPVSVMEEMMDGVRRFFEQDVEAKK  134

Query  418   QFYSRDLTRKVVYNTNFDFHTSPAATWRDTLYFIMAPHPPTPQELPQVCRDILIKYSNSV  597
             Q +SRD T++VVYN+NFD +++PAA WRDT++  MAP+PP P+ELP V RDI ++YS  +
Sbjct  135   QLFSRDYTKRVVYNSNFDLYSAPAAKWRDTVFCSMAPNPPKPEELPTVFRDITLEYSKQI  194

Query  598   QKLGLCLLELFSESLGLHKNHLEKLGCAVGLSIFGQYYPACPEPELTFALRDHSDSGFFT  777
              KLG  L EL SE+LGL+ ++L  + CA GL +   YYP CP+PELT     H+D+GF T
Sbjct  195   MKLGYLLFELLSEALGLNPDYLRDIDCAKGLVMLCHYYPICPQPELTLGSSKHADNGFLT  254

Query  778   VLNQDTQIGGLQVLHENQWVDVPPLHGALVVNVADLLQLITNDKFKSVVHRVIAQKIAPR  957
             VL QD  +GGLQVLHEN W+DVPP  GALV+N+ DLLQLI+ND   SV HRV+   + PR
Sbjct  255   VLLQD-HVGGLQVLHENHWIDVPPAPGALVINIGDLLQLISNDSCTSVAHRVLTNSVGPR  313

Query  958   VSVASFFRTIPGDVDAKKVYGPIKELVSDENPPLYRETTTEEYLMHFQKKGLDGTSGLLR  1137
             VSVASFF T    +   ++YGPIKEL+S+ENP  YRETT ++Y+ +F  KGL GTS L  
Sbjct  314   VSVASFFTT--ALLPDARLYGPIKELLSEENPSKYRETTVKDYITYFNAKGLSGTSPLPH  371

Query  1138  FRL  1146
             FRL
Sbjct  372   FRL  374



>ref|XP_008224380.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1-like [Prunus mume]
Length=366

 Score =   411 bits (1057),  Expect = 5e-137, Method: Compositional matrix adjust.
 Identities = 200/367 (54%), Positives = 266/367 (72%), Gaps = 4/367 (1%)
 Frame = +1

Query  46    ADSGDYDRKSELKAFDDMKTGVKGHVDSGIMKIPRIFIHDeikkeekeklkPAMASTYKV  225
              ++ +YDR+SELKAFDD K GVKG VD+G+ ++PRIF H    +        + A+ + +
Sbjct  4     TNNTNYDRQSELKAFDDTKEGVKGLVDAGVTEVPRIF-HQPPDQYIINSNFDSEATQFSI  62

Query  226   PIIDMEGLHTDHTTRRSEIIKEIRDACQTWGFFQIINHGIPTQVLDEMIDGVRQFHELDS  405
             P+ID+EGL  D  T+R+EI+ ++ +A +TWGFFQI NHGIP  VL+EM D VR F E D+
Sbjct  63    PLIDLEGLEFDSPTKRNEIVAKVGEASETWGFFQISNHGIPVGVLEEMKDSVRGFFEQDT  122

Query  406   EVKKQFYSRDLTRKVVYNTNFDFHTSPAATWRDTLYFIMAPHPPTPQELPQVCRDILIKY  585
             +VKKQFY+RD  + V YN+NFD + +PA  WRDT    MAP+P  P+++P+V RDI+I+Y
Sbjct  123   QVKKQFYNRDPLKPVGYNSNFDLYRAPATNWRDTFRCHMAPNPAKPEDMPEVFRDIVIEY  182

Query  586   SNSVQKLGLCLLELFSESLGLHKNHLEKLGCAVGLSIFGQYYPACPEPELTFALRDHSDS  765
             S  V KLG  L EL SE+LGL  ++L  + C +GL + G YYP+CP+PELT     H+D+
Sbjct  183   SKQVMKLGKLLFELLSEALGLKPSYLNDIDCGLGLLLGGHYYPSCPQPELTMGASKHADN  242

Query  766   GFFTVLNQDTQIGGLQVLHENQWVDVPPLHGALVVNVADLLQLITNDKFKSVVHRVIAQK  945
              F TVL QD  IGGLQVLH+N+W+DVPP+ GALVVN+ +LLQL++ND+FKSV HRV+A +
Sbjct  243   VFLTVLLQD-HIGGLQVLHQNKWIDVPPMPGALVVNIGNLLQLLSNDRFKSVEHRVLANR  301

Query  946   IAPRVSVASFFRTIPGDVDAKKVYGPIKELVSDENPPLYRETTTEEYLMHFQKKGLDGTS  1125
             + PRVSV  FF T  G +  +++YGPIKEL+S+ENPP YRETT  EY  HF  KGLDGTS
Sbjct  302   VGPRVSVPCFFTT--GMLPLERLYGPIKELLSEENPPKYRETTVREYTAHFNDKGLDGTS  359

Query  1126  GLLRFRL  1146
              L  F+L
Sbjct  360   ALTHFKL  366



>ref|XP_004246493.2| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1-like [Solanum lycopersicum]
Length=367

 Score =   411 bits (1057),  Expect = 5e-137, Method: Compositional matrix adjust.
 Identities = 198/362 (55%), Positives = 260/362 (72%), Gaps = 7/362 (2%)
 Frame = +1

Query  61    YDRKSELKAFDDMKTGVKGHVDSGIMKIPRIFIHDeikkeekeklkPAMASTYKVPIIDM  240
             Y+R +EL+AFD  K GVKG VD+GI K+PR+FI   + +  + +    +    + PIID+
Sbjct  13    YERMAELQAFDKTKAGVKGLVDAGITKVPRMFIQPSMIEHSRSENNNKLI---EFPIIDL  69

Query  241   EGLHTDHTTRRSEIIKEIRDACQTWGFFQIINHGIPTQVLDEMIDGVRQFHELDSEVKKQ  420
             +G+  D   ++  I++E+  A ++WGFFQ+INHGIP+ V+D M DGV +F E D+EVKKQ
Sbjct  70    DGIKED-PIKQKNIVQEVGHASESWGFFQVINHGIPSHVMDAMKDGVTRFFEQDTEVKKQ  128

Query  421   FYSRDLTRKVVYNTNFDFHTSPAATWRDTLYFIMAPHPPTPQELPQVCRDILIKYSNSVQ  600
             +Y+RDL ++  +N+NFD   +P   WRDT    +AP P  P++LP VCRDIL++Y+N V 
Sbjct  129   WYTRDLNKEFTFNSNFDLFRAPVTNWRDTFRATIAPIPLKPEQLPSVCRDILLEYTNQVM  188

Query  601   KLGLCLLELFSESLGLHKNHLEKLGCAVGLSIFGQYYPACPEPELTFALRDHSDSGFFTV  780
             KLG  L EL SE++GL  NHL+ +GCA GL   GQYYPACP+PELT     H+D+ F TV
Sbjct  189   KLGETLFELVSEAVGLEPNHLKDMGCAEGLLALGQYYPACPQPELTLGTSKHADNDFLTV  248

Query  781   LNQDTQIGGLQVLHENQWVDVPPLHGALVVNVADLLQLITNDKFKSVVHRVIAQKIAPRV  960
             L QD  IGGLQVLH++ WVDVPP  GALVVN+ DLLQLITNDKFKSV HRV+A K+ PRV
Sbjct  249   LLQD-NIGGLQVLHQSHWVDVPPTPGALVVNIGDLLQLITNDKFKSVDHRVLANKVGPRV  307

Query  961   SVASFFRTIPGDVDAKKVYGPIKELVSDENPPLYRETTTEEYLMHFQKKGLDGTSGLLRF  1140
             S+A FF T    +   ++YGPIKEL+S++NPP YRETT +E+  +F  KGLDGTS LL F
Sbjct  308   SLACFFMT--NCMTTHRMYGPIKELISEQNPPKYRETTIKEFTTYFNNKGLDGTSTLLHF  365

Query  1141  RL  1146
             RL
Sbjct  366   RL  367



>ref|XP_009347727.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1-like [Pyrus x bretschneideri]
Length=370

 Score =   411 bits (1056),  Expect = 7e-137, Method: Compositional matrix adjust.
 Identities = 196/371 (53%), Positives = 267/371 (72%), Gaps = 7/371 (2%)
 Frame = +1

Query  46    ADSGDYDRKSELKAFDDMKTGVKGHVDSGIMKIPRIF---IHDeikkeekeklkPAMAST  216
             A + +YDRKSE+KAFD+ K GVKG VD+GI ++PRIF      +           + A+ 
Sbjct  3     ATNTNYDRKSEVKAFDETKEGVKGLVDAGITEVPRIFHRPPESDDHYHINNSSSDSEATQ  62

Query  217   YKVPIIDMEGL-HTDHTTRRSEIIKEIRDACQTWGFFQIINHGIPTQVLDEMIDGVRQFH  393
             + +P+ID++GL   D  T+R EI+ ++ +A +TWGFFQIINH IP  VL+E+ DGVR F 
Sbjct  63    FSIPVIDLQGLDRLDSPTKRKEIVAKVGEASETWGFFQIINHEIPVGVLEEIKDGVRGFF  122

Query  394   ELDSEVKKQFYSRDLTRKVVYNTNFDFHTSPAATWRDTLYFIMAPHPPTPQELPQVCRDI  573
             ELD++VKK+ Y+RD  + ++YN+NFD +++P   WRDT    +AP+P  P++LPQVCRDI
Sbjct  123   ELDTQVKKELYTRDPFKPLIYNSNFDLYSAPVTNWRDTFMCYVAPNPTKPEDLPQVCRDI  182

Query  574   LIKYSNSVQKLGLCLLELFSESLGLHKNHLEKLGCAVGLSIFGQYYPACPEPELTFALRD  753
             L++YS  V KLG  L EL SE+LGL  +H+  + C+ GL I G YYP CP+PELT     
Sbjct  183   LVEYSMQVMKLGRLLFELLSEALGLKPSHMNDIDCSEGLVILGHYYPPCPQPELTIGTSS  242

Query  754   HSDSGFFTVLNQDTQIGGLQVLHENQWVDVPPLHGALVVNVADLLQLITNDKFKSVVHRV  933
             H+D+ F T+L QD  IGGLQVLH+++WVDVP + GALVVN+ DLLQLI+ND+FKS+ HRV
Sbjct  243   HADNDFLTILLQD-HIGGLQVLHQSKWVDVPLVPGALVVNIGDLLQLISNDRFKSIQHRV  301

Query  934   IAQKIAPRVSVASFFRTIPGDVDAKKVYGPIKELVSDENPPLYRETTTEEYLMHFQKKGL  1113
             +A ++ PR+SVASFF T  G +   K+YGPIKEL+S++NPP Y+ETT  +Y+ +F  KGL
Sbjct  302   LANRVGPRISVASFFCT--GMLPLTKLYGPIKELLSEDNPPKYKETTVRDYVAYFNNKGL  359

Query  1114  DGTSGLLRFRL  1146
             DGTS L  F+L
Sbjct  360   DGTSALSNFKL  370



>ref|XP_006341093.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1-like [Solanum tuberosum]
Length=367

 Score =   411 bits (1056),  Expect = 7e-137, Method: Compositional matrix adjust.
 Identities = 198/368 (54%), Positives = 259/368 (70%), Gaps = 7/368 (2%)
 Frame = +1

Query  43    KADSGDYDRKSELKAFDDMKTGVKGHVDSGIMKIPRIFIHDeikkeekeklkPAMASTYK  222
               +   Y+R +EL+AFD  K GVKG VD+GI+K+P +F+     ++ +           K
Sbjct  7     NTNEAKYERMAELQAFDKTKAGVKGLVDAGIIKVPSMFVQPLKVEDWRCHNNNKFI---K  63

Query  223   VPIIDMEGLHTDHTTRRSEIIKEIRDACQTWGFFQIINHGIPTQVLDEMIDGVRQFHELD  402
              PIID++G+  D   +R  I++E+  A ++WGFFQ+INHGIP+ V++ M DGV +F E D
Sbjct  64    FPIIDLDGIMED-PIKRKNIVQEVGHASESWGFFQVINHGIPSHVMEAMKDGVTRFFEQD  122

Query  403   SEVKKQFYSRDLTRKVVYNTNFDFHTSPAATWRDTLYFIMAPHPPTPQELPQVCRDILIK  582
             +EVKKQ+Y+RDLT++  +N+NFD   +P   WRDT    +AP PP P++LP VC+DIL++
Sbjct  123   TEVKKQWYTRDLTKEFTFNSNFDLFRAPVTNWRDTFRATIAPIPPKPEQLPSVCKDILLE  182

Query  583   YSNSVQKLGLCLLELFSESLGLHKNHLEKLGCAVGLSIFGQYYPACPEPELTFALRDHSD  762
             Y+N V  LG  L EL SE++GL  NHL+ +GCA GL   GQYYPACP+PELT     H+D
Sbjct  183   YTNQVMTLGDTLFELVSEAIGLEPNHLKDMGCAEGLLAIGQYYPACPQPELTLGTSKHAD  242

Query  763   SGFFTVLNQDTQIGGLQVLHENQWVDVPPLHGALVVNVADLLQLITNDKFKSVVHRVIAQ  942
             + F TVL QD  IGGLQVLH+N WVDVPP  GALVVN+ DLLQLITNDKFKSV HRV+A 
Sbjct  243   NDFLTVLLQD-NIGGLQVLHQNHWVDVPPTPGALVVNIGDLLQLITNDKFKSVDHRVLAN  301

Query  943   KIAPRVSVASFFRTIPGDVDAKKVYGPIKELVSDENPPLYRETTTEEYLMHFQKKGLDGT  1122
             K+  RVS+A FF T    V   ++YGPIKEL+S++NPP YRETT +E+  +F  KGLDGT
Sbjct  302   KVGTRVSMACFFMT--NCVTTHRLYGPIKELISEQNPPKYRETTIKEFTTYFNNKGLDGT  359

Query  1123  SGLLRFRL  1146
             S LL FRL
Sbjct  360   STLLHFRL  367



>ref|XP_008338503.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1-like [Malus domestica]
Length=371

 Score =   411 bits (1056),  Expect = 9e-137, Method: Compositional matrix adjust.
 Identities = 199/365 (55%), Positives = 261/365 (72%), Gaps = 9/365 (2%)
 Frame = +1

Query  61    YDRKSELKAFDDMKTGVKGHVDSGIMKIPRIFIHDeik---keekeklkPAMASTYKVPI  231
             YDRKSE+KAFDD K GVKG VD+GI ++PRIF                  + A+ + +P+
Sbjct  13    YDRKSEVKAFDDTKEGVKGLVDAGITEVPRIFYQPPEPDDHYSINITSSDSQATQFSIPV  72

Query  232   IDMEGLHTDHTTRRSEIIKEIRDACQTWGFFQIINHGIPTQVLDEMIDGVRQFHELDSEV  411
             ID+E L +   T+R EI+ ++ +A +TWGFFQI NHGI   VL+E+ DGVR F+E D+ V
Sbjct  73    IDLECLGS--PTKRKEIVAKVGEASETWGFFQIENHGISAGVLEEIKDGVRGFYEQDTRV  130

Query  412   KKQFYSRDLTRKVVYNTNFDFHTSPAATWRDTLYFIMAPHPPTPQELPQVCRDILIKYSN  591
             KK+ Y+R+  R V+Y++NFD +T+PA  WRD+    MAP+PP P++LP+VCRDIL++YS 
Sbjct  131   KKELYTRNHFRPVIYHSNFDLYTAPATNWRDSFMCYMAPNPPKPEDLPEVCRDILVEYSK  190

Query  592   SVQKLGLCLLELFSESLGLHKNHLEKLGCAVGLSIFGQYYPACPEPELTFALRDHSDSGF  771
              V KLG  L EL SE+LGL  +HL  + C+ GL + G YYPACP+PELT     H+DS F
Sbjct  191   QVMKLGKLLFELLSEALGLKPSHLLDIDCSEGLQVIGHYYPACPQPELTLGTSKHADSDF  250

Query  772   FTVLNQDTQIGGLQVLHENQWVDVPPLHGALVVNVADLLQLITNDKFKSVVHRVIAQKIA  951
              T+L QD  IGGLQV H N+W+DVPP+ GALVVN+ DLLQLI+ND+F+SV HRV+A +  
Sbjct  251   LTILLQD-HIGGLQV-HHNRWIDVPPVPGALVVNIGDLLQLISNDRFRSVEHRVLANRAG  308

Query  952   PRVSVASFFRTIPGDVDAKKVYGPIKELVSDENPPLYRETTTEEYLMHFQKKGLDGTSGL  1131
             PR+SVASFF  I G + + ++YGPIKEL+S+ENPP YRE T +EY  HF KKGLDGTS L
Sbjct  309   PRISVASFF--ITGLLPSARLYGPIKELLSEENPPKYREITVKEYYSHFNKKGLDGTSAL  366

Query  1132  LRFRL  1146
               F +
Sbjct  367   TYFNI  371



>ref|XP_007035061.1| 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily 
protein [Theobroma cacao]
 gb|EOY05987.1| 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily 
protein [Theobroma cacao]
Length=371

 Score =   410 bits (1055),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 202/363 (56%), Positives = 258/363 (71%), Gaps = 7/363 (2%)
 Frame = +1

Query  58    DYDRKSELKAFDDMKTGVKGHVDSGIMKIPRIFIHDeikkeekeklkPAMASTYKVPIID  237
             +YDR  ELKAFDD K GVKG VD+GI ++PRIF H   + E+      +  +  ++P+ID
Sbjct  16    EYDRTIELKAFDDTKAGVKGLVDAGIKEVPRIFQHPPDQSEKISV---SGVTQVRIPVID  72

Query  238   MEGLHTDHTTRRSEIIKEIRDACQTWGFFQIINHGIPTQVLDEMIDGVRQFHELDSEVKK  417
             +EG+  D  TR+ EI++++RDA +T GFFQ++NHGIP  VL+EM DG R+F E D EVKK
Sbjct  73    LEGVKKDPGTRQ-EIVEKVRDASKTLGFFQVVNHGIPLSVLEEMKDGARRFFEQDLEVKK  131

Query  418   QFYSRDLTRKVVYNTNFDFHTSPAATWRDTLYFIMAPHPPTPQELPQVCRDILIKYSNSV  597
             QF++RD T++V YN+NFD + SPAA WRDT+  +MAP PP P+ELP+V RDI+++YS  V
Sbjct  132   QFHTRDYTKRVAYNSNFDLYNSPAANWRDTVSSLMAPDPPMPEELPEVIRDIMMEYSKQV  191

Query  598   QKLGLCLLELFSESLGLHKNHLEKLGCAVGLSIFGQYYPACPEPELTFALRDHSDSGFFT  777
               LG  L EL SE+LGLH +HL  + CA GL +   YYPAC  PELT     H+D+ F T
Sbjct  192   MHLGYLLFELLSEALGLHPDHLRDMDCAKGLVMLSHYYPACSRPELTLGATKHADNDFLT  251

Query  778   VLNQDTQIGGLQVLHENQWVDVPPLHGALVVNVADLLQLITNDKFKSVVHRVIAQKIAPR  957
             VL QD  IGGLQV HENQWVDVPP  GALV+N+ DLL+LI+ND F SV HRV+A  +  R
Sbjct  252   VLLQD-HIGGLQVFHENQWVDVPPTPGALVINIGDLLKLISNDAFVSVEHRVLANSVGAR  310

Query  958   VSVASFFRTIPGDVDAKKVYGPIKELVSDENPPLYRETTTEEYLMHFQKKGLDGTSGLLR  1137
             VSVA FF T    +   + YGPIKEL+S++NPP YRETT  EY+ +   KGLDGTS L  
Sbjct  311   VSVACFFSTF--RLPDLRPYGPIKELLSEDNPPKYRETTVREYVDYVHAKGLDGTSALPH  368

Query  1138  FRL  1146
             F+L
Sbjct  369   FKL  371



>ref|XP_006354512.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
[Solanum tuberosum]
Length=375

 Score =   410 bits (1054),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 194/367 (53%), Positives = 267/367 (73%), Gaps = 10/367 (3%)
 Frame = +1

Query  55    GDYDRKSELKAFDDMKTGVKGHVDSGIMKIPRIFIHDeikkeekeklkPAMASTYKVPII  234
             G YDR SELKAFDD K GVKG VD+GI ++PRIF+     +E       +  + +  P+I
Sbjct  16    GSYDRMSELKAFDDTKAGVKGIVDAGITEVPRIFVQPTKIEECVS----SCETKFIFPVI  71

Query  235   DMEGLHTDHTTRRSEIIKEIRDACQTWGFFQIINHGIPTQVLDEMIDGVRQFHELDSEVK  414
             D+EG++ D   +  +I+ ++RDA +TWGFFQ++NHGIP  V++ M+ G R+F E D ++K
Sbjct  72    DLEGINKD-PIKHKQIVDKVRDASETWGFFQVVNHGIPLSVMEVMLQGTRRFFEQDVDIK  130

Query  415   KQFYSRDLTRKVVYNTNFDFHTS--PAATWRDTLYFIMAPHPPTPQELPQVCRDILIKYS  588
             KQ+Y+RD T+KVV+ +NFD ++   PA  WRD+++ +MAP+ P+P+ELP  CR+IL+++S
Sbjct  131   KQYYTRDNTKKVVHVSNFDLYSPSVPATNWRDSIFCLMAPNHPSPEELPIACREILMEFS  190

Query  589   NSVQKLGLCLLELFSESLGLHKNHLEKLGCAVGLSIFGQYYPACPEPELTFALRDHSDSG  768
             N V  LG  L EL SE LGL  +HL  + C+ GL + G YYPACP+PELT     HSD+ 
Sbjct  191   NHVMTLGKSLFELLSEGLGLDPSHLNNIDCSEGLRVLGHYYPACPQPELTIGTNKHSDND  250

Query  769   FFTVLNQDTQIGGLQVLHENQWVDVPPLHGALVVNVADLLQLITNDKFKSVVHRVIAQKI  948
             F TVL QD QIGGLQVLH+ QW+DVPP  GALVVN+ DLLQLI+NDK+ SV HRV++ K+
Sbjct  251   FITVLLQD-QIGGLQVLHKTQWIDVPPTPGALVVNIGDLLQLISNDKYLSVEHRVLSNKV  309

Query  949   APRVSVASFFRTIPGDVDAKKVYGPIKELVSDENPPLYRETTTEEYLMHFQKKGLDGTSG  1128
              PR+SVA FF T  G + + K+YGPI EL+S++NPP YR TT ++Y  +F++KGLDGTS 
Sbjct  310   GPRISVACFFYT--GSMPSSKLYGPITELLSEDNPPKYRATTVKDYADYFREKGLDGTSA  367

Query  1129  LLRFRLQ  1149
             LL +++Q
Sbjct  368   LLHYKIQ  374



>gb|AFK38092.1| unknown [Lotus japonicus]
Length=373

 Score =   409 bits (1051),  Expect = 5e-136, Method: Compositional matrix adjust.
 Identities = 198/361 (55%), Positives = 258/361 (71%), Gaps = 7/361 (2%)
 Frame = +1

Query  64    DRKSELKAFDDMKTGVKGHVDSGIMKIPRIFIHDeikkeekeklkPAMASTYKVPIIDME  243
             DR  EL+AFD+ K GVKG +D GI KIP +F H   K  +      +  + + +P+ID+ 
Sbjct  20    DRLRELQAFDETKAGVKGLIDEGITKIPSLFHHPPDKFVKASN---SDKTEHVIPVIDLA  76

Query  244   GLHTDHTTRRSEIIKEIRDACQTWGFFQIINHGIPTQVLDEMIDGVRQFHELDSEVKKQF  423
              +  D  + R E+I +IR+AC+TWGFFQ+ NHGI   VL+EM +GVR+F+E D+EVKK+ 
Sbjct  77    NVGKD-PSEREEVISKIREACETWGFFQVANHGIHVSVLEEMKEGVRRFYEQDAEVKKEL  135

Query  424   YSRDLTRKVVYNTNFDFHTSPAATWRDTLYFIMAPHPPTPQELPQVCRDILIKYSNSVQK  603
             YSRD  R VVYN+N+D ++SPA +WRDT    +AP+PP P++LP  CRDIL++Y  +V +
Sbjct  136   YSRDQKRPVVYNSNYDLYSSPALSWRDTFVCDLAPNPPKPEDLPVACRDILLEYGTNVMR  195

Query  604   LGLCLLELFSESLGLHKNHLEKLGCAVGLSIFGQYYPACPEPELTFALRDHSDSGFFTVL  783
             LG+ L EL SE+LGLH NHL+ + C  GL     YYPACPEP+LT     HSD  F TVL
Sbjct  196   LGIVLFELLSEALGLHPNHLKDMSCTEGLFSLCHYYPACPEPDLTMGTTKHSDGSFLTVL  255

Query  784   NQDTQIGGLQVLHENQWVDVPPLHGALVVNVADLLQLITNDKFKSVVHRVIAQKIAPRVS  963
              QD  IGGLQVL+++ WVD+PP+ GALVVN+ DLLQLITND+ KSV HRV+A +I PR+S
Sbjct  256   LQD-HIGGLQVLYQDNWVDIPPVPGALVVNIGDLLQLITNDRLKSVEHRVLANRIGPRIS  314

Query  964   VASFFRTIPGDVDAKKVYGPIKELVSDENPPLYRETTTEEYLMHFQKKGLDGTSGLLRFR  1143
             VA FFR+  G   + K+YGPIKEL S+ NPP YRETT ++Y+ +F  KGLDG S LL FR
Sbjct  315   VAMFFRS--GLQSSTKLYGPIKELSSENNPPKYRETTFDDYMAYFDAKGLDGISKLLHFR  372

Query  1144  L  1146
             L
Sbjct  373   L  373



>ref|XP_009784072.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1-like [Nicotiana sylvestris]
Length=361

 Score =   409 bits (1050),  Expect = 5e-136, Method: Compositional matrix adjust.
 Identities = 199/362 (55%), Positives = 258/362 (71%), Gaps = 9/362 (2%)
 Frame = +1

Query  61    YDRKSELKAFDDMKTGVKGHVDSGIMKIPRIFIHDeikkeekeklkPAMASTYKVPIIDM  240
             YDR SEL AFD  K GVKG VD+G+ K+PRIF +            P   S   +P+ID+
Sbjct  9     YDRTSELIAFDSTKAGVKGLVDAGVEKVPRIF-YTPEDAYTVASNDPE-KSQINIPVIDL  66

Query  241   EGLHTDHTTRRSEIIKEIRDACQTWGFFQIINHGIPTQVLDEMIDGVRQFHELDSEVKKQ  420
             +G+  D   +RS I+++IR   + WGFFQ++NHGIP  VL EM++GVR+F+E D+EVKK+
Sbjct  67    DGISKD-PIKRSAIVEKIR---EVWGFFQVVNHGIPESVLQEMLNGVRRFYEQDTEVKKR  122

Query  421   FYSRDLTRKVVYNTNFDFHTSPAATWRDTLYFIMAPHPPTPQELPQVCRDILIKYSNSVQ  600
             +Y+RD +++VVYN+NFD   + +A WRDT Y  MAP PPT  ELP+ CRDILI+YS  ++
Sbjct  123   WYTRDTSKRVVYNSNFDLFGAASANWRDTTYCSMAPDPPTADELPEACRDILIEYSEHIK  182

Query  601   KLGLCLLELFSESLGLHKNHLEKLGCAVGLSIFGQYYPACPEPELTFALRDHSDSGFFTV  780
             KLG  L EL SE+LGL  ++L  +GC+ GL++   YYPACPEPELT     HSDS FFTV
Sbjct  183   KLGCSLFELLSEALGLKPSYLNDIGCSEGLAVLYHYYPACPEPELTLGTSKHSDSDFFTV  242

Query  781   LNQDTQIGGLQVLHENQWVDVPPLHGALVVNVADLLQLITNDKFKSVVHRVIAQKIAPRV  960
             L QD   GGLQVLH+N WVDV PL GALVVN  +LLQLI+NDKFKS+ HRV+A ++ PRV
Sbjct  243   LLQDNS-GGLQVLHDNYWVDVHPLSGALVVNFGELLQLISNDKFKSIAHRVLASRVGPRV  301

Query  961   SVASFFRTIPGDVDAKKVYGPIKELVSDENPPLYRETTTEEYLMHFQKKGLDGTSGLLRF  1140
             SVA FF T  G   + +VYGPIKEL+S++NP  YRETT +++ +H+   GL G S LL F
Sbjct  302   SVACFFTT--GHSLSSRVYGPIKELLSEDNPARYRETTVKDFSVHYNATGLGGKSALLGF  359

Query  1141  RL  1146
             R+
Sbjct  360   RI  361



>ref|XP_007035057.1| 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily 
protein, putative [Theobroma cacao]
 gb|EOY05983.1| 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily 
protein, putative [Theobroma cacao]
Length=371

 Score =   409 bits (1050),  Expect = 6e-136, Method: Compositional matrix adjust.
 Identities = 205/378 (54%), Positives = 265/378 (70%), Gaps = 9/378 (2%)
 Frame = +1

Query  19    MATASTG--GKADSGDYDRKSELKAFDDMKTGVKGHVDSGIMKIPRIFIHDeikkeekek  192
             M  A+TG        +YDR SE+KAFDD K GVKG VD+G  ++PR+F   +   + ++ 
Sbjct  1     MVIANTGEVQTTSKPEYDRASEVKAFDDTKAGVKGLVDAGATEVPRMF--HQPPDKFEKT  58

Query  193   lkPAMASTYKVPIIDMEGLHTDHTTRRSEIIKEIRDACQTWGFFQIINHGIPTQVLDEMI  372
               P  A   ++P+I+++ +  D  TR+ EI++E+RDA + WGFFQIINHGIP  VL++M 
Sbjct  59    SVPGDAQV-RIPVINLDRVKEDPITRK-EIVEEVRDASKKWGFFQIINHGIPVGVLEDMK  116

Query  373   DGVRQFHELDSEVKKQFYSRDLTRKVVYNTNFDFHTSPAATWRDTLYFIMAPHPPTPQEL  552
               VR+F E D EV+KQFY+RD  + VVYN NFD HT+PAA WRD+++  MAP PP  +EL
Sbjct  117   HSVRRFFEQDVEVRKQFYTRDNMKTVVYNCNFDLHTAPAANWRDSVFCTMAPDPPKLEEL  176

Query  553   PQVCRDILIKYSNSVQKLGLCLLELFSESLGLHKNHLEKLGCAVGLSIFGQYYPACPEPE  732
             P+  RDI+++YSN +  LG  L EL SE+LGL+ +HL K+ CA GL +   YYPACP+PE
Sbjct  177   PESFRDIMVEYSNRLMSLGYLLFELISEALGLNPDHLVKIDCAKGLGVLCHYYPACPQPE  236

Query  733   LTFALRDHSDSGFFTVLNQDTQIGGLQVLHENQWVDVPPLHGALVVNVADLLQLITNDKF  912
             LT     H+DS F TVL QD  +G LQVLH NQW+DVPP  GALVVN+ DLLQLI+ND+ 
Sbjct  237   LTLGASKHADSDFLTVLLQD-HVGALQVLHGNQWIDVPPTPGALVVNIGDLLQLISNDRL  295

Query  913   KSVVHRVIAQKIAPRVSVASFFRTIPGDVDAKKVYGPIKELVSDENPPLYRETTTEEYLM  1092
              SV HRV+A  + PRVSVA FF T  G     ++YGPIKEL++++NPP YRETT  +YL 
Sbjct  296   LSVEHRVLANSVGPRVSVAGFFVT--GFRPNPRLYGPIKELLTEDNPPKYRETTVIDYLK  353

Query  1093  HFQKKGLDGTSGLLRFRL  1146
             HF  KGLDGTS LL FRL
Sbjct  354   HFNGKGLDGTSALLHFRL  371



>ref|XP_010104048.1| 1-aminocyclopropane-1-carboxylate oxidase-3-like protein [Morus 
notabilis]
 gb|EXB98149.1| 1-aminocyclopropane-1-carboxylate oxidase-3-like protein [Morus 
notabilis]
Length=392

 Score =   409 bits (1052),  Expect = 6e-136, Method: Compositional matrix adjust.
 Identities = 207/395 (52%), Positives = 268/395 (68%), Gaps = 26/395 (7%)
 Frame = +1

Query  28    ASTG-GKADSGDY----DRKSELKAFDDMKTGVKGHVDSGIMKIPRIFIHDeikkeekek  192
             A+TG  +A S  Y    DR  ELKAFD  K GVKG VDSGI +IPRIF H      ++  
Sbjct  2     AATGRDEAVSSSYKAKGDRLGELKAFDKTKAGVKGLVDSGITEIPRIFYHPSDHNLKQNS  61

Query  193   lkPAMASTYKVPIIDMEGL-HTDHTTRRSEIIKEIRDACQTWGFFQIINHGIPTQVLDEM  369
             +      +  +P+ID+ GL   D    R EI++ +R+A +TWGFFQI+NHGIP  VL++M
Sbjct  62    VSGDHTKS-NIPVIDLGGLISNDAVQARKEIVERVREASETWGFFQIVNHGIPESVLEDM  120

Query  370   IDGVRQFHELDSEVKKQFYSRDLTRKVVYNTNFDFHTSPAATWRDTLYFIMAPHPPTPQE  549
             IDGVR+FHE ++E KK F++RDLTR V+YN+NFD ++  +  WRD+    MAP+ P  +E
Sbjct  121   IDGVRRFHEQETEAKKTFFTRDLTRAVIYNSNFDLYSGISTNWRDSFVCTMAPNAPNLEE  180

Query  550   LPQVCRDILIKYSNSVQKLGLCLLELFSESLGLHKNHLEKLGCAVGLSIFGQYYPACPEP  729
             +P +CRDILI+YS  V K+G  + EL +E+LGL+ N+L  +GCA GL I G YYPACP+P
Sbjct  181   MPIICRDILIEYSKQVMKVGTLVFELLTEALGLNPNYLNAIGCAEGLMILGHYYPACPQP  240

Query  730   ELTFALRDHSDSGFFTVLNQDTQIGGLQVLHENQWVDVPPLHGALVVNVADLLQ------  891
             ELT     H+D+ F TVL QD  IGGLQVLH+N W+DVPP  GALVVN+ DLLQ      
Sbjct  241   ELTLGTTKHADNDFVTVLLQD-HIGGLQVLHDNDWIDVPPQPGALVVNIGDLLQASVFDL  299

Query  892   ----------LITNDKFKSVVHRVIAQKIAPRVSVASFFRTIPGDVDAKKVYGPIKELVS  1041
                       LI+NDKFKS+ HRV+A ++ PR+SVASFF T    +   K+YGPIKEL+S
Sbjct  300   LYSFVFTNFKLISNDKFKSIEHRVLASRVGPRISVASFFST--NLLPTTKLYGPIKELLS  357

Query  1042  DENPPLYRETTTEEYLMHFQKKGLDGTSGLLRFRL  1146
             ++NPP YRETT  +Y+ +F KKGLD TS L  FRL
Sbjct  358   EDNPPKYRETTMRDYVAYFNKKGLDETSALDHFRL  392



>ref|XP_011091183.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1-like isoform X1 [Sesamum indicum]
Length=401

 Score =   409 bits (1051),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 197/381 (52%), Positives = 263/381 (69%), Gaps = 7/381 (2%)
 Frame = +1

Query  7     REREMATASTGG-KADSGDYDRKSELKAFDDMKTGVKGHVDSGIMKIPRIFIHDeikkee  183
             ++ ++  A TG   + +   DR  EL+AFDD K GVKG VD+G+  +P+IF+      + 
Sbjct  27    KKMKIMEAMTGAVDSAASKLDRARELRAFDDTKAGVKGLVDAGVENVPQIFLLPRNNTKS  86

Query  184   keklkPAMASTYKVPIIDMEGLHTDHTTRRSEIIKEIRDACQTWGFFQIINHGIPTQVLD  363
                    +   + +P+ID++G+  D T R+ EI+  IR A +TWGFFQ++NHGIP  VL+
Sbjct  87    GTGDTAKV--NFTIPVIDLQGVEIDSTLRQ-EIVHRIRHASETWGFFQVVNHGIPVGVLE  143

Query  364   EMIDGVRQFHELDSEVKKQFYSRDLTRKVVYNTNFDFHTSPAATWRDTLYFIMAPHPPTP  543
             EM+ GVR+F+E D  VKKQFY+RD++RK V+N+NFD + SPAA WRDT +  MAP PP P
Sbjct  144   EMLRGVRRFNEQDVGVKKQFYTRDVSRKFVFNSNFDLYASPAANWRDTFFCFMAPTPPQP  203

Query  544   QELPQVCRDILIKYSNSVQKLGLCLLELFSESLGLHKNHLEKLGCAVGLSIFGQYYPACP  723
             QELP  CRDI I+YS  V  LG+ L  L SE+LGL  + L  + CA GL+  G YYP+CP
Sbjct  204   QELPASCRDIQIEYSRHVMTLGVRLFGLLSEALGLETSRLTNMDCANGLAFVGHYYPSCP  263

Query  724   EPELTFALRDHSDSGFFTVLNQDTQIGGLQVLHENQWVDVPPLHGALVVNVADLLQLITN  903
             +PELT     H+D GF TV+ QD  IGGLQ+  ENQW+DVPP+ GALV+N+ DLLQLI+N
Sbjct  264   QPELTLGASKHTDDGFLTVVLQD-HIGGLQIFAENQWIDVPPVPGALVINIGDLLQLISN  322

Query  904   DKFKSVVHRVIAQKIAPRVSVASFFRTIPGDVDAKKVYGPIKELVSDENPPLYRETTTEE  1083
             DKFKSV HRV+A +  PRVSVA FF T    + + K+YGPI++L+S++NP  YRETT EE
Sbjct  323   DKFKSVEHRVLANREGPRVSVACFFST--ALMPSSKLYGPIQDLLSEDNPAKYRETTVEE  380

Query  1084  YLMHFQKKGLDGTSGLLRFRL  1146
             +  +   KGLDG S LL F++
Sbjct  381   FFSYSYAKGLDGVSPLLHFKI  401



>ref|XP_004491714.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1-like [Cicer arietinum]
Length=373

 Score =   408 bits (1048),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 197/369 (53%), Positives = 258/369 (70%), Gaps = 7/369 (2%)
 Frame = +1

Query  43    KADSGDYDRKSELKAFDDMKTGVKGHVDSGIMKIPRIFIHDeikkeekeklkPAMASTYK  222
             + +   YDRK+E+KAFDD K GVKG VDSG+ KIPR+F   +    E      A  S   
Sbjct  11    EGNDSTYDRKAEVKAFDDSKAGVKGLVDSGVAKIPRMFYTKKFDITENL----ASDSNLS  66

Query  223   VPIIDMEGLHTDHTTRRSEIIKEIRDACQTWGFFQIINHGIPTQVLDEMIDGVRQFHELD  402
             VPIID + +  ++   R + I EIR AC  WGFFQ+INHGIP  +LDEMIDG+R+FHE D
Sbjct  67    VPIIDFKDV-ANNPALRVKAIDEIRSACHEWGFFQVINHGIPITILDEMIDGIRRFHEQD  125

Query  403   SEVKKQFYSRDLTRKVVYNTNFDFHTSPAATWRDTLYFIMAPHPPTPQELPQVCRDILIK  582
               V+K+FY+RDL +KV+Y +N    +  AA WRDT  F ++P P  P ++P +CRDI+I+
Sbjct  126   VNVRKEFYTRDLKKKVMYYSNVTLFSGQAANWRDTFGFAVSPDPFKPGDVPTICRDIVIE  185

Query  583   YSNSVQKLGLCLLELFSESLGLHKNHLEKLGCAVGLSIFGQYYPACPEPELTFALRDHSD  762
             YS  ++ LG  + EL SE+LGL  ++L++L CA G  I G YYP CPEPELT     H+D
Sbjct  186   YSEKIRGLGFTIFELLSEALGLDPSYLKELNCAEGQFILGHYYPPCPEPELTLGTTKHTD  245

Query  763   SGFFTVLNQDTQIGGLQVLHENQWVDVPPLHGALVVNVADLLQLITNDKFKSVVHRVIAQ  942
               F T+L QD Q+GGLQVLHENQWV+VPP  GALVVN+ DLLQ+ITND+F SV HRV++Q
Sbjct  246   GNFMTILLQD-QLGGLQVLHENQWVNVPPARGALVVNIGDLLQIITNDRFVSVYHRVLSQ  304

Query  943   KIAPRVSVASFFRTIPGDVDA-KKVYGPIKELVSDENPPLYRETTTEEYLMHFQKKGLDG  1119
              I PR+SVASFF   P  ++   KVYGPIKEL+S+ENPP+Y++ T +++L ++  KGLDG
Sbjct  305   NIGPRISVASFFVNSPDPIEGTSKVYGPIKELLSEENPPIYKDITIKDFLAYYYAKGLDG  364

Query  1120  TSGLLRFRL  1146
              S L  F+L
Sbjct  365   NSSLEPFKL  373



>ref|NP_172147.2| 2-oxoglutarate-dependent dioxygenase-like protein [Arabidopsis 
thaliana]
 sp|Q84MB3.1|ACCH1_ARATH RecName: Full=1-aminocyclopropane-1-carboxylate oxidase homolog 
1 [Arabidopsis thaliana]
 gb|AAP21238.1| At1g06620 [Arabidopsis thaliana]
 dbj|BAE99663.1| oxidoreductase like protein [Arabidopsis thaliana]
 gb|AEE28010.1| 2-oxoglutarate-dependent dioxygenase-like protein [Arabidopsis 
thaliana]
Length=365

 Score =   407 bits (1047),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 200/361 (55%), Positives = 255/361 (71%), Gaps = 7/361 (2%)
 Frame = +1

Query  64    DRKSELKAFDDMKTGVKGHVDSGIMKIPRIFIHDeikkeekeklkPAMASTYKVPIIDME  243
             DR + LKAFD+ KTGVKG +D+GI +IP IF             KP  +S + +P ID++
Sbjct  12    DRSTLLKAFDETKTGVKGLIDAGITEIPSIF---RAPPATLTSPKPPSSSDFSIPTIDLK  68

Query  244   GLHTDHTTRRSEIIKEIRDACQTWGFFQIINHGIPTQVLDEMIDGVRQFHELDSEVKKQF  423
             G  TD  TRRS ++++I DA + WGFFQ+INHGIP  VL++MIDG+R+FHE D+EVKK F
Sbjct  69    GGGTDSITRRS-LVEKIGDAAEKWGFFQVINHGIPMDVLEKMIDGIREFHEQDTEVKKGF  127

Query  424   YSRDLTRKVVYNTNFDFHTSPAATWRDTLYFIMAPHPPTPQELPQVCRDILIKYSNSVQK  603
             YSRD   K+VY++NFD  +SPAA WRDTL    AP PP P++LP  C +++I+YS  V K
Sbjct  128   YSRDPASKMVYSSNFDLFSSPAANWRDTLGCYTAPDPPRPEDLPATCGEMMIEYSKEVMK  187

Query  604   LGLCLLELFSESLGLHKNHLEKLGCAVGLSIFGQYYPACPEPELTFALRDHSDSGFFTVL  783
             LG  L EL SE+LGL+ NHL+ + C   L + G YYP CP+P+LT  L  HSD+ F T+L
Sbjct  188   LGKLLFELLSEALGLNTNHLKDMDCTNSLLLLGHYYPPCPQPDLTLGLTKHSDNSFLTIL  247

Query  784   NQDTQIGGLQVLHENQWVDVPPLHGALVVNVADLLQLITNDKFKSVVHRVIAQKIAPRVS  963
              QD  IGGLQVLH+  WVDVPP+ GALVVNV DLLQLITNDKF SV HRV+A    PR+S
Sbjct  248   LQD-HIGGLQVLHDQYWVDVPPVPGALVVNVGDLLQLITNDKFISVEHRVLANVAGPRIS  306

Query  964   VASFFRTIPGDVDAKKVYGPIKELVSDENPPLYRETTTEEYLMHFQKKGLDGTSGLLRFR  1143
             VA FF +    +   +VYGPIKE++S+ENPP YR+TT  EY   ++ KG DGTSGLL  +
Sbjct  307   VACFFSSY--LMANPRVYGPIKEILSEENPPNYRDTTITEYAKFYRSKGFDGTSGLLYLK  364

Query  1144  L  1146
             +
Sbjct  365   I  365



>ref|XP_011091188.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1-like [Sesamum indicum]
Length=368

 Score =   407 bits (1046),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 194/362 (54%), Positives = 257/362 (71%), Gaps = 6/362 (2%)
 Frame = +1

Query  61    YDRKSELKAFDDMKTGVKGHVDSGIMKIPRIFIHDeikkeekeklkPAMASTYKVPIIDM  240
             YDR SELKAFDD K+GVKG VD+G+ KIPR FI+D      +     + A     P+ID+
Sbjct  11    YDRLSELKAFDDSKSGVKGLVDAGVTKIPRFFINDNDMPGSEPCNFNSEAI---FPVIDL  67

Query  241   EGLHTDHTTRRSEIIKEIRDACQTWGFFQIINHGIPTQVLDEMIDGVRQFHELDSEVKKQ  420
              G+H  H   R+ I+  +++AC+ WGFFQIINH +P +V+DEMI GVR+FHE D+EVKK+
Sbjct  68    SGMH--HAANRAGIVSRVKEACEKWGFFQIINHEMPLRVMDEMIAGVRRFHEQDAEVKKK  125

Query  421   FYSRDLTRKVVYNTNFDFHTSPAATWRDTLYFIMAPHPPTPQELPQVCRDILIKYSNSVQ  600
             +Y RD+T+K  YN+NFD + + AA WRDT+  +MAPHPP PQELP VCRDI+ +YS  V 
Sbjct  126   YYGRDVTKKFQYNSNFDLYKTRAAMWRDTITCVMAPHPPDPQELPDVCRDIMFEYSKHVM  185

Query  601   KLGLCLLELFSESLGLHKNHLEKLGCAVGLSIFGQYYPACPEPELTFALRDHSDSGFFTV  780
             ++G  + EL SE+LGL+ ++L  +GC     I G Y PACPEPELTF +R H D G  T+
Sbjct  186   RVGHTVYELLSEALGLNPSYLRDIGCIESNFIVGHYSPACPEPELTFGIRSHVDFGLLTI  245

Query  781   LNQDTQIGGLQVLHENQWVDVPPLHGALVVNVADLLQLITNDKFKSVVHRVIAQKIAPRV  960
             L QD QIGGLQVLH+NQWVDV PL G+L++NV D +QLI+NDKFKSV HR +++++ PR+
Sbjct  246   LLQD-QIGGLQVLHQNQWVDVSPLPGSLIINVGDFIQLISNDKFKSVKHRALSKRVGPRI  304

Query  961   SVASFFRTIPGDVDAKKVYGPIKELVSDENPPLYRETTTEEYLMHFQKKGLDGTSGLLRF  1140
             SV  F +    D D  +VYGPIKEL+++E P +YRETT ++Y   +     DGT+ L  F
Sbjct  305   SVGVFIKPYYADGDNLRVYGPIKELLTEEEPAIYRETTYKDYERFYFANCDDGTTKLPYF  364

Query  1141  RL  1146
             RL
Sbjct  365   RL  366



>ref|XP_010326756.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
isoform X1 [Solanum lycopersicum]
Length=379

 Score =   407 bits (1047),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 197/371 (53%), Positives = 265/371 (71%), Gaps = 14/371 (4%)
 Frame = +1

Query  55    GDYDRKSELKAFDDMKTGVKGHVDSGIMKIPRIFIHDeikkeekeklkPAMASTYKVPII  234
             G YDR SELKAFDD K GVKG VD+GI ++PRIF+     +E          + +  P+I
Sbjct  16    GSYDRMSELKAFDDTKAGVKGIVDAGITEVPRIFVQPTKIEECVRN----CETKFIFPVI  71

Query  235   DMEGLHTDHTTRRSEIIKEIRDACQTWGFFQIINHGIPTQVLDEMIDGVRQFHELDSEVK  414
             D+EG+  D   +  EI+  +RDA +TWGFFQ++NHGIP  V++EM+ G R+F E   ++K
Sbjct  72    DLEGIDKD-PIKHKEIVDRVRDASETWGFFQVVNHGIPLSVMEEMLQGTRRFFEQHVDIK  130

Query  415   KQFYSRDLTRKVVYNTNFDFHTS--PAATWRDTLYFIMAPHPPTPQELP----QVCRDIL  576
             KQ+Y+RD T+K+V+ +NFD ++   PA  WRD+++ +MAP+ P+P+ELP      CR+IL
Sbjct  131   KQYYTRDNTKKIVHVSNFDLYSPSVPATNWRDSIFCLMAPNHPSPEELPTACSNCCREIL  190

Query  577   IKYSNSVQKLGLCLLELFSESLGLHKNHLEKLGCAVGLSIFGQYYPACPEPELTFALRDH  756
             +++SN V  LG  L EL SE LGL+ +HL  + CA GL + G YYPACP+PELT     H
Sbjct  191   MEFSNHVMTLGKSLFELLSEGLGLNPSHLNDIDCAEGLRVLGHYYPACPQPELTIGTNKH  250

Query  757   SDSGFFTVLNQDTQIGGLQVLHENQWVDVPPLHGALVVNVADLLQLITNDKFKSVVHRVI  936
             SD+ F TVL QD QIGGLQVLHE QW+DVPP  GALVVN+ DLLQLI+NDK+ SV HRV+
Sbjct  251   SDNDFITVLLQD-QIGGLQVLHETQWIDVPPTPGALVVNIGDLLQLISNDKYLSVEHRVL  309

Query  937   AQKIAPRVSVASFFRTIPGDVDAKKVYGPIKELVSDENPPLYRETTTEEYLMHFQKKGLD  1116
             + K+ PR+SVA FF T  G +   K+YGPIKEL+SD++PP YR TT ++Y  +F++KGLD
Sbjct  310   SNKVGPRISVACFFYT--GSLPTTKLYGPIKELLSDDSPPKYRATTVKDYADYFREKGLD  367

Query  1117  GTSGLLRFRLQ  1149
             GTS LL +++Q
Sbjct  368   GTSALLHYKIQ  378



>ref|XP_010510283.1| PREDICTED: probable 2-oxoacid dependent dioxygenase [Camelina 
sativa]
Length=359

 Score =   407 bits (1045),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 203/366 (55%), Positives = 259/366 (71%), Gaps = 11/366 (3%)
 Frame = +1

Query  55    GDYDRKSELKAFDDMKTGVKGHVDSGIMKIPRIFIHDeikkeekeklkPAMASTYKVPII  234
             G+YDR  E+KAFD+MK GVKG +D+GI +IPRIF H        +      +ST K+P I
Sbjct  3     GNYDRTGEVKAFDEMKIGVKGLMDAGITQIPRIFHHPNATFTNPKPS----SSTLKIPTI  58

Query  235   DMEGLHTDHTTRRSEIIKEIRDACQTWGFFQIINHGIPTQVLDEMIDGVRQFHELDSEVK  414
             D+ G   + T  R  +I ++RDA + +GFFQ+INHGIP  V D+M DG+R FHE DSEVK
Sbjct  59    DLGGCVFESTVMRESVITKVRDAVEKFGFFQVINHGIPIGVTDKMKDGIRGFHEQDSEVK  118

Query  415   KQFYSRDLTRKVVYNTNFDFHTSPAATWRDTLYFIMAPHPPTPQELPQVCRDILIKYSNS  594
             K FYSRD+T+KV YNTNFD ++S AA WRDTL  +M+P  P  ++LP VCR+I+++YS  
Sbjct  119   KTFYSRDMTKKVKYNTNFDLYSSQAANWRDTLTTVMSPDVPQVEDLPAVCREIMLEYSKR  178

Query  595   VQKLGLCLLELFSESLGLHKNHLEKLGCAVGLSIFGQYYPACPEPELTFALRDHSDSGFF  774
             + KLG  + EL SE+LGL  NHL++L CA  LS+   YYP CPEP+ TF +  H+D  F 
Sbjct  179   MMKLGEIIFELLSEALGLKPNHLKELDCAKSLSLLSHYYPPCPEPDRTFGISSHTDISFI  238

Query  775   TVLNQDTQIGGLQVLHENQWVDVPPLHGALVVNVADLLQLITNDKFKSVVHRVIAQKIA-  951
             T+L QD  IGGLQVLH+  W+DVPP   AL+VN+ DLLQLITNDKF SV HRV+A +   
Sbjct  239   TILLQD-HIGGLQVLHDGYWIDVPPNPEALIVNLGDLLQLITNDKFVSVEHRVLANRCKE  297

Query  952   PRVSVASFF-RTIPGDVDAKKVYGPIKELVSDENPPLYRETTTEEYLMHFQKKGLDGTSG  1128
             PR+S ASFF  TIP +    +VYGPIKEL+S++NPP YR+TTT E   H+  KGLDGTS 
Sbjct  298   PRISSASFFMHTIPNE----QVYGPIKELLSEQNPPKYRDTTTSEMARHYLAKGLDGTSP  353

Query  1129  LLRFRL  1146
             LL FR+
Sbjct  354   LLHFRI  359



>ref|XP_003635549.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1-like [Vitis vinifera]
Length=368

 Score =   407 bits (1045),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 201/376 (53%), Positives = 268/376 (71%), Gaps = 8/376 (2%)
 Frame = +1

Query  19    MATASTGGKADSGDYDRKSELKAFDDMKTGVKGHVDSGIMKIPRIFIHDeikkeekeklk  198
             M T +T    DS +YDRKSEL AFDD K GVKG VD+G+ KIPR+FIH +    EK    
Sbjct  1     MVTCNTREGMDS-EYDRKSELIAFDDSKAGVKGLVDAGVAKIPRMFIHPQHNLREKSVST  59

Query  199   PAMASTYKVPIIDMEGLHTDHTTRRSEIIKEIRDACQTWGFFQIINHGIPTQVLDEMIDG  378
              A     ++PIID+EG+++D    R++II ++R+AC+ WG FQI+NHGI   VL+EMI G
Sbjct  60    NAQ---LRIPIIDLEGVNSD-AILRAKIIDKVRNACEIWGIFQIVNHGILKCVLEEMIKG  115

Query  379   VRQFHELDSEVKKQFYSRDLTRKVVYNTNFDFHTSPAATWRDTLYFIMAPHPPTPQELPQ  558
             +R+F+E D+EVKK+FY+RD ++KV + +NFD   +PAATW+D+   I+AP+PP P ++P 
Sbjct  116   IRRFNEQDTEVKKEFYTRDFSKKVTFVSNFDLFQAPAATWKDSFSCIIAPNPPDPTDMPA  175

Query  559   VCRDILIKYSNSVQKLGLCLLELFSESLGLHKNHLEKLGCAVGLSIFGQYYPACPEPELT  738
             VCRDI+++YS  V+ L   L EL +E+LGL+ NHL+ + CA GL +   YYPACPEPELT
Sbjct  176   VCRDIIMEYSKQVKMLANTLFELVAEALGLNSNHLKDMECAEGLFLVSHYYPACPEPELT  235

Query  739   FALRDHSDSGFFTVLNQDTQIGGLQVLHENQWVDVPPLHGALVVNVADLLQLITNDKFKS  918
                + H+D  F TVL QD Q+GGLQVLHE QWV+V P+ GALV+N  DLLQL++ND F+S
Sbjct  236   MGTKTHTDPTFLTVLLQD-QVGGLQVLHEKQWVNVNPVPGALVINTGDLLQLVSNDMFRS  294

Query  919   VVHRVIAQKIAPRVSVASFFRTIPGDVDAKKVYGPIKELVSDENPPLYRETTTEEYLMHF  1098
               HRV+A    PRVSVASFF   P  + + K+YGPIKEL+S++NPP Y+ETT  +Y    
Sbjct  295   AKHRVLANHKGPRVSVASFFS--PFSLPSSKLYGPIKELLSEDNPPKYKETTARDYGTCH  352

Query  1099  QKKGLDGTSGLLRFRL  1146
             + + LDGTS L  F L
Sbjct  353   RAERLDGTSALQHFML  368



>ref|XP_011091184.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1-like isoform X2 [Sesamum indicum]
Length=373

 Score =   407 bits (1046),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 197/371 (53%), Positives = 257/371 (69%), Gaps = 8/371 (2%)
 Frame = +1

Query  40    GKADSG--DYDRKSELKAFDDMKTGVKGHVDSGIMKIPRIFIHDeikkeekeklkPAMAS  213
             G  DS     DR  EL+AFDD K GVKG VD+G+  +P+IF+      +        +  
Sbjct  9     GAVDSAASKLDRARELRAFDDTKAGVKGLVDAGVENVPQIFLLPRNNTKSGTGDTAKV--  66

Query  214   TYKVPIIDMEGLHTDHTTRRSEIIKEIRDACQTWGFFQIINHGIPTQVLDEMIDGVRQFH  393
              + +P+ID++G+  D T R+ EI+  IR A +TWGFFQ++NHGIP  VL+EM+ GVR+F+
Sbjct  67    NFTIPVIDLQGVEIDSTLRQ-EIVHRIRHASETWGFFQVVNHGIPVGVLEEMLRGVRRFN  125

Query  394   ELDSEVKKQFYSRDLTRKVVYNTNFDFHTSPAATWRDTLYFIMAPHPPTPQELPQVCRDI  573
             E D  VKKQFY+RD++RK V+N+NFD + SPAA WRDT +  MAP PP PQELP  CRDI
Sbjct  126   EQDVGVKKQFYTRDVSRKFVFNSNFDLYASPAANWRDTFFCFMAPTPPQPQELPASCRDI  185

Query  574   LIKYSNSVQKLGLCLLELFSESLGLHKNHLEKLGCAVGLSIFGQYYPACPEPELTFALRD  753
              I+YS  V  LG+ L  L SE+LGL  + L  + CA GL+  G YYP+CP+PELT     
Sbjct  186   QIEYSRHVMTLGVRLFGLLSEALGLETSRLTNMDCANGLAFVGHYYPSCPQPELTLGASK  245

Query  754   HSDSGFFTVLNQDTQIGGLQVLHENQWVDVPPLHGALVVNVADLLQLITNDKFKSVVHRV  933
             H+D GF TV+ QD  IGGLQ+  ENQW+DVPP+ GALV+N+ DLLQLI+NDKFKSV HRV
Sbjct  246   HTDDGFLTVVLQD-HIGGLQIFAENQWIDVPPVPGALVINIGDLLQLISNDKFKSVEHRV  304

Query  934   IAQKIAPRVSVASFFRTIPGDVDAKKVYGPIKELVSDENPPLYRETTTEEYLMHFQKKGL  1113
             +A +  PRVSVA FF T    + + K+YGPI++L+S++NP  YRETT EE+  +   KGL
Sbjct  305   LANREGPRVSVACFFST--ALMPSSKLYGPIQDLLSEDNPAKYRETTVEEFFSYSYAKGL  362

Query  1114  DGTSGLLRFRL  1146
             DG S LL F++
Sbjct  363   DGVSPLLHFKI  373



>emb|CBI23594.3| unnamed protein product [Vitis vinifera]
Length=332

 Score =   405 bits (1042),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 203/367 (55%), Positives = 251/367 (68%), Gaps = 36/367 (10%)
 Frame = +1

Query  46    ADSGDYDRKSELKAFDDMKTGVKGHVDSGIMKIPRIFIHDeikkeekeklkPAMASTYKV  225
             A   D DR  ELKAFD+ K GVKG VD+G+ ++PRIFI                      
Sbjct  2     ATQADCDRLGELKAFDETKAGVKGLVDAGVSQVPRIFIQPP-------------------  42

Query  226   PIIDMEGLHTDHTTRRSEIIKEIRDACQTWGFFQIINHGIPTQVLDEMIDGVRQFHELDS  405
                       D TT  ++      +A +TWGFF ++NHGI   VL+EM DGVR+F+E D+
Sbjct  43    ---------DDFTTGDTKF-----NASETWGFFNVVNHGISVTVLEEMKDGVRRFYEQDT  88

Query  406   EVKKQFYSRDLTRKVVYNTNFDFHTSPAATWRDTLYFIMAPHPPTPQELPQVCRDILIKY  585
             EVKKQ+YSRDL RKVVYN+NFD + +PAA WRDT YF+MAP PP PQELP   RDILI+Y
Sbjct  89    EVKKQYYSRDLERKVVYNSNFDLYKAPAANWRDTFYFLMAPQPPDPQELPPAFRDILIEY  148

Query  586   SNSVQKLGLCLLELFSESLGLHKNHLEKLGCAVGLSIFGQYYPACPEPELTFALRDHSDS  765
              + V KLG  LLEL SE+LGL  NHL+ + CA GL++   YYPACP+PELT     H+D+
Sbjct  149   KDEVMKLGFKLLELISEALGLKANHLKDMDCAEGLAMLCHYYPACPQPELTMGTTKHADN  208

Query  766   GFFTVLNQDTQIGGLQVLHENQWVDVPPLHGALVVNVADLLQLITNDKFKSVVHRVIAQK  945
              F TVL QD +IGGLQVLH++QWVDVPP+ GALV+N+ DLLQLITND+FKSV HRV+A  
Sbjct  209   DFLTVLLQD-EIGGLQVLHQDQWVDVPPMPGALVINIGDLLQLITNDRFKSVEHRVLASH  267

Query  946   IAPRVSVASFFRTIPGDVDAKKVYGPIKELVSDENPPLYRETTTEEYLMHFQKKGLDGTS  1125
               PRVSVA FF T    + + K+YGPIKEL+S+ENPP YRE T  +++ +F  KGLDGTS
Sbjct  268   KGPRVSVACFFST--ALLPSLKLYGPIKELLSEENPPKYREITVRDFVAYFNAKGLDGTS  325

Query  1126  GLLRFRL  1146
              L  F+L
Sbjct  326   ALEHFKL  332



>ref|XP_003628030.1| 1-aminocyclopropane-1-carboxylate oxidase-like protein [Medicago 
truncatula]
 gb|AET02506.1| 2OG-Fe(II) oxygenase family oxidoreductase [Medicago truncatula]
Length=381

 Score =   407 bits (1045),  Expect = 4e-135, Method: Compositional matrix adjust.
 Identities = 201/367 (55%), Positives = 260/367 (71%), Gaps = 8/367 (2%)
 Frame = +1

Query  61    YDRKSELKAFDDMKTGVKGHVDSGIMKIPRIFIHDeikkeekeklkPAMASTYKVPIIDM  240
             YDR+ ELK  D+ K GVKG VD+G+ K+P+IFIHD+I +   ++     ++   +PIID 
Sbjct  17    YDRQKELKLLDESKEGVKGLVDAGLTKVPKIFIHDKIHEHNNKQTS---STNLSIPIIDF  73

Query  241   EGLHTD-HTTRRSEIIKEIRDACQTWGFFQIINHGIPTQVLDEMIDGVRQFHELDSEVKK  417
               L T+  ++ R EII++++ A + WGFFQ++NHGIP+ VLDEMIDGV +FHE D+E KK
Sbjct  74    GPLFTNTSSSSRLEIIEKVKYASEKWGFFQVVNHGIPSTVLDEMIDGVVRFHEQDTETKK  133

Query  418   QFYSRDLTRKVVYNTNFDFHTSPAATWRDTLYFIMAPHPPTPQELPQVCRDILIKYSNSV  597
             +FYSRD  ++V YNTNFD + +PA  WRD+L  +M P P  PQ+LP VCRDI   YS  V
Sbjct  134   EFYSRDNGKRVYYNTNFDLYVTPAVNWRDSLSCVMGPQPLDPQKLPTVCRDITTTYSEYV  193

Query  598   QKLGLCLLELFSESLGLHKNHLEKLGCAVGLSIFGQYYPACPEPELTFALRDHSDSGFFT  777
             +K+G  L EL SE+LGL+ N+L+ + C  GL +   YYP CPEPELT     HSDS F T
Sbjct  194   KKVGTILFELLSEALGLNSNYLKDIDCVEGLFLISHYYPPCPEPELTIGASAHSDSSFLT  253

Query  778   VLNQDTQIGGLQVLHENQWVDVPPLHGALVVNVADLLQLITNDKFKSVVHRVIAQKIAPR  957
             VL QD Q+GGLQV HENQWVDV P+ GALVVN+ D++Q+ITNDKF SV HRV+AQ I PR
Sbjct  254   VLLQD-QLGGLQVFHENQWVDVTPIPGALVVNLGDMMQIITNDKFLSVKHRVLAQSIGPR  312

Query  958   VSVASFFRT-IPGDVDAKKVYGPIKELVSDENPPLYRETTTEEYLMHFQKKGLDGTSGLL  1134
             VSVA FFR  +P   +  K+YGPI EL++ ENPPLY+ET+ +  +     KGLDG S L 
Sbjct  313   VSVACFFRQHLPP--ENTKLYGPIAELLTPENPPLYKETSVKGLVSKLYGKGLDGNSALD  370

Query  1135  RFRLQKE  1155
              FR+Q E
Sbjct  371   HFRIQAE  377



>ref|XP_006354513.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
[Solanum tuberosum]
Length=373

 Score =   406 bits (1043),  Expect = 6e-135, Method: Compositional matrix adjust.
 Identities = 211/368 (57%), Positives = 268/368 (73%), Gaps = 17/368 (5%)
 Frame = +1

Query  61    YDRKSELKAFDDMKTGVKGHVDSGIMKIPRIFIHDeikkeekeklkPAMAST----YKVP  228
             YD+ SELKAFDD K GVKG VD+GI KIP+IFI          K +P ++ T    +  P
Sbjct  17    YDKMSELKAFDDTKAGVKGLVDAGITKIPQIFI-------LPPKNRPELSDTNETQFIFP  69

Query  229   IIDMEGLHTDHTTRRSEIIKEIRDACQTWGFFQIINHGIPTQVLDEMIDGVRQFHELDSE  408
             +ID+EG+  D + +  EI  ++RDA +TWGFFQ++NHGIPT VL+EM+ G RQF E D E
Sbjct  70    VIDLEGIDED-SIKHKEIADKVRDASETWGFFQVVNHGIPTSVLEEMLQGTRQFFEQDVE  128

Query  409   VKKQFYSRDLTRKVVYNTNFDFHTS--PAATWRDTLYFIMAPHPPTPQELPQVCRDILIK  582
             +KKQ YSRD T++V++ +NFD ++   PAA WRDTL+ +MAP PP+PQELP  C +IL++
Sbjct  129   IKKQHYSRDSTKRVIHTSNFDLYSPSVPAANWRDTLFCLMAPDPPSPQELPTACGEILME  188

Query  583   YSNSVQKLGLCLLELFSESLGLHKNHLEKLGCAVGLSIFGQYYPACPEPELTFALRDHSD  762
             YS  V KLG  LLEL SE LGL + HL+ + CA GL I G YYPACP+PEL      HSD
Sbjct  189   YSKDVMKLGFSLLELLSEGLGLDRCHLKDMDCAEGLGILGHYYPACPQPELAIGTNKHSD  248

Query  763   SGFFTVLNQDTQIGGLQVLHENQWVDVPPLHGALVVNVADLLQLITNDKFKSVVHRVIAQ  942
             + F TVL QD  IGGLQVLH+NQWVDVPP  GALVVN+ DLLQLI+NDK+ SV HRV+A 
Sbjct  249   NDFITVLIQD-HIGGLQVLHQNQWVDVPPTPGALVVNIGDLLQLISNDKYISVEHRVLAN  307

Query  943   KIAPRVSVASFFRTIPGDVDAKKVYGPIKELVSDENPPLYRETTTEEYLMHFQKKGLDGT  1122
             K+ PR+SVA FF T  G + + K+YGPI EL+S++NPP YR TT ++Y  +F+KKGLDGT
Sbjct  308   KVGPRISVACFFYT--GSMPSSKLYGPITELLSEDNPPKYRATTVKDYRDYFRKKGLDGT  365

Query  1123  SGLLRFRL  1146
             S LL +R+
Sbjct  366   STLLHYRI  373



>ref|XP_011073514.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1-like [Sesamum indicum]
Length=372

 Score =   406 bits (1043),  Expect = 6e-135, Method: Compositional matrix adjust.
 Identities = 199/374 (53%), Positives = 263/374 (70%), Gaps = 8/374 (2%)
 Frame = +1

Query  28    ASTGGKADSGDYDRKSELKAFDDMKTGVKGHVDSGIMKIPRIFIHDeikkeekeklkPAM  207
             ++T   +D  ++DR SELKAFD+ K GVKG VD+G   +PRIF     + +    +    
Sbjct  6     SNTQTISDDQNFDRASELKAFDETKAGVKGLVDAGTTTVPRIFFSPPDEFDNAADVSTLG  65

Query  208   ASTYKVPIIDMEGLHTDHTTRRSEIIKEIRDACQTWGFFQIINHGIPTQVLDEMIDGVRQ  387
              S   +P++D++G+  D   RR +I+  +R A +TWGFFQ++NHG+P  VLDEM++GVR+
Sbjct  66    VS---IPVLDLDGIDKD-PGRRRDIVHRVRQASETWGFFQVVNHGVPVSVLDEMLEGVRR  121

Query  388   FHELDSEVKKQFYSRDLTRKVVYNTNFDFHTSPAATWRDTLYFIMAPHPPTPQELPQVCR  567
             F+E D+EVKK++Y+RD +  VVYN+NFD + + +A WRDT Y  MAP  P P+ELP+ CR
Sbjct  122   FYEQDTEVKKKWYTRDGSETVVYNSNFDLYRAASANWRDTTYCNMAPRLPCPEELPEACR  181

Query  568   DILIKYSNSVQKLGLCLLELFSESLGLHKNHLEKLGCAVGLSIFGQYYPACPEPELTFAL  747
             DI+++YS  + +LG  L EL SE+LGL+ +HL  LGC+ GL++   YYPACPEPE T   
Sbjct  182   DIMLEYSKHITRLGRFLFELLSEALGLNPDHLNNLGCSEGLAVLYHYYPACPEPEKTLGA  241

Query  748   RDHSDSGFFTVLNQDTQIGGLQVLHENQWVDVPPLHGALVVNVADLLQLITNDKFKSVVH  927
               H+D  F TVL QD  IGGLQVL +N WVD+PPL GALVVNV DLLQLI+NDKFKS  H
Sbjct  242   SKHADYDFLTVLLQD-NIGGLQVLFQNLWVDIPPLSGALVVNVGDLLQLISNDKFKSSQH  300

Query  928   RVIAQKIAPRVSVASFFRTIPGDVDAKKVYGPIKELVSDE-NPPLYRETTTEEYLMHFQK  1104
             RV+A +  PRVSVA FF T  G + + K+YGPI+EL+S+E NPP YRETT  EY +H+  
Sbjct  301   RVLANRGGPRVSVACFFTT--GLMPSTKLYGPIQELLSEEDNPPKYRETTVREYSLHYNA  358

Query  1105  KGLDGTSGLLRFRL  1146
             KGL GTS L  F L
Sbjct  359   KGLGGTSALSDFML  372



>ref|XP_009119045.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1 [Brassica rapa]
Length=363

 Score =   405 bits (1042),  Expect = 8e-135, Method: Compositional matrix adjust.
 Identities = 196/361 (54%), Positives = 256/361 (71%), Gaps = 7/361 (2%)
 Frame = +1

Query  64    DRKSELKAFDDMKTGVKGHVDSGIMKIPRIFIHDeikkeekeklkPAMASTYKVPIIDME  243
             DR  +LKAFD+ KTGVKG V++GI +IP IF          +   P  +S + +P ID++
Sbjct  10    DRSVQLKAFDETKTGVKGLVEAGISEIPAIF---RAPPATIKTPTPPSSSQFTIPTIDLQ  66

Query  244   GLHTDHTTRRSEIIKEIRDACQTWGFFQIINHGIPTQVLDEMIDGVRQFHELDSEVKKQF  423
             G  TD T+RRS ++++I DA + WGFFQ+INHGIP  VL+ M +GVR+FHELD EV+K F
Sbjct  67    GGSTDSTSRRS-LVEKIGDAAERWGFFQVINHGIPLDVLERMKEGVREFHELDPEVRKGF  125

Query  424   YSRDLTRKVVYNTNFDFHTSPAATWRDTLYFIMAPHPPTPQELPQVCRDILIKYSNSVQK  603
             YSRD + K+VY++NFD ++SPAA WRDTL    AP PP P++LP  C +++I+YS  V K
Sbjct  126   YSRDPSNKLVYSSNFDLYSSPAANWRDTLGCYTAPDPPRPEDLPAACGEVMIEYSKEVMK  185

Query  604   LGLCLLELFSESLGLHKNHLEKLGCAVGLSIFGQYYPACPEPELTFALRDHSDSGFFTVL  783
             +G  L EL SE+LGL+ NHL+ + C   L + G YYP CP+P+LT  L  HSD+ F TVL
Sbjct  186   VGKMLFELLSEALGLNTNHLKDMDCTNSLLLLGHYYPPCPQPDLTLGLTKHSDNSFLTVL  245

Query  784   NQDTQIGGLQVLHENQWVDVPPLHGALVVNVADLLQLITNDKFKSVVHRVIAQKIAPRVS  963
              QD  +GGLQVLH+  WVDVPP+ GALV+NV DLLQLITN KF SV HRV+A    PR+S
Sbjct  246   LQD-NVGGLQVLHDQYWVDVPPVPGALVINVGDLLQLITNGKFISVEHRVLANGAGPRIS  304

Query  964   VASFFRTIPGDVDAKKVYGPIKELVSDENPPLYRETTTEEYLMHFQKKGLDGTSGLLRFR  1143
             VA FF +    +   +VYGPIKEL+S+ENPP+YR+TT  EY   ++ KG DGTSGLL  +
Sbjct  305   VACFFSSY--LMANPRVYGPIKELLSEENPPIYRDTTITEYSKFYRSKGFDGTSGLLYLK  362

Query  1144  L  1146
             +
Sbjct  363   I  363



>ref|XP_003591799.1| 1-aminocyclopropane-1-carboxylate oxidase-like protein [Medicago 
truncatula]
 gb|AES62050.1| 2OG-Fe(II) oxygenase family oxidoreductase [Medicago truncatula]
 gb|AFK34307.1| unknown [Medicago truncatula]
Length=370

 Score =   405 bits (1041),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 202/373 (54%), Positives = 265/373 (71%), Gaps = 10/373 (3%)
 Frame = +1

Query  37    GGKADSGDYDRKSELKAFDDMKTGVKGHVDSGIM--KIPRIFIHDeikkeekeklkPAMA  210
                  S  YDR +E+KAF++ KTGVKG ++SGI   KIPR+F H        +    A +
Sbjct  5     ASNGSSSTYDRTAEVKAFEESKTGVKGLLESGIWTTKIPRMF-HSPNLNLNSDHESEA-S  62

Query  211   STYKVPIIDMEGLHTDHTTRRSEIIKEIRDACQTWGFFQIINHGIPTQVLDEMIDGVRQF  390
             S + VPIID++ ++TD     +E++++IR AC+ WGFFQ+INHGIP  VLDEMI G+R+F
Sbjct  63    SKFSVPIIDLQDINTD-PCLHAEVLEKIRSACKEWGFFQVINHGIPVIVLDEMISGIRRF  121

Query  391   HELDSEVKKQFYSRDLTRKVVYNTNFDFHTSPAATWRDTLYFIMAPHPPTPQELPQVCRD  570
             HE D++ +K FY+RD ++KV Y +N    T PAA WRD+L F ++P+PP P+E+PQVCRD
Sbjct  122   HEQDADARKPFYTRDKSKKVRYFSNGSLFTDPAANWRDSLSFFVSPNPPDPEEIPQVCRD  181

Query  571   ILIKYSNSVQKLGLCLLELFSESLGLHKNHLEKLGCAVGLSIFGQYYPACPEPELTFALR  750
             I+I+YS  V+ LGL + ELFSE+LGLH ++L+ L    G  +   YYP CPEPELT    
Sbjct  182   IVIEYSKKVRALGLTIFELFSEALGLHPSYLKDLALDYGQFLLCHYYPPCPEPELTMGTS  241

Query  751   DHSDSGFFTVLNQDTQIGGLQVLHENQWVDVPPLHGALVVNVADLLQLITNDKFKSVVHR  930
              H+D  F T+L QD QIGGLQVLH+NQWV VPPLHG+LVVN+ DLLQL+TND F SV HR
Sbjct  242   KHTDIDFMTILLQD-QIGGLQVLHQNQWVHVPPLHGSLVVNIGDLLQLVTNDMFTSVYHR  300

Query  931   VIAQKIAPRVSVASFFRTIPGDVD-AKKVYGPIKELVSDENPPLYRETTTEEYLMHFQKK  1107
             V+++ I PRVS+ASFF      V+ + KV GPIKEL+S+ENP +YR+TT +E L H+  K
Sbjct  301   VLSKHIGPRVSIASFFA---NSVEVSSKVLGPIKELLSEENPAIYRDTTVKEVLAHYFTK  357

Query  1108  GLDGTSGLLRFRL  1146
             GLDG S L  FRL
Sbjct  358   GLDGNSSLHPFRL  370



>emb|CBI23590.3| unnamed protein product [Vitis vinifera]
Length=365

 Score =   405 bits (1040),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 190/314 (61%), Positives = 239/314 (76%), Gaps = 5/314 (2%)
 Frame = +1

Query  208   ASTYKVPIIDMEGLHTDHTTRRSEIIKEIRDACQTWGFFQIINHGIPTQVLDEMIDGVRQ  387
              + +  P++D++G+  D   RR++I+  +RDA +TWGFF ++NHGIP  VL+EM++GVR+
Sbjct  56    TTQFNFPVVDLQGMDND-PIRRNKIVDMVRDASETWGFFNVVNHGIPVSVLEEMMEGVRR  114

Query  388   FHELDSEVKKQFYSRDLTRK-VVYNTNFDFHTSPAATWRDTLYFIMAPHPPTPQELPQVC  564
             FHE D+EVKKQFY+RD +RK V+YN+NFD +T+PAA WRDT Y +MAPHPP P+ELP  C
Sbjct  115   FHEQDTEVKKQFYTRDASRKKVMYNSNFDLYTAPAANWRDTFYCLMAPHPPNPEELPASC  174

Query  565   RDILIKYSNSVQKLGLCLLELFSESLGLHKNHLEKLGCAVGLSIFGQYYPACPEPELTFA  744
             RDIL++Y + V +LG  L EL SE+LGL+ NHL+ + CA GLSI   YYP+CP+PELT  
Sbjct  175   RDILMEYKDQVMRLGFKLFELISEALGLNPNHLKDMDCAEGLSILCHYYPSCPQPELTMG  234

Query  745   LRDHSDSGFFTVLNQDTQIGGLQVLHENQWVDVPPLHGALVVNVADLLQLITNDKFKSVV  924
                H+D+ F TVL QD QIGGLQVLH+ QW+DVPP  GALV+NV DLLQLITND+FKSV 
Sbjct  235   TTKHADNDFLTVLLQD-QIGGLQVLHQGQWIDVPPRLGALVINVGDLLQLITNDRFKSVK  293

Query  925   HRVIAQKIAPRVSVASFFRTIPGDVDAKKVYGPIKELVSDENPPLYRETTTEEYLMHFQK  1104
             HRV A  I PRVSVA FFRT      + K+YGPIKEL S+ENPP YRETT  +Y+ +F  
Sbjct  294   HRVPANHIGPRVSVACFFRT--SIQPSSKLYGPIKELSSEENPPKYRETTVGDYVAYFNS  351

Query  1105  KGLDGTSGLLRFRL  1146
             KGLDGTS L  FRL
Sbjct  352   KGLDGTSALPHFRL  365



>ref|XP_006354516.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
[Solanum tuberosum]
Length=382

 Score =   405 bits (1041),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 198/366 (54%), Positives = 258/366 (70%), Gaps = 11/366 (3%)
 Frame = +1

Query  58    DYDRKSELKAFDDMKTGVKGHVDSG-IMKIPRIFIHDeikkeekeklkPAMASTYKVPII  234
             +YD+ SELKAFDD K GVKG VD+G   ++PRIF+H      +           +  P+I
Sbjct  23    NYDKHSELKAFDDTKAGVKGLVDAGNSTEVPRIFVHPRESIHDSSGFT---EKEFVFPVI  79

Query  235   DMEGLHTDHTTRRSEIIKEIRDACQTWGFFQIINHGIPTQVLDEMIDGVRQFHELDSEVK  414
             D+EG+  D+  R  EI+ ++RDA +TWGFFQ++NHGIP  VL+EM+ G R+F E D E+K
Sbjct  80    DLEGI--DNPMRHKEIVDKVRDASETWGFFQVVNHGIPLPVLEEMLQGARRFFEQDVEIK  137

Query  415   KQFYSRDLTRKVVYNTNFDFHTS--PAATWRDTLYFIMAPHPPTPQELPQVCRDILIKYS  588
             KQ+Y+RD T+KV + +NFD  +   PAA+WRD+LY  M P+PP+P+E P  CR+ILI++S
Sbjct  138   KQYYTRDTTKKVAHVSNFDLFSPSVPAASWRDSLYCFMCPNPPSPEEFPTACREILIEFS  197

Query  589   NSVQKLGLCLLELFSESLGLHKNHLEKLGCAVGLSIFGQYYPACPEPELTFALRDHSDSG  768
               + KLG  L EL SE LGL+  HL+ + CA GLSI   YYPACP+PELT   R HSD  
Sbjct  198   KKMMKLGYSLFELLSEGLGLNPCHLKDMNCAEGLSIAQHYYPACPQPELTIGTRQHSDCV  257

Query  769   FFTVLNQDTQIGGLQVLHENQWVDVPPLHGALVVNVADLLQLITNDKFKSVVHRVIAQKI  948
             F TVL QD  IGGLQV H+NQW+DVPP  GALVVN+ DLLQLI+NDK+ SV HRV++ K+
Sbjct  258   FITVLLQD-DIGGLQVRHQNQWIDVPPTPGALVVNIGDLLQLISNDKYISVEHRVLSNKV  316

Query  949   APRVSVASFFRTIPGDVDAKKVYGPIKELVSDENPPLYRETTTEEYLMHFQKKGLDGTSG  1128
              PR+SV  FF T  G   + ++YGPIKEL S+ NPP YR TT +EY  +F+KKG DGTS 
Sbjct  317   GPRISVPCFFST--GAFPSPRIYGPIKELSSECNPPKYRATTVKEYTDYFRKKGFDGTST  374

Query  1129  LLRFRL  1146
             LL +++
Sbjct  375   LLDYKI  380



>ref|XP_003532286.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1 [Glycine max]
 gb|KHN11001.1| 1-aminocyclopropane-1-carboxylate oxidase like 1 [Glycine soja]
Length=373

 Score =   404 bits (1039),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 201/378 (53%), Positives = 260/378 (69%), Gaps = 10/378 (3%)
 Frame = +1

Query  22    ATASTGGKADSGD--YDRKSELKAFDDMKTGVKGHVDSGIMKIPRIFIHDeikkeekekl  195
             A +S   K +S D  YDRK+E+KAFDD KTGVKG VDSG+ KIPR+F+      E     
Sbjct  3     AKSSNQIKEESNDSNYDRKAEIKAFDDSKTGVKGLVDSGVKKIPRMFLSGIDITENV---  59

Query  196   kPAMASTYKVPIIDMEGLHTDHTTRRSEIIKEIRDACQTWGFFQIINHGIPTQVLDEMID  375
               A  S   +P+ID++ +H ++    +E++ +IR ACQ WGFFQ+INHGIP  V+D+MID
Sbjct  60    --ASDSNLSIPVIDLQDIH-NNPALHNEVVTKIRSACQEWGFFQVINHGIPISVMDQMID  116

Query  376   GVRQFHELDSEVKKQFYSRDLTRKVVYNTNFDFHTSPAATWRDTLYFIMAPHPPTPQELP  555
             G+R+FHE D++V+KQFYSRDL + ++YN+N   +    A WRD+L   MAP+PP P+ LP
Sbjct  117   GIRRFHEQDTDVRKQFYSRDLKKTILYNSNTSLYLDKFANWRDSLGCSMAPNPPKPENLP  176

Query  556   QVCRDILIKYSNSVQKLGLCLLELFSESLGLHKNHLEKLGCAVGLSIFGQYYPACPEPEL  735
              V RDI+I+YS  +  LG  + EL SE+LGL+ ++L+++ CA GL I G YYP CPEPEL
Sbjct  177   TVFRDIIIEYSKEIMALGCTIFELLSEALGLNPSYLKEMNCAEGLFIQGHYYPPCPEPEL  236

Query  736   TFALRDHSDSGFFTVLNQDTQIGGLQVLHENQWVDVPPLHGALVVNVADLLQLITNDKFK  915
             T     H+DS F T++ Q  Q+GGLQVLHE  W +VPP+HGALVVNV D+LQLITND F 
Sbjct  237   TLGTSKHTDSSFMTIVLQG-QLGGLQVLHEKLWFNVPPVHGALVVNVGDILQLITNDNFV  295

Query  916   SVVHRVIAQKIAPRVSVASFFRTIPGDVD-AKKVYGPIKELVSDENPPLYRETTTEEYLM  1092
             SV HRV++    PRVSVASFF         A  VY PIKEL+S+ENP +YR+TT  E + 
Sbjct  296   SVYHRVLSNHGGPRVSVASFFSNSHDPAKGASMVYSPIKELLSEENPAIYRDTTIGEIMA  355

Query  1093  HFQKKGLDGTSGLLRFRL  1146
             H   KGLDG S L  FRL
Sbjct  356   HHFAKGLDGNSALQPFRL  373



>gb|AET01263.2| 1-aminocyclopropane-1-carboxylate oxidase-like protein [Medicago 
truncatula]
Length=400

 Score =   405 bits (1041),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 202/380 (53%), Positives = 264/380 (69%), Gaps = 7/380 (2%)
 Frame = +1

Query  7     REREMATASTGGKADSGDYDRKSELKAFDDMKTGVKGHVDSGIMKIPRIFIHDeikkeek  186
             R+ E+   +        DYDR SELKAFD+ K GVKG VD+ +  IPR+F H+  K    
Sbjct  25    RKMEIIKKNEISMTTKHDYDRASELKAFDETKDGVKGLVDASVTSIPRMFHHEFDKDSTS  84

Query  187   eklkPAMASTYKVPIIDMEGLHTDHTTRRSEIIKEIRDACQTWGFFQIINHGIPTQVLDE  366
                  + +    +P ID+  +H D  TRR  ++++IR+A +TWGFFQI+NHGI   VLDE
Sbjct  85    SS---SNSHKLVIPSIDLVDIHQD-PTRRKIVVEKIREASETWGFFQIVNHGIEVSVLDE  140

Query  367   MIDGVRQFHELDSEVKKQFYSRDLTRKVVYNTNFDFHTSPAATWRDTLYFIMAPHPPTPQ  546
             M +GV +F E DSEVK++ Y+RD  + +VYN+NFD ++SPAATWRDT Y  MAP+ P P+
Sbjct  141   MKNGVVRFFEQDSEVKRELYTRDPVKPLVYNSNFDLYSSPAATWRDTFYCFMAPNSPNPE  200

Query  547   ELPQVCRDILIKYSNSVQKLGLCLLELFSESLGLHKNHLEKLGCAVGLSIFGQYYPACPE  726
             +LP VCRDI+++Y+  V KLG  L EL SE+LGL  N+L ++ C  GL++   YYP+CPE
Sbjct  201   DLPSVCRDIMLEYTKQVMKLGNLLFELLSEALGLDPNYLNEMRCNEGLALVCHYYPSCPE  260

Query  727   PELTFALRDHSDSGFFTVLNQDTQIGGLQVLHENQWVDVPPLHGALVVNVADLLQLITND  906
             PELT  +  H+D+ F TVL QD  IGGLQVL EN WVDV P+ GALV+N+ DLLQLITND
Sbjct  261   PELTLGITKHTDNDFITVLLQD-HIGGLQVLRENSWVDVSPVPGALVINIGDLLQLITND  319

Query  907   KFKSVVHRVIAQKIAPRVSVASFFRTIPGDVDAKKVYGPIKELVSDENPPLYRETTTEEY  1086
             KFKSV HRV+A  + PRVSVASF+ T      + K+YGPIKELVS++NPP YRETT  +Y
Sbjct  320   KFKSVEHRVVANHVGPRVSVASFYST--SFQPSTKLYGPIKELVSEDNPPKYRETTVHDY  377

Query  1087  LMHFQKKGLDGTSGLLRFRL  1146
             +     +GLDGTS L  F++
Sbjct  378   VSFSMARGLDGTSPLPYFKI  397



>ref|XP_003596176.1| 1-aminocyclopropane-1-carboxylate oxidase-like protein [Medicago 
truncatula]
 gb|AES66427.1| 1-aminocyclopropane-1-carboxylate oxidase-like protein [Medicago 
truncatula]
Length=367

 Score =   404 bits (1038),  Expect = 4e-134, Method: Compositional matrix adjust.
 Identities = 199/361 (55%), Positives = 257/361 (71%), Gaps = 7/361 (2%)
 Frame = +1

Query  64    DRKSELKAFDDMKTGVKGHVDSGIMKIPRIFIHDeikkeekeklkPAMASTYKVPIIDME  243
             DR  ELKAFD+ K GVKG VD GI+KIP +F H   K  +      +  + + +P+ID  
Sbjct  14    DRLQELKAFDETKAGVKGLVDQGILKIPALFHHPPDKYGKSTN---STNTEHIIPVIDFL  70

Query  244   GLHTDHTTRRSEIIKEIRDACQTWGFFQIINHGIPTQVLDEMIDGVRQFHELDSEVKKQF  423
              +  D  TR+ EII +I++A +TWGFFQ++NHGIP  VL++M DGV +F E D+EVKK+ 
Sbjct  71    NIGKDPNTRQ-EIITKIKEASETWGFFQVVNHGIPINVLEDMKDGVIRFFEQDTEVKKEM  129

Query  424   YSRDLTRKVVYNTNFDFHTSPAATWRDTLYFIMAPHPPTPQELPQVCRDILIKYSNSVQK  603
             Y+RD TR +VYN+NFD ++SPA  WRDTL   MAP+ P P++LP VCRDI ++Y   V K
Sbjct  130   YTRDQTRPLVYNSNFDLYSSPALNWRDTLALKMAPNAPKPEDLPVVCRDIFLEYGEHVMK  189

Query  604   LGLCLLELFSESLGLHKNHLEKLGCAVGLSIFGQYYPACPEPELTFALRDHSDSGFFTVL  783
             LG+ L EL SE+LGLH NHL+ L C+ G  +   YYPACPEP LT     HSDS F TVL
Sbjct  190   LGIVLFELLSEALGLHPNHLKDLDCSEGNLLLCHYYPACPEPHLTMGTAKHSDSSFLTVL  249

Query  784   NQDTQIGGLQVLHENQWVDVPPLHGALVVNVADLLQLITNDKFKSVVHRVIAQKIAPRVS  963
              QD  IGGLQVLH+ +W+DVPP+  ALV+N+ D+LQLITND+FKSV HRV+A  I PRVS
Sbjct  250   LQD-HIGGLQVLHKGKWIDVPPIPEALVINIGDVLQLITNDRFKSVEHRVLANTIGPRVS  308

Query  964   VASFFRTIPGDVDAKKVYGPIKELVSDENPPLYRETTTEEYLMHFQKKGLDGTSGLLRFR  1143
             VASFFR   G    +K+YGPIKE++S++NPP YRETT  +++ ++  KGLDG S L  F+
Sbjct  309   VASFFRA--GPRAQEKLYGPIKEILSEDNPPRYRETTFTDFVAYYNAKGLDGISALEHFK  366

Query  1144  L  1146
             L
Sbjct  367   L  367



>ref|XP_006598206.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1-like [Glycine max]
Length=371

 Score =   404 bits (1038),  Expect = 4e-134, Method: Compositional matrix adjust.
 Identities = 200/361 (55%), Positives = 257/361 (71%), Gaps = 7/361 (2%)
 Frame = +1

Query  64    DRKSELKAFDDMKTGVKGHVDSGIMKIPRIFIHDeikkeekeklkPAMASTYKVPIIDME  243
             DR  ELKAFDD K GVKG VD G+ KIPR+F H   +     KL     + Y +P+ID+E
Sbjct  18    DRLGELKAFDDTKAGVKGLVDEGVAKIPRLFHHPPDEFVRASKLG---NTEYTIPVIDLE  74

Query  244   GLHTDHTTRRSEIIKEIRDACQTWGFFQIINHGIPTQVLDEMIDGVRQFHELDSEVKKQF  423
              +  D ++R+ EII  IR+A + WGFFQ++NHGIP  VL+++ DGV++FHE D E KK+ 
Sbjct  75    EVGKDPSSRQ-EIIGRIREASERWGFFQVVNHGIPVTVLEDLKDGVQRFHEQDIEEKKEL  133

Query  424   YSRDLTRKVVYNTNFDFHTSPAATWRDTLYFIMAPHPPTPQELPQVCRDILIKYSNSVQK  603
             Y+RD  + +VYN+NFD ++SPA  WRD+    +AP+PP P++LP VCRDIL++Y   V K
Sbjct  134   YTRDHMKPLVYNSNFDLYSSPALNWRDSFMCYLAPNPPKPEDLPVVCRDILLEYGTYVMK  193

Query  604   LGLCLLELFSESLGLHKNHLEKLGCAVGLSIFGQYYPACPEPELTFALRDHSDSGFFTVL  783
             LG+ L EL SE+LGLH +HL+ LGCA GL     YYPACPEP+LT     HSD+ F TVL
Sbjct  194   LGIALFELLSEALGLHPDHLKDLGCAEGLISLCHYYPACPEPDLTLGTTKHSDNCFLTVL  253

Query  784   NQDTQIGGLQVLHENQWVDVPPLHGALVVNVADLLQLITNDKFKSVVHRVIAQKIAPRVS  963
              QD  IGGLQVL++N W+D+ P  GALVVN+ DLLQLITND+FKSV HRV A  I PR+S
Sbjct  254   LQD-HIGGLQVLYQNMWIDITPEPGALVVNIGDLLQLITNDRFKSVEHRVQANLIGPRIS  312

Query  964   VASFFRTIPGDVDAKKVYGPIKELVSDENPPLYRETTTEEYLMHFQKKGLDGTSGLLRFR  1143
             VA FF    G   + K YGPIKEL++++NPP YRETT  EY+ +F+ KGLDGTS L  F+
Sbjct  313   VACFFSE--GLKSSPKPYGPIKELLTEDNPPKYRETTVAEYVRYFEAKGLDGTSALQHFK  370

Query  1144  L  1146
             +
Sbjct  371   I  371



>emb|CBI23596.3| unnamed protein product [Vitis vinifera]
Length=359

 Score =   403 bits (1036),  Expect = 4e-134, Method: Compositional matrix adjust.
 Identities = 195/364 (54%), Positives = 261/364 (72%), Gaps = 7/364 (2%)
 Frame = +1

Query  55    GDYDRKSELKAFDDMKTGVKGHVDSGIMKIPRIFIHDeikkeekeklkPAMASTYKVPII  234
              +YDRKSEL AFDD K GVKG VD+G+ KIPR+FIH +    EK     A     ++PII
Sbjct  3     SEYDRKSELIAFDDSKAGVKGLVDAGVAKIPRMFIHPQHNLREKSVSTNAQ---LRIPII  59

Query  235   DMEGLHTDHTTRRSEIIKEIRDACQTWGFFQIINHGIPTQVLDEMIDGVRQFHELDSEVK  414
             D+EG+++D    R++II ++R+AC+ WG FQI+NHGI   VL+EMI G+R+F+E D+EVK
Sbjct  60    DLEGVNSD-AILRAKIIDKVRNACEIWGIFQIVNHGILKSVLEEMIKGIRRFNEQDTEVK  118

Query  415   KQFYSRDLTRKVVYNTNFDFHTSPAATWRDTLYFIMAPHPPTPQELPQVCRDILIKYSNS  594
             K+FY+RD ++KV + +NFD   +PAATW+D+   I+ P+PP P ++P VCRDI+++YS  
Sbjct  119   KEFYTRDSSKKVKFVSNFDLFQAPAATWKDSFSCIINPNPPDPTDMPAVCRDIIMEYSKQ  178

Query  595   VQKLGLCLLELFSESLGLHKNHLEKLGCAVGLSIFGQYYPACPEPELTFALRDHSDSGFF  774
             V+ L   L EL +E+LGL+ NHL+ + CA GL +   YYPACPEPELT   + H+D  F 
Sbjct  179   VKMLANTLFELVAEALGLNSNHLKDMECAEGLFLVSHYYPACPEPELTMGTKTHTDPTFL  238

Query  775   TVLNQDTQIGGLQVLHENQWVDVPPLHGALVVNVADLLQLITNDKFKSVVHRVIAQKIAP  954
             TVL QD Q+GGLQVLHE QWV+V P+ GALV+N  DLLQL++ND F+S  HRV+A    P
Sbjct  239   TVLLQD-QVGGLQVLHEKQWVNVNPVPGALVINTGDLLQLVSNDMFRSAKHRVLANHKGP  297

Query  955   RVSVASFFRTIPGDVDAKKVYGPIKELVSDENPPLYRETTTEEYLMHFQKKGLDGTSGLL  1134
             RVSVASFF   P  +   K+YGPIKEL+S+ENPP Y+ETT  +Y  + + + L GTS L 
Sbjct  298   RVSVASFFS--PSSLPPSKLYGPIKELLSEENPPKYKETTARDYGTYHRAERLGGTSALQ  355

Query  1135  RFRL  1146
              F+L
Sbjct  356   HFKL  359



>ref|XP_003626787.1| 1-aminocyclopropane-1-carboxylate oxidase-like protein [Medicago 
truncatula]
Length=364

 Score =   404 bits (1037),  Expect = 4e-134, Method: Compositional matrix adjust.
 Identities = 200/363 (55%), Positives = 259/363 (71%), Gaps = 7/363 (2%)
 Frame = +1

Query  58    DYDRKSELKAFDDMKTGVKGHVDSGIMKIPRIFIHDeikkeekeklkPAMASTYKVPIID  237
             DYDR SELKAFD+ K GVKG VD+ +  IPR+F H+  K         + +    +P ID
Sbjct  6     DYDRASELKAFDETKDGVKGLVDASVTSIPRMFHHEFDKDSTSSS---SNSHKLVIPSID  62

Query  238   MEGLHTDHTTRRSEIIKEIRDACQTWGFFQIINHGIPTQVLDEMIDGVRQFHELDSEVKK  417
             +  +H D  TRR  ++++IR+A +TWGFFQI+NHGI   VLDEM +GV +F E DSEVK+
Sbjct  63    LVDIHQD-PTRRKIVVEKIREASETWGFFQIVNHGIEVSVLDEMKNGVVRFFEQDSEVKR  121

Query  418   QFYSRDLTRKVVYNTNFDFHTSPAATWRDTLYFIMAPHPPTPQELPQVCRDILIKYSNSV  597
             + Y+RD  + +VYN+NFD ++SPAATWRDT Y  MAP+ P P++LP VCRDI+++Y+  V
Sbjct  122   ELYTRDPVKPLVYNSNFDLYSSPAATWRDTFYCFMAPNSPNPEDLPSVCRDIMLEYTKQV  181

Query  598   QKLGLCLLELFSESLGLHKNHLEKLGCAVGLSIFGQYYPACPEPELTFALRDHSDSGFFT  777
              KLG  L EL SE+LGL  N+L ++ C  GL++   YYP+CPEPELT  +  H+D+ F T
Sbjct  182   MKLGNLLFELLSEALGLDPNYLNEMRCNEGLALVCHYYPSCPEPELTLGITKHTDNDFIT  241

Query  778   VLNQDTQIGGLQVLHENQWVDVPPLHGALVVNVADLLQLITNDKFKSVVHRVIAQKIAPR  957
             VL QD  IGGLQVL EN WVDV P+ GALV+N+ DLLQLITNDKFKSV HRV+A  + PR
Sbjct  242   VLLQD-HIGGLQVLRENSWVDVSPVPGALVINIGDLLQLITNDKFKSVEHRVVANHVGPR  300

Query  958   VSVASFFRTIPGDVDAKKVYGPIKELVSDENPPLYRETTTEEYLMHFQKKGLDGTSGLLR  1137
             VSVASF+ T      + K+YGPIKELVS++NPP YRETT  +Y+     +GLDGTS L  
Sbjct  301   VSVASFYST--SFQPSTKLYGPIKELVSEDNPPKYRETTVHDYVSFSMARGLDGTSPLPY  358

Query  1138  FRL  1146
             F++
Sbjct  359   FKI  361



>ref|NP_180641.1| 2-oxoglutarate dependent oxygenase-like protein [Arabidopsis 
thaliana]
 gb|AAC20718.1| putative dioxygenase [Arabidopsis thaliana]
 gb|AEC08446.1| 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase-like protein 
[Arabidopsis thaliana]
Length=358

 Score =   403 bits (1036),  Expect = 5e-134, Method: Compositional matrix adjust.
 Identities = 200/367 (54%), Positives = 258/367 (70%), Gaps = 12/367 (3%)
 Frame = +1

Query  52    SGDYDRKSELKAFDDMKTGVKGHVDSGIMKIPRIFIHDeikkeekeklkPAMASTYKVPI  231
             +G+YDR  E+KAFD MK GVKG VD+GI K+PRIF H ++         P  +ST ++P 
Sbjct  2     AGNYDRAGEVKAFDQMKIGVKGLVDAGITKVPRIFHHQDVAVTN-----PKPSSTLEIPT  56

Query  232   IDMEGLHTDHTTRRSEIIKEIRDACQTWGFFQIINHGIPTQVLDEMIDGVRQFHELDSEV  411
             ID+ G   + T  R  +I ++R A + +GFFQ+INHGIP +V++ M DG+R FHE DSEV
Sbjct  57    IDVGGGVFESTVTRKSVIAKVRAAVEKFGFFQVINHGIPLEVMESMKDGIRGFHEQDSEV  116

Query  412   KKQFYSRDLTRKVVYNTNFDFHTSPAATWRDTLYFIMAPHPPTPQELPQVCRDILIKYSN  591
             KK FYSRD+T+KV YNTNFD ++S AA WRDTL  +MAP  P   +LP +CR+I+++YS 
Sbjct  117   KKTFYSRDITKKVKYNTNFDLYSSQAANWRDTLTMVMAPDVPQAGDLPVICREIMLEYSK  176

Query  592   SVQKLGLCLLELFSESLGLHKNHLEKLGCAVGLSIFGQYYPACPEPELTFALRDHSDSGF  771
              + KLG  + EL SE+LGL  NHL++L CA  LS+   YYP CPEP+ TF +  H+D  F
Sbjct  177   RMMKLGELIFELLSEALGLKPNHLKELNCAKSLSLLSHYYPPCPEPDRTFGISSHTDISF  236

Query  772   FTVLNQDTQIGGLQVLHENQWVDVPPLHGALVVNVADLLQLITNDKFKSVVHRVIAQK-I  948
              T+L QD  IGGLQVLH+  W+DVPP   AL+VN+ DLLQLITNDKF SV HRV+A +  
Sbjct  237   ITILLQD-HIGGLQVLHDGYWIDVPPNPEALIVNLGDLLQLITNDKFVSVEHRVLANRGE  295

Query  949   APRVSVASFF-RTIPGDVDAKKVYGPIKELVSDENPPLYRETTTEEYLMHFQKKGLDGTS  1125
              PR+S ASFF  TIP +    +VYGP+KEL+S +NPP YR TTT E   H+  +GLDGTS
Sbjct  296   EPRISSASFFMHTIPNE----QVYGPMKELLSKQNPPKYRNTTTTEMARHYLARGLDGTS  351

Query  1126  GLLRFRL  1146
              LL FR+
Sbjct  352   PLLHFRI  358



>ref|XP_009379007.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1-like [Pyrus x bretschneideri]
Length=363

 Score =   403 bits (1036),  Expect = 5e-134, Method: Compositional matrix adjust.
 Identities = 203/367 (55%), Positives = 270/367 (74%), Gaps = 6/367 (2%)
 Frame = +1

Query  46    ADSGDYDRKSELKAFDDMKTGVKGHVDSGIMKIPRIFIHDeikkeekeklkPAMASTYKV  225
             A + +YDRKSELKAFDD K GVKG VD+GI  IPRIF H     +  +      +S + +
Sbjct  3     ATNTNYDRKSELKAFDDTKEGVKGLVDAGITVIPRIFHHPPNLDDNLDSEA---SSQFSI  59

Query  226   PIIDMEGLHTDHTTRRSEIIKEIRDACQTWGFFQIINHGIPTQVLDEMIDGVRQFHELDS  405
             P+ID++GL     T+R EI+ ++ +A +TWGFFQI NHGIP  VL+EM +G R F E D+
Sbjct  60    PVIDLQGLELGSPTKRKEIVAKVAEASETWGFFQIANHGIPVDVLEEMKNGARGFFEQDT  119

Query  406   EVKKQFYSRDLTRKVVYNTNFDFHTSPAATWRDTLYFIMAPHPPTPQELPQVCRDILIKY  585
             +VKK+ Y+RD +R V+YNTNFD +++PAATWRD+    MAP+PP P++LP++CRD+L+ Y
Sbjct  120   QVKKELYTRDQSRTVLYNTNFDLYSAPAATWRDSFGIYMAPNPPKPEDLPEICRDVLVDY  179

Query  586   SNSVQKLGLCLLELFSESLGLHKNHLEKLGCAVGLSIFGQYYPACPEPELTFALRDHSDS  765
             S  V KLG  LLEL SE+LGL  +HL  +GC+ GL++   YYPACP+PELT     H D+
Sbjct  180   SKQVMKLGKLLLELLSEALGLKPSHLNDIGCSEGLALLSNYYPACPQPELTMGTAKHGDA  239

Query  766   GFFTVLNQDTQIGGLQVLHENQWVDVPPLHGALVVNVADLLQLITNDKFKSVVHRVIAQK  945
              F T+L QD  IGGLQVL +N+W++VPP+ GALVVN+ DLLQLI+ND+FKSV HRV+A +
Sbjct  240   VFLTILLQD-HIGGLQVLPQNKWINVPPVPGALVVNIGDLLQLISNDRFKSVQHRVLASR  298

Query  946   IAPRVSVASFFRTIPGDVDAKKVYGPIKELVSDENPPLYRETTTEEYLMHFQKKGLDGTS  1125
             + PRVSVASFF T  G + + K++GPIKEL+S++NPP YRETT  +Y    + KGLDGTS
Sbjct  299   VGPRVSVASFFFT--GMLPSTKLFGPIKELLSEDNPPKYRETTVRDYFACVKLKGLDGTS  356

Query  1126  GLLRFRL  1146
              L +F+L
Sbjct  357   ALSQFKL  363



>ref|XP_010023986.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
3-like isoform X1 [Eucalyptus grandis]
 gb|KCW60403.1| hypothetical protein EUGRSUZ_H03121 [Eucalyptus grandis]
Length=374

 Score =   404 bits (1037),  Expect = 6e-134, Method: Compositional matrix adjust.
 Identities = 188/369 (51%), Positives = 264/369 (72%), Gaps = 4/369 (1%)
 Frame = +1

Query  46    ADSGDYDRKSELKAFDDMKTGVKGHVDSGIMKIPRIFIHDeikkeekeklkPAMASTYKV  225
             A  G YDR++ELK+FDD K GVKG  D+G+ KIPR F+HD +  E     + ++  +  V
Sbjct  8     APDGGYDRQAELKSFDDSKAGVKGLADAGLTKIPRFFVHDHLDLELDRASE-SLGPSPSV  66

Query  226   PIIDMEGLHTDHTT-RRSEIIKEIRDACQTWGFFQIINHGIPTQVLDEMIDGVRQFHELD  402
             P++D+ G+    +   R   +  +R+AC+TWGFFQ++NHG+P  + +EM++G+R+FHE D
Sbjct  67    PVVDLGGVGRGWSPGERKRTVGLVREACETWGFFQVVNHGVPAALTEEMVEGIRRFHEQD  126

Query  403   SEVKKQFYSRDLT-RKVVYNTNFDFHTSPAATWRDTLYFIMAPHPPTPQELPQVCRDILI  579
              E K+++YSRD   RKV+YN+NFD + +PAA WRDTL  ++AP  P PQELP VCRD++I
Sbjct  127   LEAKREWYSRDYGGRKVLYNSNFDLYRAPAANWRDTLSCVLAPRSPDPQELPAVCRDVII  186

Query  580   KYSNSVQKLGLCLLELFSESLGLHKNHLEKLGCAVGLSIFGQYYPACPEPELTFALRDHS  759
             +Y + + +L   + EL SE+LGL  ++L+ + C  GL   G YYP CPEP+LT    DH+
Sbjct  187   EYKDRILELADTIFELLSEALGLDPSYLKTIHCGEGLFFVGHYYPPCPEPDLTLGTGDHT  246

Query  760   DSGFFTVLNQDTQIGGLQVLHENQWVDVPPLHGALVVNVADLLQLITNDKFKSVVHRVIA  939
             DSGF T+L QD QIGGLQV H+NQW+DV P+ GALV+N+ DL+QLI+NDKF SV HRV+A
Sbjct  247   DSGFLTILLQD-QIGGLQVHHQNQWIDVSPIPGALVINLGDLMQLISNDKFISVSHRVLA  305

Query  940   QKIAPRVSVASFFRTIPGDVDAKKVYGPIKELVSDENPPLYRETTTEEYLMHFQKKGLDG  1119
             QKI PR+SVA   R      ++ ++YGPI+EL+S+ENPP+YRETT ++ + H+  KGL+G
Sbjct  306   QKIGPRISVACLMRQHLPPENSSRLYGPIEELLSEENPPIYRETTVKDLVTHYYAKGLNG  365

Query  1120  TSGLLRFRL  1146
              S L  F+L
Sbjct  366   VSALEHFKL  374



>ref|XP_010023982.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
3-like [Eucalyptus grandis]
 gb|KCW60393.1| hypothetical protein EUGRSUZ_H03109 [Eucalyptus grandis]
Length=374

 Score =   404 bits (1037),  Expect = 7e-134, Method: Compositional matrix adjust.
 Identities = 189/369 (51%), Positives = 261/369 (71%), Gaps = 4/369 (1%)
 Frame = +1

Query  46    ADSGDYDRKSELKAFDDMKTGVKGHVDSGIMKIPRIFIHDeikkeekeklkPAMASTYKV  225
             A  G YDR++ELK+FDD K GVKG  D+G+ KIPR F+HD +  E     +    S   V
Sbjct  8     APDGGYDRQAELKSFDDSKAGVKGLADAGLTKIPRFFVHDHLDLELDRASESPGPSP-SV  66

Query  226   PIIDMEGLHTDHTT-RRSEIIKEIRDACQTWGFFQIINHGIPTQVLDEMIDGVRQFHELD  402
             P++D+ G     +   R   +  +R+AC+TWGFFQ++NHG+P  + +EM++G+R+FHE D
Sbjct  67    PVVDLGGAGRGWSPGERKRTVGLVREACETWGFFQVVNHGVPAALTEEMVEGIRRFHEQD  126

Query  403   SEVKKQFYSRDLT-RKVVYNTNFDFHTSPAATWRDTLYFIMAPHPPTPQELPQVCRDILI  579
              E K+++YSRD   RKV+YN+NFD + +PAA WRDTL  ++AP  P PQELP VCRD++I
Sbjct  127   LEAKREWYSRDFGGRKVLYNSNFDLYQAPAANWRDTLSCVLAPRSPDPQELPAVCRDVII  186

Query  580   KYSNSVQKLGLCLLELFSESLGLHKNHLEKLGCAVGLSIFGQYYPACPEPELTFALRDHS  759
             +Y + + +L   + EL SE+LGL  ++L+ + C  GL   G YYP CPEP+LT    DH+
Sbjct  187   EYKDRILELADTVFELLSEALGLESSYLKTIQCGEGLFFVGHYYPPCPEPDLTLGTGDHT  246

Query  760   DSGFFTVLNQDTQIGGLQVLHENQWVDVPPLHGALVVNVADLLQLITNDKFKSVVHRVIA  939
             DSGF T+L QD QIGGLQV H+NQW+DV P+ GALV+N+ DL+QLI+NDKF SV HRV+A
Sbjct  247   DSGFLTILLQD-QIGGLQVHHQNQWIDVSPIPGALVINLGDLMQLISNDKFISVSHRVLA  305

Query  940   QKIAPRVSVASFFRTIPGDVDAKKVYGPIKELVSDENPPLYRETTTEEYLMHFQKKGLDG  1119
             QKI PR+SVA   R      ++ ++YGPI+EL+S+ENPP+YRETT ++ + H+  KGL+G
Sbjct  306   QKIGPRISVACLMRQHLPPENSSRLYGPIEELLSEENPPIYRETTVKDLVTHYYAKGLNG  365

Query  1120  TSGLLRFRL  1146
              S L  F+L
Sbjct  366   VSALEHFKL  374



>ref|XP_004296613.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1-like [Fragaria vesca subsp. vesca]
Length=362

 Score =   403 bits (1035),  Expect = 8e-134, Method: Compositional matrix adjust.
 Identities = 197/364 (54%), Positives = 260/364 (71%), Gaps = 7/364 (2%)
 Frame = +1

Query  58    DYDRKSELKAFDDMKTGVKGHVDSGIMKIPRIFIHDeikkeekeklkPAMASTYKVPIID  237
             +YDRKSE+KAFDD K GVKG VD+G+ ++PRIF H   +    +   P   +   +P+ID
Sbjct  5     NYDRKSEVKAFDDTKEGVKGLVDAGVTEVPRIFHHQPDEYSINDSNDPE-ETQISIPVID  63

Query  238   MEGLHTDHTTRRSEIIKEIRDACQTWGFFQIINHGIPTQVLDEMIDGVRQFHELDSEVKK  417
             +EGL    +T++ EI+ ++ +A +TWGFFQI+NHGIP  VL+E+  GV +F E D+EVKK
Sbjct  64    LEGLLD--STKQKEIVAKVGEASETWGFFQIVNHGIPVDVLEEVKHGVHRFFEQDTEVKK  121

Query  418   QFYSRDLTRK-VVYNTNFDFHTSPAATWRDTLYFIMAPHPPTPQELPQVCRDILIKYSNS  594
             Q Y RD  R  V+YN+NFD +++PA  WRDT    MAP P  P++LP+VCR+IL++YS+ 
Sbjct  122   QLYGRDHFRNPVIYNSNFDLYSAPATNWRDTFMCYMAPTPTKPEDLPEVCRNILVEYSDQ  181

Query  595   VQKLGLCLLELFSESLGLHKNHLEKLGCAVGLSIFGQYYPACPEPELTFALRDHSDSGFF  774
             V KLG  L EL SE+LGL   +L  + C+ GL +   YYP CP+PELT     H+D+ F 
Sbjct  182   VMKLGKLLFELLSEALGLKPTYLNDIDCSEGLVLLSHYYPPCPQPELTLGTTKHADNSFL  241

Query  775   TVLNQDTQIGGLQVLHENQWVDVPPLHGALVVNVADLLQLITNDKFKSVVHRVIAQKIAP  954
             TVL QD  IGGLQVLH+N+W+DVPP+ GALVVN+ DLLQLI+ND+FKSV H+V+A    P
Sbjct  242   TVLLQD-HIGGLQVLHQNKWIDVPPVPGALVVNIGDLLQLISNDRFKSVEHKVLANCRGP  300

Query  955   RVSVASFFRTIPGDVDAKKVYGPIKELVSDENPPLYRETTTEEYLMHFQKKGLDGTSGLL  1134
             RVS ASFF T  G +   K+YGPIKEL+S+ENPP YRETT  +Y  +F +KGLDGTS L 
Sbjct  301   RVSNASFFCT--GMLPLPKLYGPIKELLSEENPPKYRETTVRDYAAYFNEKGLDGTSALS  358

Query  1135  RFRL  1146
              F++
Sbjct  359   HFKV  362



>gb|KDP40304.1| hypothetical protein JCGZ_02302 [Jatropha curcas]
Length=366

 Score =   403 bits (1035),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 201/364 (55%), Positives = 268/364 (74%), Gaps = 4/364 (1%)
 Frame = +1

Query  55    GDYDRKSELKAFDDMKTGVKGHVDSGIMKIPRIFIHDeikkeekeklkPAMASTYKVPII  234
              +Y R +ELKAFD+ K+GVKG VD+G  +IPRIF H   + ++         + +  PII
Sbjct  7     NEYRRTNELKAFDETKSGVKGLVDAGTTQIPRIFHHPPDELDKISNTITCDHANFTFPII  66

Query  235   DMEGLHTDHTTRRSEIIKEIRDACQTWGFFQIINHGIPTQVLDEMIDGVRQFHELDSEVK  414
             D++ +H D   R+ EII+++++A ++WGFFQ++NHGIP +VL+EM DGVR+FHE D+E+K
Sbjct  67    DLQDIHKDSALRK-EIIQKVQNASESWGFFQVLNHGIPVRVLEEMKDGVRRFHEQDTELK  125

Query  415   KQFYSRDLTRKVVYNTNFDFHTSPAATWRDTLYFIMAPHPPTPQELPQVCRDILIKYSNS  594
             K+ Y RDL +KVVYN+NFD +++P+A WRDT    MAP PP P+ELP   RDI+++YS  
Sbjct  126   KELYCRDLAKKVVYNSNFDLYSAPSANWRDTFAIQMAPEPPNPEELPVAFRDIVMEYSME  185

Query  595   VQKLGLCLLELFSESLGLHKNHLEKLGCAVGLSIFGQYYPACPEPELTFALRDHSDSGFF  774
             VQKLG+ L EL SE+L L  ++LE + CA GL + G YYPACP+PELT     H+D+ F 
Sbjct  186   VQKLGILLFELLSEALCLKPSYLEDMECAQGLFVLGHYYPACPQPELTMGTTKHADNDFL  245

Query  775   TVLNQDTQIGGLQVLHENQWVDVPPLHGALVVNVADLLQLITNDKFKSVVHRVIAQKIAP  954
             TVL QD  IGGLQVLH+N+W+DVPP  GALVVN+ DLLQLI+ND+F SV HRV+A +I P
Sbjct  246   TVLLQD-HIGGLQVLHQNKWIDVPPTPGALVVNIGDLLQLISNDRFISVEHRVLANRIGP  304

Query  955   RVSVASFFRTIPGDVDAKKVYGPIKELVSDENPPLYRETTTEEYLMHFQKKGLDGTSGLL  1134
             RVSVA FF T    +   ++YGPIKEL+S+ENPP YRETT +E++ +F  KGLDGTS L 
Sbjct  305   RVSVACFFST--ALMSKPRLYGPIKELLSEENPPKYRETTVKEFVAYFNAKGLDGTSALQ  362

Query  1135  RFRL  1146
              F+L
Sbjct  363   HFKL  366



>ref|XP_004247708.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
[Solanum lycopersicum]
 ref|XP_010326754.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
[Solanum lycopersicum]
Length=375

 Score =   403 bits (1035),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 196/366 (54%), Positives = 258/366 (70%), Gaps = 11/366 (3%)
 Frame = +1

Query  58    DYDRKSELKAFDDMKTGVKGHVDS-GIMKIPRIFIHDeikkeekeklkPAMASTYKVPII  234
             +YD+ SELKAFDD K GVKG VD+    ++PRIF+H     +            +  P+I
Sbjct  16    NYDKHSELKAFDDTKAGVKGLVDACNSTEVPRIFVHPRESIQNSPGYT---EEEFVFPVI  72

Query  235   DMEGLHTDHTTRRSEIIKEIRDACQTWGFFQIINHGIPTQVLDEMIDGVRQFHELDSEVK  414
             D+EG+  DH  R  +I+ ++RDA +TWGFFQ++NH IP  VL+EM+ G R+F E D E+K
Sbjct  73    DLEGI--DHPIRHKDIVDKVRDASETWGFFQVVNHDIPLPVLEEMLQGARRFFEQDVEIK  130

Query  415   KQFYSRDLTRKVVYNTNFDFHTS--PAATWRDTLYFIMAPHPPTPQELPQVCRDILIKYS  588
             K++Y+RD T+KV + +NFD  +   PAA+WRD+LY  M P+PP+P+E P VCR+ILI++S
Sbjct  131   KRYYTRDTTKKVAHVSNFDLFSPSVPAASWRDSLYCFMCPNPPSPEEFPTVCREILIEFS  190

Query  589   NSVQKLGLCLLELFSESLGLHKNHLEKLGCAVGLSIFGQYYPACPEPELTFALRDHSDSG  768
               + KLG  L EL SE LGL+  HL+ + CA GLSI   YYPACP+PELT   R HSD  
Sbjct  191   KKMMKLGCSLFELLSEGLGLNPCHLKDMNCAEGLSIAQHYYPACPQPELTIGTRQHSDCV  250

Query  769   FFTVLNQDTQIGGLQVLHENQWVDVPPLHGALVVNVADLLQLITNDKFKSVVHRVIAQKI  948
             F TVL QD  IGGLQV H+NQW+DVPP  GALVVN+ DLLQLI+NDK+ SV HRV++ K+
Sbjct  251   FITVLLQD-DIGGLQVRHQNQWIDVPPTRGALVVNIGDLLQLISNDKYISVEHRVLSNKV  309

Query  949   APRVSVASFFRTIPGDVDAKKVYGPIKELVSDENPPLYRETTTEEYLMHFQKKGLDGTSG  1128
              PR+SV  FF T  G   + ++YGPIKEL+S+ NPP YR TT +EY  +F+KKG DGTS 
Sbjct  310   GPRISVPCFFST--GAFPSPRIYGPIKELLSECNPPKYRATTVKEYTDYFRKKGFDGTST  367

Query  1129  LLRFRL  1146
             LL +++
Sbjct  368   LLDYKI  373



>ref|XP_010093410.1| 1-aminocyclopropane-1-carboxylate oxidase-3-like protein [Morus 
notabilis]
 gb|EXB54016.1| 1-aminocyclopropane-1-carboxylate oxidase-3-like protein [Morus 
notabilis]
Length=377

 Score =   402 bits (1033),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 194/366 (53%), Positives = 262/366 (72%), Gaps = 6/366 (2%)
 Frame = +1

Query  55    GDYDRKSELKAFDDMKTGVKGHVDSGIMKIPRIFIHDeikkeekeklkPAMASTYKVPII  234
              +YDR SELKAFD+ + GVKG VDSG+ +IPR+F H     + +E    +  S   VP+I
Sbjct  16    AEYDRTSELKAFDETEAGVKGLVDSGVTEIPRMF-HHPSDNDFEEIYVSSGDSQISVPLI  74

Query  235   DMEGLHTDHTTRRSEIIKEIRDACQTWGFFQIINHGIPTQVLDEMIDGVRQFHELDSEVK  414
             D+ GL T    +R EI++ +R+A + WGFFQI+NHGIP  VL+EM  G+R+FHE ++EVK
Sbjct  75    DLGGLITKDPVKRKEIVERVREAAENWGFFQIVNHGIPESVLEEMKVGIRRFHEQETEVK  134

Query  415   KQFYSRDLTRKVVYNTNFDFHTSPAATWRDTLYFIMAPHPPTPQELPQVCRDILIKYSNS  594
             K++Y+RD T+ V Y++NFD ++  +  WRDT    MAP+PP P++LP  CRDILI+YS  
Sbjct  135   KEYYTRDPTKPVFYHSNFDLYSWISTNWRDTFICRMAPNPPKPEDLPIACRDILIEYSKQ  194

Query  595   VQKLGLCLLELFSESLGLHKNHLEKLGCAVGLSIFGQYYPACPEPELTFALRDHSDSGFF  774
             V ++G+ L EL SE+LGL+ N L ++ CA GL++   YYPACP+P+LT     H+D+GF 
Sbjct  195   VMEVGILLFELISEALGLNPNQLNEIDCAEGLTVLCHYYPACPQPKLTMGTTKHTDNGFL  254

Query  775   TVLNQDTQIGGLQVLHENQWVDVPPLHGALVVNVADLLQ--LITNDKFKSVVHRVIAQKI  948
             TVL QD  IGGLQVLH+N+W+DV P  G LVVN+ DLLQ  LI+N++F SV H+V+A ++
Sbjct  255   TVLLQD-NIGGLQVLHDNKWIDVSPQPGTLVVNIGDLLQASLISNERFTSVRHKVLANRV  313

Query  949   APRVSVASFFRTIPGDVDAKKVYGPIKELVSDENPPLYRETTTEEYLMHFQKKGLDGTSG  1128
              PRVSVASFF T  G +   K+YGPIKEL+S+ NPP YRETT  +Y++HF  KGL  TS 
Sbjct  314   GPRVSVASFFST--GSIPTSKLYGPIKELLSEGNPPKYRETTVRDYVLHFDSKGLGRTSA  371

Query  1129  LLRFRL  1146
             L  F+L
Sbjct  372   LDDFKL  377



>ref|XP_010023987.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
3-like isoform X2 [Eucalyptus grandis]
Length=374

 Score =   402 bits (1032),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 187/369 (51%), Positives = 264/369 (72%), Gaps = 4/369 (1%)
 Frame = +1

Query  46    ADSGDYDRKSELKAFDDMKTGVKGHVDSGIMKIPRIFIHDeikkeekeklkPAMASTYKV  225
             A  G YDR++ELK+FDD K GVKG  D+G+ KIPR F+HD +  E     + ++  +  V
Sbjct  8     APDGGYDRQAELKSFDDSKAGVKGLADAGLTKIPRFFVHDHLDLELDRASE-SLGPSPSV  66

Query  226   PIIDMEGLHTDHTT-RRSEIIKEIRDACQTWGFFQIINHGIPTQVLDEMIDGVRQFHELD  402
             P++D+ G+    +   R   +  +R+AC+TWGFFQ++NHG+P  + +EM++G+R+FHE D
Sbjct  67    PVVDLGGVGRGWSPGERKRTVGLVREACETWGFFQVVNHGVPAALTEEMVEGIRRFHEQD  126

Query  403   SEVKKQFYSRDLT-RKVVYNTNFDFHTSPAATWRDTLYFIMAPHPPTPQELPQVCRDILI  579
              E K+++YSRD   RKV+YN+NFD + +PAA WRDTL  ++AP  P PQELP VCRD++I
Sbjct  127   LEAKREWYSRDYGGRKVLYNSNFDLYRAPAANWRDTLSRVLAPRSPDPQELPAVCRDVII  186

Query  580   KYSNSVQKLGLCLLELFSESLGLHKNHLEKLGCAVGLSIFGQYYPACPEPELTFALRDHS  759
             +Y + + +L   + EL SE+LGL  ++L+ + C  GL   G YYPACPEP+LT    DH+
Sbjct  187   EYKDRILELSDTIFELLSEALGLDPSYLKTIHCGEGLFFVGHYYPACPEPDLTLGTGDHT  246

Query  760   DSGFFTVLNQDTQIGGLQVLHENQWVDVPPLHGALVVNVADLLQLITNDKFKSVVHRVIA  939
             DSGF T+L QD QIGGLQV H+NQW+DV P+ GALV+N+ DL+QLI+ND+F SV HRV+A
Sbjct  247   DSGFLTILLQD-QIGGLQVHHQNQWIDVSPIPGALVINLGDLMQLISNDEFISVSHRVLA  305

Query  940   QKIAPRVSVASFFRTIPGDVDAKKVYGPIKELVSDENPPLYRETTTEEYLMHFQKKGLDG  1119
             QKI PR+SVA   R      ++ ++YGPI+E +S+ENPP+YRETT ++ + H+  KGL+G
Sbjct  306   QKIGPRISVACLMRQHLPPENSSRLYGPIEERLSEENPPIYRETTVKDLVTHYYAKGLNG  365

Query  1120  TSGLLRFRL  1146
              S L  F+L
Sbjct  366   VSALEHFKL  374



>gb|KCW60387.1| hypothetical protein EUGRSUZ_H03103 [Eucalyptus grandis]
Length=344

 Score =   400 bits (1029),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 188/348 (54%), Positives = 260/348 (75%), Gaps = 5/348 (1%)
 Frame = +1

Query  103   TGVKGHVDSGIMKIPRIFIHDeikkeekeklkPAMASTYKVPIIDMEGLHTDHTTRRSEI  282
             TGVKG VDSG+ K+P IF+  + + +  +   PA  +++ +PI+D++G+H D +++R EI
Sbjct  2     TGVKGLVDSGVSKLPCIFV--DHRPQSPDCSDPA-ETSFSIPIVDLQGVHED-SSKRKEI  57

Query  283   IKEIRDACQTWGFFQIINHGIPTQVLDEMIDGVRQFHELDSEVKKQFYSRDLTRKVVYNT  462
             +  +  AC+ WGFFQ++NHGI   +L  +IDG+R+FHE +S++K++ YSRD ++KV++NT
Sbjct  58    VCRVGHACEDWGFFQVVNHGIGHGILSGIIDGMRRFHEQESKLKEELYSRDQSKKVIFNT  117

Query  463   NFDFHTSPAATWRDTLYFIMAPHPPTPQELPQVCRDILIKYSNSVQKLGLCLLELFSESL  642
             NFDFH++P A WRD+LY  MAPHPP+P+ELPQVCRDI+ +YS+ V +LGL + +L SE+L
Sbjct  118   NFDFHSAPVANWRDSLYCAMAPHPPSPEELPQVCRDIVREYSDKVMRLGLTIFKLLSEAL  177

Query  643   GLHKNHLEKLGCAVGLSIFGQYYPACPEPELTFALRDHSDSGFFTVLNQDTQIGGLQVLH  822
             GL+  HL+ +GCA GL + G YYP CPEP+LT     H+DS F TVL QD Q GGLQVLH
Sbjct  178   GLNPKHLQDMGCAEGLYLIGHYYPICPEPDLTQGHTKHTDSSFLTVLLQD-QTGGLQVLH  236

Query  823   ENQWVDVPPLHGALVVNVADLLQLITNDKFKSVVHRVIAQKIAPRVSVASFFRTIPGDVD  1002
             EN WVDV P+ GALVVN+ D+LQLITN KFKSV HRV A+ + PR+SVA FFR      +
Sbjct  237   ENHWVDVKPVQGALVVNLGDMLQLITNGKFKSVYHRVQAKNVGPRISVACFFRRHFEQEE  296

Query  1003  AKKVYGPIKELVSDENPPLYRETTTEEYLMHFQKKGLDGTSGLLRFRL  1146
             + + YGPIKEL+S+ENPPLYRET+ ++Y+ +   KGLDG   +   +L
Sbjct  297   SPRKYGPIKELLSEENPPLYRETSVKDYVKYIYSKGLDGVPAIDHLKL  344



>gb|EYU42211.1| hypothetical protein MIMGU_mgv1a008992mg [Erythranthe guttata]
Length=356

 Score =   401 bits (1030),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 197/362 (54%), Positives = 256/362 (71%), Gaps = 14/362 (4%)
 Frame = +1

Query  61    YDRKSELKAFDDMKTGVKGHVDSGIMKIPRIFIHDeikkeekeklkPAMASTYKVPIIDM  240
             Y+R  ELK+FD+ K GVKG VDSG+ KIPRIF         KE    A  + + +P+ID+
Sbjct  9     YNRAEELKSFDETKAGVKGLVDSGVEKIPRIF------HVPKEYSTNANEANFDIPVIDL  62

Query  241   EGLHTDHTTRRSEIIKEIRDACQTWGFFQIINHGIPTQVLDEMIDGVRQFHELDSEVKKQ  420
              G   D    + E +++IR A + +GFFQ++NHGIP  VL+EM+ G+R+F+ELD+  KK 
Sbjct  63    -GQGVD----QKESVEKIRHASERYGFFQVVNHGIPVCVLEEMLCGIRRFNELDAGAKKL  117

Query  421   FYSRDLTRKVVYNTNFDFHTSPAATWRDTLYFIMAPHPPTPQELPQVCRDILIKYSNSVQ  600
             +Y+RD+TRK VYN+NFD +++PAA WRDT +  MAP+PP P+ELP  CRDI I+YS  V 
Sbjct  118   YYTRDVTRKFVYNSNFDLYSAPAANWRDTFFSYMAPNPPKPEELPASCRDIQIEYSRHVM  177

Query  601   KLGLCLLELFSESLGLHKNHLEKLGCAVGLSIFGQYYPACPEPELTFALRDHSDSGFFTV  780
              LG  L  L SE+LGL  + L ++GC  GL+  G YYPACP+PELT     H+D GF TV
Sbjct  178   SLGFRLFGLLSEALGLESSRLFEMGCTDGLTFLGHYYPACPQPELTLGASKHTDDGFLTV  237

Query  781   LNQDTQIGGLQVLHENQWVDVPPLHGALVVNVADLLQLITNDKFKSVVHRVIAQKIAPRV  960
             L QD QIGGLQV   N W+D+PP+HGALV+N+ DLLQLI+NDKFKSV HRV+A +  PR+
Sbjct  238   LLQD-QIGGLQVFLNNMWIDIPPVHGALVINIGDLLQLISNDKFKSVEHRVLANRKGPRM  296

Query  961   SVASFFRTIPGDVDAKKVYGPIKELVSDENPPLYRETTTEEYLMHFQKKGLDGTSGLLRF  1140
             SVA FF T    + + K+YGPIKEL+S +NPP YRETT EEY+ +   KGLDG S LL F
Sbjct  297   SVACFFST--SMMPSSKIYGPIKELLSKDNPPKYRETTVEEYVTYSFTKGLDGVSPLLHF  354

Query  1141  RL  1146
             ++
Sbjct  355   KI  356



>gb|EYU32968.1| hypothetical protein MIMGU_mgv1a008832mg [Erythranthe guttata]
Length=361

 Score =   401 bits (1031),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 194/362 (54%), Positives = 251/362 (69%), Gaps = 9/362 (2%)
 Frame = +1

Query  61    YDRKSELKAFDDMKTGVKGHVDSGIMKIPRIFIHDeikkeekeklkPAMASTYKVPIIDM  240
             YDR  ELK+FD+ K GVKG VDSG+  IPRIF     ++        A  S Y +P+ID+
Sbjct  9     YDRAGELKSFDETKAGVKGLVDSGVETIPRIF--RLPEEYSTNTTAHANESNYDIPVIDL  66

Query  241   EGLHTDHTTRRSEIIKEIRDACQTWGFFQIINHGIPTQVLDEMIDGVRQFHELDSEVKKQ  420
             E    D    R   + +IR A + +GFFQ++NHGIP  VL+EM+ GVR+F+E+D+E KK 
Sbjct  67    EKEGID----RKVTVDKIRHASEKYGFFQVVNHGIPVGVLEEMLCGVRRFNEMDAEAKKV  122

Query  421   FYSRDLTRKVVYNTNFDFHTSPAATWRDTLYFIMAPHPPTPQELPQVCRDILIKYSNSVQ  600
             +Y+RD+TRK VYN+N D ++ P   WRDT    MAP+PP P+ELP  CRDI I+YS  V 
Sbjct  123   YYTRDVTRKFVYNSNSDLYSVPTVNWRDTFLSFMAPNPPKPEELPASCRDIQIEYSRHVM  182

Query  601   KLGLCLLELFSESLGLHKNHLEKLGCAVGLSIFGQYYPACPEPELTFALRDHSDSGFFTV  780
              LG  L  L SE+LGL  + L ++GC  GL+  G YYPACP+PELT    +H+D  F TV
Sbjct  183   NLGFRLFGLLSEALGLESSRLAEMGCTDGLTFVGHYYPACPQPELTLGATNHTDDAFLTV  242

Query  781   LNQDTQIGGLQVLHENQWVDVPPLHGALVVNVADLLQLITNDKFKSVVHRVIAQKIAPRV  960
             L QD QIGGLQV  +N W+D+PP+HGALV+N+ DLLQLI+NDKFKSV HRV+A +  PR+
Sbjct  243   LLQD-QIGGLQVFLDNMWIDIPPVHGALVINIGDLLQLISNDKFKSVEHRVLANREGPRM  301

Query  961   SVASFFRTIPGDVDAKKVYGPIKELVSDENPPLYRETTTEEYLMHFQKKGLDGTSGLLRF  1140
             SVA FF T    + + K+YGPIKEL+S++NPP YRETT EEY+ +   KGLDG S LL F
Sbjct  302   SVACFFST--SLMPSSKIYGPIKELLSEDNPPKYRETTVEEYVTYSFNKGLDGISALLHF  359

Query  1141  RL  1146
             ++
Sbjct  360   KI  361



>ref|XP_010274803.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1-like isoform X1 [Nelumbo nucifera]
Length=380

 Score =   401 bits (1031),  Expect = 5e-133, Method: Compositional matrix adjust.
 Identities = 211/377 (56%), Positives = 270/377 (72%), Gaps = 14/377 (4%)
 Frame = +1

Query  34    TGGKAD------SGDYDRKSELKAFDDMKTGVKGHVDSGIMKIPRIFIHDeikkeekekl  195
             TGG +       + DYDR  ELK FD+ K GVKG VDSG++K+PRIFI    K ++K   
Sbjct  4     TGGASKVSAAGVTSDYDRTKELKEFDESKAGVKGLVDSGLVKVPRIFIRPSDKTDQKSNT  63

Query  196   kPAMASTYKVPIIDMEGLHTDHTTRRSEIIKEIRDACQTWGFFQIINHGIPTQVLDEMID  375
                  +T  +P+ID+  +H D   R  EI+ +IR A +TWGFFQ++NHGIP  +LDEM++
Sbjct  64    SEIHPTT--IPVIDLGSIHED-AIRHEEIVGQIRHASETWGFFQVVNHGIPASLLDEMLE  120

Query  376   GVRQFHELDSEVKKQFYSRDLTRKVVYNTNFDFHTSPAATWRDTLYFIMAPHPPTPQELP  555
             GVR+F+E D+EVKK+FY+RD++R+VVYN+NFD + SPAA WRDT Y  MAP+PP P+ELP
Sbjct  121   GVRRFYEQDNEVKKRFYTRDISRRVVYNSNFDLYQSPAANWRDTFYCKMAPNPPNPEELP  180

Query  556   QVCRDILIKYSNSVQKLGLCLLELFSESLGLHKNHLEKLGCAVGLSIFGQYYPACPEPEL  735
             + CRDI+++YS  V +L   LL+L SE+L L    L  +GCA   +I   YYPACPEPEL
Sbjct  181   EACRDIMMEYSRQVARLAATLLQLVSEALTLEPKRLIDMGCAESEAILCHYYPACPEPEL  240

Query  736   TFALRDHSDSGFFTVLNQDTQIGGLQVLHENQWVDVPPLHGALVVNVADLLQLITNDKFK  915
             T     H+D+   T+L QD  IGGLQVLH+N WVDVPP+ GALVVNV DLLQLI+ND+FK
Sbjct  241   TMGTSKHADNDVVTILLQD-HIGGLQVLHKNHWVDVPPMPGALVVNVGDLLQLISNDRFK  299

Query  916   SVVHRVIAQKIAPRVSVASFFRTIPGDVDAKKVYGPIKELVSDENPPLYRETTTEEYLMH  1095
             SV HRV+A++I PRVSVASFF   P   D+  +YGPIKEL+S+ENPP+YRETT +EY   
Sbjct  300   SVDHRVLAKRIGPRVSVASFF---PSREDSTHIYGPIKELLSEENPPIYRETTAQEYSNF  356

Query  1096  FQKKGL-DGTSGLLRFR  1143
             F+ KGL DG S   R R
Sbjct  357   FRSKGLDDGKSKRSRER  373



>ref|XP_009347725.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1-like [Pyrus x bretschneideri]
Length=362

 Score =   400 bits (1028),  Expect = 9e-133, Method: Compositional matrix adjust.
 Identities = 198/367 (54%), Positives = 270/367 (74%), Gaps = 7/367 (2%)
 Frame = +1

Query  46    ADSGDYDRKSELKAFDDMKTGVKGHVDSGIMKIPRIFIHDeikkeekeklkPAMASTYKV  225
             A + +YDRKSE+KAFDD K GVKG VD+GI ++PRIF H    +   +    + AS + +
Sbjct  3     ATNTNYDRKSEVKAFDDTKEGVKGLVDAGITEVPRIFHHPRKSETSSD----SEASQFSI  58

Query  226   PIIDMEGLHTDHTTRRSEIIKEIRDACQTWGFFQIINHGIPTQVLDEMIDGVRQFHELDS  405
             P+ID++GL     T+R EI+ ++ +  +TWGFFQI NHGIP  VL+EM +G R F E D+
Sbjct  59    PVIDLQGLELGSLTKRKEIVAKVAEVSETWGFFQIANHGIPVDVLEEMKNGARGFFEQDT  118

Query  406   EVKKQFYSRDLTRKVVYNTNFDFHTSPAATWRDTLYFIMAPHPPTPQELPQVCRDILIKY  585
             +VKK+ Y+RD +R +VYN+NFD +++PA +WRD+    MAP+PP P+ELP+VCRDIL++Y
Sbjct  119   QVKKELYTRDHSRPLVYNSNFDLYSAPATSWRDSFGCYMAPNPPKPEELPEVCRDILVEY  178

Query  586   SNSVQKLGLCLLELFSESLGLHKNHLEKLGCAVGLSIFGQYYPACPEPELTFALRDHSDS  765
             S  V KLG  LLEL SE+LGL  +HL  + C+ GL +   YYPACP+PELT     H D 
Sbjct  179   SKQVMKLGTLLLELLSEALGLKPSHLNDIDCSEGLVLLSHYYPACPQPELTLGTTKHGDF  238

Query  766   GFFTVLNQDTQIGGLQVLHENQWVDVPPLHGALVVNVADLLQLITNDKFKSVVHRVIAQK  945
              F T+L QD  IGGLQVL +N+W++VPP+ GALVVN+ DLLQLI+ND+FKSV HRV+A +
Sbjct  239   SFLTILLQD-HIGGLQVLPQNKWINVPPVPGALVVNIGDLLQLISNDRFKSVQHRVLANR  297

Query  946   IAPRVSVASFFRTIPGDVDAKKVYGPIKELVSDENPPLYRETTTEEYLMHFQKKGLDGTS  1125
             + PRVS+AS F T  G + + K+YGPIKEL+S++NPP YRETT  +Y+++ + KGLDG+S
Sbjct  298   VGPRVSIASLFYT--GMLPSTKLYGPIKELLSEDNPPKYRETTVRDYVLYVRNKGLDGSS  355

Query  1126  GLLRFRL  1146
              L +F+L
Sbjct  356   ALSQFKL  362



>ref|XP_007226673.1| hypothetical protein PRUPE_ppa021125mg [Prunus persica]
 gb|EMJ27872.1| hypothetical protein PRUPE_ppa021125mg [Prunus persica]
Length=346

 Score =   399 bits (1026),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 194/345 (56%), Positives = 250/345 (72%), Gaps = 4/345 (1%)
 Frame = +1

Query  46    ADSGDYDRKSELKAFDDMKTGVKGHVDSGIMKIPRIFIHDeikkeekeklkPAMASTYKV  225
              ++ +YDR+SELKAFDD K GVKG VD+GI ++PRIF H    +        + A+ + +
Sbjct  4     TNNTNYDRQSELKAFDDTKEGVKGLVDAGITEVPRIF-HQPPDQYIINSNFDSEATQFSI  62

Query  226   PIIDMEGLHTDHTTRRSEIIKEIRDACQTWGFFQIINHGIPTQVLDEMIDGVRQFHELDS  405
             P+ID+EGL  D  T+R+EI+ ++ +A +TWGFFQI NHGIP  VL+EM D VR F E D+
Sbjct  63    PLIDLEGLEFDSPTKRNEIVAKVGEASETWGFFQISNHGIPVGVLEEMKDSVRGFFEQDT  122

Query  406   EVKKQFYSRDLTRKVVYNTNFDFHTSPAATWRDTLYFIMAPHPPTPQELPQVCRDILIKY  585
              VKKQFY+RD  + V YN+NFD + +PA +WRDT    MAP+P  P+E+P+V RDILI+Y
Sbjct  123   HVKKQFYNRDPLKPVGYNSNFDLYRAPATSWRDTFRCYMAPNPAKPEEMPEVFRDILIEY  182

Query  586   SNSVQKLGLCLLELFSESLGLHKNHLEKLGCAVGLSIFGQYYPACPEPELTFALRDHSDS  765
             S  + +LG  L EL SE+LGL  +HL  + C+ GL +   YYPACP+PELT     H+DS
Sbjct  183   SKQIMRLGKLLFELLSEALGLTPSHLNDIDCSEGLVLLCNYYPACPQPELTLGTSKHADS  242

Query  766   GFFTVLNQDTQIGGLQVLHENQWVDVPPLHGALVVNVADLLQLITNDKFKSVVHRVIAQK  945
              F TVL QD  IGGLQVLH+N+W+DVPP+ GALVVNV DLLQLI+N++FKSV HRV+A +
Sbjct  243   YFLTVLLQD-HIGGLQVLHKNKWIDVPPVPGALVVNVGDLLQLISNERFKSVEHRVLANR  301

Query  946   IAPRVSVASFFRTIPGDVDAKKVYGPIKELVSDENPPLYRETTTE  1080
             + PRVSVASFF T  G +  KK+YGPIKELVS +NPP YRE   E
Sbjct  302   VGPRVSVASFFTT--GMLPLKKLYGPIKELVSGDNPPKYREKNCE  344



>ref|XP_006350684.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1-like isoform X1 [Solanum tuberosum]
Length=361

 Score =   400 bits (1027),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 192/362 (53%), Positives = 257/362 (71%), Gaps = 9/362 (2%)
 Frame = +1

Query  61    YDRKSELKAFDDMKTGVKGHVDSGIMKIPRIFIHDeikkeekeklkPAMASTYKVPIIDM  240
             YDR+SEL AFD+ + GVKG VD+G+ K+P+IF        +         + + +P+ID+
Sbjct  9     YDRRSELIAFDNTQAGVKGLVDAGVKKVPKIFY-----TPQDAYSNDPEKNQFSIPVIDL  63

Query  241   EGLHTDHTTRRSEIIKEIRDACQTWGFFQIINHGIPTQVLDEMIDGVRQFHELDSEVKKQ  420
             +G+  D   +  EII++IRDA + WGFFQ++NHGI   VL+EM++GVR+F+E D+EVKKQ
Sbjct  64    DGISKD-PIQHKEIIEKIRDASEVWGFFQVVNHGISQSVLEEMLNGVRRFYEQDTEVKKQ  122

Query  421   FYSRDLTRKVVYNTNFDFHTSPAATWRDTLYFIMAPHPPTPQELPQVCRDILIKYSNSVQ  600
             +Y+RD ++KVVYN+NFD   S +A WRDT Y  MAP PP+  ELP  CRDILI+Y+  V+
Sbjct  123   WYTRDTSKKVVYNSNFDLFKSASAYWRDTTYCNMAPLPPSADELPDACRDILIEYTEQVK  182

Query  601   KLGLCLLELFSESLGLHKNHLEKLGCAVGLSIFGQYYPACPEPELTFALRDHSDSGFFTV  780
             KLG  L EL SE+LGL+ ++L  +GC+ GL++    YPA PEPELT     HSDS F TV
Sbjct  183   KLGRSLFELLSEALGLNPSYLNDIGCSEGLAVLYHCYPASPEPELTLGAGKHSDSDFLTV  242

Query  781   LNQDTQIGGLQVLHENQWVDVPPLHGALVVNVADLLQLITNDKFKSVVHRVIAQKIAPRV  960
             L QD  +GGLQV+H+N WVD+PP+ GALVVNV +LLQLI+NDK KS+ HRV+A  + PRV
Sbjct  243   LLQD-HLGGLQVIHKNYWVDIPPVSGALVVNVGELLQLISNDKLKSIAHRVLASGVGPRV  301

Query  961   SVASFFRTIPGDVDAKKVYGPIKELVSDENPPLYRETTTEEYLMHFQKKGLDGTSGLLRF  1140
             SVASFF T  G   + +VYGPIKEL+S +NP  YRET+ ++Y  H+   G+ G S L  F
Sbjct  302   SVASFFTT--GHSLSSRVYGPIKELLSKDNPARYRETSVKDYADHYNATGIGGKSALSDF  359

Query  1141  RL  1146
             R+
Sbjct  360   RI  361



>ref|XP_009796112.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
[Nicotiana sylvestris]
Length=365

 Score =   400 bits (1027),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 199/365 (55%), Positives = 267/365 (73%), Gaps = 10/365 (3%)
 Frame = +1

Query  58    DYDRKSELKAFDDMKTGVKGHVDSGIMKIPRIFIHDeikkeekeklkPAMASTYKVPIID  237
             +YD++SELKAFDD K GVKG +D+GI K+PRIFIH E  +           + +  P+ID
Sbjct  9     NYDKQSELKAFDDTKAGVKGLIDAGITKVPRIFIHPEALENPSS----PRKTRFIFPLID  64

Query  238   MEGLHTDHTTRRSEIIKEIRDACQTWGFFQIINHGIPTQVLDEMIDGVRQFHELDSEVKK  417
             ++ ++ +   +  EI+ +IRDA +TWGFFQ+INHGIP  VLDEM+ G R+FHE + +VKK
Sbjct  65    LQNINKN-PIKHKEIVNKIRDASETWGFFQVINHGIPVSVLDEMLRGARRFHEQEIDVKK  123

Query  418   QFYSRDLTRKVVYNTNFDFHTSPA--ATWRDTLYFIMAPHPPTPQELPQVCRDILIKYSN  591
              +YSRD+ RKV+YN NFD  +  A  A WRD+LY +MAP+   P+ELP+ CR+I+I+YS+
Sbjct  124   PYYSRDVARKVMYNCNFDLFSEKALAANWRDSLYSVMAPNSAKPEELPETCREIVIEYSD  183

Query  592   SVQKLGLCLLELFSESLGLHKNHLEKLGCAVGLSIFGQYYPACPEPELTFALRDHSDSGF  771
              V KLG  LLEL SE LGL  NHL+++ CA GL I   YYPACP+PEL      H+D+ F
Sbjct  184   HVMKLGCNLLELLSEGLGLKPNHLKEMDCAEGLGILCNYYPACPQPELAIGTSRHADNDF  243

Query  772   FTVLNQDTQIGGLQVLHENQWVDVPPLHGALVVNVADLLQLITNDKFKSVVHRVIAQKIA  951
             FTVL QD   GGLQV H+N WVDVPP+HGALV+N+ D+LQLI+NDK+KS+ HRV+A K+ 
Sbjct  244   FTVLLQD-DFGGLQVFHQNHWVDVPPIHGALVINIGDILQLISNDKYKSIEHRVLANKVG  302

Query  952   PRVSVASFFRTIPGDVDAKKVYGPIKELVSDENPPLYRETTTEEYLMHFQKKGLDGTSGL  1131
             PR+SVASFF T  G + + ++YGPIKEL+S++NPP YRETT +++  +  +KGLDG S L
Sbjct  303   PRISVASFFGT--GPLASSRIYGPIKELLSEDNPPKYRETTMKDFFEYSSQKGLDGNSNL  360

Query  1132  LRFRL  1146
               +R+
Sbjct  361   SYYRI  365



>gb|KEH22659.1| 2OG-Fe(II) oxygenase family oxidoreductase [Medicago truncatula]
Length=373

 Score =   400 bits (1028),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 196/369 (53%), Positives = 262/369 (71%), Gaps = 7/369 (2%)
 Frame = +1

Query  43    KADSGDYDRKSELKAFDDMKTGVKGHVDSGIMKIPRIFIHDeikkeekeklkPAMASTYK  222
             K+ +  YDR +E+KAFDD K GV+G V+SG+ KIP++F ++ +    K        S   
Sbjct  11    KSTNSTYDRYNEVKAFDDSKAGVRGLVESGVSKIPQMFHNEMLDIATKS----ICDSKLN  66

Query  223   VPIIDMEGLHTDHTTRRSEIIKEIRDACQTWGFFQIINHGIPTQVLDEMIDGVRQFHELD  402
             +PIID++G+  +  T R E+I +IR AC  WGFFQ+INH IP  VLDEMI G+R FHE D
Sbjct  67    IPIIDLKGIDIN-PTLREEVIGKIRSACHEWGFFQVINHEIPINVLDEMIHGIRNFHEQD  125

Query  403   SEVKKQFYSRDLTRKVVYNTNFDFHTSPAATWRDTLYFIMAPHPPTPQELPQVCRDILIK  582
               V+K+FY+RDL  KVVY +N    TS AA WRDT+ F++AP P  P+E+P +CRDI+I+
Sbjct  126   VNVRKEFYTRDLREKVVYFSNTTLFTSQAADWRDTVGFVVAPDPFKPEEIPPICRDIVIE  185

Query  583   YSNSVQKLGLCLLELFSESLGLHKNHLEKLGCAVGLSIFGQYYPACPEPELTFALRDHSD  762
             YS  +  LG  + EL SE++GL  ++L++L CA G+ I G Y+P CPEPELT  +  H+D
Sbjct  186   YSQKISDLGFRIFELLSEAVGLDPSYLKELKCAEGIYIMGHYFPPCPEPELTMGVGKHTD  245

Query  763   SGFFTVLNQDTQIGGLQVLHENQWVDVPPLHGALVVNVADLLQLITNDKFKSVVHRVIAQ  942
               F T+L QD QIGGL+VLHEN WV VPP HGALVVNV DLLQLITNDKF SV HRV++ 
Sbjct  246   GNFMTLLLQD-QIGGLEVLHENSWVKVPPTHGALVVNVGDLLQLITNDKFVSVHHRVLSP  304

Query  943   KIAPRVSVASFFRTIPGDVD-AKKVYGPIKELVSDENPPLYRETTTEEYLMHFQKKGLDG  1119
              I PR+SVA+FF +    ++ A KV+GPIKEL+S+ NPP+Y++ T +++L +F  KGLDG
Sbjct  305   NIGPRISVATFFLSSRDPIEGASKVFGPIKELISEANPPIYKDITIQDFLSYFHAKGLDG  364

Query  1120  TSGLLRFRL  1146
             +S L  F+L
Sbjct  365   SSSLEPFKL  373



>ref|XP_008438545.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1-like [Cucumis melo]
Length=386

 Score =   400 bits (1029),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 189/366 (52%), Positives = 259/366 (71%), Gaps = 9/366 (2%)
 Frame = +1

Query  61    YDRKSELKAFDDMKTGVKGHVDSGIMKIPRIFIHDeikkeekeklkPAMAST-YKVPIID  237
             +DR +ELK FDD K GVKG VD+GI +IPRIF              P    T   +P+ID
Sbjct  24    FDRSAELKLFDDTKAGVKGLVDNGITQIPRIFYR-----PPDSSEYPVAGDTELSIPVID  78

Query  238   MEGLHTDHTTRRSEIIKEIRDACQTWGFFQIINHGIPTQVLDEMIDGVRQFHELDSEVKK  417
             ++G+ TD +++RS+++ ++R+A + WGFFQ++NHG+P   LDE+ +G  +F+E D+EVKK
Sbjct  79    LQGIDTD-SSKRSDVVNKVREASEKWGFFQLVNHGVPLSFLDEIKNGTLRFYEQDTEVKK  137

Query  418   QFYSRDLTRKVVYNTNFDFHTSPAATWRDTLYFIMAPHPPTPQELPQVCRDILIKYSNSV  597
              FY+R  T+ +VYN+NFD  T+PAA WRDT    M P+ P PQ+LP+VCRDIL +YS  +
Sbjct  138   LFYTRHNTKSIVYNSNFDLFTAPAANWRDTFLCFMGPNVPNPQDLPEVCRDILFEYSKEM  197

Query  598   QKLGLCLLELFSESLGLHKNHLEKLGCAVGLSIFGQYYPACPEPELTFALRDHSDSGFFT  777
             +KLG  L  + SE+LGL+ N+L ++ C  GL++   YYPACP+PELT    +H+D+ F T
Sbjct  198   KKLGRILFGVLSEALGLNTNYLSEIECDRGLAVLCHYYPACPQPELTLGTTEHADNDFLT  257

Query  778   VLNQDTQIGGLQVLHENQWVDVPPLHGALVVNVADLLQLITNDKFKSVVHRVIAQKIAPR  957
             VL QD QIGGLQVLHE +WVD+PP+ GALV+N+ DLLQLI+ND+FKSV HRV+A +  PR
Sbjct  258   VLLQDDQIGGLQVLHEKKWVDIPPIPGALVINIGDLLQLISNDRFKSVEHRVVANREGPR  317

Query  958   VSVASFFRTIPGDVDAKKVYGPIKELVSDENPPLYRETTTEEYLMHFQKKGLDGTSGLLR  1137
             VSVASFF    G     +VYGPIKEL+S++NP  YRETT +++  +   +GL+G S L  
Sbjct  318   VSVASFFGI--GVYPTSQVYGPIKELLSEKNPAKYRETTLKDFYFYHNMRGLNGISALQH  375

Query  1138  FRLQKE  1155
             FR+  E
Sbjct  376   FRICLE  381



>ref|XP_011091222.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1-like [Sesamum indicum]
Length=365

 Score =   399 bits (1026),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 193/361 (53%), Positives = 252/361 (70%), Gaps = 10/361 (3%)
 Frame = +1

Query  58    DYDRKSELKAFDDMKTGVKGHVDSGIMKIPRIFIHDeikkeekeklkPAMASTYKVPIID  237
             D+DR SELKAFD+MK GVKG VD+GI K+PRIF       +       A A  + +P+ID
Sbjct  13    DFDRLSELKAFDEMKAGVKGLVDAGITKVPRIFYSQTDGFDR------APADDFAIPLID  66

Query  238   MEGLHTDHTTRRSEIIKEIRDACQTWGFFQIINHGIPTQVLDEMIDGVRQFHELDSEVKK  417
             ++ +  + + R S ++  +RDA   WGFFQ++NHGIP  VL+EM++GVR+F+E D+EVKK
Sbjct  67    IDAVEKNPSLRTS-VVDRVRDASGKWGFFQVVNHGIPGSVLEEMLEGVRRFYEQDAEVKK  125

Query  418   QFYSRDLTRKVVYNTNFDFHTSPAATWRDTLYFIMAPHPPTPQELPQVCRDILIKYSNSV  597
             Q+Y+RD  + VVYN+N++ + + +  WRDT Y  MAP PP P++LP  CRDI+++YS  V
Sbjct  126   QWYTRDGLKTVVYNSNYNLYAAESVDWRDTTYICMAPTPPDPEDLPLECRDIIVEYSKQV  185

Query  598   QKLGLCLLELFSESLGLHKNHLEKLGCAVGLSIFGQYYPACPEPELTFALRDHSDSGFFT  777
              KLG  L EL SE+L L+ NHL+ +GCA GL +   YYP CPEPELT     H+D  F T
Sbjct  186   TKLGRYLFELLSEALNLNPNHLKNIGCADGLGVLYHYYPPCPEPELTLGASAHTDIDFLT  245

Query  778   VLNQDTQIGGLQVLHENQWVDVPPLHGALVVNVADLLQLITNDKFKSVVHRVIAQKIAPR  957
             VL QD  IGGLQVL+ NQW D+PP+ GALVVN+ DLLQL++ND FKS +HRV+A    PR
Sbjct  246   VLLQD-HIGGLQVLYNNQWFDIPPVPGALVVNIGDLLQLVSNDNFKSGLHRVLASPAGPR  304

Query  958   VSVASFFRTIPGDVDAKKVYGPIKELVSDENPPLYRETTTEEYLMHFQKKGLDGTSGLLR  1137
             +SVA FF T  G + + KVYGPIKEL+SD+NPP YRETT  EY +H+  K     S LL 
Sbjct  305   LSVACFFTT--GLIPSPKVYGPIKELLSDDNPPKYRETTVREYSLHYNTKKDHEASALLD  362

Query  1138  F  1140
             F
Sbjct  363   F  363



>ref|XP_007149297.1| hypothetical protein PHAVU_005G058400g [Phaseolus vulgaris]
 gb|ESW21291.1| hypothetical protein PHAVU_005G058400g [Phaseolus vulgaris]
Length=367

 Score =   399 bits (1025),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 197/361 (55%), Positives = 251/361 (70%), Gaps = 7/361 (2%)
 Frame = +1

Query  64    DRKSELKAFDDMKTGVKGHVDSGIMKIPRIFIHDeikkeekeklkPAMASTYKVPIIDME  243
             +R  ELK FDD K GVKG VD GI KIPRIF H   +  +      +      +P+ID+ 
Sbjct  14    ERVRELKEFDDTKAGVKGLVDQGITKIPRIFHHPPDEHVKVST---SGGEADNIPVIDLA  70

Query  244   GLHTDHTTRRSEIIKEIRDACQTWGFFQIINHGIPTQVLDEMIDGVRQFHELDSEVKKQF  423
                 D + R+  +I  IR+A + WGFFQ++NHGIP  VL+++ DGV +F+E D+EVKK  
Sbjct  71    EDDKDPSLRQG-VIDRIREASEKWGFFQVVNHGIPVTVLEDLKDGVCRFYEQDTEVKKDL  129

Query  424   YSRDLTRKVVYNTNFDFHTSPAATWRDTLYFIMAPHPPTPQELPQVCRDILIKYSNSVQK  603
             Y+RD  +  +YN+NFD ++SPA  WRDT +  +AP+PP PQ+LP VCRDIL++Y   V K
Sbjct  130   YTRDQMKPFLYNSNFDIYSSPALNWRDTFFCYLAPNPPKPQDLPVVCRDILLEYGTCVMK  189

Query  604   LGLCLLELFSESLGLHKNHLEKLGCAVGLSIFGQYYPACPEPELTFALRDHSDSGFFTVL  783
             LG+ L EL SESLGLH NHL+ + CA GL     YYPACPEPELT     HSD+ F TVL
Sbjct  190   LGIALFELLSESLGLHPNHLKDMDCAKGLISLCHYYPACPEPELTLGTTKHSDNCFLTVL  249

Query  784   NQDTQIGGLQVLHENQWVDVPPLHGALVVNVADLLQLITNDKFKSVVHRVIAQKIAPRVS  963
              QD  IGGLQVL++N W+D+ P  GALVVN+ DLLQLITND+F+SV HRV+A    PR+S
Sbjct  250   LQD-HIGGLQVLYQNTWIDIAPEPGALVVNIGDLLQLITNDRFRSVEHRVVANVTGPRIS  308

Query  964   VASFFRTIPGDVDAKKVYGPIKELVSDENPPLYRETTTEEYLMHFQKKGLDGTSGLLRFR  1143
             VA FF    G   + K+YGPIKEL+S++NPP YRETT EEY+ +F +KGLDGTS L  FR
Sbjct  309   VACFFSE--GLKSSGKLYGPIKELLSEDNPPKYRETTVEEYVRYFNEKGLDGTSALHHFR  366

Query  1144  L  1146
             +
Sbjct  367   I  367



>ref|XP_010414213.1| PREDICTED: probable 2-oxoacid dependent dioxygenase [Camelina 
sativa]
Length=359

 Score =   399 bits (1024),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 200/366 (55%), Positives = 257/366 (70%), Gaps = 11/366 (3%)
 Frame = +1

Query  55    GDYDRKSELKAFDDMKTGVKGHVDSGIMKIPRIFIHDeikkeekeklkPAMASTYKVPII  234
             G+YDR  E+KAFD+MK GVKG +D+GI +IPRIF H        +      +ST K+P I
Sbjct  3     GNYDRTDEVKAFDEMKIGVKGLMDAGITQIPRIFHHPHATFTNPKPS----SSTLKIPTI  58

Query  235   DMEGLHTDHTTRRSEIIKEIRDACQTWGFFQIINHGIPTQVLDEMIDGVRQFHELDSEVK  414
             D+ G   + T  R  II +++DA + +GFFQ+INHGIP  V+++M DG+R FHE DSEVK
Sbjct  59    DLGGCVFESTVMRESIITKVKDAVEKFGFFQVINHGIPVDVMEKMKDGIRGFHEQDSEVK  118

Query  415   KQFYSRDLTRKVVYNTNFDFHTSPAATWRDTLYFIMAPHPPTPQELPQVCRDILIKYSNS  594
             K FYSRD+T+KV YNTNFD ++S A  WRDTL  +MAP     ++LP VCR+I+++YS  
Sbjct  119   KTFYSRDMTKKVKYNTNFDLYSSQAVNWRDTLTTVMAPDGLQVEDLPAVCREIMLEYSKR  178

Query  595   VQKLGLCLLELFSESLGLHKNHLEKLGCAVGLSIFGQYYPACPEPELTFALRDHSDSGFF  774
             + KLG  + EL SE+LGL  NHL++L CA  LS+   YYP CPEP+ TF +  H+D  F 
Sbjct  179   MMKLGEIIFELLSEALGLKPNHLKELDCAKSLSLLSHYYPPCPEPDRTFGISSHTDISFI  238

Query  775   TVLNQDTQIGGLQVLHENQWVDVPPLHGALVVNVADLLQLITNDKFKSVVHRVIAQK-IA  951
             T+L QD  IGGLQVLH+  W+DVPP   AL+VN+ DLLQLITNDKF SV HRV+A +   
Sbjct  239   TILLQD-HIGGLQVLHDGYWIDVPPNPEALIVNLGDLLQLITNDKFVSVEHRVLANRGEE  297

Query  952   PRVSVASFF-RTIPGDVDAKKVYGPIKELVSDENPPLYRETTTEEYLMHFQKKGLDGTSG  1128
             PR+S ASFF  TIP +    +VYGPIKE +S++NPP YR+TTT E   H+  KGLDGTS 
Sbjct  298   PRISSASFFMHTIPNE----QVYGPIKEFLSEQNPPKYRDTTTSEMARHYLAKGLDGTSP  353

Query  1129  LLRFRL  1146
             LL FR+
Sbjct  354   LLHFRI  359



>ref|XP_004513523.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1-like [Cicer arietinum]
Length=373

 Score =   399 bits (1025),  Expect = 4e-132, Method: Compositional matrix adjust.
 Identities = 197/370 (53%), Positives = 257/370 (69%), Gaps = 10/370 (3%)
 Frame = +1

Query  43    KADSGDYDRKSELKAFDDMKTGVKGHVDSGIMKIPRIFIHDeikkeekeklkPAMASTYK  222
             + +   YDRK+E+KAFDD K GV+G ++SG+ KIPR+F  +E              S+  
Sbjct  12    EGNDSTYDRKAEVKAFDDSKAGVRGLIESGVTKIPRMFYSNESNITNN-------LSSNT  64

Query  223   VPIIDMEGLHTD-HTTRRSEIIKEIRDACQTWGFFQIINHGIPTQVLDEMIDGVRQFHEL  399
             VPIID++ +H + + T   E+I +IR AC+ WGFFQ+INHGIP  VLDEM DG+R+FHE 
Sbjct  65    VPIIDLKDIHKNINLTLGEEVISQIRSACKEWGFFQVINHGIPIHVLDEMRDGIRRFHEQ  124

Query  400   DSEVKKQFYSRDLTRKVVYNTNFDFHTSPAATWRDTLYFIMAPHPPTPQELPQVCRDILI  579
             D +V+KQFY+RDL +K++Y +N        A WRDT+   MAP+PP  +ELPQV RDI+I
Sbjct  125   DVDVRKQFYTRDLKKKILYCSNTSLFRDKYANWRDTIGCSMAPNPPNSEELPQVFRDIII  184

Query  580   KYSNSVQKLGLCLLELFSESLGLHKNHLEKLGCAVGLSIFGQYYPACPEPELTFALRDHS  759
             +YS  + +LG  +LEL S +LGL  ++L++L C  GL I G YYP CPEPELT     H+
Sbjct  185   EYSKKIMELGSTILELLSMALGLDPSYLKELNCLEGLFIQGHYYPPCPEPELTMGTTKHT  244

Query  760   DSGFFTVLNQDTQIGGLQVLHENQWVDVPPLHGALVVNVADLLQLITNDKFKSVVHRVIA  939
             DS F T++ QD QIGGLQVLHENQW +VPP+HGALVVN+ DLLQLI+ND F SV HRV++
Sbjct  245   DSDFMTIVLQD-QIGGLQVLHENQWFNVPPVHGALVVNIGDLLQLISNDNFVSVYHRVLS  303

Query  940   QKIAPRVSVASFF-RTIPGDVDAKKVYGPIKELVSDENPPLYRETTTEEYLMHFQKKGLD  1116
                 PRVSVASFF  +      + KVY PIKEL+S ENP +YRET+  E++ H  +KGLD
Sbjct  304   NHKGPRVSVASFFLNSYDPSEGSSKVYSPIKELLSQENPQIYRETSISEFIGHHYEKGLD  363

Query  1117  GTSGLLRFRL  1146
             G S L  F+L
Sbjct  364   GNSALEPFKL  373



>ref|XP_007140617.1| hypothetical protein PHAVU_008G127200g [Phaseolus vulgaris]
 gb|ESW12611.1| hypothetical protein PHAVU_008G127200g [Phaseolus vulgaris]
Length=372

 Score =   399 bits (1024),  Expect = 6e-132, Method: Compositional matrix adjust.
 Identities = 195/378 (52%), Positives = 257/378 (68%), Gaps = 8/378 (2%)
 Frame = +1

Query  16    EMATASTGGKADSGDYDRKSELKAFDDMKTGVKGHVDSGIMKIPRIFIHDeikkeekekl  195
             E+ + +   +A    YDRK+E+KAFD+ K+GVKG VDSG+ +IPR+F             
Sbjct  2     EVKSTNQIEEAMDSSYDRKAEIKAFDETKSGVKGLVDSGVKRIPRMF-----HSGIDITE  56

Query  196   kPAMASTYKVPIIDMEGLHTDHTTRRSEIIKEIRDACQTWGFFQIINHGIPTQVLDEMID  375
                  S   VP+ID+E +H +   R+ E + +IR ACQ WGFFQ+INHGIP  V+D+MID
Sbjct  57    NTGSDSKLSVPVIDLESIHNNPALRK-EAVTKIRSACQEWGFFQVINHGIPIPVMDDMID  115

Query  376   GVRQFHELDSEVKKQFYSRDLTRKVVYNTNFDFHTSPAATWRDTLYFIMAPHPPTPQELP  555
             G+R+FHE D++V+KQF+SRDL  K++Y +N + +    A WRDT+   MAP+PP P+ELP
Sbjct  116   GIRRFHEQDADVRKQFFSRDLKSKILYCSNTNLYKDKFANWRDTVGCSMAPNPPKPEELP  175

Query  556   QVCRDILIKYSNSVQKLGLCLLELFSESLGLHKNHLEKLGCAVGLSIFGQYYPACPEPEL  735
              V  DI+ +YS     LG  + EL SE+LGL  ++LE+L CA GL I G YYP CP+PEL
Sbjct  176   AVFGDIITEYSKKAIALGCTIFELLSEALGLKPSYLEELNCAEGLFIQGHYYPPCPQPEL  235

Query  736   TFALRDHSDSGFFTVLNQDTQIGGLQVLHENQWVDVPPLHGALVVNVADLLQLITNDKFK  915
             T     H+D+ F T+L QD Q+GGLQ+LHENQW++VPP+HG LVVN+ D+LQL+TND F 
Sbjct  236   TLGTSKHTDTAFITILLQD-QLGGLQILHENQWLNVPPVHGGLVVNIGDVLQLMTNDNFV  294

Query  916   SVVHRVIAQKIAPRVSVASFF-RTIPGDVDAKKVYGPIKELVSDENPPLYRETTTEEYLM  1092
             SV HRV+A    PRVSVASFF  +   D    KVYGPIKEL+S+ NPP+YR+T+  E + 
Sbjct  295   SVYHRVLANHGGPRVSVASFFTNSHDPDKGMSKVYGPIKELLSENNPPMYRKTSIGEIMA  354

Query  1093  HFQKKGLDGTSGLLRFRL  1146
             H   KGLDG   L  FRL
Sbjct  355   HHFAKGLDGNHALKPFRL  372



>ref|XP_010023981.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1-like [Eucalyptus grandis]
 gb|KCW60389.1| hypothetical protein EUGRSUZ_H03105 [Eucalyptus grandis]
Length=371

 Score =   398 bits (1023),  Expect = 7e-132, Method: Compositional matrix adjust.
 Identities = 195/367 (53%), Positives = 259/367 (71%), Gaps = 16/367 (4%)
 Frame = +1

Query  61    YDRKSELKAFDDMKTGVKGHVDSGIMKIPRIFIHDeikkeekeklkPAMAST---YKVPI  231
             YDR  E KAFD+ K GVKG VD+GI ++PRIF+      +       A+AS+   + VPI
Sbjct  16    YDRMREKKAFDESKAGVKGLVDAGITEVPRIFVDHPENLQS------ALASSNGHFHVPI  69

Query  232   IDMEGLHTDHTTRRSEIIKEIRDACQTWGFFQIINHGIPTQVLDEMIDGVRQFHELDSEV  411
             +D+  +  D  +RR E++ E+R A +TWGFFQ++NHGIPT VL+EM+DGVR+FHE  +E 
Sbjct  70    VDLADIVKD-PSRRKEVVNEVRSASKTWGFFQVVNHGIPTTVLEEMLDGVRRFHEQGAEE  128

Query  412   KKQFYSRDLTRKVVYNTNFDFHTSPAATWRDTLYFIMAPHPPTPQELPQVCRDILIKYSN  591
             K++FYSRD T  V Y++NF+ + + AA WRDTL+ +MAP+ P  ++LP VCRDI++++S 
Sbjct  129   KRRFYSRDFTTSVAYHSNFNLYKTEAANWRDTLFCVMAPNAPEAEDLPAVCRDIMLEFSK  188

Query  592   SVQKLGLCLLELFSESLGLHKNHLEKLGCAVGLSIFGQYYPACPEPELTFALRDHSDSGF  771
              V  LG+ L EL SE+LGL  NHL+ + CA GL +  QYYP CP+PELT     H+DS F
Sbjct  189   RVMNLGITLFELLSEALGLKPNHLKDMECAKGLVLLNQYYPKCPQPELTMGTSRHTDSDF  248

Query  772   FTVLNQDTQIGGLQVLHENQWVDVPPLHGALVVNVADLLQLITNDKFKSVVHRVIAQKIA  951
              TVL QD  +GGLQVL++NQW+DV P+ GAL+VN+ DLLQLI+ND FKS  HRV+A  + 
Sbjct  249   LTVLLQD-HVGGLQVLYQNQWIDVSPVPGALIVNIGDLLQLISNDIFKSSEHRVVANNMG  307

Query  952   PRVSVASFFRTIPGDVDAKKVYGPIKELVSDENPPLYRETTTEEYLMHF--QKKGLDGTS  1125
             PR SVA FF T      + K+YGPIKEL+S+ +PP YRETT  EY+ HF    KG DGTS
Sbjct  308   PRASVACFFYT--ATPPSPKLYGPIKELISEGDPPKYRETTIMEYVSHFSANAKG-DGTS  364

Query  1126  GLLRFRL  1146
              L +F+L
Sbjct  365   ALQQFKL  371



>ref|XP_010469792.1| PREDICTED: probable 2-oxoacid dependent dioxygenase [Camelina 
sativa]
Length=359

 Score =   398 bits (1022),  Expect = 8e-132, Method: Compositional matrix adjust.
 Identities = 198/366 (54%), Positives = 258/366 (70%), Gaps = 11/366 (3%)
 Frame = +1

Query  55    GDYDRKSELKAFDDMKTGVKGHVDSGIMKIPRIFIHDeikkeekeklkPAMASTYKVPII  234
             G+YDR  E+KAFD+MK GVKG +D+GI +IPRIF H        +      +ST K+P I
Sbjct  3     GNYDRTGEVKAFDEMKIGVKGLMDAGITQIPRIFHHPHATFTNPKPS----SSTLKIPTI  58

Query  235   DMEGLHTDHTTRRSEIIKEIRDACQTWGFFQIINHGIPTQVLDEMIDGVRQFHELDSEVK  414
             D+ G   + T  R  +I +++DA + +GFFQ+INHGIP  V+++M DG+R FHE DS+VK
Sbjct  59    DLGGCVFESTVMRESVITKVKDAVENFGFFQVINHGIPVDVMEKMKDGIRGFHEQDSDVK  118

Query  415   KQFYSRDLTRKVVYNTNFDFHTSPAATWRDTLYFIMAPHPPTPQELPQVCRDILIKYSNS  594
             K FYSRD+T+KV YNTNF  ++S AA WRDTL  +MAP     ++LP VCR+I+++YS  
Sbjct  119   KTFYSRDITKKVKYNTNFGLYSSQAANWRDTLTMVMAPDVSQVEDLPAVCREIMLEYSKR  178

Query  595   VQKLGLCLLELFSESLGLHKNHLEKLGCAVGLSIFGQYYPACPEPELTFALRDHSDSGFF  774
             + KLG  + EL SE+LGL+ NHL++L C   LS+   YYP CPEP+ TF +  H+D  F 
Sbjct  179   MMKLGETIFELLSEALGLNPNHLKELDCDKSLSLLSHYYPPCPEPDRTFGISSHTDISFI  238

Query  775   TVLNQDTQIGGLQVLHENQWVDVPPLHGALVVNVADLLQLITNDKFKSVVHRVIAQK-IA  951
             T+L QD  IGGLQVLH+  W+DVPP   AL+VN+ DLLQLITNDKF SV HRV+A +   
Sbjct  239   TILLQD-HIGGLQVLHDGYWIDVPPNPEALIVNLGDLLQLITNDKFVSVEHRVLANRGEE  297

Query  952   PRVSVASFF-RTIPGDVDAKKVYGPIKELVSDENPPLYRETTTEEYLMHFQKKGLDGTSG  1128
             PR+S ASFF  TIP +    +VYGPIKEL+S++NPP YR+TTT E   H+  KGLDGTS 
Sbjct  298   PRISSASFFMHTIPNE----QVYGPIKELLSEQNPPKYRDTTTSEMARHYLAKGLDGTSP  353

Query  1129  LLRFRL  1146
             LL FR+
Sbjct  354   LLHFRI  359



>ref|XP_009802074.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
[Nicotiana sylvestris]
Length=374

 Score =   397 bits (1020),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 203/377 (54%), Positives = 269/377 (71%), Gaps = 14/377 (4%)
 Frame = +1

Query  34    TGGKADSG----DYDRKSELKAFDDMKTGVKGHVDSGIMKIPRIFIHDeikkeekeklkP  201
             +GG+   G    +YD++SELKAFDD K GVKG VD+GI K+PR+FIH +           
Sbjct  4     SGGEEHQGTFQQNYDKQSELKAFDDTKAGVKGVVDAGITKVPRMFIHPQESIHNSSN---  60

Query  202   AMASTYKVPIIDMEGLHTDHTTRRSEIIKEIRDACQTWGFFQIINHGIPTQVLDEMIDGV  381
             +    +  P+ID+EG+  DH  +  EI+ ++RDA +TWGFFQ++NHGIP  VL+EM+ G 
Sbjct  61    STEKNFIFPVIDLEGI--DHPIKHKEIVDKVRDASETWGFFQVVNHGIPLPVLEEMLQGA  118

Query  382   RQFHELDSEVKKQFYSRDLTRKVVYNTNFDFHTS--PAATWRDTLYFIMAPHPPTPQELP  555
             R+F E D E+K+Q+Y+RD T+KV + +NFD +++  PAA+WRD+LY +MAP+PP P+ELP
Sbjct  119   RRFFEQDIEIKRQYYTRDNTKKVAHVSNFDLYSTSVPAASWRDSLYCVMAPNPPDPEELP  178

Query  556   QVCRDILIKYSNSVQKLGLCLLELFSESLGLHKNHLEKLGCAVGLSIFGQYYPACPEPEL  735
               CR+IL+ +S  + KLG  LLEL SE LGL+  HL+ +  A GLSI   YYPACP+PEL
Sbjct  179   VACREILMDFSEHMMKLGYSLLELLSEGLGLNSCHLKDMNIAEGLSIGHHYYPACPQPEL  238

Query  736   TFALRDHSDSGFFTVLNQDTQIGGLQVLHENQWVDVPPLHGALVVNVADLLQLITNDKFK  915
             T   R HSD  F TVL QD  IGGLQVLH+NQW+DVPPL GALVVN+ D+LQLI NDK+ 
Sbjct  239   TIGTRKHSDCVFMTVLLQD-DIGGLQVLHQNQWIDVPPLSGALVVNIGDMLQLILNDKYL  297

Query  916   SVVHRVIAQKIAPRVSVASFFRTIPGDVDAKKVYGPIKELVSDENPPLYRETTTEEYLMH  1095
             SV HRV++ K+ PR+SV SFF T  G   + ++YGPIKEL+S+ NPP YR TT +EY   
Sbjct  298   SVEHRVLSNKVGPRISVPSFFST--GAFPSSRIYGPIKELLSECNPPKYRATTVKEYTDF  355

Query  1096  FQKKGLDGTSGLLRFRL  1146
             F+ KG DGTS L  +++
Sbjct  356   FRSKGFDGTSALQHYKI  372



>ref|XP_011029844.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1-like [Populus euphratica]
Length=359

 Score =   396 bits (1017),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 194/350 (55%), Positives = 250/350 (71%), Gaps = 11/350 (3%)
 Frame = +1

Query  109   VKGHVDSGIMKIPRIFIHDeikkeekeklkPAM-ASTYKVPIIDMEGLHTDHTTRRSEII  285
             +KG VD+G+ KIPR+FIH++  K E     PA     + +PIID EG + D   RR+ II
Sbjct  17    LKGLVDAGVTKIPRMFIHEQCVKLEDA---PAFHEPNFSIPIIDFEGWNEDENRRRN-II  72

Query  286   KEIRDACQTWGFFQIINHGIPTQVLDEMIDGVRQFHELDSEVKKQFYSRDLTRKVVYNTN  465
             +++  AC+ WGFFQ++NHGIP  + +E+IDG+ +FH  D EVKK+FYSRD TRKV+YN+N
Sbjct  73    QKLGSACKKWGFFQMVNHGIPRSIQEEVIDGIHRFHHQDVEVKKEFYSRDYTRKVLYNSN  132

Query  466   FDFHTSPAATWRDTLYFIMAPHPPTPQELPQVCRDILIKYSNSVQKLGLCLLELFSESLG  645
             FD +  PAA+WRDTL  +MAP PP P+ELP VCRDILI YS  +  LG  L E+ SE+LG
Sbjct  133   FDLYQVPAASWRDTLTCVMAPSPPNPEELPPVCRDILIDYSKRIMTLGNSLFEMLSEALG  192

Query  646   LHKNHLEKLGCAVGLSIFGQYYPACPEPELTFALRDHSDSGFFTVLNQDTQIGGLQVLHE  825
             L  NHL+ +GCA GL + G  YPACPEPELT     H+DSGF T+L QD QIGGLQVLHE
Sbjct  193   LEPNHLKDIGCAEGLYVLGHCYPACPEPELTMGTTKHADSGFLTLLLQD-QIGGLQVLHE  251

Query  826   NQWVDVPPLHGALVVNVADLLQLITNDKFKSVVHRVIAQKIAPRVSVASFFRT--IPGDV  999
             NQW++V P+ GALVVNV DL QLI+NDKF S  HRV+A+ + PR SVA  FR   +P   
Sbjct  252   NQWINVSPMPGALVVNVGDLFQLISNDKFVSATHRVVARNVGPRTSVACLFRQNLLP---  308

Query  1000  DAKKVYGPIKELVSDENPPLYRETTTEEYLMHFQKKGLDGTSGLLRFRLQ  1149
             +  ++YGPIKEL+S+ENPP+YRETT +++L      G DG S L   +++
Sbjct  309   ETLRLYGPIKELLSEENPPVYRETTVKDFLALKHLNGNDGVSRLKHLKIR  358



>gb|EYU32538.1| hypothetical protein MIMGU_mgv1a008409mg [Erythranthe guttata]
Length=374

 Score =   397 bits (1019),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 189/364 (52%), Positives = 261/364 (72%), Gaps = 6/364 (2%)
 Frame = +1

Query  61    YDRKSELKAFDDMKTGVKGHVDSGIMKIPRIFIH--DeikkeekeklkPAMASTYKVPII  234
             YDR++EL+AFDD K GVKG VD+G+ ++PRIFIH  + +K             +   P+I
Sbjct  15    YDRRAELQAFDDTKAGVKGLVDAGVTELPRIFIHPPESLKDITTTTTSTESTHSSTFPVI  74

Query  235   DMEGLHTDHTTRRSEIIKEIRDACQTWGFFQIINHGIPTQVLDEMIDGVRQFHELDSEVK  414
             D++G+ TD   R  +I+ E+  A ++WGFFQ+INHGI  ++L+EM+DG+R+F+E ++ +K
Sbjct  75    DLDGIDTDPRIRE-KIVDEVGKAAESWGFFQVINHGIEARILEEMLDGIRRFNEQETAIK  133

Query  415   KQFYSRDLTRKVVYNTNFDFHTSPAATWRDTLYFIMAPHPPTPQELPQVCRDILIKYSNS  594
             KQ+YSRDLT    +N+NFD  +SPAA WRD+++  +AP+PP P+ELP VCR+I+++YS  
Sbjct  134   KQYYSRDLTAAFKFNSNFDLFSSPAANWRDSIFIPVAPNPPKPEELPLVCREIMLEYSKQ  193

Query  595   VQKLGLCLLELFSESLGLHKNHLEKLGCAVGLSIFGQYYPACPEPELTFALRDHSDSGFF  774
             V +LG  LL+L SE LGL  N L ++ CA  L++   YYPACPEP+ T     HSD+ F 
Sbjct  194   VMELGKTLLKLLSEGLGLSPNRLMEMECADSLALISHYYPACPEPDKTLGTTRHSDNDFV  253

Query  775   TVLNQDTQIGGLQVLHENQWVDVPPLHGALVVNVADLLQLITNDKFKSVVHRVIAQKIAP  954
             +VL QD  +GGLQV+H+++WVDV P+ GALV+N+ DLLQL+TNDK+KSV HRV+A    P
Sbjct  254   SVLLQD-NLGGLQVVHDDRWVDVVPIPGALVINIGDLLQLVTNDKYKSVEHRVLASNTGP  312

Query  955   RVSVASFFRTIPGDVDAKKVYGPIKELVSDENPPLYRETTTEEYLMHFQKKGLDGTSGLL  1134
             R+SVASFF    G   + KV  PI+E++S+ENPP YR TT +EY   F+ KGLDGTS LL
Sbjct  313   RISVASFFGRDSG--PSPKVLAPIEEMLSEENPPKYRPTTAKEYTDFFRAKGLDGTSALL  370

Query  1135  RFRL  1146
              FRL
Sbjct  371   HFRL  374



>ref|XP_008224379.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1-like [Prunus mume]
Length=368

 Score =   396 bits (1018),  Expect = 4e-131, Method: Compositional matrix adjust.
 Identities = 205/364 (56%), Positives = 265/364 (73%), Gaps = 8/364 (2%)
 Frame = +1

Query  58    DYDRKSELKAFDDMKTGVKGHVDSGIMKIPRIFIHDeikkeekeklkPAMAST-YKVPII  234
             +YDR+S+LKAFDD K GVKG VD+GI ++PRIF     +   +    P    T + +P+I
Sbjct  12    NYDRQSDLKAFDDTKEGVKGLVDAGITEVPRIF----HQPPHEHSKNPITTQTQFSIPVI  67

Query  235   DMEGLHTDHTTRRSEIIKEIRDACQTWGFFQIINHGIPTQVLDEMIDGVRQFHELDSEVK  414
             D+EGL  D  T+R EI+ ++ ++ +TWGFFQI NHGIP  VL+E+ DGVR F E D+EVK
Sbjct  68    DLEGLALDSPTKRKEIVAKVGESSKTWGFFQIANHGIPISVLEEIKDGVRGFFEQDTEVK  127

Query  415   KQFYSRDLTRKVVYNTNFDFHTSPAATWRDTLYFIMAPHPPTPQELPQVCRDILIKYSNS  594
             K+ Y+RD  R V+YN+NFD + +PA  WRDT    MAP+   P++LP+VCRDILI+YS  
Sbjct  128   KKVYTRDYFRPVIYNSNFDLYKAPATNWRDTFICYMAPYAKKPEDLPEVCRDILIEYSKQ  187

Query  595   VQKLGLCLLELFSESLGLHKNHLEKLGCAVGLSIFGQYYPACPEPELTFALRDHSDSGFF  774
             + +LG  LLEL SE+LGL  +HL  + C+ GL +   YYPACP+PELT     H+DS F 
Sbjct  188   IMRLGKLLLELLSEALGLTPSHLNDIDCSEGLVLLCHYYPACPQPELTLGTSKHADSDFL  247

Query  775   TVLNQDTQIGGLQVLHENQWVDVPPLHGALVVNVADLLQLITNDKFKSVVHRVIAQKIAP  954
             TVL QD  IGGLQVLH+N+W+DVPP+ GALVVNV DLLQLI+N++FKSV HRV+A ++ P
Sbjct  248   TVLLQD-HIGGLQVLHKNKWIDVPPMPGALVVNVGDLLQLISNERFKSVEHRVLANRVGP  306

Query  955   RVSVASFFRTIPGDVDAKKVYGPIKELVSDENPPLYRETTTEEYLMHFQKKGLDGTSGLL  1134
             RVSVASFF T  G +  KK+YGPIKEL+S++NPP YRETT ++Y  H   KGLDGTS L 
Sbjct  307   RVSVASFFTT--GMLPLKKLYGPIKELLSEDNPPKYRETTVKDYNAHVNIKGLDGTSALN  364

Query  1135  RFRL  1146
              F+L
Sbjct  365   HFKL  368



>ref|XP_004171996.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1-like [Cucumis sativus]
 gb|KGN56871.1| hypothetical protein Csa_3G135680 [Cucumis sativus]
Length=371

 Score =   396 bits (1017),  Expect = 6e-131, Method: Compositional matrix adjust.
 Identities = 194/376 (52%), Positives = 257/376 (68%), Gaps = 5/376 (1%)
 Frame = +1

Query  19    MATASTGGKADSGDYDRKSELKAFDDMKTGVKGHVDSGIMKIPRIFIHDeikkeekeklk  198
             MA  +   K D   +DR SELKAFD  K GVKG VDSG+ +IPRIF +   ++   +K  
Sbjct  1     MANLTPLSKLDE-TFDRVSELKAFDQTKAGVKGLVDSGVAEIPRIFYYPHKERSNSDKTS  59

Query  199   PAMASTYKVPIIDMEGLHTDHTTRRSEIIKEIRDACQTWGFFQIINHGIPTQVLDEMIDG  378
                     VP++D+  +  D   RR +++ +IR+A ++WGFFQ++NHG+P  V DE+I+G
Sbjct  60    VTDEPHLGVPVVDLVDIDKDPFKRR-KVVDKIREASESWGFFQVLNHGVPASVQDEIING  118

Query  379   VRQFHELDSEVKKQFYSRDLTRKVVYNTNFDFHTSPAATWRDTLYFIMAPHPPTPQELPQ  558
              RQF E D E+KKQ+Y+RD T+  VYN+NFD  ++  A WRDT++  MAP+PP PQ+ P 
Sbjct  119   TRQFFEQDIEMKKQYYTRDNTKPFVYNSNFDLFSTSTANWRDTVFIQMAPNPPNPQDFPL  178

Query  559   VCRDILIKYSNSVQKLGLCLLELFSESLGLHKNHLEKLGCAVGLSIFGQYYPACPEPELT  738
             VCRDIL++YS  ++K+G  +  L SE+LGL   HL +L C+ G +    YYP+CP+PELT
Sbjct  179   VCRDILVEYSKQMEKVGEMIFGLLSEALGLQSTHLLELDCSEGHAFMCHYYPSCPQPELT  238

Query  739   FALRDHSDSGFFTVLNQDTQIGGLQVLHENQWVDVPPLHGALVVNVADLLQLITNDKFKS  918
                  HSDS F TVL Q+  IGGLQVLH N+WVDVPP+ GA  VNV  LLQLI+NDKF S
Sbjct  239   IGTTQHSDSSFITVLLQN-HIGGLQVLHHNKWVDVPPVPGAFAVNVGSLLQLISNDKFVS  297

Query  919   VVHRVIAQKIAPRVSVASFFRTIPGDVDAKKVYGPIKELVSDENPPLYRETTTEEYLMHF  1098
              VHRV+A +  PR+SVAS F T  G +   K+YGPIK+L+S +NPP YR+ T +EY ++F
Sbjct  298   SVHRVVANREGPRISVASAFST--GTIPTSKLYGPIKQLLSQQNPPKYRQITVKEYRLYF  355

Query  1099  QKKGLDGTSGLLRFRL  1146
              KKGLDGT  L  FRL
Sbjct  356   AKKGLDGTDALTHFRL  371



>ref|XP_003609637.1| 1-aminocyclopropane-1-carboxylate oxidase-like protein [Medicago 
truncatula]
 gb|AES91834.1| 2OG-Fe(II) oxygenase family oxidoreductase [Medicago truncatula]
Length=373

 Score =   396 bits (1017),  Expect = 7e-131, Method: Compositional matrix adjust.
 Identities = 196/369 (53%), Positives = 261/369 (71%), Gaps = 7/369 (2%)
 Frame = +1

Query  43    KADSGDYDRKSELKAFDDMKTGVKGHVDSGIMKIPRIFIHDeikkeekeklkPAMASTYK  222
             +A    YDRK+E+KAFDD + GV G V+SG+ KIPR F       +          S   
Sbjct  11    EATDSTYDRKAEVKAFDDSRAGVNGLVESGVSKIPRFF----HAGKLDIGENSTCDSKLS  66

Query  223   VPIIDMEGLHTDHTTRRSEIIKEIRDACQTWGFFQIINHGIPTQVLDEMIDGVRQFHELD  402
             VPI+D++ +H ++  +R ++I +IR AC  WGFFQ+INH IP  VLDEMIDG+R FHE D
Sbjct  67    VPIVDLKDIH-NNPAQRVDVIHQIRSACHEWGFFQVINHEIPITVLDEMIDGIRSFHEQD  125

Query  403   SEVKKQFYSRDLTRKVVYNTNFDFHTSPAATWRDTLYFIMAPHPPTPQELPQVCRDILIK  582
             ++V+K+FY+RDL +KV+Y +N    +  AA WRDT  F +APHP  P+E+P +CRDI+I+
Sbjct  126   ADVRKEFYTRDLKKKVMYYSNVHLFSGQAANWRDTFGFAVAPHPFKPEEVPPICRDIVIE  185

Query  583   YSNSVQKLGLCLLELFSESLGLHKNHLEKLGCAVGLSIFGQYYPACPEPELTFALRDHSD  762
             YS  +++LG  + EL SE+LGL+ ++L++L CA GL I G  YP CPEPELT     H+D
Sbjct  186   YSQKIKELGFTIFELLSEALGLNSSYLKELNCAEGLFILGHCYPPCPEPELTMGTTKHTD  245

Query  763   SGFFTVLNQDTQIGGLQVLHENQWVDVPPLHGALVVNVADLLQLITNDKFKSVVHRVIAQ  942
             S F T+L QD    GLQVLH+++WV+VPP+HGALVVNV DLLQLITND F SV HRV++ 
Sbjct  246   SNFMTLLLQDQLG-GLQVLHKDKWVNVPPVHGALVVNVGDLLQLITNDNFVSVYHRVLSH  304

Query  943   KIAPRVSVASFFRTIPGDVDAK-KVYGPIKELVSDENPPLYRETTTEEYLMHFQKKGLDG  1119
              I PR+SVASFF   P  ++ K KVYGPIKEL+S+ENPP+Y++ T E++L H+  KGLDG
Sbjct  305   NIGPRISVASFFVNSPDPIEGKSKVYGPIKELLSEENPPIYKDITIEDFLAHYYAKGLDG  364

Query  1120  TSGLLRFRL  1146
              S L  F+L
Sbjct  365   NSSLQPFKL  373



>ref|XP_006587351.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1-like [Glycine max]
 gb|KHN47484.1| 1-aminocyclopropane-1-carboxylate oxidase like 1 [Glycine soja]
Length=361

 Score =   395 bits (1015),  Expect = 8e-131, Method: Compositional matrix adjust.
 Identities = 186/361 (52%), Positives = 252/361 (70%), Gaps = 7/361 (2%)
 Frame = +1

Query  64    DRKSELKAFDDMKTGVKGHVDSGIMKIPRIFIHDeikkeekeklkPAMASTYKVPIIDME  243
             DRK+E++AFDD KTGVKG +DSG+ KIP +F       +          S + +PIID++
Sbjct  8     DRKAEVQAFDDSKTGVKGVLDSGVTKIPTMF-----HVKLDSTHTSPTHSNFTIPIIDLQ  62

Query  244   GLHTDHTTRRSEIIKEIRDACQTWGFFQIINHGIPTQVLDEMIDGVRQFHELDSEVKKQF  423
              ++++ +T  +E++ ++R A Q WGFFQ+INHG+P +VLDEMI G+R+FHE D+E +K F
Sbjct  63    NINSN-STLHAEVVDQLRSASQKWGFFQVINHGVPVEVLDEMISGIRRFHEQDAEARKPF  121

Query  424   YSRDLTRKVVYNTNFDFHTSPAATWRDTLYFIMAPHPPTPQELPQVCRDILIKYSNSVQK  603
             YSRD ++KV Y +N       A TWRDT+ F + P PP PQ++P VCRDI+ +YS  V+ 
Sbjct  122   YSRDSSKKVRYFSNGKLFRDMAGTWRDTIAFDVNPDPPNPQDIPAVCRDIVAEYSKQVKA  181

Query  604   LGLCLLELFSESLGLHKNHLEKLGCAVGLSIFGQYYPACPEPELTFALRDHSDSGFFTVL  783
             LG  + EL SE+LGL  ++LE++ C   L + GQYYP CPEPELT  +  H+D  F T+L
Sbjct  182   LGTTIFELLSEALGLDPSYLEEMDCTKALYVMGQYYPKCPEPELTMGISKHTDCDFITIL  241

Query  784   NQDTQIGGLQVLHENQWVDVPPLHGALVVNVADLLQLITNDKFKSVVHRVIAQKIAPRVS  963
              QD QIGGLQVLHEN WV+ PP+ GALVVN+ D+LQL+TNDKF SV HRV+ + + PR+S
Sbjct  242   LQD-QIGGLQVLHENHWVNAPPVRGALVVNIGDILQLMTNDKFISVYHRVLLRNMGPRIS  300

Query  964   VASFFRTIPGDVDAKKVYGPIKELVSDENPPLYRETTTEEYLMHFQKKGLDGTSGLLRFR  1143
             VA+FF          K YGPIKEL+S+ENPP+YR+   +E L ++  KGLDG+S LL  R
Sbjct  301   VATFFMNFTISKCTSKSYGPIKELLSEENPPVYRDMNMKEILTNYYAKGLDGSSYLLPLR  360

Query  1144  L  1146
             L
Sbjct  361   L  361



>ref|XP_003596185.1| 1-aminocyclopropane-1-carboxylate oxidase-like protein [Medicago 
truncatula]
 gb|AES66436.1| 1-aminocyclopropane-1-carboxylate oxidase-like protein [Medicago 
truncatula]
Length=358

 Score =   395 bits (1014),  Expect = 9e-131, Method: Compositional matrix adjust.
 Identities = 195/364 (54%), Positives = 249/364 (68%), Gaps = 8/364 (2%)
 Frame = +1

Query  58    DYDRKSELKAFDDMKTGVKGHVDSGIMKIPRIFIHDeikkeekeklkPAMASTYKVPIID  237
             D +R  ELKAFDD KTGVKG VD G++KIP +F H   K  +      +  + + +PIID
Sbjct  2     DSNRLHELKAFDDTKTGVKGLVDKGVVKIPTLFHHPLDKFGKATN---SNNTQHIIPIID  58

Query  238   MEGLHTDHTTRRSEIIKEIRDACQTWGFFQIINHGIPTQVLDEMIDGVRQFHELDSEVKK  417
                   D  TR  EI  +IR+AC+TWGFFQ++NHGIP  VL++M +GV +F E D EVKK
Sbjct  59    FANFGNDPKTRH-EITSKIREACETWGFFQVVNHGIPLNVLEDMRNGVIRFFEQDVEVKK  117

Query  418   QFYSRDLTRKVVYNTNFDFHTSPAATWRDTLYFIMAPHPPTPQELPQVCRDILIKYSNSV  597
             + YSRD  R   YN+NF+ ++S A  WRDT    +AP+ P PQ+LP VCRD L++Y   V
Sbjct  118   ELYSRDPMRPFSYNSNFNLYSSSALNWRDTFVCSLAPNAPKPQDLPLVCRDELLEYGEYV  177

Query  598   QKLGLCLLELFSESLGLHKNHLEKLGCAVGLSIFGQYYPACPEPELTFALRDHSDSGFFT  777
              KLG+ L EL SE+LGLH NHL+ +GCA G+     YYPACPEPELT     HSDS F T
Sbjct  178   TKLGMTLFELLSEALGLHPNHLKDMGCAKGILSLSHYYPACPEPELTMGTTKHSDSCFLT  237

Query  778   VLNQDTQIGGLQVLHENQWVDVPPLHGALVVNVADLLQLITNDKFKSVVHRVIAQKIAPR  957
             +L QD  IGGLQV H+N+W+D+PP+  ALVVNV DLLQL+TNDKFKSV H+V+A  I PR
Sbjct  238   LLLQDDHIGGLQVFHQNKWIDIPPIPDALVVNVGDLLQLVTNDKFKSVEHKVLANIIGPR  297

Query  958   VSVASFFRTIPGDVDA-KKVYGPIKELVSDENPPLYRETTTEEYLMHFQKKGLDGTSGLL  1134
             VSVA FF     D+++    YGPIKE +S++NPP Y+E T  EY+ ++  KG+DG S L 
Sbjct  298   VSVACFFN---ADLNSFSNQYGPIKEFLSEDNPPKYKEITISEYVAYYNTKGIDGISALQ  354

Query  1135  RFRL  1146
              FR+
Sbjct  355   HFRV  358



>ref|XP_006586236.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
12-like [Glycine max]
Length=373

 Score =   395 bits (1016),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 198/370 (54%), Positives = 265/370 (72%), Gaps = 7/370 (2%)
 Frame = +1

Query  40    GKADSGDYDRKSELKAFDDMKTGVKGHVDSGIMKIPRIFIHDeikkeekeklkPAMASTY  219
             G+     YDRK+E KAFDD K GV+G V+SG+ KIPR+F      K +  +  P+  +  
Sbjct  10    GETIDSTYDRKAEKKAFDDSKAGVRGLVESGVTKIPRMF---HAGKLDVIETSPS-HTKL  65

Query  220   KVPIIDMEGLHTDHTTRRSEIIKEIRDACQTWGFFQIINHGIPTQVLDEMIDGVRQFHEL  399
              +PIID++ +H++     ++++ +IR AC  WGFFQ+INHGIP  VLDEMI G+R+FHE 
Sbjct  66    SIPIIDLKDIHSN-PALHTQVMGKIRSACHEWGFFQVINHGIPISVLDEMIGGIRRFHEQ  124

Query  400   DSEVKKQFYSRDLTRKVVYNTNFDFHTSPAATWRDTLYFIMAPHPPTPQELPQVCRDILI  579
             D+EV+K+FY+RDL +KV+Y +N   ++     WRDT  F +AP P  P+E+P VCRDI+I
Sbjct  125   DAEVRKEFYTRDLKKKVLYYSNISLYSDQPVNWRDTFGFGVAPDPAKPEEIPSVCRDIVI  184

Query  580   KYSNSVQKLGLCLLELFSESLGLHKNHLEKLGCAVGLSIFGQYYPACPEPELTFALRDHS  759
             +YS  ++ LG  + EL SE+LGL+ ++L++L CA GL I G YYPACPEPELT     H+
Sbjct  185   EYSKKIRDLGFTMFELLSEALGLNPSYLKELNCAEGLFILGHYYPACPEPELTMGTTKHT  244

Query  760   DSGFFTVLNQDTQIGGLQVLHENQWVDVPPLHGALVVNVADLLQLITNDKFKSVVHRVIA  939
             DS F T+L QD    GLQVLH+NQWV+VPP+HGALVVN+ DLLQLITNDKF SV HRV++
Sbjct  245   DSNFMTLLLQDQLG-GLQVLHQNQWVNVPPVHGALVVNIGDLLQLITNDKFVSVYHRVLS  303

Query  940   QKIAPRVSVASFFRTIPGDVDA-KKVYGPIKELVSDENPPLYRETTTEEYLMHFQKKGLD  1116
             Q   PR+SVASFF      V+   K+YGPIKEL+S+ENPP+YR+TT +E+L ++  KGLD
Sbjct  304   QNTGPRISVASFFVNSHDPVEGTSKMYGPIKELLSEENPPIYRDTTLKEFLAYYYAKGLD  363

Query  1117  GTSGLLRFRL  1146
             G S L  FR+
Sbjct  364   GNSSLDPFRV  373



>ref|XP_010026850.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1-like [Eucalyptus grandis]
 gb|KCW60392.1| hypothetical protein EUGRSUZ_H03108 [Eucalyptus grandis]
Length=371

 Score =   395 bits (1015),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 196/375 (52%), Positives = 261/375 (70%), Gaps = 16/375 (4%)
 Frame = +1

Query  37    GGKADSGDYDRKSELKAFDDMKTGVKGHVDSGIMKIPRIFIHDeikkeekeklkPAMAST  216
             G    +  YDR SE+K FD++K GVKG VD+GI ++PRIF+      +       A+AS+
Sbjct  8     GAHEKTQKYDRISEIKDFDELKAGVKGLVDAGITEVPRIFVDHPENLQS------ALASS  61

Query  217   ---YKVPIIDMEGLHTDHTTRRSEIIKEIRDACQTWGFFQIINHGIPTQVLDEMIDGVRQ  387
                + VPI+D+  +  D  +RR E++ E+R A +TWGFFQ++NHGIPT VL+EM+DGVR+
Sbjct  62    NGHFHVPIVDLAEIVKD-PSRRKEVVNEVRSASKTWGFFQVVNHGIPTTVLEEMLDGVRR  120

Query  388   FHELDSEVKKQFYSRDLTRKVVYNTNFDFHTSPAATWRDTLYFIMAPHPPTPQELPQVCR  567
             FHE  +E KK+FYSRD T  V Y++NF+ + + AA WRDTL+ +MAP+    ++LP VC 
Sbjct  121   FHEQGAEEKKRFYSRDFTTSVAYHSNFNLYKTEAANWRDTLFCVMAPNALEAEDLPAVCG  180

Query  568   DILIKYSNSVQKLGLCLLELFSESLGLHKNHLEKLGCAVGLSIFGQYYPACPEPELTFAL  747
             DI++++S  V  LG  L EL SE+LGL  NHL+ + CA GL +  QYYP CP+PELT   
Sbjct  181   DIMLEFSKRVMNLGTTLFELLSEALGLKPNHLKDMECAKGLVLLNQYYPKCPQPELTMGT  240

Query  748   RDHSDSGFFTVLNQDTQIGGLQVLHENQWVDVPPLHGALVVNVADLLQLITNDKFKSVVH  927
               H+DS F TVL QD  +GGLQVL++NQW+DV P+ GAL+VN+ DLLQLI+ND FKS  H
Sbjct  241   SRHTDSDFLTVLLQD-HVGGLQVLYQNQWIDVSPVPGALIVNIGDLLQLISNDIFKSSEH  299

Query  928   RVIAQKIAPRVSVASFFRTIPGDVDAKKVYGPIKELVSDENPPLYRETTTEEYLMHF--Q  1101
             RV+A  + PRVSVA FF T      + K+YGPIKEL+S+ +PP YRETT  EY+ HF   
Sbjct  300   RVVANNMGPRVSVACFFYT--ATPPSPKLYGPIKELISEGDPPKYRETTIMEYVSHFSAN  357

Query  1102  KKGLDGTSGLLRFRL  1146
              KG DGTS L +F+L
Sbjct  358   AKG-DGTSALQQFKL  371



>ref|XP_007140619.1| hypothetical protein PHAVU_008G127400g [Phaseolus vulgaris]
 gb|ESW12613.1| hypothetical protein PHAVU_008G127400g [Phaseolus vulgaris]
Length=372

 Score =   395 bits (1015),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 193/378 (51%), Positives = 256/378 (68%), Gaps = 8/378 (2%)
 Frame = +1

Query  16    EMATASTGGKADSGDYDRKSELKAFDDMKTGVKGHVDSGIMKIPRIFIHDeikkeekekl  195
             E+ + +   +A    YDRK+E+KAFD+ K+GVKG +DSG+ ++PR+F             
Sbjct  2     EVKSTNQIEEAMDSSYDRKAEIKAFDETKSGVKGLLDSGVKRVPRMF-----HSGIDITE  56

Query  196   kPAMASTYKVPIIDMEGLHTDHTTRRSEIIKEIRDACQTWGFFQIINHGIPTQVLDEMID  375
                  S   VP+ID+E +H +   R+ E + +IR ACQ WGFFQ+INHGIP  V+D+MID
Sbjct  57    NTGSDSKLNVPVIDLESIHNNPALRK-EAVTKIRSACQEWGFFQVINHGIPIPVMDDMID  115

Query  376   GVRQFHELDSEVKKQFYSRDLTRKVVYNTNFDFHTSPAATWRDTLYFIMAPHPPTPQELP  555
             G+R+FHE D++V+KQF+SRDL  K++Y +N +      A WRDT+   MAP+PP P+ELP
Sbjct  116   GIRRFHEQDADVRKQFFSRDLKSKILYYSNNNLSKDKFANWRDTVGCSMAPNPPKPEELP  175

Query  556   QVCRDILIKYSNSVQKLGLCLLELFSESLGLHKNHLEKLGCAVGLSIFGQYYPACPEPEL  735
              V  DI+ +YS     LG  + EL SE+LGL  ++L++L CA GL I G YYP CP+PEL
Sbjct  176   AVFGDIITEYSKKAMALGCTIFELLSEALGLKPSYLKELNCAEGLFIQGHYYPPCPQPEL  235

Query  736   TFALRDHSDSGFFTVLNQDTQIGGLQVLHENQWVDVPPLHGALVVNVADLLQLITNDKFK  915
             T     H+D+ F T+L QD Q+GGLQ+LHENQW++VPP+H  LVVN+ D+LQLITND F 
Sbjct  236   TLGTSKHTDTAFITILLQD-QLGGLQILHENQWLNVPPVHRGLVVNIGDILQLITNDNFV  294

Query  916   SVVHRVIAQKIAPRVSVASFF-RTIPGDVDAKKVYGPIKELVSDENPPLYRETTTEEYLM  1092
             SV HRV+A    PRVSVASFF  +   D    KVYGPIKEL+S+ENPP+YR+T+  E + 
Sbjct  295   SVFHRVLANHGGPRVSVASFFTNSHDPDKGMSKVYGPIKELLSEENPPMYRKTSIGEIMA  354

Query  1093  HFQKKGLDGTSGLLRFRL  1146
             H   KGLDG   L  FRL
Sbjct  355   HHFAKGLDGNHALKPFRL  372



>ref|XP_010457801.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
3-like [Camelina sativa]
 ref|XP_010457804.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
3-like [Camelina sativa]
 ref|XP_010457805.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
3-like [Camelina sativa]
Length=368

 Score =   395 bits (1015),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 196/365 (54%), Positives = 248/365 (68%), Gaps = 4/365 (1%)
 Frame = +1

Query  55    GDYDRKSELKAFDDMKTGVKGHVDSGIMKIPRIFIHDeikkeekeklkPAMASTYKVPII  234
               +DR SELKAFDD KTGVKG VD+G+ KIPRIF H  +K    + L   +     +P I
Sbjct  7     ASFDRVSELKAFDDTKTGVKGLVDAGVSKIPRIFHHPSLKLSNPKPLPSDLLRLKTIPTI  66

Query  235   DMEGLHTDHTTRRSEIIKEIRDACQTWGFFQIINHGIPTQVLDEMIDGVRQFHELDSEVK  414
             D+ G   +   +R   ++EI++A   WGFFQ+INHG+   +L++M DGVR FHE   EVK
Sbjct  67    DLGGRVFEDVVKRKNAVEEIKEAAAKWGFFQVINHGVSLDLLEKMKDGVRDFHEQSPEVK  126

Query  415   KQFYSRDLTRKVVYNTNFDFHTSPAATWRDTLYFIMAPHPPTPQELPQVCRDILIKYSNS  594
             K FYSRD +R+ +Y +NFD  +SPAA WRDT    MAP+PP P +LP++CRD+L++YS  
Sbjct  127   KNFYSRDFSRRFLYQSNFDLFSSPAANWRDTFACTMAPNPPEPHDLPEICRDVLMEYSQQ  186

Query  595   VQKLGLCLLELFSESLGLHKNHLEKLGCAVGLSIFGQYYPACPEPELTFALRDHSDSGFF  774
             V  LG  L EL SE+LGL+ NHL+ + C+ GL +   YYP CPEP+LT     H+D+ F 
Sbjct  187   VMILGEFLFELLSEALGLNPNHLKDMDCSKGLLMLSHYYPPCPEPDLTLGTSQHADNSFL  246

Query  775   TVLNQDTQIGGLQVLHENQWVDVPPLHGALVVNVADLLQLITNDKFKSVVHRVIAQKIA-  951
             TVL  D QI GLQVL E  W DVP + GA+V+N+ DLLQLITNDKF S+ HRV+  K   
Sbjct  247   TVLLPD-QIEGLQVLREGYWFDVPHVPGAIVINIGDLLQLITNDKFISLEHRVLGNKATR  305

Query  952   PRVSVASFFRTIPGDVDAKKVYGPIKELVSDENPPLYRETTTEEYLMHFQKKGLDGTSGL  1131
              RVSVA FF T  G +   +VYGPI+ELVS+ENPP YRETT  EY  HF  KGLDGTS L
Sbjct  306   ARVSVACFFTT--GVLPDPRVYGPIRELVSEENPPKYRETTIREYATHFNTKGLDGTSAL  363

Query  1132  LRFRL  1146
             L F++
Sbjct  364   LHFKI  368



>ref|XP_010557155.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1-like [Tarenaya hassleriana]
Length=370

 Score =   395 bits (1014),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 197/367 (54%), Positives = 258/367 (70%), Gaps = 10/367 (3%)
 Frame = +1

Query  58    DYDRKSELKAFDDMKTGVKGHVDSGIMKIPRIFIHDeikkeekeklkPAMASTYKVPIID  237
             +YDR+S+LKAFDD KTGVKG VD+GI++IPRIF H      + + L         +P ID
Sbjct  10    EYDRESDLKAFDDAKTGVKGLVDAGIVEIPRIFRHPSANLIDAKPLSSVSPPQLTIPTID  69

Query  238   MEG-LHTDHTTRRSEIIKEIRDACQTWGFFQIINHGIPTQVLDEMIDGVRQFHELDSEVK  414
             ++G LH D  TR++ ++  IR+A + WGFFQ+INHGIP+ VL+EM DGV +FHE D EVK
Sbjct  70    LDGMLHGDSNTRKN-LVDNIREAAEKWGFFQVINHGIPSHVLEEMNDGVVRFHEQDPEVK  128

Query  415   KQFYSRDLTRKVVYNTNFDFHTSPAATWRDTLYFIMAPHPPTPQELPQVCRDILIKYSNS  594
             K FY+RD T+KVVYN+NFD ++SPAATWRDT    ++P PP  +++P  CRDI++++   
Sbjct  129   KGFYTRDPTKKVVYNSNFDLYSSPAATWRDTFGCYLSPDPPRLEDMPTTCRDIMMEFGKG  188

Query  595   VQKLGLCLLELFSESLGLHKNHLEKLGCAVGLSIFGQYYPACPEPELTFALRDHSDSGFF  774
             V K+   L EL SE+LGL  NHL+ + CA  L +   YYP CP+P+LT  L  HSD+ F 
Sbjct  189   VMKVAELLFELLSEALGLMPNHLKDMDCAKALLMLCHYYPPCPQPDLTLGLSKHSDNSFL  248

Query  775   TVLNQDTQIGGLQVLHENQWVDVPPLHGALVVNVADLLQLITNDKFKSVVHRVIAQK-IA  951
             TV+ QD   GGLQVLH + WVDVPP+ GALVVNV DLLQLITNDKF S  HRV+A++   
Sbjct  249   TVVLQDNN-GGLQVLHGDNWVDVPPVPGALVVNVGDLLQLITNDKFISAEHRVLAKRGNG  307

Query  952   PRVSVASFFRT--IPGDVDAKKVYGPIKELVSDENPPLYRETTTEEYLMHFQKKGLDGTS  1125
             PR SVA FF T  +P      ++YGP+KELVS++NP  YR+TT  E+  +++ KG DGTS
Sbjct  308   PRTSVACFFSTYLMPN----SRLYGPMKELVSEQNPAKYRDTTITEFAAYYRAKGHDGTS  363

Query  1126  GLLRFRL  1146
              LL  R+
Sbjct  364   ALLHLRI  370



>ref|XP_010457800.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
3-like [Camelina sativa]
Length=368

 Score =   394 bits (1013),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 196/365 (54%), Positives = 248/365 (68%), Gaps = 4/365 (1%)
 Frame = +1

Query  55    GDYDRKSELKAFDDMKTGVKGHVDSGIMKIPRIFIHDeikkeekeklkPAMASTYKVPII  234
               +DR SELKAFDD KTGVKG VD+G+ KIPRIF H  +K    + L   +     +P I
Sbjct  7     ASFDRVSELKAFDDTKTGVKGLVDAGVSKIPRIFHHPSLKLSNPKPLPSDLLRLKTIPTI  66

Query  235   DMEGLHTDHTTRRSEIIKEIRDACQTWGFFQIINHGIPTQVLDEMIDGVRQFHELDSEVK  414
             D+ G   +   +R   ++EI++A   WGFFQ+INHG+   +L++M DGVR FHE   EVK
Sbjct  67    DLGGRVFEDVVKRKNAVEEIKEAAAKWGFFQVINHGVSLDLLEKMKDGVRDFHEQSPEVK  126

Query  415   KQFYSRDLTRKVVYNTNFDFHTSPAATWRDTLYFIMAPHPPTPQELPQVCRDILIKYSNS  594
             K FYSRD +R+ +Y +NFD  +SPAA WRDT    MAP+PP P +LP++CRD+L++YS  
Sbjct  127   KGFYSRDFSRRFLYQSNFDLFSSPAANWRDTFACTMAPNPPEPHDLPEICRDVLMEYSQQ  186

Query  595   VQKLGLCLLELFSESLGLHKNHLEKLGCAVGLSIFGQYYPACPEPELTFALRDHSDSGFF  774
             V  LG  L EL SE+LGL+ NHL+ + C+ GL +   YYP CPEP+LT     H+D+ F 
Sbjct  187   VMILGEFLFELLSEALGLNPNHLKDMDCSKGLLMLSHYYPPCPEPDLTLGTSQHADNSFL  246

Query  775   TVLNQDTQIGGLQVLHENQWVDVPPLHGALVVNVADLLQLITNDKFKSVVHRVIAQKIA-  951
             TVL  D QI GLQVL E  W DVP + GA+V+N+ DLLQLITNDKF S+ HRV+  K   
Sbjct  247   TVLLPD-QIEGLQVLREGYWFDVPHVPGAIVINIGDLLQLITNDKFISLEHRVLGNKATR  305

Query  952   PRVSVASFFRTIPGDVDAKKVYGPIKELVSDENPPLYRETTTEEYLMHFQKKGLDGTSGL  1131
              RVSVA FF T  G +   +VYGPI+ELVS+ENPP YRETT  EY  HF  KGLDGTS L
Sbjct  306   ARVSVACFFTT--GVLPDPRVYGPIRELVSEENPPKYRETTIREYATHFNTKGLDGTSAL  363

Query  1132  LRFRL  1146
             L F++
Sbjct  364   LHFKI  368



>gb|AES62052.2| 2OG-Fe(II) oxygenase family oxidoreductase [Medicago truncatula]
Length=378

 Score =   394 bits (1013),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 198/385 (51%), Positives = 261/385 (68%), Gaps = 14/385 (4%)
 Frame = +1

Query  10    EREMATASTGGKADSGDYDRKSELKAFDDMKTGVKGHVDSG--IMKIPRIFIHDeikkee  183
             E E + +ST     +  Y+R +E+KAFD+ K GVKG V+SG  + KIPR+F H      +
Sbjct  2     ELEASNSST-----TSTYNRIAEVKAFDESKAGVKGLVESGTCVTKIPRMF-HFPKSSLK  55

Query  184   keklkPAM----ASTYKVPIIDMEGLHTDHTTRRSEIIKEIRDACQTWGFFQIINHGIPT  351
                 +  +    +S   VPIID++ ++T+      E++ +IR AC+ WGFFQ+INHGIP 
Sbjct  56    NNTHETILQIDSSSKLCVPIIDLQDMNTN-PCLHVEVVDKIRSACKEWGFFQVINHGIPV  114

Query  352   QVLDEMIDGVRQFHELDSEVKKQFYSRDLTRKVVYNTNFDFHTSPAATWRDTLYFIMAPH  531
              VLDEM   +R+FHE + + +K FY+RD ++KV Y +N      PAA WRDT+ F  +P 
Sbjct  115   SVLDEMTSAIRRFHEQEVDARKPFYTRDTSKKVRYFSNGTLFRDPAANWRDTIAFFTSPD  174

Query  532   PPTPQELPQVCRDILIKYSNSVQKLGLCLLELFSESLGLHKNHLEKLGCAVGLSIFGQYY  711
             PP P+E+PQVCRDI+I+YS  V+ LGL + EL+SE+LGLH ++L KL    G  +   YY
Sbjct  175   PPNPEEIPQVCRDIVIEYSKKVRALGLTIFELYSEALGLHPSYLTKLLSTYGQFLLCHYY  234

Query  712   PACPEPELTFALRDHSDSGFFTVLNQDTQIGGLQVLHENQWVDVPPLHGALVVNVADLLQ  891
             PACPEPELT     H+D  F T+L QD QIGG QVLH+NQWVDVPPLHG+LVVNV DL+Q
Sbjct  235   PACPEPELTMGTSKHTDIDFMTILLQD-QIGGFQVLHQNQWVDVPPLHGSLVVNVGDLMQ  293

Query  892   LITNDKFKSVVHRVIAQKIAPRVSVASFFRTIPGDVDAKKVYGPIKELVSDENPPLYRET  1071
             LITND F SV HRV+++ I PR+S+ASFF     +    KV  PIKEL+S+ENPP+YR+T
Sbjct  294   LITNDMFTSVYHRVLSKNIGPRISIASFFVNPSSEEVTSKVVAPIKELLSEENPPIYRDT  353

Query  1072  TTEEYLMHFQKKGLDGTSGLLRFRL  1146
             T +E L H+  KGLDG S L  FRL
Sbjct  354   TLKEVLAHYFTKGLDGNSSLHPFRL  378



>ref|XP_004309371.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1-like, partial [Fragaria vesca subsp. vesca]
Length=384

 Score =   395 bits (1014),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 191/363 (53%), Positives = 262/363 (72%), Gaps = 10/363 (3%)
 Frame = +1

Query  64    DRKSELKAFDDMKTGVKGHVDSGIMKIPRIFIHDeikkeekeklkPAMASTYKVPIIDME  243
             DR SELKAFDD K GVKG +D+G+  IPRIF H   +    ++      + + +P ID++
Sbjct  30    DRTSELKAFDDTKAGVKGLLDAGVKTIPRIF-HSRSQPNVDQREGGDDDARFSIPTIDLQ  88

Query  244   G--LHTDHTTRRSEIIKEIRDACQTWGFFQIINHGIPTQVLDEMIDGVRQFHELDSEVKK  417
             G  +  D +  R+E+++++R AC+ WGFFQ++NHGIP  VLDE+I G+R+FHE DSE+KK
Sbjct  89    GGKIQAD-SALRAEVMEKVRHACEKWGFFQVVNHGIPVNVLDEVIRGIREFHEQDSELKK  147

Query  418   QFYSRDLTRKVVYNTNFDFHTSPAATWRDTLYFIMAPHPPTPQELPQVCRDILIKYSNSV  597
             +FY+R   +KV Y++N+D + + +  WRDTL   MAP+PP P+ELP VCRDI+I+YS  V
Sbjct  148   EFYTRTPGKKVYYHSNYDLYQASSTDWRDTLGCFMAPNPPKPEELPSVCRDIVIEYSKHV  207

Query  598   QKLGLCLLELFSESLGLHKNHLEKLGCAVGLSIFGQYYPACPEPELTFALRDHSDSGFFT  777
              ++GL L E+ SESLGL+ NHL+ + CA GL + G  YPACPEP+LTF    H+D  F T
Sbjct  208   MEVGLTLFEILSESLGLNPNHLKDMNCAEGLLLLGHCYPACPEPDLTFGASKHTDGTFIT  267

Query  778   VLNQDTQIGGLQVLHENQWVDVPPLHGALVVNVADLLQLITNDKFKSVVHRVIAQKIAPR  957
             +L QD Q+GGLQ L+ENQWV+VPP++GALVVNV DLLQLITNDKF S+ HRV A+ + PR
Sbjct  268   ILLQD-QVGGLQALYENQWVNVPPMYGALVVNVGDLLQLITNDKFISLAHRVRAKNVGPR  326

Query  958   VSVASFFRTIPGDVDAKKVYGPIKELVSDENPPLYRETTTEEYLMHFQKKGLDGTSGLLR  1137
              SVASFFR+        KV+GPIKEL+S+ENP +Y+E   ++Y+ ++  +G +  S LL 
Sbjct  327   TSVASFFRS----ERNTKVFGPIKELLSEENPQIYQEVDIKDYVRYYYSEGKE-NSPLLH  381

Query  1138  FRL  1146
             F+L
Sbjct  382   FKL  384



>ref|XP_003534012.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1-like isoform X1 [Glycine max]
 ref|XP_006587352.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1-like isoform X2 [Glycine max]
Length=375

 Score =   394 bits (1013),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 195/369 (53%), Positives = 257/369 (70%), Gaps = 7/369 (2%)
 Frame = +1

Query  40    GKADSGDYDRKSELKAFDDMKTGVKGHVDSGIMKIPRIFIHDeikkeekeklkPAMASTY  219
              K DS  YDR +E+KAFD+ K GVKG  DSGI  IPRIF H +++   +        S +
Sbjct  14    SKKDST-YDRIAEVKAFDETKLGVKGLFDSGITNIPRIFHHAKVEDHTETMPN---DSNF  69

Query  220   KVPIIDMEGLHTDHTTRRSEIIKEIRDACQTWGFFQIINHGIPTQVLDEMIDGVRQFHEL  399
              VPIID++ + T+ ++ R + + +IR AC+ WGFFQ++NHGI   +LDEMI G+R+FHE 
Sbjct  70    SVPIIDLQDIDTN-SSLRVKALDKIRSACKEWGFFQVVNHGIAVDLLDEMICGIRRFHEQ  128

Query  400   DSEVKKQFYSRDLTRKVVYNTNFDFHTSPAATWRDTLYFIMAPHPPTPQELPQVCRDILI  579
             D+EV+K FYSRD+ +KV Y +N   +  PAA WRDT+ F   P PP P+E+P VCRDI+I
Sbjct  129   DAEVRKSFYSRDMNKKVRYFSNGTLYRDPAANWRDTIAFFRTPDPPNPEEIPSVCRDIVI  188

Query  580   KYSNSVQKLGLCLLELFSESLGLHKNHLEKLGCAVGLSIFGQYYPACPEPELTFALRDHS  759
              YS  V+ LG  + ELFSE+LGLH ++L++L    G  +   YYP CPEPELT     H+
Sbjct  189   GYSEKVRALGFTIFELFSEALGLHSSYLKELDSVDGQFLLCHYYPPCPEPELTMGTSKHT  248

Query  760   DSGFFTVLNQDTQIGGLQVLHENQWVDVPPLHGALVVNVADLLQLITNDKFKSVVHRVIA  939
             D  F T+L QD Q+GGLQVLH+NQWVDVPP+HG+LVVN+ D LQLITND F SV HRV++
Sbjct  249   DISFMTILLQD-QMGGLQVLHQNQWVDVPPVHGSLVVNIGDFLQLITNDMFLSVYHRVLS  307

Query  940   QKIAPRVSVASFFRTIPGDVDAKKVYGPIKELVSDENPPLYRETTTEEYLMHFQKKGLDG  1119
                 PR+SVASFF T      + KV GPIKEL+S++NPP+YR+TT ++   H+ +KGLDG
Sbjct  308   SHTGPRISVASFF-TKSFQQSSLKVVGPIKELLSEDNPPIYRDTTVKDVAAHYFEKGLDG  366

Query  1120  TSGLLRFRL  1146
              + L  FRL
Sbjct  367   NNSLHPFRL  375



>gb|AES66420.2| 2OG-Fe(II) oxygenase family oxidoreductase [Medicago truncatula]
Length=372

 Score =   394 bits (1012),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 198/361 (55%), Positives = 251/361 (70%), Gaps = 6/361 (2%)
 Frame = +1

Query  64    DRKSELKAFDDMKTGVKGHVDSGIMKIPRIFIHDeikkeekeklkPAMASTYKVPIIDME  243
             DR  ELKAFD+ K GVKG VD GI+KIP +F H   K  +      +  + + +P+ID  
Sbjct  18    DRLQELKAFDETKAGVKGLVDQGILKIPTLFHHPPDKYGKATN---STNTQHIIPVIDFA  74

Query  244   GLHTDHTTRRSEIIKEIRDACQTWGFFQIINHGIPTQVLDEMIDGVRQFHELDSEVKKQF  423
              +  D  TR+ EII +I++A +TWGFFQ+INHGIP  VL++M DGV++F E D+EVKK+ 
Sbjct  75    NIDKDPNTRQ-EIITKIKEASETWGFFQVINHGIPLNVLEDMKDGVKRFFEQDTEVKKEM  133

Query  424   YSRDLTRKVVYNTNFDFHTSPAATWRDTLYFIMAPHPPTPQELPQVCRDILIKYSNSVQK  603
             Y+RD TR +VYN+NFD + SPA  WRDT     A +    ++LP VCRDIL++Y   + K
Sbjct  134   YTRDRTRPLVYNSNFDLYRSPALNWRDTFICDFAVNASKLEDLPVVCRDILMEYGTCLMK  193

Query  604   LGLCLLELFSESLGLHKNHLEKLGCAVGLSIFGQYYPACPEPELTFALRDHSDSGFFTVL  783
             LG  L EL SE+LGLH NHL+ L C  G  I G YYPACPEP+LT     HSD  F TVL
Sbjct  194   LGRVLFELLSEALGLHPNHLKDLDCCEGNMIIGHYYPACPEPDLTMGTTKHSDVSFLTVL  253

Query  784   NQDTQIGGLQVLHENQWVDVPPLHGALVVNVADLLQLITNDKFKSVVHRVIAQKIAPRVS  963
              QD  IGGLQVLH+++W+DVPP+ GALVVN+ DLLQLITNDKFKSV HRV+A  I PR+S
Sbjct  254   LQDRIIGGLQVLHQDKWIDVPPVPGALVVNIGDLLQLITNDKFKSVEHRVLANGIGPRIS  313

Query  964   VASFFRTIPGDVDAKKVYGPIKELVSDENPPLYRETTTEEYLMHFQKKGLDGTSGLLRFR  1143
             VA FF+   G    KK+YGPI EL+S+ NPP Y+ETT  +++ +   KGLDGTS L  F+
Sbjct  314   VACFFKA--GLRAHKKLYGPITELLSENNPPRYKETTVADFIAYVYAKGLDGTSVLQDFK  371

Query  1144  L  1146
             L
Sbjct  372   L  372



>ref|XP_006598208.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1-like [Glycine max]
Length=368

 Score =   394 bits (1012),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 193/379 (51%), Positives = 264/379 (70%), Gaps = 14/379 (4%)
 Frame = +1

Query  19    MATASTGGKADSG---DYDRKSELKAFDDMKTGVKGHVDSGIMKIPRIFIHDeikkeeke  189
             MA  ST  K ++G    YDRKSE+KAFDD KTGV+G V++G+ K+P +F  +     +  
Sbjct  1     MAATSTD-KLEAGTVSSYDRKSEIKAFDDSKTGVQGLVENGVTKVPLMFYSENSNLNDGV  59

Query  190   klkPAMASTYKVPIIDMEGLHTDHTTRRSEIIKEIRDACQTWGFFQIINHGIPTQVLDEM  369
                 A  S   +PIID+ G+H D    R  ++ ++R AC+ WGFFQ+INHGIPT VLDEM
Sbjct  60    TG--ASYSKISIPIIDLTGIHDD-PILRDHVVGKVRYACEKWGFFQVINHGIPTHVLDEM  116

Query  370   IDGVRQFHELDSEVKKQFYSRDLTRKVVYNTNFDFHTSPAATWRDTLYFIMAPHPPTPQE  549
             I G  +FH+ D++V+K++Y+R+++RKV Y +N+     P+A WRDTL F +APHPP  +E
Sbjct  117   IKGTCRFHQQDAKVRKEYYTREVSRKVAYLSNYTLFEDPSADWRDTLAFSLAPHPPEAEE  176

Query  550   LPQVCRDILIKYSNSVQKLGLCLLELFSESLGLHKNHLEKLGCAVGLSIFGQYYPACPEP  729
              P VCRDI+ +YS  +  L   L EL SE+LGL++ +L+++ CA G  +   YYPACPEP
Sbjct  177   FPAVCRDIVNEYSKKIMALAYALFELLSEALGLNRFYLKEMDCAEGQLLLCHYYPACPEP  236

Query  730   ELTFALRDHSDSGFFTVLNQDTQIGGLQVLHENQWVDVPPLHGALVVNVADLLQLITNDK  909
             ELT     HSD    T+L QD QIGGLQVLH++QW+DVPP+HGALVVN+ D++QL+TNDK
Sbjct  237   ELTMGNTKHSDGNTITILLQD-QIGGLQVLHDSQWIDVPPMHGALVVNIGDIMQLMTNDK  295

Query  910   FKSVVHRVIAQKIAPRVSVASFFRTIPGDVDAKKVYGPIKELVSDENPPLYRETTTEEYL  1089
             F SV HRV+A+   PR+SVASFFRT        +V+GPIKEL+S+E+PP+YR+ + ++Y+
Sbjct  296   FISVQHRVLAKDQGPRISVASFFRT-----GISRVFGPIKELLSEEHPPVYRDISLKDYM  350

Query  1090  MHFQKKGLDGTSGLLRFRL  1146
              H    G  GTS LL F+L
Sbjct  351   AHRYTSG-SGTSALLHFKL  368



>ref|XP_004134416.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1-like [Cucumis sativus]
 ref|XP_004167603.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1-like [Cucumis sativus]
 gb|KGN56875.1| hypothetical protein Csa_3G135720 [Cucumis sativus]
Length=374

 Score =   394 bits (1013),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 195/384 (51%), Positives = 267/384 (70%), Gaps = 19/384 (5%)
 Frame = +1

Query  19    MATASTG------GKADSGDYDRKSELKAFDDMKTGVKGHVDSGIMKIPRIFIHDeikke  180
             MA A++G       KAD  ++ R +ELKAFDD K GVKG VD+ + +IPRIF H      
Sbjct  1     MAVAASGINLTPLSKADE-NFHRPTELKAFDDTKAGVKGLVDAKVNEIPRIFYHPPEDVH  59

Query  181   ekeklkPAMASTYKVPIIDMEGLHTDHTTRRSEIIKEIRDACQTWGFFQIINHGIPTQVL  360
                    +  +   +P+ID+EG+  D + +R  II++IRDA +  GFFQ+INHGIPT VL
Sbjct  60    -------SAQTHIHIPLIDLEGVGND-SLKRKHIIEQIRDASEELGFFQLINHGIPTSVL  111

Query  361   DEMIDGVRQFHELDSEVKKQFYSRDLTRKVVYNTNFDFHTSPAATWRDTLYFIMAPHPPT  540
             +EM D VR+FHE D+E KKQ+Y+RD  +  +YN+NFD +T+P   WRDT  ++ AP+PP 
Sbjct  112   EEMRDSVRRFHEQDTEDKKQYYTRDFMKPFIYNSNFDLYTAPTTNWRDTFSYVCAPNPPN  171

Query  541   PQELPQVCRDILIKYSNSVQKLGLCLLELFSESLGLHKNHLEKLGCAVGLSIFGQYYPAC  720
             PQELP++CRDI++ YS  V ++G  +LEL SE+LGL+ N+L+ +GC  GL+    YYP C
Sbjct  172   PQELPEICRDIMVDYSKWVMEIGKLVLELLSEALGLNPNYLDNIGCNDGLAFVYHYYPPC  231

Query  721   PEPELTFALRDHSDSGFFTVLNQDTQIGGLQVLHENQWVDVPPLHGALVVNVADLLQLIT  900
             P+P+LT  + +HSD+ F TVL QD  IGGLQ+ H+N+W+DV P+ GALVVN+ DL+QLIT
Sbjct  232   PQPKLTTGISEHSDTDFITVLLQD-HIGGLQIRHDNKWIDVHPVAGALVVNIGDLMQLIT  290

Query  901   NDKFKSVVHRVIAQKIAPRVSVASFFRTIPGDVDAKKVYGPIKELVSDENPPLYRETTTE  1080
             ND+FKSV HRV+A    PR+SVA  F T+    D  K+YGPIKELVS+E P +YRETT  
Sbjct  291   NDRFKSVNHRVLASHEGPRISVAGVFSTMVSPSD--KLYGPIKELVSEEKPAIYRETTVR  348

Query  1081  EYLMHFQKKGLDGTSGLLRFRLQK  1152
             ++ + F+  GL GTS L  ++L +
Sbjct  349   DFSVQFKSDGL-GTSTLKHYKLNQ  371



>gb|AAC49827.1| desacetoxyvindoline 4-hydroxylase, partial [Catharanthus roseus]
Length=382

 Score =   394 bits (1013),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 200/385 (52%), Positives = 267/385 (69%), Gaps = 8/385 (2%)
 Frame = +1

Query  4     EREREMATASTGGKADSGDYDRKSELKAFDDMKTGVKGHVDSGIMKIPRIFIHDeikkee  183
             E+ER+M   +    A   + +   ELKAFD+ K GVKG VD+GI KIPRIFI      + 
Sbjct  2     EQERKMKDLNFHA-ATLSEEESLRELKAFDETKAGVKGIVDTGITKIPRIFIDQPKNLDR  60

Query  184   keklkPAMASTYKVPIIDMEGLHTDHTTRRSEIIKEIRDACQTWGFFQIINHGIPTQVLD  363
                 +    S  K+P+I++ GL ++   RR EI+++I +A + +GFFQI+NHGIP  V+D
Sbjct  61    ISVCRGK--SDIKIPVINLNGLSSNSEIRR-EIVEKIGEASEKYGFFQIVNHGIPQDVMD  117

Query  364   EMIDGVRQFHELDSEVKKQFYSRD-LTRKVVYNTNFDFHTSPAATWRDTLYFIMAPHPPT  540
             +M+DGVR+FHE D ++K+Q+YSRD   +  +Y++N+      A  WRDT+  IM  + P 
Sbjct  118   KMVDGVRKFHEQDDQIKRQYYSRDRFNKNFLYSSNYVLIPGIACNWRDTMECIMNSNQPD  177

Query  541   PQELPQVCRDILIKYSNSVQKLGLCLLELFSESLGLHKNHLEKLGCAVGLSIFGQYYPAC  720
             PQE P VCRDIL+KYSN V+ LGL L EL SE+LGL  NHLE++ CA GL + G YYPAC
Sbjct  178   PQEFPDVCRDILMKYSNYVRNLGLILFELLSEALGLKPNHLEEMDCAEGLILLGHYYPAC  237

Query  721   PEPELTFALRDHSDSGFFTVLNQDTQIGGLQVLHENQWVDVPPLHGALVVNVADLLQLIT  900
             P+PELTF    HSDSGF T+L QD QIGGLQ+L ENQW+DVP + GALV+N+ADLLQLIT
Sbjct  238   PQPELTFGTSKHSDSGFLTILMQD-QIGGLQILLENQWIDVPFIPGALVINIADLLQLIT  296

Query  901   NDKFKSVVHRVIAQKIAPRVSVASFF--RTIPGDVDAKKVYGPIKELVSDENPPLYRETT  1074
             NDKFKSV HRV+A K+ PR+SVA  F  +T   +  + ++YGPIKEL+S+ENPP+Y+E T
Sbjct  297   NDKFKSVEHRVLANKVGPRISVAVAFGIKTQTQEGVSPRLYGPIKELISEENPPIYKEVT  356

Query  1075  TEEYLMHFQKKGLDGTSGLLRFRLQ  1149
              ++++     K  D +S L  FRL 
Sbjct  357   VKDFITIRFAKRFDDSSSLSPFRLN  381



>ref|XP_010556890.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1-like [Tarenaya hassleriana]
Length=361

 Score =   394 bits (1011),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 191/366 (52%), Positives = 254/366 (69%), Gaps = 9/366 (2%)
 Frame = +1

Query  49    DSGDYDRKSELKAFDDMKTGVKGHVDSGIMKIPRIFIHDeikkeekeklkPAMASTYKVP  228
             +SG++DR  ELKAFD+ K GVKG VDSGI +IPRIF        +++   P       +P
Sbjct  5     NSGEFDRAKELKAFDETKAGVKGLVDSGITEIPRIFHIQPGTLADRKPPLP-----LAIP  59

Query  229   IIDMEGLHTDHTTRRSEIIKEIRDACQTWGFFQIINHGIPTQVLDEMIDGVRQFHELDSE  408
              ID+EG   D  +R++ +++++R+A + WGFFQ+INHG+P  VL+EM DGVR+FHE D E
Sbjct  60    TIDLEGAFKDEFSRKN-VVEDVRNAAEKWGFFQVINHGVPLSVLEEMKDGVRRFHEEDLE  118

Query  409   VKKQFYSRDLTRKVVYNTNFDFHTSPAATWRDTLYFIMAPHPPTPQELPQVCRDILIKYS  588
              KK+++SRD T ++ YN+NFD ++SP+A WRDTL   +AP PP P+++P  CRD++++YS
Sbjct  119   AKKRYFSRDYTNRLGYNSNFDLYSSPSANWRDTLSCYIAPDPPKPEDMPDSCRDVMMEYS  178

Query  589   NSVQKLGLCLLELFSESLGLHKNHLEKLGCAVGLSIFGQYYPACPEPELTFALRDHSDSG  768
               V  LG  L EL SE+LGL+   L+ + CA GL +   YYP CP+P+LT     H+DS 
Sbjct  179   KHVMNLGNLLFELLSEALGLNPETLKDMDCAKGLFVLSHYYPPCPQPDLTLGTSKHTDSS  238

Query  769   FFTVLNQDTQIGGLQVLHENQWVDVPPLHGALVVNVADLLQLITNDKFKSVVHRVIAQKI  948
             F TVL QD  IGGLQV H++ WVDVPP+ GALVVN  D LQL+TNDKF S  HRV+A + 
Sbjct  239   FITVLLQD-HIGGLQVSHQDCWVDVPPVPGALVVNFGDFLQLLTNDKFISAEHRVLANRA  297

Query  949   APRVSVASFFRTIPGDVDAKKVYGPIKELVSDENPPLYRETTTEEYLMHFQKKGLDGTSG  1128
              PR+SVA FF T  G +   +VYGPIKEL+S+ENPP YR+ T  EY   +  KGLDGTS 
Sbjct  298   GPRISVACFFST--GVLPNPRVYGPIKELLSEENPPKYRDMTITEYTSKYISKGLDGTSQ  355

Query  1129  LLRFRL  1146
             L  FR+
Sbjct  356   LRHFRI  361



>ref|XP_007152330.1| hypothetical protein PHAVU_004G120800g [Phaseolus vulgaris]
 gb|ESW24324.1| hypothetical protein PHAVU_004G120800g [Phaseolus vulgaris]
Length=373

 Score =   394 bits (1012),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 196/370 (53%), Positives = 262/370 (71%), Gaps = 13/370 (4%)
 Frame = +1

Query  46    ADSGDYDRKSELKAFDDMKTGVKGHVDSGIMKIPRIFIHDeikkeekeklkPAMASTYKV  225
             ++S  YDR +E+KAFDD K GVKG +DSG+ KIPR+F H+    E  +       S   V
Sbjct  14    SNSFTYDRAAEVKAFDDTKLGVKGQLDSGLTKIPRMFHHELDINEISKGD-----SKLSV  68

Query  226   PIIDMEGLHTDHTTRRSEIIKEIRDACQTWGFFQIINHGIPTQVLDEMIDGVRQFHELDS  405
             PIID++ + T+ ++ R+E++ ++R AC+ WGFFQ+INHGI  +VL+EMI G+R+FHE DS
Sbjct  69    PIIDLQDIDTN-SSLRAEVVDKVRSACKKWGFFQVINHGIGVEVLNEMICGIRRFHEQDS  127

Query  406   EVKKQFYSRDLTRKVVYNTNFDFHTSPAATWRDTLYFIMAPHPPTPQELPQVCRDILIKY  585
             EV+K FYSRD  +KV Y +N +      A WRDT+ F + P PP+P+E+P VCRDI+I+Y
Sbjct  128   EVRKTFYSRDSNKKVKYFSNVNLSRGKGANWRDTISFFLTPDPPSPEEIPIVCRDIVIEY  187

Query  586   SNSVQKLGLCLLELFSESLGLHKNHLEKLGCAVGLSIFGQYYPACPEPELTFALRDHSDS  765
             S  V+ LG  + ELFSE+LGL+ ++L++L  A G    G YYPACPEPELT     H+DS
Sbjct  188   SKKVRMLGYTMFELFSEALGLNPSYLKELDSADGQFHLGHYYPACPEPELTLGTSKHTDS  247

Query  766   GFFTVLNQDTQIGGLQVLHENQWVDVPPLHGALVVNVADLLQLITNDKFKSVVHRVIAQK  945
              F T+L +D Q+GGLQVLHENQWVDV P+HG+LVVN+ D LQLITN  F SV HRV+A+ 
Sbjct  248   SFMTILLED-QMGGLQVLHENQWVDVHPVHGSLVVNIGDFLQLITNGMFMSVYHRVLAKH  306

Query  946   IAPRVSVASFF--RTIPGDVDAKKVYGPIKELVSDENPPLYRETTTEEYLMH-FQKKGLD  1116
               PR+SVASFF    + G     KV GP+KEL+S+ENPP+YR+TT ++ + H F +K LD
Sbjct  307   TGPRISVASFFINTALHG---TSKVVGPMKELLSEENPPIYRDTTVKDVMAHYFDEKCLD  363

Query  1117  GTSGLLRFRL  1146
             G + L  FRL
Sbjct  364   GNTPLQPFRL  373



>ref|XP_008367169.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
3-like [Malus domestica]
Length=375

 Score =   394 bits (1012),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 193/370 (52%), Positives = 257/370 (69%), Gaps = 13/370 (4%)
 Frame = +1

Query  55    GDYDRKSELKAFDDMKTGVKGHVDSGIMKIPRIFIHDei---kkeekeklkPAMASTYKV  225
              +YDRKSE+KAFD+ + GVKG VD+G+ ++PRIF        +         + A+ + +
Sbjct  11    NNYDRKSEVKAFDETREGVKGLVDAGVAEVPRIFHQPPQLDDQYSINNTSTDSEATQFSI  70

Query  226   PIIDMEGLHTDH--TTRRSEIIKEIRDACQTWGFFQIINHGIPTQVLDEMIDGVRQFHEL  399
             P+ID+E    DH   T+R+EI+ ++ +A +TWGFFQI NHGIP  VL+ + DGVR F+E 
Sbjct  71    PLIDLE----DHGNPTKRNEIVAKVGEASETWGFFQIXNHGIPVXVLEXIKDGVRGFYEQ  126

Query  400   DSEVKKQFYSRDLTRKVVYNTNFDFHTSPAATWRDTLYFIMAPHPPTPQELPQVCRDILI  579
             D+ VKK+FY+RD ++ + YN+NFD ++S A  WRDT    MAP PP P++LP+VCRD+LI
Sbjct  127   DTRVKKEFYTRDHSKPLFYNSNFDLYSSXATNWRDTFKCYMAPXPPKPEDLPEVCRDVLI  186

Query  580   KYSNSVQKLGLCLLELFSESLGLHKNHLEKLGCAVGLSIFGQYYPACPEPELTFALRDHS  759
             +YS  V +LG  L EL SE+LGL  +HL  + C+ GL + G YYPACP+PELT     H+
Sbjct  187   EYSKRVMELGKLLFELLSEALGLKPSHLNXIDCSKGLQVLGHYYPACPQPELTLGTSKHA  246

Query  760   DSGFFTVLNQDTQIGGLQ-VLHENQWVDVPPLHGALVVNVADLLQLITNDKFKSVVHRVI  936
             D  F TVL QD  IGGLQ V  + +W+DVPP+ GAL VN+ DLLQLI+ND+FKSV HRV 
Sbjct  247   DDSFLTVLLQD-HIGGLQXVXRQXKWIDVPPVPGALXVNIGDLLQLISNDRFKSVEHRVX  305

Query  937   AQKIAPRVSVASFFRTIPGDVDAKKVYGPIKELVSDENPPLYRETTTEEYLMHFQKKGLD  1116
             A +  PR+S+ASFF T  G +    +YGPIKELVS++NPP YRETT  +Y  HF  KGLD
Sbjct  306   ANREGPRISIASFFST--GLLPFTNLYGPIKELVSEDNPPKYRETTVRDYDTHFYDKGLD  363

Query  1117  GTSGLLRFRL  1146
             GTS L  F++
Sbjct  364   GTSALSHFKI  373



>gb|AAC49826.1| desacetoxyvindoline 4-hydroxylase, partial [Catharanthus roseus]
Length=386

 Score =   394 bits (1013),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 200/385 (52%), Positives = 267/385 (69%), Gaps = 8/385 (2%)
 Frame = +1

Query  4     EREREMATASTGGKADSGDYDRKSELKAFDDMKTGVKGHVDSGIMKIPRIFIHDeikkee  183
             E+ER+M   +    A   + +   ELKAFD+ K GVKG VD+GI KIPRIFI      + 
Sbjct  6     EQERKMKDLNFHA-ATLSEEESLRELKAFDETKAGVKGIVDTGITKIPRIFIDQPKNLDR  64

Query  184   keklkPAMASTYKVPIIDMEGLHTDHTTRRSEIIKEIRDACQTWGFFQIINHGIPTQVLD  363
                 +    S  K+P+I++ GL ++   RR EI+++I +A + +GFFQI+NHGIP  V+D
Sbjct  65    ISVCRGK--SDIKIPVINLNGLSSNSEIRR-EIVEKIGEASEKYGFFQIVNHGIPQDVMD  121

Query  364   EMIDGVRQFHELDSEVKKQFYSRD-LTRKVVYNTNFDFHTSPAATWRDTLYFIMAPHPPT  540
             +M+DGVR+FHE D ++K+Q+YSRD   +  +Y++N+      A  WRDT+  IM  + P 
Sbjct  122   KMVDGVRKFHEQDDQIKRQYYSRDRFNKNFLYSSNYVLIPGIACNWRDTMECIMNSNQPD  181

Query  541   PQELPQVCRDILIKYSNSVQKLGLCLLELFSESLGLHKNHLEKLGCAVGLSIFGQYYPAC  720
             PQE P VCRDIL+KYSN V+ LGL L EL SE+LGL  NHLE++ CA GL + G YYPAC
Sbjct  182   PQEFPDVCRDILMKYSNYVRNLGLILFELLSEALGLKPNHLEEMDCAEGLILLGHYYPAC  241

Query  721   PEPELTFALRDHSDSGFFTVLNQDTQIGGLQVLHENQWVDVPPLHGALVVNVADLLQLIT  900
             P+PELTF    HSDSGF T+L QD QIGGLQ+L ENQW+DVP + GALV+N+ADLLQLIT
Sbjct  242   PQPELTFGTSKHSDSGFLTILMQD-QIGGLQILLENQWIDVPFIPGALVINIADLLQLIT  300

Query  901   NDKFKSVVHRVIAQKIAPRVSVASFF--RTIPGDVDAKKVYGPIKELVSDENPPLYRETT  1074
             NDKFKSV HRV+A K+ PR+SVA  F  +T   +  + ++YGPIKEL+S+ENPP+Y+E T
Sbjct  301   NDKFKSVEHRVLANKVGPRISVAVAFGIKTQTQEGVSPRLYGPIKELISEENPPIYKEVT  360

Query  1075  TEEYLMHFQKKGLDGTSGLLRFRLQ  1149
              ++++     K  D +S L  FRL 
Sbjct  361   VKDFITIRFAKRFDDSSSLSPFRLN  385



>ref|XP_004134072.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
3-like [Cucumis sativus]
Length=371

 Score =   394 bits (1011),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 192/376 (51%), Positives = 257/376 (68%), Gaps = 5/376 (1%)
 Frame = +1

Query  19    MATASTGGKADSGDYDRKSELKAFDDMKTGVKGHVDSGIMKIPRIFIHDeikkeekeklk  198
             MA  +   K D   +DR SELKAFD  K GVKG VDSG+ +IPRIF +   ++   +K  
Sbjct  1     MANLTPLSKLDE-TFDRVSELKAFDQTKAGVKGLVDSGVAEIPRIFYYPHKERSNSDKTS  59

Query  199   PAMASTYKVPIIDMEGLHTDHTTRRSEIIKEIRDACQTWGFFQIINHGIPTQVLDEMIDG  378
                     VP++D+  +  D   RR +++ +IR+A ++WGFFQ++NHG+P  V DE+I+G
Sbjct  60    VTDEPHLGVPVVDLVDIDKDPFKRR-QVVDKIREASESWGFFQVLNHGVPASVQDEIING  118

Query  379   VRQFHELDSEVKKQFYSRDLTRKVVYNTNFDFHTSPAATWRDTLYFIMAPHPPTPQELPQ  558
              RQF E D E+KKQ+Y+RD ++  +YN+NFD  ++  A WRDT++  MAP+PP PQ+ P 
Sbjct  119   TRQFFEQDIEMKKQYYTRDNSKPFLYNSNFDLFSTSTANWRDTVFIQMAPNPPNPQDFPL  178

Query  559   VCRDILIKYSNSVQKLGLCLLELFSESLGLHKNHLEKLGCAVGLSIFGQYYPACPEPELT  738
             VCRDIL++YS  ++K+G  +  L SE+LGL   HL +L C+ G +    YYP+CP+PELT
Sbjct  179   VCRDILVEYSKQMEKVGEMIFGLLSEALGLQSTHLLELDCSEGHAFMCHYYPSCPQPELT  238

Query  739   FALRDHSDSGFFTVLNQDTQIGGLQVLHENQWVDVPPLHGALVVNVADLLQLITNDKFKS  918
                  HSDS F TVL Q+  IGGLQVLH N+WVDVPP+ GA  VNV  LLQLI+NDKF S
Sbjct  239   IGTTQHSDSSFITVLLQN-HIGGLQVLHHNKWVDVPPVPGAFAVNVGSLLQLISNDKFVS  297

Query  919   VVHRVIAQKIAPRVSVASFFRTIPGDVDAKKVYGPIKELVSDENPPLYRETTTEEYLMHF  1098
              VHRV+A +  PR+SVAS F T  G +   K+YGPIK+L+S +NPP YR+ T +EY ++F
Sbjct  298   SVHRVVANREGPRISVASAFST--GTIPTSKLYGPIKQLLSQQNPPKYRQITVKEYRLYF  355

Query  1099  QKKGLDGTSGLLRFRL  1146
              KKGLDGT  L  FRL
Sbjct  356   AKKGLDGTDALTHFRL  371



>gb|KFK31257.1| hypothetical protein AALP_AA6G088800 [Arabis alpina]
Length=364

 Score =   393 bits (1010),  Expect = 5e-130, Method: Compositional matrix adjust.
 Identities = 192/366 (52%), Positives = 258/366 (70%), Gaps = 12/366 (3%)
 Frame = +1

Query  55    GDYDRKSELKAFDDMKTGVKGHVDSGIMKIPRIFIHDeikkeekeklkPAMASTYKVPII  234
             G Y+R  E+KAF +MK GVKG VD+GI +IPRIF H      +     P  +ST ++PII
Sbjct  9     GTYNRAGEVKAFGEMKIGVKGLVDTGITQIPRIFHH-----PQVFLANPKPSSTVRIPII  63

Query  235   DMEGLHTDHTTRRSEIIKEIRDACQTWGFFQIINHGIPTQVLDEMIDGVRQFHELDSEVK  414
             ++ G   +    R  +I ++R A + +GFFQ+INHGIP  V+++M DG+R+FHE DSEVK
Sbjct  64    NLGGGMFESKVMRETVIAKVRVAVEKFGFFQVINHGIPVDVMEKMKDGIREFHEQDSEVK  123

Query  415   KQFYSRDLTRKVVYNTNFDFHTSPAATWRDTLYFIMAPHPPTPQELPQVCRDILIKYSNS  594
             K FYSRD+T+KV YNTNFD ++S AA WRDTL  +MAP  P   +LP +C +I+++Y+  
Sbjct  124   KTFYSRDITKKVKYNTNFDLYSSQAANWRDTLTTVMAPDVPKADDLPNICGEIMLEYTKR  183

Query  595   VQKLGLCLLELFSESLGLHKNHLEKLGCAVGLSIFGQYYPACPEPELTFALRDHSDSGFF  774
             + KLG  + EL SE+LGL  NHL+++ CA  LS+   YYP CPEP+ TF +  H+D  F 
Sbjct  184   MMKLGELIFELLSEALGLKSNHLKEMDCAKSLSLLSHYYPPCPEPDRTFGISSHTDISFI  243

Query  775   TVLNQDTQIGGLQVLHENQWVDVPPLHGALVVNVADLLQLITNDKFKSVVHRVIAQK-IA  951
             T+L QD  IGGLQ+LH+  W+DVPP   AL++N+ DLLQLITND+F SV HRV+A +   
Sbjct  244   TILLQD-HIGGLQILHDGYWIDVPPNPEALILNLGDLLQLITNDQFVSVDHRVLANRGEE  302

Query  952   PRVSVASFF-RTIPGDVDAKKVYGPIKELVSDENPPLYRETTTEEYLMHFQKKGLDGTSG  1128
             PR+S+ASFF  TIP +    +VYGPIKEL+S+ENPP YR+TTT E   H+  +GLDGTS 
Sbjct  303   PRISIASFFMHTIPNE----QVYGPIKELLSEENPPKYRDTTTTEMATHYLARGLDGTSP  358

Query  1129  LLRFRL  1146
             LL F++
Sbjct  359   LLHFKI  364



>gb|ACU19421.1| unknown [Glycine max]
Length=373

 Score =   394 bits (1011),  Expect = 5e-130, Method: Compositional matrix adjust.
 Identities = 197/370 (53%), Positives = 264/370 (71%), Gaps = 7/370 (2%)
 Frame = +1

Query  40    GKADSGDYDRKSELKAFDDMKTGVKGHVDSGIMKIPRIFIHDeikkeekeklkPAMASTY  219
             G+     YDRK+E KAFDD K GV+G V+SG+ K PR+F      K +  +  P+  +  
Sbjct  10    GETIDSTYDRKAEKKAFDDSKAGVRGLVESGVTKFPRMF---HAGKLDVIETSPS-HTKL  65

Query  220   KVPIIDMEGLHTDHTTRRSEIIKEIRDACQTWGFFQIINHGIPTQVLDEMIDGVRQFHEL  399
              +PIID++ +H++     ++++ +IR AC  WGFFQ+INHGIP  VLDEMI G+R+FHE 
Sbjct  66    SIPIIDLKDIHSN-PALHTQVMGKIRSACHEWGFFQVINHGIPISVLDEMIGGIRRFHEQ  124

Query  400   DSEVKKQFYSRDLTRKVVYNTNFDFHTSPAATWRDTLYFIMAPHPPTPQELPQVCRDILI  579
             D+EV+K+FY+RDL +KV+Y +N   ++     WRDT  F +AP P  P+E+P VCRDI+I
Sbjct  125   DAEVRKEFYTRDLKKKVLYYSNISLYSDQPVNWRDTFGFGVAPDPAKPEEIPSVCRDIVI  184

Query  580   KYSNSVQKLGLCLLELFSESLGLHKNHLEKLGCAVGLSIFGQYYPACPEPELTFALRDHS  759
             +YS  ++ LG  + EL SE+LGL+ ++L++L CA GL I G YYPACPEPELT     H+
Sbjct  185   EYSKKIRDLGFTMFELLSEALGLNPSYLKELNCAEGLFILGHYYPACPEPELTMGTTKHT  244

Query  760   DSGFFTVLNQDTQIGGLQVLHENQWVDVPPLHGALVVNVADLLQLITNDKFKSVVHRVIA  939
             DS F T+L QD    GLQVLH+NQWV+VPP+HGALVVN+ DLLQLITNDKF SV HRV++
Sbjct  245   DSNFMTLLLQDQLG-GLQVLHQNQWVNVPPVHGALVVNIGDLLQLITNDKFVSVYHRVLS  303

Query  940   QKIAPRVSVASFFRTIPGDVDA-KKVYGPIKELVSDENPPLYRETTTEEYLMHFQKKGLD  1116
             Q   PR+SVASFF      V+   K+YGPIKEL+S+ENPP+YR+TT +E+L ++  KGLD
Sbjct  304   QNTGPRISVASFFVNSHDPVEGTSKMYGPIKELLSEENPPIYRDTTLKEFLAYYYAKGLD  363

Query  1117  GTSGLLRFRL  1146
             G S L  FR+
Sbjct  364   GNSSLDPFRV  373



>ref|XP_003591798.1| 1-aminocyclopropane-1-carboxylate oxidase-like protein [Medicago 
truncatula]
 gb|AES62049.1| 2OG-Fe(II) oxygenase family oxidoreductase [Medicago truncatula]
Length=374

 Score =   393 bits (1010),  Expect = 7e-130, Method: Compositional matrix adjust.
 Identities = 188/374 (50%), Positives = 261/374 (70%), Gaps = 5/374 (1%)
 Frame = +1

Query  31    STGGKADSGDYDRKSELKAFDDMKTGVKGHVDSGIM--KIPRIFIHDeikkeekeklkPA  204
             S   K+ +  YDR +E+KAF++ K GVKG ++SGI   KIPR+F +  +        +  
Sbjct  4     SEENKSSTSTYDRVAEVKAFEESKVGVKGLLESGICVTKIPRMFHYPNLNLNMNSTHESD  63

Query  205   MASTYKVPIIDMEGLHTDHTTRRSEIIKEIRDACQTWGFFQIINHGIPTQVLDEMIDGVR  384
              +S + VPIID++ +HT+     +E++ +IR AC+ WG FQ+INHGIP  VLDEMI G+R
Sbjct  64    PSSKFNVPIIDLQNIHTN-PCLHAEVLDKIRSACREWGCFQVINHGIPDSVLDEMISGIR  122

Query  385   QFHELDSEVKKQFYSRDLTRKVVYNTNFDFHTSPAATWRDTLYFIMAPHPPTPQELPQVC  564
             +FHE ++E +K FY+RD ++KV Y +N     + AA WRDT+ F ++P PP P+E+PQVC
Sbjct  123   RFHEQEAEERKPFYTRDTSKKVRYFSNGSLFKNHAANWRDTISFYVSPDPPNPEEIPQVC  182

Query  565   RDILIKYSNSVQKLGLCLLELFSESLGLHKNHLEKLGCAVGLSIFGQYYPACPEPELTFA  744
             RDI+I+YS  V+ LG    E+FSE+LGL  ++L+KL    G  I   YYP CPEPELT  
Sbjct  183   RDIVIEYSKKVRDLGFTFFEIFSEALGLDPSYLKKLASPNGHFIACHYYPPCPEPELTMG  242

Query  745   LRDHSDSGFFTVLNQDTQIGGLQVLHENQWVDVPPLHGALVVNVADLLQLITNDKFKSVV  924
               +H+D  F T+L QD +IGGLQVLH+NQW+DVPP+HG+L+VN+ DLLQL+TND F SV 
Sbjct  243   ASNHTDGDFMTILLQD-RIGGLQVLHQNQWIDVPPVHGSLIVNIGDLLQLVTNDMFTSVY  301

Query  925   HRVIAQKIAPRVSVASFFRTIPGDVDAKKVYGPIKELVSDENPPLYRETTTEEYLMHFQK  1104
             HRV+++ I PR+S+ASFF          KV GPI EL+S+ENPP+YR+TT  ++L H+ +
Sbjct  302   HRVLSKNIGPRISIASFFVNSLSK-GTSKVVGPINELLSEENPPIYRDTTVNDFLAHYYE  360

Query  1105  KGLDGTSGLLRFRL  1146
             K LDG+S L  FR+
Sbjct  361   KSLDGSSSLQPFRV  374



>ref|XP_004134415.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1-like [Cucumis sativus]
 gb|KGN56874.1| hypothetical protein Csa_3G135710 [Cucumis sativus]
Length=386

 Score =   394 bits (1011),  Expect = 7e-130, Method: Compositional matrix adjust.
 Identities = 191/373 (51%), Positives = 257/373 (69%), Gaps = 11/373 (3%)
 Frame = +1

Query  46    ADSGD--YDRKSELKAFDDMKTGVKGHVDSGIMKIPRIFIHDeikkeekeklkPAMAST-  216
             A +GD  +DR +ELK FDD K GVKG VD+GI +IPRIF              P    T 
Sbjct  17    AANGDEYFDRSAELKLFDDTKAGVKGLVDNGITQIPRIFYR-----PPDSSDYPVAGDTE  71

Query  217   YKVPIIDMEGLHTDHTTRRSEIIKEIRDACQTWGFFQIINHGIPTQVLDEMIDGVRQFHE  396
               +P+ID+EG+  D + RR  ++  +R+A + WGFFQ++NHG+P  VLDE+ +   +F+E
Sbjct  72    LSIPVIDLEGIDADSSKRR-HVVNTVREASEKWGFFQLVNHGVPLSVLDEIKNRTLRFYE  130

Query  397   LDSEVKKQFYSRDLTRKVVYNTNFDFHTSPAATWRDTLYFIMAPHPPTPQELPQVCRDIL  576
              D+E+KK FY+R  T+ +VYN+NFD  T+PAA WRDT    MAP+ P PQ+LP+VCRDIL
Sbjct  131   QDTELKKLFYTRHNTKSIVYNSNFDLFTAPAANWRDTFLCFMAPNVPNPQDLPEVCRDIL  190

Query  577   IKYSNSVQKLGLCLLELFSESLGLHKNHLEKLGCAVGLSIFGQYYPACPEPELTFALRDH  756
              +YS  ++KLG  L  + SE+LGL+ N+L  + C  GL++   YYPACP+PELT    +H
Sbjct  191   FEYSKEMKKLGRVLFGMLSEALGLNTNYLSDIECDRGLAVLCHYYPACPQPELTLGTTEH  250

Query  757   SDSGFFTVLNQDTQIGGLQVLHENQWVDVPPLHGALVVNVADLLQLITNDKFKSVVHRVI  936
             +D+ F T+L QD QIGGLQVLHE +WVD+PP+ GALV+N+ DLLQLI+ND+FKSV HRV+
Sbjct  251   ADNDFLTLLLQDDQIGGLQVLHEKKWVDIPPIPGALVINIGDLLQLISNDRFKSVEHRVV  310

Query  937   AQKIAPRVSVASFFRTIPGDVDAKKVYGPIKELVSDENPPLYRETTTEEYLMHFQKKGLD  1116
             A +  PRVSVASFF    G     +VYGPIKEL+S++N   YRETT +++  +   +GL+
Sbjct  311   ANREGPRVSVASFFGI--GVYPTSQVYGPIKELLSEKNRAKYRETTLKDFYFYHNMRGLN  368

Query  1117  GTSGLLRFRLQKE  1155
             G S L  FRL  E
Sbjct  369   GISALQHFRLGPE  381



>ref|XP_004167607.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1-like [Cucumis sativus]
Length=375

 Score =   393 bits (1010),  Expect = 8e-130, Method: Compositional matrix adjust.
 Identities = 188/366 (51%), Positives = 253/366 (69%), Gaps = 9/366 (2%)
 Frame = +1

Query  61    YDRKSELKAFDDMKTGVKGHVDSGIMKIPRIFIHDeikkeekeklkPAMAST-YKVPIID  237
             +DR +ELK FDD K GVKG VD+GI +IPRIF              P    T   +P+ID
Sbjct  13    FDRSAELKLFDDTKAGVKGLVDNGITQIPRIFYR-----PPDSSDYPVAGDTELSIPVID  67

Query  238   MEGLHTDHTTRRSEIIKEIRDACQTWGFFQIINHGIPTQVLDEMIDGVRQFHELDSEVKK  417
             +EG+  D + RR  ++  +R+A + WGFFQ++NHG+P  VLDE+ +   +F+E D+E+KK
Sbjct  68    LEGIDADSSKRR-HVVNTVREASEKWGFFQLVNHGVPLSVLDEIKNRTLRFYEQDTELKK  126

Query  418   QFYSRDLTRKVVYNTNFDFHTSPAATWRDTLYFIMAPHPPTPQELPQVCRDILIKYSNSV  597
              FY+R  T+ +VYN+NFD  T+PAA WRDT    MAP+ P PQ+LP+VCRDIL +YS  +
Sbjct  127   LFYTRHNTKSIVYNSNFDLFTAPAANWRDTFLCFMAPNVPNPQDLPEVCRDILFEYSKEM  186

Query  598   QKLGLCLLELFSESLGLHKNHLEKLGCAVGLSIFGQYYPACPEPELTFALRDHSDSGFFT  777
             +KLG  L  + SE+LGL+ N+L  + C  GL++   YYPACP+PELT    +H+D+ F T
Sbjct  187   KKLGRVLFGMLSEALGLNTNYLSDIECDRGLAVLCHYYPACPQPELTLGTTEHADNDFLT  246

Query  778   VLNQDTQIGGLQVLHENQWVDVPPLHGALVVNVADLLQLITNDKFKSVVHRVIAQKIAPR  957
             +L QD QIGGLQVLHE +WVD+PP+ GALV+N+ DLLQLI+ND+FKSV HRV+A +  PR
Sbjct  247   LLLQDDQIGGLQVLHEKKWVDIPPIPGALVINIGDLLQLISNDRFKSVEHRVVANREGPR  306

Query  958   VSVASFFRTIPGDVDAKKVYGPIKELVSDENPPLYRETTTEEYLMHFQKKGLDGTSGLLR  1137
             VSVASFF    G     +VYGPIKEL+S++N   YRETT +++  +   +GL+G S L  
Sbjct  307   VSVASFFGI--GVYPTSQVYGPIKELLSEKNRAKYRETTLKDFYFYHNMRGLNGISALQH  364

Query  1138  FRLQKE  1155
             FRL  E
Sbjct  365   FRLGPE  370



>ref|XP_010025844.1| PREDICTED: LOW QUALITY PROTEIN: 1-aminocyclopropane-1-carboxylate 
oxidase homolog 1 [Eucalyptus grandis]
Length=366

 Score =   392 bits (1008),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 191/363 (53%), Positives = 248/363 (68%), Gaps = 16/363 (4%)
 Frame = +1

Query  58    DYDRKSELKAFDDMKTGVKGHVDSGIMKIPRIFIHDeikkeekeklkPAMASTYKVPIID  237
             DYDR SELKAFD+ KTGVKG VD+GI K+PRIFIH+    + K       +S   VP++D
Sbjct  20    DYDRVSELKAFDEPKTGVKGLVDAGIRKVPRIFIHEPESFDRKYGRG---SSDLVVPVVD  76

Query  238   MEGLHTDHTTRRSEIIKEIRDACQTWGFFQIINHGIPTQVLDEMIDGVRQFHELDSEVKK  417
             +EG+  D   R+  I+ ++R A + WGFFQ+INHG+P ++  EMI G  +F + D E+KK
Sbjct  77    LEGMADDPVGRKL-IVGQVRSASEEWGFFQVINHGVPEEITQEMIAGAIRFFDQDPEIKK  135

Query  418   QFYSRDLTRKVVYNTNFDFHTSPAATWRDTLYFIMAPHPPTPQELPQVCRDILIKYSNSV  597
               Y+RD T+KVV+N+NFD + S AA WRD +Y  +AP PP  +E+P  CRDI+  Y   V
Sbjct  136   ALYTRDATKKVVHNSNFDLYQSKAADWRDNMYCPLAPSPPPYEEIPAACRDIMPDYQKQV  195

Query  598   QKLGLCLLELFSESLGLHKNHLEKLGCAVGLSIFGQYYPACPEPELTFALRDHSDSGFFT  777
              K+GL L EL SE+LGL  +HL+ + CA GL++   YYPACPEPELT     H D  F T
Sbjct  196   TKVGLLLFELLSEALGLKPSHLKDINCAEGLAMLLNYYPACPEPELTMGTSKHQDDYFLT  255

Query  778   VLNQDTQIGGLQVLHENQWVDVPPLHGALVVNVADLLQLITNDKFKSVVHRVIAQKIAPR  957
             VL QD QIGGLQ LH++QWVDVPP+ GALV+N+ DLLQL++ND+FKSV HR +A ++ PR
Sbjct  256   VLLQD-QIGGLQALHKDQWVDVPPIPGALVINIGDLLQLVSNDQFKSVEHRALASRVGPR  314

Query  958   VSVASFFRTIPGDVDAKKVYGPIKELVSDENPPLYRETTTEEYLMHFQKKGLDGTSGLLR  1137
              +  S            +VYGPIKEL+S+ NPP YRETT  +Y  +F  KGLDGTS L  
Sbjct  315   NAXPS-----------SRVYGPIKELLSESNPPKYRETTVRDYTYYFNMKGLDGTSALPH  363

Query  1138  FRL  1146
             FR+
Sbjct  364   FRI  366



>ref|XP_008779114.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1-like [Phoenix dactylifera]
Length=363

 Score =   392 bits (1008),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 187/367 (51%), Positives = 259/367 (71%), Gaps = 7/367 (2%)
 Frame = +1

Query  52    SGDYDRKSELKAFDDMKTGVKGHVDSGIMKIPRIFIHDeikkeekeklkPAMAST-YKVP  228
             S D DR   +KAFD+ K GVKG VD+GI KIP  F       +         A+   ++P
Sbjct  2     SIDDDRAGAMKAFDETKAGVKGLVDAGIRKIPPFFFQPPDHLDGINPSNSDGATARLQIP  61

Query  229   IIDMEGLHTDHTTRRSEIIKEIRDACQTWGFFQIINHGIPTQVLDEMIDGVRQFHELDSE  408
             +ID+ G  +D + RR E++ E+R A +T GFFQ++NHG+P  VLDEM+ GVR F+E  +E
Sbjct  62    VIDLRGSDSD-SARRKEVVAEVRRASETLGFFQVVNHGVPAPVLDEMLAGVRTFNEAAAE  120

Query  409   VKKQFYSRDLTRKVVYNTNFDFHTSPAATWRDTLYFIMAPHPPTPQELPQVCRDILIKYS  588
             VK+++Y+RD  +KV +N+NFD + +PAA WRDT++  MAP PP P ELP  CR+I ++Y+
Sbjct  121   VKREYYTRDPAKKVQFNSNFDLYQAPAANWRDTMFCAMAPEPPRPDELPLACREITLQYA  180

Query  589   NSVQKLGLCLLELFSESLGLHKNHLEKLGCAVGLSIFGQYYPACPEPELTFALRDHSDSG  768
             N +QK+G+ L EL SE+LGL+++HL ++ CA GL +   YYP CPEP LT  +  HSD  
Sbjct  181   NHIQKVGIFLFELLSEALGLNRDHLNEMECAKGLGVVAHYYPPCPEPHLTLGISKHSDPD  240

Query  769   FFTVLNQDTQIGGLQVLHENQWVDVPPLHGALVVNVADLLQLITNDKFKSVVHRVIAQK-  945
             F T+L QD QIGGLQV+H+NQW+DVPPL GAL+VN+ DLLQLI+ND+ KSV HRV+A K 
Sbjct  241   FLTILLQD-QIGGLQVVHQNQWIDVPPLPGALIVNIGDLLQLISNDRLKSVEHRVLANKS  299

Query  946   IAPRVSVASFFRTIPGDVDAKKVYGPIKELVSDENPPLYRETTTEEYLMHFQKKGLDGTS  1125
             + PR+SVA FF T      + K+YGPIKEL+S+E  P+Y+E + +EY+ +++ KGLDG S
Sbjct  300   VDPRISVACFFST--HFYPSTKLYGPIKELLSNER-PMYKEVSAKEYVTYYKSKGLDGQS  356

Query  1126  GLLRFRL  1146
              L  F++
Sbjct  357   ALNYFKI  363



>ref|XP_010102247.1| 1-aminocyclopropane-1-carboxylate oxidase-1-like protein [Morus 
notabilis]
 gb|EXB93190.1| 1-aminocyclopropane-1-carboxylate oxidase-1-like protein [Morus 
notabilis]
Length=372

 Score =   392 bits (1008),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 189/363 (52%), Positives = 249/363 (69%), Gaps = 4/363 (1%)
 Frame = +1

Query  58    DYDRKSELKAFDDMKTGVKGHVDSGIMKIPRIFIHDeikkeekeklkPAMASTYKVPIID  237
             DY+R   LKAFDD K GVKG VD+GI  IP  F+         ++        +KVP ID
Sbjct  14    DYERAKSLKAFDDAKAGVKGLVDAGISTIPPFFVMPPEDLSSSQRPGDLGFPRFKVPTID  73

Query  238   MEGLHTDHTTRRSEIIKEIRDACQTWGFFQIINHGIPTQVLDEMIDGVRQFHELDSEVKK  417
             ++  H D   R+ +I++EIR AC+TWGFFQ++NHGIP  ++D+M++GVR+F+E  +E K 
Sbjct  74    LKHTHGDFLWRK-QIVEEIRCACETWGFFQVVNHGIPQDIMDQMLEGVRRFNEQSNEAKM  132

Query  418   QFYSRDLTRKVVYNTNFDFHTSPAATWRDTLYFIMAPHPPTPQELPQVCRDILIKYSNSV  597
             + YSRD  +KV +N+NFD + + AA WRDTL   MAP+PP P+E P  CRDI+ +YS  V
Sbjct  133   EIYSRDKMKKVRFNSNFDLYKAKAANWRDTLLCAMAPNPPQPEEYPAACRDIMKQYSEHV  192

Query  598   QKLGLCLLELFSESLGLHKNHLEKLGCAVGLSIFGQYYPACPEPELTFALRDHSDSGFFT  777
             +KLG  L +L S++L L  NHLE +GCA G   F  YYPACPEP+ T     H+D  F T
Sbjct  193   EKLGEILYQLISQALELDPNHLEDMGCAKGHVFFCHYYPACPEPDRTLGHAKHTDPSFLT  252

Query  778   VLNQDTQIGGLQVLHENQWVDVPPLHGALVVNVADLLQLITNDKFKSVVHRVIAQKIAPR  957
             +L QD  IGGLQVLH+N+WVDVPP+ GALV+N+ DLLQLI+NDKFKS+ HRV+A+   PR
Sbjct  253   ILLQD-HIGGLQVLHQNRWVDVPPVRGALVINIGDLLQLISNDKFKSIEHRVLAKSAGPR  311

Query  958   VSVASFFRTIPGDVDAKKVYGPIKELVSDENPPLYRETTTEEYLMHFQKKGLDGTSGLLR  1137
             +S A FF T   + D  K+YGPIKEL+ D+NPPLY+ET  ++Y+  F   GL G S L +
Sbjct  312   ISAACFFTTHFQESD--KLYGPIKELLKDDNPPLYKETYVKDYIDSFHSAGLGGISALAQ  369

Query  1138  FRL  1146
              RL
Sbjct  370   LRL  372



>ref|XP_004309351.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1-like [Fragaria vesca subsp. vesca]
Length=438

 Score =   395 bits (1014),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 191/363 (53%), Positives = 262/363 (72%), Gaps = 10/363 (3%)
 Frame = +1

Query  64    DRKSELKAFDDMKTGVKGHVDSGIMKIPRIFIHDeikkeekeklkPAMASTYKVPIIDME  243
             DR SELKAFDD K GVKG +D+G+  IPRIF H   +    ++      + + +P ID++
Sbjct  84    DRTSELKAFDDTKAGVKGLLDAGVKTIPRIF-HSRSQPNVDQREGGDDDARFSIPTIDLQ  142

Query  244   G--LHTDHTTRRSEIIKEIRDACQTWGFFQIINHGIPTQVLDEMIDGVRQFHELDSEVKK  417
             G  +  D +  R+E+++++R AC+ WGFFQ++NHGIP  VLDE+I G+R+FHE DSE+KK
Sbjct  143   GGKIQAD-SALRAEVMEKVRHACEKWGFFQVVNHGIPVNVLDEVIRGIREFHEQDSELKK  201

Query  418   QFYSRDLTRKVVYNTNFDFHTSPAATWRDTLYFIMAPHPPTPQELPQVCRDILIKYSNSV  597
             +FY+R   +KV Y++N+D + + +  WRDTL   MAP+PP P+ELP VCRDI+I+YS  V
Sbjct  202   EFYTRTPGKKVYYHSNYDLYQASSTDWRDTLGCFMAPNPPKPEELPSVCRDIVIEYSKHV  261

Query  598   QKLGLCLLELFSESLGLHKNHLEKLGCAVGLSIFGQYYPACPEPELTFALRDHSDSGFFT  777
              ++GL L E+ SESLGL+ NHL+ + CA GL + G  YPACPEP+LTF    H+D  F T
Sbjct  262   MEVGLTLFEILSESLGLNPNHLKDMNCAEGLLLLGHCYPACPEPDLTFGASKHTDGTFIT  321

Query  778   VLNQDTQIGGLQVLHENQWVDVPPLHGALVVNVADLLQLITNDKFKSVVHRVIAQKIAPR  957
             +L QD Q+GGLQ L+ENQWV+VPP++GALVVNV DLLQLITNDKF S+ HRV A+ + PR
Sbjct  322   ILLQD-QVGGLQALYENQWVNVPPMYGALVVNVGDLLQLITNDKFISLAHRVRAKNVGPR  380

Query  958   VSVASFFRTIPGDVDAKKVYGPIKELVSDENPPLYRETTTEEYLMHFQKKGLDGTSGLLR  1137
              SVASFFR+        KV+GPIKEL+S+ENP +Y+E   ++Y+ ++  +G +  S LL 
Sbjct  381   TSVASFFRS----ERNTKVFGPIKELLSEENPQIYQEVDIKDYVRYYYSEGKE-NSPLLH  435

Query  1138  FRL  1146
             F+L
Sbjct  436   FKL  438



>ref|XP_004247706.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
isoform X2 [Solanum lycopersicum]
Length=373

 Score =   392 bits (1008),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 201/364 (55%), Positives = 261/364 (72%), Gaps = 9/364 (2%)
 Frame = +1

Query  61    YDRKSELKAFDDMKTGVKGHVDSGIMKIPRIFIHDeikkeekeklkPAMASTYKVPIIDM  240
             YD+ SELKAFDD K GVKG VD+GI K+P+IFI   +    + +        +  P+ID 
Sbjct  17    YDKMSELKAFDDTKAGVKGLVDAGITKVPQIFI---LPPNNRTESLDTSEKQFIFPVIDF  73

Query  241   EGLHTDHTTRRSEIIKEIRDACQTWGFFQIINHGIPTQVLDEMIDGVRQFHELDSEVKKQ  420
             EG+  D   +R EI+ ++RDA +TWGFFQ++NHGIPT VL+ M+ G R+F E D EVKKQ
Sbjct  74    EGIDED-PIKRKEIVGKVRDASETWGFFQVVNHGIPTSVLEGMLQGTREFFEQDIEVKKQ  132

Query  421   FYSRDLTRKVVYNTNFDFHTS--PAATWRDTLYFIMAPHPPTPQELPQVCRDILIKYSNS  594
             +Y+RD+ +KVV+N+NFD ++   PAA WRD+  F MAP+PP+P+E P+ CR+IL+ YS +
Sbjct  133   YYTRDIMKKVVHNSNFDLYSPSVPAANWRDSFCFSMAPNPPSPEEFPRPCREILMDYSKN  192

Query  595   VQKLGLCLLELFSESLGLHKNHLEKLGCAVGLSIFGQYYPACPEPELTFALRDHSDSGFF  774
             V +LG  LL L SE LGL   HLE + C  GL + G YYP CP+PELT     HSD+ F 
Sbjct  193   VMELGCSLLGLLSEGLGLDPCHLEDMDCVKGLGVVGHYYPPCPQPELTIGTNTHSDNDFI  252

Query  775   TVLNQDTQIGGLQVLHENQWVDVPPLHGALVVNVADLLQLITNDKFKSVVHRVIAQKIAP  954
             TVL QD  IGGLQVLH+NQWVD+PP   ALVVN+ DLLQLI+NDK+ SV HRV++ K+ P
Sbjct  253   TVLLQD-HIGGLQVLHQNQWVDIPPTSAALVVNIGDLLQLISNDKYTSVEHRVLSNKVGP  311

Query  955   RVSVASFFRTIPGDVDAKKVYGPIKELVSDENPPLYRETTTEEYLMHFQKKGLDGTSGLL  1134
             R+SVASFF T  G   + K+YGPI EL+S++NPP YR TT  +Y  +F+KKGLDGTS LL
Sbjct  312   RISVASFFTT--GPFPSPKLYGPIAELLSEDNPPKYRATTVTDYSDYFRKKGLDGTSALL  369

Query  1135  RFRL  1146
              F++
Sbjct  370   HFKI  373



>ref|XP_004296614.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1-like [Fragaria vesca subsp. vesca]
Length=369

 Score =   392 bits (1008),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 192/363 (53%), Positives = 253/363 (70%), Gaps = 7/363 (2%)
 Frame = +1

Query  61    YDRKSELKAFDDMKTGVKGHVDSGIMKIPRIFIHDeikkeekeklkPAMASTYKVPIIDM  240
             YDRKSEL+AFDD K GVKG VD+GI +IPRIF H    +           + + +P++D+
Sbjct  13    YDRKSELQAFDDTKEGVKGLVDAGITEIPRIF-HHPPDQYNIINTSDIEENQFTIPVVDL  71

Query  241   EGLHTDHTTRRSEIIKEIRDACQTWGFFQIINHGIPTQVLDEMIDGVRQFHELDSEVKKQ  420
              GL      ++ EI+  + +A +TWGFFQIINHGIP  VL+EM +GV +F+E DSEVKKQ
Sbjct  72    GGL--SDPAKQKEIVARVGEASETWGFFQIINHGIPVPVLEEMKNGVLRFYEQDSEVKKQ  129

Query  421   FYSRD-LTRKVVYNTNFDFHTSPAATWRDTLYFIMAPHPPTPQELPQVCRDILIKYSNSV  597
             FY RD  ++   YN+NFD +++P+  WRDT    MAP P  P+++P+VCRD + +YS  V
Sbjct  130   FYCRDDFSKPWQYNSNFDLYSAPSTNWRDTFMCYMAPTPTKPEDMPEVCRDEMAEYSKEV  189

Query  598   QKLGLCLLELFSESLGLHKNHLEKLGCAVGLSIFGQYYPACPEPELTFALRDHSDSGFFT  777
              KLG  L EL SE+LGL  +HL  + C  GL + G YYPAC +PELT     H+D GF T
Sbjct  190   MKLGKILFELLSEALGLEPSHLNDIDCGEGLLVLGHYYPACSQPELTMGTSKHADGGFLT  249

Query  778   VLNQDTQIGGLQVLHENQWVDVPPLHGALVVNVADLLQLITNDKFKSVVHRVIAQKIAPR  957
             VL QD  IGGLQVLH+N+W+ VPP+ GALVVN+ DLLQLI+ND+F+SV HRV+A    PR
Sbjct  250   VLLQD-HIGGLQVLHQNKWIHVPPVTGALVVNIGDLLQLISNDRFRSVEHRVLANHRGPR  308

Query  958   VSVASFFRTIPGDVDAKKVYGPIKELVSDENPPLYRETTTEEYLMHFQKKGLDGTSGLLR  1137
             +SVASFF T  G + + K+YGPIK+L+S++NPP YRETT  +Y+ +  +KGLDG S L  
Sbjct  309   ISVASFFCT--GMLPSTKLYGPIKDLLSEDNPPKYRETTVRDYVAYHSQKGLDGKSSLSH  366

Query  1138  FRL  1146
              +L
Sbjct  367   VKL  369



>sp|O04847.2|DV4H_CATRO RecName: Full=Deacetoxyvindoline 4-hydroxylase [Catharanthus 
roseus]
 gb|AAB97311.1| desacetoxyvindoline-4-hydroxylase [Catharanthus roseus]
Length=401

 Score =   393 bits (1010),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 200/385 (52%), Positives = 267/385 (69%), Gaps = 8/385 (2%)
 Frame = +1

Query  4     EREREMATASTGGKADSGDYDRKSELKAFDDMKTGVKGHVDSGIMKIPRIFIHDeikkee  183
             E+ER+M   +    A   + +   ELKAFD+ K GVKG VD+GI KIPRIFI      + 
Sbjct  21    EQERKMKDLNFHA-ATLSEEESLRELKAFDETKAGVKGIVDTGITKIPRIFIDQPKNLDR  79

Query  184   keklkPAMASTYKVPIIDMEGLHTDHTTRRSEIIKEIRDACQTWGFFQIINHGIPTQVLD  363
                 +    S  K+P+I++ GL ++   RR EI+++I +A + +GFFQI+NHGIP  V+D
Sbjct  80    ISVCRGK--SDIKIPVINLNGLSSNSEIRR-EIVEKIGEASEKYGFFQIVNHGIPQDVMD  136

Query  364   EMIDGVRQFHELDSEVKKQFYSRD-LTRKVVYNTNFDFHTSPAATWRDTLYFIMAPHPPT  540
             +M+DGVR+FHE D ++K+Q+YSRD   +  +Y++N+      A  WRDT+  IM  + P 
Sbjct  137   KMVDGVRKFHEQDDQIKRQYYSRDRFNKNFLYSSNYVLIPGIACNWRDTMECIMNSNQPD  196

Query  541   PQELPQVCRDILIKYSNSVQKLGLCLLELFSESLGLHKNHLEKLGCAVGLSIFGQYYPAC  720
             PQE P VCRDIL+KYSN V+ LGL L EL SE+LGL  NHLE++ CA GL + G YYPAC
Sbjct  197   PQEFPDVCRDILMKYSNYVRNLGLILFELLSEALGLKPNHLEEMDCAEGLILLGHYYPAC  256

Query  721   PEPELTFALRDHSDSGFFTVLNQDTQIGGLQVLHENQWVDVPPLHGALVVNVADLLQLIT  900
             P+PELTF    HSDSGF T+L QD QIGGLQ+L ENQW+DVP + GALV+N+ADLLQLIT
Sbjct  257   PQPELTFGTSKHSDSGFLTILMQD-QIGGLQILLENQWIDVPFIPGALVINIADLLQLIT  315

Query  901   NDKFKSVVHRVIAQKIAPRVSVASFF--RTIPGDVDAKKVYGPIKELVSDENPPLYRETT  1074
             NDKFKSV HRV+A K+ PR+SVA  F  +T   +  + ++YGPIKEL+S+ENPP+Y+E T
Sbjct  316   NDKFKSVEHRVLANKVGPRISVAVAFGIKTQTQEGVSPRLYGPIKELISEENPPIYKEVT  375

Query  1075  TEEYLMHFQKKGLDGTSGLLRFRLQ  1149
              ++++     K  D +S L  FRL 
Sbjct  376   VKDFITIRFAKRFDDSSSLSPFRLN  400



>ref|XP_003596162.1| 1-aminocyclopropane-1-carboxylate oxidase-like protein [Medicago 
truncatula]
 gb|AES66413.1| 2OG-Fe(II) oxygenase family oxidoreductase [Medicago truncatula]
Length=381

 Score =   392 bits (1008),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 196/379 (52%), Positives = 262/379 (69%), Gaps = 8/379 (2%)
 Frame = +1

Query  19    MATASTGGKA-DSGDYDRKSELKAFDDMKTGVKGHVDSGIMKIPRIFIHDeikkeekekl  195
             MAT ++   A +S  YDRKSELK FD+ K GV+G  ++G+ K+PR+F  ++         
Sbjct  2     MATITSNDVAGNSPIYDRKSELKKFDESKVGVQGLTENGVTKVPRMFYCEQSNINHGSVN  61

Query  196   kPAMASTYKVPIIDMEGLHTDHTTRRSEIIKEIRDACQTWGFFQIINHGIPTQVLDEMID  375
             +    S   VP ID+ G+H D    R E+++++R+A + WGFFQ+INHGIPTQ+LDEMI+
Sbjct  62    ESN--SKLSVPTIDLTGIHDD-PVLRDEVVRKVRNASEKWGFFQVINHGIPTQILDEMIN  118

Query  376   GVRQFHELDSEVKKQFYSRDLTRKVVYNTNFDFHTSPAATWRDTLYFIMAPHPPTPQELP  555
             G  +FH+ D++V+K++Y+RDLT+KVVY +NF  +   +A WRDTL F  AP PP   ELP
Sbjct  119   GTCRFHQQDAKVRKEYYTRDLTKKVVYLSNFTLYLDQSADWRDTLAFFWAPDPPKADELP  178

Query  556   QVCRDILIKYSNSVQKLGLCLLELFSESLGLHKNHLEKLGCAVGLSIFGQYYPACPEPEL  735
              VC DI+ +Y+  V  LG  L EL SE+LGL+++HL+++G A        YYPACPEPEL
Sbjct  179   PVCSDIVNEYTKEVMALGSSLYELLSEALGLNRSHLKEMGAAESFVHLCHYYPACPEPEL  238

Query  736   TFALRDHSDSGFFTVLNQDTQIGGLQVLHENQWVDVPPLHGALVVNVADLLQLITNDKFK  915
             T     HSD+ F TVL QD  IGGLQ+LH+NQW+DVPP+HGALVVN+ DLLQL++NDKF 
Sbjct  239   TIGTTKHSDASFITVLLQD-HIGGLQILHDNQWIDVPPIHGALVVNIGDLLQLVSNDKFT  297

Query  916   SVVHRVIAQKIAPRVSVASFFRTIP--GDVDAKKVYGPIKELVSDENPPLYRETTTEEYL  1089
             SV HRV+A    PR+SVA+FFRT         +KV GPIKEL+S ENPP+YR+T+ +EYL
Sbjct  298   SVQHRVLANHAGPRISVATFFRTQHDYSHEGMEKVIGPIKELLSKENPPIYRDTSLKEYL  357

Query  1090  MHFQKKGLDGTSGLLRFRL  1146
              +    GL G S L  F+L
Sbjct  358   AYRFANGL-GASALSPFKL  375



>ref|XP_010475402.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
3 [Camelina sativa]
Length=368

 Score =   392 bits (1006),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 196/365 (54%), Positives = 245/365 (67%), Gaps = 4/365 (1%)
 Frame = +1

Query  55    GDYDRKSELKAFDDMKTGVKGHVDSGIMKIPRIFIHDeikkeekeklkPAMASTYKVPII  234
               +DR  ELKAFDD KTGVKG VD+G+ KIPRIF H  +K      L   + S   +P I
Sbjct  7     ASFDRARELKAFDDTKTGVKGLVDAGVSKIPRIFHHPSLKLSNPNPLPSDLLSLKTIPTI  66

Query  235   DMEGLHTDHTTRRSEIIKEIRDACQTWGFFQIINHGIPTQVLDEMIDGVRQFHELDSEVK  414
             D+ G   +   +R   ++EI++A   WGFFQ+INHG+   +L++M DGVR FHE   EVK
Sbjct  67    DLGGRVFEDVVKRKNAVEEIKEAAAKWGFFQVINHGVSLDLLEKMKDGVRDFHEQSPEVK  126

Query  415   KQFYSRDLTRKVVYNTNFDFHTSPAATWRDTLYFIMAPHPPTPQELPQVCRDILIKYSNS  594
             K FYSRD +R+ +Y +NFD  +SPAA WRDT    MAP+PP P +LP++CRD+L++YS  
Sbjct  127   KGFYSRDFSRRFLYQSNFDLFSSPAANWRDTFACTMAPNPPEPHDLPEICRDVLMEYSQQ  186

Query  595   VQKLGLCLLELFSESLGLHKNHLEKLGCAVGLSIFGQYYPACPEPELTFALRDHSDSGFF  774
             V  LG  L EL SE+LGL+ NHL+ + C+ GL +   YYP CPEP+LT     HSD+ F 
Sbjct  187   VMILGEFLFELLSEALGLNPNHLKDMDCSKGLLMLSHYYPPCPEPDLTLGTSQHSDNSFL  246

Query  775   TVLNQDTQIGGLQVLHENQWVDVPPLHGALVVNVADLLQLITNDKFKSVVHRVIAQKIA-  951
             TVL  D QI GLQV  E  W DVP + GALV+N+ DLLQLITNDKF S+ HRV+  +   
Sbjct  247   TVLLPD-QIEGLQVRREGYWFDVPHVPGALVINIGDLLQLITNDKFISLEHRVLGNRATR  305

Query  952   PRVSVASFFRTIPGDVDAKKVYGPIKELVSDENPPLYRETTTEEYLMHFQKKGLDGTSGL  1131
              RVSVA FF T  G     +VYGPI+ELVS+ENPP YRETT  EY  HF  KGLDGTS L
Sbjct  306   ARVSVACFFTT--GVRPDPRVYGPIRELVSEENPPKYRETTIREYATHFNTKGLDGTSAL  363

Query  1132  LRFRL  1146
             L F++
Sbjct  364   LHFKI  368



>gb|KHN22506.1| 1-aminocyclopropane-1-carboxylate oxidase like 1 [Glycine soja]
Length=375

 Score =   392 bits (1007),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 193/369 (52%), Positives = 257/369 (70%), Gaps = 7/369 (2%)
 Frame = +1

Query  40    GKADSGDYDRKSELKAFDDMKTGVKGHVDSGIMKIPRIFIHDeikkeekeklkPAMASTY  219
              K DS  YDR +E+KAFD+ K GVKG  DSGI KIPR+F H +++   +        S +
Sbjct  14    SKKDST-YDRIAEVKAFDETKLGVKGLFDSGITKIPRMFHHAKVEDHTETMPN---DSNF  69

Query  220   KVPIIDMEGLHTDHTTRRSEIIKEIRDACQTWGFFQIINHGIPTQVLDEMIDGVRQFHEL  399
              VPIID++ + T+ ++ R + + +IR AC+ WGFFQ++NHGI   +LDEMI G+R+FHE 
Sbjct  70    SVPIIDLQDIDTN-SSLRVKALDKIRSACKEWGFFQVVNHGIAVDLLDEMICGIRRFHEQ  128

Query  400   DSEVKKQFYSRDLTRKVVYNTNFDFHTSPAATWRDTLYFIMAPHPPTPQELPQVCRDILI  579
             D+EV+K FYSRD+ +KV Y +N   +  PAA WRDT+ F   P PP P+E+P VCRDI+I
Sbjct  129   DAEVRKSFYSRDMNKKVRYFSNGTLYRDPAANWRDTIAFFRTPDPPNPEEIPSVCRDIVI  188

Query  580   KYSNSVQKLGLCLLELFSESLGLHKNHLEKLGCAVGLSIFGQYYPACPEPELTFALRDHS  759
              YS  V+ LG  + ELFSE+LGLH ++L++L    G  +   YYP CPEPELT     H+
Sbjct  189   GYSEKVRALGFTIFELFSEALGLHSSYLKELDSVDGQFLLCHYYPPCPEPELTMGTSKHT  248

Query  760   DSGFFTVLNQDTQIGGLQVLHENQWVDVPPLHGALVVNVADLLQLITNDKFKSVVHRVIA  939
             D  F T+L QD Q+GGLQVLH+NQWVDVPP+HG+LVVN+ D LQLI+ND F SV HRV++
Sbjct  249   DISFMTILLQD-QMGGLQVLHQNQWVDVPPVHGSLVVNIGDFLQLISNDMFVSVYHRVLS  307

Query  940   QKIAPRVSVASFFRTIPGDVDAKKVYGPIKELVSDENPPLYRETTTEEYLMHFQKKGLDG  1119
                 PR+SVASFF        + KV GPIKEL+S++NPP+YR+TT ++   H+ +KGLDG
Sbjct  308   SHTGPRISVASFFAN-SFQQSSLKVVGPIKELLSEDNPPIYRDTTVKDVKAHYFEKGLDG  366

Query  1120  TSGLLRFRL  1146
              + L  FRL
Sbjct  367   NNSLHPFRL  375



>ref|XP_007149300.1| hypothetical protein PHAVU_005G058700g [Phaseolus vulgaris]
 gb|ESW21294.1| hypothetical protein PHAVU_005G058700g [Phaseolus vulgaris]
Length=367

 Score =   392 bits (1006),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 191/362 (53%), Positives = 249/362 (69%), Gaps = 11/362 (3%)
 Frame = +1

Query  61    YDRKSELKAFDDMKTGVKGHVDSGIMKIPRIFIHDeikkeekeklkPAMASTYKVPIIDM  240
             YDRKSEL AFDD K GV+  V++G+ K+PR+F  D            A  S   +PIID+
Sbjct  17    YDRKSELMAFDDSKAGVQELVENGVEKVPRMFYCDHSHDYGFVS---ASNSKISIPIIDL  73

Query  241   EGLHTDHTTRRSEIIKEIRDACQTWGFFQIINHGIPTQVLDEMIDGVRQFHELDSEVKKQ  420
              G+H D   R   ++ ++R AC+ WGFFQ+INHGIPT VLDEMI G R FH+ D+EV+K+
Sbjct  74    TGIHDDPNLRDG-VVGKVRYACEKWGFFQVINHGIPTHVLDEMIKGTRMFHQQDAEVRKE  132

Query  421   FYSRDLTRKVVYNTNFDFHTSPAATWRDTLYFIMAPHPPTPQELPQVCRDILIKYSNSVQ  600
             +Y+RD +RKV Y +N+  +  P+A WRDT+ F +AP  P  +E P VCRDI+I+YS    
Sbjct  133   YYTRDFSRKVAYLSNYTLYEDPSADWRDTIAFSLAPDHPKAEEFPAVCRDIVIEYSKKTM  192

Query  601   KLGLCLLELFSESLGLHKNHLEKLGCAVGLSIFGQYYPACPEPELTFALRDHSDSGFFTV  780
              L   L EL SE+LGL K HL++ GCA GL +   YYPACPEP LT   ++HSD    T+
Sbjct  193   VLAYALFELLSEALGLDKFHLKEKGCAEGLLLLCNYYPACPEPALTMGNKEHSDGDIMTI  252

Query  781   LNQDTQIGGLQVLHENQWVDVPPLHGALVVNVADLLQLITNDKFKSVVHRVIAQKIAPRV  960
             L QD Q+GGLQVLH++QW+ VPP+HGALVVN+ DLLQL++NDKF SV HRV+A    PR+
Sbjct  253   LLQD-QMGGLQVLHDSQWICVPPMHGALVVNIGDLLQLMSNDKFISVQHRVLANDQGPRI  311

Query  961   SVASFFRTIPGDVDAKKVYGPIKELVSDENPPLYRETTTEEYLMHFQKKGLDGTSGLLRF  1140
             SVASFFRT        KV+GPIKELV +++PP+YRE + ++Y+ H    G  GTS LL F
Sbjct  312   SVASFFRTA-----ISKVFGPIKELVCEDHPPVYREISLKDYMAHRYASG-SGTSALLHF  365

Query  1141  RL  1146
             +L
Sbjct  366   KL  367



>ref|XP_008438542.1| PREDICTED: LOW QUALITY PROTEIN: 1-aminocyclopropane-1-carboxylate 
oxidase homolog 1-like [Cucumis melo]
Length=384

 Score =   392 bits (1007),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 190/362 (52%), Positives = 250/362 (69%), Gaps = 8/362 (2%)
 Frame = +1

Query  61    YDRKSELKAFDDMKTGVKGHVDSGIMKIPRIFIHDeikkeekeklkPAMASTYKVPIIDM  240
             +DR SELKAFD  K GVKG VDSG+ +IP IF     +       +  +     VP++D+
Sbjct  31    FDRASELKAFDQTKAGVKGLVDSGVAEIPGIFYCPPKEASNSIPEETHLG----VPVVDL  86

Query  241   EGLHTDHTTRRSEIIKEIRDACQTWGFFQIINHGIPTQVLDEMIDGVRQFHELDSEVKKQ  420
             E +  D   RR +++ EIR+A + WGFFQ+INHG+P  V +E+I+ VR+F E DSEVKKQ
Sbjct  87    EDIDKDPFKRR-QVVDEIREASEXWGFFQVINHGVPVSVQEEIINRVRRFFEQDSEVKKQ  145

Query  421   FYSRDLTRKVVYNTNFDFHTSPAATWRDTLYFIMAPHPPTPQELPQVCRDILIKYSNSVQ  600
             +Y+RD T+  +YN NFD  +SP A WRDT+  +MAP+PP P +LPQVCRDIL +YS  + 
Sbjct  146   YYTRDYTKSFIYNCNFDLFSSPVANWRDTIVTVMAPNPPNPHDLPQVCRDILFEYSKHIM  205

Query  601   KLGLCLLELFSESLGLHKNHLEKLGCAVGLSIFGQYYPACPEPELTFALRDHSDSGFFTV  780
             KLG  +  L SE+LGL   HL  L C  GL I G YYP+ P+PEL+    +HSD  F TV
Sbjct  206   KLGELIFGLLSEALGLKSTHLVDLDCNEGLRIIGHYYPSSPQPELSIGTTEHSDDTFITV  265

Query  781   LNQDTQIGGLQVLHENQWVDVPPLHGALVVNVADLLQLITNDKFKSVVHRVIAQKIAPRV  960
             L QD  +GGLQV  +N+WVDVPP+ GA V+NV +LLQLITND+F S  H+V+A +  PR+
Sbjct  266   LLQDN-MGGLQVRQQNKWVDVPPVPGAFVINVGNLLQLITNDRFVSSEHKVLANREGPRI  324

Query  961   SVASFFRTIPGDVDAKKVYGPIKELVSDENPPLYRETTTEEYLMHFQKKGLDGTSGLLRF  1140
             SVASFF T  G +   K+YGPIKEL+S++NPP Y+E T  EY ++F +KGLDGTS L  F
Sbjct  325   SVASFFST--GRLPTSKLYGPIKELLSEQNPPKYKEITVREYNIYFAEKGLDGTSALPHF  382

Query  1141  RL  1146
             ++
Sbjct  383   KI  384



>ref|XP_003628651.1| 1-aminocyclopropane-1-carboxylate oxidase-like protein [Medicago 
truncatula]
 gb|AET03127.1| 2OG-Fe(II) oxygenase family oxidoreductase [Medicago truncatula]
Length=373

 Score =   392 bits (1006),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 192/378 (51%), Positives = 258/378 (68%), Gaps = 7/378 (2%)
 Frame = +1

Query  16    EMATASTGGKADSGDYDRKSELKAFDDMKTGVKGHVDSGIMKIPRIFIHDeikkeekekl  195
             E+  ++   +  +  Y+R  E+KAF++ K GV+G V+SG+ KIPR+F   E+   +    
Sbjct  2     ELNGSNLSHENTNSAYNRNIEVKAFEESKVGVRGLVESGVTKIPRMFYSGELNIFDNSNN  61

Query  196   kPAMASTYKVPIIDMEGLHTDHTTRRSEIIKEIRDACQTWGFFQIINHGIPTQVLDEMID  375
                  +T  VPIID++G+H D   RR E+I +IR AC+ WGFFQ+INH IP  VLDEM+D
Sbjct  62    N----TTLSVPIIDLKGIHVD-PARRIEVISQIRTACKEWGFFQVINHEIPICVLDEMLD  116

Query  376   GVRQFHELDSEVKKQFYSRDLTRKVVYNTNFDFHTSPAATWRDTLYFIMAPHPPTPQELP  555
             G R+FHE DSEV+ QFY+RD  + +VY +N   + +    WRD+    MAP PP  +E P
Sbjct  117   GFRRFHEQDSEVRSQFYNRDNKKNIVYFSNASLYENKYVNWRDSFGCSMAPKPPKSEEFP  176

Query  556   QVCRDILIKYSNSVQKLGLCLLELFSESLGLHKNHLEKLGCAVGLSIFGQYYPACPEPEL  735
             +V RDI+I+YS+ +  LG  + ELFSE+LGL  ++L++L C   L + G YYP+CPEPEL
Sbjct  177   EVLRDIIIEYSSKIMALGNTIFELFSEALGLDPSYLKELNCLEALYVQGHYYPSCPEPEL  236

Query  736   TFALRDHSDSGFFTVLNQDTQIGGLQVLHENQWVDVPPLHGALVVNVADLLQLITNDKFK  915
             T     H+D GF  ++ QD Q+GGLQVLHENQWV+V P+HGALVVNV DLLQLITND F 
Sbjct  237   TMGASKHTDPGFMAIVLQD-QLGGLQVLHENQWVNVSPVHGALVVNVGDLLQLITNDNFV  295

Query  916   SVVHRVIAQKIAPRVSVASFFRTIPG-DVDAKKVYGPIKELVSDENPPLYRETTTEEYLM  1092
             SV HRV+     PRVSVA+FF  +   D  + KVYGPIK+L+S+E PP+YRET+ EE++ 
Sbjct  296   SVFHRVLLSDKGPRVSVANFFGNLYDLDESSSKVYGPIKKLLSEEIPPIYRETSFEEFMA  355

Query  1093  HFQKKGLDGTSGLLRFRL  1146
             H+ KKG DG+  L  F L
Sbjct  356   HYLKKGYDGSKALQPFTL  373



>ref|XP_007149298.1| hypothetical protein PHAVU_005G058500g [Phaseolus vulgaris]
 gb|ESW21292.1| hypothetical protein PHAVU_005G058500g [Phaseolus vulgaris]
Length=367

 Score =   391 bits (1005),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 193/361 (53%), Positives = 249/361 (69%), Gaps = 7/361 (2%)
 Frame = +1

Query  64    DRKSELKAFDDMKTGVKGHVDSGIMKIPRIFIHDeikkeekeklkPAMASTYKVPIIDME  243
             +R  ELK FDD K GVKG  D GI KIPR+F H   ++ +      +      +P+ID+ 
Sbjct  14    ERVRELKEFDDTKAGVKGLADQGITKIPRVFHHPPDEQVKVST---SGGEADDIPVIDLA  70

Query  244   GLHTDHTTRRSEIIKEIRDACQTWGFFQIINHGIPTQVLDEMIDGVRQFHELDSEVKKQF  423
              +  D + R+  +I  I++A + WGFFQ++NHGIP  VL+++ DGV +F+E D+EVKK  
Sbjct  71    EVDKDPSLRQG-VIDRIKEASEKWGFFQVVNHGIPVTVLEDLKDGVCRFYEQDTEVKKDL  129

Query  424   YSRDLTRKVVYNTNFDFHTSPAATWRDTLYFIMAPHPPTPQELPQVCRDILIKYSNSVQK  603
             Y+RD  +  VYN+NFD ++SPA +WRDT +  +AP+PP PQ+LP VCRDIL++Y   V K
Sbjct  130   YTRDHKKPFVYNSNFDIYSSPALSWRDTFFCYLAPNPPKPQDLPAVCRDILLEYGTWVMK  189

Query  604   LGLCLLELFSESLGLHKNHLEKLGCAVGLSIFGQYYPACPEPELTFALRDHSDSGFFTVL  783
             LG+ L EL SESLGLH NHL+ + CA G+     YYPACPEPELT     HSD+ F TVL
Sbjct  190   LGIALFELLSESLGLHPNHLKDMDCAKGIISLCHYYPACPEPELTLGTIKHSDNSFLTVL  249

Query  784   NQDTQIGGLQVLHENQWVDVPPLHGALVVNVADLLQLITNDKFKSVVHRVIAQKIAPRVS  963
              QD  IGGLQVL++N W+D+ P  GALVVN+ D LQLITND+FKSV HRV+A    PR+S
Sbjct  250   LQD-HIGGLQVLYQNTWIDIAPEPGALVVNIGDFLQLITNDRFKSVEHRVVANVTGPRIS  308

Query  964   VASFFRTIPGDVDAKKVYGPIKELVSDENPPLYRETTTEEYLMHFQKKGLDGTSGLLRFR  1143
             VA FF    G     K+YGPIKEL+S+ENPP YRE T EEY  ++ +KGLDGTS L  FR
Sbjct  309   VACFFSE--GLRTPGKLYGPIKELLSEENPPKYREVTVEEYARNYFEKGLDGTSALHPFR  366

Query  1144  L  1146
             +
Sbjct  367   I  367



>ref|XP_004510134.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
12-like [Cicer arietinum]
Length=362

 Score =   391 bits (1004),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 187/358 (52%), Positives = 254/358 (71%), Gaps = 10/358 (3%)
 Frame = +1

Query  73    SELKAFDDMKTGVKGHVDSGIMKIPRIFIHDeikkeekeklkPAMASTYKVPIIDMEGLH  252
             SE KAFD+ K GVKG VD+GI KIP IF H   K E+      +  + + +P+ID+  + 
Sbjct  15    SERKAFDEAKEGVKGLVDAGIKKIPEIFHHQPDKYEK------SYNTCHVIPVIDLTNID  68

Query  253   TDHTTRRSEIIKEIRDACQTWGFFQIINHGIPTQVLDEMIDGVRQFHELDSEVKKQFYSR  432
              D +  + EI++++++AC+TWGFFQ+INHGIP  VL+E+ DGV++F+E +++VKK  Y+R
Sbjct  69    KDPSLHQ-EIVQKVKEACETWGFFQVINHGIPLSVLEEIKDGVKRFYEQNTQVKKDLYTR  127

Query  433   DLTRKVVYNTNFDFHTSPAATWRDTLYFIMAPHPPTPQELPQVCRDILIKYSNSVQKLGL  612
             D  +  +YN+NFD ++SPA  WRDT    +APH P  ++ P VCRDIL++Y   +  LG 
Sbjct  128   DRNKSFIYNSNFDIYSSPALNWRDTFMCYLAPHTPKLEDFPIVCRDILLEYGKHMMNLGT  187

Query  613   CLLELFSESLGLHKNHLEKLGCAVGLSIFGQYYPACPEPELTFALRDHSDSGFFTVLNQD  792
              L EL SE+LGL  NHL+++ C  GL     YYP CPEPELT     HSD+ F TVL QD
Sbjct  188   LLFELLSEALGLKPNHLKEMDCVEGLIALCHYYPPCPEPELTVGTTKHSDNDFLTVLLQD  247

Query  793   TQIGGLQVLHENQWVDVPPLHGALVVNVADLLQLITNDKFKSVVHRVIAQKIAPRVSVAS  972
               IGGLQVLHE++W+D+ P+ GAL+VNV DLLQLITNDKFKSV HRV+A ++ PR+SVA 
Sbjct  248   -HIGGLQVLHEDKWIDITPVTGALIVNVGDLLQLITNDKFKSVEHRVVANEVGPRISVAC  306

Query  973   FFRTIPGDVDAKKVYGPIKELVSDENPPLYRETTTEEYLMHFQKKGLDGTSGLLRFRL  1146
             FF T      + K+YGPIKEL+S+ENPP YRETT  +Y+ +F+ KGLDGT+ L  +++
Sbjct  307   FFST--AYRSSSKLYGPIKELLSEENPPKYRETTVADYVAYFEAKGLDGTTALTHYKI  362



>ref|XP_006304979.1| hypothetical protein CARUB_v10011473mg [Capsella rubella]
 gb|EOA37877.1| hypothetical protein CARUB_v10011473mg [Capsella rubella]
Length=365

 Score =   391 bits (1004),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 195/361 (54%), Positives = 251/361 (70%), Gaps = 7/361 (2%)
 Frame = +1

Query  64    DRKSELKAFDDMKTGVKGHVDSGIMKIPRIFIHDeikkeekeklkPAMASTYKVPIIDME  243
             DR ++LKAFD+ KTGVKG VD+GI ++P IF             KP  +S + +P ID++
Sbjct  12    DRSTQLKAFDETKTGVKGLVDAGISEVPAIF---RAPPATLTSPKPPSSSEFTIPTIDLK  68

Query  244   GLHTDHTTRRSEIIKEIRDACQTWGFFQIINHGIPTQVLDEMIDGVRQFHELDSEVKKQF  423
             G   D  TRRS +++ I DA + WGFFQ+INHGIP  VL++M +GVR+FHE D+EVKK F
Sbjct  69    GGGADSITRRS-LVEMIGDAPEKWGFFQVINHGIPLDVLEKMKEGVREFHEQDTEVKKGF  127

Query  424   YSRDLTRKVVYNTNFDFHTSPAATWRDTLYFIMAPHPPTPQELPQVCRDILIKYSNSVQK  603
             YSRD   K+VY++NFD  +S AA WRDTL    AP PP  ++LP  C +++I+YS  V K
Sbjct  128   YSRDPASKMVYSSNFDLFSSQAANWRDTLGCYTAPDPPRQEDLPAACGEMMIEYSKEVMK  187

Query  604   LGLCLLELFSESLGLHKNHLEKLGCAVGLSIFGQYYPACPEPELTFALRDHSDSGFFTVL  783
             LG  L EL SE+LGL+ NH + + C   L + G YYP CP+P+LT  L  HSD+ F T+L
Sbjct  188   LGELLFELLSEALGLNTNHFKDIDCTNSLLLLGHYYPPCPQPDLTLGLTKHSDNSFLTLL  247

Query  784   NQDTQIGGLQVLHENQWVDVPPLHGALVVNVADLLQLITNDKFKSVVHRVIAQKIAPRVS  963
              QD  IGGLQVLH+  WVDVPP+ GALVVNV DLLQLITNDKF SV HRV+A +  PR+S
Sbjct  248   LQD-HIGGLQVLHDQYWVDVPPVPGALVVNVGDLLQLITNDKFISVEHRVLANEDGPRIS  306

Query  964   VASFFRTIPGDVDAKKVYGPIKELVSDENPPLYRETTTEEYLMHFQKKGLDGTSGLLRFR  1143
             VA FF +    +   +VYGPIKEL+S++NPP YR+TT  EY   ++ KG DGTSGLL  +
Sbjct  307   VACFFSSY--LMANPRVYGPIKELLSEQNPPKYRDTTITEYAKFYRSKGFDGTSGLLYLK  364

Query  1144  L  1146
             +
Sbjct  365   I  365



>ref|XP_002276308.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1 [Vitis vinifera]
Length=353

 Score =   390 bits (1003),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 186/350 (53%), Positives = 253/350 (72%), Gaps = 7/350 (2%)
 Frame = +1

Query  58    DYDRKSELKAFDDMKTGVKGHVDSGIMKIPRIFIHDeikkeekeklkPAMASTYKVPIID  237
             +YDRKSELKAFDD K+GVKG +D G+ KIP +FIH     + K +   +  S ++VP+ID
Sbjct  9     EYDRKSELKAFDDSKSGVKGLLDGGMTKIPLMFIHPRYNPDAKSE---SAVSQFRVPLID  65

Query  238   MEGLHTDHTTRRSEIIKEIRDACQTWGFFQIINHGIPTQVLDEMIDGVRQFHELDSEVKK  417
             ++G+  D+ T R++II ++R AC+ WGFFQ++NHGIP  VL+EMIDG+R FHE D+++KK
Sbjct  66    LDGVK-DNATVRAKIIDQVRGACENWGFFQVVNHGIPASVLEEMIDGIRGFHEQDTQMKK  124

Query  418   QFYSRDLTRKVVYNTNFDFHTSPAATWRDTLYFIMAPHPPTPQELPQVCRDILIKYSNSV  597
             +FY+RD   KV + +NFD   + AATW+D+L + M P+PP P E P VCRDI+ +YS  V
Sbjct  125   EFYTRDFKDKVSFVSNFDLFEATAATWKDSLSWPMVPNPPDPTEFPAVCRDIVTEYSKQV  184

Query  598   QKLGLCLLELFSESLGLHKNHLEKLGCAVGLSIFGQYYPACPEPELTFALRDHSDSGFFT  777
             ++LG  L EL SE LGLH NHL+  GCA  +   G YYP CPEPELT     H+DSGF T
Sbjct  185   KRLGYTLFELLSEGLGLHVNHLKDTGCAEVIFHVGHYYPPCPEPELTLGASRHADSGFLT  244

Query  778   VLNQDTQIGGLQVLHENQWVDVPPLHGALVVNVADLLQLITNDKFKSVVHRVIAQKIAPR  957
             VL QD Q+GGLQVLH+NQW+D+ P+ GALV+NV   LQ+ITND+FKS+ HRV+A +++ R
Sbjct  245   VLLQD-QVGGLQVLHQNQWIDLVPMPGALVINVGFSLQVITNDRFKSIEHRVLANRVSSR  303

Query  958   VSVASFFRTIPGDVDAKKVYGPIKELVSDENPPLYRETTTEEYLMHFQKK  1107
             VS+AS F T      + K+Y PIKEL++ ENPP Y+E T + ++ + + K
Sbjct  304   VSMASAFGTTL--FPSSKLYSPIKELLTQENPPKYKEATLQAHVAYLRGK  351



>gb|KEH18776.1| 1-aminocyclopropane-1-carboxylate oxidase-like protein [Medicago 
truncatula]
Length=364

 Score =   390 bits (1003),  Expect = 6e-129, Method: Compositional matrix adjust.
 Identities = 185/358 (52%), Positives = 255/358 (71%), Gaps = 9/358 (3%)
 Frame = +1

Query  73    SELKAFDDMKTGVKGHVDSGIMKIPRIFIHDeikkeekeklkPAMASTYKVPIIDMEGLH  252
             +E KAFD+ K GVKG VD G+ KIP +F H   K E       A  +++ +PIID+  + 
Sbjct  16    NERKAFDETKAGVKGLVDGGLNKIPTLFHHQPDKYEL------AYNTSHVIPIIDLADID  69

Query  253   TDHTTRRSEIIKEIRDACQTWGFFQIINHGIPTQVLDEMIDGVRQFHELDSEVKKQFYSR  432
                 +   +I+ ++++AC+TWGFFQ++NHGIP  VL+E+ DGV++F+E D+EVKK  Y+R
Sbjct  70    NKDPSIHQKIVDKVKEACETWGFFQVVNHGIPLSVLEELKDGVKRFYEQDTEVKKDLYTR  129

Query  433   DLTRKVVYNTNFDFHTSPAATWRDTLYFIMAPHPPTPQELPQVCRDILIKYSNSVQKLGL  612
             D  +  +YN+NFD ++SPA  WRDT    +AP  P P+++P VCRDIL++Y   ++ LG 
Sbjct  130   DRHKSFIYNSNFDIYSSPALNWRDTFTCYLAPDTPKPEDIPVVCRDILLEYGKHMRNLGT  189

Query  613   CLLELFSESLGLHKNHLEKLGCAVGLSIFGQYYPACPEPELTFALRDHSDSGFFTVLNQD  792
              L EL SE+LGL+ NHL+ + CA GL   G YYP CPEPELT     HSD+ F TVL QD
Sbjct  190   LLFELCSEALGLNPNHLKDIDCAEGLLALGHYYPPCPEPELTVGTTKHSDNDFLTVLLQD  249

Query  793   TQIGGLQVLHENQWVDVPPLHGALVVNVADLLQLITNDKFKSVVHRVIAQKIAPRVSVAS  972
               IGGLQVL++++W+D+ P+ GAL+VNV DLLQLITNDKFKSV HRV+A  + PR+SVA 
Sbjct  250   -HIGGLQVLYQDKWIDITPVPGALIVNVGDLLQLITNDKFKSVEHRVLANNVGPRISVAC  308

Query  973   FFRTIPGDVDAKKVYGPIKELVSDENPPLYRETTTEEYLMHFQKKGLDGTSGLLRFRL  1146
             FF T  G   + K+YGPIKEL+S++NPP+YRET+  +Y+ +F+ KGLDGTS L  +++
Sbjct  309   FFCT--GHRSSSKLYGPIKELLSEDNPPIYRETSVADYVAYFEAKGLDGTSALTHYKI  364



>ref|XP_003534014.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1-like [Glycine max]
Length=375

 Score =   391 bits (1004),  Expect = 6e-129, Method: Compositional matrix adjust.
 Identities = 193/369 (52%), Positives = 256/369 (69%), Gaps = 7/369 (2%)
 Frame = +1

Query  40    GKADSGDYDRKSELKAFDDMKTGVKGHVDSGIMKIPRIFIHDeikkeekeklkPAMASTY  219
              K DS  YDR +E+KAFD+ K GVKG  DSGI KIPR+F H +++   +        S +
Sbjct  14    SKKDST-YDRIAEVKAFDETKLGVKGLFDSGITKIPRMFHHAKVEDHTETMPN---DSNF  69

Query  220   KVPIIDMEGLHTDHTTRRSEIIKEIRDACQTWGFFQIINHGIPTQVLDEMIDGVRQFHEL  399
              VPIID++ + T+ ++ R + + +IR AC+ WGFFQ++NHGI   +LDEMI G+R+FHE 
Sbjct  70    SVPIIDLQDIDTN-SSLRVKALDKIRSACKEWGFFQVVNHGIAVDLLDEMICGIRRFHEQ  128

Query  400   DSEVKKQFYSRDLTRKVVYNTNFDFHTSPAATWRDTLYFIMAPHPPTPQELPQVCRDILI  579
             D EV+K FYSRD+ +KV Y +N   +  PAA WRDT+ F   P PP P+E+P VCRDI+I
Sbjct  129   DVEVRKSFYSRDMNKKVRYFSNGTLYRDPAANWRDTIAFFRTPDPPNPEEIPSVCRDIVI  188

Query  580   KYSNSVQKLGLCLLELFSESLGLHKNHLEKLGCAVGLSIFGQYYPACPEPELTFALRDHS  759
              YS  V+ LG  + ELFSE+LGLH ++L++L    G  +   YYP CPEPELT     H+
Sbjct  189   GYSEKVRALGFTIFELFSEALGLHSSYLKELDSVDGQFLLCHYYPPCPEPELTMGTSKHT  248

Query  760   DSGFFTVLNQDTQIGGLQVLHENQWVDVPPLHGALVVNVADLLQLITNDKFKSVVHRVIA  939
             D  F T+L QD Q+GGLQVLH+NQWVDVPP+HG+LVVN+ D LQLI+ND F SV HRV++
Sbjct  249   DISFMTILLQD-QMGGLQVLHQNQWVDVPPVHGSLVVNIGDFLQLISNDMFVSVYHRVLS  307

Query  940   QKIAPRVSVASFFRTIPGDVDAKKVYGPIKELVSDENPPLYRETTTEEYLMHFQKKGLDG  1119
                 PR+SVASFF        + KV GPIKEL+S++NPP+YR+TT ++   H+ +KGLDG
Sbjct  308   SHTGPRISVASFFAN-SFQQSSLKVVGPIKELLSEDNPPIYRDTTVKDVKAHYFEKGLDG  366

Query  1120  TSGLLRFRL  1146
              + L  FRL
Sbjct  367   NNSLHPFRL  375



>emb|CDO99204.1| unnamed protein product [Coffea canephora]
Length=609

 Score =   399 bits (1024),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 197/358 (55%), Positives = 246/358 (69%), Gaps = 16/358 (4%)
 Frame = +1

Query  73    SELKAFDDMKTGVKGHVDSGIMKIPRIFIHDeikkeekeklkPAMASTYKVPIIDMEGLH  252
             ++   FD+ K GVKG VD+GI K+PRIFI  +   ++           +K P+ID++G+ 
Sbjct  268   TDYSPFDETKAGVKGLVDAGITKVPRIFIQPQCSLDDGLN---GTKGIFKFPVIDLDGID  324

Query  253   TDHTTRRSEIIKEIRDACQTWGFFQIINHGIPTQVLDEMIDGVRQFHELDSEVKKQFYSR  432
             TD   RR EI+ ++RDA +TWGFF ++NHGIP  VL+EMI G R+F E D+E KKQ+Y+R
Sbjct  325   TD-PARRKEIVDKVRDASETWGFFTVVNHGIPFSVLEEMIQGARRFFEQDTEFKKQWYTR  383

Query  433   DLTRKVVYNTNFDFHTSPAATWRDTLYFIMAPHPPTPQELPQVCRDILIKYSNSVQKLGL  612
             D T+ VVYN NFD H SPAA WRDT Y  MAP+PP P+ELP  C +I+I+YS  V KLG 
Sbjct  384   DYTKTVVYNCNFDLHISPAANWRDTCYCYMAPNPPAPEELPDACSEIVIEYSKLVMKLGC  443

Query  613   CLLELFSESLGLHKNHLEKLGCAVGLSIFGQYYPACPEPELTFALRDHSDSGFFTVLNQD  792
              LLE  SE LGL+ ++L+ + CA GL++   YYP CP+PELT     HSD+GF TVL QD
Sbjct  444   LLLEFLSEGLGLNLSYLKDIDCAEGLAVLCHYYPPCPQPELTLGTSKHSDNGFITVLLQD  503

Query  793   TQIGGLQVLHENQWVDVPPLHGALVVNVADLLQLITNDKFKSVVHRVIAQKIAPRVSVAS  972
              +IGGLQVLH+NQW+DVPP  GAL         LI+ND +KSV HRV A K+ PRVSV S
Sbjct  504   -KIGGLQVLHQNQWIDVPPTPGAL---------LISNDTYKSVEHRVKANKVGPRVSVPS  553

Query  973   FFRTIPGDVDAKKVYGPIKELVSDENPPLYRETTTEEYLMHFQKKGLDGTSGLLRFRL  1146
              F T  G     KVYGPIKEL+S ENPP YR TT  EY  +F+ KGLDGTS LL F+L
Sbjct  554   LFST--GPRPTAKVYGPIKELLSAENPPKYRATTVNEYTQYFRAKGLDGTSALLHFKL  609


 Score =   298 bits (762),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 159/281 (57%), Positives = 200/281 (71%), Gaps = 15/281 (5%)
 Frame = +1

Query  247   LHTDHTTRRSEIIKEIRDACQTWGFFQIINHGIPTQVLDEMIDGVRQFHELDSEVKKQFY  426
             +H D   RR EI+ ++RDA +  GFFQ++NHGI   VL+EMI G R+F E D+EVKK++Y
Sbjct  1     MHKD-PVRRKEIVDKVRDASERGGFFQVVNHGIQVSVLEEMIQGARRFFEQDTEVKKKWY  59

Query  427   SRDLTRKVVYNTNFDFHTSPAATWRDTLYFIMAPHPPTPQELPQVCRDILIKYSNSVQKL  606
             +RD T++VVYN NFD ++  AA WRDT Y  MAP+PP P+ELP VC  ILI+YS  V  L
Sbjct  60    TRDRTKRVVYNCNFDLYSPTAANWRDTAYCFMAPNPPAPEELPDVCSKILIEYSKQVMNL  119

Query  607   GLCLLELFSESLGLHKNHLEKLGCAVGLSIFGQYYPACPEPELTFALRDHSDSGFFTVLN  786
             G  LLEL SE LGL  ++LE + C  GL++   YYPACP+PELTF    HSD+  FT+L 
Sbjct  120   GCLLLELLSEGLGLDPSYLESIDCGKGLAVLCHYYPACPQPELTFGTSPHSDNDSFTILL  179

Query  787   QDTQIGGLQVLHENQWVDVPPLHGALVVNVADLLQLITNDKFKSVVHRVIAQKIAPRVSV  966
             QD  +GGLQVLH+NQWVDVPP  GAL+         I+NDK+KS  HRV+A ++ PRVS+
Sbjct  180   QD-NLGGLQVLHQNQWVDVPPTPGALI---------ISNDKYKSSEHRVLANRVGPRVSI  229

Query  967   ASFFRTIPGDVDAK-KVYGPIKELVSDENPPLYRETTTEEY  1086
             ASFF     DV A  K+YGPIKEL+S+ENPP Y ETT +EY
Sbjct  230   ASFFTP---DVRATGKLYGPIKELLSEENPPKYHETTAKEY  267



>emb|CBI23588.3| unnamed protein product [Vitis vinifera]
Length=296

 Score =   387 bits (995),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 176/294 (60%), Positives = 232/294 (79%), Gaps = 3/294 (1%)
 Frame = +1

Query  265   TRRSEIIKEIRDACQTWGFFQIINHGIPTQVLDEMIDGVRQFHELDSEVKKQFYSRDLTR  444
              +R +I+ ++R+A +TWGFF ++NHGIP  VL+EM++GVR+F+E D+E+K++FY+RD++R
Sbjct  6     VQRKQIVDKVREASETWGFFNVLNHGIPVTVLEEMMNGVRRFYEQDTELKQEFYTRDVSR  65

Query  445   KVVYNTNFDFHTSPAATWRDTLYFIMAPHPPTPQELPQVCRDILIKYSNSVQKLGLCLLE  624
             K+VYN+NFD +T+ AA+WRDT Y +MAPHPP PQ+LP  CRDIL++Y   V KLG  LLE
Sbjct  66    KLVYNSNFDLYTAKAASWRDTFYCLMAPHPPNPQDLPAACRDILMEYKEQVMKLGFKLLE  125

Query  625   LFSESLGLHKNHLEKLGCAVGLSIFGQYYPACPEPELTFALRDHSDSGFFTVLNQDTQIG  804
             L SE+LGL+ NHL+ + CA GL++   YYPACP+PELT     H+D+ F TVL QD QIG
Sbjct  126   LMSEALGLNPNHLKGMDCAEGLAMVCHYYPACPQPELTLGTGFHTDNDFLTVLLQD-QIG  184

Query  805   GLQVLHENQWVDVPPLHGALVVNVADLLQLITNDKFKSVVHRVIAQKIAPRVSVASFFRT  984
             GLQVLH++QWVDVPP+ GALV+NV DLLQLITND+FKSV HRV+A    PRVS+A FF T
Sbjct  185   GLQVLHQDQWVDVPPMPGALVINVGDLLQLITNDRFKSVEHRVLANHTGPRVSIACFFST  244

Query  985   IPGDVDAKKVYGPIKELVSDENPPLYRETTTEEYLMHFQKKGLDGTSGLLRFRL  1146
                   + K+YGPIKEL+S+ENP  YRETT  +Y+ HFQ+KGL+G++ L  FRL
Sbjct  245   --SVQPSSKLYGPIKELLSEENPARYRETTVSDYVAHFQEKGLEGSTALQLFRL  296



>ref|XP_008367206.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1-like [Malus domestica]
Length=363

 Score =   390 bits (1001),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 199/367 (54%), Positives = 263/367 (72%), Gaps = 6/367 (2%)
 Frame = +1

Query  46    ADSGDYDRKSELKAFDDMKTGVKGHVDSGIMKIPRIFIHDeikkeekeklkPAMASTYKV  225
             A + +YDRKSELKAFDD K GVKG VD+GI  IPRIF H     +  +      +S + +
Sbjct  3     ATNTNYDRKSELKAFDDTKEGVKGLVDAGITVIPRIFHHPPKLDDNLDSEA---SSQFSI  59

Query  226   PIIDMEGLHTDHTTRRSEIIKEIRDACQTWGFFQIINHGIPTQVLDEMIDGVRQFHELDS  405
             P+ID++GL     T+R EI+ ++ +A + WGFFQI NHGIP  VL+EM  G R F E D+
Sbjct  60    PVIDLQGLELGSPTKRKEIVAKVAEASEAWGFFQIANHGIPVDVLEEMKXGARGFFEQDT  119

Query  406   EVKKQFYSRDLTRKVVYNTNFDFHTSPAATWRDTLYFIMAPHPPTPQELPQVCRDILIKY  585
             +VKK+ Y+RD +R V+ NTNFD  ++PAATWRD+    MAP+PP P++LP++CRD+L+ Y
Sbjct  120   QVKKELYTRDHSRPVLXNTNFDLFSAPAATWRDSFGIYMAPNPPKPEDLPEICRDVLVDY  179

Query  586   SNSVQKLGLCLLELFSESLGLHKNHLEKLGCAVGLSIFGQYYPACPEPELTFALRDHSDS  765
             S  V KLG  LLEL SE+LGL  +HL  +GC+ GL +   YYPACP+PELT     H D 
Sbjct  180   SKQVMKLGKLLLELLSEALGLKPSHLNDIGCSEGLVLVSNYYPACPQPELTMGTAKHGDG  239

Query  766   GFFTVLNQDTQIGGLQVLHENQWVDVPPLHGALVVNVADLLQLITNDKFKSVVHRVIAQK  945
              F T+L +D  IGGLQVL +N+W++VPP  GALVVN+ DLLQLI+ND+FKSV HRV+A +
Sbjct  240   TFLTILLRD-HIGGLQVLPQNKWINVPPAPGALVVNIGDLLQLISNDRFKSVQHRVLANR  298

Query  946   IAPRVSVASFFRTIPGDVDAKKVYGPIKELVSDENPPLYRETTTEEYLMHFQKKGLDGTS  1125
             + PRVS+ASFF T  G + + K++GPIKEL+S++NPP YRETT  +YL +   KG DGTS
Sbjct  299   VGPRVSIASFFFT--GMLPSTKLFGPIKELLSEDNPPKYRETTVRDYLAYVHHKGHDGTS  356

Query  1126  GLLRFRL  1146
              L +F+L
Sbjct  357   ALSQFKL  363



>ref|XP_004247710.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
[Solanum lycopersicum]
Length=370

 Score =   390 bits (1002),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 198/368 (54%), Positives = 267/368 (73%), Gaps = 10/368 (3%)
 Frame = +1

Query  52    SGDYDRKSELKAFDDMKTGVKGHVDSGIMKIPRIFIHDeikkeekeklkPAMAST-YKVP  228
             S +YD+  ELKAFDD K GVKG VD+GI ++PRIFIH    +       P++  T +  P
Sbjct  10    SSNYDKNIELKAFDDTKAGVKGLVDAGITQVPRIFIH---PEVSGSGPSPSLEETRFVFP  66

Query  229   IIDMEGLHTDHTTRRSEIIKEIRDACQTWGFFQIINHGIPTQVLDEMIDGVRQFHELDSE  408
             IID+E ++ D   +  EI+K++ DA +TWGFFQ+INHGIP  VLDEM+ G R F E D +
Sbjct  67    IIDLENINKD-PIKHKEIVKKVGDASETWGFFQVINHGIPMSVLDEMLRGARGFFEQDID  125

Query  409   VKKQFYSRDLTRKVVYNTNFDFHT--SPAATWRDTLYFIMAPHPPTPQELPQVCRDILIK  582
             VKK++Y RD TR+VVYN+NFD +   + A  WRD+LY  M P P  P+ELP+ CR+I+++
Sbjct  126   VKKKYYHRDYTRRVVYNSNFDLYNPKALAVNWRDSLYSTMGPEPFNPEELPEACREIVME  185

Query  583   YSNSVQKLGLCLLELFSESLGLHKNHLEKLGCAVGLSIFGQYYPACPEPELTFALRDHSD  762
             YS+ V K+G  LLEL SESLGL  +HL+++ C+ GLSI   YYP+CP+P+LT  L  H+D
Sbjct  186   YSHHVMKMGCTLLELLSESLGLKTSHLKEMECSEGLSILCNYYPSCPQPDLTIGLSKHTD  245

Query  763   SGFFTVLNQDTQIGGLQVLHENQWVDVPPLHGALVVNVADLLQLITNDKFKSVVHRVIAQ  942
             + FFT+L QD  IGGLQVLH N WVDVPP  GALV+N+ D+LQLI+NDK+KSV HR ++ 
Sbjct  246   NDFFTILLQD-DIGGLQVLHHNHWVDVPPTPGALVINIGDVLQLISNDKYKSVDHRALSN  304

Query  943   KIAPRVSVASFFRTIPGDVDAKKVYGPIKELVSDENPPLYRETTTEEYLMHFQKKGLDGT  1122
             KI PR+S+ASFF +  G + + K+YGPI+EL+S+ NPP YR TT +++  HF +KGLDGT
Sbjct  305   KIGPRISIASFFSS--GPLPSSKLYGPIEELLSENNPPKYRATTLKDFYDHFSQKGLDGT  362

Query  1123  SGLLRFRL  1146
             S L  +++
Sbjct  363   SNLSHYKI  370



>ref|XP_008438543.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1-like [Cucumis melo]
Length=372

 Score =   390 bits (1002),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 188/376 (50%), Positives = 260/376 (69%), Gaps = 4/376 (1%)
 Frame = +1

Query  19    MATASTGGKADSGDYDRKSELKAFDDMKTGVKGHVDSGIMKIPRIFIHDeikkeekeklk  198
             MA  +   K D   +DR SELKAFD  K GVKG VDSG+ +IP IF +   ++    +  
Sbjct  1     MANLTPFSKLDE-TFDRASELKAFDQTKAGVKGLVDSGLAEIPAIFYYPHKERSNSNETS  59

Query  199   PAMASTYKVPIIDMEGLHTDHTTRRSEIIKEIRDACQTWGFFQIINHGIPTQVLDEMIDG  378
                     VP++D+E +  D   RR +++ +IR+A +TWGFFQ++NHG+P  V +E+I+G
Sbjct  60    VPNEPHLGVPVVDLEDIDKD-PIRRRQVVDKIREASETWGFFQLLNHGVPVSVQEEIING  118

Query  379   VRQFHELDSEVKKQFYSRDLTRKVVYNTNFDFHTSPAATWRDTLYFIMAPHPPTPQELPQ  558
              R+F E D+EVKKQ+Y+RD+T+  +YN+NFD  ++P   WRDT+   +AP+  +PQ+LPQ
Sbjct  119   TRRFFEQDTEVKKQYYTRDITKPFIYNSNFDLFSAPITNWRDTILTQIAPNSFSPQDLPQ  178

Query  559   VCRDILIKYSNSVQKLGLCLLELFSESLGLHKNHLEKLGCAVGLSIFGQYYPACPEPELT  738
             VCRD+L+ YS  ++KLG  +  L SE+LGL   HL  + C  G +I   YYP+CP+PEL 
Sbjct  179   VCRDVLLDYSKHMEKLGELIFGLLSEALGLKSTHLVDIDCNEGHAILCHYYPSCPQPELA  238

Query  739   FALRDHSDSGFFTVLNQDTQIGGLQVLHENQWVDVPPLHGALVVNVADLLQLITNDKFKS  918
               + +H+D  F TVL QD  IG LQVLH+N+WVD+PP+ GALVVNV +LLQLI+NDKF S
Sbjct  239   IGITEHADGTFITVLLQD-HIGALQVLHDNKWVDIPPVPGALVVNVGNLLQLISNDKFVS  297

Query  919   VVHRVIAQKIAPRVSVASFFRTIPGDVDAKKVYGPIKELVSDENPPLYRETTTEEYLMHF  1098
              VHRV+A    PRVSVA+FF T  G     K+YGPIKEL+S++NPP Y++TT  +Y +++
Sbjct  298   SVHRVLATGKGPRVSVATFFSTT-GYAQTSKLYGPIKELLSEQNPPKYKQTTVRDYRLYY  356

Query  1099  QKKGLDGTSGLLRFRL  1146
              K+GLDGT+ L  FRL
Sbjct  357   AKRGLDGTNPLTHFRL  372



>ref|XP_003626795.1| 1-aminocyclopropane-1-carboxylate oxidase-like protein [Medicago 
truncatula]
 gb|AET01271.1| 1-aminocyclopropane-1-carboxylate oxidase-like protein [Medicago 
truncatula]
Length=364

 Score =   390 bits (1001),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 184/358 (51%), Positives = 252/358 (70%), Gaps = 9/358 (3%)
 Frame = +1

Query  73    SELKAFDDMKTGVKGHVDSGIMKIPRIFIHDeikkeekeklkPAMASTYKVPIIDMEGLH  252
             SE  AFD+ K GVKG VD+G+ KIP +F H   K EE      A  +++ +P+ID++ + 
Sbjct  16    SERIAFDETKAGVKGLVDAGVKKIPTLFHHQPDKYEE------ANNTSHVIPVIDLKDID  69

Query  253   TDHTTRRSEIIKEIRDACQTWGFFQIINHGIPTQVLDEMIDGVRQFHELDSEVKKQFYSR  432
                 +    I+  I++AC+TWGFFQ++NHGIP  VL+E+ DGV++F+E  +E KK  Y+R
Sbjct  70    NQDPSIHQGIVDNIKEACETWGFFQVVNHGIPLSVLEELKDGVKRFYEQATEAKKSLYTR  129

Query  433   DLTRKVVYNTNFDFHTSPAATWRDTLYFIMAPHPPTPQELPQVCRDILIKYSNSVQKLGL  612
             D+ R  VYN+NFD ++SPA  WRD+    +AP  P P++ P VCRD++++Y   V  LG 
Sbjct  130   DMNRSFVYNSNFDIYSSPALNWRDSFACYLAPDTPKPEDFPAVCRDVILEYGKQVMNLGT  189

Query  613   CLLELFSESLGLHKNHLEKLGCAVGLSIFGQYYPACPEPELTFALRDHSDSGFFTVLNQD  792
              L EL SE+LGL+ NHL+ +GCA GL     YYP CPEPELT     HSD+ F TVL QD
Sbjct  190   LLFELMSEALGLNPNHLKDMGCAEGLIALCHYYPPCPEPELTVGTTKHSDNDFLTVLLQD  249

Query  793   TQIGGLQVLHENQWVDVPPLHGALVVNVADLLQLITNDKFKSVVHRVIAQKIAPRVSVAS  972
               IGGLQVL+E++W+D+ P+ GAL+VNV DLLQLITNDKFKSVVHRV+A ++ PR+SVA 
Sbjct  250   -HIGGLQVLYEDKWIDITPVSGALIVNVGDLLQLITNDKFKSVVHRVLANQVGPRISVAC  308

Query  973   FFRTIPGDVDAKKVYGPIKELVSDENPPLYRETTTEEYLMHFQKKGLDGTSGLLRFRL  1146
             FF T      + K+YGP+KEL+S++NPP YRET+  +Y+ +F+ KGLDGTS L  +++
Sbjct  309   FFST--ALKASSKLYGPMKELLSEDNPPKYRETSVADYVAYFRAKGLDGTSALTHYKI  364



>ref|XP_010475401.1| PREDICTED: LOW QUALITY PROTEIN: 1-aminocyclopropane-1-carboxylate 
oxidase homolog 2-like [Camelina sativa]
Length=379

 Score =   390 bits (1001),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 194/384 (51%), Positives = 254/384 (66%), Gaps = 8/384 (2%)
 Frame = +1

Query  1     REREREMATASTGGKADSGDYDRKSELKAFDDMKTGVKGHVDSGIMKIPRIFIHDeikke  180
             R ++  M TA       +  +DR SELKAFD+ KTGVKG VD+GI KIPRIF H  + + 
Sbjct  2     RNKKTIMETAKI-----ASSFDRASELKAFDETKTGVKGLVDAGISKIPRIFHHSSVVEL  56

Query  181   ekeklkPA-MASTYKVPIIDMEGLHTDHTTRRSEIIKEIRDACQTWGFFQIINHGIPTQV  357
                K  P+ +     +P ID+ G   +   +R + I+ I++A   WGFFQ+INHG+   +
Sbjct  57    ANPKPIPSELLHLKTIPTIDLGGRVFEDAVKRKKAIEGIKEAAAKWGFFQVINHGVSLHL  116

Query  358   LDEMIDGVRQFHELDSEVKKQFYSRDLTRKVVYNTNFDFHTSPAATWRDTLYFIMAPHPP  537
             L+EM DGVR FHE   E +K+ Y+RD ++K +Y +NFD + +P+A WRD+ Y  MAP+PP
Sbjct  117   LEEMKDGVRNFHEQPPEARKELYTRDYSKKFMYTSNFDLYRAPSANWRDSCYCYMAPYPP  176

Query  538   TPQELPQVCRDILIKYSNSVQKLGLCLLELFSESLGLHKNHLEKLGCAVGLSIFGQYYPA  717
              PQ++P++CRD++++YS  V  LG  L EL SE+LGL+ NHL+ + C  GL +   YYP 
Sbjct  177   KPQDIPEICRDVMLEYSKQVMILGEFLFELLSEALGLNHNHLKDMDCLKGLRMLCHYYPP  236

Query  718   CPEPELTFALRDHSDSGFFTVLNQDTQIGGLQVLHENQWVDVPPLHGALVVNVADLLQLI  897
             CPEP+LTF    HSDS F TVL QD QIGGLQV  E  W DVP + GALV+N+ DLLQLI
Sbjct  237   CPEPDLTFGTSQHSDSSFLTVLLQD-QIGGLQVRREGYWFDVPHVPGALVINIGDLLQLI  295

Query  898   TNDKFKSVVHRVIAQKIA-PRVSVASFFRTIPGDVDAKKVYGPIKELVSDENPPLYRETT  1074
             TNDKF S+ HRV+A +    RVSVA FF T    +   + YGPIKELVSDENPP YRET 
Sbjct  296   TNDKFISLEHRVLANRATRARVSVACFFTTYVQVLPNPRSYGPIKELVSDENPPKYRETI  355

Query  1075  TEEYLMHFQKKGLDGTSGLLRFRL  1146
               +Y  +   KGLDGTS LL  ++
Sbjct  356   VRDYATYVNAKGLDGTSALLHLKI  379



>ref|XP_008380113.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1-like [Malus domestica]
 ref|XP_008380114.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1-like [Malus domestica]
Length=363

 Score =   389 bits (999),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 197/367 (54%), Positives = 269/367 (73%), Gaps = 6/367 (2%)
 Frame = +1

Query  46    ADSGDYDRKSELKAFDDMKTGVKGHVDSGIMKIPRIFIHDeikkeekeklkPAMASTYKV  225
             A + +YDRKSE+KAFDD K GVKG VD+GI ++PRIF H   + E       + AS + +
Sbjct  3     ATNTNYDRKSEVKAFDDTKEGVKGLVDAGITEVPRIFHHPLEESETSSD---SEASQFSI  59

Query  226   PIIDMEGLHTDHTTRRSEIIKEIRDACQTWGFFQIINHGIPTQVLDEMIDGVRQFHELDS  405
              +ID++GL     T+R EI+ ++ +A +TWGFFQI NHGIP  VL+EM +G R F E D+
Sbjct  60    AVIDLQGLELGSLTKRKEIVAKVAEASETWGFFQIANHGIPVDVLEEMKNGARGFFEQDT  119

Query  406   EVKKQFYSRDLTRKVVYNTNFDFHTSPAATWRDTLYFIMAPHPPTPQELPQVCRDILIKY  585
             +VKK+ Y+R+ +R +VYN+NFD +++PA +WRD+    MAP+PP P+ELP+VCRDIL++Y
Sbjct  120   QVKKELYTREHSRPLVYNSNFDLYSAPATSWRDSFGCYMAPNPPKPEELPEVCRDILVEY  179

Query  586   SNSVQKLGLCLLELFSESLGLHKNHLEKLGCAVGLSIFGQYYPACPEPELTFALRDHSDS  765
             S  V KLG  LL+L SE+LGL  +HL  + C+ GL +   YYPACP+PELT     H D 
Sbjct  180   SKQVMKLGKLLLZLLSEALGLKPSHLNDIDCSEGLVLLSHYYPACPQPELTLGTTKHGDF  239

Query  766   GFFTVLNQDTQIGGLQVLHENQWVDVPPLHGALVVNVADLLQLITNDKFKSVVHRVIAQK  945
              F T+L QD  IGGLQVL +N+W++VPP+ GALVVN+ DLLQLI+ND+FKSV HRV+A +
Sbjct  240   SFLTILLQD-HIGGLQVLPQNKWINVPPVPGALVVNIGDLLQLISNDRFKSVQHRVLANR  298

Query  946   IAPRVSVASFFRTIPGDVDAKKVYGPIKELVSDENPPLYRETTTEEYLMHFQKKGLDGTS  1125
             + PRVS+AS F T  G + + K+YGPIKEL+S++NPP YRETT  +Y+++   KGLDG+S
Sbjct  299   VGPRVSIASLFYT--GMLPSTKLYGPIKELLSEDNPPKYRETTVRDYVLYVHNKGLDGSS  356

Query  1126  GLLRFRL  1146
              L +F+L
Sbjct  357   ALSQFKL  363



>ref|XP_010475400.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1-like [Camelina sativa]
Length=362

 Score =   389 bits (999),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 191/361 (53%), Positives = 248/361 (69%), Gaps = 6/361 (2%)
 Frame = +1

Query  64    DRKSELKAFDDMKTGVKGHVDSGIMKIPRIFIHDeikkeekeklkPAMASTYKVPIIDME  243
             DR  +LKAFDD KTGVKG VD+GI ++P IF             KP  +S + +P ID++
Sbjct  8     DRLIQLKAFDDTKTGVKGLVDAGISEVPAIF---RAPPVTLASPKPPSSSEFTIPTIDLK  64

Query  244   GLHTDHTTRRSEIIKEIRDACQTWGFFQIINHGIPTQVLDEMIDGVRQFHELDSEVKKQF  423
             G     +  R  ++++IRDA + WGFFQ++NHGIP  VL++M  G+R+FHE D+EVKK F
Sbjct  65    GGRGAGSITRRNLVEKIRDAAEKWGFFQVVNHGIPLDVLEKMKKGIREFHEQDTEVKKGF  124

Query  424   YSRDLTRKVVYNTNFDFHTSPAATWRDTLYFIMAPHPPTPQELPQVCRDILIKYSNSVQK  603
             YSRD   K+VY++NFD  +S AA WRDTL    AP PP P++LP  C + +I+YS  V K
Sbjct  125   YSRDPASKMVYSSNFDLFSSSAANWRDTLGCYTAPDPPRPEDLPATCGETMIEYSKEVMK  184

Query  604   LGLCLLELFSESLGLHKNHLEKLGCAVGLSIFGQYYPACPEPELTFALRDHSDSGFFTVL  783
             LG  L EL SE+LGL+ NHL+ + C   L + G YYP CP+P+LT  L  HSD+ F T+L
Sbjct  185   LGELLFELLSEALGLNTNHLKGMDCTNSLLLLGHYYPPCPQPDLTLGLTKHSDNSFLTLL  244

Query  784   NQDTQIGGLQVLHENQWVDVPPLHGALVVNVADLLQLITNDKFKSVVHRVIAQKIAPRVS  963
              QD  IGGLQVLH+  WVDVPP+ GALVVNV DLLQLITNDKF SV HRV+A +  PR+S
Sbjct  245   LQD-HIGGLQVLHDQYWVDVPPVPGALVVNVGDLLQLITNDKFISVEHRVLANEDGPRIS  303

Query  964   VASFFRTIPGDVDAKKVYGPIKELVSDENPPLYRETTTEEYLMHFQKKGLDGTSGLLRFR  1143
             VA FF +    +   ++YGPIKE +S++NPP YR+TT  EY   ++ KG DGTSGLL  +
Sbjct  304   VACFFSSY--MMANPRLYGPIKEHLSEQNPPKYRDTTITEYAKFYRSKGFDGTSGLLYLK  361

Query  1144  L  1146
             +
Sbjct  362   I  362



>ref|XP_006367031.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1-like [Solanum tuberosum]
Length=364

 Score =   389 bits (999),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 187/368 (51%), Positives = 257/368 (70%), Gaps = 11/368 (3%)
 Frame = +1

Query  58    DYDRKSELKAFDDMKTGVKGHVDSGIMKIPRIFIHDeikk---eekeklkPAMASTYKVP  228
             D +R  ELKAFDD K GVKG VDSGI+ IP IF+   + +     +     + A   ++P
Sbjct  3     DNNRAKELKAFDDSKAGVKGLVDSGIVHIPEIFVTPSVTENEFSAENLNSCSDAVNAQIP  62

Query  229   IIDMEGLHTDHTTRRSEIIKEIRDACQTWGFFQIINHGIPTQVLDEMIDGVRQFHELDSE  408
             IID+EG++ D   RR  I++E+ +AC+TWGFFQ++NHG+P  V+DEMI G+R FHE  ++
Sbjct  63    IIDIEGINED-DFRRRRIVEEVGEACKTWGFFQVVNHGVPQHVMDEMIGGIRSFHEQPND  121

Query  409   VKKQFYSRDLTRKVVYNTNFDFHTSPAATWRDTLYFIMAPHPPTPQELPQVCRDILIKYS  588
             +K++FYS D  +KV++N+NFD + +  A WRDTL  +MAP+PPT  ELPQ CR+ L++YS
Sbjct  122   IKREFYSMDPMKKVMFNSNFDLYQAQVANWRDTLACLMAPNPPTNDELPQACREELLQYS  181

Query  589   NSVQKLGLCLLELFSESLGLHKNHLEKLGCAVGLSIFGQYYPACPEPELTFALRDHSDSG  768
               V+KLG  + EL +E+LGL  NHL  + CA G  I   YYP CPEP  T  +  H+D  
Sbjct  182   QHVRKLGHTIFELLAEALGLKPNHLLDMDCAKGQFIISHYYPPCPEPNKTLGITKHTDPN  241

Query  769   FFTVLNQDTQIGGLQVLHENQWVDVPPLHGALVVNVADLLQLITNDKFKSVVHRVIAQKI  948
             FFT+L QD QIGGLQ+ H+NQW+D+ P+ GALV+N+ DLLQL++NDKFKS  HRV+A+ I
Sbjct  242   FFTILLQD-QIGGLQINHQNQWIDIHPVTGALVINLGDLLQLLSNDKFKSAEHRVLAKHI  300

Query  949   APRVSVASFFRT--IPGDVDAKKVYGPIKELVSDENPPLYRETTTEEYLMHFQKKGLDGT  1122
              PR+S+A FF T  +P D     +YGPIKEL+SDEN  LY+ETT ++Y++++  KGL   
Sbjct  301   GPRISIACFFTTQLLPFDT----LYGPIKELLSDENHALYKETTIKDYVLYYNSKGLGAL  356

Query  1123  SGLLRFRL  1146
               LL  +L
Sbjct  357   PSLLHLKL  364



>ref|XP_007140620.1| hypothetical protein PHAVU_008G127500g [Phaseolus vulgaris]
 gb|ESW12614.1| hypothetical protein PHAVU_008G127500g [Phaseolus vulgaris]
Length=365

 Score =   389 bits (999),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 201/364 (55%), Positives = 259/364 (71%), Gaps = 17/364 (5%)
 Frame = +1

Query  61    YDRKSELKAFDDMKTGVKGHVDSGIMKIPRIFIHDeikkeekeklkPAMASTYKVPIIDM  240
             YDRK E+K FDD K GV+G V+SG+ KIPR+F      +        A  S+ KVPIID+
Sbjct  17    YDRKDEVKRFDDSKAGVQGLVESGVTKIPRMF----HSENLDIIETSATDSSLKVPIIDL  72

Query  241   EGLHTDHTTRRSEIIKEIRDACQTWGFFQIINHGIPTQVLDEMIDGVRQFHELDSEVKKQ  420
             + +++   T  +E+I++IR AC  WGFFQ+INHGI   VLDEMIDG+R+FHE D+E++K+
Sbjct  73    KDINS---TLHTEVIEKIRSACHEWGFFQVINHGISISVLDEMIDGIRRFHEQDTEIRKE  129

Query  421   FYSRDLTRKVVYNTNFDFHTSPAATWRDTLYFIMAPHPPTPQELPQVCRDILIKYSNSVQ  600
             FYSRD+ +KV+Y +N    +  +A WRDT  F  AP    P+ELP VCRDILI+YS  ++
Sbjct  130   FYSRDVKKKVLYYSNLSLFSGQSANWRDTFGFAAAPDQAKPEELPSVCRDILIEYSKKIR  189

Query  601   KLGLCLLELFSESLGLHKNHLEKLGCAVGLSIFGQYYPACPEPELTFALRDHSDSGFFTV  780
              LG  + EL SE+LGL  ++L++  CA GL I G YYPACPEPELT     H+DS F T+
Sbjct  190   DLGFTIFELLSEALGLDASYLKEFNCAEGLFILGHYYPACPEPELTMGTTKHTDSNFMTL  249

Query  781   LNQDTQIGGLQVLHENQWVDVPPLHGALVVNVADLLQLITNDKFKSVVHRVIAQKIAPRV  960
             L Q  Q+GGLQVLH+NQW++VPP+HGALVVN+ DLLQLITND+F SV HRV+     PRV
Sbjct  250   LLQ-DQLGGLQVLHQNQWINVPPVHGALVVNMGDLLQLITNDRFVSVYHRVLPNT-GPRV  307

Query  961   SVASFFRTIPGDVDAK--KVYGPIKELVSDENPPLYRETTTEEYLMHFQKKGLDGTSGLL  1134
             SVASFF      V+++  KVY PIKEL+S+ENPP+YR+TT +E L H+  KGLDG S L 
Sbjct  308   SVASFF------VNSRDTKVYCPIKELLSEENPPIYRDTTIKELLAHYFAKGLDGNSSLD  361

Query  1135  RFRL  1146
              FRL
Sbjct  362   PFRL  365



>ref|XP_008438546.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1-like [Cucumis melo]
Length=374

 Score =   389 bits (999),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 190/383 (50%), Positives = 268/383 (70%), Gaps = 19/383 (5%)
 Frame = +1

Query  19    MATASTG------GKADSGDYDRKSELKAFDDMKTGVKGHVDSGIMKIPRIFIHDeikke  180
             MA A++G       KAD  ++ R +ELKAFDD K GVKG VD+ I +IPRIF H   + +
Sbjct  1     MAVAASGINLTPLSKADD-NFHRPTELKAFDDTKAGVKGLVDANITEIPRIFYHPPEEVD  59

Query  181   ekeklkPAMASTYKVPIIDMEGLHTDHTTRRSEIIKEIRDACQTWGFFQIINHGIPTQVL  360
                    +  +   +P+ID+EG+  D + +R  II +IRDA +  GFFQ+INHGIPT VL
Sbjct  60    -------SAETHIHIPLIDLEGV-GDDSLKRKHIIDQIRDASEELGFFQLINHGIPTSVL  111

Query  361   DEMIDGVRQFHELDSEVKKQFYSRDLTRKVVYNTNFDFHTSPAATWRDTLYFIMAPHPPT  540
             +E+ D VR+FHE D+EVKKQ+Y+RD  +  +YN+NFD +++P   WRDT  ++ AP+PP 
Sbjct  112   EEIRDSVRRFHEQDTEVKKQYYTRDFMKPFIYNSNFDLYSAPTTNWRDTFSYVSAPNPPN  171

Query  541   PQELPQVCRDILIKYSNSVQKLGLCLLELFSESLGLHKNHLEKLGCAVGLSIFGQYYPAC  720
             PQELP++CRDI++ +S  V ++G  +LEL SE+LGL+ N+L+ +GC+ GL+    YYP C
Sbjct  172   PQELPEICRDIMVDFSKWVMEIGKLVLELLSEALGLNPNYLDNIGCSDGLAFVYHYYPPC  231

Query  721   PEPELTFALRDHSDSGFFTVLNQDTQIGGLQVLHENQWVDVPPLHGALVVNVADLLQLIT  900
             P+P+LT  + +HSD+ F TVL QD  +GGLQ+ H+N+W+DV P+ GALVVN+ DL+QLIT
Sbjct  232   PQPKLTIGISEHSDTDFITVLLQDL-VGGLQIRHQNKWIDVRPVAGALVVNIGDLMQLIT  290

Query  901   NDKFKSVVHRVIAQKIAPRVSVASFFRTIPGDVDAKKVYGPIKELVSDENPPLYRETTTE  1080
             ND+F+SV HRV++    PR+SVA  F T+    D  K YGPIKEL+S E P +YRETT +
Sbjct  291   NDRFESVNHRVLSSHEGPRISVAGVFSTMVSPSD--KFYGPIKELLSKEKPAIYRETTVK  348

Query  1081  EYLMHFQKKGLDGTSGLLRFRLQ  1149
             ++ + F+  GL GTS L  ++L 
Sbjct  349   DFSVQFKSDGL-GTSTLKHYKLN  370



>ref|XP_006598207.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1-like [Glycine max]
 gb|KHN27715.1| Deacetoxyvindoline 4-hydroxylase [Glycine soja]
Length=374

 Score =   389 bits (999),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 189/365 (52%), Positives = 255/365 (70%), Gaps = 10/365 (3%)
 Frame = +1

Query  61    YDRKSELKAFDDMKTGVKGHVDSGIMKIPRIFIHDeikkeekeklkPAMASTYKVPIIDM  240
             YDRKSE+K FD+ KTGV+G V++G+ K+PR+F  +     +    +    S + +P ID+
Sbjct  17    YDRKSEIKVFDESKTGVQGLVENGVTKVPRMFYCEHSNLSDGLTTESN--SNFTIPSIDL  74

Query  241   EGLHTDHTTRRSEIIKEIRDACQTWGFFQIINHGIPTQVLDEMIDGVRQFHELDSEVKKQ  420
              G++ D   R + ++ ++R AC+ WGFFQ+ NHGIPTQVLDEMI G  +FHE D++V+K+
Sbjct  75    TGINDDPILRDA-VVGKVRYACEKWGFFQVTNHGIPTQVLDEMIKGTGRFHEQDAKVRKE  133

Query  421   FYSRDLTRKVVYNTNFDFHTSPAATWRDTLYFIMAPHPPTPQELPQVCRDILIKYSNSVQ  600
             +Y+RD++RKV+Y +NF  +  P+A WRDTL F  AP+ P  +ELP VCRDI+ +YS  V 
Sbjct  134   YYTRDMSRKVIYLSNFSLYQDPSADWRDTLAFFWAPNSPNDEELPAVCRDIVPEYSTKVM  193

Query  601   KLGLCLLELFSESLGLHKNHLEKLGCAVGLSIFGQYYPACPEPELTFALRDHSDSGFFTV  780
              L   L EL SE+LGL + HL+++GC  GL     YYPACPEPELT     H+D  F T+
Sbjct  194   ALASTLFELLSEALGLDRFHLKEMGCDEGLLHLCHYYPACPEPELTMGTSRHTDGNFMTI  253

Query  781   LNQDTQIGGLQVLHENQWVDVPPLHGALVVNVADLLQLITNDKFKSVVHRVIAQKIAPRV  960
             L QD Q+GGLQ+LHENQW+DVP  HGALVVN+ DLLQL+TN+KF SV HRV+A    PR 
Sbjct  254   LLQD-QMGGLQILHENQWIDVPAAHGALVVNIGDLLQLVTNEKFISVQHRVLANHQGPRT  312

Query  961   SVASFFRTIPGDVDAK---KVYGPIKELVSDENPPLYRETTTEEYLMHFQKKGLDGTSGL  1131
             S+ASFFR   GD   +   +V+GPIKEL+S+ NPP+YRET+ ++YL H   K + G S L
Sbjct  313   SIASFFRI--GDQSPEGLSRVFGPIKELLSEHNPPVYRETSLKDYLAHQYAKSI-GASSL  369

Query  1132  LRFRL  1146
               F+L
Sbjct  370   SLFKL  374



>ref|XP_002529306.1| Desacetoxyvindoline 4-hydroxylase, putative [Ricinus communis]
 gb|EEF33075.1| Desacetoxyvindoline 4-hydroxylase, putative [Ricinus communis]
Length=377

 Score =   389 bits (998),  Expect = 5e-128, Method: Compositional matrix adjust.
 Identities = 194/387 (50%), Positives = 266/387 (69%), Gaps = 21/387 (5%)
 Frame = +1

Query  16    EMATASTGGKADSGDYDRKSELKAFDDMKTGVKGHVDSGIMKIPRIF--IHDeikkeeke  189
             E+++ +      + +YDR SELKAFD+ K GVKG +D+G+ K+PRIF   HD        
Sbjct  2     ELSSRNAASGTINHEYDRNSELKAFDETKLGVKGLIDAGVTKVPRIFHKPHDYPDDISSA  61

Query  190   klkPAMASTYKVPIIDMEGLHTDHTTRRSEIIKEIRDACQTWGFFQIINHGIPTQVLDEM  369
                 A  + +++PIID+E +  D TT   + ++EIR+A +TWGFFQIINHGI   +++EM
Sbjct  62    ----AEDAQFRIPIIDLEAVEMDSTTHE-KAVEEIRNAAETWGFFQIINHGIDLSIMEEM  116

Query  370   IDGVRQFHELDSEVKKQFYSRDLTRKVVYNTNFDFHTSPAATWRDTLYFIMAPHPPTPQE  549
             I+GVR+F E DSEVKK+FYSR+  +  +Y +NFD + S  A+WRDT    +AP+   P+E
Sbjct  117   INGVRRFFEQDSEVKKKFYSREAGKSFMYVSNFDLYFSKFASWRDTFSCNIAPNTVKPEE  176

Query  550   LPQVCRDILIKYSNSVQKLGLCLLELFSESLGLHKNHLEKLGCAVGLSIFGQYYPACPEP  729
             LP+VCRDI ++YS  V+++G+ L EL SE+LGL  N L ++ C  GL +   YYP CPEP
Sbjct  177   LPEVCRDITLEYSKKVRRVGIFLFELLSEALGLKPNRLREMECTEGLVVLCHYYPPCPEP  236

Query  730   ELTFALRDHSDSGFFTVLNQDTQIGGLQVLHENQWVDVPPLHGALVVNVADLL-------  888
             ELT     H+D GF TVL QD QIGGLQVLH+N+WVD+PP+ GALVVN+AD+L       
Sbjct  237   ELTTGTVGHTDPGFLTVLLQD-QIGGLQVLHQNKWVDIPPVPGALVVNLADMLQAIIPNF  295

Query  889   QLITNDKFKSVVHRVIAQKIAPRVSVASFFRTIPGDVDAKKVYGPIKELVSDENPPLYRE  1068
             QLI+NDKFKS +HRV++ +I PR+SVASFF T  G   + K++GPIKEL+S++NPP+YRE
Sbjct  296   QLISNDKFKSSMHRVLSNRIGPRISVASFFST--GFQKSSKLFGPIKELLSEDNPPIYRE  353

Query  1069  TTTEEYLMHFQKKGLDGTSGLLRFRLQ  1149
             T   ++    +    DG  GL  F+LQ
Sbjct  354   TAVYDFATSLK----DGKGGLQNFKLQ  376



>gb|AFK35571.1| unknown [Lotus japonicus]
Length=366

 Score =   388 bits (997),  Expect = 5e-128, Method: Compositional matrix adjust.
 Identities = 191/361 (53%), Positives = 254/361 (70%), Gaps = 15/361 (4%)
 Frame = +1

Query  73    SELKAFDDMKTGVKGHVDSGIMKIPRIFIHDeikkeekeklkPAMASTYKVPIIDMEGLH  252
             SE KAFD+ K GVKG VD+G+ KIP  F H   K E+      + +  + VP+ID+  + 
Sbjct  18    SERKAFDETKAGVKGLVDAGVKKIPTFFHHQHDKFEQA-----SNSGDHVVPVIDLANID  72

Query  253   TDHTTRRSEIIKEIRDACQTWGFFQIINHGIPTQVLDEMIDGVRQFHELDSEVKKQFYSR  432
              D + R+ E++ ++R+A +TWGFFQI+NHGIP  VL+E+ DGV++F+E D+EV K+FY+R
Sbjct  73    KDPSLRQ-EVVNQLREASETWGFFQIVNHGIPLSVLEEIKDGVQRFYEQDTEVTKEFYTR  131

Query  433   DLTRKVVYNTNFDFHTSPAATWRDTLYFIMAPHPPTPQELPQVCRDILIKYSNSVQKLGL  612
             +  +  +YN+NFD ++SPA  WRDT    +AP PP P++LPQVCRDIL++Y   +  LG 
Sbjct  132   ERYKSFIYNSNFDIYSSPALNWRDTFLCYLAPDPPKPEDLPQVCRDILLEYGKHIMNLGT  191

Query  613   CLLELFSESLGLHKNHLEKLGCAVGLSIFGQYYPACPEPELTFALRDHSDSGFFTVLNQD  792
              L ELFSE+LGL+ NHL+ +GC  GL     YYPACPEPELT     HSD+ F TVL QD
Sbjct  192   LLFELFSEALGLNPNHLKDMGCLEGLYALCHYYPACPEPELTLGTTKHSDNDFLTVLLQD  251

Query  793   TQIGGLQVLHENQWVDVPPLHGALVVNVADLLQLITNDKFKSVVHRVIAQKIAPRVSVAS  972
               IGGLQV ++++W+DV P+ GALVVNV D LQLITND+FKSV H+V+A    PR+SVA 
Sbjct  252   -HIGGLQVRYQDKWIDVTPVPGALVVNVGDFLQLITNDRFKSVEHQVLANHAGPRISVAC  310

Query  973   FFRT---IPGDVDAKKVYGPIKELVSDENPPLYRETTTEEYLMHFQKKGLDGTSGLLRFR  1143
             FF T   +P      K+YGPIKEL+S +NP  YRETT  EY+ ++ KKGLDGTS L  +R
Sbjct  311   FFSTAFRLP-----SKLYGPIKELLSKDNPAKYRETTIAEYVAYYVKKGLDGTSALSHYR  365

Query  1144  L  1146
             +
Sbjct  366   I  366



>ref|XP_010023989.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1-like [Eucalyptus grandis]
 gb|KCW60402.1| hypothetical protein EUGRSUZ_H03120 [Eucalyptus grandis]
Length=371

 Score =   388 bits (997),  Expect = 6e-128, Method: Compositional matrix adjust.
 Identities = 192/367 (52%), Positives = 256/367 (70%), Gaps = 16/367 (4%)
 Frame = +1

Query  61    YDRKSELKAFDDMKTGVKGHVDSGIMKIPRIFIHDeikkeekeklkPAMAST---YKVPI  231
             YDR  E+K FD+   GVKG VD+GI ++PRIF+      +       A+AS+   + VPI
Sbjct  16    YDRMREIKDFDESMAGVKGLVDAGITEVPRIFVDHPENLQS------ALASSNGHFHVPI  69

Query  232   IDMEGLHTDHTTRRSEIIKEIRDACQTWGFFQIINHGIPTQVLDEMIDGVRQFHELDSEV  411
             +D+  +  D  +RR E++ E+R A +TWGFFQ++NHGIPT VL+EM+DGVR+FHE  +E 
Sbjct  70    VDLADIVKD-PSRRKEVVNEVRSASKTWGFFQVVNHGIPTTVLEEMLDGVRRFHEQGAEE  128

Query  412   KKQFYSRDLTRKVVYNTNFDFHTSPAATWRDTLYFIMAPHPPTPQELPQVCRDILIKYSN  591
             K++FYSRD T  V Y++NF+ + + AA WRDTL+ +MAP+    ++LP VC DI++++S 
Sbjct  129   KRRFYSRDFTTSVAYHSNFNLYKTEAANWRDTLFCVMAPNALEAEDLPAVCGDIMLEFSK  188

Query  592   SVQKLGLCLLELFSESLGLHKNHLEKLGCAVGLSIFGQYYPACPEPELTFALRDHSDSGF  771
              V  LG  L EL SE+LGL  NHL+ + CA GL +  QYYP CP+PELT     H+DS F
Sbjct  189   RVMNLGTTLFELLSEALGLKPNHLKDMECAKGLVLLNQYYPKCPQPELTMGTSRHTDSDF  248

Query  772   FTVLNQDTQIGGLQVLHENQWVDVPPLHGALVVNVADLLQLITNDKFKSVVHRVIAQKIA  951
              TVL QD  +GGLQVL++NQW+DV P+ GAL+VN+ DLLQLI+ND FKS  HRV+A  + 
Sbjct  249   LTVLLQD-HVGGLQVLYQNQWIDVSPVPGALIVNIGDLLQLISNDIFKSSEHRVVANNMG  307

Query  952   PRVSVASFFRTIPGDVDAKKVYGPIKELVSDENPPLYRETTTEEYLMHF--QKKGLDGTS  1125
             PRVSVA FF T      + K+YGPIKEL+S+ +PP YRETT  EY+ HF    KG DGTS
Sbjct  308   PRVSVACFFYT--ATPPSPKLYGPIKELISEGDPPKYRETTIMEYVSHFSANAKG-DGTS  364

Query  1126  GLLRFRL  1146
              L +F+L
Sbjct  365   ALQQFKL  371



>ref|XP_009347731.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1-like [Pyrus x bretschneideri]
Length=366

 Score =   388 bits (997),  Expect = 6e-128, Method: Compositional matrix adjust.
 Identities = 195/373 (52%), Positives = 265/373 (71%), Gaps = 10/373 (3%)
 Frame = +1

Query  34    TGGKADSGDYDRKSELKAFDDMKTGVKGHVDSGIMKIPRIFIHDeikkeekeklkPAMAS  213
              G KA+S + DR SELKAFD+ K GVKG +DSGI K+P IF   ++  ++++     +  
Sbjct  2     AGVKANS-NTDRISELKAFDETKGGVKGLLDSGITKLPSIFHSKQLSVDDRKVASDDVQL  60

Query  214   TYKVPIIDMEGLHTDHTTRRSEIIKEIRDACQTWGFFQIINHGIPTQVLDEMIDGVRQFH  393
             +  +PIID++ +H D +  R+E+I+++R A + WGFF +INHGI   VLD MIDG+R+FH
Sbjct  61    S--IPIIDLKNIHID-SVLRAEVIEKVRYASEKWGFFAVINHGISDDVLDRMIDGMRRFH  117

Query  394   ELDSEVKKQFYSRDLTRKVVYNTNFDFHTSPAATWRDTLYFIMAPHPPTPQELPQVCRDI  573
             E D+E+KK+ YSR+  +KV+Y++N+D + +  A WRDT    MAP PPTP+E+P VCR+I
Sbjct  118   EQDAELKKKLYSRESGKKVLYSSNYDLYHAQEANWRDTFSCYMAPDPPTPEEMPSVCREI  177

Query  574   LIKYSNSVQKLGLCLLELFSESLGLHKNHLEKLGCAVGLSIFGQYYPACPEPELTFALRD  753
             +I+YS  V KL   L ELFSE+LGL+ N L+ +GCA G  + G YYPACPEP++T     
Sbjct  178   VIEYSEKVMKLAHTLFELFSEALGLNPNKLKDMGCAEGQFLLGHYYPACPEPKITLGTSK  237

Query  754   HSDSGFFTVLNQDTQIGGLQVLHENQWVDVPPLHGALVVNVADLLQLITNDKFKSVVHRV  933
             H+D  F +VL QD QIGGLQVL++NQWV+VPP  GALV+N+ DLLQLITN +F SV HRV
Sbjct  238   HTDGTFISVLLQD-QIGGLQVLYDNQWVNVPPKKGALVINIGDLLQLITNGRFISVYHRV  296

Query  934   IAQKIAPRVSVASFFRTIPGDVDAKK--VYGPIKELVSDENPPLYRETTTEEYLMHFQKK  1107
             IAQK+ PR+SV  FFR     V   K   YGPIKEL+SD NP +Y+E   ++YL H+  K
Sbjct  297   IAQKVGPRISVPIFFRPY---VQGGKSYAYGPIKELLSDGNPQIYKEVDFKDYLNHYLTK  353

Query  1108  GLDGTSGLLRFRL  1146
             G+D  S L++F+L
Sbjct  354   GIDFVSPLVKFKL  366



>ref|XP_006588550.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1-like isoform X1 [Glycine max]
 ref|XP_006588551.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1-like isoform X2 [Glycine max]
 gb|KHN00305.1| 1-aminocyclopropane-1-carboxylate oxidase like 1 [Glycine soja]
Length=357

 Score =   388 bits (996),  Expect = 6e-128, Method: Compositional matrix adjust.
 Identities = 193/364 (53%), Positives = 248/364 (68%), Gaps = 8/364 (2%)
 Frame = +1

Query  55    GDYDRKSELKAFDDMKTGVKGHVDSGIMKIPRIFIHDeikkeekeklkPAMASTYKVPII  234
              D DR+ ELKAFDD K GVKG VD+GI KIPRIF H     ++   L       Y +P+I
Sbjct  2     ADSDREKELKAFDDTKLGVKGLVDAGITKIPRIFHHPPDNFKKASDLG---YKDYTIPVI  58

Query  235   DMEGLHTDHTTRRSEIIKEIRDACQTWGFFQIINHGIPTQVLDEMIDGVRQFHELDSEVK  414
             D+  +  D    R  +++ I++A +TWGFFQI+NHGIP   L+EM+DGV +F E DSEVK
Sbjct  59    DLASIRED-LRERERVVERIKEASETWGFFQIVNHGIPVSTLEEMVDGVLRFFEQDSEVK  117

Query  415   KQFYSRDLTRKVVYNTNFDFHTSPAATWRDTLYFIMAPHPPTPQELPQVCRDILIKYSNS  594
             K+FY+R+L R   Y +N++ +T+   TW+D+ Y  +AP+ P P++LP VCRDIL++YSN 
Sbjct  118   KEFYTREL-RPFFYTSNYNLYTTAPTTWKDSFYCNLAPNAPKPEDLPAVCRDILVEYSNE  176

Query  595   VQKLGLCLLELFSESLGLHKNHLEKLGCAVGLSIFGQYYPACPEPELTFALRDHSDSGFF  774
             V KLG  L EL SE+LGL   +L  +GC  GL  F  YYPACPEPELT     HSD  F 
Sbjct  177   VLKLGTLLFELLSEALGLDPTYLTNIGCTEGLFAFSHYYPACPEPELTMGTAKHSDMDFI  236

Query  775   TVLNQDTQIGGLQVLHENQWVDVPPLHGALVVNVADLLQLITNDKFKSVVHRVIAQKIAP  954
             TVL Q   IGGLQV H++ W+D+PPL GALVVN+ D LQLI+NDKFKS  HRV+A  I P
Sbjct  237   TVLLQG-HIGGLQVFHKDMWIDLPPLTGALVVNIGDFLQLISNDKFKSAQHRVLANPIGP  295

Query  955   RVSVASFFRTIPGDVDAKKVYGPIKELVSDENPPLYRETTTEEYLMHFQKKGLDGTSGLL  1134
             RVS+A FF T  G     ++YGPIKEL+S++NP  YRE T  ++L H + K L+GTS LL
Sbjct  296   RVSIACFFST--GLNPTSRIYGPIKELLSEDNPAKYREFTVPKFLAHHRTKCLNGTSPLL  353

Query  1135  RFRL  1146
              FR+
Sbjct  354   HFRI  357



>ref|XP_004488811.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1-like [Cicer arietinum]
Length=373

 Score =   388 bits (997),  Expect = 6e-128, Method: Compositional matrix adjust.
 Identities = 194/369 (53%), Positives = 259/369 (70%), Gaps = 10/369 (3%)
 Frame = +1

Query  43    KADSGDYDRKSELKAFDDMKTGVKGHVDSGIMKIPRIFIHDeikkeekeklkPAMASTYK  222
             K +SG   R  ELKAFDD K GVKG VD G++KIP +F H   K E+         +   
Sbjct  14    KFNSG---RLHELKAFDDTKAGVKGLVDEGVIKIPTLFHHPPDKFEKATNSSNTQHNL--  68

Query  223   VPIIDMEGLHTDHTTRRSEIIKEIRDACQTWGFFQIINHGIPTQVLDEMIDGVRQFHELD  402
             +P+ID   +  D  TR+ EII ++++A +TWGFFQ++NHGIP  VL++M DGV +F+E D
Sbjct  69    IPVIDFANIGKDSITRQ-EIISKVKEASETWGFFQLVNHGIPLSVLEDMKDGVLRFYEQD  127

Query  403   SEVKKQFYSRDLTRKVVYNTNFDFHT-SPAATWRDTLYFIMAPHPPTPQELPQVCRDILI  579
              EVKK+ YSRD TR ++YN+NFD ++ SPA  WRDT    +AP+ P P++ P VCRDIL+
Sbjct  128   FEVKKELYSRDQTRSLIYNSNFDLYSNSPALNWRDTFACHLAPNTPKPEDFPVVCRDILL  187

Query  580   KYSNSVQKLGLCLLELFSESLGLHKNHLEKLGCAVGLSIFGQYYPACPEPELTFALRDHS  759
             +Y   + KLG+ + EL SE+LGL K+H++ LGC+ G+ +   YYPACPEPELT     HS
Sbjct  188   EYGEHIMKLGMTVFELLSEALGLDKDHVKNLGCSEGIMLLCHYYPACPEPELTMGTTKHS  247

Query  760   DSGFFTVLNQDTQIGGLQVLHENQWVDVPPLHGALVVNVADLLQLITNDKFKSVVHRVIA  939
             D+ F T+L QD  IGGLQVLH+++W D+PP+  ALVVN+ DLLQL+TNDKFKSV HRV+A
Sbjct  248   DNSFLTLLLQD-HIGGLQVLHKDKWFDIPPIPEALVVNIGDLLQLVTNDKFKSVEHRVLA  306

Query  940   QKIAPRVSVASFFRTIPGDVDAKKVYGPIKELVSDENPPLYRETTTEEYLMHFQKKGLDG  1119
               I PR+SVA FF  +      +K+YGPIKEL+S +NPP YRET   +Y+ +++ KGLDG
Sbjct  307   NSIGPRISVACFF--MADHRSKEKLYGPIKELLSQDNPPRYRETNFADYVDYYKAKGLDG  364

Query  1120  TSGLLRFRL  1146
             TS L  F+L
Sbjct  365   TSSLQHFKL  373



>ref|XP_002529301.1| Desacetoxyvindoline 4-hydroxylase, putative [Ricinus communis]
 gb|EEF33070.1| Desacetoxyvindoline 4-hydroxylase, putative [Ricinus communis]
Length=359

 Score =   387 bits (995),  Expect = 7e-128, Method: Compositional matrix adjust.
 Identities = 198/363 (55%), Positives = 262/363 (72%), Gaps = 7/363 (2%)
 Frame = +1

Query  58    DYDRKSELKAFDDMKTGVKGHVDSGIMKIPRIFIHDeikkeekeklkPAMASTYKVPIID  237
             D+   SE KAFDD K GVKG VD+GI KIP  F       ++       + S ++ P+I+
Sbjct  4     DWSPTSERKAFDDTKAGVKGLVDAGINKIPHFFHQPVDVSDKSSL---GVDSRFRFPVIN  60

Query  238   MEGLHTDHTTRRSEIIKEIRDACQTWGFFQIINHGIPTQVLDEMIDGVRQFHELDSEVKK  417
             +E +H D + RR E++ +++ A +TWGFF+++NHG+P  VL+EM DG+R+F+E D E+KK
Sbjct  61    LEAIHKD-SIRRKEVVDKVQIASETWGFFEVVNHGVPVNVLEEMKDGIRRFYEQDIELKK  119

Query  418   QFYSRDLTRKVVYNTNFDFHTSPAATWRDTLYFIMAPHPPTPQELPQVCRDILIKYSNSV  597
             +FYSRD T+K+VYN+NFD  T+ AA WRDT++F+MAP PP  +ELP VCR+IL +Y   V
Sbjct  120   EFYSRDYTKKIVYNSNFDLFTAQAANWRDTIFFLMAPDPPKSEELPAVCRNILKEYCKEV  179

Query  598   QKLGLCLLELFSESLGLHKNHLEKLGCAVGLSIFGQYYPACPEPELTFALRDHSDSGFFT  777
               LG  LLEL SE+LGL  +HL+++ CA GL++   YYPACP+PELT A   H+D+ F T
Sbjct  180   TSLGNLLLELLSEALGLSPSHLKEMDCAEGLAVLCHYYPACPQPELTLATSKHTDNDFLT  239

Query  778   VLNQDTQIGGLQVLHENQWVDVPPLHGALVVNVADLLQLITNDKFKSVVHRVIAQKIAPR  957
             VL QD  IGGLQV H+NQW+DVPP  GALVVN+ DLLQLI+NDKF SV HRV+A  I PR
Sbjct  240   VLLQD-HIGGLQVQHQNQWIDVPPTPGALVVNIGDLLQLISNDKFISVEHRVLANHIGPR  298

Query  958   VSVASFFRTIPGDVDAKKVYGPIKELVSDENPPLYRETTTEEYLMHFQKKGLDGTSGLLR  1137
             +S A FF T    +   ++YGPI+EL+S+ENPP YRETT  EY+++   KGLDGTS LL 
Sbjct  299   ISAACFFST--SVMPKSRLYGPIQELLSEENPPKYRETTVTEYVLYSNGKGLDGTSPLLH  356

Query  1138  FRL  1146
             F+L
Sbjct  357   FKL  359



>ref|XP_006283978.1| hypothetical protein CARUB_v10005101mg [Capsella rubella]
 gb|EOA16876.1| hypothetical protein CARUB_v10005101mg [Capsella rubella]
Length=365

 Score =   388 bits (996),  Expect = 7e-128, Method: Compositional matrix adjust.
 Identities = 195/366 (53%), Positives = 246/366 (67%), Gaps = 6/366 (2%)
 Frame = +1

Query  55    GDYDRKSELKAFDDMKTGVKGHVDSGIMKIPRIFIHDeikkeekeklkPAMASTYKVPII  234
               +DR SELKAFD+  TGVKG VDSGI KIPRIF H         K  P+      +P I
Sbjct  4     ASFDRASELKAFDETNTGVKGLVDSGISKIPRIF-HHSSLNLANPKPLPSDLLLKTIPTI  62

Query  235   DMEGLHTDHTTRRSEIIKEIRDACQTWGFFQIINHGIPTQVLDEMIDGVRQFHELDSEVK  414
             D+ G   + +  R   I+ I++A   WGFFQ+INHG+   +L++M DGVR+FHE   EVK
Sbjct  63    DIGGRIFETSMERKNAIERIKEAAGKWGFFQVINHGVSLDLLEKMKDGVREFHEQSPEVK  122

Query  415   KQFYSRDLTR-KVVYNTNFDFHTSPAATWRDTLYFIMAPHPPTPQELPQVCRDILIKYSN  591
             K+ YSRD+TR K  Y++NFD +TSPAA WRDT+   MAP PP PQ+LP++ RD++I+YS 
Sbjct  123   KELYSRDITRQKFHYSSNFDLYTSPAANWRDTVTCFMAPDPPNPQDLPEMLRDVMIEYSK  182

Query  592   SVQKLGLCLLELFSESLGLHKNHLEKLGCAVGLSIFGQYYPACPEPELTFALRDHSDSGF  771
              V  LG  L  L SE+LGL+ NHL  + CA GL + G YYP CPEP+LT     H+D+ F
Sbjct  183   QVMSLGKFLFTLLSEALGLNPNHLNDMDCAKGLIMLGHYYPTCPEPDLTLGTSQHADTSF  242

Query  772   FTVLNQDTQIGGLQVLHENQWVDVPPLHGALVVNVADLLQLITNDKFKSVVHRVIAQKIA  951
              TVL QD QIGGLQVL E  W DVP + GAL++N+ DLLQLI+ND F S  HRV+A + +
Sbjct  243   LTVLLQD-QIGGLQVLQEGYWFDVPHVPGALIINIGDLLQLISNDNFVSSEHRVLANRAS  301

Query  952   -PRVSVASFFRTIPGDVDAKKVYGPIKELVSDENPPLYRETTTEEYLMHFQKKGLDGTSG  1128
               R+SVA FF T         +YGPI+E+VS+ENPP YRETT +EY  HF  KGLDGTS 
Sbjct  302   KARISVACFFFT--AMTPNPTLYGPIREIVSEENPPKYRETTIKEYTAHFNAKGLDGTSA  359

Query  1129  LLRFRL  1146
             LL F++
Sbjct  360   LLHFKI  365



>ref|XP_003626788.1| 1-aminocyclopropane-1-carboxylate oxidase-like protein [Medicago 
truncatula]
 gb|AET01264.1| 1-aminocyclopropane-1-carboxylate oxidase-like protein [Medicago 
truncatula]
Length=364

 Score =   388 bits (996),  Expect = 7e-128, Method: Compositional matrix adjust.
 Identities = 184/358 (51%), Positives = 250/358 (70%), Gaps = 9/358 (3%)
 Frame = +1

Query  73    SELKAFDDMKTGVKGHVDSGIMKIPRIFIHDeikkeekeklkPAMASTYKVPIIDMEGLH  252
             +E KAFD+ K GVKG VD G+ KIP +F H   K E       A  +++ +P+ID++ + 
Sbjct  16    NERKAFDETKAGVKGLVDGGVEKIPSLFHHQPDKYEI------AYNTSHVIPVIDLKDID  69

Query  253   TDHTTRRSEIIKEIRDACQTWGFFQIINHGIPTQVLDEMIDGVRQFHELDSEVKKQFYSR  432
                 +    I+ +I++AC+TWGFFQ++NHGIP  VL+EM DGV++FHE++++ KK+FY+R
Sbjct  70    NKDPSIHQGIVSKIKEACETWGFFQVVNHGIPLSVLEEMKDGVKRFHEMETDAKKEFYTR  129

Query  433   DLTRKVVYNTNFDFHTSPAATWRDTLYFIMAPHPPTPQELPQVCRDILIKYSNSVQKLGL  612
             DL    +Y +NFD ++SPA  WRDT    +AP  P P++ P VCRDIL++Y   V  LG 
Sbjct  130   DLHGSFIYKSNFDLYSSPALNWRDTCTCSLAPDTPKPEDFPVVCRDILLEYGKQVMNLGT  189

Query  613   CLLELFSESLGLHKNHLEKLGCAVGLSIFGQYYPACPEPELTFALRDHSDSGFFTVLNQD  792
              L EL S++LGL+ NHL+ +GCA GL     YYP CPEPELT     H D+ F TVL QD
Sbjct  190   LLFELLSQALGLNPNHLKDMGCAEGLIALCHYYPPCPEPELTVGTTKHCDNDFLTVLLQD  249

Query  793   TQIGGLQVLHENQWVDVPPLHGALVVNVADLLQLITNDKFKSVVHRVIAQKIAPRVSVAS  972
               IGGLQVL+E++W+D+ P+ GALVVNV DLLQLITND+FKSV HRV+A ++ PR+SVA 
Sbjct  250   -HIGGLQVLYEDKWIDITPVPGALVVNVGDLLQLITNDRFKSVEHRVVANQVGPRISVAC  308

Query  973   FFRTIPGDVDAKKVYGPIKELVSDENPPLYRETTTEEYLMHFQKKGLDGTSGLLRFRL  1146
             FF T  G   + K+YGP+KEL+S+ NPP YRETT  ++  +F  KGLDGTS L  +++
Sbjct  309   FFST--GLRPSSKLYGPMKELLSENNPPKYRETTVADFAAYFNAKGLDGTSALTHYKI  364



>ref|XP_002276339.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1 [Vitis vinifera]
Length=355

 Score =   387 bits (995),  Expect = 7e-128, Method: Compositional matrix adjust.
 Identities = 184/350 (53%), Positives = 255/350 (73%), Gaps = 7/350 (2%)
 Frame = +1

Query  58    DYDRKSELKAFDDMKTGVKGHVDSGIMKIPRIFIHDeikkeekeklkPAMASTYKVPIID  237
             +YDRKSEL+AFD  K+GVKG VD G+ KIP +FIH     + K     +  S ++VP+ID
Sbjct  11    EYDRKSELEAFDASKSGVKGLVDGGLTKIPLMFIHPHYNPDAKSG---SAVSQFRVPLID  67

Query  238   MEGLHTDHTTRRSEIIKEIRDACQTWGFFQIINHGIPTQVLDEMIDGVRQFHELDSEVKK  417
             ++G++ D+ T R++II ++R+AC+ WGF Q++NHGIP  VL+EM+DG+R FHE D+++KK
Sbjct  68    LDGVN-DNATLRAKIIDQVREACENWGFLQVVNHGIPASVLEEMLDGIRGFHEQDTQMKK  126

Query  418   QFYSRDLTRKVVYNTNFDFHTSPAATWRDTLYFIMAPHPPTPQELPQVCRDILIKYSNSV  597
             +FY+RD   KV + +NFD   + AATW+D+L + +AP+PP P+ELP VCRDI+++YS  V
Sbjct  127   EFYTRDFKEKVSFVSNFDLFQATAATWKDSLSWAVAPNPPHPKELPAVCRDIVMEYSKQV  186

Query  598   QKLGLCLLELFSESLGLHKNHLEKLGCAVGLSIFGQYYPACPEPELTFALRDHSDSGFFT  777
             ++LG  L E+ SE+LGL  NHL+ + CA  +   G YYP CPEPELT   R H+DSGF T
Sbjct  187   KRLGYTLFEVLSEALGLDVNHLKDMECAEMMFHAGHYYPPCPEPELTLGARRHTDSGFLT  246

Query  778   VLNQDTQIGGLQVLHENQWVDVPPLHGALVVNVADLLQLITNDKFKSVVHRVIAQKIAPR  957
             VL QD Q+GGLQVLH+NQW+D+ P+ GALV+NV D LQ+ITND+FKS+ HRV+    + R
Sbjct  247   VLLQD-QVGGLQVLHQNQWIDLVPMPGALVINVGDSLQVITNDRFKSIEHRVLVNSESSR  305

Query  958   VSVASFFRTIPGDVDAKKVYGPIKELVSDENPPLYRETTTEEYLMHFQKK  1107
             VSVAS F T      + K+Y PIKEL+S ENPP Y+E T + ++ + + K
Sbjct  306   VSVASAFGTTL--FPSSKLYSPIKELLSQENPPKYKEATLQTHVAYLRGK  353



>dbj|BAB68392.1| CmE8 [Cucumis melo]
Length=367

 Score =   387 bits (994),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 189/362 (52%), Positives = 250/362 (69%), Gaps = 8/362 (2%)
 Frame = +1

Query  61    YDRKSELKAFDDMKTGVKGHVDSGIMKIPRIFIHDeikkeekeklkPAMASTYKVPIIDM  240
             +DR SELKAFD  K GVKG VDSG+ +IP IF     +       +  +     VP++D+
Sbjct  14    FDRASELKAFDQTKAGVKGLVDSGVAEIPGIFYCPPKEASNSIPEETHLG----VPVVDL  69

Query  241   EGLHTDHTTRRSEIIKEIRDACQTWGFFQIINHGIPTQVLDEMIDGVRQFHELDSEVKKQ  420
               +  D   RR ++++EIR+A +T GFFQ+INHG+P  V +E+I+ VR+F E DSEVKKQ
Sbjct  70    GDIDKDPFKRR-QVVEEIREASETGGFFQVINHGVPVSVQEEIINRVRRFFEQDSEVKKQ  128

Query  421   FYSRDLTRKVVYNTNFDFHTSPAATWRDTLYFIMAPHPPTPQELPQVCRDILIKYSNSVQ  600
             +Y+RD T+  +YN NFD  +SP A WRDT+  +MAP+PP P +LPQVCRDIL +YS  + 
Sbjct  129   YYTRDYTKSFIYNCNFDLFSSPVANWRDTIVTVMAPNPPNPHDLPQVCRDILFEYSKHIM  188

Query  601   KLGLCLLELFSESLGLHKNHLEKLGCAVGLSIFGQYYPACPEPELTFALRDHSDSGFFTV  780
             KLG  +  L SE+LGL   HL  L C  GL I G YYP+ P+PEL+    +HSD  F TV
Sbjct  189   KLGELIFGLLSEALGLKSTHLVDLDCNEGLRIIGHYYPSSPQPELSIGTTEHSDDTFITV  248

Query  781   LNQDTQIGGLQVLHENQWVDVPPLHGALVVNVADLLQLITNDKFKSVVHRVIAQKIAPRV  960
             L QD  +GGLQV  +N+WVDVPP+ GA V+NV +LLQLITND+F S  H+V+A +  PR+
Sbjct  249   LLQD-NMGGLQVRQQNKWVDVPPVPGAFVINVGNLLQLITNDRFVSSEHKVLANREGPRI  307

Query  961   SVASFFRTIPGDVDAKKVYGPIKELVSDENPPLYRETTTEEYLMHFQKKGLDGTSGLLRF  1140
             SVASFF T  G +   K+YGPIKEL+S++NPP Y+E T  EY ++F +KGLDGTS L  F
Sbjct  308   SVASFFST--GRLPTSKLYGPIKELLSEQNPPKYKEITVREYNIYFAEKGLDGTSALPHF  365

Query  1141  RL  1146
             ++
Sbjct  366   KI  367



>ref|XP_006354514.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
[Solanum tuberosum]
Length=373

 Score =   387 bits (995),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 199/364 (55%), Positives = 262/364 (72%), Gaps = 9/364 (2%)
 Frame = +1

Query  61    YDRKSELKAFDDMKTGVKGHVDSGIMKIPRIFIHDeikkeekeklkPAMASTYKVPIIDM  240
             YD+ SELKAFDD K GVKG VD+GI K+P+IFI   +  + + +        +  P+ID+
Sbjct  17    YDKMSELKAFDDTKAGVKGLVDAGITKVPQIFI---LPPKNRPESLDTSEKQFIFPVIDL  73

Query  241   EGLHTDHTTRRSEIIKEIRDACQTWGFFQIINHGIPTQVLDEMIDGVRQFHELDSEVKKQ  420
             EG+  D   +  EI+ ++RDA +TWGFFQ++NHGIPT VL+ M+ G R+F E D EVKKQ
Sbjct  74    EGIDED-PIKHKEIVDKVRDASETWGFFQVVNHGIPTSVLEAMLQGTREFFEQDIEVKKQ  132

Query  421   FYSRDLTRKVVYNTNFDFHTS--PAATWRDTLYFIMAPHPPTPQELPQVCRDILIKYSNS  594
             +Y+RD+T+KVV+ +NFD ++   PAA WRD+L+F MAP+PP+P+E P+ CR IL+ YS  
Sbjct  133   YYTRDITKKVVHTSNFDLYSPSVPAANWRDSLFFSMAPNPPSPEEFPRPCRGILMDYSKH  192

Query  595   VQKLGLCLLELFSESLGLHKNHLEKLGCAVGLSIFGQYYPACPEPELTFALRDHSDSGFF  774
             V +LG  LL L SE LGL + HLE + CA GL + G YYP CP+PELT     HSD+ F 
Sbjct  193   VMELGCSLLGLLSEGLGLDRCHLEDMDCAEGLGVVGHYYPPCPQPELTIGTNKHSDNDFI  252

Query  775   TVLNQDTQIGGLQVLHENQWVDVPPLHGALVVNVADLLQLITNDKFKSVVHRVIAQKIAP  954
             TVL QD  IGGLQVLH+NQWVDVPP  GA+VVN+ DLLQLI+NDK+ SV HRV++ K+ P
Sbjct  253   TVLLQD-DIGGLQVLHQNQWVDVPPTPGAIVVNIGDLLQLISNDKYLSVEHRVLSNKVGP  311

Query  955   RVSVASFFRTIPGDVDAKKVYGPIKELVSDENPPLYRETTTEEYLMHFQKKGLDGTSGLL  1134
             R+SVA FF T  G + + K+YGPI EL+S++NPP Y  TT   +  +F+KKGLDGTS LL
Sbjct  312   RISVACFFST--GPLPSSKLYGPIAELLSEDNPPKYCATTVNAFSDYFRKKGLDGTSALL  369

Query  1135  RFRL  1146
               ++
Sbjct  370   HLKI  373



>emb|CBI23601.3| unnamed protein product [Vitis vinifera]
Length=387

 Score =   388 bits (996),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 173/292 (59%), Positives = 233/292 (80%), Gaps = 2/292 (1%)
 Frame = +1

Query  271   RSEIIKEIRDACQTWGFFQIINHGIPTQVLDEMIDGVRQFHELDSEVKKQFYSRDLTRKV  450
             R++IIK++ +AC+ WGFFQ++NHGIP  VL++MIDG+R+FHE D+E KK++YSRD  +KV
Sbjct  57    RTQIIKKVGEACEKWGFFQVVNHGIPESVLNDMIDGIRRFHEQDAETKKEYYSRDFQKKV  116

Query  451   VYNTNFDFHTSPAATWRDTLYFIMAPHPPTPQELPQVCRDILIKYSNSVQKLGLCLLELF  630
              +N+NFD + +  A WRD+L  +MAP+PP P++LP VCRDI+++YS  V KLGL L EL 
Sbjct  117   RFNSNFDLYQARMANWRDSLACVMAPNPPLPEQLPAVCRDIVMEYSEQVMKLGLTLFELL  176

Query  631   SESLGLHKNHLEKLGCAVGLSIFGQYYPACPEPELTFALRDHSDSGFFTVLNQDTQIGGL  810
             SE+LGL+ NHL+ + CA GL + G YYPACPEPELT     H+DS FFT+L QD Q+GGL
Sbjct  177   SEALGLNPNHLKDMECAEGLFLLGHYYPACPEPELTLGTSSHTDSDFFTILLQD-QMGGL  235

Query  811   QVLHENQWVDVPPLHGALVVNVADLLQLITNDKFKSVVHRVIAQKIAPRVSVASFFRTIP  990
             QVLHE+QWVDVPP+ GALV+N+ DLLQL++ND+FKS+ HRV+A+ + PR+SVASFFR   
Sbjct  236   QVLHEDQWVDVPPIPGALVINMGDLLQLVSNDRFKSIFHRVLAKNVGPRISVASFFRKSH  295

Query  991   GDVDAKKVYGPIKELVSDENPPLYRETTTEEYLMHFQKKGLDGTSGLLRFRL  1146
              + +  ++YGPIKEL+S+ENPP+YRETT +E+L ++  KGLDG S L  F+L
Sbjct  296   RE-NNSRLYGPIKELLSEENPPIYRETTVDEFLTYYFSKGLDGNSSLPHFKL  346



>gb|KFK42977.1| hypothetical protein AALP_AA1G063700 [Arabis alpina]
Length=363

 Score =   387 bits (994),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 200/361 (55%), Positives = 253/361 (70%), Gaps = 7/361 (2%)
 Frame = +1

Query  64    DRKSELKAFDDMKTGVKGHVDSGIMKIPRIFIHDeikkeekeklkPAMASTYKVPIIDME  243
             DR S+LKAFDD KTGVKG VD+GI  IP IF+            KP  +S + +P ID++
Sbjct  10    DRSSQLKAFDDTKTGVKGLVDAGISSIPDIFL---APPVTLTSPKPPSSSQFTIPTIDLK  66

Query  244   GLHTDHTTRRSEIIKEIRDACQTWGFFQIINHGIPTQVLDEMIDGVRQFHELDSEVKKQF  423
             G  TD TT RS+++++I DA + WGFFQ++NHGI   VL+ M DG+R+FHE D EVKK F
Sbjct  67    G-GTDSTTTRSDLVEKIGDAAEKWGFFQVVNHGISLDVLEMMRDGIREFHEQDPEVKKGF  125

Query  424   YSRDLTRKVVYNTNFDFHTSPAATWRDTLYFIMAPHPPTPQELPQVCRDILIKYSNSVQK  603
             YSRD   K+VY++NFD  +SPAA WRDTL    AP PP P++LP VC +++I+YS  V K
Sbjct  126   YSRDPKSKMVYSSNFDLFSSPAANWRDTLGCYTAPDPPKPEDLPAVCGEMMIEYSKEVMK  185

Query  604   LGLCLLELFSESLGLHKNHLEKLGCAVGLSIFGQYYPACPEPELTFALRDHSDSGFFTVL  783
             LG  L EL SESLGL  N+L+ + C   L + G YYP CP+P+LT  L  HSD+ F TVL
Sbjct  186   LGKLLFELLSESLGLSTNYLKDMDCTNSLLLLGHYYPPCPQPDLTLGLSKHSDNSFLTVL  245

Query  784   NQDTQIGGLQVLHENQWVDVPPLHGALVVNVADLLQLITNDKFKSVVHRVIAQKIAPRVS  963
              QD  IGGLQVLH+  WVDVPP+ GALV+NV DLLQLITN KF SV HRV+A +  PR+S
Sbjct  246   LQD-HIGGLQVLHDQYWVDVPPVPGALVINVGDLLQLITNGKFISVEHRVLANETGPRIS  304

Query  964   VASFFRTIPGDVDAKKVYGPIKELVSDENPPLYRETTTEEYLMHFQKKGLDGTSGLLRFR  1143
             VA FF +     D  +VYGP+KEL+S++NPP YR+TT  EY   ++ KG DGTSGLL  +
Sbjct  305   VACFFSSYLMAND--RVYGPVKELLSEQNPPKYRDTTITEYAKFYRSKGFDGTSGLLYLK  362

Query  1144  L  1146
             +
Sbjct  363   I  363



>gb|KFK31253.1| hypothetical protein AALP_AA6G088500 [Arabis alpina]
Length=363

 Score =   387 bits (993),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 194/365 (53%), Positives = 254/365 (70%), Gaps = 10/365 (3%)
 Frame = +1

Query  61    YDRKSELKAFDDMKTGVKGHVDSGIMKIPRIFIHDeikkeekeklkPAMAST-YKVPIID  237
             YDR SELKAFDDMK GVKG VD+GI +IPRIF H            P ++S    +P ID
Sbjct  6     YDRASELKAFDDMKVGVKGLVDTGITQIPRIFHH--PHLNITLNPNPLLSSKKMMIPTID  63

Query  238   MEGLHTDHTTRRSEIIKEIRDACQTWGFFQIINHGIPTQVLDEMIDGVRQFHELDSEVKK  417
             ++G   D T  R  +I +IR+A + +GFFQ INHGIP  +L++M DGVR FHE DSEV+K
Sbjct  64    LQGGLFDSTVTRESVIVKIREAVENFGFFQAINHGIPLDLLEKMKDGVRGFHEQDSEVRK  123

Query  418   QFYSRDLTRKVVYNTNFDFHTSPAATWRDTLYFIMAPHPPTPQELPQVCRDILIKYSNSV  597
             +FYSRD T+ V YN+NFD ++SP+  WRDTL   M P  P  +ELP++C +I+++YS  V
Sbjct  124   KFYSRDNTKTVRYNSNFDLYSSPSTNWRDTLSCFMFPDLPKAEELPEICGEIMLEYSKGV  183

Query  598   QKLGLCLLELFSESLGLHKNHLEKLGCAVGLSIFGQYYPACPEPELTFALRDHSDSGFFT  777
              KL   + EL SE+LGL+ NHL+++ C  GL +   YYP CPEP+ TF    HSD  F T
Sbjct  184   MKLAELIFELLSEALGLNPNHLKEMDCTKGLFMLSHYYPPCPEPDRTFGTSQHSDRSFLT  243

Query  778   VLNQDTQIGGLQVLHENQWVDVPPLHGALVVNVADLLQLITNDKFKSVVHRVIAQK-IAP  954
             +L QD  IGGLQVLH++ WVDVPP+ GAL+VN+ D+LQLI+NDKF SV HRV+A +   P
Sbjct  244   ILLQD-HIGGLQVLHDDYWVDVPPVSGALLVNLGDILQLISNDKFVSVEHRVLANRGEKP  302

Query  955   RVSVASFF-RTIPGDVDAKKVYGPIKELVSDENPPLYRETTTEEYLMHFQKKGLDGTSGL  1131
             R+SVASFF   +P    + +VYGPI+EL+S+ENPP YR+TT  EY   +  +GLDG S L
Sbjct  303   RISVASFFVHPLP----SLRVYGPIEELLSEENPPKYRDTTITEYTSQYMARGLDGNSVL  358

Query  1132  LRFRL  1146
             L +++
Sbjct  359   LHYKI  363



>ref|XP_009347730.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1-like [Pyrus x bretschneideri]
Length=364

 Score =   387 bits (993),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 193/367 (53%), Positives = 247/367 (67%), Gaps = 15/367 (4%)
 Frame = +1

Query  64    DRKSELKAFDDMKTGVKGHVDSGIMKIPRIFI----HDeikkeekeklkPAMASTYKVPI  231
             DR SELKAFDD K GVKG +D+G  KIPRIF     HD   +           +T  +P+
Sbjct  7     DRISELKAFDDTKAGVKGLLDAGFTKIPRIFYCPSRHDHETEAT------GEKATLSIPV  60

Query  232   IDMEGLHTDHTTRRSEIIKEIRDACQTWGFFQIINHGIPTQVLDEMIDGVRQFHELDSEV  411
             ID++G+H +    R  +I E+R A + WGFFQ++NHGIP +VL+ MIDGVR+FHELD E+
Sbjct  61    IDLQGIHQNDPASRPRVIDEVRVASEKWGFFQVVNHGIPVEVLNRMIDGVREFHELDIEL  120

Query  412   KKQFYSRDLTRKVVYNTNFDFHTSPAATWRDTLYFIMAPHPPTPQELPQVCRDILIKYSN  591
             KK+FYSRD  RKV + +N D + S  A W+DTL   +AP PP P+ELP VCR+I+  YS 
Sbjct  121   KKEFYSRDFARKVFFMSNRDMYHSLEANWKDTLVCYVAPDPPKPEELPSVCREIVNDYSK  180

Query  592   SVQKLGLCLLELFSESLGLHKNHLEKLGCAVGLSIFGQYYPACPEPELTFALRDHSDSGF  771
              V  LG  L EL SE+LGL+ NHL+ + CA GL     YYPACPEP+LT     H+D  F
Sbjct  181   QVMDLGFILFELLSEALGLNSNHLKNMDCAEGLIQLCHYYPACPEPDLTLGTGKHTDGTF  240

Query  772   FTVLNQDTQIGGLQVLHENQWVDVPPLHGALVVNVADLLQLITNDKFKSVVHRVIAQKIA  951
              T+L QD Q GGLQVL++N+WV+VPP  GAL+VN+ D LQL+ NDK+ SV HRVI++ + 
Sbjct  241   ITILLQD-QTGGLQVLYDNRWVNVPPKEGALIVNIGDFLQLMANDKYTSVPHRVISKSVG  299

Query  952   PRVSVASFFRTIPGDVDAK-KVYGPIKELVSDENPPLYRETTTEEYLMHFQKKGLDGTSG  1128
             PR+SVASFFR  P  V  K K Y PIKELV++ENP  YRE   +EY+MH   +   GT  
Sbjct  300   PRISVASFFR--PYVVAGKSKAYAPIKELVTEENPQFYRELELKEYMMHHASEKAKGTCQ  357

Query  1129  -LLRFRL  1146
              LL F++
Sbjct  358   PLLHFKI  364



>ref|XP_006489612.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
12-like [Citrus sinensis]
Length=403

 Score =   388 bits (997),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 185/358 (52%), Positives = 250/358 (70%), Gaps = 9/358 (3%)
 Frame = +1

Query  58    DYDRKSELKAFDDMKTGVKGHVDSGIMKIPRIFIHDeikkeekeklkPAMASTYKVPIID  237
             +YDR+SELKAFDD K GVKG VD+ + K+PRIF      ++    L    +S  +VP ID
Sbjct  10    NYDRESELKAFDDTKAGVKGLVDARVAKVPRIF----ECEQSVVNLNSGNSSQLRVPTID  65

Query  238   MEGLHTDHTTRRSEIIKEIRDACQTWGFFQIINHGIPTQVLDEMIDGVRQFHELDSEVKK  417
              EG+H D  TR +EII ++++A + WGFFQ+I+HGIP  VL+++ DG+R+FHELD+E KK
Sbjct  66    PEGIHKDPNTR-TEIINKVKNASEEWGFFQVISHGIPLSVLNDIKDGIRKFHELDTETKK  124

Query  418   QFYSRDLTRKVVYNTNFDFHTSPAATWRDTLYFIMAPHPPTPQELPQVCRDILIKYSNSV  597
             + YSRD T++V YN+NFD + +P A WRDT+   ++PHPP+P EL  VCRD +++Y   V
Sbjct  125   KLYSRDPTQRVFYNSNFDLYQAPLAGWRDTILCHLSPHPPSPVELLDVCRDAVMEYRTHV  184

Query  598   QKLGLCLLELFSESLGLHKNHLEKLGCAVGLSIFGQYYPACPEPELTFALRDHSDSGFFT  777
              +LG  + EL SE+ GL  +HL  + C  GL + G YYPACPEPE T     H+D  F T
Sbjct  185   LRLGHTMFELLSEAFGLSSSHLNDMDCEEGLLLLGHYYPACPEPEFTLGTTQHTDGSFIT  244

Query  778   VLNQDTQIGGLQVLHENQWVDVPPLHGALVVNVADLLQ---LITNDKFKSVVHRVIAQKI  948
             +L QD Q+GGLQVLHENQW+DV P  GAL++N+ + LQ   LI+NDKF S  HRV+ + +
Sbjct  245   ILLQD-QVGGLQVLHENQWIDVRPTDGALIMNIGNFLQESSLISNDKFISANHRVLVKDV  303

Query  949   APRVSVASFFRTIPGDVDAKKVYGPIKELVSDENPPLYRETTTEEYLMHFQKKGLDGT  1122
               RVSVA FFR      D+ +VYGP+K+L+SDENPP+YR+T  ++Y+     KGLDGT
Sbjct  304   GSRVSVACFFRPEAHKGDSSRVYGPVKDLLSDENPPIYRDTFVKDYMKALFSKGLDGT  361



>ref|XP_002315711.2| hypothetical protein POPTR_0010s08380g [Populus trichocarpa]
 gb|EEF01882.2| hypothetical protein POPTR_0010s08380g [Populus trichocarpa]
Length=370

 Score =   387 bits (993),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 186/377 (49%), Positives = 255/377 (68%), Gaps = 8/377 (2%)
 Frame = +1

Query  19    MATASTGGKADSGDYDRKSELKAFDDMKTGVKGHVDSGIMKIPRIFIHDeikkeekeklk  198
             MA  +      S  YDR  E+++FD+ K GVKG VD+GI K+PR FI         +   
Sbjct  1     MAVTADSTTGVSATYDRYQEIRSFDESKCGVKGLVDAGITKVPRFFIRPPEDIAADDINT  60

Query  199   PAMAST-YKVPIIDMEGLHTDHTTRRSEIIKEIRDACQTWGFFQIINHGIPTQVLDEMID  375
                 +T + +P+ID++ +     +RR+E +  ++ A +  GFFQ++NHG+  +VL+EM++
Sbjct  61    GEWINTQFTIPVIDLKNM----DSRRAEAVAGVKRAAEEVGFFQVVNHGMENRVLEEMLE  116

Query  376   GVRQFHELDSEVKKQFYSRDLTRKVVYNTNFDFHTSPAATWRDTLYFIMAPHPPTPQELP  555
              VR FHE   EVK+++YSR++TRKV Y +NFD + S  A WRDTL+ +M P P  PQELP
Sbjct  117   AVRGFHEQPREVKEEYYSREMTRKVKYVSNFDLYKSKYANWRDTLFCVMGPDPLDPQELP  176

Query  556   QVCRDILIKYSNSVQKLGLCLLELFSESLGLHKNHLEKLGCAVGLSIFGQYYPACPEPEL  735
              V RDI+++YSN V KL   L EL SE+LGL  +HL+++ C  G ++   YYPACPEPEL
Sbjct  177   LVSRDIMMEYSNKVCKLATVLFELLSEALGLKSDHLKEMDCVKGHALLSHYYPACPEPEL  236

Query  736   TFALRDHSDSGFFTVLNQDTQIGGLQVLHENQWVDVPPLHGALVVNVADLLQLITNDKFK  915
                   HSD  F T+L QD  IGGLQ+ H+N W+DVPP+HGALVVN+ DLLQLI+NDKFK
Sbjct  237   AMGTTKHSDPDFLTILLQD-DIGGLQIFHQNHWIDVPPVHGALVVNIGDLLQLISNDKFK  295

Query  916   SVVHRVIAQKIAPRVSVASFFRTIPGDVDAKKVYGPIKELVSDENPPLYRETTTEEYLMH  1095
             SV HRV+A  I PRVSVASFF   P    + ++YGPIKEL+S+ENPP+Y E T ++++ +
Sbjct  296   SVEHRVVANHIGPRVSVASFF--TPHLYPSTRLYGPIKELLSEENPPIYCEITVKDFIAY  353

Query  1096  FQKKGLDGTSGLLRFRL  1146
             +  KGLDG S L  F++
Sbjct  354   YDSKGLDGNSALPHFKV  370



>ref|XP_004236794.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1 [Solanum lycopersicum]
Length=364

 Score =   386 bits (992),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 186/368 (51%), Positives = 259/368 (70%), Gaps = 11/368 (3%)
 Frame = +1

Query  58    DYDRKSELKAFDDMKTGVKGHVDSGIMKIPRIFIHDeikkeekeklkPAMAS---TYKVP  228
             D +R  ELKAFDD K GVKG VDSGI+ IP IFI   + ++E         S   + ++P
Sbjct  3     DNNRAKELKAFDDTKAGVKGLVDSGIVHIPEIFITPSLTEKEFSVENLDSGSDIVSVQIP  62

Query  229   IIDMEGLHTDHTTRRSEIIKEIRDACQTWGFFQIINHGIPTQVLDEMIDGVRQFHELDSE  408
             +ID++ ++ D   RR  +++E+ +AC++WGFFQ++NHG+P  V+DEMI G+R FHE  ++
Sbjct  63    VIDLKDMNGDDFQRR-RVVEEVGEACKSWGFFQVVNHGVPQHVMDEMIGGIRCFHEQPND  121

Query  409   VKKQFYSRDLTRKVVYNTNFDFHTSPAATWRDTLYFIMAPHPPTPQELPQVCRDILIKYS  588
             +K++FYS D  +KV++N+NFD + +  A WRDTL  +MAP+PPT  ELPQVCR+ L++YS
Sbjct  122   IKEEFYSMDPMKKVMFNSNFDLYQAKVANWRDTLACLMAPNPPTNDELPQVCREELLQYS  181

Query  589   NSVQKLGLCLLELFSESLGLHKNHLEKLGCAVGLSIFGQYYPACPEPELTFALRDHSDSG  768
               V+KLGL + EL +E LGL  NHL  + CA G  I   YYP CPEP  T  +  H+D  
Sbjct  182   QHVRKLGLTIFELLAEELGLRPNHLLDMDCAKGQFIISHYYPPCPEPNKTLGITKHTDPD  241

Query  769   FFTVLNQDTQIGGLQVLHENQWVDVPPLHGALVVNVADLLQLITNDKFKSVVHRVIAQKI  948
             FFT+L QD QIGGLQ+ H+NQW+D+ P++GALVVN+ DL+QL++NDKFKS  HRV+AQ I
Sbjct  242   FFTILLQD-QIGGLQINHQNQWIDIHPVNGALVVNLGDLMQLLSNDKFKSAEHRVLAQHI  300

Query  949   APRVSVASFFRT--IPGDVDAKKVYGPIKELVSDENPPLYRETTTEEYLMHFQKKGLDGT  1122
              PR+S+A FF T  +P D     +YGPIKEL+SDEN  LY+ETT ++Y++++  KGL   
Sbjct  301   GPRISIACFFTTQLLPFDT----LYGPIKELLSDENHALYKETTVKDYVLYYNSKGLGAL  356

Query  1123  SGLLRFRL  1146
               LL  ++
Sbjct  357   PSLLHLKI  364



>ref|XP_003596174.1| 1-aminocyclopropane-1-carboxylate oxidase-like protein [Medicago 
truncatula]
 gb|AES66425.1| 1-aminocyclopropane-1-carboxylate oxidase-like protein [Medicago 
truncatula]
Length=371

 Score =   387 bits (993),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 196/361 (54%), Positives = 251/361 (70%), Gaps = 7/361 (2%)
 Frame = +1

Query  64    DRKSELKAFDDMKTGVKGHVDSGIMKIPRIFIHDeikkeekeklkPAMASTYKVPIIDME  243
             DR  +LKAFD+ K GVKG VD GI+KIP +F H   K  +      +  + + +PIID+ 
Sbjct  18    DRLQDLKAFDERKAGVKGLVDQGILKIPTLFHHPPDKFSKSTN---STNTQHIIPIIDLA  74

Query  244   GLHTDHTTRRSEIIKEIRDACQTWGFFQIINHGIPTQVLDEMIDGVRQFHELDSEVKKQF  423
              +  D  TR+ EII +I++A +TWGFFQ++NHGIP  VL++M DGV +F E D EVKK+ 
Sbjct  75    NIGKDPNTRQ-EIISKIKEASETWGFFQVVNHGIPINVLEDMKDGVIRFFEQDIEVKKEM  133

Query  424   YSRDLTRKVVYNTNFDFHTSPAATWRDTLYFIMAPHPPTPQELPQVCRDILIKYSNSVQK  603
             Y+RD TR +VYN+NFD ++SPA  WRDT     A + P  ++LP VCRDIL++Y   + K
Sbjct  134   YTRDQTRPLVYNSNFDLYSSPALNWRDTFICDFALNAPKLEDLPVVCRDILMEYGTRLMK  193

Query  604   LGLCLLELFSESLGLHKNHLEKLGCAVGLSIFGQYYPACPEPELTFALRDHSDSGFFTVL  783
             LG  L EL SE+LGLH NHL+ L C  G  + G YYPACPEP+LT     HSD  F TVL
Sbjct  194   LGTILFELLSEALGLHSNHLKDLDCCEGNILLGHYYPACPEPDLTMGTTKHSDGSFLTVL  253

Query  784   NQDTQIGGLQVLHENQWVDVPPLHGALVVNVADLLQLITNDKFKSVVHRVIAQKIAPRVS  963
              QD  IGGLQVL++ +W+DVPP+  ALVVN+ DLLQLITNDKFKSV HRV+A  I PR+S
Sbjct  254   LQD-HIGGLQVLYQEKWIDVPPVPEALVVNIGDLLQLITNDKFKSVEHRVLANDIGPRIS  312

Query  964   VASFFRTIPGDVDAKKVYGPIKELVSDENPPLYRETTTEEYLMHFQKKGLDGTSGLLRFR  1143
             VA FF+   G    +K+YGPI EL+S++NPP YRETT  +Y+ +   KGLDGTS L  F+
Sbjct  313   VACFFKA--GLRAHEKLYGPITELLSEDNPPRYRETTFADYVAYLCAKGLDGTSVLQHFK  370

Query  1144  L  1146
             L
Sbjct  371   L  371



>ref|XP_010026859.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1-like [Eucalyptus grandis]
 gb|KCW60400.1| hypothetical protein EUGRSUZ_H03118 [Eucalyptus grandis]
Length=371

 Score =   386 bits (992),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 192/367 (52%), Positives = 254/367 (69%), Gaps = 16/367 (4%)
 Frame = +1

Query  61    YDRKSELKAFDDMKTGVKGHVDSGIMKIPRIFIHDeikkeekeklkPAMAST---YKVPI  231
             YDR  E KAFD+   GVKG VD+GI ++PRIF+      +       A+AS+   + VPI
Sbjct  16    YDRMREKKAFDESMAGVKGLVDAGITEVPRIFVDHPENLQS------ALASSNGHFHVPI  69

Query  232   IDMEGLHTDHTTRRSEIIKEIRDACQTWGFFQIINHGIPTQVLDEMIDGVRQFHELDSEV  411
             +D+  +  D  +RR E++ E+R A +TWGFFQ++NHGIPT VL+EM+DGVR+FHE  +E 
Sbjct  70    VDLADIVKD-PSRRKEVVNEVRSASKTWGFFQVVNHGIPTTVLEEMLDGVRRFHEQGAEE  128

Query  412   KKQFYSRDLTRKVVYNTNFDFHTSPAATWRDTLYFIMAPHPPTPQELPQVCRDILIKYSN  591
             K++FYSRD T  V Y++NF+ + + AA WRDTL+ +MAP+    +ELP VC DI++++S 
Sbjct  129   KRRFYSRDFTTSVAYHSNFNLYKTEAANWRDTLFCVMAPNALEAEELPAVCGDIMLEFSK  188

Query  592   SVQKLGLCLLELFSESLGLHKNHLEKLGCAVGLSIFGQYYPACPEPELTFALRDHSDSGF  771
              V  LG  L EL SE+LGL  NHL+ + CA GL +  QYY  CP+PELT     H+DS F
Sbjct  189   RVMNLGTTLFELLSEALGLKPNHLKDMECAKGLVLLNQYYSKCPQPELTLGTSRHTDSDF  248

Query  772   FTVLNQDTQIGGLQVLHENQWVDVPPLHGALVVNVADLLQLITNDKFKSVVHRVIAQKIA  951
              TVL QD  +GGLQVL++NQW+DV P+ GAL+VN+ DLLQLI+ND FKS  HRV+A  + 
Sbjct  249   LTVLLQD-HVGGLQVLYQNQWIDVSPVPGALIVNIGDLLQLISNDIFKSSEHRVVANNMG  307

Query  952   PRVSVASFFRTIPGDVDAKKVYGPIKELVSDENPPLYRETTTEEYLMHF--QKKGLDGTS  1125
             PR SVA FF T      + K+YGPIKEL+S+ +PP YRETT  EY+ HF    KG DGTS
Sbjct  308   PRASVACFFYT--ATPPSPKLYGPIKELISEGDPPKYRETTIMEYVSHFSANAKG-DGTS  364

Query  1126  GLLRFRL  1146
              L +F+L
Sbjct  365   ALQQFKL  371



>ref|XP_011030519.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
2-like [Populus euphratica]
Length=370

 Score =   386 bits (992),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 186/377 (49%), Positives = 253/377 (67%), Gaps = 8/377 (2%)
 Frame = +1

Query  19    MATASTGGKADSGDYDRKSELKAFDDMKTGVKGHVDSGIMKIPRIFIHDeikkeekeklk  198
             M   +      S  YDR  E+K+FD+ K GVKG VD+GI K+PR FI         +   
Sbjct  1     MVVTADSTTGVSATYDRYREIKSFDESKCGVKGLVDAGITKLPRFFIRSPEDIAADDINT  60

Query  199   PAMAST-YKVPIIDMEGLHTDHTTRRSEIIKEIRDACQTWGFFQIINHGIPTQVLDEMID  375
                 +T + +P+ID++ +     +RR+E +  ++ A +  GFFQ++NHG+  +VL+EM++
Sbjct  61    GEWINTQFTIPVIDLKNM----DSRRAEAVAGVKRAAEEVGFFQVVNHGMENRVLEEMLE  116

Query  376   GVRQFHELDSEVKKQFYSRDLTRKVVYNTNFDFHTSPAATWRDTLYFIMAPHPPTPQELP  555
              VR FHE   EVK+++YSR++ RKV Y +NFD + S  A WRDTL+ +M P P  PQELP
Sbjct  117   AVRGFHEQPREVKEEYYSREMMRKVKYVSNFDLYKSKYANWRDTLFCVMGPDPLDPQELP  176

Query  556   QVCRDILIKYSNSVQKLGLCLLELFSESLGLHKNHLEKLGCAVGLSIFGQYYPACPEPEL  735
              V RDI+++YSN V KL   L EL SE+LGL  +HL+++ C  G ++   YYPACPEPEL
Sbjct  177   LVARDIMMEYSNKVCKLATVLFELLSEALGLKSDHLKEMDCVKGHALLSHYYPACPEPEL  236

Query  736   TFALRDHSDSGFFTVLNQDTQIGGLQVLHENQWVDVPPLHGALVVNVADLLQLITNDKFK  915
                   HSD  F T+L QD  IGGLQ+ H+N W+DVPP+HGALVVN+ DLLQLI+NDKFK
Sbjct  237   AMGTTKHSDPDFLTILLQD-NIGGLQIFHQNHWIDVPPVHGALVVNIGDLLQLISNDKFK  295

Query  916   SVVHRVIAQKIAPRVSVASFFRTIPGDVDAKKVYGPIKELVSDENPPLYRETTTEEYLMH  1095
             SV HRV+A  I PRVSVASFF   P    + ++YGPIKEL+S+ENPP+Y E T ++++ +
Sbjct  296   SVEHRVVANHIGPRVSVASFF--TPHLYPSTRLYGPIKELLSEENPPIYCEITVKDFIAY  353

Query  1096  FQKKGLDGTSGLLRFRL  1146
             +  KGLDG S L  F+L
Sbjct  354   YDSKGLDGNSALPHFKL  370



>gb|KHG16548.1| hypothetical protein F383_20832 [Gossypium arboreum]
Length=370

 Score =   386 bits (992),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 196/379 (52%), Positives = 255/379 (67%), Gaps = 12/379 (3%)
 Frame = +1

Query  19    MATAST--GGKADSGDYDRKSELKAFDDMKTGVKGHVDSGIMKIPRIFIHDeikkeekek  192
             MA + T   G      YDR  ELKAFDD K+GVKG VD+GI KIPRIF   +++  +  K
Sbjct  1     MAASFTRDSGTQTPTTYDRFQELKAFDDSKSGVKGLVDAGITKIPRIFCRPKVEDHDSVK  60

Query  193   lkPAMASTYKVPIIDMEGLHTDHTTRRSEIIKEIRDACQTWGFFQIINHGIPTQVLDEMI  372
               P   + + +P++D+E +     TR  E+++ IR A    GFFQ++NHG+P  VL+EM+
Sbjct  61    PIP---TQFTIPVVDLENI----KTRSDEVVEGIRKAGGEIGFFQVVNHGVPQSVLEEML  113

Query  373   DGVRQFHELDSEVKKQFYSRDLTRKVVYNTNFDFHTSPAATWRDTLYFIMAPHPPTPQEL  552
                R FHEL SEVKK +Y+R+ T+KV+Y +NFD + S  A WRDTL+ +M P P  PQ+L
Sbjct  114   AAARGFHELPSEVKKSYYTREKTKKVIYGSNFDLYESRFANWRDTLFCVMGPEPLHPQQL  173

Query  553   PQVCRDILIKYSNSVQKLGLCLLELFSESLGLHKNHLEKLGCAVGLSIFGQYYPACPEPE  732
             P VCRDI ++YS  + KLG  L +L S+++GL  +HL  L C+ G  +   YYPACPEPE
Sbjct  174   PLVCRDITMEYSKQIHKLGTTLFKLLSKAIGLTPDHLIGLDCSKGHCLLSHYYPACPEPE  233

Query  733   LTFALRDHSDSGFFTVLNQDTQIGGLQVLHENQWVDVPPLHGALVVNVADLLQLITNDKF  912
             LT     HSD  F T+L QD  IGGLQV H+NQW DVP L GALVVN+ DLLQLI+NDK 
Sbjct  234   LTLGTAKHSDPDFLTILLQD-HIGGLQVFHQNQWFDVPFLPGALVVNIGDLLQLISNDKL  292

Query  913   KSVVHRVIAQKIAPRVSVASFFRTIPGDVDAKKVYGPIKELVSDENPPLYRETTTEEYLM  1092
             KSV H+V+A +  PRVSVA FF   P    + ++YGPIKEL+S ENPPLYRETT E+++ 
Sbjct  293   KSVEHQVLANEKGPRVSVACFF--TPHLYPSTRIYGPIKELLSKENPPLYRETTVEDFIS  350

Query  1093  HFQKKGLDGTSGLLRFRLQ  1149
             ++  KGLD  S L  F+LQ
Sbjct  351   YYDSKGLDEKSALAHFKLQ  369



>gb|ABK96309.1| unknown [Populus trichocarpa x Populus deltoides]
Length=370

 Score =   386 bits (992),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 185/377 (49%), Positives = 253/377 (67%), Gaps = 8/377 (2%)
 Frame = +1

Query  19    MATASTGGKADSGDYDRKSELKAFDDMKTGVKGHVDSGIMKIPRIFIHDeikkeekeklk  198
             M   +      S  YDR  E+++FD+ K GVKG VD+GI K+PR FI             
Sbjct  1     MVVTADSTTGVSATYDRDQEIRSFDESKCGVKGLVDAGITKLPRFFIRPPEDIAADYINT  60

Query  199   PAMAST-YKVPIIDMEGLHTDHTTRRSEIIKEIRDACQTWGFFQIINHGIPTQVLDEMID  375
                 +T + +P+ID++ +     +RR+E +  ++ A +  GFFQ++NHG+  +VL+EM++
Sbjct  61    GEWINTQFTIPVIDLKNM----DSRRAEAVAGVKRAAEEVGFFQVVNHGMENRVLEEMLE  116

Query  376   GVRQFHELDSEVKKQFYSRDLTRKVVYNTNFDFHTSPAATWRDTLYFIMAPHPPTPQELP  555
              VR FHE   EVK+++YSR++TRKV Y +NFD + +  A WRDTL+ +M P P  PQELP
Sbjct  117   AVRGFHEQPREVKEEYYSREMTRKVTYVSNFDLYKAKYANWRDTLFCVMGPDPLDPQELP  176

Query  556   QVCRDILIKYSNSVQKLGLCLLELFSESLGLHKNHLEKLGCAVGLSIFGQYYPACPEPEL  735
              V RDI+++YSN V KL   L EL SE+LGL  +HL+++ C  G ++   YYPACPEPEL
Sbjct  177   LVSRDIIMEYSNKVCKLATVLFELLSEALGLKSDHLKEMDCVKGHALLSHYYPACPEPEL  236

Query  736   TFALRDHSDSGFFTVLNQDTQIGGLQVLHENQWVDVPPLHGALVVNVADLLQLITNDKFK  915
                   HSD  F T+L QD  IGGLQ+ H+N W+DVPP+HGALVVN+ DLLQLI+NDKFK
Sbjct  237   AMGTTKHSDPDFLTILLQD-DIGGLQIFHQNHWIDVPPVHGALVVNIGDLLQLISNDKFK  295

Query  916   SVVHRVIAQKIAPRVSVASFFRTIPGDVDAKKVYGPIKELVSDENPPLYRETTTEEYLMH  1095
             SV HRV+A  I PRVSVASFF   P    + ++YGPIKEL+S+ENPP+Y E T ++++ +
Sbjct  296   SVEHRVVANHIGPRVSVASFF--TPHLYPSTRLYGPIKELLSEENPPIYCEITVKDFIAY  353

Query  1096  FQKKGLDGTSGLLRFRL  1146
             +  KGLDG S L  F+L
Sbjct  354   YDSKGLDGNSALPHFKL  370



>ref|XP_006367030.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1-like [Solanum tuberosum]
Length=368

 Score =   386 bits (991),  Expect = 5e-127, Method: Compositional matrix adjust.
 Identities = 184/368 (50%), Positives = 254/368 (69%), Gaps = 7/368 (2%)
 Frame = +1

Query  55    GDYDRKSELKAFDDMKTGVKGHVDSGIMKIPRIFIHDeikkeekekl---kPAMASTYKV  225
              +YDR  +LKAFDD K GVKG VDSGI+ IP IF+   + + E         +     ++
Sbjct  2     ANYDRAKDLKAFDDTKAGVKGLVDSGIVHIPEIFVTSALTENELSAKNLDSDSNVVNVQI  61

Query  226   PIIDMEGLHTDHTTRRSEIIKEIRDACQTWGFFQIINHGIPTQVLDEMIDGVRQFHELDS  405
             P+ID++G++ D   RR  I++E+ +AC+TWGFFQ++NHG+P  V+DEMI GV+ F+E  +
Sbjct  62    PVIDLKGMNGD-DFRRRRIVEEVGEACKTWGFFQVLNHGVPQHVMDEMISGVKSFNEQSN  120

Query  406   EVKKQFYSRDLTRKVVYNTNFDFHTSPAATWRDTLYFIMAPHPPTPQELPQVCRDILIKY  585
             E K +FYSRD  +KV +N+NFD ++S AA WRD+L  +MAP+PPT  ELP+ CR+ L++Y
Sbjct  121   EKKMEFYSRDNLKKVKFNSNFDLYSSKAANWRDSLTCVMAPNPPTKDELPEACREELLQY  180

Query  586   SNSVQKLGLCLLELFSESLGLHKNHLEKLGCAVGLSIFGQYYPACPEPELTFALRDHSDS  765
             S  V+KLG  + EL +E+LGL  NHL  + CA G  I   YYP CPEP  T  +  H+D 
Sbjct  181   SEHVRKLGHTIFELLAEALGLKPNHLLDMDCAKGQFIISHYYPPCPEPNKTLGITKHTDP  240

Query  766   GFFTVLNQDTQIGGLQVLHENQWVDVPPLHGALVVNVADLLQLITNDKFKSVVHRVIAQK  945
              FFT+L QD QIGGLQ+ H+NQW+D+ P+ GALV+N+ DLLQL++NDKFKS  HRV++++
Sbjct  241   DFFTILLQD-QIGGLQINHQNQWIDIHPVTGALVINLGDLLQLLSNDKFKSAEHRVLSKQ  299

Query  946   IAPRVSVASFFRTIPGDVDAKKVYGPIKELVSDENPPLYRETTTEEYLMHFQKKGLDGTS  1125
             I PR+S+A FF T     D   +YGPIKEL+SDEN  LY+ETT  +Y+ ++  +GL    
Sbjct  300   IGPRISIACFFTTQFQPFDT--LYGPIKELLSDENHALYKETTVRDYVSYYNSRGLGAHP  357

Query  1126  GLLRFRLQ  1149
              LL  RL 
Sbjct  358   SLLHLRLN  365



>ref|XP_006417896.1| hypothetical protein EUTSA_v10009596mg [Eutrema salsugineum]
 gb|ESQ36249.1| hypothetical protein EUTSA_v10009596mg [Eutrema salsugineum]
Length=458

 Score =   389 bits (999),  Expect = 5e-127, Method: Compositional matrix adjust.
 Identities = 196/369 (53%), Positives = 250/369 (68%), Gaps = 6/369 (2%)
 Frame = +1

Query  43    KADSGDYDRKSELKAFDDMKTGVKGHVDSGIMKIPRIFIHDeikkeekeklkPAMASTYK  222
             K DS  +DR SELKAFD+ KTGVKG VD+GI +IPRIF H  +     + L   +     
Sbjct  95    KIDS--FDRASELKAFDETKTGVKGLVDAGISQIPRIFHHSSLNLATPKPLSSDLLHLTT  152

Query  223   VPIIDMEGLHTDHTTRRSEIIKEIRDACQTWGFFQIINHGIPTQVLDEMIDGVRQFHELD  402
             +P ID+ G   +   +R   I+ ++DA + WGFFQ+INHG+   +L++M DGVR FHE  
Sbjct  153   IPTIDLGGRVFEDAIKRKHAIEGVKDAAEKWGFFQVINHGVSLDLLEKMKDGVRGFHEQS  212

Query  403   SEVKKQFYSRDLTRKVVYNTNFDFHTSPAATWRDTLYFIMAPHPPTPQELPQVCRDILIK  582
              EVKKQFY RD TR+ +Y++NFD ++SPAA WRDT    +AP PP PQ LP++CRD++++
Sbjct  213   PEVKKQFYGRDFTREFLYSSNFDLYSSPAANWRDTFSCNIAPDPPKPQNLPEICRDVMLE  272

Query  583   YSNSVQKLGLCLLELFSESLGLHKNHLEKLGCAVGLSIFGQYYPACPEPELTFALRDHSD  762
             YS  V  LG  L EL SE+LGL+ NHL  + C+ GL +   YYP CPEPELT     HSD
Sbjct  273   YSQQVINLGEFLFELLSEALGLNPNHLNDIDCSKGLLMLSHYYPPCPEPELTLGTSPHSD  332

Query  763   SGFFTVLNQDTQIGGLQVLHENQWVDVPPLHGALVVNVADLLQLITNDKFKSVVHRVIAQ  942
             + F TVL  D QI GLQV  E  W DVPP+ GALV+N+ D LQLITNDKF S+ HRV+A 
Sbjct  333   NSFLTVLLTD-QIEGLQVHREGYWFDVPPVPGALVINIGDFLQLITNDKFISLEHRVLAN  391

Query  943   KIA-PRVSVASFFRTIPGDVDAKKVYGPIKELVSDENPPLYRETTTEEYLMHFQKKGLDG  1119
             +    RVSVA FF T  G     ++YGPIKELVS+E+PP YRETT ++Y  +F  KGLDG
Sbjct  392   RATRARVSVACFFST--GVRPNPRMYGPIKELVSEEDPPKYRETTIKDYSTYFNAKGLDG  449

Query  1120  TSGLLRFRL  1146
             TS LL F++
Sbjct  450   TSALLHFKI  458



>gb|KHN22504.1| 1-aminocyclopropane-1-carboxylate oxidase like 1 [Glycine soja]
Length=371

 Score =   386 bits (991),  Expect = 5e-127, Method: Compositional matrix adjust.
 Identities = 194/369 (53%), Positives = 256/369 (69%), Gaps = 11/369 (3%)
 Frame = +1

Query  40    GKADSGDYDRKSELKAFDDMKTGVKGHVDSGIMKIPRIFIHDeikkeekeklkPAMASTY  219
              K DS  YDR +E+KAFD+ K GVKG  DSGI  IPRIF H +++   +        S +
Sbjct  14    SKKDST-YDRIAEVKAFDETKLGVKGLFDSGITNIPRIFHHAKVEDHTETMPN---DSNF  69

Query  220   KVPIIDMEGLHTDHTTRRSEIIKEIRDACQTWGFFQIINHGIPTQVLDEMIDGVRQFHEL  399
              VPIID++ + T+ ++ R + + +IR AC+ WGFFQ++NHGI   +LDEMI G+R+FHE 
Sbjct  70    SVPIIDLQDIDTN-SSLRVKALDKIRSACKEWGFFQVVNHGIAVDLLDEMICGIRRFHEQ  128

Query  400   DSEVKKQFYSRDLTRKVVYNTNFDFHTSPAATWRDTLYFIMAPHPPTPQELPQVCRDILI  579
             D+EV+K FYSRD+ +KV Y +N   +  PAA WRD++     P PP P+E+P VCRDI+I
Sbjct  129   DAEVRKSFYSRDMNKKVRYFSNGTLYRDPAANWRDSI----VPDPPYPEEIPAVCRDIVI  184

Query  580   KYSNSVQKLGLCLLELFSESLGLHKNHLEKLGCAVGLSIFGQYYPACPEPELTFALRDHS  759
              YS  V+ LG  + ELFSE+LGLH ++L +L    G  +   YYP CPEPELT     H+
Sbjct  185   GYSEKVRALGFTIFELFSEALGLHSSYLNELDSVDGQYLLCHYYPPCPEPELTMGTSKHT  244

Query  760   DSGFFTVLNQDTQIGGLQVLHENQWVDVPPLHGALVVNVADLLQLITNDKFKSVVHRVIA  939
             D  F T+L QD Q+GGLQVLH+NQWVDVPP+HG+LVVN+ DLLQLITND F SV HRV++
Sbjct  245   DISFMTILLQD-QMGGLQVLHQNQWVDVPPVHGSLVVNIGDLLQLITNDMFLSVYHRVLS  303

Query  940   QKIAPRVSVASFFRTIPGDVDAKKVYGPIKELVSDENPPLYRETTTEEYLMHFQKKGLDG  1119
                 PR+SVASFF T      + KV GPIKEL+S++NPP+YR+TT ++   H+ +KGLDG
Sbjct  304   SHTGPRISVASFF-TKSFQQSSLKVVGPIKELLSEDNPPIYRDTTVKDVKAHYFEKGLDG  362

Query  1120  TSGLLRFRL  1146
              + L  FRL
Sbjct  363   NNSLHPFRL  371



>gb|AAK44137.1|AF370322_1 putative oxidoreductase [Arabidopsis thaliana]
Length=369

 Score =   385 bits (990),  Expect = 5e-127, Method: Compositional matrix adjust.
 Identities = 190/363 (52%), Positives = 246/363 (68%), Gaps = 4/363 (1%)
 Frame = +1

Query  61    YDRKSELKAFDDMKTGVKGHVDSGIMKIPRIFIHDeikkeekeklkPAMASTYKVPIIDM  240
             +DR SELKAFD+ KTGVKG VDSG+ ++PRIF H  +K    + L   +     +P ID+
Sbjct  10    FDRASELKAFDETKTGVKGLVDSGVSQVPRIFHHPTVKLSTPKPLPSGLLHLKTIPTIDL  69

Query  241   EGLHTDHTTRRSEIIKEIRDACQTWGFFQIINHGIPTQVLDEMIDGVRQFHELDSEVKKQ  420
              G       +R+  I+EI++A   WGFFQ+INHG+  ++L++M  GVR FHE   EV+K+
Sbjct  70    GGRDFQDAIKRNNAIEEIKEAAAKWGFFQVINHGVSLELLEKMKKGVRDFHEQSQEVRKE  129

Query  421   FYSRDLTRKVVYNTNFDFHTSPAATWRDTLYFIMAPHPPTPQELPQVCRDILIKYSNSVQ  600
             FYSRD +R+ +Y +NFD  +SPAA WRDT    MAP  P PQ+LP++CRDI+++YS  V 
Sbjct  130   FYSRDFSRRFLYLSNFDLFSSPAANWRDTFSCTMAPDTPKPQDLPEICRDIMMEYSKQVM  189

Query  601   KLGLCLLELFSESLGLHKNHLEKLGCAVGLSIFGQYYPACPEPELTFALRDHSDSGFFTV  780
              LG  L EL SE+LGL  NHL  + C+ GL +   YYP CPEP+LT     HSD+ F TV
Sbjct  190   NLGKFLFELLSEALGLEPNHLNDMDCSKGLLMLSHYYPPCPEPDLTLGTSQHSDNSFLTV  249

Query  781   LNQDTQIGGLQVLHENQWVDVPPLHGALVVNVADLLQLITNDKFKSVVHRVIAQKIA-PR  957
             L  D QI GLQV  E  W DVP + GAL++N+ DLLQLITNDKF S+ HRV+A +    R
Sbjct  250   LLPD-QIEGLQVRREGHWFDVPHVSGALIINIGDLLQLITNDKFISLEHRVLANRATRAR  308

Query  958   VSVASFFRTIPGDVDAKKVYGPIKELVSDENPPLYRETTTEEYLMHFQKKGLDGTSGLLR  1137
             VSVA FF T  G     ++YGPI+ELVS+ENPP YRETT ++Y  +F  KGLDGTS LL 
Sbjct  309   VSVACFFTT--GVRPNPRMYGPIRELVSEENPPKYRETTIKDYATYFNAKGLDGTSALLH  366

Query  1138  FRL  1146
             F++
Sbjct  367   FKI  369



>ref|XP_009765554.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1-like [Nicotiana sylvestris]
Length=359

 Score =   385 bits (988),  Expect = 7e-127, Method: Compositional matrix adjust.
 Identities = 190/364 (52%), Positives = 254/364 (70%), Gaps = 6/364 (2%)
 Frame = +1

Query  55    GDYDRKSELKAFDDMKTGVKGHVDSGIMKIPRIFIHDeikkeekeklkPAMASTYKVPII  234
              DYDR  ELKAFDD KTGVKG VD+GI+ IP  F+   I+ E   K    +    ++PII
Sbjct  2     ADYDRAKELKAFDDKKTGVKGLVDAGIVHIPEFFVTTAIENEFNAKNL-DLCFNVQIPII  60

Query  235   DMEGLHTDHTTRRSEIIKEIRDACQTWGFFQIINHGIPTQVLDEMIDGVRQFHELDSEVK  414
             D + +  +   RR +I+++IR+AC+TWGFFQ++NHGIP  V+DEMI+GV++F+E  +E K
Sbjct  61    DFKNIEENDFQRR-KIVEQIREACETWGFFQVLNHGIPQHVMDEMIEGVKRFNEQSNE-K  118

Query  415   KQFYSRDLTRKVVYNTNFDFHTSPAATWRDTLYFIMAPHPPTPQELPQVCRDILIKYSNS  594
             K+FYSRD  +KV +N+NFD + S AA WRDTL  IMAP+PP   ELP  CR  L++YS  
Sbjct  119   KEFYSRDNLKKVKFNSNFDLYQSKAANWRDTLGCIMAPNPPRSDELPDACRKELLEYSEH  178

Query  595   VQKLGLCLLELFSESLGLHKNHLEKLGCAVGLSIFGQYYPACPEPELTFALRDHSDSGFF  774
             V++LG+ + EL +E+LGL  NHL ++ CA G  I   YYP CPEP  T  +  H+D  FF
Sbjct  179   VRELGITIFELLAEALGLKPNHLLEMECAKGHFILSHYYPPCPEPNKTLGITKHTDPDFF  238

Query  775   TVLNQDTQIGGLQVLHENQWVDVPPLHGALVVNVADLLQLITNDKFKSVVHRVIAQKIAP  954
             T+L QD  IGGLQ+ H+NQW+D+ P+ GALV+N+ DLLQL++NDKFKS  HRV+++ I P
Sbjct  239   TILLQD-HIGGLQIYHQNQWIDIHPVTGALVINLGDLLQLLSNDKFKSAEHRVLSKHIGP  297

Query  955   RVSVASFFRTIPGDVDAKKVYGPIKELVSDENPPLYRETTTEEYLMHFQKKGLDGTSGLL  1134
             R+SVA FF T     D  ++YGPI EL+SDENPP Y+ETT  +Y+ ++  KGL     LL
Sbjct  298   RISVACFFTTQFQPFD--RLYGPINELLSDENPPKYKETTVRDYVSYYNSKGLGARPSLL  355

Query  1135  RFRL  1146
               RL
Sbjct  356   HLRL  359



>ref|XP_010457799.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
3-like isoform X8 [Camelina sativa]
Length=368

 Score =   385 bits (989),  Expect = 8e-127, Method: Compositional matrix adjust.
 Identities = 192/365 (53%), Positives = 244/365 (67%), Gaps = 4/365 (1%)
 Frame = +1

Query  55    GDYDRKSELKAFDDMKTGVKGHVDSGIMKIPRIFIHDeikkeekeklkPAMASTYKVPII  234
               +DR SELKAFD+ KTGVKG VD+G+ KIPRIF+H        + L   +     +P I
Sbjct  7     ASFDRASELKAFDETKTGVKGLVDAGVSKIPRIFLHPSATLSNPKPLSSDLLHLKTIPTI  66

Query  235   DMEGLHTDHTTRRSEIIKEIRDACQTWGFFQIINHGIPTQVLDEMIDGVRQFHELDSEVK  414
             D+ G   +  T+R   ++ I+ A   WGFFQ+INHG+   +L+++ DGVR FHE   EVK
Sbjct  67    DLGGRVFEDVTKRKNAVEGIKKAAAKWGFFQVINHGVSFDLLEKVKDGVRDFHEQSPEVK  126

Query  415   KQFYSRDLTRKVVYNTNFDFHTSPAATWRDTLYFIMAPHPPTPQELPQVCRDILIKYSNS  594
             K FYSRD +R+ +Y +NF   +SP+A+WRDTL   MAP+PP P +LP+ CRD++++YSN 
Sbjct  127   KGFYSRDFSRRFLYLSNFHLFSSPSASWRDTLACTMAPNPPKPHDLPETCRDVMMEYSNQ  186

Query  595   VQKLGLCLLELFSESLGLHKNHLEKLGCAVGLSIFGQYYPACPEPELTFALRDHSDSGFF  774
             V  LG  L EL SE+LGL+  HL+ + C+ GL +   YYP CPEP+LT     HSD  F 
Sbjct  187   VMVLGEFLFELLSEALGLNPYHLKDMDCSKGLIMLSHYYPPCPEPDLTLGTSQHSDISFL  246

Query  775   TVLNQDTQIGGLQVLHENQWVDVPPLHGALVVNVADLLQLITNDKFKSVVHRVIAQKIA-  951
             TVL  D QI GLQV  E  W DVP + GALV+N+ DLLQLITNDKF S+ HRV+  K   
Sbjct  247   TVLLPD-QIEGLQVRREGSWFDVPYVPGALVINIGDLLQLITNDKFISLEHRVLGNKATR  305

Query  952   PRVSVASFFRTIPGDVDAKKVYGPIKELVSDENPPLYRETTTEEYLMHFQKKGLDGTSGL  1131
              RVSVA FF T  G +   +VYGPI+ELVS+ENPP YRETT  EY  HF  KGLDGTS L
Sbjct  306   ARVSVACFFTT--GVLPDPRVYGPIRELVSEENPPKYRETTIREYATHFNTKGLDGTSAL  363

Query  1132  LRFRL  1146
             L F++
Sbjct  364   LHFKI  368



>ref|XP_010671066.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1-like [Beta vulgaris subsp. vulgaris]
Length=371

 Score =   385 bits (989),  Expect = 8e-127, Method: Compositional matrix adjust.
 Identities = 181/370 (49%), Positives = 250/370 (68%), Gaps = 7/370 (2%)
 Frame = +1

Query  52    SGDYDRKSELKAFDDMKTGVKGHVDSGIMKIPRIFIHDeikkeekeklkPAMASTYKVPI  231
             S +YDR  E+KAFD+ K GVKG   +G+ K+P IFI+ +      ++  P   S + +P 
Sbjct  5     SHEYDRNIEIKAFDETKLGVKGLAATGLTKVPSIFINHQEHNRNNKQHTPDSKSQFTIPT  64

Query  232   IDMEGLHTDHTTRRSEIIKEIRDACQTWGFFQIINHGIPTQVLDEMIDGVRQFHELDSEV  411
             ID+ G+  D + +  +++ EI DAC+ WGFFQ+INHGIP +VLD ++DGVR+FHE D EV
Sbjct  65    IDLAGIDID-SDKFKKVVDEIWDACKEWGFFQVINHGIPQEVLDGVMDGVRRFHEEDDEV  123

Query  412   KKQFYSRDLT---RKVVYNTNFDFHTSPAATWRDTLYFIMAPHPPTPQELPQVCRDILIK  582
             KKQ+Y+RD+T    +  Y +N+     P   WRDT++  MAP+PP P+ELP  CRD+L +
Sbjct  124   KKQYYTRDITISSMRFAYFSNYYLFKGPVTNWRDTMWASMAPYPPQPEELPIACRDVLFE  183

Query  583   YSNSVQKLGLCLLELFSESLGLHKNHLEKLGCAVGLSIFGQYYPACPEPELTFALRDHSD  762
             Y+  V K+G  LLE+ S  LGL+  HL+ + CA  L + G YYP CPEP+L      H+D
Sbjct  184   YAKHVTKVGHTLLEMISMGLGLNPTHLKDIDCAQELMLLGNYYPPCPEPDLAIGFSKHAD  243

Query  763   SGFFTVLNQDTQIGGLQVLHENQWVDVPPLHGALVVNVADLLQLITNDKFKSVVHRVIAQ  942
             +   T+L QD QIGGLQV H+NQWVDVP + GALV+N  D+LQLITNDK KSV HRV+AQ
Sbjct  244   NDVLTILIQDKQIGGLQVWHQNQWVDVPHVPGALVINTGDVLQLITNDKMKSVYHRVVAQ  303

Query  943   KIAPRVSVASFFRTIPGDVDAKKVYGPIKELVSDENPPLYRETTTEEYLMHFQKKGLDGT  1122
              + PR+S+ +FF+         +++GPIKEL+S+E PP+YRETT ++YL H+   G DG+
Sbjct  304   GVGPRISLGAFFKP---HTHNPRLFGPIKELLSEEKPPIYRETTMKDYLTHYFSTGQDGS  360

Query  1123  SGLLRFRLQK  1152
               L  F+LQ 
Sbjct  361   YALDEFKLQN  370



>ref|XP_010486415.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1-like [Camelina sativa]
Length=362

 Score =   385 bits (988),  Expect = 9e-127, Method: Compositional matrix adjust.
 Identities = 190/361 (53%), Positives = 248/361 (69%), Gaps = 6/361 (2%)
 Frame = +1

Query  64    DRKSELKAFDDMKTGVKGHVDSGIMKIPRIFIHDeikkeekeklkPAMASTYKVPIIDME  243
             DR  +LKAFDD KTGVKG VD+GI ++P IF             KP  +S + +P ID++
Sbjct  8     DRSIQLKAFDDTKTGVKGLVDAGISEVPAIF---RAPPVTLASPKPPSSSEFTIPTIDLK  64

Query  244   GLHTDHTTRRSEIIKEIRDACQTWGFFQIINHGIPTQVLDEMIDGVRQFHELDSEVKKQF  423
             G     +  R  ++++IRDA + WGFFQ++NHGIP  VL++M +G+R+FHE D+EVKK F
Sbjct  65    GGGGADSITRRNLVEKIRDAAEKWGFFQVVNHGIPLDVLEKMKEGIREFHEQDTEVKKGF  124

Query  424   YSRDLTRKVVYNTNFDFHTSPAATWRDTLYFIMAPHPPTPQELPQVCRDILIKYSNSVQK  603
             YSRD   K+VY++NFD  +S AA WRDTL    AP PP  ++LP  C +++I+YS  V K
Sbjct  125   YSRDPASKMVYSSNFDLFSSSAANWRDTLGCYTAPDPPRQEDLPATCGEMMIEYSKEVMK  184

Query  604   LGLCLLELFSESLGLHKNHLEKLGCAVGLSIFGQYYPACPEPELTFALRDHSDSGFFTVL  783
             LG  L EL SE+LGL+ NHL+ + C   L + G YYP CP+P+LT  L  HSD+ F T+L
Sbjct  185   LGELLFELLSEALGLNTNHLKDMDCTNSLLLLGHYYPPCPQPDLTLGLTKHSDNSFLTLL  244

Query  784   NQDTQIGGLQVLHENQWVDVPPLHGALVVNVADLLQLITNDKFKSVVHRVIAQKIAPRVS  963
              QD  IGGLQVLH   WVDVPP+ GALVVNV DLLQLITNDKF SV HRV+A +  PR+S
Sbjct  245   LQD-HIGGLQVLHGQYWVDVPPVPGALVVNVGDLLQLITNDKFISVEHRVLANEDGPRIS  303

Query  964   VASFFRTIPGDVDAKKVYGPIKELVSDENPPLYRETTTEEYLMHFQKKGLDGTSGLLRFR  1143
             VA FF +    +   ++YGPIKEL+S++N P YR+TT  EY   ++ KG DGTSGLL  +
Sbjct  304   VACFFSSYL--MANPRLYGPIKELLSEQNHPKYRDTTITEYAKFYRSKGFDGTSGLLYLK  361

Query  1144  L  1146
             +
Sbjct  362   I  362



>ref|XP_004297996.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
3-like [Fragaria vesca subsp. vesca]
Length=637

 Score =   394 bits (1013),  Expect = 9e-127, Method: Compositional matrix adjust.
 Identities = 196/364 (54%), Positives = 258/364 (71%), Gaps = 7/364 (2%)
 Frame = +1

Query  58    DYDRKSELKAFDDMKTGVKGHVDSGIMKIPRIFIHDeikkeekeklkPAMASTYKVPIID  237
             +YDRK ELKAFDD K GVKG VD+GI +IPRIF H   +            S + +P+ID
Sbjct  280   NYDRKHELKAFDDTKEGVKGLVDAGITEIPRIFYHPPDECSNDYTFD-HEESQHSIPVID  338

Query  238   MEGLHTDHTTRRSEIIKEIRDACQTWGFFQIINHGIPTQVLDEMIDGVRQFHELDSEVKK  417
             +EGL     T+R EI+  + +A +TWGFFQI NHGIP  VL+EM  GV  FHE D+EVKK
Sbjct  339   LEGLFD--PTKRKEIVAAVGEASETWGFFQIENHGIPFDVLEEMKKGVLGFHEQDTEVKK  396

Query  418   QFYSRDLTRK-VVYNTNFDFHTSPAATWRDTLYFIMAPHPPTPQELPQVCRDILIKYSNS  594
             QFY+RD +   V+YN+NFD +++PA  WRD+    MAP PP  ++LP+VCR+IL++YS  
Sbjct  397   QFYTRDHSSSPVIYNSNFDLYSAPATNWRDSFLCYMAPIPPKIEDLPEVCREILVEYSKQ  456

Query  595   VQKLGLCLLELFSESLGLHKNHLEKLGCAVGLSIFGQYYPACPEPELTFALRDHSDSGFF  774
             V KLG  L EL SE+LGL  +HL  + C+ GL + G YYP CP+PELT     H+D+ F 
Sbjct  457   VMKLGKLLFELLSEALGLKPSHLNDIDCSEGLLVLGHYYPPCPQPELTMGTSKHADNNFM  516

Query  775   TVLNQDTQIGGLQVLHENQWVDVPPLHGALVVNVADLLQLITNDKFKSVVHRVIAQKIAP  954
             +VL QD  IGGLQV H+N+W+DVP + GALVVN+ DL+QLI+ND FKSV HRV+A +  P
Sbjct  517   SVLLQD-DIGGLQVFHQNKWIDVPHVPGALVVNIGDLIQLISNDIFKSVEHRVMANRRGP  575

Query  955   RVSVASFFRTIPGDVDAKKVYGPIKELVSDENPPLYRETTTEEYLMHFQKKGLDGTSGLL  1134
             RVSVASFF T  G   + K++GPIKEL+S++NPP YRETT  ++ +++++KGL+G S L 
Sbjct  576   RVSVASFFST--GVRPSTKLFGPIKELLSEDNPPKYRETTLRDFNVYYREKGLNGKSALS  633

Query  1135  RFRL  1146
              F+L
Sbjct  634   HFKL  637


 Score =   212 bits (539),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 110/188 (59%), Positives = 138/188 (73%), Gaps = 3/188 (2%)
 Frame = +1

Query  571   ILIKYSNSVQKLGLCLLELFSESLGLHKNHLEKLGCAVGLSIFGQYYPACPEPELTFALR  750
             IL++YSN V KLG  L +L SESLGL ++HL  + C+ GL + G YYPACP+PELT    
Sbjct  66    ILVEYSNQVIKLGKLLFKLLSESLGLKRSHLNDIDCSEGLLVIGHYYPACPQPELTLGTS  125

Query  751   DHSDSGFFTVLNQDTQIGGLQVLHENQWVDVPPLHGALVVNVADLLQLITNDKFKSVVHR  930
              H+D+ F T+L QD  IGGLQVLH N+W+DVPP+ G+LVVN+ D LQLI+NDKFKSV HR
Sbjct  126   KHADNTFITILLQD-NIGGLQVLHHNKWIDVPPVPGSLVVNIGDFLQLISNDKFKSVEHR  184

Query  931   VIAQKIAPRVSVASFFRTIPGDVDAKKVYGPIKELVSDENPPLYRETTTEEYLMHFQKKG  1110
             V+A    PR+SVA FF T  G +   K+YGPIKEL+S+ENPP YRETT  +Y  +++ KG
Sbjct  185   VLANCRGPRISVAGFFST--GLLQLAKLYGPIKELLSEENPPKYRETTVRDYNAYYRGKG  242

Query  1111  LDGTSGLL  1134
             LDG  G L
Sbjct  243   LDGRLGDL  250


 Score = 54.3 bits (129),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 27/45 (60%), Positives = 30/45 (67%), Gaps = 0/45 (0%)
 Frame = +1

Query  28   ASTGGKADSGDYDRKSELKAFDDMKTGVKGHVDSGIMKIPRIFIH  162
            A+T     S  YDRK  LKAFDD K GVKG  D+GI +IPRIF H
Sbjct  2    AATNDDDFSTSYDRKHALKAFDDTKEGVKGLADAGITEIPRIFYH  46



>ref|XP_002889610.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH65869.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=362

 Score =   385 bits (988),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 191/361 (53%), Positives = 251/361 (70%), Gaps = 11/361 (3%)
 Frame = +1

Query  64    DRKSELKAFDDMKTGVKGHVDSGIMKIPRIFIHDeikkeekeklkPAMASTYKVPIIDME  243
             +R ++LKAFD+ KTGVKG VD+GI +IP IF             KP  +S + +P ID++
Sbjct  13    NRSTQLKAFDETKTGVKGLVDAGIAEIPSIF---RAPPATLTSPKPPSSSEFTIPTIDLK  69

Query  244   GLHTDHTTRRSEIIKEIRDACQTWGFFQIINHGIPTQVLDEMIDGVRQFHELDSEVKKQF  423
             G      TRRS ++++I DA + WGFFQ+INHGIP  VL++  +G+R+FHE D++VKK F
Sbjct  70    G----GGTRRS-LVEKIGDAAEKWGFFQVINHGIPMDVLEKKKEGIREFHEQDTQVKKGF  124

Query  424   YSRDLTRKVVYNTNFDFHTSPAATWRDTLYFIMAPHPPTPQELPQVCRDILIKYSNSVQK  603
             YSRD   KVVY++NFD  +SPAA WRDTL    AP PP P++LP  C +++I+YS  V K
Sbjct  125   YSRDPASKVVYSSNFDLFSSPAANWRDTLGCYTAPDPPRPEDLPAACGEMMIEYSKEVMK  184

Query  604   LGLCLLELFSESLGLHKNHLEKLGCAVGLSIFGQYYPACPEPELTFALRDHSDSGFFTVL  783
             LG  L EL SE+LGL+ +HL+ + C   L + G YYP CP+P+LT  L  H D+ F T+L
Sbjct  185   LGKLLFELLSEALGLNTSHLKDMDCTNSLLLLGHYYPPCPQPDLTLGLTKHFDNSFLTIL  244

Query  784   NQDTQIGGLQVLHENQWVDVPPLHGALVVNVADLLQLITNDKFKSVVHRVIAQKIAPRVS  963
              QD  IGGLQVLH+  WVDVPP+ GALVVNV DLLQ ITNDKFKSV HRV+A    PR+S
Sbjct  245   LQD-HIGGLQVLHDQYWVDVPPVPGALVVNVGDLLQHITNDKFKSVEHRVLANVAGPRIS  303

Query  964   VASFFRTIPGDVDAKKVYGPIKELVSDENPPLYRETTTEEYLMHFQKKGLDGTSGLLRFR  1143
             VA FF +    +   +VYGPIK+++S++NPP YR+TT  EY   ++ KG DGTSGLL  +
Sbjct  304   VACFFSSY--LMANPRVYGPIKDILSEQNPPKYRDTTITEYAKFYRSKGFDGTSGLLYLK  361

Query  1144  L  1146
             +
Sbjct  362   I  362



>ref|XP_008224378.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 
1-like [Prunus mume]
Length=378

 Score =   385 bits (989),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 191/363 (53%), Positives = 247/363 (68%), Gaps = 8/363 (2%)
 Frame = +1

Query  64    DRKSELKAFDDMKTGVKGHVDSGIMKIPRIFIHDeikkeekeklkPAMASTYKVPIIDME  243
             DR SELKAFD  K GVKG +D+G+ KIP IF +   +    EK   +    + VPIID+ 
Sbjct  22    DRMSELKAFDAAKAGVKGLLDTGLTKIPSIF-YSSSRPSFDEKKLQSDDVQFSVPIIDLR  80

Query  244   GLHTDHTTRRSEIIKEIRDACQTWGFFQIINHGIPTQVLDEMIDGVRQFHELDSEVKKQF  423
             G+  D  +  + +++++R A + WGFFQ++NHG+P  +LD+MIDG+R+FHE DSEVKK+F
Sbjct  81    GIQNDAVSH-ARVVEKVRHASEKWGFFQVVNHGVPVDILDQMIDGIRRFHEQDSEVKKEF  139

Query  424   YSRDLTRKVVYNTNFDFHTSPAATWRDTLYFIMAPHPPTPQELPQVCRDILIKYSNSVQK  603
             YSRD  +KV Y +N+  + S  A WRDT    +AP PP  +ELP VCR+++ +YS  V  
Sbjct  140   YSRDFGKKVYYMSNYHLYQSSEANWRDTFVCYVAPDPPKQEELPSVCRELVNEYSKQVMD  199

Query  604   LGLCLLELFSESLGLHKNHLEKLGCAVGLSIFGQYYPACPEPELTFALRDHSDSGFFTVL  783
             LG  L EL SE+LGL+ N LE + C   L   G YYPACPE ELT     H+D  F T+L
Sbjct  200   LGSTLFELLSEALGLNPNQLEDMNCGEALLHLGHYYPACPELELTMGTSKHTDGSFITIL  259

Query  784   NQDTQIGGLQVLHENQWVDVPPLHGALVVNVADLLQLITNDKFKSVVHRVIAQKIAPRVS  963
              QD Q+GGLQVLHENQWV+VPP  G+LVVN+ DL+QLITNDKF SV HRVI +   PRVS
Sbjct  260   LQD-QVGGLQVLHENQWVNVPPKQGSLVVNIGDLMQLITNDKFISVDHRVIVKNAGPRVS  318

Query  964   VASFFR--TIPGDVDAKKVYGPIKELVSDENPPLYRETTTEEYLMHFQKKGLDGTSGLLR  1137
             VASFFR   + G+    KVYGPIKEL+S++ P +YRET   +Y+ H+   GL GTS L  
Sbjct  319   VASFFRPYVLTGN---SKVYGPIKELLSEDVPQIYRETDVGDYMKHYLSGGLKGTSALEH  375

Query  1138  FRL  1146
             F+L
Sbjct  376   FKL  378



>ref|NP_172150.1| 2-oxoglutarate-dependent dioxygenase-like protein [Arabidopsis 
thaliana]
 sp|Q8H1S4.1|ACCH3_ARATH RecName: Full=1-aminocyclopropane-1-carboxylate oxidase homolog 
3 [Arabidopsis thaliana]
 gb|AAN13044.1| putative oxidoreductase [Arabidopsis thaliana]
 gb|AEE28019.1| 2-oxoglutarate-dependent dioxygenase-like protein [Arabidopsis 
thaliana]
Length=369

 Score =   385 bits (988),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 190/363 (52%), Positives = 246/363 (68%), Gaps = 4/363 (1%)
 Frame = +1

Query  61    YDRKSELKAFDDMKTGVKGHVDSGIMKIPRIFIHDeikkeekeklkPAMASTYKVPIIDM  240
             +DR SELKAFD+ KTGVKG VDSG+ ++PRIF H  +K    + L   +     +P ID+
Sbjct  10    FDRASELKAFDETKTGVKGLVDSGVSQVPRIFHHPTVKLSTPKPLPSDLLHLKTIPTIDL  69

Query  241   EGLHTDHTTRRSEIIKEIRDACQTWGFFQIINHGIPTQVLDEMIDGVRQFHELDSEVKKQ  420
              G       +R+  I+EI++A   WGFFQ+INHG+  ++L++M  GVR FHE   EV+K+
Sbjct  70    GGRDFQDAIKRNNAIEEIKEAAAKWGFFQVINHGVSLELLEKMKKGVRDFHEQSQEVRKE  129

Query  421   FYSRDLTRKVVYNTNFDFHTSPAATWRDTLYFIMAPHPPTPQELPQVCRDILIKYSNSVQ  600
             FYSRD +R+ +Y +NFD  +SPAA WRDT    MAP  P PQ+LP++CRDI+++YS  V 
Sbjct  130   FYSRDFSRRFLYLSNFDLFSSPAANWRDTFSCTMAPDTPKPQDLPEICRDIMMEYSKQVM  189

Query  601   KLGLCLLELFSESLGLHKNHLEKLGCAVGLSIFGQYYPACPEPELTFALRDHSDSGFFTV  780
              LG  L EL SE+LGL  NHL  + C+ GL +   YYP CPEP+LT     HSD+ F TV
Sbjct  190   NLGKFLFELLSEALGLEPNHLNDMDCSKGLLMLSHYYPPCPEPDLTLGTSQHSDNSFLTV  249

Query  781   LNQDTQIGGLQVLHENQWVDVPPLHGALVVNVADLLQLITNDKFKSVVHRVIAQKIA-PR  957
             L  D QI GLQV  E  W DVP + GAL++N+ DLLQLITNDKF S+ HRV+A +    R
Sbjct  250   LLPD-QIEGLQVRREGHWFDVPHVSGALIINIGDLLQLITNDKFISLEHRVLANRATRAR  308

Query  958   VSVASFFRTIPGDVDAKKVYGPIKELVSDENPPLYRETTTEEYLMHFQKKGLDGTSGLLR  1137
             VSVA FF T  G     ++YGPI+ELVS+ENPP YRETT ++Y  +F  KGLDGTS LL 
Sbjct  309   VSVACFFTT--GVRPNPRMYGPIRELVSEENPPKYRETTIKDYATYFNAKGLDGTSALLH  366

Query  1138  FRL  1146
             F++
Sbjct  367   FKI  369



>ref|XP_002889612.1| hypothetical protein ARALYDRAFT_470684 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH65871.1| hypothetical protein ARALYDRAFT_470684 [Arabidopsis lyrata subsp. 
lyrata]
Length=369

 Score =   385 bits (988),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 190/366 (52%), Positives = 248/366 (68%), Gaps = 4/366 (1%)
 Frame = +1

Query  52    SGDYDRKSELKAFDDMKTGVKGHVDSGIMKIPRIFIHDeikkeekeklkPAMASTYKVPI  231
             +  +DR  ELKAFD+ KTGVKG VD+G+ +IPRIF H  +K    + L   +     +P 
Sbjct  7     ASSFDRAGELKAFDETKTGVKGLVDAGVSQIPRIFHHPSVKLSNHKPLSSDLVHLKTIPT  66

Query  232   IDMEGLHTDHTTRRSEIIKEIRDACQTWGFFQIINHGIPTQVLDEMIDGVRQFHELDSEV  411
             ID+ G   + T++R   I+ I++A + WGFFQ+INHG+   +L++M DGVR FHE   EV
Sbjct  67    IDLGGRIVEDTSKRKNAIEGIKEAAEKWGFFQVINHGVSLDLLEKMKDGVRDFHEQSPEV  126

Query  412   KKQFYSRDLTRKVVYNTNFDFHTSPAATWRDTLYFIMAPHPPTPQELPQVCRDILIKYSN  591
             +K+FYSRD +R+ +Y++NFD  +SPAA WRDT    MAP  P PQ+LP++CRD++++YS 
Sbjct  127   RKEFYSRDFSRRFLYSSNFDLFSSPAANWRDTFSCTMAPDTPKPQDLPEICRDVMMEYSK  186

Query  592   SVQKLGLCLLELFSESLGLHKNHLEKLGCAVGLSIFGQYYPACPEPELTFALRDHSDSGF  771
              V  LG  L EL SE+LGL  NHL  + C+ GL +   YYP CPEP+LTF    HSD+ F
Sbjct  187   QVMILGKFLFELLSEALGLEPNHLNNIDCSKGLLMLSHYYPPCPEPDLTFGTSQHSDNSF  246

Query  772   FTVLNQDTQIGGLQVLHENQWVDVPPLHGALVVNVADLLQLITNDKFKSVVHRVIAQKIA  951
              TVL  D QI GLQV  E  W DVP + GAL++N+ DLLQLITNDKF S+ HRV+A +  
Sbjct  247   LTVLLPD-QIEGLQVRREGYWFDVPHVPGALIINIGDLLQLITNDKFISLEHRVLANRAT  305

Query  952   -PRVSVASFFRTIPGDVDAKKVYGPIKELVSDENPPLYRETTTEEYLMHFQKKGLDGTSG  1128
               RVSVA FF T  G     +VYGPI+ELVS+EN P YRETT  EY  ++  KGLDGTS 
Sbjct  306   RARVSVACFFTT--GVRPNPRVYGPIRELVSEENLPKYRETTIREYATYYNAKGLDGTSA  363

Query  1129  LLRFRL  1146
             LL F++
Sbjct  364   LLHFKI  369



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3881615318581