BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c6273_g1_i1 len=528 path=[506:0-527]

Length=528
                                                                      Score     E

gb|EYU37674.1|  hypothetical protein MIMGU_mgv1a003340mg                205   3e-59   
ref|XP_011088260.1|  PREDICTED: ferredoxin--nitrite reductase, ch...    196   9e-56   
emb|CDP17819.1|  unnamed protein product                                194   2e-55   
gb|ABR13305.1|  putative ferredoxin--nitrite reductase                  183   6e-55   Prunus dulcis [sweet almond]
ref|XP_004230820.1|  PREDICTED: ferredoxin--nitrite reductase, ch...    193   7e-55   
ref|NP_001275023.1|  ferredoxin--nitrite reductase, chloroplastic...    192   2e-54   
ref|XP_009628462.1|  PREDICTED: ferredoxin--nitrite reductase, ch...    190   2e-53   
ref|XP_009628648.1|  PREDICTED: ferredoxin--nitrite reductase, ch...    189   2e-53   
dbj|BAD15363.1|  nitrite reductase                                      189   2e-53   Nicotiana tabacum [American tobacco]
ref|XP_009776470.1|  PREDICTED: LOW QUALITY PROTEIN: ferredoxin--...    188   7e-53   
ref|XP_009783559.1|  PREDICTED: ferredoxin--nitrite reductase, ch...    187   2e-52   
dbj|BAD15364.1|  nitrite reductase                                      187   2e-52   Nicotiana tabacum [American tobacco]
gb|KDO59703.1|  hypothetical protein CISIN_1g047572mg                   186   3e-52   
ref|XP_002518763.1|  Ferredoxin--nitrite reductase, chloroplast p...    186   4e-52   Ricinus communis
ref|XP_006423019.1|  hypothetical protein CICLE_v10028067mg             185   8e-52   
ref|XP_010530781.1|  PREDICTED: ferredoxin--nitrite reductase, ch...    184   1e-51   
dbj|BAE48314.1|  nitrite reductase                                      177   4e-51   Capsicum annuum
ref|XP_006384408.1|  Ferredoxin--nitrite reductase family protein       182   6e-51   
gb|ABK95605.1|  unknown                                                 182   7e-51   Populus trichocarpa [western balsam poplar]
emb|CAA46940.1|  ferredoxin--nitrite reductase                          182   9e-51   Nicotiana tabacum [American tobacco]
ref|XP_006487107.1|  PREDICTED: ferredoxin--nitrite reductase, ch...    182   1e-50   
prf||1908371A  nitrite reductase                                        182   1e-50
ref|XP_010548020.1|  PREDICTED: ferredoxin--nitrite reductase, ch...    182   2e-50   
ref|XP_008236500.1|  PREDICTED: ferredoxin--nitrite reductase, ch...    181   2e-50   
ref|XP_003607969.1|  Ferredoxin-nitrite reductase                       181   3e-50   
ref|XP_011005977.1|  PREDICTED: ferredoxin--nitrite reductase, ch...    180   8e-50   
ref|XP_007042430.1|  Ferredoxin--nitrite reductase, chloroplastic       179   1e-49   
ref|XP_010028471.1|  PREDICTED: ferredoxin--nitrite reductase, ch...    179   1e-49   
ref|XP_010468620.1|  PREDICTED: ferredoxin--nitrite reductase, ch...    170   2e-49   
pdb|3B0H|A  Chain A, Assimilatory Nitrite Reductase (Nii4) From T...    178   3e-49   
ref|XP_007201180.1|  hypothetical protein PRUPE_ppa003315mg             178   3e-49   
ref|XP_010263547.1|  PREDICTED: ferredoxin--nitrite reductase, ch...    178   4e-49   
ref|XP_008373138.1|  PREDICTED: ferredoxin--nitrite reductase, ch...    177   4e-49   
pdb|3VLX|A  Chain A, Assimilatory Nitrite Reductase (Nii3) - N226...    177   5e-49   
pdb|3B0L|A  Chain A, M175g Mutant Of Assimilatory Nitrite Reducta...    177   5e-49   
ref|XP_004505220.1|  PREDICTED: ferredoxin--nitrite reductase, ch...    177   5e-49   
pdb|3B0N|A  Chain A, Q448k Mutant Of Assimilatory Nitrite Reducta...    177   5e-49   
pdb|3B0M|A  Chain A, M175k Mutant Of Assimilatory Nitrite Reducta...    177   5e-49   
gb|KDP42275.1|  hypothetical protein JCGZ_01599                         177   5e-49   
pdb|3B0J|A  Chain A, M175e Mutant Of Assimilatory Nitrite Reducta...    177   5e-49   
pdb|3B0G|A  Chain A, Assimilatory Nitrite Reductase (Nii3) From T...    177   5e-49   
ref|XP_004248736.1|  PREDICTED: ferredoxin--nitrite reductase, ch...    177   9e-49   
ref|XP_009346246.1|  PREDICTED: ferredoxin--nitrite reductase, ch...    177   9e-49   
ref|XP_006349625.1|  PREDICTED: ferredoxin--nitrite reductase, ch...    176   1e-48   
sp|P38500.1|NIR_BETPN  RecName: Full=Ferredoxin--nitrite reductas...    175   4e-48   Betula pendula [white birch]
ref|XP_003529397.1|  PREDICTED: ferredoxin--nitrite reductase, ch...    174   7e-48   
ref|NP_001268194.1|  ferredoxin--nitrite reductase, chloroplastic...    174   1e-47   
gb|ADJ68001.1|  nitrite reductase protein                               173   2e-47   
gb|AAC17127.1|  nitrite reductase                                       172   3e-47   Capsicum annuum
gb|EPS71034.1|  hypothetical protein M569_03724                         171   1e-46   
ref|XP_007156512.1|  hypothetical protein PHAVU_003G292100g             171   2e-46   
ref|XP_002883906.1|  hypothetical protein ARALYDRAFT_899777             171   2e-46   
gb|AAA74456.1|  nitrite reductase                                       170   3e-46   Phaseolus vulgaris [French bean]
gb|AGQ43559.1|  nitrite reductase                                       170   3e-46   
ref|XP_008456121.1|  PREDICTED: ferredoxin--nitrite reductase, ch...    170   3e-46   
emb|CDY72359.1|  BnaA07g36300D                                          167   4e-46   
gb|AAN31830.1|  putative ferredoxin--nitrite reductase                  169   6e-46   Arabidopsis thaliana [mouse-ear cress]
ref|NP_179164.1|  Ferredoxin--nitrite reductase                         169   6e-46   Arabidopsis thaliana [mouse-ear cress]
emb|CAC06095.1|  ferredoxin-nitrite reductase                           169   7e-46   Lotus japonicus
ref|XP_004140695.1|  PREDICTED: ferredoxin--nitrite reductase, ch...    169   9e-46   
ref|XP_004163915.1|  PREDICTED: LOW QUALITY PROTEIN: ferredoxin--...    169   9e-46   
ref|XP_004294803.1|  PREDICTED: ferredoxin--nitrite reductase, ch...    168   9e-46   
gb|AAN31831.1|  putative ferredoxin--nitrite reductase                  168   1e-45   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010517336.1|  PREDICTED: ferredoxin--nitrite reductase, ch...    168   1e-45   
ref|XP_010467309.1|  PREDICTED: ferredoxin--nitrite reductase, ch...    168   1e-45   
ref|XP_009119404.1|  PREDICTED: ferredoxin--nitrite reductase, ch...    167   4e-45   
gb|KFK40026.1|  hypothetical protein AALP_AA3G320500                    166   9e-45   
pdb|2AKJ|A  Chain A, Structure Of Spinach Nitrite Reductase             166   1e-44   
ref|XP_006826233.1|  hypothetical protein AMTR_s00132p00099120          165   1e-44   
sp|P05314.1|NIR_SPIOL  RecName: Full=Ferredoxin--nitrite reductas...    165   1e-44   Spinacia oleracea
emb|CDY37232.1|  BnaA09g08530D                                          165   1e-44   
ref|XP_010107937.1|  Ferredoxin--nitrite reductase                      165   1e-44   
gb|ADN97117.1|  nitrite reductase                                       165   1e-44   
ref|XP_002454602.1|  hypothetical protein SORBIDRAFT_04g034160          165   2e-44   Sorghum bicolor [broomcorn]
emb|CDX71230.1|  BnaC07g05090D                                          165   2e-44   
ref|XP_010675576.1|  PREDICTED: ferredoxin--nitrite reductase, ch...    165   2e-44   
emb|CDY36642.1|  BnaA07g04150D                                          164   3e-44   
gb|ACD13218.1|  nitrite reductase                                       164   3e-44   Brassica rapa subsp. chinensis [bok-choy]
ref|XP_009123250.1|  PREDICTED: ferredoxin--nitrite reductase, ch...    164   3e-44   
ref|XP_010488973.1|  PREDICTED: ferredoxin--nitrite reductase, ch...    164   3e-44   
gb|AGO67239.1|  ferredoxin--nitrite reductase                           164   3e-44   
ref|XP_006297287.1|  hypothetical protein CARUB_v10013302mg             164   3e-44   
ref|XP_006409539.1|  hypothetical protein EUTSA_v10022613mg             164   4e-44   
ref|NP_001274384.1|  nitrate reductase precursor                        164   6e-44   
ref|XP_004954025.1|  PREDICTED: ferredoxin--nitrite reductase, ch...    163   7e-44   
gb|AAA60450.1|  nitrite reductase                                       162   1e-43   Zea mays [maize]
sp|P17847.1|NIR_MAIZE  RecName: Full=Ferredoxin--nitrite reductas...    162   1e-43   Zea mays [maize]
ref|XP_006379199.1|  hypothetical protein POPTR_0009s10440g             161   1e-43   
gb|KHN37511.1|  Ferredoxin--nitrite reductase, chloroplastic            162   1e-43   
gb|ACG29734.1|  ferredoxin--nitrite reductase                           162   2e-43   Zea mays [maize]
ref|XP_008679282.1|  PREDICTED: ferredoxin--nitrite reductase, ch...    162   2e-43   
ref|XP_001777025.1|  predicted protein                                  160   1e-42   
gb|AAB50233.1|  nitrite reductase                                       160   1e-42   Glycine max [soybeans]
gb|EEC70619.1|  hypothetical protein OsI_01871                          158   4e-42   Oryza sativa Indica Group [Indian rice]
sp|Q42997.1|NIR_ORYSJ  RecName: Full=Ferredoxin--nitrite reductas...    158   5e-42   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001043008.1|  Os01g0357100                                       158   6e-42   Oryza sativa Japonica Group [Japonica rice]
dbj|BAD53072.1|  putative ferredoxin--nitrite reductase, chloropl...    158   6e-42   Oryza sativa Japonica Group [Japonica rice]
ref|XP_001775824.1|  predicted protein                                  157   1e-41   
ref|XP_010943064.1|  PREDICTED: ferredoxin--nitrite reductase, ch...    156   2e-41   
ref|XP_006647964.1|  PREDICTED: ferredoxin--nitrite reductase, ch...    156   2e-41   
ref|XP_002979935.1|  hypothetical protein SELMODRAFT_178021             155   7e-41   
gb|AFW73584.1|  hypothetical protein ZEAMMB73_832658                    152   5e-40   
ref|XP_002987413.1|  hypothetical protein SELMODRAFT_183174             152   7e-40   
ref|XP_008646302.1|  PREDICTED: ferredoxin--nitrite reductase, ch...    152   1e-39   
ref|XP_009417626.1|  PREDICTED: ferredoxin--nitrite reductase, ch...    150   3e-39   
gb|AFW64351.1|  hypothetical protein ZEAMMB73_724678                    142   3e-39   
dbj|BAB55003.1|  nitrite reductase                                      149   8e-39   Prunus persica
gb|AFW64353.1|  hypothetical protein ZEAMMB73_724678                    139   3e-38   
gb|ACL13516.1|  ferredoxin-nitrite reductase precursor                  147   3e-38   Triticum aestivum [Canadian hard winter wheat]
ref|XP_003570568.1|  PREDICTED: ferredoxin--nitrite reductase, ch...    147   3e-38   
gb|ACL13515.1|  ferredoxin-nitrite reductase precursor                  145   1e-37   Triticum aestivum [Canadian hard winter wheat]
dbj|BAK02992.1|  predicted protein                                      144   3e-37   
ref|XP_002507511.1|  nadh-nitrite reductase                           99.8    1e-20   Micromonas commoda
ref|XP_001419920.1|  predicted protein                                92.4    2e-18   Ostreococcus lucimarinus CCE9901
gb|EEE57859.1|  hypothetical protein OsJ_08501                        90.5    6e-18   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003081527.1|  Nii, plastid-targeted nitrite reductase apoe...  91.3    1e-17   
ref|XP_007514721.1|  nitrite reductase                                89.0    5e-17   
emb|CBI32406.3|  unnamed protein product                              84.0    1e-15   
gb|EAY73990.1|  hypothetical protein OsI_01875                        77.0    7e-15   Oryza sativa Indica Group [Indian rice]
ref|XP_003057941.1|  nitrite reductase fusion with b5r chloroplas...  81.6    2e-14   
gb|ABF46822.1|  putative nitrite reductase                            64.3    5e-10   Fagus sylvatica
gb|ACF22998.1|  nitrite reductase                                     63.5    2e-09   
gb|ABK22801.1|  unknown                                               61.6    3e-09   Picea sitchensis
emb|CBJ25514.1|  ferredoxin nitrite reductase                         63.2    1e-08   
ref|XP_005844715.1|  hypothetical protein CHLNCDRAFT_26644            62.0    3e-08   
ref|XP_005646410.1|  hypothetical protein COCSUDRAFT_29833            61.6    4e-08   
gb|AEW90647.1|  nitrite reductase                                     59.7    2e-07   
emb|CAA70137.1|  nitrite reductase                                    59.3    2e-07   Chlamydomonas reinhardtii
ref|XP_001696787.1|  nitrite reductase                                59.3    2e-07   Chlamydomonas reinhardtii
gb|AAP79144.1|  ferredoxin nitrite reductase                          58.9    4e-07   Bigelowiella natans
ref|XP_005714928.1|  unnamed protein product                          56.2    3e-06   
dbj|BAE46578.1|  nitrite reductase                                    54.3    4e-06   Solanum lycopersicum
ref|XP_005791045.1|  ferredoxin-nitrite reductase precursor           55.1    6e-06   
ref|XP_005777302.1|  putative nitrite reductase                       55.1    6e-06   
gb|AAT99257.1|  nitrite reductase                                     54.3    1e-05   Pseudochlorella pringsheimii
dbj|BAE46576.1|  nitrite reductase                                    52.4    2e-05   Physalis alkekengi [Chinese-lantern]
ref|XP_002180496.1|  predicted protein                                52.4    4e-05   Phaeodactylum tricornutum CCAP 1055/1
ref|XP_005704382.1|  ferredoxin-nitrite reductase                     52.0    5e-05   
gb|EWM20575.1|  nitrite reductase                                     51.2    1e-04   
gb|EJK78098.1|  nitrite reductase                                     50.4    2e-04   
ref|WP_012629926.1|  ferredoxin-nitrite reductase                     50.4    2e-04   
dbj|BAE46575.1|  nitrite reductase                                    49.7    2e-04   Physalis alkekengi [Chinese-lantern]
dbj|BAE46577.1|  nitrite reductase                                    49.7    2e-04   Solanum lycopersicum
ref|WP_006508771.1|  precorrin-3B synthase                            50.1    3e-04   
ref|XP_002289265.1|  nitrite reductase-ferredoxin dependent           49.7    4e-04   Thalassiosira pseudonana CCMP1335
ref|WP_017321046.1|  ferredoxin-nitrite reductase                     49.3    5e-04   



>gb|EYU37674.1| hypothetical protein MIMGU_mgv1a003340mg [Erythranthe guttata]
Length=591

 Score =   205 bits (522),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 107/141 (76%), Positives = 117/141 (83%), Gaps = 3/141 (2%)
 Frame = -1

Query  414  MASLSVKFLAPSLQIHHANKLPKSTRLHatp---pqavapsppPEIDTARLEPRVEERDG  244
            M+SLSV+FLAPSL  + +N   KSTRL AT      A   S   E+D  RLEPRVEE+DG
Sbjct  1    MSSLSVRFLAPSLLTNSSNNRFKSTRLQATTPPQTAAPPSSGAAEVDALRLEPRVEEKDG  60

Query  243  YFVLKEKFRQGINPQEKVKIEKEPMKLFMENGIEELANIPFEEIEQSKLTKDDIDVRLKW  64
            YF+LKEKFRQGINPQEKVKIEKEPMKLFMENGIE+LA I  EEIE+SKLTK+DIDVRLKW
Sbjct  61   YFILKEKFRQGINPQEKVKIEKEPMKLFMENGIEDLAKISLEEIEKSKLTKEDIDVRLKW  120

Query  63   LGLFHRRKHHYGRFMMRLKLP  1
            LGLFHRRKHHYGRFMMRLKLP
Sbjct  121  LGLFHRRKHHYGRFMMRLKLP  141



>ref|XP_011088260.1| PREDICTED: ferredoxin--nitrite reductase, chloroplastic [Sesamum 
indicum]
Length=588

 Score =   196 bits (497),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 106/140 (76%), Positives = 115/140 (82%), Gaps = 4/140 (3%)
 Frame = -1

Query  414  MASLSVKFLAPSLQIHHANKLPKSTRLHat--ppqavapsppPEIDTARLEPRVEERDGY  241
            M+SLSVKFLAPSL  + +N+  KS RL AT     A   S    +D  RLEPRVEE+DGY
Sbjct  1    MSSLSVKFLAPSLP-NGSNRF-KSVRLQATPPQTVAAPASGAAGVDAERLEPRVEEKDGY  58

Query  240  FVLKEKFRQGINPQEKVKIEKEPMKLFMENGIEELANIPFEEIEQSKLTKDDIDVRLKWL  61
            FVLKEKFRQGINPQEKVKIEKEPMKLFMENGIEELA +  EEIE+SKL+KDDIDVRLKWL
Sbjct  59   FVLKEKFRQGINPQEKVKIEKEPMKLFMENGIEELAKMSLEEIEKSKLSKDDIDVRLKWL  118

Query  60   GLFHRRKHHYGRFMMRLKLP  1
            GLFHRRKH YGRFMMRLKLP
Sbjct  119  GLFHRRKHQYGRFMMRLKLP  138



>emb|CDP17819.1| unnamed protein product [Coffea canephora]
Length=590

 Score =   194 bits (494),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 107/147 (73%), Positives = 118/147 (80%), Gaps = 16/147 (11%)
 Frame = -1

Query  414  MASLSVKFLAPSLQIHHANKLP--KSTRLHatppq-------avapsppPEIDTARLEPR  262
            MASLSVKFLAP       N LP  K+ RLHATPP        A +     ++D  RLEPR
Sbjct  1    MASLSVKFLAP-------NPLPNSKTFRLHATPPASQTVAPPASSSGGAADVDALRLEPR  53

Query  261  VEERDGYFVLKEKFRQGINPQEKVKIEKEPMKLFMENGIEELANIPFEEIEQSKLTKDDI  82
            VEER+GY+VLKEK+RQGINP EKVKIEKEPM+LFMENGI+ELANIP EEI++SKLTKDDI
Sbjct  54   VEEREGYWVLKEKYRQGINPPEKVKIEKEPMRLFMENGIQELANIPLEEIDKSKLTKDDI  113

Query  81   DVRLKWLGLFHRRKHHYGRFMMRLKLP  1
            DVRLKWLGLFHRRKHHYGRFMMRLKLP
Sbjct  114  DVRLKWLGLFHRRKHHYGRFMMRLKLP  140



>gb|ABR13305.1| putative ferredoxin--nitrite reductase [Prunus dulcis]
Length=174

 Score =   183 bits (464),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 91/137 (66%), Positives = 105/137 (77%), Gaps = 4/137 (3%)
 Frame = -1

Query  411  ASLSVKFLAPSLQIHHANKLPKSTRLHatppqavapsppPEIDTARLEPRVEERDGYFVL  232
            +SLSV+FL+P L    ++ LP   +                ++ ARLEPRVEERDGY+VL
Sbjct  3    SSLSVQFLSPPL----SSALPCCKQTRLAAATTPLAPVSTNVEAARLEPRVEERDGYWVL  58

Query  231  KEKFRQGINPQEKVKIEKEPMKLFMENGIEELANIPFEEIEQSKLTKDDIDVRLKWLGLF  52
            KEKFR GIN QEKVKI+KEPMKLFMENGIEELA   FEE+E+SK +KDDIDVRLKWLGLF
Sbjct  59   KEKFRGGINVQEKVKIQKEPMKLFMENGIEELAKTSFEELEKSKDSKDDIDVRLKWLGLF  118

Query  51   HRRKHHYGRFMMRLKLP  1
            HRRK+HYGRFMMRLKLP
Sbjct  119  HRRKNHYGRFMMRLKLP  135



>ref|XP_004230820.1| PREDICTED: ferredoxin--nitrite reductase, chloroplastic [Solanum 
lycopersicum]
Length=587

 Score =   193 bits (491),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 107/140 (76%), Positives = 121/140 (86%), Gaps = 4/140 (3%)
 Frame = -1

Query  414  MASLSVKFLAPSLQIHHANKLPKST--RLHatppqavapsppPEIDTARLEPRVEERDGY  241
            MAS S+KFLAPSL   +  +  KS+  +L+ATPPQ VA + PPE+   RLEPRVEE+DGY
Sbjct  1    MASFSIKFLAPSLP--NPTRFSKSSIVKLNATPPQTVAAAGPPEVAAERLEPRVEEKDGY  58

Query  240  FVLKEKFRQGINPQEKVKIEKEPMKLFMENGIEELANIPFEEIEQSKLTKDDIDVRLKWL  61
            ++LKE+FRQGINPQEKVKIEKEPMKLFMENGIEELA IP EEI+QSKLTKDDIDVRLKWL
Sbjct  59   WILKEQFRQGINPQEKVKIEKEPMKLFMENGIEELAKIPIEEIDQSKLTKDDIDVRLKWL  118

Query  60   GLFHRRKHHYGRFMMRLKLP  1
            GLFHRRK+ YGRFMMRLKLP
Sbjct  119  GLFHRRKNQYGRFMMRLKLP  138



>ref|NP_001275023.1| ferredoxin--nitrite reductase, chloroplastic-like [Solanum tuberosum]
 emb|CBL43265.1| nitrite reductase [Solanum tuberosum]
Length=587

 Score =   192 bits (488),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 107/140 (76%), Positives = 119/140 (85%), Gaps = 4/140 (3%)
 Frame = -1

Query  414  MASLSVKFLAPSLQIHHANKLPKST--RLHatppqavapsppPEIDTARLEPRVEERDGY  241
            MAS S+KFLAPSL   +  +  KST  +L+ATPPQ VA   PPE+   RLEPRVEE+DGY
Sbjct  1    MASFSIKFLAPSLP--NPTRFSKSTIVKLNATPPQTVAAVGPPEVAAERLEPRVEEKDGY  58

Query  240  FVLKEKFRQGINPQEKVKIEKEPMKLFMENGIEELANIPFEEIEQSKLTKDDIDVRLKWL  61
            ++ KE+FRQGINPQEKVKIEKEPMKLFMENGIEELA IP EEI+QSKLTKDDIDVRLKWL
Sbjct  59   WIQKEQFRQGINPQEKVKIEKEPMKLFMENGIEELAKIPIEEIDQSKLTKDDIDVRLKWL  118

Query  60   GLFHRRKHHYGRFMMRLKLP  1
            GLFHRRK+ YGRFMMRLKLP
Sbjct  119  GLFHRRKNQYGRFMMRLKLP  138



>ref|XP_009628462.1| PREDICTED: ferredoxin--nitrite reductase, chloroplastic-like 
[Nicotiana tomentosiformis]
 dbj|BAD15365.1| nitrite reductase [Nicotiana tabacum]
Length=587

 Score =   190 bits (482),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 106/140 (76%), Positives = 115/140 (82%), Gaps = 4/140 (3%)
 Frame = -1

Query  414  MASLSVKFLAPSLQIHHANKLPKSTRLHatppqavap--sppPEIDTARLEPRVEERDGY  241
            MAS SVKF A SL   + N+  ++ +LHATPPQ VA   S   EI + RLEPRVEE+DGY
Sbjct  1    MASFSVKFSATSLP--NPNRFSRTAKLHATPPQTVAVPPSGEAEIASERLEPRVEEKDGY  58

Query  240  FVLKEKFRQGINPQEKVKIEKEPMKLFMENGIEELANIPFEEIEQSKLTKDDIDVRLKWL  61
            +VLKEKFRQGINP EK KIEKEPMKLFMENGIE+LA I  EEIE SKLTKDDIDVRLKWL
Sbjct  59   WVLKEKFRQGINPAEKAKIEKEPMKLFMENGIEDLAKISLEEIEGSKLTKDDIDVRLKWL  118

Query  60   GLFHRRKHHYGRFMMRLKLP  1
            GLFHRRKHHYGRFMMRLKLP
Sbjct  119  GLFHRRKHHYGRFMMRLKLP  138



>ref|XP_009628648.1| PREDICTED: ferredoxin--nitrite reductase, chloroplastic-like 
[Nicotiana tomentosiformis]
Length=587

 Score =   189 bits (481),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 103/139 (74%), Positives = 115/139 (83%), Gaps = 2/139 (1%)
 Frame = -1

Query  414  MASLSVKFLAPSLQIHHANKLPKSTRLHatppqavapsppP-EIDTARLEPRVEERDGYF  238
            MAS S+KFLAPSL  + A     + +LHATPP   AP     E+   RLEPRVEE+DGY+
Sbjct  1    MASFSIKFLAPSLP-NPARFSKNAVKLHATPPSVAAPPAGAPEVAAERLEPRVEEKDGYW  59

Query  237  VLKEKFRQGINPQEKVKIEKEPMKLFMENGIEELANIPFEEIEQSKLTKDDIDVRLKWLG  58
            +LKE+FR+GINPQEKVKIEKEPMKLFMENGIEELA IP EEI+QSKLTKDDIDVRLKWLG
Sbjct  60   ILKEQFRKGINPQEKVKIEKEPMKLFMENGIEELAKIPIEEIDQSKLTKDDIDVRLKWLG  119

Query  57   LFHRRKHHYGRFMMRLKLP  1
            LFHRRK+ YGRFMMRLKLP
Sbjct  120  LFHRRKNQYGRFMMRLKLP  138



>dbj|BAD15363.1| nitrite reductase [Nicotiana tabacum]
Length=587

 Score =   189 bits (481),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 103/139 (74%), Positives = 115/139 (83%), Gaps = 2/139 (1%)
 Frame = -1

Query  414  MASLSVKFLAPSLQIHHANKLPKSTRLHatppqavapsppP-EIDTARLEPRVEERDGYF  238
            MAS S+KFLAPSL  + A     + +LHATPP   AP     E+   RLEPRVEE+DGY+
Sbjct  1    MASFSIKFLAPSLP-NPARFSKNAVKLHATPPSVAAPPTGAPEVAAERLEPRVEEKDGYW  59

Query  237  VLKEKFRQGINPQEKVKIEKEPMKLFMENGIEELANIPFEEIEQSKLTKDDIDVRLKWLG  58
            +LKE+FR+GINPQEKVKIEKEPMKLFMENGIEELA IP EEI+QSKLTKDDIDVRLKWLG
Sbjct  60   ILKEQFRKGINPQEKVKIEKEPMKLFMENGIEELAKIPIEEIDQSKLTKDDIDVRLKWLG  119

Query  57   LFHRRKHHYGRFMMRLKLP  1
            LFHRRK+ YGRFMMRLKLP
Sbjct  120  LFHRRKNQYGRFMMRLKLP  138



>ref|XP_009776470.1| PREDICTED: LOW QUALITY PROTEIN: ferredoxin--nitrite reductase, 
chloroplastic-like [Nicotiana sylvestris]
Length=578

 Score =   188 bits (477),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 102/139 (73%), Positives = 114/139 (82%), Gaps = 2/139 (1%)
 Frame = -1

Query  414  MASLSVKFLAPSLQIHHANKLPKSTRLHatppqavapsppP-EIDTARLEPRVEERDGYF  238
            MAS S+KFLAPSL  + A     + +LHATPP   AP     E+   RLEPRVEE+DGY+
Sbjct  1    MASFSIKFLAPSLP-NPARFSKNAVKLHATPPSVAAPPTGAPEVAAERLEPRVEEKDGYW  59

Query  237  VLKEKFRQGINPQEKVKIEKEPMKLFMENGIEELANIPFEEIEQSKLTKDDIDVRLKWLG  58
            +LKE+FR+GINPQEKVKIEKEPMKLFMENGIEEL  IP EEI+QSKLTKDDIDVRLKWLG
Sbjct  60   ILKEQFRKGINPQEKVKIEKEPMKLFMENGIEELTKIPIEEIDQSKLTKDDIDVRLKWLG  119

Query  57   LFHRRKHHYGRFMMRLKLP  1
            LFHRRK+ YGRFMMRLKLP
Sbjct  120  LFHRRKNQYGRFMMRLKLP  138



>ref|XP_009783559.1| PREDICTED: ferredoxin--nitrite reductase, chloroplastic-like 
[Nicotiana sylvestris]
Length=584

 Score =   187 bits (474),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 105/140 (75%), Positives = 112/140 (80%), Gaps = 7/140 (5%)
 Frame = -1

Query  414  MASLSVKFLAPSLQIHHANKLPKSTRLHat--ppqavapsppPEIDTARLEPRVEERDGY  241
            MAS SVKF A SL  H      + ++LHAT     AVAPS   EI + RLEPRVEE+DGY
Sbjct  1    MASFSVKFSATSLPNHK-----RFSKLHATPPQTVAVAPSGAAEIASERLEPRVEEKDGY  55

Query  240  FVLKEKFRQGINPQEKVKIEKEPMKLFMENGIEELANIPFEEIEQSKLTKDDIDVRLKWL  61
            +VLKEKFRQGINP EK KIEKEPMKLFMENGIE+LA I  EEIE SKLTKDDIDVRLKWL
Sbjct  56   WVLKEKFRQGINPAEKAKIEKEPMKLFMENGIEDLAKISLEEIEGSKLTKDDIDVRLKWL  115

Query  60   GLFHRRKHHYGRFMMRLKLP  1
            GLFHRRKHHYGRFMMRLKLP
Sbjct  116  GLFHRRKHHYGRFMMRLKLP  135



>dbj|BAD15364.1| nitrite reductase [Nicotiana tabacum]
Length=584

 Score =   187 bits (474),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 105/140 (75%), Positives = 112/140 (80%), Gaps = 7/140 (5%)
 Frame = -1

Query  414  MASLSVKFLAPSLQIHHANKLPKSTRLHat--ppqavapsppPEIDTARLEPRVEERDGY  241
            MAS SVKF A SL  H      + ++LHAT     AVAPS   EI + RLEPRVEE+DGY
Sbjct  1    MASFSVKFSATSLPNHK-----RFSKLHATPPQTVAVAPSGAAEIASERLEPRVEEKDGY  55

Query  240  FVLKEKFRQGINPQEKVKIEKEPMKLFMENGIEELANIPFEEIEQSKLTKDDIDVRLKWL  61
            +VLKEKFRQGINP EK KIEKEPMKLFMENGIE+LA I  EEIE SKLTKDDIDVRLKWL
Sbjct  56   WVLKEKFRQGINPAEKAKIEKEPMKLFMENGIEDLAKISLEEIEGSKLTKDDIDVRLKWL  115

Query  60   GLFHRRKHHYGRFMMRLKLP  1
            GLFHRRKHHYGRFMMRLKLP
Sbjct  116  GLFHRRKHHYGRFMMRLKLP  135



>gb|KDO59703.1| hypothetical protein CISIN_1g047572mg [Citrus sinensis]
Length=595

 Score =   186 bits (473),  Expect = 3e-52, Method: Composition-based stats.
 Identities = 98/137 (72%), Positives = 110/137 (80%), Gaps = 4/137 (3%)
 Frame = -1

Query  399  VKFLAPSLQIHHA--NKLPKSTRLHatppqav--apsppPEIDTARLEPRVEERDGYFVL  232
            V+F +P L    A  +  PK+ R+HAT P       +  PE+D  RLEPRVEERDGYFVL
Sbjct  10   VRFASPLLPSPAAATSASPKTWRVHATTPAVAPVTTTSAPEVDAERLEPRVEERDGYFVL  69

Query  231  KEKFRQGINPQEKVKIEKEPMKLFMENGIEELANIPFEEIEQSKLTKDDIDVRLKWLGLF  52
            KEKFR+GINPQEKVKIEKEPMKLFMENGIE+LA +  EEI+Q+K TKDDIDVRLKWLGLF
Sbjct  70   KEKFRKGINPQEKVKIEKEPMKLFMENGIEDLAKLSMEEIDQAKNTKDDIDVRLKWLGLF  129

Query  51   HRRKHHYGRFMMRLKLP  1
            HRRKHHYGRFMMRLKLP
Sbjct  130  HRRKHHYGRFMMRLKLP  146



>ref|XP_002518763.1| Ferredoxin--nitrite reductase, chloroplast precursor, putative 
[Ricinus communis]
 gb|EEF43688.1| Ferredoxin--nitrite reductase, chloroplast precursor, putative 
[Ricinus communis]
Length=587

 Score =   186 bits (472),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 100/139 (72%), Positives = 113/139 (81%), Gaps = 3/139 (2%)
 Frame = -1

Query  414  MASL-SVKFLAPSLQIHHANKLPKSTRLHatppqavapsppPEIDTARLEPRVEERDGYF  238
            M+SL SV+ L+P L   H+ +  +STR+ A  P  V P    ++D  RLEPRVEE+DGYF
Sbjct  1    MSSLPSVRLLSPPLS-SHSTRPTRSTRIFAAGPTVVQPVEV-QVDAERLEPRVEEKDGYF  58

Query  237  VLKEKFRQGINPQEKVKIEKEPMKLFMENGIEELANIPFEEIEQSKLTKDDIDVRLKWLG  58
            VLKEKFRQGINPQEKVKIEKEPMKLFMENGIEELA +  EEI+Q+KLTKDDIDVRLKWLG
Sbjct  59   VLKEKFRQGINPQEKVKIEKEPMKLFMENGIEELAKLSMEEIDQNKLTKDDIDVRLKWLG  118

Query  57   LFHRRKHHYGRFMMRLKLP  1
            LFHRRK  YGRFMMRLKLP
Sbjct  119  LFHRRKQQYGRFMMRLKLP  137



>ref|XP_006423019.1| hypothetical protein CICLE_v10028067mg [Citrus clementina]
 gb|ESR36259.1| hypothetical protein CICLE_v10028067mg [Citrus clementina]
Length=595

 Score =   185 bits (470),  Expect = 8e-52, Method: Composition-based stats.
 Identities = 97/137 (71%), Positives = 109/137 (80%), Gaps = 4/137 (3%)
 Frame = -1

Query  399  VKFLAPSLQIHHA--NKLPKSTRLHatppqavapsppP--EIDTARLEPRVEERDGYFVL  232
            V+F +P L    A  +  PK+ R+HAT P     +     E+D  RLEPRVEERDGYFVL
Sbjct  10   VRFASPLLPSPAAATSASPKTWRVHATTPTVAPVTTSSAPEVDAERLEPRVEERDGYFVL  69

Query  231  KEKFRQGINPQEKVKIEKEPMKLFMENGIEELANIPFEEIEQSKLTKDDIDVRLKWLGLF  52
            KEKFR+GINPQEKVKIEKEPMKLFMENGIE+LA +  EEI+Q+K TKDDIDVRLKWLGLF
Sbjct  70   KEKFRKGINPQEKVKIEKEPMKLFMENGIEDLAKLSMEEIDQAKNTKDDIDVRLKWLGLF  129

Query  51   HRRKHHYGRFMMRLKLP  1
            HRRKHHYGRFMMRLKLP
Sbjct  130  HRRKHHYGRFMMRLKLP  146



>ref|XP_010530781.1| PREDICTED: ferredoxin--nitrite reductase, chloroplastic-like 
[Tarenaya hassleriana]
Length=590

 Score =   184 bits (468),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 96/139 (69%), Positives = 111/139 (80%), Gaps = 1/139 (1%)
 Frame = -1

Query  414  MASLSVKFLAP-SLQIHHANKLPKSTRLHatppqavapsppPEIDTARLEPRVEERDGYF  238
            MASLSV+FL+P +L    ++  P+ + L A    A A S  P +D  R+EPRVEE+DG+F
Sbjct  1    MASLSVRFLSPQALLSSGSSSKPQRSVLAAAQTTAPAGSAAPAVDAERIEPRVEEKDGFF  60

Query  237  VLKEKFRQGINPQEKVKIEKEPMKLFMENGIEELANIPFEEIEQSKLTKDDIDVRLKWLG  58
            VLKEKFR+GINPQEKVKIEKEPMKLFMENGIEELA +  EEIE  K +KDDIDVRLKWLG
Sbjct  61   VLKEKFRKGINPQEKVKIEKEPMKLFMENGIEELAKMTLEEIEGDKTSKDDIDVRLKWLG  120

Query  57   LFHRRKHHYGRFMMRLKLP  1
            LFHRRKH YG+FMMRLKLP
Sbjct  121  LFHRRKHQYGKFMMRLKLP  139



>dbj|BAE48314.1| nitrite reductase [Capsicum annuum]
Length=310

 Score =   177 bits (449),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 83/97 (86%), Positives = 91/97 (94%), Gaps = 0/97 (0%)
 Frame = -1

Query  291  EIDTARLEPRVEERDGYFVLKEKFRQGINPQEKVKIEKEPMKLFMENGIEELANIPFEEI  112
            E+   RLEPRVEE+DGY++LKEKFRQGINPQEKVKI+KEPMKLFMENGIEELA IP EEI
Sbjct  1    EVAAERLEPRVEEKDGYWILKEKFRQGINPQEKVKIDKEPMKLFMENGIEELAKIPIEEI  60

Query  111  EQSKLTKDDIDVRLKWLGLFHRRKHHYGRFMMRLKLP  1
            +QSKL+KDDIDVRLKWLGLFHRRK+ YGRFMMRLKLP
Sbjct  61   DQSKLSKDDIDVRLKWLGLFHRRKNQYGRFMMRLKLP  97



>ref|XP_006384408.1| Ferredoxin--nitrite reductase family protein [Populus trichocarpa]
 gb|ERP62205.1| Ferredoxin--nitrite reductase family protein [Populus trichocarpa]
Length=588

 Score =   182 bits (463),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 98/140 (70%), Positives = 112/140 (80%), Gaps = 4/140 (3%)
 Frame = -1

Query  414  MASLSVKFLAPSLQ--IHHANKLPKSTRLHatppqavapsppPEIDTARLEPRVEERDGY  241
            M+SLSV+FL P L   +  ++  P+ TRL A PP    P+    +D  RLEPRVE++DGY
Sbjct  1    MSSLSVRFLTPQLSPTVPSSSARPR-TRLFAGPPTVAQPAETG-VDAGRLEPRVEKKDGY  58

Query  240  FVLKEKFRQGINPQEKVKIEKEPMKLFMENGIEELANIPFEEIEQSKLTKDDIDVRLKWL  61
            +VLKEKFRQGINPQEKVKIEKEPMKLFMENGIEELA +  EEI++ K TKDDIDVRLKWL
Sbjct  59   YVLKEKFRQGINPQEKVKIEKEPMKLFMENGIEELAKLSMEEIDKEKSTKDDIDVRLKWL  118

Query  60   GLFHRRKHHYGRFMMRLKLP  1
            GLFHRRKH YGRFMMRLKLP
Sbjct  119  GLFHRRKHQYGRFMMRLKLP  138



>gb|ABK95605.1| unknown [Populus trichocarpa]
Length=588

 Score =   182 bits (463),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 98/140 (70%), Positives = 112/140 (80%), Gaps = 4/140 (3%)
 Frame = -1

Query  414  MASLSVKFLAPSLQ--IHHANKLPKSTRLHatppqavapsppPEIDTARLEPRVEERDGY  241
            M+SLSV+FL P L   +  ++  P+ TRL A PP    P+    +D  RLEPRVE++DGY
Sbjct  1    MSSLSVRFLTPQLSPTVPSSSARPR-TRLFAGPPTVAQPAETG-VDAGRLEPRVEKKDGY  58

Query  240  FVLKEKFRQGINPQEKVKIEKEPMKLFMENGIEELANIPFEEIEQSKLTKDDIDVRLKWL  61
            +VLKEKFRQGINPQEKVKIEKEPMKLFMENGIEELA +  EEI++ K TKDDIDVRLKWL
Sbjct  59   YVLKEKFRQGINPQEKVKIEKEPMKLFMENGIEELAKLSMEEIDKEKSTKDDIDVRLKWL  118

Query  60   GLFHRRKHHYGRFMMRLKLP  1
            GLFHRRKH YGRFMMRLKLP
Sbjct  119  GLFHRRKHQYGRFMMRLKLP  138



>emb|CAA46940.1| ferredoxin--nitrite reductase [Nicotiana tabacum]
Length=583

 Score =   182 bits (462),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 99/135 (73%), Positives = 112/135 (83%), Gaps = 2/135 (1%)
 Frame = -1

Query  402  SVKFLAPSLQIHHANKLPKSTRLHatppqavapsppP-EIDTARLEPRVEERDGYFVLKE  226
            S+KFLAPSL  + A     + +LHATPP   AP     E+   RLEPRVEE+DGY++LKE
Sbjct  1    SIKFLAPSLP-NPARFSKNAVKLHATPPSVAAPPAGAPEVAAERLEPRVEEKDGYWILKE  59

Query  225  KFRQGINPQEKVKIEKEPMKLFMENGIEELANIPFEEIEQSKLTKDDIDVRLKWLGLFHR  46
            +FR+GINPQEKVKIEK+PMKLFMENGIEELA IP EEI+QSKLTKDDIDVRLKWLGLFHR
Sbjct  60   QFRKGINPQEKVKIEKQPMKLFMENGIEELAKIPIEEIDQSKLTKDDIDVRLKWLGLFHR  119

Query  45   RKHHYGRFMMRLKLP  1
            RK+ YGRFMMRLKLP
Sbjct  120  RKNQYGRFMMRLKLP  134



>ref|XP_006487107.1| PREDICTED: ferredoxin--nitrite reductase, chloroplastic-like 
[Citrus sinensis]
Length=596

 Score =   182 bits (462),  Expect = 1e-50, Method: Composition-based stats.
 Identities = 98/138 (71%), Positives = 110/138 (80%), Gaps = 5/138 (4%)
 Frame = -1

Query  399  VKFLAPSLQIHHA--NKLPKSTRLHatppqav--apsppPEIDTARLEPRVEERDGYFVL  232
            V+F +P L    A  +  PK+ R+HAT P       +  PE+D  RLEPRVEERDGYFVL
Sbjct  10   VRFASPLLPSPAAATSARPKTWRVHATTPAVAPVTTTSAPEVDAERLEPRVEERDGYFVL  69

Query  231  KEKFRQGINPQEKVKIEKEPMKLFM-ENGIEELANIPFEEIEQSKLTKDDIDVRLKWLGL  55
            KEKFR+GINPQEKVKIEKEPMKLFM ENGIE+LA +  EEI+Q+K TKDDIDVRLKWLGL
Sbjct  70   KEKFRKGINPQEKVKIEKEPMKLFMVENGIEDLAKLSMEEIDQAKNTKDDIDVRLKWLGL  129

Query  54   FHRRKHHYGRFMMRLKLP  1
            FHRRKHHYGRFMMRLKLP
Sbjct  130  FHRRKHHYGRFMMRLKLP  147



>prf||1908371A nitrite reductase
Length=583

 Score =   182 bits (461),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 100/135 (74%), Positives = 113/135 (84%), Gaps = 2/135 (1%)
 Frame = -1

Query  402  SVKFLAPSLQIHHANKLPKSTRLHatppqavapsppP-EIDTARLEPRVEERDGYFVLKE  226
            S+KFLAPSL  + A     + +LHATPP   AP P   E+   RLEPRVEE+DGY++LKE
Sbjct  1    SIKFLAPSLP-NPARFSKNAVKLHATPPSVAAPPPGAPEVAAERLEPRVEEKDGYWILKE  59

Query  225  KFRQGINPQEKVKIEKEPMKLFMENGIEELANIPFEEIEQSKLTKDDIDVRLKWLGLFHR  46
            +FR+GINPQEKVKIEK+PMKLFMENGIEELA IP EEI+QSKLTKDDIDVRLKWLGLFHR
Sbjct  60   QFRKGINPQEKVKIEKQPMKLFMENGIEELAKIPIEEIDQSKLTKDDIDVRLKWLGLFHR  119

Query  45   RKHHYGRFMMRLKLP  1
            RK+ YGRFMMRLKLP
Sbjct  120  RKNQYGRFMMRLKLP  134



>ref|XP_010548020.1| PREDICTED: ferredoxin--nitrite reductase, chloroplastic [Tarenaya 
hassleriana]
Length=588

 Score =   182 bits (461),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 96/139 (69%), Positives = 109/139 (78%), Gaps = 4/139 (3%)
 Frame = -1

Query  414  MASLSVKFLAP-SLQIHHANKLPKSTRLHatppqavapsppPEIDTARLEPRVEERDGYF  238
            MASLSV+FL+P +L    ++  PK T L A    A A      +D  RLEPRVEERDG+F
Sbjct  1    MASLSVRFLSPQALLSSGSSSKPKRTVLFAAQTTAPAEPA---VDADRLEPRVEERDGFF  57

Query  237  VLKEKFRQGINPQEKVKIEKEPMKLFMENGIEELANIPFEEIEQSKLTKDDIDVRLKWLG  58
            VLKEKFR+GINPQEKVKIEKEPMKLFM+NGIEELA +  EEI+  K +KDDI+VRLKWLG
Sbjct  58   VLKEKFRKGINPQEKVKIEKEPMKLFMDNGIEELAKMTMEEIDNDKTSKDDIEVRLKWLG  117

Query  57   LFHRRKHHYGRFMMRLKLP  1
            LFHRRKH YGRFMMRLKLP
Sbjct  118  LFHRRKHQYGRFMMRLKLP  136



>ref|XP_008236500.1| PREDICTED: ferredoxin--nitrite reductase, chloroplastic [Prunus 
mume]
Length=585

 Score =   181 bits (459),  Expect = 2e-50, Method: Composition-based stats.
 Identities = 90/137 (66%), Positives = 106/137 (77%), Gaps = 4/137 (3%)
 Frame = -1

Query  411  ASLSVKFLAPSLQIHHANKLPKSTRLHatppqavapsppPEIDTARLEPRVEERDGYFVL  232
            +SLSV+FL+P L    ++ LP   +               +++ ARLEPRVEERDGY+VL
Sbjct  3    SSLSVQFLSPPL----SSALPCCKQTRLAAATTPLAPVSTDVEAARLEPRVEERDGYWVL  58

Query  231  KEKFRQGINPQEKVKIEKEPMKLFMENGIEELANIPFEEIEQSKLTKDDIDVRLKWLGLF  52
            KEKFR GIN QEKVKI+KEPMK+FMENGIEELA   FEE+E+SK +KDDIDVRLKWLGLF
Sbjct  59   KEKFRGGINVQEKVKIQKEPMKIFMENGIEELAKTSFEELEKSKDSKDDIDVRLKWLGLF  118

Query  51   HRRKHHYGRFMMRLKLP  1
            HRRK+HYGRFMMRLKLP
Sbjct  119  HRRKNHYGRFMMRLKLP  135



>ref|XP_003607969.1| Ferredoxin-nitrite reductase [Medicago truncatula]
 gb|AES90166.1| ferredoxin-nitrite reductase [Medicago truncatula]
Length=582

 Score =   181 bits (458),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 95/138 (69%), Positives = 111/138 (80%), Gaps = 6/138 (4%)
 Frame = -1

Query  414  MASLSVKFLAPSLQIHHANKLPKSTRLHatppqavapsppPEIDTARLEPRVEERDGYFV  235
            M+S SV+FL P      +   PK T L +    +VAP   P++D++RLEPRVEE+DGY+V
Sbjct  1    MSSFSVRFLTPP-----SITRPK-TWLLSAATPSVAPVSTPQVDSSRLEPRVEEKDGYWV  54

Query  234  LKEKFRQGINPQEKVKIEKEPMKLFMENGIEELANIPFEEIEQSKLTKDDIDVRLKWLGL  55
            LKE++R GINPQEKVKI+KEPMKLFME GI +LAN+  EEIE SKLTKDDIDVRLKWLGL
Sbjct  55   LKEEYRGGINPQEKVKIQKEPMKLFMEGGINDLANMSLEEIESSKLTKDDIDVRLKWLGL  114

Query  54   FHRRKHHYGRFMMRLKLP  1
            FHRRKHHYGRFMMRLKLP
Sbjct  115  FHRRKHHYGRFMMRLKLP  132



>ref|XP_011005977.1| PREDICTED: ferredoxin--nitrite reductase, chloroplastic [Populus 
euphratica]
Length=588

 Score =   180 bits (456),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 98/143 (69%), Positives = 111/143 (78%), Gaps = 10/143 (7%)
 Frame = -1

Query  414  MASLSVKFLAPSLQIHHANKLPKS-----TRLHatppqavapsppPEIDTARLEPRVEER  250
            M+SLSV+FL P L    +  LP S     TRL A PP    P+    +D  RLEPRVE++
Sbjct  1    MSSLSVRFLTPQL----SPALPGSSARPRTRLFAGPPTVTQPAETG-VDAGRLEPRVEKK  55

Query  249  DGYFVLKEKFRQGINPQEKVKIEKEPMKLFMENGIEELANIPFEEIEQSKLTKDDIDVRL  70
            DGY+VLKEKFRQGINPQEKVKIEKEPMKLFMENGIEELA +  EEI++ K ++DDIDVRL
Sbjct  56   DGYYVLKEKFRQGINPQEKVKIEKEPMKLFMENGIEELAKLSMEEIDKEKSSRDDIDVRL  115

Query  69   KWLGLFHRRKHHYGRFMMRLKLP  1
            KWLGLFHRRKH YGRFMMRLKLP
Sbjct  116  KWLGLFHRRKHQYGRFMMRLKLP  138



>ref|XP_007042430.1| Ferredoxin--nitrite reductase, chloroplastic [Theobroma cacao]
 gb|EOX98261.1| Ferredoxin--nitrite reductase, chloroplastic [Theobroma cacao]
Length=553

 Score =   179 bits (453),  Expect = 1e-49, Method: Composition-based stats.
 Identities = 90/138 (65%), Positives = 101/138 (73%), Gaps = 4/138 (3%)
 Frame = -1

Query  414  MASLSVKFLAPSLQIHHANKLPKSTRLHatppqavapsppPEIDTARLEPRVEERDGYFV  235
            M+S SV+FLAP      ++  PK+  L              E+D  RLEPRVEERDGYFV
Sbjct  1    MSSFSVRFLAPQALQSTSSSRPKTWVL----AAPTTAPASVEVDAGRLEPRVEERDGYFV  56

Query  234  LKEKFRQGINPQEKVKIEKEPMKLFMENGIEELANIPFEEIEQSKLTKDDIDVRLKWLGL  55
            LKEKFR+GINPQEKVKI K+PMKLF E GIE LA +  EEI++ K TKDDIDVRLKWLGL
Sbjct  57   LKEKFREGINPQEKVKIGKDPMKLFREGGIEGLAKMSMEEIDKDKTTKDDIDVRLKWLGL  116

Query  54   FHRRKHHYGRFMMRLKLP  1
            FHRRKH YGRFMMRLKLP
Sbjct  117  FHRRKHQYGRFMMRLKLP  134



>ref|XP_010028471.1| PREDICTED: ferredoxin--nitrite reductase, chloroplastic [Eucalyptus 
grandis]
 gb|KCW55212.1| hypothetical protein EUGRSUZ_I01148 [Eucalyptus grandis]
Length=589

 Score =   179 bits (454),  Expect = 1e-49, Method: Composition-based stats.
 Identities = 93/139 (67%), Positives = 108/139 (78%), Gaps = 1/139 (1%)
 Frame = -1

Query  414  MASLSVKFLAPSLQIHHANKLPKSTRLHatppqavapspp-PEIDTARLEPRVEERDGYF  238
            M+S+S++FL   L    ++     TR+        AP PP    D  RLEPRVEERDGY+
Sbjct  1    MSSMSIRFLLSPLPCQKSSASLSRTRVSTDATPTAAPPPPGVGADAVRLEPRVEERDGYW  60

Query  237  VLKEKFRQGINPQEKVKIEKEPMKLFMENGIEELANIPFEEIEQSKLTKDDIDVRLKWLG  58
            VLKEKFRQGINPQEKVKIEKEPMKLFMENGIEELA +  E+I+++K+TK+DIDVRLKWLG
Sbjct  61   VLKEKFRQGINPQEKVKIEKEPMKLFMENGIEELAKMSMEDIDKAKVTKNDIDVRLKWLG  120

Query  57   LFHRRKHHYGRFMMRLKLP  1
            LFHRRKH YGRFMMRLKLP
Sbjct  121  LFHRRKHQYGRFMMRLKLP  139



>ref|XP_010468620.1| PREDICTED: ferredoxin--nitrite reductase, chloroplastic-like 
[Camelina sativa]
Length=203

 Score =   170 bits (430),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 85/138 (62%), Positives = 99/138 (72%), Gaps = 4/138 (3%)
 Frame = -1

Query  414  MASLSVKFLAPSLQIHHANKLPKSTRLHatppqavapsppPEIDTARLEPRVEERDGYFV  235
            M S S+ F AP L     +  PK + L A             +D  RLEPRVE +DG+++
Sbjct  1    MTSFSLTFTAPLL----PSSKPKRSVLVAAAQTTAPAESTASVDADRLEPRVELKDGFYI  56

Query  234  LKEKFRQGINPQEKVKIEKEPMKLFMENGIEELANIPFEEIEQSKLTKDDIDVRLKWLGL  55
            LKEKFR+GINPQEKVKIE+EPMKLFMENGIEELA    EE++  K +KDDIDVRLKWLGL
Sbjct  57   LKEKFRKGINPQEKVKIEREPMKLFMENGIEELAKKSMEELDSEKSSKDDIDVRLKWLGL  116

Query  54   FHRRKHHYGRFMMRLKLP  1
            FHRRKH YG+FMMRLKLP
Sbjct  117  FHRRKHQYGKFMMRLKLP  134



>pdb|3B0H|A Chain A, Assimilatory Nitrite Reductase (Nii4) From Tobbaco Root
 pdb|3B0H|B Chain B, Assimilatory Nitrite Reductase (Nii4) From Tobbaco Root
Length=588

 Score =   178 bits (452),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 85/97 (88%), Positives = 89/97 (92%), Gaps = 0/97 (0%)
 Frame = -1

Query  291  EIDTARLEPRVEERDGYFVLKEKFRQGINPQEKVKIEKEPMKLFMENGIEELANIPFEEI  112
            EI + RLEPRVEE+DGY+VLKEKFRQGINP EK KIEKEPMKLFMENGIE+LA I  EEI
Sbjct  43   EIASERLEPRVEEKDGYWVLKEKFRQGINPAEKAKIEKEPMKLFMENGIEDLAKISLEEI  102

Query  111  EQSKLTKDDIDVRLKWLGLFHRRKHHYGRFMMRLKLP  1
            E SKLTKDDIDVRLKWLGLFHRRKHHYGRFMMRLKLP
Sbjct  103  EGSKLTKDDIDVRLKWLGLFHRRKHHYGRFMMRLKLP  139



>ref|XP_007201180.1| hypothetical protein PRUPE_ppa003315mg [Prunus persica]
 gb|EMJ02379.1| hypothetical protein PRUPE_ppa003315mg [Prunus persica]
 gb|AHM02308.1| nitrite reductase [Prunus persica]
Length=585

 Score =   178 bits (451),  Expect = 3e-49, Method: Composition-based stats.
 Identities = 90/137 (66%), Positives = 104/137 (76%), Gaps = 4/137 (3%)
 Frame = -1

Query  411  ASLSVKFLAPSLQIHHANKLPKSTRLHatppqavapsppPEIDTARLEPRVEERDGYFVL  232
            +SLSV+FL+P L    ++ LP   +                ++ ARLEPRVEERDGY+VL
Sbjct  3    SSLSVQFLSPPL----SSALPCCKQTRLAAATTPLAPVSKNVEAARLEPRVEERDGYWVL  58

Query  231  KEKFRQGINPQEKVKIEKEPMKLFMENGIEELANIPFEEIEQSKLTKDDIDVRLKWLGLF  52
            KEKFR GIN QEKVKI+KEPMKLFMENGIEELA   FEE+E+SK +KDDID RLKWLGLF
Sbjct  59   KEKFRGGINVQEKVKIQKEPMKLFMENGIEELAKTSFEELEKSKDSKDDIDGRLKWLGLF  118

Query  51   HRRKHHYGRFMMRLKLP  1
            HRRK+HYGRFMMRLKLP
Sbjct  119  HRRKNHYGRFMMRLKLP  135



>ref|XP_010263547.1| PREDICTED: ferredoxin--nitrite reductase, chloroplastic [Nelumbo 
nucifera]
Length=592

 Score =   178 bits (451),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 98/141 (70%), Positives = 110/141 (78%), Gaps = 3/141 (2%)
 Frame = -1

Query  414  MASLSVKFLAPSL---QIHHANKLPKSTRLHatppqavapsppPEIDTARLEPRVEERDG  244
            M+S S +FLAPS+         +        ATP QA APS   E+D +RLEPRVEER+G
Sbjct  1    MSSSSFRFLAPSVPSSSSMRRTRRGARAPAAATPSQAEAPSVAKEVDGSRLEPRVEEREG  60

Query  243  YFVLKEKFRQGINPQEKVKIEKEPMKLFMENGIEELANIPFEEIEQSKLTKDDIDVRLKW  64
            Y+VLKEKFRQGINPQEKVK+E+EPMKLFME GI ELA  P +EIE+SKLTKDDIDVRLKW
Sbjct  61   YWVLKEKFRQGINPQEKVKLEREPMKLFMEGGINELAKTPLQEIEKSKLTKDDIDVRLKW  120

Query  63   LGLFHRRKHHYGRFMMRLKLP  1
            LGLFHRRKH YGRFMMRLKLP
Sbjct  121  LGLFHRRKHQYGRFMMRLKLP  141



>ref|XP_008373138.1| PREDICTED: ferredoxin--nitrite reductase, chloroplastic [Malus 
domestica]
Length=585

 Score =   177 bits (450),  Expect = 4e-49, Method: Composition-based stats.
 Identities = 92/136 (68%), Positives = 104/136 (76%), Gaps = 4/136 (3%)
 Frame = -1

Query  408  SLSVKFLAPSLQIHHANKLPKSTRLHatppqavapsppPEIDTARLEPRVEERDGYFVLK  229
            SLSV FL+P L    A    ++TRL              E++ ARLEPRVEERDGY+VLK
Sbjct  4    SLSVLFLSPPLS--SAAPYCRATRL--AAATTPVAPVSAEVEAARLEPRVEERDGYWVLK  59

Query  228  EKFRQGINPQEKVKIEKEPMKLFMENGIEELANIPFEEIEQSKLTKDDIDVRLKWLGLFH  49
            EKFR GIN QEKVKIE+EPMKLFME GIE+LA I FEE++++K TKDDIDVRLKWLGLFH
Sbjct  60   EKFRGGINVQEKVKIEREPMKLFMEGGIEDLAKISFEELDKAKDTKDDIDVRLKWLGLFH  119

Query  48   RRKHHYGRFMMRLKLP  1
            RRK HYGRFMMRLKLP
Sbjct  120  RRKQHYGRFMMRLKLP  135



>pdb|3VLX|A Chain A, Assimilatory Nitrite Reductase (Nii3) - N226k Mutant 
- Ligand Free Form From Tobacco Leaf
 pdb|3VLY|A Chain A, Assimilatory Nitrite Reductase (Nii3) - N226k Mutant 
- So3 Partial Complex From Tobacco Leaf
 pdb|3VLZ|A Chain A, Assimilatory Nitrite Reductase (Nii3) - N226k Mutant 
- So3 Full Complex From Tobacco Leaf
 pdb|3VM0|A Chain A, Assimilatory Nitrite Reductase (Nii3) - N226k Mutant 
- No2 Complex From Tobacco Leaf
 pdb|3VM1|A Chain A, Assimilatory Nitrite Reductase (Nii3) - N226k Mutant 
- Hco3 Complex From Tobacco Leaf
Length=584

 Score =   177 bits (450),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 83/97 (86%), Positives = 91/97 (94%), Gaps = 0/97 (0%)
 Frame = -1

Query  291  EIDTARLEPRVEERDGYFVLKEKFRQGINPQEKVKIEKEPMKLFMENGIEELANIPFEEI  112
            E+   RLEPRVEE+DGY++LKE+FR+GINPQEKVKIEKEPMKLFMENGIEELA IP EEI
Sbjct  46   EVAAERLEPRVEEKDGYWILKEQFRKGINPQEKVKIEKEPMKLFMENGIEELAKIPIEEI  105

Query  111  EQSKLTKDDIDVRLKWLGLFHRRKHHYGRFMMRLKLP  1
            +QSKLTKDDIDVRLKWLGLFHRRK+ YGRFMMRLKLP
Sbjct  106  DQSKLTKDDIDVRLKWLGLFHRRKNQYGRFMMRLKLP  142



>pdb|3B0L|A Chain A, M175g Mutant Of Assimilatory Nitrite Reductase (Nii3) 
From Tobbaco Leaf
Length=584

 Score =   177 bits (450),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 83/97 (86%), Positives = 91/97 (94%), Gaps = 0/97 (0%)
 Frame = -1

Query  291  EIDTARLEPRVEERDGYFVLKEKFRQGINPQEKVKIEKEPMKLFMENGIEELANIPFEEI  112
            E+   RLEPRVEE+DGY++LKE+FR+GINPQEKVKIEKEPMKLFMENGIEELA IP EEI
Sbjct  46   EVAAERLEPRVEEKDGYWILKEQFRKGINPQEKVKIEKEPMKLFMENGIEELAKIPIEEI  105

Query  111  EQSKLTKDDIDVRLKWLGLFHRRKHHYGRFMMRLKLP  1
            +QSKLTKDDIDVRLKWLGLFHRRK+ YGRFMMRLKLP
Sbjct  106  DQSKLTKDDIDVRLKWLGLFHRRKNQYGRFMMRLKLP  142



>ref|XP_004505220.1| PREDICTED: ferredoxin--nitrite reductase, chloroplastic-like 
[Cicer arietinum]
Length=582

 Score =   177 bits (450),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 92/138 (67%), Positives = 108/138 (78%), Gaps = 6/138 (4%)
 Frame = -1

Query  414  MASLSVKFLAPSLQIHHANKLPKSTRLHatppqavapsppPEIDTARLEPRVEERDGYFV  235
            M+S SV+FL P      +   PK T + +    + APS   ++D  RLEPRVEE+DGY+V
Sbjct  1    MSSFSVRFLTPP-----SISRPK-TWILSAATPSFAPSVSSQVDATRLEPRVEEKDGYWV  54

Query  234  LKEKFRQGINPQEKVKIEKEPMKLFMENGIEELANIPFEEIEQSKLTKDDIDVRLKWLGL  55
            LKE++R GINPQEKVK++KEPMKLFME GI +LAN+  EEIE SKLTKDDIDVRLKWLGL
Sbjct  55   LKEEYRGGINPQEKVKLQKEPMKLFMEGGIHDLANMSLEEIESSKLTKDDIDVRLKWLGL  114

Query  54   FHRRKHHYGRFMMRLKLP  1
            FHRRKHHYGRFMMRLKLP
Sbjct  115  FHRRKHHYGRFMMRLKLP  132



>pdb|3B0N|A Chain A, Q448k Mutant Of Assimilatory Nitrite Reductase (Nii3) 
From Tobbaco Leaf
Length=584

 Score =   177 bits (450),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 83/97 (86%), Positives = 91/97 (94%), Gaps = 0/97 (0%)
 Frame = -1

Query  291  EIDTARLEPRVEERDGYFVLKEKFRQGINPQEKVKIEKEPMKLFMENGIEELANIPFEEI  112
            E+   RLEPRVEE+DGY++LKE+FR+GINPQEKVKIEKEPMKLFMENGIEELA IP EEI
Sbjct  46   EVAAERLEPRVEEKDGYWILKEQFRKGINPQEKVKIEKEPMKLFMENGIEELAKIPIEEI  105

Query  111  EQSKLTKDDIDVRLKWLGLFHRRKHHYGRFMMRLKLP  1
            +QSKLTKDDIDVRLKWLGLFHRRK+ YGRFMMRLKLP
Sbjct  106  DQSKLTKDDIDVRLKWLGLFHRRKNQYGRFMMRLKLP  142



>pdb|3B0M|A Chain A, M175k Mutant Of Assimilatory Nitrite Reductase (Nii3) 
From Tobbaco Leaf
Length=584

 Score =   177 bits (450),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 83/97 (86%), Positives = 91/97 (94%), Gaps = 0/97 (0%)
 Frame = -1

Query  291  EIDTARLEPRVEERDGYFVLKEKFRQGINPQEKVKIEKEPMKLFMENGIEELANIPFEEI  112
            E+   RLEPRVEE+DGY++LKE+FR+GINPQEKVKIEKEPMKLFMENGIEELA IP EEI
Sbjct  46   EVAAERLEPRVEEKDGYWILKEQFRKGINPQEKVKIEKEPMKLFMENGIEELAKIPIEEI  105

Query  111  EQSKLTKDDIDVRLKWLGLFHRRKHHYGRFMMRLKLP  1
            +QSKLTKDDIDVRLKWLGLFHRRK+ YGRFMMRLKLP
Sbjct  106  DQSKLTKDDIDVRLKWLGLFHRRKNQYGRFMMRLKLP  142



>gb|KDP42275.1| hypothetical protein JCGZ_01599 [Jatropha curcas]
Length=587

 Score =   177 bits (450),  Expect = 5e-49, Method: Composition-based stats.
 Identities = 95/139 (68%), Positives = 106/139 (76%), Gaps = 3/139 (2%)
 Frame = -1

Query  414  MASLS-VKFLAPSLQIHHANKLPKSTRLHatppqavapsppPEIDTARLEPRVEERDGYF  238
            M+SLS V+  +P L     +  PK TR+ + P  A       E+D  RLEPRVEERDGY+
Sbjct  1    MSSLSSVRVFSPPLSHSLTSTRPK-TRIFSGPTVAQPVEAV-EVDAERLEPRVEERDGYW  58

Query  237  VLKEKFRQGINPQEKVKIEKEPMKLFMENGIEELANIPFEEIEQSKLTKDDIDVRLKWLG  58
            VLKEK+RQGINPQEKVKI KEPM LFMENGIEELA +  EEI+Q K  KDDIDVRLKWLG
Sbjct  59   VLKEKYRQGINPQEKVKIAKEPMTLFMENGIEELAKLSMEEIDQDKNNKDDIDVRLKWLG  118

Query  57   LFHRRKHHYGRFMMRLKLP  1
            LFHRRKHHYGRFMMRLKLP
Sbjct  119  LFHRRKHHYGRFMMRLKLP  137



>pdb|3B0J|A Chain A, M175e Mutant Of Assimilatory Nitrite Reductase (Nii3) 
From Tobbaco Leaf
Length=584

 Score =   177 bits (450),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 83/97 (86%), Positives = 91/97 (94%), Gaps = 0/97 (0%)
 Frame = -1

Query  291  EIDTARLEPRVEERDGYFVLKEKFRQGINPQEKVKIEKEPMKLFMENGIEELANIPFEEI  112
            E+   RLEPRVEE+DGY++LKE+FR+GINPQEKVKIEKEPMKLFMENGIEELA IP EEI
Sbjct  46   EVAAERLEPRVEEKDGYWILKEQFRKGINPQEKVKIEKEPMKLFMENGIEELAKIPIEEI  105

Query  111  EQSKLTKDDIDVRLKWLGLFHRRKHHYGRFMMRLKLP  1
            +QSKLTKDDIDVRLKWLGLFHRRK+ YGRFMMRLKLP
Sbjct  106  DQSKLTKDDIDVRLKWLGLFHRRKNQYGRFMMRLKLP  142



>pdb|3B0G|A Chain A, Assimilatory Nitrite Reductase (Nii3) From Tobbaco Leaf
 pdb|3VKP|A Chain A, Assimilatory Nitrite Reductase (nii3) - No2 Complex 
From Tobbaco Leaf Analysed With Low X-ray Dose
 pdb|3VKQ|A Chain A, Assimilatory Nitrite Reductase (nii3) - No2 Complex 
From Tobbaco Leaf Analysed With Middle X-ray Dose
 pdb|3VKR|A Chain A, Assimilatory Nitrite Reductase (nii3) - No2 Complex 
From Tobbaco Leaf Analysed With High X-ray Dose
 pdb|3VKS|A Chain A, Assimilatory Nitrite Reductase (nii3) - No Complex From 
Tobbaco Leaf
 pdb|3VKT|A Chain A, Assimilatory Nitrite Reductase (nii3) - Nh2oh Complex 
From Tobbaco Leaf
Length=591

 Score =   177 bits (450),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 83/97 (86%), Positives = 91/97 (94%), Gaps = 0/97 (0%)
 Frame = -1

Query  291  EIDTARLEPRVEERDGYFVLKEKFRQGINPQEKVKIEKEPMKLFMENGIEELANIPFEEI  112
            E+   RLEPRVEE+DGY++LKE+FR+GINPQEKVKIEKEPMKLFMENGIEELA IP EEI
Sbjct  46   EVAAERLEPRVEEKDGYWILKEQFRKGINPQEKVKIEKEPMKLFMENGIEELAKIPIEEI  105

Query  111  EQSKLTKDDIDVRLKWLGLFHRRKHHYGRFMMRLKLP  1
            +QSKLTKDDIDVRLKWLGLFHRRK+ YGRFMMRLKLP
Sbjct  106  DQSKLTKDDIDVRLKWLGLFHRRKNQYGRFMMRLKLP  142



>ref|XP_004248736.1| PREDICTED: ferredoxin--nitrite reductase, chloroplastic [Solanum 
lycopersicum]
Length=584

 Score =   177 bits (448),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 97/140 (69%), Positives = 108/140 (77%), Gaps = 7/140 (5%)
 Frame = -1

Query  414  MASLSVKFLAPSLQIHHANKLPKSTRLHat--ppqavapsppPEIDTARLEPRVEERDGY  241
            M S SVKF A SL   ++N+  K   LHAT     AV      EI   RLEPRVE+RDGY
Sbjct  1    MTSFSVKFSATSLP--NSNRFSK---LHATPPQTVAVPSYGAAEIAAERLEPRVEQRDGY  55

Query  240  FVLKEKFRQGINPQEKVKIEKEPMKLFMENGIEELANIPFEEIEQSKLTKDDIDVRLKWL  61
            +V+K+KFRQGINP EK KIEKEPMKLF ENGIE+LA I  EEIE+SKLTK+DID+RLKWL
Sbjct  56   WVVKDKFRQGINPAEKAKIEKEPMKLFTENGIEDLAKISLEEIEKSKLTKEDIDIRLKWL  115

Query  60   GLFHRRKHHYGRFMMRLKLP  1
            GLFHRRKHHYGRFMMRLKLP
Sbjct  116  GLFHRRKHHYGRFMMRLKLP  135



>ref|XP_009346246.1| PREDICTED: ferredoxin--nitrite reductase, chloroplastic [Pyrus 
x bretschneideri]
Length=585

 Score =   177 bits (448),  Expect = 9e-49, Method: Composition-based stats.
 Identities = 91/136 (67%), Positives = 105/136 (77%), Gaps = 4/136 (3%)
 Frame = -1

Query  408  SLSVKFLAPSLQIHHANKLPKSTRLHatppqavapsppPEIDTARLEPRVEERDGYFVLK  229
            SLSV FL+P L    A    ++TRL              E++ ARLEPRVEERDGY+VLK
Sbjct  4    SLSVPFLSPPLS--PAAPCCRATRL--AAATTPVVPVSAEVEAARLEPRVEERDGYWVLK  59

Query  228  EKFRQGINPQEKVKIEKEPMKLFMENGIEELANIPFEEIEQSKLTKDDIDVRLKWLGLFH  49
            EKFR GIN QEK+KIE+EPMKLFME GIEE+A I FEE++++K T+DDIDVRLKWLGLFH
Sbjct  60   EKFRGGINVQEKMKIEREPMKLFMEGGIEEVAKISFEELDKAKDTRDDIDVRLKWLGLFH  119

Query  48   RRKHHYGRFMMRLKLP  1
            RRKHHYGRFMMRLKLP
Sbjct  120  RRKHHYGRFMMRLKLP  135



>ref|XP_006349625.1| PREDICTED: ferredoxin--nitrite reductase, chloroplastic-like 
[Solanum tuberosum]
Length=584

 Score =   176 bits (447),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 97/140 (69%), Positives = 110/140 (79%), Gaps = 7/140 (5%)
 Frame = -1

Query  414  MASLSVKFLAPSLQIHHANKLPKSTRLHat--ppqavapsppPEIDTARLEPRVEERDGY  241
            M S SVKF A SL   ++N+    ++LHAT     AV  S   EI   RLEPRVE++DGY
Sbjct  1    MTSFSVKFSATSLP--NSNRF---SKLHATPPQTVAVPSSGAAEIAAERLEPRVEQKDGY  55

Query  240  FVLKEKFRQGINPQEKVKIEKEPMKLFMENGIEELANIPFEEIEQSKLTKDDIDVRLKWL  61
            +VLKEKFRQGINP EK KIEKEPMKLF ENGIE+LA I  EE+E+SKLTK+DID+RLKWL
Sbjct  56   WVLKEKFRQGINPAEKAKIEKEPMKLFTENGIEDLAKISLEEMEKSKLTKEDIDIRLKWL  115

Query  60   GLFHRRKHHYGRFMMRLKLP  1
            GLFHRRKHHYGRFMMRLKLP
Sbjct  116  GLFHRRKHHYGRFMMRLKLP  135



>sp|P38500.1|NIR_BETPN RecName: Full=Ferredoxin--nitrite reductase, chloroplastic; Flags: 
Precursor [Betula pendula]
 emb|CAA42690.1| ferredoxin--nitrite reductase [Betula pendula]
Length=583

 Score =   175 bits (443),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 87/138 (63%), Positives = 105/138 (76%), Gaps = 5/138 (4%)
 Frame = -1

Query  414  MASLSVKFLAPSLQIHHANKLPKSTRLHatppqavapsppPEIDTARLEPRVEERDGYFV  235
            M+SLSV+FL+P L        P++            P    E+D  RLEPRVEER+GY+V
Sbjct  1    MSSLSVRFLSPPL-FSSTPAWPRTG----LAATQAVPPVVAEVDAGRLEPRVEEREGYWV  55

Query  234  LKEKFRQGINPQEKVKIEKEPMKLFMENGIEELANIPFEEIEQSKLTKDDIDVRLKWLGL  55
            LKEKFR+GINPQEK+K+E+EPMKLFME GIE+LA +  EEI++ K++K DIDVRLKWLGL
Sbjct  56   LKEKFREGINPQEKLKLEREPMKLFMEGGIEDLAKMSLEEIDKDKISKSDIDVRLKWLGL  115

Query  54   FHRRKHHYGRFMMRLKLP  1
            FHRRKHHYGRFMMRLKLP
Sbjct  116  FHRRKHHYGRFMMRLKLP  133



>ref|XP_003529397.1| PREDICTED: ferredoxin--nitrite reductase, chloroplastic-like 
[Glycine max]
 gb|KHN43071.1| Ferredoxin--nitrite reductase, chloroplastic [Glycine soja]
Length=588

 Score =   174 bits (442),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 88/137 (64%), Positives = 107/137 (78%), Gaps = 1/137 (1%)
 Frame = -1

Query  411  ASLSVKFLAPSLQIHHANKLPKSTRLHatppqavapsppPEIDTARLEPRVEERDGYFVL  232
            +S SV+FLAP      +++ PK+    AT P     +   E++ +RLEPRVEERDG++VL
Sbjct  3    SSFSVRFLAPPSSCFPSSR-PKTWLCAATTPTVAPATASSEVEASRLEPRVEERDGFWVL  61

Query  231  KEKFRQGINPQEKVKIEKEPMKLFMENGIEELANIPFEEIEQSKLTKDDIDVRLKWLGLF  52
            KE++R GI+PQEKVK+EK+PMKLFME GIE+LA +  EEIE SK TKDDIDVRLKWLGLF
Sbjct  62   KEEYRGGISPQEKVKLEKDPMKLFMEGGIEDLAKMSLEEIESSKHTKDDIDVRLKWLGLF  121

Query  51   HRRKHHYGRFMMRLKLP  1
            HRRK HYGRFMMRLKLP
Sbjct  122  HRRKQHYGRFMMRLKLP  138



>ref|NP_001268194.1| ferredoxin--nitrite reductase, chloroplastic-like [Vitis vinifera]
 gb|AEO72336.1| nitrite reductase 1 [Vitis vinifera]
Length=594

 Score =   174 bits (440),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 97/145 (67%), Positives = 115/145 (79%), Gaps = 8/145 (6%)
 Frame = -1

Query  414  MASLSVKFL--APSLQIHHANKLPKSTRLHatppqa-----vapsppPEIDTARLEPRVE  256
            MAS+SV FL  AP+  + ++  L   TR+ ATP        VAPS    +D++R+EPRVE
Sbjct  1    MASISVPFLSQAPT-HLSNSTSLRLKTRISATPTPTPTPTTVAPSSTAAVDSSRMEPRVE  59

Query  255  ERDGYFVLKEKFRQGINPQEKVKIEKEPMKLFMENGIEELANIPFEEIEQSKLTKDDIDV  76
            ER GY+VLKEKFR+GINPQEKVKIEK+PMKLF+E+G  ELA++ FEEIE+SK TKDDIDV
Sbjct  60   ERGGYWVLKEKFREGINPQEKVKIEKDPMKLFIEDGFNELASMSFEEIEKSKHTKDDIDV  119

Query  75   RLKWLGLFHRRKHHYGRFMMRLKLP  1
            RLKWLGLFHRRKH YGRFMMRLKLP
Sbjct  120  RLKWLGLFHRRKHQYGRFMMRLKLP  144



>gb|ADJ68001.1| nitrite reductase protein [Gossypium hirsutum]
Length=588

 Score =   173 bits (439),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 84/138 (61%), Positives = 104/138 (75%), Gaps = 0/138 (0%)
 Frame = -1

Query  414  MASLSVKFLAPSLQIHHANKLPKSTRLHatppqavapsppPEIDTARLEPRVEERDGYFV  235
            M+S SV+F AP   +  +       +         AP+   ++D  RLEPRVEER+GYFV
Sbjct  1    MSSFSVRFFAPQQPLLPSTASSFKPKTWVMAAPTTAPATSVDVDGGRLEPRVEEREGYFV  60

Query  234  LKEKFRQGINPQEKVKIEKEPMKLFMENGIEELANIPFEEIEQSKLTKDDIDVRLKWLGL  55
            LKEKFR GINPQEK+KIEK+P+KLFME GI++LA + FE+++++K TKDDIDVRLKWLGL
Sbjct  61   LKEKFRDGINPQEKIKIEKDPLKLFMEAGIDKLAKMSFEDLDKAKATKDDIDVRLKWLGL  120

Query  54   FHRRKHHYGRFMMRLKLP  1
            FHRRKH YGRFMMRLKLP
Sbjct  121  FHRRKHQYGRFMMRLKLP  138



>gb|AAC17127.1| nitrite reductase [Capsicum annuum]
Length=588

 Score =   172 bits (437),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 98/140 (70%), Positives = 109/140 (78%), Gaps = 6/140 (4%)
 Frame = -1

Query  414  MASLSVKFLAPSLQIHHANKLPKSTRLHatppqavapsppPEIDTA--RLEPRVEERDGY  241
            MAS SVKF A S          + ++LHATPPQ VA  P   ++ A  RLEPR+EERDGY
Sbjct  1    MASFSVKFSATS----SLTSSKRFSKLHATPPQTVAVPPSGAVEVAAERLEPRLEERDGY  56

Query  240  FVLKEKFRQGINPQEKVKIEKEPMKLFMENGIEELANIPFEEIEQSKLTKDDIDVRLKWL  61
            +VLKEKFR+GINP EK KIEKEPMKLF ENGIE++A I  EEIE+SKL KDDIDVRLKWL
Sbjct  57   WVLKEKFRKGINPAEKAKIEKEPMKLFTENGIEDIAKISLEEIEKSKLAKDDIDVRLKWL  116

Query  60   GLFHRRKHHYGRFMMRLKLP  1
            GLFHRRKH YGRFMMRLKLP
Sbjct  117  GLFHRRKHQYGRFMMRLKLP  136



>gb|EPS71034.1| hypothetical protein M569_03724 [Genlisea aurea]
Length=591

 Score =   171 bits (433),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 91/142 (64%), Positives = 107/142 (75%), Gaps = 4/142 (3%)
 Frame = -1

Query  414  MASLSVKFLAPSL---QIHHANKLPKSTRLHatppqavapsppPEIDTA-RLEPRVEERD  247
            M+SLSVKF A SL    +   ++  K          A   +   E   A RLEPRVEER+
Sbjct  1    MSSLSVKFSAASLPDRGVASRSETGKPRFASVRRAMASPRAAEAEKSNADRLEPRVEERN  60

Query  246  GYFVLKEKFRQGINPQEKVKIEKEPMKLFMENGIEELANIPFEEIEQSKLTKDDIDVRLK  67
            GYFV+KEKFR+GINPQEK+KIEKEPMKLF+EN IE+L ++PFE IE+SKL +DDIDVRLK
Sbjct  61   GYFVVKEKFREGINPQEKLKIEKEPMKLFIENEIEDLVSLPFEAIEKSKLARDDIDVRLK  120

Query  66   WLGLFHRRKHHYGRFMMRLKLP  1
            WLGLFHRRKHHYGRFM+RLKLP
Sbjct  121  WLGLFHRRKHHYGRFMLRLKLP  142



>ref|XP_007156512.1| hypothetical protein PHAVU_003G292100g [Phaseolus vulgaris]
 gb|ESW28506.1| hypothetical protein PHAVU_003G292100g [Phaseolus vulgaris]
Length=582

 Score =   171 bits (432),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 88/139 (63%), Positives = 105/139 (76%), Gaps = 8/139 (6%)
 Frame = -1

Query  414  MASLSVKFLAPSLQIHHANKLPKS-TRLHatppqavapsppPEIDTARLEPRVEERDGYF  238
            M+S SV+FLAP          P S ++         AP+    ++ +RLEPRVEERDG++
Sbjct  1    MSSFSVRFLAPPC-------CPSSRSKTLLCATPTAAPAASETVEASRLEPRVEERDGFW  53

Query  237  VLKEKFRQGINPQEKVKIEKEPMKLFMENGIEELANIPFEEIEQSKLTKDDIDVRLKWLG  58
            VLKE++R GI+PQEKVK+EK+PMKLFME GIE+LA +  EEIE SK TKDDIDVRLKWLG
Sbjct  54   VLKEEYRGGISPQEKVKLEKDPMKLFMEGGIEDLAKMSLEEIESSKHTKDDIDVRLKWLG  113

Query  57   LFHRRKHHYGRFMMRLKLP  1
            LFHRRKHHYGRFMMRLKLP
Sbjct  114  LFHRRKHHYGRFMMRLKLP  132



>ref|XP_002883906.1| hypothetical protein ARALYDRAFT_899777 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH60165.1| hypothetical protein ARALYDRAFT_899777 [Arabidopsis lyrata subsp. 
lyrata]
Length=585

 Score =   171 bits (432),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 87/138 (63%), Positives = 100/138 (72%), Gaps = 3/138 (2%)
 Frame = -1

Query  414  MASLSVKFLAPSLQIHHANKLPKSTRLHatppqavapsppPEIDTARLEPRVEERDGYFV  235
            M S S+ F +P L    ++  PK + L A             +D  RLEPRVE +DG+F+
Sbjct  1    MTSFSLTFTSPLLP---SSSKPKRSILVAAAQTTAPAESTASVDADRLEPRVELKDGFFI  57

Query  234  LKEKFRQGINPQEKVKIEKEPMKLFMENGIEELANIPFEEIEQSKLTKDDIDVRLKWLGL  55
            LKEKFR+GINPQEKVKIEKEPMKLFMENGIEELA    EEI+  K +KDDIDVRLKWLGL
Sbjct  58   LKEKFRKGINPQEKVKIEKEPMKLFMENGIEELAKKSMEEIDSEKSSKDDIDVRLKWLGL  117

Query  54   FHRRKHHYGRFMMRLKLP  1
            FHRRKH YG+FMMRLKLP
Sbjct  118  FHRRKHQYGKFMMRLKLP  135



>gb|AAA74456.1| nitrite reductase [Phaseolus vulgaris]
Length=582

 Score =   170 bits (430),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 88/139 (63%), Positives = 105/139 (76%), Gaps = 8/139 (6%)
 Frame = -1

Query  414  MASLSVKFLAPSLQIHHANKLPKS-TRLHatppqavapsppPEIDTARLEPRVEERDGYF  238
            M+S SV+FLAP          P S ++         AP+    ++ +RLEPRVEERDG++
Sbjct  1    MSSFSVRFLAPPC-------CPTSRSKTLLCASPTAAPAASEAVEASRLEPRVEERDGFW  53

Query  237  VLKEKFRQGINPQEKVKIEKEPMKLFMENGIEELANIPFEEIEQSKLTKDDIDVRLKWLG  58
            VLKE++R GI+PQEKVK+EK+PMKLFME GIE+LA +  EEIE SK TKDDIDVRLKWLG
Sbjct  54   VLKEEYRGGISPQEKVKLEKDPMKLFMEGGIEDLAKMSLEEIESSKHTKDDIDVRLKWLG  113

Query  57   LFHRRKHHYGRFMMRLKLP  1
            LFHRRKHHYGRFMMRLKLP
Sbjct  114  LFHRRKHHYGRFMMRLKLP  132



>gb|AGQ43559.1| nitrite reductase [Morus alba]
Length=587

 Score =   170 bits (430),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 93/138 (67%), Positives = 110/138 (80%), Gaps = 1/138 (1%)
 Frame = -1

Query  414  MASLSVKFLAPSLQIHHANKLPKSTRLHatppqavapsppPEIDTARLEPRVEERDGYFV  235
            M+SLSV+ L+  L    ++   K TRL+AT   AVAP+    +D  RLEPRVE+RDGY+V
Sbjct  1    MSSLSVRLLSIPLSSSSSSSSNK-TRLNATTTPAVAPAAAVAVDAGRLEPRVEKRDGYWV  59

Query  234  LKEKFRQGINPQEKVKIEKEPMKLFMENGIEELANIPFEEIEQSKLTKDDIDVRLKWLGL  55
            LKEKFR+G+NPQEKVK+EKEPMKLFMENGIEEL+ +  EEI+  K  K+DIDVRLKWLGL
Sbjct  60   LKEKFREGLNPQEKVKLEKEPMKLFMENGIEELSKMSMEEIDSHKAAKNDIDVRLKWLGL  119

Query  54   FHRRKHHYGRFMMRLKLP  1
            FHRRKH YGRFMMRLKLP
Sbjct  120  FHRRKHQYGRFMMRLKLP  137



>ref|XP_008456121.1| PREDICTED: ferredoxin--nitrite reductase, chloroplastic [Cucumis 
melo]
Length=583

 Score =   170 bits (430),  Expect = 3e-46, Method: Composition-based stats.
 Identities = 77/96 (80%), Positives = 88/96 (92%), Gaps = 0/96 (0%)
 Frame = -1

Query  288  IDTARLEPRVEERDGYFVLKEKFRQGINPQEKVKIEKEPMKLFMENGIEELANIPFEEIE  109
            ++ +RLE RVEERDGY+V+KEKFR+G+NPQEK KIEKEPMKLFMENGIEEL+ +  EEI+
Sbjct  38   VEESRLECRVEERDGYWVVKEKFREGLNPQEKAKIEKEPMKLFMENGIEELSKLSMEEID  97

Query  108  QSKLTKDDIDVRLKWLGLFHRRKHHYGRFMMRLKLP  1
             SKLTKDD+DVRLKWLGLFHRRKH YGRFMMRLKLP
Sbjct  98   ASKLTKDDVDVRLKWLGLFHRRKHQYGRFMMRLKLP  133



>emb|CDY72359.1| BnaA07g36300D, partial [Brassica napus]
Length=411

 Score =   167 bits (422),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 87/140 (62%), Positives = 104/140 (74%), Gaps = 1/140 (1%)
 Frame = -1

Query  420  LQMASLSVKFLAPSLQIHHANKLPKSTRLHatppqavapsppPEIDTARLEPRVEERDGY  241
            +  +SLS+ F APS  +   +K  +S  + A        +  P +D  RLEPRVE RDG+
Sbjct  1    MTSSSLSLHFTAPSHTLL-PSKPRRSVIVAAQTAHPAESTASPTVDADRLEPRVELRDGF  59

Query  240  FVLKEKFRQGINPQEKVKIEKEPMKLFMENGIEELANIPFEEIEQSKLTKDDIDVRLKWL  61
            F+LKEKFR+GINPQEKVKIE EPMKLFMENGIEELA    EEI+  K +K+D+DVRLKWL
Sbjct  60   FILKEKFRKGINPQEKVKIESEPMKLFMENGIEELAKKSMEEIDSDKSSKEDVDVRLKWL  119

Query  60   GLFHRRKHHYGRFMMRLKLP  1
            GLFHRRKHHYG+FMMRLKLP
Sbjct  120  GLFHRRKHHYGKFMMRLKLP  139



>gb|AAN31830.1| putative ferredoxin--nitrite reductase [Arabidopsis thaliana]
Length=586

 Score =   169 bits (428),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 85/138 (62%), Positives = 100/138 (72%), Gaps = 2/138 (1%)
 Frame = -1

Query  414  MASLSVKFLAPSLQIHHANKLPKSTRLHatppqavapsppPEIDTARLEPRVEERDGYFV  235
            M S S+ F +P L    ++  PK + L A             +D  RLEPRVE +DG+F+
Sbjct  1    MTSFSLTFTSPLLP--SSSTKPKRSVLVAAAQTTAPAESTASVDADRLEPRVELKDGFFI  58

Query  234  LKEKFRQGINPQEKVKIEKEPMKLFMENGIEELANIPFEEIEQSKLTKDDIDVRLKWLGL  55
            LKEKFR+GINPQEKVKIE+EPMKLFMENGIEELA    EE++  K +KDDIDVRLKWLGL
Sbjct  59   LKEKFRKGINPQEKVKIEREPMKLFMENGIEELAKKSMEELDSEKSSKDDIDVRLKWLGL  118

Query  54   FHRRKHHYGRFMMRLKLP  1
            FHRRKH YG+FMMRLKLP
Sbjct  119  FHRRKHQYGKFMMRLKLP  136



>ref|NP_179164.1| Ferredoxin--nitrite reductase [Arabidopsis thaliana]
 sp|Q39161.1|NIR_ARATH RecName: Full=Ferredoxin--nitrite reductase, chloroplastic; Short=NiR; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AAK26030.1|AF360320_1 putative ferredoxin-nitrite reductase [Arabidopsis thaliana]
 dbj|BAA03561.1| nitrite reductase [Arabidopsis thaliana]
 dbj|BAA21672.1| nitrite reductase [Arabidopsis thaliana]
 gb|AAD17406.1| ferredoxin--nitrite reductase [Arabidopsis thaliana]
 gb|AAK73966.1| At2g15620/F9O13.17 [Arabidopsis thaliana]
 gb|AAM16256.1| At2g15620/F9O13.17 [Arabidopsis thaliana]
 gb|AAN13223.1| putative ferredoxin-nitrite reductase [Arabidopsis thaliana]
 gb|AEC06424.1| Ferredoxin--nitrite reductase [Arabidopsis thaliana]
Length=586

 Score =   169 bits (428),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 85/138 (62%), Positives = 100/138 (72%), Gaps = 2/138 (1%)
 Frame = -1

Query  414  MASLSVKFLAPSLQIHHANKLPKSTRLHatppqavapsppPEIDTARLEPRVEERDGYFV  235
            M S S+ F +P L    ++  PK + L A             +D  RLEPRVE +DG+F+
Sbjct  1    MTSFSLTFTSPLLP--SSSTKPKRSVLVAAAQTTAPAESTASVDADRLEPRVELKDGFFI  58

Query  234  LKEKFRQGINPQEKVKIEKEPMKLFMENGIEELANIPFEEIEQSKLTKDDIDVRLKWLGL  55
            LKEKFR+GINPQEKVKIE+EPMKLFMENGIEELA    EE++  K +KDDIDVRLKWLGL
Sbjct  59   LKEKFRKGINPQEKVKIEREPMKLFMENGIEELAKKSMEELDSEKSSKDDIDVRLKWLGL  118

Query  54   FHRRKHHYGRFMMRLKLP  1
            FHRRKH YG+FMMRLKLP
Sbjct  119  FHRRKHQYGKFMMRLKLP  136



>emb|CAC06095.1| ferredoxin-nitrite reductase [Lotus japonicus]
Length=582

 Score =   169 bits (427),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 84/137 (61%), Positives = 101/137 (74%), Gaps = 8/137 (6%)
 Frame = -1

Query  411  ASLSVKFLAPSLQIHHANKLPKSTRLHatppqavapsppPEIDTARLEPRVEERDGYFVL  232
            +S S++FLAP          P ++R  +    A     P +   +RLEPRVEER+GY+VL
Sbjct  3    SSFSIRFLAPPF--------PSTSRPKSCLSAATPAVAPTDAAVSRLEPRVEERNGYWVL  54

Query  231  KEKFRQGINPQEKVKIEKEPMKLFMENGIEELANIPFEEIEQSKLTKDDIDVRLKWLGLF  52
            KE+ R GINPQEKVK+EKEPM LFME GI+ELA +  EE++ SKLTKDD+DVRLKWLGLF
Sbjct  55   KEEHRGGINPQEKVKLEKEPMALFMEGGIDELAKVSIEELDSSKLTKDDVDVRLKWLGLF  114

Query  51   HRRKHHYGRFMMRLKLP  1
            HRRKH YGRFMMRLKLP
Sbjct  115  HRRKHQYGRFMMRLKLP  131



>ref|XP_004140695.1| PREDICTED: ferredoxin--nitrite reductase, chloroplastic-like 
[Cucumis sativus]
 gb|KGN57540.1| hypothetical protein Csa_3G207890 [Cucumis sativus]
Length=583

 Score =   169 bits (427),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 78/96 (81%), Positives = 89/96 (93%), Gaps = 0/96 (0%)
 Frame = -1

Query  288  IDTARLEPRVEERDGYFVLKEKFRQGINPQEKVKIEKEPMKLFMENGIEELANIPFEEIE  109
            ++ +RLE RVEERDGY+V+KEKFR+GINPQEKVKIEKEPMKLFMENGIEE++ +  EEI+
Sbjct  38   VEESRLESRVEERDGYWVVKEKFREGINPQEKVKIEKEPMKLFMENGIEEVSKLSMEEID  97

Query  108  QSKLTKDDIDVRLKWLGLFHRRKHHYGRFMMRLKLP  1
             SKL+KDDIDVRLKWLGLFHRRKH YGRFMMRLKLP
Sbjct  98   ASKLSKDDIDVRLKWLGLFHRRKHQYGRFMMRLKLP  133



>ref|XP_004163915.1| PREDICTED: LOW QUALITY PROTEIN: ferredoxin--nitrite reductase, 
chloroplastic-like [Cucumis sativus]
Length=583

 Score =   169 bits (427),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 78/96 (81%), Positives = 89/96 (93%), Gaps = 0/96 (0%)
 Frame = -1

Query  288  IDTARLEPRVEERDGYFVLKEKFRQGINPQEKVKIEKEPMKLFMENGIEELANIPFEEIE  109
            ++ +RLE RVEERDGY+V+KEKFR+GINPQEKVKIEKEPMKLFMENGIEE++ +  EEI+
Sbjct  38   VEESRLESRVEERDGYWVVKEKFREGINPQEKVKIEKEPMKLFMENGIEEVSKLSMEEID  97

Query  108  QSKLTKDDIDVRLKWLGLFHRRKHHYGRFMMRLKLP  1
             SKL+KDDIDVRLKWLGLFHRRKH YGRFMMRLKLP
Sbjct  98   ASKLSKDDIDVRLKWLGLFHRRKHQYGRFMMRLKLP  133



>ref|XP_004294803.1| PREDICTED: ferredoxin--nitrite reductase, chloroplastic-like 
[Fragaria vesca subsp. vesca]
Length=582

 Score =   168 bits (426),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 78/97 (80%), Positives = 89/97 (92%), Gaps = 0/97 (0%)
 Frame = -1

Query  291  EIDTARLEPRVEERDGYFVLKEKFRQGINPQEKVKIEKEPMKLFMENGIEELANIPFEEI  112
            ++   RLEPRVEER GY+VLKEKFRQGIN QEKVKI++EPMKL+ME GIEELA +PFEE+
Sbjct  36   DVAAERLEPRVEERQGYWVLKEKFRQGINVQEKVKIQREPMKLYMEGGIEELAKLPFEEL  95

Query  111  EQSKLTKDDIDVRLKWLGLFHRRKHHYGRFMMRLKLP  1
            +++K TKDDIDVRLKWLGLFHRRKHHYGRFMMRLKLP
Sbjct  96   DKAKDTKDDIDVRLKWLGLFHRRKHHYGRFMMRLKLP  132



>gb|AAN31831.1| putative ferredoxin--nitrite reductase [Arabidopsis thaliana]
Length=586

 Score =   168 bits (426),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 85/138 (62%), Positives = 99/138 (72%), Gaps = 2/138 (1%)
 Frame = -1

Query  414  MASLSVKFLAPSLQIHHANKLPKSTRLHatppqavapsppPEIDTARLEPRVEERDGYFV  235
            M S S+ F +P L    ++  PK + L A             +D  RLEPRVE +DG+F+
Sbjct  1    MTSFSLTFTSPLLP--SSSTKPKRSVLVAAAQTTAPAESTASVDADRLEPRVELKDGFFI  58

Query  234  LKEKFRQGINPQEKVKIEKEPMKLFMENGIEELANIPFEEIEQSKLTKDDIDVRLKWLGL  55
            LKEKFR+GINPQEKVKIE EPMKLFMENGIEELA    EE++  K +KDDIDVRLKWLGL
Sbjct  59   LKEKFRKGINPQEKVKIEGEPMKLFMENGIEELAKKSMEELDSEKSSKDDIDVRLKWLGL  118

Query  54   FHRRKHHYGRFMMRLKLP  1
            FHRRKH YG+FMMRLKLP
Sbjct  119  FHRRKHQYGKFMMRLKLP  136



>ref|XP_010517336.1| PREDICTED: ferredoxin--nitrite reductase, chloroplastic-like 
[Camelina sativa]
Length=584

 Score =   168 bits (426),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 85/138 (62%), Positives = 99/138 (72%), Gaps = 4/138 (3%)
 Frame = -1

Query  414  MASLSVKFLAPSLQIHHANKLPKSTRLHatppqavapsppPEIDTARLEPRVEERDGYFV  235
            M S S+ F AP L     +  PK + L A             +D  RLEPRVE +DG+++
Sbjct  1    MTSFSLTFTAPLL----PSSKPKRSVLVAAAQTTAPAESTASVDADRLEPRVELKDGFYI  56

Query  234  LKEKFRQGINPQEKVKIEKEPMKLFMENGIEELANIPFEEIEQSKLTKDDIDVRLKWLGL  55
            LKEKFR+GINPQEKVKIE+EPMKLFMENGIEELA    EE++  K +KDDIDVRLKWLGL
Sbjct  57   LKEKFRKGINPQEKVKIEREPMKLFMENGIEELAKKSMEELDSEKSSKDDIDVRLKWLGL  116

Query  54   FHRRKHHYGRFMMRLKLP  1
            FHRRKH YG+FMMRLKLP
Sbjct  117  FHRRKHQYGKFMMRLKLP  134



>ref|XP_010467309.1| PREDICTED: ferredoxin--nitrite reductase, chloroplastic-like 
[Camelina sativa]
Length=584

 Score =   168 bits (425),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 85/138 (62%), Positives = 99/138 (72%), Gaps = 4/138 (3%)
 Frame = -1

Query  414  MASLSVKFLAPSLQIHHANKLPKSTRLHatppqavapsppPEIDTARLEPRVEERDGYFV  235
            M S S+ F AP L     +  PK + L A             +D  RLEPRVE +DG+++
Sbjct  1    MTSFSLTFTAPLL----PSSKPKRSVLVAAAQTTAPAESTASVDADRLEPRVELKDGFYI  56

Query  234  LKEKFRQGINPQEKVKIEKEPMKLFMENGIEELANIPFEEIEQSKLTKDDIDVRLKWLGL  55
            LKEKFR+GINPQEKVKIE+EPMKLFMENGIEELA    EE++  K +KDDIDVRLKWLGL
Sbjct  57   LKEKFRKGINPQEKVKIEREPMKLFMENGIEELAKKSMEELDSEKSSKDDIDVRLKWLGL  116

Query  54   FHRRKHHYGRFMMRLKLP  1
            FHRRKH YG+FMMRLKLP
Sbjct  117  FHRRKHQYGKFMMRLKLP  134



>ref|XP_009119404.1| PREDICTED: ferredoxin--nitrite reductase, chloroplastic [Brassica 
rapa]
Length=589

 Score =   167 bits (422),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 87/140 (62%), Positives = 104/140 (74%), Gaps = 1/140 (1%)
 Frame = -1

Query  420  LQMASLSVKFLAPSLQIHHANKLPKSTRLHatppqavapsppPEIDTARLEPRVEERDGY  241
            +  +SLS+ F APS  +   +K  +S  + A        +  P +D  RLEPRVE RDG+
Sbjct  1    MTSSSLSLHFTAPSHTLL-PSKPRRSVIVAAQTAHPAESTASPTVDADRLEPRVELRDGF  59

Query  240  FVLKEKFRQGINPQEKVKIEKEPMKLFMENGIEELANIPFEEIEQSKLTKDDIDVRLKWL  61
            F+LKEKFR+GINPQEKVKIE EPMKLFMENGIEELA    EEI+  K +K+D+DVRLKWL
Sbjct  60   FILKEKFRKGINPQEKVKIESEPMKLFMENGIEELAKKSMEEIDSDKSSKEDVDVRLKWL  119

Query  60   GLFHRRKHHYGRFMMRLKLP  1
            GLFHRRKHHYG+FMMRLKLP
Sbjct  120  GLFHRRKHHYGKFMMRLKLP  139



>gb|KFK40026.1| hypothetical protein AALP_AA3G320500 [Arabis alpina]
Length=583

 Score =   166 bits (419),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 85/136 (63%), Positives = 101/136 (74%), Gaps = 4/136 (3%)
 Frame = -1

Query  408  SLSVKFLAPSLQIHHANKLPKSTRLHatppqavapsppPEIDTARLEPRVEERDGYFVLK  229
            SLS+ F AP L    ++K  +S  + A        +    +D  RLEPRVE RDG+++LK
Sbjct  2    SLSLHFTAPLL----SSKPKRSVLVSAQTTAPADSTASASLDADRLEPRVELRDGFYILK  57

Query  228  EKFRQGINPQEKVKIEKEPMKLFMENGIEELANIPFEEIEQSKLTKDDIDVRLKWLGLFH  49
            EKFR+GINPQEKVKIEKEPMKLFMENGIEELA    EE++  K +K+DIDVRLKWLGLFH
Sbjct  58   EKFRKGINPQEKVKIEKEPMKLFMENGIEELAKKSMEELDSDKSSKEDIDVRLKWLGLFH  117

Query  48   RRKHHYGRFMMRLKLP  1
            RRKH YG+FMMRLKLP
Sbjct  118  RRKHSYGKFMMRLKLP  133



>pdb|2AKJ|A Chain A, Structure Of Spinach Nitrite Reductase
Length=608

 Score =   166 bits (419),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 75/96 (78%), Positives = 87/96 (91%), Gaps = 0/96 (0%)
 Frame = -1

Query  288  IDTARLEPRVEERDGYFVLKEKFRQGINPQEKVKIEKEPMKLFMENGIEELANIPFEEIE  109
            +D ARLEPRVEERDG++VLKE+FR GINP EKVKIEK+PMKLF+E+GI +LA +  EE++
Sbjct  64   VDAARLEPRVEERDGFWVLKEEFRSGINPAEKVKIEKDPMKLFIEDGISDLATLSMEEVD  123

Query  108  QSKLTKDDIDVRLKWLGLFHRRKHHYGRFMMRLKLP  1
            +SK  KDDIDVRLKWLGLFHRRKHHYGRFMMRLKLP
Sbjct  124  KSKHNKDDIDVRLKWLGLFHRRKHHYGRFMMRLKLP  159



>ref|XP_006826233.1| hypothetical protein AMTR_s00132p00099120 [Amborella trichopoda]
 gb|ERM93470.1| hypothetical protein AMTR_s00132p00099120 [Amborella trichopoda]
Length=580

 Score =   165 bits (418),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 77/97 (79%), Positives = 88/97 (91%), Gaps = 0/97 (0%)
 Frame = -1

Query  291  EIDTARLEPRVEERDGYFVLKEKFRQGINPQEKVKIEKEPMKLFMENGIEELANIPFEEI  112
            E++  RLEPRVE+RDGY+VLKEKFRQG+NP EKVK++KEPMKLFMENGI+EL+ +  EEI
Sbjct  36   EVELERLEPRVEKRDGYWVLKEKFRQGLNPAEKVKLDKEPMKLFMENGIDELSKMSMEEI  95

Query  111  EQSKLTKDDIDVRLKWLGLFHRRKHHYGRFMMRLKLP  1
            + SKL KDDIDVRLKWLGLFHRRKH YGRFMMRLKLP
Sbjct  96   DASKLHKDDIDVRLKWLGLFHRRKHQYGRFMMRLKLP  132



>sp|P05314.1|NIR_SPIOL RecName: Full=Ferredoxin--nitrite reductase, chloroplastic; Flags: 
Precursor [Spinacia oleracea]
 emb|CAA34893.1| ferredoxin-nitrite reductase [Spinacia oleracea]
 emb|CAA30453.1| unnamed protein product [Spinacia oleracea]
Length=594

 Score =   165 bits (418),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 75/96 (78%), Positives = 87/96 (91%), Gaps = 0/96 (0%)
 Frame = -1

Query  288  IDTARLEPRVEERDGYFVLKEKFRQGINPQEKVKIEKEPMKLFMENGIEELANIPFEEIE  109
            +D ARLEPRVEERDG++VLKE+FR GINP EKVKIEK+PMKLF+E+GI +LA +  EE++
Sbjct  50   VDAARLEPRVEERDGFWVLKEEFRSGINPAEKVKIEKDPMKLFIEDGISDLATLSMEEVD  109

Query  108  QSKLTKDDIDVRLKWLGLFHRRKHHYGRFMMRLKLP  1
            +SK  KDDIDVRLKWLGLFHRRKHHYGRFMMRLKLP
Sbjct  110  KSKHNKDDIDVRLKWLGLFHRRKHHYGRFMMRLKLP  145



>emb|CDY37232.1| BnaA09g08530D [Brassica napus]
Length=584

 Score =   165 bits (418),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 90/137 (66%), Positives = 98/137 (72%), Gaps = 7/137 (5%)
 Frame = -1

Query  411  ASLSVKFLAPSLQIHHANKLPKSTRLHatppqavapsppPEIDTARLEPRVEERDGYFVL  232
             SLS++F  P   +     LP   R       A    P  E D  RLEPRVE RDG+F+L
Sbjct  5    TSLSLRFSPPPHTL-----LPSKPRRSLVVAAAQTAPPAVEAD--RLEPRVELRDGFFIL  57

Query  231  KEKFRQGINPQEKVKIEKEPMKLFMENGIEELANIPFEEIEQSKLTKDDIDVRLKWLGLF  52
            KEKFR+GINPQEKVKIE EPMKLFMENGIEELA    EEI+  KLTKDDIDVRLKWLGLF
Sbjct  58   KEKFRKGINPQEKVKIESEPMKLFMENGIEELAKKSMEEIDGEKLTKDDIDVRLKWLGLF  117

Query  51   HRRKHHYGRFMMRLKLP  1
            HRRKH YG+FMMRLKLP
Sbjct  118  HRRKHQYGKFMMRLKLP  134



>ref|XP_010107937.1| Ferredoxin--nitrite reductase [Morus notabilis]
 gb|EXC17337.1| Ferredoxin--nitrite reductase [Morus notabilis]
Length=583

 Score =   165 bits (418),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 77/95 (81%), Positives = 84/95 (88%), Gaps = 0/95 (0%)
 Frame = -1

Query  285  DTARLEPRVEERDGYFVLKEKFRQGINPQEKVKIEKEPMKLFMENGIEELANIPFEEIEQ  106
            D  RLEPRVEERDGY+VLKEKFRQG+NP EKVK+EKEPMKLFMENGIEEL+ +  EEI+ 
Sbjct  39   DAGRLEPRVEERDGYWVLKEKFRQGLNPHEKVKLEKEPMKLFMENGIEELSKMSMEEIDS  98

Query  105  SKLTKDDIDVRLKWLGLFHRRKHHYGRFMMRLKLP  1
             K  K+DIDVRLKWLGLFHRRKH YGRFMMRLKLP
Sbjct  99   HKAAKNDIDVRLKWLGLFHRRKHQYGRFMMRLKLP  133



>gb|ADN97117.1| nitrite reductase [Beta vulgaris]
 gb|ADR71053.1| nitrite reductase [Beta vulgaris]
Length=599

 Score =   165 bits (418),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 87/150 (58%), Positives = 104/150 (69%), Gaps = 12/150 (8%)
 Frame = -1

Query  414  MASLSVKFLAPSLQIHHANKLPKSTRLHatppqavapsppP------------EIDTARL  271
            MASL V  + PS   H  N+  +  + H                          +D+ARL
Sbjct  1    MASLPVNKIIPSTLQHSRNRTIRCQKQHQHQKMVQPAGAVSPAAKTAPASSSSSVDSARL  60

Query  270  EPRVEERDGYFVLKEKFRQGINPQEKVKIEKEPMKLFMENGIEELANIPFEEIEQSKLTK  91
            EPRVEERDG++VLKEKFR GINP EKVKIEK+PMKLF+ENGI ELA++  E+++QSK +K
Sbjct  61   EPRVEERDGFWVLKEKFRAGINPAEKVKIEKDPMKLFIENGISELASLSMEQVDQSKDSK  120

Query  90   DDIDVRLKWLGLFHRRKHHYGRFMMRLKLP  1
            DD+DVRLKWLGLFHRRKHHYGRFMMRLKLP
Sbjct  121  DDVDVRLKWLGLFHRRKHHYGRFMMRLKLP  150



>ref|XP_002454602.1| hypothetical protein SORBIDRAFT_04g034160 [Sorghum bicolor]
 gb|EES07578.1| hypothetical protein SORBIDRAFT_04g034160 [Sorghum bicolor]
Length=593

 Score =   165 bits (417),  Expect = 2e-44, Method: Composition-based stats.
 Identities = 76/98 (78%), Positives = 88/98 (90%), Gaps = 1/98 (1%)
 Frame = -1

Query  291  EIDTARLEPRVEERDG-YFVLKEKFRQGINPQEKVKIEKEPMKLFMENGIEELANIPFEE  115
            E+   RLEPRVEER+G Y+VLKEK+R G+NPQEKVK+EKEPM LFME+GI++LA IP EE
Sbjct  46   EVPAERLEPRVEEREGGYWVLKEKYRTGLNPQEKVKLEKEPMGLFMEDGIKDLAKIPMEE  105

Query  114  IEQSKLTKDDIDVRLKWLGLFHRRKHHYGRFMMRLKLP  1
            I+ +KLTKDD+DVRLKWLGLFHRRKH YGRFMMRLKLP
Sbjct  106  IDAAKLTKDDVDVRLKWLGLFHRRKHQYGRFMMRLKLP  143



>emb|CDX71230.1| BnaC07g05090D [Brassica napus]
Length=586

 Score =   165 bits (417),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 84/133 (63%), Positives = 99/133 (74%), Gaps = 4/133 (3%)
 Frame = -1

Query  387  APSLQIHHANKLP----KSTRLHatppqavapsppPEIDTARLEPRVEERDGYFVLKEKF  220
            + SL +H    LP    +S  + A        +  P +D  RLEPRVE RDG+F+LKEKF
Sbjct  4    SSSLSLHFTALLPSKPRRSVIVGAQTAHPAESTASPTVDADRLEPRVELRDGFFILKEKF  63

Query  219  RQGINPQEKVKIEKEPMKLFMENGIEELANIPFEEIEQSKLTKDDIDVRLKWLGLFHRRK  40
            R+GINPQEKVKIE+EPMKLFMENGIEELA    EEI+  K +K+D+DVRLKWLGLFHRRK
Sbjct  64   RKGINPQEKVKIEREPMKLFMENGIEELAKKSMEEIDSEKSSKEDVDVRLKWLGLFHRRK  123

Query  39   HHYGRFMMRLKLP  1
            HHYG+FMMRLKLP
Sbjct  124  HHYGKFMMRLKLP  136



>ref|XP_010675576.1| PREDICTED: ferredoxin--nitrite reductase, chloroplastic [Beta 
vulgaris subsp. vulgaris]
Length=601

 Score =   165 bits (417),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 75/92 (82%), Positives = 86/92 (93%), Gaps = 0/92 (0%)
 Frame = -1

Query  276  RLEPRVEERDGYFVLKEKFRQGINPQEKVKIEKEPMKLFMENGIEELANIPFEEIEQSKL  97
            RLEPRVEERDG++VLKEKFR GINP EKVKIEK+PMKLF+ENGI ELA++  E+++QSK 
Sbjct  61   RLEPRVEERDGFWVLKEKFRAGINPAEKVKIEKDPMKLFIENGISELASLSMEQVDQSKD  120

Query  96   TKDDIDVRLKWLGLFHRRKHHYGRFMMRLKLP  1
            +KDD+DVRLKWLGLFHRRKHHYGRFMMRLKLP
Sbjct  121  SKDDVDVRLKWLGLFHRRKHHYGRFMMRLKLP  152



>emb|CDY36642.1| BnaA07g04150D [Brassica napus]
Length=586

 Score =   164 bits (416),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 84/133 (63%), Positives = 98/133 (74%), Gaps = 4/133 (3%)
 Frame = -1

Query  387  APSLQIHHANKLP----KSTRLHatppqavapsppPEIDTARLEPRVEERDGYFVLKEKF  220
            + SL +H    LP    +S  + A        +  P +D  RLEPRVE RDG+F+LKEKF
Sbjct  4    SSSLSLHFTALLPSKPRRSVIVAAQTAHPAESTASPTVDADRLEPRVELRDGFFILKEKF  63

Query  219  RQGINPQEKVKIEKEPMKLFMENGIEELANIPFEEIEQSKLTKDDIDVRLKWLGLFHRRK  40
            R+GINPQEKVKIE EPMKLFMENGIEELA    EEI+  K +K+D+DVRLKWLGLFHRRK
Sbjct  64   RKGINPQEKVKIESEPMKLFMENGIEELAKKSMEEIDSDKSSKEDVDVRLKWLGLFHRRK  123

Query  39   HHYGRFMMRLKLP  1
            HHYG+FMMRLKLP
Sbjct  124  HHYGKFMMRLKLP  136



>gb|ACD13218.1| nitrite reductase [Brassica rapa subsp. chinensis]
Length=593

 Score =   164 bits (416),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 78/96 (81%), Positives = 85/96 (89%), Gaps = 0/96 (0%)
 Frame = -1

Query  288  IDTARLEPRVEERDGYFVLKEKFRQGINPQEKVKIEKEPMKLFMENGIEELANIPFEEIE  109
            ++  RLEPRVE RDG+F+LKEKFR+GINPQEKVKIE EPMKLFMENGIEELA    EEI+
Sbjct  48   VEADRLEPRVELRDGFFILKEKFRKGINPQEKVKIESEPMKLFMENGIEELAKKSMEEID  107

Query  108  QSKLTKDDIDVRLKWLGLFHRRKHHYGRFMMRLKLP  1
              KLTKDDIDVRLKWLGLFHRRKH YG+FMMRLKLP
Sbjct  108  GEKLTKDDIDVRLKWLGLFHRRKHQYGKFMMRLKLP  143



>ref|XP_009123250.1| PREDICTED: ferredoxin--nitrite reductase, chloroplastic-like 
[Brassica rapa]
Length=628

 Score =   164 bits (416),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 78/96 (81%), Positives = 85/96 (89%), Gaps = 0/96 (0%)
 Frame = -1

Query  288  IDTARLEPRVEERDGYFVLKEKFRQGINPQEKVKIEKEPMKLFMENGIEELANIPFEEIE  109
            ++  RLEPRVE RDG+F+LKEKFR+GINPQEKVKIE EPMKLFMENGIEELA    EEI+
Sbjct  83   VEADRLEPRVELRDGFFILKEKFRKGINPQEKVKIESEPMKLFMENGIEELAKKSMEEID  142

Query  108  QSKLTKDDIDVRLKWLGLFHRRKHHYGRFMMRLKLP  1
              KLTKDDIDVRLKWLGLFHRRKH YG+FMMRLKLP
Sbjct  143  GEKLTKDDIDVRLKWLGLFHRRKHQYGKFMMRLKLP  178



>ref|XP_010488973.1| PREDICTED: ferredoxin--nitrite reductase, chloroplastic [Camelina 
sativa]
Length=584

 Score =   164 bits (415),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 84/138 (61%), Positives = 98/138 (71%), Gaps = 4/138 (3%)
 Frame = -1

Query  414  MASLSVKFLAPSLQIHHANKLPKSTRLHatppqavapsppPEIDTARLEPRVEERDGYFV  235
            M S S+ F AP L     +  PK + L A             +D  RLEPRVE +DG+++
Sbjct  1    MTSFSLTFTAPLL----PSSKPKRSVLVAAAQTTAPAESTASVDADRLEPRVELKDGFYI  56

Query  234  LKEKFRQGINPQEKVKIEKEPMKLFMENGIEELANIPFEEIEQSKLTKDDIDVRLKWLGL  55
            LKEKFR+GINPQEKVKIE+EPMKLFMEN IEELA    EE++  K +KDDIDVRLKWLGL
Sbjct  57   LKEKFRKGINPQEKVKIEREPMKLFMENVIEELAKKSMEELDSEKSSKDDIDVRLKWLGL  116

Query  54   FHRRKHHYGRFMMRLKLP  1
            FHRRKH YG+FMMRLKLP
Sbjct  117  FHRRKHQYGKFMMRLKLP  134



>gb|AGO67239.1| ferredoxin--nitrite reductase [Silene vulgaris]
Length=592

 Score =   164 bits (416),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 87/143 (61%), Positives = 106/143 (74%), Gaps = 6/143 (4%)
 Frame = -1

Query  414  MASLSV-KFLAPSLQIHHANKLPKSTRLHatppqavapsppPE---IDTARLEPRVEERD  247
            M SLSV K + PS  +    K P S+R   +     + +   E   +D  RLEPRVEER+
Sbjct  1    MTSLSVNKIIIPSSSLTKT-KRPTSSRGVTSIRCQKSQAAAAETAKVDVTRLEPRVEERE  59

Query  246  G-YFVLKEKFRQGINPQEKVKIEKEPMKLFMENGIEELANIPFEEIEQSKLTKDDIDVRL  70
            G Y+VLKEKFR GI+PQEK+K+EK+PMKLF+ENGI ELAN+  E+++ SK TKDDIDVRL
Sbjct  60   GGYWVLKEKFRGGISPQEKIKVEKDPMKLFIENGINELANLSMEDVDASKHTKDDIDVRL  119

Query  69   KWLGLFHRRKHHYGRFMMRLKLP  1
            KWLGLFHRRK+ YGRFMMRLKLP
Sbjct  120  KWLGLFHRRKNQYGRFMMRLKLP  142



>ref|XP_006297287.1| hypothetical protein CARUB_v10013302mg [Capsella rubella]
 gb|EOA30185.1| hypothetical protein CARUB_v10013302mg [Capsella rubella]
Length=588

 Score =   164 bits (415),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 77/96 (80%), Positives = 85/96 (89%), Gaps = 0/96 (0%)
 Frame = -1

Query  288  IDTARLEPRVEERDGYFVLKEKFRQGINPQEKVKIEKEPMKLFMENGIEELANIPFEEIE  109
            +DT RLEPRVE +DG+F+LKEKFR+GINPQEKVKIE EPMKLFMENGIEELA    EEI+
Sbjct  43   VDTDRLEPRVELKDGFFILKEKFRKGINPQEKVKIESEPMKLFMENGIEELAKKSMEEID  102

Query  108  QSKLTKDDIDVRLKWLGLFHRRKHHYGRFMMRLKLP  1
              K +KDDIDVRLKWLGLFHRRKH YG+FMMRLKLP
Sbjct  103  SEKSSKDDIDVRLKWLGLFHRRKHQYGKFMMRLKLP  138



>ref|XP_006409539.1| hypothetical protein EUTSA_v10022613mg [Eutrema salsugineum]
 gb|ESQ50992.1| hypothetical protein EUTSA_v10022613mg [Eutrema salsugineum]
Length=590

 Score =   164 bits (415),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 77/96 (80%), Positives = 86/96 (90%), Gaps = 0/96 (0%)
 Frame = -1

Query  288  IDTARLEPRVEERDGYFVLKEKFRQGINPQEKVKIEKEPMKLFMENGIEELANIPFEEIE  109
            +D  RLEPRVE RDG+F+LKEKFR+GINPQEKVKIE+EPMKLFMENGIEELA    EEI+
Sbjct  44   LDADRLEPRVELRDGFFILKEKFRKGINPQEKVKIEREPMKLFMENGIEELAKKSMEEID  103

Query  108  QSKLTKDDIDVRLKWLGLFHRRKHHYGRFMMRLKLP  1
              K +K+DIDVRLKWLGLFHRRKHHYG+FMMRLKLP
Sbjct  104  SEKSSKEDIDVRLKWLGLFHRRKHHYGKFMMRLKLP  139



>ref|NP_001274384.1| nitrate reductase precursor [Glycine max]
 gb|AGY36141.1| nitrite and sulphite reductase [Glycine max]
Length=605

 Score =   164 bits (414),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 86/143 (60%), Positives = 103/143 (72%), Gaps = 6/143 (4%)
 Frame = -1

Query  411  ASLSVKFLAPSLQIHHANK----LPKS--TRLHatppqavapsppPEIDTARLEPRVEER  250
            +S SV+FLAP      +      LPK+               +   E++ +RLEPRVEER
Sbjct  13   SSFSVRFLAPLPPSSSSCFPTSSLPKTWLCAAATPTVAPSTTTSSSEVEASRLEPRVEER  72

Query  249  DGYFVLKEKFRQGINPQEKVKIEKEPMKLFMENGIEELANIPFEEIEQSKLTKDDIDVRL  70
            DG++VLKE++R GI+PQEKVK+EK+PMKLFME GIEELA +  EEIE SK TKDDIDVRL
Sbjct  73   DGFWVLKEEYRGGISPQEKVKLEKDPMKLFMEGGIEELAKMSLEEIESSKHTKDDIDVRL  132

Query  69   KWLGLFHRRKHHYGRFMMRLKLP  1
            KWLGLFHRRK H+GRFMMRLKLP
Sbjct  133  KWLGLFHRRKQHHGRFMMRLKLP  155



>ref|XP_004954025.1| PREDICTED: ferredoxin--nitrite reductase, chloroplastic-like 
[Setaria italica]
Length=593

 Score =   163 bits (413),  Expect = 7e-44, Method: Composition-based stats.
 Identities = 76/98 (78%), Positives = 86/98 (88%), Gaps = 1/98 (1%)
 Frame = -1

Query  291  EIDTARLEPRVEER-DGYFVLKEKFRQGINPQEKVKIEKEPMKLFMENGIEELANIPFEE  115
            E+   RLEPRVEER  GY+VLKEK+R G+NPQEKVKIEKEPM LFME GI++LA IP EE
Sbjct  46   EVPAERLEPRVEERVGGYWVLKEKYRTGLNPQEKVKIEKEPMGLFMEGGIKDLAKIPMEE  105

Query  114  IEQSKLTKDDIDVRLKWLGLFHRRKHHYGRFMMRLKLP  1
            I+ +K+TKDD+DVRLKWLGLFHRRKH YGRFMMRLKLP
Sbjct  106  IDAAKVTKDDVDVRLKWLGLFHRRKHQYGRFMMRLKLP  143



>gb|AAA60450.1| nitrite reductase, partial [Zea mays]
Length=567

 Score =   162 bits (411),  Expect = 1e-43, Method: Composition-based stats.
 Identities = 74/98 (76%), Positives = 87/98 (89%), Gaps = 1/98 (1%)
 Frame = -1

Query  291  EIDTARLEPRVEER-DGYFVLKEKFRQGINPQEKVKIEKEPMKLFMENGIEELANIPFEE  115
            ++ T RLEPRVEER  GY+VLKEK+R G+NPQEKVK+EKEPM LFME GI++LA +P E+
Sbjct  19   QVPTERLEPRVEERAGGYWVLKEKYRAGLNPQEKVKLEKEPMALFMEGGIQDLARVPMEQ  78

Query  114  IEQSKLTKDDIDVRLKWLGLFHRRKHHYGRFMMRLKLP  1
            I+ +KLTKDD+DVRLKWLGLFHRRKH YGRFMMRLKLP
Sbjct  79   IDAAKLTKDDVDVRLKWLGLFHRRKHQYGRFMMRLKLP  116



>sp|P17847.1|NIR_MAIZE RecName: Full=Ferredoxin--nitrite reductase, chloroplastic; Flags: 
Precursor, partial [Zea mays]
Length=569

 Score =   162 bits (411),  Expect = 1e-43, Method: Composition-based stats.
 Identities = 74/98 (76%), Positives = 87/98 (89%), Gaps = 1/98 (1%)
 Frame = -1

Query  291  EIDTARLEPRVEER-DGYFVLKEKFRQGINPQEKVKIEKEPMKLFMENGIEELANIPFEE  115
            ++ T RLEPRVEER  GY+VLKEK+R G+NPQEKVK+EKEPM LFME GI++LA +P E+
Sbjct  21   QVPTERLEPRVEERAGGYWVLKEKYRAGLNPQEKVKLEKEPMALFMEGGIQDLARVPMEQ  80

Query  114  IEQSKLTKDDIDVRLKWLGLFHRRKHHYGRFMMRLKLP  1
            I+ +KLTKDD+DVRLKWLGLFHRRKH YGRFMMRLKLP
Sbjct  81   IDAAKLTKDDVDVRLKWLGLFHRRKHQYGRFMMRLKLP  118



>ref|XP_006379199.1| hypothetical protein POPTR_0009s10440g, partial [Populus trichocarpa]
 gb|ERP56996.1| hypothetical protein POPTR_0009s10440g, partial [Populus trichocarpa]
Length=467

 Score =   161 bits (408),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 75/96 (78%), Positives = 85/96 (89%), Gaps = 0/96 (0%)
 Frame = -1

Query  288  IDTARLEPRVEERDGYFVLKEKFRQGINPQEKVKIEKEPMKLFMENGIEELANIPFEEIE  109
            +D  RLEPRV+ERDGY+VLKEKFRQGINPQEKVKI+ EPMKLFMENGIEELA +  EEI+
Sbjct  38   VDAGRLEPRVDERDGYYVLKEKFRQGINPQEKVKIKTEPMKLFMENGIEELAKLSMEEID  97

Query  108  QSKLTKDDIDVRLKWLGLFHRRKHHYGRFMMRLKLP  1
            + K +KDDIDVRLKWLGL HRRKH + RFM+RLKLP
Sbjct  98   KEKSSKDDIDVRLKWLGLLHRRKHRHCRFMIRLKLP  133



>gb|KHN37511.1| Ferredoxin--nitrite reductase, chloroplastic [Glycine soja]
Length=591

 Score =   162 bits (411),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 76/97 (78%), Positives = 88/97 (91%), Gaps = 0/97 (0%)
 Frame = -1

Query  291  EIDTARLEPRVEERDGYFVLKEKFRQGINPQEKVKIEKEPMKLFMENGIEELANIPFEEI  112
            E++ +RLEPRVEERDG++VLKE++R GI+PQEKVK+EK+PMKLFME GIEELA +  EEI
Sbjct  45   EVEASRLEPRVEERDGFWVLKEEYRGGISPQEKVKLEKDPMKLFMEGGIEELAKMSLEEI  104

Query  111  EQSKLTKDDIDVRLKWLGLFHRRKHHYGRFMMRLKLP  1
            E SK TKDDIDVRLKWLGLFHRRK H+GRFMMRLKLP
Sbjct  105  ESSKHTKDDIDVRLKWLGLFHRRKQHHGRFMMRLKLP  141



>gb|ACG29734.1| ferredoxin--nitrite reductase [Zea mays]
Length=597

 Score =   162 bits (410),  Expect = 2e-43, Method: Composition-based stats.
 Identities = 74/98 (76%), Positives = 87/98 (89%), Gaps = 1/98 (1%)
 Frame = -1

Query  291  EIDTARLEPRVEER-DGYFVLKEKFRQGINPQEKVKIEKEPMKLFMENGIEELANIPFEE  115
            ++ T RLEPRVEER  GY+VLKEK+R G+NPQEKVK+EKEPM LFME GI++LA +P E+
Sbjct  49   QVPTERLEPRVEERAGGYWVLKEKYRAGLNPQEKVKLEKEPMALFMEGGIQDLARVPMEQ  108

Query  114  IEQSKLTKDDIDVRLKWLGLFHRRKHHYGRFMMRLKLP  1
            I+ +KLTKDD+DVRLKWLGLFHRRKH YGRFMMRLKLP
Sbjct  109  IDAAKLTKDDVDVRLKWLGLFHRRKHQYGRFMMRLKLP  146



>ref|XP_008679282.1| PREDICTED: ferredoxin--nitrite reductase, chloroplastic [Zea 
mays]
 gb|AFW64352.1| ferredoxin--nitrite reductase, Precursor [Zea mays]
Length=597

 Score =   162 bits (410),  Expect = 2e-43, Method: Composition-based stats.
 Identities = 74/98 (76%), Positives = 87/98 (89%), Gaps = 1/98 (1%)
 Frame = -1

Query  291  EIDTARLEPRVEER-DGYFVLKEKFRQGINPQEKVKIEKEPMKLFMENGIEELANIPFEE  115
            ++ T RLEPRVEER  GY+VLKEK+R G+NPQEKVK+EKEPM LFME GI++LA +P E+
Sbjct  49   QVPTERLEPRVEERAGGYWVLKEKYRAGLNPQEKVKLEKEPMALFMEGGIQDLARVPMEQ  108

Query  114  IEQSKLTKDDIDVRLKWLGLFHRRKHHYGRFMMRLKLP  1
            I+ +KLTKDD+DVRLKWLGLFHRRKH YGRFMMRLKLP
Sbjct  109  IDAAKLTKDDVDVRLKWLGLFHRRKHQYGRFMMRLKLP  146



>ref|XP_001777025.1| predicted protein [Physcomitrella patens]
 dbj|BAE06055.1| ferredoxin-nitrite reductase [Physcomitrella patens]
 dbj|BAF43438.1| nitrite reductase [Physcomitrella patens]
 gb|EDQ58139.1| predicted protein [Physcomitrella patens]
Length=602

 Score =   160 bits (405),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 75/96 (78%), Positives = 80/96 (83%), Gaps = 0/96 (0%)
 Frame = -1

Query  288  IDTARLEPRVEERDGYFVLKEKFRQGINPQEKVKIEKEPMKLFMENGIEELANIPFEEIE  109
            I   RL PRVEERDGY+VLKE+FRQGINP EK+KI KEPMK FMEN IEELA  PF E++
Sbjct  65   IAADRLVPRVEERDGYYVLKEEFRQGINPSEKIKIAKEPMKFFMENEIEELAKTPFAELD  124

Query  108  QSKLTKDDIDVRLKWLGLFHRRKHHYGRFMMRLKLP  1
             SK  KDDIDVRLKWLGLFHRRKH YGRFMMR KLP
Sbjct  125  SSKAGKDDIDVRLKWLGLFHRRKHQYGRFMMRFKLP  160



>gb|AAB50233.1| nitrite reductase [Glycine max]
Length=596

 Score =   160 bits (404),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 75/96 (78%), Positives = 87/96 (91%), Gaps = 0/96 (0%)
 Frame = -1

Query  291  EIDTARLEPRVEERDGYFVLKEKFRQGINPQEKVKIEKEPMKLFMENGIEELANIPFEEI  112
            E++ +RLEPRVEERDG++VLKE++R GI+PQEKVK+EK+PMKLFME GIEELA +  EEI
Sbjct  48   EVEASRLEPRVEERDGFWVLKEEYRGGISPQEKVKLEKDPMKLFMEGGIEELAKMSLEEI  107

Query  111  EQSKLTKDDIDVRLKWLGLFHRRKHHYGRFMMRLKL  4
            E SK TKDDIDVRLKWLGLFHRRK H+GRFMMRLKL
Sbjct  108  ESSKHTKDDIDVRLKWLGLFHRRKQHHGRFMMRLKL  143



>gb|EEC70619.1| hypothetical protein OsI_01871 [Oryza sativa Indica Group]
Length=596

 Score =   158 bits (400),  Expect = 4e-42, Method: Composition-based stats.
 Identities = 73/97 (75%), Positives = 84/97 (87%), Gaps = 1/97 (1%)
 Frame = -1

Query  288  IDTARLEPRVEERDG-YFVLKEKFRQGINPQEKVKIEKEPMKLFMENGIEELANIPFEEI  112
            +   RLEPRVE+R+G Y+VLKEK+R G+NPQEKVK+ KEPM LFME GI+ELA +P EEI
Sbjct  51   VSAERLEPRVEQREGRYWVLKEKYRTGLNPQEKVKLGKEPMSLFMEGGIKELAKMPMEEI  110

Query  111  EQSKLTKDDIDVRLKWLGLFHRRKHHYGRFMMRLKLP  1
            E  KL+K+DIDVRLKWLGLFHRRKH YGRFMMRLKLP
Sbjct  111  EADKLSKEDIDVRLKWLGLFHRRKHQYGRFMMRLKLP  147



>sp|Q42997.1|NIR_ORYSJ RecName: Full=Ferredoxin--nitrite reductase, chloroplastic; Flags: 
Precursor [Oryza sativa Japonica Group]
 dbj|BAA09122.1| ferredoxin-nitrite reductase [Oryza sativa (japonica cultivar-group)]
 dbj|BAC10721.1| putative ferredoxin--nitrite reductase, chloroplast precursor 
[Oryza sativa Japonica Group]
 gb|EEE54549.1| hypothetical protein OsJ_01727 [Oryza sativa Japonica Group]
Length=596

 Score =   158 bits (400),  Expect = 5e-42, Method: Composition-based stats.
 Identities = 73/97 (75%), Positives = 84/97 (87%), Gaps = 1/97 (1%)
 Frame = -1

Query  288  IDTARLEPRVEERDG-YFVLKEKFRQGINPQEKVKIEKEPMKLFMENGIEELANIPFEEI  112
            +   RLEPRVE+R+G Y+VLKEK+R G+NPQEKVK+ KEPM LFME GI+ELA +P EEI
Sbjct  51   VSAERLEPRVEQREGRYWVLKEKYRTGLNPQEKVKLGKEPMSLFMEGGIKELAKMPMEEI  110

Query  111  EQSKLTKDDIDVRLKWLGLFHRRKHHYGRFMMRLKLP  1
            E  KL+K+DIDVRLKWLGLFHRRKH YGRFMMRLKLP
Sbjct  111  EADKLSKEDIDVRLKWLGLFHRRKHQYGRFMMRLKLP  147



>ref|NP_001043008.1| Os01g0357100 [Oryza sativa Japonica Group]
 dbj|BAF04922.1| Os01g0357100 [Oryza sativa Japonica Group]
Length=594

 Score =   158 bits (399),  Expect = 6e-42, Method: Composition-based stats.
 Identities = 73/97 (75%), Positives = 84/97 (87%), Gaps = 1/97 (1%)
 Frame = -1

Query  288  IDTARLEPRVEERDG-YFVLKEKFRQGINPQEKVKIEKEPMKLFMENGIEELANIPFEEI  112
            +   RLEPRVE+R+G Y+VLKEK+R G+NPQEKVK+ KEPM LFME GI+ELA +P EEI
Sbjct  51   VSAERLEPRVEQREGRYWVLKEKYRTGLNPQEKVKLGKEPMSLFMEGGIKELAKMPMEEI  110

Query  111  EQSKLTKDDIDVRLKWLGLFHRRKHHYGRFMMRLKLP  1
            E  KL+K+DIDVRLKWLGLFHRRKH YGRFMMRLKLP
Sbjct  111  EADKLSKEDIDVRLKWLGLFHRRKHQYGRFMMRLKLP  147



>dbj|BAD53072.1| putative ferredoxin--nitrite reductase, chloroplast precursor 
[Oryza sativa Japonica Group]
Length=627

 Score =   158 bits (399),  Expect = 6e-42, Method: Composition-based stats.
 Identities = 73/97 (75%), Positives = 84/97 (87%), Gaps = 1/97 (1%)
 Frame = -1

Query  288  IDTARLEPRVEERDG-YFVLKEKFRQGINPQEKVKIEKEPMKLFMENGIEELANIPFEEI  112
            +   RLEPRVE+R+G Y+VLKEK+R G+NPQEKVK+ KEPM LFME GI+ELA +P EEI
Sbjct  51   VSAERLEPRVEQREGRYWVLKEKYRTGLNPQEKVKLGKEPMSLFMEGGIKELAKMPMEEI  110

Query  111  EQSKLTKDDIDVRLKWLGLFHRRKHHYGRFMMRLKLP  1
            E  KL+K+DIDVRLKWLGLFHRRKH YGRFMMRLKLP
Sbjct  111  EADKLSKEDIDVRLKWLGLFHRRKHQYGRFMMRLKLP  147



>ref|XP_001775824.1| predicted protein [Physcomitrella patens]
 dbj|BAB92078.1| ferredoxin-nitrite reductase [Physcomitrella patens]
 dbj|BAF43437.1| nitrite reductase [Physcomitrella patens]
 gb|EDQ59363.1| predicted protein [Physcomitrella patens]
Length=602

 Score =   157 bits (396),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 72/92 (78%), Positives = 80/92 (87%), Gaps = 0/92 (0%)
 Frame = -1

Query  276  RLEPRVEERDGYFVLKEKFRQGINPQEKVKIEKEPMKLFMENGIEELANIPFEEIEQSKL  97
            RL PRV+ERDGY+VLKE+FRQGINPQEK+K+ KEPMK F+EN IEELA  PF E++ SK 
Sbjct  69   RLTPRVQERDGYYVLKEEFRQGINPQEKIKLGKEPMKFFIENEIEELAKTPFAELDSSKP  128

Query  96   TKDDIDVRLKWLGLFHRRKHHYGRFMMRLKLP  1
             KDDIDVRLKWLGLFHRRKH YGRFMMR KLP
Sbjct  129  GKDDIDVRLKWLGLFHRRKHQYGRFMMRFKLP  160



>ref|XP_010943064.1| PREDICTED: ferredoxin--nitrite reductase, chloroplastic [Elaeis 
guineensis]
Length=590

 Score =   156 bits (395),  Expect = 2e-41, Method: Composition-based stats.
 Identities = 72/97 (74%), Positives = 85/97 (88%), Gaps = 1/97 (1%)
 Frame = -1

Query  288  IDTARLEPRVEERDG-YFVLKEKFRQGINPQEKVKIEKEPMKLFMENGIEELANIPFEEI  112
            ++T RLE RVEE+ G Y+VLKEK+R GINPQEK+K+EKEPM L M++GI ELA  P E+I
Sbjct  40   VETERLEARVEEKGGGYWVLKEKYRAGINPQEKIKLEKEPMTLVMQDGIRELAVTPLEDI  99

Query  111  EQSKLTKDDIDVRLKWLGLFHRRKHHYGRFMMRLKLP  1
            ++SKL+KDDIDVRLKWLGLFHRRKH YGRFMMRLKLP
Sbjct  100  DKSKLSKDDIDVRLKWLGLFHRRKHQYGRFMMRLKLP  136



>ref|XP_006647964.1| PREDICTED: ferredoxin--nitrite reductase, chloroplastic-like 
[Oryza brachyantha]
Length=597

 Score =   156 bits (395),  Expect = 2e-41, Method: Composition-based stats.
 Identities = 74/93 (80%), Positives = 81/93 (87%), Gaps = 1/93 (1%)
 Frame = -1

Query  276  RLEPRVEERDG-YFVLKEKFRQGINPQEKVKIEKEPMKLFMENGIEELANIPFEEIEQSK  100
            RLEPRVEER+G Y+VLKEK R G+NPQEKVK+ KEPM LFME GI ELA +P EEIE  K
Sbjct  56   RLEPRVEEREGGYWVLKEKHRTGLNPQEKVKLGKEPMSLFMEGGIRELAKMPLEEIEADK  115

Query  99   LTKDDIDVRLKWLGLFHRRKHHYGRFMMRLKLP  1
            L+K+DIDVRLKWLGLFHRRKH YGRFMMRLKLP
Sbjct  116  LSKEDIDVRLKWLGLFHRRKHQYGRFMMRLKLP  148



>ref|XP_002979935.1| hypothetical protein SELMODRAFT_178021 [Selaginella moellendorffii]
 gb|EFJ18805.1| hypothetical protein SELMODRAFT_178021 [Selaginella moellendorffii]
Length=604

 Score =   155 bits (391),  Expect = 7e-41, Method: Composition-based stats.
 Identities = 70/96 (73%), Positives = 81/96 (84%), Gaps = 0/96 (0%)
 Frame = -1

Query  288  IDTARLEPRVEERDGYFVLKEKFRQGINPQEKVKIEKEPMKLFMENGIEELANIPFEEIE  109
            +D  RL PRVE+ D Y+VLK +FR+GINP EK+KIEKEPMKLFMENGIEELA  PF+EI+
Sbjct  68   LDAGRLVPRVEQIDNYWVLKPEFRKGINPAEKIKIEKEPMKLFMENGIEELAKKPFDEID  127

Query  108  QSKLTKDDIDVRLKWLGLFHRRKHHYGRFMMRLKLP  1
              K +K+D+D RLKWLGLFHRRKH YG FMMRLKLP
Sbjct  128  ADKESKEDVDARLKWLGLFHRRKHQYGTFMMRLKLP  163



>gb|AFW73584.1| hypothetical protein ZEAMMB73_832658 [Zea mays]
Length=593

 Score =   152 bits (385),  Expect = 5e-40, Method: Composition-based stats.
 Identities = 69/98 (70%), Positives = 82/98 (84%), Gaps = 1/98 (1%)
 Frame = -1

Query  291  EIDTARLEPRVEERDG-YFVLKEKFRQGINPQEKVKIEKEPMKLFMENGIEELANIPFEE  115
            E+   RLEPRVE R+G Y+ LKE++R G+NP EKVK+EKEPM LFM+ G+ +LA IP E 
Sbjct  44   EVPAERLEPRVEAREGGYWSLKERYRTGLNPHEKVKLEKEPMALFMDGGVRDLAKIPMEV  103

Query  114  IEQSKLTKDDIDVRLKWLGLFHRRKHHYGRFMMRLKLP  1
            I+ +KLTKDD+DVRLKWLGLFHRRKH YGRFMMRLKLP
Sbjct  104  IDAAKLTKDDVDVRLKWLGLFHRRKHQYGRFMMRLKLP  141



>ref|XP_002987413.1| hypothetical protein SELMODRAFT_183174 [Selaginella moellendorffii]
 gb|EFJ11500.1| hypothetical protein SELMODRAFT_183174 [Selaginella moellendorffii]
Length=604

 Score =   152 bits (384),  Expect = 7e-40, Method: Composition-based stats.
 Identities = 68/96 (71%), Positives = 81/96 (84%), Gaps = 0/96 (0%)
 Frame = -1

Query  288  IDTARLEPRVEERDGYFVLKEKFRQGINPQEKVKIEKEPMKLFMENGIEELANIPFEEIE  109
            +D  RL PRV++ D Y+VLK +FR+GINP EK+KI+KEPMKLFMENGIEELA  PF+EI+
Sbjct  68   LDAGRLVPRVKQIDNYWVLKPEFRKGINPAEKIKIDKEPMKLFMENGIEELAKKPFDEID  127

Query  108  QSKLTKDDIDVRLKWLGLFHRRKHHYGRFMMRLKLP  1
              K +K+D+D RLKWLGLFHRRKH YG FMMRLKLP
Sbjct  128  ADKESKEDVDARLKWLGLFHRRKHQYGTFMMRLKLP  163



>ref|XP_008646302.1| PREDICTED: ferredoxin--nitrite reductase, chloroplastic-like 
[Zea mays]
Length=666

 Score =   152 bits (383),  Expect = 1e-39, Method: Composition-based stats.
 Identities = 69/98 (70%), Positives = 82/98 (84%), Gaps = 1/98 (1%)
 Frame = -1

Query  291  EIDTARLEPRVEERDG-YFVLKEKFRQGINPQEKVKIEKEPMKLFMENGIEELANIPFEE  115
            E+   RLEPRVE R+G Y+ LKE++R G+NP EKVK+EKEPM LFM+ G+ +LA IP E 
Sbjct  117  EVPAERLEPRVEAREGGYWSLKERYRTGLNPHEKVKLEKEPMALFMDGGVRDLAKIPMEV  176

Query  114  IEQSKLTKDDIDVRLKWLGLFHRRKHHYGRFMMRLKLP  1
            I+ +KLTKDD+DVRLKWLGLFHRRKH YGRFMMRLKLP
Sbjct  177  IDAAKLTKDDVDVRLKWLGLFHRRKHQYGRFMMRLKLP  214



>ref|XP_009417626.1| PREDICTED: ferredoxin--nitrite reductase, chloroplastic [Musa 
acuminata subsp. malaccensis]
Length=597

 Score =   150 bits (380),  Expect = 3e-39, Method: Composition-based stats.
 Identities = 71/93 (76%), Positives = 81/93 (87%), Gaps = 1/93 (1%)
 Frame = -1

Query  276  RLEPRVEERDG-YFVLKEKFRQGINPQEKVKIEKEPMKLFMENGIEELANIPFEEIEQSK  100
            RLEPRVEER+G Y+VLKEK+R+GINPQEKVK+ KEPM L +E+GI ELA    EEI+ +K
Sbjct  48   RLEPRVEEREGGYWVLKEKYREGINPQEKVKLAKEPMSLVLEDGIRELAAKSMEEIDATK  107

Query  99   LTKDDIDVRLKWLGLFHRRKHHYGRFMMRLKLP  1
            + KDDIDVRLKWLGLFHRRKH YGRFMMRLKLP
Sbjct  108  VHKDDIDVRLKWLGLFHRRKHQYGRFMMRLKLP  140



>gb|AFW64351.1| hypothetical protein ZEAMMB73_724678 [Zea mays]
Length=157

 Score =   142 bits (358),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 64/88 (73%), Positives = 77/88 (88%), Gaps = 1/88 (1%)
 Frame = -1

Query  291  EIDTARLEPRVEER-DGYFVLKEKFRQGINPQEKVKIEKEPMKLFMENGIEELANIPFEE  115
            ++ T RLEPRVEER  GY+VLKEK+R G+NPQEKVK+EKEPM LFME GI++LA +P E+
Sbjct  49   QVPTERLEPRVEERAGGYWVLKEKYRAGLNPQEKVKLEKEPMALFMEGGIQDLARVPMEQ  108

Query  114  IEQSKLTKDDIDVRLKWLGLFHRRKHHY  31
            I+ +KLTKDD+DVRLKWLGLFHRRKH Y
Sbjct  109  IDAAKLTKDDVDVRLKWLGLFHRRKHQY  136



>dbj|BAB55003.1| nitrite reductase [Prunus persica]
Length=532

 Score =   149 bits (375),  Expect = 8e-39, Method: Composition-based stats.
 Identities = 70/82 (85%), Positives = 76/82 (93%), Gaps = 0/82 (0%)
 Frame = -1

Query  246  GYFVLKEKFRQGINPQEKVKIEKEPMKLFMENGIEELANIPFEEIEQSKLTKDDIDVRLK  67
            GY+VLKEKFR GIN QEKVKI+KEPMKLFMENGIEELA   FEE+E+SK +KDDIDVRLK
Sbjct  1    GYWVLKEKFRGGINVQEKVKIQKEPMKLFMENGIEELAKTSFEELEKSKDSKDDIDVRLK  60

Query  66   WLGLFHRRKHHYGRFMMRLKLP  1
            WLGLFHRRK+HYGRFMMRLKLP
Sbjct  61   WLGLFHRRKNHYGRFMMRLKLP  82



>gb|AFW64353.1| hypothetical protein ZEAMMB73_724678 [Zea mays]
Length=145

 Score =   139 bits (350),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 63/87 (72%), Positives = 76/87 (87%), Gaps = 1/87 (1%)
 Frame = -1

Query  291  EIDTARLEPRVEER-DGYFVLKEKFRQGINPQEKVKIEKEPMKLFMENGIEELANIPFEE  115
            ++ T RLEPRVEER  GY+VLKEK+R G+NPQEKVK+EKEPM LFME GI++LA +P E+
Sbjct  49   QVPTERLEPRVEERAGGYWVLKEKYRAGLNPQEKVKLEKEPMALFMEGGIQDLARVPMEQ  108

Query  114  IEQSKLTKDDIDVRLKWLGLFHRRKHH  34
            I+ +KLTKDD+DVRLKWLGLFHRRKH 
Sbjct  109  IDAAKLTKDDVDVRLKWLGLFHRRKHQ  135



>gb|ACL13516.1| ferredoxin-nitrite reductase precursor [Triticum aestivum]
Length=597

 Score =   147 bits (371),  Expect = 3e-38, Method: Composition-based stats.
 Identities = 68/93 (73%), Positives = 80/93 (86%), Gaps = 1/93 (1%)
 Frame = -1

Query  276  RLEPRVEERDG-YFVLKEKFRQGINPQEKVKIEKEPMKLFMENGIEELANIPFEEIEQSK  100
            RLEPRVE+R+G Y+VLKEK+R  +NPQEKVK+ KEPM LF E GI+ELA +P E+I+  K
Sbjct  56   RLEPRVEQREGGYWVLKEKYRTSLNPQEKVKLGKEPMALFTEGGIKELAKLPMEQIDADK  115

Query  99   LTKDDIDVRLKWLGLFHRRKHHYGRFMMRLKLP  1
            LTK+D+DVRLKWLGLFHRRK  YGRFMMRLKLP
Sbjct  116  LTKEDVDVRLKWLGLFHRRKQQYGRFMMRLKLP  148



>ref|XP_003570568.1| PREDICTED: ferredoxin--nitrite reductase, chloroplastic [Brachypodium 
distachyon]
Length=598

 Score =   147 bits (371),  Expect = 3e-38, Method: Composition-based stats.
 Identities = 68/93 (73%), Positives = 79/93 (85%), Gaps = 1/93 (1%)
 Frame = -1

Query  276  RLEPRVEERDG-YFVLKEKFRQGINPQEKVKIEKEPMKLFMENGIEELANIPFEEIEQSK  100
            RLEPRVE+R+G Y+VLKEK+R G+NPQEKVK+ KEPM LF E+GI +LA IP  EI+  K
Sbjct  57   RLEPRVEQREGGYWVLKEKYRTGLNPQEKVKLGKEPMALFTESGIRDLAKIPMAEIDADK  116

Query  99   LTKDDIDVRLKWLGLFHRRKHHYGRFMMRLKLP  1
            L K+D+DVRLKWLGLFHRRK  YGRFMMRLKLP
Sbjct  117  LAKEDVDVRLKWLGLFHRRKQQYGRFMMRLKLP  149



>gb|ACL13515.1| ferredoxin-nitrite reductase precursor [Triticum aestivum]
Length=597

 Score =   145 bits (367),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 68/93 (73%), Positives = 80/93 (86%), Gaps = 1/93 (1%)
 Frame = -1

Query  276  RLEPRVEERDG-YFVLKEKFRQGINPQEKVKIEKEPMKLFMENGIEELANIPFEEIEQSK  100
            RLEPRVE+R+G Y+VLKEK+R  +NPQEKVK+ KEPM LF E GI+ELA +P E+I+  K
Sbjct  56   RLEPRVEQREGGYWVLKEKYRTSLNPQEKVKLGKEPMALFTEGGIKELAKLPMEQIDTDK  115

Query  99   LTKDDIDVRLKWLGLFHRRKHHYGRFMMRLKLP  1
            LTK+D+DVRLKWLGLFHRRK  YGRFMMRLKLP
Sbjct  116  LTKEDVDVRLKWLGLFHRRKQQYGRFMMRLKLP  148



>dbj|BAK02992.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=599

 Score =   144 bits (364),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 67/93 (72%), Positives = 79/93 (85%), Gaps = 1/93 (1%)
 Frame = -1

Query  276  RLEPRVEERDG-YFVLKEKFRQGINPQEKVKIEKEPMKLFMENGIEELANIPFEEIEQSK  100
            RLEPRVE+R+G Y+VLKEK+R  +NPQEKVK+ KEPM LF E GI +LA +P E+I+  K
Sbjct  58   RLEPRVEQREGGYWVLKEKYRTSLNPQEKVKLGKEPMALFTEGGINDLAKLPMEQIDADK  117

Query  99   LTKDDIDVRLKWLGLFHRRKHHYGRFMMRLKLP  1
            LTK+D+DVRLKWLGLFHRRK  YGRFMMRLKLP
Sbjct  118  LTKEDVDVRLKWLGLFHRRKQQYGRFMMRLKLP  150



>ref|XP_002507511.1| nadh-nitrite reductase [Micromonas sp. RCC299]
 gb|ACO68769.1| nadh-nitrite reductase [Micromonas sp. RCC299]
Length=997

 Score = 99.8 bits (247),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 48/100 (48%), Positives = 72/100 (72%), Gaps = 6/100 (6%)
 Frame = -1

Query  285  DTARLEPRV-EERDGYFVLKEKFRQGINPQEKVKIEKEPMK-LFMENGIEELAN---IPF  121
            D  R +  V +++DGY+V+KE++R+  NP E++K+EK+PMK L    G+EE+A    + F
Sbjct  101  DVVRADSHVYKDQDGYYVVKEEYRKPTNPFERLKLEKDPMKELIHLGGLEEMAEASAVNF  160

Query  120  EEIEQSKLTKDDIDVRLKWLGLFHRRKHHYGRFMMRLKLP  1
            +E +++    D++D R KW GLFHRRK HYGR+MMRLK+P
Sbjct  161  KEWDEAN-GADEVDQRPKWAGLFHRRKGHYGRYMMRLKIP  199



>ref|XP_001419920.1| predicted protein, partial [Ostreococcus lucimarinus CCE9901]
 gb|ABO98213.1| predicted protein, partial [Ostreococcus lucimarinus CCE9901]
Length=633

 Score = 92.4 bits (228),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 46/89 (52%), Positives = 63/89 (71%), Gaps = 4/89 (4%)
 Frame = -1

Query  255  ERDGYFVLKEKFRQGINPQEKVKIEKEPMK-LFMENGIEELANIP---FEEIEQSKLTKD  88
            + DGY+V+KE++R+  NP EK+K+ K+PM+ L   NGIEE+A      F+  +++    D
Sbjct  103  DADGYYVVKEEWRKPTNPFEKLKLAKDPMRELIGMNGIEEMAKASAADFKAWDEALNDPD  162

Query  87   DIDVRLKWLGLFHRRKHHYGRFMMRLKLP  1
            + D R KW GLFHRRK HYGR+MMRLKLP
Sbjct  163  ETDQRPKWAGLFHRRKGHYGRYMMRLKLP  191



>gb|EEE57859.1| hypothetical protein OsJ_08501 [Oryza sativa Japonica Group]
Length=501

 Score = 90.5 bits (223),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 41/53 (77%), Positives = 45/53 (85%), Gaps = 0/53 (0%)
 Frame = -1

Query  159  MENGIEELANIPFEEIEQSKLTKDDIDVRLKWLGLFHRRKHHYGRFMMRLKLP  1
            ME GI+ELA +P EEIE  KL+K+DIDVRLKWLGLFH  KH YGRFMMRLKLP
Sbjct  1    MEGGIKELAKMPMEEIEADKLSKEDIDVRLKWLGLFHCHKHQYGRFMMRLKLP  53



>ref|XP_003081527.1| Nii, plastid-targeted nitrite reductase apoenzyme (IC) [Ostreococcus 
tauri]
 emb|CAL56050.1| Riboflavin synthase-like beta-barrel [Ostreococcus tauri]
Length=986

 Score = 91.3 bits (225),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 44/90 (49%), Positives = 64/90 (71%), Gaps = 4/90 (4%)
 Frame = -1

Query  258  EERDGYFVLKEKFRQGINPQEKVKIEKEPMK-LFMENGIEELAN---IPFEEIEQSKLTK  91
            ++ DGY+V+KE++R+  NP EK+K+EK+PM+ L    G+E +A    + F+  +++    
Sbjct  94   KDADGYYVVKEEWRKPTNPFEKLKLEKDPMRELIGLAGLEAMAEASAVDFKAWDEALNDP  153

Query  90   DDIDVRLKWLGLFHRRKHHYGRFMMRLKLP  1
            D+ D R KW GLFHRRK HYGR+MMRLKLP
Sbjct  154  DETDQRPKWAGLFHRRKGHYGRYMMRLKLP  183



>ref|XP_007514721.1| nitrite reductase [Bathycoccus prasinos]
 emb|CCO14961.1| nitrite reductase [Bathycoccus prasinos]
Length=1060

 Score = 89.0 bits (219),  Expect = 5e-17, Method: Composition-based stats.
 Identities = 46/93 (49%), Positives = 62/93 (67%), Gaps = 7/93 (8%)
 Frame = -1

Query  258  EERDGYFVLKEKFRQGINPQEKVKIEKEPMKLFME-NGIEELANIP------FEEIEQSK  100
            ++ DGY+V+KE++++  NP EK+K+ K+ MK  +  N I+ L          FE+ E+  
Sbjct  163  KDEDGYYVVKEEWQKPTNPFEKLKLAKDAMKTVIALNEIKTLGEKSGSTKEDFEKFEKEL  222

Query  99   LTKDDIDVRLKWLGLFHRRKHHYGRFMMRLKLP  1
               D+ID RLKW GLFHRRK HYGRFMMRLKLP
Sbjct  223  GDGDEIDHRLKWAGLFHRRKGHYGRFMMRLKLP  255



>emb|CBI32406.3| unnamed protein product [Vitis vinifera]
Length=499

 Score = 84.0 bits (206),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 38/41 (93%), Positives = 39/41 (95%), Gaps = 0/41 (0%)
 Frame = -1

Query  123  FEEIEQSKLTKDDIDVRLKWLGLFHRRKHHYGRFMMRLKLP  1
            FEEIE+SK TKDDIDVRLKWLGLFHRRKH YGRFMMRLKLP
Sbjct  3    FEEIEKSKHTKDDIDVRLKWLGLFHRRKHQYGRFMMRLKLP  43



>gb|EAY73990.1| hypothetical protein OsI_01875 [Oryza sativa Indica Group]
Length=100

 Score = 77.0 bits (188),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 35/47 (74%), Positives = 39/47 (83%), Gaps = 0/47 (0%)
 Frame = -1

Query  171  MKLFMENGIEELANIPFEEIEQSKLTKDDIDVRLKWLGLFHRRKHHY  31
            M LFME GI+ELA +P EEIE  KL+K+DIDVRLKWLGLFH RKH Y
Sbjct  1    MSLFMEGGIKELAKMPMEEIEADKLSKEDIDVRLKWLGLFHPRKHQY  47



>ref|XP_003057941.1| nitrite reductase fusion with b5r chloroplast precursor [Micromonas 
pusilla CCMP1545]
 gb|EEH57892.1| nitrite reductase fusion with b5r chloroplast precursor [Micromonas 
pusilla CCMP1545]
Length=1004

 Score = 81.6 bits (200),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 37/91 (41%), Positives = 59/91 (65%), Gaps = 4/91 (4%)
 Frame = -1

Query  261  VEERDGYFVLKEKFRQGINPQEKVKIEKEPMK----LFMENGIEELANIPFEEIEQSKLT  94
            +++ DGY+V+KE F++  NP E++K+ K+PMK    +         +   F   +++   
Sbjct  110  MKDADGYYVVKEAFQKPTNPFERLKLAKDPMKETIHMAGLEAAAAASAADFAAWDEAMND  169

Query  93   KDDIDVRLKWLGLFHRRKHHYGRFMMRLKLP  1
             D++D R KW GLFHRRK+HYGR+MMR+K+P
Sbjct  170  PDEVDQRYKWAGLFHRRKNHYGRYMMRMKIP  200



>gb|ABF46822.1| putative nitrite reductase [Fagus sylvatica]
Length=143

 Score = 64.3 bits (155),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 27/27 (100%), Positives = 27/27 (100%), Gaps = 0/27 (0%)
 Frame = -1

Query  81  DVRLKWLGLFHRRKHHYGRFMMRLKLP  1
           DVRLKWLGLFHRRKHHYGRFMMRLKLP
Sbjct  1   DVRLKWLGLFHRRKHHYGRFMMRLKLP  27



>gb|ACF22998.1| nitrite reductase [Chlorella vulgaris]
Length=206

 Score = 63.5 bits (153),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 33/64 (52%), Positives = 40/64 (63%), Gaps = 1/64 (2%)
 Frame = -1

Query  189  KIEKEPMKLFMENGIEELANIPFE-EIEQSKLTKDDIDVRLKWLGLFHRRKHHYGRFMMR  13
            K + E     M N + ELA +  E +   + L  DD+DVRLKW GLFHRRK   GRFMMR
Sbjct  84   KTKNEKCGSHMWNDVTELATLIREGKTTWADLNLDDVDVRLKWAGLFHRRKRTPGRFMMR  143

Query  12   LKLP  1
            LK+P
Sbjct  144  LKVP  147



>gb|ABK22801.1| unknown [Picea sitchensis]
Length=127

 Score = 61.6 bits (148),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 26/32 (81%), Positives = 30/32 (94%), Gaps = 0/32 (0%)
 Frame = -1

Query  288  IDTARLEPRVEERDGYFVLKEKFRQGINPQEK  193
            +D +RLEPRVEERDGY+VLKE+FR GINPQEK
Sbjct  79   VDASRLEPRVEERDGYWVLKEEFRAGINPQEK  110



>emb|CBJ25514.1| ferredoxin nitrite reductase [Ectocarpus siliculosus]
Length=645

 Score = 63.2 bits (152),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 35/70 (50%), Positives = 44/70 (63%), Gaps = 3/70 (4%)
 Frame = -1

Query  207  NPQEKVKIEKEPMKLFMENGIEELAN-IPFEEIEQSKLTKDDIDVRLKWLGLFHRRKHHY  31
            NP EK K EK    +F E  + ELA  I   E    +L+ DD D+RLKW G+FHRRK + 
Sbjct  123  NPFEKKKCEKPGDIMFTE--VHELAAAIRSGEYTWEELSVDDADIRLKWAGMFHRRKRNP  180

Query  30   GRFMMRLKLP  1
            G FMMR+K+P
Sbjct  181  GTFMMRVKIP  190



>ref|XP_005844715.1| hypothetical protein CHLNCDRAFT_26644 [Chlorella variabilis]
 gb|EFN52613.1| hypothetical protein CHLNCDRAFT_26644 [Chlorella variabilis]
Length=592

 Score = 62.0 bits (149),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 39/87 (45%), Positives = 46/87 (53%), Gaps = 4/87 (5%)
 Frame = -1

Query  255  ERDGYFVLKEKFRQGINPQEKVKIEK---EPMKLFMENGIEELANIPFE-EIEQSKLTKD  88
            ER G   L  + R     ++ VK EK   E     M   + ELA +  E +     L  D
Sbjct  66   ERSGLKYLPNEARMRAMDRKSVKFEKTKNEKCGSHMWEDVSELAQLIREGKTSWQDLNLD  125

Query  87   DIDVRLKWLGLFHRRKHHYGRFMMRLK  7
            D+DVRLKW GLFHRRK   GRFMMRLK
Sbjct  126  DVDVRLKWAGLFHRRKRTPGRFMMRLK  152



>ref|XP_005646410.1| hypothetical protein COCSUDRAFT_29833 [Coccomyxa subellipsoidea 
C-169]
 gb|EIE21866.1| hypothetical protein COCSUDRAFT_29833 [Coccomyxa subellipsoidea 
C-169]
Length=627

 Score = 61.6 bits (148),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 34/70 (49%), Positives = 44/70 (63%), Gaps = 3/70 (4%)
 Frame = -1

Query  207  NPQEKVKIEKEPMKLFMENGIEELANIPFE-EIEQSKLTKDDIDVRLKWLGLFHRRKHHY  31
            N  E +K +K   K++ E  + ELA +  + E +   L  DDIDVRLKW G+FHRRK   
Sbjct  109  NKAEGIKAQKGGHKMWTE--VTELAELIRKGETKWEDLDLDDIDVRLKWSGMFHRRKRAP  166

Query  30   GRFMMRLKLP  1
            G FMMRLK+P
Sbjct  167  GTFMMRLKVP  176



>gb|AEW90647.1| nitrite reductase [Saponaria officinalis]
Length=426

 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 25/27 (93%), Positives = 26/27 (96%), Gaps = 0/27 (0%)
 Frame = -1

Query  81  DVRLKWLGLFHRRKHHYGRFMMRLKLP  1
           DVRLKWLGLFHRRK+ YGRFMMRLKLP
Sbjct  1   DVRLKWLGLFHRRKNQYGRFMMRLKLP  27



>emb|CAA70137.1| nitrite reductase [Chlamydomonas reinhardtii]
Length=589

 Score = 59.3 bits (142),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 33/70 (47%), Positives = 46/70 (66%), Gaps = 3/70 (4%)
 Frame = -1

Query  207  NPQEKVKIEKEPMKLFMENGIEELANIPFE-EIEQSKLTKDDIDVRLKWLGLFHRRKHHY  31
            N  EKVK+EK   + +  N + EL+++  E + +   L  DD+D+RLKW GLFHR K   
Sbjct  74   NKFEKVKVEKCGSRAW--NDVFELSSLLKEGKTKWEDLNLDDVDIRLKWAGLFHRGKRTP  131

Query  30   GRFMMRLKLP  1
            G+FMMRLK+P
Sbjct  132  GKFMMRLKVP  141



>ref|XP_001696787.1| nitrite reductase [Chlamydomonas reinhardtii]
 gb|EDP00895.1| nitrite reductase [Chlamydomonas reinhardtii]
Length=589

 Score = 59.3 bits (142),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 33/70 (47%), Positives = 46/70 (66%), Gaps = 3/70 (4%)
 Frame = -1

Query  207  NPQEKVKIEKEPMKLFMENGIEELANIPFE-EIEQSKLTKDDIDVRLKWLGLFHRRKHHY  31
            N  EKVK+EK   + +  N + EL+++  E + +   L  DD+D+RLKW GLFHR K   
Sbjct  74   NKFEKVKVEKCGSRAW--NDVFELSSLLKEGKTKWEDLNLDDVDIRLKWAGLFHRGKRTP  131

Query  30   GRFMMRLKLP  1
            G+FMMRLK+P
Sbjct  132  GKFMMRLKVP  141



>gb|AAP79144.1| ferredoxin nitrite reductase [Bigelowiella natans]
Length=647

 Score = 58.9 bits (141),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 36/70 (51%), Positives = 40/70 (57%), Gaps = 3/70 (4%)
 Frame = -1

Query  207  NPQEKVKIEKEPMKLFMENGIEELANIPFEEIEQ-SKLTKDDIDVRLKWLGLFHRRKHHY  31
            N  EK+K+EK     F E  + E A    E       L  DD DVRLKW GLFHRRK   
Sbjct  105  NKIEKLKLEKCGSAAFEE--VHEFAAAIREGTTTWEDLDIDDADVRLKWAGLFHRRKRTP  162

Query  30   GRFMMRLKLP  1
            GRFMMRLK+P
Sbjct  163  GRFMMRLKVP  172



>ref|XP_005714928.1| unnamed protein product [Chondrus crispus]
 emb|CDF35109.1| unnamed protein product [Chondrus crispus]
Length=587

 Score = 56.2 bits (134),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 34/77 (44%), Positives = 47/77 (61%), Gaps = 4/77 (5%)
 Frame = -1

Query  228  EKFRQGINPQEKVKIEKEPMKLFMENGIEELANIPFE-EIEQSKLTKDDIDVRLKWLGLF  52
            EK R+G    EK+K+EK+   ++ E  I ELA +  + +     L  DD++ R KW GLF
Sbjct  67   EKARKGTKI-EKLKLEKDGSAIWDE--IPELAELLRKGQTSWDDLQVDDLETRFKWAGLF  123

Query  51   HRRKHHYGRFMMRLKLP  1
            HR+K    RFMMRLK+P
Sbjct  124  HRKKRTPRRFMMRLKVP  140



>dbj|BAE46578.1| nitrite reductase [Solanum lycopersicum]
Length=234

 Score = 54.3 bits (129),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 22/22 (100%), Positives = 22/22 (100%), Gaps = 0/22 (0%)
 Frame = -1

Query  66  WLGLFHRRKHHYGRFMMRLKLP  1
           WLGLFHRRKHHYGRFMMRLKLP
Sbjct  1   WLGLFHRRKHHYGRFMMRLKLP  22



>ref|XP_005791045.1| ferredoxin-nitrite reductase precursor [Emiliania huxleyi CCMP1516]
 gb|EOD38616.1| ferredoxin-nitrite reductase precursor [Emiliania huxleyi CCMP1516]
Length=717

 Score = 55.1 bits (131),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 30/70 (43%), Positives = 41/70 (59%), Gaps = 3/70 (4%)
 Frame = -1

Query  207  NPQEKVKIEKEPMKLFMENGIEELAN-IPFEEIEQSKLTKDDIDVRLKWLGLFHRRKHHY  31
            NP EK K+ K+    F  N +   A  +   E++   + K D++ RLKW+GL HR K   
Sbjct  139  NPIEKAKLAKDATAAF--NDVYTFAAAVRAGEMDWEDVEKMDMNTRLKWVGLVHRDKRTP  196

Query  30   GRFMMRLKLP  1
            GRFMMRL+LP
Sbjct  197  GRFMMRLRLP  206



>ref|XP_005777302.1| putative nitrite reductase [Emiliania huxleyi CCMP1516]
 gb|EOD24873.1| putative nitrite reductase [Emiliania huxleyi CCMP1516]
Length=715

 Score = 55.1 bits (131),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 30/70 (43%), Positives = 41/70 (59%), Gaps = 3/70 (4%)
 Frame = -1

Query  207  NPQEKVKIEKEPMKLFMENGIEELAN-IPFEEIEQSKLTKDDIDVRLKWLGLFHRRKHHY  31
            NP EK K+ K+    F  N +   A  +   E++   + K D++ RLKW+GL HR K   
Sbjct  139  NPIEKAKLAKDATAAF--NDVYTFAAAVRAGEMDWEDVEKMDMNTRLKWVGLVHRDKRTP  196

Query  30   GRFMMRLKLP  1
            GRFMMRL+LP
Sbjct  197  GRFMMRLRLP  206



>gb|AAT99257.1| nitrite reductase [Pseudochlorella pringsheimii]
Length=647

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 31/67 (46%), Positives = 42/67 (63%), Gaps = 3/67 (4%)
 Frame = -1

Query  198  EKVKIEKEPMKLFMENGIEELANIPFE-EIEQSKLTKDDIDVRLKWLGLFHRRKHHYGRF  22
            EK+K +K   +++ +  I ELA +    E    +L  DD+DVR KW GLFHR+K   G F
Sbjct  113  EKMKNKKSGDRIWSD--ISELAALVRSGEKTWEELNLDDVDVRTKWAGLFHRKKRAPGTF  170

Query  21   MMRLKLP  1
            MMRLK+P
Sbjct  171  MMRLKVP  177



>dbj|BAE46576.1| nitrite reductase [Physalis alkekengi]
Length=206

 Score = 52.4 bits (124),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 21/22 (95%), Positives = 21/22 (95%), Gaps = 0/22 (0%)
 Frame = -1

Query  66  WLGLFHRRKHHYGRFMMRLKLP  1
           WLGLFHRRKH YGRFMMRLKLP
Sbjct  8   WLGLFHRRKHQYGRFMMRLKLP  29



>ref|XP_002180496.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
 gb|EEC47904.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
Length=621

 Score = 52.4 bits (124),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 29/70 (41%), Positives = 43/70 (61%), Gaps = 3/70 (4%)
 Frame = -1

Query  207  NPQEKVKIEKEPMKLFMENGIEELA-NIPFEEIEQSKLTKDDIDVRLKWLGLFHRRKHHY  31
            NP EK K+ K+    F++  + E A  I   E+   ++ K D+D RLK++G+ HR K   
Sbjct  91   NPIEKAKLAKDGTSAFID--VYEYARKIREGEMTWEEVEKADLDTRLKYVGMLHRGKRTP  148

Query  30   GRFMMRLKLP  1
            G+FMMRLK+P
Sbjct  149  GQFMMRLKVP  158



>ref|XP_005704382.1| ferredoxin-nitrite reductase [Galdieria sulphuraria]
 gb|EME27862.1| ferredoxin-nitrite reductase [Galdieria sulphuraria]
Length=586

 Score = 52.0 bits (123),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 37/108 (34%), Positives = 56/108 (52%), Gaps = 18/108 (17%)
 Frame = -1

Query  285  DTARLEPRVEERD-----GYFVLKEKFRQGI----NPQEKVKIEKEPMKLFME----NGI  145
            D+A LE  +   D     G+  L +  +Q +    N  EK+K EK+    + E    + +
Sbjct  27   DSAPLEDSLPSFDLPLITGWDFLPKTIQQSVLENNNKIEKLKAEKDGSLAWQEIQKYSQM  86

Query  144  EELANIPFEEIEQSKLTKDDIDVRLKWLGLFHRRKHHYGRFMMRLKLP  1
                N+ +E+I       +D+D+RLKW G FHRRK   G FM+RL+LP
Sbjct  87   LRDGNVNWEDI-----PPEDLDIRLKWAGFFHRRKRVPGTFMVRLRLP  129



>gb|EWM20575.1| nitrite reductase, partial [Nannochloropsis gaditana]
Length=411

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 30/72 (42%), Positives = 46/72 (64%), Gaps = 9/72 (13%)
 Frame = -1

Query  198  EKVKIEKEPMKLFMENGIEELANI------PFEEIEQSKLTKDDIDVRLKWLGLFHRRKH  37
            EK+K++K+    + E  + ELA +       +EE++     KDD+D RLK+ G+FHRRK 
Sbjct  93   EKIKLKKDGSVAWRE--VHELAALLRSGQYTWEELDLMT-DKDDMDQRLKYAGIFHRRKK  149

Query  36   HYGRFMMRLKLP  1
              GRFMMR+++P
Sbjct  150  TPGRFMMRMRIP  161



>gb|EJK78098.1| nitrite reductase [Thalassiosira oceanica]
Length=622

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 27/69 (39%), Positives = 41/69 (59%), Gaps = 1/69 (1%)
 Frame = -1

Query  207  NPQEKVKIEKEPMKLFMENGIEELANIPFEEIEQSKLTKDDIDVRLKWLGLFHRRKHHYG  28
            NP EK K+ K+    F++   E  A I    +   ++ K D++ RLK++G+ HR K   G
Sbjct  75   NPIEKAKLAKDGTSAFVDV-YEYAAKIREGSMTWDEVEKADLNTRLKFVGMLHRDKRTPG  133

Query  27   RFMMRLKLP  1
            +FMMRLK+P
Sbjct  134  QFMMRLKVP  142



>ref|WP_012629926.1| ferredoxin-nitrite reductase [Cyanothece sp. PCC 7425]
 ref|YP_002485242.1| ferredoxin-nitrite reductase [Cyanothece sp. PCC 7425]
 gb|ACL46881.1| Ferredoxin--nitrite reductase [Cyanothece sp. PCC 7425]
Length=521

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 30/71 (42%), Positives = 44/71 (62%), Gaps = 8/71 (11%)
 Frame = -1

Query  213  GINPQEKVKIEKEPMKLFMENGIEELANIPFEEIEQSKLTKDDIDVRLKWLGLFHRRKHH  34
            G+N  E++K EK+ + L  E  +E +A++ +E +E+      D D RLKWLGLF R    
Sbjct  12   GVNKFERIKAEKDGLALKAE--LERIASLGWENLEEG-----DRDYRLKWLGLFFRPVSP  64

Query  33   YGRFMMRLKLP  1
             G+FMMRL+ P
Sbjct  65   -GKFMMRLRTP  74



>dbj|BAE46575.1| nitrite reductase [Physalis alkekengi]
Length=235

 Score = 49.7 bits (117),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 20/22 (91%), Positives = 21/22 (95%), Gaps = 0/22 (0%)
 Frame = -1

Query  66  WLGLFHRRKHHYGRFMMRLKLP  1
           WLGLFHRRK+ YGRFMMRLKLP
Sbjct  1   WLGLFHRRKNQYGRFMMRLKLP  22



>dbj|BAE46577.1| nitrite reductase [Solanum lycopersicum]
Length=234

 Score = 49.7 bits (117),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 20/22 (91%), Positives = 21/22 (95%), Gaps = 0/22 (0%)
 Frame = -1

Query  66  WLGLFHRRKHHYGRFMMRLKLP  1
           WLGLFHRRK+ YGRFMMRLKLP
Sbjct  1   WLGLFHRRKNQYGRFMMRLKLP  22



>ref|WP_006508771.1| precorrin-3B synthase [Xenococcus sp. PCC 7305]
 gb|ELS04107.1| precorrin-3B synthase [Xenococcus sp. PCC 7305]
Length=626

 Score = 50.1 bits (118),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 27/70 (39%), Positives = 45/70 (64%), Gaps = 8/70 (11%)
 Frame = -1

Query  210  INPQEKVKIEKEPMKLFMENGIEELANIPFEEIEQSKLTKDDIDVRLKWLGLFHRRKHHY  31
            +N  EK K  K+ + +  +N +E  A I +E ++     K D+++RLKWLG+F+R K   
Sbjct  11   LNKLEKAKAAKDGLDV--KNELEHFAKIGWEAVD-----KQDLEMRLKWLGIFYRPKTP-  62

Query  30   GRFMMRLKLP  1
            G+FM+RL++P
Sbjct  63   GKFMLRLRVP  72



>ref|XP_002289265.1| nitrite reductase-ferredoxin dependent [Thalassiosira pseudonana 
CCMP1335]
 gb|EED92802.1| nitrite reductase-ferredoxin dependent, partial [Thalassiosira 
pseudonana CCMP1335]
Length=547

 Score = 49.7 bits (117),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 29/75 (39%), Positives = 44/75 (59%), Gaps = 13/75 (17%)
 Frame = -1

Query  207  NPQEKVKIEKEPMKLFMENGIEELA------NIPFEEIEQSKLTKDDIDVRLKWLGLFHR  46
            NP EK K+ K+    F++  I E A       + +EE+E +     D++ RLK++G+ HR
Sbjct  21   NPIEKTKLAKDGTSAFVD--IYEYAAKFRSGEMTWEEVEAA-----DMNTRLKFVGMLHR  73

Query  45   RKHHYGRFMMRLKLP  1
             K   G+FMMRLK+P
Sbjct  74   DKRTPGQFMMRLKVP  88



>ref|WP_017321046.1| ferredoxin-nitrite reductase [cyanobacterium PCC 7702]
Length=526

 Score = 49.3 bits (116),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 30/70 (43%), Positives = 45/70 (64%), Gaps = 8/70 (11%)
 Frame = -1

Query  210  INPQEKVKIEKEPMKLFMENGIEELANIPFEEIEQSKLTKDDIDVRLKWLGLFHRRKHHY  31
            +N  EK+K EK+ + +  E  IE+ A++ +E I++S     D D RLKWLG+F  R    
Sbjct  11   LNKFEKIKAEKDGLAVKAE--IEKFASLGWEAIDES-----DRDYRLKWLGVFF-RPVTP  62

Query  30   GRFMMRLKLP  1
            G+FMMRL++P
Sbjct  63   GKFMMRLRIP  72



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 514890587360