BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c6261_g1_i2 len=1172 path=[1781:0-574 2355:575-1171]

Length=1172
                                                                      Score     E

gb|KHG14738.1|  SPX domain-containing 4 -like protein                 91.3    2e-17   
gb|EYU44132.1|  hypothetical protein MIMGU_mgv1a020769mg              89.0    1e-16   
ref|XP_011085739.1|  PREDICTED: SPX domain-containing protein 4       87.8    3e-16   
gb|AFK33322.1|  unknown                                               85.1    7e-16   
ref|XP_006338428.1|  PREDICTED: SPX domain-containing protein 4-like  86.7    7e-16   
ref|XP_007151238.1|  hypothetical protein PHAVU_004G029600g           86.3    1e-15   
emb|CDP02255.1|  unnamed protein product                              86.3    1e-15   
ref|XP_004304283.1|  PREDICTED: SPX domain-containing protein 4-like  85.9    2e-15   
ref|XP_007032604.1|  Xenotropic and polytropic murine leukemia vi...  85.5    2e-15   
ref|NP_001241021.1|  uncharacterized protein LOC100792209             85.1    3e-15   
gb|AFK34670.1|  unknown                                               85.1    3e-15   
ref|XP_010088129.1|  hypothetical protein L484_013573                 85.1    4e-15   
gb|KHN13209.1|  SPX domain-containing protein 4                       85.5    4e-15   
ref|XP_010316248.1|  PREDICTED: SPX domain-containing protein 4-l...  84.3    4e-15   
ref|XP_004232210.1|  PREDICTED: SPX domain-containing protein 4-l...  84.3    5e-15   
ref|XP_008798633.1|  PREDICTED: SPX domain-containing protein 4 i...  83.6    9e-15   
ref|XP_010550031.1|  PREDICTED: SPX domain-containing protein 4       83.2    2e-14   
ref|XP_010029315.1|  PREDICTED: SPX domain-containing protein 4       82.8    2e-14   
ref|XP_004233370.1|  PREDICTED: SPX domain-containing protein 4       82.0    4e-14   
gb|EYU34641.1|  hypothetical protein MIMGU_mgv1a011020mg              81.6    4e-14   
ref|XP_002530001.1|  xenotropic and polytropic murine leukemia vi...  81.6    6e-14   Ricinus communis
emb|CBI22247.3|  unnamed protein product                              80.5    8e-14   
ref|XP_010908687.1|  PREDICTED: SPX domain-containing protein 4 i...  80.9    9e-14   
ref|XP_008798634.1|  PREDICTED: SPX domain-containing protein 4 i...  80.1    1e-13   
ref|XP_009775847.1|  PREDICTED: SPX domain-containing protein 4       80.1    2e-13   
gb|KDP27173.1|  hypothetical protein JCGZ_19872                       80.1    2e-13   
ref|XP_009602126.1|  PREDICTED: SPX domain-containing protein 4       79.0    4e-13   
ref|XP_002283890.1|  PREDICTED: SPX domain-containing protein 4       79.0    5e-13   Vitis vinifera
gb|EPS59264.1|  hypothetical protein M569_15543                       78.2    5e-13   
emb|CDX69529.1|  BnaA10g18780D                                        78.6    6e-13   
ref|XP_006363409.1|  PREDICTED: SPX domain-containing protein 4-like  78.2    7e-13   
ref|XP_004171215.1|  PREDICTED: SPX domain-containing protein 4-like  78.2    9e-13   
ref|XP_010908689.1|  PREDICTED: SPX domain-containing protein 4 i...  77.4    1e-12   
ref|XP_006384151.1|  hypothetical protein POPTR_0004s08470g           75.1    2e-12   
ref|XP_003629411.1|  SPX-domain protein                               77.0    2e-12   
ref|XP_002871662.1|  hypothetical protein ARALYDRAFT_488382           76.6    3e-12   
ref|XP_010670237.1|  PREDICTED: SPX domain-containing protein 4       75.9    7e-12   
gb|KFK25782.1|  hypothetical protein AALP_AA8G159600                  75.5    7e-12   
ref|XP_002323873.1|  SPX domain-containing family protein             75.5    9e-12   Populus trichocarpa [western balsam poplar]
ref|XP_006373335.1|  hypothetical protein POPTR_0017s12250g           75.1    9e-12   
ref|XP_004141576.1|  PREDICTED: SPX domain-containing protein 4-like  75.5    9e-12   
ref|XP_008379380.1|  PREDICTED: SPX domain-containing protein 4       74.7    2e-11   
ref|XP_009121581.1|  PREDICTED: SPX domain-containing protein 4       74.3    2e-11   
ref|XP_006431205.1|  hypothetical protein CICLE_v10012222mg           74.3    2e-11   
ref|XP_006482630.1|  PREDICTED: SPX domain-containing protein 4-like  74.3    2e-11   
ref|XP_011035795.1|  PREDICTED: SPX domain-containing protein 4       73.9    3e-11   
ref|NP_568312.1|  SPX domain-containing protein 4                     73.9    3e-11   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006840588.1|  hypothetical protein AMTR_s00045p00232830        73.6    4e-11   
ref|XP_009360600.1|  PREDICTED: SPX domain-containing protein 4-like  73.2    6e-11   
emb|CAB89343.1|  ids-4 protein-like                                   73.6    6e-11   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010245395.1|  PREDICTED: SPX domain-containing protein 4       72.4    1e-10   
emb|CDY26417.1|  BnaC09g42510D                                        71.6    1e-10   
ref|XP_007215658.1|  hypothetical protein PRUPE_ppa008419mg           72.0    1e-10   
ref|XP_009414474.1|  PREDICTED: SPX domain-containing protein 4-like  71.2    2e-10   
ref|XP_008368434.1|  PREDICTED: SPX domain-containing protein 4-like  71.6    2e-10   
ref|XP_010453669.1|  PREDICTED: SPX domain-containing protein 4       70.5    4e-10   
ref|XP_006288240.1|  hypothetical protein CARUB_v10001482mg           70.1    5e-10   
ref|XP_006400057.1|  hypothetical protein EUTSA_v10014185mg           69.3    8e-10   
ref|XP_011098655.1|  PREDICTED: SPX domain-containing protein 4-like  65.9    9e-09   
ref|XP_010420189.1|  PREDICTED: SPX domain-containing protein 4-like  66.6    9e-09   
ref|XP_008368466.1|  PREDICTED: SPX domain-containing protein 4-like  63.5    1e-08   
ref|XP_010492366.1|  PREDICTED: SPX domain-containing protein 4-like  65.5    2e-08   
ref|XP_008362154.1|  PREDICTED: SPX domain-containing protein 4-like  62.4    8e-08   
gb|ABF99665.1|  BLYIDS4G, putative, expressed                         60.1    2e-07   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006650832.1|  PREDICTED: SPX domain-containing protein 4-like  62.4    2e-07   
dbj|BAJ97120.1|  predicted protein                                    62.0    2e-07   
ref|XP_010258944.1|  PREDICTED: SPX domain-containing protein 3-like  61.2    3e-07   
gb|KEH29183.1|  phosphorus starvation-induced protein                 60.8    3e-07   
ref|XP_004287317.1|  PREDICTED: SPX domain-containing protein 1-like  60.5    5e-07   
gb|ACJ84638.1|  unknown                                               58.9    9e-07   Medicago truncatula
ref|XP_009591083.1|  PREDICTED: SPX domain-containing protein 1-like  60.1    1e-06   
ref|XP_010088906.1|  hypothetical protein L484_020896                 59.3    1e-06   
sp|Q10B79.1|SPX4_ORYSJ  RecName: Full=SPX domain-containing prote...  59.7    1e-06   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009418990.1|  PREDICTED: SPX domain-containing protein 4-like  59.3    2e-06   
ref|XP_004506478.1|  PREDICTED: SPX domain-containing protein 3-like  58.5    2e-06   
ref|XP_003563294.1|  PREDICTED: SPX domain-containing protein 4       59.3    2e-06   
ref|XP_004251718.1|  PREDICTED: SPX domain-containing protein 1       58.5    2e-06   
ref|XP_007134740.1|  hypothetical protein PHAVU_010G0720001g          55.8    3e-06   
ref|XP_010510881.1|  PREDICTED: SPX domain-containing protein 2       58.5    3e-06   
ref|XP_009360601.1|  PREDICTED: SPX domain-containing protein 4-like  58.5    3e-06   
ref|XP_010420853.1|  PREDICTED: SPX domain-containing protein 1-like  58.2    3e-06   
ref|XP_003633934.1|  PREDICTED: SPX domain-containing protein 3       57.8    4e-06   
ref|XP_008459339.1|  PREDICTED: SPX domain-containing protein 4       58.2    4e-06   
ref|XP_002524498.1|  xenotropic and polytropic murine leukemia vi...  57.8    5e-06   Ricinus communis
ref|XP_008804593.1|  PREDICTED: SPX domain-containing protein 1-like  57.0    7e-06   
ref|XP_003517020.1|  PREDICTED: SPX domain-containing protein 3-like  57.0    8e-06   
ref|XP_010264412.1|  PREDICTED: SPX domain-containing protein 3-like  57.0    8e-06   
ref|XP_010692168.1|  PREDICTED: SPX domain-containing protein 3       57.0    8e-06   
ref|XP_004489493.1|  PREDICTED: SPX domain-containing protein 4-like  57.4    9e-06   
ref|XP_008792042.1|  PREDICTED: SPX domain-containing protein 1-like  57.0    1e-05   
ref|XP_009408839.1|  PREDICTED: SPX domain-containing protein 5-like  56.6    1e-05   
ref|XP_006400582.1|  hypothetical protein EUTSA_v10014356mg           56.6    1e-05   
ref|XP_009398179.1|  PREDICTED: SPX domain-containing protein 3-l...  56.2    1e-05   
ref|XP_009398178.1|  PREDICTED: SPX domain-containing protein 5-l...  56.2    1e-05   
ref|XP_010454318.1|  PREDICTED: SPX domain-containing protein 1       56.2    1e-05   
ref|XP_002986054.1|  hypothetical protein SELMODRAFT_123281           56.2    1e-05   
ref|XP_003522024.1|  PREDICTED: SPX domain-containing protein 3-like  56.2    1e-05   
ref|XP_002966709.1|  hypothetical protein SELMODRAFT_85666            56.2    1e-05   
ref|XP_009133937.1|  PREDICTED: SPX domain-containing protein 2       56.2    1e-05   
emb|CDX83238.1|  BnaA03g22680D                                        56.2    1e-05   
ref|XP_006345229.1|  PREDICTED: SPX domain-containing protein 2-like  56.2    1e-05   
emb|CDY38527.1|  BnaC03g26700D                                        56.2    2e-05   
ref|XP_008337294.1|  PREDICTED: SPX domain-containing protein 1       56.2    2e-05   
gb|KFK30512.1|  hypothetical protein AALP_AA7G271900                  55.8    2e-05   
ref|XP_008802486.1|  PREDICTED: SPX domain-containing protein 5       55.5    2e-05   
ref|XP_003609335.1|  hypothetical protein MTR_4g114550                55.8    2e-05   
ref|XP_006409728.1|  hypothetical protein EUTSA_v10016985mg           56.2    2e-05   
gb|ACJ85241.1|  unknown                                               55.8    2e-05   Medicago truncatula
ref|XP_004308469.1|  PREDICTED: SPX domain-containing protein 3-like  55.5    2e-05   
ref|XP_002308081.1|  hypothetical protein POPTR_0006s06880g           55.8    2e-05   Populus trichocarpa [western balsam poplar]
ref|XP_010914861.1|  PREDICTED: SPX domain-containing protein 1-like  55.5    3e-05   
ref|XP_006375297.1|  hypothetical protein POPTR_0014s06020g           55.1    3e-05   
gb|EYU31951.1|  hypothetical protein MIMGU_mgv1a024738mg              54.7    4e-05   
gb|AFW66117.1|  hypothetical protein ZEAMMB73_937184                  52.8    4e-05   
ref|XP_009775255.1|  PREDICTED: SPX domain-containing protein 1-like  55.1    4e-05   
ref|XP_002871925.1|  SPX domain-containing protein                    54.7    4e-05   
gb|EMT28546.1|  hypothetical protein F775_25863                       54.7    5e-05   
gb|KDP28799.1|  hypothetical protein JCGZ_14570                       54.3    5e-05   
ref|XP_011033628.1|  PREDICTED: SPX domain-containing protein 3-l...  54.3    5e-05   
ref|XP_011017757.1|  PREDICTED: SPX domain-containing protein 1-like  54.7    5e-05   
ref|XP_009408982.1|  PREDICTED: SPX domain-containing protein 1-like  54.7    6e-05   
ref|XP_010939888.1|  PREDICTED: SPX domain-containing protein 5 i...  53.9    6e-05   
emb|CBI21037.3|  unnamed protein product                              54.3    6e-05   
ref|XP_011033635.1|  PREDICTED: SPX domain-containing protein 3-l...  53.9    7e-05   
ref|XP_009773844.1|  PREDICTED: SPX domain-containing protein 1-like  54.3    7e-05   
ref|XP_010939887.1|  PREDICTED: SPX domain-containing protein 5 i...  53.9    7e-05   
ref|XP_004984066.1|  PREDICTED: SPX domain-containing protein 5-like  53.9    7e-05   
ref|XP_004508498.1|  PREDICTED: SPX domain-containing protein 2-like  54.3    7e-05   
ref|XP_002466164.1|  hypothetical protein SORBIDRAFT_01g002690        54.3    8e-05   Sorghum bicolor [broomcorn]
ref|XP_002285094.1|  PREDICTED: SPX domain-containing protein 1       53.9    9e-05   Vitis vinifera
ref|XP_009397480.1|  PREDICTED: SPX domain-containing protein 1-like  53.9    9e-05   
ref|XP_008444000.1|  PREDICTED: SPX domain-containing protein 1-like  53.9    1e-04   
gb|KHG08005.1|  SPX domain-containing 3 -like protein                 53.5    1e-04   
ref|XP_010524397.1|  PREDICTED: SPX domain-containing protein 3       52.8    2e-04   
ref|XP_008659744.1|  PREDICTED: SPX domain-containing protein 1-l...  51.2    2e-04   
ref|XP_008659745.1|  PREDICTED: SPX domain-containing protein 1-l...  51.2    2e-04   
ref|XP_008659746.1|  PREDICTED: SPX domain-containing protein 1-l...  51.2    2e-04   
tpg|DAA50080.1|  TPA: hypothetical protein ZEAMMB73_872399            52.0    2e-04   
ref|XP_003559963.1|  PREDICTED: SPX domain-containing protein 6-like  52.4    2e-04   
ref|XP_008676663.1|  PREDICTED: uncharacterized protein LOC100216...  52.8    2e-04   
ref|NP_001136588.1|  uncharacterized protein LOC100216711             52.8    2e-04   Zea mays [maize]
ref|XP_011017455.1|  PREDICTED: SPX domain-containing protein 3-like  52.4    2e-04   
gb|ACG49051.1|  IDS4-like protein                                     52.8    2e-04   Zea mays [maize]
ref|XP_002438650.1|  hypothetical protein SORBIDRAFT_10g023590        52.8    2e-04   Sorghum bicolor [broomcorn]
ref|XP_004308470.1|  PREDICTED: SPX domain-containing protein 3-like  52.4    2e-04   
ref|XP_008232577.1|  PREDICTED: SPX domain-containing protein 3       52.4    2e-04   
ref|XP_011093319.1|  PREDICTED: SPX domain-containing protein 3-like  52.4    2e-04   
ref|XP_007218822.1|  hypothetical protein PRUPE_ppa010111mg           52.4    3e-04   
ref|XP_006364936.1|  PREDICTED: SPX domain-containing protein 2-like  52.4    3e-04   
ref|XP_010053938.1|  PREDICTED: SPX domain-containing protein 3       52.4    3e-04   
ref|XP_006658812.1|  PREDICTED: SPX domain-containing protein 6-like  50.1    3e-04   
ref|XP_008664986.1|  PREDICTED: SPX domain-containing protein 3-l...  51.6    3e-04   
ref|XP_008665041.1|  PREDICTED: hypothetical protein isoform X2       52.4    3e-04   
gb|AIL30510.1|  IDS4-like protein                                     52.0    4e-04   
ref|XP_009605842.1|  PREDICTED: SPX domain-containing protein 1-like  52.0    4e-04   
ref|XP_007052145.1|  SPX domain gene 3                                52.0    4e-04   
ref|XP_009772195.1|  PREDICTED: SPX domain-containing protein 3       52.0    4e-04   
ref|NP_001136595.1|  hypothetical protein                             52.0    4e-04   Zea mays [maize]
emb|CDY37028.1|  BnaA04g26060D                                        51.6    4e-04   
ref|XP_002301267.2|  hypothetical protein POPTR_0002s14470g           51.6    4e-04   Populus trichocarpa [western balsam poplar]
ref|XP_008459739.1|  PREDICTED: SPX domain-containing protein 3       51.6    5e-04   
ref|XP_008230989.1|  PREDICTED: SPX domain-containing protein 4       52.0    5e-04   
emb|CDX83401.1|  BnaA03g21050D                                        51.2    5e-04   
ref|NP_001288809.1|  SPX domain-containing protein 3                  51.2    5e-04   
ref|NP_001050332.1|  Os03g0406100                                     51.2    5e-04   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009595238.1|  PREDICTED: SPX domain-containing protein 3       51.2    5e-04   
ref|NP_001234034.1|  IDS4-like protein                                51.2    5e-04   
ref|XP_009349310.1|  PREDICTED: SPX domain-containing protein 3-like  51.2    5e-04   
ref|XP_003549761.1|  PREDICTED: SPX domain-containing protein 2-like  51.6    6e-04   
gb|AEG42535.1|  SPX domain-harboring protein 3.2                      50.8    6e-04   
ref|XP_009375757.1|  PREDICTED: SPX domain-containing protein 3-like  51.2    6e-04   
ref|XP_006656217.1|  PREDICTED: SPX domain-containing protein 1-like  51.6    6e-04   
ref|XP_009142318.1|  PREDICTED: SPX domain-containing protein 3       50.8    6e-04   
emb|CDY27393.1|  BnaC04g50120D                                        50.8    7e-04   
ref|XP_010506449.1|  PREDICTED: SPX domain-containing protein 3       50.8    7e-04   
ref|XP_010518125.1|  PREDICTED: SPX domain-containing protein 3-like  50.8    7e-04   
ref|XP_003542678.1|  PREDICTED: SPX domain-containing protein 2-like  51.2    8e-04   
ref|XP_006294897.1|  hypothetical protein CARUB_v10023947mg           50.8    8e-04   
ref|XP_004968896.1|  PREDICTED: SPX domain-containing protein 6-like  50.8    8e-04   
ref|XP_006347900.1|  PREDICTED: SPX domain-containing protein 3-like  50.8    8e-04   
ref|XP_004229786.1|  PREDICTED: SPX domain-containing protein 3       50.8    8e-04   
ref|XP_010508209.1|  PREDICTED: SPX domain-containing protein 3-like  50.4    9e-04   
ref|XP_003588761.1|  Vacuolar transporter chaperone                   48.9    0.001   
ref|XP_007155005.1|  hypothetical protein PHAVU_003G164900g           50.8    0.001   



>gb|KHG14738.1| SPX domain-containing 4 -like protein [Gossypium arboreum]
Length=320

 Score = 91.3 bits (225),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 60/103 (58%), Positives = 74/103 (72%), Gaps = 15/103 (15%)
 Frame = +2

Query  311  MKFGKEFKVHLEDTLPEWRDkylrykplkkllkslpAHPSA---------AAAGDGSFQP  463
            MKFGKEFK HLE+TLPEWRDK+L YKPLKKLLK++ + PS          A A + +  P
Sbjct  1    MKFGKEFKTHLEETLPEWRDKFLCYKPLKKLLKNISSTPSLDPHHQRPVFADATNTAVTP  60

Query  464  P------PPSELHDWFIRLLTEDLEKFNDFYVEQEEEFIIRFQ  574
                   PP +L DWF+R+L E+LEKFNDFYV++EEEF+IRFQ
Sbjct  61   VCHDHQHPPLDLQDWFVRILNEELEKFNDFYVDKEEEFVIRFQ  103



>gb|EYU44132.1| hypothetical protein MIMGU_mgv1a020769mg [Erythranthe guttata]
Length=307

 Score = 89.0 bits (219),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 57/89 (64%), Positives = 68/89 (76%), Gaps = 1/89 (1%)
 Frame = +2

Query  311  MKFGKEFKVHLEDTLPEWRDkylrykplkkllkslpAHPSAAAAGDGSFQPPPP-SELHD  487
            MKFGKEF++HLE TLP WRDK+L YK LKKLLK++PA       G G+  P  P  ELH 
Sbjct  1    MKFGKEFRMHLEKTLPSWRDKFLCYKVLKKLLKNVPAAADNPPRGVGAAVPMLPLPELHV  60

Query  488  WFIRLLTEDLEKFNDFYVEQEEEFIIRFQ  574
            WF+ +L E+LEKFNDFYVE+EE+FIIRFQ
Sbjct  61   WFVTILNEELEKFNDFYVEKEEDFIIRFQ  89



>ref|XP_011085739.1| PREDICTED: SPX domain-containing protein 4 [Sesamum indicum]
Length=299

 Score = 87.8 bits (216),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 57/89 (64%), Positives = 71/89 (80%), Gaps = 5/89 (6%)
 Frame = +2

Query  311  MKFGKEFKVHLEDTLPEWRDkylrykplkkllkslpAHPSAAAAGDGSFQPPPPSELHDW  490
            MKFGKEF++HLE+TLPEWRDKYL YKPLKKLLK++PA  +     +GS       ELH+W
Sbjct  1    MKFGKEFRIHLEETLPEWRDKYLSYKPLKKLLKNIPAPAAHNLPPEGSL-----PELHEW  55

Query  491  FIRLLTEDLEKFNDFYVEQEEEFIIRFQV  577
            F+ +L E+LEKFNDFYV++EEEF+IRFQ 
Sbjct  56   FVGILNEELEKFNDFYVDKEEEFVIRFQA  84



>gb|AFK33322.1| unknown [Lotus japonicus]
Length=199

 Score = 85.1 bits (209),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 55/92 (60%), Positives = 66/92 (72%), Gaps = 4/92 (4%)
 Frame = +2

Query  311  MKFGKEFKVHLEDTLPEWRDkylrykplkkllkslpAHPSAAAAGDGSF----QPPPPSE  478
            MKFGKEFK HLE+T+PEWRDK+L YKPLKKLLK      + A   D       QP  P  
Sbjct  1    MKFGKEFKTHLEETIPEWRDKFLCYKPLKKLLKHHHLPTTVAPPLDLHLHLFQQPISPHL  60

Query  479  LHDWFIRLLTEDLEKFNDFYVEQEEEFIIRFQ  574
            L  WF+R+L ++LEKFNDFYV++EEEF+IRFQ
Sbjct  61   LQAWFLRILNQELEKFNDFYVDKEEEFVIRFQ  92



>ref|XP_006338428.1| PREDICTED: SPX domain-containing protein 4-like [Solanum tuberosum]
Length=294

 Score = 86.7 bits (213),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 53/88 (60%), Positives = 60/88 (68%), Gaps = 9/88 (10%)
 Frame = +2

Query  311  MKFGKEFKVHLEDTLPEWRDkylrykplkkllkslpAHPSAAAAGDGSFQPPPPSELHDW  490
            MKFGKEF  HLE+TLPEWRDKYL YKPLK                DG   PPP   L DW
Sbjct  1    MKFGKEFTTHLEETLPEWRDKYLCYKPLK-------KLLKNLPPTDGGDNPPP--HLQDW  51

Query  491  FIRLLTEDLEKFNDFYVEQEEEFIIRFQ  574
            F+R+L E+L+KFNDFYV++EEEFIIR Q
Sbjct  52   FVRILNEELDKFNDFYVDKEEEFIIRLQ  79



>ref|XP_007151238.1| hypothetical protein PHAVU_004G029600g [Phaseolus vulgaris]
 gb|ESW23232.1| hypothetical protein PHAVU_004G029600g [Phaseolus vulgaris]
Length=308

 Score = 86.3 bits (212),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 57/94 (61%), Positives = 67/94 (71%), Gaps = 8/94 (9%)
 Frame = +2

Query  311  MKFGKEFKVHLEDTLPEWRDkylrykplkkllkslpAHPSAAAAGDGSF------QPPPP  472
            MKFGKEFK HLE+T+PEWRDK+L YKPLKKLLK     PS A     +       QP  P
Sbjct  1    MKFGKEFKTHLEETIPEWRDKFLCYKPLKKLLKHHL--PSTATTTPINLPLHLLPQPSSP  58

Query  473  SELHDWFIRLLTEDLEKFNDFYVEQEEEFIIRFQ  574
              L  WF+R+L E+LEKFNDFYV++EEEF+IRFQ
Sbjct  59   QLLQAWFVRILNEELEKFNDFYVDKEEEFVIRFQ  92



>emb|CDP02255.1| unnamed protein product [Coffea canephora]
Length=312

 Score = 86.3 bits (212),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 50/99 (51%), Positives = 62/99 (63%), Gaps = 11/99 (11%)
 Frame = +2

Query  311  MKFGKEFKVHLEDTLPEWRDk---------ylrykplkkllkslpAHPSAAAAGDGSFQP  463
            MKFGKEFK HLE+TLPEWR+K          L+  P      +    P+     DG   P
Sbjct  1    MKFGKEFKTHLEETLPEWREKYLCYKPLKKLLKNIPTPDAAPAPAPAPAPLPPADGDNYP  60

Query  464  PPPS--ELHDWFIRLLTEDLEKFNDFYVEQEEEFIIRFQ  574
            PP    EL DWF+R+LTE+LEKFNDFY+++EE+FIIR Q
Sbjct  61   PPAPFPELQDWFVRILTEELEKFNDFYIDKEEDFIIRLQ  99



>ref|XP_004304283.1| PREDICTED: SPX domain-containing protein 4-like [Fragaria vesca 
subsp. vesca]
Length=317

 Score = 85.9 bits (211),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 50/102 (49%), Positives = 60/102 (59%), Gaps = 14/102 (14%)
 Frame = +2

Query  311  MKFGKEFKVHLEDTLPEWRDk-------ylrykplkkllkslpAHP-------SAAAAGD  448
            MKFGKEF  HLE+T+PEWRDK           K L         HP       S A AG 
Sbjct  1    MKFGKEFTNHLEETIPEWRDKFLCYKLLKKLLKRLPTSTVDALPHPFNLNQRLSDADAGG  60

Query  449  GSFQPPPPSELHDWFIRLLTEDLEKFNDFYVEQEEEFIIRFQ  574
            G+    P  EL DWF+R+L ++LEK NDFYV++EE+FIIRFQ
Sbjct  61   GTGPSRPLGELQDWFVRILNDELEKLNDFYVDKEEDFIIRFQ  102



>ref|XP_007032604.1| Xenotropic and polytropic murine leukemia virus receptor ids-4, 
putative [Theobroma cacao]
 gb|EOY03530.1| Xenotropic and polytropic murine leukemia virus receptor ids-4, 
putative [Theobroma cacao]
Length=322

 Score = 85.5 bits (210),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 60/107 (56%), Positives = 72/107 (67%), Gaps = 20/107 (19%)
 Frame = +2

Query  311  MKFGKEFKVHLEDTLPEWRDkylrykplkkllkslpAHPS-------------------A  433
            MKFGKEFK HLE+TLPEWRDK+L YKPLKKLLK+LP  P+                   A
Sbjct  1    MKFGKEFKTHLEETLPEWRDKFLCYKPLKKLLKNLPQTPTLDPHLPHDQRPIFADTTNTA  60

Query  434  AAAGDGSFQPPPPSELHDWFIRLLTEDLEKFNDFYVEQEEEFIIRFQ  574
                D   Q PP  +L DWF+R+L E+LEKFNDFYV++EE+F+IRFQ
Sbjct  61   VTTVDHDHQQPP-VDLQDWFVRILNEELEKFNDFYVDKEEDFVIRFQ  106



>ref|NP_001241021.1| uncharacterized protein LOC100792209 [Glycine max]
 gb|ACU20567.1| unknown [Glycine max]
Length=311

 Score = 85.1 bits (209),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 59/97 (61%), Positives = 67/97 (69%), Gaps = 11/97 (11%)
 Frame = +2

Query  311  MKFGKEFKVHLEDTLPEWRDkylrykplkkllkslpAHPSAAAA-GDGSF--------QP  463
            MKFGKEFK HLEDT+PEWRDK+L YKPLKKLLK     PS   A  D           QP
Sbjct  1    MKFGKEFKTHLEDTIPEWRDKFLCYKPLKKLLKQNL--PSITTAITDIPINLPLHLLQQP  58

Query  464  PPPSELHDWFIRLLTEDLEKFNDFYVEQEEEFIIRFQ  574
              P  L  WF+R+L E+LEKFNDFYV++EEEF+IRFQ
Sbjct  59   SSPQLLQAWFVRILNEELEKFNDFYVDKEEEFVIRFQ  95



>gb|AFK34670.1| unknown [Lotus japonicus]
Length=309

 Score = 85.1 bits (209),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 55/92 (60%), Positives = 66/92 (72%), Gaps = 4/92 (4%)
 Frame = +2

Query  311  MKFGKEFKVHLEDTLPEWRDkylrykplkkllkslpAHPSAAAAGDGSF----QPPPPSE  478
            MKFGKEFK HLE+T+PEWRDK+L YKPLKKLLK      + A   D       QP  P  
Sbjct  1    MKFGKEFKTHLEETIPEWRDKFLCYKPLKKLLKHHHLPTTVAPPLDLHLHLFQQPISPHL  60

Query  479  LHDWFIRLLTEDLEKFNDFYVEQEEEFIIRFQ  574
            L  WF+R+L ++LEKFNDFYV++EEEF+IRFQ
Sbjct  61   LQAWFLRILNQELEKFNDFYVDKEEEFVIRFQ  92



>ref|XP_010088129.1| hypothetical protein L484_013573 [Morus notabilis]
 gb|EXB31941.1| hypothetical protein L484_013573 [Morus notabilis]
Length=331

 Score = 85.1 bits (209),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 55/88 (63%), Positives = 66/88 (75%), Gaps = 7/88 (8%)
 Frame = +2

Query  311  MKFGKEFKVHLEDTLPEWRDkylrykplkkllkslpAHPSAAAAGDGSFQPPPPSELHDW  490
            MKFGKEF  HLE+TLPEWRDK+L YKPLKKLLK      +     D   +P  P +L DW
Sbjct  1    MKFGKEFTTHLEETLPEWRDKFLCYKPLKKLLK------NVPTDSDAENRPNNP-DLQDW  53

Query  491  FIRLLTEDLEKFNDFYVEQEEEFIIRFQ  574
            FIR+L E+L+KFNDFYV++EEEF+IRFQ
Sbjct  54   FIRILNEELDKFNDFYVDKEEEFVIRFQ  81



>gb|KHN13209.1| SPX domain-containing protein 4 [Glycine soja]
Length=337

 Score = 85.5 bits (210),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 59/97 (61%), Positives = 67/97 (69%), Gaps = 11/97 (11%)
 Frame = +2

Query  311  MKFGKEFKVHLEDTLPEWRDkylrykplkkllkslpAHPSAAAA-GDGSF--------QP  463
            MKFGKEFK HLEDT+PEWRDK+L YKPLKKLLK     PS   A  D           QP
Sbjct  1    MKFGKEFKTHLEDTIPEWRDKFLCYKPLKKLLKQNL--PSITTAITDIPINLPLHLLQQP  58

Query  464  PPPSELHDWFIRLLTEDLEKFNDFYVEQEEEFIIRFQ  574
              P  L  WF+R+L E+LEKFNDFYV++EEEF+IRFQ
Sbjct  59   SSPQLLQAWFVRILNEELEKFNDFYVDKEEEFVIRFQ  95



>ref|XP_010316248.1| PREDICTED: SPX domain-containing protein 4-like isoform X2 [Solanum 
lycopersicum]
Length=288

 Score = 84.3 bits (207),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 58/88 (66%), Positives = 69/88 (78%), Gaps = 7/88 (8%)
 Frame = +2

Query  311  MKFGKEFKVHLEDTLPEWRDkylrykplkkllkslpAHPSAAAAGDGSFQPPPPSELHDW  490
            MKFGKEF  HLE+TLPEWRDKYL YKPLKKLLK+LP+  +A    DG+  PP      DW
Sbjct  1    MKFGKEFTTHLEETLPEWRDKYLCYKPLKKLLKNLPS--TADNLPDGADNPP-----QDW  53

Query  491  FIRLLTEDLEKFNDFYVEQEEEFIIRFQ  574
            F+R+L E+L+KFNDFYV++EEEFIIR Q
Sbjct  54   FVRILNEELDKFNDFYVDKEEEFIIRLQ  81



>ref|XP_004232210.1| PREDICTED: SPX domain-containing protein 4-like isoform X1 [Solanum 
lycopersicum]
Length=296

 Score = 84.3 bits (207),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 58/88 (66%), Positives = 69/88 (78%), Gaps = 7/88 (8%)
 Frame = +2

Query  311  MKFGKEFKVHLEDTLPEWRDkylrykplkkllkslpAHPSAAAAGDGSFQPPPPSELHDW  490
            MKFGKEF  HLE+TLPEWRDKYL YKPLKKLLK+LP+  +A    DG+  PP      DW
Sbjct  1    MKFGKEFTTHLEETLPEWRDKYLCYKPLKKLLKNLPS--TADNLPDGADNPP-----QDW  53

Query  491  FIRLLTEDLEKFNDFYVEQEEEFIIRFQ  574
            F+R+L E+L+KFNDFYV++EEEFIIR Q
Sbjct  54   FVRILNEELDKFNDFYVDKEEEFIIRLQ  81



>ref|XP_008798633.1| PREDICTED: SPX domain-containing protein 4 isoform X1 [Phoenix 
dactylifera]
Length=298

 Score = 83.6 bits (205),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 55/90 (61%), Positives = 70/90 (78%), Gaps = 2/90 (2%)
 Frame = +2

Query  311  MKFGKEFKVHLEDTLPEWRDkylrykplkkllkslpAHPSAAAAGDGSFQPPPPSELHDW  490
            MKFGK+F+ HLE+TLPEWRDK+L YKPLKKL+K LP  P+      G+  P P   L +W
Sbjct  1    MKFGKDFRNHLEETLPEWRDKFLCYKPLKKLIKHLPPDPNPHPVDAGA--PRPWVGLEEW  58

Query  491  FIRLLTEDLEKFNDFYVEQEEEFIIRFQVS  580
            F+R+L E+L+KFNDFYV++EEEF+IR QVS
Sbjct  59   FVRILNEELDKFNDFYVDKEEEFVIRLQVS  88



>ref|XP_010550031.1| PREDICTED: SPX domain-containing protein 4 [Tarenaya hassleriana]
Length=319

 Score = 83.2 bits (204),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 57/117 (49%), Positives = 70/117 (60%), Gaps = 33/117 (28%)
 Frame = +2

Query  311  MKFGKEFKVHLEDTLPEWRDkylrykplkkllkslpAHPSAAAAGDGSFQPP--------  466
            MKFGKEF+ HLE+TLPEWRDK+L YKPLKKLL     H   ++AGD  F PP        
Sbjct  1    MKFGKEFRTHLEETLPEWRDKFLCYKPLKKLL----KHYPHSSAGDVDFPPPDASQLRPV  56

Query  467  ---------------------PPSELHDWFIRLLTEDLEKFNDFYVEQEEEFIIRFQ  574
                                 PP +LHD F+R+L  +LEKFNDFYV++EE+F+IR Q
Sbjct  57   FADTTNTSPSAASDAAIPGGRPPEDLHDSFVRILNNELEKFNDFYVDKEEDFVIRLQ  113



>ref|XP_010029315.1| PREDICTED: SPX domain-containing protein 4 [Eucalyptus grandis]
 gb|KCW56212.1| hypothetical protein EUGRSUZ_I01961 [Eucalyptus grandis]
Length=311

 Score = 82.8 bits (203),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 58/100 (58%), Positives = 72/100 (72%), Gaps = 15/100 (15%)
 Frame = +2

Query  311  MKFGKEFKVHLEDTLPEWRDkylrykplkkllkslpAHPSAAAAG----------DGSFQ  460
            MKFGKEF  HLE+TLPEWRDK+L YKPLKKLLK     PS+AAA           +G+ Q
Sbjct  1    MKFGKEFTTHLEETLPEWRDKFLCYKPLKKLLKR---FPSSAAADSLPPRPGRDPNGAPQ  57

Query  461  PP--PPSELHDWFIRLLTEDLEKFNDFYVEQEEEFIIRFQ  574
            P   P  +  +WF+R+L E+L+KFNDFYV++EEEF+IRFQ
Sbjct  58   PGAGPLVDSQEWFVRILNEELDKFNDFYVDKEEEFVIRFQ  97



>ref|XP_004233370.1| PREDICTED: SPX domain-containing protein 4 [Solanum lycopersicum]
Length=307

 Score = 82.0 bits (201),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 59/93 (63%), Positives = 71/93 (76%), Gaps = 8/93 (9%)
 Frame = +2

Query  311  MKFGKEFKVHLEDTLPEWRDkylrykplkkllkslpAHPSAAAAGDGSFQPPPPS-----  475
            MKFGKEF +HLE+TLPEWRDKYL YKPLKKL+K +   PS+ A       P PP+     
Sbjct  1    MKFGKEFSIHLEETLPEWRDKYLCYKPLKKLIKHI---PSSTADNTPPLPPLPPATAAAT  57

Query  476  ELHDWFIRLLTEDLEKFNDFYVEQEEEFIIRFQ  574
            EL DWFIR+L E+L+KFNDFYV++EE+FIIRFQ
Sbjct  58   ELQDWFIRILNEELDKFNDFYVDKEEDFIIRFQ  90



>gb|EYU34641.1| hypothetical protein MIMGU_mgv1a011020mg [Erythranthe guttata]
Length=294

 Score = 81.6 bits (200),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 54/88 (61%), Positives = 69/88 (78%), Gaps = 5/88 (6%)
 Frame = +2

Query  311  MKFGKEFKVHLEDTLPEWRDkylrykplkkllkslpAHPSAAAAGDGSFQPPPPSELHDW  490
            MKFGKEF++HLE+TLPEWRDKYL YKPLKKLLK++PA  +     DG     P  E+ +W
Sbjct  1    MKFGKEFRIHLEETLPEWRDKYLSYKPLKKLLKNIPATAADNPPPDG-----PLPEIQEW  55

Query  491  FIRLLTEDLEKFNDFYVEQEEEFIIRFQ  574
            F+ +L  +L+KFNDFYV++EE+FIIRFQ
Sbjct  56   FVGILNVELDKFNDFYVDKEEDFIIRFQ  83



>ref|XP_002530001.1| xenotropic and polytropic murine leukemia virus receptor ids-4, 
putative [Ricinus communis]
 gb|EEF32363.1| xenotropic and polytropic murine leukemia virus receptor ids-4, 
putative [Ricinus communis]
Length=330

 Score = 81.6 bits (200),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 61/114 (54%), Positives = 72/114 (63%), Gaps = 26/114 (23%)
 Frame = +2

Query  311  MKFGKEFKVHLEDTLPEWRDkylrykplkkllkslpAHPSAAAAGDGSF-----------  457
            MKFGKEFK HLE+TLPEWRDK+L YKPLKKLLK  PA  +A+ + D SF           
Sbjct  1    MKFGKEFKTHLEETLPEWRDKFLCYKPLKKLLKQFPATSAASLSFDPSFLLQHQQLFPID  60

Query  458  ----------QPPPPSE-----LHDWFIRLLTEDLEKFNDFYVEQEEEFIIRFQ  574
                       P   +      L DWFIR+L E+L+KFNDFYV++EEEFIIRFQ
Sbjct  61   GIDGLDGDHHNPETGANRSLLLLQDWFIRILNEELDKFNDFYVDKEEEFIIRFQ  114



>emb|CBI22247.3| unnamed protein product [Vitis vinifera]
Length=276

 Score = 80.5 bits (197),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 40/88 (45%), Positives = 50/88 (57%), Gaps = 31/88 (35%)
 Frame = +2

Query  311  MKFGKEFKVHLEDTLPEWRDkylrykplkkllkslpAHPSAAAAGDGSFQPPPPSELHDW  490
            MKFGKEF+ HLE+TLPEWRD                                P  +L +W
Sbjct  1    MKFGKEFRTHLEETLPEWRD-------------------------------KPLMDLQEW  29

Query  491  FIRLLTEDLEKFNDFYVEQEEEFIIRFQ  574
            F+R+L E+LEKFNDFYV++EEEF+IR Q
Sbjct  30   FVRILNEELEKFNDFYVDKEEEFVIRLQ  57



>ref|XP_010908687.1| PREDICTED: SPX domain-containing protein 4 isoform X1 [Elaeis 
guineensis]
Length=294

 Score = 80.9 bits (198),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 53/90 (59%), Positives = 68/90 (76%), Gaps = 6/90 (7%)
 Frame = +2

Query  311  MKFGKEFKVHLEDTLPEWRDkylrykplkkllkslpAHPSAAAAGDGSFQPPPPSELHDW  490
            MKFGK+F+ HLEDTLP+WRDK+L YKPLKKL+K +P  P  A A        P   L +W
Sbjct  1    MKFGKDFRNHLEDTLPDWRDKFLCYKPLKKLIKHIPPDPVDAGA------QGPWVGLEEW  54

Query  491  FIRLLTEDLEKFNDFYVEQEEEFIIRFQVS  580
            F+R+L E+L+KFNDFYV++EE+F+IR QVS
Sbjct  55   FVRILNEELDKFNDFYVDKEEDFVIRLQVS  84



>ref|XP_008798634.1| PREDICTED: SPX domain-containing protein 4 isoform X2 [Phoenix 
dactylifera]
Length=295

 Score = 80.1 bits (196),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 53/88 (60%), Positives = 68/88 (77%), Gaps = 2/88 (2%)
 Frame = +2

Query  311  MKFGKEFKVHLEDTLPEWRDkylrykplkkllkslpAHPSAAAAGDGSFQPPPPSELHDW  490
            MKFGK+F+ HLE+TLPEWRDK+L YKPLKKL+K LP  P+      G+  P P   L +W
Sbjct  1    MKFGKDFRNHLEETLPEWRDKFLCYKPLKKLIKHLPPDPNPHPVDAGA--PRPWVGLEEW  58

Query  491  FIRLLTEDLEKFNDFYVEQEEEFIIRFQ  574
            F+R+L E+L+KFNDFYV++EEEF+IR Q
Sbjct  59   FVRILNEELDKFNDFYVDKEEEFVIRLQ  86



>ref|XP_009775847.1| PREDICTED: SPX domain-containing protein 4 [Nicotiana sylvestris]
Length=307

 Score = 80.1 bits (196),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 60/94 (64%), Positives = 68/94 (72%), Gaps = 8/94 (9%)
 Frame = +2

Query  311  MKFGKEFKVHLEDTLPEWRDkylrykplkkllkslpAHPSAAAAGDG------SFQPPPP  472
            MKFGKEF  HLE+TLPEWRDKYL YKPLKKLLK      S  A GD       +  P PP
Sbjct  1    MKFGKEFTTHLEETLPEWRDKYLCYKPLKKLLKHHLR--SIPATGDNLPDGGDNPPPLPP  58

Query  473  SELHDWFIRLLTEDLEKFNDFYVEQEEEFIIRFQ  574
              L DWF+R+L E+L+KFNDFYV++EEEFIIRFQ
Sbjct  59   PHLQDWFVRILNEELDKFNDFYVDKEEEFIIRFQ  92



>gb|KDP27173.1| hypothetical protein JCGZ_19872 [Jatropha curcas]
Length=326

 Score = 80.1 bits (196),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 57/110 (52%), Positives = 67/110 (61%), Gaps = 22/110 (20%)
 Frame = +2

Query  311  MKFGKEFKVHLEDTLPEWRDkylrykplkkllkslpAHPSAAAAG--DGSFQPPPPSEL-  481
            MKFGKEFK HLE+TLPEWRDK+L YKPLKKLLK   A     +         PPPP ++ 
Sbjct  1    MKFGKEFKTHLEETLPEWRDKFLCYKPLKKLLKQFHATSDGVSLSLHPAVLLPPPPFDVL  60

Query  482  -------------------HDWFIRLLTEDLEKFNDFYVEQEEEFIIRFQ  574
                                DWFIR+L E+ +KFNDFYV++EEEFIIRFQ
Sbjct  61   DDHTHHHPEGDANRSLMLFEDWFIRILNEEFDKFNDFYVDKEEEFIIRFQ  110



>ref|XP_009602126.1| PREDICTED: SPX domain-containing protein 4 [Nicotiana tomentosiformis]
Length=310

 Score = 79.0 bits (193),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 61/97 (63%), Positives = 68/97 (70%), Gaps = 11/97 (11%)
 Frame = +2

Query  311  MKFGKEFKVHLEDTLPEWRDkylrykplkkllkslpAHPSAAAAGDG---------SFQP  463
            MKFGKEF  HLE+TLPEWRDKYL YKPLKKLLK      S+ A GD             P
Sbjct  1    MKFGKEFTTHLEETLPEWRDKYLCYKPLKKLLKHHLR--SSPATGDNLPDGGDNPPPLPP  58

Query  464  PPPSELHDWFIRLLTEDLEKFNDFYVEQEEEFIIRFQ  574
            PPP  L DWF+R+L E+L KFNDFYV++EEEFIIRFQ
Sbjct  59   PPPPHLQDWFVRILNEELNKFNDFYVDKEEEFIIRFQ  95



>ref|XP_002283890.1| PREDICTED: SPX domain-containing protein 4 [Vitis vinifera]
Length=322

 Score = 79.0 bits (193),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 56/106 (53%), Positives = 72/106 (68%), Gaps = 21/106 (20%)
 Frame = +2

Query  311  MKFGKEFKVHLEDTLPEWRDkylrykplkkllkslpAHPSAA-------------AAGD-  448
            MKFGKEF+ HLE+TLPEWRDK+L YKPLKKLLK++   P+AA              + D 
Sbjct  1    MKFGKEFRTHLEETLPEWRDKFLCYKPLKKLLKTI---PTAADSLPPPHDFRLLEGSADV  57

Query  449  ----GSFQPPPPSELHDWFIRLLTEDLEKFNDFYVEQEEEFIIRFQ  574
                G  +  P  +L +WF+R+L E+LEKFNDFYV++EEEF+IR Q
Sbjct  58   DDVHGHHENRPLMDLQEWFVRILNEELEKFNDFYVDKEEEFVIRLQ  103



>gb|EPS59264.1| hypothetical protein M569_15543, partial [Genlisea aurea]
Length=255

 Score = 78.2 bits (191),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 54/89 (61%), Positives = 62/89 (70%), Gaps = 15/89 (17%)
 Frame = +2

Query  311  MKFGKEFKVHLEDTLPEWRDkylrykplkkllkslpAHPSAAAAGDGSFQPPPPSELHDW  490
            MKFGKEF +HLE+TLPEWRDKYL YKPLKKLL          +   GS  P       DW
Sbjct  1    MKFGKEFGIHLEETLPEWRDKYLSYKPLKKLL---------KSIPPGSLPP------EDW  45

Query  491  FIRLLTEDLEKFNDFYVEQEEEFIIRFQV  577
            F+ +L E+LEKFNDFYV++EEEFIIRFQ 
Sbjct  46   FLGILNEELEKFNDFYVDKEEEFIIRFQA  74



>emb|CDX69529.1| BnaA10g18780D [Brassica napus]
Length=304

 Score = 78.6 bits (192),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 54/93 (58%), Positives = 66/93 (71%), Gaps = 5/93 (5%)
 Frame = +2

Query  311  MKFGKEFKVHLEDTLPEWRDkylrykplkkllkslpAHPSAAAAG-----DGSFQPPPPS  475
            MKFGKEF+ HLE+TLPEWRDK+L YKPLKKLLK  P  P A  +      D      P  
Sbjct  1    MKFGKEFRTHLEETLPEWRDKFLCYKPLKKLLKYYPYPPPADDSSNSDQIDSHDGVRPAE  60

Query  476  ELHDWFIRLLTEDLEKFNDFYVEQEEEFIIRFQ  574
            +L D F+R+L E+LEKFNDFYV++EE+F+IR Q
Sbjct  61   DLQDSFVRILNEELEKFNDFYVDKEEDFVIRLQ  93



>ref|XP_006363409.1| PREDICTED: SPX domain-containing protein 4-like [Solanum tuberosum]
Length=307

 Score = 78.2 bits (191),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 58/95 (61%), Positives = 69/95 (73%), Gaps = 12/95 (13%)
 Frame = +2

Query  311  MKFGKEFKVHLEDTLPEWRDkylrykplkkllkslpAHPSAAAAGDGSFQPPPPS-----  475
            MKFGKEF +HLE+TLPEWRDKYL YKPLKKL+K +   PS+   GD     PP       
Sbjct  1    MKFGKEFSIHLEETLPEWRDKYLCYKPLKKLIKHI---PSST--GDNPPPLPPLPPATAA  55

Query  476  --ELHDWFIRLLTEDLEKFNDFYVEQEEEFIIRFQ  574
              EL  WFIR+L E+L+KFNDFYV++EE+FIIRFQ
Sbjct  56   ATELQGWFIRILNEELDKFNDFYVDKEEDFIIRFQ  90



>ref|XP_004171215.1| PREDICTED: SPX domain-containing protein 4-like [Cucumis sativus]
Length=325

 Score = 78.2 bits (191),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 57/115 (50%), Positives = 66/115 (57%), Gaps = 27/115 (23%)
 Frame = +2

Query  311  MKFGKEFKVHLEDTLPEWRDkylrykplkkllkslpAHPSA-------------------  433
            MKFGKEFK HLE TLPEWRDK+L YKPLKKLLK  P  PS                    
Sbjct  1    MKFGKEFKTHLEQTLPEWRDKFLCYKPLKKLLKHYPNLPSTLYPIPTNHSLNFLLPPLHP  60

Query  434  --------AAAGDGSFQPPPPSELHDWFIRLLTEDLEKFNDFYVEQEEEFIIRFQ  574
                      A       P  ++L DWF+R+L E+LEK NDFYV++EEEF+IRFQ
Sbjct  61   PPVSFDDLTEAAPCETAAPSLADLQDWFVRILNEELEKLNDFYVDKEEEFVIRFQ  115



>ref|XP_010908689.1| PREDICTED: SPX domain-containing protein 4 isoform X2 [Elaeis 
guineensis]
Length=291

 Score = 77.4 bits (189),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 51/88 (58%), Positives = 66/88 (75%), Gaps = 6/88 (7%)
 Frame = +2

Query  311  MKFGKEFKVHLEDTLPEWRDkylrykplkkllkslpAHPSAAAAGDGSFQPPPPSELHDW  490
            MKFGK+F+ HLEDTLP+WRDK+L YKPLKKL+K +P  P  A A        P   L +W
Sbjct  1    MKFGKDFRNHLEDTLPDWRDKFLCYKPLKKLIKHIPPDPVDAGA------QGPWVGLEEW  54

Query  491  FIRLLTEDLEKFNDFYVEQEEEFIIRFQ  574
            F+R+L E+L+KFNDFYV++EE+F+IR Q
Sbjct  55   FVRILNEELDKFNDFYVDKEEDFVIRLQ  82



>ref|XP_006384151.1| hypothetical protein POPTR_0004s08470g [Populus trichocarpa]
 gb|ERP61948.1| hypothetical protein POPTR_0004s08470g [Populus trichocarpa]
Length=176

 Score = 75.1 bits (183),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 56/109 (51%), Positives = 75/109 (69%), Gaps = 21/109 (19%)
 Frame = +2

Query  311  MKFGKEFKVHLEDTLPEWRDkylrykplkkllkslpAHPSAAAA-----GDGSFQ----P  463
            MKFGKEFK HLE+TLPEWRDK+L YKPLKKLLK LP+  + +        + +FQ    P
Sbjct  1    MKFGKEFKTHLEETLPEWRDKFLCYKPLKKLLKQLPSTLTCSVFFLKFFLNINFQLHPHP  60

Query  464  PPPS------------ELHDWFIRLLTEDLEKFNDFYVEQEEEFIIRFQ  574
            PP +            +L +WF+R+L+E+L+KFNDFYV++EE+F+IR Q
Sbjct  61   PPLTGDVHGNTNRPLVDLQEWFVRILSEELDKFNDFYVDKEEDFVIRLQ  109



>ref|XP_003629411.1| SPX-domain protein [Medicago truncatula]
 gb|AET03887.1| SPX domain protein [Medicago truncatula]
Length=307

 Score = 77.0 bits (188),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 53/93 (57%), Positives = 65/93 (70%), Gaps = 5/93 (5%)
 Frame = +2

Query  311  MKFGKEFKVHLEDTLPEWRDkylrykplkkllkslpAHPSAAAAGDGSF-----QPPPPS  475
            MKFGKEFK HLE+T+PEWRDK+L YKPLKKLLK      +              QP  P+
Sbjct  1    MKFGKEFKTHLEETIPEWRDKFLCYKPLKKLLKHHLPITTTTTTPINLHLHFLQQPFSPN  60

Query  476  ELHDWFIRLLTEDLEKFNDFYVEQEEEFIIRFQ  574
             L  WF+R+L ++LEKFNDFYV++EEEF+IRFQ
Sbjct  61   ILQAWFLRILNQELEKFNDFYVDKEEEFVIRFQ  93



>ref|XP_002871662.1| hypothetical protein ARALYDRAFT_488382 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH47921.1| hypothetical protein ARALYDRAFT_488382 [Arabidopsis lyrata subsp. 
lyrata]
Length=313

 Score = 76.6 bits (187),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 46/104 (44%), Positives = 60/104 (58%), Gaps = 16/104 (15%)
 Frame = +2

Query  311  MKFGKEFKVHLEDTLPEWRDk-------ylrykplkkllkslpAHPS-------AAAAGD  448
            MKFGKEF+ HLE+TLPEWRDK           K        L + P        ++AA D
Sbjct  1    MKFGKEFRTHLEETLPEWRDKFLCYKPLKKLLKYYPYSSDHLDSRPVFADTTNISSAADD  60

Query  449  GSFQPP--PPSELHDWFIRLLTEDLEKFNDFYVEQEEEFIIRFQ  574
            G   P   P  +L   F+R+L E+L+KFNDFYV++EE+F+IR Q
Sbjct  61   GDVAPGVRPTEDLQGSFVRILNEELDKFNDFYVDKEEDFVIRLQ  104



>ref|XP_010670237.1| PREDICTED: SPX domain-containing protein 4 [Beta vulgaris subsp. 
vulgaris]
Length=325

 Score = 75.9 bits (185),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 45/113 (40%), Positives = 59/113 (52%), Gaps = 25/113 (22%)
 Frame = +2

Query  311  MKFGKEFKVHLEDTLPEWRDk--------------ylrykplkkllkslpAHPSAAAAGD  448
            MKFGKEF++HLE+TLPEWRDK                          +     S    G+
Sbjct  1    MKFGKEFRIHLEETLPEWRDKFLCYKPLKKLLKHLPNTTISGHNNNNNPQNRQSVGNHGE  60

Query  449  G---SFQPPPPS--------ELHDWFIRLLTEDLEKFNDFYVEQEEEFIIRFQ  574
            G   S +  P +        E  DWF+RLL ++L+K NDFYVE+EE+F+IRFQ
Sbjct  61   GGPSSSESVPTTTQRSMSLEEFQDWFVRLLNDELDKLNDFYVEKEEDFVIRFQ  113



>gb|KFK25782.1| hypothetical protein AALP_AA8G159600 [Arabis alpina]
Length=323

 Score = 75.5 bits (184),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 55/114 (48%), Positives = 69/114 (61%), Gaps = 26/114 (23%)
 Frame = +2

Query  311  MKFGKEFKVHLEDTLPEWRDkylrykplkkllk------------------------slp  418
            MKFGKEF+ HLEDTLPEWRDK+L YKPLKKLLK                        +  
Sbjct  1    MKFGKEFRTHLEDTLPEWRDKFLCYKPLKKLLKYYPYSSADLPTGDFPDQIDLRTVFADT  60

Query  419  AHPSAAAAGDGSFQPP--PPSELHDWFIRLLTEDLEKFNDFYVEQEEEFIIRFQ  574
             + S++A  DG   P   P  +L   F+R+L E+LEKFNDFYV++EE+F+IR Q
Sbjct  61   TNLSSSAVEDGVVVPGVRPTEDLQGSFVRILNEELEKFNDFYVDKEEDFVIRLQ  114



>ref|XP_002323873.1| SPX domain-containing family protein [Populus trichocarpa]
 gb|EEF04006.1| SPX domain-containing family protein [Populus trichocarpa]
Length=321

 Score = 75.5 bits (184),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 42/105 (40%), Positives = 55/105 (52%), Gaps = 17/105 (16%)
 Frame = +2

Query  311  MKFGKEFKVHLEDTLPEWRD-----------------kylrykplkkllkslpAHPSAAA  439
            MKFGKEFK HLE+TLPEWRD                         + +   L  HP    
Sbjct  1    MKFGKEFKTHLEETLPEWRDKFLCYKPLKKLLKQLPPTVDSLNLDRPVNFQLHPHPPPLT  60

Query  440  AGDGSFQPPPPSELHDWFIRLLTEDLEKFNDFYVEQEEEFIIRFQ  574
                     P  +L +WF+R+L E+L+KFNDFYV++EE+F+IR Q
Sbjct  61   GDVHGNTNRPLVDLQEWFVRILNEELDKFNDFYVDKEEDFVIRLQ  105



>ref|XP_006373335.1| hypothetical protein POPTR_0017s12250g [Populus trichocarpa]
 gb|ERP51132.1| hypothetical protein POPTR_0017s12250g [Populus trichocarpa]
Length=310

 Score = 75.1 bits (183),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 42/105 (40%), Positives = 55/105 (52%), Gaps = 17/105 (16%)
 Frame = +2

Query  311  MKFGKEFKVHLEDTLPEWRD-----------------kylrykplkkllkslpAHPSAAA  439
            MKFGKEFK HLE+TLPEWRD                         + +   L  HP    
Sbjct  1    MKFGKEFKTHLEETLPEWRDKFLCYKPLKKLLKQLPPTVDSLNLDRPVNFQLHPHPPPLT  60

Query  440  AGDGSFQPPPPSELHDWFIRLLTEDLEKFNDFYVEQEEEFIIRFQ  574
                     P  +L +WF+R+L E+L+KFNDFYV++EE+F+IR Q
Sbjct  61   GDVHGNTNRPLVDLQEWFVRILNEELDKFNDFYVDKEEDFVIRLQ  105



>ref|XP_004141576.1| PREDICTED: SPX domain-containing protein 4-like [Cucumis sativus]
 gb|KGN52477.1| hypothetical protein Csa_5G637670 [Cucumis sativus]
Length=325

 Score = 75.5 bits (184),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 56/115 (49%), Positives = 65/115 (57%), Gaps = 27/115 (23%)
 Frame = +2

Query  311  MKFGKEFKVHLEDTLPEWRDkylrykplkkllkslpAHPSA-------------------  433
            MKFGKEFK HLE TLPEWRDK+L YKPLKKLLK  P  PS                    
Sbjct  1    MKFGKEFKTHLEQTLPEWRDKFLCYKPLKKLLKHYPNLPSTLYPIPTNHSLNFLLPPLHP  60

Query  434  --------AAAGDGSFQPPPPSELHDWFIRLLTEDLEKFNDFYVEQEEEFIIRFQ  574
                      A          ++L DWF+R+L E+LEK NDFYV++EEEF+IRFQ
Sbjct  61   PPVSFDDLTEAAPCETAAASLADLQDWFVRILNEELEKLNDFYVDKEEEFVIRFQ  115



>ref|XP_008379380.1| PREDICTED: SPX domain-containing protein 4 [Malus domestica]
Length=331

 Score = 74.7 bits (182),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 53/112 (47%), Positives = 67/112 (60%), Gaps = 26/112 (23%)
 Frame = +2

Query  311  MKFGKEFKVHLEDTLPEWRDkylrykplkk------------------------llkslp  418
            MKFGK+F+ HLE+TLPEWRDK+L Y  LKK                          +   
Sbjct  1    MKFGKKFRTHLEETLPEWRDKFLCYNLLKKLLKGFPATAAAIAAVDSLPRQLEFQRQPAD  60

Query  419  AHPSAAAAGDGSFQPPPPSELHDWFIRLLTEDLEKFNDFYVEQEEEFIIRFQ  574
            AHP+AA  GDG F   P + L DWF+ +L E+LEK N+FYV++EEEF+IRFQ
Sbjct  61   AHPAAADGGDGGFH--PLAGLQDWFVAILNEELEKLNNFYVDKEEEFVIRFQ  110



>ref|XP_009121581.1| PREDICTED: SPX domain-containing protein 4 [Brassica rapa]
Length=317

 Score = 74.3 bits (181),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 55/109 (50%), Positives = 69/109 (63%), Gaps = 23/109 (21%)
 Frame = +2

Query  311  MKFGKEFKVHLEDTLPEWRDkylrykplkkllkslpAHPSA-------------------  433
            MKFGKEF+ HLE+TLPEWRDK+L YKPLKKLLK  P  P A                   
Sbjct  1    MKFGKEFRTHLEETLPEWRDKFLCYKPLKKLLKYYPYPPPADDSSNSDQIDSRQVFADTT  60

Query  434  --AAAGDGSFQPPPPSELHDWFIRLLTEDLEKFNDFYVEQEEEFIIRFQ  574
              ++A D   +P    +L D F+R+L E+LEKFNDFYV++EE+F+IR Q
Sbjct  61   NLSSAEDDGVRPA--EDLQDSFVRILNEELEKFNDFYVDKEEDFVIRLQ  107



>ref|XP_006431205.1| hypothetical protein CICLE_v10012222mg [Citrus clementina]
 gb|ESR44445.1| hypothetical protein CICLE_v10012222mg [Citrus clementina]
Length=319

 Score = 74.3 bits (181),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 55/107 (51%), Positives = 66/107 (62%), Gaps = 19/107 (18%)
 Frame = +2

Query  311  MKFGKEFKVHLEDTLPEWRDkylrykplkkllkslpA-------HPSAAA----------  439
            MKFGKEF  HL++TLPEWRDK+L YKPLKKLLK  PA        P+             
Sbjct  1    MKFGKEFTTHLKETLPEWRDKFLCYKPLKKLLKHFPAADFQPHSQPTPTVDVVVIIDDDH  60

Query  440  --AGDGSFQPPPPSELHDWFIRLLTEDLEKFNDFYVEQEEEFIIRFQ  574
               G  S        L DWF+R+L E+LEKFNDFY+++EEEF+IRFQ
Sbjct  61   NRTGSSSSNCWSLDRLQDWFVRILREELEKFNDFYIDKEEEFVIRFQ  107



>ref|XP_006482630.1| PREDICTED: SPX domain-containing protein 4-like [Citrus sinensis]
 gb|KDO72638.1| hypothetical protein CISIN_1g020930mg [Citrus sinensis]
Length=319

 Score = 74.3 bits (181),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 55/107 (51%), Positives = 66/107 (62%), Gaps = 19/107 (18%)
 Frame = +2

Query  311  MKFGKEFKVHLEDTLPEWRDkylrykplkkllkslpA-------HPSAAA----------  439
            MKFGKEF  HL++TLPEWRDK+L YKPLKKLLK  PA        P+             
Sbjct  1    MKFGKEFTTHLKETLPEWRDKFLCYKPLKKLLKHFPAADFQPHSQPTPTVDVVVIIDDDH  60

Query  440  --AGDGSFQPPPPSELHDWFIRLLTEDLEKFNDFYVEQEEEFIIRFQ  574
               G  S        L DWF+R+L E+LEKFNDFY+++EEEF+IRFQ
Sbjct  61   NRTGSSSSNCWSLDRLQDWFVRILREELEKFNDFYIDKEEEFVIRFQ  107



>ref|XP_011035795.1| PREDICTED: SPX domain-containing protein 4 [Populus euphratica]
Length=320

 Score = 73.9 bits (180),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 41/105 (39%), Positives = 55/105 (52%), Gaps = 17/105 (16%)
 Frame = +2

Query  311  MKFGKEFKVHLEDTLPEWRD-----------------kylrykplkkllkslpAHPSAAA  439
            MKFGK+FK HLE+TLPEWRD                         + +   L  HP    
Sbjct  1    MKFGKDFKTHLEETLPEWRDKFLCYKPLKKLLKQLPPTLDSLNLDRPINFQLHPHPPPLT  60

Query  440  AGDGSFQPPPPSELHDWFIRLLTEDLEKFNDFYVEQEEEFIIRFQ  574
                     P  +L +WF+R+L E+L+KFNDFYV++EE+F+IR Q
Sbjct  61   GDVHGNTNRPLVDLQEWFVRILNEELDKFNDFYVDKEEDFVIRLQ  105



>ref|NP_568312.1| SPX domain-containing protein 4 [Arabidopsis thaliana]
 sp|Q94A21.1|SPX4_ARATH RecName: Full=SPX domain-containing protein 4; AltName: Full=Protein 
SPX DOMAIN GENE 4; Short=AtSPX4 [Arabidopsis thaliana]
 gb|AAK91456.1| AT5g15330/F8M21_220 [Arabidopsis thaliana]
 gb|AAV97799.1| At5g15330 [Arabidopsis thaliana]
 gb|AED92150.1| SPX domain-containing protein 4 [Arabidopsis thaliana]
Length=318

 Score = 73.9 bits (180),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 54/112 (48%), Positives = 70/112 (63%), Gaps = 24/112 (21%)
 Frame = +2

Query  311  MKFGKEFKVHLEDTLPEWRDkylrykplkkllkslpAHPS--------------------  430
            MKFGKEF+ HLE+TLPEWRDK+L YKPLKKLLK  P + +                    
Sbjct  1    MKFGKEFRTHLEETLPEWRDKFLCYKPLKKLLKYYPYYSADFGPANSDHNDSRPVFADTT  60

Query  431  --AAAAGDGSFQPP--PPSELHDWFIRLLTEDLEKFNDFYVEQEEEFIIRFQ  574
              ++AA DG   P   P  +L   F+R+L ++LEKFNDFYV++EE+F+IR Q
Sbjct  61   NISSAADDGGVVPGVRPSEDLQGSFVRILNDELEKFNDFYVDKEEDFVIRLQ  112



>ref|XP_006840588.1| hypothetical protein AMTR_s00045p00232830 [Amborella trichopoda]
 gb|ERN02263.1| hypothetical protein AMTR_s00045p00232830 [Amborella trichopoda]
Length=354

 Score = 73.6 bits (179),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 57/125 (46%), Positives = 69/125 (55%), Gaps = 37/125 (30%)
 Frame = +2

Query  311  MKFGKEFKVHLEDTLPEWRDkylrykplkkllkslpAHPSAAAAGD--------------  448
            MKFGKEFK HLE+T+PEWRDK+L YKPLKKLLK   A    + A D              
Sbjct  1    MKFGKEFKTHLEETIPEWRDKFLSYKPLKKLLKQASAGEVHSRADDFGANREIVGLGDRR  60

Query  449  --------GSFQPPPPSEL---------------HDWFIRLLTEDLEKFNDFYVEQEEEF  559
                    G FQ   PS +                DWF++LL E+L+KFNDFYV++EEEF
Sbjct  61   IGSSESVNGGFQCVYPSRIVAEIGENGGRPWAIQEDWFVKLLDEELDKFNDFYVDKEEEF  120

Query  560  IIRFQ  574
            +IR Q
Sbjct  121  VIRLQ  125



>ref|XP_009360600.1| PREDICTED: SPX domain-containing protein 4-like [Pyrus x bretschneideri]
Length=321

 Score = 73.2 bits (178),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 43/110 (39%), Positives = 58/110 (53%), Gaps = 25/110 (23%)
 Frame = +2

Query  311  MKFGKEFKVHLEDTLPEWRD----------------------kylrykplkkllkslpAH  424
            MKFGKEF+ HLE+TLPEWRD                        +         +   AH
Sbjct  1    MKFGKEFRTHLEETLPEWRDKFLCYKLLKKLLKGFLTTAAVIAAVDSLHRHLEFQPAYAH  60

Query  425  PSAAAAGDGSFQPPPPSELHDWFIRLLTEDLEKFNDFYVEQEEEFIIRFQ  574
            P+AA  G G F   P + L  WF+ +L ++L K NDFY+++EE+F+IRFQ
Sbjct  61   PAAADEG-GGFH--PLAGLQYWFVAILNKELYKLNDFYMDKEEDFVIRFQ  107



>emb|CAB89343.1| ids-4 protein-like [Arabidopsis thaliana]
Length=387

 Score = 73.6 bits (179),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 54/112 (48%), Positives = 70/112 (63%), Gaps = 24/112 (21%)
 Frame = +2

Query  311  MKFGKEFKVHLEDTLPEWRDkylrykplkkllkslpAHPS--------------------  430
            MKFGKEF+ HLE+TLPEWRDK+L YKPLKKLLK  P + +                    
Sbjct  70   MKFGKEFRTHLEETLPEWRDKFLCYKPLKKLLKYYPYYSADFGPANSDHNDSRPVFADTT  129

Query  431  --AAAAGDGSFQP--PPPSELHDWFIRLLTEDLEKFNDFYVEQEEEFIIRFQ  574
              ++AA DG   P   P  +L   F+R+L ++LEKFNDFYV++EE+F+IR Q
Sbjct  130  NISSAADDGGVVPGVRPSEDLQGSFVRILNDELEKFNDFYVDKEEDFVIRLQ  181



>ref|XP_010245395.1| PREDICTED: SPX domain-containing protein 4 [Nelumbo nucifera]
Length=323

 Score = 72.4 bits (176),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 54/109 (50%), Positives = 68/109 (62%), Gaps = 21/109 (19%)
 Frame = +2

Query  311  MKFGKEFKVHLEDTLPEWRDkylrykplkkllkslpAHPSA---------------AAAG  445
            MKFGKEF+ HLE+T+PEWRDK+L YKPLKKLLK  P+ P +                A  
Sbjct  1    MKFGKEFRTHLEETIPEWRDKFLCYKPLKKLLKHFPSSPDSLVLDDLLRHHRQIIDGAPT  60

Query  446  DGSF------QPPPPSELHDWFIRLLTEDLEKFNDFYVEQEEEFIIRFQ  574
            DG        +  P   L +WF+R+L E+LEK NDFYV++EEEF+IR Q
Sbjct  61   DGDVSTDDTERNKPWIGLEEWFVRILDEELEKINDFYVDKEEEFVIRLQ  109



>emb|CDY26417.1| BnaC09g42510D [Brassica napus]
Length=303

 Score = 71.6 bits (174),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 52/96 (54%), Positives = 65/96 (68%), Gaps = 11/96 (11%)
 Frame = +2

Query  311  MKFGKEFKVHLEDTLPEWRDkylrykplkkllkslpAHPSAAAAGDGSFQPPPPS-----  475
            MKFGKEF+ HLE+TLPEWRDK+L YKPLKKLLK    +P    A D S      S     
Sbjct  1    MKFGKEFRTHLEETLPEWRDKFLCYKPLKKLLKY---YPYPPPADDSSNSDQIDSHDGVR  57

Query  476  ---ELHDWFIRLLTEDLEKFNDFYVEQEEEFIIRFQ  574
               +L   F+R+L E+L+KFNDFYV++EE+F+IR Q
Sbjct  58   AAEDLQGSFVRILNEELDKFNDFYVDKEEDFVIRLQ  93



>ref|XP_007215658.1| hypothetical protein PRUPE_ppa008419mg [Prunus persica]
 gb|EMJ16857.1| hypothetical protein PRUPE_ppa008419mg [Prunus persica]
Length=332

 Score = 72.0 bits (175),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 56/110 (51%), Positives = 70/110 (64%), Gaps = 23/110 (21%)
 Frame = +2

Query  311  MKFGKEFKVHLEDTLPEWRDkylrykplkkllkslpAHPSAAAAGDG-----SFQPPPP-  472
            MKFGKEF+ HLE+TLPEWRDK+L YK LKKLLK LPA  +A AA D      +F+  P  
Sbjct  1    MKFGKEFRTHLEETLPEWRDKFLCYKLLKKLLKRLPA-ATAIAAVDSLPSHLNFRQQPSD  59

Query  473  ----------------SELHDWFIRLLTEDLEKFNDFYVEQEEEFIIRFQ  574
                            + L DWF+ +L E++EK NDFYV+ EE+F+IRFQ
Sbjct  60   ADAAAAGDGGRGFRPFAGLQDWFVGILNEEVEKLNDFYVDTEEDFVIRFQ  109



>ref|XP_009414474.1| PREDICTED: SPX domain-containing protein 4-like [Musa acuminata 
subsp. malaccensis]
Length=300

 Score = 71.2 bits (173),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 51/94 (54%), Positives = 65/94 (69%), Gaps = 8/94 (9%)
 Frame = +2

Query  311  MKFGKEFKVHLEDTLPEWRDkylrykplkkllkslpAHPSAAAAGDGSFQPPPPSE----  478
            MKFGK+F+ HLE+TLPEWRDK+L YK LKKL+K LP  P      D   +PP  +     
Sbjct  1    MKFGKDFRNHLEETLPEWRDKFLAYKALKKLIKHLPQPPPLGV--DLPDEPPRGAARPLD  58

Query  479  --LHDWFIRLLTEDLEKFNDFYVEQEEEFIIRFQ  574
              L  WF+ +L E+LEKFNDFYV++EE+F+IR Q
Sbjct  59   AVLEAWFVGILNEELEKFNDFYVDKEEDFVIRLQ  92



>ref|XP_008368434.1| PREDICTED: SPX domain-containing protein 4-like [Malus domestica]
Length=324

 Score = 71.6 bits (174),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 53/109 (49%), Positives = 68/109 (62%), Gaps = 21/109 (19%)
 Frame = +2

Query  311  MKFGKEFKVHLEDTLPEWRDkylrykplkkllkslpAHPSAAAAGDG---------SFQP  463
            MKFGKEF+ HLE+TLPEWRDK+L YK LKKLLK LPA  +  AA D          ++  
Sbjct  1    MKFGKEFRTHLEETLPEWRDKFLCYKLLKKLLKGLPATAATIAAVDSLPRHLEFQLAYAY  60

Query  464  P------------PPSELHDWFIRLLTEDLEKFNDFYVEQEEEFIIRFQ  574
            P            P + L  WF+ +L E+L K NDFY+++EE+F+IRFQ
Sbjct  61   PAAGDGGGGGGFHPLAGLQYWFVAILNEELYKLNDFYMDKEEDFVIRFQ  109



>ref|XP_010453669.1| PREDICTED: SPX domain-containing protein 4 [Camelina sativa]
Length=328

 Score = 70.5 bits (171),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 55/119 (46%), Positives = 69/119 (58%), Gaps = 31/119 (26%)
 Frame = +2

Query  311  MKFGKEFKVHLEDTLPEWRDkylrykplkkllkslpAHPSAAAAG---DGSFQP------  463
            MKFGKEF+ HLE+TLPEWRDK+L YKPLKKLLK  P  P +A+     D S +P      
Sbjct  1    MKFGKEFRTHLEETLPEWRDKFLCYKPLKKLLKYYPDFPPSASDSHLFDSSSRPVFADTT  60

Query  464  ----------------------PPPSELHDWFIRLLTEDLEKFNDFYVEQEEEFIIRFQ  574
                                   P  +L   F+R+L E+LEKFNDFYV++EE+F+IR Q
Sbjct  61   NISSADHDHDHDDDVLVLPAGVRPTEDLQGSFVRILNEELEKFNDFYVDKEEDFVIRLQ  119



>ref|XP_006288240.1| hypothetical protein CARUB_v10001482mg [Capsella rubella]
 gb|EOA21138.1| hypothetical protein CARUB_v10001482mg [Capsella rubella]
Length=318

 Score = 70.1 bits (170),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 54/109 (50%), Positives = 68/109 (62%), Gaps = 21/109 (19%)
 Frame = +2

Query  311  MKFGKEFKVHLEDTLPEWRDkylrykplkkllkslpAHPS-------------------A  433
            MKFGKEF+ HLE+TLPEWRDK+L YKPLKKLLK  P  P                    +
Sbjct  1    MKFGKEFRTHLEETLPEWRDKFLCYKPLKKLLKYYPDFPPPSDSDHLDSRPVFADTTNLS  60

Query  434  AAAGDGSFQPP--PPSELHDWFIRLLTEDLEKFNDFYVEQEEEFIIRFQ  574
            +AA D    P   P  +L   F+R+L E+L+KFNDFYV++EE+F+IR Q
Sbjct  61   SAAEDDVVLPGVRPTEDLQGSFLRILNEELDKFNDFYVDKEEDFVIRLQ  109



>ref|XP_006400057.1| hypothetical protein EUTSA_v10014185mg [Eutrema salsugineum]
 gb|ESQ41510.1| hypothetical protein EUTSA_v10014185mg [Eutrema salsugineum]
Length=308

 Score = 69.3 bits (168),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 42/111 (38%), Positives = 59/111 (53%), Gaps = 23/111 (21%)
 Frame = +2

Query  311  MKFGKEFKVHLEDTLPEWRDk---------------ylrykplkkllkslpAHP------  427
            MKFGKEF+ HLE+TLPEWRDK               Y        +   + + P      
Sbjct  1    MKFGKEFRTHLEETLPEWRDKFLCYKPLKKLLKYYPYSSSDLGSAIPDQIDSRPVFADTT  60

Query  428  SAAAAGDGSFQP--PPPSELHDWFIRLLTEDLEKFNDFYVEQEEEFIIRFQ  574
            + ++  D    P   P  +L   F+R+L E+L+KFNDFYV++EE+F+IR Q
Sbjct  61   NTSSVADDVVLPGVRPTEDLQGSFVRILNEELDKFNDFYVDKEEDFVIRLQ  111



>ref|XP_011098655.1| PREDICTED: SPX domain-containing protein 4-like [Sesamum indicum]
Length=268

 Score = 65.9 bits (159),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 52/88 (59%), Positives = 60/88 (68%), Gaps = 11/88 (13%)
 Frame = +2

Query  311  MKFGKEFKVHLEDTLPEWRDkylrykplkkllkslpAHPSAAAAGDGSFQPPPPSELHDW  490
            MKFGKEF +HL  T+PEWRDKYL YKPLKKLLK+LP  P                 L  W
Sbjct  1    MKFGKEFYMHLAKTIPEWRDKYLCYKPLKKLLKNLPPAPPLPLP-----------LLRQW  49

Query  491  FIRLLTEDLEKFNDFYVEQEEEFIIRFQ  574
            F+ +L E+LEKFNDFYVE+EEE IIRF+
Sbjct  50   FLTILYEELEKFNDFYVEKEEELIIRFE  77



>ref|XP_010420189.1| PREDICTED: SPX domain-containing protein 4-like [Camelina sativa]
Length=339

 Score = 66.6 bits (161),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 55/130 (42%), Positives = 69/130 (53%), Gaps = 42/130 (32%)
 Frame = +2

Query  311  MKFGKEFKVHLEDTLPEWRDkylrykplkkllkslpAHPSAAAAG---------------  445
            MKFGKEF+ HLE+TLPEWRDK+L YKPLKKLLK  P  P +A+                 
Sbjct  1    MKFGKEFRTHLEETLPEWRDKFLCYKPLKKLLKYYPDPPPSASGSHLLDSSSRPSASGSH  60

Query  446  --DGSFQP-------------------------PPPSELHDWFIRLLTEDLEKFNDFYVE  544
              D S +P                          P  +L   F+R+L E+LEKFNDFYV+
Sbjct  61   LLDSSSRPVFADTTNISSADHDHDVLVLPAAGVRPTEDLQGSFVRILNEELEKFNDFYVD  120

Query  545  QEEEFIIRFQ  574
            +EE+F+IR Q
Sbjct  121  KEEDFVIRLQ  130



>ref|XP_008368466.1| PREDICTED: SPX domain-containing protein 4-like [Malus domestica]
Length=141

 Score = 63.5 bits (153),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 54/106 (51%), Positives = 65/106 (61%), Gaps = 16/106 (15%)
 Frame = +2

Query  311  MKFGKEFKVHLEDTLPEWRDkylrykplkkllkslpAHPSAAAAGDG-----SFQPPPP-  472
            MK  K  + HLE+TLPEWRDK+L YK LKKLLK LPA  +A AA D       FQP    
Sbjct  1    MKLAKFRRTHLEETLPEWRDKFLCYKLLKKLLKRLPATTAAIAAVDSLPRHLEFQPANAH  60

Query  473  -------SELH---DWFIRLLTEDLEKFNDFYVEQEEEFIIRFQVS  580
                    E H     F+ +L E+L+K NDFYV++EEEF+IRFQ S
Sbjct  61   LAVADGSGEFHPLGGLFVPILNEELKKLNDFYVDKEEEFVIRFQSS  106



>ref|XP_010492366.1| PREDICTED: SPX domain-containing protein 4-like [Camelina sativa]
Length=327

 Score = 65.5 bits (158),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 53/118 (45%), Positives = 66/118 (56%), Gaps = 30/118 (25%)
 Frame = +2

Query  311  MKFGKEFKVHLEDTLPEWRDkylrykplkkllkslpAHPSAAAAGDGSFQPP--------  466
            MKFGKEF+ HLE+TLPEWRDK+L YKPLKKLLK  P  P + +    S   P        
Sbjct  1    MKFGKEFRTHLEETLPEWRDKFLCYKPLKKLLKYYPDLPPSDSHLLDSSSRPVFADTTNI  60

Query  467  ----------------------PPSELHDWFIRLLTEDLEKFNDFYVEQEEEFIIRFQ  574
                                  P  +L   F+R+L E+LEKFNDFYV++EE+F+IR Q
Sbjct  61   SSADHDHDEDDDVLVLPAGVVRPTEDLQGSFVRILNEELEKFNDFYVDKEEDFVIRLQ  118



>ref|XP_008362154.1| PREDICTED: SPX domain-containing protein 4-like [Malus domestica]
Length=231

 Score = 62.4 bits (150),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 52/104 (50%), Positives = 63/104 (61%), Gaps = 16/104 (15%)
 Frame = +2

Query  311  MKFGKEFKVHLEDTLPEWRDkylrykplkkllkslpAHPSAAAAGDG-----SFQPPPP-  472
            MK  K  + HLE+TLPEWRDK+L YK LKKLLK LPA  +A AA D       FQP    
Sbjct  1    MKLAKFRRTHLEETLPEWRDKFLCYKLLKKLLKRLPATTAAIAAVDSLPRHLEFQPANAH  60

Query  473  ----------SELHDWFIRLLTEDLEKFNDFYVEQEEEFIIRFQ  574
                        L   F+ +L E+L+K NDFYV++EEEF+IRFQ
Sbjct  61   LAVADGSGEFXPLGGLFVPILNEELKKLNDFYVDKEEEFVIRFQ  104



>gb|ABF99665.1| BLYIDS4G, putative, expressed [Oryza sativa Japonica Group]
Length=157

 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 48/95 (51%), Positives = 62/95 (65%), Gaps = 6/95 (6%)
 Frame = +2

Query  311  MKFGKEFKVHLEDTLPEWRDkylrykplkkllksl------pAHPSAAAAGDGSFQPPPP  472
            MKFGK+F+ HLE+TLP WRDKYL YK LKKL+K+L      P   +AA    G       
Sbjct  1    MKFGKDFRSHLEETLPAWRDKYLAYKSLKKLIKNLPPDGDPPPVAAAAEVPAGDGDGDGG  60

Query  473  SELHDWFIRLLTEDLEKFNDFYVEQEEEFIIRFQV  577
              L +WF R+L  +L+K NDFY+E+EE ++IR QV
Sbjct  61   IALGNWFARVLDMELQKLNDFYIEREEWYVIRLQV  95



>ref|XP_006650832.1| PREDICTED: SPX domain-containing protein 4-like [Oryza brachyantha]
Length=329

 Score = 62.4 bits (150),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 50/102 (49%), Positives = 65/102 (64%), Gaps = 13/102 (13%)
 Frame = +2

Query  311  MKFGKEFKVHLEDTLPEWRDkylrykplkkllkslpAHPSAAAA-----------GDGSF  457
            MKFGK+F+ HLE+TLP WRDKYL YK LKKL+K+LP  P   A            GDG  
Sbjct  1    MKFGKDFRNHLEETLPAWRDKYLAYKSLKKLIKNLPPDPPDGAPPPAAGAVPAGDGDGVR  60

Query  458  QPPPPSE--LHDWFIRLLTEDLEKFNDFYVEQEEEFIIRFQV  577
                 ++  L +WF R+L  +L+K NDFY+E+EE ++IR QV
Sbjct  61   VGVGDADVALGNWFARVLDMELQKLNDFYIEREEWYVIRLQV  102



>dbj|BAJ97120.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=319

 Score = 62.0 bits (149),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 46/91 (51%), Positives = 58/91 (64%), Gaps = 2/91 (2%)
 Frame = +2

Query  311  MKFGKEFKVHLEDTLPEWRDkylrykplkkllksl--pAHPSAAAAGDGSFQPPPPSELH  484
            MKFGK+F+ HLE TLP+W+DKYL YK LKKL+K+L   A                P  L 
Sbjct  1    MKFGKDFRSHLEGTLPDWKDKYLAYKALKKLIKTLPPDAVDQPPPPLPPPGHGDGPLGLG  60

Query  485  DWFIRLLTEDLEKFNDFYVEQEEEFIIRFQV  577
            DWF R+L  +L K NDFY+E+EE ++IR QV
Sbjct  61   DWFARILDVELHKLNDFYMEREEWYVIRLQV  91



>ref|XP_010258944.1| PREDICTED: SPX domain-containing protein 3-like [Nelumbo nucifera]
Length=254

 Score = 61.2 bits (147),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 40/86 (47%), Positives = 57/86 (66%), Gaps = 6/86 (7%)
 Frame = +2

Query  311  MKFGKEFKVHLEDTLPEWRDkylrykplkkllkslpAHPSAAAAGDGSFQPPPPSELHDW  490
            MKFGK  K  +++TLPEWRDK+L YK +KKL++ + + PS +       + P   +    
Sbjct  1    MKFGKRLKNQIQETLPEWRDKFLSYKDMKKLVRLISSGPSTSE------ELPDSGKAEAE  54

Query  491  FIRLLTEDLEKFNDFYVEQEEEFIIR  568
            FI LL  +++KFN F+VEQEE+FIIR
Sbjct  55   FIYLLNSEIDKFNSFFVEQEEDFIIR  80



>gb|KEH29183.1| phosphorus starvation-induced protein [Medicago truncatula]
Length=261

 Score = 60.8 bits (146),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 41/86 (48%), Positives = 56/86 (65%), Gaps = 5/86 (6%)
 Frame = +2

Query  311  MKFGKEFKVHLEDTLPEWRDkylrykplkkllkslpAHPSAAAAGDGSFQPPPPSELHDW  490
            MKFGK  K  ++DTLPEWRDK+L YK LKKLL+ + A P++   G   +           
Sbjct  1    MKFGKRLKQQVQDTLPEWRDKFLSYKELKKLLRLISAAPTSLLNGSIGYGKSEAE-----  55

Query  491  FIRLLTEDLEKFNDFYVEQEEEFIIR  568
            F+ LL  +++KFN F++EQEE+FIIR
Sbjct  56   FMYLLNNEIDKFNGFFMEQEEDFIIR  81



>ref|XP_004287317.1| PREDICTED: SPX domain-containing protein 1-like [Fragaria vesca 
subsp. vesca]
Length=280

 Score = 60.5 bits (145),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 44/93 (47%), Positives = 56/93 (60%), Gaps = 5/93 (5%)
 Frame = +2

Query  311  MKFGKEFKVHLEDTLPEWRDkylrykplkkllks-----lpAHPSAAAAGDGSFQPPPPS  475
            MKFGK     +++TLPEWRDK+L YK LKK LK          P+     DG   P   S
Sbjct  1    MKFGKSLSSQIDETLPEWRDKFLSYKELKKRLKLIEPKDASTRPAKRPRLDGDAPPDDMS  60

Query  476  ELHDWFIRLLTEDLEKFNDFYVEQEEEFIIRFQ  574
                 FI+LL ++LEKFN F+VE+EEE+IIR +
Sbjct  61   SEEINFIQLLEDELEKFNSFFVEKEEEYIIRLK  93



>gb|ACJ84638.1| unknown [Medicago truncatula]
Length=214

 Score = 58.9 bits (141),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 25/40 (63%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = +2

Query  455  FQPPPPSELHDWFIRLLTEDLEKFNDFYVEQEEEFIIRFQ  574
             QP  P+ L  WF+R+L ++LEKFNDFYV++EEEF+IRFQ
Sbjct  8    LQPFSPNILQAWFLRILNQELEKFNDFYVDKEEEFVIRFQ  47



>ref|XP_009591083.1| PREDICTED: SPX domain-containing protein 1-like [Nicotiana tomentosiformis]
Length=291

 Score = 60.1 bits (144),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 48/104 (46%), Positives = 60/104 (58%), Gaps = 16/104 (15%)
 Frame = +2

Query  311  MKFGKEFKVHLEDTLPEWRDkylrykplkkllkslpAHPSAAAAGD-------------G  451
            MKFGK     +E+TLPEWRDK+L YK LKK LK +    SAAAA D             G
Sbjct  1    MKFGKSLSNQIEETLPEWRDKFLSYKDLKKKLKLIEQKKSAAAAADEGVRVAKKMKLAAG  60

Query  452  SF---QPPPPSELHDWFIRLLTEDLEKFNDFYVEQEEEFIIRFQ  574
             F   Q    +E    F+ LL ++LEKFN F+VE+EEE+II  +
Sbjct  61   DFAGSQKVVMTEAEVDFVNLLEDELEKFNSFFVEKEEEYIITLK  104



>ref|XP_010088906.1| hypothetical protein L484_020896 [Morus notabilis]
 gb|EXB37103.1| hypothetical protein L484_020896 [Morus notabilis]
Length=265

 Score = 59.3 bits (142),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 41/86 (48%), Positives = 59/86 (69%), Gaps = 5/86 (6%)
 Frame = +2

Query  311  MKFGKEFKVHLEDTLPEWRDkylrykplkkllkslpAHPSAAAAGDGSFQPPPPSELHDW  490
            MKFGK  K  +E+TLP+WRDK+L YK LKKL++ + + P+     +GS +    +E    
Sbjct  1    MKFGKRLKQQIEETLPDWRDKFLSYKELKKLVRLISSSPTLL---NGSVEYGKAAEAE--  55

Query  491  FIRLLTEDLEKFNDFYVEQEEEFIIR  568
            F+ LL  ++EKFN F++EQEE+FIIR
Sbjct  56   FVYLLNNEIEKFNAFFMEQEEDFIIR  81



>sp|Q10B79.1|SPX4_ORYSJ RecName: Full=SPX domain-containing protein 4; AltName: Full=Protein 
SPX DOMAIN GENE 4; Short=OsSPX4 [Oryza sativa Japonica 
Group]
 sp|A2XNL6.1|SPX4_ORYSI RecName: Full=SPX domain-containing protein 4; AltName: Full=Protein 
SPX DOMAIN GENE 4; Short=OsSPX4 [Oryza sativa Indica 
Group]
 gb|AAL79759.1|AC096687_23 putative signal transduction protein [Oryza sativa Japonica Group]
 gb|ABF99664.1| BLYIDS4G, putative, expressed [Oryza sativa Japonica Group]
 gb|EAY92426.1| hypothetical protein OsI_14160 [Oryza sativa Indica Group]
Length=320

 Score = 59.7 bits (143),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 47/95 (49%), Positives = 61/95 (64%), Gaps = 6/95 (6%)
 Frame = +2

Query  311  MKFGKEFKVHLEDTLPEWRDkylrykplkkllks------lpAHPSAAAAGDGSFQPPPP  472
            MKFGK+F+ HLE+TLP WRDKYL YK LKKL+K+       P   +AA    G       
Sbjct  1    MKFGKDFRSHLEETLPAWRDKYLAYKSLKKLIKNLPPDGDPPPVAAAAEVPAGDGDGDGG  60

Query  473  SELHDWFIRLLTEDLEKFNDFYVEQEEEFIIRFQV  577
              L +WF R+L  +L+K NDFY+E+EE ++IR QV
Sbjct  61   IALGNWFARVLDMELQKLNDFYIEREEWYVIRLQV  95



>ref|XP_009418990.1| PREDICTED: SPX domain-containing protein 4-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009418997.1| PREDICTED: SPX domain-containing protein 4-like [Musa acuminata 
subsp. malaccensis]
Length=294

 Score = 59.3 bits (142),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 51/99 (52%), Positives = 64/99 (65%), Gaps = 12/99 (12%)
 Frame = +2

Query  311  MKFGKEFKVHLEDTLPEWRDkylrykplkkllkslpAHPSAA------AAG-----DGSF  457
            MKFGK+F+  LE TLPEWRDK+L YKPLKKL+K LP  P  A      A G      G+ 
Sbjct  1    MKFGKDFRRFLEQTLPEWRDKFLPYKPLKKLIKHLPPPPPRAEGLPPQAEGPPRPTGGAA  60

Query  458  QPPPPSELHDWFIRLLTEDLEKFNDFYVEQEEEFIIRFQ  574
            +P  P+ L  WF  +L E L+KFNDFYV++EE ++I  Q
Sbjct  61   RPLAPA-LDAWFAAVLNEQLKKFNDFYVDEEEYYVIWLQ  98



>ref|XP_004506478.1| PREDICTED: SPX domain-containing protein 3-like [Cicer arietinum]
Length=258

 Score = 58.5 bits (140),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 41/86 (48%), Positives = 54/86 (63%), Gaps = 5/86 (6%)
 Frame = +2

Query  311  MKFGKEFKVHLEDTLPEWRDkylrykplkkllkslpAHPSAAAAGDGSFQPPPPSELHDW  490
            MKFGK  K  ++D+LPEWRDK+L YK LKKLL+ + A P     G   +           
Sbjct  1    MKFGKRLKQQIQDSLPEWRDKFLSYKELKKLLRLISAAPKILLNGSIGYGKDVAE-----  55

Query  491  FIRLLTEDLEKFNDFYVEQEEEFIIR  568
            F+ LL  ++EKFN F+VE+EE+FIIR
Sbjct  56   FMYLLNNEIEKFNGFFVEKEEDFIIR  81



>ref|XP_003563294.1| PREDICTED: SPX domain-containing protein 4 [Brachypodium distachyon]
Length=324

 Score = 59.3 bits (142),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 45/96 (47%), Positives = 58/96 (60%), Gaps = 7/96 (7%)
 Frame = +2

Query  311  MKFGKEFKVHLEDTLPEWRDkylrykplkkllks-------lpAHPSAAAAGDGSFQPPP  469
            MKFGK+F+ HLE TLP+W+DKYL YK LKKL+K+           P   A     F    
Sbjct  1    MKFGKDFRNHLEGTLPDWKDKYLAYKALKKLIKTLPPDADHPAPPPPPPAPAAAGFGYGD  60

Query  470  PSELHDWFIRLLTEDLEKFNDFYVEQEEEFIIRFQV  577
               L +WF R+L  +L K NDFY+E+EE ++IR QV
Sbjct  61   DVALGNWFARILDVELHKLNDFYMEREEWYVIRLQV  96



>ref|XP_004251718.1| PREDICTED: SPX domain-containing protein 1 [Solanum lycopersicum]
Length=292

 Score = 58.5 bits (140),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 46/105 (44%), Positives = 60/105 (57%), Gaps = 17/105 (16%)
 Frame = +2

Query  311  MKFGKEFKVHLEDTLPEWRDkylrykplkkllkslpAHPSAAAA-------------GDG  451
            MKFGK     +E+TLPEWRDK+L YK LKK LK +    S ++               DG
Sbjct  1    MKFGKSLSNQIEETLPEWRDKFLSYKDLKKKLKLIEPKRSVSSGDGDDVRASKRMKMADG  60

Query  452  SFQPPPPSE-LHDW---FIRLLTEDLEKFNDFYVEQEEEFIIRFQ  574
             F   P  E + D    F+ LL ++LEKFN F+VE+EEE+IIR +
Sbjct  61   GFDKAPEKEPMTDAEVEFVNLLEDELEKFNSFFVEKEEEYIIRLK  105



>ref|XP_007134740.1| hypothetical protein PHAVU_010G0720001g, partial [Phaseolus vulgaris]
 gb|ESW06734.1| hypothetical protein PHAVU_010G0720001g, partial [Phaseolus vulgaris]
Length=82

 Score = 55.8 bits (133),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 40/86 (47%), Positives = 59/86 (69%), Gaps = 6/86 (7%)
 Frame = +2

Query  311  MKFGKEFKVHLEDTLPEWRDkylrykplkkllkslpAHPSAAAAGDGSFQPPPPSELHDW  490
            MKFGK  K  ++++LPEWRDKYL YK LKKL++ +   P+     +GSF+     +  + 
Sbjct  1    MKFGKRLKQQIQESLPEWRDKYLSYKELKKLVRLISEAPTLL---NGSFEY---GKTENE  54

Query  491  FIRLLTEDLEKFNDFYVEQEEEFIIR  568
            F+ LL  D++KFN F++E+EE+FIIR
Sbjct  55   FMCLLNNDIDKFNGFFMEKEEDFIIR  80



>ref|XP_010510881.1| PREDICTED: SPX domain-containing protein 2 [Camelina sativa]
Length=286

 Score = 58.5 bits (140),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 42/99 (42%), Positives = 55/99 (56%), Gaps = 13/99 (13%)
 Frame = +2

Query  311  MKFGKEFKVHLEDTLPEWRDk-----ylrykplkkllkslpAHPSAAAAGDGSFQPPPPS  475
            MKFGK     +E+TLPEWRDK      L+ K      +S+   PS  +  D +     P+
Sbjct  1    MKFGKSLSNQIEETLPEWRDKFLSYKELKKKLKLMEPRSVENRPSKRSRSDSNSVDSDPT  60

Query  476  ------ELHDWFIRLLTEDLEKFNDFYVEQEEEFIIRFQ  574
                  EL   FI LL ++LEKFN F+VEQEEE+IIR +
Sbjct  61   AGMTKEELD--FISLLEDELEKFNSFFVEQEEEYIIRLK  97



>ref|XP_009360601.1| PREDICTED: SPX domain-containing protein 4-like [Pyrus x bretschneideri]
Length=321

 Score = 58.5 bits (140),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 50/109 (46%), Positives = 62/109 (57%), Gaps = 26/109 (24%)
 Frame = +2

Query  311  MKFGKEFKVHLEDTLPEWRDkylrykplkkllkslpAHPSAAAA----------------  442
            MK  K  + HLE+TLPEWRDK+L YK LKKLLK LPA  +  AA                
Sbjct  1    MKLAKFRRTHLEETLPEWRDKFLCYKLLKKLLKHLPATVATIAAVDSLPRHLEFLPANAH  60

Query  443  -----GDGSFQPPPPSELHDWFIRLLTEDLEKFNDFYVEQEEEFIIRFQ  574
                 G G F P     L   F+ +L E+L+K NDFYV+++EEF+IRFQ
Sbjct  61   LAVADGSGEFHP-----LGGLFVPILNEELKKLNDFYVDKKEEFVIRFQ  104



>ref|XP_010420853.1| PREDICTED: SPX domain-containing protein 1-like [Camelina sativa]
 ref|XP_010493122.1| PREDICTED: SPX domain-containing protein 1 [Camelina sativa]
Length=266

 Score = 58.2 bits (139),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 46/100 (46%), Positives = 62/100 (62%), Gaps = 13/100 (13%)
 Frame = +2

Query  311  MKFGKEFKVHLEDTLPEWRDkylrykplkkllkslpAHPS------------AAAAGDGS  454
            MKFGK     +E TLPEW+DK+L YK LKK LK +P+  S            +++AGD  
Sbjct  1    MKFGKSLSNQIEQTLPEWQDKFLSYKDLKKRLKLIPSKSSLDRPVKRLRLDPSSSAGDDD  60

Query  455  FQPPPPSELHDWFIRLLTEDLEKFNDFYVEQEEEFIIRFQ  574
            F      E    FI+LL ++LEKFN+F+VE+EEE+IIR +
Sbjct  61   FSLGMSKE-EISFIQLLEDELEKFNNFFVEKEEEYIIRLK  99



>ref|XP_003633934.1| PREDICTED: SPX domain-containing protein 3 [Vitis vinifera]
 emb|CBI38913.3| unnamed protein product [Vitis vinifera]
Length=259

 Score = 57.8 bits (138),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 41/86 (48%), Positives = 59/86 (69%), Gaps = 8/86 (9%)
 Frame = +2

Query  311  MKFGKEFKVHLEDTLPEWRDkylrykplkkllkslpAHPSAAAAGDGSFQPPPPSELHDW  490
            MKFGK  K  +++TLP+WRDK+L YK LKKL+K + + P+ A   +GS      ++    
Sbjct  1    MKFGKRLKQQIQETLPDWRDKFLAYKDLKKLVKLVSSPPAVA---NGS-----AAKAEAE  52

Query  491  FIRLLTEDLEKFNDFYVEQEEEFIIR  568
            F+ LL  ++EKFN F++EQEE+FIIR
Sbjct  53   FVYLLNNEIEKFNAFFMEQEEDFIIR  78



>ref|XP_008459339.1| PREDICTED: SPX domain-containing protein 4 [Cucumis melo]
Length=328

 Score = 58.2 bits (139),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 23/34 (68%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = +2

Query  473  SELHDWFIRLLTEDLEKFNDFYVEQEEEFIIRFQ  574
            ++L DWF+R+L E+LEK NDFYV++EEEF+IRFQ
Sbjct  84   ADLQDWFVRILNEELEKLNDFYVDKEEEFVIRFQ  117



>ref|XP_002524498.1| xenotropic and polytropic murine leukemia virus receptor ids-4, 
putative [Ricinus communis]
 gb|EEF37938.1| xenotropic and polytropic murine leukemia virus receptor ids-4, 
putative [Ricinus communis]
Length=286

 Score = 57.8 bits (138),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 46/98 (47%), Positives = 58/98 (59%), Gaps = 12/98 (12%)
 Frame = +2

Query  311  MKFGKEFKVHLEDTLPEWRDkylrykplkkllkslpAHPSAAA----------AGDGSFQ  460
            MKFGK     +E+TLPEWRDK+L YK LKK LK L                  AGD +  
Sbjct  1    MKFGKSLSNQIEETLPEWRDKFLSYKELKKRLKLLEPKKCVGDRPNKRQKLEDAGDCADA  60

Query  461  PPPPSELHDWFIRLLTEDLEKFNDFYVEQEEEFIIRFQ  574
            P    E+   FI+LL ++LEKFN F+VE+EEE+IIR +
Sbjct  61   PMSEEEID--FIKLLEDELEKFNSFFVEKEEEYIIRLK  96



>ref|XP_008804593.1| PREDICTED: SPX domain-containing protein 1-like [Phoenix dactylifera]
Length=284

 Score = 57.0 bits (136),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 44/93 (47%), Positives = 55/93 (59%), Gaps = 7/93 (8%)
 Frame = +2

Query  311  MKFGKEFKVHLEDTLPEWRDkylrykplkkllkslpA------HPSAAAAGDGSFQPPPP  472
            MKFGK     +E+TLPEWRDK+L YK LKK LK +         P  A  GD +      
Sbjct  1    MKFGKSLSNQIEETLPEWRDKFLSYKELKKRLKLIGGGDRPAKRPRVADDGDSAAASEAA  60

Query  473  SELHDW-FIRLLTEDLEKFNDFYVEQEEEFIIR  568
                +  F+RLL  +LEKFN F+VE+EEE+IIR
Sbjct  61   MTREEVDFLRLLEAELEKFNAFFVEKEEEYIIR  93



>ref|XP_003517020.1| PREDICTED: SPX domain-containing protein 3-like [Glycine max]
Length=261

 Score = 57.0 bits (136),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 39/86 (45%), Positives = 55/86 (64%), Gaps = 5/86 (6%)
 Frame = +2

Query  311  MKFGKEFKVHLEDTLPEWRDkylrykplkkllkslpAHPSAAAAGDGSFQPPPPSELHDW  490
            MKFGK  K  ++++LPEWRDKYL YK LKKL++ + A P     G   F      +    
Sbjct  1    MKFGKRLKQQIQESLPEWRDKYLSYKELKKLVRLISAAPPTLLNGSLEF-----GKTEAE  55

Query  491  FIRLLTEDLEKFNDFYVEQEEEFIIR  568
            F+ LL  +++KFN F++E+EE+FIIR
Sbjct  56   FVYLLNNEIDKFNGFFMEKEEDFIIR  81



>ref|XP_010264412.1| PREDICTED: SPX domain-containing protein 3-like [Nelumbo nucifera]
Length=262

 Score = 57.0 bits (136),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 39/86 (45%), Positives = 58/86 (67%), Gaps = 6/86 (7%)
 Frame = +2

Query  311  MKFGKEFKVHLEDTLPEWRDkylrykplkkllkslpAHPSAAAAGDGSFQPPPPSELHDW  490
            MKFGK  K+ +++TLPEWRDK+L YK LKKL++ +    S+  +  G    P  +E +  
Sbjct  1    MKFGKRLKLQIQETLPEWRDKFLSYKDLKKLVRLI----SSGTSTLGKLHEPCKAEAN--  54

Query  491  FIRLLTEDLEKFNDFYVEQEEEFIIR  568
            F+  L  +++KFN F++EQEE+FIIR
Sbjct  55   FVYFLNAEIDKFNAFFMEQEEDFIIR  80



>ref|XP_010692168.1| PREDICTED: SPX domain-containing protein 3 [Beta vulgaris subsp. 
vulgaris]
Length=275

 Score = 57.0 bits (136),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 37/86 (43%), Positives = 56/86 (65%), Gaps = 0/86 (0%)
 Frame = +2

Query  311  MKFGKEFKVHLEDTLPEWRDkylrykplkkllkslpAHPSAAAAGDGSFQPPPPSELHDW  490
            MKFGK  K  +++TLPEW+D++L YK LKKL++ + + P      +GS  P    +    
Sbjct  1    MKFGKRLKQQIQETLPEWKDEFLSYKELKKLVRLISSTPPLENWLNGSPSPELYCKPESE  60

Query  491  FIRLLTEDLEKFNDFYVEQEEEFIIR  568
            F+ LL   ++KFN F++E+EE+FIIR
Sbjct  61   FVYLLNNQIDKFNTFFMEKEEDFIIR  86



>ref|XP_004489493.1| PREDICTED: SPX domain-containing protein 4-like [Cicer arietinum]
Length=373

 Score = 57.4 bits (137),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 24/39 (62%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = +2

Query  458  QPPPPSELHDWFIRLLTEDLEKFNDFYVEQEEEFIIRFQ  574
            QP  P+ L  WF+ +L ++LEKFNDFYV++EEEF+IRFQ
Sbjct  119  QPFSPNILQSWFLNILNQELEKFNDFYVDKEEEFVIRFQ  157



>ref|XP_008792042.1| PREDICTED: SPX domain-containing protein 1-like [Phoenix dactylifera]
Length=284

 Score = 57.0 bits (136),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 45/91 (49%), Positives = 55/91 (60%), Gaps = 6/91 (7%)
 Frame = +2

Query  311  MKFGKEFKVHLEDTLPEWRDkylrykplkkllk-----slpAHPSAAAAGDGSFQPPPPS  475
            MKFGK     +E+TLPEWRDK+L YK LK+ LK        A     A  D S +     
Sbjct  1    MKFGKSLSNQIEETLPEWRDKFLSYKELKRRLKFIGGGDRLAKRPRLADDDDSTEAAITR  60

Query  476  ELHDWFIRLLTEDLEKFNDFYVEQEEEFIIR  568
            E  D F+RLL  +LEKFN F+VE+EEE+IIR
Sbjct  61   EEED-FLRLLEAELEKFNAFFVEKEEEYIIR  90



>ref|XP_009408839.1| PREDICTED: SPX domain-containing protein 5-like [Musa acuminata 
subsp. malaccensis]
Length=267

 Score = 56.6 bits (135),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 36/87 (41%), Positives = 47/87 (54%), Gaps = 15/87 (17%)
 Frame = +2

Query  311  MKFGKEFKVHLEDTLPEWRDk-ylrykplkkllkslpAHPSAAAAGDGSFQPPPPSELHD  487
            MKFGK  K  +E++LPEWRDK        K +     A PS+ A  +             
Sbjct  26   MKFGKRLKRQIEESLPEWRDKFLCYKDLKKLVKLISAAQPSSKAEAE-------------  72

Query  488  WFIRLLTEDLEKFNDFYVEQEEEFIIR  568
             FI LL  +++KFN F+V+QEEEFIIR
Sbjct  73   -FICLLDSEIDKFNAFFVDQEEEFIIR  98



>ref|XP_006400582.1| hypothetical protein EUTSA_v10014356mg [Eutrema salsugineum]
 gb|ESQ42035.1| hypothetical protein EUTSA_v10014356mg [Eutrema salsugineum]
Length=276

 Score = 56.6 bits (135),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 44/99 (44%), Positives = 60/99 (61%), Gaps = 13/99 (13%)
 Frame = +2

Query  311  MKFGKEFKVHLEDTLPEWRDkylrykplkkllkslpAHP-----------SAAAAGDGSF  457
            MKFGK     +E TLPEWRDK+L YK LKK LK + +             S+ A GD   
Sbjct  1    MKFGKSLSNQIEQTLPEWRDKFLSYKDLKKRLKLIDSKTGDRPAKRLRLDSSFAVGDDYS  60

Query  458  QPPPPSELHDWFIRLLTEDLEKFNDFYVEQEEEFIIRFQ  574
                  E++  F++LL ++LEKFN+F+VE+EEE+IIR +
Sbjct  61   VGMSKEEIN--FVQLLEDELEKFNNFFVEKEEEYIIRLK  97



>ref|XP_009398179.1| PREDICTED: SPX domain-containing protein 3-like isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=248

 Score = 56.2 bits (134),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 40/86 (47%), Positives = 55/86 (64%), Gaps = 13/86 (15%)
 Frame = +2

Query  311  MKFGKEFKVHLEDTLPEWRDkylrykplkkllkslpAHPSAAAAGDGSFQPPPPSELHDW  490
            MKFGK  K  +E++LPEWRDK+L YK LKKL        ++AA         P S +   
Sbjct  1    MKFGKRLKKQVEESLPEWRDKFLSYKDLKKL-----VRLTSAAQ--------PCSRVEAE  47

Query  491  FIRLLTEDLEKFNDFYVEQEEEFIIR  568
            F+++L  +++KFN F+VEQEE+FIIR
Sbjct  48   FVQMLNAEIDKFNAFFVEQEEDFIIR  73



>ref|XP_009398178.1| PREDICTED: SPX domain-containing protein 5-like isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=262

 Score = 56.2 bits (134),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 39/86 (45%), Positives = 54/86 (63%), Gaps = 13/86 (15%)
 Frame = +2

Query  311  MKFGKEFKVHLEDTLPEWRDkylrykplkkllkslpAHPSAAAAGDGSFQPPPPSELHDW  490
            MKFGK  K  +E++LPEWRDK+L YK LKKL++   A               P S +   
Sbjct  1    MKFGKRLKKQVEESLPEWRDKFLSYKDLKKLVRLTSA-------------AQPCSRVEAE  47

Query  491  FIRLLTEDLEKFNDFYVEQEEEFIIR  568
            F+++L  +++KFN F+VEQEE+FIIR
Sbjct  48   FVQMLNAEIDKFNAFFVEQEEDFIIR  73



>ref|XP_010454318.1| PREDICTED: SPX domain-containing protein 1 [Camelina sativa]
Length=265

 Score = 56.2 bits (134),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 45/99 (45%), Positives = 61/99 (62%), Gaps = 12/99 (12%)
 Frame = +2

Query  311  MKFGKEFKVHLEDTLPEWRDkylrykplkkllkslpAHPSA-----------AAAGDGSF  457
            MKFGK     +E TLPEW+DK+L YK LKK LK +P+  S            +++GD  F
Sbjct  1    MKFGKSLSNQIEQTLPEWQDKFLSYKDLKKRLKLIPSKSSLDRPVKRLRLDPSSSGDDDF  60

Query  458  QPPPPSELHDWFIRLLTEDLEKFNDFYVEQEEEFIIRFQ  574
                  E    FI+LL ++LEKFN+F+VE+EEE+IIR +
Sbjct  61   SLGMSKE-EISFIQLLEDELEKFNNFFVEKEEEYIIRLK  98



>ref|XP_002986054.1| hypothetical protein SELMODRAFT_123281 [Selaginella moellendorffii]
 ref|XP_002989623.1| hypothetical protein SELMODRAFT_130208 [Selaginella moellendorffii]
 gb|EFJ09293.1| hypothetical protein SELMODRAFT_130208 [Selaginella moellendorffii]
 gb|EFJ12873.1| hypothetical protein SELMODRAFT_123281 [Selaginella moellendorffii]
Length=254

 Score = 56.2 bits (134),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 42/90 (47%), Positives = 54/90 (60%), Gaps = 1/90 (1%)
 Frame = +2

Query  311  MKFGKEFKVHLEDTLPEWRDkylrykplkkllkslpAHPSAAAAGDGSFQPPPPSELHDW  490
            MKFGK     +E+TLPEWRDK+L YK LKK LK + A      A   S    P  E    
Sbjct  1    MKFGKRLASQMEETLPEWRDKFLSYKQLKKRLKLISAPDCFTQAAFESGGTSPQQE-ESE  59

Query  491  FIRLLTEDLEKFNDFYVEQEEEFIIRFQVS  580
            F  LL  +L+KFN F++E+EEE++IR Q +
Sbjct  60   FTSLLEVELDKFNTFFMEKEEEYVIRLQAN  89



>ref|XP_003522024.1| PREDICTED: SPX domain-containing protein 3-like [Glycine max]
Length=262

 Score = 56.2 bits (134),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 38/86 (44%), Positives = 55/86 (64%), Gaps = 5/86 (6%)
 Frame = +2

Query  311  MKFGKEFKVHLEDTLPEWRDkylrykplkkllkslpAHPSAAAAGDGSFQPPPPSELHDW  490
            MKFGK  K  ++++LPEWRDKYL YK LKKL++ + A P     G   +      +    
Sbjct  1    MKFGKRLKQQIQESLPEWRDKYLSYKELKKLVRLISAAPPTLLNGSLEY-----GKTETE  55

Query  491  FIRLLTEDLEKFNDFYVEQEEEFIIR  568
            F+ LL  +++KFN F++E+EE+FIIR
Sbjct  56   FVYLLNNEIDKFNGFFMEKEEDFIIR  81



>ref|XP_002966709.1| hypothetical protein SELMODRAFT_85666 [Selaginella moellendorffii]
 gb|EFJ32736.1| hypothetical protein SELMODRAFT_85666 [Selaginella moellendorffii]
Length=256

 Score = 56.2 bits (134),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 43/92 (47%), Positives = 57/92 (62%), Gaps = 9/92 (10%)
 Frame = +2

Query  311  MKFGKEFKVHLEDTLPEWRDkylrykplkkllkslpAHPSAAAAGDGSFQPPPP----SE  478
            MKFGK  +  +E+TLPEW+DK+L YK LKK LK +     AA   D  FQ        + 
Sbjct  1    MKFGKRLQQQIEETLPEWQDKFLSYKQLKKRLKLI-----AADNADRQFQENEEGRGLTS  55

Query  479  LHDWFIRLLTEDLEKFNDFYVEQEEEFIIRFQ  574
                FIRLL  +LEKFN F++++EEE++IR Q
Sbjct  56   QEVEFIRLLNLELEKFNAFFIDKEEEYVIRLQ  87



>ref|XP_009133937.1| PREDICTED: SPX domain-containing protein 2 [Brassica rapa]
Length=296

 Score = 56.2 bits (134),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 43/96 (45%), Positives = 57/96 (59%), Gaps = 9/96 (9%)
 Frame = +2

Query  311  MKFGKEFKVHLEDTLPEWRDkylrykplkkll--------kslpAHPSAAAAGDGSFQPP  466
            MKFGK     +E+TLPEW+DK+L YK LKK L             +  + ++   S    
Sbjct  16   MKFGKSLSNQIEETLPEWQDKFLSYKELKKKLKLLEPRGGVENRPNKRSRSSDPNSTDTD  75

Query  467  PPSELHDWFIRLLTEDLEKFNDFYVEQEEEFIIRFQ  574
            P  E  D FIRLL E+L+KFN F+VE+EEE+IIR +
Sbjct  76   PTKEELD-FIRLLEEELDKFNSFFVEKEEEYIIRLK  110



>emb|CDX83238.1| BnaA03g22680D [Brassica napus]
Length=281

 Score = 56.2 bits (134),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 43/96 (45%), Positives = 57/96 (59%), Gaps = 9/96 (9%)
 Frame = +2

Query  311  MKFGKEFKVHLEDTLPEWRDkylrykplkkll--------kslpAHPSAAAAGDGSFQPP  466
            MKFGK     +E+TLPEW+DK+L YK LKK L             +  + ++   S    
Sbjct  1    MKFGKSLSNQIEETLPEWQDKFLSYKELKKKLKLLEPRGGVENRPNKRSRSSDPNSTDTD  60

Query  467  PPSELHDWFIRLLTEDLEKFNDFYVEQEEEFIIRFQ  574
            P  E  D FIRLL E+L+KFN F+VE+EEE+IIR +
Sbjct  61   PTKEELD-FIRLLEEELDKFNSFFVEKEEEYIIRLK  95



>ref|XP_006345229.1| PREDICTED: SPX domain-containing protein 2-like [Solanum tuberosum]
Length=292

 Score = 56.2 bits (134),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 47/105 (45%), Positives = 61/105 (58%), Gaps = 17/105 (16%)
 Frame = +2

Query  311  MKFGKEFKVHLEDTLPEWRDkylrykplkkllkslpAHPSAAAA-GD------------G  451
            MKFGK     +E+TLPEWRDK+L YK LKK LK +    S ++  GD            G
Sbjct  1    MKFGKSLSNQIEETLPEWRDKFLSYKDLKKKLKLIEPKRSLSSGDGDDVRASKRMKMAAG  60

Query  452  SFQPPPPSE-LHDW---FIRLLTEDLEKFNDFYVEQEEEFIIRFQ  574
             F   P  E + D    F+ LL ++LEKFN F+VE+EEE+IIR +
Sbjct  61   GFDKAPEKEPMTDAEVEFVNLLEDELEKFNSFFVEKEEEYIIRLK  105



>emb|CDY38527.1| BnaC03g26700D [Brassica napus]
Length=281

 Score = 56.2 bits (134),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 42/96 (44%), Positives = 54/96 (56%), Gaps = 14/96 (15%)
 Frame = +2

Query  311  MKFGKEFKVHLEDTLPEWRDkylrykplkkllkslpAHPSAAAAGDGSFQPPPPSELHDW  490
            MKFGK     +E+TLPEW++K+L YK LKK              G G  +P   S   D 
Sbjct  1    MKFGKSLSNQIEETLPEWQEKFLSYKELKK------KLKLLEPRGGGDNRPNKRSRSSDT  54

Query  491  --------FIRLLTEDLEKFNDFYVEQEEEFIIRFQ  574
                    FIRLL E+L+KFN F+VE+EEE+IIR +
Sbjct  55   DPTKEELDFIRLLEEELDKFNSFFVEKEEEYIIRLK  90



>ref|XP_008337294.1| PREDICTED: SPX domain-containing protein 1 [Malus domestica]
 ref|XP_008352259.1| PREDICTED: SPX domain-containing protein 1-like [Malus domestica]
Length=289

 Score = 56.2 bits (134),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 46/101 (46%), Positives = 62/101 (61%), Gaps = 15/101 (15%)
 Frame = +2

Query  311  MKFGKEFKVHLEDTLPEWRDkylrykplkkllkslpAH------------PSAAAAGDGS  454
            MKFGK     +++TLPEWRDK+L YK LKK LK +               PSAA   DG 
Sbjct  1    MKFGKSLSNQIDETLPEWRDKFLSYKELKKRLKLIEPKAADRPAKRPRIDPSAADFNDGG  60

Query  455  FQPP-PPSELHDWFIRLLTEDLEKFNDFYVEQEEEFIIRFQ  574
             +     +E++  FI+LL ++LEKFN F+VE+EEE+IIR +
Sbjct  61   BKEDISAAEIN--FIQLLEDELEKFNSFFVEKEEEYIIRLK  99



>gb|KFK30512.1| hypothetical protein AALP_AA7G271900 [Arabis alpina]
Length=267

 Score = 55.8 bits (133),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 46/90 (51%), Positives = 58/90 (64%), Gaps = 4/90 (4%)
 Frame = +2

Query  311  MKFGKEFKVHLEDTLPEWRDkylrykplkkllkslpA--HPSAAAAGDGSFQPPPPSELH  484
            MKFGK     +E+TLPEWRDK+L YK LKK LK L     P+  +  D S       EL 
Sbjct  1    MKFGKSLSNQIEETLPEWRDKFLSYKELKKTLKLLGGDNRPNKRSRSDPSSSDMTKEELD  60

Query  485  DWFIRLLTEDLEKFNDFYVEQEEEFIIRFQ  574
              FIRLL ++L+KFN F+VE+EEE+IIR +
Sbjct  61   --FIRLLEDELDKFNSFFVEKEEEYIIRLK  88



>ref|XP_008802486.1| PREDICTED: SPX domain-containing protein 5 [Phoenix dactylifera]
Length=253

 Score = 55.5 bits (132),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 41/86 (48%), Positives = 53/86 (62%), Gaps = 13/86 (15%)
 Frame = +2

Query  311  MKFGKEFKVHLEDTLPEWRDkylrykplkkllkslpAHPSAAAAGDGSFQPPPPSELHDW  490
            MKFGK  K  +E+TLPEWRDK+L YK LKKL++ + +               P +E    
Sbjct  1    MKFGKRLKQQIEETLPEWRDKFLSYKDLKKLVRLISSTN-------------PSTEAEAA  47

Query  491  FIRLLTEDLEKFNDFYVEQEEEFIIR  568
            F  LL  +++KFN F+VEQEEEFIIR
Sbjct  48   FTDLLDAEIDKFNAFFVEQEEEFIIR  73



>ref|XP_003609335.1| hypothetical protein MTR_4g114550 [Medicago truncatula]
 gb|AES91532.1| IDS4-like protein [Medicago truncatula]
 gb|AFK45878.1| unknown [Medicago truncatula]
Length=285

 Score = 55.8 bits (133),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 46/98 (47%), Positives = 59/98 (60%), Gaps = 12/98 (12%)
 Frame = +2

Query  311  MKFGKEFKVHLEDTLPEWRDkylrykplkkllkslpAHPSAAAAGD----------GSFQ  460
            MKFGK     +E TLPEWRDK+L YK LKK LKS    P++A+A D          G+  
Sbjct  1    MKFGKSLSSQIEKTLPEWRDKFLSYKELKKKLKS--LEPASASADDRPVKRLKVDSGNAD  58

Query  461  PPPPSELHDWFIRLLTEDLEKFNDFYVEQEEEFIIRFQ  574
                S+    F  LL  +LEKFN+F+VE+EEE+IIR +
Sbjct  59   AGEMSKEESDFRNLLENELEKFNNFFVEKEEEYIIRLK  96



>ref|XP_006409728.1| hypothetical protein EUTSA_v10016985mg [Eutrema salsugineum]
 gb|ESQ51181.1| hypothetical protein EUTSA_v10016985mg [Eutrema salsugineum]
Length=306

 Score = 56.2 bits (134),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 43/97 (44%), Positives = 56/97 (58%), Gaps = 9/97 (9%)
 Frame = +2

Query  311  MKFGKEFKVHLEDTLPEWRDkylrykplkkllkslpAHPSAAAAGDGSFQPPPPSELHDW  490
            MKFGK     +E+TLPEW+DK+L YK LKK LK +      +     S   P P +    
Sbjct  20   MKFGKSLSNQIEETLPEWQDKFLSYKELKKKLKLMEPRGGESRPNKRSRSDPNPVDADPT  79

Query  491  ---------FIRLLTEDLEKFNDFYVEQEEEFIIRFQ  574
                     FIRLL ++LEKFN F+VE+EEE+IIR +
Sbjct  80   EGMTKEELDFIRLLEDELEKFNSFFVEKEEEYIIRLK  116



>gb|ACJ85241.1| unknown [Medicago truncatula]
 gb|AFK39120.1| unknown [Medicago truncatula]
Length=285

 Score = 55.8 bits (133),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 46/98 (47%), Positives = 59/98 (60%), Gaps = 12/98 (12%)
 Frame = +2

Query  311  MKFGKEFKVHLEDTLPEWRDkylrykplkkllkslpAHPSAAAAGD----------GSFQ  460
            MKFGK     +E TLPEWRDK+L YK LKK LKS    P++A+A D          G+  
Sbjct  1    MKFGKSLSSQIEKTLPEWRDKFLSYKELKKKLKS--LEPASASADDRPVKRLKVDSGNAD  58

Query  461  PPPPSELHDWFIRLLTEDLEKFNDFYVEQEEEFIIRFQ  574
                S+    F  LL  +LEKFN+F+VE+EEE+IIR +
Sbjct  59   AGEMSKEESDFRNLLENELEKFNNFFVEKEEEYIIRLK  96



>ref|XP_004308469.1| PREDICTED: SPX domain-containing protein 3-like [Fragaria vesca 
subsp. vesca]
Length=259

 Score = 55.5 bits (132),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 37/86 (43%), Positives = 54/86 (63%), Gaps = 8/86 (9%)
 Frame = +2

Query  311  MKFGKEFKVHLEDTLPEWRDkylrykplkkllkslpAHPSAAAAGDGSFQPPPPSELHDW  490
            MKFGK  K  +++TLP WRDK+L YK LKKL++ + + P+      G  +          
Sbjct  1    MKFGKRLKHQMQETLPSWRDKFLSYKDLKKLVRLISSAPAVLNGKSGKAEAE--------  52

Query  491  FIRLLTEDLEKFNDFYVEQEEEFIIR  568
            F+ LL  +++KFN F++EQEE+FIIR
Sbjct  53   FVYLLNNEIDKFNAFFMEQEEDFIIR  78



>ref|XP_002308081.1| hypothetical protein POPTR_0006s06880g [Populus trichocarpa]
 gb|EEE91604.1| hypothetical protein POPTR_0006s06880g [Populus trichocarpa]
Length=294

 Score = 55.8 bits (133),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 43/104 (41%), Positives = 60/104 (58%), Gaps = 16/104 (15%)
 Frame = +2

Query  311  MKFGKEFKVHLEDTLPEWRDkylrykplkkllkslpAHPS----------------AAAA  442
            MKFGK     +E+TLPEWRDK+L YK LKK LK +  + +                +AA+
Sbjct  1    MKFGKSLSNQIEETLPEWRDKFLSYKELKKRLKLIEPNNNTSKNNGESRPMKKPRLSAAS  60

Query  443  GDGSFQPPPPSELHDWFIRLLTEDLEKFNDFYVEQEEEFIIRFQ  574
             D   +    +     FI+LL ++LEKFN F+VE+EEE+IIR +
Sbjct  61   ADADSKEVSMTREEIDFIKLLEDELEKFNSFFVEKEEEYIIRLK  104



>ref|XP_010914861.1| PREDICTED: SPX domain-containing protein 1-like [Elaeis guineensis]
Length=282

 Score = 55.5 bits (132),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 45/91 (49%), Positives = 56/91 (62%), Gaps = 6/91 (7%)
 Frame = +2

Query  311  MKFGKEFKVHLEDTLPEWRDkylrykplkkllkslpAHPSAA-----AAGDGSFQPPPPS  475
            MKFGK     +E+TLPEWRDK+L YK LKK LK +      A     A  DGS +     
Sbjct  1    MKFGKSLSNQIEETLPEWRDKFLSYKELKKRLKLIGGGDRPAKRPRPANDDGSSEVAITP  60

Query  476  ELHDWFIRLLTEDLEKFNDFYVEQEEEFIIR  568
            E  + F+ LL  +LEKFN F+VE+EEE+IIR
Sbjct  61   E-EEGFLTLLEAELEKFNAFFVEKEEEYIIR  90



>ref|XP_006375297.1| hypothetical protein POPTR_0014s06020g [Populus trichocarpa]
 ref|XP_006388478.1| hypothetical protein POPTR_0176s00240g [Populus trichocarpa]
 gb|ERP47392.1| hypothetical protein POPTR_0176s00240g [Populus trichocarpa]
 gb|ERP53094.1| hypothetical protein POPTR_0014s06020g [Populus trichocarpa]
Length=259

 Score = 55.1 bits (131),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 38/86 (44%), Positives = 56/86 (65%), Gaps = 6/86 (7%)
 Frame = +2

Query  311  MKFGKEFKVHLEDTLPEWRDkylrykplkkllkslpAHPSAAAAGDGSFQPPPPSELHDW  490
            MKFGK  K  +++TLP+WRDK+L YK LKKL++ + + P        S+      +    
Sbjct  1    MKFGKRLKQQVQETLPDWRDKFLSYKELKKLVRLISSAPPF------SYGSVEYGKAEAE  54

Query  491  FIRLLTEDLEKFNDFYVEQEEEFIIR  568
            F+RLL  +++KFN F++EQEE+FIIR
Sbjct  55   FVRLLNSEIDKFNTFFMEQEEDFIIR  80



>gb|EYU31951.1| hypothetical protein MIMGU_mgv1a024738mg [Erythranthe guttata]
Length=260

 Score = 54.7 bits (130),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 37/86 (43%), Positives = 55/86 (64%), Gaps = 5/86 (6%)
 Frame = +2

Query  311  MKFGKEFKVHLEDTLPEWRDkylrykplkkllkslpAHPSAAAAGDGSFQPPPPSELHDW  490
            MKFGK  K  +E +LP+WRDKYL YK LKKLL+ + + P+  +     +      +    
Sbjct  1    MKFGKRLKQQIEQSLPDWRDKYLSYKELKKLLRLITSAPAKMSGSPSEY-----GKAEAE  55

Query  491  FIRLLTEDLEKFNDFYVEQEEEFIIR  568
            F+ LL  +++KFN F++EQEE+F+IR
Sbjct  56   FMYLLNNEIDKFNSFFMEQEEDFVIR  81



>gb|AFW66117.1| hypothetical protein ZEAMMB73_937184 [Zea mays]
Length=98

 Score = 52.8 bits (125),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 39/96 (41%), Positives = 56/96 (58%), Gaps = 7/96 (7%)
 Frame = +2

Query  311  MKFGKEFKVHLEDTLPEWRDkylrykplkkllkslpAHPSAAAA-------GDGSFQPPP  469
            MKFGK     + +TLP+WRDK+L YK LKK LK + A      +       G G   PP 
Sbjct  1    MKFGKSLNNQIVETLPDWRDKFLSYKDLKKRLKQIGAGSGERRSKRQRVGDGRGGSSPPA  60

Query  470  PSELHDWFIRLLTEDLEKFNDFYVEQEEEFIIRFQV  577
             +     F+ LL  +L+KFN F++E+EE+++IR +V
Sbjct  61   MTPEEAGFVALLDAELDKFNAFFLEKEEDYVIRLKV  96



>ref|XP_009775255.1| PREDICTED: SPX domain-containing protein 1-like [Nicotiana sylvestris]
Length=281

 Score = 55.1 bits (131),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 40/93 (43%), Positives = 62/93 (67%), Gaps = 4/93 (4%)
 Frame = +2

Query  311  MKFGKEFKVHLEDTLPEWRDkylrykplkkllkslpA----HPSAAAAGDGSFQPPPPSE  478
            MKF K  K H+E+TLPEW+DK+L YK LKK LK +       P+     DG  +    ++
Sbjct  1    MKFWKILKAHIEETLPEWQDKFLNYKDLKKELKLIYPKDGDRPNKRQKVDGDDKGEVVTK  60

Query  479  LHDWFIRLLTEDLEKFNDFYVEQEEEFIIRFQV  577
              + F++LL E++EKFN+F++E+EE++II+ +V
Sbjct  61   EVNDFVKLLEEEIEKFNNFFMEKEEDYIIQLKV  93



>ref|XP_002871925.1| SPX domain-containing protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH48184.1| SPX domain-containing protein [Arabidopsis lyrata subsp. lyrata]
Length=257

 Score = 54.7 bits (130),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 44/92 (48%), Positives = 59/92 (64%), Gaps = 5/92 (5%)
 Frame = +2

Query  311  MKFGKEFKVHLEDTLPEWRDkylrykplkkllkslpA----HPSAAAAGDGSFQPPPPSE  478
            MKFGK     +E TLPEW+DK+L YK LKK LK +P+     P+     D  F      E
Sbjct  1    MKFGKSLSNQIEQTLPEWQDKFLSYKELKKRLKLIPSKTGDRPAKRLRFDDEFSVGMSKE  60

Query  479  LHDWFIRLLTEDLEKFNDFYVEQEEEFIIRFQ  574
              + FI+LL ++LEKFN+F+VE+EEE+IIR +
Sbjct  61   EIN-FIQLLEDELEKFNNFFVEKEEEYIIRLK  91



>gb|EMT28546.1| hypothetical protein F775_25863 [Aegilops tauschii]
Length=272

 Score = 54.7 bits (130),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 36/86 (42%), Positives = 53/86 (62%), Gaps = 12/86 (14%)
 Frame = +2

Query  311  MKFGKEFKVHLEDTLPEWRDkylrykplkkllkslpAHPSAAAAGDGSFQPPPPSELHDW  490
            MKFGK  K  +E++LP WRDK+L YK LK L++ +       A  + +F           
Sbjct  1    MKFGKRLKKQVEESLPGWRDKFLAYKRLKVLVRLVSGSSPHRAVAEATF-----------  49

Query  491  FIRLLTEDLEKFNDFYVEQEEEFIIR  568
             +RLL +++++FN F++EQEEEFIIR
Sbjct  50   -VRLLNDEVDRFNAFFLEQEEEFIIR  74



>gb|KDP28799.1| hypothetical protein JCGZ_14570 [Jatropha curcas]
Length=259

 Score = 54.3 bits (129),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 39/89 (44%), Positives = 60/89 (67%), Gaps = 6/89 (7%)
 Frame = +2

Query  311  MKFGKEFKVHLEDTLPEWRDkylrykplkkllkslpAHPSAAAAGDGSFQPPPPSELHDW  490
            MKFGK  K  +++TLP+WRDKYL YK LKKL++ + + P  ++   GS +     +    
Sbjct  1    MKFGKRLKQQIQETLPDWRDKYLSYKELKKLVRLISSAPPLSS---GSIEY---GKAEAE  54

Query  491  FIRLLTEDLEKFNDFYVEQEEEFIIRFQV  577
            F+ LL  +++KFN F++EQEE+FIIR ++
Sbjct  55   FVYLLNNEIDKFNVFFMEQEEDFIIRHKI  83



>ref|XP_011033628.1| PREDICTED: SPX domain-containing protein 3-like isoform X1 [Populus 
euphratica]
Length=260

 Score = 54.3 bits (129),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 38/86 (44%), Positives = 56/86 (65%), Gaps = 6/86 (7%)
 Frame = +2

Query  311  MKFGKEFKVHLEDTLPEWRDkylrykplkkllkslpAHPSAAAAGDGSFQPPPPSELHDW  490
            MKFGK  K  +++TLP+WRDK+L YK LKKL++ + + P        S+      +    
Sbjct  1    MKFGKRLKQQVQETLPDWRDKFLSYKELKKLVRLISSAPPF------SYGSVEYGKAEAE  54

Query  491  FIRLLTEDLEKFNDFYVEQEEEFIIR  568
            F+RLL  +++KFN F++EQEE+FIIR
Sbjct  55   FMRLLNSEIDKFNTFFMEQEEDFIIR  80



>ref|XP_011017757.1| PREDICTED: SPX domain-containing protein 1-like [Populus euphratica]
Length=290

 Score = 54.7 bits (130),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 45/107 (42%), Positives = 58/107 (54%), Gaps = 19/107 (18%)
 Frame = +2

Query  311  MKFGKEFKVHLEDTLPEWRDkylrykplkkllks-----------lpAHP--------SA  433
            MKFGK     +E+TLPEWRDK+L YK LKK LK                P        +A
Sbjct  1    MKFGKSLSNQIEETLPEWRDKFLSYKELKKRLKLIEPNNNNSTTKNNGDPRPLKKPRFAA  60

Query  434  AAAGDGSFQPPPPSELHDWFIRLLTEDLEKFNDFYVEQEEEFIIRFQ  574
            A  G G       ++    FI+LL ++LEKFN F+VE+EEE+IIR +
Sbjct  61   AEGGRGDCNEGSMTKEEIDFIKLLDDELEKFNSFFVEKEEEYIIRLK  107



>ref|XP_009408982.1| PREDICTED: SPX domain-containing protein 1-like [Musa acuminata 
subsp. malaccensis]
Length=288

 Score = 54.7 bits (130),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 42/98 (43%), Positives = 57/98 (58%), Gaps = 12/98 (12%)
 Frame = +2

Query  311  MKFGKEFKVHLEDTLPEWRDkylrykplkkllkslpA---------HPSAAAAGDGSFQP  463
            MKFGK     +++TLPEWRDK+L YK LK+ LK + A          P  A     +   
Sbjct  1    MKFGKSLSNQIDETLPEWRDKFLSYKDLKRRLKLIAAGGGGERPAKRPRVADDDRAASSA  60

Query  464  PPPSELHDW---FIRLLTEDLEKFNDFYVEQEEEFIIR  568
            P  S + +    F+RLL  +L+KFN F+VE+EEE+IIR
Sbjct  61   PEDSAMREEEEDFMRLLESELDKFNYFFVEKEEEYIIR  98



>ref|XP_010939888.1| PREDICTED: SPX domain-containing protein 5 isoform X2 [Elaeis 
guineensis]
Length=253

 Score = 53.9 bits (128),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 40/85 (47%), Positives = 54/85 (64%), Gaps = 13/85 (15%)
 Frame = +2

Query  311  MKFGKEFKVHLEDTLPEWRDkylrykplkkllkslpAHPSAAAAGDGSFQPPPPSELHDW  490
            MKFGK  K  +E+TLPEWRDK+L YK LK+L++ +            +  P P +E    
Sbjct  1    MKFGKRLKQQIEETLPEWRDKFLSYKDLKQLVRLI-----------STTNPSPNAEAE--  47

Query  491  FIRLLTEDLEKFNDFYVEQEEEFII  565
            FI LL  +++KFN F+VEQEE+FII
Sbjct  48   FIDLLNAEIDKFNTFFVEQEEDFII  72



>emb|CBI21037.3| unnamed protein product [Vitis vinifera]
Length=263

 Score = 54.3 bits (129),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 43/95 (45%), Positives = 59/95 (62%), Gaps = 8/95 (8%)
 Frame = +2

Query  311  MKFGKEFKVHLEDTLPEWRDkylrykplkkllkslp-----AHPSAAAAGDGSFQPPP--  469
            MKF K     +E+TLP WRDK+L YK LKK LK +      AHP+  A  DG        
Sbjct  1    MKFWKSLSNLIEETLPAWRDKFLSYKDLKKQLKLIYPKADDAHPNKRARSDGGGGEASDV  60

Query  470  PSELHDWFIRLLTEDLEKFNDFYVEQEEEFIIRFQ  574
              E+ D F+RLL +++EKFN F+VE+EEE++I+ +
Sbjct  61   TKEVTD-FVRLLEDEIEKFNIFFVEKEEEYVIKLK  94



>ref|XP_011033635.1| PREDICTED: SPX domain-containing protein 3-like isoform X2 [Populus 
euphratica]
Length=259

 Score = 53.9 bits (128),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 39/88 (44%), Positives = 57/88 (65%), Gaps = 10/88 (11%)
 Frame = +2

Query  311  MKFGKEFKVHLEDTLPEWRDkylrykplkkllkslpAHP--SAAAAGDGSFQPPPPSELH  484
            MKFGK  K  +++TLP+WRDK+L YK LKKL++ + + P  S  +   G  +        
Sbjct  1    MKFGKRLKQQVQETLPDWRDKFLSYKELKKLVRLISSAPPFSYGSVEYGKAEAE------  54

Query  485  DWFIRLLTEDLEKFNDFYVEQEEEFIIR  568
              F+RLL  +++KFN F++EQEE+FIIR
Sbjct  55   --FMRLLNSEIDKFNTFFMEQEEDFIIR  80



>ref|XP_009773844.1| PREDICTED: SPX domain-containing protein 1-like [Nicotiana sylvestris]
Length=290

 Score = 54.3 bits (129),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 46/108 (43%), Positives = 60/108 (56%), Gaps = 21/108 (19%)
 Frame = +2

Query  311  MKFGKEFKVHLEDTLPEWRDkylrykplkkllkslpAHPSAAAAG---------------  445
            MKFGK     +E+TLPEWRDK+L YK LKK LK +     A+AA                
Sbjct  1    MKFGKSLSNQIEETLPEWRDKFLSYKDLKKKLKLIEPKKPASAATTAVDEDVRVSKKMKL  60

Query  446  -----DGSFQPPPPSELHDWFIRLLTEDLEKFNDFYVEQEEEFIIRFQ  574
                 DGS + P  +   D F+ LL ++LEKFN F+VE+EEE+II  +
Sbjct  61   AAGDFDGSQKVPMTAAEVD-FVNLLEDELEKFNSFFVEKEEEYIITLK  107



>ref|XP_010939887.1| PREDICTED: SPX domain-containing protein 5 isoform X1 [Elaeis 
guineensis]
Length=271

 Score = 53.9 bits (128),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 40/85 (47%), Positives = 54/85 (64%), Gaps = 13/85 (15%)
 Frame = +2

Query  311  MKFGKEFKVHLEDTLPEWRDkylrykplkkllkslpAHPSAAAAGDGSFQPPPPSELHDW  490
            MKFGK  K  +E+TLPEWRDK+L YK LK+L++ +            +  P P +E    
Sbjct  1    MKFGKRLKQQIEETLPEWRDKFLSYKDLKQLVRLI-----------STTNPSPNAEAE--  47

Query  491  FIRLLTEDLEKFNDFYVEQEEEFII  565
            FI LL  +++KFN F+VEQEE+FII
Sbjct  48   FIDLLNAEIDKFNTFFVEQEEDFII  72



>ref|XP_004984066.1| PREDICTED: SPX domain-containing protein 5-like [Setaria italica]
Length=252

 Score = 53.9 bits (128),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 36/87 (41%), Positives = 54/87 (62%), Gaps = 15/87 (17%)
 Frame = +2

Query  311  MKFGKEFKVHLEDTLPEWRDkylrykplkkllkslpA-HPSAAAAGDGSFQPPPPSELHD  487
            MKFGK  K  +E++LPEWR ++L YK LK+ + ++ +  P+ AA  D             
Sbjct  1    MKFGKRLKKQIEESLPEWRSQFLNYKELKRRVNAVSSPAPTPAAEAD-------------  47

Query  488  WFIRLLTEDLEKFNDFYVEQEEEFIIR  568
             F+ LL  +++KFN F++EQEEEF+IR
Sbjct  48   -FLTLLNAEVDKFNAFFLEQEEEFVIR  73



>ref|XP_004508498.1| PREDICTED: SPX domain-containing protein 2-like [Cicer arietinum]
Length=288

 Score = 54.3 bits (129),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 45/101 (45%), Positives = 55/101 (54%), Gaps = 15/101 (15%)
 Frame = +2

Query  311  MKFGKEFKVHLEDTLPEWRDkylrykplkkllkslpAHPSAAA-------------AGDG  451
            MKFGK     +E TLPEWRDK+L YK LKK LK+    PS A               GD 
Sbjct  1    MKFGKSLSSQIEKTLPEWRDKFLSYKELKKKLKN--LEPSVAGEDRPAKRPRVDSGTGDS  58

Query  452  SFQPPPPSELHDWFIRLLTEDLEKFNDFYVEQEEEFIIRFQ  574
                   S+    F  LL  +LEKFN+F+VE+EEE+IIR +
Sbjct  59   VADAGEMSKEESGFRNLLENELEKFNNFFVEKEEEYIIRLK  99



>ref|XP_002466164.1| hypothetical protein SORBIDRAFT_01g002690 [Sorghum bicolor]
 gb|EER93162.1| hypothetical protein SORBIDRAFT_01g002690 [Sorghum bicolor]
Length=335

 Score = 54.3 bits (129),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 48/107 (45%), Positives = 62/107 (58%), Gaps = 18/107 (17%)
 Frame = +2

Query  311  MKFGKEFKVHLEDTLPEWRDkylrykplkkllkslpAHPSAAAAGDGSFQPPPPS-----  475
            MKFGK+F+ HLE+TLP WRDKYL YK LKKL+K+L     AAA       P P       
Sbjct  1    MKFGKDFRNHLEETLPAWRDKYLAYKALKKLIKNLVPPHPAAAPPLPPPPPAPAPAAAEG  60

Query  476  -------------ELHDWFIRLLTEDLEKFNDFYVEQEEEFIIRFQV  577
                         +L +WF R+L  +L K N+FY+E+EE ++IR QV
Sbjct  61   PGAGAVAAAQGNVDLGNWFARILDAELHKLNEFYIEREEWYVIRLQV  107



>ref|XP_002285094.1| PREDICTED: SPX domain-containing protein 1 [Vitis vinifera]
Length=284

 Score = 53.9 bits (128),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 43/95 (45%), Positives = 59/95 (62%), Gaps = 8/95 (8%)
 Frame = +2

Query  311  MKFGKEFKVHLEDTLPEWRDkylrykplkkllk-----slpAHPSAAAAGDGSFQPPP--  469
            MKF K     +E+TLP WRDK+L YK LKK LK     +  AHP+  A  DG        
Sbjct  1    MKFWKSLSNLIEETLPAWRDKFLSYKDLKKQLKLIYPKADDAHPNKRARSDGGGGEASDV  60

Query  470  PSELHDWFIRLLTEDLEKFNDFYVEQEEEFIIRFQ  574
              E+ D F+RLL +++EKFN F+VE+EEE++I+ +
Sbjct  61   TKEVTD-FVRLLEDEIEKFNIFFVEKEEEYVIKLK  94



>ref|XP_009397480.1| PREDICTED: SPX domain-containing protein 1-like [Musa acuminata 
subsp. malaccensis]
Length=291

 Score = 53.9 bits (128),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 44/100 (44%), Positives = 57/100 (57%), Gaps = 14/100 (14%)
 Frame = +2

Query  311  MKFGKEFKVHLEDTLPEWRDkylrykplkkllkslpAHPSAA----AAGDGSFQPPPPSE  478
            MKFGK     +E+TLPEWRDK+L YK LK+ LK + A    A     A DG+      S 
Sbjct  1    MKFGKSLSNQIEETLPEWRDKFLSYKDLKRRLKLIAAGDKPAKRPKVAEDGAATGRAASL  60

Query  479  LHDW----------FIRLLTEDLEKFNDFYVEQEEEFIIR  568
            +             F+RLL  +L+KFN F+VE+EEE+IIR
Sbjct  61   VTREEEEEEEEEEDFVRLLEAELDKFNTFFVEKEEEYIIR  100



>ref|XP_008444000.1| PREDICTED: SPX domain-containing protein 1-like [Cucumis melo]
 gb|ADN33759.1| ids4-like protein [Cucumis melo subsp. melo]
Length=287

 Score = 53.9 bits (128),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 43/96 (45%), Positives = 60/96 (63%), Gaps = 11/96 (11%)
 Frame = +2

Query  311  MKFGKEFKVHLEDTLPEWRDkylrykplkkllkslpAHPSAAAAGDGSFQPPP-------  469
            MKFGK     +E+TLPEWRDK+L YK LKK LK     P++A   +   + P        
Sbjct  1    MKFGKSLSNQIEETLPEWRDKFLSYKHLKKKLKL--LQPNSAHINNPPSKKPKLDSHADS  58

Query  470  -PSELHDWFIRLLTEDLEKFNDFYVEQEEEFIIRFQ  574
              +E+ D F+ LL ++L+KFN F+VE+EEE+IIR +
Sbjct  59   ISNEVFD-FVTLLEKELDKFNSFFVEKEEEYIIRLK  93



>gb|KHG08005.1| SPX domain-containing 3 -like protein [Gossypium arboreum]
Length=260

 Score = 53.5 bits (127),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 37/86 (43%), Positives = 53/86 (62%), Gaps = 8/86 (9%)
 Frame = +2

Query  311  MKFGKEFKVHLEDTLPEWRDkylrykplkkllkslpAHPSAAAAGDGSFQPPPPSELHDW  490
            MKFGK  K  +E++LP WRDK+L YK LKKL++ + +  S    G    +          
Sbjct  1    MKFGKRLKQQIEESLPAWRDKFLSYKELKKLVRLISSAESCVEYGKADVEAE--------  52

Query  491  FIRLLTEDLEKFNDFYVEQEEEFIIR  568
            F+ LL  +++KFN F++EQEE+FIIR
Sbjct  53   FVHLLNNEIDKFNVFFMEQEEDFIIR  78



>ref|XP_010524397.1| PREDICTED: SPX domain-containing protein 3 [Tarenaya hassleriana]
Length=250

 Score = 52.8 bits (125),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 39/86 (45%), Positives = 56/86 (65%), Gaps = 13/86 (15%)
 Frame = +2

Query  311  MKFGKEFKVHLEDTLPEWRDkylrykplkkllkslpAHPSAAAAGDGSFQPPPPSELHDW  490
            MKFGK  K  +++TLPEWRDK+LRYK LK +++ + +  +A  AG+ SF           
Sbjct  1    MKFGKRIKEQVQETLPEWRDKFLRYKELKNMVRQISS-SAADKAGEVSF-----------  48

Query  491  FIRLLTEDLEKFNDFYVEQEEEFIIR  568
             +  L  +++KFN F+VEQEE+FIIR
Sbjct  49   -VHSLNSEIDKFNAFFVEQEEDFIIR  73



>ref|XP_008659744.1| PREDICTED: SPX domain-containing protein 1-like isoform X1 [Zea 
mays]
 gb|AFW87184.1| hypothetical protein ZEAMMB73_228145 [Zea mays]
Length=156

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 40/104 (38%), Positives = 54/104 (52%), Gaps = 25/104 (24%)
 Frame = +2

Query  311  MKFGKEFKVHLEDTLPEWRDkylrykplkkllkslpAHPSAAAAGDGSFQPPPPSELHD-  487
            MKFGK     + +TLPEWRDK+L YK LKK             AG+G+ + P  +   D 
Sbjct  1    MKFGKSLSGQIVETLPEWRDKFLSYKDLKK-------RLKLIGAGNGAERQPKRARRDDS  53

Query  488  -----------------WFIRLLTEDLEKFNDFYVEQEEEFIIR  568
                              F++LL  +L+KFN F+VE+EEE+IIR
Sbjct  54   GEADAAAAAAAMTPEEAEFMQLLEAELDKFNSFFVEKEEEYIIR  97



>ref|XP_008659745.1| PREDICTED: SPX domain-containing protein 1-like isoform X2 [Zea 
mays]
 gb|AFW87183.1| hypothetical protein ZEAMMB73_228145 [Zea mays]
Length=155

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 40/104 (38%), Positives = 54/104 (52%), Gaps = 25/104 (24%)
 Frame = +2

Query  311  MKFGKEFKVHLEDTLPEWRDkylrykplkkllkslpAHPSAAAAGDGSFQPPPPSELHD-  487
            MKFGK     + +TLPEWRDK+L YK LKK             AG+G+ + P  +   D 
Sbjct  1    MKFGKSLSGQIVETLPEWRDKFLSYKDLKK-------RLKLIGAGNGAERQPKRARRDDS  53

Query  488  -----------------WFIRLLTEDLEKFNDFYVEQEEEFIIR  568
                              F++LL  +L+KFN F+VE+EEE+IIR
Sbjct  54   GEADAAAAAAAMTPEEAEFMQLLEAELDKFNSFFVEKEEEYIIR  97



>ref|XP_008659746.1| PREDICTED: SPX domain-containing protein 1-like isoform X3 [Zea 
mays]
Length=144

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 39/104 (38%), Positives = 53/104 (51%), Gaps = 25/104 (24%)
 Frame = +2

Query  311  MKFGKEFKVHLEDTLPEWRDkylrykplkkllkslpAHPSAAAAGDGSFQPPPPSELHD-  487
            MKFGK     + +TLPEWRDK+L YK LK              AG+G+ + P  +   D 
Sbjct  1    MKFGKSLSGQIVETLPEWRDKFLSYKDLK-------KRLKLIGAGNGAERQPKRARRDDS  53

Query  488  -----------------WFIRLLTEDLEKFNDFYVEQEEEFIIR  568
                              F++LL  +L+KFN F+VE+EEE+IIR
Sbjct  54   GEADAAAAAAAMTPEEAEFMQLLEAELDKFNSFFVEKEEEYIIR  97



>tpg|DAA50080.1| TPA: hypothetical protein ZEAMMB73_872399 [Zea mays]
Length=214

 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 35/86 (41%), Positives = 56/86 (65%), Gaps = 9/86 (10%)
 Frame = +2

Query  311  MKFGKEFKVHLEDTLPEWRDkylrykplkkllkslpAHPSAAAAGDGSFQPPPPSELHDW  490
            MKFGK  K  +E++LP+WRDK+L YK LK+L++ +PA   +   G  +            
Sbjct  1    MKFGKRLKKQVEESLPDWRDKFLAYKRLKRLVRLVPASSPSRRGGRAA---------DAA  51

Query  491  FIRLLTEDLEKFNDFYVEQEEEFIIR  568
            F+RLL  ++++FN F++E+EE+F+IR
Sbjct  52   FLRLLHAEVDRFNAFFLEREEDFVIR  77



>ref|XP_003559963.1| PREDICTED: SPX domain-containing protein 6-like [Brachypodium 
distachyon]
Length=241

 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 40/86 (47%), Positives = 53/86 (62%), Gaps = 18/86 (21%)
 Frame = +2

Query  311  MKFGKEFKVHLEDTLPEWRDkylrykplkkllkslpAHPSAAAAGDGSFQPPPPSELHDW  490
            MKFGK  K  +E +LP WR+ +LRYK LK ++       S+AA       PP P+E    
Sbjct  1    MKFGKWLKRQIEQSLPAWREHFLRYKELKGIV-------SSAA-------PPSPAE----  42

Query  491  FIRLLTEDLEKFNDFYVEQEEEFIIR  568
            F+ LL  D++K N F++EQEEEFIIR
Sbjct  43   FVALLEADIDKINAFFIEQEEEFIIR  68



>ref|XP_008676663.1| PREDICTED: uncharacterized protein LOC100216711 isoform X2 [Zea 
mays]
 gb|ACF83640.1| unknown [Zea mays]
 gb|AFW66119.1| IDS4-like protein [Zea mays]
Length=279

 Score = 52.8 bits (125),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 38/95 (40%), Positives = 55/95 (58%), Gaps = 7/95 (7%)
 Frame = +2

Query  311  MKFGKEFKVHLEDTLPEWRDkylrykplkkllkslpAHPSAAAA-------GDGSFQPPP  469
            MKFGK     + +TLP+WRDK+L YK LKK LK + A      +       G G   PP 
Sbjct  1    MKFGKSLNNQIVETLPDWRDKFLSYKDLKKRLKQIGAGSGERRSKRQRVGDGRGGSSPPA  60

Query  470  PSELHDWFIRLLTEDLEKFNDFYVEQEEEFIIRFQ  574
             +     F+ LL  +L+KFN F++E+EE+++IR +
Sbjct  61   MTPEEAGFVALLDAELDKFNAFFLEKEEDYVIRLK  95



>ref|NP_001136588.1| uncharacterized protein LOC100216711 [Zea mays]
 gb|ACF82227.1| unknown [Zea mays]
 gb|AFW66118.1| hypothetical protein ZEAMMB73_937184 [Zea mays]
Length=276

 Score = 52.8 bits (125),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 38/95 (40%), Positives = 55/95 (58%), Gaps = 7/95 (7%)
 Frame = +2

Query  311  MKFGKEFKVHLEDTLPEWRDkylrykplkkllkslpAHPSAAAA-------GDGSFQPPP  469
            MKFGK     + +TLP+WRDK+L YK LKK LK + A      +       G G   PP 
Sbjct  1    MKFGKSLNNQIVETLPDWRDKFLSYKDLKKRLKQIGAGSGERRSKRQRVGDGRGGSSPPA  60

Query  470  PSELHDWFIRLLTEDLEKFNDFYVEQEEEFIIRFQ  574
             +     F+ LL  +L+KFN F++E+EE+++IR +
Sbjct  61   MTPEEAGFVALLDAELDKFNAFFLEKEEDYVIRLK  95



>ref|XP_011017455.1| PREDICTED: SPX domain-containing protein 3-like [Populus euphratica]
Length=260

 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 38/86 (44%), Positives = 55/86 (64%), Gaps = 6/86 (7%)
 Frame = +2

Query  311  MKFGKEFKVHLEDTLPEWRDkylrykplkkllkslpAHPSAAAAGDGSFQPPPPSELHDW  490
            MKFGK  K  +++TLP+WRDK+L YK LKKL++ + + P     G   +           
Sbjct  1    MKFGKRLKQQVQETLPDWRDKFLSYKELKKLVRLISSAP-PFLNGSSEYGKSEAE-----  54

Query  491  FIRLLTEDLEKFNDFYVEQEEEFIIR  568
            F+RLL  +++KFN F++EQEE+FIIR
Sbjct  55   FVRLLNCEIDKFNAFFMEQEEDFIIR  80



>gb|ACG49051.1| IDS4-like protein [Zea mays]
Length=279

 Score = 52.8 bits (125),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 38/95 (40%), Positives = 55/95 (58%), Gaps = 7/95 (7%)
 Frame = +2

Query  311  MKFGKEFKVHLEDTLPEWRDkylrykplkkllkslpAHPSAAAA-------GDGSFQPPP  469
            MKFGK     + +TLP+WRDK+L YK LKK LK + A      +       G G   PP 
Sbjct  1    MKFGKSLNNQIVETLPDWRDKFLSYKDLKKRLKQIGAGSGERRSKRQRVRDGRGGSSPPA  60

Query  470  PSELHDWFIRLLTEDLEKFNDFYVEQEEEFIIRFQ  574
             +     F+ LL  +L+KFN F++E+EE+++IR +
Sbjct  61   MTPEEAGFVALLDAELDKFNAFFLEKEEDYVIRLK  95



>ref|XP_002438650.1| hypothetical protein SORBIDRAFT_10g023590 [Sorghum bicolor]
 gb|EER90017.1| hypothetical protein SORBIDRAFT_10g023590 [Sorghum bicolor]
Length=308

 Score = 52.8 bits (125),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 46/100 (46%), Positives = 58/100 (58%), Gaps = 16/100 (16%)
 Frame = +2

Query  311  MKFGKEFKVHLEDTLPEWRDkylrykplkkllkslpAHPSAA------AAGDGSFQPP--  466
            MKFGK     + +TLPEWRDK+L YK LKK LK + A   AA      A  D + +P   
Sbjct  1    MKFGKSLSGQIVETLPEWRDKFLSYKDLKKRLKLIGAGNGAAERQPKRARRDDAGEPDAS  60

Query  467  ------PPSELHDWFIRLLTEDLEKFNDFYVEQEEEFIIR  568
                   P E    F+RLL  +L+KFN F+VE+EEE+IIR
Sbjct  61   AAAAAMTPEEAD--FMRLLEAELDKFNSFFVEKEEEYIIR  98



>ref|XP_004308470.1| PREDICTED: SPX domain-containing protein 3-like [Fragaria vesca 
subsp. vesca]
Length=259

 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 34/86 (40%), Positives = 53/86 (62%), Gaps = 8/86 (9%)
 Frame = +2

Query  311  MKFGKEFKVHLEDTLPEWRDkylrykplkkllkslpAHPSAAAAGDGSFQPPPPSELHDW  490
            MKFGK  K  +++TLP WRDK+L Y  LKKL++ + + P+      G  +          
Sbjct  1    MKFGKRLKHQMQETLPSWRDKFLSYDHLKKLVRLISSAPAMLIGKSGKAKA--------Q  52

Query  491  FIRLLTEDLEKFNDFYVEQEEEFIIR  568
            F+ +L  +++KFN F++E+EE+FIIR
Sbjct  53   FLYVLNNEIDKFNAFFMEREEDFIIR  78



>ref|XP_008232577.1| PREDICTED: SPX domain-containing protein 3 [Prunus mume]
Length=263

 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 39/86 (45%), Positives = 56/86 (65%), Gaps = 5/86 (6%)
 Frame = +2

Query  311  MKFGKEFKVHLEDTLPEWRDkylrykplkkllkslpAHPSAAAAGDGSFQPPPPSELHDW  490
            MKFGK  K  ++ TLP WRDK+L YK LKK++K + +  +A    +GS +     +    
Sbjct  1    MKFGKRLKQQMQGTLPGWRDKFLSYKHLKKIVKLIAS--AAPMLLNGSLEY---GKAEAE  55

Query  491  FIRLLTEDLEKFNDFYVEQEEEFIIR  568
            F+ LL  +++KFN F+VEQEE+FIIR
Sbjct  56   FVYLLNNEIDKFNAFFVEQEEDFIIR  81



>ref|XP_011093319.1| PREDICTED: SPX domain-containing protein 3-like [Sesamum indicum]
Length=259

 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 42/86 (49%), Positives = 54/86 (63%), Gaps = 7/86 (8%)
 Frame = +2

Query  311  MKFGKEFKVHLEDTLPEWRDkylrykplkkllkslpAHPSAAAAGDGSFQPPPPSELHDW  490
            MKFGK  K  +E +LPEWRDK+L YK LKKL+K +    +AA  G         +E    
Sbjct  1    MKFGKRLKQQIEQSLPEWRDKFLSYKELKKLVKLIS---TAATLGRSMEDGVAEAE----  53

Query  491  FIRLLTEDLEKFNDFYVEQEEEFIIR  568
            FI LL  ++EKFN F++E EE+FIIR
Sbjct  54   FIYLLNHEIEKFNAFFMENEEDFIIR  79



>ref|XP_007218822.1| hypothetical protein PRUPE_ppa010111mg [Prunus persica]
 gb|EMJ20021.1| hypothetical protein PRUPE_ppa010111mg [Prunus persica]
Length=263

 Score = 52.4 bits (124),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 39/86 (45%), Positives = 56/86 (65%), Gaps = 5/86 (6%)
 Frame = +2

Query  311  MKFGKEFKVHLEDTLPEWRDkylrykplkkllkslpAHPSAAAAGDGSFQPPPPSELHDW  490
            MKFGK  K  ++ TLP WRDK+L YK LKK++K + +  +A    +GS +     +    
Sbjct  1    MKFGKRLKQQMQGTLPGWRDKFLSYKHLKKIVKLIAS--AAPMLLNGSLEY---GKAEAE  55

Query  491  FIRLLTEDLEKFNDFYVEQEEEFIIR  568
            F+ LL  +++KFN F+VEQEE+FIIR
Sbjct  56   FVYLLNNEIDKFNAFFVEQEEDFIIR  81



>ref|XP_006364936.1| PREDICTED: SPX domain-containing protein 2-like [Solanum tuberosum]
Length=266

 Score = 52.4 bits (124),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 39/89 (44%), Positives = 57/89 (64%), Gaps = 1/89 (1%)
 Frame = +2

Query  311  MKFGKEFKVHLEDTLPEWRDkylrykplkkllkslpAHPSAAAAGDGSFQPPPPSELHDW  490
            MKF K  K H+E+TLPEW+DK+L YK LKK LK +    +               E++D 
Sbjct  1    MKFWKILKSHIEETLPEWQDKFLCYKDLKKELKLIYPQDARPMKRQRLNNDEVTKEVND-  59

Query  491  FIRLLTEDLEKFNDFYVEQEEEFIIRFQV  577
            F++LL E+++KFN F+VE+EE++II  +V
Sbjct  60   FVKLLEEEIDKFNSFFVEKEEDYIIHLKV  88



>ref|XP_010053938.1| PREDICTED: SPX domain-containing protein 3 [Eucalyptus grandis]
 gb|KCW78314.1| hypothetical protein EUGRSUZ_D02493 [Eucalyptus grandis]
Length=265

 Score = 52.4 bits (124),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 38/86 (44%), Positives = 55/86 (64%), Gaps = 4/86 (5%)
 Frame = +2

Query  311  MKFGKEFKVHLEDTLPEWRDkylrykplkkllkslpAHPSAAAAGDGSFQPPPPSELHDW  490
            MKFGK  K  +++TLP W DK+L YK LKKL++ + + P+      G+      +E    
Sbjct  1    MKFGKRLKQQIQETLPGWCDKFLSYKELKKLVRLISSAPTRLGGQAGAEYGKAEAE----  56

Query  491  FIRLLTEDLEKFNDFYVEQEEEFIIR  568
            F+ LL  ++EKFN F+VE+EE+FIIR
Sbjct  57   FMYLLHGEIEKFNSFFVEKEEDFIIR  82



>ref|XP_006658812.1| PREDICTED: SPX domain-containing protein 6-like [Oryza brachyantha]
Length=126

 Score = 50.1 bits (118),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 36/86 (42%), Positives = 49/86 (57%), Gaps = 13/86 (15%)
 Frame = +2

Query  311  MKFGKEFKVHLEDTLPEWRDkylrykplkkllkslpAHPSAAAAGDGSFQPPPPSELHDW  490
            MKFGK  K  +E +LPEWRDK++ YK LK+                 S  PP P+E    
Sbjct  1    MKFGKLLKRQIEQSLPEWRDKFVSYKELKR------------IVSSISGCPPSPAE-EAM  47

Query  491  FIRLLTEDLEKFNDFYVEQEEEFIIR  568
            F+  L  D++K + F++EQEEEF+IR
Sbjct  48   FVAALDADIDKIDSFFLEQEEEFVIR  73



>ref|XP_008664986.1| PREDICTED: SPX domain-containing protein 3-like isoform X1 [Zea 
mays]
Length=235

 Score = 51.6 bits (122),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 35/86 (41%), Positives = 56/86 (65%), Gaps = 9/86 (10%)
 Frame = +2

Query  311  MKFGKEFKVHLEDTLPEWRDkylrykplkkllkslpAHPSAAAAGDGSFQPPPPSELHDW  490
            MKFGK  K  +E++LP+WRDK+L YK LK+L++ +PA   +   G  +            
Sbjct  1    MKFGKRLKKQVEESLPDWRDKFLAYKRLKRLVRLVPASSPSRRGGRAA---------DAA  51

Query  491  FIRLLTEDLEKFNDFYVEQEEEFIIR  568
            F+RLL  ++++FN F++E+EE+F+IR
Sbjct  52   FLRLLHAEVDRFNAFFLEREEDFVIR  77



>ref|XP_008665041.1| PREDICTED: hypothetical protein isoform X2 [Zea mays]
 gb|ACN29172.1| unknown [Zea mays]
 tpg|DAA52297.1| TPA: hypothetical protein ZEAMMB73_369753 [Zea mays]
Length=332

 Score = 52.4 bits (124),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 46/103 (45%), Positives = 59/103 (57%), Gaps = 14/103 (14%)
 Frame = +2

Query  311  MKFGKEFKVHLEDTLPEWRDkylrykplkkllkslpAHPSAAAAGDGSFQPPPPS-----  475
            MKFGK+F+ HLE+TLP WRDKYL YK LKKL+K+L     AAA       P         
Sbjct  1    MKFGKDFRNHLEETLPAWRDKYLAYKALKKLIKNLVPREPAAAPPLPPPAPAAADAEGPG  60

Query  476  ---------ELHDWFIRLLTEDLEKFNDFYVEQEEEFIIRFQV  577
                      L +WF  +L  +L K N+FY+E+EE ++IR QV
Sbjct  61   APAAAHGNVNLANWFASILDAELHKLNEFYIEREEWYVIRLQV  103



>gb|AIL30510.1| IDS4-like protein [Nicotiana tabacum]
Length=281

 Score = 52.0 bits (123),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 39/93 (42%), Positives = 61/93 (66%), Gaps = 4/93 (4%)
 Frame = +2

Query  311  MKFGKEFKVHLEDTLPEWRDkylrykplkkllkslpA----HPSAAAAGDGSFQPPPPSE  478
            MKF K  K H+E+TLPEW+DK+L YK LKK LK +       P+     D   +    ++
Sbjct  1    MKFWKILKAHIEETLPEWQDKFLNYKDLKKELKLIYPKDGDRPNKRQKVDDDDKGEVVTK  60

Query  479  LHDWFIRLLTEDLEKFNDFYVEQEEEFIIRFQV  577
              + F++LL E++EKFN+F++E+EE++II+ +V
Sbjct  61   EVNDFVKLLEEEIEKFNNFFMEKEEDYIIQLKV  93



>ref|XP_009605842.1| PREDICTED: SPX domain-containing protein 1-like [Nicotiana tomentosiformis]
Length=281

 Score = 52.0 bits (123),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 39/93 (42%), Positives = 61/93 (66%), Gaps = 4/93 (4%)
 Frame = +2

Query  311  MKFGKEFKVHLEDTLPEWRDkylrykplkkllkslpA----HPSAAAAGDGSFQPPPPSE  478
            MKF K  K H+E+TLPEW+DK+L YK LKK LK +       P+     D   +    ++
Sbjct  1    MKFWKILKAHIEETLPEWQDKFLNYKDLKKELKLIYPKDGDRPNKRQKVDDDDKGEVVTK  60

Query  479  LHDWFIRLLTEDLEKFNDFYVEQEEEFIIRFQV  577
              + F++LL E++EKFN+F++E+EE++II+ +V
Sbjct  61   EVNDFVKLLEEEIEKFNNFFMEKEEDYIIQLKV  93



>ref|XP_007052145.1| SPX domain gene 3 [Theobroma cacao]
 gb|EOX96302.1| SPX domain gene 3 [Theobroma cacao]
Length=266

 Score = 52.0 bits (123),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 37/86 (43%), Positives = 54/86 (63%), Gaps = 6/86 (7%)
 Frame = +2

Query  311  MKFGKEFKVHLEDTLPEWRDkylrykplkkllkslpAHPSAAAAGDGSFQPPPPSELHDW  490
            MKFGK  K  +E+TLP WRD +L YK LKKL++ + + P  +A      +     +    
Sbjct  1    MKFGKILKQQIEETLPAWRDNFLNYKELKKLVRLISSAPLLSA------ESMEYGKAEAQ  54

Query  491  FIRLLTEDLEKFNDFYVEQEEEFIIR  568
            F+ LL  +++KFN F++EQEE+FIIR
Sbjct  55   FVYLLNNEIDKFNVFFMEQEEDFIIR  80



>ref|XP_009772195.1| PREDICTED: SPX domain-containing protein 3 [Nicotiana sylvestris]
Length=261

 Score = 52.0 bits (123),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 40/86 (47%), Positives = 56/86 (65%), Gaps = 6/86 (7%)
 Frame = +2

Query  311  MKFGKEFKVHLEDTLPEWRDkylrykplkkllkslpAHPSAAAAGDGSFQPPPPSELHDW  490
            MKFGK  K  +++TLP WRDK+L YK LKKL+K +    SA+    GS +     +    
Sbjct  1    MKFGKRLKQQIQETLPGWRDKFLSYKDLKKLVKLIS---SASPMISGSLEY---GKAEAE  54

Query  491  FIRLLTEDLEKFNDFYVEQEEEFIIR  568
            F+ LL  +++KFN F++EQEE+FIIR
Sbjct  55   FVYLLNNEIDKFNAFFMEQEEDFIIR  80



>ref|NP_001136595.1| hypothetical protein [Zea mays]
 gb|ACF82238.1| unknown [Zea mays]
 tpg|DAA52296.1| TPA: hypothetical protein ZEAMMB73_369753 [Zea mays]
Length=309

 Score = 52.0 bits (123),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 46/103 (45%), Positives = 59/103 (57%), Gaps = 14/103 (14%)
 Frame = +2

Query  311  MKFGKEFKVHLEDTLPEWRDkylrykplkkllkslpAHPSAAAAGDGSFQPPPPS-----  475
            MKFGK+F+ HLE+TLP WRDKYL YK LKKL+K+L     AAA       P         
Sbjct  1    MKFGKDFRNHLEETLPAWRDKYLAYKALKKLIKNLVPREPAAAPPLPPPAPAAADAEGPG  60

Query  476  ---------ELHDWFIRLLTEDLEKFNDFYVEQEEEFIIRFQV  577
                      L +WF  +L  +L K N+FY+E+EE ++IR QV
Sbjct  61   APAAAHGNVNLANWFASILDAELHKLNEFYIEREEWYVIRLQV  103



>emb|CDY37028.1| BnaA04g26060D [Brassica napus]
Length=262

 Score = 51.6 bits (122),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 39/85 (46%), Positives = 50/85 (59%), Gaps = 19/85 (22%)
 Frame = +2

Query  311  MKFGKEFKVHLEDTLPEWRDkylrykplkkllkslpAHPSAAAAGDGSFQPPPPSELHDW  490
            MKFGK  K  ++++LPEWRDK+LRYK LK L                    P P+E    
Sbjct  1    MKFGKRIKEQIQESLPEWRDKFLRYKELKNL-----------------ISSPAPAE--SI  41

Query  491  FIRLLTEDLEKFNDFYVEQEEEFII  565
            F+ LL  ++EKFN F+VEQEE+FII
Sbjct  42   FVGLLNAEIEKFNAFFVEQEEDFII  66



>ref|XP_002301267.2| hypothetical protein POPTR_0002s14470g [Populus trichocarpa]
 gb|EEE80540.2| hypothetical protein POPTR_0002s14470g [Populus trichocarpa]
Length=260

 Score = 51.6 bits (122),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 39/86 (45%), Positives = 58/86 (67%), Gaps = 6/86 (7%)
 Frame = +2

Query  311  MKFGKEFKVHLEDTLPEWRDkylrykplkkllkslpAHPSAAAAGDGSFQPPPPSELHDW  490
            MKFGK  K  +++TLP+WRDK+L YK LKKL++ + + P      +GS +     +    
Sbjct  1    MKFGKRLKQQVQETLPDWRDKFLSYKELKKLVRLISSAPPFL---NGSSEY---GKSEAE  54

Query  491  FIRLLTEDLEKFNDFYVEQEEEFIIR  568
            F+RLL  +++KFN F++EQEE+FIIR
Sbjct  55   FVRLLDCEIDKFNAFFMEQEEDFIIR  80



>ref|XP_008459739.1| PREDICTED: SPX domain-containing protein 3 [Cucumis melo]
Length=252

 Score = 51.6 bits (122),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 36/86 (42%), Positives = 51/86 (59%), Gaps = 11/86 (13%)
 Frame = +2

Query  311  MKFGKEFKVHLEDTLPEWRDkylrykplkkllkslpAHPSAAAAGDGSFQPPPPSELHDW  490
            MKFGK  K  ++DTLP+WRDK+L YK LKKL++    +        G+            
Sbjct  1    MKFGKRLKQQVDDTLPDWRDKFLSYKDLKKLVRLTSNNVDVINNNAGA-----------D  49

Query  491  FIRLLTEDLEKFNDFYVEQEEEFIIR  568
            F+ LL  +++KFN F+VEQEE+ +IR
Sbjct  50   FVFLLNSEIDKFNSFFVEQEEDLVIR  75



>ref|XP_008230989.1| PREDICTED: SPX domain-containing protein 4 [Prunus mume]
Length=338

 Score = 52.0 bits (123),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 20/32 (63%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = +2

Query  479  LHDWFIRLLTEDLEKFNDFYVEQEEEFIIRFQ  574
            L DWF+ +L E++EK NDFYV+ EE+F+IRFQ
Sbjct  77   LQDWFVGILNEEIEKLNDFYVDTEEDFVIRFQ  108



>emb|CDX83401.1| BnaA03g21050D [Brassica napus]
Length=246

 Score = 51.2 bits (121),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 38/85 (45%), Positives = 48/85 (56%), Gaps = 19/85 (22%)
 Frame = +2

Query  311  MKFGKEFKVHLEDTLPEWRDkylrykplkkllkslpAHPSAAAAGDGSFQPPPPSELHDW  490
            MKFGK  K  ++++LPEWRDK+LRYK L                       P P+E    
Sbjct  1    MKFGKRIKEQIQESLPEWRDKFLRYKEL-----------------KNLISSPDPAEF--I  41

Query  491  FIRLLTEDLEKFNDFYVEQEEEFII  565
            FI LL  ++EKFN F+VEQEE+FII
Sbjct  42   FIGLLNSEIEKFNAFFVEQEEDFII  66



>ref|NP_001288809.1| SPX domain-containing protein 3 [Brassica rapa]
 gb|AEG42534.1| SPX domain-harboring protein 3.1 [Brassica napus]
 gb|AER70120.1| phosphorus starvation-induced protein [Brassica napus]
 gb|AER70122.1| phosphorus starvation-induced protein [Brassica rapa]
Length=246

 Score = 51.2 bits (121),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 38/85 (45%), Positives = 48/85 (56%), Gaps = 19/85 (22%)
 Frame = +2

Query  311  MKFGKEFKVHLEDTLPEWRDkylrykplkkllkslpAHPSAAAAGDGSFQPPPPSELHDW  490
            MKFGK  K  ++++LPEWRDK+LRYK L                       P P+E    
Sbjct  1    MKFGKRIKEQIQESLPEWRDKFLRYKEL-----------------KNLISSPDPAEF--I  41

Query  491  FIRLLTEDLEKFNDFYVEQEEEFII  565
            FI LL  ++EKFN F+VEQEE+FII
Sbjct  42   FIGLLNSEIEKFNAFFVEQEEDFII  66



>ref|NP_001050332.1| Os03g0406100 [Oryza sativa Japonica Group]
 sp|Q7Y0F6.1|SPX5_ORYSJ RecName: Full=SPX domain-containing protein 5; AltName: Full=Protein 
SPX DOMAIN GENE 5; Short=OsSPX5 [Oryza sativa Japonica 
Group]
 sp|A2XHU0.1|SPX5_ORYSI RecName: Full=SPX domain-containing protein 5; AltName: Full=Protein 
SPX DOMAIN GENE 5; Short=OsSPX5 [Oryza sativa Indica 
Group]
 gb|AAP50928.1| putative SPX domain containing protein [Oryza sativa Japonica 
Group]
 gb|AAU89246.1| SPX domain containing protein [Oryza sativa Japonica Group]
 gb|ABF96518.1| SPX domain-containing protein, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF12246.1| Os03g0406100 [Oryza sativa Japonica Group]
 gb|EAY90400.1| hypothetical protein OsI_11977 [Oryza sativa Indica Group]
 gb|EAZ27274.1| hypothetical protein OsJ_11210 [Oryza sativa Japonica Group]
 gb|AHL42466.1| SPX domain-containing protein 5 [Oryza sativa Japonica Group]
Length=247

 Score = 51.2 bits (121),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 36/86 (42%), Positives = 51/86 (59%), Gaps = 15/86 (17%)
 Frame = +2

Query  311  MKFGKEFKVHLEDTLPEWRDkylrykplkkllkslpAHPSAAAAGDGSFQPPPPSELHDW  490
            MKFGK  K  +E++LPEWRD +L YK LK+ L             +    P P +E    
Sbjct  1    MKFGKRLKRQIEESLPEWRDHFLNYKELKRRL-------------NAVSSPDPAAEAR--  45

Query  491  FIRLLTEDLEKFNDFYVEQEEEFIIR  568
            F+ LL  +++KFN F++EQEE+F+IR
Sbjct  46   FLALLHAEVDKFNAFFLEQEEDFVIR  71



>ref|XP_009595238.1| PREDICTED: SPX domain-containing protein 3 [Nicotiana tomentosiformis]
Length=261

 Score = 51.2 bits (121),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 39/86 (45%), Positives = 56/86 (65%), Gaps = 6/86 (7%)
 Frame = +2

Query  311  MKFGKEFKVHLEDTLPEWRDkylrykplkkllkslpAHPSAAAAGDGSFQPPPPSELHDW  490
            MKFGK  K  +++T+P WRDK+L YK LKKL+K +    SA+    GS +     +    
Sbjct  1    MKFGKRLKQQIQETIPGWRDKFLSYKDLKKLVKLIS---SASPMMSGSLEY---GKAEAE  54

Query  491  FIRLLTEDLEKFNDFYVEQEEEFIIR  568
            F+ LL  +++KFN F++EQEE+FIIR
Sbjct  55   FVYLLNNEIDKFNAFFMEQEEDFIIR  80



>ref|NP_001234034.1| IDS4-like protein [Solanum lycopersicum]
 emb|CAG29394.1| IDS4-like protein [Solanum lycopersicum]
Length=266

 Score = 51.2 bits (121),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 39/89 (44%), Positives = 56/89 (63%), Gaps = 1/89 (1%)
 Frame = +2

Query  311  MKFGKEFKVHLEDTLPEWRDkylrykplkkllkslpAHPSAAAAGDGSFQPPPPSELHDW  490
            MKF K  K H+E+TLPEW+DK+L YK LKK LK +                    E++D 
Sbjct  1    MKFWKILKSHIEETLPEWQDKFLSYKDLKKELKLIYPQDDRPIKKQRLNNDELAKEVND-  59

Query  491  FIRLLTEDLEKFNDFYVEQEEEFIIRFQV  577
            F++LL E+++KFN F+VE+EE++II  +V
Sbjct  60   FVKLLEEEIDKFNTFFVEKEEDYIIHLKV  88



>ref|XP_009349310.1| PREDICTED: SPX domain-containing protein 3-like [Pyrus x bretschneideri]
Length=262

 Score = 51.2 bits (121),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 39/86 (45%), Positives = 51/86 (59%), Gaps = 6/86 (7%)
 Frame = +2

Query  311  MKFGKEFKVHLEDTLPEWRDkylrykplkkllkslpAHPSAAAAGDGSFQPPPPSELHDW  490
            MKFGK  K  +  TLP WRDK+L YK LKKL+K + + P          Q     +    
Sbjct  1    MKFGKRLKQQMHGTLPGWRDKFLSYKDLKKLVKLISSAPMLLE------QASEYGKTEAE  54

Query  491  FIRLLTEDLEKFNDFYVEQEEEFIIR  568
            F+ LL  ++EKFN F++EQEE+FIIR
Sbjct  55   FVYLLNNEIEKFNAFFMEQEEDFIIR  80



>ref|XP_003549761.1| PREDICTED: SPX domain-containing protein 2-like [Glycine max]
Length=295

 Score = 51.6 bits (122),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 45/105 (43%), Positives = 57/105 (54%), Gaps = 18/105 (17%)
 Frame = +2

Query  311  MKFGKEFKVHLEDTLPEWRDkylrykplkkllkslpAHPSAAAAGD-----------GSF  457
            MKFGK     +E TLPEWRDK+L YK LKK LK     P+ A+A D           G+ 
Sbjct  1    MKFGKSLSSQIEKTLPEWRDKFLSYKELKKKLKQFDP-PAPASAADERPGKRLKTDAGNA  59

Query  458  QPPPPSELHDW------FIRLLTEDLEKFNDFYVEQEEEFIIRFQ  574
                 S+  D       F  LL  +L+KFN F+VE+EEE+IIR +
Sbjct  60   DADAVSDASDMSKEESDFRNLLENELDKFNTFFVEKEEEYIIRLK  104



>gb|AEG42535.1| SPX domain-harboring protein 3.2 [Brassica napus]
 gb|AER70121.1| phosphorus starvation-induced protein [Brassica napus]
 gb|AER70123.1| phosphorus starvation-induced protein [Brassica oleracea]
 emb|CDX95630.1| BnaC03g25110D [Brassica napus]
Length=239

 Score = 50.8 bits (120),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 39/85 (46%), Positives = 51/85 (60%), Gaps = 19/85 (22%)
 Frame = +2

Query  311  MKFGKEFKVHLEDTLPEWRDkylrykplkkllkslpAHPSAAAAGDGSFQPPPPSELHDW  490
            MKFGK  K  ++++LPEWRDK+LRYK LK L                    P P+E+   
Sbjct  1    MKFGKRIKEQIQESLPEWRDKFLRYKELKNL-----------------ISSPDPAEI--I  41

Query  491  FIRLLTEDLEKFNDFYVEQEEEFII  565
            FI LL  +++KFN F+VEQEE+FII
Sbjct  42   FIGLLNAEIDKFNAFFVEQEEDFII  66



>ref|XP_009375757.1| PREDICTED: SPX domain-containing protein 3-like [Pyrus x bretschneideri]
Length=262

 Score = 51.2 bits (121),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 39/86 (45%), Positives = 51/86 (59%), Gaps = 6/86 (7%)
 Frame = +2

Query  311  MKFGKEFKVHLEDTLPEWRDkylrykplkkllkslpAHPSAAAAGDGSFQPPPPSELHDW  490
            MKFGK  K  +  TLP WRDK+L YK LKKL+K + + P          Q     +    
Sbjct  1    MKFGKRLKQQMHGTLPGWRDKFLSYKDLKKLVKLISSAPMLLE------QASEYGKTEAE  54

Query  491  FIRLLTEDLEKFNDFYVEQEEEFIIR  568
            F+ LL  ++EKFN F++EQEE+FIIR
Sbjct  55   FVYLLNNEIEKFNAFFMEQEEDFIIR  80



>ref|XP_006656217.1| PREDICTED: SPX domain-containing protein 1-like [Oryza brachyantha]
Length=293

 Score = 51.6 bits (122),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 44/97 (45%), Positives = 55/97 (57%), Gaps = 13/97 (13%)
 Frame = +2

Query  311  MKFGKEFKVHLEDTLPEWRDkylrykplkkllkslpA-----HPSAAAAGD------GSF  457
            MKFGK     + +TLPEWRDK+L YK LKK LK +          A   GD       +F
Sbjct  1    MKFGKSLSSQIVETLPEWRDKFLSYKDLKKRLKLIGGGEERQAKRARVGGDEEAAAAAAF  60

Query  458  QPPPPSELHDWFIRLLTEDLEKFNDFYVEQEEEFIIR  568
                P E    F+RLL  +L+KFN F+VE+EEE+IIR
Sbjct  61   PAMTPEEAD--FVRLLEAELDKFNSFFVEKEEEYIIR  95



>ref|XP_009142318.1| PREDICTED: SPX domain-containing protein 3 [Brassica rapa]
Length=247

 Score = 50.8 bits (120),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 37/85 (44%), Positives = 48/85 (56%), Gaps = 19/85 (22%)
 Frame = +2

Query  311  MKFGKEFKVHLEDTLPEWRDkylrykplkkllkslpAHPSAAAAGDGSFQPPPPSELHDW  490
            MKFGK  K  ++++LPEWRDK+LRYK L                       P P+E    
Sbjct  1    MKFGKRIKEQIQESLPEWRDKFLRYKEL-----------------KNLISSPAPAE--SI  41

Query  491  FIRLLTEDLEKFNDFYVEQEEEFII  565
            F+ LL  ++EKFN F+VEQEE+FII
Sbjct  42   FVGLLNAEIEKFNAFFVEQEEDFII  66



>emb|CDY27393.1| BnaC04g50120D [Brassica napus]
Length=247

 Score = 50.8 bits (120),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 37/85 (44%), Positives = 48/85 (56%), Gaps = 19/85 (22%)
 Frame = +2

Query  311  MKFGKEFKVHLEDTLPEWRDkylrykplkkllkslpAHPSAAAAGDGSFQPPPPSELHDW  490
            MKFGK  K  ++++LPEWRDK+LRYK L                       P P+E    
Sbjct  1    MKFGKRIKEQIQESLPEWRDKFLRYKEL-----------------KNLISSPAPAE--SI  41

Query  491  FIRLLTEDLEKFNDFYVEQEEEFII  565
            F+ LL  ++EKFN F+VEQEE+FII
Sbjct  42   FVGLLNAEIEKFNAFFVEQEEDFII  66



>ref|XP_010506449.1| PREDICTED: SPX domain-containing protein 3 [Camelina sativa]
Length=244

 Score = 50.8 bits (120),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 38/85 (45%), Positives = 50/85 (59%), Gaps = 19/85 (22%)
 Frame = +2

Query  311  MKFGKEFKVHLEDTLPEWRDkylrykplkkllkslpAHPSAAAAGDGSFQPPPPSELHDW  490
            MKFGK  K  ++++LPEWRDK+LRYK LK L                    P P+E    
Sbjct  1    MKFGKRIKEQIQESLPEWRDKFLRYKELKNL-----------------ISSPAPAE--SI  41

Query  491  FIRLLTEDLEKFNDFYVEQEEEFII  565
            F+ LL  +++KFN F+VEQEE+FII
Sbjct  42   FVGLLNAEIDKFNAFFVEQEEDFII  66



>ref|XP_010518125.1| PREDICTED: SPX domain-containing protein 3-like [Camelina sativa]
Length=244

 Score = 50.8 bits (120),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 38/85 (45%), Positives = 50/85 (59%), Gaps = 19/85 (22%)
 Frame = +2

Query  311  MKFGKEFKVHLEDTLPEWRDkylrykplkkllkslpAHPSAAAAGDGSFQPPPPSELHDW  490
            MKFGK  K  ++++LPEWRDK+LRYK LK L                    P P+E    
Sbjct  1    MKFGKRIKEQIQESLPEWRDKFLRYKELKNL-----------------ISSPAPAE--SI  41

Query  491  FIRLLTEDLEKFNDFYVEQEEEFII  565
            F+ LL  +++KFN F+VEQEE+FII
Sbjct  42   FVGLLNAEIDKFNAFFVEQEEDFII  66



>ref|XP_003542678.1| PREDICTED: SPX domain-containing protein 2-like [Glycine max]
Length=284

 Score = 51.2 bits (121),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 40/94 (43%), Positives = 50/94 (53%), Gaps = 6/94 (6%)
 Frame = +2

Query  311  MKFGKEFKVHLEDTLPEWRDkylrykplkkll------kslpAHPSAAAAGDGSFQPPPP  472
            MKFGK     +E TLPEWRDK+L YK LKK L       +    P      D        
Sbjct  1    MKFGKSLSSQIEKTLPEWRDKFLSYKELKKKLKQFDPPAAADERPGKRLKSDAVPDAADM  60

Query  473  SELHDWFIRLLTEDLEKFNDFYVEQEEEFIIRFQ  574
            S+    F  LL  +L+KFN F+VE+EEE+IIR +
Sbjct  61   SKEESDFRNLLENELDKFNTFFVEKEEEYIIRLK  94



>ref|XP_006294897.1| hypothetical protein CARUB_v10023947mg [Capsella rubella]
 gb|EOA27795.1| hypothetical protein CARUB_v10023947mg [Capsella rubella]
Length=241

 Score = 50.8 bits (120),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 37/85 (44%), Positives = 50/85 (59%), Gaps = 19/85 (22%)
 Frame = +2

Query  311  MKFGKEFKVHLEDTLPEWRDkylrykplkkllkslpAHPSAAAAGDGSFQPPPPSELHDW  490
            MKFGK  K  ++++LPEWRDK+LRYK LK L+                     P+ L   
Sbjct  1    MKFGKRIKEQIQESLPEWRDKFLRYKELKNLI-------------------SSPAPLESI  41

Query  491  FIRLLTEDLEKFNDFYVEQEEEFII  565
            F+ LL  +++KFN F+VEQEE+FII
Sbjct  42   FLALLNAEIDKFNAFFVEQEEDFII  66



>ref|XP_004968896.1| PREDICTED: SPX domain-containing protein 6-like [Setaria italica]
Length=253

 Score = 50.8 bits (120),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 40/85 (47%), Positives = 50/85 (59%), Gaps = 12/85 (14%)
 Frame = +2

Query  311  MKFGKEFKVHLEDTLPEWRDkylrykplkkllkslpAHPSAAAAGDGSFQPPPPSELHDW  490
            MKFGK  K  +E +LPEWRD++LRYK LK+            A   G   PP P E  + 
Sbjct  1    MKFGKWLKRQIEQSLPEWRDQFLRYKELKR---------CVNAVSGGC--PPSPVEEAE-  48

Query  491  FIRLLTEDLEKFNDFYVEQEEEFII  565
            FI  L  ++EK N F++EQEEEFII
Sbjct  49   FIATLDAEMEKINAFFLEQEEEFII  73



>ref|XP_006347900.1| PREDICTED: SPX domain-containing protein 3-like [Solanum tuberosum]
Length=262

 Score = 50.8 bits (120),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 36/86 (42%), Positives = 54/86 (63%), Gaps = 5/86 (6%)
 Frame = +2

Query  311  MKFGKEFKVHLEDTLPEWRDkylrykplkkllkslpAHPSAAAAGDGSFQPPPPSELHDW  490
            MKFGK  K  +++TLP W DK+L YK LKKL+K + ++     +G   +      +    
Sbjct  1    MKFGKRLKQQIQETLPGWGDKFLSYKELKKLVKLISSYAPQMMSGSLEY-----GKAEAE  55

Query  491  FIRLLTEDLEKFNDFYVEQEEEFIIR  568
            F+ LL  +++KFN F++EQEE+FIIR
Sbjct  56   FVYLLNNEIDKFNAFFMEQEEDFIIR  81



>ref|XP_004229786.1| PREDICTED: SPX domain-containing protein 3 [Solanum lycopersicum]
Length=262

 Score = 50.8 bits (120),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 36/86 (42%), Positives = 54/86 (63%), Gaps = 5/86 (6%)
 Frame = +2

Query  311  MKFGKEFKVHLEDTLPEWRDkylrykplkkllkslpAHPSAAAAGDGSFQPPPPSELHDW  490
            MKFGK  K  +++TLP W DK+L YK LKKL+K + ++     +G   +      +    
Sbjct  1    MKFGKRLKQQIQETLPGWGDKFLSYKELKKLVKLISSYAPQMMSGSLEY-----GKAEAE  55

Query  491  FIRLLTEDLEKFNDFYVEQEEEFIIR  568
            F+ LL  +++KFN F++EQEE+FIIR
Sbjct  56   FVYLLNNEIDKFNAFFMEQEEDFIIR  81



>ref|XP_010508209.1| PREDICTED: SPX domain-containing protein 3-like [Camelina sativa]
Length=245

 Score = 50.4 bits (119),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 38/85 (45%), Positives = 51/85 (60%), Gaps = 18/85 (21%)
 Frame = +2

Query  311  MKFGKEFKVHLEDTLPEWRDkylrykplkkllkslpAHPSAAAAGDGSFQPPPPSELHDW  490
            MKFGK  K  ++++LPEWRDK+LRYK LK L+                   P P+E    
Sbjct  1    MKFGKRIKEQIQESLPEWRDKFLRYKELKNLIS----------------SAPAPAE--SI  42

Query  491  FIRLLTEDLEKFNDFYVEQEEEFII  565
            F+ LL  +++KFN F+VEQEE+FII
Sbjct  43   FVGLLNAEIDKFNAFFVEQEEDFII  67



>ref|XP_003588761.1| Vacuolar transporter chaperone [Medicago truncatula]
Length=155

 Score = 48.9 bits (115),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 39/95 (41%), Positives = 57/95 (60%), Gaps = 8/95 (8%)
 Frame = +2

Query  311  MKFGKEFKVHLEDTLPEWRDkylrykplkkllkslpAHPSAAAAG-------DGSFQPPP  469
            MKF K     +E TLP+WRDK+L YK LKK LK +      ++         DG  +   
Sbjct  1    MKFWKILNNQIEQTLPDWRDKFLSYKDLKKQLKLIVPKEIDSSCSKRRRLDDDGGAEGEV  60

Query  470  PSELHDWFIRLLTEDLEKFNDFYVEQEEEFIIRFQ  574
              E+ D F+RLL  ++EKFN F+VE+EEE++I+++
Sbjct  61   TKEVKD-FLRLLEVEIEKFNGFFVEKEEEYVIKWK  94



>ref|XP_007155005.1| hypothetical protein PHAVU_003G164900g [Phaseolus vulgaris]
 gb|ESW26999.1| hypothetical protein PHAVU_003G164900g [Phaseolus vulgaris]
Length=286

 Score = 50.8 bits (120),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 44/96 (46%), Positives = 54/96 (56%), Gaps = 9/96 (9%)
 Frame = +2

Query  311  MKFGKEFKVHLEDTLPEWRDkylrykplkkllkslpAHPSAAAAGDGSFQPPPP------  472
            MKFGK     +E TLPEWRDK+L YK LKK LK     P+AA    G    P        
Sbjct  1    MKFGKSLSSQIEKTLPEWRDKFLSYKELKKKLKQFDP-PAAADYRPGKRLKPDAAAATAT  59

Query  473  --SELHDWFIRLLTEDLEKFNDFYVEQEEEFIIRFQ  574
              S+    F  LL  +L+KFN F+VE+EEE+IIR +
Sbjct  60   DMSKEETDFRNLLENELDKFNTFFVEKEEEYIIRLK  95



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2936596470519