BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c6254_g3_i1 len=583 path=[919:0-582]

Length=583
                                                                      Score     E

gb|EYU30298.1|  hypothetical protein MIMGU_mgv1a017316mg                102   2e-24   
ref|XP_009795761.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  92.8    3e-20   
ref|XP_009795760.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  93.2    4e-20   
ref|XP_009796139.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  92.0    9e-20   
dbj|BAA05471.1|  tumor-related protein                                90.1    9e-20   Nicotiana glauca x Nicotiana langsdorffii
ref|XP_009782706.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  91.7    1e-19   
ref|XP_009796138.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  90.9    2e-19   
ref|XP_009783445.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  90.5    3e-19   
ref|XP_009619251.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  90.5    4e-19   
ref|XP_009619252.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  90.5    4e-19   
ref|XP_009600481.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  90.1    6e-19   
dbj|BAA13150.1|  NT16 polypeptide                                     90.1    6e-19   Nicotiana tabacum [American tobacco]
ref|XP_009617786.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  88.6    1e-18   
ref|XP_009795762.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  87.4    4e-18   
sp|P14009.1|14KD_DAUCA  RecName: Full=14 kDa proline-rich protein...  86.7    6e-18   Daucus carota [carrots]
dbj|BAA13155.1|  glycine-rich polypeptide                             85.5    7e-18   Nicotiana tabacum [American tobacco]
ref|XP_007210550.1|  hypothetical protein PRUPE_ppa014094mg           83.2    3e-17   
ref|XP_010258985.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  84.3    5e-17   
ref|XP_010264242.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  84.0    6e-17   
emb|CDP05328.1|  unnamed protein product                              83.2    9e-17   
ref|XP_011070108.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  83.2    1e-16   
gb|ABG91752.1|  HyPRP2                                                83.2    1e-16   Gossypium hirsutum [American cotton]
ref|XP_008362163.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  83.2    1e-16   
ref|XP_006477234.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  82.4    2e-16   
ref|XP_004299470.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  82.8    2e-16   
gb|EYU31726.1|  hypothetical protein MIMGU_mgv1a019851mg              81.6    2e-16   
ref|XP_011076346.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  82.8    2e-16   
ref|XP_006440349.1|  hypothetical protein CICLE_v10022832mg           82.0    2e-16   
ref|XP_004299469.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  82.4    3e-16   
ref|XP_011001498.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  81.6    4e-16   
gb|AAD01800.1|  HyPRP                                                 82.0    5e-16   Fragaria x ananassa
ref|XP_004986077.1|  PREDICTED: putative glycine-rich cell wall s...  82.4    7e-16   
ref|XP_009333597.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  81.3    7e-16   
ref|XP_002533299.1|  14 kDa proline-rich protein DC2.15 precursor...  80.9    7e-16   Ricinus communis
ref|XP_004299468.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  81.6    8e-16   
dbj|BAF46299.1|  extensin like protein                                80.9    8e-16   Ipomoea nil [qian niu]
ref|XP_010053451.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  80.9    8e-16   
emb|CBI31906.3|  unnamed protein product                              80.1    8e-16   
ref|XP_006440347.1|  hypothetical protein CICLE_v10022825mg           80.5    1e-15   
ref|XP_011081228.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  80.5    1e-15   
ref|XP_009333675.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  80.9    1e-15   
gb|KCW77749.1|  hypothetical protein EUGRSUZ_D02043                   80.9    1e-15   
ref|XP_004251936.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  80.1    1e-15   
gb|KDO61485.1|  hypothetical protein CISIN_1g047179mg                 80.1    1e-15   
ref|XP_006440346.1|  hypothetical protein CICLE_v10022839mg           80.1    1e-15   
gb|AAC02087.1|  hairy root 4                                          81.6    1e-15   Nicotiana tabacum [American tobacco]
ref|XP_007218576.1|  hypothetical protein PRUPE_ppa013120mg           80.5    1e-15   
ref|XP_010055513.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  80.1    1e-15   
ref|XP_006477231.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  80.1    1e-15   
ref|XP_010906608.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  80.1    1e-15   
ref|XP_006369032.1|  HyPRP family protein                             80.1    1e-15   
gb|EYU18564.1|  hypothetical protein MIMGU_mgv1a016162mg              80.1    1e-15   
emb|CDP09932.1|  unnamed protein product                              80.5    1e-15   
ref|XP_009611018.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  80.1    1e-15   
emb|CAA59472.1|  hybrid proline-rich protein                          80.1    2e-15   Catharanthus roseus [chatas]
ref|XP_007039886.1|  14 kDa proline-rich protein DC2.15, putative     80.1    2e-15   
ref|XP_009798259.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  80.1    2e-15   
emb|CAA81526.1|  14 kDa polypeptide                                   80.1    2e-15   Catharanthus roseus [chatas]
gb|KCW71996.1|  hypothetical protein EUGRSUZ_E00449                   78.6    2e-15   
ref|XP_010676152.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  80.1    2e-15   
ref|XP_008392581.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  79.7    2e-15   
emb|CDP18670.1|  unnamed protein product                              79.7    2e-15   
gb|EYU24741.1|  hypothetical protein MIMGU_mgv1a016172mg              79.3    2e-15   
gb|ABF93505.1|  retrotransposon protein, putative, Ty1-copia subc...  80.5    2e-15   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002271461.1|  PREDICTED: 14 kDa proline-rich protein DC2.15    79.3    2e-15   Vitis vinifera
ref|NP_001048668.1|  Os03g0103300                                     80.5    3e-15   Oryza sativa Japonica Group [Japonica rice]
gb|EAY88189.1|  hypothetical protein OsI_09636                        80.1    3e-15   Oryza sativa Indica Group [Indian rice]
ref|XP_009375766.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  79.3    3e-15   
dbj|BAG50511.1|  qLTG-3-1                                             80.1    3e-15   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008232588.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  79.3    3e-15   
tpg|DAA37198.1|  TPA: hypothetical protein ZEAMMB73_187029            79.3    3e-15   
ref|XP_007052129.1|  Bifunctional inhibitor/lipid-transfer protei...  79.3    3e-15   
dbj|BAJ08379.1|  qLTG3-1                                              80.1    3e-15   
ref|XP_010053452.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  79.0    3e-15   
ref|XP_008669243.1|  PREDICTED: uncharacterized protein LOC103646289  80.5    3e-15   
dbj|BAJ08384.1|  qLTG3-1                                              80.1    3e-15   
dbj|BAJ08383.1|  qLTG3-1                                              80.1    3e-15   
dbj|BAJ08381.1|  qLTG3-1                                              80.1    3e-15   
dbj|BAJ08382.1|  qLTG3-1                                              80.1    4e-15   
dbj|BAJ08386.1|  qLTG3-1                                              80.1    4e-15   
dbj|BAJ08385.1|  qLTG3-1                                              80.1    4e-15   
dbj|BAA99575.1|  DC2.15 like protein                                  78.6    4e-15   Daucus carota [carrots]
ref|XP_007039887.1|  Bifunctional inhibitor/lipid-transfer protei...  78.6    5e-15   
gb|KHG02760.1|  14 kDa proline-rich DC2                               78.2    6e-15   
gb|ABP35529.1|  proline-rich protein                                  78.2    7e-15   Ipomoea batatas [batate]
ref|XP_010093705.1|  hypothetical protein L484_019046                 77.8    7e-15   
ref|XP_011018291.1|  PREDICTED: 14 kDa proline-rich protein DC2.15    78.2    7e-15   
ref|XP_010053929.1|  PREDICTED: 14 kDa proline-rich protein DC2.15    78.2    7e-15   
ref|XP_008344389.1|  PREDICTED: lipid transfer protein EARLI 1-like   78.2    7e-15   
ref|XP_011081229.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  78.2    7e-15   
ref|XP_006417265.1|  hypothetical protein EUTSA_v10009083mg           78.2    8e-15   
ref|XP_011018292.1|  PREDICTED: 14 kDa proline-rich protein DC2.15    78.2    8e-15   
ref|XP_006289141.1|  hypothetical protein CARUB_v10002564mg           78.2    8e-15   
ref|XP_006289733.1|  hypothetical protein CARUB_v10003301mg           78.2    8e-15   
ref|XP_007209745.1|  hypothetical protein PRUPE_ppa013010mg           78.2    8e-15   
ref|XP_010088890.1|  hypothetical protein L484_020878                 77.8    8e-15   
gb|KDP25644.1|  hypothetical protein JCGZ_20800                       77.8    8e-15   
ref|XP_008338137.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  77.8    9e-15   
ref|XP_011070106.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  77.8    9e-15   
ref|XP_003559027.1|  PREDICTED: putative glycine-rich cell wall s...  79.0    9e-15   
gb|EYU30296.1|  hypothetical protein MIMGU_mgv1a015783mg              78.2    1e-14   
ref|XP_010055514.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  77.8    1e-14   
emb|CDY31241.1|  BnaC08g15360D                                        77.8    1e-14   
emb|CDY21034.1|  BnaA08g24910D                                        77.8    1e-14   
ref|XP_011081227.1|  PREDICTED: pEARLI1-like lipid transfer prote...  77.8    1e-14   
ref|XP_010264241.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  77.8    1e-14   
ref|XP_009110670.1|  PREDICTED: 14 kDa proline-rich protein DC2.15    77.8    1e-14   
ref|XP_009589966.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  77.4    1e-14   
ref|XP_006367623.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  77.4    1e-14   
dbj|BAA11854.1|  extensin like protein                                77.8    1e-14   Populus nigra [black poplar]
tpg|DAA42812.1|  TPA: hypothetical protein ZEAMMB73_664289            78.6    1e-14   
ref|XP_002533292.1|  14 kDa proline-rich protein DC2.15 precursor...  77.4    1e-14   Ricinus communis
ref|XP_006366172.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  77.0    1e-14   
ref|XP_010919520.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  77.4    2e-14   
ref|XP_002271593.1|  PREDICTED: 14 kDa proline-rich protein DC2.15    77.0    2e-14   Vitis vinifera
ref|XP_009388030.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  77.4    2e-14   
ref|XP_009795308.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  77.0    2e-14   
ref|XP_006304906.1|  hypothetical protein CARUB_v10011959mg           77.0    2e-14   
ref|XP_008437101.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  77.0    2e-14   
gb|KGN50238.1|  hypothetical protein Csa_5G161870                     77.0    2e-14   
ref|XP_010422223.1|  PREDICTED: lipid transfer protein EARLI 1-li...  77.0    2e-14   
ref|XP_008238564.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  77.4    2e-14   
ref|XP_004152413.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  77.0    2e-14   
ref|XP_010433379.1|  PREDICTED: lipid transfer protein EARLI 1-like   77.0    2e-14   
ref|XP_004165754.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  77.0    2e-14   
ref|XP_010422222.1|  PREDICTED: lipid transfer protein EARLI 1-li...  77.0    2e-14   
ref|XP_010455699.1|  PREDICTED: lipid transfer protein EARLI 1-like   77.0    2e-14   
ref|XP_010455698.1|  PREDICTED: lipid transfer protein EARLI 1-like   77.0    2e-14   
ref|XP_009333630.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  77.0    2e-14   
ref|XP_010422224.1|  PREDICTED: lipid transfer protein EARLI 1-like   77.0    2e-14   
ref|XP_006355479.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  76.6    2e-14   
ref|XP_010093706.1|  hypothetical protein L484_019047                 76.6    2e-14   
dbj|BAK05563.1|  predicted protein                                    77.8    2e-14   
ref|XP_004171279.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  76.6    2e-14   
ref|XP_010493734.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  76.6    2e-14   
gb|AEX33654.1|  lipid transfer protein                                76.6    3e-14   
ref|XP_010264240.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  76.6    3e-14   
ref|XP_002270769.1|  PREDICTED: 14 kDa proline-rich protein DC2.15    76.6    3e-14   Vitis vinifera
ref|XP_009382414.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  76.6    3e-14   
ref|XP_004152415.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  76.6    3e-14   
ref|XP_004152410.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  76.6    3e-14   
ref|XP_009338026.1|  PREDICTED: vegetative cell wall protein gp1-...  79.0    3e-14   
ref|XP_009388037.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  76.3    3e-14   
ref|XP_010493743.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  76.3    3e-14   
ref|XP_008437105.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  76.3    3e-14   
ref|XP_009591583.1|  PREDICTED: pEARLI1-like lipid transfer prote...  76.3    3e-14   
gb|ABQ88334.1|  lipid transfer protein                                76.6    3e-14   Capsicum annuum
gb|KDP25645.1|  hypothetical protein JCGZ_20801                       76.3    3e-14   
ref|XP_008796820.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  75.9    3e-14   
ref|XP_006355478.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  76.3    4e-14   
ref|XP_002529775.1|  14 kDa proline-rich protein DC2.15 precursor...  76.3    4e-14   Ricinus communis
ref|XP_010476166.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  76.3    4e-14   
emb|CAI51313.1|  arachidonic acid-induced DEA1                        76.3    4e-14   Capsicum chinense [bonnet pepper]
ref|XP_002511665.1|  14 kDa proline-rich protein DC2.15 precursor...  76.3    4e-14   Ricinus communis
ref|XP_010553464.1|  PREDICTED: 14 kDa proline-rich protein DC2.15    75.9    5e-14   
ref|XP_006368194.1|  HyPRP family protein                             75.9    5e-14   
ref|XP_010906607.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  75.9    5e-14   
ref|NP_001235008.1|  uncharacterized protein LOC100499716 precursor   76.6    5e-14   
ref|XP_006368193.1|  hypothetical protein POPTR_0001s00400g           75.5    5e-14   
ref|XP_009783170.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  75.5    5e-14   
ref|XP_009411010.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  75.9    6e-14   
ref|XP_010041843.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  75.1    6e-14   
ref|XP_009601879.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  75.5    7e-14   
ref|XP_011033953.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  75.5    7e-14   
ref|NP_001148300.1|  cortical cell-delineating protein precursor      75.1    7e-14   Zea mays [maize]
ref|XP_002874779.1|  hypothetical protein ARALYDRAFT_911652           75.5    7e-14   
gb|KFK31985.1|  hypothetical protein AALP_AA6G185200                  75.5    7e-14   
ref|XP_008437103.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  75.5    7e-14   
ref|XP_010258987.1|  PREDICTED: 14 kDa proline-rich protein DC2.15    75.5    7e-14   
ref|NP_176440.1|  bifunctional inhibitor/lipid-transfer protein/s...  75.5    8e-14   Arabidopsis thaliana [mouse-ear cress]
gb|ACV74341.1|  proline-rich protein                                  75.1    8e-14   Jatropha curcas
ref|XP_010433369.1|  PREDICTED: lipid transfer protein EARLI 1-like   75.1    8e-14   
ref|XP_002454521.1|  hypothetical protein SORBIDRAFT_04g032620        75.1    8e-14   Sorghum bicolor [broomcorn]
ref|XP_008786990.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  75.1    8e-14   
ref|XP_004152411.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  75.1    9e-14   
gb|AIX10944.1|  PRP2-like protein                                     75.5    9e-14   
ref|XP_004245750.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  75.1    9e-14   
ref|XP_009113072.1|  PREDICTED: lipid transfer protein EARLI 1        75.5    9e-14   
gb|KGN50240.1|  hypothetical protein Csa_5G161890                     75.1    9e-14   
ref|XP_010053450.1|  PREDICTED: 14 kDa proline-rich protein DC2.15    74.7    9e-14   
gb|AAC60566.1|  proline-rich SAC51                                    75.1    1e-13   Brassica napus [oilseed rape]
ref|XP_008808739.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  74.7    1e-13   
ref|XP_002867769.1|  hypothetical protein ARALYDRAFT_914370           75.1    1e-13   
ref|XP_004152412.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  75.1    1e-13   
ref|XP_008437102.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  75.1    1e-13   
ref|XP_004165755.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  75.1    1e-13   
ref|XP_010458632.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  75.1    1e-13   
ref|XP_010493725.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  75.1    1e-13   
ref|XP_003572782.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  74.3    1e-13   
gb|EMS62564.1|  14 kDa proline-rich protein DC2.15                    74.3    1e-13   
gb|EPS73889.1|  hypothetical protein M569_00868                       74.7    1e-13   
ref|XP_002271619.1|  PREDICTED: 14 kDa proline-rich protein DC2.15    74.7    1e-13   Vitis vinifera
ref|XP_009782252.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  74.7    1e-13   
ref|XP_008786992.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  74.7    1e-13   
ref|XP_010493717.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  74.7    1e-13   
ref|XP_009110671.1|  PREDICTED: 14 kDa proline-rich protein DC2.15    74.7    1e-13   
ref|XP_006286053.1|  hypothetical protein CARUB_v10007585mg           74.7    1e-13   
ref|XP_004976454.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  74.3    1e-13   
ref|XP_008437107.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  74.7    1e-13   
ref|XP_006355477.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  74.7    1e-13   
gb|EYU30303.1|  hypothetical protein MIMGU_mgv1a016181mg              74.3    2e-13   
ref|NP_001233824.1|  arachidonic acid-induced DEA1 precursor          74.3    2e-13   
ref|XP_002533291.1|  lipid binding protein, putative                  73.9    2e-13   Ricinus communis
ref|XP_009397884.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  74.3    2e-13   
emb|CDY31240.1|  BnaC08g15350D                                        74.3    2e-13   
ref|XP_006417266.1|  hypothetical protein EUTSA_v10009061mg           74.3    2e-13   
ref|XP_004516838.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  74.7    2e-13   
ref|XP_008437111.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  74.3    2e-13   
ref|XP_006306558.1|  hypothetical protein CARUB_v10012658mg           74.3    2e-13   
ref|XP_007155640.1|  hypothetical protein PHAVU_003G218800g           75.5    2e-13   
ref|XP_007155639.1|  hypothetical protein PHAVU_003G218800g           75.5    2e-13   
gb|EYU30301.1|  hypothetical protein MIMGU_mgv1a018370mg              73.6    2e-13   
gb|KFK25909.1|  hypothetical protein AALP_AA8G178400                  74.3    2e-13   
ref|XP_006396750.1|  hypothetical protein EUTSA_v10029060mg           73.9    2e-13   
ref|XP_002533294.1|  14 kDa proline-rich protein DC2.15 precursor...  73.9    2e-13   Ricinus communis
ref|XP_002874778.1|  hypothetical protein ARALYDRAFT_911651           73.9    2e-13   
ref|XP_011081223.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  73.9    2e-13   
ref|XP_008786988.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  73.9    2e-13   
emb|CAI48077.1|  extensin-like protein                                73.9    2e-13   Capsicum chinense [bonnet pepper]
ref|NP_567391.1|  bifunctional inhibitor/lipid-transfer protein/s...  73.6    3e-13   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010695115.1|  PREDICTED: putative lipid-binding protein AIR1B  73.2    3e-13   
ref|XP_006445312.1|  hypothetical protein CICLE_v10022835mg           73.6    3e-13   
ref|XP_011081224.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  73.6    3e-13   
ref|XP_003549907.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  73.6    3e-13   
ref|XP_006647641.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  73.6    3e-13   
ref|XP_010676150.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  73.9    3e-13   
ref|XP_010676148.1|  PREDICTED: pEARLI1-like lipid transfer prote...  73.9    3e-13   
ref|XP_009798258.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  73.6    3e-13   
ref|XP_004165505.1|  PREDICTED: LOW QUALITY PROTEIN: 14 kDa proli...  73.6    3e-13   
ref|XP_010448889.1|  PREDICTED: putative lipid-binding protein AIR1   73.6    3e-13   
ref|XP_006302912.1|  hypothetical protein CARUB_v10021046mg           73.9    3e-13   
emb|CDP09930.1|  unnamed protein product                              73.2    4e-13   
ref|XP_002533293.1|  14 kDa proline-rich protein DC2.15 precursor...  73.6    4e-13   Ricinus communis
ref|XP_010919519.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  73.6    4e-13   
ref|XP_003608743.1|  14 kDa proline-rich protein DC2.15               73.6    4e-13   
ref|XP_010430305.1|  PREDICTED: lipid transfer protein EARLI 1        73.6    4e-13   
gb|KHN04353.1|  14 kDa proline-rich protein DC2.15                    73.2    4e-13   
emb|CAL07983.1|  arachidonic acid-induced DEA1-like protein           71.6    4e-13   Platanus x hispanica [London plane tree]
ref|XP_009134275.1|  PREDICTED: lipid transfer protein EARLI 1-like   73.2    4e-13   
ref|XP_002464967.1|  hypothetical protein SORBIDRAFT_01g029610        73.2    4e-13   Sorghum bicolor [broomcorn]
ref|XP_007155641.1|  hypothetical protein PHAVU_003G218900g           73.2    4e-13   
ref|XP_003546415.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  73.2    4e-13   
ref|XP_006391856.1|  hypothetical protein EUTSA_v10023747mg           73.6    4e-13   
ref|XP_002454523.1|  hypothetical protein SORBIDRAFT_04g032640        72.8    4e-13   Sorghum bicolor [broomcorn]
ref|NP_001047650.1|  Os02g0662000                                     73.2    5e-13   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009373377.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  73.2    5e-13   
ref|XP_002454525.1|  hypothetical protein SORBIDRAFT_04g032660        72.8    5e-13   Sorghum bicolor [broomcorn]
ref|XP_002454524.1|  hypothetical protein SORBIDRAFT_04g032650        72.8    5e-13   Sorghum bicolor [broomcorn]
ref|XP_007155638.1|  hypothetical protein PHAVU_003G218700g           73.6    5e-13   
ref|XP_009148613.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  73.2    5e-13   
ref|XP_010933689.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  72.8    5e-13   
gb|EAY95110.1|  hypothetical protein OsI_16927                        72.8    5e-13   Oryza sativa Indica Group [Indian rice]
gb|KDP25650.1|  hypothetical protein JCGZ_20806                       72.8    5e-13   
ref|XP_010473467.1|  PREDICTED: lipid transfer protein EARLI 1-like   73.2    5e-13   
ref|XP_010418243.1|  PREDICTED: lipid transfer protein EARLI 1-like   73.2    5e-13   
ref|XP_004245748.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  72.8    6e-13   
ref|NP_001053511.1|  Os04g0554500                                     72.8    6e-13   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010676151.1|  PREDICTED: putative lipid-binding protein AIR1B  72.8    6e-13   
ref|XP_007209690.1|  hypothetical protein PRUPE_ppa012402mg           73.2    6e-13   
ref|XP_008238562.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  72.8    7e-13   
ref|XP_008232586.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  72.8    7e-13   
emb|CDY21275.1|  BnaC03g29590D                                        72.4    7e-13   
ref|XP_009598876.1|  PREDICTED: lipid transfer protein EARLI 1-like   71.6    7e-13   
ref|XP_008448870.1|  PREDICTED: lipid transfer protein EARLI 1-like   73.6    7e-13   
ref|XP_010258988.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  72.4    7e-13   
ref|XP_009376589.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  72.4    7e-13   
gb|AAM47507.1|  extensin-like protein                                 72.8    8e-13   Citrus junos [kuzu]
ref|XP_004306948.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  72.4    8e-13   
ref|XP_006286641.1|  hypothetical protein CARUB_v10002511mg           72.0    8e-13   
ref|XP_008381149.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  72.4    8e-13   
gb|EMT15431.1|  14 kDa proline-rich protein                           72.0    8e-13   
ref|XP_010539640.1|  PREDICTED: lipid transfer protein EARLI 1-like   72.4    8e-13   
ref|XP_010553463.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  72.4    8e-13   
ref|XP_004291444.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  72.4    9e-13   
ref|XP_004976456.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  72.4    9e-13   
emb|CDP09931.1|  unnamed protein product                              72.0    9e-13   
ref|XP_009123402.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  72.4    9e-13   
emb|CDY32208.1|  BnaA03g54590D                                        72.4    9e-13   
ref|XP_004298650.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  72.4    9e-13   
ref|NP_001047651.1|  Os02g0662100                                     72.0    9e-13   
ref|XP_008232632.1|  PREDICTED: lipid transfer protein EARLI 1-like   72.8    1e-12   
ref|XP_002446915.1|  hypothetical protein SORBIDRAFT_06g024790        72.0    1e-12   
gb|KHN04347.1|  14 kDa proline-rich protein DC2.15                    72.0    1e-12   
emb|CDY08680.1|  BnaC04g19890D                                        72.0    1e-12   
ref|XP_004955126.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  73.6    1e-12   
ref|XP_002446914.1|  hypothetical protein SORBIDRAFT_06g024780        72.0    1e-12   
ref|XP_010933688.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  72.0    1e-12   
ref|XP_009333632.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  72.0    1e-12   
ref|XP_004976453.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  72.0    1e-12   
ref|XP_008448867.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  72.0    1e-12   
ref|XP_004235416.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  71.2    1e-12   
ref|XP_003525814.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  72.0    1e-12   
gb|AFK41425.1|  unknown                                               72.0    1e-12   
ref|XP_007052128.1|  Bifunctional inhibitor/lipid-transfer protei...  72.0    1e-12   
gb|KHN04345.1|  14 kDa proline-rich protein DC2.15                    72.4    1e-12   
ref|NP_001053512.1|  Os04g0554600                                     71.6    1e-12   
ref|XP_009333674.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  71.6    1e-12   
ref|XP_003525810.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  72.4    1e-12   
ref|XP_006367622.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  72.4    1e-12   
ref|XP_003608748.1|  14 kDa proline-rich protein DC2.15               72.4    1e-12   
emb|CDY61290.1|  BnaCnng37610D                                        71.6    1e-12   
gb|AAM75351.1|AF520576_1  extensin-like protein                       72.4    1e-12   
ref|XP_009333598.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  71.6    1e-12   
gb|ACU21436.1|  unknown                                               72.4    1e-12   
ref|XP_004298648.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  71.6    2e-12   
ref|XP_008808738.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  71.6    2e-12   
ref|XP_008238566.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  71.6    2e-12   
ref|XP_009134277.1|  PREDICTED: putative lipid-binding protein AIR1   71.2    2e-12   
emb|CDY21277.1|  BnaC03g29610D                                        71.2    2e-12   
gb|KFK43474.1|  hypothetical protein AALP_AA1G129700                  71.6    2e-12   
ref|XP_010533776.1|  PREDICTED: lipid transfer protein EARLI 1        71.6    2e-12   
gb|EPS71802.1|  hypothetical protein M569_02964                       71.6    2e-12   
ref|XP_006367621.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  72.4    2e-12   
ref|XP_004235149.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  70.9    2e-12   
ref|XP_006295216.1|  hypothetical protein CARUB_v10024298mg           71.2    2e-12   
ref|XP_010919517.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  71.6    2e-12   
ref|XP_006367620.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  72.4    2e-12   
ref|XP_008646032.1|  PREDICTED: cortical cell-delineating protein...  71.2    2e-12   
ref|XP_006652622.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  71.2    2e-12   
ref|XP_009135928.1|  PREDICTED: putative lipid-binding protein AIR1   71.2    2e-12   
ref|XP_009623719.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  71.2    2e-12   
gb|AFK47547.1|  unknown                                               71.2    2e-12   
ref|XP_002271792.1|  PREDICTED: 14 kDa proline-rich protein DC2.15    71.2    2e-12   
ref|XP_007218581.1|  hypothetical protein PRUPE_ppa013196mg           71.2    2e-12   
ref|XP_008663526.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  70.9    2e-12   
ref|XP_010439335.1|  PREDICTED: putative lipid-binding protein AIR1   71.2    2e-12   
ref|XP_002874775.1|  hypothetical protein ARALYDRAFT_490053           71.6    2e-12   
ref|XP_004169260.1|  PREDICTED: putative lipid-binding protein At...  72.0    2e-12   
gb|KDP25647.1|  hypothetical protein JCGZ_20803                       70.9    2e-12   
ref|XP_006579357.1|  PREDICTED: uncharacterized protein LOC100499...  70.9    2e-12   
ref|NP_001235511.1|  uncharacterized protein LOC100500518 precursor   70.9    2e-12   
ref|XP_010539616.1|  PREDICTED: lipid transfer protein EARLI 1-like   71.2    2e-12   
ref|XP_006396746.1|  hypothetical protein EUTSA_v10029045mg           71.2    3e-12   
ref|XP_008648736.1|  PREDICTED: pEARLI1-like lipid transfer prote...  70.9    3e-12   
ref|XP_010518131.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  70.9    3e-12   
emb|CDY64848.1|  BnaC05g49400D                                        70.9    3e-12   
gb|KDP25648.1|  hypothetical protein JCGZ_20804                       72.4    3e-12   
ref|XP_008392579.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  70.9    3e-12   
ref|NP_001152587.1|  cortical cell-delineating protein precursor      70.9    3e-12   
ref|XP_008448871.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  70.9    3e-12   
ref|NP_001152585.1|  LOC100286225 precursor                           70.5    3e-12   
ref|XP_004150818.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  70.9    3e-12   
ref|NP_001152584.1|  cortical cell-delineating protein precursor      70.9    3e-12   
ref|NP_001235642.1|  uncharacterized protein LOC100500016 precursor   70.9    3e-12   
ref|XP_009401672.1|  PREDICTED: pEARLI1-like lipid transfer prote...  70.9    3e-12   
ref|XP_004147199.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  70.9    3e-12   
gb|AFW63295.1|  cortical cell-delineating protein                     70.5    3e-12   
ref|XP_003525817.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  70.5    4e-12   
ref|XP_010506455.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  70.5    4e-12   
ref|NP_001152564.1|  cortical cell-delineating protein precursor      70.5    4e-12   
ref|XP_010508203.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  70.5    4e-12   
ref|XP_010422221.1|  PREDICTED: lipid transfer protein EARLI 1        70.9    4e-12   
ref|NP_192985.1|  putative lipid transfer protein                     70.9    4e-12   
gb|ACN26094.1|  unknown                                               70.5    4e-12   
ref|XP_008238565.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  70.1    4e-12   
gb|ADD11814.1|  hybrid proline-rich protein                           70.1    4e-12   
ref|XP_004235155.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  70.1    4e-12   
gb|KFK28807.1|  hypothetical protein AALP_AA7G051200                  70.1    4e-12   
ref|NP_001151721.1|  LOC100285357 precursor                           70.1    4e-12   
ref|XP_006841163.1|  hypothetical protein AMTR_s00086p00157840        70.5    5e-12   
emb|CAN80712.1|  hypothetical protein VITISV_033379                   70.5    5e-12   
ref|NP_192984.1|  azelaic acid induced 1                              70.5    5e-12   
ref|NP_172673.1|  extensin-like protein                               70.1    5e-12   
ref|NP_001235888.1|  uncharacterized protein LOC100500033 precursor   70.1    5e-12   
ref|NP_001238461.1|  uncharacterized protein LOC100499693 precursor   70.1    5e-12   
emb|CBI38878.3|  unnamed protein product                              70.1    5e-12   
ref|XP_010529481.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  70.5    5e-12   
gb|KDP25651.1|  hypothetical protein JCGZ_20807                       71.6    5e-12   
ref|XP_002892674.1|  hypothetical protein ARALYDRAFT_471359           70.1    5e-12   
gb|KHN09805.1|  14 kDa proline-rich protein DC2.15                    70.1    5e-12   
ref|XP_008232631.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  70.1    6e-12   
ref|XP_010434049.1|  PREDICTED: putative lipid-binding protein AIR1   70.1    6e-12   
ref|XP_006396753.1|  hypothetical protein EUTSA_v10029038mg           70.1    6e-12   
ref|NP_001238293.1|  uncharacterized protein LOC100527330 precursor   70.1    6e-12   
ref|XP_004516834.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  69.7    6e-12   
ref|XP_002436327.1|  hypothetical protein SORBIDRAFT_10g000510        69.7    6e-12   
gb|AFK47889.1|  unknown                                               69.3    7e-12   
ref|NP_001235027.1|  uncharacterized protein LOC100500229 precursor   69.7    7e-12   
ref|XP_006847372.1|  hypothetical protein AMTR_s01045p00008470        69.7    7e-12   
ref|XP_010695114.1|  PREDICTED: lipid transfer protein EARLI 1-like   70.5    7e-12   
ref|XP_006289270.1|  hypothetical protein CARUB_v10002736mg           69.7    7e-12   
ref|XP_008786991.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  69.7    7e-12   
ref|XP_006396754.1|  hypothetical protein EUTSA_v10029528mg           70.1    7e-12   
ref|NP_566036.1|  protease inhibitor/seed storage/lipid transfer ...  69.7    7e-12   
gb|KHN04346.1|  14 kDa proline-rich protein DC2.15                    69.7    7e-12   
gb|AAK30571.1|AF346659_1  extensin-like protein                       69.7    7e-12   
gb|ADA67933.1|  putative 14 kDa proline-rich protein DC2.15           69.7    8e-12   
ref|XP_002874777.1|  hypothetical protein ARALYDRAFT_911650           70.1    8e-12   
ref|XP_002454527.1|  hypothetical protein SORBIDRAFT_04g032680        69.3    8e-12   
ref|XP_003608746.1|  14 kDa proline-rich protein DC2.15               69.7    8e-12   
ref|XP_010455695.1|  PREDICTED: pEARLI1-like lipid transfer prote...  70.1    8e-12   
ref|XP_010422218.1|  PREDICTED: lipid transfer protein EARLI 1-like   69.7    8e-12   
emb|CDP16135.1|  unnamed protein product                              68.2    9e-12   
ref|XP_009346906.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  69.7    9e-12   
ref|XP_004235151.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  68.9    9e-12   
ref|XP_010458633.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  69.7    9e-12   
ref|XP_002446913.1|  hypothetical protein SORBIDRAFT_06g024770        69.3    9e-12   
ref|XP_010433390.1|  PREDICTED: lipid transfer protein EARLI 1-like   69.7    1e-11   
ref|XP_009346905.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  69.3    1e-11   
ref|XP_003633921.2|  PREDICTED: putative lipid-binding protein At...  69.7    1e-11   
gb|ACE82175.1|  extensin-like protein                                 69.3    1e-11   
ref|XP_010433333.1|  PREDICTED: putative lipid-binding protein AIR1   69.3    1e-11   
ref|XP_003608741.1|  Cortical cell-delineating protein                69.3    1e-11   
ref|XP_009134274.1|  PREDICTED: lipid transfer protein EARLI 1-like   69.3    1e-11   
gb|AFK37038.1|  unknown                                               69.3    1e-11   
emb|CAN77080.1|  hypothetical protein VITISV_025477                   68.9    1e-11   
ref|XP_006396752.1|  hypothetical protein EUTSA_v10029040mg           69.7    1e-11   
ref|XP_006289684.1|  hypothetical protein CARUB_v10003241mg           69.3    1e-11   
ref|XP_006600137.1|  PREDICTED: uncharacterized protein LOC100500...  69.3    1e-11   
ref|XP_010539605.1|  PREDICTED: putative lipid-binding protein AIR1   69.3    1e-11   
ref|XP_010099842.1|  hypothetical protein L484_008499                 68.9    1e-11   
ref|NP_001237154.1|  uncharacterized protein LOC100500124 precursor   69.3    1e-11   
ref|XP_004976455.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  68.9    1e-11   
ref|XP_006396747.1|  hypothetical protein EUTSA_v10029313mg           68.9    1e-11   
ref|XP_010695113.1|  PREDICTED: lipid transfer protein EARLI 1-like   69.7    1e-11   
gb|KDP28790.1|  hypothetical protein JCGZ_14561                       68.9    1e-11   
ref|XP_010455696.1|  PREDICTED: lipid transfer protein EARLI 1-like   69.3    1e-11   
ref|XP_006290087.1|  hypothetical protein CARUB_v10003726mg           68.6    1e-11   
ref|XP_010422216.1|  PREDICTED: pEARLI1-like lipid transfer prote...  69.3    1e-11   
ref|XP_002874776.1|  hypothetical protein ARALYDRAFT_911648           69.7    1e-11   
ref|XP_010695178.1|  PREDICTED: pEARLI1-like lipid transfer prote...  70.1    1e-11   
ref|XP_010422226.1|  PREDICTED: putative lipid-binding protein AIR1   68.6    2e-11   
dbj|BAA89334.1|  EEF48                                                67.8    2e-11   
ref|XP_010433400.1|  PREDICTED: lipid transfer protein EARLI 1-like   69.3    2e-11   
gb|EAY95111.1|  hypothetical protein OsI_16928                        68.6    2e-11   
ref|XP_002285197.1|  PREDICTED: putative lipid-binding protein At...  68.6    2e-11   
ref|XP_008232589.1|  PREDICTED: putative lipid-binding protein At...  68.6    2e-11   
ref|XP_004151035.1|  PREDICTED: uncharacterized protein LOC101220...  70.1    2e-11   
gb|KFK37310.1|  hypothetical protein AALP_AA4G240600                  68.6    2e-11   
ref|NP_001053513.2|  Os04g0554800                                     68.6    2e-11   
ref|XP_009775547.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  68.9    2e-11   
ref|XP_006413657.1|  hypothetical protein EUTSA_v10026536mg           68.6    2e-11   
emb|CBI31904.3|  unnamed protein product                              68.2    2e-11   
gb|AAC49369.1|  proline-rich 14 kDa protein                           68.2    2e-11   
emb|CDY21276.1|  BnaC03g29600D                                        67.8    2e-11   
ref|XP_002880164.1|  hypothetical protein ARALYDRAFT_483654           68.6    2e-11   
ref|XP_010422217.1|  PREDICTED: lipid transfer protein EARLI 1-like   68.9    2e-11   
emb|CDP19512.1|  unnamed protein product                              68.2    2e-11   
ref|XP_004244453.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  68.6    2e-11   
ref|XP_009626056.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  68.2    2e-11   
ref|XP_004151036.1|  PREDICTED: uncharacterized protein LOC101220...  69.3    2e-11   
ref|XP_010433312.1|  PREDICTED: putative lipid-binding protein AIR1   68.2    2e-11   
ref|XP_007218590.1|  hypothetical protein PRUPE_ppa013286mg           68.2    2e-11   
ref|NP_001237899.1|  uncharacterized protein LOC100527818 precursor   68.2    2e-11   
ref|XP_004235150.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  67.8    2e-11   
gb|KFK30593.1|  hypothetical protein AALP_AA6G001800                  68.2    2e-11   
ref|XP_002466039.1|  hypothetical protein SORBIDRAFT_01g050420        68.2    2e-11   
ref|XP_006397698.1|  hypothetical protein EUTSA_v10001680mg           68.2    2e-11   
ref|XP_007155643.1|  hypothetical protein PHAVU_003G219100g           68.2    3e-11   
ref|XP_010455702.1|  PREDICTED: putative lipid-binding protein AIR1   68.2    3e-11   
ref|NP_001237995.1|  uncharacterized protein LOC100305616 precursor   68.2    3e-11   
ref|XP_004251927.1|  PREDICTED: putative glycine-rich cell wall s...  68.9    3e-11   
ref|XP_003549906.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  68.2    3e-11   
gb|KHN04344.1|  14 kDa proline-rich protein DC2.15                    67.4    3e-11   
ref|XP_010424613.1|  PREDICTED: putative lipid-binding protein AIR1   67.4    3e-11   
ref|XP_010519362.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  67.8    3e-11   
ref|NP_192987.1|  bifunctional inhibitor/lipid-transfer protein/s...  68.6    3e-11   
ref|XP_010695112.1|  PREDICTED: lipid transfer protein EARLI 1-like   68.9    3e-11   
ref|XP_009133710.1|  PREDICTED: 14 kDa proline-rich protein DC2.15    67.8    3e-11   
ref|XP_010919518.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  67.8    3e-11   
ref|XP_006282240.1|  hypothetical protein CARUB_v10028513mg           67.8    3e-11   
ref|XP_006375281.1|  hypothetical protein POPTR_0014s05870g           67.8    4e-11   
gb|ABK95307.1|  unknown                                               67.8    4e-11   
emb|CDX95635.1|  BnaC03g25160D                                        67.8    4e-11   
ref|NP_199500.1|  bifunctional inhibitor/lipid-transfer protein/s...  67.4    4e-11   
emb|CDX90834.1|  BnaA03g25140D                                        67.8    4e-11   
gb|EMS59022.1|  14 kDa proline-rich protein DC2.15                    67.4    4e-11   
gb|ABX84384.1|  protease inhibitor-like protein                       67.4    4e-11   
ref|XP_010906606.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  67.4    4e-11   
ref|XP_006289359.1|  hypothetical protein CARUB_v10002845mg           67.0    4e-11   
gb|AAM62750.1|  extA                                                  67.4    4e-11   
gb|AFK37174.1|  unknown                                               67.4    4e-11   
ref|XP_011036580.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  67.4    4e-11   
ref|XP_009384469.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  67.4    4e-11   
ref|XP_011033419.1|  PREDICTED: putative lipid-binding protein At...  67.4    4e-11   
ref|XP_003609035.1|  Proline-rich protein                             67.0    5e-11   
ref|XP_010422228.1|  PREDICTED: putative lipid-binding protein AIR1   67.4    5e-11   
emb|CDY21274.1|  BnaC03g29580D                                        67.8    5e-11   
emb|CDX82944.1|  BnaC01g13940D                                        67.4    5e-11   
ref|XP_004516837.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  67.4    5e-11   
ref|XP_003588783.1|  14 kDa proline-rich protein DC2.15               67.4    5e-11   
ref|XP_010456924.1|  PREDICTED: putative lipid-binding protein AIR1   66.6    6e-11   
ref|XP_010433403.1|  PREDICTED: pEARLI1-like lipid transfer prote...  67.4    6e-11   
ref|XP_010422379.1|  PREDICTED: putative lipid-binding protein AIR1   66.6    6e-11   
gb|KGN55880.1|  hypothetical protein Csa_3G026160                     70.1    6e-11   
ref|XP_002863385.1|  hypothetical protein ARALYDRAFT_494287           67.0    6e-11   
gb|KCW77747.1|  hypothetical protein EUGRSUZ_D02041                   66.6    6e-11   
emb|CDX94516.1|  BnaC09g23200D                                        66.6    6e-11   
ref|NP_199501.1|  Bifunctional inhibitor/lipid-transfer protein/s...  67.0    6e-11   
ref|XP_006282307.1|  hypothetical protein CARUB_v10028597mg           67.0    6e-11   
ref|XP_009787417.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  67.0    6e-11   
ref|XP_010053449.1|  PREDICTED: 14 kDa proline-rich protein DC2.15    66.6    6e-11   
gb|ABU63756.1|  root specific protein                                 67.0    6e-11   
ref|NP_192986.1|  Bifunctional inhibitor/lipid-transfer protein/s...  67.8    7e-11   
ref|XP_004498751.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  66.6    7e-11   
ref|XP_004306947.1|  PREDICTED: putative lipid-binding protein At...  66.6    7e-11   
ref|XP_007010839.1|  QLTG3-1 protein                                  68.2    8e-11   
ref|NP_680546.1|  bifunctional inhibitor/lipid-transfer protein/s...  66.6    8e-11   
ref|XP_009801825.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  66.6    8e-11   
gb|AAA32650.1|  bimodular protein                                     67.4    8e-11   



>gb|EYU30298.1| hypothetical protein MIMGU_mgv1a017316mg [Erythranthe guttata]
Length=82

 Score =   102 bits (253),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 48/82 (59%), Positives = 60/82 (73%), Gaps = 0/82 (0%)
 Frame = -3

Query  290  VKPFGSWRPQLLRTRLRESGTLRFIPRMLARIAVHRHTAASRSASPAIKLQHGSVGGVPI  111
            +K FG++  Q LR++L E GT RFIPR  A +AV R TAASRSA+PA++LQHG  GGVPI
Sbjct  1    MKSFGTFLEQTLRSKLSERGTFRFIPRTFALMAVQRQTAASRSANPAMRLQHGVFGGVPI  60

Query  110  TTPTSPPSKFAHTPNFKASLGH  45
              P +PPSK  HTP+F+ S G 
Sbjct  61   VRPINPPSKLVHTPSFRVSFGQ  82



>ref|XP_009795761.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like isoform X2 
[Nicotiana sylvestris]
Length=146

 Score = 92.8 bits (229),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 76/84 (90%), Positives = 80/84 (95%), Gaps = 0/84 (0%)
 Frame = +1

Query  43   RCPRDALKlgvcanllgglvgvvIGTPPTLPCCSLIAGLADLEAAVCLCTAIRANILGIn  222
            RCPRDALKLGVCA+L+GGLVG VIGTPPT+PCCSLI GLADLEAAVCLCTAIRAN+LGIN
Sbjct  63   RCPRDALKLGVCASLVGGLVGAVIGTPPTMPCCSLITGLADLEAAVCLCTAIRANVLGIN  122

Query  223  lnvplslslvlnnCGRQLPNGFTC  294
            LNVPLSLSLVLNNCGR  PNGFTC
Sbjct  123  LNVPLSLSLVLNNCGRNPPNGFTC  146



>ref|XP_009795760.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like isoform X1 
[Nicotiana sylvestris]
Length=158

 Score = 93.2 bits (230),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 76/84 (90%), Positives = 80/84 (95%), Gaps = 0/84 (0%)
 Frame = +1

Query  43   RCPRDALKlgvcanllgglvgvvIGTPPTLPCCSLIAGLADLEAAVCLCTAIRANILGIn  222
            RCPRDALKLGVCA+L+GGLVG VIGTPPT+PCCSLI GLADLEAAVCLCTAIRAN+LGIN
Sbjct  75   RCPRDALKLGVCASLVGGLVGAVIGTPPTMPCCSLITGLADLEAAVCLCTAIRANVLGIN  134

Query  223  lnvplslslvlnnCGRQLPNGFTC  294
            LNVPLSLSLVLNNCGR  PNGFTC
Sbjct  135  LNVPLSLSLVLNNCGRNPPNGFTC  158



>ref|XP_009796139.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Nicotiana 
sylvestris]
Length=158

 Score = 92.0 bits (227),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 78/84 (93%), Positives = 80/84 (95%), Gaps = 0/84 (0%)
 Frame = +1

Query  43   RCPRDALKlgvcanllgglvgvvIGTPPTLPCCSLIAGLADLEAAVCLCTAIRANILGIn  222
            RCPRDALKLGVCANLLGGLVG VIGTPPT+PCCSLIAGLADLEAAVCLCTAIRAN+LGIN
Sbjct  75   RCPRDALKLGVCANLLGGLVGAVIGTPPTMPCCSLIAGLADLEAAVCLCTAIRANVLGIN  134

Query  223  lnvplslslvlnnCGRQLPNGFTC  294
            LNVPLSLSLVLNNCGR  P GFTC
Sbjct  135  LNVPLSLSLVLNNCGRNPPTGFTC  158



>dbj|BAA05471.1| tumor-related protein [Nicotiana glauca x Nicotiana langsdorffii]
Length=87

 Score = 90.1 bits (222),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 75/84 (89%), Positives = 80/84 (95%), Gaps = 0/84 (0%)
 Frame = +1

Query  43   RCPRDALKlgvcanllgglvgvvIGTPPTLPCCSLIAGLADLEAAVCLCTAIRANILGIn  222
            RCPRDALKLGVCANL+GGLVG ++G+PPTLPCCSLIAGLADLEAAVCLCTAIRAN+LGIN
Sbjct  4    RCPRDALKLGVCANLVGGLVGAIVGSPPTLPCCSLIAGLADLEAAVCLCTAIRANVLGIN  63

Query  223  lnvplslslvlnnCGRQLPNGFTC  294
            LNVPLSLSLVLNNCGR  P GFTC
Sbjct  64   LNVPLSLSLVLNNCGRNPPTGFTC  87



>ref|XP_009782706.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Nicotiana 
sylvestris]
Length=158

 Score = 91.7 bits (226),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 77/84 (92%), Positives = 80/84 (95%), Gaps = 0/84 (0%)
 Frame = +1

Query  43   RCPRDALKlgvcanllgglvgvvIGTPPTLPCCSLIAGLADLEAAVCLCTAIRANILGIn  222
            RCPRDALKLGVCANL+GGLVG VIGTPPT+PCCSLIAGLADLEAAVCLCTAIRAN+LGIN
Sbjct  75   RCPRDALKLGVCANLVGGLVGAVIGTPPTMPCCSLIAGLADLEAAVCLCTAIRANVLGIN  134

Query  223  lnvplslslvlnnCGRQLPNGFTC  294
            LNVPLSLSLVLNNCGR  P GFTC
Sbjct  135  LNVPLSLSLVLNNCGRNPPTGFTC  158



>ref|XP_009796138.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Nicotiana 
sylvestris]
 ref|XP_009796140.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Nicotiana 
sylvestris]
Length=152

 Score = 90.9 bits (224),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 76/84 (90%), Positives = 80/84 (95%), Gaps = 0/84 (0%)
 Frame = +1

Query  43   RCPRDALKlgvcanllgglvgvvIGTPPTLPCCSLIAGLADLEAAVCLCTAIRANILGIn  222
            RCPRDALKLGVCANL+GGLVG VIG+PPT+PCCSLIAGLADLEAAVCLCTAIRAN+LGIN
Sbjct  69   RCPRDALKLGVCANLVGGLVGAVIGSPPTMPCCSLIAGLADLEAAVCLCTAIRANVLGIN  128

Query  223  lnvplslslvlnnCGRQLPNGFTC  294
            LNVPLSLSLVLNNCGR  P GFTC
Sbjct  129  LNVPLSLSLVLNNCGRNPPTGFTC  152



>ref|XP_009783445.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Nicotiana 
sylvestris]
Length=158

 Score = 90.5 bits (223),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 76/84 (90%), Positives = 80/84 (95%), Gaps = 0/84 (0%)
 Frame = +1

Query  43   RCPRDALKlgvcanllgglvgvvIGTPPTLPCCSLIAGLADLEAAVCLCTAIRANILGIn  222
            RCPRDALKLGVCANL+GGLVG VIG+PPT+PCCSLIAGLADLEAAVCLCTAIRAN+LGIN
Sbjct  75   RCPRDALKLGVCANLVGGLVGAVIGSPPTMPCCSLIAGLADLEAAVCLCTAIRANVLGIN  134

Query  223  lnvplslslvlnnCGRQLPNGFTC  294
            LNVPLSLSLVLNNCGR  P GFTC
Sbjct  135  LNVPLSLSLVLNNCGRNPPTGFTC  158



>ref|XP_009619251.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Nicotiana 
tomentosiformis]
Length=158

 Score = 90.5 bits (223),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 75/84 (89%), Positives = 80/84 (95%), Gaps = 0/84 (0%)
 Frame = +1

Query  43   RCPRDALKlgvcanllgglvgvvIGTPPTLPCCSLIAGLADLEAAVCLCTAIRANILGIn  222
            RCPRDALKLGVCANL+GGLVG ++G+PPTLPCCSLIAGLADLEAAVCLCTAIRAN+LGIN
Sbjct  75   RCPRDALKLGVCANLVGGLVGAIVGSPPTLPCCSLIAGLADLEAAVCLCTAIRANVLGIN  134

Query  223  lnvplslslvlnnCGRQLPNGFTC  294
            LNVPLSLSLVLNNCGR  P GFTC
Sbjct  135  LNVPLSLSLVLNNCGRNPPTGFTC  158



>ref|XP_009619252.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Nicotiana 
tomentosiformis]
 dbj|BAA95941.1| glycine-rich protein [Nicotiana tabacum]
Length=158

 Score = 90.5 bits (223),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 75/84 (89%), Positives = 80/84 (95%), Gaps = 0/84 (0%)
 Frame = +1

Query  43   RCPRDALKlgvcanllgglvgvvIGTPPTLPCCSLIAGLADLEAAVCLCTAIRANILGIn  222
            RCPRDALKLGVCANL+GGLVG ++G+PPTLPCCSLIAGLADLEAAVCLCTAIRAN+LGIN
Sbjct  75   RCPRDALKLGVCANLVGGLVGAIVGSPPTLPCCSLIAGLADLEAAVCLCTAIRANVLGIN  134

Query  223  lnvplslslvlnnCGRQLPNGFTC  294
            LNVPLSLSLVLNNCGR  P GFTC
Sbjct  135  LNVPLSLSLVLNNCGRNPPTGFTC  158



>ref|XP_009600481.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Nicotiana 
tomentosiformis]
Length=170

 Score = 90.1 bits (222),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 77/84 (92%), Positives = 81/84 (96%), Gaps = 0/84 (0%)
 Frame = +1

Query  43   RCPRDALKlgvcanllgglvgvvIGTPPTLPCCSLIAGLADLEAAVCLCTAIRANILGIn  222
            RCPRDALKLGVCANLLGGLVGV++G+PPTLPCCSLIAGLADLEAAVCLCTAIRAN+LGIN
Sbjct  87   RCPRDALKLGVCANLLGGLVGVIVGSPPTLPCCSLIAGLADLEAAVCLCTAIRANVLGIN  146

Query  223  lnvplslslvlnnCGRQLPNGFTC  294
            LNVPLSLSLVLNNCGR  P GFTC
Sbjct  147  LNVPLSLSLVLNNCGRNPPTGFTC  170



>dbj|BAA13150.1| NT16 polypeptide [Nicotiana tabacum]
Length=170

 Score = 90.1 bits (222),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 77/84 (92%), Positives = 81/84 (96%), Gaps = 0/84 (0%)
 Frame = +1

Query  43   RCPRDALKlgvcanllgglvgvvIGTPPTLPCCSLIAGLADLEAAVCLCTAIRANILGIn  222
            RCPRDALKLGVCANLLGGLVGV++G+PPTLPCCSLIAGLADLEAAVCLCTAIRAN+LGIN
Sbjct  87   RCPRDALKLGVCANLLGGLVGVIVGSPPTLPCCSLIAGLADLEAAVCLCTAIRANVLGIN  146

Query  223  lnvplslslvlnnCGRQLPNGFTC  294
            LNVPLSLSLVLNNCGR  P GFTC
Sbjct  147  LNVPLSLSLVLNNCGRNPPTGFTC  170



>ref|XP_009617786.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Nicotiana 
tomentosiformis]
Length=146

 Score = 88.6 bits (218),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 76/84 (90%), Positives = 79/84 (94%), Gaps = 0/84 (0%)
 Frame = +1

Query  43   RCPRDALKlgvcanllgglvgvvIGTPPTLPCCSLIAGLADLEAAVCLCTAIRANILGIn  222
            R PRDALKLGVCANL+GGLVG VIG+PPTLPCCSLIAGLADLEAAVCLCTAIRAN+LGIN
Sbjct  63   RWPRDALKLGVCANLVGGLVGAVIGSPPTLPCCSLIAGLADLEAAVCLCTAIRANVLGIN  122

Query  223  lnvplslslvlnnCGRQLPNGFTC  294
            LNVPLSLSLVLNNCGR  P GFTC
Sbjct  123  LNVPLSLSLVLNNCGRNPPTGFTC  146



>ref|XP_009795762.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Nicotiana 
sylvestris]
Length=149

 Score = 87.4 bits (215),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 73/84 (87%), Positives = 78/84 (93%), Gaps = 0/84 (0%)
 Frame = +1

Query  43   RCPRDALKlgvcanllgglvgvvIGTPPTLPCCSLIAGLADLEAAVCLCTAIRANILGIn  222
            RCPRDAL  GVCANL+GGLVG VIG+PPT+PCCSLIAGLADLEAAVCLCTAIRAN+LG+N
Sbjct  66   RCPRDALMFGVCANLVGGLVGAVIGSPPTMPCCSLIAGLADLEAAVCLCTAIRANVLGLN  125

Query  223  lnvplslslvlnnCGRQLPNGFTC  294
            LNVPLSLSLVLNNCGR  P GFTC
Sbjct  126  LNVPLSLSLVLNNCGRSPPTGFTC  149



>sp|P14009.1|14KD_DAUCA RecName: Full=14 kDa proline-rich protein DC2.15; Flags: Precursor 
[Daucus carota]
 emb|CAA33476.1| unnamed protein product [Daucus carota]
Length=137

 Score = 86.7 bits (213),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 63/84 (75%), Positives = 76/84 (90%), Gaps = 0/84 (0%)
 Frame = +1

Query  43   RCPRDALKlgvcanllgglvgvvIGTPPTLPCCSLIAGLADLEAAVCLCTAIRANILGIn  222
            +CPRDALKLGVCA++L  +  VVIG+PPTLPCCSL+ GL +LEAAVCLCTAI+ANILG N
Sbjct  53   KCPRDALKLGVCADVLNLVHNVVIGSPPTLPCCSLLEGLVNLEAAVCLCTAIKANILGKN  112

Query  223  lnvplslslvlnnCGRQLPNGFTC  294
            LN+P++LSLVLNNCG+Q+PNGF C
Sbjct  113  LNLPIALSLVLNNCGKQVPNGFEC  136



>dbj|BAA13155.1| glycine-rich polypeptide [Nicotiana tabacum]
Length=98

 Score = 85.5 bits (210),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 76/84 (90%), Positives = 81/84 (96%), Gaps = 0/84 (0%)
 Frame = +1

Query  43   RCPRDALKlgvcanllgglvgvvIGTPPTLPCCSLIAGLADLEAAVCLCTAIRANILGIn  222
            RCPRDALKLGVCANL+GGLVGV++G+PPTLPCCSLIAGLADLEAAVCLCTAIRAN+LGIN
Sbjct  15   RCPRDALKLGVCANLVGGLVGVIVGSPPTLPCCSLIAGLADLEAAVCLCTAIRANVLGIN  74

Query  223  lnvplslslvlnnCGRQLPNGFTC  294
            LNVPLSLSLVLNNCGR  P GFTC
Sbjct  75   LNVPLSLSLVLNNCGRNPPTGFTC  98



>ref|XP_007210550.1| hypothetical protein PRUPE_ppa014094mg [Prunus persica]
 gb|EMJ11749.1| hypothetical protein PRUPE_ppa014094mg [Prunus persica]
Length=87

 Score = 83.2 bits (204),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 41/69 (59%), Positives = 48/69 (70%), Gaps = 0/69 (0%)
 Frame = -3

Query  251  TRLRESGTLRFIPRMLARIAVHRHTAASRSASPAIKLQHGSVGGVPITTPTSPPSKFAHT  72
            T+L+  G LR IPR+LA +AV RH A SRS SP+ K Q G  GG PI  PT+P SK A T
Sbjct  2    TKLKAMGILRLIPRILALMAVQRHIATSRSRSPSSKAQQGVSGGFPIIAPTAPLSKLAQT  61

Query  71   PNFKASLGH  45
            PNF+ASLG 
Sbjct  62   PNFRASLGQ  70



>ref|XP_010258985.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Nelumbo nucifera]
Length=137

 Score = 84.3 bits (207),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 64/84 (76%), Positives = 74/84 (88%), Gaps = 0/84 (0%)
 Frame = +1

Query  43   RCPRDALKlgvcanllgglvgvvIGTPPTLPCCSLIAGLADLEAAVCLCTAIRANILGIn  222
             CPRD LKLGVCANLL  LV +V+GTPP  PCCSLI GLADLEAAVCLCTAI+ANILGI+
Sbjct  53   SCPRDTLKLGVCANLLNDLVHLVVGTPPKYPCCSLIEGLADLEAAVCLCTAIKANILGIH  112

Query  223  lnvplslslvlnnCGRQLPNGFTC  294
            LNVP+SLSL+LN CG+++P+GF C
Sbjct  113  LNVPVSLSLLLNYCGKKVPSGFQC  136



>ref|XP_010264242.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Nelumbo nucifera]
Length=133

 Score = 84.0 bits (206),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 64/84 (76%), Positives = 74/84 (88%), Gaps = 0/84 (0%)
 Frame = +1

Query  43   RCPRDALKlgvcanllgglvgvvIGTPPTLPCCSLIAGLADLEAAVCLCTAIRANILGIn  222
             CPRD LKLGVCANLL  LV +VIGTPP  PCC+LI GLADLEAAVCLCTAI+ANILGI+
Sbjct  49   SCPRDTLKLGVCANLLNDLVHLVIGTPPKYPCCTLIEGLADLEAAVCLCTAIKANILGIH  108

Query  223  lnvplslslvlnnCGRQLPNGFTC  294
            LNVP+SLSL+LN CG+++P+GF C
Sbjct  109  LNVPVSLSLLLNYCGKKVPSGFQC  132



>emb|CDP05328.1| unnamed protein product [Coffea canephora]
Length=129

 Score = 83.2 bits (204),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 67/84 (80%), Positives = 74/84 (88%), Gaps = 1/84 (1%)
 Frame = +1

Query  43   RCPRDALKlgvcanllgglvgvvIGTPPTLPCCSLIAGLADLEAAVCLCTAIRANILGIn  222
            RCPRDALKLGVCAN+LG +    IG PPTLPCCSL+ GLADLEAA+CLCTAIRANILGIN
Sbjct  46   RCPRDALKLGVCANVLGLIRVS-IGAPPTLPCCSLLQGLADLEAALCLCTAIRANILGIN  104

Query  223  lnvplslslvlnnCGRQLPNGFTC  294
            LN+P++LSLVLNNCGR  PNGF C
Sbjct  105  LNLPVTLSLVLNNCGRNPPNGFIC  128



>ref|XP_011070108.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Sesamum indicum]
Length=137

 Score = 83.2 bits (204),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 63/84 (75%), Positives = 75/84 (89%), Gaps = 0/84 (0%)
 Frame = +1

Query  43   RCPRDALKlgvcanllgglvgvvIGTPPTLPCCSLIAGLADLEAAVCLCTAIRANILGIn  222
            +CP+D LKLGVCANLL  LV +V+GTPP  PCCSLI GLADLEAAVCLCTAI+AN+LGIN
Sbjct  53   KCPKDTLKLGVCANLLNDLVHLVVGTPPKTPCCSLIGGLADLEAAVCLCTAIKANVLGIN  112

Query  223  lnvplslslvlnnCGRQLPNGFTC  294
            LNVP+SLSL+LN CG+++P+GF C
Sbjct  113  LNVPVSLSLLLNYCGKKVPSGFQC  136



>gb|ABG91752.1| HyPRP2 [Gossypium hirsutum]
Length=137

 Score = 83.2 bits (204),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 67/84 (80%), Positives = 76/84 (90%), Gaps = 0/84 (0%)
 Frame = +1

Query  43   RCPRDALKlgvcanllgglvgvvIGTPPTLPCCSLIAGLADLEAAVCLCTAIRANILGIn  222
            +CPRDALKLGVCA+LLGGL+ V IGTPP  PCCSLI GLADLEAAVCLCTAI+ANILGIN
Sbjct  53   KCPRDALKLGVCADLLGGLLNVTIGTPPVQPCCSLIQGLADLEAAVCLCTAIKANILGIN  112

Query  223  lnvplslslvlnnCGRQLPNGFTC  294
            LNVPLSLSL+LN C +++P+GF C
Sbjct  113  LNVPLSLSLLLNVCSKKVPSGFQC  136



>ref|XP_008362163.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Malus domestica]
Length=145

 Score = 83.2 bits (204),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 61/84 (73%), Positives = 72/84 (86%), Gaps = 0/84 (0%)
 Frame = +1

Query  43   RCPRDALKlgvcanllgglvgvvIGTPPTLPCCSLIAGLADLEAAVCLCTAIRANILGIn  222
             CP+D LKLGVC +LL  LV +V+GTPP  PCCSLI GLADLEAAVCLCTAI+AN+LGIN
Sbjct  61   SCPKDTLKLGVCGDLLNDLVTIVVGTPPKTPCCSLIGGLADLEAAVCLCTAIKANVLGIN  120

Query  223  lnvplslslvlnnCGRQLPNGFTC  294
            L+VP+SLSL+LN CG+ +PNGF C
Sbjct  121  LDVPVSLSLLLNYCGKSVPNGFQC  144



>ref|XP_006477234.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Citrus sinensis]
Length=134

 Score = 82.4 bits (202),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 63/83 (76%), Positives = 73/83 (88%), Gaps = 0/83 (0%)
 Frame = +1

Query  46   CPRDALKlgvcanllgglvgvvIGTPPTLPCCSLIAGLADLEAAVCLCTAIRANILGInl  225
            CPRD LKLGVCAN+L  LV +V+GTPP  PCCSLI GL DLEAAVCLCTAI+ANILGINL
Sbjct  51   CPRDTLKLGVCANVLNDLVHLVVGTPPKTPCCSLIKGLVDLEAAVCLCTAIKANILGINL  110

Query  226  nvplslslvlnnCGRQLPNGFTC  294
            NVP+SLSL+LN CG+++P+GF C
Sbjct  111  NVPVSLSLLLNFCGKKVPSGFQC  133



>ref|XP_004299470.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like isoform 3 
[Fragaria vesca subsp. vesca]
Length=144

 Score = 82.8 bits (203),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 62/83 (75%), Positives = 72/83 (87%), Gaps = 0/83 (0%)
 Frame = +1

Query  46   CPRDALKlgvcanllgglvgvvIGTPPTLPCCSLIAGLADLEAAVCLCTAIRANILGInl  225
            CPRDALKLG+CAN+L  L+ V IGTPP  PCC+LI GLADLEAAVCLCTAIRA+ILGINL
Sbjct  61   CPRDALKLGICANVLNNLLNVTIGTPPVQPCCTLIQGLADLEAAVCLCTAIRASILGINL  120

Query  226  nvplslslvlnnCGRQLPNGFTC  294
            N+P++LSL+LN CG Q+P GF C
Sbjct  121  NIPIALSLLLNACGNQVPRGFQC  143



>gb|EYU31726.1| hypothetical protein MIMGU_mgv1a019851mg, partial [Erythranthe 
guttata]
Length=116

 Score = 81.6 bits (200),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 45/98 (46%), Positives = 55/98 (56%), Gaps = 6/98 (6%)
 Frame = -3

Query  335  LCIACKAYLV*AA*QVKPFGSWRPQLLRTRLRESGTLRFIPRMLARIAVHRHTAASRSAS  156
            L + C  Y       +KP G++  Q  R +L E GT R +P  LA  AV R TAASRS  
Sbjct  24   LALYCNFYA-----HLKPDGTFLSQAFRIKLSEMGTFRLMPNTLALTAVQRQTAASRSVK  78

Query  155  PAIKLQHGSV-GGVPITTPTSPPSKFAHTPNFKASLGH  45
            P +++QHG    GVP T PT   SKFA  PN + SLGH
Sbjct  79   PPMRVQHGFFESGVPTTMPTKSFSKFAQAPNLRVSLGH  116



>ref|XP_011076346.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Sesamum indicum]
Length=152

 Score = 82.8 bits (203),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 66/83 (80%), Positives = 73/83 (88%), Gaps = 0/83 (0%)
 Frame = +1

Query  46   CPRDALKlgvcanllgglvgvvIGTPPTLPCCSLIAGLADLEAAVCLCTAIRANILGInl  225
            CPRDALKLGVCANLLG   GVV+G PPT PCCSL+AGL DLEAAVCLCTAI+AN+LGINL
Sbjct  69   CPRDALKLGVCANLLGRAAGVVVGNPPTTPCCSLLAGLVDLEAAVCLCTAIKANVLGINL  128

Query  226  nvplslslvlnnCGRQLPNGFTC  294
            N+P+SLSL+LN CGR  P GFTC
Sbjct  129  NIPVSLSLLLNACGRTPPTGFTC  151



>ref|XP_006440349.1| hypothetical protein CICLE_v10022832mg [Citrus clementina]
 gb|ESR53589.1| hypothetical protein CICLE_v10022832mg [Citrus clementina]
 gb|KDO61488.1| hypothetical protein CISIN_1g035808mg [Citrus sinensis]
Length=131

 Score = 82.0 bits (201),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 63/83 (76%), Positives = 73/83 (88%), Gaps = 0/83 (0%)
 Frame = +1

Query  46   CPRDALKlgvcanllgglvgvvIGTPPTLPCCSLIAGLADLEAAVCLCTAIRANILGInl  225
            CPRD LKLGVCAN+L  LV +V+GTPP  PCCSLI GL DLEAAVCLCTAI+ANILGINL
Sbjct  48   CPRDTLKLGVCANVLNDLVHLVVGTPPKTPCCSLIKGLVDLEAAVCLCTAIKANILGINL  107

Query  226  nvplslslvlnnCGRQLPNGFTC  294
            NVP+SLSL+LN CG+++P+GF C
Sbjct  108  NVPVSLSLLLNFCGKKVPSGFQC  130



>ref|XP_004299469.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like isoform 2 
[Fragaria vesca subsp. vesca]
Length=152

 Score = 82.4 bits (202),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 62/83 (75%), Positives = 72/83 (87%), Gaps = 0/83 (0%)
 Frame = +1

Query  46   CPRDALKlgvcanllgglvgvvIGTPPTLPCCSLIAGLADLEAAVCLCTAIRANILGInl  225
            CPRDALKLG+CAN+L  L+ V IGTPP  PCC+LI GLADLEAAVCLCTAIRA+ILGINL
Sbjct  69   CPRDALKLGICANVLNNLLNVTIGTPPVQPCCTLIQGLADLEAAVCLCTAIRASILGINL  128

Query  226  nvplslslvlnnCGRQLPNGFTC  294
            N+P++LSL+LN CG Q+P GF C
Sbjct  129  NIPIALSLLLNACGNQVPRGFQC  151



>ref|XP_011001498.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Populus euphratica]
Length=132

 Score = 81.6 bits (200),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 61/84 (73%), Positives = 73/84 (87%), Gaps = 0/84 (0%)
 Frame = +1

Query  43   RCPRDALKlgvcanllgglvgvvIGTPPTLPCCSLIAGLADLEAAVCLCTAIRANILGIn  222
            +CP+DALKLGVCA LLG L+ V +GTPP  PCCS+I GL DLEAAVCLCTAI+ANILGIN
Sbjct  48   KCPKDALKLGVCAGLLGSLLNVTVGTPPVQPCCSVIQGLLDLEAAVCLCTAIKANILGIN  107

Query  223  lnvplslslvlnnCGRQLPNGFTC  294
            LN+P+SLSL+LN CG+++P GF C
Sbjct  108  LNIPVSLSLLLNVCGKKVPKGFQC  131



>gb|AAD01800.1| HyPRP [Fragaria x ananassa]
 gb|AAS76505.1| HyPRP [Fragaria x ananassa]
Length=156

 Score = 82.0 bits (201),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 62/83 (75%), Positives = 72/83 (87%), Gaps = 0/83 (0%)
 Frame = +1

Query  46   CPRDALKlgvcanllgglvgvvIGTPPTLPCCSLIAGLADLEAAVCLCTAIRANILGInl  225
            CPRDALKLG+CAN+L  L+ V IGTPP  PCC+LI GLADLEAAVCLCTAIRA+ILGINL
Sbjct  73   CPRDALKLGICANVLNNLLNVTIGTPPVQPCCTLIQGLADLEAAVCLCTAIRASILGINL  132

Query  226  nvplslslvlnnCGRQLPNGFTC  294
            N+P++LSL+LN CG Q+P GF C
Sbjct  133  NIPIALSLLLNACGNQVPRGFQC  155



>ref|XP_004986077.1| PREDICTED: putative glycine-rich cell wall structural protein 
1-like [Setaria italica]
Length=203

 Score = 82.4 bits (202),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 60/84 (71%), Positives = 74/84 (88%), Gaps = 0/84 (0%)
 Frame = +1

Query  43   RCPRDALKlgvcanllgglvgvvIGTPPTLPCCSLIAGLADLEAAVCLCTAIRANILGIn  222
            RCP DALKLGVCAN+L GL+ V +GTPP  PCC+LI GLADLEAAVCLCTA+RAN+LGI 
Sbjct  119  RCPIDALKLGVCANVLQGLINVTLGTPPRTPCCTLIQGLADLEAAVCLCTALRANVLGIT  178

Query  223  lnvplslslvlnnCGRQLPNGFTC  294
            +N+P++LSL++N CGR++PNGF C
Sbjct  179  INLPINLSLLVNYCGRRVPNGFQC  202



>ref|XP_009333597.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Pyrus x bretschneideri]
Length=145

 Score = 81.3 bits (199),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 63/84 (75%), Positives = 71/84 (85%), Gaps = 0/84 (0%)
 Frame = +1

Query  43   RCPRDALKlgvcanllgglvgvvIGTPPTLPCCSLIAGLADLEAAVCLCTAIRANILGIn  222
            RCPRD LKLGVCAN+L GL+ + +G PP  PCCSLI GL DLEAAVCLCTAIRANILGIN
Sbjct  61   RCPRDTLKLGVCANVLNGLLNITVGNPPVQPCCSLIQGLVDLEAAVCLCTAIRANILGIN  120

Query  223  lnvplslslvlnnCGRQLPNGFTC  294
            LN+PLSLSL+LN CG ++P GF C
Sbjct  121  LNIPLSLSLLLNVCGNKVPKGFQC  144



>ref|XP_002533299.1| 14 kDa proline-rich protein DC2.15 precursor, putative [Ricinus 
communis]
 gb|EEF29093.1| 14 kDa proline-rich protein DC2.15 precursor, putative [Ricinus 
communis]
Length=133

 Score = 80.9 bits (198),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 63/84 (75%), Positives = 73/84 (87%), Gaps = 0/84 (0%)
 Frame = +1

Query  43   RCPRDALKlgvcanllgglvgvvIGTPPTLPCCSLIAGLADLEAAVCLCTAIRANILGIn  222
            +CPRDALKLGVCAN+LG L+ + IG PP  PCCSLI GL DLEAAVCLCTAI+ANILGIN
Sbjct  49   KCPRDALKLGVCANVLGSLLNLNIGKPPVEPCCSLIQGLVDLEAAVCLCTAIKANILGIN  108

Query  223  lnvplslslvlnnCGRQLPNGFTC  294
            LN+PLSLSL+LN CG++ P+GF C
Sbjct  109  LNIPLSLSLLLNVCGKKTPSGFQC  132



>ref|XP_004299468.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like isoform 1 
[Fragaria vesca subsp. vesca]
Length=166

 Score = 81.6 bits (200),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 62/83 (75%), Positives = 72/83 (87%), Gaps = 0/83 (0%)
 Frame = +1

Query  46   CPRDALKlgvcanllgglvgvvIGTPPTLPCCSLIAGLADLEAAVCLCTAIRANILGInl  225
            CPRDALKLG+CAN+L  L+ V IGTPP  PCC+LI GLADLEAAVCLCTAIRA+ILGINL
Sbjct  83   CPRDALKLGICANVLNNLLNVTIGTPPVQPCCTLIQGLADLEAAVCLCTAIRASILGINL  142

Query  226  nvplslslvlnnCGRQLPNGFTC  294
            N+P++LSL+LN CG Q+P GF C
Sbjct  143  NIPIALSLLLNACGNQVPRGFQC  165



>dbj|BAF46299.1| extensin like protein [Ipomoea nil]
Length=133

 Score = 80.9 bits (198),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 64/84 (76%), Positives = 76/84 (90%), Gaps = 0/84 (0%)
 Frame = +1

Query  43   RCPRDALKlgvcanllgglvgvvIGTPPTLPCCSLIAGLADLEAAVCLCTAIRANILGIn  222
            +CP+DALKLGVCAN+LG L+G+V+G PP  PCCSLI GL DLEAAVCLCTAI+ANILGIN
Sbjct  49   KCPKDALKLGVCANVLGNLLGLVVGNPPKKPCCSLIEGLVDLEAAVCLCTAIKANILGIN  108

Query  223  lnvplslslvlnnCGRQLPNGFTC  294
            LNVPLSLSL+LN CG+++P+GF C
Sbjct  109  LNVPLSLSLLLNVCGKKVPSGFQC  132



>ref|XP_010053451.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Eucalyptus 
grandis]
Length=131

 Score = 80.9 bits (198),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 60/83 (72%), Positives = 74/83 (89%), Gaps = 0/83 (0%)
 Frame = +1

Query  46   CPRDALKlgvcanllgglvgvvIGTPPTLPCCSLIAGLADLEAAVCLCTAIRANILGInl  225
            CPRD +KLGVCAN+L  L+ +V+GTPP  PCCSLI GLADLEAAVCLCTAI+AN+LG+NL
Sbjct  48   CPRDTIKLGVCANVLKNLLHLVVGTPPKTPCCSLINGLADLEAAVCLCTAIKANVLGLNL  107

Query  226  nvplslslvlnnCGRQLPNGFTC  294
            NVP+SLSL+LN CG+++P+GF C
Sbjct  108  NVPVSLSLLLNYCGKKVPSGFQC  130



>emb|CBI31906.3| unnamed protein product [Vitis vinifera]
Length=113

 Score = 80.1 bits (196),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 59/83 (71%), Positives = 71/83 (86%), Gaps = 0/83 (0%)
 Frame = +1

Query  46   CPRDALKlgvcanllgglvgvvIGTPPTLPCCSLIAGLADLEAAVCLCTAIRANILGInl  225
            CP+D LKLGVCA+LL  L+  V+GTPP  PCCSLI GLADLEAAVCLCTAI+AN+LGI L
Sbjct  30   CPKDTLKLGVCADLLNDLLHAVVGTPPKSPCCSLIGGLADLEAAVCLCTAIKANVLGIKL  89

Query  226  nvplslslvlnnCGRQLPNGFTC  294
            NVP+SLSL+LN CG+++P G+ C
Sbjct  90   NVPVSLSLLLNYCGKKVPTGYQC  112



>ref|XP_006440347.1| hypothetical protein CICLE_v10022825mg [Citrus clementina]
 ref|XP_006477232.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Citrus sinensis]
 gb|ESR53587.1| hypothetical protein CICLE_v10022825mg [Citrus clementina]
 gb|KDO61486.1| hypothetical protein CISIN_1g044385mg [Citrus sinensis]
Length=132

 Score = 80.5 bits (197),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 64/84 (76%), Positives = 72/84 (86%), Gaps = 0/84 (0%)
 Frame = +1

Query  43   RCPRDALKlgvcanllgglvgvvIGTPPTLPCCSLIAGLADLEAAVCLCTAIRANILGIn  222
             CPRDALKLGVCAN+L GL+ V IGTPP  PCC+LI GLADLEAAVCLCTAI+ANILGIN
Sbjct  48   SCPRDALKLGVCANVLNGLLNVTIGTPPVQPCCTLIQGLADLEAAVCLCTAIKANILGIN  107

Query  223  lnvplslslvlnnCGRQLPNGFTC  294
            LN+PLSLSL+LN C + +P GF C
Sbjct  108  LNIPLSLSLLLNVCSKSVPRGFQC  131



>ref|XP_011081228.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Sesamum indicum]
Length=133

 Score = 80.5 bits (197),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 62/84 (74%), Positives = 74/84 (88%), Gaps = 0/84 (0%)
 Frame = +1

Query  43   RCPRDALKlgvcanllgglvgvvIGTPPTLPCCSLIAGLADLEAAVCLCTAIRANILGIn  222
            +CP+D LKLGVCANLL  LV +V+GTPP  PCC+LI GLADLEAAVCLCTAI+AN+LGIN
Sbjct  49   KCPKDTLKLGVCANLLNDLVHLVVGTPPKTPCCTLIEGLADLEAAVCLCTAIKANVLGIN  108

Query  223  lnvplslslvlnnCGRQLPNGFTC  294
            LNVP+SLSL+LN CG++ P+GF C
Sbjct  109  LNVPVSLSLLLNYCGKKAPSGFQC  132



>ref|XP_009333675.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Pyrus x bretschneideri]
Length=153

 Score = 80.9 bits (198),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 63/84 (75%), Positives = 71/84 (85%), Gaps = 0/84 (0%)
 Frame = +1

Query  43   RCPRDALKlgvcanllgglvgvvIGTPPTLPCCSLIAGLADLEAAVCLCTAIRANILGIn  222
            RCPRD LKLGVCAN+L GL+ + +G PP  PCCSLI GL DLEAAVCLCTAIRANILGIN
Sbjct  69   RCPRDTLKLGVCANVLNGLLNITVGNPPVQPCCSLIQGLVDLEAAVCLCTAIRANILGIN  128

Query  223  lnvplslslvlnnCGRQLPNGFTC  294
            LN+PLSLSL+LN CG ++P GF C
Sbjct  129  LNIPLSLSLLLNVCGNKVPRGFQC  152



>gb|KCW77749.1| hypothetical protein EUGRSUZ_D02043, partial [Eucalyptus grandis]
Length=147

 Score = 80.9 bits (198),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 60/83 (72%), Positives = 74/83 (89%), Gaps = 0/83 (0%)
 Frame = +1

Query  46   CPRDALKlgvcanllgglvgvvIGTPPTLPCCSLIAGLADLEAAVCLCTAIRANILGInl  225
            CPRD +KLGVCAN+L  L+ +V+GTPP  PCCSLI GLADLEAAVCLCTAI+AN+LG+NL
Sbjct  64   CPRDTIKLGVCANVLKNLLHLVVGTPPKTPCCSLINGLADLEAAVCLCTAIKANVLGLNL  123

Query  226  nvplslslvlnnCGRQLPNGFTC  294
            NVP+SLSL+LN CG+++P+GF C
Sbjct  124  NVPVSLSLLLNYCGKKVPSGFQC  146



>ref|XP_004251936.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Solanum lycopersicum]
Length=123

 Score = 80.1 bits (196),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 64/84 (76%), Positives = 72/84 (86%), Gaps = 1/84 (1%)
 Frame = +1

Query  43   RCPRDALKlgvcanllgglvgvvIGTPPTLPCCSLIAGLADLEAAVCLCTAIRANILGIn  222
            +CP+DALKLGVCAN+L  +    +G+PP LPCCSLI GL DLEAAVCLCTAIRAN+LGIN
Sbjct  41   KCPKDALKLGVCANVLNLVNVT-VGSPPPLPCCSLIQGLTDLEAAVCLCTAIRANVLGIN  99

Query  223  lnvplslslvlnnCGRQLPNGFTC  294
            LN+PLSLSLVLNNCGR  P GFTC
Sbjct  100  LNIPLSLSLVLNNCGRNPPTGFTC  123



>gb|KDO61485.1| hypothetical protein CISIN_1g047179mg [Citrus sinensis]
Length=130

 Score = 80.1 bits (196),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 59/84 (70%), Positives = 72/84 (86%), Gaps = 0/84 (0%)
 Frame = +1

Query  43   RCPRDALKlgvcanllgglvgvvIGTPPTLPCCSLIAGLADLEAAVCLCTAIRANILGIn  222
            RCPRDALKLGVCA +L G VG V+G PP  PCCS++ GL DLEAAVCLCTAI+ANILGIN
Sbjct  46   RCPRDALKLGVCAKVLDGTVGAVVGNPPDFPCCSVLQGLLDLEAAVCLCTAIKANILGIN  105

Query  223  lnvplslslvlnnCGRQLPNGFTC  294
            +N+P+SLSL++N CG++LP+ F C
Sbjct  106  INIPISLSLLINTCGKKLPSDFIC  129



>ref|XP_006440346.1| hypothetical protein CICLE_v10022839mg [Citrus clementina]
 gb|ESR53586.1| hypothetical protein CICLE_v10022839mg [Citrus clementina]
Length=130

 Score = 80.1 bits (196),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 59/84 (70%), Positives = 72/84 (86%), Gaps = 0/84 (0%)
 Frame = +1

Query  43   RCPRDALKlgvcanllgglvgvvIGTPPTLPCCSLIAGLADLEAAVCLCTAIRANILGIn  222
            RCPRDALKLGVCA +L G VG V+G PP  PCCS++ GL DLEAAVCLCTAI+ANILGIN
Sbjct  46   RCPRDALKLGVCAKVLDGTVGAVVGNPPDFPCCSVLQGLLDLEAAVCLCTAIKANILGIN  105

Query  223  lnvplslslvlnnCGRQLPNGFTC  294
            +N+P+SLSL++N CG++LP+ F C
Sbjct  106  INIPISLSLLINTCGKKLPSDFIC  129



>gb|AAC02087.1| hairy root 4 [Nicotiana tabacum]
Length=196

 Score = 81.6 bits (200),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 70/77 (91%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +1

Query  43   RCPRDALKlgvcanllgglvgvvIGTPPTLPCCSLIAGLADLEAAVCLCTAIRANILGIn  222
            RCPRDALKLGVCANL+GGLVG VIG+PPT+PCCSLIAGLADLEAAVCLCTAIRAN+LGIN
Sbjct  75   RCPRDALKLGVCANLVGGLVGAVIGSPPTMPCCSLIAGLADLEAAVCLCTAIRANVLGIN  134

Query  223  lnvplslslvlnnCGRQ  273
            LNVPLSLSLVLNNCG++
Sbjct  135  LNVPLSLSLVLNNCGKE  151



>ref|XP_007218576.1| hypothetical protein PRUPE_ppa013120mg [Prunus persica]
 gb|EMJ19775.1| hypothetical protein PRUPE_ppa013120mg [Prunus persica]
Length=139

 Score = 80.5 bits (197),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 61/84 (73%), Positives = 71/84 (85%), Gaps = 0/84 (0%)
 Frame = +1

Query  43   RCPRDALKlgvcanllgglvgvvIGTPPTLPCCSLIAGLADLEAAVCLCTAIRANILGIn  222
             CP+D LKLGVC  LL GLV +V+GTPP  PCCSLI GLAD+EAAVCLCTAI+AN+LGIN
Sbjct  55   SCPKDTLKLGVCGALLNGLVHLVVGTPPKTPCCSLIGGLADVEAAVCLCTAIKANVLGIN  114

Query  223  lnvplslslvlnnCGRQLPNGFTC  294
            LNVP+SLSL+LN CG+ +P GF C
Sbjct  115  LNVPVSLSLLLNYCGKSVPTGFQC  138



>ref|XP_010055513.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Eucalyptus 
grandis]
Length=132

 Score = 80.1 bits (196),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 59/84 (70%), Positives = 72/84 (86%), Gaps = 0/84 (0%)
 Frame = +1

Query  43   RCPRDALKlgvcanllgglvgvvIGTPPTLPCCSLIAGLADLEAAVCLCTAIRANILGIn  222
             CPRDALKLGVCA +L G V  +IGTPP +PCCS++ GL DLEAAVCLCTAI+ANILGIN
Sbjct  48   SCPRDALKLGVCAKVLDGPVNAIIGTPPDMPCCSVLEGLLDLEAAVCLCTAIKANILGIN  107

Query  223  lnvplslslvlnnCGRQLPNGFTC  294
            LN+P+SLSL++N CG+ +P+GF C
Sbjct  108  LNIPISLSLLINTCGKNVPSGFQC  131



>ref|XP_006477231.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Citrus sinensis]
Length=130

 Score = 80.1 bits (196),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 58/84 (69%), Positives = 72/84 (86%), Gaps = 0/84 (0%)
 Frame = +1

Query  43   RCPRDALKlgvcanllgglvgvvIGTPPTLPCCSLIAGLADLEAAVCLCTAIRANILGIn  222
            RCPRDALKLG+CA +L G VG V+G PP  PCCS++ GL DLEAAVCLCTAI+ANILGIN
Sbjct  46   RCPRDALKLGICAKVLDGTVGAVVGNPPDFPCCSVLQGLLDLEAAVCLCTAIKANILGIN  105

Query  223  lnvplslslvlnnCGRQLPNGFTC  294
            +N+P+SLSL++N CG++LP+ F C
Sbjct  106  INIPISLSLLINTCGKKLPSDFIC  129



>ref|XP_010906608.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Elaeis guineensis]
Length=129

 Score = 80.1 bits (196),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 60/84 (71%), Positives = 74/84 (88%), Gaps = 0/84 (0%)
 Frame = +1

Query  43   RCPRDALKlgvcanllgglvgvvIGTPPTLPCCSLIAGLADLEAAVCLCTAIRANILGIn  222
            +CP DALKLGVCA++L GL+ V IGTPP  PCCSL++GL DLEAAVCLCTAI+ANILGIN
Sbjct  45   KCPIDALKLGVCADVLSGLLNVTIGTPPKEPCCSLLSGLVDLEAAVCLCTAIKANILGIN  104

Query  223  lnvplslslvlnnCGRQLPNGFTC  294
            LN+P+ LSL+LN CG+++P+GF C
Sbjct  105  LNIPVDLSLLLNYCGKKVPSGFQC  128



>ref|XP_006369032.1| HyPRP family protein [Populus trichocarpa]
 gb|ERP65601.1| HyPRP family protein [Populus trichocarpa]
Length=132

 Score = 80.1 bits (196),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 61/84 (73%), Positives = 73/84 (87%), Gaps = 0/84 (0%)
 Frame = +1

Query  43   RCPRDALKlgvcanllgglvgvvIGTPPTLPCCSLIAGLADLEAAVCLCTAIRANILGIn  222
            +CP+DALKLGVCA+LLG L+ V +GTPP  PCCSLI GL DLEAAVCLCTAI+ANILGIN
Sbjct  48   KCPKDALKLGVCADLLGSLLNVTVGTPPVEPCCSLIQGLLDLEAAVCLCTAIKANILGIN  107

Query  223  lnvplslslvlnnCGRQLPNGFTC  294
            LN+P+SLSL+LN CG+++P  F C
Sbjct  108  LNIPVSLSLLLNVCGKKVPKDFQC  131



>gb|EYU18564.1| hypothetical protein MIMGU_mgv1a016162mg [Erythranthe guttata]
Length=132

 Score = 80.1 bits (196),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 61/83 (73%), Positives = 74/83 (89%), Gaps = 0/83 (0%)
 Frame = +1

Query  46   CPRDALKlgvcanllgglvgvvIGTPPTLPCCSLIAGLADLEAAVCLCTAIRANILGInl  225
            CP+D LKLGVCANLL  LV +V+G+PP  PCCSLI GLADLEAAVCLCTA++AN+LGINL
Sbjct  49   CPKDTLKLGVCANLLNDLVHLVVGSPPKTPCCSLIGGLADLEAAVCLCTAVKANVLGINL  108

Query  226  nvplslslvlnnCGRQLPNGFTC  294
            NVP+SLSL+LN CG+++P+GF C
Sbjct  109  NVPVSLSLLLNYCGKKVPSGFQC  131



>emb|CDP09932.1| unnamed protein product [Coffea canephora]
Length=147

 Score = 80.5 bits (197),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 62/84 (74%), Positives = 74/84 (88%), Gaps = 1/84 (1%)
 Frame = +1

Query  43   RCPRDALKlgvcanllgglvgvvIGTPPTLPCCSLIAGLADLEAAVCLCTAIRANILGIn  222
             CPRDALKLGVCANLL  +    IG+PPT PCCSL+ GLADLEAA+CLCTAI+ANILGIN
Sbjct  64   SCPRDALKLGVCANLLNIIGIS-IGSPPTEPCCSLLQGLADLEAALCLCTAIKANILGIN  122

Query  223  lnvplslslvlnnCGRQLPNGFTC  294
            LNVP+SLS++LN+CG+++PNGF C
Sbjct  123  LNVPVSLSVILNDCGKKVPNGFQC  146



>ref|XP_009611018.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Nicotiana 
tomentosiformis]
Length=137

 Score = 80.1 bits (196),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 58/84 (69%), Positives = 73/84 (87%), Gaps = 0/84 (0%)
 Frame = +1

Query  43   RCPRDALKlgvcanllgglvgvvIGTPPTLPCCSLIAGLADLEAAVCLCTAIRANILGIn  222
             CPRDALKLGVCA +L G VG VIGTPP +PCCS++ GL DLEAAVCLCTA++ANILGIN
Sbjct  53   HCPRDALKLGVCAKVLNGPVGAVIGTPPDMPCCSVLGGLLDLEAAVCLCTALKANILGIN  112

Query  223  lnvplslslvlnnCGRQLPNGFTC  294
            +++P++LSL++N CG+ LP+ FTC
Sbjct  113  IDIPIALSLLINTCGKSLPSDFTC  136



>emb|CAA59472.1| hybrid proline-rich protein [Catharanthus roseus]
Length=138

 Score = 80.1 bits (196),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 64/83 (77%), Positives = 73/83 (88%), Gaps = 0/83 (0%)
 Frame = +1

Query  46   CPRDALKlgvcanllgglvgvvIGTPPTLPCCSLIAGLADLEAAVCLCTAIRANILGInl  225
            CPRDALKLGVCA+LLGGL+  VIG PP  PCCSLI GLADLEAAVCLCTAI+AN+LGINL
Sbjct  55   CPRDALKLGVCADLLGGLISAVIGAPPKTPCCSLIEGLADLEAAVCLCTAIKANVLGINL  114

Query  226  nvplslslvlnnCGRQLPNGFTC  294
            NVP+SLSL+LN C +++P GF C
Sbjct  115  NVPVSLSLLLNVCSKKVPEGFIC  137



>ref|XP_007039886.1| 14 kDa proline-rich protein DC2.15, putative [Theobroma cacao]
 gb|EOY24387.1| 14 kDa proline-rich protein DC2.15, putative [Theobroma cacao]
Length=140

 Score = 80.1 bits (196),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 62/84 (74%), Positives = 74/84 (88%), Gaps = 0/84 (0%)
 Frame = +1

Query  43   RCPRDALKlgvcanllgglvgvvIGTPPTLPCCSLIAGLADLEAAVCLCTAIRANILGIn  222
            +CPRDALKLG+CA+LLGGL+ V +G PP  PCCSLI GLADLEAAVCLCTAI+ANILGIN
Sbjct  56   KCPRDALKLGICADLLGGLLNVTVGKPPVQPCCSLIQGLADLEAAVCLCTAIKANILGIN  115

Query  223  lnvplslslvlnnCGRQLPNGFTC  294
            LN+P+SLSL+LN C + +P+GF C
Sbjct  116  LNIPVSLSLLLNVCSKNVPSGFQC  139



>ref|XP_009798259.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Nicotiana 
sylvestris]
Length=138

 Score = 80.1 bits (196),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 57/84 (68%), Positives = 73/84 (87%), Gaps = 0/84 (0%)
 Frame = +1

Query  43   RCPRDALKlgvcanllgglvgvvIGTPPTLPCCSLIAGLADLEAAVCLCTAIRANILGIn  222
             CPRDALKLGVCA +L G +G VIGTPP +PCCS++ GL DLEAAVCLCTA++ANILGIN
Sbjct  54   HCPRDALKLGVCAKVLNGPIGAVIGTPPDMPCCSVLGGLLDLEAAVCLCTALKANILGIN  113

Query  223  lnvplslslvlnnCGRQLPNGFTC  294
            +++P++LSL++N CG+ LP+ FTC
Sbjct  114  IDIPIALSLLINTCGKSLPSDFTC  137



>emb|CAA81526.1| 14 kDa polypeptide [Catharanthus roseus]
Length=138

 Score = 80.1 bits (196),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 63/83 (76%), Positives = 73/83 (88%), Gaps = 0/83 (0%)
 Frame = +1

Query  46   CPRDALKlgvcanllgglvgvvIGTPPTLPCCSLIAGLADLEAAVCLCTAIRANILGInl  225
            CPRDALKLGVCA+LLGGL+  VIG PP  PCCSLI GLADLEAAVCLCTAI+AN+LGINL
Sbjct  55   CPRDALKLGVCADLLGGLISAVIGAPPKTPCCSLIEGLADLEAAVCLCTAIKANVLGINL  114

Query  226  nvplslslvlnnCGRQLPNGFTC  294
            NVP+SL+L+LN C +++P GF C
Sbjct  115  NVPVSLTLLLNVCSKKVPEGFIC  137



>gb|KCW71996.1| hypothetical protein EUGRSUZ_E00449 [Eucalyptus grandis]
Length=86

 Score = 78.6 bits (192),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 40/69 (58%), Positives = 46/69 (67%), Gaps = 0/69 (0%)
 Frame = -3

Query  251  TRLRESGTLRFIPRMLARIAVHRHTAASRSASPAIKLQHGSVGGVPITTPTSPPSKFAHT  72
            ++LRE G LR IPRMLA +AV R TAASRS  P+   Q G  GGVP+   T P S  AHT
Sbjct  2    SKLREMGMLRLIPRMLALMAVQRQTAASRSRRPSRTEQQGMSGGVPMMALTGPSSTLAHT  61

Query  71   PNFKASLGH  45
            P+F ASLG 
Sbjct  62   PSFSASLGQ  70



>ref|XP_010676152.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Beta vulgaris 
subsp. vulgaris]
Length=146

 Score = 80.1 bits (196),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 58/84 (69%), Positives = 70/84 (83%), Gaps = 0/84 (0%)
 Frame = +1

Query  43   RCPRDALKlgvcanllgglvgvvIGTPPTLPCCSLIAGLADLEAAVCLCTAIRANILGIn  222
             CPRDALKLG+CA +L G V  V+GTPPTLPCCS+I GL DLEAAVCLCTAI+ANILGIN
Sbjct  62   HCPRDALKLGICAKVLDGPVNAVVGTPPTLPCCSIIHGLLDLEAAVCLCTAIKANILGIN  121

Query  223  lnvplslslvlnnCGRQLPNGFTC  294
            LN+P+ L+L++N CG+  P+ F C
Sbjct  122  LNIPIVLNLLINACGKSTPSDFIC  145



>ref|XP_008392581.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Malus domestica]
Length=137

 Score = 79.7 bits (195),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 62/84 (74%), Positives = 71/84 (85%), Gaps = 0/84 (0%)
 Frame = +1

Query  43   RCPRDALKlgvcanllgglvgvvIGTPPTLPCCSLIAGLADLEAAVCLCTAIRANILGIn  222
             CPRD LKLGVCAN+L GL+ + IG PP  PCCSLI GLADLEAAVCLCTAI+ANILGIN
Sbjct  53   SCPRDTLKLGVCANVLNGLLNITIGKPPVEPCCSLIQGLADLEAAVCLCTAIKANILGIN  112

Query  223  lnvplslslvlnnCGRQLPNGFTC  294
            LN+P+SLSL+LN CG ++P GF C
Sbjct  113  LNIPISLSLLLNVCGNKVPKGFQC  136



>emb|CDP18670.1| unnamed protein product [Coffea canephora]
Length=148

 Score = 79.7 bits (195),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 65/84 (77%), Positives = 72/84 (86%), Gaps = 1/84 (1%)
 Frame = +1

Query  43   RCPRDALKlgvcanllgglvgvvIGTPPTLPCCSLIAGLADLEAAVCLCTAIRANILGIn  222
            RCPR ALKLGVCAN+LG +    IG+PPTLPCCSL+ GLADLEAAVCLCTAIRAN+LGIN
Sbjct  65   RCPRYALKLGVCANVLGLIGVT-IGSPPTLPCCSLLQGLADLEAAVCLCTAIRANVLGIN  123

Query  223  lnvplslslvlnnCGRQLPNGFTC  294
            LN P+SLSL+LNN GR  PNGF C
Sbjct  124  LNFPVSLSLILNNYGRNTPNGFIC  147



>gb|EYU24741.1| hypothetical protein MIMGU_mgv1a016172mg [Erythranthe guttata]
Length=132

 Score = 79.3 bits (194),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 60/83 (72%), Positives = 73/83 (88%), Gaps = 0/83 (0%)
 Frame = +1

Query  46   CPRDALKlgvcanllgglvgvvIGTPPTLPCCSLIAGLADLEAAVCLCTAIRANILGInl  225
            CP+D LKLGVCANLL  LV +V+G+PP  PCCSLI GL DLEAAVCLCTA++AN+LGINL
Sbjct  49   CPKDTLKLGVCANLLNDLVHLVVGSPPKTPCCSLIGGLVDLEAAVCLCTAVKANVLGINL  108

Query  226  nvplslslvlnnCGRQLPNGFTC  294
            NVP+SLSL+LN CG+++P+GF C
Sbjct  109  NVPVSLSLLLNYCGKKVPSGFQC  131



>gb|ABF93505.1| retrotransposon protein, putative, Ty1-copia subclass, expressed 
[Oryza sativa Japonica Group]
Length=179

 Score = 80.5 bits (197),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 62/84 (74%), Positives = 73/84 (87%), Gaps = 0/84 (0%)
 Frame = +1

Query  43   RCPRDALKlgvcanllgglvgvvIGTPPTLPCCSLIAGLADLEAAVCLCTAIRANILGIn  222
            RCP D LKLGVCAN+L GL+ V +GTPP  PCCSLI GLADLEAAVCLCTA+RANILGIN
Sbjct  94   RCPIDTLKLGVCANVLNGLINVQLGTPPRQPCCSLIQGLADLEAAVCLCTALRANILGIN  153

Query  223  lnvplslslvlnnCGRQLPNGFTC  294
            LN+P++LSL++N CGR +P+GF C
Sbjct  154  LNLPINLSLLVNYCGRSVPSGFQC  177



>ref|XP_002271461.1| PREDICTED: 14 kDa proline-rich protein DC2.15 [Vitis vinifera]
Length=132

 Score = 79.3 bits (194),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 59/83 (71%), Positives = 71/83 (86%), Gaps = 0/83 (0%)
 Frame = +1

Query  46   CPRDALKlgvcanllgglvgvvIGTPPTLPCCSLIAGLADLEAAVCLCTAIRANILGInl  225
            CP+D LKLGVCA+LL  L+  V+GTPP  PCCSLI GLADLEAAVCLCTAI+AN+LGI L
Sbjct  49   CPKDTLKLGVCADLLNDLLHAVVGTPPKSPCCSLIGGLADLEAAVCLCTAIKANVLGIKL  108

Query  226  nvplslslvlnnCGRQLPNGFTC  294
            NVP+SLSL+LN CG+++P G+ C
Sbjct  109  NVPVSLSLLLNYCGKKVPTGYQC  131



>ref|NP_001048668.1| Os03g0103300 [Oryza sativa Japonica Group]
 gb|ABF93504.1| retrotransposon protein, putative, Ty1-copia subclass, expressed 
[Oryza sativa Japonica Group]
 dbj|BAF10582.1| Os03g0103300 [Oryza sativa Japonica Group]
 gb|EAZ25261.1| hypothetical protein OsJ_09069 [Oryza sativa Japonica Group]
 dbj|BAI60003.1| Low-temperature germinability 3-1 [Oryza sativa Japonica Group]
 dbj|BAJ08375.1| qLTG3-1 [Oryza sativa Japonica Group]
Length=184

 Score = 80.5 bits (197),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 62/84 (74%), Positives = 73/84 (87%), Gaps = 0/84 (0%)
 Frame = +1

Query  43   RCPRDALKlgvcanllgglvgvvIGTPPTLPCCSLIAGLADLEAAVCLCTAIRANILGIn  222
            RCP D LKLGVCAN+L GL+ V +GTPP  PCCSLI GLADLEAAVCLCTA+RANILGIN
Sbjct  99   RCPIDTLKLGVCANVLNGLINVQLGTPPRQPCCSLIQGLADLEAAVCLCTALRANILGIN  158

Query  223  lnvplslslvlnnCGRQLPNGFTC  294
            LN+P++LSL++N CGR +P+GF C
Sbjct  159  LNLPINLSLLVNYCGRSVPSGFQC  182



>gb|EAY88189.1| hypothetical protein OsI_09636 [Oryza sativa Indica Group]
 dbj|BAJ08376.1| qLTG3-1 [Oryza sativa Indica Group]
 dbj|BAJ08377.1| qLTG3-1 [Oryza sativa Indica Group]
 dbj|BAJ08378.1| qLTG3-1 [Oryza sativa Indica Group]
 dbj|BAJ08380.1| qLTG3-1 [Oryza sativa Indica Group]
Length=178

 Score = 80.1 bits (196),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 62/84 (74%), Positives = 73/84 (87%), Gaps = 0/84 (0%)
 Frame = +1

Query  43   RCPRDALKlgvcanllgglvgvvIGTPPTLPCCSLIAGLADLEAAVCLCTAIRANILGIn  222
            RCP D LKLGVCAN+L GL+ V +GTPP  PCCSLI GLADLEAAVCLCTA+RANILGIN
Sbjct  93   RCPIDTLKLGVCANVLNGLINVQLGTPPRQPCCSLIQGLADLEAAVCLCTALRANILGIN  152

Query  223  lnvplslslvlnnCGRQLPNGFTC  294
            LN+P++LSL++N CGR +P+GF C
Sbjct  153  LNLPINLSLLVNYCGRSVPSGFQC  176



>ref|XP_009375766.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Pyrus x bretschneideri]
Length=142

 Score = 79.3 bits (194),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 59/84 (70%), Positives = 70/84 (83%), Gaps = 0/84 (0%)
 Frame = +1

Query  43   RCPRDALKlgvcanllgglvgvvIGTPPTLPCCSLIAGLADLEAAVCLCTAIRANILGIn  222
             CP+D LKLGVC +LL  LV +V+GTPP  PCCSLI GL DLEAAVCLCTAI+AN+LGIN
Sbjct  58   SCPKDTLKLGVCGDLLNDLVTIVVGTPPKTPCCSLIGGLTDLEAAVCLCTAIKANVLGIN  117

Query  223  lnvplslslvlnnCGRQLPNGFTC  294
            L+VP+SLSL+LN CG+ +P GF C
Sbjct  118  LDVPVSLSLLLNYCGKSVPKGFQC  141



>dbj|BAG50511.1| qLTG-3-1 [Oryza sativa Japonica Group]
 dbj|BAJ08371.1| qLTG3-1 [Oryza sativa Indica Group]
 dbj|BAJ08372.1| qLTG3-1 [Oryza sativa Indica Group]
 dbj|BAJ08373.1| qLTG3-1 [Oryza sativa Japonica Group]
 dbj|BAJ08374.1| qLTG3-1 [Oryza sativa Indica Group]
 dbj|BAN84541.1| QTL for low-temperature germinability 3-1 [Oryza sativa Japonica 
Group]
Length=184

 Score = 80.1 bits (196),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 62/84 (74%), Positives = 73/84 (87%), Gaps = 0/84 (0%)
 Frame = +1

Query  43   RCPRDALKlgvcanllgglvgvvIGTPPTLPCCSLIAGLADLEAAVCLCTAIRANILGIn  222
            RCP D LKLGVCAN+L GL+ V +GTPP  PCCSLI GLADLEAAVCLCTA+RANILGIN
Sbjct  99   RCPIDTLKLGVCANVLNGLINVQLGTPPRQPCCSLIQGLADLEAAVCLCTALRANILGIN  158

Query  223  lnvplslslvlnnCGRQLPNGFTC  294
            LN+P++LSL++N CGR +P+GF C
Sbjct  159  LNLPINLSLLVNYCGRSVPSGFQC  182



>ref|XP_008232588.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Prunus mume]
Length=139

 Score = 79.3 bits (194),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 61/84 (73%), Positives = 72/84 (86%), Gaps = 0/84 (0%)
 Frame = +1

Query  43   RCPRDALKlgvcanllgglvgvvIGTPPTLPCCSLIAGLADLEAAVCLCTAIRANILGIn  222
             CP+D LKLGVC +LL GLV +V+GTPP  PCCSLI GLAD+EAAVCLCTAI+AN+LGIN
Sbjct  55   SCPKDTLKLGVCGDLLNGLVHLVMGTPPKTPCCSLIGGLADVEAAVCLCTAIKANVLGIN  114

Query  223  lnvplslslvlnnCGRQLPNGFTC  294
            LNVP+SLSL+LN CG+ +P GF C
Sbjct  115  LNVPVSLSLLLNYCGKSVPTGFQC  138



>tpg|DAA37198.1| TPA: hypothetical protein ZEAMMB73_187029 [Zea mays]
 tpg|DAA42811.1| TPA: hypothetical protein ZEAMMB73_664289 [Zea mays]
Length=142

 Score = 79.3 bits (194),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 60/84 (71%), Positives = 73/84 (87%), Gaps = 0/84 (0%)
 Frame = +1

Query  43   RCPRDALKlgvcanllgglvgvvIGTPPTLPCCSLIAGLADLEAAVCLCTAIRANILGIn  222
            RCP DALKLGVCANLL GL+   +GTPP  PCC+LI GLADLEAAVCLCT +RAN+LGIN
Sbjct  58   RCPVDALKLGVCANLLNGLINATLGTPPRTPCCTLIQGLADLEAAVCLCTVLRANVLGIN  117

Query  223  lnvplslslvlnnCGRQLPNGFTC  294
            LN+P++LSL++N CGR++P+GF C
Sbjct  118  LNLPINLSLLVNYCGRRVPSGFQC  141



>ref|XP_007052129.1| Bifunctional inhibitor/lipid-transfer protein/seed storage 2S 
albumin superfamily protein [Theobroma cacao]
 gb|EOX96286.1| Bifunctional inhibitor/lipid-transfer protein/seed storage 2S 
albumin superfamily protein [Theobroma cacao]
Length=139

 Score = 79.3 bits (194),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 62/84 (74%), Positives = 71/84 (85%), Gaps = 0/84 (0%)
 Frame = +1

Query  43   RCPRDALKlgvcanllgglvgvvIGTPPTLPCCSLIAGLADLEAAVCLCTAIRANILGIn  222
             CPRD LKLGVCAN+L  L+ +V+GTPP  PCC LI GLADLEAAVCLCTAI+ANILGIN
Sbjct  55   SCPRDTLKLGVCANVLNDLIHLVVGTPPKTPCCPLIQGLADLEAAVCLCTAIKANILGIN  114

Query  223  lnvplslslvlnnCGRQLPNGFTC  294
            LNVP+SLSL+LN CG+ +P GF C
Sbjct  115  LNVPVSLSLLLNYCGKNVPKGFQC  138



>dbj|BAJ08379.1| qLTG3-1 [Oryza sativa Indica Group]
Length=190

 Score = 80.1 bits (196),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 62/84 (74%), Positives = 73/84 (87%), Gaps = 0/84 (0%)
 Frame = +1

Query  43   RCPRDALKlgvcanllgglvgvvIGTPPTLPCCSLIAGLADLEAAVCLCTAIRANILGIn  222
            RCP D LKLGVCAN+L GL+ V +GTPP  PCCSLI GLADLEAAVCLCTA+RANILGIN
Sbjct  105  RCPIDTLKLGVCANVLNGLINVQLGTPPRQPCCSLIQGLADLEAAVCLCTALRANILGIN  164

Query  223  lnvplslslvlnnCGRQLPNGFTC  294
            LN+P++LSL++N CGR +P+GF C
Sbjct  165  LNLPINLSLLVNYCGRSVPSGFQC  188



>ref|XP_010053452.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Eucalyptus 
grandis]
 gb|KCW77751.1| hypothetical protein EUGRSUZ_D02045 [Eucalyptus grandis]
Length=134

 Score = 79.0 bits (193),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 63/84 (75%), Positives = 74/84 (88%), Gaps = 0/84 (0%)
 Frame = +1

Query  43   RCPRDALKlgvcanllgglvgvvIGTPPTLPCCSLIAGLADLEAAVCLCTAIRANILGIn  222
             CPRDALKLGVCA+LL GLV +V+GTPP  PCCSL+ GLADLEAAVCLCTAI+A++LGIN
Sbjct  50   SCPRDALKLGVCADLLNGLVNIVVGTPPKTPCCSLLEGLADLEAAVCLCTAIKASVLGIN  109

Query  223  lnvplslslvlnnCGRQLPNGFTC  294
            LNVP+SLSL+LN CG+ +P GF C
Sbjct  110  LNVPVSLSLLLNYCGKDVPYGFQC  133



>ref|XP_008669243.1| PREDICTED: uncharacterized protein LOC103646289 [Zea mays]
Length=201

 Score = 80.5 bits (197),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 60/84 (71%), Positives = 73/84 (87%), Gaps = 0/84 (0%)
 Frame = +1

Query  43   RCPRDALKlgvcanllgglvgvvIGTPPTLPCCSLIAGLADLEAAVCLCTAIRANILGIn  222
            RCP DALKLGVCANLL GL+   +GTPP  PCC+LI GLADLEAAVCLCT +RAN+LGIN
Sbjct  117  RCPVDALKLGVCANLLNGLINATLGTPPRTPCCTLIQGLADLEAAVCLCTVLRANVLGIN  176

Query  223  lnvplslslvlnnCGRQLPNGFTC  294
            LN+P++LSL++N CGR++P+GF C
Sbjct  177  LNLPINLSLLVNYCGRRVPSGFQC  200



>dbj|BAJ08384.1| qLTG3-1 [Oryza longistaminata]
Length=194

 Score = 80.1 bits (196),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 62/84 (74%), Positives = 73/84 (87%), Gaps = 0/84 (0%)
 Frame = +1

Query  43   RCPRDALKlgvcanllgglvgvvIGTPPTLPCCSLIAGLADLEAAVCLCTAIRANILGIn  222
            RCP D LKLGVCAN+L GL+ V +GTPP  PCCSLI GLADLEAAVCLCTA+RANILGIN
Sbjct  109  RCPIDTLKLGVCANVLNGLINVQLGTPPRQPCCSLIQGLADLEAAVCLCTALRANILGIN  168

Query  223  lnvplslslvlnnCGRQLPNGFTC  294
            LN+P++LSL++N CGR +P+GF C
Sbjct  169  LNLPINLSLLVNYCGRSVPSGFQC  192



>dbj|BAJ08383.1| qLTG3-1 [Oryza glumipatula]
Length=194

 Score = 80.1 bits (196),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 62/84 (74%), Positives = 73/84 (87%), Gaps = 0/84 (0%)
 Frame = +1

Query  43   RCPRDALKlgvcanllgglvgvvIGTPPTLPCCSLIAGLADLEAAVCLCTAIRANILGIn  222
            RCP D LKLGVCAN+L GL+ V +GTPP  PCCSLI GLADLEAAVCLCTA+RANILGIN
Sbjct  109  RCPIDTLKLGVCANVLNGLINVQLGTPPRQPCCSLIQGLADLEAAVCLCTALRANILGIN  168

Query  223  lnvplslslvlnnCGRQLPNGFTC  294
            LN+P++LSL++N CGR +P+GF C
Sbjct  169  LNLPINLSLLVNYCGRSVPSGFQC  192



>dbj|BAJ08381.1| qLTG3-1 [Oryza rufipogon]
Length=194

 Score = 80.1 bits (196),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 62/84 (74%), Positives = 73/84 (87%), Gaps = 0/84 (0%)
 Frame = +1

Query  43   RCPRDALKlgvcanllgglvgvvIGTPPTLPCCSLIAGLADLEAAVCLCTAIRANILGIn  222
            RCP D LKLGVCAN+L GL+ V +GTPP  PCCSLI GLADLEAAVCLCTA+RANILGIN
Sbjct  109  RCPIDTLKLGVCANVLNGLINVQLGTPPRQPCCSLIQGLADLEAAVCLCTALRANILGIN  168

Query  223  lnvplslslvlnnCGRQLPNGFTC  294
            LN+P++LSL++N CGR +P+GF C
Sbjct  169  LNLPINLSLLVNYCGRSVPSGFQC  192



>dbj|BAJ08382.1| qLTG3-1 [Oryza barthii]
Length=198

 Score = 80.1 bits (196),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 62/84 (74%), Positives = 73/84 (87%), Gaps = 0/84 (0%)
 Frame = +1

Query  43   RCPRDALKlgvcanllgglvgvvIGTPPTLPCCSLIAGLADLEAAVCLCTAIRANILGIn  222
            RCP D LKLGVCAN+L GL+ V +GTPP  PCCSLI GLADLEAAVCLCTA+RANILGIN
Sbjct  113  RCPIDTLKLGVCANVLNGLINVQLGTPPRQPCCSLIQGLADLEAAVCLCTALRANILGIN  172

Query  223  lnvplslslvlnnCGRQLPNGFTC  294
            LN+P++LSL++N CGR +P+GF C
Sbjct  173  LNLPINLSLLVNYCGRSVPSGFQC  196



>dbj|BAJ08386.1| qLTG3-1 [Oryza meridionalis]
Length=199

 Score = 80.1 bits (196),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 62/84 (74%), Positives = 73/84 (87%), Gaps = 0/84 (0%)
 Frame = +1

Query  43   RCPRDALKlgvcanllgglvgvvIGTPPTLPCCSLIAGLADLEAAVCLCTAIRANILGIn  222
            RCP D LKLGVCAN+L GL+ V +GTPP  PCCSLI GLADLEAAVCLCTA+RANILGIN
Sbjct  114  RCPIDTLKLGVCANVLNGLINVQLGTPPRQPCCSLIQGLADLEAAVCLCTALRANILGIN  173

Query  223  lnvplslslvlnnCGRQLPNGFTC  294
            LN+P++LSL++N CGR +P+GF C
Sbjct  174  LNLPINLSLLVNYCGRSVPSGFQC  197



>dbj|BAJ08385.1| qLTG3-1 [Oryza longistaminata]
Length=204

 Score = 80.1 bits (196),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 62/84 (74%), Positives = 73/84 (87%), Gaps = 0/84 (0%)
 Frame = +1

Query  43   RCPRDALKlgvcanllgglvgvvIGTPPTLPCCSLIAGLADLEAAVCLCTAIRANILGIn  222
            RCP D LKLGVCAN+L GL+ V +GTPP  PCCSLI GLADLEAAVCLCTA+RANILGIN
Sbjct  119  RCPIDTLKLGVCANVLNGLINVQLGTPPRQPCCSLIQGLADLEAAVCLCTALRANILGIN  178

Query  223  lnvplslslvlnnCGRQLPNGFTC  294
            LN+P++LSL++N CGR +P+GF C
Sbjct  179  LNLPINLSLLVNYCGRSVPSGFQC  202



>dbj|BAA99575.1| DC2.15 like protein [Daucus carota]
Length=127

 Score = 78.6 bits (192),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 60/84 (71%), Positives = 74/84 (88%), Gaps = 0/84 (0%)
 Frame = +1

Query  43   RCPRDALKlgvcanllgglvgvvIGTPPTLPCCSLIAGLADLEAAVCLCTAIRANILGIn  222
            +CPRD LKLGVCA++L  +  VV+G PPTLPCC+L+ GL +LEAA+CLCTAI+ANILGIN
Sbjct  43   KCPRDQLKLGVCADVLNLVKNVVVGAPPTLPCCALLEGLVNLEAALCLCTAIKANILGIN  102

Query  223  lnvplslslvlnnCGRQLPNGFTC  294
            LN+P++LSLVLNNCG+ LPNGF C
Sbjct  103  LNLPVALSLVLNNCGKTLPNGFEC  126



>ref|XP_007039887.1| Bifunctional inhibitor/lipid-transfer protein/seed storage 2S 
albumin superfamily protein [Theobroma cacao]
 gb|EOY24388.1| Bifunctional inhibitor/lipid-transfer protein/seed storage 2S 
albumin superfamily protein [Theobroma cacao]
Length=132

 Score = 78.6 bits (192),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 58/84 (69%), Positives = 72/84 (86%), Gaps = 0/84 (0%)
 Frame = +1

Query  43   RCPRDALKlgvcanllgglvgvvIGTPPTLPCCSLIAGLADLEAAVCLCTAIRANILGIn  222
             CPRDALKLGVCA LL G +G V+G PP  PCCS+++GL DLEAAVCLCTAI+AN+LGIN
Sbjct  48   SCPRDALKLGVCAKLLNGTIGGVVGNPPDTPCCSVLSGLVDLEAAVCLCTAIKANVLGIN  107

Query  223  lnvplslslvlnnCGRQLPNGFTC  294
            +N+P+SLSL++N CG+QLP+ F C
Sbjct  108  INIPISLSLLINTCGKQLPSDFIC  131



>gb|KHG02760.1| 14 kDa proline-rich DC2 [Gossypium arboreum]
Length=132

 Score = 78.2 bits (191),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 59/84 (70%), Positives = 69/84 (82%), Gaps = 1/84 (1%)
 Frame = +1

Query  43   RCPRDALKlgvcanllgglvgvvIGTPPTLPCCSLIAGLADLEAAVCLCTAIRANILGIn  222
            RCPRDALKLGVCAN+L  +    +G+PP +PCCSL+ GL DLEAA CLCTAIRANILGIN
Sbjct  50   RCPRDALKLGVCANVLNLVNVT-VGSPPVMPCCSLLNGLVDLEAAACLCTAIRANILGIN  108

Query  223  lnvplslslvlnnCGRQLPNGFTC  294
            LN+P+SLSL+LN C R +P GF C
Sbjct  109  LNIPVSLSLLLNVCSRNVPTGFQC  132



>gb|ABP35529.1| proline-rich protein [Ipomoea batatas]
Length=132

 Score = 78.2 bits (191),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 62/84 (74%), Positives = 73/84 (87%), Gaps = 0/84 (0%)
 Frame = +1

Query  43   RCPRDALKlgvcanllgglvgvvIGTPPTLPCCSLIAGLADLEAAVCLCTAIRANILGIn  222
            +CP+DALKLGVCAN+LG L+G+V+G PP  PCCS I GL DLEAAVCLCTAI+AN+LGIN
Sbjct  48   KCPKDALKLGVCANVLGNLLGLVVGNPPKKPCCSFIEGLVDLEAAVCLCTAIKANVLGIN  107

Query  223  lnvplslslvlnnCGRQLPNGFTC  294
            LNVPLSLSL LN CG+++P GF C
Sbjct  108  LNVPLSLSLFLNVCGKKVPFGFQC  131



>ref|XP_010093705.1| hypothetical protein L484_019046 [Morus notabilis]
 gb|EXB54485.1| hypothetical protein L484_019046 [Morus notabilis]
Length=114

 Score = 77.8 bits (190),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 59/84 (70%), Positives = 75/84 (89%), Gaps = 0/84 (0%)
 Frame = +1

Query  43   RCPRDALKlgvcanllgglvgvvIGTPPTLPCCSLIAGLADLEAAVCLCTAIRANILGIn  222
            +CPRDALKLGVCA++L G VGVV+G+PP +PCCSL+ GL DLEAAVCLCTAI+ANILGIN
Sbjct  30   KCPRDALKLGVCADVLKGPVGVVVGSPPDVPCCSLLEGLIDLEAAVCLCTAIKANILGIN  89

Query  223  lnvplslslvlnnCGRQLPNGFTC  294
            LN+P+SLSL+++ C + +P+GF C
Sbjct  90   LNIPISLSLLISTCRKDIPSGFQC  113



>ref|XP_011018291.1| PREDICTED: 14 kDa proline-rich protein DC2.15 [Populus euphratica]
Length=131

 Score = 78.2 bits (191),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 57/84 (68%), Positives = 73/84 (87%), Gaps = 0/84 (0%)
 Frame = +1

Query  43   RCPRDALKlgvcanllgglvgvvIGTPPTLPCCSLIAGLADLEAAVCLCTAIRANILGIn  222
            RCPRDALKLGVCA LL G +G V+G+PP  PCC+++ GL DLEAAVCLCTAI+ANILGIN
Sbjct  47   RCPRDALKLGVCAKLLNGAIGGVVGSPPDTPCCTVLQGLVDLEAAVCLCTAIKANILGIN  106

Query  223  lnvplslslvlnnCGRQLPNGFTC  294
            +++P+SLSL++N CG++LP+ F C
Sbjct  107  IDIPISLSLLINTCGKKLPSDFIC  130



>ref|XP_010053929.1| PREDICTED: 14 kDa proline-rich protein DC2.15 [Eucalyptus grandis]
 gb|KCW78308.1| hypothetical protein EUGRSUZ_D02488 [Eucalyptus grandis]
Length=133

 Score = 78.2 bits (191),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 62/83 (75%), Positives = 71/83 (86%), Gaps = 0/83 (0%)
 Frame = +1

Query  46   CPRDALKlgvcanllgglvgvvIGTPPTLPCCSLIAGLADLEAAVCLCTAIRANILGInl  225
            CPRD LKLGVCANLL  L+ +V+GTPP  PCCSLI GLADLEAAVCLCTAI+ANILG NL
Sbjct  50   CPRDTLKLGVCANLLNDLLHLVVGTPPKTPCCSLIEGLADLEAAVCLCTAIKANILGNNL  109

Query  226  nvplslslvlnnCGRQLPNGFTC  294
            N+P+SLSL+LN CG+ +P GF C
Sbjct  110  NIPISLSLLLNYCGQGVPKGFQC  132



>ref|XP_008344389.1| PREDICTED: lipid transfer protein EARLI 1-like, partial [Malus 
domestica]
Length=136

 Score = 78.2 bits (191),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 59/84 (70%), Positives = 70/84 (83%), Gaps = 0/84 (0%)
 Frame = +1

Query  43   RCPRDALKlgvcanllgglvgvvIGTPPTLPCCSLIAGLADLEAAVCLCTAIRANILGIn  222
             CP+D LKLGVC NLL  LV +V+GTPP  PCCSL+ GLADLEAAVCLCTAI+AN+LGIN
Sbjct  52   SCPKDVLKLGVCGNLLNDLVNIVVGTPPKTPCCSLVGGLADLEAAVCLCTAIKANVLGIN  111

Query  223  lnvplslslvlnnCGRQLPNGFTC  294
            L+VP+SL L+LN CG+ +P GF C
Sbjct  112  LDVPVSLGLLLNYCGKSIPKGFHC  135



>ref|XP_011081229.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Sesamum indicum]
Length=133

 Score = 78.2 bits (191),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 60/84 (71%), Positives = 73/84 (87%), Gaps = 0/84 (0%)
 Frame = +1

Query  43   RCPRDALKlgvcanllgglvgvvIGTPPTLPCCSLIAGLADLEAAVCLCTAIRANILGIn  222
            +CP+D LKLGVCANLL  LV +V+GTPP  PCC+LI GLADLEAAVCLCTAI+AN+LG +
Sbjct  49   KCPKDTLKLGVCANLLNDLVHLVVGTPPKTPCCTLIKGLADLEAAVCLCTAIKANVLGND  108

Query  223  lnvplslslvlnnCGRQLPNGFTC  294
            LN+PLSLSL+LN CG+++P GF C
Sbjct  109  LNIPLSLSLLLNYCGKKVPTGFQC  132



>ref|XP_006417265.1| hypothetical protein EUTSA_v10009083mg [Eutrema salsugineum]
 gb|ESQ35618.1| hypothetical protein EUTSA_v10009083mg [Eutrema salsugineum]
Length=134

 Score = 78.2 bits (191),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 58/84 (69%), Positives = 71/84 (85%), Gaps = 0/84 (0%)
 Frame = +1

Query  43   RCPRDALKlgvcanllgglvgvvIGTPPTLPCCSLIAGLADLEAAVCLCTAIRANILGIn  222
             CPRDALKLGVCA +L G VG VIG PP  PCCS++ GL DLEAAVCLCTAI+ANILGIN
Sbjct  50   SCPRDALKLGVCAKILDGAVGTVIGNPPDTPCCSVLQGLVDLEAAVCLCTAIKANILGIN  109

Query  223  lnvplslslvlnnCGRQLPNGFTC  294
            +++P+SLSL++N CG++LP+ F C
Sbjct  110  IDIPISLSLLINTCGKKLPSDFIC  133



>ref|XP_011018292.1| PREDICTED: 14 kDa proline-rich protein DC2.15 [Populus euphratica]
Length=140

 Score = 78.2 bits (191),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 61/84 (73%), Positives = 73/84 (87%), Gaps = 0/84 (0%)
 Frame = +1

Query  43   RCPRDALKlgvcanllgglvgvvIGTPPTLPCCSLIAGLADLEAAVCLCTAIRANILGIn  222
            RCP+DALKLGVCA+LLG L+ V IG+PP  PCCS+I GL DLEAAVCLCTAI+ANILGIN
Sbjct  56   RCPKDALKLGVCADLLGSLLNVTIGSPPVKPCCSVIQGLLDLEAAVCLCTAIKANILGIN  115

Query  223  lnvplslslvlnnCGRQLPNGFTC  294
            LN+PLSLSL++N CG+++P  F C
Sbjct  116  LNIPLSLSLLVNVCGKKVPKDFQC  139



>ref|XP_006289141.1| hypothetical protein CARUB_v10002564mg [Capsella rubella]
 gb|EOA22039.1| hypothetical protein CARUB_v10002564mg [Capsella rubella]
Length=135

 Score = 78.2 bits (191),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 58/84 (69%), Positives = 71/84 (85%), Gaps = 0/84 (0%)
 Frame = +1

Query  43   RCPRDALKlgvcanllgglvgvvIGTPPTLPCCSLIAGLADLEAAVCLCTAIRANILGIn  222
             CP+D LKLGVCAN+L  L+ + +GTPP  PCCSLI GL DLEAA CLCTAI+AN+LGIN
Sbjct  51   SCPKDTLKLGVCANVLKDLLKIELGTPPVKPCCSLIKGLVDLEAAACLCTAIKANVLGIN  110

Query  223  lnvplslslvlnnCGRQLPNGFTC  294
            LNVP+SLSL+LN CG+++P+GF C
Sbjct  111  LNVPVSLSLLLNVCGKKVPSGFKC  134



>ref|XP_006289733.1| hypothetical protein CARUB_v10003301mg [Capsella rubella]
 gb|EOA22631.1| hypothetical protein CARUB_v10003301mg [Capsella rubella]
Length=135

 Score = 78.2 bits (191),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 58/84 (69%), Positives = 71/84 (85%), Gaps = 0/84 (0%)
 Frame = +1

Query  43   RCPRDALKlgvcanllgglvgvvIGTPPTLPCCSLIAGLADLEAAVCLCTAIRANILGIn  222
             CP+D LKLGVCAN+L  L+ + +GTPP  PCCSLI GL DLEAA CLCTAI+AN+LGIN
Sbjct  51   SCPKDTLKLGVCANVLKDLLKIELGTPPVKPCCSLIKGLVDLEAAACLCTAIKANVLGIN  110

Query  223  lnvplslslvlnnCGRQLPNGFTC  294
            LNVP+SLSL+LN CG+++P+GF C
Sbjct  111  LNVPISLSLLLNVCGKKVPSGFVC  134



>ref|XP_007209745.1| hypothetical protein PRUPE_ppa013010mg [Prunus persica]
 gb|EMJ10944.1| hypothetical protein PRUPE_ppa013010mg [Prunus persica]
Length=144

 Score = 78.2 bits (191),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 61/84 (73%), Positives = 71/84 (85%), Gaps = 0/84 (0%)
 Frame = +1

Query  43   RCPRDALKlgvcanllgglvgvvIGTPPTLPCCSLIAGLADLEAAVCLCTAIRANILGIn  222
            RCPRD LKLGVCAN+L GL+ + IG PP  PCCSLI GLAD+EAAVCLCTAI+ANILGIN
Sbjct  60   RCPRDTLKLGVCANVLNGLLNITIGKPPVAPCCSLIQGLADVEAAVCLCTAIKANILGIN  119

Query  223  lnvplslslvlnnCGRQLPNGFTC  294
            LN+P+SLSL+LN CG ++P  F C
Sbjct  120  LNIPISLSLLLNVCGNKVPKDFQC  143



>ref|XP_010088890.1| hypothetical protein L484_020878 [Morus notabilis]
 gb|EXB37087.1| hypothetical protein L484_020878 [Morus notabilis]
Length=135

 Score = 77.8 bits (190),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 58/83 (70%), Positives = 71/83 (86%), Gaps = 0/83 (0%)
 Frame = +1

Query  46   CPRDALKlgvcanllgglvgvvIGTPPTLPCCSLIAGLADLEAAVCLCTAIRANILGInl  225
            CP+D LK GVCA+LL GL  V++GTPP  PCCSL+ GLAD+EAAVCLCTAI+AN+LGINL
Sbjct  52   CPKDTLKFGVCADLLNGLEHVIVGTPPVTPCCSLLKGLADVEAAVCLCTAIKANVLGINL  111

Query  226  nvplslslvlnnCGRQLPNGFTC  294
            N+P+SLSL+LN CG++ P GF C
Sbjct  112  NIPVSLSLLLNYCGKKAPKGFQC  134



>gb|KDP25644.1| hypothetical protein JCGZ_20800 [Jatropha curcas]
Length=128

 Score = 77.8 bits (190),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 60/84 (71%), Positives = 71/84 (85%), Gaps = 0/84 (0%)
 Frame = +1

Query  43   RCPRDALKlgvcanllgglvgvvIGTPPTLPCCSLIAGLADLEAAVCLCTAIRANILGIn  222
             CPRDALKLGVCA LL G VG V+G PP  PCCS++ GL DLEAAVCLCTAI+ANILGIN
Sbjct  44   SCPRDALKLGVCAKLLNGAVGGVVGNPPDHPCCSVLQGLVDLEAAVCLCTAIKANILGIN  103

Query  223  lnvplslslvlnnCGRQLPNGFTC  294
            +N+P+SLSL++N CG+QLP+ F C
Sbjct  104  INIPISLSLLINTCGKQLPSDFIC  127



>ref|XP_008338137.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Malus domestica]
 ref|XP_008389722.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Malus domestica]
Length=139

 Score = 77.8 bits (190),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 60/84 (71%), Positives = 71/84 (85%), Gaps = 0/84 (0%)
 Frame = +1

Query  43   RCPRDALKlgvcanllgglvgvvIGTPPTLPCCSLIAGLADLEAAVCLCTAIRANILGIn  222
             CPRD LKLGVCAN+L GL+ + +G PP  PCCSLI GLADLEAAVCLCTA++ANILGIN
Sbjct  55   SCPRDTLKLGVCANVLNGLLNISVGKPPVEPCCSLIQGLADLEAAVCLCTALKANILGIN  114

Query  223  lnvplslslvlnnCGRQLPNGFTC  294
            LN+P+SLSL+LN CG ++P GF C
Sbjct  115  LNIPVSLSLLLNVCGNKVPKGFQC  138



>ref|XP_011070106.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Sesamum indicum]
Length=127

 Score = 77.8 bits (190),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 64/84 (76%), Positives = 74/84 (88%), Gaps = 0/84 (0%)
 Frame = +1

Query  43   RCPRDALKlgvcanllgglvgvvIGTPPTLPCCSLIAGLADLEAAVCLCTAIRANILGIn  222
             CP+D LKLGVCA+LLGGL+G+ IGTPP  PCC+LI GLADLEAAVCLCTAI+ANILGIN
Sbjct  43   YCPKDTLKLGVCADLLGGLLGITIGTPPKTPCCTLIEGLADLEAAVCLCTAIKANILGIN  102

Query  223  lnvplslslvlnnCGRQLPNGFTC  294
            LNVPLSLSL+LN C +++P GF C
Sbjct  103  LNVPLSLSLLLNVCSKKVPKGFVC  126



>ref|XP_003559027.1| PREDICTED: putative glycine-rich cell wall structural protein 
1 [Brachypodium distachyon]
 gb|ACF22748.1| proline-rich protein [Brachypodium distachyon]
Length=186

 Score = 79.0 bits (193),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 61/84 (73%), Positives = 73/84 (87%), Gaps = 0/84 (0%)
 Frame = +1

Query  43   RCPRDALKlgvcanllgglvgvvIGTPPTLPCCSLIAGLADLEAAVCLCTAIRANILGIn  222
            RCP DALKLGVCAN+L GL+ + +GTPP  PCC+LI GLADLEAAVCLCTA+RANILGIN
Sbjct  102  RCPIDALKLGVCANVLNGLINLELGTPPKKPCCTLIQGLADLEAAVCLCTALRANILGIN  161

Query  223  lnvplslslvlnnCGRQLPNGFTC  294
            LNVP+ LSL++N CG+++P GF C
Sbjct  162  LNVPIDLSLLVNYCGKRVPTGFQC  185



>gb|EYU30296.1| hypothetical protein MIMGU_mgv1a015783mg [Erythranthe guttata]
Length=146

 Score = 78.2 bits (191),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 64/83 (77%), Positives = 74/83 (89%), Gaps = 0/83 (0%)
 Frame = +1

Query  46   CPRDALKlgvcanllgglvgvvIGTPPTLPCCSLIAGLADLEAAVCLCTAIRANILGInl  225
            CPRDALKLGVCA+LLGGL+G+ IG+PP  PCCSLI GLADLEAAVCLCTAI+AN+LGINL
Sbjct  63   CPRDALKLGVCADLLGGLIGLTIGSPPKTPCCSLIEGLADLEAAVCLCTAIKANVLGINL  122

Query  226  nvplslslvlnnCGRQLPNGFTC  294
            NVP+SLSL+LN C + +P GF C
Sbjct  123  NVPISLSLLLNVCSKNIPPGFQC  145



>ref|XP_010055514.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Eucalyptus 
grandis]
 gb|KCW71995.1| hypothetical protein EUGRSUZ_E00448 [Eucalyptus grandis]
Length=135

 Score = 77.8 bits (190),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 60/83 (72%), Positives = 71/83 (86%), Gaps = 0/83 (0%)
 Frame = +1

Query  46   CPRDALKlgvcanllgglvgvvIGTPPTLPCCSLIAGLADLEAAVCLCTAIRANILGInl  225
            CPRDALKLGVCA++LG L+ V +G PP  PCCSL+ GL DLEAAVCLCTAI+ANILGINL
Sbjct  52   CPRDALKLGVCADVLGNLLNVTVGKPPVTPCCSLLNGLVDLEAAVCLCTAIKANILGINL  111

Query  226  nvplslslvlnnCGRQLPNGFTC  294
            N+P+SLSL+LN C +Q+P GF C
Sbjct  112  NIPISLSLLLNVCSKQVPPGFKC  134



>emb|CDY31241.1| BnaC08g15360D [Brassica napus]
Length=132

 Score = 77.8 bits (190),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 58/84 (69%), Positives = 70/84 (83%), Gaps = 0/84 (0%)
 Frame = +1

Query  43   RCPRDALKlgvcanllgglvgvvIGTPPTLPCCSLIAGLADLEAAVCLCTAIRANILGIn  222
             CPRDALKLGVCA +L G VG VIG PP  PCCS + GL DLEAAVCLCTAI+ANILGI+
Sbjct  48   SCPRDALKLGVCAKILDGAVGTVIGNPPDTPCCSFLQGLVDLEAAVCLCTAIKANILGID  107

Query  223  lnvplslslvlnnCGRQLPNGFTC  294
            +N+P+SLSL++N CG++LP+ F C
Sbjct  108  INIPISLSLLINTCGKKLPSDFIC  131



>emb|CDY21034.1| BnaA08g24910D [Brassica napus]
Length=134

 Score = 77.8 bits (190),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 57/84 (68%), Positives = 70/84 (83%), Gaps = 0/84 (0%)
 Frame = +1

Query  43   RCPRDALKlgvcanllgglvgvvIGTPPTLPCCSLIAGLADLEAAVCLCTAIRANILGIn  222
             CPRDALKLGVCA +L G VG VIG PP  PCCS + GL DLEAAVCLCTAI+ANILGI+
Sbjct  50   SCPRDALKLGVCAKILDGAVGTVIGNPPDTPCCSFLQGLVDLEAAVCLCTAIKANILGID  109

Query  223  lnvplslslvlnnCGRQLPNGFTC  294
            +++P+SLSL++N CG++LP+ F C
Sbjct  110  IDIPISLSLLINTCGKKLPSDFIC  133



>ref|XP_011081227.1| PREDICTED: pEARLI1-like lipid transfer protein 1 [Sesamum indicum]
Length=139

 Score = 77.8 bits (190),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 64/83 (77%), Positives = 74/83 (89%), Gaps = 0/83 (0%)
 Frame = +1

Query  46   CPRDALKlgvcanllgglvgvvIGTPPTLPCCSLIAGLADLEAAVCLCTAIRANILGInl  225
            CPRDALKLGVCANLLGGL+ + IGTPP  PCC+LI GLAD+EAAVCLCTAI+AN+LGINL
Sbjct  56   CPRDALKLGVCANLLGGLIDLTIGTPPKTPCCTLIEGLADVEAAVCLCTAIKANVLGINL  115

Query  226  nvplslslvlnnCGRQLPNGFTC  294
            NVPLSLSL+LN C +++P GF C
Sbjct  116  NVPLSLSLLLNVCSKKVPPGFQC  138



>ref|XP_010264241.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Nelumbo nucifera]
Length=134

 Score = 77.8 bits (190),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 65/83 (78%), Positives = 73/83 (88%), Gaps = 1/83 (1%)
 Frame = +1

Query  46   CPRDALKlgvcanllgglvgvvIGTPPTLPCCSLIAGLADLEAAVCLCTAIRANILGInl  225
            CPRDALKLGVCAN+L  +  V +GTPP LPCCSLI GLA+LEAAVCLCTAI+ANILGINL
Sbjct  52   CPRDALKLGVCANVLNLVNVV-VGTPPYLPCCSLIQGLANLEAAVCLCTAIKANILGINL  110

Query  226  nvplslslvlnnCGRQLPNGFTC  294
            N+PLSLSLVLNNCG++ P GF C
Sbjct  111  NIPLSLSLVLNNCGKKFPTGFQC  133



>ref|XP_009110670.1| PREDICTED: 14 kDa proline-rich protein DC2.15 [Brassica rapa]
Length=134

 Score = 77.8 bits (190),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 57/84 (68%), Positives = 70/84 (83%), Gaps = 0/84 (0%)
 Frame = +1

Query  43   RCPRDALKlgvcanllgglvgvvIGTPPTLPCCSLIAGLADLEAAVCLCTAIRANILGIn  222
             CPRDALKLGVCA +L G VG VIG PP  PCCS + GL DLEAAVCLCTAI+ANILGI+
Sbjct  50   SCPRDALKLGVCAKILDGAVGTVIGNPPDTPCCSFLQGLVDLEAAVCLCTAIKANILGID  109

Query  223  lnvplslslvlnnCGRQLPNGFTC  294
            +++P+SLSL++N CG++LP+ F C
Sbjct  110  IDIPISLSLLINTCGKKLPSDFIC  133



>ref|XP_009589966.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Nicotiana 
tomentosiformis]
 dbj|BAB16431.1| P-rich protein NtEIG-C29 [Nicotiana tabacum]
Length=130

 Score = 77.4 bits (189),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 63/84 (75%), Positives = 75/84 (89%), Gaps = 0/84 (0%)
 Frame = +1

Query  43   RCPRDALKlgvcanllgglvgvvIGTPPTLPCCSLIAGLADLEAAVCLCTAIRANILGIn  222
            +CP D LKLGVCAN+LG L+G+VIG PP  PCC+LI G+ADLEAA+CLCTAI+ANILGIN
Sbjct  46   KCPIDTLKLGVCANVLGNLLGLVIGNPPKKPCCTLIQGVADLEAAICLCTAIKANILGIN  105

Query  223  lnvplslslvlnnCGRQLPNGFTC  294
            LNVPLSLSL+LN CG+Q+P+GF C
Sbjct  106  LNVPLSLSLLLNVCGKQVPSGFQC  129



>ref|XP_006367623.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Solanum tuberosum]
Length=125

 Score = 77.4 bits (189),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 66/84 (79%), Positives = 73/84 (87%), Gaps = 1/84 (1%)
 Frame = +1

Query  43   RCPRDALKlgvcanllgglvgvvIGTPPTLPCCSLIAGLADLEAAVCLCTAIRANILGIn  222
            +CP DALKLGVCAN+L  +  V +G+PPTLPCCSLI GL DLEAAVCLCTAIRAN+LGIN
Sbjct  43   KCPIDALKLGVCANVLNLVNVV-VGSPPTLPCCSLIQGLVDLEAAVCLCTAIRANVLGIN  101

Query  223  lnvplslslvlnnCGRQLPNGFTC  294
            LN+PLSLSLVLNNCGR  P GFTC
Sbjct  102  LNIPLSLSLVLNNCGRNPPTGFTC  125



>dbj|BAA11854.1| extensin like protein [Populus nigra]
 dbj|BAA11855.1| extensin like protein [Populus nigra]
Length=141

 Score = 77.8 bits (190),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 61/84 (73%), Positives = 73/84 (87%), Gaps = 0/84 (0%)
 Frame = +1

Query  43   RCPRDALKlgvcanllgglvgvvIGTPPTLPCCSLIAGLADLEAAVCLCTAIRANILGIn  222
            +CP+DALKLGVCA+LLG L+ V +GTPP  PCCS+I GL DLEAAVCLCTAI+ANILGIN
Sbjct  57   KCPKDALKLGVCADLLGSLLNVTVGTPPVKPCCSVIQGLLDLEAAVCLCTAIKANILGIN  116

Query  223  lnvplslslvlnnCGRQLPNGFTC  294
            LN+PLSLSL+LN CG+++P  F C
Sbjct  117  LNIPLSLSLLLNVCGKKVPKDFQC  140



>tpg|DAA42812.1| TPA: hypothetical protein ZEAMMB73_664289 [Zea mays]
Length=189

 Score = 78.6 bits (192),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 60/84 (71%), Positives = 73/84 (87%), Gaps = 0/84 (0%)
 Frame = +1

Query  43   RCPRDALKlgvcanllgglvgvvIGTPPTLPCCSLIAGLADLEAAVCLCTAIRANILGIn  222
            RCP DALKLGVCANLL GL+   +GTPP  PCC+LI GLADLEAAVCLCT +RAN+LGIN
Sbjct  105  RCPVDALKLGVCANLLNGLINATLGTPPRTPCCTLIQGLADLEAAVCLCTVLRANVLGIN  164

Query  223  lnvplslslvlnnCGRQLPNGFTC  294
            LN+P++LSL++N CGR++P+GF C
Sbjct  165  LNLPINLSLLVNYCGRRVPSGFQC  188



>ref|XP_002533292.1| 14 kDa proline-rich protein DC2.15 precursor, putative [Ricinus 
communis]
 gb|EEF29086.1| 14 kDa proline-rich protein DC2.15 precursor, putative [Ricinus 
communis]
Length=137

 Score = 77.4 bits (189),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 56/84 (67%), Positives = 69/84 (82%), Gaps = 0/84 (0%)
 Frame = +1

Query  43   RCPRDALKlgvcanllgglvgvvIGTPPTLPCCSLIAGLADLEAAVCLCTAIRANILGIn  222
            +CPRD LKLGVC +LL  L+ V +GTPP  PCCSLIA L DLEAAVCLCT I+A++LGIN
Sbjct  53   KCPRDTLKLGVCVDLLKDLLSVTVGTPPKTPCCSLIADLVDLEAAVCLCTTIKASLLGIN  112

Query  223  lnvplslslvlnnCGRQLPNGFTC  294
            L+VP+ LSL+LN CG+++P GF C
Sbjct  113  LSVPVDLSLLLNYCGKKVPEGFKC  136



>ref|XP_006366172.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Solanum tuberosum]
Length=120

 Score = 77.0 bits (188),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 50/61 (82%), Positives = 56/61 (92%), Gaps = 0/61 (0%)
 Frame = +1

Query  112  IGTPPTLPCCSLIAGLADLEAAVCLCTAIRANILGInlnvplslslvlnnCGRQLPNGFT  291
            +G+PPTLPCCSLI GL DLEAAVCLCTAIRAN+LGINLNVPLSLSL+LN+CG+  P GFT
Sbjct  60   VGSPPTLPCCSLIQGLTDLEAAVCLCTAIRANVLGINLNVPLSLSLILNSCGKNPPTGFT  119

Query  292  C  294
            C
Sbjct  120  C  120



>ref|XP_010919520.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Elaeis guineensis]
Length=140

 Score = 77.4 bits (189),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 59/84 (70%), Positives = 70/84 (83%), Gaps = 0/84 (0%)
 Frame = +1

Query  43   RCPRDALKlgvcanllgglvgvvIGTPPTLPCCSLIAGLADLEAAVCLCTAIRANILGIn  222
             CPRDALK GVCAN+L GL+ V +G PP  PCCSL+ GLADLEAAVCLCTAI+ANILG N
Sbjct  56   SCPRDALKFGVCANVLQGLINVQLGNPPKKPCCSLLEGLADLEAAVCLCTAIKANILGTN  115

Query  223  lnvplslslvlnnCGRQLPNGFTC  294
            LNVP+ LSL+LN CG+++P G+ C
Sbjct  116  LNVPVDLSLLLNYCGKKVPAGYKC  139



>ref|XP_002271593.1| PREDICTED: 14 kDa proline-rich protein DC2.15 [Vitis vinifera]
 emb|CAN80709.1| hypothetical protein VITISV_033376 [Vitis vinifera]
 emb|CBI31903.3| unnamed protein product [Vitis vinifera]
Length=132

 Score = 77.0 bits (188),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 58/84 (69%), Positives = 69/84 (82%), Gaps = 0/84 (0%)
 Frame = +1

Query  43   RCPRDALKlgvcanllgglvgvvIGTPPTLPCCSLIAGLADLEAAVCLCTAIRANILGIn  222
             CPRDALKLGVCA LL G VG V+GTPP  PCCSL+ GL DLE A CLCTAI+ANILGI+
Sbjct  48   SCPRDALKLGVCAKLLNGTVGAVVGTPPVTPCCSLLEGLLDLEVAACLCTAIKANILGIH  107

Query  223  lnvplslslvlnnCGRQLPNGFTC  294
            L++P+SLSL++N CG++LP  F C
Sbjct  108  LDIPVSLSLLVNICGKKLPKDFQC  131



>ref|XP_009388030.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like isoform X1 
[Musa acuminata subsp. malaccensis]
Length=143

 Score = 77.4 bits (189),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 55/84 (65%), Positives = 72/84 (86%), Gaps = 0/84 (0%)
 Frame = +1

Query  43   RCPRDALKlgvcanllgglvgvvIGTPPTLPCCSLIAGLADLEAAVCLCTAIRANILGIn  222
            +CPRDALKLG+CAN+L GL+ V +GTPP  PCCSL+ GL DLEAAVCLCTA++ N+LG+ 
Sbjct  59   KCPRDALKLGICANVLRGLLNVTLGTPPKQPCCSLLEGLVDLEAAVCLCTALKGNVLGLK  118

Query  223  lnvplslslvlnnCGRQLPNGFTC  294
            LN+P+SLSL++N CG+++P GF C
Sbjct  119  LNIPVSLSLLINYCGKKVPKGFLC  142



>ref|XP_009795308.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Nicotiana 
sylvestris]
Length=132

 Score = 77.0 bits (188),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 63/84 (75%), Positives = 75/84 (89%), Gaps = 0/84 (0%)
 Frame = +1

Query  43   RCPRDALKlgvcanllgglvgvvIGTPPTLPCCSLIAGLADLEAAVCLCTAIRANILGIn  222
            +CP D LKLGVCAN+LG L+G+VIG PP  PCC+LI G+ADLEAAVCLCTAI+ANILGIN
Sbjct  48   KCPIDTLKLGVCANVLGNLLGLVIGNPPKKPCCTLIQGVADLEAAVCLCTAIKANILGIN  107

Query  223  lnvplslslvlnnCGRQLPNGFTC  294
            LNVPLSLSL+LN CG+++P+GF C
Sbjct  108  LNVPLSLSLLLNVCGKKVPSGFQC  131



>ref|XP_006304906.1| hypothetical protein CARUB_v10011959mg [Capsella rubella]
 gb|EOA37804.1| hypothetical protein CARUB_v10011959mg [Capsella rubella]
Length=138

 Score = 77.0 bits (188),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 59/84 (70%), Positives = 73/84 (87%), Gaps = 0/84 (0%)
 Frame = +1

Query  43   RCPRDALKlgvcanllgglvgvvIGTPPTLPCCSLIAGLADLEAAVCLCTAIRANILGIn  222
            +CP+D LKLGVCAN+L GL+ + +G PP  PCCSLI GLAD+EAAVCLCTA++AN+LGIN
Sbjct  55   KCPKDTLKLGVCANVLNGLLDLTLGKPPVEPCCSLIQGLADVEAAVCLCTALKANVLGIN  114

Query  223  lnvplslslvlnnCGRQLPNGFTC  294
            LNVP+SLSL+LN C +QLP+GF C
Sbjct  115  LNVPISLSLLLNVCSKQLPSGFQC  138



>ref|XP_008437101.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Cucumis melo]
Length=140

 Score = 77.0 bits (188),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 62/84 (74%), Positives = 71/84 (85%), Gaps = 0/84 (0%)
 Frame = +1

Query  43   RCPRDALKlgvcanllgglvgvvIGTPPTLPCCSLIAGLADLEAAVCLCTAIRANILGIn  222
            +CPRD LKLGVCA LLGGLV V IG PP  PCCSLI GLADLEAAVCLCTAI+AN+LG+N
Sbjct  57   KCPRDTLKLGVCAKLLGGLVDVTIGKPPVTPCCSLIEGLADLEAAVCLCTAIKANLLGLN  116

Query  223  lnvplslslvlnnCGRQLPNGFTC  294
            LN+P+SLSL+LN C + +P GF C
Sbjct  117  LNIPVSLSLLLNVCQKNVPKGFQC  140



>gb|KGN50238.1| hypothetical protein Csa_5G161870 [Cucumis sativus]
Length=130

 Score = 77.0 bits (188),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 55/84 (65%), Positives = 69/84 (82%), Gaps = 0/84 (0%)
 Frame = +1

Query  43   RCPRDALKlgvcanllgglvgvvIGTPPTLPCCSLIAGLADLEAAVCLCTAIRANILGIn  222
            +CP+DALK+GVCA LLGGLV + IG PP  PCC+L+ GLADLEAAVCLCTAI+A++LG  
Sbjct  47   KCPKDALKIGVCAKLLGGLVDLTIGKPPVTPCCTLVEGLADLEAAVCLCTAIKASVLGKM  106

Query  223  lnvplslslvlnnCGRQLPNGFTC  294
            + +PL LSL++N C + LPNGF C
Sbjct  107  IKIPLHLSLLINVCNKNLPNGFQC  130



>ref|XP_010422223.1| PREDICTED: lipid transfer protein EARLI 1-like isoform X2 [Camelina 
sativa]
Length=135

 Score = 77.0 bits (188),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 57/84 (68%), Positives = 70/84 (83%), Gaps = 0/84 (0%)
 Frame = +1

Query  43   RCPRDALKlgvcanllgglvgvvIGTPPTLPCCSLIAGLADLEAAVCLCTAIRANILGIn  222
             CPRD LKLGVCAN+L  L+ + +GTPP  PCCSL+ GL DLEAA CLCTA++AN+LGIN
Sbjct  51   SCPRDTLKLGVCANVLKDLLKIELGTPPVKPCCSLLNGLVDLEAAACLCTALKANVLGIN  110

Query  223  lnvplslslvlnnCGRQLPNGFTC  294
            LNVP+SLSL+LN CG++ P+GF C
Sbjct  111  LNVPISLSLLLNVCGKKFPSGFVC  134



>ref|XP_008238564.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Prunus mume]
Length=147

 Score = 77.4 bits (189),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 60/84 (71%), Positives = 71/84 (85%), Gaps = 0/84 (0%)
 Frame = +1

Query  43   RCPRDALKlgvcanllgglvgvvIGTPPTLPCCSLIAGLADLEAAVCLCTAIRANILGIn  222
            +CPRD LKLGVCAN+L GL+ + IG PP  PCCSLI GLAD+EAAVCLCTAI+ANILGIN
Sbjct  63   KCPRDTLKLGVCANVLNGLLNITIGKPPVAPCCSLIQGLADVEAAVCLCTAIKANILGIN  122

Query  223  lnvplslslvlnnCGRQLPNGFTC  294
            LN+P+SLSL+LN CG ++P  F C
Sbjct  123  LNIPISLSLLLNVCGNKVPKDFQC  146



>ref|XP_004152413.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Cucumis sativus]
 ref|XP_004171280.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Cucumis sativus]
Length=130

 Score = 77.0 bits (188),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 56/84 (67%), Positives = 69/84 (82%), Gaps = 0/84 (0%)
 Frame = +1

Query  43   RCPRDALKlgvcanllgglvgvvIGTPPTLPCCSLIAGLADLEAAVCLCTAIRANILGIn  222
            +CP+DALK+GVCA LLGGLV + IG PP  PCC+L+ GLADLEAAVCLCTAI+A++LG  
Sbjct  47   KCPKDALKIGVCAKLLGGLVDLTIGKPPVTPCCTLVEGLADLEAAVCLCTAIKASVLGKM  106

Query  223  lnvplslslvlnnCGRQLPNGFTC  294
            + +PL LSL+LN C + LPNGF C
Sbjct  107  IKIPLHLSLLLNVCNKNLPNGFQC  130



>ref|XP_010433379.1| PREDICTED: lipid transfer protein EARLI 1-like [Camelina sativa]
Length=135

 Score = 77.0 bits (188),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 57/84 (68%), Positives = 70/84 (83%), Gaps = 0/84 (0%)
 Frame = +1

Query  43   RCPRDALKlgvcanllgglvgvvIGTPPTLPCCSLIAGLADLEAAVCLCTAIRANILGIn  222
             CPRD LKLGVCANLL  L+ + +GTPP  PCCSL+ GL DLEAA CLCTA++AN++GI 
Sbjct  51   SCPRDTLKLGVCANLLKDLLKIELGTPPVKPCCSLLNGLVDLEAAACLCTALKANVIGIK  110

Query  223  lnvplslslvlnnCGRQLPNGFTC  294
            LNVP+SLSL+LN CGR++P+GF C
Sbjct  111  LNVPVSLSLLLNVCGRKVPSGFVC  134



>ref|XP_004165754.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Cucumis sativus]
 gb|KGN50241.1| HyPRP2 [Cucumis sativus]
Length=140

 Score = 77.0 bits (188),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 63/84 (75%), Positives = 71/84 (85%), Gaps = 0/84 (0%)
 Frame = +1

Query  43   RCPRDALKlgvcanllgglvgvvIGTPPTLPCCSLIAGLADLEAAVCLCTAIRANILGIn  222
            +CPRD LKLGVCA LLGGL+ + IG PP  PCCSLI GLADLEAAVCLCTAI+A+ILGIN
Sbjct  57   KCPRDTLKLGVCAKLLGGLLDITIGKPPVTPCCSLIEGLADLEAAVCLCTAIKADILGIN  116

Query  223  lnvplslslvlnnCGRQLPNGFTC  294
            LNVPLSLSL+LN C + +P GF C
Sbjct  117  LNVPLSLSLLLNVCQKNVPKGFQC  140



>ref|XP_010422222.1| PREDICTED: lipid transfer protein EARLI 1-like isoform X1 [Camelina 
sativa]
Length=135

 Score = 77.0 bits (188),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 57/84 (68%), Positives = 71/84 (85%), Gaps = 0/84 (0%)
 Frame = +1

Query  43   RCPRDALKlgvcanllgglvgvvIGTPPTLPCCSLIAGLADLEAAVCLCTAIRANILGIn  222
             CPRD LKLGVCAN+L  L+ + +GTPP  PCCSL+ GL DLEAA CLCTA++AN+LGIN
Sbjct  51   SCPRDTLKLGVCANVLKDLLKIELGTPPVKPCCSLLNGLVDLEAAACLCTALKANVLGIN  110

Query  223  lnvplslslvlnnCGRQLPNGFTC  294
            LNVP+SLSL+LN CG+++P+GF C
Sbjct  111  LNVPISLSLLLNVCGKKVPSGFVC  134



>ref|XP_010455699.1| PREDICTED: lipid transfer protein EARLI 1-like [Camelina sativa]
 ref|XP_010455700.1| PREDICTED: lipid transfer protein EARLI 1-like [Camelina sativa]
Length=135

 Score = 77.0 bits (188),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 57/84 (68%), Positives = 71/84 (85%), Gaps = 0/84 (0%)
 Frame = +1

Query  43   RCPRDALKlgvcanllgglvgvvIGTPPTLPCCSLIAGLADLEAAVCLCTAIRANILGIn  222
             CPRD LKLGVCAN+L  L+ + +GTPP  PCCSL+ GL DLEAA CLCTA++AN+LGIN
Sbjct  51   SCPRDTLKLGVCANVLKDLLKIELGTPPVKPCCSLLNGLVDLEAAACLCTALKANVLGIN  110

Query  223  lnvplslslvlnnCGRQLPNGFTC  294
            LNVP+SLSL+LN CG+++P+GF C
Sbjct  111  LNVPISLSLLLNVCGKKVPSGFVC  134



>ref|XP_010455698.1| PREDICTED: lipid transfer protein EARLI 1-like [Camelina sativa]
Length=135

 Score = 77.0 bits (188),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 57/84 (68%), Positives = 71/84 (85%), Gaps = 0/84 (0%)
 Frame = +1

Query  43   RCPRDALKlgvcanllgglvgvvIGTPPTLPCCSLIAGLADLEAAVCLCTAIRANILGIn  222
             CPRD LKLGVCAN+L  L+ + +GTPP  PCCSL+ GL DLEAA CLCTA++AN+LGIN
Sbjct  51   SCPRDTLKLGVCANVLKDLLKIELGTPPVKPCCSLLNGLVDLEAAACLCTALKANVLGIN  110

Query  223  lnvplslslvlnnCGRQLPNGFTC  294
            LNVP+SLSL+LN CG+++P+GF C
Sbjct  111  LNVPISLSLLLNVCGKKVPSGFVC  134



>ref|XP_009333630.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Pyrus x bretschneideri]
Length=135

 Score = 77.0 bits (188),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 59/84 (70%), Positives = 71/84 (85%), Gaps = 0/84 (0%)
 Frame = +1

Query  43   RCPRDALKlgvcanllgglvgvvIGTPPTLPCCSLIAGLADLEAAVCLCTAIRANILGIn  222
             CPRD LKLGVCAN+L GL+ + +G PP  PCCSLI GLAD+EAAVCLCTA++ANILGIN
Sbjct  51   SCPRDTLKLGVCANVLNGLLNISVGKPPVEPCCSLIQGLADIEAAVCLCTALKANILGIN  110

Query  223  lnvplslslvlnnCGRQLPNGFTC  294
            LN+P+SLSL+LN CG ++P GF C
Sbjct  111  LNIPISLSLLLNVCGNKVPKGFQC  134



>ref|XP_010422224.1| PREDICTED: lipid transfer protein EARLI 1-like [Camelina sativa]
Length=135

 Score = 77.0 bits (188),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 57/84 (68%), Positives = 71/84 (85%), Gaps = 0/84 (0%)
 Frame = +1

Query  43   RCPRDALKlgvcanllgglvgvvIGTPPTLPCCSLIAGLADLEAAVCLCTAIRANILGIn  222
             CPRD LKLGVCAN+L  L+ + +GTPP  PCCSL+ GL DLEAA CLCTA++AN+LGIN
Sbjct  51   SCPRDTLKLGVCANVLKDLLKIELGTPPVKPCCSLLNGLVDLEAAACLCTALKANVLGIN  110

Query  223  lnvplslslvlnnCGRQLPNGFTC  294
            LNVP+SLSL+LN CG+++P+GF C
Sbjct  111  LNVPISLSLLLNVCGKKVPSGFVC  134



>ref|XP_006355479.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Solanum tuberosum]
Length=131

 Score = 76.6 bits (187),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 59/84 (70%), Positives = 71/84 (85%), Gaps = 0/84 (0%)
 Frame = +1

Query  43   RCPRDALKlgvcanllgglvgvvIGTPPTLPCCSLIAGLADLEAAVCLCTAIRANILGIn  222
            +CP+DALKLGVCAN+L GL+ V +GTPP  PCCSLI  L DLEAAVCLCTA++ANILGIN
Sbjct  47   KCPKDALKLGVCANVLSGLLNVTLGTPPVKPCCSLIGNLVDLEAAVCLCTALKANILGIN  106

Query  223  lnvplslslvlnnCGRQLPNGFTC  294
            LN+P+SLSL+LN C + +P GF C
Sbjct  107  LNIPISLSLLLNVCSKDVPKGFIC  130



>ref|XP_010093706.1| hypothetical protein L484_019047 [Morus notabilis]
 gb|EXB54486.1| hypothetical protein L484_019047 [Morus notabilis]
Length=133

 Score = 76.6 bits (187),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 60/84 (71%), Positives = 71/84 (85%), Gaps = 0/84 (0%)
 Frame = +1

Query  43   RCPRDALKlgvcanllgglvgvvIGTPPTLPCCSLIAGLADLEAAVCLCTAIRANILGIn  222
            RCPRDALK+GVCAN+LGGLV   +G PP  PCC+LI GLADLEAA+CLCTAIRA+ILGIN
Sbjct  49   RCPRDALKIGVCANVLGGLVNATVGNPPVTPCCTLIQGLADLEAALCLCTAIRASILGIN  108

Query  223  lnvplslslvlnnCGRQLPNGFTC  294
            +N+P++LSL+LN C R  P GF C
Sbjct  109  INIPVNLSLLLNVCSRNSPPGFQC  132



>dbj|BAK05563.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=193

 Score = 77.8 bits (190),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 60/84 (71%), Positives = 72/84 (86%), Gaps = 0/84 (0%)
 Frame = +1

Query  43   RCPRDALKlgvcanllgglvgvvIGTPPTLPCCSLIAGLADLEAAVCLCTAIRANILGIn  222
            RCP DALKLGVCAN+L GL+ + +GTPP  PCC+LI GLADLEAAVCLCTA++ANILGIN
Sbjct  108  RCPIDALKLGVCANVLNGLINLQLGTPPKKPCCTLIQGLADLEAAVCLCTALKANILGIN  167

Query  223  lnvplslslvlnnCGRQLPNGFTC  294
            LNVP+ LSL++N CG+ +P GF C
Sbjct  168  LNVPIDLSLLVNYCGKNVPAGFQC  191



>ref|XP_004171279.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Cucumis sativus]
 gb|KGN50237.1| hypothetical protein Csa_5G161860 [Cucumis sativus]
Length=136

 Score = 76.6 bits (187),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 56/84 (67%), Positives = 69/84 (82%), Gaps = 0/84 (0%)
 Frame = +1

Query  43   RCPRDALKlgvcanllgglvgvvIGTPPTLPCCSLIAGLADLEAAVCLCTAIRANILGIn  222
            +CP+DALK+GVCA LLGGLV + IG PP  PCC+L+ GLADLEAAVCLCTAI+A++LG  
Sbjct  53   KCPKDALKIGVCAKLLGGLVDLTIGKPPVTPCCTLVQGLADLEAAVCLCTAIKASVLGKT  112

Query  223  lnvplslslvlnnCGRQLPNGFTC  294
            + +PL LSL+LN C + LPNGF C
Sbjct  113  IKIPLHLSLLLNVCNKNLPNGFQC  136



>ref|XP_010493734.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Camelina 
sativa]
Length=132

 Score = 76.6 bits (187),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 56/84 (67%), Positives = 71/84 (85%), Gaps = 0/84 (0%)
 Frame = +1

Query  43   RCPRDALKlgvcanllgglvgvvIGTPPTLPCCSLIAGLADLEAAVCLCTAIRANILGIn  222
             CP+DALKLGVCA +L G VG VIG PP  PCCS++ GL DLEAAVCLCTAI+ANILGIN
Sbjct  48   SCPKDALKLGVCAKILDGAVGTVIGNPPDTPCCSVLQGLVDLEAAVCLCTAIKANILGIN  107

Query  223  lnvplslslvlnnCGRQLPNGFTC  294
            +++P+SLSL+++ CG++LP+ F C
Sbjct  108  IDIPISLSLLISTCGKKLPSDFIC  131



>gb|AEX33654.1| lipid transfer protein [Uromyces hobsonii]
Length=137

 Score = 76.6 bits (187),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 59/84 (70%), Positives = 73/84 (87%), Gaps = 0/84 (0%)
 Frame = +1

Query  43   RCPRDALKlgvcanllgglvgvvIGTPPTLPCCSLIAGLADLEAAVCLCTAIRANILGIn  222
            +CP+D LKLGVCANLL  LV +V+G PP  PCC+L+ GLADLEAA+CLCTAI+AN+LGIN
Sbjct  50   KCPKDTLKLGVCANLLNDLVHLVVGAPPKTPCCTLLKGLADLEAALCLCTAIKANVLGIN  109

Query  223  lnvplslslvlnnCGRQLPNGFTC  294
            LNVP+SLSL+LN CG+++P GF C
Sbjct  110  LNVPVSLSLLLNYCGKKVPTGFQC  133



>ref|XP_010264240.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Nelumbo nucifera]
Length=132

 Score = 76.6 bits (187),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 58/84 (69%), Positives = 69/84 (82%), Gaps = 0/84 (0%)
 Frame = +1

Query  43   RCPRDALKlgvcanllgglvgvvIGTPPTLPCCSLIAGLADLEAAVCLCTAIRANILGIn  222
             CPRDALKLGVCA LL G VG  +G PP  PCC+L+ GL DLE A CLCTAI+ANILGIN
Sbjct  48   SCPRDALKLGVCAKLLNGAVGAEVGNPPDHPCCTLLEGLVDLEVAACLCTAIKANILGIN  107

Query  223  lnvplslslvlnnCGRQLPNGFTC  294
            LN+P+SLSL++N CG++LP+GF C
Sbjct  108  LNIPVSLSLLVNTCGKKLPSGFQC  131



>ref|XP_002270769.1| PREDICTED: 14 kDa proline-rich protein DC2.15 [Vitis vinifera]
 emb|CAN65287.1| hypothetical protein VITISV_042739 [Vitis vinifera]
Length=135

 Score = 76.6 bits (187),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 64/83 (77%), Positives = 74/83 (89%), Gaps = 0/83 (0%)
 Frame = +1

Query  46   CPRDALKlgvcanllgglvgvvIGTPPTLPCCSLIAGLADLEAAVCLCTAIRANILGInl  225
            CP+D LKLGVCANLLGGL+G V+GTPP  PCCSLI GLADLEAAVCLCTAI+AN+LGINL
Sbjct  52   CPKDTLKLGVCANLLGGLIGAVVGTPPKTPCCSLIQGLADLEAAVCLCTAIKANVLGINL  111

Query  226  nvplslslvlnnCGRQLPNGFTC  294
            N+PLSLSL+LN C +++P GF C
Sbjct  112  NIPLSLSLLLNVCSKKVPPGFQC  134



>ref|XP_009382414.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Musa acuminata 
subsp. malaccensis]
Length=145

 Score = 76.6 bits (187),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 57/84 (68%), Positives = 73/84 (87%), Gaps = 0/84 (0%)
 Frame = +1

Query  43   RCPRDALKlgvcanllgglvgvvIGTPPTLPCCSLIAGLADLEAAVCLCTAIRANILGIn  222
            RCPRDALKLGVCAN+LGGL+ + +GTPP  PCC+L+ GL DLEAAVCLCTA++ N+LG+ 
Sbjct  61   RCPRDALKLGVCANVLGGLLNITLGTPPKEPCCTLLQGLVDLEAAVCLCTALKGNVLGLV  120

Query  223  lnvplslslvlnnCGRQLPNGFTC  294
            LN+P+SLSL+LN CG+++P GF C
Sbjct  121  LNLPISLSLLLNYCGKEVPTGFLC  144



>ref|XP_004152415.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Cucumis sativus]
Length=136

 Score = 76.6 bits (187),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 56/84 (67%), Positives = 69/84 (82%), Gaps = 0/84 (0%)
 Frame = +1

Query  43   RCPRDALKlgvcanllgglvgvvIGTPPTLPCCSLIAGLADLEAAVCLCTAIRANILGIn  222
            +CP+DALK+GVCA LLGGLV + IG PP  PCC+L+ GLADLEAAVCLCTAI+A++LG  
Sbjct  53   KCPKDALKIGVCAKLLGGLVDLTIGKPPVTPCCTLVHGLADLEAAVCLCTAIKASVLGNK  112

Query  223  lnvplslslvlnnCGRQLPNGFTC  294
            + +PL LSL+LN C + LPNGF C
Sbjct  113  IKIPLHLSLLLNVCNKNLPNGFQC  136



>ref|XP_004152410.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Cucumis sativus]
Length=140

 Score = 76.6 bits (187),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 63/84 (75%), Positives = 71/84 (85%), Gaps = 0/84 (0%)
 Frame = +1

Query  43   RCPRDALKlgvcanllgglvgvvIGTPPTLPCCSLIAGLADLEAAVCLCTAIRANILGIn  222
            +CPRD LKLGVCA LLGGL+ + IG PP  PCCSLI GLADLEAAVCLCTAI+A+ILGIN
Sbjct  57   KCPRDTLKLGVCAKLLGGLLDITIGKPPVTPCCSLIDGLADLEAAVCLCTAIKADILGIN  116

Query  223  lnvplslslvlnnCGRQLPNGFTC  294
            LNVPLSLSL+LN C + +P GF C
Sbjct  117  LNVPLSLSLLLNVCQKNVPKGFQC  140



>ref|XP_009338026.1| PREDICTED: vegetative cell wall protein gp1-like [Pyrus x bretschneideri]
Length=334

 Score = 79.0 bits (193),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 59/84 (70%), Positives = 70/84 (83%), Gaps = 0/84 (0%)
 Frame = +1

Query  43   RCPRDALKlgvcanllgglvgvvIGTPPTLPCCSLIAGLADLEAAVCLCTAIRANILGIn  222
             CP+D LKLGVC NLL  LV +V+GTPP  PCCSL+ GLADLEAAVCLCTAI+AN+LGIN
Sbjct  250  SCPKDVLKLGVCGNLLNDLVNIVVGTPPKTPCCSLVGGLADLEAAVCLCTAIKANVLGIN  309

Query  223  lnvplslslvlnnCGRQLPNGFTC  294
            L+VP+SL L+LN CG+ +P GF C
Sbjct  310  LDVPVSLGLLLNYCGKSVPKGFQC  333



>ref|XP_009388037.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like isoform X2 
[Musa acuminata subsp. malaccensis]
Length=129

 Score = 76.3 bits (186),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 55/83 (66%), Positives = 71/83 (86%), Gaps = 0/83 (0%)
 Frame = +1

Query  46   CPRDALKlgvcanllgglvgvvIGTPPTLPCCSLIAGLADLEAAVCLCTAIRANILGInl  225
            CPRDALKLG+CAN+L GL+ V +GTPP  PCCSL+ GL DLEAAVCLCTA++ N+LG+ L
Sbjct  46   CPRDALKLGICANVLRGLLNVTLGTPPKQPCCSLLEGLVDLEAAVCLCTALKGNVLGLKL  105

Query  226  nvplslslvlnnCGRQLPNGFTC  294
            N+P+SLSL++N CG+++P GF C
Sbjct  106  NIPVSLSLLINYCGKKVPKGFLC  128



>ref|XP_010493743.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Camelina 
sativa]
Length=132

 Score = 76.3 bits (186),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 57/84 (68%), Positives = 71/84 (85%), Gaps = 0/84 (0%)
 Frame = +1

Query  43   RCPRDALKlgvcanllgglvgvvIGTPPTLPCCSLIAGLADLEAAVCLCTAIRANILGIn  222
             CP+DALKLGVCA +L G VG VIG PP  PCCS++ GL DLEAAVCLCTAI+ANILGIN
Sbjct  48   SCPKDALKLGVCAKILDGAVGTVIGNPPDAPCCSVLQGLVDLEAAVCLCTAIKANILGIN  107

Query  223  lnvplslslvlnnCGRQLPNGFTC  294
            +++P+SLSL++N CG++LP+ F C
Sbjct  108  IDIPISLSLLINTCGKKLPSDFIC  131



>ref|XP_008437105.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Cucumis melo]
Length=136

 Score = 76.3 bits (186),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 56/84 (67%), Positives = 69/84 (82%), Gaps = 0/84 (0%)
 Frame = +1

Query  43   RCPRDALKlgvcanllgglvgvvIGTPPTLPCCSLIAGLADLEAAVCLCTAIRANILGIn  222
            +CP+DALK+GVCA LLGGLV + IG PP  PCC+L+ GLADLEAAVCLCTAI+A++LG  
Sbjct  53   KCPKDALKIGVCAKLLGGLVDLTIGKPPVTPCCTLVQGLADLEAAVCLCTAIKASVLGNK  112

Query  223  lnvplslslvlnnCGRQLPNGFTC  294
            + +PL LSL+LN C + LPNGF C
Sbjct  113  IKIPLHLSLLLNVCNKNLPNGFQC  136



>ref|XP_009591583.1| PREDICTED: pEARLI1-like lipid transfer protein 1 [Nicotiana tomentosiformis]
Length=135

 Score = 76.3 bits (186),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 59/84 (70%), Positives = 71/84 (85%), Gaps = 0/84 (0%)
 Frame = +1

Query  43   RCPRDALKlgvcanllgglvgvvIGTPPTLPCCSLIAGLADLEAAVCLCTAIRANILGIn  222
            +CP DALKLGVCAN+L GL+ V +GTPP  PCCSLI  L DLEAAVCLCTA++ANILGIN
Sbjct  51   KCPTDALKLGVCANVLNGLLNVTLGTPPVKPCCSLIENLVDLEAAVCLCTALKANILGIN  110

Query  223  lnvplslslvlnnCGRQLPNGFTC  294
            LN+P+SL+L+LN C ++ P GFTC
Sbjct  111  LNLPISLNLLLNVCSKKAPKGFTC  134



>gb|ABQ88334.1| lipid transfer protein [Capsicum annuum]
Length=142

 Score = 76.6 bits (187),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 61/84 (73%), Positives = 75/84 (89%), Gaps = 0/84 (0%)
 Frame = +1

Query  43   RCPRDALKlgvcanllgglvgvvIGTPPTLPCCSLIAGLADLEAAVCLCTAIRANILGIn  222
            +CP DALKLG+CAN+LG L+GVV+G PP  PCCSLI GL DLEAA+CLCTA++ANILGIN
Sbjct  57   KCPVDALKLGICANVLGNLLGVVLGNPPKKPCCSLIQGLVDLEAALCLCTALKANILGIN  116

Query  223  lnvplslslvlnnCGRQLPNGFTC  294
            LNVP+SLSL+LN CG+++P+GF C
Sbjct  117  LNVPISLSLLLNVCGKKVPSGFQC  140



>gb|KDP25645.1| hypothetical protein JCGZ_20801 [Jatropha curcas]
Length=138

 Score = 76.3 bits (186),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 60/84 (71%), Positives = 71/84 (85%), Gaps = 0/84 (0%)
 Frame = +1

Query  43   RCPRDALKlgvcanllgglvgvvIGTPPTLPCCSLIAGLADLEAAVCLCTAIRANILGIn  222
            +CPRDALKLGVCA +LG L+ + IG PP  PCCSL+ GL DLEAAVCLCTAI+ANILGIN
Sbjct  54   KCPRDALKLGVCAKVLGSLLNITIGDPPVKPCCSLLEGLVDLEAAVCLCTAIKANILGIN  113

Query  223  lnvplslslvlnnCGRQLPNGFTC  294
            LNVPLSLSL+LN C +++P+ F C
Sbjct  114  LNVPLSLSLLLNVCSKKVPSDFQC  137



>ref|XP_008796820.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Phoenix dactylifera]
Length=124

 Score = 75.9 bits (185),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 57/84 (68%), Positives = 69/84 (82%), Gaps = 0/84 (0%)
 Frame = +1

Query  43   RCPRDALKlgvcanllgglvgvvIGTPPTLPCCSLIAGLADLEAAVCLCTAIRANILGIn  222
            +CP DALKLGVCAN+L GL+ + +G PP  PCCSL+ GL DLEAAVCLCTA+RANILGI 
Sbjct  40   KCPMDALKLGVCANVLKGLINLNLGKPPKKPCCSLLEGLVDLEAAVCLCTALRANILGIK  99

Query  223  lnvplslslvlnnCGRQLPNGFTC  294
            LN+P+ LSL+LN CG++ P GF C
Sbjct  100  LNLPIHLSLLLNYCGKKTPKGFQC  123



>ref|XP_006355478.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Solanum tuberosum]
Length=132

 Score = 76.3 bits (186),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 58/84 (69%), Positives = 71/84 (85%), Gaps = 0/84 (0%)
 Frame = +1

Query  43   RCPRDALKlgvcanllgglvgvvIGTPPTLPCCSLIAGLADLEAAVCLCTAIRANILGIn  222
            +CP+DALKLG+CAN+L GL+ V +GTPP  PCCSLI  L DLEAAVCLCTA++ANILGIN
Sbjct  48   KCPKDALKLGICANVLNGLLNVTLGTPPVKPCCSLIGNLVDLEAAVCLCTALKANILGIN  107

Query  223  lnvplslslvlnnCGRQLPNGFTC  294
            LN+P+SLSL+LN C ++ P GF C
Sbjct  108  LNIPISLSLLLNVCSKEAPKGFIC  131



>ref|XP_002529775.1| 14 kDa proline-rich protein DC2.15 precursor, putative [Ricinus 
communis]
 gb|EEF32589.1| 14 kDa proline-rich protein DC2.15 precursor, putative [Ricinus 
communis]
Length=139

 Score = 76.3 bits (186),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 60/84 (71%), Positives = 71/84 (85%), Gaps = 0/84 (0%)
 Frame = +1

Query  43   RCPRDALKlgvcanllgglvgvvIGTPPTLPCCSLIAGLADLEAAVCLCTAIRANILGIn  222
            +CPRDALKLGVCA++LG L+ + IG PP  PCCSLI GL DLEAAVCLCTAI+ANILGIN
Sbjct  55   KCPRDALKLGVCADVLGSLLNITIGKPPVEPCCSLIQGLVDLEAAVCLCTAIKANILGIN  114

Query  223  lnvplslslvlnnCGRQLPNGFTC  294
            LN+PLSLSL+LN C ++ P+ F C
Sbjct  115  LNIPLSLSLLLNVCSKKTPSDFQC  138



>ref|XP_010476166.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Camelina 
sativa]
Length=143

 Score = 76.3 bits (186),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 58/84 (69%), Positives = 73/84 (87%), Gaps = 0/84 (0%)
 Frame = +1

Query  43   RCPRDALKlgvcanllgglvgvvIGTPPTLPCCSLIAGLADLEAAVCLCTAIRANILGIn  222
            +CP+D LKLGVCAN+L GL+ + +G PP  PCCSLI GLA+LEAAVCLCTA++AN+LGIN
Sbjct  59   KCPKDTLKLGVCANVLNGLLDLTLGKPPVEPCCSLIQGLANLEAAVCLCTALKANVLGIN  118

Query  223  lnvplslslvlnnCGRQLPNGFTC  294
            LN+P+SLSL+LN C +QLP+GF C
Sbjct  119  LNLPISLSLLLNVCSKQLPSGFQC  142



>emb|CAI51313.1| arachidonic acid-induced DEA1 [Capsicum chinense]
Length=142

 Score = 76.3 bits (186),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 61/84 (73%), Positives = 75/84 (89%), Gaps = 0/84 (0%)
 Frame = +1

Query  43   RCPRDALKlgvcanllgglvgvvIGTPPTLPCCSLIAGLADLEAAVCLCTAIRANILGIn  222
            +CP DALKLG+CAN+LG L+GVV+G PP  PCCSLI GL DLEAA+CLCTA++ANILGIN
Sbjct  57   KCPIDALKLGICANVLGNLLGVVLGNPPKKPCCSLIQGLVDLEAALCLCTALKANILGIN  116

Query  223  lnvplslslvlnnCGRQLPNGFTC  294
            LNVP+SLSL+LN CG+++P+GF C
Sbjct  117  LNVPISLSLLLNVCGKKVPSGFQC  140



>ref|XP_002511665.1| 14 kDa proline-rich protein DC2.15 precursor, putative [Ricinus 
communis]
 gb|EEF50334.1| 14 kDa proline-rich protein DC2.15 precursor, putative [Ricinus 
communis]
Length=139

 Score = 76.3 bits (186),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 61/84 (73%), Positives = 72/84 (86%), Gaps = 0/84 (0%)
 Frame = +1

Query  43   RCPRDALKlgvcanllgglvgvvIGTPPTLPCCSLIAGLADLEAAVCLCTAIRANILGIn  222
             CP++ALKLGVCA+LL  LV +V+GTPP  PCC LI GLADLEAAVCLCTA++ANILGIN
Sbjct  55   SCPKNALKLGVCADLLNDLVHLVVGTPPKEPCCPLIQGLADLEAAVCLCTALKANILGIN  114

Query  223  lnvplslslvlnnCGRQLPNGFTC  294
            LNVP+SLSL+LN CG+ +P GF C
Sbjct  115  LNVPVSLSLLLNYCGKGVPAGFQC  138



>ref|XP_010553464.1| PREDICTED: 14 kDa proline-rich protein DC2.15 [Tarenaya hassleriana]
Length=128

 Score = 75.9 bits (185),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 57/84 (68%), Positives = 70/84 (83%), Gaps = 0/84 (0%)
 Frame = +1

Query  43   RCPRDALKlgvcanllgglvgvvIGTPPTLPCCSLIAGLADLEAAVCLCTAIRANILGIn  222
             CPRDALKLGVCA +L G VG V+G PP +PCCS++ GL DLEAAVCLCTAI+ANILGI+
Sbjct  44   SCPRDALKLGVCAKILDGAVGTVVGGPPDMPCCSVLQGLVDLEAAVCLCTAIKANILGID  103

Query  223  lnvplslslvlnnCGRQLPNGFTC  294
            +N+P+SLSL++N CG+ LP  F C
Sbjct  104  INIPISLSLLINTCGKSLPPDFVC  127



>ref|XP_006368194.1| HyPRP family protein [Populus trichocarpa]
 gb|ABK92650.1| unknown [Populus trichocarpa]
 gb|ERP64763.1| HyPRP family protein [Populus trichocarpa]
Length=140

 Score = 75.9 bits (185),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 58/84 (69%), Positives = 73/84 (87%), Gaps = 0/84 (0%)
 Frame = +1

Query  43   RCPRDALKlgvcanllgglvgvvIGTPPTLPCCSLIAGLADLEAAVCLCTAIRANILGIn  222
            +CP+DALKLGVCA+LLG L+ V IG+PP  PCCS+I GL DLEAA+CLCTAI+ANILGIN
Sbjct  56   KCPKDALKLGVCADLLGSLLNVTIGSPPVKPCCSVIQGLLDLEAAICLCTAIKANILGIN  115

Query  223  lnvplslslvlnnCGRQLPNGFTC  294
            LN+P+SLSL++N CG+++P  F C
Sbjct  116  LNIPISLSLLINVCGKKVPKDFQC  139



>ref|XP_010906607.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Elaeis guineensis]
Length=129

 Score = 75.9 bits (185),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 56/84 (67%), Positives = 72/84 (86%), Gaps = 0/84 (0%)
 Frame = +1

Query  43   RCPRDALKlgvcanllgglvgvvIGTPPTLPCCSLIAGLADLEAAVCLCTAIRANILGIn  222
            +CP DALKLGVCA++L GL+ V IGTPP  PCCSL++GL DLE AVCLCT I+A+ILGIN
Sbjct  45   KCPIDALKLGVCADVLSGLLNVTIGTPPKEPCCSLLSGLVDLEVAVCLCTVIKASILGIN  104

Query  223  lnvplslslvlnnCGRQLPNGFTC  294
            LN+P+ LSL++N CG+++P+GF C
Sbjct  105  LNIPVDLSLLVNYCGKKVPSGFQC  128



>ref|NP_001235008.1| uncharacterized protein LOC100499716 precursor [Glycine max]
 gb|ACU13356.1| unknown [Glycine max]
Length=170

 Score = 76.6 bits (187),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 61/83 (73%), Positives = 70/83 (84%), Gaps = 0/83 (0%)
 Frame = +1

Query  46   CPRDALKlgvcanllgglvgvvIGTPPTLPCCSLIAGLADLEAAVCLCTAIRANILGInl  225
            CPRDALKLGVCAN+L GL+ V +G PP  PCCSL+ GL DLEAAVCLCTA+RANILGINL
Sbjct  87   CPRDALKLGVCANVLNGLLNVTLGQPPVTPCCSLLNGLVDLEAAVCLCTALRANILGINL  146

Query  226  nvplslslvlnnCGRQLPNGFTC  294
            N+P+SLSL+LN C RQ+P  F C
Sbjct  147  NLPISLSLLLNVCSRQVPRDFQC  169



>ref|XP_006368193.1| hypothetical protein POPTR_0001s00400g [Populus trichocarpa]
 gb|ERP64762.1| hypothetical protein POPTR_0001s00400g [Populus trichocarpa]
Length=128

 Score = 75.5 bits (184),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 56/84 (67%), Positives = 72/84 (86%), Gaps = 0/84 (0%)
 Frame = +1

Query  43   RCPRDALKlgvcanllgglvgvvIGTPPTLPCCSLIAGLADLEAAVCLCTAIRANILGIn  222
             CPRDALKLGVCA LL G +G V+G+PP  PCC+++ GL DLEAAVCLCTAI+ANILGIN
Sbjct  44   SCPRDALKLGVCAKLLNGAIGGVVGSPPDTPCCTVLQGLVDLEAAVCLCTAIKANILGIN  103

Query  223  lnvplslslvlnnCGRQLPNGFTC  294
            +++P+SLSL++N CG++LP+ F C
Sbjct  104  IDIPISLSLLINTCGKKLPSDFIC  127



>ref|XP_009783170.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Nicotiana 
sylvestris]
Length=126

 Score = 75.5 bits (184),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 59/84 (70%), Positives = 71/84 (85%), Gaps = 0/84 (0%)
 Frame = +1

Query  43   RCPRDALKlgvcanllgglvgvvIGTPPTLPCCSLIAGLADLEAAVCLCTAIRANILGIn  222
            +CP DALKLGVCAN+L GL+ V +GTPP  PCCSL+  L DLEAAVCLCTA++ANILGIN
Sbjct  42   KCPTDALKLGVCANVLNGLLNVTLGTPPVKPCCSLLGNLVDLEAAVCLCTALKANILGIN  101

Query  223  lnvplslslvlnnCGRQLPNGFTC  294
            LN+P+SLSL+LN C + +P GFTC
Sbjct  102  LNIPISLSLLLNVCSKDIPKGFTC  125



>ref|XP_009411010.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Musa acuminata 
subsp. malaccensis]
Length=137

 Score = 75.9 bits (185),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 57/83 (69%), Positives = 68/83 (82%), Gaps = 0/83 (0%)
 Frame = +1

Query  46   CPRDALKlgvcanllgglvgvvIGTPPTLPCCSLIAGLADLEAAVCLCTAIRANILGInl  225
            CP DALKLG CAN+L GL+   +G PP  PCCSLI GL DLEAAVCLCTAI+AN+LGI+L
Sbjct  54   CPVDALKLGGCANVLDGLIHAKVGEPPKEPCCSLIDGLVDLEAAVCLCTAIKANVLGIHL  113

Query  226  nvplslslvlnnCGRQLPNGFTC  294
            N+P++LSL+LN CG+Q P GF C
Sbjct  114  NLPINLSLLLNYCGKQSPTGFKC  136



>ref|XP_010041843.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Eucalyptus 
grandis]
 ref|XP_010042382.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Eucalyptus 
grandis]
Length=121

 Score = 75.1 bits (183),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 59/84 (70%), Positives = 70/84 (83%), Gaps = 0/84 (0%)
 Frame = +1

Query  43   RCPRDALKlgvcanllgglvgvvIGTPPTLPCCSLIAGLADLEAAVCLCTAIRANILGIn  222
             CP +ALKLGVC +LLG LV V +GTPP  PCCSLI GL DLEAAVCLCTAIRAN+LG++
Sbjct  37   SCPENALKLGVCLDLLGSLVNVTVGTPPKEPCCSLIQGLVDLEAAVCLCTAIRANVLGLH  96

Query  223  lnvplslslvlnnCGRQLPNGFTC  294
            L+VPLSLSL+LN C +++P GF C
Sbjct  97   LDVPLSLSLLLNVCSKKVPPGFQC  120



>ref|XP_009601879.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Nicotiana 
tomentosiformis]
Length=128

 Score = 75.5 bits (184),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 59/84 (70%), Positives = 70/84 (83%), Gaps = 0/84 (0%)
 Frame = +1

Query  43   RCPRDALKlgvcanllgglvgvvIGTPPTLPCCSLIAGLADLEAAVCLCTAIRANILGIn  222
            +CP DALKLGVCAN+L GL+ V +GTPP  PCCSLI  L DLEAAVCLCTA++ANILGIN
Sbjct  44   KCPTDALKLGVCANVLNGLLNVTLGTPPVKPCCSLIGNLVDLEAAVCLCTALKANILGIN  103

Query  223  lnvplslslvlnnCGRQLPNGFTC  294
            LN+P+SLSL+LN C + +P GF C
Sbjct  104  LNIPISLSLLLNVCSKDIPKGFAC  127



>ref|XP_011033953.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Populus euphratica]
Length=137

 Score = 75.5 bits (184),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 59/84 (70%), Positives = 72/84 (86%), Gaps = 0/84 (0%)
 Frame = +1

Query  43   RCPRDALKlgvcanllgglvgvvIGTPPTLPCCSLIAGLADLEAAVCLCTAIRANILGIn  222
            +CP+DALKLGVCA+LLG L+ V +G PP  PCCS+I GL DLE+AVCLCTAI+ANILGIN
Sbjct  53   KCPKDALKLGVCADLLGSLLNVTVGNPPVKPCCSVIQGLLDLESAVCLCTAIKANILGIN  112

Query  223  lnvplslslvlnnCGRQLPNGFTC  294
            LN+PLSLSL+LN CG+++P  F C
Sbjct  113  LNIPLSLSLLLNVCGKKVPKDFQC  136



>ref|NP_001148300.1| cortical cell-delineating protein precursor [Zea mays]
 gb|ACG30459.1| cortical cell-delineating protein precursor [Zea mays]
 gb|AFW72687.1| cortical cell-delineating protein [Zea mays]
Length=128

 Score = 75.1 bits (183),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 49/84 (58%), Positives = 66/84 (79%), Gaps = 1/84 (1%)
 Frame = +1

Query  43   RCPRDALKlgvcanllgglvgvvIGTPPTLPCCSLIAGLADLEAAVCLCTAIRANILGIn  222
            +CP+ ALK   CAN+LG +    +G PP  PCCS++ GLADLEAAVCLCTAI+AN+LGI 
Sbjct  45   KCPKHALKFAACANVLGLVSAE-VGHPPAEPCCSILGGLADLEAAVCLCTAIKANVLGIT  103

Query  223  lnvplslslvlnnCGRQLPNGFTC  294
            +++P+ LSL++N CG+ LP+GF C
Sbjct  104  VDIPVKLSLIINYCGKNLPSGFIC  127



>ref|XP_002874779.1| hypothetical protein ARALYDRAFT_911652 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH51038.1| hypothetical protein ARALYDRAFT_911652 [Arabidopsis lyrata subsp. 
lyrata]
Length=129

 Score = 75.5 bits (184),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 56/84 (67%), Positives = 69/84 (82%), Gaps = 0/84 (0%)
 Frame = +1

Query  43   RCPRDALKlgvcanllgglvgvvIGTPPTLPCCSLIAGLADLEAAVCLCTAIRANILGIn  222
             CPRD LKLGVCAN+L  L+ + +GTPP  PCCSL+ GL DLEAA CLCTA++AN+LG  
Sbjct  45   SCPRDTLKLGVCANVLKDLLKIQLGTPPVKPCCSLLKGLVDLEAAACLCTALKANVLGNK  104

Query  223  lnvplslslvlnnCGRQLPNGFTC  294
            LNVP+SLSL+LN CGR++P+GF C
Sbjct  105  LNVPVSLSLLLNVCGRKVPSGFVC  128



>gb|KFK31985.1| hypothetical protein AALP_AA6G185200 [Arabis alpina]
Length=133

 Score = 75.5 bits (184),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 52/84 (62%), Positives = 71/84 (85%), Gaps = 0/84 (0%)
 Frame = +1

Query  43   RCPRDALKlgvcanllgglvgvvIGTPPTLPCCSLIAGLADLEAAVCLCTAIRANILGIn  222
            +CP+D ++LGVCAN+L  L+ + +GTPP  PCCSLI GL DLEAA CLCTA++AN+LGI 
Sbjct  49   KCPKDTIRLGVCANVLKDLLKIKLGTPPVKPCCSLIDGLVDLEAAACLCTALKANVLGIK  108

Query  223  lnvplslslvlnnCGRQLPNGFTC  294
            LN+P+SL+L+LN CG+++P+GF C
Sbjct  109  LNIPISLNLLLNVCGKKVPSGFKC  132



>ref|XP_008437103.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Cucumis melo]
Length=138

 Score = 75.5 bits (184),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 54/84 (64%), Positives = 69/84 (82%), Gaps = 0/84 (0%)
 Frame = +1

Query  43   RCPRDALKlgvcanllgglvgvvIGTPPTLPCCSLIAGLADLEAAVCLCTAIRANILGIn  222
            +CP+DALK+GVCA LLGGLV + IG PP  PCC+L+ GLADLEAA CLCTAI+A++LG  
Sbjct  55   KCPKDALKIGVCAKLLGGLVDITIGKPPVTPCCTLVKGLADLEAAACLCTAIKASVLGNK  114

Query  223  lnvplslslvlnnCGRQLPNGFTC  294
            + +P+ LSL+LN C ++LPNGF C
Sbjct  115  IKIPVHLSLLLNVCNKKLPNGFQC  138



>ref|XP_010258987.1| PREDICTED: 14 kDa proline-rich protein DC2.15 [Nelumbo nucifera]
Length=135

 Score = 75.5 bits (184),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 60/83 (72%), Positives = 70/83 (84%), Gaps = 1/83 (1%)
 Frame = +1

Query  46   CPRDALKlgvcanllgglvgvvIGTPPTLPCCSLIAGLADLEAAVCLCTAIRANILGInl  225
            CPRDALKLGVCAN+L  +    +GTPP LPCCSLI  LADLEAA CLCTAI+A +LGINL
Sbjct  53   CPRDALKLGVCANVLKLVSVS-VGTPPYLPCCSLIKDLADLEAAACLCTAIKAKVLGINL  111

Query  226  nvplslslvlnnCGRQLPNGFTC  294
            NVP+SLSL+LNNCG+++P GF C
Sbjct  112  NVPVSLSLILNNCGKKVPTGFKC  134



>ref|NP_176440.1| bifunctional inhibitor/lipid-transfer protein/seed storage 2S 
albumin-like protein [Arabidopsis thaliana]
 gb|AAD43608.1|AC005698_7 T3P18.7 [Arabidopsis thaliana]
 gb|AAQ65111.1| At1g62510 [Arabidopsis thaliana]
 dbj|BAD95067.1| At1g62510 [Arabidopsis thaliana]
 dbj|BAD93991.1| similar to 14KD proline-rich protein DC2.15 precursor [Arabidopsis 
thaliana]
 dbj|BAD94286.1| At1g62510 [Arabidopsis thaliana]
 dbj|BAF01655.1| similar to 14KD proline-rich protein DC2.15 precursor sp|P14009 
[Arabidopsis thaliana]
 dbj|BAF02193.1| similar to 14KD proline-rich protein DC2.15 precursor sp|P14009 
[Arabidopsis thaliana]
 gb|AEE33973.1| bifunctional inhibitor/lipid-transfer protein/seed storage 2S 
albumin-like protein [Arabidopsis thaliana]
Length=149

 Score = 75.5 bits (184),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 60/84 (71%), Positives = 72/84 (86%), Gaps = 0/84 (0%)
 Frame = +1

Query  43   RCPRDALKlgvcanllgglvgvvIGTPPTLPCCSLIAGLADLEAAVCLCTAIRANILGIn  222
            +CPRDALKLGVCAN+L GL+ V +G PP  PCC+LI GLADLEAA CLCTA++ANILGIN
Sbjct  66   KCPRDALKLGVCANVLNGLLNVTLGKPPVEPCCTLIQGLADLEAAACLCTALKANILGIN  125

Query  223  lnvplslslvlnnCGRQLPNGFTC  294
            LN+PLSLSL+LN C +++P GF C
Sbjct  126  LNIPLSLSLLLNVCSKKVPRGFQC  149



>gb|ACV74341.1| proline-rich protein [Jatropha curcas]
Length=138

 Score = 75.1 bits (183),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 59/84 (70%), Positives = 69/84 (82%), Gaps = 0/84 (0%)
 Frame = +1

Query  43   RCPRDALKlgvcanllgglvgvvIGTPPTLPCCSLIAGLADLEAAVCLCTAIRANILGIn  222
            +CPRDALKLGVCA +LG L+ + IG PP  PCCSL+ GL DLEAAVCLCTAI+ANILGI 
Sbjct  54   KCPRDALKLGVCAKVLGSLLNITIGDPPVKPCCSLLEGLVDLEAAVCLCTAIKANILGIT  113

Query  223  lnvplslslvlnnCGRQLPNGFTC  294
            LNVPLSLSL+LN C +++P  F C
Sbjct  114  LNVPLSLSLLLNVCSKKVPFDFQC  137



>ref|XP_010433369.1| PREDICTED: lipid transfer protein EARLI 1-like [Camelina sativa]
Length=135

 Score = 75.1 bits (183),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 55/84 (65%), Positives = 69/84 (82%), Gaps = 0/84 (0%)
 Frame = +1

Query  43   RCPRDALKlgvcanllgglvgvvIGTPPTLPCCSLIAGLADLEAAVCLCTAIRANILGIn  222
             CPRD LKLGVCAN+L  L+ + +G PP  PCCSL+ GL DLEAA CLCTA++AN+LGI 
Sbjct  51   SCPRDTLKLGVCANVLKDLLKIELGKPPVKPCCSLLNGLVDLEAAACLCTALKANVLGIK  110

Query  223  lnvplslslvlnnCGRQLPNGFTC  294
            LNVP+SLSL+LN CG+++P+GF C
Sbjct  111  LNVPVSLSLLLNVCGKKVPSGFVC  134



>ref|XP_002454521.1| hypothetical protein SORBIDRAFT_04g032620 [Sorghum bicolor]
 gb|EES07497.1| hypothetical protein SORBIDRAFT_04g032620 [Sorghum bicolor]
Length=131

 Score = 75.1 bits (183),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 50/84 (60%), Positives = 67/84 (80%), Gaps = 1/84 (1%)
 Frame = +1

Query  43   RCPRDALKlgvcanllgglvgvvIGTPPTLPCCSLIAGLADLEAAVCLCTAIRANILGIn  222
            +CP+ ALKL  CAN+LG +    +G PP  PCCS++ GLADLEAAVCLCTAI+AN+LGI 
Sbjct  48   KCPKHALKLAACANVLGFVSAE-VGHPPAEPCCSILGGLADLEAAVCLCTAIKANVLGIT  106

Query  223  lnvplslslvlnnCGRQLPNGFTC  294
            +++P+ LSL++N CG+ LP+GF C
Sbjct  107  VDIPVKLSLIVNYCGKNLPSGFIC  130



>ref|XP_008786990.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Phoenix dactylifera]
Length=127

 Score = 75.1 bits (183),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 56/84 (67%), Positives = 70/84 (83%), Gaps = 0/84 (0%)
 Frame = +1

Query  43   RCPRDALKlgvcanllgglvgvvIGTPPTLPCCSLIAGLADLEAAVCLCTAIRANILGIn  222
            +CP D LKLGVCAN+L GL+ + +G PP  PCCSLI GLADLEAAVCLCTA++ANILGI 
Sbjct  43   KCPIDTLKLGVCANVLNGLINLNLGKPPKKPCCSLIKGLADLEAAVCLCTALKANILGIK  102

Query  223  lnvplslslvlnnCGRQLPNGFTC  294
            LN+P+ LSL++N CG+++P GF C
Sbjct  103  LNIPVDLSLLINYCGKKVPTGFQC  126



>ref|XP_004152411.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Cucumis sativus]
Length=136

 Score = 75.1 bits (183),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 55/84 (65%), Positives = 68/84 (81%), Gaps = 0/84 (0%)
 Frame = +1

Query  43   RCPRDALKlgvcanllgglvgvvIGTPPTLPCCSLIAGLADLEAAVCLCTAIRANILGIn  222
            +CP+D LK+GVCA LLGGLV + IG PP  PCC+L+ GLADLEAAVCLCTAI+A++LG  
Sbjct  53   KCPKDTLKIGVCAKLLGGLVDLTIGKPPVTPCCTLVQGLADLEAAVCLCTAIKASVLGKT  112

Query  223  lnvplslslvlnnCGRQLPNGFTC  294
            + +PL LSL+LN C + LPNGF C
Sbjct  113  IKIPLHLSLLLNVCNKNLPNGFQC  136



>gb|AIX10944.1| PRP2-like protein [Gardenia jasminoides]
Length=147

 Score = 75.5 bits (184),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 63/83 (76%), Positives = 72/83 (87%), Gaps = 1/83 (1%)
 Frame = +1

Query  46   CPRDALKlgvcanllgglvgvvIGTPPTLPCCSLIAGLADLEAAVCLCTAIRANILGInl  225
            CP DALKLGVCA+LLG +    IG+PPT PCCSL+ GLADLEAAVCLCTAI+ANILGINL
Sbjct  65   CPGDALKLGVCADLLGLIGIS-IGSPPTKPCCSLLEGLADLEAAVCLCTAIKANILGINL  123

Query  226  nvplslslvlnnCGRQLPNGFTC  294
            NVP+SLSL+LNNCG+ +P GF C
Sbjct  124  NVPISLSLILNNCGKSVPKGFQC  146



>ref|XP_004245750.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Solanum lycopersicum]
Length=131

 Score = 75.1 bits (183),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 58/84 (69%), Positives = 71/84 (85%), Gaps = 0/84 (0%)
 Frame = +1

Query  43   RCPRDALKlgvcanllgglvgvvIGTPPTLPCCSLIAGLADLEAAVCLCTAIRANILGIn  222
            +CPRDALKLGVCAN+L GL+ V +GTPP  PCCSL+  L DLEAAVCLCTA++ANILGIN
Sbjct  47   KCPRDALKLGVCANVLNGLLNVTLGTPPVKPCCSLLGNLVDLEAAVCLCTALKANILGIN  106

Query  223  lnvplslslvlnnCGRQLPNGFTC  294
            L++P+SLSL+LN C ++ P GF C
Sbjct  107  LDIPISLSLLLNVCTKEAPKGFIC  130



>ref|XP_009113072.1| PREDICTED: lipid transfer protein EARLI 1 [Brassica rapa]
 emb|CDY19562.1| BnaC09g13410D [Brassica napus]
 emb|CDY12952.1| BnaA09g13220D [Brassica napus]
Length=147

 Score = 75.5 bits (184),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 58/84 (69%), Positives = 72/84 (86%), Gaps = 0/84 (0%)
 Frame = +1

Query  43   RCPRDALKlgvcanllgglvgvvIGTPPTLPCCSLIAGLADLEAAVCLCTAIRANILGIn  222
            +CPRDALKLGVCAN+L GL+ + +G PP  PCC+LI GLADLEAA CLCTA++ANILGIN
Sbjct  64   KCPRDALKLGVCANVLSGLLNITLGKPPVKPCCTLIKGLADLEAAACLCTALKANILGIN  123

Query  223  lnvplslslvlnnCGRQLPNGFTC  294
            LN+P+SLSL+LN C +++P GF C
Sbjct  124  LNIPISLSLLLNVCSKKVPPGFQC  147



>gb|KGN50240.1| hypothetical protein Csa_5G161890 [Cucumis sativus]
Length=136

 Score = 75.1 bits (183),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 55/84 (65%), Positives = 68/84 (81%), Gaps = 0/84 (0%)
 Frame = +1

Query  43   RCPRDALKlgvcanllgglvgvvIGTPPTLPCCSLIAGLADLEAAVCLCTAIRANILGIn  222
            +CP+D LK+GVCA LLGGLV + IG PP  PCC+L+ GLADLEAAVCLCTAI+A++LG  
Sbjct  53   KCPKDTLKIGVCAKLLGGLVDLTIGKPPVTPCCTLVKGLADLEAAVCLCTAIKASVLGNK  112

Query  223  lnvplslslvlnnCGRQLPNGFTC  294
            + +PL LSL+LN C + LPNGF C
Sbjct  113  IKIPLHLSLLLNVCNKNLPNGFQC  136



>ref|XP_010053450.1| PREDICTED: 14 kDa proline-rich protein DC2.15 [Eucalyptus grandis]
 gb|KCW77748.1| hypothetical protein EUGRSUZ_D02042 [Eucalyptus grandis]
Length=121

 Score = 74.7 bits (182),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 59/84 (70%), Positives = 71/84 (85%), Gaps = 0/84 (0%)
 Frame = +1

Query  43   RCPRDALKlgvcanllgglvgvvIGTPPTLPCCSLIAGLADLEAAVCLCTAIRANILGIn  222
             CP +ALKLGVC +LLG LV V +GTPP  PCCSLI GLADLEAAVCLCTAIRA++LG++
Sbjct  37   SCPENALKLGVCLDLLGSLVNVTVGTPPKEPCCSLIQGLADLEAAVCLCTAIRADVLGLH  96

Query  223  lnvplslslvlnnCGRQLPNGFTC  294
            L+VPLSLSL+LN C +++P GF C
Sbjct  97   LDVPLSLSLLLNVCSKKVPPGFQC  120



>gb|AAC60566.1| proline-rich SAC51 [Brassica napus]
Length=147

 Score = 75.1 bits (183),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 58/84 (69%), Positives = 72/84 (86%), Gaps = 0/84 (0%)
 Frame = +1

Query  43   RCPRDALKlgvcanllgglvgvvIGTPPTLPCCSLIAGLADLEAAVCLCTAIRANILGIn  222
            +CPRDALKLGVCAN+L GL+ + +G PP  PCC+LI GLADLEAA CLCTA++ANILGIN
Sbjct  64   KCPRDALKLGVCANVLSGLLNITLGKPPVKPCCTLIKGLADLEAAACLCTALKANILGIN  123

Query  223  lnvplslslvlnnCGRQLPNGFTC  294
            LN+P+SLSL+LN C +++P GF C
Sbjct  124  LNIPISLSLLLNVCSKKVPPGFQC  147



>ref|XP_008808739.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Phoenix dactylifera]
Length=126

 Score = 74.7 bits (182),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 56/84 (67%), Positives = 73/84 (87%), Gaps = 0/84 (0%)
 Frame = +1

Query  43   RCPRDALKlgvcanllgglvgvvIGTPPTLPCCSLIAGLADLEAAVCLCTAIRANILGIn  222
            +CP DALKLGVCA++LGGL+ + IGTPP  PCCSL++GL DLE AVCLC AI+A+ILGIN
Sbjct  42   KCPIDALKLGVCADVLGGLLNITIGTPPKEPCCSLLSGLVDLEVAVCLCIAIKASILGIN  101

Query  223  lnvplslslvlnnCGRQLPNGFTC  294
            LN+P+ LSL++N CG+++P+GF C
Sbjct  102  LNIPVDLSLLVNYCGKKVPSGFQC  125



>ref|XP_002867769.1| hypothetical protein ARALYDRAFT_914370 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH44028.1| hypothetical protein ARALYDRAFT_914370 [Arabidopsis lyrata subsp. 
lyrata]
Length=133

 Score = 75.1 bits (183),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 56/83 (67%), Positives = 67/83 (81%), Gaps = 0/83 (0%)
 Frame = +1

Query  46   CPRDALKlgvcanllgglvgvvIGTPPTLPCCSLIAGLADLEAAVCLCTAIRANILGInl  225
            CP+DALKLGVC N L  L  V +GTPP  PCCSLI GL DLEAAVCLCTA++A++LGINL
Sbjct  50   CPKDALKLGVCVNALNLLNDVTLGTPPVTPCCSLIKGLVDLEAAVCLCTALKASVLGINL  109

Query  226  nvplslslvlnnCGRQLPNGFTC  294
            N+P+ LSL+LN C R+ P+GF C
Sbjct  110  NLPIDLSLLLNVCSRKAPHGFQC  132



>ref|XP_004152412.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Cucumis sativus]
 gb|KGN50239.1| hypothetical protein Csa_5G161880 [Cucumis sativus]
Length=136

 Score = 75.1 bits (183),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 55/84 (65%), Positives = 68/84 (81%), Gaps = 0/84 (0%)
 Frame = +1

Query  43   RCPRDALKlgvcanllgglvgvvIGTPPTLPCCSLIAGLADLEAAVCLCTAIRANILGIn  222
            +CP+D LK+GVCA LLGGLV + IG PP  PCC+L+ GLADLEAAVCLCTAI+A++LG  
Sbjct  53   KCPKDTLKIGVCAKLLGGLVDLTIGKPPVTPCCTLVQGLADLEAAVCLCTAIKASVLGNK  112

Query  223  lnvplslslvlnnCGRQLPNGFTC  294
            + +PL LSL+LN C + LPNGF C
Sbjct  113  IKIPLHLSLLLNVCNKNLPNGFQC  136



>ref|XP_008437102.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Cucumis melo]
Length=136

 Score = 75.1 bits (183),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 55/84 (65%), Positives = 68/84 (81%), Gaps = 0/84 (0%)
 Frame = +1

Query  43   RCPRDALKlgvcanllgglvgvvIGTPPTLPCCSLIAGLADLEAAVCLCTAIRANILGIn  222
            +CP+D LK+GVCA LLGGLV + IG PP  PCC+L+ GLADLEAAVCLCTAI+A++LG  
Sbjct  53   KCPKDTLKIGVCAKLLGGLVDLTIGKPPVTPCCTLVEGLADLEAAVCLCTAIKASVLGNK  112

Query  223  lnvplslslvlnnCGRQLPNGFTC  294
            + +PL LSL+LN C + LPNGF C
Sbjct  113  IKIPLHLSLLLNVCNKNLPNGFQC  136



>ref|XP_004165755.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Cucumis sativus]
Length=136

 Score = 75.1 bits (183),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 55/84 (65%), Positives = 68/84 (81%), Gaps = 0/84 (0%)
 Frame = +1

Query  43   RCPRDALKlgvcanllgglvgvvIGTPPTLPCCSLIAGLADLEAAVCLCTAIRANILGIn  222
            +CP+D LK+GVCA LLGGLV + IG PP  PCC+L+ GLADLEAAVCLCTAI+A++LG  
Sbjct  53   KCPKDTLKIGVCAKLLGGLVDLTIGKPPVTPCCTLVQGLADLEAAVCLCTAIKASVLGNK  112

Query  223  lnvplslslvlnnCGRQLPNGFTC  294
            + +PL LSL+LN C + LPNGF C
Sbjct  113  IKIPLHLSLLLNVCNKNLPNGFQC  136



>ref|XP_010458632.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Camelina 
sativa]
Length=143

 Score = 75.1 bits (183),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 51/84 (61%), Positives = 66/84 (79%), Gaps = 0/84 (0%)
 Frame = +1

Query  43   RCPRDALKlgvcanllgglvgvvIGTPPTLPCCSLIAGLADLEAAVCLCTAIRANILGIn  222
            +CP+D LK  VC N+L  +    +G PP  PCCSLI GLA+LEAAVCLCTA++AN+LGIN
Sbjct  59   KCPKDTLKFAVCDNVLKTVFHYTLGKPPVEPCCSLIQGLANLEAAVCLCTALKANVLGIN  118

Query  223  lnvplslslvlnnCGRQLPNGFTC  294
            L+VP++LSL+LN C ++LP GF C
Sbjct  119  LDVPITLSLLLNVCSKELPPGFQC  142



>ref|XP_010493725.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Camelina 
sativa]
Length=143

 Score = 75.1 bits (183),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 55/84 (65%), Positives = 69/84 (82%), Gaps = 0/84 (0%)
 Frame = +1

Query  43   RCPRDALKlgvcanllgglvgvvIGTPPTLPCCSLIAGLADLEAAVCLCTAIRANILGIn  222
            +CP+D LK  VC N+L GL+ + +G PP  PCCSLI GLA+LEAAVCLCTA++AN+LGIN
Sbjct  59   KCPKDTLKFAVCDNVLNGLLDLTLGKPPVEPCCSLIQGLANLEAAVCLCTALKANVLGIN  118

Query  223  lnvplslslvlnnCGRQLPNGFTC  294
            LN+P+SLSL+LN C +QLP GF C
Sbjct  119  LNLPISLSLLLNVCSKQLPPGFQC  142



>ref|XP_003572782.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Brachypodium 
distachyon]
Length=123

 Score = 74.3 bits (181),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 50/84 (60%), Positives = 69/84 (82%), Gaps = 1/84 (1%)
 Frame = +1

Query  43   RCPRDALKlgvcanllgglvgvvIGTPPTLPCCSLIAGLADLEAAVCLCTAIRANILGIn  222
            +CP++ALKL  CA++LG +    +G PP  PCCS++ GLADLEAAVCLCTAI+AN+LGI+
Sbjct  40   KCPKNALKLAACADVLGLVSAE-VGHPPAEPCCSILGGLADLEAAVCLCTAIKANVLGIS  98

Query  223  lnvplslslvlnnCGRQLPNGFTC  294
            L++P+ LSL++N CG+ LP+GF C
Sbjct  99   LDIPVKLSLLVNYCGKSLPSGFIC  122



>gb|EMS62564.1| 14 kDa proline-rich protein DC2.15 [Triticum urartu]
Length=126

 Score = 74.3 bits (181),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 50/84 (60%), Positives = 70/84 (83%), Gaps = 1/84 (1%)
 Frame = +1

Query  43   RCPRDALKlgvcanllgglvgvvIGTPPTLPCCSLIAGLADLEAAVCLCTAIRANILGIn  222
            +CP++ALKL  CA++LG ++   +G PP  PCCS++ GLADLEAAVCLCTAI+AN+LGI+
Sbjct  43   KCPKNALKLAACADVLGLVLAQ-VGQPPAEPCCSILGGLADLEAAVCLCTAIKANVLGIS  101

Query  223  lnvplslslvlnnCGRQLPNGFTC  294
            L++P+ LSL++N CG+ LP+GF C
Sbjct  102  LDIPVKLSLLVNYCGKNLPSGFIC  125



>gb|EPS73889.1| hypothetical protein M569_00868, partial [Genlisea aurea]
Length=137

 Score = 74.7 bits (182),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 46/61 (75%), Positives = 55/61 (90%), Gaps = 0/61 (0%)
 Frame = +1

Query  112  IGTPPTLPCCSLIAGLADLEAAVCLCTAIRANILGInlnvplslslvlnnCGRQLPNGFT  291
            IGTPP  PCCSLI GLADLEAAVCLCTAI+AN+LGI+L+VP+SLSL+LN+C ++LP GF 
Sbjct  77   IGTPPKTPCCSLIEGLADLEAAVCLCTAIKANVLGISLDVPISLSLLLNDCSKKLPTGFQ  136

Query  292  C  294
            C
Sbjct  137  C  137



>ref|XP_002271619.1| PREDICTED: 14 kDa proline-rich protein DC2.15 [Vitis vinifera]
Length=133

 Score = 74.7 bits (182),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 61/84 (73%), Positives = 71/84 (85%), Gaps = 0/84 (0%)
 Frame = +1

Query  43   RCPRDALKlgvcanllgglvgvvIGTPPTLPCCSLIAGLADLEAAVCLCTAIRANILGIn  222
             CP DALKLGVCAN+L GLVGVVIGTPP  PCC+L+ GL DLEAA+CLCTAI+ANILGIN
Sbjct  49   SCPIDALKLGVCANVLSGLVGVVIGTPPDTPCCALLDGLLDLEAAICLCTAIKANILGIN  108

Query  223  lnvplslslvlnnCGRQLPNGFTC  294
            L++ LSLSL++N CG+ LP  F C
Sbjct  109  LDIHLSLSLLINTCGKTLPKDFQC  132



>ref|XP_009782252.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Nicotiana 
sylvestris]
Length=133

 Score = 74.7 bits (182),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 58/84 (69%), Positives = 70/84 (83%), Gaps = 0/84 (0%)
 Frame = +1

Query  43   RCPRDALKlgvcanllgglvgvvIGTPPTLPCCSLIAGLADLEAAVCLCTAIRANILGIn  222
            +CP DALKLGVCAN+L GL+ V +GTPP  PCCSLI  L DLEAAVCLCTA++ANIL IN
Sbjct  49   KCPTDALKLGVCANVLNGLLNVTLGTPPVKPCCSLIGNLVDLEAAVCLCTALKANILSIN  108

Query  223  lnvplslslvlnnCGRQLPNGFTC  294
            LN+P+SL+L+LN C ++ P GFTC
Sbjct  109  LNLPISLNLLLNVCSKKAPKGFTC  132



>ref|XP_008786992.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Phoenix dactylifera]
Length=143

 Score = 74.7 bits (182),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 55/84 (65%), Positives = 68/84 (81%), Gaps = 0/84 (0%)
 Frame = +1

Query  43   RCPRDALKlgvcanllgglvgvvIGTPPTLPCCSLIAGLADLEAAVCLCTAIRANILGIn  222
            +CP DALKLGVCA++L GL+ + +G PP LPCCSL+ GL DLEAAVCLCT ++ANILGI 
Sbjct  59   KCPVDALKLGVCADVLNGLIHLKLGKPPKLPCCSLLDGLVDLEAAVCLCTVLKANILGIK  118

Query  223  lnvplslslvlnnCGRQLPNGFTC  294
            LN+P+ LSL+LN CG+  P GF C
Sbjct  119  LNLPIHLSLLLNYCGKNTPKGFQC  142



>ref|XP_010493717.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Camelina 
sativa]
 ref|XP_010476165.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Camelina 
sativa]
Length=143

 Score = 74.7 bits (182),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 50/84 (60%), Positives = 66/84 (79%), Gaps = 0/84 (0%)
 Frame = +1

Query  43   RCPRDALKlgvcanllgglvgvvIGTPPTLPCCSLIAGLADLEAAVCLCTAIRANILGIn  222
            +CP+D LK  VC N+L  +    +G PP  PCCSLI GLA+LEAAVCLCTA++AN+LGIN
Sbjct  59   KCPKDTLKFAVCDNVLKTVFHYTLGKPPVEPCCSLIQGLANLEAAVCLCTALKANVLGIN  118

Query  223  lnvplslslvlnnCGRQLPNGFTC  294
            L++P++LSL+LN C ++LP GF C
Sbjct  119  LDLPITLSLLLNVCSKELPPGFQC  142



>ref|XP_009110671.1| PREDICTED: 14 kDa proline-rich protein DC2.15 [Brassica rapa]
 emb|CDY21033.1| BnaA08g24920D [Brassica napus]
Length=137

 Score = 74.7 bits (182),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 57/84 (68%), Positives = 72/84 (86%), Gaps = 0/84 (0%)
 Frame = +1

Query  43   RCPRDALKlgvcanllgglvgvvIGTPPTLPCCSLIAGLADLEAAVCLCTAIRANILGIn  222
            +CP+D LKLGVCAN+L GL+ + +G PP  PCCSLI GLAD+EAAVCLCTA++AN+LGIN
Sbjct  54   KCPKDTLKLGVCANVLSGLLDLTLGKPPVEPCCSLIQGLADVEAAVCLCTALKANVLGIN  113

Query  223  lnvplslslvlnnCGRQLPNGFTC  294
            LN+P+SLSL+LN C +Q+P GF C
Sbjct  114  LNLPISLSLLLNVCSKQVPPGFQC  137



>ref|XP_006286053.1| hypothetical protein CARUB_v10007585mg [Capsella rubella]
 gb|EOA18951.1| hypothetical protein CARUB_v10007585mg [Capsella rubella]
Length=137

 Score = 74.7 bits (182),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 55/83 (66%), Positives = 66/83 (80%), Gaps = 0/83 (0%)
 Frame = +1

Query  46   CPRDALKlgvcanllgglvgvvIGTPPTLPCCSLIAGLADLEAAVCLCTAIRANILGInl  225
            CP+DALKLGVC N L  L  V +GTPP  PCCSLI GL DLEAAVCLCTA++A++LGINL
Sbjct  54   CPKDALKLGVCVNALNLLKDVTLGTPPVTPCCSLIEGLVDLEAAVCLCTALKASVLGINL  113

Query  226  nvplslslvlnnCGRQLPNGFTC  294
             +P++LSL+LN C R+ P GF C
Sbjct  114  YLPINLSLLLNVCSRKAPRGFQC  136



>ref|XP_004976454.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Setaria italica]
Length=127

 Score = 74.3 bits (181),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 57/84 (68%), Positives = 69/84 (82%), Gaps = 1/84 (1%)
 Frame = +1

Query  43   RCPRDALKlgvcanllgglvgvvIGTPPTLPCCSLIAGLADLEAAVCLCTAIRANILGIn  222
            RCPRDALKLGVCAN+LG +    +G PPT PCC L+ GL DLEAAVCLCTAI+ NILGIN
Sbjct  44   RCPRDALKLGVCANVLGLIKAK-VGVPPTEPCCPLLEGLVDLEAAVCLCTAIKGNILGIN  102

Query  223  lnvplslslvlnnCGRQLPNGFTC  294
            LN+P+ +SL+LN+CG+ +P GF C
Sbjct  103  LNLPIDVSLILNHCGKTVPTGFKC  126



>ref|XP_008437107.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Cucumis melo]
Length=138

 Score = 74.7 bits (182),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 55/84 (65%), Positives = 68/84 (81%), Gaps = 0/84 (0%)
 Frame = +1

Query  43   RCPRDALKlgvcanllgglvgvvIGTPPTLPCCSLIAGLADLEAAVCLCTAIRANILGIn  222
            +CP+DALK+GVCA LLGGLV + IG PP  PCC+L+ GLADLEAA CLCTAI+A++LG  
Sbjct  55   KCPKDALKIGVCAKLLGGLVDLTIGKPPVTPCCTLVEGLADLEAAACLCTAIKASVLGNK  114

Query  223  lnvplslslvlnnCGRQLPNGFTC  294
            + +PL LSL+LN C + LPNGF C
Sbjct  115  IKIPLHLSLLLNVCKKNLPNGFQC  138



>ref|XP_006355477.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Solanum tuberosum]
Length=138

 Score = 74.7 bits (182),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 62/84 (74%), Positives = 73/84 (87%), Gaps = 0/84 (0%)
 Frame = +1

Query  43   RCPRDALKlgvcanllgglvgvvIGTPPTLPCCSLIAGLADLEAAVCLCTAIRANILGIn  222
            +CP D LKLGVCAN+LG ++GVV+G PP  PCCSLI GL DLEAA+CLCTAI+ANILGIN
Sbjct  53   KCPIDTLKLGVCANVLGNVLGVVLGNPPKKPCCSLIEGLVDLEAALCLCTAIKANILGIN  112

Query  223  lnvplslslvlnnCGRQLPNGFTC  294
            LNVPLSLSL+LN CG++ P+GF C
Sbjct  113  LNVPLSLSLLLNACGKKAPSGFQC  136



>gb|EYU30303.1| hypothetical protein MIMGU_mgv1a016181mg [Erythranthe guttata]
Length=131

 Score = 74.3 bits (181),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 55/84 (65%), Positives = 69/84 (82%), Gaps = 0/84 (0%)
 Frame = +1

Query  43   RCPRDALKlgvcanllgglvgvvIGTPPTLPCCSLIAGLADLEAAVCLCTAIRANILGIn  222
             CPRDALKLG+CA LL G VG  +G+PP  PCCS++ GL DLEAAVCLCTA++ANILGIN
Sbjct  47   SCPRDALKLGICAKLLNGSVGAELGSPPDHPCCSVLGGLLDLEAAVCLCTALKANILGIN  106

Query  223  lnvplslslvlnnCGRQLPNGFTC  294
            +++P+SLSL++N CG+ LP  F C
Sbjct  107  IDIPISLSLLINTCGKTLPEDFKC  130



>ref|NP_001233824.1| arachidonic acid-induced DEA1 precursor [Solanum lycopersicum]
 gb|AAS80139.1| arachidonic acid-induced DEA1 [Solanum lycopersicum]
Length=138

 Score = 74.3 bits (181),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 63/84 (75%), Positives = 73/84 (87%), Gaps = 0/84 (0%)
 Frame = +1

Query  43   RCPRDALKlgvcanllgglvgvvIGTPPTLPCCSLIAGLADLEAAVCLCTAIRANILGIn  222
            +CP D LKLGVCAN+LG L+GVV+G PP  PCCSLI GL DLEAA+CLCTAI+ANILGIN
Sbjct  53   KCPIDTLKLGVCANVLGNLLGVVLGNPPKKPCCSLIEGLVDLEAALCLCTAIKANILGIN  112

Query  223  lnvplslslvlnnCGRQLPNGFTC  294
            LNVPLSLSL+LN CG++ P+GF C
Sbjct  113  LNVPLSLSLLLNVCGKKAPSGFQC  136



>ref|XP_002533291.1| lipid binding protein, putative [Ricinus communis]
 gb|EEF29085.1| lipid binding protein, putative [Ricinus communis]
Length=114

 Score = 73.9 bits (180),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 53/84 (63%), Positives = 66/84 (79%), Gaps = 0/84 (0%)
 Frame = +1

Query  43   RCPRDALKlgvcanllgglvgvvIGTPPTLPCCSLIAGLADLEAAVCLCTAIRANILGIn  222
             CP+D +KLGVC NLL  L+ V +GTPP  PCCSLIAGL DLEAA CLCT I+A++ GI 
Sbjct  29   SCPKDTVKLGVCVNLLKDLLSVTVGTPPKTPCCSLIAGLVDLEAAACLCTTIKADVAGIK  88

Query  223  lnvplslslvlnnCGRQLPNGFTC  294
            LN+P+ LSL+LN CG+++P GF C
Sbjct  89   LNLPIHLSLLLNYCGKKVPQGFKC  112



>ref|XP_009397884.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Musa acuminata 
subsp. malaccensis]
Length=132

 Score = 74.3 bits (181),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 55/84 (65%), Positives = 69/84 (82%), Gaps = 0/84 (0%)
 Frame = +1

Query  43   RCPRDALKlgvcanllgglvgvvIGTPPTLPCCSLIAGLADLEAAVCLCTAIRANILGIn  222
             CP D +KLG CAN+LGGL+ + IGTPP  PCCSLI GLAD EAA+CLCTAI+ANILGI+
Sbjct  48   SCPIDTVKLGACANVLGGLINLQIGTPPKKPCCSLIEGLADFEAALCLCTAIKANILGIS  107

Query  223  lnvplslslvlnnCGRQLPNGFTC  294
            LNV + L+L+LN CG+++P G+ C
Sbjct  108  LNVDVDLTLLLNYCGKKVPYGYLC  131



>emb|CDY31240.1| BnaC08g15350D [Brassica napus]
Length=137

 Score = 74.3 bits (181),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 57/84 (68%), Positives = 72/84 (86%), Gaps = 0/84 (0%)
 Frame = +1

Query  43   RCPRDALKlgvcanllgglvgvvIGTPPTLPCCSLIAGLADLEAAVCLCTAIRANILGIn  222
            +CP+D LKLGVCAN+L GL+ + +G PP  PCCSLI GLAD+EAAVCLCTA++AN+LGIN
Sbjct  54   KCPKDTLKLGVCANVLNGLLDLTLGKPPVKPCCSLIQGLADVEAAVCLCTALKANVLGIN  113

Query  223  lnvplslslvlnnCGRQLPNGFTC  294
            LN+P+SLSL+LN C +Q+P GF C
Sbjct  114  LNLPISLSLLLNVCSKQVPPGFQC  137



>ref|XP_006417266.1| hypothetical protein EUTSA_v10009061mg [Eutrema salsugineum]
 gb|ESQ35619.1| hypothetical protein EUTSA_v10009061mg [Eutrema salsugineum]
Length=139

 Score = 74.3 bits (181),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 57/84 (68%), Positives = 72/84 (86%), Gaps = 0/84 (0%)
 Frame = +1

Query  43   RCPRDALKlgvcanllgglvgvvIGTPPTLPCCSLIAGLADLEAAVCLCTAIRANILGIn  222
            +CP+D LKLGVCAN+L GL+ + +G PP  PCCSLI GLAD+EAAVCLCTA++AN+LGIN
Sbjct  56   KCPKDTLKLGVCANVLNGLLDLTLGKPPVEPCCSLIQGLADVEAAVCLCTALKANVLGIN  115

Query  223  lnvplslslvlnnCGRQLPNGFTC  294
            LN+P+SLSL+LN C +Q+P GF C
Sbjct  116  LNLPISLSLLLNVCSKQVPPGFQC  139



>ref|XP_004516838.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Cicer arietinum]
Length=166

 Score = 74.7 bits (182),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 60/83 (72%), Positives = 69/83 (83%), Gaps = 0/83 (0%)
 Frame = +1

Query  46   CPRDALKlgvcanllgglvgvvIGTPPTLPCCSLIAGLADLEAAVCLCTAIRANILGInl  225
            CPRDALKLGVCAN+L GL+ V +G PP  PCCSL+ GL DLEAAVCLCTA++ANILGINL
Sbjct  83   CPRDALKLGVCANVLNGLLNVTLGQPPVTPCCSLLQGLVDLEAAVCLCTALKANILGINL  142

Query  226  nvplslslvlnnCGRQLPNGFTC  294
            N+P+SLSL+LN C RQ P  F C
Sbjct  143  NLPISLSLLLNVCSRQAPRDFQC  165



>ref|XP_008437111.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Cucumis melo]
Length=140

 Score = 74.3 bits (181),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 55/84 (65%), Positives = 68/84 (81%), Gaps = 0/84 (0%)
 Frame = +1

Query  43   RCPRDALKlgvcanllgglvgvvIGTPPTLPCCSLIAGLADLEAAVCLCTAIRANILGIn  222
            +CP+DALK+GVCA LLGGLV + IG PP  PCC+L+ GLADLEAA CLCTAI+A++LG  
Sbjct  57   KCPKDALKIGVCAKLLGGLVDLTIGKPPVTPCCTLVEGLADLEAATCLCTAIKASVLGNK  116

Query  223  lnvplslslvlnnCGRQLPNGFTC  294
            + +PL LSL+LN C + LPNGF C
Sbjct  117  IKIPLHLSLLLNVCKKNLPNGFQC  140



>ref|XP_006306558.1| hypothetical protein CARUB_v10012658mg [Capsella rubella]
 gb|EOA39456.1| hypothetical protein CARUB_v10012658mg [Capsella rubella]
Length=132

 Score = 74.3 bits (181),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 55/84 (65%), Positives = 70/84 (83%), Gaps = 0/84 (0%)
 Frame = +1

Query  43   RCPRDALKlgvcanllgglvgvvIGTPPTLPCCSLIAGLADLEAAVCLCTAIRANILGIn  222
             CP+DAL+LGVCA +L G VG VIG PP  PCCS++ GL DLEAAVCLCTAI+AN+LGIN
Sbjct  48   SCPKDALQLGVCAKILDGAVGTVIGNPPDTPCCSVLKGLVDLEAAVCLCTAIKANVLGIN  107

Query  223  lnvplslslvlnnCGRQLPNGFTC  294
            +++P+SLSL++N CG+ LP+ F C
Sbjct  108  IDIPISLSLLINTCGKTLPSNFIC  131



>ref|XP_007155640.1| hypothetical protein PHAVU_003G218800g [Phaseolus vulgaris]
 gb|ESW27634.1| hypothetical protein PHAVU_003G218800g [Phaseolus vulgaris]
Length=205

 Score = 75.5 bits (184),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 61/83 (73%), Positives = 70/83 (84%), Gaps = 0/83 (0%)
 Frame = +1

Query  46   CPRDALKlgvcanllgglvgvvIGTPPTLPCCSLIAGLADLEAAVCLCTAIRANILGInl  225
            CPRDALKLGVCAN+L GLV V +G PP  PCC+L+ GL DLEAAVCLCTA+RANILGINL
Sbjct  122  CPRDALKLGVCANVLNGLVNVTLGQPPVSPCCTLLNGLVDLEAAVCLCTALRANILGINL  181

Query  226  nvplslslvlnnCGRQLPNGFTC  294
            N+P+SLSL+LN C RQ+P  F C
Sbjct  182  NLPISLSLLLNVCSRQVPRDFQC  204



>ref|XP_007155639.1| hypothetical protein PHAVU_003G218800g [Phaseolus vulgaris]
 gb|ESW27633.1| hypothetical protein PHAVU_003G218800g [Phaseolus vulgaris]
Length=208

 Score = 75.5 bits (184),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 61/83 (73%), Positives = 70/83 (84%), Gaps = 0/83 (0%)
 Frame = +1

Query  46   CPRDALKlgvcanllgglvgvvIGTPPTLPCCSLIAGLADLEAAVCLCTAIRANILGInl  225
            CPRDALKLGVCAN+L GLV V +G PP  PCC+L+ GL DLEAAVCLCTA+RANILGINL
Sbjct  125  CPRDALKLGVCANVLNGLVNVTLGQPPVSPCCTLLNGLVDLEAAVCLCTALRANILGINL  184

Query  226  nvplslslvlnnCGRQLPNGFTC  294
            N+P+SLSL+LN C RQ+P  F C
Sbjct  185  NLPISLSLLLNVCSRQVPRDFQC  207



>gb|EYU30301.1| hypothetical protein MIMGU_mgv1a018370mg [Erythranthe guttata]
Length=119

 Score = 73.6 bits (179),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 56/83 (67%), Positives = 69/83 (83%), Gaps = 0/83 (0%)
 Frame = +1

Query  46   CPRDALKlgvcanllgglvgvvIGTPPTLPCCSLIAGLADLEAAVCLCTAIRANILGInl  225
            CP+D LKLGVCA+LL GL+ V +GTPP  PCCSLI GL DLEAAVCLCTAI+AN+LGIN+
Sbjct  36   CPKDTLKLGVCADLLNGLLNVTVGTPPKTPCCSLIEGLVDLEAAVCLCTAIKANVLGINI  95

Query  226  nvplslslvlnnCGRQLPNGFTC  294
            +VP+SL+L+LN C + +P  F C
Sbjct  96   DVPISLTLLLNVCTKSVPKDFVC  118



>gb|KFK25909.1| hypothetical protein AALP_AA8G178400 [Arabis alpina]
Length=157

 Score = 74.3 bits (181),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 58/84 (69%), Positives = 72/84 (86%), Gaps = 0/84 (0%)
 Frame = +1

Query  43   RCPRDALKlgvcanllgglvgvvIGTPPTLPCCSLIAGLADLEAAVCLCTAIRANILGIn  222
            +CPRDALKLGVCAN+L GL+ + +G PP  PCC+LI GLADLEAA CLCTA++ANILGIN
Sbjct  74   KCPRDALKLGVCANVLNGLLNITLGKPPVEPCCTLIQGLADLEAAACLCTALKANILGIN  133

Query  223  lnvplslslvlnnCGRQLPNGFTC  294
            LN+P+SLSL+LN C +++P GF C
Sbjct  134  LNIPISLSLLLNVCSKKVPPGFQC  157



>ref|XP_006396750.1| hypothetical protein EUTSA_v10029060mg [Eutrema salsugineum]
 gb|ESQ38203.1| hypothetical protein EUTSA_v10029060mg [Eutrema salsugineum]
Length=135

 Score = 73.9 bits (180),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 55/83 (66%), Positives = 68/83 (82%), Gaps = 0/83 (0%)
 Frame = +1

Query  46   CPRDALKlgvcanllgglvgvvIGTPPTLPCCSLIAGLADLEAAVCLCTAIRANILGInl  225
            CPRD LKLGVCAN+L  L+ + +G PP  PCCS++ GL DLEAA CLCTA++AN+LGI L
Sbjct  52   CPRDTLKLGVCANVLKDLLKIDVGKPPVKPCCSVLKGLVDLEAAACLCTALKANVLGIKL  111

Query  226  nvplslslvlnnCGRQLPNGFTC  294
            NVP+SLSL+LN CGR+ P+GF C
Sbjct  112  NVPISLSLLLNVCGRKTPSGFIC  134



>ref|XP_002533294.1| 14 kDa proline-rich protein DC2.15 precursor, putative [Ricinus 
communis]
 gb|EEF29088.1| 14 kDa proline-rich protein DC2.15 precursor, putative [Ricinus 
communis]
Length=140

 Score = 73.9 bits (180),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 55/84 (65%), Positives = 68/84 (81%), Gaps = 0/84 (0%)
 Frame = +1

Query  43   RCPRDALKlgvcanllgglvgvvIGTPPTLPCCSLIAGLADLEAAVCLCTAIRANILGIn  222
            +CP+D LKLGVC +LL  L+ V IG PP  PCCSLI  L DLEAAVCLCT+I+A++LGIN
Sbjct  56   KCPKDTLKLGVCVDLLKDLLSVTIGKPPKTPCCSLIGDLVDLEAAVCLCTSIKASLLGIN  115

Query  223  lnvplslslvlnnCGRQLPNGFTC  294
            LN+P+ LSLVLN CG+++P GF C
Sbjct  116  LNLPVDLSLVLNYCGKKVPEGFQC  139



>ref|XP_002874778.1| hypothetical protein ARALYDRAFT_911651 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH51037.1| hypothetical protein ARALYDRAFT_911651 [Arabidopsis lyrata subsp. 
lyrata]
Length=129

 Score = 73.9 bits (180),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 55/84 (65%), Positives = 68/84 (81%), Gaps = 0/84 (0%)
 Frame = +1

Query  43   RCPRDALKlgvcanllgglvgvvIGTPPTLPCCSLIAGLADLEAAVCLCTAIRANILGIn  222
             CPRD LKLGVCAN+L  L+ + +GTPP  PCCSL+ GL DLEAA CLCTA++AN+LG  
Sbjct  45   SCPRDTLKLGVCANVLKDLLKIQLGTPPVKPCCSLLKGLVDLEAAACLCTALKANVLGTK  104

Query  223  lnvplslslvlnnCGRQLPNGFTC  294
            LNVP+SLSL+LN CGR++P+ F C
Sbjct  105  LNVPVSLSLLLNVCGRKVPSKFVC  128



>ref|XP_011081223.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Sesamum indicum]
Length=137

 Score = 73.9 bits (180),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 58/83 (70%), Positives = 68/83 (82%), Gaps = 0/83 (0%)
 Frame = +1

Query  46   CPRDALKlgvcanllgglvgvvIGTPPTLPCCSLIAGLADLEAAVCLCTAIRANILGInl  225
            CPRDALKLG+CA LL G VG  IG+PP  PCCS + GL DLEAAVCLCTA++ANILGINL
Sbjct  54   CPRDALKLGICAKLLNGSVGTEIGSPPDHPCCSALGGLLDLEAAVCLCTALKANILGINL  113

Query  226  nvplslslvlnnCGRQLPNGFTC  294
            N+P+SLSL++N CG+ LP  F C
Sbjct  114  NIPISLSLLINTCGKTLPKDFIC  136



>ref|XP_008786988.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Phoenix dactylifera]
Length=136

 Score = 73.9 bits (180),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 57/84 (68%), Positives = 70/84 (83%), Gaps = 0/84 (0%)
 Frame = +1

Query  43   RCPRDALKlgvcanllgglvgvvIGTPPTLPCCSLIAGLADLEAAVCLCTAIRANILGIn  222
             CPRDAL+LGVCAN+L GL+ + +G PP  PCCSL+  L DLEAAVCLCTAI+ANILGIN
Sbjct  52   SCPRDALELGVCANVLQGLINLQLGNPPKKPCCSLLEDLVDLEAAVCLCTAIKANILGIN  111

Query  223  lnvplslslvlnnCGRQLPNGFTC  294
            LNVP+ LSL+LN CG+++P G+ C
Sbjct  112  LNVPVDLSLLLNYCGKKVPAGYAC  135



>emb|CAI48077.1| extensin-like protein [Capsicum chinense]
Length=137

 Score = 73.9 bits (180),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 57/84 (68%), Positives = 69/84 (82%), Gaps = 0/84 (0%)
 Frame = +1

Query  43   RCPRDALKlgvcanllgglvgvvIGTPPTLPCCSLIAGLADLEAAVCLCTAIRANILGIn  222
            +CP DALKLGVCAN+L GL+ V +G PP  PCCSLI  L DLEAAVCLCTA++ANILGI 
Sbjct  53   KCPTDALKLGVCANVLNGLLNVTLGKPPVEPCCSLIENLVDLEAAVCLCTALKANILGIK  112

Query  223  lnvplslslvlnnCGRQLPNGFTC  294
            LN+P+SL+L+LN C ++ P GFTC
Sbjct  113  LNLPISLNLLLNVCSKKAPKGFTC  136



>ref|NP_567391.1| bifunctional inhibitor/lipid-transfer protein/seed storage 2S 
albumin superfamily protein [Arabidopsis thaliana]
 ref|NP_567392.1| Bifunctional inhibitor/lipid-transfer protein/seed storage 2S 
albumin superfamily protein [Arabidopsis thaliana]
 emb|CAB41721.1| pEARLI 1-like protein [Arabidopsis thaliana]
 emb|CAB41722.1| pEARLI 1-like protein [Arabidopsis thaliana]
 emb|CAB78294.1| pEARLI 1-like protein [Arabidopsis thaliana]
 emb|CAB78295.1| pEARLI 1-like protein [Arabidopsis thaliana]
 gb|AAO23622.1| At4g12520 [Arabidopsis thaliana]
 dbj|BAE99415.1| pEARLI 1-like protein [Arabidopsis thaliana]
 gb|AEE83141.1| bifunctional inhibitor/lipid-transfer protein/seed storage 2S 
albumin superfamily protein [Arabidopsis thaliana]
 gb|AEE83142.1| Bifunctional inhibitor/lipid-transfer protein/seed storage 2S 
albumin superfamily protein [Arabidopsis thaliana]
Length=129

 Score = 73.6 bits (179),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 55/84 (65%), Positives = 70/84 (83%), Gaps = 0/84 (0%)
 Frame = +1

Query  43   RCPRDALKlgvcanllgglvgvvIGTPPTLPCCSLIAGLADLEAAVCLCTAIRANILGIn  222
             CP+D LKLGVCAN+L  L+ + +GTPP  PCCSL+ GL DLEAA CLCTA++A +LGIN
Sbjct  45   SCPKDTLKLGVCANVLKDLLKIQLGTPPVKPCCSLLNGLVDLEAAACLCTALKAKVLGIN  104

Query  223  lnvplslslvlnnCGRQLPNGFTC  294
            LNVP+SLSL+LN CG+++P+GF C
Sbjct  105  LNVPVSLSLLLNVCGKKVPSGFVC  128



>ref|XP_010695115.1| PREDICTED: putative lipid-binding protein AIR1B [Beta vulgaris 
subsp. vulgaris]
Length=116

 Score = 73.2 bits (178),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 60/83 (72%), Positives = 69/83 (83%), Gaps = 0/83 (0%)
 Frame = +1

Query  46   CPRDALKlgvcanllgglvgvvIGTPPTLPCCSLIAGLADLEAAVCLCTAIRANILGInl  225
            CP D LKL VCAN+L GL+G+ IGTPP   CCSLI GLADL+AAVCLCTA+RAN+LGI L
Sbjct  33   CPFDTLKLKVCANVLNGLLGLTIGTPPRHSCCSLIQGLADLDAAVCLCTALRANVLGIRL  92

Query  226  nvplslslvlnnCGRQLPNGFTC  294
            NVP+SLSL+LN CG   P+GFTC
Sbjct  93   NVPISLSLLLNACGCNYPDGFTC  115



>ref|XP_006445312.1| hypothetical protein CICLE_v10022835mg [Citrus clementina]
 ref|XP_006490869.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Citrus sinensis]
 gb|ESR58552.1| hypothetical protein CICLE_v10022835mg [Citrus clementina]
Length=130

 Score = 73.6 bits (179),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 59/81 (73%), Positives = 70/81 (86%), Gaps = 0/81 (0%)
 Frame = +1

Query  52   RDALKlgvcanllgglvgvvIGTPPTLPCCSLIAGLADLEAAVCLCTAIRANILGInlnv  231
            RD LKLGVCA+LL  LV +V+GTPP  PCC+L+ GLADLEAAVCLCTAI+ANILGINLN+
Sbjct  48   RDTLKLGVCADLLNDLVHLVVGTPPVTPCCALLKGLADLEAAVCLCTAIKANILGINLNL  107

Query  232  plslslvlnnCGRQLPNGFTC  294
            P+SLSL+LN CG  +P+GF C
Sbjct  108  PISLSLLLNYCGNGVPSGFQC  128



>ref|XP_011081224.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Sesamum indicum]
Length=135

 Score = 73.6 bits (179),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 55/84 (65%), Positives = 70/84 (83%), Gaps = 0/84 (0%)
 Frame = +1

Query  43   RCPRDALKlgvcanllgglvgvvIGTPPTLPCCSLIAGLADLEAAVCLCTAIRANILGIn  222
             CPRDALKLGVCA LLGG +G ++G PP  PCCS++ GL DLEAAVCLCTA++AN+LGIN
Sbjct  51   HCPRDALKLGVCAKLLGGNIGTIVGNPPNTPCCSILGGLLDLEAAVCLCTALKANVLGIN  110

Query  223  lnvplslslvlnnCGRQLPNGFTC  294
            +N+P++LSL++N CG+ LP  F C
Sbjct  111  INIPIALSLLINTCGKTLPKDFIC  134



>ref|XP_003549907.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Glycine max]
Length=138

 Score = 73.6 bits (179),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 58/84 (69%), Positives = 70/84 (83%), Gaps = 0/84 (0%)
 Frame = +1

Query  43   RCPRDALKlgvcanllgglvgvvIGTPPTLPCCSLIAGLADLEAAVCLCTAIRANILGIn  222
             CPRDALKLGVCAN+L GL+ V +G PP  PCC+L+ GL DLEAAVCLCTA++AN+LGIN
Sbjct  54   SCPRDALKLGVCANVLKGLLNVTLGQPPVTPCCTLLDGLVDLEAAVCLCTALKANVLGIN  113

Query  223  lnvplslslvlnnCGRQLPNGFTC  294
            LN+P+SLSL+LN C RQ+P  F C
Sbjct  114  LNLPISLSLLLNVCSRQVPRDFQC  137



>ref|XP_006647641.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Oryza brachyantha]
Length=128

 Score = 73.6 bits (179),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 49/84 (58%), Positives = 68/84 (81%), Gaps = 1/84 (1%)
 Frame = +1

Query  43   RCPRDALKlgvcanllgglvgvvIGTPPTLPCCSLIAGLADLEAAVCLCTAIRANILGIn  222
            +CP++ALKL  CA++LG +    +G PP  PCCS++ GLADLEAAVCLCTAI+AN+LGI 
Sbjct  45   KCPKNALKLAACADVLGLVSAE-VGQPPYEPCCSVLGGLADLEAAVCLCTAIKANVLGIT  103

Query  223  lnvplslslvlnnCGRQLPNGFTC  294
            L++P+ LSL++N CG+ +P+GF C
Sbjct  104  LDIPVKLSLLVNYCGKNVPSGFIC  127



>ref|XP_010676150.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Beta vulgaris 
subsp. vulgaris]
Length=150

 Score = 73.9 bits (180),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 59/83 (71%), Positives = 69/83 (83%), Gaps = 0/83 (0%)
 Frame = +1

Query  46   CPRDALKlgvcanllgglvgvvIGTPPTLPCCSLIAGLADLEAAVCLCTAIRANILGInl  225
            CP DALKLGVCAN+L GL+ + IGTPP  PCC LI GL D EAAVCLCTAI+AN+LGINL
Sbjct  67   CPIDALKLGVCANVLNGLLDLTIGTPPKSPCCPLIQGLIDAEAAVCLCTAIKANVLGINL  126

Query  226  nvplslslvlnnCGRQLPNGFTC  294
             +PLS+SL++N CG QLP+GF C
Sbjct  127  EIPLSISLLVNYCGCQLPHGFQC  149



>ref|XP_010676148.1| PREDICTED: pEARLI1-like lipid transfer protein 1 [Beta vulgaris 
subsp. vulgaris]
Length=161

 Score = 73.9 bits (180),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 59/83 (71%), Positives = 69/83 (83%), Gaps = 0/83 (0%)
 Frame = +1

Query  46   CPRDALKlgvcanllgglvgvvIGTPPTLPCCSLIAGLADLEAAVCLCTAIRANILGInl  225
            CP DALK GVCAN+L  L+ + +GTPP  PCC LIAGL DLEAAVCLCTAI+ANILGINL
Sbjct  78   CPIDALKFGVCANVLTDLLNLNLGTPPKTPCCPLIAGLVDLEAAVCLCTAIKANILGINL  137

Query  226  nvplslslvlnnCGRQLPNGFTC  294
            N+PLSLSL++N CG ++P GF C
Sbjct  138  NIPLSLSLLVNYCGTKVPRGFQC  160



>ref|XP_009798258.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Nicotiana 
sylvestris]
Length=135

 Score = 73.6 bits (179),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 57/84 (68%), Positives = 70/84 (83%), Gaps = 0/84 (0%)
 Frame = +1

Query  43   RCPRDALKlgvcanllgglvgvvIGTPPTLPCCSLIAGLADLEAAVCLCTAIRANILGIn  222
            +CP DALKLGVCAN+L GL+ V +GTPP  PCCSLI  L DLEAAVCLCTA++A ILG+N
Sbjct  51   KCPTDALKLGVCANVLNGLLNVTLGTPPVKPCCSLIENLVDLEAAVCLCTALKAKILGVN  110

Query  223  lnvplslslvlnnCGRQLPNGFTC  294
            LN+P+SL+L+LN C ++ P GFTC
Sbjct  111  LNLPISLNLLLNVCSKKAPKGFTC  134



>ref|XP_004165505.1| PREDICTED: LOW QUALITY PROTEIN: 14 kDa proline-rich protein DC2.15-like 
[Cucumis sativus]
Length=136

 Score = 73.6 bits (179),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 55/84 (65%), Positives = 68/84 (81%), Gaps = 0/84 (0%)
 Frame = +1

Query  43   RCPRDALKlgvcanllgglvgvvIGTPPTLPCCSLIAGLADLEAAVCLCTAIRANILGIn  222
            +CP+DALK+GVCA LLGGLV + IG  P  PCC+L+ GLADLEAAVCLCTAI+A++LG  
Sbjct  53   KCPKDALKIGVCAKLLGGLVDLTIGKXPVTPCCTLVHGLADLEAAVCLCTAIKASVLGNK  112

Query  223  lnvplslslvlnnCGRQLPNGFTC  294
            + +PL LSL+LN C + LPNGF C
Sbjct  113  IKIPLHLSLLLNVCNKNLPNGFQC  136



>ref|XP_010448889.1| PREDICTED: putative lipid-binding protein AIR1 [Camelina sativa]
Length=136

 Score = 73.6 bits (179),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 56/83 (67%), Positives = 67/83 (81%), Gaps = 0/83 (0%)
 Frame = +1

Query  46   CPRDALKlgvcanllgglvgvvIGTPPTLPCCSLIAGLADLEAAVCLCTAIRANILGInl  225
            CP+DALKLGVC N L  L  V +GTPP  PCCSLI GL DLEAAVCLCTA++A++LGINL
Sbjct  53   CPKDALKLGVCVNALNLLNDVTLGTPPVTPCCSLIQGLVDLEAAVCLCTALKASVLGINL  112

Query  226  nvplslslvlnnCGRQLPNGFTC  294
            N+P++LSL+LN C R+ P GF C
Sbjct  113  NLPINLSLLLNVCSRKAPRGFQC  135



>ref|XP_006302912.1| hypothetical protein CARUB_v10021046mg [Capsella rubella]
 gb|EOA35810.1| hypothetical protein CARUB_v10021046mg [Capsella rubella]
Length=170

 Score = 73.9 bits (180),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 57/84 (68%), Positives = 72/84 (86%), Gaps = 0/84 (0%)
 Frame = +1

Query  43   RCPRDALKlgvcanllgglvgvvIGTPPTLPCCSLIAGLADLEAAVCLCTAIRANILGIn  222
            +CP+DALKLGVCAN+L GL+ + +G PP  PCC+LI GLADLEAA CLCTA++ANILGIN
Sbjct  87   KCPKDALKLGVCANVLNGLLNITLGKPPVEPCCTLIKGLADLEAAACLCTALKANILGIN  146

Query  223  lnvplslslvlnnCGRQLPNGFTC  294
            LN+P+SLSL+LN C +++P GF C
Sbjct  147  LNIPVSLSLLLNVCSKKVPPGFQC  170



>emb|CDP09930.1| unnamed protein product [Coffea canephora]
Length=130

 Score = 73.2 bits (178),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 56/84 (67%), Positives = 67/84 (80%), Gaps = 2/84 (2%)
 Frame = +1

Query  43   RCPRDALKlgvcanllgglvgvvIGTPPTLPCCSLIAGLADLEAAVCLCTAIRANILGIn  222
             CPRDALKLGVCA LL       IG PP  PCCS++ GL DLEAA+CLCTA+RANILGIN
Sbjct  48   SCPRDALKLGVCAKLLSIGTV--IGNPPDTPCCSILGGLLDLEAAICLCTALRANILGIN  105

Query  223  lnvplslslvlnnCGRQLPNGFTC  294
            LN+P+SLSL++N CG++LP+ F C
Sbjct  106  LNIPISLSLLVNTCGKKLPSDFIC  129



>ref|XP_002533293.1| 14 kDa proline-rich protein DC2.15 precursor, putative [Ricinus 
communis]
 gb|EEF29087.1| 14 kDa proline-rich protein DC2.15 precursor, putative [Ricinus 
communis]
Length=136

 Score = 73.6 bits (179),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 55/84 (65%), Positives = 67/84 (80%), Gaps = 0/84 (0%)
 Frame = +1

Query  43   RCPRDALKlgvcanllgglvgvvIGTPPTLPCCSLIAGLADLEAAVCLCTAIRANILGIn  222
            +CP+D LKLGVC +LL  L+ V IG PP  PCCSLI  L DLEAAVCLCT I+A++LGIN
Sbjct  52   KCPKDTLKLGVCVDLLKDLLSVTIGKPPKSPCCSLIGDLVDLEAAVCLCTTIKASLLGIN  111

Query  223  lnvplslslvlnnCGRQLPNGFTC  294
            LNVP+ LSL+LN CG+++P GF C
Sbjct  112  LNVPVDLSLLLNYCGKKVPEGFKC  135



>ref|XP_010919519.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Elaeis guineensis]
Length=143

 Score = 73.6 bits (179),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 56/84 (67%), Positives = 70/84 (83%), Gaps = 0/84 (0%)
 Frame = +1

Query  43   RCPRDALKlgvcanllgglvgvvIGTPPTLPCCSLIAGLADLEAAVCLCTAIRANILGIn  222
            +CP D LKLGVCAN+L GL+ + +G PP  PCCSLI GLADLEAAVCLCTA++ANILG N
Sbjct  59   KCPIDTLKLGVCANVLNGLINLTLGKPPKKPCCSLIKGLADLEAAVCLCTALKANILGAN  118

Query  223  lnvplslslvlnnCGRQLPNGFTC  294
            LN+P+ LSL++N CG+++P GF C
Sbjct  119  LNIPIDLSLLINYCGKKVPTGFQC  142



>ref|XP_003608743.1| 14 kDa proline-rich protein DC2.15 [Medicago truncatula]
 gb|AES90940.1| Lipid transfer protein [Medicago truncatula]
 gb|AFK42391.1| unknown [Medicago truncatula]
Length=143

 Score = 73.6 bits (179),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 57/83 (69%), Positives = 70/83 (84%), Gaps = 0/83 (0%)
 Frame = +1

Query  46   CPRDALKlgvcanllgglvgvvIGTPPTLPCCSLIAGLADLEAAVCLCTAIRANILGInl  225
            CPRDALKLGVCAN+L GL+ + +G PP  PCCSL+ GL DLEAA CLCTA++ANILGINL
Sbjct  60   CPRDALKLGVCANVLSGLLNLTLGKPPVTPCCSLLNGLVDLEAAACLCTALKANILGINL  119

Query  226  nvplslslvlnnCGRQLPNGFTC  294
            N+P+SLSL+LN C R++P+ F C
Sbjct  120  NLPISLSLLLNVCSRKVPHDFQC  142



>ref|XP_010430305.1| PREDICTED: lipid transfer protein EARLI 1 [Camelina sativa]
Length=149

 Score = 73.6 bits (179),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 57/84 (68%), Positives = 72/84 (86%), Gaps = 0/84 (0%)
 Frame = +1

Query  43   RCPRDALKlgvcanllgglvgvvIGTPPTLPCCSLIAGLADLEAAVCLCTAIRANILGIn  222
            +CP+DALKLGVCAN+L GL+ + +G PP  PCC+LI GLADLEAA CLCTA++ANILGIN
Sbjct  66   KCPKDALKLGVCANVLNGLLNITLGKPPVEPCCTLIQGLADLEAAACLCTALKANILGIN  125

Query  223  lnvplslslvlnnCGRQLPNGFTC  294
            LN+P+SLSL+LN C +++P GF C
Sbjct  126  LNIPISLSLLLNVCSKKVPPGFQC  149



>gb|KHN04353.1| 14 kDa proline-rich protein DC2.15 [Glycine soja]
Length=132

 Score = 73.2 bits (178),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 50/84 (60%), Positives = 65/84 (77%), Gaps = 0/84 (0%)
 Frame = +1

Query  43   RCPRDALKlgvcanllgglvgvvIGTPPTLPCCSLIAGLADLEAAVCLCTAIRANILGIn  222
             CP++ +K  V    + GL+ V +G PP  PCC+LI GLADLEAAVCLCTA++AN+LGIN
Sbjct  48   SCPKETIKFSVVCADVLGLINVQLGKPPKTPCCNLIQGLADLEAAVCLCTALKANVLGIN  107

Query  223  lnvplslslvlnnCGRQLPNGFTC  294
            LNVP++LSL+LN CG+ +P GF C
Sbjct  108  LNVPVNLSLLLNYCGKGVPKGFVC  131



>emb|CAL07983.1| arachidonic acid-induced DEA1-like protein [Platanus x acerifolia]
Length=66

 Score = 71.6 bits (174),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 46/61 (75%), Positives = 53/61 (87%), Gaps = 0/61 (0%)
 Frame = +1

Query  112  IGTPPTLPCCSLIAGLADLEAAVCLCTAIRANILGInlnvplslslvlnnCGRQLPNGFT  291
            +GTPP  P CSLI GL DLEAAVCLCTAI+A ILGINLNVP+SLSL+LN CG+++PNGF 
Sbjct  5    VGTPPKTPYCSLIEGLVDLEAAVCLCTAIKAKILGINLNVPVSLSLLLNYCGKKVPNGFQ  64

Query  292  C  294
            C
Sbjct  65   C  65



>ref|XP_009134275.1| PREDICTED: lipid transfer protein EARLI 1-like [Brassica rapa]
 emb|CDX90835.1| BnaA03g25150D [Brassica napus]
Length=133

 Score = 73.2 bits (178),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 56/83 (67%), Positives = 67/83 (81%), Gaps = 0/83 (0%)
 Frame = +1

Query  46   CPRDALKlgvcanllgglvgvvIGTPPTLPCCSLIAGLADLEAAVCLCTAIRANILGInl  225
            CPR  LKLGVCAN+L  L+ + +GTPP  PCCSL+ GL DLEAA CLCTA++AN+LGI L
Sbjct  50   CPRKTLKLGVCANVLKDLLKIELGTPPVKPCCSLLNGLVDLEAAACLCTALKANVLGIKL  109

Query  226  nvplslslvlnnCGRQLPNGFTC  294
            NVP+SLSL+LN CGR+ P GF C
Sbjct  110  NVPVSLSLLLNACGRKTPRGFIC  132



>ref|XP_002464967.1| hypothetical protein SORBIDRAFT_01g029610 [Sorghum bicolor]
 gb|EER91965.1| hypothetical protein SORBIDRAFT_01g029610 [Sorghum bicolor]
Length=124

 Score = 73.2 bits (178),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 59/84 (70%), Positives = 69/84 (82%), Gaps = 1/84 (1%)
 Frame = +1

Query  43   RCPRDALKlgvcanllgglvgvvIGTPPTLPCCSLIAGLADLEAAVCLCTAIRANILGIn  222
             CPRD+LKLGVCAN+LG +    IG+PP  PCCSL+ GL DLEAAVCLCTAI+ANILGIN
Sbjct  41   HCPRDSLKLGVCANVLGLVKAK-IGSPPYQPCCSLLDGLVDLEAAVCLCTAIKANILGIN  99

Query  223  lnvplslslvlnnCGRQLPNGFTC  294
            LN+P+ LSL+LNNCG+  PN F C
Sbjct  100  LNLPIDLSLILNNCGKNCPNDFHC  123



>ref|XP_007155641.1| hypothetical protein PHAVU_003G218900g [Phaseolus vulgaris]
 gb|ESW27635.1| hypothetical protein PHAVU_003G218900g [Phaseolus vulgaris]
Length=133

 Score = 73.2 bits (178),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 59/84 (70%), Positives = 68/84 (81%), Gaps = 0/84 (0%)
 Frame = +1

Query  43   RCPRDALKlgvcanllgglvgvvIGTPPTLPCCSLIAGLADLEAAVCLCTAIRANILGIn  222
             CPRDALKLGVCAN+L GLV   +G PP  PCC+L+ GL DLEAAVCLCTA++ANILGIN
Sbjct  49   SCPRDALKLGVCANVLNGLVNATLGQPPVTPCCTLLDGLVDLEAAVCLCTALKANILGIN  108

Query  223  lnvplslslvlnnCGRQLPNGFTC  294
            LN+P+SLSL+LN C RQ P  F C
Sbjct  109  LNLPISLSLLLNVCSRQAPRDFQC  132



>ref|XP_003546415.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Glycine max]
 gb|KHN15311.1| 14 kDa proline-rich protein DC2.15 [Glycine soja]
Length=139

 Score = 73.2 bits (178),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 48/83 (58%), Positives = 61/83 (73%), Gaps = 0/83 (0%)
 Frame = +1

Query  46   CPRDALKlgvcanllgglvgvvIGTPPTLPCCSLIAGLADLEAAVCLCTAIRANILGInl  225
            CPRD LKLG+C NLL   V + +G PP +PCCSLIAGL D EAAVCLCT +R NILGI+L
Sbjct  57   CPRDELKLGICTNLLNRTVNITLGEPPVIPCCSLIAGLVDFEAAVCLCTPLRQNILGIDL  116

Query  226  nvplslslvlnnCGRQLPNGFTC  294
            ++P+  + + N C R++P  F C
Sbjct  117  DIPVIFNFLFNICSREVPRDFLC  139



>ref|XP_006391856.1| hypothetical protein EUTSA_v10023747mg [Eutrema salsugineum]
 gb|ESQ29142.1| hypothetical protein EUTSA_v10023747mg [Eutrema salsugineum]
Length=147

 Score = 73.6 bits (179),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 58/84 (69%), Positives = 71/84 (85%), Gaps = 0/84 (0%)
 Frame = +1

Query  43   RCPRDALKlgvcanllgglvgvvIGTPPTLPCCSLIAGLADLEAAVCLCTAIRANILGIn  222
            +CPRDALKLGVCAN+L GL+ + +G PP  PCC+LI GLADLEAA CLCTA++ NILGIN
Sbjct  64   KCPRDALKLGVCANVLNGLLNITLGKPPVEPCCNLIKGLADLEAAACLCTALKGNILGIN  123

Query  223  lnvplslslvlnnCGRQLPNGFTC  294
            LN+PLSLSL+LN C +++P GF C
Sbjct  124  LNIPLSLSLLLNVCSKKVPPGFQC  147



>ref|XP_002454523.1| hypothetical protein SORBIDRAFT_04g032640 [Sorghum bicolor]
 ref|XP_002454526.1| hypothetical protein SORBIDRAFT_04g032670 [Sorghum bicolor]
 gb|EES07499.1| hypothetical protein SORBIDRAFT_04g032640 [Sorghum bicolor]
 gb|EES07502.1| hypothetical protein SORBIDRAFT_04g032670 [Sorghum bicolor]
Length=122

 Score = 72.8 bits (177),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 59/84 (70%), Positives = 68/84 (81%), Gaps = 1/84 (1%)
 Frame = +1

Query  43   RCPRDALKlgvcanllgglvgvvIGTPPTLPCCSLIAGLADLEAAVCLCTAIRANILGIn  222
             CPRDALKLGVCAN+LG +    +G PP  PCC L+AGL DLEAAVCLCTAI+AN+LGIN
Sbjct  40   SCPRDALKLGVCANVLGLIKAQ-VGVPPAEPCCPLLAGLVDLEAAVCLCTAIKANVLGIN  98

Query  223  lnvplslslvlnnCGRQLPNGFTC  294
            LNVPL LSL+LN CG+ +P GF C
Sbjct  99   LNVPLDLSLILNYCGKTVPTGFMC  122



>ref|NP_001047650.1| Os02g0662000 [Oryza sativa Japonica Group]
 gb|AAA65513.1| RCc3 [Oryza sativa Japonica Group]
 dbj|BAD25630.1| root-specific protein RCc3 [Oryza sativa Japonica Group]
 dbj|BAD27673.1| root-specific protein RCc3 [Oryza sativa Japonica Group]
 dbj|BAF09564.1| Os02g0662000 [Oryza sativa Japonica Group]
 gb|EAY86972.1| hypothetical protein OsI_08366 [Oryza sativa Indica Group]
 gb|EAZ24089.1| hypothetical protein OsJ_07827 [Oryza sativa Japonica Group]
 dbj|BAG98613.1| unnamed protein product [Oryza sativa Japonica Group]
Length=133

 Score = 73.2 bits (178),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 58/84 (69%), Positives = 67/84 (80%), Gaps = 1/84 (1%)
 Frame = +1

Query  43   RCPRDALKlgvcanllgglvgvvIGTPPTLPCCSLIAGLADLEAAVCLCTAIRANILGIn  222
            RCPRDALKLGVCAN+LG +    +G PP  PCC L+ GL DLEAAVCLCTAIR NILGIN
Sbjct  51   RCPRDALKLGVCANVLGLIKAK-VGVPPAEPCCPLLEGLVDLEAAVCLCTAIRGNILGIN  109

Query  223  lnvplslslvlnnCGRQLPNGFTC  294
            LN+P+ LSL+LN CG+ +P GF C
Sbjct  110  LNLPIDLSLILNYCGKTVPTGFKC  133



>ref|XP_009373377.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Pyrus x bretschneideri]
 ref|XP_009373378.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Pyrus x bretschneideri]
 ref|XP_009346904.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Pyrus x bretschneideri]
Length=140

 Score = 73.2 bits (178),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 57/83 (69%), Positives = 71/83 (86%), Gaps = 1/83 (1%)
 Frame = +1

Query  46   CPRDALKlgvcanllgglvgvvIGTPPTLPCCSLIAGLADLEAAVCLCTAIRANILGInl  225
            CPRD LKLG CA++L GLV +V+G PP  PCCSLI GL DL+AAVCLCTAI+AN++GINL
Sbjct  58   CPRDTLKLGACADVLNGLVHLVVG-PPKFPCCSLIEGLVDLDAAVCLCTAIKANVMGINL  116

Query  226  nvplslslvlnnCGRQLPNGFTC  294
            N+P+SLSL+LN CG+Q+P G+ C
Sbjct  117  NIPISLSLLLNYCGKQVPTGYEC  139



>ref|XP_002454525.1| hypothetical protein SORBIDRAFT_04g032660 [Sorghum bicolor]
 gb|EES07501.1| hypothetical protein SORBIDRAFT_04g032660 [Sorghum bicolor]
Length=122

 Score = 72.8 bits (177),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 59/84 (70%), Positives = 68/84 (81%), Gaps = 1/84 (1%)
 Frame = +1

Query  43   RCPRDALKlgvcanllgglvgvvIGTPPTLPCCSLIAGLADLEAAVCLCTAIRANILGIn  222
             CPRDALKLGVCAN+LG +    +G PP  PCC L+AGL DLEAAVCLCTAI+AN+LGIN
Sbjct  40   SCPRDALKLGVCANVLGLIKAQ-VGVPPAEPCCPLLAGLVDLEAAVCLCTAIKANVLGIN  98

Query  223  lnvplslslvlnnCGRQLPNGFTC  294
            LNVPL LSL+LN CG+ +P GF C
Sbjct  99   LNVPLDLSLILNYCGKTVPTGFMC  122



>ref|XP_002454524.1| hypothetical protein SORBIDRAFT_04g032650 [Sorghum bicolor]
 gb|EES07500.1| hypothetical protein SORBIDRAFT_04g032650 [Sorghum bicolor]
Length=131

 Score = 72.8 bits (177),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 59/84 (70%), Positives = 68/84 (81%), Gaps = 1/84 (1%)
 Frame = +1

Query  43   RCPRDALKlgvcanllgglvgvvIGTPPTLPCCSLIAGLADLEAAVCLCTAIRANILGIn  222
             CPRDALKLGVCAN+LG +    +G PP  PCC L+AGL DLEAAVCLCTAI+AN+LGIN
Sbjct  49   SCPRDALKLGVCANVLGLIKAQ-VGVPPAEPCCPLLAGLVDLEAAVCLCTAIKANVLGIN  107

Query  223  lnvplslslvlnnCGRQLPNGFTC  294
            LNVPL LSL+LN CG+ +P GF C
Sbjct  108  LNVPLDLSLILNYCGKTVPTGFMC  131



>ref|XP_007155638.1| hypothetical protein PHAVU_003G218700g [Phaseolus vulgaris]
 gb|ESW27632.1| hypothetical protein PHAVU_003G218700g [Phaseolus vulgaris]
Length=172

 Score = 73.6 bits (179),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 61/83 (73%), Positives = 69/83 (83%), Gaps = 0/83 (0%)
 Frame = +1

Query  46   CPRDALKlgvcanllgglvgvvIGTPPTLPCCSLIAGLADLEAAVCLCTAIRANILGInl  225
            CPRDALKLGVCAN+L GLV V +G PP  PCCSL++GL DLEAAVCLCTA+RANILGINL
Sbjct  89   CPRDALKLGVCANVLNGLVNVTLGQPPVTPCCSLLSGLVDLEAAVCLCTALRANILGINL  148

Query  226  nvplslslvlnnCGRQLPNGFTC  294
            N+P+SLSL+LN C  Q P  F C
Sbjct  149  NLPISLSLLLNVCSIQAPRDFQC  171



>ref|XP_009148613.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Brassica 
rapa]
 emb|CDY53347.1| BnaA06g38220D [Brassica napus]
Length=137

 Score = 73.2 bits (178),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 56/84 (67%), Positives = 72/84 (86%), Gaps = 0/84 (0%)
 Frame = +1

Query  43   RCPRDALKlgvcanllgglvgvvIGTPPTLPCCSLIAGLADLEAAVCLCTAIRANILGIn  222
            +CP+D L+LGVCAN+L GL+ + +G PP  PCCSLI GLAD+EAAVCLCTA++AN+LGIN
Sbjct  54   KCPKDTLQLGVCANVLNGLLDLTLGKPPVEPCCSLIQGLADVEAAVCLCTALKANVLGIN  113

Query  223  lnvplslslvlnnCGRQLPNGFTC  294
            LN+P+SLSL+LN C +Q+P GF C
Sbjct  114  LNLPISLSLLLNVCSKQVPPGFQC  137



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 666899500002