BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c62441_g1_i1 len=565 path=[1:0-564]

Length=565
                                                                      Score     E

ref|XP_009795079.1|  PREDICTED: probable LRR receptor-like serine...    242   8e-74   
ref|XP_006359902.1|  PREDICTED: probable LRR receptor-like serine...    237   7e-72   
ref|XP_009603226.1|  PREDICTED: probable LRR receptor-like serine...    231   1e-69   
ref|XP_004247374.1|  PREDICTED: probable LRR receptor-like serine...    231   1e-69   
ref|XP_002281432.1|  PREDICTED: probable LRR receptor-like serine...    220   2e-65   Vitis vinifera
gb|KHN15789.1|  Putative leucine-rich repeat receptor-like serine...    213   5e-64   
ref|XP_003555335.1|  PREDICTED: putative leucine-rich repeat rece...    213   1e-62   
gb|KHG00154.1|  hypothetical protein F383_18587                         211   1e-61   
ref|XP_003535659.1|  PREDICTED: leucine-rich repeat receptor-like...    208   1e-60   
ref|XP_006489350.1|  PREDICTED: probable LRR receptor-like serine...    207   3e-60   
ref|XP_006419882.1|  hypothetical protein CICLE_v10004756mg             207   3e-60   
ref|XP_010255977.1|  PREDICTED: probable LRR receptor-like serine...    204   2e-59   
ref|XP_011026171.1|  PREDICTED: leucine-rich repeat receptor-like...    204   5e-59   
ref|XP_004298162.1|  PREDICTED: leucine-rich repeat receptor-like...    202   1e-58   
ref|XP_010107993.1|  Putative leucine-rich repeat receptor-like s...    202   3e-58   
emb|CDO99027.1|  unnamed protein product                                201   4e-58   
ref|XP_002315786.1|  leucine-rich repeat family protein                 199   6e-58   Populus trichocarpa [western balsam poplar]
ref|XP_002311609.1|  leucine-rich repeat family protein                 200   9e-58   Populus trichocarpa [western balsam poplar]
ref|XP_003592431.1|  Receptor-like protein kinase                       199   3e-57   
ref|XP_007034690.1|  Serine-threonine protein kinase, plant-type,...    199   4e-57   
ref|XP_004496756.1|  PREDICTED: putative leucine-rich repeat rece...    198   4e-57   
gb|EYU45632.1|  hypothetical protein MIMGU_mgv11b003932mg               198   5e-57   
ref|XP_006297437.1|  hypothetical protein CARUB_v10013460mg             198   5e-57   
ref|XP_011071564.1|  PREDICTED: probable LRR receptor-like serine...    197   1e-56   
ref|XP_007143225.1|  hypothetical protein PHAVU_007G054600g             197   2e-56   
gb|KCW60816.1|  hypothetical protein EUGRSUZ_H03552                     193   3e-56   
ref|XP_008797062.1|  PREDICTED: leucine-rich repeat receptor-like...    195   8e-56   
ref|XP_008222988.1|  PREDICTED: probable LRR receptor-like serine...    196   8e-56   
ref|XP_010942424.1|  PREDICTED: leucine-rich repeat receptor-like...    195   1e-55   
ref|XP_007223269.1|  hypothetical protein PRUPE_ppa004492mg             194   2e-55   
ref|XP_011021564.1|  PREDICTED: probable LRR receptor-like serine...    194   2e-55   
ref|XP_010464165.1|  PREDICTED: probable LRR receptor-like serine...    194   2e-55   
ref|XP_010434850.1|  PREDICTED: leucine-rich repeat receptor-like...    194   3e-55   
gb|KDP40146.1|  hypothetical protein JCGZ_02144                         193   4e-55   
ref|NP_187250.1|  leucine-rich repeat family protein                    193   4e-55   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010486080.1|  PREDICTED: leucine-rich repeat receptor-like...    193   5e-55   
ref|XP_010277754.1|  PREDICTED: probable LRR receptor-like serine...    193   6e-55   
ref|XP_010024362.1|  PREDICTED: probable LRR receptor-like serine...    193   7e-55   
gb|KFK38012.1|  hypothetical protein AALP_AA3G058900                    192   2e-54   
ref|XP_006851088.1|  hypothetical protein AMTR_s00025p00244550          191   4e-54   
ref|XP_006408000.1|  hypothetical protein EUTSA_v10020522mg             187   1e-53   
ref|XP_006408001.1|  hypothetical protein EUTSA_v10020522mg             187   6e-53   
ref|XP_007034689.1|  Serine-threonine protein kinase, plant-type,...    187   9e-53   
emb|CDY05220.1|  BnaC05g45830D                                          184   2e-51   
ref|XP_004140259.1|  PREDICTED: putative leucine-rich repeat rece...    183   2e-51   
emb|CDY18839.1|  BnaAnng03040D                                          183   3e-51   
ref|XP_008449566.1|  PREDICTED: putative leucine-rich repeat rece...    183   6e-51   
emb|CDY27721.1|  BnaA05g31300D                                          182   8e-51   
ref|XP_010255974.1|  PREDICTED: probable LRR receptor-like serine...    182   1e-50   
ref|XP_009124944.1|  PREDICTED: leucine-rich repeat receptor-like...    181   2e-50   
ref|XP_009129624.1|  PREDICTED: leucine-rich repeat receptor-like...    178   2e-49   
ref|XP_009391353.1|  PREDICTED: probable LRR receptor-like serine...    173   2e-47   
ref|XP_011000432.1|  PREDICTED: probable LRR receptor-like serine...    172   3e-47   
gb|EAY88815.1|  hypothetical protein OsI_10287                          169   4e-46   Oryza sativa Indica Group [Indian rice]
emb|CAN75980.1|  hypothetical protein VITISV_012184                     169   4e-46   Vitis vinifera
ref|XP_004230793.1|  PREDICTED: probable LRR receptor-like serine...    167   1e-45   
ref|XP_002282141.2|  PREDICTED: probable LRR receptor-like serine...    167   3e-45   Vitis vinifera
ref|XP_008797310.1|  PREDICTED: probable LRR receptor-like serine...    166   4e-45   
ref|NP_001049189.1|  Os03g0184400                                       166   4e-45   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010546813.1|  PREDICTED: leucine-rich repeat receptor-like...    166   6e-45   
ref|XP_009772535.1|  PREDICTED: probable LRR receptor-like serine...    166   9e-45   
ref|XP_010666243.1|  PREDICTED: probable LRR receptor-like serine...    165   1e-44   
ref|XP_010028479.1|  PREDICTED: probable LRR receptor-like serine...    165   1e-44   
gb|AAK92623.1|AC079633_3  Putative protein with similarity to put...    165   2e-44   Oryza sativa [red rice]
ref|XP_002518770.1|  serine-threonine protein kinase, plant-type,...    164   3e-44   Ricinus communis
ref|XP_009617369.1|  PREDICTED: probable LRR receptor-like serine...    164   4e-44   
ref|XP_010551757.1|  PREDICTED: probable LRR receptor-like serine...    160   6e-44   
ref|XP_002313850.2|  hypothetical protein POPTR_0009s10510g             162   1e-43   Populus trichocarpa [western balsam poplar]
ref|XP_006489351.1|  PREDICTED: probable LRR receptor-like serine...    162   1e-43   
ref|XP_006489349.1|  PREDICTED: probable LRR receptor-like serine...    162   1e-43   
ref|XP_009384361.1|  PREDICTED: putative leucine-rich repeat rece...    161   3e-43   
ref|XP_006829745.1|  hypothetical protein AMTR_s00126p00126940          162   3e-43   
ref|XP_007034691.1|  Serine-threonine protein kinase, plant-type,...    160   4e-43   
ref|XP_008358552.1|  PREDICTED: probable LRR receptor-like serine...    162   5e-43   
ref|XP_009364215.1|  PREDICTED: putative leucine-rich repeat rece...    160   5e-43   
ref|XP_010939431.1|  PREDICTED: probable LRR receptor-like serine...    160   9e-43   
ref|XP_007042419.1|  Leucine-rich repeat (LRR) family protein, pu...    160   1e-42   
gb|KDP42294.1|  hypothetical protein JCGZ_01618                         159   1e-42   
ref|XP_006346435.1|  PREDICTED: probable LRR receptor-like serine...    159   1e-42   
ref|XP_010939430.1|  PREDICTED: probable LRR receptor-like serine...    159   2e-42   
ref|XP_010028480.1|  PREDICTED: probable LRR receptor-like serine...    159   2e-42   
ref|XP_004985457.1|  PREDICTED: probable LRR receptor-like serine...    159   2e-42   
dbj|BAK07739.1|  predicted protein                                      159   3e-42   
ref|XP_009338442.1|  PREDICTED: probable LRR receptor-like serine...    157   7e-42   
ref|XP_006649517.1|  PREDICTED: probable LRR receptor-like serine...    157   7e-42   
ref|XP_010241285.1|  PREDICTED: putative leucine-rich repeat rece...    157   8e-42   
emb|CBI32418.3|  unnamed protein product                                157   8e-42   
ref|XP_008654835.1|  PREDICTED: uncharacterized protein LOC100279...    157   1e-41   
ref|XP_002439749.1|  hypothetical protein SORBIDRAFT_09g019440          156   2e-41   Sorghum bicolor [broomcorn]
dbj|BAK07987.1|  predicted protein                                      155   4e-41   
ref|XP_008349097.1|  PREDICTED: probable LRR receptor-like serine...    155   1e-40   
ref|XP_004962178.1|  PREDICTED: leucine-rich repeat receptor-like...    154   1e-40   
ref|XP_002517208.1|  serine-threonine protein kinase, plant-type,...    154   1e-40   Ricinus communis
ref|XP_003578232.1|  PREDICTED: probable LRR receptor-like serine...    154   2e-40   
ref|XP_006654359.1|  PREDICTED: probable leucine-rich repeat rece...    151   2e-40   
ref|XP_006487131.1|  PREDICTED: probable LRR receptor-like serine...    153   2e-40   
ref|XP_003561977.1|  PREDICTED: probable leucine-rich repeat rece...    152   5e-40   
ref|XP_008782339.1|  PREDICTED: probable LRR receptor-like serine...    151   1e-39   
ref|XP_010241286.1|  PREDICTED: putative leucine-rich repeat rece...    150   2e-39   
gb|EPS72113.1|  hypothetical protein M569_02646                         150   4e-39   
ref|XP_010487850.1|  PREDICTED: putative leucine-rich repeat rece...    150   4e-39   
ref|XP_010466053.1|  PREDICTED: putative leucine-rich repeat rece...    149   5e-39   
ref|XP_009145818.1|  PREDICTED: putative leucine-rich repeat rece...    149   7e-39   
emb|CDX92310.1|  BnaA05g20970D                                          149   7e-39   
emb|CDX99256.1|  BnaC05g33710D                                          148   2e-38   
ref|XP_008660471.1|  PREDICTED: receptor-like protein kinase At3g...    148   2e-38   
gb|EYU37680.1|  hypothetical protein MIMGU_mgv1a004889mg                147   2e-38   
ref|XP_008373156.1|  PREDICTED: putative leucine-rich repeat rece...    147   3e-38   
dbj|BAJ92476.1|  predicted protein                                      147   3e-38   
ref|NP_188554.1|  leucine-rich repeat-containing protein                147   4e-38   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011088267.1|  PREDICTED: putative leucine-rich repeat rece...    147   5e-38   
ref|NP_001055453.1|  Os05g0393100                                       147   6e-38   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004957020.1|  PREDICTED: putative leucine-rich repeat rece...    147   6e-38   
ref|XP_011088266.1|  PREDICTED: putative leucine-rich repeat rece...    146   7e-38   
gb|EEC79168.1|  hypothetical protein OsI_19848                          146   7e-38   Oryza sativa Indica Group [Indian rice]
ref|XP_009419483.1|  PREDICTED: probable LRR receptor-like serine...    146   8e-38   
gb|KDO59697.1|  hypothetical protein CISIN_1g042915mg                   146   9e-38   
ref|XP_006423028.1|  hypothetical protein CICLE_v10030280mg             145   2e-37   
ref|XP_010521449.1|  PREDICTED: probable LRR receptor-like serine...    144   3e-37   
ref|XP_004296071.1|  PREDICTED: putative leucine-rich repeat rece...    144   4e-37   
ref|XP_010107946.1|  hypothetical protein L484_027536                   144   7e-37   
ref|XP_008236545.1|  PREDICTED: probable LRR receptor-like serine...    144   8e-37   
ref|NP_001063375.1|  Os09g0458300                                       143   9e-37   Oryza sativa Japonica Group [Japonica rice]
gb|EEC84704.1|  hypothetical protein OsI_31653                          143   9e-37   Oryza sativa Indica Group [Indian rice]
dbj|BAB02964.1|  unnamed protein product                                143   1e-36   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003568529.1|  PREDICTED: putative leucine-rich repeat rece...    142   2e-36   
ref|XP_008670240.1|  PREDICTED: probable LRR receptor-like serine...    142   2e-36   
ref|XP_008360349.1|  PREDICTED: LOW QUALITY PROTEIN: putative leu...    142   4e-36   
ref|XP_007200685.1|  hypothetical protein PRUPE_ppa017037mg             142   4e-36   
gb|KFK39243.1|  hypothetical protein AALP_AA3G219000                    142   4e-36   
ref|XP_010691040.1|  PREDICTED: probable LRR receptor-like serine...    141   4e-36   
ref|XP_010691039.1|  PREDICTED: probable LRR receptor-like serine...    141   4e-36   
ref|XP_006660701.1|  PREDICTED: probable LRR receptor-like serine...    141   5e-36   
ref|XP_006296645.1|  hypothetical protein CARUB_v10015204mg             140   1e-35   
ref|XP_006406523.1|  hypothetical protein EUTSA_v10022285mg             140   1e-35   
gb|EMT12993.1|  Putative LRR receptor-like serine/threonine-prote...    140   1e-35   
ref|XP_008454942.1|  PREDICTED: probable LRR receptor-like serine...    140   1e-35   
ref|XP_008660470.1|  PREDICTED: receptor-like protein kinase At3g...    139   3e-35   
tpg|DAA40243.1|  TPA: hypothetical protein ZEAMMB73_532617              141   3e-35   
gb|KGN43935.1|  hypothetical protein Csa_7G073710                       139   4e-35   
ref|XP_004136983.1|  PREDICTED: probable LRR receptor-like serine...    139   4e-35   
ref|XP_004166668.1|  PREDICTED: probable LRR receptor-like serine...    138   5e-35   
ref|XP_007156516.1|  hypothetical protein PHAVU_003G292500g             137   2e-34   
gb|EEE63620.1|  hypothetical protein OsJ_18437                          136   2e-34   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003520166.2|  PREDICTED: probable LRR receptor-like serine...    137   2e-34   
ref|XP_003607986.1|  Receptor-like protein kinase                       136   4e-34   
gb|EMT30919.1|  hypothetical protein F775_31967                         136   4e-34   
ref|XP_003528508.2|  PREDICTED: probable LRR receptor-like serine...    133   3e-33   
gb|KHN31071.1|  Putative LRR receptor-like serine/threonine-prote...    133   3e-33   
ref|XP_004505211.1|  PREDICTED: probable LRR receptor-like serine...    133   5e-33   
gb|AES90183.2|  Serine/Threonine kinase, plant-type protein, puta...    132   9e-33   
ref|XP_007042420.1|  Leucine-rich repeat (LRR) family protein iso...    128   1e-31   
gb|AFW82162.1|  hypothetical protein ZEAMMB73_909570                    126   1e-30   
emb|CDO97171.1|  unnamed protein product                                125   2e-30   
gb|EMS55102.1|  hypothetical protein TRIUR3_07045                       120   5e-29   
dbj|BAM21554.1|  hypothetical protein                                   111   2e-24   
ref|XP_002468379.1|  hypothetical protein SORBIDRAFT_01g044920          108   2e-24   Sorghum bicolor [broomcorn]
ref|XP_010521450.1|  PREDICTED: probable LRR receptor-like serine...    105   2e-23   
gb|EPS64562.1|  hypothetical protein M569_10219                         100   9e-22   
tpg|DAA40244.1|  TPA: hypothetical protein ZEAMMB73_532617            99.4    3e-21   
ref|XP_010647751.1|  PREDICTED: leucine-rich repeat receptor-like...  97.1    9e-21   
ref|XP_010415352.1|  PREDICTED: probable LRR receptor-like serine...    100   1e-20   
ref|XP_001770308.1|  predicted protein                                99.4    1e-20   
ref|NP_564904.1|  putative LRR receptor-like serine/threonine-pro...  99.8    1e-20   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010470688.1|  PREDICTED: probable LRR receptor-like serine...  97.8    4e-20   
ref|XP_010511725.1|  PREDICTED: probable LRR receptor-like serine...  96.3    2e-19   
ref|XP_010511724.1|  PREDICTED: probable LRR receptor-like serine...  96.3    2e-19   
ref|XP_006341770.1|  PREDICTED: probable LRR receptor-like serine...  96.3    2e-19   
ref|XP_004497458.1|  PREDICTED: probable LRR receptor-like serine...  96.3    2e-19   
ref|XP_011086716.1|  PREDICTED: probable LRR receptor-like serine...  96.3    2e-19   
ref|XP_004239170.1|  PREDICTED: probable LRR receptor-like serine...  96.3    2e-19   
ref|XP_010320968.1|  PREDICTED: probable LRR receptor-like serine...  95.9    3e-19   
ref|XP_009764239.1|  PREDICTED: probable LRR receptor-like serine...  95.5    4e-19   
ref|XP_009764238.1|  PREDICTED: probable LRR receptor-like serine...  95.5    4e-19   
ref|XP_007044946.1|  Leucine-rich repeat protein kinase family pr...  95.1    6e-19   
ref|XP_007044945.1|  Leucine-rich repeat protein kinase family pr...  95.1    6e-19   
gb|KFK41178.1|  hypothetical protein AALP_AA2G095700                  94.7    8e-19   
gb|KFK41177.1|  hypothetical protein AALP_AA2G095700                  94.7    8e-19   
ref|XP_010930016.1|  PREDICTED: probable LRR receptor-like serine...  94.4    1e-18   
emb|CDP13280.1|  unnamed protein product                              94.4    1e-18   
ref|XP_006391229.1|  hypothetical protein EUTSA_v10018088mg           93.6    1e-18   
ref|XP_006852166.1|  hypothetical protein AMTR_s00049p00092560        93.2    2e-18   
gb|EPS70255.1|  hypothetical protein M569_04504                       92.0    3e-18   
ref|XP_011094724.1|  PREDICTED: probable LRR receptor-like serine...  92.8    3e-18   
ref|XP_004310014.1|  PREDICTED: probable LRR receptor-like serine...  92.8    3e-18   
ref|XP_006300354.1|  hypothetical protein CARUB_v10021974mg           92.4    4e-18   
gb|KHG03301.1|  hypothetical protein F383_26873                       92.4    5e-18   
ref|XP_007225338.1|  hypothetical protein PRUPE_ppa001029mg           92.0    6e-18   
ref|XP_009105317.1|  PREDICTED: probable LRR receptor-like serine...  92.0    7e-18   
ref|XP_009605521.1|  PREDICTED: probable LRR receptor-like serine...  91.7    7e-18   
ref|XP_010682389.1|  PREDICTED: probable LRR receptor-like serine...  91.7    7e-18   
ref|XP_009605520.1|  PREDICTED: probable LRR receptor-like serine...  91.7    7e-18   
ref|XP_010682388.1|  PREDICTED: probable LRR receptor-like serine...  91.7    8e-18   
ref|XP_009105318.1|  PREDICTED: probable LRR receptor-like serine...  91.7    9e-18   
gb|EYU25957.1|  hypothetical protein MIMGU_mgv1a000970mg              91.7    1e-17   
gb|EMS48998.1|  hypothetical protein TRIUR3_02651                     88.6    1e-17   
ref|XP_008368257.1|  PREDICTED: probable LRR receptor-like serine...  91.3    1e-17   
ref|XP_006484013.1|  PREDICTED: probable LRR receptor-like serine...  90.9    1e-17   
gb|AAG28906.1|AC008113_22  F12A21.14                                  90.9    2e-17   Arabidopsis thaliana [mouse-ear cress]
emb|CDX79713.1|  BnaC03g20490D                                        90.9    2e-17   
ref|XP_006438153.1|  hypothetical protein CICLE_v10030677mg           90.5    2e-17   
gb|KDO82074.1|  hypothetical protein CISIN_1g002336mg                 90.5    2e-17   
gb|KEH35279.1|  LRR receptor-like kinase                              90.5    2e-17   
ref|XP_006438152.1|  hypothetical protein CICLE_v10030677mg           90.5    2e-17   
ref|XP_002311739.2|  leucine-rich repeat family protein               90.5    2e-17   Populus trichocarpa [western balsam poplar]
gb|KDO82072.1|  hypothetical protein CISIN_1g002336mg                 90.1    3e-17   
gb|KDO82076.1|  hypothetical protein CISIN_1g002336mg                 90.1    3e-17   
gb|KDO82071.1|  hypothetical protein CISIN_1g002336mg                 90.1    3e-17   
ref|XP_009133111.1|  PREDICTED: probable LRR receptor-like serine...  90.1    3e-17   
ref|XP_009133114.1|  PREDICTED: probable LRR receptor-like serine...  90.1    3e-17   
emb|CDY46751.1|  BnaA03g16950D                                        90.1    3e-17   
ref|XP_006580105.1|  PREDICTED: probable LRR receptor-like serine...  89.7    4e-17   
ref|XP_007158729.1|  hypothetical protein PHAVU_002G177200g           89.7    4e-17   
ref|XP_011029602.1|  PREDICTED: probable LRR receptor-like serine...  89.7    5e-17   
gb|KHN12422.1|  Putative LRR receptor-like serine/threonine-prote...  89.4    5e-17   
ref|XP_010043607.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  88.6    5e-17   
ref|XP_010253497.1|  PREDICTED: probable LRR receptor-like serine...  89.4    6e-17   
ref|XP_011029603.1|  PREDICTED: probable LRR receptor-like serine...  89.4    6e-17   
ref|NP_001239648.1|  probable LRR receptor-like serine/threonine-...  89.0    7e-17   
ref|XP_002314568.2|  leucine-rich repeat family protein               89.0    7e-17   Populus trichocarpa [western balsam poplar]
gb|ACM89490.1|  leucine-rich repeat family protein / protein kina...  89.0    7e-17   Glycine max [soybeans]
ref|XP_004978420.1|  PREDICTED: probable LRR receptor-like serine...  89.0    7e-17   
ref|XP_006584597.1|  PREDICTED: probable LRR receptor-like serine...  89.0    8e-17   
ref|XP_010260164.1|  PREDICTED: probable LRR receptor-like serine...  88.6    8e-17   
ref|XP_006584598.1|  PREDICTED: probable LRR receptor-like serine...  88.6    8e-17   
ref|XP_006391230.1|  hypothetical protein EUTSA_v10018088mg           88.6    8e-17   
ref|XP_010260163.1|  PREDICTED: probable LRR receptor-like serine...  88.6    8e-17   
ref|XP_010238835.1|  PREDICTED: probable LRR receptor-like serine...  88.6    9e-17   
ref|XP_010260162.1|  PREDICTED: probable LRR receptor-like serine...  88.6    9e-17   
ref|XP_004977651.1|  PREDICTED: probable LRR receptor-like serine...  88.6    1e-16   
ref|XP_009598261.1|  PREDICTED: probable LRR receptor-like serine...  87.8    1e-16   
ref|XP_011042336.1|  PREDICTED: probable LRR receptor-like serine...  88.2    1e-16   
ref|XP_011042340.1|  PREDICTED: probable LRR receptor-like serine...  88.2    1e-16   
gb|KHN44396.1|  Putative LRR receptor-like serine/threonine-prote...  88.2    1e-16   
ref|XP_003537548.1|  PREDICTED: probable LRR receptor-like serine...  88.2    1e-16   
ref|XP_010250885.1|  PREDICTED: probable LRR receptor-like serine...  88.2    1e-16   
ref|XP_008389778.1|  PREDICTED: probable LRR receptor-like serine...  88.2    1e-16   
ref|XP_010250886.1|  PREDICTED: probable LRR receptor-like serine...  88.2    1e-16   
ref|XP_006410884.1|  hypothetical protein EUTSA_v10016198mg           87.8    2e-16   
ref|XP_008807217.1|  PREDICTED: probable LRR receptor-like serine...  86.7    2e-16   
ref|XP_010100308.1|  putative LRR receptor-like serine/threonine-...  87.8    2e-16   
ref|XP_008674464.1|  PREDICTED: probable LRR receptor-like serine...  87.0    3e-16   
ref|XP_009359353.1|  PREDICTED: probable LRR receptor-like serine...  86.7    4e-16   
ref|XP_009787248.1|  PREDICTED: probable LRR receptor-like serine...  86.3    4e-16   
ref|XP_011006929.1|  PREDICTED: probable LRR receptor-like serine...  85.9    7e-16   
ref|XP_006601909.1|  PREDICTED: probable LRR receptor-like serine...  85.9    7e-16   
emb|CDX96066.1|  BnaA07g26650D                                        85.9    9e-16   
gb|KHN24106.1|  Putative LRR receptor-like serine/threonine-prote...  85.1    1e-15   
ref|XP_002322852.1|  leucine-rich repeat family protein               85.1    1e-15   Populus trichocarpa [western balsam poplar]
gb|KDO82075.1|  hypothetical protein CISIN_1g002336mg                 85.1    1e-15   
gb|KGN58929.1|  hypothetical protein Csa_3G736770                     85.1    1e-15   
gb|KDO82077.1|  hypothetical protein CISIN_1g002336mg                 84.7    1e-15   
ref|XP_002530229.1|  serine-threonine protein kinase, plant-type,...  84.0    2e-15   Ricinus communis
ref|XP_011048405.1|  PREDICTED: probable LRR receptor-like serine...  85.1    2e-15   
ref|XP_006438151.1|  hypothetical protein CICLE_v10030677mg           84.3    2e-15   
ref|XP_003567556.2|  PREDICTED: uncharacterized protein LOC100822022  85.1    2e-15   
ref|XP_010499357.1|  PREDICTED: putative leucine-rich repeat rece...  84.3    2e-15   
gb|KCW86601.1|  hypothetical protein EUGRSUZ_B03231                   84.3    2e-15   
ref|XP_009413555.1|  PREDICTED: probable LRR receptor-like serine...  84.3    2e-15   
ref|XP_010044512.1|  PREDICTED: probable LRR receptor-like serine...  84.3    2e-15   
ref|XP_010044511.1|  PREDICTED: probable LRR receptor-like serine...  84.3    2e-15   
emb|CDY01841.1|  BnaC06g28810D                                        84.3    3e-15   
ref|XP_006424721.1|  hypothetical protein CICLE_v10030050mg           83.6    3e-15   
ref|XP_010028481.1|  PREDICTED: probable LRR receptor-like serine...  82.4    3e-15   
gb|KFK36595.1|  hypothetical protein AALP_AA4G144100                  84.0    4e-15   
ref|XP_008372604.1|  PREDICTED: probable LRR receptor-like serine...  80.9    4e-15   
ref|XP_008679322.1|  PREDICTED: probable LRR receptor-like serine...  83.6    4e-15   
ref|XP_011004155.1|  PREDICTED: probable LRR receptor-like serine...  83.6    4e-15   
ref|XP_008446104.1|  PREDICTED: probable LRR receptor-like serine...  83.2    5e-15   
ref|XP_006381498.1|  leucine-rich repeat family protein               83.2    5e-15   
dbj|BAF79954.1|  receptor-like kinase                                 83.2    6e-15   Marchantia polymorpha
gb|KEH42291.1|  LRR receptor-like kinase                              83.2    7e-15   
ref|XP_007016571.1|  Leucine-rich repeat transmembrane protein ki...  82.4    7e-15   
ref|XP_008442636.1|  PREDICTED: probable LRR receptor-like serine...  82.8    7e-15   
ref|XP_008442635.1|  PREDICTED: probable LRR receptor-like serine...  82.8    7e-15   
ref|XP_008792368.1|  PREDICTED: probable LRR receptor-like serine...  82.8    7e-15   
gb|ABA91110.1|  leucine-rich repeat family protein, putative, exp...  82.8    8e-15   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008792358.1|  PREDICTED: probable LRR receptor-like serine...  82.8    8e-15   
tpg|DAA55633.1|  TPA: putative protein kinase superfamily protein     82.0    8e-15   
gb|ABA95578.2|  leucine-rich repeat family protein, putative, exp...  82.8    8e-15   
ref|XP_006361768.1|  PREDICTED: probable LRR receptor-like serine...  82.8    8e-15   
gb|KCW49705.1|  hypothetical protein EUGRSUZ_K03207                   82.0    9e-15   
emb|CDX74990.1|  BnaA05g07360D                                        82.4    9e-15   
ref|XP_010528095.1|  PREDICTED: probable LRR receptor-like serine...  82.4    1e-14   
ref|XP_010528086.1|  PREDICTED: probable LRR receptor-like serine...  82.4    1e-14   
ref|XP_002319587.1|  hypothetical protein POPTR_0013s03130g           81.6    1e-14   
ref|XP_006646748.1|  PREDICTED: probable LRR receptor-like serine...  82.4    1e-14   
ref|XP_008462389.1|  PREDICTED: putative leucine-rich repeat rece...  82.4    1e-14   
ref|XP_004155981.1|  PREDICTED: putative leucine-rich repeat rece...  82.0    1e-14   
ref|XP_004141796.1|  PREDICTED: putative leucine-rich repeat rece...  82.0    1e-14   
ref|XP_011023495.1|  PREDICTED: uncharacterized protein At1g24485...  81.6    1e-14   
ref|XP_010653460.1|  PREDICTED: probable LRR receptor-like serine...  82.4    1e-14   
ref|XP_010653459.1|  PREDICTED: probable LRR receptor-like serine...  82.4    1e-14   
ref|XP_003601851.1|  Leucine-rich repeat family protein / protein...  82.4    1e-14   
ref|NP_001031498.1|  putative receptor protein kinase                 82.0    1e-14   
ref|XP_010460621.1|  PREDICTED: putative leucine-rich repeat rece...  81.6    1e-14   
gb|KGN45557.1|  hypothetical protein Csa_7G452120                     82.0    1e-14   
ref|XP_008789752.1|  PREDICTED: probable LRR receptor-like serine...  81.6    1e-14   
ref|XP_009342370.1|  PREDICTED: probable LRR receptor-like serine...  82.0    1e-14   
ref|XP_006488657.1|  PREDICTED: putative leucine-rich repeat rece...  81.3    2e-14   
ref|XP_009342366.1|  PREDICTED: probable LRR receptor-like serine...  82.0    2e-14   
ref|XP_009620317.1|  PREDICTED: probable LRR receptor-like serine...  82.0    2e-14   
ref|XP_010696375.1|  PREDICTED: probable LRR receptor-like serine...  82.0    2e-14   
ref|XP_010509399.1|  PREDICTED: probable LRR receptor-like serine...  82.0    2e-14   
ref|XP_010505262.1|  PREDICTED: probable LRR receptor-like serine...  81.6    2e-14   
ref|XP_010556245.1|  PREDICTED: probable LRR receptor-like serine...  81.6    2e-14   
ref|NP_001031499.1|  putative receptor protein kinase                 81.6    2e-14   
gb|AAO22763.1|  putative receptor protein kinase                      81.6    2e-14   
ref|NP_181242.3|  putative receptor protein kinase                    81.6    2e-14   
ref|XP_010928957.1|  PREDICTED: putative receptor-like protein ki...  80.9    2e-14   
ref|XP_010037927.1|  PREDICTED: probable LRR receptor-like serine...  81.3    2e-14   
gb|KHG27933.1|  hypothetical protein F383_10215                       81.3    2e-14   
ref|XP_008221974.1|  PREDICTED: probable LRR receptor-like serine...  81.3    2e-14   
ref|XP_008221975.1|  PREDICTED: probable LRR receptor-like serine...  81.3    3e-14   
ref|XP_010478202.1|  PREDICTED: putative leucine-rich repeat rece...  80.9    3e-14   
emb|CDX91333.1|  BnaC04g08170D                                        81.3    3e-14   
emb|CDP08977.1|  unnamed protein product                              80.9    3e-14   
ref|XP_009406948.1|  PREDICTED: probable LRR receptor-like serine...  80.9    4e-14   
gb|AAF16758.1|AC010155_11  F3M18.23                                   80.5    4e-14   
ref|NP_174156.1|  receptor like protein 4                             80.5    4e-14   
ref|XP_007152619.1|  hypothetical protein PHAVU_004G145300g           80.1    4e-14   
ref|XP_003625573.1|  Leucine-rich repeat receptor-like protein ki...  80.9    4e-14   
ref|XP_008364347.1|  PREDICTED: probable LRR receptor-like serine...  80.1    4e-14   
ref|XP_009143531.1|  PREDICTED: probable LRR receptor-like serine...  80.5    5e-14   
ref|XP_002267668.1|  PREDICTED: probable LRR receptor-like serine...  80.5    5e-14   
gb|KDO55256.1|  hypothetical protein CISIN_1g002382mg                 80.1    5e-14   
emb|CBI27523.3|  unnamed protein product                              80.5    5e-14   
ref|XP_004135296.1|  PREDICTED: LOW QUALITY PROTEIN: probable LRR...  80.5    5e-14   
gb|KGN51709.1|  hypothetical protein Csa_5G591740                     80.5    5e-14   
ref|XP_004164199.1|  PREDICTED: probable LRR receptor-like serine...  80.5    6e-14   
ref|XP_010107600.1|  putative LRR receptor-like serine/threonine-...  80.1    6e-14   
ref|XP_003551909.1|  PREDICTED: probable LRR receptor-like serine...  80.1    6e-14   
ref|XP_006307000.1|  hypothetical protein CARUB_v10008578mg           79.7    6e-14   
ref|XP_010686419.1|  PREDICTED: receptor-like protein kinase At5g...  79.7    6e-14   
emb|CDP06699.1|  unnamed protein product                              80.1    6e-14   
gb|KDP29068.1|  hypothetical protein JCGZ_16457                       80.1    6e-14   
gb|KHN09470.1|  Putative LRR receptor-like serine/threonine-prote...  80.1    6e-14   
ref|XP_006577007.1|  PREDICTED: probable LRR receptor-like serine...  80.1    6e-14   
ref|XP_006577006.1|  PREDICTED: probable LRR receptor-like serine...  80.1    6e-14   
gb|KDO55255.1|  hypothetical protein CISIN_1g002382mg                 80.1    6e-14   
ref|XP_006577008.1|  PREDICTED: probable LRR receptor-like serine...  80.1    6e-14   
gb|KDO55257.1|  hypothetical protein CISIN_1g002382mg                 80.1    7e-14   
gb|KDO55259.1|  hypothetical protein CISIN_1g002382mg                 79.7    7e-14   
dbj|BAJ93703.1|  predicted protein                                    80.1    7e-14   
ref|XP_004246699.1|  PREDICTED: probable LRR receptor-like serine...  80.1    7e-14   
ref|XP_010920942.1|  PREDICTED: probable LRR receptor-like serine...  79.7    7e-14   
gb|KDO55254.1|  hypothetical protein CISIN_1g002382mg                 79.7    8e-14   
gb|KDO55252.1|  hypothetical protein CISIN_1g002382mg                 79.7    8e-14   
gb|KHN02370.1|  Putative LRR receptor-like serine/threonine-prote...  79.7    9e-14   
ref|NP_179051.1|  putative leucine-rich repeat receptor-like seri...  79.7    9e-14   
ref|XP_006604549.1|  PREDICTED: probable LRR receptor-like serine...  79.7    9e-14   
gb|KEH26746.1|  carbohydrate-binding protein of the ER protein        79.0    9e-14   
ref|XP_007144524.1|  hypothetical protein PHAVU_007G163000g           79.7    1e-13   
ref|XP_009757162.1|  PREDICTED: probable LRR receptor-like serine...  79.3    1e-13   
ref|XP_004493940.1|  PREDICTED: probable LRR receptor-like serine...  79.3    1e-13   
ref|XP_004493941.1|  PREDICTED: probable LRR receptor-like serine...  79.3    1e-13   
ref|XP_004493939.1|  PREDICTED: probable LRR receptor-like serine...  79.3    1e-13   
gb|KEH26745.1|  carbohydrate-binding protein of the ER protein        79.0    1e-13   
gb|EYU36242.1|  hypothetical protein MIMGU_mgv1a021395mg              78.6    1e-13   
ref|XP_010253387.1|  PREDICTED: probable LRR receptor-like serine...  78.6    1e-13   
ref|XP_011096342.1|  PREDICTED: putative leucine-rich repeat rece...  78.6    1e-13   
gb|AIZ68210.1|  leucine-rich repeat receptor-like serine/threonin...  78.6    1e-13   
ref|XP_002279791.2|  PREDICTED: putative leucine-rich repeat rece...  78.6    1e-13   
ref|XP_006480593.1|  PREDICTED: probable LRR receptor-like serine...  79.0    1e-13   
ref|XP_004513345.1|  PREDICTED: probable LRR receptor-like serine...  78.6    1e-13   
ref|XP_009396541.1|  PREDICTED: probable LRR receptor-like protei...  79.0    1e-13   
ref|XP_007207221.1|  hypothetical protein PRUPE_ppa001056mg           79.0    1e-13   
ref|XP_004502339.1|  PREDICTED: probable LRR receptor-like serine...  79.0    2e-13   
ref|XP_006428885.1|  hypothetical protein CICLE_v10011018mg           79.0    2e-13   
ref|XP_007162718.1|  hypothetical protein PHAVU_001G174500g           79.0    2e-13   
ref|XP_009388886.1|  PREDICTED: putative receptor-like protein ki...  78.6    2e-13   
ref|XP_010272369.1|  PREDICTED: putative leucine-rich repeat rece...  78.2    2e-13   
gb|KFK44705.1|  hypothetical protein AALP_AA1G292400                  78.2    2e-13   
ref|XP_007207222.1|  hypothetical protein PRUPE_ppa001056mg           78.6    2e-13   
ref|XP_007159352.1|  hypothetical protein PHAVU_002G230800g           78.2    2e-13   
ref|XP_010253386.1|  PREDICTED: uncharacterized protein At1g24485...  78.2    2e-13   
ref|XP_010516950.1|  PREDICTED: probable LRR receptor-like serine...  78.6    2e-13   
ref|XP_006438150.1|  hypothetical protein CICLE_v10030677mg           77.8    2e-13   
gb|EYU28502.1|  hypothetical protein MIMGU_mgv1a010461mg              75.9    2e-13   
gb|KFK38399.1|  hypothetical protein AALP_AA3G108000                  77.4    2e-13   
ref|XP_006293593.1|  hypothetical protein CARUB_v10022540mg           78.6    2e-13   
ref|XP_010111192.1|  hypothetical protein L484_015076                 77.8    2e-13   
ref|XP_006415667.1|  hypothetical protein EUTSA_v10007074mg           77.8    3e-13   
ref|XP_008239163.1|  PREDICTED: probable LRR receptor-like serine...  78.2    3e-13   
gb|KCW49706.1|  hypothetical protein EUGRSUZ_K03208                   78.2    3e-13   
ref|XP_010037926.1|  PREDICTED: LOW QUALITY PROTEIN: probable LRR...  78.2    3e-13   
ref|XP_006594111.1|  PREDICTED: probable LRR receptor-like serine...  78.2    3e-13   
ref|XP_010238012.1|  PREDICTED: probable LRR receptor-like serine...  77.8    3e-13   
ref|XP_010260297.1|  PREDICTED: receptor-like protein kinase At5g...  77.4    3e-13   
gb|KHG07084.1|  hypothetical protein F383_33781                       77.4    4e-13   
ref|XP_011090084.1|  PREDICTED: probable LRR receptor-like serine...  77.0    4e-13   
gb|KDP20997.1|  hypothetical protein JCGZ_21468                       77.4    4e-13   
gb|KDO82079.1|  hypothetical protein CISIN_1g002336mg                 77.0    4e-13   
ref|XP_010260296.1|  PREDICTED: receptor-like protein kinase At5g...  77.0    5e-13   
ref|NP_197192.2|  putative LRR receptor-like serine/threonine-pro...  77.4    5e-13   
ref|XP_009406963.1|  PREDICTED: probable LRR receptor-like serine...  74.3    5e-13   
ref|XP_008372415.1|  PREDICTED: probable LRR receptor-like serine...  77.4    5e-13   
gb|ABK24881.1|  unknown                                               73.9    5e-13   
ref|XP_008372603.1|  PREDICTED: probable LRR receptor-like serine...  77.4    6e-13   
gb|EYU18910.1|  hypothetical protein MIMGU_mgv1a025255mg              76.6    6e-13   
ref|XP_009384896.1|  PREDICTED: putative leucine-rich repeat rece...  76.6    6e-13   
gb|KDO82073.1|  hypothetical protein CISIN_1g002336mg                 77.0    6e-13   
ref|XP_003528463.1|  PREDICTED: putative leucine-rich repeat rece...  76.6    7e-13   
ref|XP_009397386.1|  PREDICTED: probable LRR receptor-like serine...  77.0    8e-13   
gb|EYU27999.1|  hypothetical protein MIMGU_mgv1a002935mg              76.3    9e-13   
ref|XP_006853556.1|  hypothetical protein AMTR_s00032p00238080        75.9    1e-12   
gb|EYU36240.1|  hypothetical protein MIMGU_mgv1a006092mg              75.5    1e-12   
gb|KHG14094.1|  hypothetical protein F383_20289                       75.9    1e-12   
ref|XP_006585557.1|  PREDICTED: probable LRR receptor-like serine...  76.3    1e-12   
ref|XP_007027232.1|  Leucine-rich repeat protein kinase family pr...  76.3    1e-12   
gb|KHN48328.1|  Putative LRR receptor-like serine/threonine-prote...  76.3    1e-12   
ref|XP_004485811.1|  PREDICTED: receptor-like protein kinase At3g...  75.9    1e-12   
ref|XP_003542736.1|  PREDICTED: putative leucine-rich repeat rece...  75.9    1e-12   
ref|XP_007027234.1|  Leucine-rich repeat protein kinase family pr...  76.3    1e-12   
gb|KHN09981.1|  Putative LRR receptor-like serine/threonine-prote...  75.9    1e-12   
gb|KHG07085.1|  hypothetical protein F383_33781                       75.9    1e-12   
ref|XP_007027235.1|  Leucine-rich repeat protein kinase family pr...  76.3    1e-12   
ref|XP_007027233.1|  Leucine-rich repeat protein kinase family pr...  75.9    1e-12   
ref|XP_007139356.1|  hypothetical protein PHAVU_008G022700g           75.5    2e-12   
ref|XP_009113673.1|  PREDICTED: putative leucine-rich repeat rece...  75.5    2e-12   
ref|XP_008653115.1|  PREDICTED: putative leucine-rich repeat rece...  75.5    2e-12   
ref|XP_008369797.1|  PREDICTED: probable LRR receptor-like serine...  75.9    2e-12   
ref|XP_002462899.1|  hypothetical protein SORBIDRAFT_02g034070        75.5    2e-12   
ref|XP_009358189.1|  PREDICTED: probable LRR receptor-like serine...  75.5    2e-12   
ref|XP_009358188.1|  PREDICTED: probable LRR receptor-like serine...  75.5    2e-12   
gb|KEH18237.1|  LRR receptor-like kinase plant                        75.5    2e-12   
ref|XP_007207984.1|  hypothetical protein PRUPE_ppa015663mg           75.1    2e-12   
emb|CDY30804.1|  BnaC05g21800D                                        75.1    2e-12   
ref|XP_003543034.1|  PREDICTED: putative leucine-rich repeat rece...  74.7    3e-12   
ref|XP_006449386.1|  hypothetical protein CICLE_v10014609mg           74.3    3e-12   
ref|XP_006594576.1|  PREDICTED: putative leucine-rich repeat rece...  74.7    3e-12   
ref|XP_007025562.1|  Receptor like protein 4 isoform 1                74.7    3e-12   
ref|XP_008372239.1|  PREDICTED: probable LRR receptor-like serine...  75.1    3e-12   
ref|XP_009362221.1|  PREDICTED: probable LRR receptor-like serine...  75.1    3e-12   
ref|XP_006449385.1|  hypothetical protein CICLE_v10014609mg           74.7    3e-12   
gb|KEH18235.1|  LRR receptor-like kinase plant                        74.7    3e-12   
ref|XP_004164020.1|  PREDICTED: putative leucine-rich repeat rece...  74.3    3e-12   
ref|XP_010052291.1|  PREDICTED: putative leucine-rich repeat rece...  74.3    4e-12   
ref|XP_004146611.1|  PREDICTED: putative leucine-rich repeat rece...  74.3    4e-12   
ref|XP_006467753.1|  PREDICTED: receptor-like protein kinase At3g...  74.3    4e-12   
ref|XP_004164019.1|  PREDICTED: putative leucine-rich repeat rece...  74.3    4e-12   
ref|XP_004146610.1|  PREDICTED: putative leucine-rich repeat rece...  74.3    4e-12   
ref|XP_010922499.1|  PREDICTED: probable LRR receptor-like serine...  74.7    4e-12   
ref|XP_009407463.1|  PREDICTED: probable LRR receptor-like serine...  74.7    4e-12   
gb|KDO77658.1|  hypothetical protein CISIN_1g006035mg                 73.9    4e-12   
gb|KHN08500.1|  Putative leucine-rich repeat receptor-like serine...  74.3    4e-12   
ref|XP_004955444.1|  PREDICTED: probable LRR receptor-like serine...  74.7    4e-12   
ref|XP_006597454.1|  PREDICTED: putative leucine-rich repeat rece...  74.3    4e-12   
gb|KDO77657.1|  hypothetical protein CISIN_1g006035mg                 73.9    4e-12   
gb|KDO77655.1|  hypothetical protein CISIN_1g006035mg                 74.3    4e-12   
ref|XP_006586412.1|  PREDICTED: putative leucine-rich repeat rece...  74.3    4e-12   
gb|KDO77656.1|  hypothetical protein CISIN_1g006035mg                 74.3    5e-12   
ref|XP_002509445.1|  serine-threonine protein kinase, plant-type,...  74.3    5e-12   
ref|XP_010549347.1|  PREDICTED: probable LRR receptor-like protei...  73.9    5e-12   
ref|XP_003547157.1|  PREDICTED: putative leucine-rich repeat rece...  73.9    5e-12   
gb|KHN18954.1|  Putative leucine-rich repeat receptor-like serine...  73.9    5e-12   
ref|XP_007211384.1|  hypothetical protein PRUPE_ppa003081mg           73.9    5e-12   
emb|CBI36003.3|  unnamed protein product                              74.3    5e-12   
ref|XP_006657439.1|  PREDICTED: probable LRR receptor-like serine...  74.3    5e-12   
ref|XP_010654576.1|  PREDICTED: putative leucine-rich repeat rece...  74.3    5e-12   
gb|EMT24947.1|  Putative LRR receptor-like serine/threonine-prote...  74.3    6e-12   
ref|XP_006363347.1|  PREDICTED: putative leucine-rich repeat rece...  73.6    6e-12   
gb|KDP26730.1|  hypothetical protein JCGZ_17888                       73.2    6e-12   
ref|XP_011032554.1|  PREDICTED: uncharacterized protein At1g24485...  73.6    7e-12   
ref|NP_001059721.1|  Os07g0501800                                     73.6    8e-12   
ref|XP_008222690.1|  PREDICTED: uncharacterized protein At1g24485...  73.6    8e-12   
gb|AFK42489.1|  unknown                                               73.2    8e-12   
ref|XP_006588750.1|  PREDICTED: probable LRR receptor-like serine...  73.6    8e-12   
ref|XP_009398234.1|  PREDICTED: putative leucine-rich repeat rece...  73.6    8e-12   
ref|XP_003593625.1|  Receptor-like protein kinase                     73.2    8e-12   
ref|XP_010273367.1|  PREDICTED: putative leucine-rich repeat rece...  73.2    9e-12   
ref|XP_009801598.1|  PREDICTED: probable LRR receptor-like serine...  73.6    9e-12   
ref|XP_004251454.1|  PREDICTED: putative leucine-rich repeat rece...  73.2    9e-12   
ref|XP_008383390.1|  PREDICTED: probable LRR receptor-like serine...  73.6    1e-11   
dbj|BAF79953.1|  receptor-like kinase                                 73.2    1e-11   
ref|XP_007148136.1|  hypothetical protein PHAVU_006G183300g           73.2    1e-11   
gb|KCW53657.1|  hypothetical protein EUGRSUZ_J02925                   73.2    1e-11   
ref|XP_010273297.1|  PREDICTED: probable LRR receptor-like serine...  72.8    1e-11   
ref|XP_002307192.2|  hypothetical protein POPTR_0005s04520g           72.8    1e-11   
ref|XP_011043422.1|  PREDICTED: putative leucine-rich repeat rece...  72.8    1e-11   
ref|XP_008385234.1|  PREDICTED: uncharacterized protein At1g24485...  72.8    1e-11   
ref|XP_010040064.1|  PREDICTED: probable LRR receptor-like serine...  72.0    1e-11   
ref|XP_002305781.2|  hypothetical protein POPTR_0004s04690g           72.8    1e-11   
emb|CDP02372.1|  unnamed protein product                              72.8    1e-11   
ref|XP_010098554.1|  putative LRR receptor-like serine/threonine-...  73.2    1e-11   
ref|XP_011043421.1|  PREDICTED: putative leucine-rich repeat rece...  72.8    1e-11   
ref|XP_006344295.1|  PREDICTED: protein NSP-INTERACTING KINASE 2-...  72.8    1e-11   
ref|XP_008225131.1|  PREDICTED: receptor-like protein kinase At3g...  72.8    1e-11   
gb|KCW86527.1|  hypothetical protein EUGRSUZ_B03173                   70.5    2e-11   
ref|NP_193826.2|  leucine-rich receptor-like protein kinase           72.8    2e-11   
gb|AGT59499.1|  GHR1 protein                                          72.8    2e-11   
ref|XP_011014142.1|  PREDICTED: probable LRR receptor-like serine...  72.4    2e-11   
ref|XP_007141067.1|  hypothetical protein PHAVU_008G164600g           72.4    2e-11   
gb|KCW52292.1|  hypothetical protein EUGRSUZ_J01715                   72.4    2e-11   
gb|AFW89440.1|  hypothetical protein ZEAMMB73_263749                  71.6    2e-11   
emb|CAN69260.1|  hypothetical protein VITISV_027160                   72.4    2e-11   
sp|C0LGQ9.1|Y4294_ARATH  RecName: Full=Probable LRR receptor-like...  72.8    2e-11   
ref|XP_010034520.1|  PREDICTED: probable LRR receptor-like serine...  72.4    2e-11   
ref|XP_006657733.1|  PREDICTED: putative leucine-rich repeat rece...  72.4    2e-11   
ref|XP_006283044.1|  hypothetical protein CARUB_v10004041mg           72.4    2e-11   



>ref|XP_009795079.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g67720 [Nicotiana sylvestris]
Length=514

 Score =   242 bits (618),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 132/167 (79%), Positives = 142/167 (85%), Gaps = 0/167 (0%)
 Frame = -2

Query  564  FRVLPLGGKTHTRDVIALEKLKEGFENPPLDWNGDPCLPPQYSWTGVVCSGGTRIRVttl  385
            F VLPLGGKTHTRDVIALE+LKE  +NPPLDWNGDPCLPPQY WTGV CSGG RIRV TL
Sbjct  347  FEVLPLGGKTHTRDVIALERLKESLKNPPLDWNGDPCLPPQYPWTGVTCSGGPRIRVITL  406

Query  384  nltgmglsgmlssSIANLTALSGIWLGNNDLSGSTPDLSSLKRLEILHLEDNQIGGEIAP  205
            NL  MGLSG +S SI+ LTALSGIWLGNN L+GS PDLSSL  LEILHLEDNQ+ GEI P
Sbjct  407  NLMSMGLSGSISPSISRLTALSGIWLGNNSLTGSIPDLSSLSNLEILHLEDNQLIGEIPP  466

Query  204  SLGRIKSLRELFLQNNNLTGQIPGSILGRPGINLRTTPGNPFLSGPP  64
            SLG IKSL E+FLQNNNLTG +P S+LG P +NLRTTPGNPFLS PP
Sbjct  467  SLGNIKSLDEIFLQNNNLTGNVPSSLLGNPKLNLRTTPGNPFLSQPP  513



>ref|XP_006359902.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g67720-like [Solanum tuberosum]
Length=511

 Score =   237 bits (605),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 128/167 (77%), Positives = 144/167 (86%), Gaps = 0/167 (0%)
 Frame = -2

Query  564  FRVLPLGGKTHTRDVIALEKLKEGFENPPLDWNGDPCLPPQYSWTGVVCSGGTRIRVttl  385
            F VLPLGG+THTRDVIALEKLKE F+NPP DWNGDPCLPPQY WTGV C+GG+RIRVT+L
Sbjct  344  FEVLPLGGRTHTRDVIALEKLKESFKNPPPDWNGDPCLPPQYQWTGVTCAGGSRIRVTSL  403

Query  384  nltgmglsgmlssSIANLTALSGIWLGNNDLSGSTPDLSSLKRLEILHLEDNQIGGEIAP  205
            NLT MGLSG +S SIA LTAL+GIWL +N+L+GS PDLSSL  LE LHLEDNQ+ GEI P
Sbjct  404  NLTSMGLSGSISPSIARLTALNGIWLADNNLTGSIPDLSSLSILETLHLEDNQLSGEIPP  463

Query  204  SLGRIKSLRELFLQNNNLTGQIPGSILGRPGINLRTTPGNPFLSGPP  64
            SLG I SL E+FLQNNNL+GQIP S+LG+P +NLRTTPGNP LS PP
Sbjct  464  SLGNIMSLNEIFLQNNNLSGQIPSSLLGKPTLNLRTTPGNPLLSQPP  510



>ref|XP_009603226.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g67720 [Nicotiana tomentosiformis]
Length=514

 Score =   231 bits (590),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 125/167 (75%), Positives = 139/167 (83%), Gaps = 0/167 (0%)
 Frame = -2

Query  564  FRVLPLGGKTHTRDVIALEKLKEGFENPPLDWNGDPCLPPQYSWTGVVCSGGTRIRVttl  385
            F VLP+GGKTHTRDVIALE+LKE F+NP  DWNGDPCLPPQY WTGV C+GG RIRV TL
Sbjct  347  FEVLPVGGKTHTRDVIALERLKESFKNPLPDWNGDPCLPPQYPWTGVTCAGGPRIRVITL  406

Query  384  nltgmglsgmlssSIANLTALSGIWLGNNDLSGSTPDLSSLKRLEILHLEDNQIGGEIAP  205
            NLT MGL G +S SI+ LTALSG+WLGNN L+GS PDLSSL  LEILHLEDNQ+ GEI P
Sbjct  407  NLTSMGLLGSISPSISRLTALSGLWLGNNSLTGSIPDLSSLSNLEILHLEDNQLSGEIPP  466

Query  204  SLGRIKSLRELFLQNNNLTGQIPGSILGRPGINLRTTPGNPFLSGPP  64
            SLG +KSL E+FL NNNLTG +P S+LG P +NLRTTPGNP LS PP
Sbjct  467  SLGNVKSLNEIFLHNNNLTGNVPSSLLGNPKLNLRTTPGNPLLSQPP  513



>ref|XP_004247374.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g67720 [Solanum lycopersicum]
Length=511

 Score =   231 bits (590),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 126/167 (75%), Positives = 142/167 (85%), Gaps = 0/167 (0%)
 Frame = -2

Query  564  FRVLPLGGKTHTRDVIALEKLKEGFENPPLDWNGDPCLPPQYSWTGVVCSGGTRIRVttl  385
            F VLPLGGKTHTRDVIALEKLKE F+NPP DW+GDPCLPPQY WTGV C+GG+RIRVT+L
Sbjct  344  FEVLPLGGKTHTRDVIALEKLKESFKNPPPDWHGDPCLPPQYQWTGVTCAGGSRIRVTSL  403

Query  384  nltgmglsgmlssSIANLTALSGIWLGNNDLSGSTPDLSSLKRLEILHLEDNQIGGEIAP  205
            NLT MGLSG +S SIA LTAL+ IWL +N+L+GS PDLSSL  LE LHLEDNQ+ GEI  
Sbjct  404  NLTSMGLSGSISPSIARLTALNHIWLADNNLTGSIPDLSSLSILETLHLEDNQLSGEIPH  463

Query  204  SLGRIKSLRELFLQNNNLTGQIPGSILGRPGINLRTTPGNPFLSGPP  64
            SLG I SL E+FLQNNNL+GQIP S+LG+P +NLRTTPGNP LS PP
Sbjct  464  SLGNIMSLNEIFLQNNNLSGQIPSSLLGKPTLNLRTTPGNPLLSQPP  510



>ref|XP_002281432.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g67720 [Vitis vinifera]
 emb|CBI26218.3| unnamed protein product [Vitis vinifera]
Length=514

 Score =   220 bits (561),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 121/168 (72%), Positives = 136/168 (81%), Gaps = 0/168 (0%)
 Frame = -2

Query  564  FRVLPLGGKTHTRDVIALEKLKEGFENPPLDWNGDPCLPPQYSWTGVVCSGGTRIRVttl  385
            F +L LGG+T TRDVIALE +K+  ENPP DWNGDPC P QYSWTGV CS G RIRV +L
Sbjct  345  FNLLRLGGRTLTRDVIALESVKKSLENPPHDWNGDPCFPSQYSWTGVTCSEGPRIRVVSL  404

Query  384  nltgmglsgmlssSIANLTALSGIWLGNNDLSGSTPDLSSLKRLEILHLEDNQIGGEIAP  205
            NL+ MGLSG LS S+ANLTAL+ IWLGNN LSGS PDLSSLKRLEILHLEDNQ  GEI  
Sbjct  405  NLSNMGLSGSLSPSVANLTALTNIWLGNNSLSGSIPDLSSLKRLEILHLEDNQFSGEIPS  464

Query  204  SLGRIKSLRELFLQNNNLTGQIPGSILGRPGINLRTTPGNPFLSGPPA  61
            SLG I SL+ELFLQNNNLTGQ+P S+ G+PG+NL+  PGN F S PP+
Sbjct  465  SLGNIDSLQELFLQNNNLTGQVPNSLTGKPGLNLKIFPGNNFSSSPPS  512



>gb|KHN15789.1| Putative leucine-rich repeat receptor-like serine/threonine-protein 
kinase [Glycine soja]
Length=362

 Score =   213 bits (541),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 119/168 (71%), Positives = 137/168 (82%), Gaps = 2/168 (1%)
 Frame = -2

Query  564  FRVLPLGGKTHTRDVIALEKLKEGFENPPLDWNGDPCLPPQYSWTGVVCSGGTRIRVttl  385
            F VLPLGG+T TRDVIALEK+K+   NPPLDWNGDPC+P QYSWTG+ CS G RIRV TL
Sbjct  196  FDVLPLGGRTLTRDVIALEKVKQSLRNPPLDWNGDPCMPRQYSWTGISCSEGPRIRVVTL  255

Query  384  nltgmglsgmlssSIANLTALSGIWLGNNDLSGSTPDLSSLKRLEILHLEDNQIGGEIAP  205
            NLT M LSG LS  +AN+TAL+ IWLGNN LSG  PDLSSLK LE LHLEDNQ  GEI  
Sbjct  256  NLTSMDLSGSLSPFVANMTALTNIWLGNNSLSGQIPDLSSLKILETLHLEDNQFSGEIPS  315

Query  204  SLGRIKSLRELFLQNNNLTGQIPGSILGRPGINLRTTPGNPFLSGPPA  61
            SLG I SL+E+FLQNNNLTGQIP +++G+PG+++RT+ GN FLS PPA
Sbjct  316  SLGDISSLQEVFLQNNNLTGQIPANLIGKPGLDIRTS-GNNFLS-PPA  361



>ref|XP_003555335.1| PREDICTED: putative leucine-rich repeat receptor-like serine/threonine-protein 
kinase At2g14440-like [Glycine max]
Length=510

 Score =   213 bits (542),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 119/168 (71%), Positives = 137/168 (82%), Gaps = 2/168 (1%)
 Frame = -2

Query  564  FRVLPLGGKTHTRDVIALEKLKEGFENPPLDWNGDPCLPPQYSWTGVVCSGGTRIRVttl  385
            F VLPLGG+T TRDVIALEK+K+   NPPLDWNGDPC+P QYSWTG+ CS G RIRV TL
Sbjct  344  FDVLPLGGRTLTRDVIALEKVKQSLRNPPLDWNGDPCMPRQYSWTGISCSEGPRIRVVTL  403

Query  384  nltgmglsgmlssSIANLTALSGIWLGNNDLSGSTPDLSSLKRLEILHLEDNQIGGEIAP  205
            NLT M LSG LS  +AN+TAL+ IWLGNN LSG  PDLSSLK LE LHLEDNQ  GEI  
Sbjct  404  NLTSMDLSGSLSPFVANMTALTNIWLGNNSLSGQIPDLSSLKILETLHLEDNQFSGEIPS  463

Query  204  SLGRIKSLRELFLQNNNLTGQIPGSILGRPGINLRTTPGNPFLSGPPA  61
            SLG I SL+E+FLQNNNLTGQIP +++G+PG+++RT+ GN FLS PPA
Sbjct  464  SLGDISSLQEVFLQNNNLTGQIPANLIGKPGLDIRTS-GNNFLS-PPA  509



>gb|KHG00154.1| hypothetical protein F383_18587 [Gossypium arboreum]
Length=523

 Score =   211 bits (536),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 117/168 (70%), Positives = 138/168 (82%), Gaps = 1/168 (1%)
 Frame = -2

Query  564  FRVLPLGGKTHTRDVIALEKLKEGFENPPLDWNGDPCLPPQYSWTGVVCSGGTRIRVttl  385
            F +L LGG+THTRDVI L  +K    NPPLDWNGDPCLP  Y+WTG+ CS G RIRV TL
Sbjct  357  FDILRLGGRTHTRDVITLNAMKSSLRNPPLDWNGDPCLPLNYTWTGITCSEGERIRVVTL  416

Query  384  nltgmglsgmlssSIANLTALSGIWLGNNDLSGSTPDLSSLKRLEILHLEDNQIGGEIAP  205
            NLT MGLSG LSSSIANLTAL+GIWLGNN LSG+ P+LSSL+ LE+LHLEDNQ  G+I  
Sbjct  417  NLTSMGLSGSLSSSIANLTALTGIWLGNNSLSGTIPNLSSLRLLEVLHLEDNQFNGDIPS  476

Query  204  SLGRIKSLRELFLQNNNLTGQIPGSILGRPGINLRTTPGNPFLSGPPA  61
            SLG ++SLRELFLQNNNLTG+IP S++G+PG++LRT+ GN FLS  P+
Sbjct  477  SLGEVRSLRELFLQNNNLTGRIPDSLVGKPGLDLRTS-GNQFLSPSPS  523



>ref|XP_003535659.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase At2g14510-like [Glycine max]
Length=510

 Score =   208 bits (529),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 117/168 (70%), Positives = 133/168 (79%), Gaps = 2/168 (1%)
 Frame = -2

Query  564  FRVLPLGGKTHTRDVIALEKLKEGFENPPLDWNGDPCLPPQYSWTGVVCSGGTRIRVttl  385
            F VLPLGG+T TRDVIAL+K+KE   NPPLDWNGDPC+P QYSWTG+ CS G RIRV TL
Sbjct  344  FDVLPLGGRTLTRDVIALQKVKESLRNPPLDWNGDPCMPRQYSWTGITCSEGPRIRVVTL  403

Query  384  nltgmglsgmlssSIANLTALSGIWLGNNDLSGSTPDLSSLKRLEILHLEDNQIGGEIAP  205
            NLT   LSG LS  +AN+TAL+ IWLGNN LSG  PDLSSLK LE LHLEDNQ  GEI  
Sbjct  404  NLTSKDLSGSLSPFVANMTALTNIWLGNNSLSGQIPDLSSLKILETLHLEDNQFSGEIPS  463

Query  204  SLGRIKSLRELFLQNNNLTGQIPGSILGRPGINLRTTPGNPFLSGPPA  61
            SLG I SL ++FLQNNNLTGQIP  ++G+PG+N+ T+ GN FLS PPA
Sbjct  464  SLGDISSLEKVFLQNNNLTGQIPAILVGKPGLNIITS-GNNFLS-PPA  509



>ref|XP_006489350.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g67720-like isoform X2 [Citrus sinensis]
 gb|KDO74686.1| hypothetical protein CISIN_1g010316mg [Citrus sinensis]
Length=513

 Score =   207 bits (526),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 117/168 (70%), Positives = 138/168 (82%), Gaps = 1/168 (1%)
 Frame = -2

Query  564  FRVLPLGGKTHTRDVIALEKLKEGFENPPLDWNGDPCLPPQYSWTGVVCSGGTRIRVttl  385
            F+VL LGG+T TRDVIALE L+   +NPPLDW+GDPCLP  YSWTG+ C+   RIR+ TL
Sbjct  347  FQVLELGGRTLTRDVIALETLRNSLQNPPLDWSGDPCLPHGYSWTGITCTYDRRIRIVTL  406

Query  384  nltgmglsgmlssSIANLTALSGIWLGNNDLSGSTPDLSSLKRLEILHLEDNQIGGEIAP  205
            NLT MGLSG L S+I+ LTALSGIWLGNN+LSG+ PDLSSL RLE LHLEDNQ  GEI  
Sbjct  407  NLTNMGLSGSLPSNISRLTALSGIWLGNNNLSGTIPDLSSLMRLETLHLEDNQFSGEIPS  466

Query  204  SLGRIKSLRELFLQNNNLTGQIPGSILGRPGINLRTTPGNPFLSGPPA  61
            SLG+I+SLRELFLQNNNLTGQIP S++ +PG+NL+T+PGN   S PP+
Sbjct  467  SLGKIQSLRELFLQNNNLTGQIPSSLI-KPGLNLKTSPGNQLSSPPPS  513



>ref|XP_006419882.1| hypothetical protein CICLE_v10004756mg [Citrus clementina]
 gb|ESR33122.1| hypothetical protein CICLE_v10004756mg [Citrus clementina]
Length=513

 Score =   207 bits (526),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 117/168 (70%), Positives = 138/168 (82%), Gaps = 1/168 (1%)
 Frame = -2

Query  564  FRVLPLGGKTHTRDVIALEKLKEGFENPPLDWNGDPCLPPQYSWTGVVCSGGTRIRVttl  385
            F+VL LGG+T TRDVIALE L+   +NPPLDW+GDPCLP  YSWTG+ C+   RIR+ TL
Sbjct  347  FQVLELGGRTLTRDVIALETLRNSLQNPPLDWSGDPCLPHGYSWTGITCTYDRRIRIVTL  406

Query  384  nltgmglsgmlssSIANLTALSGIWLGNNDLSGSTPDLSSLKRLEILHLEDNQIGGEIAP  205
            NLT MGLSG L S+I+ LTALSGIWLGNN+LSG+ PDLSSL RLE LHLEDNQ  GEI  
Sbjct  407  NLTNMGLSGSLPSNISRLTALSGIWLGNNNLSGTIPDLSSLMRLETLHLEDNQFSGEIPS  466

Query  204  SLGRIKSLRELFLQNNNLTGQIPGSILGRPGINLRTTPGNPFLSGPPA  61
            SLG+I+SLRELFLQNNNLTGQIP S++ +PG+NL+T+PGN   S PP+
Sbjct  467  SLGKIQSLRELFLQNNNLTGQIPSSLI-KPGLNLKTSPGNQLSSPPPS  513



>ref|XP_010255977.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g67720 [Nelumbo nucifera]
Length=511

 Score =   204 bits (520),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 111/163 (68%), Positives = 132/163 (81%), Gaps = 1/163 (1%)
 Frame = -2

Query  564  FRVLPLGGKTHTRDVIALEKLKEGFENPPLDWNGDPCLPPQYSWTGVVCSGGTRIRVttl  385
            F +L LGG+T TRDV+ALEK+K   ENPPLDWNGDPCLP QYSWTGV CS GTRIRV  L
Sbjct  348  FDLLLLGGRTVTRDVVALEKMKNSLENPPLDWNGDPCLPRQYSWTGVTCSEGTRIRVVAL  407

Query  384  nltgmglsgmlssSIANLTALSGIWLGNNDLSGSTPDLSSLKRLEILHLEDNQIGGEIAP  205
            NL+ +GL G LS +IA LTAL+ IWLGNN L+GS PDLS LKRL+ LHLEDN   GE++P
Sbjct  408  NLSSLGLQGSLSPNIAKLTALTDIWLGNNTLTGSIPDLSQLKRLKTLHLEDNVFSGEVSP  467

Query  204  SLGRIKSLRELFLQNNNLTGQIPGSILGRPGINLRTTPGNPFL  76
            SLG I SLRELF+QNNNLTG++P S+  +PG+NL+T+ GN F+
Sbjct  468  SLGDIDSLRELFIQNNNLTGEVPNSLKVKPGLNLKTS-GNHFI  509



>ref|XP_011026171.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase At2g14510 [Populus euphratica]
 ref|XP_011026178.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase At2g14510 [Populus euphratica]
Length=568

 Score =   204 bits (520),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 118/168 (70%), Positives = 132/168 (79%), Gaps = 1/168 (1%)
 Frame = -2

Query  564  FRVLPLGGKTHTRDVIALEKLKEGFENPPLDWNGDPCLPPQYSWTGVVCSGGTRIRVttl  385
            F V+ LGG+T TRDVIALE LK  F+N P DWNGDPC+P Q+SWTG+ CS G RIRV TL
Sbjct  402  FDVIALGGRTLTRDVIALEALKSSFQNTPHDWNGDPCMPRQFSWTGIACSEGPRIRVVTL  461

Query  384  nltgmglsgmlssSIANLTALSGIWLGNNDLSGSTPDLSSLKRLEILHLEDNQIGGEIAP  205
            NLT MGLSG L  SIA LTAL+ IWLGNN LSG  PD SSLK LE LHLEDNQ  GEI  
Sbjct  462  NLTSMGLSGSLPLSIARLTALTSIWLGNNTLSGPIPDFSSLKMLETLHLEDNQFTGEIPL  521

Query  204  SLGRIKSLRELFLQNNNLTGQIPGSILGRPGINLRTTPGNPFLSGPPA  61
            SLG IK LRELFLQNNNLTGQIP +++G+PG+NLRT+ GN FLS  P+
Sbjct  522  SLGNIKGLRELFLQNNNLTGQIPHNLIGKPGLNLRTS-GNQFLSLSPS  568



>ref|XP_004298162.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase At2g14510-like [Fragaria vesca subsp. vesca]
Length=502

 Score =   202 bits (514),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 113/168 (67%), Positives = 134/168 (80%), Gaps = 3/168 (2%)
 Frame = -2

Query  564  FRVLPLGGKTHTRDVIALEKLKEGFENPPLDWNGDPCLPPQYSWTGVVCSGGTRIRVttl  385
            F+VLPL  +T TRDVIAL+K+KE  ENPP +WNGDPCLP QY+WTG+ CSG   +RV +L
Sbjct  338  FQVLPLRARTLTRDVIALQKVKESLENPPPNWNGDPCLPRQYTWTGITCSG---VRVVSL  394

Query  384  nltgmglsgmlssSIANLTALSGIWLGNNDLSGSTPDLSSLKRLEILHLEDNQIGGEIAP  205
            NLT MGLSG LS +IAN+TALS IWLGNN+LSG  PDLS LK LE LHLEDNQ  G I  
Sbjct  395  NLTSMGLSGSLSPNIANMTALSDIWLGNNNLSGPIPDLSQLKILETLHLEDNQFSGAIPS  454

Query  204  SLGRIKSLRELFLQNNNLTGQIPGSILGRPGINLRTTPGNPFLSGPPA  61
            SLG I+SLRELFLQNNNLTGQ+P S+ G+PG++LR +PGN   + PP+
Sbjct  455  SLGNIESLRELFLQNNNLTGQVPNSLTGKPGLDLRFSPGNSLSAPPPS  502



>ref|XP_010107993.1| Putative leucine-rich repeat receptor-like serine/threonine-protein 
kinase [Morus notabilis]
 gb|EXC17558.1| Putative leucine-rich repeat receptor-like serine/threonine-protein 
kinase [Morus notabilis]
Length=549

 Score =   202 bits (514),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 115/157 (73%), Positives = 127/157 (81%), Gaps = 0/157 (0%)
 Frame = -2

Query  564  FRVLPLGGKTHTRDVIALEKLKEGFENPPLDWNGDPCLPPQYSWTGVVCSGGTRIRVttl  385
            F VLPLGG+T TRDVIAL + K+  ENPPLDWNGDPCLP QYSWTG+ CS G RIRV TL
Sbjct  346  FEVLPLGGRTLTRDVIALVQFKDSLENPPLDWNGDPCLPRQYSWTGITCSEGPRIRVLTL  405

Query  384  nltgmglsgmlssSIANLTALSGIWLGNNDLSGSTPDLSSLKRLEILHLEDNQIGGEIAP  205
            NLTGM LSG LS  IAN+TAL+ I LGNN LSG+ PDLSSLKRLE LHLEDNQ  GEI  
Sbjct  406  NLTGMSLSGTLSPGIANMTALNSILLGNNRLSGTIPDLSSLKRLERLHLEDNQFSGEIPS  465

Query  204  SLGRIKSLRELFLQNNNLTGQIPGSILGRPGINLRTT  94
            SLG I SLRELFLQNNNLTG IP S+ G+ G++LRT+
Sbjct  466  SLGDIASLRELFLQNNNLTGDIPSSLKGKTGLDLRTS  502



>emb|CDO99027.1| unnamed protein product [Coffea canephora]
Length=515

 Score =   201 bits (512),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 114/168 (68%), Positives = 142/168 (85%), Gaps = 2/168 (1%)
 Frame = -2

Query  564  FRVLPLGGKTHTRDVIALEKLKEGFENPPLDWNGDPCLPPQYSWTGVVCSGGTRIRVttl  385
            F VL LGG+T TRDVIA+E++K   +NPPLDWNGDPCLP QYSWTGV CS G ++RVTTL
Sbjct  349  FEVLNLGGRTLTRDVIAMERIKASIKNPPLDWNGDPCLPRQYSWTGVSCSKGPKVRVTTL  408

Query  384  nltgmglsgmlssSIANLTALSGIWLGNNDLSGSTPDLSSLKRLEILHLEDNQIGGEIAP  205
            NLT MG+SG +S +I++LTALSGI LG+N L+GS P+LSSLKRLEILHLEDN++ GEI  
Sbjct  409  NLTNMGISGSISPNISSLTALSGILLGSNSLTGSIPNLSSLKRLEILHLEDNKLSGEIPS  468

Query  204  SLGRIKSLRELFLQNNNLTGQIPGSILGRPGINLRTTPGNPFLSGPPA  61
            S+G I++LRELFLQNNNLTG +P +++G+ G+NL+ + GNPFLS PPA
Sbjct  469  SVGNIQNLRELFLQNNNLTGTLPSNLVGKSGLNLKDS-GNPFLS-PPA  514



>ref|XP_002315786.1| leucine-rich repeat family protein [Populus trichocarpa]
 gb|EEF01957.1| leucine-rich repeat family protein [Populus trichocarpa]
Length=449

 Score =   199 bits (506),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 120/168 (71%), Positives = 134/168 (80%), Gaps = 2/168 (1%)
 Frame = -2

Query  564  FRVLPLGGKTHTRDVIALEKLKEGFENPPLDWNGDPCLPPQYSWTGVVCSGGTRIRVttl  385
            F V+ LG +T TRDVIALE LK   +N PLDWNGDPC+P QYSWTG+ CS G RIRV TL
Sbjct  284  FEVIALGERTLTRDVIALEALKSSLQNAPLDWNGDPCMPLQYSWTGITCSEGPRIRVVTL  343

Query  384  nltgmglsgmlssSIANLTALSGIWLGNNDLSGSTPDLSSLKRLEILHLEDNQIGGEIAP  205
            NLTGMGLSG L  SIA LTAL+ IWLGNN LSGS PDLSSLK LE LHLEDN+  GEI  
Sbjct  344  NLTGMGLSGSLPPSIARLTALADIWLGNNTLSGSIPDLSSLKMLETLHLEDNRFTGEIPL  403

Query  204  SLGRIKSLRELFLQNNNLTGQIPGSILGRPGINLRTTPGNPFLSGPPA  61
            SLG IK LRELFLQNNNLTGQIP ++L +PG+NLRT+ GN FL+ PP+
Sbjct  404  SLGNIKGLRELFLQNNNLTGQIPNNLL-KPGLNLRTS-GNQFLAPPPS  449



>ref|XP_002311609.1| leucine-rich repeat family protein [Populus trichocarpa]
 gb|EEE88976.1| leucine-rich repeat family protein [Populus trichocarpa]
Length=514

 Score =   200 bits (509),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 117/168 (70%), Positives = 132/168 (79%), Gaps = 3/168 (2%)
 Frame = -2

Query  564  FRVLPLGGKTHTRDVIALEKLKEGFENPPLDWNGDPCLPPQYSWTGVVCSGGTRIRVttl  385
            F V+ LGG+T TRD  ALE LK  F+N P DWNGDPC+P Q+SWTG+ CS G RIRV TL
Sbjct  350  FDVIALGGRTLTRD--ALEALKSSFQNTPHDWNGDPCMPRQFSWTGIACSEGPRIRVVTL  407

Query  384  nltgmglsgmlssSIANLTALSGIWLGNNDLSGSTPDLSSLKRLEILHLEDNQIGGEIAP  205
            NLT MGLSG L  SIA LTAL+GIWLGNN LSGS PD SSLK LE LHLEDNQ  GEI  
Sbjct  408  NLTSMGLSGSLPLSIARLTALTGIWLGNNTLSGSIPDFSSLKMLETLHLEDNQFTGEIPL  467

Query  204  SLGRIKSLRELFLQNNNLTGQIPGSILGRPGINLRTTPGNPFLSGPPA  61
            SLG IK LRELFLQNNNL+GQIP +++G+PG+NLRT+ GN FLS  P+
Sbjct  468  SLGNIKDLRELFLQNNNLSGQIPNNLIGKPGLNLRTS-GNQFLSPSPS  514



>ref|XP_003592431.1| Receptor-like protein kinase [Medicago truncatula]
 gb|AES62682.1| Serine/Threonine kinase, plant-type protein, putative [Medicago 
truncatula]
Length=508

 Score =   199 bits (505),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 113/168 (67%), Positives = 135/168 (80%), Gaps = 3/168 (2%)
 Frame = -2

Query  564  FRVLPLGGKTHTRDVIALEKLKEGFENPPLDWNGDPCLPPQYSWTGVVCSGGTRIRVttl  385
            F VL LGG+T TRDVIAL+++KE   NPPLDW+GDPC+P QYSWTG+ CS G RIR+ TL
Sbjct  343  FNVLSLGGRTSTRDVIALQRVKESLRNPPLDWSGDPCVPRQYSWTGITCSEGLRIRIVTL  402

Query  384  nltgmglsgmlssSIANLTALSGIWLGNNDLSGSTPDLSSLKRLEILHLEDNQIGGEIAP  205
            NLT M LSG LSS +AN+TAL+ IWLGNN LSG  P+LSSL  LE LHLE+NQ  GEI  
Sbjct  403  NLTSMDLSGSLSSFVANMTALTNIWLGNNSLSGQIPNLSSLTMLETLHLEENQFSGEIPS  462

Query  204  SLGRIKSLRELFLQNNNLTGQIPGSILGRPGINLRTTPGNPFLSGPPA  61
            SLG I SL+E+FLQNNNLTGQIP ++L +PG+++RT+ GN FLS PPA
Sbjct  463  SLGNISSLKEVFLQNNNLTGQIPANLL-KPGLSIRTS-GNNFLS-PPA  507



>ref|XP_007034690.1| Serine-threonine protein kinase, plant-type, putative isoform 
2 [Theobroma cacao]
 gb|EOY05616.1| Serine-threonine protein kinase, plant-type, putative isoform 
2 [Theobroma cacao]
Length=518

 Score =   199 bits (505),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 118/168 (70%), Positives = 130/168 (77%), Gaps = 1/168 (1%)
 Frame = -2

Query  564  FRVLPLGGKTHTRDVIALEKLKEGFENPPLDWNGDPCLPPQYSWTGVVCSGGTRIRVttl  385
            F VL LGG+THTRDV ALE++K    N P DWNGDPCLP  YSWTGV CS G RIRV  L
Sbjct  352  FNVLRLGGRTHTRDVRALEEMKNSLHNLPFDWNGDPCLPLNYSWTGVTCSEGERIRVIAL  411

Query  384  nltgmglsgmlssSIANLTALSGIWLGNNDLSGSTPDLSSLKRLEILHLEDNQIGGEIAP  205
            NLT MGLSG LS SI+NLTALSGI LGNN LSG  PDLSSLK LEILHLEDNQ+ GEI  
Sbjct  412  NLTSMGLSGSLSPSISNLTALSGILLGNNSLSGVIPDLSSLKLLEILHLEDNQLRGEIPS  471

Query  204  SLGRIKSLRELFLQNNNLTGQIPGSILGRPGINLRTTPGNPFLSGPPA  61
            SLG +  LRELFLQNNNLTG IP  ++GR G+ +RT+ GN FLS PP+
Sbjct  472  SLGDLGRLRELFLQNNNLTGSIPDRLVGRSGLEVRTS-GNQFLSPPPS  518



>ref|XP_004496756.1| PREDICTED: putative leucine-rich repeat receptor-like serine/threonine-protein 
kinase At2g14440-like [Cicer arietinum]
Length=509

 Score =   198 bits (504),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 112/168 (67%), Positives = 131/168 (78%), Gaps = 2/168 (1%)
 Frame = -2

Query  564  FRVLPLGGKTHTRDVIALEKLKEGFENPPLDWNGDPCLPPQYSWTGVVCSGGTRIRVttl  385
            F V+ LGG+T TRDVIALE++KE   NPPLDW+GDPC P  YSWTG+ CS G  IRV TL
Sbjct  343  FNVMSLGGRTSTRDVIALERVKESLRNPPLDWSGDPCAPQIYSWTGITCSEGPHIRVVTL  402

Query  384  nltgmglsgmlssSIANLTALSGIWLGNNDLSGSTPDLSSLKRLEILHLEDNQIGGEIAP  205
            NLT M LSG LS  +AN+TAL+ IWLGNN LSG  P+LSSL  LE LHLEDNQ  GEI  
Sbjct  403  NLTNMDLSGSLSPFVANMTALTNIWLGNNSLSGQIPNLSSLTMLETLHLEDNQFNGEIPS  462

Query  204  SLGRIKSLRELFLQNNNLTGQIPGSILGRPGINLRTTPGNPFLSGPPA  61
            SLG I SL+E+FLQNNNLTGQIP +++G+PG+ +RT+ GN FLS PPA
Sbjct  463  SLGNIGSLKEVFLQNNNLTGQIPANLIGKPGLIIRTS-GNSFLS-PPA  508



>gb|EYU45632.1| hypothetical protein MIMGU_mgv11b003932mg [Erythranthe guttata]
Length=510

 Score =   198 bits (504),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 107/168 (64%), Positives = 128/168 (76%), Gaps = 0/168 (0%)
 Frame = -2

Query  564  FRVLPLGGKTHTRDVIALEKLKEGFENPPLDWNGDPCLPPQYSWTGVVCSGGTRIRVttl  385
            F+VLP G KT  RDVIA+ +L+  F NPP DW+GDPCLP QY WTGV C  G RIRV +L
Sbjct  343  FQVLPAGAKTLPRDVIAMMELRSSFRNPPADWHGDPCLPSQYPWTGVTCLEGRRIRVVSL  402

Query  384  nltgmglsgmlssSIANLTALSGIWLGNNDLSGSTPDLSSLKRLEILHLEDNQIGGEIAP  205
            NLT MGLSG +S  I  +TAL+ I+LGNN L G+ PD S LK LEILHLEDN +GG I P
Sbjct  403  NLTSMGLSGSISHLITRMTALTSIFLGNNSLHGTIPDFSPLKGLEILHLEDNHLGGTIPP  462

Query  204  SLGRIKSLRELFLQNNNLTGQIPGSILGRPGINLRTTPGNPFLSGPPA  61
            SLG ++ LRELFLQNNNLTG IP +++ +PG+ LR TPGNPFL+ PP+
Sbjct  463  SLGNLQYLRELFLQNNNLTGSIPSNLISKPGLTLRYTPGNPFLTPPPS  510



>ref|XP_006297437.1| hypothetical protein CARUB_v10013460mg [Capsella rubella]
 gb|EOA30335.1| hypothetical protein CARUB_v10013460mg [Capsella rubella]
Length=519

 Score =   198 bits (504),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 108/166 (65%), Positives = 130/166 (78%), Gaps = 1/166 (1%)
 Frame = -2

Query  564  FRVLPLGGKTHTRDVIALEKLKEGFENPPLDWNGDPCLPPQYSWTGVVCSGGTRIRVttl  385
            F ++PLGGKT  RD+ A+  +K  FE+ P DWNGDPC P  YSW+GV CS G RIR+ TL
Sbjct  353  FELVPLGGKTLVRDMTAMNAIKNSFEDAPADWNGDPCFPKNYSWSGVTCSEGPRIRIVTL  412

Query  384  nltgmglsgmlssSIANLTALSGIWLGNNDLSGSTPDLSSLKRLEILHLEDNQIGGEIAP  205
            NLT MG+SG L+ +++ LTALS IWLGNN LSGS PD+SSLKRLE LHLEDN+  G I P
Sbjct  413  NLTNMGVSGSLAPALSKLTALSSIWLGNNSLSGSLPDISSLKRLESLHLEDNRFSGNIPP  472

Query  204  SLGRIKSLRELFLQNNNLTGQIPGSILGRPGINLRTTPGNPFLSGP  67
            SLG +  LRELFLQNNNLTGQIP ++L +PG+NLRT+ GNPFL+ P
Sbjct  473  SLGGVPHLRELFLQNNNLTGQIPSNLLQKPGLNLRTS-GNPFLTQP  517



>ref|XP_011071564.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g67720 [Sesamum indicum]
Length=510

 Score =   197 bits (500),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 108/163 (66%), Positives = 131/163 (80%), Gaps = 0/163 (0%)
 Frame = -2

Query  564  FRVLPLGGKTHTRDVIALEKLKEGFENPPLDWNGDPCLPPQYSWTGVVCSGGTRIRVttl  385
            F +LP GGKT  RDVIA+  L++ F+NPP DW+GDPCLP  YSWTGV CS G RIR+ TL
Sbjct  346  FHMLPTGGKTLPRDVIAMINLRKSFQNPPADWHGDPCLPSGYSWTGVTCSEGPRIRIITL  405

Query  384  nltgmglsgmlssSIANLTALSGIWLGNNDLSGSTPDLSSLKRLEILHLEDNQIGGEIAP  205
            NLT +GLSG +S SI+ +TAL+ I LGNN L G+ PDLSSLK LEILHLE+NQ+GG I P
Sbjct  406  NLTSIGLSGSISPSISRMTALNSILLGNNSLMGTIPDLSSLKGLEILHLENNQLGGTIHP  465

Query  204  SLGRIKSLRELFLQNNNLTGQIPGSILGRPGINLRTTPGNPFL  76
            SLG +++LRELFLQNNNLTGQ+P ++  +PG+ LR TPGNPFL
Sbjct  466  SLGNLRNLRELFLQNNNLTGQVPSNLAQKPGLTLRYTPGNPFL  508



>ref|XP_007143225.1| hypothetical protein PHAVU_007G054600g [Phaseolus vulgaris]
 gb|ESW15219.1| hypothetical protein PHAVU_007G054600g [Phaseolus vulgaris]
Length=513

 Score =   197 bits (500),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 115/168 (68%), Positives = 137/168 (82%), Gaps = 1/168 (1%)
 Frame = -2

Query  564  FRVLPLGGKTHTRDVIALEKLKEGFENPPLDWNGDPCLPPQYSWTGVVCSGGTRIRVttl  385
            F +LPL G+T TRDVIALEK+KE   NPPLDWNGDPC+P QYSWTG+ CS G RIRV TL
Sbjct  347  FYLLPLTGRTSTRDVIALEKVKESLRNPPLDWNGDPCMPQQYSWTGITCSEGPRIRVVTL  406

Query  384  nltgmglsgmlssSIANLTALSGIWLGNNDLSGSTPDLSSLKRLEILHLEDNQIGGEIAP  205
            NLT M LSG L+ SIAN+TAL+ IWLGNN L+G  PDLSSLK L+ LHLEDNQ  GE+  
Sbjct  407  NLTSMDLSGSLTPSIANMTALTNIWLGNNSLTGQIPDLSSLKLLKTLHLEDNQFSGEVPS  466

Query  204  SLGRIKSLRELFLQNNNLTGQIPGSILGRPGINLRTTPGNPFLSGPPA  61
            SLG I SL+E+FLQNNNLTG+IP S++G+PG+++RT+ GN FLS PP+
Sbjct  467  SLGNISSLQEVFLQNNNLTGRIPESLIGKPGLDIRTS-GNNFLSPPPS  513



>gb|KCW60816.1| hypothetical protein EUGRSUZ_H03552 [Eucalyptus grandis]
Length=397

 Score =   193 bits (491),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 110/167 (66%), Positives = 125/167 (75%), Gaps = 1/167 (1%)
 Frame = -2

Query  564  FRVLPLGGKTHTRDVIALEKLKEGFENPPLDWNGDPCLPPQYSWTGVVCSGGTRIRVttl  385
            F+VLPLG  TH RDVIALE LK G  N P+DW+GDPC P QYSWTGV CS G+RIRV +L
Sbjct  230  FQVLPLGRTTHPRDVIALENLKLGLHNYPIDWSGDPCFPQQYSWTGVTCSQGSRIRVVSL  289

Query  384  nltgmglsgmlssSIANLTALSGIWLGNNDLSGSTPDLSSLKRLEILHLEDNQIGGEIAP  205
            NLT  GLSG LS  +AN+TAL+GIWLGNN L G  P LSSLK LEILHL DNQ+ G I  
Sbjct  290  NLTSAGLSGTLSPYLANMTALTGIWLGNNGLYGPIPKLSSLKHLEILHLNDNQLDGPIPS  349

Query  204  SLGRIKSLRELFLQNNNLTGQIPGSILGRPGINLRTTPGNPFLSGPP  64
            SLG I  L+ELFLQNNNLTGQ+P S+L +PG+NL+   GN   S  P
Sbjct  350  SLGAISGLQELFLQNNNLTGQVPSSLLNKPGLNLKVN-GNHLSSAQP  395



>ref|XP_008797062.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase At2g14510 [Phoenix dactylifera]
Length=515

 Score =   195 bits (496),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 108/168 (64%), Positives = 131/168 (78%), Gaps = 0/168 (0%)
 Frame = -2

Query  564  FRVLPLGGKTHTRDVIALEKLKEGFENPPLDWNGDPCLPPQYSWTGVVCSGGTRIRVttl  385
            +R+  LG  THT D+IAL  +K+   NPPLDW+GDPC+P +YSWTGV CS GTRIRV TL
Sbjct  347  YRLFSLGRVTHTGDIIALVAIKKNISNPPLDWSGDPCMPREYSWTGVTCSEGTRIRVITL  406

Query  384  nltgmglsgmlssSIANLTALSGIWLGNNDLSGSTPDLSSLKRLEILHLEDNQIGGEIAP  205
            NL+ MGLSG LS S+A LTALS I   NN+LSG+ PDLS LKRLE LHL+DNQ+ G I  
Sbjct  407  NLSSMGLSGSLSPSLARLTALSDISFANNNLSGNIPDLSRLKRLEKLHLQDNQLTGRIPS  466

Query  204  SLGRIKSLRELFLQNNNLTGQIPGSILGRPGINLRTTPGNPFLSGPPA  61
            SLG  K L ELFLQNNNLTG++P ++LG+PG+N++  PGNPFLS PP+
Sbjct  467  SLGNSKRLSELFLQNNNLTGEVPSNLLGKPGLNIKLVPGNPFLSLPPS  514



>ref|XP_008222988.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g67720 [Prunus mume]
Length=549

 Score =   196 bits (497),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 114/168 (68%), Positives = 129/168 (77%), Gaps = 1/168 (1%)
 Frame = -2

Query  564  FRVLPLGGKTHTRDVIALEKLKEGFENPPLDWNGDPCLPPQYSWTGVVCSGGTRIRVttl  385
            F VLPLGG T TRDVIALE +K+  +NPP DWNGDPCLP QYSWTG+ CS G R RV TL
Sbjct  383  FDVLPLGGTTLTRDVIALESVKQRIQNPPSDWNGDPCLPRQYSWTGITCSSGPRPRVVTL  442

Query  384  nltgmglsgmlssSIANLTALSGIWLGNNDLSGSTPDLSSLKRLEILHLEDNQIGGEIAP  205
            NLT MGLSG LS S AN+TALS IWLG N+ SG  PDLSSLKRLE LHLEDN   G+I  
Sbjct  443  NLTSMGLSGSLSPSFANMTALSNIWLGKNNFSGPIPDLSSLKRLEKLHLEDNHFSGDIPS  502

Query  204  SLGRIKSLRELFLQNNNLTGQIPGSILGRPGINLRTTPGNPFLSGPPA  61
            SLG I SL ELFLQNNNLTGQ+P S+ G+ G++LRT+ GN   + PP+
Sbjct  503  SLGNIVSLHELFLQNNNLTGQVPSSLTGKSGLDLRTS-GNSLSAPPPS  549



>ref|XP_010942424.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase At2g14510 [Elaeis guineensis]
Length=515

 Score =   195 bits (495),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 108/166 (65%), Positives = 128/166 (77%), Gaps = 0/166 (0%)
 Frame = -2

Query  564  FRVLPLGGKTHTRDVIALEKLKEGFENPPLDWNGDPCLPPQYSWTGVVCSGGTRIRVttl  385
            F + PLG  THT D+IALE +K+   NPPLDW+GDPC+P  YSWTGV CS GTRIRV TL
Sbjct  347  FHLFPLGRVTHTGDIIALEAIKKNISNPPLDWSGDPCMPRVYSWTGVTCSEGTRIRVVTL  406

Query  384  nltgmglsgmlssSIANLTALSGIWLGNNDLSGSTPDLSSLKRLEILHLEDNQIGGEIAP  205
            NL+ MGLSG LS S+A LTALS I   NN++SG+ PDLS LKRLE LHL+DNQ+ G I  
Sbjct  407  NLSSMGLSGSLSPSLARLTALSDISFANNNISGNIPDLSRLKRLEKLHLQDNQLTGRIPS  466

Query  204  SLGRIKSLRELFLQNNNLTGQIPGSILGRPGINLRTTPGNPFLSGP  67
            SLG IK L ELFLQNNNLTG++P ++LG+PG+ +   PGNPFLS P
Sbjct  467  SLGNIKRLSELFLQNNNLTGEVPANLLGKPGLKIELFPGNPFLSRP  512



>ref|XP_007223269.1| hypothetical protein PRUPE_ppa004492mg [Prunus persica]
 gb|EMJ24468.1| hypothetical protein PRUPE_ppa004492mg [Prunus persica]
Length=507

 Score =   194 bits (492),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 113/168 (67%), Positives = 128/168 (76%), Gaps = 1/168 (1%)
 Frame = -2

Query  564  FRVLPLGGKTHTRDVIALEKLKEGFENPPLDWNGDPCLPPQYSWTGVVCSGGTRIRVttl  385
            F VLPLGG T TRDVIALE +K+  +NPP DWNGDPCLP QYSWTG+ CS G R RV TL
Sbjct  341  FDVLPLGGTTLTRDVIALESVKQRIQNPPSDWNGDPCLPRQYSWTGITCSSGPRPRVVTL  400

Query  384  nltgmglsgmlssSIANLTALSGIWLGNNDLSGSTPDLSSLKRLEILHLEDNQIGGEIAP  205
            NLT MGLSG LS S AN+TALS IWLG N+ SG  PDLSSLKRLE LHLEDN   G+I  
Sbjct  401  NLTSMGLSGSLSPSFANMTALSNIWLGKNNFSGPIPDLSSLKRLEKLHLEDNHFSGDIPS  460

Query  204  SLGRIKSLRELFLQNNNLTGQIPGSILGRPGINLRTTPGNPFLSGPPA  61
            SLG I SL ELFLQNNNLTGQ+P  + G+ G++LRT+ GN   + PP+
Sbjct  461  SLGNIDSLHELFLQNNNLTGQVPTGLTGKSGLDLRTS-GNSLSAPPPS  507



>ref|XP_011021564.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g67720 [Populus euphratica]
Length=513

 Score =   194 bits (492),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 117/168 (70%), Positives = 132/168 (79%), Gaps = 2/168 (1%)
 Frame = -2

Query  564  FRVLPLGGKTHTRDVIALEKLKEGFENPPLDWNGDPCLPPQYSWTGVVCSGGTRIRVttl  385
            F ++ LG +T TRDVI LE LK   +N PLDW GDPC+P QYSWTG+ CS G RIRV TL
Sbjct  348  FELIALGERTLTRDVIVLEALKSSLQNVPLDWYGDPCMPLQYSWTGITCSEGPRIRVVTL  407

Query  384  nltgmglsgmlssSIANLTALSGIWLGNNDLSGSTPDLSSLKRLEILHLEDNQIGGEIAP  205
            NLTGMGLSG L  SIA LTAL+ IWLGNN LSGS PDLSSLK LE LHLEDN+  GEI  
Sbjct  408  NLTGMGLSGSLPPSIARLTALADIWLGNNTLSGSIPDLSSLKMLETLHLEDNRFTGEIPL  467

Query  204  SLGRIKSLRELFLQNNNLTGQIPGSILGRPGINLRTTPGNPFLSGPPA  61
            SLG IK LRELFLQNNNLTGQIP ++L +PG+NLRT+ GN FL+ PP+
Sbjct  468  SLGNIKGLRELFLQNNNLTGQIPNNLL-KPGLNLRTS-GNQFLAPPPS  513



>ref|XP_010464165.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g67720 [Camelina sativa]
Length=513

 Score =   194 bits (492),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 107/167 (64%), Positives = 127/167 (76%), Gaps = 1/167 (1%)
 Frame = -2

Query  564  FRVLPLGGKTHTRDVIALEKLKEGFENPPLDWNGDPCLPPQYSWTGVVCSGGTRIRVttl  385
            F ++PLGGKT  RDV AL  +K+ F+N P DWNGDPC P  Y+W+GV CS G RIR+ TL
Sbjct  347  FELVPLGGKTLVRDVTALNAIKKSFKNAPADWNGDPCFPKNYTWSGVTCSEGPRIRIVTL  406

Query  384  nltgmglsgmlssSIANLTALSGIWLGNNDLSGSTPDLSSLKRLEILHLEDNQIGGEIAP  205
            NLT MG+SG L+ ++  LTALS IWLG N LSGS PD SSLK LE LHLEDN+  G I P
Sbjct  407  NLTNMGISGSLAPAVTKLTALSSIWLGKNSLSGSLPDFSSLKLLESLHLEDNRFSGNIPP  466

Query  204  SLGRIKSLRELFLQNNNLTGQIPGSILGRPGINLRTTPGNPFLSGPP  64
            SLG +  LRELFLQNNNLTGQIP ++L +PG+NLRT+ GNPFL+  P
Sbjct  467  SLGGVPHLRELFLQNNNLTGQIPSNLLQKPGLNLRTS-GNPFLTQQP  512



>ref|XP_010434850.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase At2g14510 [Camelina sativa]
Length=516

 Score =   194 bits (492),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 107/167 (64%), Positives = 127/167 (76%), Gaps = 1/167 (1%)
 Frame = -2

Query  564  FRVLPLGGKTHTRDVIALEKLKEGFENPPLDWNGDPCLPPQYSWTGVVCSGGTRIRVttl  385
            F ++PL GKT  RDV AL  +K  F+N P DWNGDPCLP  Y+W+GV CS G RIR+ TL
Sbjct  350  FELVPLRGKTLVRDVTALNAIKRSFKNAPADWNGDPCLPKNYTWSGVTCSEGPRIRIVTL  409

Query  384  nltgmglsgmlssSIANLTALSGIWLGNNDLSGSTPDLSSLKRLEILHLEDNQIGGEIAP  205
            NLT MG+SG L+ ++  LTALS IW+G N LSGS PD SSLKRLE LHLEDN+  G I P
Sbjct  410  NLTNMGISGSLAPAVTKLTALSSIWIGKNSLSGSLPDFSSLKRLESLHLEDNRFSGNIPP  469

Query  204  SLGRIKSLRELFLQNNNLTGQIPGSILGRPGINLRTTPGNPFLSGPP  64
            SLG +  LRELFLQNNNLTGQIP ++L +PG+NLRT+ GNPFL+  P
Sbjct  470  SLGGVPHLRELFLQNNNLTGQIPSNLLQKPGLNLRTS-GNPFLTQQP  515



>gb|KDP40146.1| hypothetical protein JCGZ_02144 [Jatropha curcas]
Length=514

 Score =   193 bits (491),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 113/168 (67%), Positives = 130/168 (77%), Gaps = 1/168 (1%)
 Frame = -2

Query  564  FRVLPLGGKTHTRDVIALEKLKEGFENPPLDWNGDPCLPPQYSWTGVVCSGGTRIRVttl  385
            F V  LGG+T TRDVIALE LK    NPP DW+GDPC+P +YSWTG+ CS G RIRV TL
Sbjct  347  FYVTELGGRTLTRDVIALESLKSTLRNPPFDWSGDPCMPRRYSWTGITCSEGPRIRVLTL  406

Query  384  nltgmglsgmlssSIANLTALSGIWLGNNDLSGSTPDLSSLKRLEILHLEDNQIGGEIAP  205
            NLT MGLSG L  SIA LTAL+ IWLGNN L+GS PDLS LK L+ LHLE+NQ+ G I  
Sbjct  407  NLTSMGLSGSLPRSIARLTALTDIWLGNNSLTGSIPDLSLLKMLQTLHLENNQLTGGIPS  466

Query  204  SLGRIKSLRELFLQNNNLTGQIPGSILGRPGINLRTTPGNPFLSGPPA  61
            SLG IK LRELFLQNNNLTGQIP ++ G+ G++LRT+PGN  L+ PPA
Sbjct  467  SLGSIKPLRELFLQNNNLTGQIPSNLTGKQGLDLRTSPGNQ-LTPPPA  513



>ref|NP_187250.1| leucine-rich repeat family protein [Arabidopsis thaliana]
 gb|AAF23217.1|AC013454_4 hypothetical protein [Arabidopsis thaliana]
 gb|AAP21283.1| At3g05990 [Arabidopsis thaliana]
 dbj|BAE99514.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE74327.1| leucine-rich repeat domain-containing protein [Arabidopsis thaliana]
Length=517

 Score =   193 bits (491),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 107/166 (64%), Positives = 125/166 (75%), Gaps = 1/166 (1%)
 Frame = -2

Query  564  FRVLPLGGKTHTRDVIALEKLKEGFENPPLDWNGDPCLPPQYSWTGVVCSGGTRIRVttl  385
            F +L LGGKT  RDV AL  +K  F+N P DW+GDPCLP  YSW+G+ CS G RIRV  L
Sbjct  351  FELLSLGGKTLVRDVTALNAIKNSFKNAPADWSGDPCLPKNYSWSGISCSEGPRIRVVAL  410

Query  384  nltgmglsgmlssSIANLTALSGIWLGNNDLSGSTPDLSSLKRLEILHLEDNQIGGEIAP  205
            NLT MG+SG L+ ++A LTALS IWLGNN LSGS PD SSLKRLE LH EDN   G I  
Sbjct  411  NLTNMGVSGSLAPAVAKLTALSSIWLGNNSLSGSLPDFSSLKRLESLHFEDNLFSGSIPS  470

Query  204  SLGRIKSLRELFLQNNNLTGQIPGSILGRPGINLRTTPGNPFLSGP  67
            SLG +  LRELFLQNNNLTGQ+P ++L +PG+NLRT+ GNPFL+ P
Sbjct  471  SLGGVPHLRELFLQNNNLTGQVPSNLLQKPGLNLRTS-GNPFLTQP  515



>ref|XP_010486080.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase At2g14510 [Camelina sativa]
Length=516

 Score =   193 bits (490),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 107/167 (64%), Positives = 126/167 (75%), Gaps = 1/167 (1%)
 Frame = -2

Query  564  FRVLPLGGKTHTRDVIALEKLKEGFENPPLDWNGDPCLPPQYSWTGVVCSGGTRIRVttl  385
            F ++PLGGKT  RDV AL  +K  F+N P DWNGDPC P  Y+W+GV CS G RIR+ TL
Sbjct  350  FELVPLGGKTLVRDVTALNAIKRSFKNAPADWNGDPCFPKNYTWSGVTCSEGPRIRIVTL  409

Query  384  nltgmglsgmlssSIANLTALSGIWLGNNDLSGSTPDLSSLKRLEILHLEDNQIGGEIAP  205
            NLT MG+SG L+ ++  LTALS IWLG N LSGS PD SSLK LE LHLEDN+  G I P
Sbjct  410  NLTNMGISGSLAPAVTKLTALSSIWLGKNSLSGSLPDFSSLKLLESLHLEDNRFSGNIPP  469

Query  204  SLGRIKSLRELFLQNNNLTGQIPGSILGRPGINLRTTPGNPFLSGPP  64
            SLG +  LRELFLQNNNLTGQIP ++L +PG+NLRT+ GNPFL+  P
Sbjct  470  SLGGVPHLRELFLQNNNLTGQIPSNLLQKPGLNLRTS-GNPFLTQQP  515



>ref|XP_010277754.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g67720 [Nelumbo nucifera]
Length=518

 Score =   193 bits (490),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 110/167 (66%), Positives = 124/167 (74%), Gaps = 1/167 (1%)
 Frame = -2

Query  564  FRVLPLGGKTHTRDVIALEKLKEGFENPPLDWNGDPCLPPQYSWTGVVCSGGTRIRVttl  385
            F VLPLGG+T TRDV+AL  + +  ENPPLDWNGDPCLP QYSWTGVVCS  TRIRV  L
Sbjct  350  FNVLPLGGRTLTRDVVALNVVNKSLENPPLDWNGDPCLPRQYSWTGVVCSYETRIRVVAL  409

Query  384  nltgmglsgmlssSIANLTALSGIWLGNNDLSGSTPDLSSLKRLEILHLEDNQIGGEIAP  205
            NLT MG+ G LS  IANLTAL+ IWLGNN   G+ PDLS+LK LE LHLEDN   G I P
Sbjct  410  NLTSMGIRGPLSPEIANLTALTEIWLGNNTFWGTIPDLSNLKMLETLHLEDNHFSGVIPP  469

Query  204  SLGRIKSLRELFLQNNNLTGQIPGSILGRPGINLRTTPGNPFLSGPP  64
            SLG I  LRELFLQNN L G++P S+  +PG+NL+T  GN FL   P
Sbjct  470  SLGNIVKLRELFLQNNELGGEVPNSLKVKPGLNLKTY-GNQFLVQAP  515



>ref|XP_010024362.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At5g59680 [Eucalyptus grandis]
Length=528

 Score =   193 bits (490),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 110/167 (66%), Positives = 125/167 (75%), Gaps = 1/167 (1%)
 Frame = -2

Query  564  FRVLPLGGKTHTRDVIALEKLKEGFENPPLDWNGDPCLPPQYSWTGVVCSGGTRIRVttl  385
            F+VLPLG  TH RDVIALE LK G  N P+DW+GDPC P QYSWTGV CS G+RIRV +L
Sbjct  361  FQVLPLGRTTHPRDVIALENLKLGLHNYPIDWSGDPCFPQQYSWTGVTCSQGSRIRVVSL  420

Query  384  nltgmglsgmlssSIANLTALSGIWLGNNDLSGSTPDLSSLKRLEILHLEDNQIGGEIAP  205
            NLT  GLSG LS  +AN+TAL+GIWLGNN L G  P LSSLK LEILHL DNQ+ G I  
Sbjct  421  NLTSAGLSGTLSPYLANMTALTGIWLGNNGLYGPIPKLSSLKHLEILHLNDNQLDGPIPS  480

Query  204  SLGRIKSLRELFLQNNNLTGQIPGSILGRPGINLRTTPGNPFLSGPP  64
            SLG I  L+ELFLQNNNLTGQ+P S+L +PG+NL+   GN   S  P
Sbjct  481  SLGAISGLQELFLQNNNLTGQVPSSLLNKPGLNLKVN-GNHLSSAQP  526



>gb|KFK38012.1| hypothetical protein AALP_AA3G058900 [Arabis alpina]
Length=515

 Score =   192 bits (487),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 104/167 (62%), Positives = 126/167 (75%), Gaps = 1/167 (1%)
 Frame = -2

Query  564  FRVLPLGGKTHTRDVIALEKLKEGFENPPLDWNGDPCLPPQYSWTGVVCSGGTRIRVttl  385
            F+++ LGG+T  RDV AL  +K  FEN P+DWNGDPC+P  YSW+GV CS G RIRV  L
Sbjct  349  FQLISLGGRTLVRDVTALNAIKSSFENAPVDWNGDPCMPKNYSWSGVTCSEGPRIRVVAL  408

Query  384  nltgmglsgmlssSIANLTALSGIWLGNNDLSGSTPDLSSLKRLEILHLEDNQIGGEIAP  205
            NLT MGLSG L+  ++ LTALS IWLGNN LSG+ PD SSLK LE +HLEDN+  G I  
Sbjct  409  NLTNMGLSGSLAPEVSKLTALSSIWLGNNSLSGTIPDFSSLKYLESVHLEDNRFSGNIPA  468

Query  204  SLGRIKSLRELFLQNNNLTGQIPGSILGRPGINLRTTPGNPFLSGPP  64
              G +  LRELFLQNNNLTGQ+P ++L +PG+NLRT+ GNPFL+ PP
Sbjct  469  FFGGVPHLRELFLQNNNLTGQVPNNLLQKPGLNLRTS-GNPFLTQPP  514



>ref|XP_006851088.1| hypothetical protein AMTR_s00025p00244550 [Amborella trichopoda]
 gb|ERN12669.1| hypothetical protein AMTR_s00025p00244550 [Amborella trichopoda]
Length=512

 Score =   191 bits (484),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 109/166 (66%), Positives = 127/166 (77%), Gaps = 0/166 (0%)
 Frame = -2

Query  561  RVLPLGGKTHTRDVIALEKLKEGFENPPLDWNGDPCLPPQYSWTGVVCSGGTRIRVttln  382
            +VL LGG+T TRDVIALE +K      PLDW GDPCLP QYSWTGV CS G+RIRV  LN
Sbjct  343  QVLMLGGRTVTRDVIALEVMKRSLAKVPLDWQGDPCLPRQYSWTGVTCSEGSRIRVIALN  402

Query  381  ltgmglsgmlssSIANLTALSGIWLGNNDLSGSTPDLSSLKRLEILHLEDNQIGGEIAPS  202
            LTG+GLSG LS  IANLTALS IWLGNN+LSGS PD S L+RL  LHLE+NQ  GEI P+
Sbjct  403  LTGLGLSGSLSPRIANLTALSDIWLGNNNLSGSIPDFSPLRRLVSLHLENNQFSGEIPPT  462

Query  201  LGRIKSLRELFLQNNNLTGQIPGSILGRPGINLRTTPGNPFLSGPP  64
            LG I  LREL+LQNNNLTG +P S+  +PG++LR +PGN  ++  P
Sbjct  463  LGNISGLRELWLQNNNLTGVVPNSLQTKPGLDLRVSPGNRLVNSMP  508



>ref|XP_006408000.1| hypothetical protein EUTSA_v10020522mg [Eutrema salsugineum]
 gb|ESQ49453.1| hypothetical protein EUTSA_v10020522mg [Eutrema salsugineum]
Length=419

 Score =   187 bits (476),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 102/167 (61%), Positives = 125/167 (75%), Gaps = 1/167 (1%)
 Frame = -2

Query  564  FRVLPLGGKTHTRDVIALEKLKEGFENPPLDWNGDPCLPPQYSWTGVVCSGGTRIRVttl  385
            F ++ LGG+T  RDV AL  +K  F+N P+DWNGDPC+P  Y+W+GV CS G RIR+  L
Sbjct  253  FELISLGGRTLVRDVTALNAIKSSFKNAPVDWNGDPCMPKNYTWSGVTCSEGPRIRIVAL  312

Query  384  nltgmglsgmlssSIANLTALSGIWLGNNDLSGSTPDLSSLKRLEILHLEDNQIGGEIAP  205
            NLT MGLSG L++ +  LT LS IWLGNN LSGS PDLSSLK LE +HLEDN+  G I P
Sbjct  313  NLTSMGLSGSLATEVGKLTGLSSIWLGNNSLSGSIPDLSSLKLLESVHLEDNRFSGTIPP  372

Query  204  SLGRIKSLRELFLQNNNLTGQIPGSILGRPGINLRTTPGNPFLSGPP  64
              G +  LREL+LQNNNLTGQIP ++L +PG+ LRT+ GNPFL+ PP
Sbjct  373  FFGGVPHLRELYLQNNNLTGQIPSNLLQKPGLELRTS-GNPFLTQPP  418



>ref|XP_006408001.1| hypothetical protein EUTSA_v10020522mg [Eutrema salsugineum]
 gb|ESQ49454.1| hypothetical protein EUTSA_v10020522mg [Eutrema salsugineum]
Length=517

 Score =   187 bits (476),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 102/167 (61%), Positives = 125/167 (75%), Gaps = 1/167 (1%)
 Frame = -2

Query  564  FRVLPLGGKTHTRDVIALEKLKEGFENPPLDWNGDPCLPPQYSWTGVVCSGGTRIRVttl  385
            F ++ LGG+T  RDV AL  +K  F+N P+DWNGDPC+P  Y+W+GV CS G RIR+  L
Sbjct  351  FELISLGGRTLVRDVTALNAIKSSFKNAPVDWNGDPCMPKNYTWSGVTCSEGPRIRIVAL  410

Query  384  nltgmglsgmlssSIANLTALSGIWLGNNDLSGSTPDLSSLKRLEILHLEDNQIGGEIAP  205
            NLT MGLSG L++ +  LT LS IWLGNN LSGS PDLSSLK LE +HLEDN+  G I P
Sbjct  411  NLTSMGLSGSLATEVGKLTGLSSIWLGNNSLSGSIPDLSSLKLLESVHLEDNRFSGTIPP  470

Query  204  SLGRIKSLRELFLQNNNLTGQIPGSILGRPGINLRTTPGNPFLSGPP  64
              G +  LREL+LQNNNLTGQIP ++L +PG+ LRT+ GNPFL+ PP
Sbjct  471  FFGGVPHLRELYLQNNNLTGQIPSNLLQKPGLELRTS-GNPFLTQPP  516



>ref|XP_007034689.1| Serine-threonine protein kinase, plant-type, putative isoform 
1 [Theobroma cacao]
 gb|EOY05615.1| Serine-threonine protein kinase, plant-type, putative isoform 
1 [Theobroma cacao]
Length=538

 Score =   187 bits (476),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 110/155 (71%), Positives = 120/155 (77%), Gaps = 0/155 (0%)
 Frame = -2

Query  564  FRVLPLGGKTHTRDVIALEKLKEGFENPPLDWNGDPCLPPQYSWTGVVCSGGTRIRVttl  385
            F VL LGG+THTRDV ALE++K    N P DWNGDPCLP  YSWTGV CS G RIRV  L
Sbjct  352  FNVLRLGGRTHTRDVRALEEMKNSLHNLPFDWNGDPCLPLNYSWTGVTCSEGERIRVIAL  411

Query  384  nltgmglsgmlssSIANLTALSGIWLGNNDLSGSTPDLSSLKRLEILHLEDNQIGGEIAP  205
            NLT MGLSG LS SI+NLTALSGI LGNN LSG  PDLSSLK LEILHLEDNQ+ GEI  
Sbjct  412  NLTSMGLSGSLSPSISNLTALSGILLGNNSLSGVIPDLSSLKLLEILHLEDNQLRGEIPS  471

Query  204  SLGRIKSLRELFLQNNNLTGQIPGSILGRPGINLR  100
            SLG +  LRELFLQNNNLTG IP  ++GR G+ +R
Sbjct  472  SLGDLGRLRELFLQNNNLTGSIPDRLVGRSGLEVR  506



>emb|CDY05220.1| BnaC05g45830D [Brassica napus]
Length=514

 Score =   184 bits (466),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 101/167 (60%), Positives = 121/167 (72%), Gaps = 1/167 (1%)
 Frame = -2

Query  564  FRVLPLGGKTHTRDVIALEKLKEGFENPPLDWNGDPCLPPQYSWTGVVCSGGTRIRVttl  385
            F ++ LGG+T  RD  AL  +K  FEN P+DW+GDPC+P  YSWTGV CS G RIR+  L
Sbjct  348  FELIALGGRTLVRDATALNAIKRSFENVPVDWSGDPCMPKNYSWTGVTCSEGPRIRIVAL  407

Query  384  nltgmglsgmlssSIANLTALSGIWLGNNDLSGSTPDLSSLKRLEILHLEDNQIGGEIAP  205
            NLT MGLSG L+  +A LTALS IWLGNN LSGS PD  SLK LE +HLEDN+  G    
Sbjct  408  NLTNMGLSGSLAPEVARLTALSSIWLGNNSLSGSIPDFGSLKLLESVHLEDNRFSGPFPS  467

Query  204  SLGRIKSLRELFLQNNNLTGQIPGSILGRPGINLRTTPGNPFLSGPP  64
              G +  LRELFLQNNNLTGQ+P ++L +PG+ LRT+ GNPFL+ PP
Sbjct  468  FFGGVPRLRELFLQNNNLTGQVPSNLLQKPGLELRTS-GNPFLTQPP  513



>ref|XP_004140259.1| PREDICTED: putative leucine-rich repeat receptor-like serine/threonine-protein 
kinase At2g14440-like [Cucumis sativus]
 ref|XP_004156110.1| PREDICTED: putative leucine-rich repeat receptor-like serine/threonine-protein 
kinase At2g14440-like [Cucumis sativus]
 gb|KGN48022.1| hypothetical protein Csa_6G425100 [Cucumis sativus]
Length=519

 Score =   183 bits (465),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 104/167 (62%), Positives = 120/167 (72%), Gaps = 0/167 (0%)
 Frame = -2

Query  564  FRVLPLGGKTHTRDVIALEKLKEGFENPPLDWNGDPCLPPQYSWTGVVCSGGTRIRVttl  385
            F ++PL  +T  RDVI LE++K    NPP DW GDPC P QY WTG+ CS G+RIRV TL
Sbjct  351  FHIVPLEARTLVRDVINLERVKSSLNNPPTDWIGDPCFPQQYRWTGITCSEGSRIRVITL  410

Query  384  nltgmglsgmlssSIANLTALSGIWLGNNDLSGSTPDLSSLKRLEILHLEDNQIGGEIAP  205
            NLT M LSG LS SIANLTALSGIWLGNN LSG  PDLS+LK LEI+HLEDN   GEI  
Sbjct  411  NLTNMDLSGSLSPSIANLTALSGIWLGNNSLSGPIPDLSTLKLLEIVHLEDNNFSGEIPS  470

Query  204  SLGRIKSLRELFLQNNNLTGQIPGSILGRPGINLRTTPGNPFLSGPP  64
            SLG +  L+ELFL NNNLTG++P S+     ++LR  PGN  L  PP
Sbjct  471  SLGNLARLQELFLYNNNLTGEVPQSLTNNERLDLRIFPGNHLLGPPP  517



>emb|CDY18839.1| BnaAnng03040D [Brassica napus]
Length=518

 Score =   183 bits (464),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 100/167 (60%), Positives = 120/167 (72%), Gaps = 1/167 (1%)
 Frame = -2

Query  564  FRVLPLGGKTHTRDVIALEKLKEGFENPPLDWNGDPCLPPQYSWTGVVCSGGTRIRVttl  385
            F ++ LGG+T  RD  AL  +K  F+N P+DWNGDPC+P  YSWTGV CS G RIR+  L
Sbjct  352  FELISLGGRTLVRDATALNAIKRSFKNVPVDWNGDPCMPKNYSWTGVTCSDGPRIRIVAL  411

Query  384  nltgmglsgmlssSIANLTALSGIWLGNNDLSGSTPDLSSLKRLEILHLEDNQIGGEIAP  205
            NLT MGLSG L+  +A LTALS IWLGNN LSGS PDL SLK LE +HLEDN+ GG    
Sbjct  412  NLTSMGLSGSLAPQVAKLTALSSIWLGNNSLSGSIPDLGSLKFLESVHLEDNRFGGTFPS  471

Query  204  SLGRIKSLRELFLQNNNLTGQIPGSILGRPGINLRTTPGNPFLSGPP  64
                +  LRELFLQNNNLTG++P  +L +PG+ LR + GNPFL+ PP
Sbjct  472  FFNGVPRLRELFLQNNNLTGKVPSKLLQKPGLELRVS-GNPFLTQPP  517



>ref|XP_008449566.1| PREDICTED: putative leucine-rich repeat receptor-like serine/threonine-protein 
kinase At2g14440 [Cucumis melo]
Length=549

 Score =   183 bits (464),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 104/167 (62%), Positives = 120/167 (72%), Gaps = 0/167 (0%)
 Frame = -2

Query  564  FRVLPLGGKTHTRDVIALEKLKEGFENPPLDWNGDPCLPPQYSWTGVVCSGGTRIRVttl  385
            F V+PL  +T  RDVI LE++K   +NPP DW GDPC P QY WTG+ CS G+RIRV TL
Sbjct  381  FHVVPLEARTLVRDVINLERVKRSLKNPPTDWIGDPCFPEQYRWTGITCSAGSRIRVITL  440

Query  384  nltgmglsgmlssSIANLTALSGIWLGNNDLSGSTPDLSSLKRLEILHLEDNQIGGEIAP  205
            NLT M LSG LS SIANLTALSGIWLGNN LSG  PDLS+LK LE +HLEDN   GEI  
Sbjct  441  NLTSMDLSGSLSPSIANLTALSGIWLGNNSLSGPIPDLSTLKLLEKVHLEDNNFSGEIPS  500

Query  204  SLGRIKSLRELFLQNNNLTGQIPGSILGRPGINLRTTPGNPFLSGPP  64
            SLG +  L+ELFL NNNLTG++P S+     ++LR  PGN  L  PP
Sbjct  501  SLGNLPRLQELFLYNNNLTGEVPQSLTNNERLDLRIFPGNHLLGPPP  547



>emb|CDY27721.1| BnaA05g31300D [Brassica napus]
Length=526

 Score =   182 bits (462),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 100/167 (60%), Positives = 120/167 (72%), Gaps = 1/167 (1%)
 Frame = -2

Query  564  FRVLPLGGKTHTRDVIALEKLKEGFENPPLDWNGDPCLPPQYSWTGVVCSGGTRIRVttl  385
            F ++ LGG+T  RD  AL  +K  FEN P+DW+GDPC+P  YSWTGV CS G RIR+  L
Sbjct  360  FELIALGGRTLVRDATALNAIKRSFENVPVDWSGDPCMPKNYSWTGVTCSEGPRIRIVAL  419

Query  384  nltgmglsgmlssSIANLTALSGIWLGNNDLSGSTPDLSSLKRLEILHLEDNQIGGEIAP  205
            NLT MGLSG L+  +A LTALS IWLGNN LSGS PD  SLK LE +HLEDN+  G    
Sbjct  420  NLTNMGLSGSLAPEVARLTALSSIWLGNNSLSGSIPDFGSLKLLESVHLEDNRFSGPFPS  479

Query  204  SLGRIKSLRELFLQNNNLTGQIPGSILGRPGINLRTTPGNPFLSGPP  64
                +  LRELFLQNNNLTGQ+P ++L +PG+ LRT+ GNPFL+ PP
Sbjct  480  FFSGVPRLRELFLQNNNLTGQVPSNLLQKPGLELRTS-GNPFLTQPP  525



>ref|XP_010255974.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g67720 [Nelumbo nucifera]
 ref|XP_010255975.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g67720 [Nelumbo nucifera]
Length=521

 Score =   182 bits (461),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 105/169 (62%), Positives = 121/169 (72%), Gaps = 3/169 (2%)
 Frame = -2

Query  564  FRVLPLGGKTHTRDVIALEKLKEGFENPPLDWNGDPCLPPQYSWTGVVCSGGTR--IRVt  391
            F VLPLG +T TRDV++L ++K    NPPLDWNGDPC P QYSWTGV+C+ G R   RV 
Sbjct  350  FDVLPLGRRTVTRDVVSLVEVKRSLLNPPLDWNGDPCFPQQYSWTGVICAEGNRNQTRVV  409

Query  390  tlnltgmglsgmlssSIANLTALSGIWLGNNDLSGSTPDLSSLKRLEILHLEDNQIGGEI  211
             LNLT M L G LS  IANLTAL+ IWLGNN LSG  PDLS LK L+ LHLEDNQ  GEI
Sbjct  410  ALNLTSMSLQGSLSPKIANLTALTDIWLGNNSLSGPIPDLSQLKMLKTLHLEDNQFSGEI  469

Query  210  APSLGRIKSLRELFLQNNNLTGQIPGSILGRPGINLRTTPGNPFLSGPP  64
               LG I  L ELF+QNNNLTG++P S+L + G+NL+T  GN  L  PP
Sbjct  470  PTLLGDIAYLHELFIQNNNLTGEVPHSLLVKSGLNLKTF-GNQHLVQPP  517



>ref|XP_009124944.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase At2g14510 [Brassica rapa]
Length=518

 Score =   181 bits (458),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 99/167 (59%), Positives = 119/167 (71%), Gaps = 1/167 (1%)
 Frame = -2

Query  564  FRVLPLGGKTHTRDVIALEKLKEGFENPPLDWNGDPCLPPQYSWTGVVCSGGTRIRVttl  385
            F ++ LGG+T  RD  AL  +K  F+N P+DWNGDPC+P  YSWTGV CS G RIR+  L
Sbjct  352  FELISLGGRTLVRDATALNAIKRSFKNVPVDWNGDPCMPKNYSWTGVTCSDGPRIRIVAL  411

Query  384  nltgmglsgmlssSIANLTALSGIWLGNNDLSGSTPDLSSLKRLEILHLEDNQIGGEIAP  205
            NLT MGLSG L+  +A LTALS IWLGNN LSGS PDL SLK LE +HLEDN+  G    
Sbjct  412  NLTSMGLSGSLAPQVAKLTALSSIWLGNNSLSGSIPDLGSLKFLESVHLEDNRFSGTFPS  471

Query  204  SLGRIKSLRELFLQNNNLTGQIPGSILGRPGINLRTTPGNPFLSGPP  64
                +  LRELFLQNNNLTG++P  +L +PG+ LR + GNPFL+ PP
Sbjct  472  FFDGVPRLRELFLQNNNLTGKVPSKLLQKPGLELRVS-GNPFLTQPP  517



>ref|XP_009129624.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase At2g14510 [Brassica rapa]
Length=513

 Score =   178 bits (451),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 97/167 (58%), Positives = 119/167 (71%), Gaps = 1/167 (1%)
 Frame = -2

Query  564  FRVLPLGGKTHTRDVIALEKLKEGFENPPLDWNGDPCLPPQYSWTGVVCSGGTRIRVttl  385
            F ++ LGG+T  RD  AL  +K  F+N P+DW+GDPC+P  YSWTGV CS G RIR+  L
Sbjct  347  FELIALGGRTLVRDATALNAIKSSFKNVPVDWSGDPCMPKNYSWTGVTCSEGPRIRIVAL  406

Query  384  nltgmglsgmlssSIANLTALSGIWLGNNDLSGSTPDLSSLKRLEILHLEDNQIGGEIAP  205
            NLT MGLSG L+  ++ LTALS IWLGNN LSGS PD  SLK LE +HLEDN+  G    
Sbjct  407  NLTSMGLSGSLAPEVSRLTALSSIWLGNNSLSGSIPDFGSLKLLESVHLEDNRFSGTFPS  466

Query  204  SLGRIKSLRELFLQNNNLTGQIPGSILGRPGINLRTTPGNPFLSGPP  64
                +  LRELFLQNNNLTGQ+P +++  PG+ LRT+ GNPFL+ PP
Sbjct  467  FFSGVPRLRELFLQNNNLTGQVPSNLVQNPGLELRTS-GNPFLTQPP  512



>ref|XP_009391353.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g67720 [Musa acuminata subsp. malaccensis]
Length=511

 Score =   173 bits (438),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 95/158 (60%), Positives = 119/158 (75%), Gaps = 0/158 (0%)
 Frame = -2

Query  558  VLPLGGKTHTRDVIALEKLKEGFENPPLDWNGDPCLPPQYSWTGVVCSGGTRIRVttlnl  379
            V+PLGG+T TRDVIA+E L   F+NPP DW+GDPCLP Q +WTG+ CSGG  +RV +LNL
Sbjct  351  VVPLGGRTLTRDVIAMEALARSFDNPPSDWSGDPCLPRQSAWTGLTCSGGKIMRVVSLNL  410

Query  378  tgmglsgmlssSIANLTALSGIWLGNNDLSGSTPDLSSLKRLEILHLEDNQIGGEIAPSL  199
            T  G+SG L SSIA LTA+S IWLG N LSG  PD+SSLK L  LHLE+NQ+ G ++PSL
Sbjct  411  TNYGISGSLPSSIAKLTAISSIWLGGNKLSGPIPDMSSLKHLASLHLENNQLSGTVSPSL  470

Query  198  GRIKSLRELFLQNNNLTGQIPGSILGRPGINLRTTPGN  85
            G +  L+EL+LQNNNL G +P S+  R G  ++ +PGN
Sbjct  471  GYLPKLQELYLQNNNLQGPLPDSLKQRKGTIIQVSPGN  508



>ref|XP_011000432.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At5g59680 [Populus euphratica]
Length=509

 Score =   172 bits (436),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 95/160 (59%), Positives = 122/160 (76%), Gaps = 0/160 (0%)
 Frame = -2

Query  564  FRVLPLGGKTHTRDVIALEKLKEGFENPPLDWNGDPCLPPQYSWTGVVCSGGTRIRVttl  385
            + +LPLGG+T TRDV+A+E L   F NPP DW+GDPCLPP+ SWTGV CS     RV  L
Sbjct  346  YHILPLGGRTLTRDVMAMENLARRFVNPPSDWSGDPCLPPENSWTGVKCSQDKLARVVAL  405

Query  384  nltgmglsgmlssSIANLTALSGIWLGNNDLSGSTPDLSSLKRLEILHLEDNQIGGEIAP  205
            NLT MG+SG L SS+ANLTA++ IWLG N LSGS P+LS+LK L+ LHLE+N++ G I  
Sbjct  406  NLTSMGISGSLPSSLANLTAVAHIWLGGNKLSGSIPNLSTLKELQTLHLENNKLEGTIPQ  465

Query  204  SLGRIKSLRELFLQNNNLTGQIPGSILGRPGINLRTTPGN  85
            SLG++  LRELFLQNNNL G++P S+  + G+N++ +PGN
Sbjct  466  SLGQLGQLRELFLQNNNLDGRVPDSLRNKKGLNIQVSPGN  505



>gb|EAY88815.1| hypothetical protein OsI_10287 [Oryza sativa Indica Group]
Length=512

 Score =   169 bits (428),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 88/156 (56%), Positives = 117/156 (75%), Gaps = 0/156 (0%)
 Frame = -2

Query  564  FRVLPLGGKTHTRDVIALEKLKEGFENPPLDWNGDPCLPPQYSWTGVVCSGGTRIRVttl  385
            ++++PLGG+T TRDV+A+E+L    +NPP DW GDPCLP Q SWTGV+CS G+ +RV +L
Sbjct  351  YQIVPLGGRTATRDVVAMEELARSIKNPPPDWAGDPCLPRQNSWTGVICSEGSPVRVVSL  410

Query  384  nltgmglsgmlssSIANLTALSGIWLGNNDLSGSTPDLSSLKRLEILHLEDNQIGGEIAP  205
            +L   GLSG L  SI NLT +  I+ G N L+GS PDLSS+  LE LH E NQ+ G I+P
Sbjct  411  DLKNHGLSGSLPDSIGNLTGMKNIYFGGNKLTGSIPDLSSMHILEELHFEGNQLSGPISP  470

Query  204  SLGRIKSLRELFLQNNNLTGQIPGSILGRPGINLRT  97
            SLG + +L+EL+L NNNLTGQIP S+  +PG+++RT
Sbjct  471  SLGTLTNLKELYLNNNNLTGQIPESLKNKPGLDMRT  506



>emb|CAN75980.1| hypothetical protein VITISV_012184 [Vitis vinifera]
Length=503

 Score =   169 bits (428),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 98/136 (72%), Positives = 107/136 (79%), Gaps = 0/136 (0%)
 Frame = -2

Query  564  FRVLPLGGKTHTRDVIALEKLKEGFENPPLDWNGDPCLPPQYSWTGVVCSGGTRIRVttl  385
            F +L LGG+T TRDVIALE +K+   NPP DWNGDPC P QYSWTGV CS G RIRV +L
Sbjct  345  FNLLRLGGRTLTRDVIALESVKKSLXNPPHDWNGDPCFPSQYSWTGVTCSEGPRIRVVSL  404

Query  384  nltgmglsgmlssSIANLTALSGIWLGNNDLSGSTPDLSSLKRLEILHLEDNQIGGEIAP  205
            NL+ MGLSG LS S+ANLTAL+ IWLGNN LSGS PDLSSLKRLEILHLEDNQ  GEI  
Sbjct  405  NLSBMGLSGSLSPSVANLTALTNIWLGNNSLSGSIPDLSSLKRLEILHLEDNQFSGEIPS  464

Query  204  SLGRIKSLRELFLQNN  157
            SLG I SL+EL L  N
Sbjct  465  SLGNIDSLQELRLDVN  480



>ref|XP_004230793.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g67720 [Solanum lycopersicum]
Length=510

 Score =   167 bits (424),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 90/160 (56%), Positives = 116/160 (73%), Gaps = 0/160 (0%)
 Frame = -2

Query  564  FRVLPLGGKTHTRDVIALEKLKEGFENPPLDWNGDPCLPPQYSWTGVVCSGGTRIRVttl  385
            F++LPL G+T TRDV  +  L++ F   P DW+GDPCLP   SW+GV CS GT  R+  L
Sbjct  347  FQLLPLAGRTLTRDVSVMTDLRKSFNKKPQDWHGDPCLPKDKSWSGVTCSSGTNARIIAL  406

Query  384  nltgmglsgmlssSIANLTALSGIWLGNNDLSGSTPDLSSLKRLEILHLEDNQIGGEIAP  205
            NLT  G+SG L  SI+ LTALS +WLG+N+L+G  PDLSSL+ LE LHLE+NQ+ G I  
Sbjct  407  NLTNAGISGALPPSISKLTALSHLWLGSNELTGQIPDLSSLQNLETLHLENNQLEGSIPE  466

Query  204  SLGRIKSLRELFLQNNNLTGQIPGSILGRPGINLRTTPGN  85
            SLG++  LRE+FLQNN L G +PGS+  + GINL+ +PGN
Sbjct  467  SLGKLPKLREVFLQNNRLKGSVPGSLRNKNGINLKVSPGN  506



>ref|XP_002282141.2| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g67720 isoform X1 [Vitis vinifera]
Length=511

 Score =   167 bits (422),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 92/160 (58%), Positives = 115/160 (72%), Gaps = 0/160 (0%)
 Frame = -2

Query  564  FRVLPLGGKTHTRDVIALEKLKEGFENPPLDWNGDPCLPPQYSWTGVVCSGGTRIRVttl  385
            F++LPLGG+T TRDV+ +E L  GF NPP DW+GDPCLP   SWTGV C+ G   RV TL
Sbjct  346  FQMLPLGGRTLTRDVMGMEDLARGFNNPPSDWSGDPCLPQNNSWTGVTCTTGKLARVVTL  405

Query  384  nltgmglsgmlssSIANLTALSGIWLGNNDLSGSTPDLSSLKRLEILHLEDNQIGGEIAP  205
            NLT   L+G LS SIANLT L+ +WLG N LSG  P++S+L  L+ LHLEDN   G    
Sbjct  406  NLTNFDLAGSLSPSIANLTGLTHLWLGGNKLSGPIPEMSTLNELQTLHLEDNGFEGSFPR  465

Query  204  SLGRIKSLRELFLQNNNLTGQIPGSILGRPGINLRTTPGN  85
            SL ++ SL+E+++QNNNL G IPG++  R GINL+ TPGN
Sbjct  466  SLDQVTSLQEIYVQNNNLNGTIPGTLQKRLGINLKVTPGN  505



>ref|XP_008797310.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g67720 [Phoenix dactylifera]
Length=508

 Score =   166 bits (421),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 93/158 (59%), Positives = 115/158 (73%), Gaps = 0/158 (0%)
 Frame = -2

Query  558  VLPLGGKTHTRDVIALEKLKEGFENPPLDWNGDPCLPPQYSWTGVVCSGGTRIRVttlnl  379
            ++PL G+T  RDV+A+E +   F NPP DW+GDPC PP+ SWTGV CS G R RVT LNL
Sbjct  348  MVPLKGRTLGRDVLAMEAIARSFNNPPSDWSGDPCSPPENSWTGVTCSQGKRARVTALNL  407

Query  378  tgmglsgmlssSIANLTALSGIWLGNNDLSGSTPDLSSLKRLEILHLEDNQIGGEIAPSL  199
            T  GL+G L +SIA L+A++ IWLG N LSG  PD+ SLK L  LHLE+NQ+ G I  SL
Sbjct  408  TNFGLTGSLPNSIAKLSAITSIWLGGNKLSGPIPDMGSLKHLVSLHLENNQLTGSIPSSL  467

Query  198  GRIKSLRELFLQNNNLTGQIPGSILGRPGINLRTTPGN  85
            G +  LRE+FLQNNNL GQIP S+  R GIN++ +PGN
Sbjct  468  GNLGKLREIFLQNNNLEGQIPDSLKRRSGINIQISPGN  505



>ref|NP_001049189.1| Os03g0184400 [Oryza sativa Japonica Group]
 gb|ABF94347.1| leucine-rich repeat family protein, putative, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF11103.1| Os03g0184400 [Oryza sativa Japonica Group]
 gb|EEE58454.1| hypothetical protein OsJ_09686 [Oryza sativa Japonica Group]
Length=519

 Score =   166 bits (421),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 87/156 (56%), Positives = 116/156 (74%), Gaps = 0/156 (0%)
 Frame = -2

Query  564  FRVLPLGGKTHTRDVIALEKLKEGFENPPLDWNGDPCLPPQYSWTGVVCSGGTRIRVttl  385
            ++++PLGG+T TRDV+A+E+L    +NPP DW GDPCLP Q SWTGV+CS G+ +RV +L
Sbjct  358  YQIVPLGGRTATRDVVAMEELARSIKNPPPDWAGDPCLPRQNSWTGVICSEGSPVRVVSL  417

Query  384  nltgmglsgmlssSIANLTALSGIWLGNNDLSGSTPDLSSLKRLEILHLEDNQIGGEIAP  205
            +L   GLSG L  SI NLT +  I+ G N L+GS PDLSS+  LE LH E NQ+ G I+P
Sbjct  418  DLKNHGLSGSLPDSIGNLTGMKNIYFGGNKLTGSIPDLSSMHILEELHFEGNQLSGPISP  477

Query  204  SLGRIKSLRELFLQNNNLTGQIPGSILGRPGINLRT  97
            SLG + +L+EL+L NNNLTGQIP S+  +P +++RT
Sbjct  478  SLGTLTNLKELYLNNNNLTGQIPESLKNKPELDMRT  513



>ref|XP_010546813.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase At2g14510 [Tarenaya hassleriana]
Length=517

 Score =   166 bits (420),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 102/157 (65%), Positives = 123/157 (78%), Gaps = 0/157 (0%)
 Frame = -2

Query  564  FRVLPLGGKTHTRDVIALEKLKEGFENPPLDWNGDPCLPPQYSWTGVVCSGGTRIRVttl  385
            F ++PL GK   RD  +L  +K   +NPP+DWNGDPCLP QYSWTGV CS G+RIRV +L
Sbjct  349  FELIPLEGKALVRDATSLNAIKNSLQNPPVDWNGDPCLPRQYSWTGVTCSEGSRIRVVSL  408

Query  384  nltgmglsgmlssSIANLTALSGIWLGNNDLSGSTPDLSSLKRLEILHLEDNQIGGEIAP  205
            NLT MGLSG L+  +ANLTALS IWLGNN LSG  PDLSSLK LE LHLE+N+  G I P
Sbjct  409  NLTNMGLSGSLAPEVANLTALSAIWLGNNSLSGPVPDLSSLKLLESLHLENNRFTGNIPP  468

Query  204  SLGRIKSLRELFLQNNNLTGQIPGSILGRPGINLRTT  94
            S G +++LRELFLQNNNLTGQIP ++L +PG++LRT+
Sbjct  469  SFGEMQNLRELFLQNNNLTGQIPSNLLKKPGLDLRTS  505



>ref|XP_009772535.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g67720 [Nicotiana sylvestris]
Length=511

 Score =   166 bits (419),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 90/160 (56%), Positives = 115/160 (72%), Gaps = 0/160 (0%)
 Frame = -2

Query  564  FRVLPLGGKTHTRDVIALEKLKEGFENPPLDWNGDPCLPPQYSWTGVVCSGGTRIRVttl  385
            F++LPL G T TRDV  +E L++ F   P DW+GDPCLP   SWTGV CS G   R+ +L
Sbjct  348  FQLLPLAGLTLTRDVAVMEDLRKSFNKKPQDWHGDPCLPKDKSWTGVTCSSGMNTRIISL  407

Query  384  nltgmglsgmlssSIANLTALSGIWLGNNDLSGSTPDLSSLKRLEILHLEDNQIGGEIAP  205
            NLT  G+SG L  SI+ LTAL+ +WLG+N+L+G  PDLS LK LE LHLE+NQ+ G I  
Sbjct  408  NLTNAGISGPLPPSISKLTALTHLWLGSNELTGQIPDLSQLKNLETLHLENNQLQGSIPE  467

Query  204  SLGRIKSLRELFLQNNNLTGQIPGSILGRPGINLRTTPGN  85
            SLG++  L+E+FLQNN+L G IP S+  + GINL+ TPGN
Sbjct  468  SLGQLPKLKEVFLQNNHLKGSIPASLQNKNGINLKVTPGN  507



>ref|XP_010666243.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g67720 [Beta vulgaris subsp. vulgaris]
Length=517

 Score =   165 bits (417),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 97/161 (60%), Positives = 115/161 (71%), Gaps = 1/161 (1%)
 Frame = -2

Query  564  FRVLPLGGKTHTRDVIALEKLKEGFENPPLDWNGDPCLPPQYSWTGVVCSGGTRIRVttl  385
            F VL LG +T  RDVI LE++K  F NPP DW+GDPC P  YSWTG+ CS GTR+R+ ++
Sbjct  347  FNVLALGKRTLVRDVIVLERIKRSFLNPPEDWSGDPCFPAGYSWTGITCSNGTRVRIISI  406

Query  384  nltgmglsgmlssSIANLTALSGIWLGNNDLSGSTPD-LSSLKRLEILHLEDNQIGGEIA  208
            NLT MGLSG LS  IANLTAL+ I L NN LSG  P  LS L  LEIL LE+N   G I 
Sbjct  407  NLTNMGLSGSLSPDIANLTALNTIVLRNNSLSGLIPSTLSRLNHLEILGLENNHFNGTIP  466

Query  207  PSLGRIKSLRELFLQNNNLTGQIPGSILGRPGINLRTTPGN  85
            PSLG I+SLREL L+NNNL+G +P S+L +PG+    TPGN
Sbjct  467  PSLGEIRSLRELHLENNNLSGTVPRSLLQKPGLRFSFTPGN  507



>ref|XP_010028479.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g67720 isoform X1 [Eucalyptus grandis]
 gb|KCW55221.1| hypothetical protein EUGRSUZ_I01156 [Eucalyptus grandis]
Length=511

 Score =   165 bits (417),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 91/160 (57%), Positives = 117/160 (73%), Gaps = 0/160 (0%)
 Frame = -2

Query  564  FRVLPLGGKTHTRDVIALEKLKEGFENPPLDWNGDPCLPPQYSWTGVVCSGGTRIRVttl  385
             ++LPL G+T TRDV+A+E+L     NPP DWNGDPCLP Q+SWTGV CS G   RV TL
Sbjct  346  LQILPLAGRTLTRDVMAMEELARSLNNPPSDWNGDPCLPQQHSWTGVTCSQGKLARVITL  405

Query  384  nltgmglsgmlssSIANLTALSGIWLGNNDLSGSTPDLSSLKRLEILHLEDNQIGGEIAP  205
            NLT  GLSG L  SI+NLTAL  +WLG N+LSG+ P ++SLK L+ LHLE+N+  G +  
Sbjct  406  NLTNAGLSGSLPPSISNLTALKNLWLGGNELSGTIPKMASLKALQTLHLENNKFEGSLPE  465

Query  204  SLGRIKSLRELFLQNNNLTGQIPGSILGRPGINLRTTPGN  85
            SLG++ +LRE+ LQNN L G IP ++  + GINL+ +PGN
Sbjct  466  SLGQLPNLREILLQNNKLNGSIPDALQDKNGINLQVSPGN  505



>gb|AAK92623.1|AC079633_3 Putative protein with similarity to putative protein kinases 
[Oryza sativa Japonica Group]
Length=530

 Score =   165 bits (417),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 86/155 (55%), Positives = 115/155 (74%), Gaps = 0/155 (0%)
 Frame = -2

Query  564  FRVLPLGGKTHTRDVIALEKLKEGFENPPLDWNGDPCLPPQYSWTGVVCSGGTRIRVttl  385
            ++++PLGG+T TRDV+A+E+L    +NPP DW GDPCLP Q SWTGV+CS G+ +RV +L
Sbjct  358  YQIVPLGGRTATRDVVAMEELARSIKNPPPDWAGDPCLPRQNSWTGVICSEGSPVRVVSL  417

Query  384  nltgmglsgmlssSIANLTALSGIWLGNNDLSGSTPDLSSLKRLEILHLEDNQIGGEIAP  205
            +L   GLSG L  SI NLT +  I+ G N L+GS PDLSS+  LE LH E NQ+ G I+P
Sbjct  418  DLKNHGLSGSLPDSIGNLTGMKNIYFGGNKLTGSIPDLSSMHILEELHFEGNQLSGPISP  477

Query  204  SLGRIKSLRELFLQNNNLTGQIPGSILGRPGINLR  100
            SLG + +L+EL+L NNNLTGQIP S+  +P +++R
Sbjct  478  SLGTLTNLKELYLNNNNLTGQIPESLKNKPELDMR  512



>ref|XP_002518770.1| serine-threonine protein kinase, plant-type, putative [Ricinus 
communis]
 gb|EEF43695.1| serine-threonine protein kinase, plant-type, putative [Ricinus 
communis]
Length=521

 Score =   164 bits (415),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 91/155 (59%), Positives = 117/155 (75%), Gaps = 0/155 (0%)
 Frame = -2

Query  564  FRVLPLGGKTHTRDVIALEKLKEGFENPPLDWNGDPCLPPQYSWTGVVCSGGTRIRVttl  385
            F+ LPL G+T TRDVIA+E L   F+NPP DW+GDPCLPP+ SWTGV CS     RV +L
Sbjct  346  FQFLPLSGRTLTRDVIAMEDLARSFDNPPPDWSGDPCLPPKNSWTGVACSRDKLARVVSL  405

Query  384  nltgmglsgmlssSIANLTALSGIWLGNNDLSGSTPDLSSLKRLEILHLEDNQIGGEIAP  205
            +LTGMG+SG + SSI NL+A++ +WLG N L GS PD+S+LK L+ LHL++NQ+ G I  
Sbjct  406  DLTGMGISGSIPSSIGNLSAITHLWLGENKLYGSIPDMSALKDLQTLHLDNNQLEGTIPQ  465

Query  204  SLGRIKSLRELFLQNNNLTGQIPGSILGRPGINLR  100
            SLG++K L E+FLQNNNLTG+IP S+     INL+
Sbjct  466  SLGQLKGLHEIFLQNNNLTGKIPSSLRTNNNINLK  500



>ref|XP_009617369.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g67720 [Nicotiana tomentosiformis]
Length=511

 Score =   164 bits (414),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 90/160 (56%), Positives = 114/160 (71%), Gaps = 0/160 (0%)
 Frame = -2

Query  564  FRVLPLGGKTHTRDVIALEKLKEGFENPPLDWNGDPCLPPQYSWTGVVCSGGTRIRVttl  385
            F++LPL G T TRDV  ++ L++ F   P DW+GDPCLP   SWTGV CS G   R+ +L
Sbjct  348  FQLLPLAGLTLTRDVAVMDDLRKSFNKKPQDWHGDPCLPKDKSWTGVTCSSGMNTRIISL  407

Query  384  nltgmglsgmlssSIANLTALSGIWLGNNDLSGSTPDLSSLKRLEILHLEDNQIGGEIAP  205
            NLT  G+SG L  SI+ LTAL+ +WLG+N+L+G  PDLS LK LE LHLE+NQ+ G I  
Sbjct  408  NLTNAGISGPLPPSISKLTALTHLWLGSNELTGQIPDLSQLKYLETLHLENNQLQGSIPE  467

Query  204  SLGRIKSLRELFLQNNNLTGQIPGSILGRPGINLRTTPGN  85
            SLG++  LRE+FLQNN+L G IP S+  + GINL  TPGN
Sbjct  468  SLGQLPKLREVFLQNNHLKGSIPASLKNKNGINLTVTPGN  507



>ref|XP_010551757.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g67720 [Tarenaya hassleriana]
 ref|XP_010551758.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g67720 [Tarenaya hassleriana]
Length=355

 Score =   160 bits (405),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 101/154 (66%), Positives = 120/154 (78%), Gaps = 1/154 (1%)
 Frame = -2

Query  564  FRVLPLGGKTHTRDVIALEKLKEGFENPPLDWNGDPCLPPQYSWTGVVCSGGTRIRVttl  385
            F ++PL G+TH RD  AL  +K+  +NPP+DWNGDPCLP +YSWTGV CS G RIR+ +L
Sbjct  202  FELIPLEGRTHVRDATALNAIKKSLQNPPVDWNGDPCLPQRYSWTGVSCSEGPRIRIISL  261

Query  384  nltgmglsgmlssSIANLTALSGIWLGNNDLSGSTPDLSSLKRLEILHLEDNQIGGEIAP  205
            NLT MGLSG L+  IANLTALS +WLG N LSG  PDLSSLK LE L LE+N+  G I P
Sbjct  262  NLTNMGLSGSLAPEIANLTALSTVWLGGNSLSGPIPDLSSLKLLESLRLENNRFSGSIPP  321

Query  204  SLGRIKSLRELFLQNNNLTGQIPGSILGRPGINL  103
            SLG ++SLRELFLQNNNLTGQIPG+ L +PG+ L
Sbjct  322  SLGEMQSLRELFLQNNNLTGQIPGN-LRKPGLEL  354



>ref|XP_002313850.2| hypothetical protein POPTR_0009s10510g [Populus trichocarpa]
 gb|EEE87805.2| hypothetical protein POPTR_0009s10510g [Populus trichocarpa]
Length=504

 Score =   162 bits (410),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 91/155 (59%), Positives = 115/155 (74%), Gaps = 0/155 (0%)
 Frame = -2

Query  564  FRVLPLGGKTHTRDVIALEKLKEGFENPPLDWNGDPCLPPQYSWTGVVCSGGTRIRVttl  385
            + +LPLGG+T TRDV+A+E L   F NPP DW+GDPCLPP+ SWTGV CS     RV  L
Sbjct  346  YHILPLGGRTLTRDVMAMENLARRFVNPPSDWSGDPCLPPENSWTGVKCSQDKLARVVAL  405

Query  384  nltgmglsgmlssSIANLTALSGIWLGNNDLSGSTPDLSSLKRLEILHLEDNQIGGEIAP  205
            NLT MG+SG L SS+ANLTA++ IWLG N LSGS P+LS+LK L+ LHLE+N++ G I  
Sbjct  406  NLTSMGISGSLPSSLANLTAVTHIWLGGNKLSGSIPNLSTLKELQTLHLENNKLEGTIPQ  465

Query  204  SLGRIKSLRELFLQNNNLTGQIPGSILGRPGINLR  100
            SLG +  L ELFLQNNNL G++P S+  + G+N+ 
Sbjct  466  SLGHLGQLHELFLQNNNLDGRVPDSLRNKKGLNIH  500



>ref|XP_006489351.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g67720-like isoform X3 [Citrus sinensis]
Length=480

 Score =   162 bits (409),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 93/131 (71%), Positives = 107/131 (82%), Gaps = 0/131 (0%)
 Frame = -2

Query  564  FRVLPLGGKTHTRDVIALEKLKEGFENPPLDWNGDPCLPPQYSWTGVVCSGGTRIRVttl  385
            F+VL LGG+T TRDVIALE L+   +NPPLDW+GDPCLP  YSWTG+ C+   RIR+ TL
Sbjct  347  FQVLELGGRTLTRDVIALETLRNSLQNPPLDWSGDPCLPHGYSWTGITCTYDRRIRIVTL  406

Query  384  nltgmglsgmlssSIANLTALSGIWLGNNDLSGSTPDLSSLKRLEILHLEDNQIGGEIAP  205
            NLT MGLSG L S+I+ LTALSGIWLGNN+LSG+ PDLSSL RLE LHLEDNQ  GEI  
Sbjct  407  NLTNMGLSGSLPSNISRLTALSGIWLGNNNLSGTIPDLSSLMRLETLHLEDNQFSGEIPS  466

Query  204  SLGRIKSLREL  172
            SLG+I+SLREL
Sbjct  467  SLGKIQSLREL  477



>ref|XP_006489349.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g67720-like isoform X1 [Citrus sinensis]
Length=515

 Score =   162 bits (410),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 96/141 (68%), Positives = 114/141 (81%), Gaps = 1/141 (1%)
 Frame = -2

Query  564  FRVLPLGGKTHTRDVIALEKLKEGFENPPLDWNGDPCLPPQYSWTGVVCSGGTRIRVttl  385
            F+VL LGG+T TRDVIALE L+   +NPPLDW+GDPCLP  YSWTG+ C+   RIR+ TL
Sbjct  347  FQVLELGGRTLTRDVIALETLRNSLQNPPLDWSGDPCLPHGYSWTGITCTYDRRIRIVTL  406

Query  384  nltgmglsgmlssSIANLTALSGIWLGNNDLSGSTPDLSSLKRLEILHLEDNQIGGEIAP  205
            NLT MGLSG L S+I+ LTALSGIWLGNN+LSG+ PDLSSL RLE LHLEDNQ  GEI  
Sbjct  407  NLTNMGLSGSLPSNISRLTALSGIWLGNNNLSGTIPDLSSLMRLETLHLEDNQFSGEIPS  466

Query  204  SLGRIKSLRELFLQNNNLTGQ  142
            SLG+I+SLREL  Q+ ++TG+
Sbjct  467  SLGKIQSLRELG-QSISITGK  486



>ref|XP_009384361.1| PREDICTED: putative leucine-rich repeat receptor-like serine/threonine-protein 
kinase At2g14440 [Musa acuminata subsp. malaccensis]
Length=517

 Score =   161 bits (408),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 87/162 (54%), Positives = 115/162 (71%), Gaps = 1/162 (1%)
 Frame = -2

Query  564  FRVLPLGGKTHTRDVIALEKLKEGFENPPLDWNGDPCLPPQYSWTGVVCSGGTRIRVttl  385
            F +  +G  THTRD+IALE +K+   +PP DW+GDPC+P QYSWTG+ CS G++IRV  L
Sbjct  357  FGLFSIGNVTHTRDIIALENIKKKIASPPSDWSGDPCMPEQYSWTGITCSNGSKIRVVAL  416

Query  384  nltgmglsgmlssSIANLTALSGIWLGNNDLSGSTPDLSSLKRLEILHLEDNQIGGEIAP  205
            NL+ MGL+G LS  IA +TAL+ I    N+ +G  PDLS LK L+ LHL++NQ+ G I P
Sbjct  417  NLSSMGLAGSLSPLIARMTALTDISFAYNNFTGPIPDLSKLKNLQKLHLQNNQLTGVIPP  476

Query  204  SLGRIKSLRELFLQNNNLTGQIPGSILGRPGINLRTTPGNPF  79
            SL  +  LREL+L+NNNLTG+IP  +  R G++ R  PGN F
Sbjct  477  SLANLSQLRELYLENNNLTGEIPRRLF-RKGLDFRFLPGNHF  517



>ref|XP_006829745.1| hypothetical protein AMTR_s00126p00126940 [Amborella trichopoda]
 gb|ERM97161.1| hypothetical protein AMTR_s00126p00126940 [Amborella trichopoda]
Length=542

 Score =   162 bits (409),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 93/160 (58%), Positives = 114/160 (71%), Gaps = 0/160 (0%)
 Frame = -2

Query  564  FRVLPLGGKTHTRDVIALEKLKEGFENPPLDWNGDPCLPPQYSWTGVVCSGGTRIRVttl  385
            F++L L G+T TRD+IA+E L     NPP DW GDPC+P + SW GV CS G  IRV +L
Sbjct  377  FQLLVLHGRTVTRDLIAMEDLARSLNNPPPDWRGDPCMPKENSWKGVTCSDGDHIRVLSL  436

Query  384  nltgmglsgmlssSIANLTALSGIWLGNNDLSGSTPDLSSLKRLEILHLEDNQIGGEIAP  205
            NLTG GLSG +  SIANLTA+  IWLGNN+L+GS PDL  LK L  LHLE+N  GG I  
Sbjct  437  NLTGFGLSGKIPPSIANLTAIKSIWLGNNNLTGSLPDLKPLKELVSLHLENNNFGGNIPR  496

Query  204  SLGRIKSLRELFLQNNNLTGQIPGSILGRPGINLRTTPGN  85
            S G + +L+E+FLQNNNL G +P S+  + GINL+ TPGN
Sbjct  497  SWGYLDNLQEIFLQNNNLKGSMPLSLTQKTGINLKITPGN  536



>ref|XP_007034691.1| Serine-threonine protein kinase, plant-type, putative isoform 
3 [Theobroma cacao]
 gb|EOY05617.1| Serine-threonine protein kinase, plant-type, putative isoform 
3 [Theobroma cacao]
Length=486

 Score =   160 bits (406),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 97/133 (73%), Positives = 103/133 (77%), Gaps = 0/133 (0%)
 Frame = -2

Query  564  FRVLPLGGKTHTRDVIALEKLKEGFENPPLDWNGDPCLPPQYSWTGVVCSGGTRIRVttl  385
            F VL LGG+THTRDV ALE++K    N P DWNGDPCLP  YSWTGV CS G RIRV  L
Sbjct  352  FNVLRLGGRTHTRDVRALEEMKNSLHNLPFDWNGDPCLPLNYSWTGVTCSEGERIRVIAL  411

Query  384  nltgmglsgmlssSIANLTALSGIWLGNNDLSGSTPDLSSLKRLEILHLEDNQIGGEIAP  205
            NLT MGLSG LS SI+NLTALSGI LGNN LSG  PDLSSLK LEILHLEDNQ+ GEI  
Sbjct  412  NLTSMGLSGSLSPSISNLTALSGILLGNNSLSGVIPDLSSLKLLEILHLEDNQLRGEIPS  471

Query  204  SLGRIKSLRELFL  166
            SLG +  LRELFL
Sbjct  472  SLGDLGRLRELFL  484



>ref|XP_008358552.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g67720 [Malus domestica]
Length=658

 Score =   162 bits (409),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 105/168 (63%), Positives = 126/168 (75%), Gaps = 1/168 (1%)
 Frame = -2

Query  564  FRVLPLGGKTHTRDVIALEKLKEGFENPPLDWNGDPCLPPQYSWTGVVCSGGTRIRVttl  385
            F VLPLGG T TRDVIAL+++K+   NPP DWNGDPC P QYSWTG+ CS G R+RV TL
Sbjct  492  FDVLPLGGTTLTRDVIALQRVKQSLLNPPPDWNGDPCFPRQYSWTGITCSPGPRVRVVTL  551

Query  384  nltgmglsgmlssSIANLTALSGIWLGNNDLSGSTPDLSSLKRLEILHLEDNQIGGEIAP  205
            NLT  GLSG LS +IAN+TALS + LG N+ +G  PDLSSLK LE LHLEDN   G I  
Sbjct  552  NLTNTGLSGSLSPNIANMTALSNVLLGKNNFTGPIPDLSSLKLLEKLHLEDNHFSGNIPS  611

Query  204  SLGRIKSLRELFLQNNNLTGQIPGSILGRPGINLRTTPGNPFLSGPPA  61
            SLG I  L ELFLQNNNLTG++P S++ + G++LRT+ GN F + PP+
Sbjct  612  SLGSIDRLHELFLQNNNLTGEVPDSLIRKSGLDLRTS-GNSFSAQPPS  658



>ref|XP_009364215.1| PREDICTED: putative leucine-rich repeat receptor-like serine/threonine-protein 
kinase At2g14440, partial [Pyrus x bretschneideri]
Length=499

 Score =   160 bits (406),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 105/168 (63%), Positives = 126/168 (75%), Gaps = 1/168 (1%)
 Frame = -2

Query  564  FRVLPLGGKTHTRDVIALEKLKEGFENPPLDWNGDPCLPPQYSWTGVVCSGGTRIRVttl  385
            F VLPLGG T TRD+IAL+++K+  +NPP  W+GDPCLP QYSWTG+ CS G R+RV +L
Sbjct  333  FDVLPLGGTTLTRDIIALQRVKQSLQNPPPGWSGDPCLPRQYSWTGITCSSGPRVRVVSL  392

Query  384  nltgmglsgmlssSIANLTALSGIWLGNNDLSGSTPDLSSLKRLEILHLEDNQIGGEIAP  205
            NLT MGLSG LS  IAN+TALS I LG N  +G  PDLSSLK LE LHLEDN   G I  
Sbjct  393  NLTSMGLSGSLSPRIANMTALSNILLGKNKFTGPIPDLSSLKLLEKLHLEDNHFSGNIPS  452

Query  204  SLGRIKSLRELFLQNNNLTGQIPGSILGRPGINLRTTPGNPFLSGPPA  61
            SLG I SL ELFLQNN LTG++P S++G+ G++LRT+ GN F + PP 
Sbjct  453  SLGSIDSLHELFLQNNCLTGEVPDSLVGKSGLDLRTS-GNSFSAPPPT  499



>ref|XP_010939431.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g67720 isoform X2 [Elaeis guineensis]
Length=502

 Score =   160 bits (404),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 90/158 (57%), Positives = 112/158 (71%), Gaps = 0/158 (0%)
 Frame = -2

Query  558  VLPLGGKTHTRDVIALEKLKEGFENPPLDWNGDPCLPPQYSWTGVVCSGGTRIRVttlnl  379
            ++PL  +T  RDV A+E +   F NPP DW+GDPCLP + SWTGV CS G   RVT LNL
Sbjct  342  MVPLKRRTLGRDVRAMEAIARSFNNPPSDWSGDPCLPQENSWTGVTCSQGKHARVTALNL  401

Query  378  tgmglsgmlssSIANLTALSGIWLGNNDLSGSTPDLSSLKRLEILHLEDNQIGGEIAPSL  199
               GL+G L  SIA L+A+S IWLG N LSG  PD+ SLK+L  LHLE+NQ+ G I  SL
Sbjct  402  ANFGLTGSLPKSIAKLSAISSIWLGGNKLSGPIPDMGSLKQLVSLHLENNQLTGSIPSSL  461

Query  198  GRIKSLRELFLQNNNLTGQIPGSILGRPGINLRTTPGN  85
            G ++ L+ELFLQNNNL GQIP S+  R GI+++ +PGN
Sbjct  462  GNLEKLQELFLQNNNLEGQIPESLKRRSGIHIQISPGN  499



>ref|XP_007042419.1| Leucine-rich repeat (LRR) family protein, putative isoform 1 
[Theobroma cacao]
 gb|EOX98250.1| Leucine-rich repeat (LRR) family protein, putative isoform 1 
[Theobroma cacao]
Length=527

 Score =   160 bits (404),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 87/155 (56%), Positives = 114/155 (74%), Gaps = 0/155 (0%)
 Frame = -2

Query  564  FRVLPLGGKTHTRDVIALEKLKEGFENPPLDWNGDPCLPPQYSWTGVVCSGGTRIRVttl  385
            +++LPLGG+T TRDV+ +E+L   F+NPP DW GDPCLP + SWTGV CS     RV ++
Sbjct  373  YQILPLGGRTLTRDVVVMEELARSFDNPPPDWTGDPCLPRENSWTGVTCSNDEMARVVSM  432

Query  384  nltgmglsgmlssSIANLTALSGIWLGNNDLSGSTPDLSSLKRLEILHLEDNQIGGEIAP  205
            +LT  GLSG+L  SI NLTAL  +WLG N +SGS P+++SL RLE LHLE+N   G I  
Sbjct  433  DLTNFGLSGVLHPSIDNLTALHHLWLGGNHISGSIPEMNSLGRLETLHLENNDFTGPIPK  492

Query  204  SLGRIKSLRELFLQNNNLTGQIPGSILGRPGINLR  100
            +LG++ SLRE+ LQNNNL G IP ++ G+ GINL+
Sbjct  493  ALGKLGSLREILLQNNNLDGPIPEALRGKKGINLQ  527



>gb|KDP42294.1| hypothetical protein JCGZ_01618 [Jatropha curcas]
Length=499

 Score =   159 bits (403),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 90/155 (58%), Positives = 114/155 (74%), Gaps = 0/155 (0%)
 Frame = -2

Query  564  FRVLPLGGKTHTRDVIALEKLKEGFENPPLDWNGDPCLPPQYSWTGVVCSGGTRIRVttl  385
            F++LP G +T TRDV+A+E L   F+N P DW GDPCLP   SWTGV CS     R+ +L
Sbjct  345  FQILPFGERTLTRDVMAMEDLARNFDNAPPDWKGDPCLPNNNSWTGVSCSKDKLPRIVSL  404

Query  384  nltgmglsgmlssSIANLTALSGIWLGNNDLSGSTPDLSSLKRLEILHLEDNQIGGEIAP  205
            NLT MG+SG ++  IANLTAL+ I LG N LSG+ PD+SSL  L+ILHLEDNQ+ G I  
Sbjct  405  NLTKMGISGSIAPGIANLTALTHILLGENKLSGAIPDMSSLNELQILHLEDNQLEGSIPQ  464

Query  204  SLGRIKSLRELFLQNNNLTGQIPGSILGRPGINLR  100
            SLGR+K L+E+FLQNNNL+G+IP S+    GIN++
Sbjct  465  SLGRLKKLQEIFLQNNNLSGRIPPSLENDDGINIQ  499



>ref|XP_006346435.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g67720-like [Solanum tuberosum]
Length=504

 Score =   159 bits (403),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 86/157 (55%), Positives = 113/157 (72%), Gaps = 0/157 (0%)
 Frame = -2

Query  564  FRVLPLGGKTHTRDVIALEKLKEGFENPPLDWNGDPCLPPQYSWTGVVCSGGTRIRVttl  385
            F++LPL G+T TRDV  +  L + F   P DW+GDPCLP   SW+GV+CS G   R+ +L
Sbjct  347  FQLLPLAGRTLTRDVSVMNDLTKSFNKKPQDWHGDPCLPKDKSWSGVICSSGMNTRIISL  406

Query  384  nltgmglsgmlssSIANLTALSGIWLGNNDLSGSTPDLSSLKRLEILHLEDNQIGGEIAP  205
            NLT  G+SG L  SI+ LTALS +WLG+N+L+G  PDLSSL+ LE LHLE+NQ+ G I  
Sbjct  407  NLTNAGISGSLPPSISKLTALSHLWLGSNELTGQIPDLSSLQNLETLHLENNQLEGSIPE  466

Query  204  SLGRIKSLRELFLQNNNLTGQIPGSILGRPGINLRTT  94
            SLG++  LRE+FLQNN L G +PGS+  + GINL+ +
Sbjct  467  SLGKLPKLREVFLQNNRLKGSVPGSLRNKNGINLKVS  503



>ref|XP_010939430.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g67720 isoform X1 [Elaeis guineensis]
Length=509

 Score =   159 bits (402),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 90/158 (57%), Positives = 112/158 (71%), Gaps = 0/158 (0%)
 Frame = -2

Query  558  VLPLGGKTHTRDVIALEKLKEGFENPPLDWNGDPCLPPQYSWTGVVCSGGTRIRVttlnl  379
            ++PL  +T  RDV A+E +   F NPP DW+GDPCLP + SWTGV CS G   RVT LNL
Sbjct  349  MVPLKRRTLGRDVRAMEAIARSFNNPPSDWSGDPCLPQENSWTGVTCSQGKHARVTALNL  408

Query  378  tgmglsgmlssSIANLTALSGIWLGNNDLSGSTPDLSSLKRLEILHLEDNQIGGEIAPSL  199
               GL+G L  SIA L+A+S IWLG N LSG  PD+ SLK+L  LHLE+NQ+ G I  SL
Sbjct  409  ANFGLTGSLPKSIAKLSAISSIWLGGNKLSGPIPDMGSLKQLVSLHLENNQLTGSIPSSL  468

Query  198  GRIKSLRELFLQNNNLTGQIPGSILGRPGINLRTTPGN  85
            G ++ L+ELFLQNNNL GQIP S+  R GI+++ +PGN
Sbjct  469  GNLEKLQELFLQNNNLEGQIPESLKRRSGIHIQISPGN  506



>ref|XP_010028480.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g67720 isoform X2 [Eucalyptus grandis]
Length=510

 Score =   159 bits (402),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 90/160 (56%), Positives = 116/160 (73%), Gaps = 1/160 (1%)
 Frame = -2

Query  564  FRVLPLGGKTHTRDVIALEKLKEGFENPPLDWNGDPCLPPQYSWTGVVCSGGTRIRVttl  385
             ++LPL G+T TRDV+A+E+L     NPP DWNGDPCLP Q+SWTGV CS G   RV TL
Sbjct  346  LQILPLAGRTLTRDVMAMEELARSLNNPPSDWNGDPCLPQQHSWTGVTCSQGKLARVITL  405

Query  384  nltgmglsgmlssSIANLTALSGIWLGNNDLSGSTPDLSSLKRLEILHLEDNQIGGEIAP  205
            NLT  GLSG L  SI+NLTAL  +WLG N+LSG+ P ++SLK L+  HLE+N+  G +  
Sbjct  406  NLTNAGLSGSLPPSISNLTALKNLWLGGNELSGTIPKMASLKALQT-HLENNKFEGSLPE  464

Query  204  SLGRIKSLRELFLQNNNLTGQIPGSILGRPGINLRTTPGN  85
            SLG++ +LRE+ LQNN L G IP ++  + GINL+ +PGN
Sbjct  465  SLGQLPNLREILLQNNKLNGSIPDALQDKNGINLQVSPGN  504



>ref|XP_004985457.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g67720-like [Setaria italica]
Length=518

 Score =   159 bits (402),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 88/162 (54%), Positives = 115/162 (71%), Gaps = 1/162 (1%)
 Frame = -2

Query  564  FRVLPLGGKTHTRDVIALEKLKEGFENPPLDWNGDPCLPPQYSWTGVVCSGGTRIRVttl  385
            ++++PLGGKT TRDV+A+E L    +NPP DW GDPCLP Q+SWTGV CS G+ +RV +L
Sbjct  357  YQIVPLGGKTATRDVVAMEDLAMSLKNPPPDWAGDPCLPQQHSWTGVECSQGSPVRVLSL  416

Query  384  nltgmglsgmlssSIANLTALSGIWLGNNDLSGSTPDLSSLKRLEILHLEDNQIGGEIAP  205
            +L   GLSG L  SI NLT +  I L  N LSGS PD+SS+  L  LHL+ NQ  G I P
Sbjct  417  DLKNHGLSGSLPDSIGNLTGMKTINLSGNKLSGSIPDMSSMHTLTALHLDGNQFSGTINP  476

Query  204  SLGRIKSLRELFLQNNNLTGQIPGSILGRPGINLRTTPGNPF  79
            S+ ++ +L+EL+L NNNLTG+IP  +  +PG++LRT  GN F
Sbjct  477  SMEKLVNLKELYLNNNNLTGKIPDGLKNKPGLDLRTE-GNKF  517



>dbj|BAK07739.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=517

 Score =   159 bits (401),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 90/158 (57%), Positives = 109/158 (69%), Gaps = 1/158 (1%)
 Frame = -2

Query  558  VLPLGGKTHTRDVIALEKLKEGFENPPLDWNGDPCLPPQYSWTGVVCSGGTRIRVttlnl  379
            V+PLGG+TH RDVI +E L  GF +PP DW+GDPCLP   SWTGV CS G   RVT LNL
Sbjct  356  VVPLGGRTHPRDVIGMEGLARGFASPPSDWSGDPCLPVGNSWTGVSCSQGLLARVTALNL  415

Query  378  tgmglsgmlssSIANLTALSGIWLGNNDLSGSTPDLSSLKRLEILHLEDNQIGGEIAPSL  199
            T   + G +S +IANLTA+S +WL  N+L+G  P +S+L  L  LHLEDNQ+ G I PSL
Sbjct  416  TNFSVGGSISDNIANLTAISSVWLAGNNLTGPIPVMSALHHLSSLHLEDNQLSGPIPPSL  475

Query  198  GRIKSLRELFLQNNNLTGQIPGSILGRPGINLRTTPGN  85
            G +  L+ELF+QNNNL G IP   L R  I  + TPGN
Sbjct  476  GDLPRLQELFVQNNNLQGSIPIG-LNRTSITFKYTPGN  512



>ref|XP_009338442.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g67720 [Pyrus x bretschneideri]
Length=511

 Score =   157 bits (398),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 105/168 (63%), Positives = 124/168 (74%), Gaps = 1/168 (1%)
 Frame = -2

Query  564  FRVLPLGGKTHTRDVIALEKLKEGFENPPLDWNGDPCLPPQYSWTGVVCSGGTRIRVttl  385
            F VLPLGG T TRDVIAL+++K+   NPP DWNGDPC P +YSWTG+ CS G R+RV TL
Sbjct  345  FDVLPLGGTTLTRDVIALQRVKQSLLNPPPDWNGDPCFPREYSWTGITCSPGPRVRVVTL  404

Query  384  nltgmglsgmlssSIANLTALSGIWLGNNDLSGSTPDLSSLKRLEILHLEDNQIGGEIAP  205
            NLT  GLSG LS SIAN+TALS I LG N+ +G  PDLSSLK LE LHLE+N   G I  
Sbjct  405  NLTNTGLSGSLSPSIANMTALSNILLGKNNFTGHIPDLSSLKLLEKLHLENNHFSGNIPS  464

Query  204  SLGRIKSLRELFLQNNNLTGQIPGSILGRPGINLRTTPGNPFLSGPPA  61
            SLG I  L ELFLQNNNLTG++P S+  + G++LRT  GN F + PP+
Sbjct  465  SLGSIDRLHELFLQNNNLTGEVPDSLTRKSGLDLRTF-GNSFSAQPPS  511



>ref|XP_006649517.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At5g59680-like [Oryza brachyantha]
Length=512

 Score =   157 bits (398),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 84/156 (54%), Positives = 115/156 (74%), Gaps = 0/156 (0%)
 Frame = -2

Query  564  FRVLPLGGKTHTRDVIALEKLKEGFENPPLDWNGDPCLPPQYSWTGVVCSGGTRIRVttl  385
            ++++PLGG+T TRDV+A+E L   F+NPP DW GDPCLP + SWTGVVCS G+ +RVT+L
Sbjct  351  YQIVPLGGRTATRDVVAMEDLARSFKNPPPDWAGDPCLPRENSWTGVVCSEGSPVRVTSL  410

Query  384  nltgmglsgmlssSIANLTALSGIWLGNNDLSGSTPDLSSLKRLEILHLEDNQIGGEIAP  205
            +L   GLSG L  S  NLT +  I+L  N L+GS PDL+S+  L  L ++ NQ+ G I+P
Sbjct  411  DLKNHGLSGSLPDSFGNLTGIQTIYLSGNKLTGSIPDLTSMHILTALRVDGNQLSGAISP  470

Query  204  SLGRIKSLRELFLQNNNLTGQIPGSILGRPGINLRT  97
            SLG + +L+EL+L NNNLTG IP S+  +PG+++RT
Sbjct  471  SLGTLVNLKELYLNNNNLTGLIPESLKNKPGLDMRT  506



>ref|XP_010241285.1| PREDICTED: putative leucine-rich repeat receptor-like serine/threonine-protein 
kinase At2g14440 isoform X1 [Nelumbo nucifera]
Length=512

 Score =   157 bits (398),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 89/159 (56%), Positives = 115/159 (72%), Gaps = 0/159 (0%)
 Frame = -2

Query  561  RVLPLGGKTHTRDVIALEKLKEGFENPPLDWNGDPCLPPQYSWTGVVCSGGTRIRVttln  382
            ++ PLGG+T TRDV+A+E + E   NPP DW+GDPCLP + SWTGV CS G   RVTTLN
Sbjct  348  QIFPLGGRTLTRDVMAMEDIAEKLNNPPPDWHGDPCLPHENSWTGVSCSQGHLARVTTLN  407

Query  381  ltgmglsgmlssSIANLTALSGIWLGNNDLSGSTPDLSSLKRLEILHLEDNQIGGEIAPS  202
            LT +GLSG LS S+ANLTAL+ +W G N L+G+ P+L  L  L  LHLE+NQ  G    S
Sbjct  408  LTNLGLSGTLSPSVANLTALAHLWAGGNKLTGTIPNLLQLNELVTLHLENNQFEGPFPQS  467

Query  201  LGRIKSLRELFLQNNNLTGQIPGSILGRPGINLRTTPGN  85
            LG++  LRE+FLQNNNL G +P  +  +PG+N++ +PGN
Sbjct  468  LGKLAKLREIFLQNNNLQGTVPDILKKKPGLNIQVSPGN  506



>emb|CBI32418.3| unnamed protein product [Vitis vinifera]
Length=520

 Score =   157 bits (398),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 88/154 (57%), Positives = 110/154 (71%), Gaps = 0/154 (0%)
 Frame = -2

Query  564  FRVLPLGGKTHTRDVIALEKLKEGFENPPLDWNGDPCLPPQYSWTGVVCSGGTRIRVttl  385
            F++LPLGG+T TRDV+ +E L  GF NPP DW+GDPCLP   SWTGV C+ G   RV TL
Sbjct  340  FQMLPLGGRTLTRDVMGMEDLARGFNNPPSDWSGDPCLPQNNSWTGVTCTTGKLARVVTL  399

Query  384  nltgmglsgmlssSIANLTALSGIWLGNNDLSGSTPDLSSLKRLEILHLEDNQIGGEIAP  205
            NLT   L+G LS SIANLT L+ +WLG N LSG  P++S+L  L+ LHLEDN   G    
Sbjct  400  NLTNFDLAGSLSPSIANLTGLTHLWLGGNKLSGPIPEMSTLNELQTLHLEDNGFEGSFPR  459

Query  204  SLGRIKSLRELFLQNNNLTGQIPGSILGRPGINL  103
            SL ++ SL+E+++QNNNL G IPG++  R GINL
Sbjct  460  SLDQVTSLQEIYVQNNNLNGTIPGTLQKRLGINL  493



>ref|XP_008654835.1| PREDICTED: uncharacterized protein LOC100279902 isoform X1 [Zea 
mays]
 gb|ACG45225.1| protein binding protein [Zea mays]
 gb|AFW82161.1| protein binding protein [Zea mays]
Length=525

 Score =   157 bits (396),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 86/167 (51%), Positives = 115/167 (69%), Gaps = 0/167 (0%)
 Frame = -2

Query  564  FRVLPLGGKTHTRDVIALEKLKEGFENPPLDWNGDPCLPPQYSWTGVVCSGGTRIRVttl  385
            F + P+G  T+ RDV+ALE +K+  +N P DWNGDPC+P  YSWTGV C  G++IRV +L
Sbjct  358  FGLFPVGRLTYARDVLALESIKKSLQNIPEDWNGDPCMPSGYSWTGVTCDEGSKIRVISL  417

Query  384  nltgmglsgmlssSIANLTALSGIWLGNNDLSGSTPDLSSLKRLEILHLEDNQIGGEIAP  205
            N + M LSG LS  IA LTAL+ I L +N LSG  P+LS+L+ L+ LHL++NQ+ G +  
Sbjct  418  NFSSMSLSGFLSPDIAKLTALTDISLAHNMLSGPIPNLSNLRNLQRLHLQENQLSGSVPE  477

Query  204  SLGRIKSLRELFLQNNNLTGQIPGSILGRPGINLRTTPGNPFLSGPP  64
            +LG I +LRE+FLQ NNLTG +P ++L   G+     PGN F   PP
Sbjct  478  TLGTINTLREIFLQYNNLTGTVPENLLNNTGLTYTFLPGNSFSPKPP  524



>ref|XP_002439749.1| hypothetical protein SORBIDRAFT_09g019440 [Sorghum bicolor]
 gb|EES18179.1| hypothetical protein SORBIDRAFT_09g019440 [Sorghum bicolor]
Length=521

 Score =   156 bits (395),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 86/167 (51%), Positives = 117/167 (70%), Gaps = 0/167 (0%)
 Frame = -2

Query  564  FRVLPLGGKTHTRDVIALEKLKEGFENPPLDWNGDPCLPPQYSWTGVVCSGGTRIRVttl  385
            F + P+G  T+ RDV+ALE +K+  +N P DWNGDPC+P  YSWTGV C  G++IRV +L
Sbjct  354  FGLFPVGRLTYARDVLALESMKKNLQNIPEDWNGDPCMPSGYSWTGVTCDEGSKIRVISL  413

Query  384  nltgmglsgmlssSIANLTALSGIWLGNNDLSGSTPDLSSLKRLEILHLEDNQIGGEIAP  205
            N + MGLSG LS  IANLTAL+ I   +N L GS P+LS+L+ L+ LHL++NQ+ G +  
Sbjct  414  NFSSMGLSGFLSPDIANLTALTDISFAHNRLGGSIPNLSNLRNLQRLHLQENQLTGSVPE  473

Query  204  SLGRIKSLRELFLQNNNLTGQIPGSILGRPGINLRTTPGNPFLSGPP  64
            +LG I +LRE+FLQ+NNL G +P ++L + G+     PGN F   PP
Sbjct  474  TLGTINTLREIFLQDNNLNGTVPENLLNKTGLTYIFLPGNSFSPQPP  520



>dbj|BAK07987.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=521

 Score =   155 bits (393),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 85/156 (54%), Positives = 110/156 (71%), Gaps = 0/156 (0%)
 Frame = -2

Query  564  FRVLPLGGKTHTRDVIALEKLKEGFENPPLDWNGDPCLPPQYSWTGVVCSGGTRIRVttl  385
            ++++P+GG+T TRDV A+E L   F+NPP DW GDPCLP Q SWTGV CS  + +RV +L
Sbjct  360  YQIVPVGGRTATRDVGAMEDLARSFKNPPPDWAGDPCLPRQNSWTGVGCSDASPVRVLSL  419

Query  384  nltgmglsgmlssSIANLTALSGIWLGNNDLSGSTPDLSSLKRLEILHLEDNQIGGEIAP  205
            +L    LSG L  SI NLT ++ I L  N LSG  PDLSS++ L +LHL+ NQ  G I P
Sbjct  420  DLKNRSLSGSLPDSIGNLTGMNTISLSGNKLSGPIPDLSSMQNLTVLHLDGNQFSGAINP  479

Query  204  SLGRIKSLRELFLQNNNLTGQIPGSILGRPGINLRT  97
            SLG I SL+EL+L NNNL+G IP S+  +PG+ +RT
Sbjct  480  SLGNITSLKELYLNNNNLSGLIPPSLKTKPGLVMRT  515



>ref|XP_008349097.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g67720 [Malus domestica]
Length=579

 Score =   155 bits (391),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 98/155 (63%), Positives = 116/155 (75%), Gaps = 0/155 (0%)
 Frame = -2

Query  564  FRVLPLGGKTHTRDVIALEKLKEGFENPPLDWNGDPCLPPQYSWTGVVCSGGTRIRVttl  385
            F VLPLGG T TRDVIAL+++K+   NPP DWNGDPC P QYSWTG+ CS G R+RV TL
Sbjct  425  FDVLPLGGTTLTRDVIALQRVKQSLLNPPPDWNGDPCFPRQYSWTGITCSPGPRVRVVTL  484

Query  384  nltgmglsgmlssSIANLTALSGIWLGNNDLSGSTPDLSSLKRLEILHLEDNQIGGEIAP  205
             LT  GLSG LS +IAN+TALS + LG N+ +G  PDLSSLK LE LHLEDN   G I  
Sbjct  485  XLTNTGLSGSLSPNIANMTALSNVLLGKNNFTGPIPDLSSLKLLEKLHLEDNHFSGNIPS  544

Query  204  SLGRIKSLRELFLQNNNLTGQIPGSILGRPGINLR  100
            SLG I  L ELFLQNNNLTG++P S++ + G++LR
Sbjct  545  SLGSIDRLHELFLQNNNLTGEVPDSLIRKSGLDLR  579



>ref|XP_004962178.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase At2g14510-like [Setaria italica]
Length=535

 Score =   154 bits (390),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 89/167 (53%), Positives = 118/167 (71%), Gaps = 0/167 (0%)
 Frame = -2

Query  564  FRVLPLGGKTHTRDVIALEKLKEGFENPPLDWNGDPCLPPQYSWTGVVCSGGTRIRVttl  385
            F + PLG  T+ RDV ALE +K+  +N P DWNGDPC+P  YSWTGV C  G+RIRV +L
Sbjct  368  FGLFPLGRLTYARDVRALESIKKNLQNVPEDWNGDPCMPSGYSWTGVTCDEGSRIRVISL  427

Query  384  nltgmglsgmlssSIANLTALSGIWLGNNDLSGSTPDLSSLKRLEILHLEDNQIGGEIAP  205
            NL+GMGLSG +S  IA+LTAL+ I  G+N L G  PDLS+L +LE LHL++N + G +  
Sbjct  428  NLSGMGLSGSISPEIASLTALTNISFGHNSLLGPIPDLSNLSKLERLHLQENNLSGSVPR  487

Query  204  SLGRIKSLRELFLQNNNLTGQIPGSILGRPGINLRTTPGNPFLSGPP  64
            +LG I +LRELFL +N+L+G +P ++L + G+  R  PGN F   PP
Sbjct  488  TLGTINTLRELFLYSNSLSGPVPDNLLNKQGLTYRFLPGNLFAPPPP  534



>ref|XP_002517208.1| serine-threonine protein kinase, plant-type, putative [Ricinus 
communis]
 gb|EEF45371.1| serine-threonine protein kinase, plant-type, putative [Ricinus 
communis]
Length=557

 Score =   154 bits (390),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 90/131 (69%), Positives = 106/131 (81%), Gaps = 0/131 (0%)
 Frame = -2

Query  564  FRVLPLGGKTHTRDVIALEKLKEGFENPPLDWNGDPCLPPQYSWTGVVCSGGTRIRVttl  385
            F ++ LGG+T TRDVIA+E++K   +N P+DW+GDPC+P QYSWTGV CS G RIRV TL
Sbjct  347  FELVVLGGRTLTRDVIAMEQVKSSLQNAPIDWSGDPCMPRQYSWTGVTCSEGPRIRVVTL  406

Query  384  nltgmglsgmlssSIANLTALSGIWLGNNDLSGSTPDLSSLKRLEILHLEDNQIGGEIAP  205
            NLTGMGLSG LS SIA +TAL+ IWLGNN+LSGS PDLSSLK L+ LHLE+NQ  GEI  
Sbjct  407  NLTGMGLSGSLSPSIARMTALTNIWLGNNNLSGSLPDLSSLKMLQTLHLENNQFTGEIPL  466

Query  204  SLGRIKSLREL  172
            SLG IK L+EL
Sbjct  467  SLGNIKDLQEL  477



>ref|XP_003578232.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g67720 [Brachypodium distachyon]
Length=513

 Score =   154 bits (388),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 86/158 (54%), Positives = 107/158 (68%), Gaps = 0/158 (0%)
 Frame = -2

Query  558  VLPLGGKTHTRDVIALEKLKEGFENPPLDWNGDPCLPPQYSWTGVVCSGGTRIRVttlnl  379
            V+PLGG+T+ RDVI +E L  GF +PP DW GDPCLP   SWTGV CS     RV +LNL
Sbjct  353  VVPLGGRTNPRDVIGMEALARGFVSPPSDWRGDPCLPQGNSWTGVACSQEPLARVISLNL  412

Query  378  tgmglsgmlssSIANLTALSGIWLGNNDLSGSTPDLSSLKRLEILHLEDNQIGGEIAPSL  199
            T   + G +S  IANLTA+S IWL  N+L+G+ PD+S L  L  LHLE+N++ G I  SL
Sbjct  413  TNFNVGGSISDHIANLTAISSIWLAGNNLTGTIPDMSPLHHLASLHLENNRLTGPILQSL  472

Query  198  GRIKSLRELFLQNNNLTGQIPGSILGRPGINLRTTPGN  85
            G +  L+ELF+QNNNL G IP ++  R GI    TPGN
Sbjct  473  GTLPKLQELFVQNNNLQGIIPSNLKNRMGITFEYTPGN  510



>ref|XP_006654359.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At2g28990-like [Oryza brachyantha]
Length=360

 Score =   151 bits (382),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 87/167 (52%), Positives = 113/167 (68%), Gaps = 0/167 (0%)
 Frame = -2

Query  564  FRVLPLGGKTHTRDVIALEKLKEGFENPPLDWNGDPCLPPQYSWTGVVCSGGTRIRVttl  385
            F + PLGG T  RD  ALE +K   +N P DWNGDPC+P  Y+W+GV C  G + RV +L
Sbjct  193  FGLFPLGGYTFARDARALESIKRSLQNIPDDWNGDPCMPNGYAWSGVTCDKGLKPRVISL  252

Query  384  nltgmglsgmlssSIANLTALSGIWLGNNDLSGSTPDLSSLKRLEILHLEDNQIGGEIAP  205
            N + MGLSG LSS IA+LTAL+ I   NN LSG  P+LS+L+ L  LHL+DN++ G +  
Sbjct  253  NFSSMGLSGYLSSDIASLTALTDISFANNSLSGPIPNLSNLRNLTRLHLQDNKLNGTVPQ  312

Query  204  SLGRIKSLRELFLQNNNLTGQIPGSILGRPGINLRTTPGNPFLSGPP  64
            +LG + SLRELFLQNN L G +P ++L + G+N +  PGN F   PP
Sbjct  313  TLGTLASLRELFLQNNELVGAVPLNLLFKQGLNYQFLPGNNFSPRPP  359



>ref|XP_006487131.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase PAM74-like [Citrus sinensis]
Length=512

 Score =   153 bits (387),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 84/160 (53%), Positives = 112/160 (70%), Gaps = 1/160 (1%)
 Frame = -2

Query  564  FRVLPLGGKTHTRDVIALEKLKEGFENPPLDWNGDPCLPPQYSWTGVVCSGGTRIRVttl  385
            F++LPL G T  RDV+A+E+L + F+NPP+DWNGDPCLP + SWTGV C+     RV ++
Sbjct  348  FQLLPLAGTTFPRDVVAMEELAKHFKNPPIDWNGDPCLPWENSWTGVTCNKSKHTRVVSI  407

Query  384  nltgmglsgmlssSIANLTALSGIWLGNNDLSGSTPDLSSLKRLEILHLEDNQIGGEIAP  205
            +L G  +SG L  SI NLTAL  + LG N L G  P++ +L  LE LHLE+NQ  G I  
Sbjct  408  DLKGFEISGTLPESIGNLTALKHLRLGGNKLWGQIPEMKTLTALETLHLENNQFEGWIPQ  467

Query  204  SLGRIKSLRELFLQNNNLTGQIPGSILGRPGINLRTTPGN  85
            +L ++  LRE+FLQNNNL GQIP   L +PG+N++ +PGN
Sbjct  468  TLSQLPILREIFLQNNNLDGQIPDG-LWKPGLNIQVSPGN  506



>ref|XP_003561977.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At2g28990 [Brachypodium distachyon]
Length=516

 Score =   152 bits (385),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 80/155 (52%), Positives = 109/155 (70%), Gaps = 0/155 (0%)
 Frame = -2

Query  564  FRVLPLGGKTHTRDVIALEKLKEGFENPPLDWNGDPCLPPQYSWTGVVCSGGTRIRVttl  385
            ++++P+GG+T T+DV+A+E+L    +N P DW GDPCLPPQ SWTGV CS    +RV +L
Sbjct  355  YQIVPVGGRTATKDVVAMEELARSLKNTPPDWAGDPCLPPQNSWTGVKCSADAPVRVLSL  414

Query  384  nltgmglsgmlssSIANLTALSGIWLGNNDLSGSTPDLSSLKRLEILHLEDNQIGGEIAP  205
            +L    LSG L  S  NLT L+ I+L  N LSG  PDLS+++ L  LHL+DNQ  G I P
Sbjct  415  DLKNHSLSGSLPDSFGNLTGLNTIFLSGNKLSGPIPDLSNMQSLAALHLDDNQFSGAINP  474

Query  204  SLGRIKSLRELFLQNNNLTGQIPGSILGRPGINLR  100
            SLG + +L+ELFL NNNL+GQIP  +  +PG+ ++
Sbjct  475  SLGVLVNLKELFLNNNNLSGQIPLVLKTKPGLVMK  509



>ref|XP_008782339.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g67720 [Phoenix dactylifera]
Length=515

 Score =   151 bits (382),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 84/161 (52%), Positives = 110/161 (68%), Gaps = 0/161 (0%)
 Frame = -2

Query  561  RVLPLGGKTHTRDVIALEKLKEGFENPPLDWNGDPCLPPQYSWTGVVCSGGTRIRVttln  382
            +V+PLGG+T TRDVIA+E+L   F+ PP DW GDPCLP  +SWTGV C G   +RV  L+
Sbjct  352  QVVPLGGRTRTRDVIAMEELARRFDKPPPDWRGDPCLPSSHSWTGVYCVGSDILRVVKLD  411

Query  381  ltgmglsgmlssSIANLTALSGIWLGNNDLSGSTPDLSSLKRLEILHLEDNQIGGEIAPS  202
            LT  G+SG L   I +LTAL+ IWLG N LSGS PD+++L  L  L L  N+  GEI P 
Sbjct  412  LTDHGISGTLPDIINDLTALTHIWLGGNKLSGSIPDMTNLNNLVSLRLSKNEFTGEIPPW  471

Query  201  LGRIKSLRELFLQNNNLTGQIPGSILGRPGINLRTTPGNPF  79
            LG+++ L+EL LQ N  TG+ P S+ GR G++L+ +  N F
Sbjct  472  LGKLEILKELHLQENKFTGKAPESLRGRSGLDLQLSSENQF  512



>ref|XP_010241286.1| PREDICTED: putative leucine-rich repeat receptor-like serine/threonine-protein 
kinase At2g14440 isoform X2 [Nelumbo nucifera]
Length=501

 Score =   150 bits (380),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 86/154 (56%), Positives = 111/154 (72%), Gaps = 0/154 (0%)
 Frame = -2

Query  561  RVLPLGGKTHTRDVIALEKLKEGFENPPLDWNGDPCLPPQYSWTGVVCSGGTRIRVttln  382
            ++ PLGG+T TRDV+A+E + E   NPP DW+GDPCLP + SWTGV CS G   RVTTLN
Sbjct  348  QIFPLGGRTLTRDVMAMEDIAEKLNNPPPDWHGDPCLPHENSWTGVSCSQGHLARVTTLN  407

Query  381  ltgmglsgmlssSIANLTALSGIWLGNNDLSGSTPDLSSLKRLEILHLEDNQIGGEIAPS  202
            LT +GLSG LS S+ANLTAL+ +W G N L+G+ P+L  L  L  LHLE+NQ  G    S
Sbjct  408  LTNLGLSGTLSPSVANLTALAHLWAGGNKLTGTIPNLLQLNELVTLHLENNQFEGPFPQS  467

Query  201  LGRIKSLRELFLQNNNLTGQIPGSILGRPGINLR  100
            LG++  LRE+FLQNNNL G +P  +  +PG+N++
Sbjct  468  LGKLAKLREIFLQNNNLQGTVPDILKKKPGLNIQ  501



>gb|EPS72113.1| hypothetical protein M569_02646, partial [Genlisea aurea]
Length=510

 Score =   150 bits (379),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 84/154 (55%), Positives = 106/154 (69%), Gaps = 0/154 (0%)
 Frame = -2

Query  561  RVLPLGGKTHTRDVIALEKLKEGFENPPLDWNGDPCLPPQYSWTGVVCSGGTRIRVttln  382
            ++L LGGKT TRDV+A+  +K+ F + P DW GDPCLP + SWTGV CS     R+ +L+
Sbjct  357  QILALGGKTVTRDVVAINGIKDHFTHAPEDWAGDPCLPRENSWTGVSCSKQAPFRIHSLD  416

Query  381  ltgmglsgmlssSIANLTALSGIWLGNNDLSGSTPDLSSLKRLEILHLEDNQIGGEIAPS  202
            LTG+GLSG L   IA LTAL  +WLGNN  +G  PD S LK LE LHLE+NQ  G I  +
Sbjct  417  LTGLGLSGSLPHHIAKLTALKNLWLGNNKFTGEIPDFSELKSLETLHLENNQFEGSIPST  476

Query  201  LGRIKSLRELFLQNNNLTGQIPGSILGRPGINLR  100
            LG +  LRELFLQNN + G +P S+  + GIN+R
Sbjct  477  LGELPYLRELFLQNNKINGSLPESLKHKHGINIR  510



>ref|XP_010487850.1| PREDICTED: putative leucine-rich repeat receptor-like serine/threonine-protein 
kinase At2g14440 [Camelina sativa]
Length=520

 Score =   150 bits (378),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 86/160 (54%), Positives = 108/160 (68%), Gaps = 0/160 (0%)
 Frame = -2

Query  564  FRVLPLGGKTHTRDVIALEKLKEGFENPPLDWNGDPCLPPQYSWTGVVCSGGTRIRVttl  385
            F+VLPLGG T+ +D IA+E L E  + PP+DW+GDPCLP   SWTG+ CS     RV +L
Sbjct  346  FQVLPLGGTTNIKDAIAMEDLLESIKQPPVDWSGDPCLPRANSWTGLTCSKDKITRVISL  405

Query  384  nltgmglsgmlssSIANLTALSGIWLGNNDLSGSTPDLSSLKRLEILHLEDNQIGGEIAP  205
            NLT +GLSG L  SI  +TAL  +WLG N L+G  PDLS + RLE LHLEDNQ  G I  
Sbjct  406  NLTNLGLSGSLPPSINTMTALKDLWLGKNKLTGPIPDLSPMTRLETLHLEDNQFTGAIPE  465

Query  204  SLGRIKSLRELFLQNNNLTGQIPGSILGRPGINLRTTPGN  85
            SL ++ SLR L ++NN L G IP  IL R G+ ++ +P N
Sbjct  466  SLAKLPSLRTLSIKNNKLKGTIPSVILQRKGLTVQASPEN  505



>ref|XP_010466053.1| PREDICTED: putative leucine-rich repeat receptor-like serine/threonine-protein 
kinase At2g14440 [Camelina sativa]
Length=520

 Score =   149 bits (377),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 87/160 (54%), Positives = 109/160 (68%), Gaps = 0/160 (0%)
 Frame = -2

Query  564  FRVLPLGGKTHTRDVIALEKLKEGFENPPLDWNGDPCLPPQYSWTGVVCSGGTRIRVttl  385
            F+VLPLGG T+ +D IALE L E  + PP+DW+GDPCLP   SWTG+ CS     RV +L
Sbjct  346  FQVLPLGGTTNIKDAIALEDLLESIKQPPVDWSGDPCLPRANSWTGLTCSKEKITRVISL  405

Query  384  nltgmglsgmlssSIANLTALSGIWLGNNDLSGSTPDLSSLKRLEILHLEDNQIGGEIAP  205
            NLT +GLSG L  SI  +TAL  +WLG N L+G  PDLS + RLE LHLEDNQ  G I  
Sbjct  406  NLTNLGLSGSLPPSINMMTALKDLWLGKNKLTGPIPDLSPMTRLETLHLEDNQFTGAIPE  465

Query  204  SLGRIKSLRELFLQNNNLTGQIPGSILGRPGINLRTTPGN  85
            SL ++ SLR L ++NN LTG IP  IL + G+ ++ +P N
Sbjct  466  SLAKLPSLRILSIKNNKLTGTIPSVILQKKGLTIQASPEN  505



>ref|XP_009145818.1| PREDICTED: putative leucine-rich repeat receptor-like serine/threonine-protein 
kinase At2g14440 [Brassica rapa]
Length=514

 Score =   149 bits (377),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 83/160 (52%), Positives = 110/160 (69%), Gaps = 0/160 (0%)
 Frame = -2

Query  564  FRVLPLGGKTHTRDVIALEKLKEGFENPPLDWNGDPCLPPQYSWTGVVCSGGTRIRVttl  385
            F+V+P+GG T+  DV ALE L E  + PP+DW+GDPCLP   SWTGV CS     +V +L
Sbjct  345  FQVIPIGGATNISDVTALEDLLESIDEPPVDWSGDPCLPLANSWTGVTCSKEKITKVISL  404

Query  384  nltgmglsgmlssSIANLTALSGIWLGNNDLSGSTPDLSSLKRLEILHLEDNQIGGEIAP  205
            NLT  GL+G L  SI+N+TAL  +WLG N+L+G  PDLS + RLE LHLEDNQ  G I  
Sbjct  405  NLTNRGLAGSLPPSISNMTALKDLWLGKNNLTGPIPDLSPMTRLETLHLEDNQFNGSIPE  464

Query  204  SLGRIKSLRELFLQNNNLTGQIPGSILGRPGINLRTTPGN  85
            SL ++ +LR L ++NN L G IP ++L R G+ ++ +P N
Sbjct  465  SLAQLPNLRILSIKNNKLQGTIPSALLQRKGLTIQASPEN  504



>emb|CDX92310.1| BnaA05g20970D [Brassica napus]
Length=514

 Score =   149 bits (376),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 83/160 (52%), Positives = 110/160 (69%), Gaps = 0/160 (0%)
 Frame = -2

Query  564  FRVLPLGGKTHTRDVIALEKLKEGFENPPLDWNGDPCLPPQYSWTGVVCSGGTRIRVttl  385
            F+V+P+GG T+  DV ALE L E  + PP+DW+GDPCLP   SWTGV CS     +V +L
Sbjct  345  FQVIPIGGATNISDVTALEDLLESIDEPPVDWSGDPCLPLANSWTGVTCSKEKITKVISL  404

Query  384  nltgmglsgmlssSIANLTALSGIWLGNNDLSGSTPDLSSLKRLEILHLEDNQIGGEIAP  205
            NLT  GL+G L  SI+N+TAL  +WLG N+L+G  PDLS + RLE LHLEDNQ  G I  
Sbjct  405  NLTNRGLAGSLPPSISNMTALKDLWLGKNNLTGPIPDLSPMTRLETLHLEDNQFNGSIPE  464

Query  204  SLGRIKSLRELFLQNNNLTGQIPGSILGRPGINLRTTPGN  85
            SL ++ +LR L ++NN L G IP ++L R G+ ++ +P N
Sbjct  465  SLAQLPNLRILSIKNNKLQGTIPSALLQRKGLTIQASPEN  504



>emb|CDX99256.1| BnaC05g33710D [Brassica napus]
Length=514

 Score =   148 bits (374),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 83/160 (52%), Positives = 109/160 (68%), Gaps = 0/160 (0%)
 Frame = -2

Query  564  FRVLPLGGKTHTRDVIALEKLKEGFENPPLDWNGDPCLPPQYSWTGVVCSGGTRIRVttl  385
            F+V+P+GG T+  DV ALE L E  + PP+DW+GDPCLP   SWTGV CS     +V +L
Sbjct  345  FQVIPIGGATNISDVTALEDLLESIDEPPVDWSGDPCLPLPNSWTGVTCSKEKITKVISL  404

Query  384  nltgmglsgmlssSIANLTALSGIWLGNNDLSGSTPDLSSLKRLEILHLEDNQIGGEIAP  205
            NLT  GL+G L  SI+N+TAL  +WLG N L+G  PDLS + RLE LHLEDNQ  G I  
Sbjct  405  NLTNRGLAGSLPPSISNMTALKDLWLGKNKLTGPIPDLSPMTRLETLHLEDNQFNGSIPE  464

Query  204  SLGRIKSLRELFLQNNNLTGQIPGSILGRPGINLRTTPGN  85
            SL ++ +LR L ++NN L G IP ++L R G+ ++ +P N
Sbjct  465  SLAQLPNLRILSIKNNKLQGTIPSALLQRKGLTIQASPEN  504



>ref|XP_008660471.1| PREDICTED: receptor-like protein kinase At3g21340 isoform X2 
[Zea mays]
 gb|AFW89439.1| hypothetical protein ZEAMMB73_263749 [Zea mays]
Length=523

 Score =   148 bits (374),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 82/162 (51%), Positives = 112/162 (69%), Gaps = 1/162 (1%)
 Frame = -2

Query  564  FRVLPLGGKTHTRDVIALEKLKEGFENPPLDWNGDPCLPPQYSWTGVVCSGGTRIRVttl  385
            ++++PLGG+T TRDV+A+E L    +N P DW GDPCLP Q+SWTGV CS G+ +RV +L
Sbjct  362  YQIVPLGGRTATRDVVAMEDLASSLKNLPPDWAGDPCLPQQHSWTGVECSQGSPVRVLSL  421

Query  384  nltgmglsgmlssSIANLTALSGIWLGNNDLSGSTPDLSSLKRLEILHLEDNQIGGEIAP  205
            +L   GLSG L  SI +LT +  I+L  N+LSG  PDLSS+  L  + L+ NQ  G I P
Sbjct  422  DLKNHGLSGSLPDSIVHLTGMKTIYLSGNNLSGPIPDLSSMHALTAVRLDSNQFSGTINP  481

Query  204  SLGRIKSLRELFLQNNNLTGQIPGSILGRPGINLRTTPGNPF  79
            S+ ++ +L+EL L NNNLTG+IP  +  + G++LRT  GN F
Sbjct  482  SMEKLANLKELHLNNNNLTGKIPDGLKNKAGLDLRTE-GNKF  522



>gb|EYU37680.1| hypothetical protein MIMGU_mgv1a004889mg [Erythranthe guttata]
Length=506

 Score =   147 bits (372),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 85/156 (54%), Positives = 111/156 (71%), Gaps = 1/156 (1%)
 Frame = -2

Query  564  FRVLPLGGKTHTRDVIALEKLKEGFENPPLDWNGDPCLPPQYSWTGVVCSGGTRIRVttl  385
            F++L  GGKT TRDV+A+E+L+E   NPP DW GDPCLP Q SWTGV CS     R+ +L
Sbjct  349  FQILSSGGKTVTRDVVAMEELREKISNPPEDWAGDPCLPRQNSWTGVSCSKQAPFRILSL  408

Query  384  nltgmglsgmlssSIANLTALSGIWLGNNDLSGSTPDLSSLKRLEILHLEDNQIGGEIAP  205
            +LTG GL G L +SI+NLTAL  + LG+N  SG+ PD S+LK LEILHLE+N   G +  
Sbjct  409  DLTGFGLYGSLPASISNLTALKHLLLGDNRFSGTIPDFSALKSLEILHLENNHFEGAVPS  468

Query  204  SLGRIKSLRELFLQNNNLTGQ-IPGSILGRPGINLR  100
            SLG++ +L E+FLQNN L G  IP S+  + G+++R
Sbjct  469  SLGQLPNLHEVFLQNNKLDGSNIPESLTKKDGVSVR  504



>ref|XP_008373156.1| PREDICTED: putative leucine-rich repeat receptor-like serine/threonine-protein 
kinase At2g14440 [Malus domestica]
Length=521

 Score =   147 bits (372),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 84/146 (58%), Positives = 106/146 (73%), Gaps = 0/146 (0%)
 Frame = -2

Query  564  FRVLPLGGKTHTRDVIALEKLKEGFENPPLDWNGDPCLPPQYSWTGVVCSGGTRIRVttl  385
             +VLPLGG T  RDV+A+ +L+  F+NPP DW+GDPCLP   SWTGV C GG   RV TL
Sbjct  353  LQVLPLGGMTLPRDVMAMNELRRNFDNPPPDWSGDPCLPEGNSWTGVTCDGGKFFRVITL  412

Query  384  nltgmglsgmlssSIANLTALSGIWLGNNDLSGSTPDLSSLKRLEILHLEDNQIGGEIAP  205
            NLTG G+SG L+ +IANLTAL  IWLG N L G+ P++ SLK L+ LHLE NQ+ G I  
Sbjct  413  NLTGAGISGSLAPNIANLTALHHIWLGGNKLLGNIPEMGSLKELQSLHLEKNQLEGSIPE  472

Query  204  SLGRIKSLRELFLQNNNLTGQIPGSI  127
            SLGR+  +RE+FLQ+N L G +P ++
Sbjct  473  SLGRLPKIREIFLQDNKLEGDVPETL  498



>dbj|BAJ92476.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK03890.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=512

 Score =   147 bits (372),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 86/168 (51%), Positives = 112/168 (67%), Gaps = 1/168 (1%)
 Frame = -2

Query  564  FRVLPLGGKTHTRDVIALEKLKEGFENPPLDWNGDPCLPPQYSWTGVVCSGGTRIRVttl  385
            F + P+G  T TRD +A+E +K   +N P DW GDPC+P  Y+WTGV C  G  IRV +L
Sbjct  346  FGLFPIGRLTITRDALAMESMKRSLQNIPDDWIGDPCMPHGYAWTGVTCLEGQNIRVISL  405

Query  384  nltgmglsgmlssSIANLTALSGIWLGNNDLSGSTPDLSSLKRLEILHLEDNQIGGEIAP  205
            N + MG+SG LS  I NLTAL+ I+L NN LSG  PDL+ L +L+ LHL DN++ G I  
Sbjct  406  NFSSMGISGSLSPDIGNLTALTDIFLANNSLSGPIPDLTKLGKLQRLHLNDNKLNGTIPQ  465

Query  204  SLGRIKSLRELFLQNNNLTGQIPGSILGRPGINLRTTPGNPFLSGPPA  61
            +LG I+ LRELFLQNN L G +P ++L + G+  +  PGN F S PP 
Sbjct  466  TLGTIQPLRELFLQNNELGGAVPLNLLNKAGLTRKFCPGNQF-SQPPC  512



>ref|NP_188554.1| leucine-rich repeat-containing protein [Arabidopsis thaliana]
 gb|AEE76211.1| leucine-rich repeat-containing protein [Arabidopsis thaliana]
Length=519

 Score =   147 bits (371),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 84/160 (53%), Positives = 107/160 (67%), Gaps = 0/160 (0%)
 Frame = -2

Query  564  FRVLPLGGKTHTRDVIALEKLKEGFENPPLDWNGDPCLPPQYSWTGVVCSGGTRIRVttl  385
            F++LPLGG T+ +D IA+E L E    PP+DW+GDPCLP   SWTG+ CS     RV +L
Sbjct  345  FQILPLGGTTNIKDAIAMEDLLESIMKPPVDWSGDPCLPRANSWTGLTCSKDKIARVISL  404

Query  384  nltgmglsgmlssSIANLTALSGIWLGNNDLSGSTPDLSSLKRLEILHLEDNQIGGEIAP  205
            NLT +GLSG L  SI  +TAL  +WLG N L+G  PDLS + RLE LHLEDNQ  G I  
Sbjct  405  NLTNLGLSGSLPPSINKMTALKDLWLGKNKLTGPIPDLSPMTRLETLHLEDNQFTGAIPE  464

Query  204  SLGRIKSLRELFLQNNNLTGQIPGSILGRPGINLRTTPGN  85
            SL ++ SLR L ++NN L G IP  +L R G+ ++ +P N
Sbjct  465  SLAKLPSLRTLSIKNNKLKGTIPSVLLQRKGLTIQASPEN  504



>ref|XP_011088267.1| PREDICTED: putative leucine-rich repeat receptor-like serine/threonine-protein 
kinase At2g14440 isoform X2 [Sesamum indicum]
Length=504

 Score =   147 bits (370),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 84/154 (55%), Positives = 110/154 (71%), Gaps = 0/154 (0%)
 Frame = -2

Query  558  VLPLGGKTHTRDVIALEKLKEGFENPPLDWNGDPCLPPQYSWTGVVCSGGTRIRVttlnl  379
            +LP GGKT TRDV+A+E+ +    N P DW GDPCLP + SWTGV CS    +R+ +LNL
Sbjct  351  MLPSGGKTITRDVVAIEQFRTELTNEPEDWTGDPCLPRENSWTGVSCSDTVPVRILSLNL  410

Query  378  tgmglsgmlssSIANLTALSGIWLGNNDLSGSTPDLSSLKRLEILHLEDNQIGGEIAPSL  199
            TG GLSG L  SI+ LTAL  + LG+N LSG+ PDLSSLK LE LHLE+NQ  G +  S+
Sbjct  411  TGFGLSGSLPQSISKLTALKDLLLGDNKLSGNIPDLSSLKSLETLHLENNQFEGSVPSSM  470

Query  198  GRIKSLRELFLQNNNLTGQIPGSILGRPGINLRT  97
            G + +LRE++LQNN L G IP S+  + G+N+++
Sbjct  471  GELPNLREVYLQNNKLNGSIPDSLKNKRGVNVKS  504



>ref|NP_001055453.1| Os05g0393100 [Oryza sativa Japonica Group]
 gb|AAV31268.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF17367.1| Os05g0393100 [Oryza sativa Japonica Group]
 dbj|BAG93492.1| unnamed protein product [Oryza sativa Japonica Group]
Length=510

 Score =   147 bits (370),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 88/167 (53%), Positives = 109/167 (65%), Gaps = 0/167 (0%)
 Frame = -2

Query  564  FRVLPLGGKTHTRDVIALEKLKEGFENPPLDWNGDPCLPPQYSWTGVVCSGGTRIRVttl  385
            F + PLGG T  RD  ALE +K   +N P DWNGDPC+P  Y+WTGV C  G   RV +L
Sbjct  343  FGLFPLGGYTFPRDAHALEAIKRSLQNIPDDWNGDPCMPHGYAWTGVTCDKGQIPRVISL  402

Query  384  nltgmglsgmlssSIANLTALSGIWLGNNDLSGSTPDLSSLKRLEILHLEDNQIGGEIAP  205
            N + MGLSG LSS IA LTAL+ I   NN LSG  P+LS+L+ L  LHL+DN++ G +  
Sbjct  403  NFSSMGLSGYLSSDIARLTALTDISFANNSLSGPIPNLSNLRNLTRLHLQDNKLNGTVPQ  462

Query  204  SLGRIKSLRELFLQNNNLTGQIPGSILGRPGINLRTTPGNPFLSGPP  64
            +LG I SLRELFLQNN L G +P ++L   G+  +  PGN F   PP
Sbjct  463  TLGIITSLRELFLQNNELDGAVPLNLLLNQGLTYQFLPGNNFFPRPP  509



>ref|XP_004957020.1| PREDICTED: putative leucine-rich repeat receptor-like serine/threonine-protein 
kinase At2g14440-like isoform X1 [Setaria 
italica]
Length=516

 Score =   147 bits (370),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 84/162 (52%), Positives = 104/162 (64%), Gaps = 4/162 (2%)
 Frame = -2

Query  558  VLPLGGKTHTRDVIALEKLKEGFENPPLDWNGDPCLPPQYSWTGVVCSGGTRIRVttlnl  379
            ++PLGG+TH RDVI +E L  GF NPP DW GDPCLP   SWTGV C+     RV  +NL
Sbjct  352  IVPLGGRTHPRDVIGMEALARGFWNPPSDWRGDPCLPKGNSWTGVTCNEDPLARVIAINL  411

Query  378  tgmglsgmlssSIANLTALSGIWLGNNDLSGSTPDLSSLKRLEILHLEDNQIGGEIAPSL  199
            T   + G +S  IANLTA+S IWL  N+L+G  PD+S L  L  LHLEDN + G +  SL
Sbjct  412  TNSRVGGSISDHIANLTAVSSIWLVGNNLTGPIPDMSPLHHLVSLHLEDNGLTGSLPESL  471

Query  198  GRIKSLRELFLQNNNLTGQIPGSILGRPGINL----RTTPGN  85
            G +  L EL +QNNNL G IP SI  R  +++    + TPGN
Sbjct  472  GNLTRLEELSVQNNNLQGTIPSSIRNRAMVDISFRFKYTPGN  513



>ref|XP_011088266.1| PREDICTED: putative leucine-rich repeat receptor-like serine/threonine-protein 
kinase At2g14440 isoform X1 [Sesamum indicum]
Length=516

 Score =   146 bits (369),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 84/153 (55%), Positives = 109/153 (71%), Gaps = 0/153 (0%)
 Frame = -2

Query  558  VLPLGGKTHTRDVIALEKLKEGFENPPLDWNGDPCLPPQYSWTGVVCSGGTRIRVttlnl  379
            +LP GGKT TRDV+A+E+ +    N P DW GDPCLP + SWTGV CS    +R+ +LNL
Sbjct  351  MLPSGGKTITRDVVAIEQFRTELTNEPEDWTGDPCLPRENSWTGVSCSDTVPVRILSLNL  410

Query  378  tgmglsgmlssSIANLTALSGIWLGNNDLSGSTPDLSSLKRLEILHLEDNQIGGEIAPSL  199
            TG GLSG L  SI+ LTAL  + LG+N LSG+ PDLSSLK LE LHLE+NQ  G +  S+
Sbjct  411  TGFGLSGSLPQSISKLTALKDLLLGDNKLSGNIPDLSSLKSLETLHLENNQFEGSVPSSM  470

Query  198  GRIKSLRELFLQNNNLTGQIPGSILGRPGINLR  100
            G + +LRE++LQNN L G IP S+  + G+N++
Sbjct  471  GELPNLREVYLQNNKLNGSIPDSLKNKRGVNVK  503



>gb|EEC79168.1| hypothetical protein OsI_19848 [Oryza sativa Indica Group]
Length=510

 Score =   146 bits (369),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 88/167 (53%), Positives = 109/167 (65%), Gaps = 0/167 (0%)
 Frame = -2

Query  564  FRVLPLGGKTHTRDVIALEKLKEGFENPPLDWNGDPCLPPQYSWTGVVCSGGTRIRVttl  385
            F + PLGG T  RD  ALE +K   +N P DWNGDPC+P  Y+WTGV C  G   RV +L
Sbjct  343  FGLFPLGGYTFPRDARALEAIKRSLQNIPDDWNGDPCMPHGYAWTGVTCDKGQIPRVISL  402

Query  384  nltgmglsgmlssSIANLTALSGIWLGNNDLSGSTPDLSSLKRLEILHLEDNQIGGEIAP  205
            N + MGLSG LSS IA LTAL+ I   NN LSG  P+LS+L+ L  LHL+DN++ G +  
Sbjct  403  NFSSMGLSGYLSSDIARLTALTDISFANNSLSGPIPNLSNLRNLTRLHLQDNKLNGTVPQ  462

Query  204  SLGRIKSLRELFLQNNNLTGQIPGSILGRPGINLRTTPGNPFLSGPP  64
            +LG I SLRELFLQNN L G +P ++L   G+  +  PGN F   PP
Sbjct  463  TLGIITSLRELFLQNNELDGAVPLNLLLNQGLTYQFLPGNNFFPRPP  509



>ref|XP_009419483.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g67720 [Musa acuminata subsp. malaccensis]
Length=498

 Score =   146 bits (368),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 83/154 (54%), Positives = 109/154 (71%), Gaps = 0/154 (0%)
 Frame = -2

Query  561  RVLPLGGKTHTRDVIALEKLKEGFENPPLDWNGDPCLPPQYSWTGVVCSGGTRIRVttln  382
            +++P G KT TRDVI +E L    +NPP DW GDPCLP Q+SWTGV CS    IR+  LN
Sbjct  345  QIVPFGEKTITRDVITMEDLARNLKNPPPDWRGDPCLPRQHSWTGVSCSQSGSIRIVGLN  404

Query  381  ltgmglsgmlssSIANLTALSGIWLGNNDLSGSTPDLSSLKRLEILHLEDNQIGGEIAPS  202
            LT  GLSG L SSI NLTAL+ IWL  N LSG  P++SSL+ L  L L+DNQ+ G I  S
Sbjct  405  LTNFGLSGSLPSSINNLTALANIWLSGNKLSGPIPEMSSLRNLVSLQLQDNQLSGSIPSS  464

Query  201  LGRIKSLRELFLQNNNLTGQIPGSILGRPGINLR  100
            LG +++L+E++LQNN LTG +P S+  + G++++
Sbjct  465  LGGLENLKEIYLQNNKLTGNVPESLKKKIGVDMK  498



>gb|KDO59697.1| hypothetical protein CISIN_1g042915mg [Citrus sinensis]
Length=501

 Score =   146 bits (368),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 81/155 (52%), Positives = 108/155 (70%), Gaps = 1/155 (1%)
 Frame = -2

Query  564  FRVLPLGGKTHTRDVIALEKLKEGFENPPLDWNGDPCLPPQYSWTGVVCSGGTRIRVttl  385
            F++LPL G T  RDV+A+E+L + F+NPP+DWNGDPCLP + SWTGV C+     RV ++
Sbjct  348  FQLLPLAGTTFPRDVVAMEELAKHFKNPPIDWNGDPCLPWENSWTGVTCNKSKHTRVVSI  407

Query  384  nltgmglsgmlssSIANLTALSGIWLGNNDLSGSTPDLSSLKRLEILHLEDNQIGGEIAP  205
            +L G  +SG L  SI NLTAL  + LG N L G  P++ +L  LE LHLE+NQ  G I  
Sbjct  408  DLKGFEISGTLPESIGNLTALKHLRLGGNKLWGQIPEMKTLTALETLHLENNQFEGWIPQ  467

Query  204  SLGRIKSLRELFLQNNNLTGQIPGSILGRPGINLR  100
            +L ++  LRE+FLQNNNL GQIP   L +PG+N++
Sbjct  468  TLSQLPILREIFLQNNNLDGQIPDG-LWKPGLNIQ  501



>ref|XP_006423028.1| hypothetical protein CICLE_v10030280mg [Citrus clementina]
 gb|ESR36268.1| hypothetical protein CICLE_v10030280mg [Citrus clementina]
Length=501

 Score =   145 bits (365),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 81/155 (52%), Positives = 107/155 (69%), Gaps = 1/155 (1%)
 Frame = -2

Query  564  FRVLPLGGKTHTRDVIALEKLKEGFENPPLDWNGDPCLPPQYSWTGVVCSGGTRIRVttl  385
            F++LPL G T  RDV A+E+L + F+NPP+DWNGDPCLP + SWTGV C+     RV ++
Sbjct  348  FQLLPLAGTTFPRDVAAMEELAKHFKNPPIDWNGDPCLPWENSWTGVTCTKSKHTRVVSI  407

Query  384  nltgmglsgmlssSIANLTALSGIWLGNNDLSGSTPDLSSLKRLEILHLEDNQIGGEIAP  205
            +L G  +SG L  SI NLTAL  + LG N L G  P++ +L  LE LHLE+NQ  G I  
Sbjct  408  DLKGFEISGTLPESIGNLTALKHLRLGGNKLWGQIPEMKTLTALETLHLENNQFEGWIPQ  467

Query  204  SLGRIKSLRELFLQNNNLTGQIPGSILGRPGINLR  100
            +L ++  LRE+FLQNNNL GQIP   L +PG+N++
Sbjct  468  TLSQLPILREIFLQNNNLDGQIPDG-LWKPGLNIQ  501



>ref|XP_010521449.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g67720 isoform X1 [Tarenaya hassleriana]
Length=518

 Score =   144 bits (364),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 83/160 (52%), Positives = 108/160 (68%), Gaps = 0/160 (0%)
 Frame = -2

Query  564  FRVLPLGGKTHTRDVIALEKLKEGFENPPLDWNGDPCLPPQYSWTGVVCSGGTRIRVttl  385
            F+++PLGGKTHTRD  A+  L     N P DW+GDPCLP + SWTGV CS G   RVT+L
Sbjct  348  FQIVPLGGKTHTRDATAMHDLSRSIMNLPSDWSGDPCLPHENSWTGVTCSKGLVSRVTSL  407

Query  384  nltgmglsgmlssSIANLTALSGIWLGNNDLSGSTPDLSSLKRLEILHLEDNQIGGEIAP  205
            NLT +GL+G L SS+  +TAL   W+G N L+G+ PDLS +KRLE LHLEDNQ  G I  
Sbjct  408  NLTNLGLAGSLPSSVNKMTALKDFWIGKNKLTGTIPDLSLMKRLETLHLEDNQFSGTIPQ  467

Query  204  SLGRIKSLRELFLQNNNLTGQIPGSILGRPGINLRTTPGN  85
            S+ ++ +LREL L NN L G+     L + G+N++ +  N
Sbjct  468  SVTQLPNLRELLLVNNKLQGRFTRGFLKKRGLNIQVSREN  507



>ref|XP_004296071.1| PREDICTED: putative leucine-rich repeat receptor-like serine/threonine-protein 
kinase At2g14440-like [Fragaria vesca subsp. 
vesca]
Length=507

 Score =   144 bits (364),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 79/149 (53%), Positives = 105/149 (70%), Gaps = 0/149 (0%)
 Frame = -2

Query  564  FRVLPLGGKTHTRDVIALEKLKEGFENPPLDWNGDPCLPPQYSWTGVVCSGGTRIRVttl  385
             ++ PLG +T  RDV A+ ++K  F+NPP DW+GDPCLP    WTGV CS     RV  L
Sbjct  354  MQIFPLGLETLNRDVTAMHEVKRSFDNPPPDWSGDPCLPEGNGWTGVTCSHDKFARVICL  413

Query  384  nltgmglsgmlssSIANLTALSGIWLGNNDLSGSTPDLSSLKRLEILHLEDNQIGGEIAP  205
            NLT +GLSG ++ SIANLTAL  IWLGNN L+G  P++ +LK LE LHLE+NQ+ G+I  
Sbjct  414  NLTNVGLSGSIAPSIANLTALHNIWLGNNKLAGEIPEMGALKELETLHLENNQLEGKIPE  473

Query  204  SLGRIKSLRELFLQNNNLTGQIPGSILGR  118
            SLG++  LRE++LQNN L G +P ++  +
Sbjct  474  SLGQLPKLREIYLQNNKLKGDVPNTLQDK  502



>ref|XP_010107946.1| hypothetical protein L484_027536 [Morus notabilis]
 gb|EXC17346.1| hypothetical protein L484_027536 [Morus notabilis]
Length=515

 Score =   144 bits (362),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 87/161 (54%), Positives = 112/161 (70%), Gaps = 7/161 (4%)
 Frame = -2

Query  561  RVLPLGGKTHTRDVIALEKLKEGFENPPLDWNGDPCLPPQYSWTGVVCSGGTRIRVttln  382
            ++LPLGG+T TRD +A+  L   F  PP DW+GDPCLP + SWTGV CS G   RV  LN
Sbjct  355  QILPLGGRTLTRDAVAMMDLARNFNKPPSDWSGDPCLPEKNSWTGVTCSRGKFSRVVALN  414

Query  381  ltgmglsgmlssSIANLTALSGIWLGNNDLSGSTPDLSSLKRLEIL-------HLEDNQI  223
            LTG GLSG L S+I+NLTAL+ IWLG N L+GS P++ SLK L+ L       HLE+NQ+
Sbjct  415  LTGKGLSGSLPSTISNLTALNHIWLGGNKLTGSIPEMWSLKELKTLYVYNEAWHLENNQL  474

Query  222  GGEIAPSLGRIKSLRELFLQNNNLTGQIPGSILGRPGINLR  100
             G I  SLG++  L E+FLQNNNL GQIP ++  + G +++
Sbjct  475  EGPIPKSLGQLPRLYEIFLQNNNLGGQIPATLQAQNGRSIQ  515



>ref|XP_008236545.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g67720 [Prunus mume]
Length=516

 Score =   144 bits (362),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 83/143 (58%), Positives = 106/143 (74%), Gaps = 0/143 (0%)
 Frame = -2

Query  564  FRVLPLGGKTHTRDVIALEKLKEGFENPPLDWNGDPCLPPQYSWTGVVCSGGTRIRVttl  385
             ++LPLGG T  RDV A+ +L+  F+NPP DW+GDPCLP + SWTGV CS G   R+T L
Sbjct  348  MQILPLGGVTVNRDVAAMIELRRHFDNPPSDWSGDPCLPGENSWTGVTCSHGKNYRITAL  407

Query  384  nltgmglsgmlssSIANLTALSGIWLGNNDLSGSTPDLSSLKRLEILHLEDNQIGGEIAP  205
            NLTG+GLSG L+ +IANLTAL  IWLG N LSG+ P++ SLK L+ LHLE+NQ+ G I  
Sbjct  408  NLTGIGLSGSLAPNIANLTALRHIWLGGNKLSGNIPEMGSLKDLQSLHLENNQLEGLIPQ  467

Query  204  SLGRIKSLRELFLQNNNLTGQIP  136
            SL ++  LRE+FLQNN + G +P
Sbjct  468  SLQKLPKLREIFLQNNKVKGDVP  490



>ref|NP_001063375.1| Os09g0458300 [Oryza sativa Japonica Group]
 dbj|BAD38375.1| putative serine/threonine-specific receptor protein kinase [Oryza 
sativa Japonica Group]
 dbj|BAF25289.1| Os09g0458300 [Oryza sativa Japonica Group]
 dbj|BAG98450.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE69852.1| hypothetical protein OsJ_29635 [Oryza sativa Japonica Group]
Length=510

 Score =   143 bits (361),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 85/158 (54%), Positives = 106/158 (67%), Gaps = 0/158 (0%)
 Frame = -2

Query  558  VLPLGGKTHTRDVIALEKLKEGFENPPLDWNGDPCLPPQYSWTGVVCSGGTRIRVttlnl  379
            V+PLGG+TH RDVI ++ L  GF+NPP DW GDPCLP   SWTGV C+     RV +LNL
Sbjct  350  VVPLGGRTHPRDVIGMQALARGFDNPPADWAGDPCLPQGNSWTGVTCTQEPLARVVSLNL  409

Query  378  tgmglsgmlssSIANLTALSGIWLGNNDLSGSTPDLSSLKRLEILHLEDNQIGGEIAPSL  199
            T   + G +S  IANLTA+S IWL  N+L+G  PD+S L  L  LHLE+N++ G+I PSL
Sbjct  410  TNFKVGGSISDGIANLTAISSIWLVGNNLTGPIPDMSLLHHLVSLHLENNRLTGQIPPSL  469

Query  198  GRIKSLRELFLQNNNLTGQIPGSILGRPGINLRTTPGN  85
            G +  LRELF+QNN L G IP S   + G   +  PGN
Sbjct  470  GSMPRLRELFVQNNALQGAIPISFKNKTGFMFQYAPGN  507



>gb|EEC84704.1| hypothetical protein OsI_31653 [Oryza sativa Indica Group]
Length=510

 Score =   143 bits (361),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 85/158 (54%), Positives = 106/158 (67%), Gaps = 0/158 (0%)
 Frame = -2

Query  558  VLPLGGKTHTRDVIALEKLKEGFENPPLDWNGDPCLPPQYSWTGVVCSGGTRIRVttlnl  379
            V+PLGG+TH RDVI ++ L  GF+NPP DW GDPCLP   SWTGV C+     RV +LNL
Sbjct  350  VVPLGGRTHPRDVIGMQALARGFDNPPADWAGDPCLPQGNSWTGVTCTQEPLARVVSLNL  409

Query  378  tgmglsgmlssSIANLTALSGIWLGNNDLSGSTPDLSSLKRLEILHLEDNQIGGEIAPSL  199
            T   + G +S  IANLTA+S IWL  N+L+G  PD+S L  L  LHLE+N++ G+I PSL
Sbjct  410  TNFKVGGSISDGIANLTAISSIWLVGNNLTGPIPDMSLLHHLVSLHLENNRLTGQIPPSL  469

Query  198  GRIKSLRELFLQNNNLTGQIPGSILGRPGINLRTTPGN  85
            G +  LRELF+QNN L G IP S   + G   +  PGN
Sbjct  470  GSMPRLRELFVQNNALQGAIPISFKNKTGFMFQYAPGN  507



>dbj|BAB02964.1| unnamed protein product [Arabidopsis thaliana]
Length=499

 Score =   143 bits (360),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 82/155 (53%), Positives = 104/155 (67%), Gaps = 0/155 (0%)
 Frame = -2

Query  564  FRVLPLGGKTHTRDVIALEKLKEGFENPPLDWNGDPCLPPQYSWTGVVCSGGTRIRVttl  385
            F++LPLGG T+ +D IA+E L E    PP+DW+GDPCLP   SWTG+ CS     RV +L
Sbjct  345  FQILPLGGTTNIKDAIAMEDLLESIMKPPVDWSGDPCLPRANSWTGLTCSKDKIARVISL  404

Query  384  nltgmglsgmlssSIANLTALSGIWLGNNDLSGSTPDLSSLKRLEILHLEDNQIGGEIAP  205
            NLT +GLSG L  SI  +TAL  +WLG N L+G  PDLS + RLE LHLEDNQ  G I  
Sbjct  405  NLTNLGLSGSLPPSINKMTALKDLWLGKNKLTGPIPDLSPMTRLETLHLEDNQFTGAIPE  464

Query  204  SLGRIKSLRELFLQNNNLTGQIPGSILGRPGINLR  100
            SL ++ SLR L ++NN L G IP  +L R G+ ++
Sbjct  465  SLAKLPSLRTLSIKNNKLKGTIPSVLLQRKGLTIQ  499



>ref|XP_003568529.1| PREDICTED: putative leucine-rich repeat receptor-like serine/threonine-protein 
kinase At2g14440 [Brachypodium distachyon]
Length=513

 Score =   142 bits (359),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 87/167 (52%), Positives = 110/167 (66%), Gaps = 0/167 (0%)
 Frame = -2

Query  564  FRVLPLGGKTHTRDVIALEKLKEGFENPPLDWNGDPCLPPQYSWTGVVCSGGTRIRVttl  385
            F + P+G  T TRD +ALE +K   +N P DW GDPC+P  Y+WTGV C  G  IR+ +L
Sbjct  346  FGLFPIGKLTITRDALALESVKRNLQNIPDDWIGDPCMPRGYAWTGVTCDEGEFIRIVSL  405

Query  384  nltgmglsgmlssSIANLTALSGIWLGNNDLSGSTPDLSSLKRLEILHLEDNQIGGEIAP  205
            N + MG+SG LS  IANLTAL+ I   NN LSG  PDLS L +L+ LHL DN++ G I  
Sbjct  406  NFSSMGISGSLSPDIANLTALTNISFANNSLSGPIPDLSKLNKLQRLHLYDNKLNGTIPQ  465

Query  204  SLGRIKSLRELFLQNNNLTGQIPGSILGRPGINLRTTPGNPFLSGPP  64
            +LG I+ LRELFLQNN L G +P ++L   G+N +  PGN F   PP
Sbjct  466  TLGTIQVLRELFLQNNELVGTVPLNLLNNQGLNSQFVPGNQFSPKPP  512



>ref|XP_008670240.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g67720 [Zea mays]
 tpg|DAA40242.1| TPA: hypothetical protein ZEAMMB73_532617 [Zea mays]
Length=515

 Score =   142 bits (358),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 85/162 (52%), Positives = 106/162 (65%), Gaps = 4/162 (2%)
 Frame = -2

Query  558  VLPLGGKTHTRDVIALEKLKEGFENPPLDWNGDPCLPPQYSWTGVVCSGGTRIRVttlnl  379
            V+PLGG+TH RDVI +++L  GF NPP DW GDPCLP   SWTGV C+     RVT LNL
Sbjct  351  VVPLGGRTHPRDVIGMQELARGFTNPPSDWRGDPCLPQGNSWTGVTCNQDPLARVTGLNL  410

Query  378  tgmglsgmlssSIANLTALSGIWLGNNDLSGSTPDLSSLKRLEILHLEDNQIGGEIAPSL  199
            T   + G +S++IANLTA+S IWL  N+L+G  PDL+ L  +  LHLEDN + G +  SL
Sbjct  411  TNFRVGGSISNNIANLTAISSIWLVGNNLTGPIPDLNHLLHVVSLHLEDNGLTGPLPESL  470

Query  198  GRIKSLRELFLQNNNLTGQIPGSILGR----PGINLRTTPGN  85
            G +  L EL +QNN+L G IP SI  R    P    + TPGN
Sbjct  471  GNLTRLEELSVQNNSLQGTIPSSIRNRAAVDPRFRFQYTPGN  512



>ref|XP_008360349.1| PREDICTED: LOW QUALITY PROTEIN: putative leucine-rich repeat 
receptor-like serine/threonine-protein kinase At2g14440 [Malus 
domestica]
Length=514

 Score =   142 bits (357),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 96/151 (64%), Positives = 113/151 (75%), Gaps = 0/151 (0%)
 Frame = -2

Query  564  FRVLPLGGKTHTRDVIALEKLKEGFENPPLDWNGDPCLPPQYSWTGVVCSGGTRIRVttl  385
            F VLPLGG T TRDVIAL+++K+  +NP  D +GDPCLP  YSWTG+ CS G R+RV +L
Sbjct  343  FDVLPLGGTTLTRDVIALQRVKQSLQNPLPDXSGDPCLPRXYSWTGITCSPGPRVRVVSL  402

Query  384  nltgmglsgmlssSIANLTALSGIWLGNNDLSGSTPDLSSLKRLEILHLEDNQIGGEIAP  205
            NLT MG+SG LS SIAN+TALS I LG N  +G  PDLSSLK LE LHLEDN   G I  
Sbjct  403  NLTSMGISGSLSPSIANMTALSNILLGKNKFTGPIPDLSSLKLLEKLHLEDNHFSGNIPS  462

Query  204  SLGRIKSLRELFLQNNNLTGQIPGSILGRPG  112
            SL  I SL ELFLQNNNLTG++P S++G+ G
Sbjct  463  SLRSIDSLHELFLQNNNLTGEVPDSLVGKSG  493



>ref|XP_007200685.1| hypothetical protein PRUPE_ppa017037mg [Prunus persica]
 gb|EMJ01884.1| hypothetical protein PRUPE_ppa017037mg [Prunus persica]
Length=501

 Score =   142 bits (357),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 82/143 (57%), Positives = 105/143 (73%), Gaps = 0/143 (0%)
 Frame = -2

Query  564  FRVLPLGGKTHTRDVIALEKLKEGFENPPLDWNGDPCLPPQYSWTGVVCSGGTRIRVttl  385
             ++LPLGG T  RDV A+ +L+  F+NPP DW+GDPCLP + SWTGV CS G   RVT L
Sbjct  348  MQILPLGGVTVNRDVGAMNELRRHFDNPPPDWSGDPCLPRENSWTGVTCSHGKNYRVTAL  407

Query  384  nltgmglsgmlssSIANLTALSGIWLGNNDLSGSTPDLSSLKRLEILHLEDNQIGGEIAP  205
            NLTG+GLSG L+ +IANLTAL  IW G N LSG+ P++ SLK L+ LHLE+NQ+ G I  
Sbjct  408  NLTGIGLSGSLAPNIANLTALRHIWFGGNKLSGNIPEMGSLKELQSLHLENNQLEGLIPQ  467

Query  204  SLGRIKSLRELFLQNNNLTGQIP  136
            SL ++  L+E+FLQNN + G +P
Sbjct  468  SLRKLPKLQEIFLQNNKVKGDVP  490



>gb|KFK39243.1| hypothetical protein AALP_AA3G219000 [Arabis alpina]
Length=518

 Score =   142 bits (357),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 81/160 (51%), Positives = 106/160 (66%), Gaps = 0/160 (0%)
 Frame = -2

Query  564  FRVLPLGGKTHTRDVIALEKLKEGFENPPLDWNGDPCLPPQYSWTGVVCSGGTRIRVttl  385
            F+V+PLGG T+  D  ALE L E  + PP+DW+GDPCLP   SWTGV CS     RV +L
Sbjct  344  FQVIPLGGTTNIIDATALEDLLESIKEPPVDWSGDPCLPLANSWTGVTCSKEKITRVISL  403

Query  384  nltgmglsgmlssSIANLTALSGIWLGNNDLSGSTPDLSSLKRLEILHLEDNQIGGEIAP  205
            NLT  GLSG LS +I  +TAL  +W+G N L+G  PDLS + +LE LHLEDNQ  G I  
Sbjct  404  NLTNRGLSGSLSPTINTMTALKDLWMGKNKLTGPIPDLSPMTKLETLHLEDNQFSGAIPE  463

Query  204  SLGRIKSLRELFLQNNNLTGQIPGSILGRPGINLRTTPGN  85
            SL ++ +LR L L+NN   G IP ++L + G+ ++ +P N
Sbjct  464  SLAQLPNLRTLSLKNNRFQGTIPIALLQKKGLTIQASPEN  503



>ref|XP_010691040.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase PAM74 isoform X2 [Beta vulgaris subsp. vulgaris]
Length=514

 Score =   141 bits (356),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 80/156 (51%), Positives = 112/156 (72%), Gaps = 1/156 (1%)
 Frame = -2

Query  564  FRVLPLGGKTHTRDVIALEKLKEGFENPPLDWNGDPCLPPQYSWTGVVCSGGTRI-RVtt  388
            F+++PLGGKT +RDVIA+ +L     NPP DW+GDPCLP Q SW+GV CS    + +V +
Sbjct  359  FQLIPLGGKTTSRDVIAMAELARSLNNPPSDWSGDPCLPRQNSWSGVTCSQTKDLAQVAS  418

Query  387  lnltgmglsgmlssSIANLTALSGIWLGNNDLSGSTPDLSSLKRLEILHLEDNQIGGEIA  208
            +NLTG+GL+G LS+S+ NL+A+  +WLG+N LSGS PDLSS+K L+ LHLE+NQ  G I 
Sbjct  419  MNLTGLGLTGSLSTSMGNLSAIVHLWLGHNKLSGSLPDLSSMKMLQTLHLENNQFEGSIP  478

Query  207  PSLGRIKSLRELFLQNNNLTGQIPGSILGRPGINLR  100
             SL  + ++RE++LQNN   G IP  +  R  + ++
Sbjct  479  ESLSNLPNIREIYLQNNKFKGGIPNGLKNRRSVTIQ  514



>ref|XP_010691039.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase PAM74 isoform X1 [Beta vulgaris subsp. vulgaris]
Length=515

 Score =   141 bits (356),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 80/156 (51%), Positives = 112/156 (72%), Gaps = 1/156 (1%)
 Frame = -2

Query  564  FRVLPLGGKTHTRDVIALEKLKEGFENPPLDWNGDPCLPPQYSWTGVVCSGGTRI-RVtt  388
            F+++PLGGKT +RDVIA+ +L     NPP DW+GDPCLP Q SW+GV CS    + +V +
Sbjct  359  FQLIPLGGKTTSRDVIAMAELARSLNNPPSDWSGDPCLPRQNSWSGVTCSQTKDLAQVAS  418

Query  387  lnltgmglsgmlssSIANLTALSGIWLGNNDLSGSTPDLSSLKRLEILHLEDNQIGGEIA  208
            +NLTG+GL+G LS+S+ NL+A+  +WLG+N LSGS PDLSS+K L+ LHLE+NQ  G I 
Sbjct  419  MNLTGLGLTGSLSTSMGNLSAIVHLWLGHNKLSGSLPDLSSMKMLQTLHLENNQFEGSIP  478

Query  207  PSLGRIKSLRELFLQNNNLTGQIPGSILGRPGINLR  100
             SL  + ++RE++LQNN   G IP  +  R  + ++
Sbjct  479  ESLSNLPNIREIYLQNNKFKGGIPNGLKNRRSVTIQ  514



>ref|XP_006660701.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g67720-like [Oryza brachyantha]
Length=535

 Score =   141 bits (356),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 85/158 (54%), Positives = 106/158 (67%), Gaps = 0/158 (0%)
 Frame = -2

Query  558  VLPLGGKTHTRDVIALEKLKEGFENPPLDWNGDPCLPPQYSWTGVVCSGGTRIRVttlnl  379
            V+PLGG+TH RDVI +E L  GF++ P DW GDPCLP   SWTGV C+ G   RV  LNL
Sbjct  375  VVPLGGRTHPRDVIGMEALARGFDSTPPDWAGDPCLPQGNSWTGVTCTQGPLARVVALNL  434

Query  378  tgmglsgmlssSIANLTALSGIWLGNNDLSGSTPDLSSLKRLEILHLEDNQIGGEIAPSL  199
            T   + G +S  IANLTA+S IWL  N+L+G+ PD+S L  L  LHLE+N++ G I PSL
Sbjct  435  TNFSVGGSISDGIANLTAVSSIWLVGNNLTGAIPDMSLLHHLVSLHLENNRLTGVIPPSL  494

Query  198  GRIKSLRELFLQNNNLTGQIPGSILGRPGINLRTTPGN  85
            G +  LRELF+QNN L G IP ++  R  I  +  PGN
Sbjct  495  GNLPRLRELFVQNNTLQGMIPSNLKNRTDIMFQYAPGN  532



>ref|XP_006296645.1| hypothetical protein CARUB_v10015204mg [Capsella rubella]
 gb|EOA29543.1| hypothetical protein CARUB_v10015204mg [Capsella rubella]
Length=513

 Score =   140 bits (353),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 81/160 (51%), Positives = 107/160 (67%), Gaps = 0/160 (0%)
 Frame = -2

Query  564  FRVLPLGGKTHTRDVIALEKLKEGFENPPLDWNGDPCLPPQYSWTGVVCSGGTRIRVttl  385
            F+VLPLGG T+ +D IA++ L E  + PP+DW+GDPCLP   SWTG+ CS     RV +L
Sbjct  346  FQVLPLGGFTNIKDAIAMDDLLESIKKPPVDWSGDPCLPRANSWTGLTCSKDKITRVISL  405

Query  384  nltgmglsgmlssSIANLTALSGIWLGNNDLSGSTPDLSSLKRLEILHLEDNQIGGEIAP  205
            NLT +GLSG L  SI  ++AL  +WLG N L+G  PDLS + RL+ L+LEDNQ  G I  
Sbjct  406  NLTNLGLSGSLPPSINKMSALKDLWLGKNKLTGPIPDLSPMTRLQTLNLEDNQFTGAIPE  465

Query  204  SLGRIKSLRELFLQNNNLTGQIPGSILGRPGINLRTTPGN  85
            SL ++ SLR L L+NN L G  P +IL R  + ++ +P N
Sbjct  466  SLAKLPSLRILSLKNNKLKGTFPSAILQRKNLTIQASPEN  505



>ref|XP_006406523.1| hypothetical protein EUTSA_v10022285mg [Eutrema salsugineum]
 gb|ESQ47976.1| hypothetical protein EUTSA_v10022285mg [Eutrema salsugineum]
Length=513

 Score =   140 bits (353),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 83/160 (52%), Positives = 105/160 (66%), Gaps = 0/160 (0%)
 Frame = -2

Query  564  FRVLPLGGKTHTRDVIALEKLKEGFENPPLDWNGDPCLPPQYSWTGVVCSGGTRIRVttl  385
            F+VLPL G T+ RD  A+E L E  + PP+DW+GDPCLP   SWTG+ CS     RV +L
Sbjct  344  FQVLPLRGITNIRDASAMEDLLESIKKPPVDWSGDPCLPLANSWTGLTCSKNKISRVISL  403

Query  384  nltgmglsgmlssSIANLTALSGIWLGNNDLSGSTPDLSSLKRLEILHLEDNQIGGEIAP  205
            NLT  GLSG LS SI  +TAL  +WLG N  +G  PDLS + RLE LHLEDNQ  G I  
Sbjct  404  NLTNRGLSGSLSPSINKMTALKDLWLGKNKFTGPIPDLSPMTRLETLHLEDNQFSGAIPE  463

Query  204  SLGRIKSLRELFLQNNNLTGQIPGSILGRPGINLRTTPGN  85
            SL  + +LR L L+NN L G IP ++L + G+ ++ +P N
Sbjct  464  SLALLPNLRILSLKNNKLQGTIPSALLQKKGLTIQASPEN  503



>gb|EMT12993.1| Putative LRR receptor-like serine/threonine-protein kinase [Aegilops 
tauschii]
Length=456

 Score =   140 bits (352),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 80/156 (51%), Positives = 105/156 (67%), Gaps = 0/156 (0%)
 Frame = -2

Query  564  FRVLPLGGKTHTRDVIALEKLKEGFENPPLDWNGDPCLPPQYSWTGVVCSGGTRIRVttl  385
            ++++P+GG+T T DV A+E L    + PP DW GDPCLP Q SWTGV CS  + +RV +L
Sbjct  271  YQIVPVGGRTATSDVGAMEDLARSLKTPPPDWAGDPCLPRQNSWTGVGCSDDSPVRVLSL  330

Query  384  nltgmglsgmlssSIANLTALSGIWLGNNDLSGSTPDLSSLKRLEILHLEDNQIGGEIAP  205
            +L   GLSG L  SI NLT ++ I L  N LSG  PD SS++ L  LHL+ NQ  G I P
Sbjct  331  DLKNRGLSGSLPDSIGNLTGMNTISLSGNKLSGPIPDFSSMQTLTALHLDGNQFSGPINP  390

Query  204  SLGRIKSLRELFLQNNNLTGQIPGSILGRPGINLRT  97
            SLG + +L+ELFL NNNL+G IP S+  +PG+ + T
Sbjct  391  SLGNLTNLKELFLNNNNLSGLIPPSLKIKPGLVMST  426



>ref|XP_008454942.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At5g59680 [Cucumis melo]
Length=508

 Score =   140 bits (352),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 80/140 (57%), Positives = 100/140 (71%), Gaps = 0/140 (0%)
 Frame = -2

Query  561  RVLPLGGKTHTRDVIALEKLKEGFENPPLDWNGDPCLPPQYSWTGVVCSGGTRIRVttln  382
            +V  LGG+T TRDV+A+E L   F NPP DW+GDPCLP + SW+GV CS G   RV  LN
Sbjct  355  QVFRLGGRTLTRDVMAMEDLARSFNNPPHDWSGDPCLPKENSWSGVTCSVGKLARVVNLN  414

Query  381  ltgmglsgmlssSIANLTALSGIWLGNNDLSGSTPDLSSLKRLEILHLEDNQIGGEIAPS  202
            LT  GLSG L SSI NLTAL+ +WLG+N L+GS P++ SLK L+ LHLE NQ  G I  S
Sbjct  415  LTNFGLSGTLPSSINNLTALTHLWLGSNKLTGSIPEMGSLKELQTLHLEKNQFEGPIPHS  474

Query  201  LGRIKSLRELFLQNNNLTGQ  142
            L ++  +RE+FLQNN+L  +
Sbjct  475  LSKLPHIREIFLQNNDLKSK  494



>ref|XP_008660470.1| PREDICTED: receptor-like protein kinase At3g21340 isoform X1 
[Zea mays]
Length=535

 Score =   139 bits (351),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 82/174 (47%), Positives = 112/174 (64%), Gaps = 13/174 (7%)
 Frame = -2

Query  564  FRVLPLGGKTHTRDV------------IALEKLKEGFENPPLDWNGDPCLPPQYSWTGVV  421
            ++++PLGG+T TRDV            +A+E L    +N P DW GDPCLP Q+SWTGV 
Sbjct  362  YQIVPLGGRTATRDVSSCRSRPVSCAVVAMEDLASSLKNLPPDWAGDPCLPQQHSWTGVE  421

Query  420  CSGGTRIRVttlnltgmglsgmlssSIANLTALSGIWLGNNDLSGSTPDLSSLKRLEILH  241
            CS G+ +RV +L+L   GLSG L  SI +LT +  I+L  N+LSG  PDLSS+  L  + 
Sbjct  422  CSQGSPVRVLSLDLKNHGLSGSLPDSIVHLTGMKTIYLSGNNLSGPIPDLSSMHALTAVR  481

Query  240  LEDNQIGGEIAPSLGRIKSLRELFLQNNNLTGQIPGSILGRPGINLRTTPGNPF  79
            L+ NQ  G I PS+ ++ +L+EL L NNNLTG+IP  +  + G++LRT  GN F
Sbjct  482  LDSNQFSGTINPSMEKLANLKELHLNNNNLTGKIPDGLKNKAGLDLRTE-GNKF  534



>tpg|DAA40243.1| TPA: hypothetical protein ZEAMMB73_532617 [Zea mays]
Length=793

 Score =   141 bits (356),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 84/161 (52%), Positives = 106/161 (66%), Gaps = 2/161 (1%)
 Frame = -2

Query  558  VLPLGGKTHTRDVIALEKLKEGFENPPLDWNGDPCLPPQYSWTGVVCSGGTRIRVttlnl  379
            V+PLGG+TH RDVI +++L  GF NPP DW GDPCLP   SWTGV C+     RVT LNL
Sbjct  351  VVPLGGRTHPRDVIGMQELARGFTNPPSDWRGDPCLPQGNSWTGVTCNQDPLARVTGLNL  410

Query  378  tgmglsgmlssSIANLTALSGIWLGNNDLSGSTPDLSSLKRLEILHLEDNQIGGEIAPSL  199
            T   + G +S++IANLTA+S IWL  N+L+G  PDL+ L  +  LHLEDN + G +  SL
Sbjct  411  TNFRVGGSISNNIANLTAISSIWLVGNNLTGPIPDLNHLLHVVSLHLEDNGLTGPLPESL  470

Query  198  GRIKSLRELFLQNNNLTGQIPGSILGRPGIN--LRTTPGNP  82
            G +  L EL +QNN+L G IP SI  R  ++   R  P NP
Sbjct  471  GNLTRLEELSVQNNSLQGTIPSSIRNRAAVDPRFRFQPCNP  511



>gb|KGN43935.1| hypothetical protein Csa_7G073710 [Cucumis sativus]
Length=515

 Score =   139 bits (349),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 83/154 (54%), Positives = 105/154 (68%), Gaps = 1/154 (1%)
 Frame = -2

Query  561  RVLPLGGKTHTRDVIALEKLKEGFENPPLDWNGDPCLPPQYSWTGVVCSGGTRIRVttln  382
            +V  L G+T TRDV+A+E+L   F NPP DW+GDPCLP   SWTGV CS G   RV  LN
Sbjct  363  QVFRLSGRTLTRDVMAMEELARSFNNPPHDWSGDPCLPKDNSWTGVTCSDGKLARVVNLN  422

Query  381  ltgmglsgmlssSIANLTALSGIWLGNNDLSGSTPDLSSLKRLEILHLEDNQIGGEIAPS  202
            LT  GLSG L SSI NLTAL+ +WLG+N LSG  P++ SLK L+ LHLE NQ  G I  S
Sbjct  423  LTNFGLSGALPSSINNLTALTHLWLGSNKLSGFIPEMGSLKELQTLHLEKNQFEGPIPRS  482

Query  201  LGRIKSLRELFLQNNNLTGQIPGSILGRPGINLR  100
            L ++  +RE+FLQNN+L  +    +L + GI++ 
Sbjct  483  LSKLPHIREIFLQNNDLKSKA-LEVLQKRGIHVE  515



>ref|XP_004136983.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g51810-like [Cucumis sativus]
Length=516

 Score =   139 bits (349),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 83/154 (54%), Positives = 105/154 (68%), Gaps = 1/154 (1%)
 Frame = -2

Query  561  RVLPLGGKTHTRDVIALEKLKEGFENPPLDWNGDPCLPPQYSWTGVVCSGGTRIRVttln  382
            +V  L G+T TRDV+A+E+L   F NPP DW+GDPCLP   SWTGV CS G   RV  LN
Sbjct  363  QVFRLSGRTLTRDVMAMEELARSFNNPPHDWSGDPCLPKDNSWTGVTCSDGKLARVVNLN  422

Query  381  ltgmglsgmlssSIANLTALSGIWLGNNDLSGSTPDLSSLKRLEILHLEDNQIGGEIAPS  202
            LT  GLSG L SSI NLTAL+ +WLG+N LSG  P++ SLK L+ LHLE NQ  G I  S
Sbjct  423  LTNFGLSGALPSSINNLTALTHLWLGSNKLSGFIPEMGSLKELQTLHLEKNQFEGPIPRS  482

Query  201  LGRIKSLRELFLQNNNLTGQIPGSILGRPGINLR  100
            L ++  +RE+FLQNN+L  +    +L + GI++ 
Sbjct  483  LSKLPHIREIFLQNNDLKSKA-LEVLQKRGIHVE  515



>ref|XP_004166668.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g51810-like [Cucumis sativus]
Length=508

 Score =   138 bits (348),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 83/154 (54%), Positives = 105/154 (68%), Gaps = 1/154 (1%)
 Frame = -2

Query  561  RVLPLGGKTHTRDVIALEKLKEGFENPPLDWNGDPCLPPQYSWTGVVCSGGTRIRVttln  382
            +V  L G+T TRDV+A+E+L   F NPP DW+GDPCLP   SWTGV CS G   RV  LN
Sbjct  355  QVFRLSGRTLTRDVMAMEELARSFNNPPHDWSGDPCLPKDNSWTGVTCSDGKLARVVNLN  414

Query  381  ltgmglsgmlssSIANLTALSGIWLGNNDLSGSTPDLSSLKRLEILHLEDNQIGGEIAPS  202
            LT  GLSG L SSI NLTAL+ +WLG+N LSG  P++ SLK L+ LHLE NQ  G I  S
Sbjct  415  LTNFGLSGALPSSINNLTALTHLWLGSNKLSGFIPEMGSLKELQTLHLEKNQFEGPIPRS  474

Query  201  LGRIKSLRELFLQNNNLTGQIPGSILGRPGINLR  100
            L ++  +RE+FLQNN+L  +    +L + GI++ 
Sbjct  475  LSKLPHIREIFLQNNDLKSKA-LEVLQKRGIHVE  507



>ref|XP_007156516.1| hypothetical protein PHAVU_003G292500g [Phaseolus vulgaris]
 gb|ESW28510.1| hypothetical protein PHAVU_003G292500g [Phaseolus vulgaris]
Length=512

 Score =   137 bits (345),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 74/132 (56%), Positives = 95/132 (72%), Gaps = 0/132 (0%)
 Frame = -2

Query  564  FRVLPLGGKTHTRDVIALEKLKEGFENPPLDWNGDPCLPPQYSWTGVVCSGGTRIRVttl  385
            +++LPLGG+THTRDVI +E L    +NPP DW+GDPCLP   SWTGV C+ G   RVTTL
Sbjct  371  YQILPLGGRTHTRDVIGMEDLARSIQNPPADWSGDPCLPKGNSWTGVTCTNGFHARVTTL  430

Query  384  nltgmglsgmlssSIANLTALSGIWLGNNDLSGSTPDLSSLKRLEILHLEDNQIGGEIAP  205
            NLT  GL G L  ++ NL+ALS +WLG N L+G+ PDL+ LK LE LHLE N   G + P
Sbjct  431  NLTNAGLGGTLPPTLDNLSALSHLWLGGNKLTGTIPDLNGLKDLETLHLEKNNFEGPLPP  490

Query  204  SLGRIKSLRELF  169
            S+G++  LRE++
Sbjct  491  SIGKLPKLREIY  502



>gb|EEE63620.1| hypothetical protein OsJ_18437 [Oryza sativa Japonica Group]
Length=441

 Score =   136 bits (343),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 81/147 (55%), Positives = 100/147 (68%), Gaps = 0/147 (0%)
 Frame = -2

Query  564  FRVLPLGGKTHTRDVIALEKLKEGFENPPLDWNGDPCLPPQYSWTGVVCSGGTRIRVttl  385
            F + PLGG T  RD  ALE +K   +N P DWNGDPC+P  Y+WTGV C  G   RV +L
Sbjct  262  FGLFPLGGYTFPRDAHALEAIKRSLQNIPDDWNGDPCMPHGYAWTGVTCDKGQIPRVISL  321

Query  384  nltgmglsgmlssSIANLTALSGIWLGNNDLSGSTPDLSSLKRLEILHLEDNQIGGEIAP  205
            N + MGLSG LSS IA LTAL+ I   NN LSG  P+LS+L+ L  LHL+DN++ G +  
Sbjct  322  NFSSMGLSGYLSSDIARLTALTDISFANNSLSGPIPNLSNLRNLTRLHLQDNKLNGTVPQ  381

Query  204  SLGRIKSLRELFLQNNNLTGQIPGSIL  124
            +LG I SLRELFLQNN L G +P ++L
Sbjct  382  TLGIITSLRELFLQNNELDGAVPLNLL  408



>ref|XP_003520166.2| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g51810-like [Glycine max]
 gb|KHN37506.1| Putative LRR receptor-like serine/threonine-protein kinase [Glycine 
soja]
Length=491

 Score =   137 bits (344),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 73/131 (56%), Positives = 94/131 (72%), Gaps = 0/131 (0%)
 Frame = -2

Query  564  FRVLPLGGKTHTRDVIALEKLKEGFENPPLDWNGDPCLPPQYSWTGVVCSGGTRIRVttl  385
            ++VLPLGG+THTRDVIA+E L    +NPP+DW+GDPCLP   SWTGV CS G   RVT +
Sbjct  361  YQVLPLGGRTHTRDVIAMEDLARSIQNPPVDWHGDPCLPKGNSWTGVTCSNGFHARVTIV  420

Query  384  nltgmglsgmlssSIANLTALSGIWLGNNDLSGSTPDLSSLKRLEILHLEDNQIGGEIAP  205
            NLT  G+SG L  ++ +L+AL  +WLG N LSG+ PDLS LK LE LHLE N   G + P
Sbjct  421  NLTNAGVSGSLPPTLGHLSALEHLWLGENKLSGNIPDLSGLKELETLHLEKNNFEGPLPP  480

Query  204  SLGRIKSLREL  172
            S+ ++  LR++
Sbjct  481  SIKKLPKLRDM  491



>ref|XP_003607986.1| Receptor-like protein kinase [Medicago truncatula]
Length=558

 Score =   136 bits (343),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 73/135 (54%), Positives = 96/135 (71%), Gaps = 0/135 (0%)
 Frame = -2

Query  564  FRVLPLGGKTHTRDVIALEKLKEGFENPPLDWNGDPCLPPQYSWTGVVCSGGTRIRVttl  385
            +++LPLGG+T TRD+I +E L    +NPP DWNGDPC P + SWTGV CS     R+T +
Sbjct  358  YQILPLGGRTQTRDIITMEDLARSIQNPPRDWNGDPCRPKENSWTGVTCSSQFVARITVV  417

Query  384  nltgmglsgmlssSIANLTALSGIWLGNNDLSGSTPDLSSLKRLEILHLEDNQIGGEIAP  205
            NLT  GL G L  SI +LTALS +WLG N L+G+ PDLS LK LE LHLE+N+  G++ P
Sbjct  418  NLTNAGLVGTLPPSIGHLTALSHLWLGGNKLTGTIPDLSGLKELETLHLENNKFEGKLPP  477

Query  204  SLGRIKSLRELFLQN  160
            S  ++  LRE++LQ+
Sbjct  478  STEKLPKLREMWLQH  492



>gb|EMT30919.1| hypothetical protein F775_31967 [Aegilops tauschii]
Length=522

 Score =   136 bits (342),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 82/168 (49%), Positives = 109/168 (65%), Gaps = 6/168 (4%)
 Frame = -2

Query  564  FRVLPLGGKTHTRDVIALEKLKEGFENPPLDWNGDPCLPPQYSWTGVVCSGGTR--IRVt  391
            F + P+G  T TRD +A+E +K   +N P DW GDPC+P  Y+WTGV C  G    IRV 
Sbjct  296  FGIFPIGRLTITRDALAMESMKRSLQNIPDDWIGDPCMPHGYAWTGVTCQEGQNENIRVI  355

Query  390  tlnltgmglsgmlssSIANLTALSGIWLGNNDLSGSTPDLSSLKRLEILHLEDNQIGGEI  211
            +LN + MG+SG LS  IANLTAL+ I   NN LSG+ PDL +L +L+ L+L DN++ G+I
Sbjct  356  SLNFSSMGISGSLSPDIANLTALTDISFANNSLSGTIPDLINLGKLQRLYLNDNKLNGKI  415

Query  210  APSLGRIKSLRELFLQNNNLTGQIPGSILGRPGINLRTTPGNPFLSGP  67
            A +LG I+ LRELFLQ N L G +P ++L + G+    T   P  S P
Sbjct  416  AQTLGTIQPLRELFLQGNELGGAVPQNLLNKTGL----TSNQPMKSAP  459



>ref|XP_003528508.2| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g51810-like [Glycine max]
Length=519

 Score =   133 bits (335),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 75/129 (58%), Positives = 90/129 (70%), Gaps = 0/129 (0%)
 Frame = -2

Query  564  FRVLPLGGKTHTRDVIALEKLKEGFENPPLDWNGDPCLPPQYSWTGVVCSGGTRIRVttl  385
            ++VLPLGG+THTRDVIA+E L    +NPP DW+GDPCLP   SWTGV CS G   RVTTL
Sbjct  360  YQVLPLGGRTHTRDVIAMEDLARSIQNPPADWHGDPCLPKGNSWTGVTCSNGFHARVTTL  419

Query  384  nltgmglsgmlssSIANLTALSGIWLGNNDLSGSTPDLSSLKRLEILHLEDNQIGGEIAP  205
            NLT  G+SG L  ++  L+AL  +WLG N LSG+ PDLS LK LE LHLE N   G + P
Sbjct  420  NLTNAGVSGSLPPTLGRLSALEHLWLGENKLSGTIPDLSGLKELETLHLEKNNFEGPLPP  479

Query  204  SLGRIKSLR  178
            S  ++  LR
Sbjct  480  STKKLPKLR  488



>gb|KHN31071.1| Putative LRR receptor-like serine/threonine-protein kinase [Glycine 
soja]
Length=490

 Score =   133 bits (335),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 75/129 (58%), Positives = 90/129 (70%), Gaps = 0/129 (0%)
 Frame = -2

Query  564  FRVLPLGGKTHTRDVIALEKLKEGFENPPLDWNGDPCLPPQYSWTGVVCSGGTRIRVttl  385
            ++VLPLGG+THTRDVIA+E L    +NPP DW+GDPCLP   SWTGV CS G   RVTTL
Sbjct  360  YQVLPLGGRTHTRDVIAMEDLARSIQNPPADWHGDPCLPKGNSWTGVTCSNGFHARVTTL  419

Query  384  nltgmglsgmlssSIANLTALSGIWLGNNDLSGSTPDLSSLKRLEILHLEDNQIGGEIAP  205
            NLT  G+SG L  ++  L+AL  +WLG N LSG+ PDLS LK LE LHLE N   G + P
Sbjct  420  NLTNAGVSGSLPPTLGRLSALEHLWLGENKLSGTIPDLSGLKELETLHLEKNNFEGPLPP  479

Query  204  SLGRIKSLR  178
            S  ++  LR
Sbjct  480  STKKLPKLR  488



>ref|XP_004505211.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At5g59680-like [Cicer arietinum]
Length=553

 Score =   133 bits (334),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 75/143 (52%), Positives = 99/143 (69%), Gaps = 2/143 (1%)
 Frame = -2

Query  564  FRVLPLGGKTHTRDVIALEKLKEGFENPPLDWNGDPCLPPQYSWTGVVCSGGTRIRVttl  385
            +++LPLGG+T T+D+IALE L    +NPP DWNGDPC P  +SWTGV CS     RVT+L
Sbjct  406  YQILPLGGRTQTKDLIALEDLARSIQNPPRDWNGDPCRPKGHSWTGVTCSEQFIARVTSL  465

Query  384  nltgmglsgmlssSIANLTALSGIWLGNNDLSGSTPDLSSLKRLEILHLEDNQIGGEIAP  205
            NLT  GL+G L  +I NLTALS +WLG N  +G  P+L  LK LE LHLE+N+  G + P
Sbjct  466  NLTNGGLAGTLPPTIGNLTALSHLWLGGNKFTGKIPELGGLKELETLHLENNKFEGPLPP  525

Query  204  SLGRIKSLRELF--LQNNNLTGQ  142
            S+ ++  LRE++  +QNN   G+
Sbjct  526  SIQKLPKLREIYSDMQNNKSDGK  548



>gb|AES90183.2| Serine/Threonine kinase, plant-type protein, putative [Medicago 
truncatula]
Length=504

 Score =   132 bits (332),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 71/131 (54%), Positives = 92/131 (70%), Gaps = 0/131 (0%)
 Frame = -2

Query  564  FRVLPLGGKTHTRDVIALEKLKEGFENPPLDWNGDPCLPPQYSWTGVVCSGGTRIRVttl  385
            +++LPLGG+T TRD+I +E L    +NPP DWNGDPC P + SWTGV CS     R+T +
Sbjct  358  YQILPLGGRTQTRDIITMEDLARSIQNPPRDWNGDPCRPKENSWTGVTCSSQFVARITVV  417

Query  384  nltgmglsgmlssSIANLTALSGIWLGNNDLSGSTPDLSSLKRLEILHLEDNQIGGEIAP  205
            NLT  GL G L  SI +LTALS +WLG N L+G+ PDLS LK LE LHLE+N+  G++ P
Sbjct  418  NLTNAGLVGTLPPSIGHLTALSHLWLGGNKLTGTIPDLSGLKELETLHLENNKFEGKLPP  477

Query  204  SLGRIKSLREL  172
            S  ++  LRE+
Sbjct  478  STEKLPKLREI  488



>ref|XP_007042420.1| Leucine-rich repeat (LRR) family protein isoform 2, partial [Theobroma 
cacao]
 gb|EOX98251.1| Leucine-rich repeat (LRR) family protein isoform 2, partial [Theobroma 
cacao]
Length=432

 Score =   128 bits (322),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 77/160 (48%), Positives = 100/160 (63%), Gaps = 23/160 (14%)
 Frame = -2

Query  564  FRVLPLGGKTHTRDVIALEKLKEGFENPPLDWNGDPCLPPQYSWTGVVCSGGTRIRVttl  385
            +++LPLGG+T TRDV+ +E+L   F+NPP DW GDPCLP + SWTGV CS     RV ++
Sbjct  292  YQILPLGGRTLTRDVVVMEELARSFDNPPPDWTGDPCLPRENSWTGVTCSNDEMARVVSM  351

Query  384  nltgmglsgmlssSIANLTALSGIWLGNNDLSGSTPDLSSLKRLEILHLEDNQIGGEIAP  205
            +LT  GLSG+L  SI NLTAL                         LHLE+N   G I  
Sbjct  352  DLTNFGLSGVLHPSIDNLTALHH-----------------------LHLENNDFTGPIPK  388

Query  204  SLGRIKSLRELFLQNNNLTGQIPGSILGRPGINLRTTPGN  85
            +LG++ SLRE+ LQNNNL G IP ++ G+ GINL+ +PGN
Sbjct  389  ALGKLGSLREILLQNNNLDGPIPEALRGKKGINLQVSPGN  428



>gb|AFW82162.1| hypothetical protein ZEAMMB73_909570 [Zea mays]
Length=488

 Score =   126 bits (316),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 69/131 (53%), Positives = 94/131 (72%), Gaps = 0/131 (0%)
 Frame = -2

Query  564  FRVLPLGGKTHTRDVIALEKLKEGFENPPLDWNGDPCLPPQYSWTGVVCSGGTRIRVttl  385
            F + P+G  T+ RDV+ALE +K+  +N P DWNGDPC+P  YSWTGV C  G++IRV +L
Sbjct  358  FGLFPVGRLTYARDVLALESIKKSLQNIPEDWNGDPCMPSGYSWTGVTCDEGSKIRVISL  417

Query  384  nltgmglsgmlssSIANLTALSGIWLGNNDLSGSTPDLSSLKRLEILHLEDNQIGGEIAP  205
            N + M LSG LS  IA LTAL+ I L +N LSG  P+LS+L+ L+ LHL++NQ+ G +  
Sbjct  418  NFSSMSLSGFLSPDIAKLTALTDISLAHNMLSGPIPNLSNLRNLQRLHLQENQLSGSVPE  477

Query  204  SLGRIKSLREL  172
            +LG I +LRE+
Sbjct  478  TLGTINTLREM  488



>emb|CDO97171.1| unnamed protein product [Coffea canephora]
Length=517

 Score =   125 bits (315),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 73/156 (47%), Positives = 95/156 (61%), Gaps = 1/156 (1%)
 Frame = -2

Query  564  FRVLPLGGKTHTRDVIALEKLKEGFENPPLDWNGDPCLPPQYSWTGVVCSGG-TRIRVtt  388
            F++L L  +T  RDVI ++ +    ++ PLDW GDPC+P   +WTGV C    T   V+ 
Sbjct  362  FQLLALEERTAARDVIVMDDIVRSIQHLPLDWEGDPCVPRGNAWTGVTCRHRLTTHIVSL  421

Query  387  lnltgmglsgmlssSIANLTALSGIWLGNNDLSGSTPDLSSLKRLEILHLEDNQIGGEIA  208
                   L+G L  S++NL+AL  +WLG N L+GS PDLS L  LE LHLE+NQ  G I 
Sbjct  422  NLTGLGVLTGTLPKSLSNLSALHHLWLGGNSLTGSIPDLSPLMALETLHLENNQFEGPIP  481

Query  207  PSLGRIKSLRELFLQNNNLTGQIPGSILGRPGINLR  100
             SLG +  LRE+FLQNN  TG IP S+  R  I L+
Sbjct  482  ESLGHLPKLREVFLQNNKFTGDIPASLKNRRDILLK  517



>gb|EMS55102.1| hypothetical protein TRIUR3_07045 [Triticum urartu]
Length=363

 Score =   120 bits (302),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 69/131 (53%), Positives = 89/131 (68%), Gaps = 0/131 (0%)
 Frame = -2

Query  564  FRVLPLGGKTHTRDVIALEKLKEGFENPPLDWNGDPCLPPQYSWTGVVCSGGTRIRVttl  385
            F + P+G  T TRD +A+E +K   +N P DW GDPC+P  Y+WTGV C  G  IRV +L
Sbjct  152  FGIFPIGRLTITRDALAMESMKRSLQNIPDDWIGDPCMPHGYAWTGVTCDEGQNIRVISL  211

Query  384  nltgmglsgmlssSIANLTALSGIWLGNNDLSGSTPDLSSLKRLEILHLEDNQIGGEIAP  205
            N + MG+SG LS  IANLTAL+ I   NN LSG+ PD  +L +L+ LHL DN++ G IA 
Sbjct  212  NFSSMGISGSLSPDIANLTALTDISFANNSLSGTIPDFINLGKLQRLHLNDNKLNGTIAQ  271

Query  204  SLGRIKSLREL  172
            +LG I+ LREL
Sbjct  272  TLGTIQPLREL  282



>dbj|BAM21554.1| hypothetical protein [Cryptomeria japonica]
Length=892

 Score =   111 bits (277),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 74/166 (45%), Positives = 103/166 (62%), Gaps = 3/166 (2%)
 Frame = -2

Query  564  FRVLPLGGKTHTRDVIALEKLKEGFENPPLDW-NGDPCLPPQYSWTGVVCSGGTRIRVtt  388
            F++  +   TH  DV+ +  +     N P DW  GDPCLP  Y+ TG++C+G    RV  
Sbjct  358  FQIKDVQNMTHPEDVMTIRTIASSI-NVPDDWFGGDPCLPAGYACTGIICNGDNPSRVII  416

Query  387  lnltgmglsgmlssSIANLTALSGIWLGNNDLSGSTPDLSSLKRLEILHLEDNQIGGEIA  208
            LNLT  GLSG +   I  L AL+ + LG+N+LSGS PD SSLK L  L L++NQ+ GEI 
Sbjct  417  LNLTNFGLSGNIPPIIGRLGALTRLLLGSNNLSGSIPDFSSLKNLTTLQLQNNQLTGEIP  476

Query  207  PSLGRIKSLRELFLQNNNLTGQIPGSILGRPGINLRTTPGNPFLSG  70
             SL ++  L +L+L+NN L G +P S L +PG++ R TP + F +G
Sbjct  477  ASLEKLPLLNQLYLENNKLDGTVP-SGLNKPGLDFRLTPQSNFPTG  521



>ref|XP_002468379.1| hypothetical protein SORBIDRAFT_01g044920 [Sorghum bicolor]
 gb|EER95377.1| hypothetical protein SORBIDRAFT_01g044920 [Sorghum bicolor]
Length=499

 Score =   108 bits (271),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 67/155 (43%), Positives = 93/155 (60%), Gaps = 24/155 (15%)
 Frame = -2

Query  564  FRVLPLGGKTHTRDVIALEKLKEGFENPPLDWNGDPCLPPQYSWTGVVCSGGTRIRVttl  385
            ++++PLGG+T TRDV+A+E L    +N P DW GDPCLP ++SWTGV CS  + +RV +L
Sbjct  364  YQIVPLGGRTATRDVVAMEDLASSLKNLPPDWAGDPCLPQKHSWTGVECSQESPMRVLSL  423

Query  384  nltgmglsgmlssSIANLTALSGIWLGNNDLSGSTPDLSSLKRLEILHLEDNQIGGEIAP  205
            +L   GLSG L  SIANLT +  I+L  N+LSG  PDLSS+                   
Sbjct  424  DLKNHGLSGSLPDSIANLTGMKTIYLSGNNLSGPIPDLSSM-------------------  464

Query  204  SLGRIKSLRELFLQNNNLTGQIPGSILGRPGINLR  100
                  +L  ++L  NNLTG+IP  +  + G++LR
Sbjct  465  -----HTLTAVYLNYNNLTGKIPDGLKNKAGLDLR  494



>ref|XP_010521450.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase PAM74 isoform X2 [Tarenaya hassleriana]
Length=489

 Score =   105 bits (263),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 61/109 (56%), Positives = 78/109 (72%), Gaps = 0/109 (0%)
 Frame = -2

Query  564  FRVLPLGGKTHTRDVIALEKLKEGFENPPLDWNGDPCLPPQYSWTGVVCSGGTRIRVttl  385
            F+++PLGGKTHTRD  A+  L     N P DW+GDPCLP + SWTGV CS G   RVT+L
Sbjct  348  FQIVPLGGKTHTRDATAMHDLSRSIMNLPSDWSGDPCLPHENSWTGVTCSKGLVSRVTSL  407

Query  384  nltgmglsgmlssSIANLTALSGIWLGNNDLSGSTPDLSSLKRLEILHL  238
            NLT +GL+G L SS+  +TAL   W+G N L+G+ PDLS +KRLE L++
Sbjct  408  NLTNLGLAGSLPSSVNKMTALKDFWIGKNKLTGTIPDLSLMKRLETLYV  456



>gb|EPS64562.1| hypothetical protein M569_10219, partial [Genlisea aurea]
Length=423

 Score =   100 bits (250),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 60/96 (63%), Positives = 75/96 (78%), Gaps = 0/96 (0%)
 Frame = -2

Query  564  FRVLPLGGKTHTRDVIALEKLKEGFENPPLDWNGDPCLPPQYSWTGVVCSGGTRIRVttl  385
            F+V+P  G+T +RDVIAL  L+  F NPP+DWNG+PCLP Q++WTG+ CSGG R RV +L
Sbjct  328  FQVIPSVGRTLSRDVIALLDLRNSFLNPPVDWNGEPCLPSQFAWTGITCSGGIRNRVVSL  387

Query  384  nltgmglsgmlssSIANLTALSGIWLGNNDLSGSTP  277
            NLTGMGLSG++S +IA LTAL  I+LGNN L G  P
Sbjct  388  NLTGMGLSGIISPTIAQLTALKNIFLGNNSLYGVIP  423



>tpg|DAA40244.1| TPA: hypothetical protein ZEAMMB73_532617 [Zea mays]
Length=434

 Score = 99.4 bits (246),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 57/99 (58%), Positives = 71/99 (72%), Gaps = 0/99 (0%)
 Frame = -2

Query  558  VLPLGGKTHTRDVIALEKLKEGFENPPLDWNGDPCLPPQYSWTGVVCSGGTRIRVttlnl  379
            V+PLGG+TH RDVI +++L  GF NPP DW GDPCLP   SWTGV C+     RVT LNL
Sbjct  330  VVPLGGRTHPRDVIGMQELARGFTNPPSDWRGDPCLPQGNSWTGVTCNQDPLARVTGLNL  389

Query  378  tgmglsgmlssSIANLTALSGIWLGNNDLSGSTPDLSSL  262
            T   + G +S++IANLTA+S IWL  N+L+G  PDL+ L
Sbjct  390  TNFRVGGSISNNIANLTAISSIWLVGNNLTGPIPDLNHL  428



>ref|XP_010647751.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase At2g14510 isoform X2 [Vitis vinifera]
Length=311

 Score = 97.1 bits (240),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 47/86 (55%), Positives = 62/86 (72%), Gaps = 0/86 (0%)
 Frame = -2

Query  342  IANLTALSGIWLGNNDLSGSTPDLSSLKRLEILHLEDNQIGGEIAPSLGRIKSLRELFLQ  163
            IANLT L+ +WLG N LSG  P++S+L  L+ LHLEDN   G    SL ++ SL+E+++Q
Sbjct  220  IANLTGLTHLWLGGNKLSGPIPEMSTLNELQTLHLEDNGFEGSFPRSLDQVTSLQEIYVQ  279

Query  162  NNNLTGQIPGSILGRPGINLRTTPGN  85
            NNNL G IPG++  R GINL+ TPGN
Sbjct  280  NNNLNGTIPGTLQKRLGINLKVTPGN  305



>ref|XP_010415352.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g67720 isoform X1 [Camelina sativa]
 ref|XP_010415353.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g67720 isoform X2 [Camelina sativa]
Length=934

 Score =   100 bits (248),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 58/149 (39%), Positives = 90/149 (60%), Gaps = 7/149 (5%)
 Frame = -2

Query  561  RVLPLGGKTHTRDVIALEKLKEGFENPPLDW---NGDPCLPPQYSWTGVVCSGGTRIRVt  391
            + LP+  KT   DV  L+ ++    +P  DW    GDPC+P  +SW  V CS  +  RVT
Sbjct  367  KYLPISLKTDRNDVSVLDAIR--LMSPDSDWANEGGDPCIPVLWSW--VNCSSTSAPRVT  422

Query  390  tlnltgmglsgmlssSIANLTALSGIWLGNNDLSGSTPDLSSLKRLEILHLEDNQIGGEI  211
             + L+   L G +   I ++ AL+ +WL  N L+G+ PD+S L  L+I+HLE+NQ+ G +
Sbjct  423  KIALSRKNLMGEILPGINSMEALTELWLDGNGLTGNLPDMSKLVNLKIMHLENNQLSGLL  482

Query  210  APSLGRIKSLRELFLQNNNLTGQIPGSIL  124
             P L  + +L+ELF++NN+  G IP ++L
Sbjct  483  PPYLAHLPNLQELFIENNSFRGPIPSALL  511



>ref|XP_001770308.1| predicted protein [Physcomitrella patens]
 gb|EDQ64798.1| predicted protein [Physcomitrella patens]
Length=659

 Score = 99.4 bits (246),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 67/155 (43%), Positives = 92/155 (59%), Gaps = 8/155 (5%)
 Frame = -2

Query  537  THTRDVIALEKLKEGFENPPLDWNGDPCLPPQYSWTGVVCSGGTR---IRVttlnltgmg  367
            T+  DV A+EK+K         W GDPCLP  +SW  V CS  T+    RV ++ L+G  
Sbjct  120  TNELDVAAMEKIKVALR--LTGWGGDPCLPVPHSW--VSCSPATKSSAARVISVRLSGYN  175

Query  366  lsgmlssSIANLTALSGIWLGNNDLSGSTPDLSSLKRLEILHLEDNQIGGEIAPSLGRIK  187
            L+G++ +  ANLTAL  +WL NN L G  P+L +L++L+ LHL DN + G I  SL  I 
Sbjct  176  LTGIIPADFANLTALQTLWLDNNKLDGIIPNLQTLQQLKSLHLNDNALIGSIPNSLSFIP  235

Query  186  SLRELFLQNNNLTGQIPGSILGRPGINLRTTPGNP  82
            +L ELFLQN N  G +P ++  +P + L    GNP
Sbjct  236  TLEELFLQNKNFNGTVPDALKNKPWLKLNIN-GNP  269



>ref|NP_564904.1| putative LRR receptor-like serine/threonine-protein kinase [Arabidopsis 
thaliana]
 sp|C0LGI2.1|Y1677_ARATH RecName: Full=Probable LRR receptor-like serine/threonine-protein 
kinase At1g67720; Flags: Precursor [Arabidopsis thaliana]
 gb|ACN59267.1| leucine-rich repeat receptor-like protein kinase [Arabidopsis 
thaliana]
 gb|AEE34687.1| putative LRR receptor-like serine/threonine-protein kinase [Arabidopsis 
thaliana]
Length=929

 Score = 99.8 bits (247),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 57/149 (38%), Positives = 91/149 (61%), Gaps = 7/149 (5%)
 Frame = -2

Query  561  RVLPLGGKTHTRDVIALEKLKEGFENPPLDW---NGDPCLPPQYSWTGVVCSGGTRIRVt  391
            + LP+  KT   DV  L+ ++    +P  DW    GDPC+P  +SW  V CS  +  RVT
Sbjct  362  KYLPISVKTDRSDVSVLDAIRS--MSPDSDWASEGGDPCIPVLWSW--VNCSSTSPPRVT  417

Query  390  tlnltgmglsgmlssSIANLTALSGIWLGNNDLSGSTPDLSSLKRLEILHLEDNQIGGEI  211
             + L+   L G +   I  + AL+ +WL +N+L+G+ PD+S L  L+I+HLE+NQ+ G +
Sbjct  418  KIALSRKNLRGEIPPGINYMEALTELWLDDNELTGTLPDMSKLVNLKIMHLENNQLSGSL  477

Query  210  APSLGRIKSLRELFLQNNNLTGQIPGSIL  124
             P L  + +L+EL ++NN+  G+IP ++L
Sbjct  478  PPYLAHLPNLQELSIENNSFKGKIPSALL  506



>ref|XP_010470688.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g67720 [Camelina sativa]
 ref|XP_010470689.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g67720 [Camelina sativa]
Length=659

 Score = 97.8 bits (242),  Expect = 4e-20, Method: Composition-based stats.
 Identities = 58/149 (39%), Positives = 90/149 (60%), Gaps = 7/149 (5%)
 Frame = -2

Query  561  RVLPLGGKTHTRDVIALEKLKEGFENPPLDW---NGDPCLPPQYSWTGVVCSGGTRIRVt  391
            + L +  KT   DV  L+ ++    +P  DW    GDPC+P  +SW  V CS  +  RVT
Sbjct  362  KYLQISLKTDRNDVSVLDAIR--LMSPDSDWANEGGDPCIPILWSW--VNCSSTSPPRVT  417

Query  390  tlnltgmglsgmlssSIANLTALSGIWLGNNDLSGSTPDLSSLKRLEILHLEDNQIGGEI  211
             + L+   L G +   I ++ AL+ +WL  N L+G+ PD+S L  L+I+HLE+NQ+ G +
Sbjct  418  KIVLSRKNLMGEILPGINSMEALTELWLDGNGLTGNLPDMSKLVNLKIMHLENNQLSGLL  477

Query  210  APSLGRIKSLRELFLQNNNLTGQIPGSIL  124
             P LG + +L+ELF++NN+  G IP ++L
Sbjct  478  PPYLGHLPNLQELFIENNSFRGPIPSALL  506



>ref|XP_010511725.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g67720 isoform X2 [Camelina sativa]
Length=925

 Score = 96.3 bits (238),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 57/149 (38%), Positives = 89/149 (60%), Gaps = 7/149 (5%)
 Frame = -2

Query  561  RVLPLGGKTHTRDVIALEKLKEGFENPPLDW---NGDPCLPPQYSWTGVVCSGGTRIRVt  391
            + L +  KT   DV  L+ ++    +P  DW    GDPC+P  +SW  V CS  +  RVT
Sbjct  362  KYLQISLKTDRNDVSVLDAIR--LMSPDSDWANEGGDPCIPVLWSW--VNCSSTSPPRVT  417

Query  390  tlnltgmglsgmlssSIANLTALSGIWLGNNDLSGSTPDLSSLKRLEILHLEDNQIGGEI  211
             + L+   L G +   I ++ AL+ +WL  N L+G+ PD+S L  L+I+HLE+NQ+ G +
Sbjct  418  KIALSRKNLMGEILPGINSMEALTELWLDGNGLTGNLPDMSKLVNLKIMHLENNQLSGLL  477

Query  210  APSLGRIKSLRELFLQNNNLTGQIPGSIL  124
             P L  + +L+ELF++NN+  G IP ++L
Sbjct  478  PPYLAHLPNLQELFIENNSFRGPIPSALL  506



>ref|XP_010511724.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g67720 isoform X1 [Camelina sativa]
Length=929

 Score = 96.3 bits (238),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 57/149 (38%), Positives = 89/149 (60%), Gaps = 7/149 (5%)
 Frame = -2

Query  561  RVLPLGGKTHTRDVIALEKLKEGFENPPLDW---NGDPCLPPQYSWTGVVCSGGTRIRVt  391
            + L +  KT   DV  L+ ++    +P  DW    GDPC+P  +SW  V CS  +  RVT
Sbjct  362  KYLQISLKTDRNDVSVLDAIR--LMSPDSDWANEGGDPCIPVLWSW--VNCSSTSPPRVT  417

Query  390  tlnltgmglsgmlssSIANLTALSGIWLGNNDLSGSTPDLSSLKRLEILHLEDNQIGGEI  211
             + L+   L G +   I ++ AL+ +WL  N L+G+ PD+S L  L+I+HLE+NQ+ G +
Sbjct  418  KIALSRKNLMGEILPGINSMEALTELWLDGNGLTGNLPDMSKLVNLKIMHLENNQLSGLL  477

Query  210  APSLGRIKSLRELFLQNNNLTGQIPGSIL  124
             P L  + +L+ELF++NN+  G IP ++L
Sbjct  478  PPYLAHLPNLQELFIENNSFRGPIPSALL  506



>ref|XP_006341770.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g67720-like [Solanum tuberosum]
Length=926

 Score = 96.3 bits (238),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 58/149 (39%), Positives = 90/149 (60%), Gaps = 7/149 (5%)
 Frame = -2

Query  561  RVLPLGGKTHTRDVIALEKLKE---GFENPPLDWNGDPCLPPQYSWTGVVCSGGTRIRVt  391
            R + +  KT  +DV  L   +    G + P  D +GDPC+P Q+ W  V CS  +  R+T
Sbjct  361  RYVQIAPKTDEQDVSTLNAFRSMSLGSDCP--DEDGDPCVPTQWEW--VTCSTTSPPRIT  416

Query  390  tlnltgmglsgmlssSIANLTALSGIWLGNNDLSGSTPDLSSLKRLEILHLEDNQIGGEI  211
             + L+G  ++G +   + ++  L+ +WL  N L+G  PD+S+L  L I+HLE+N++ G I
Sbjct  417  KITLSGKNVTGEIPRELQHMEGLTELWLDGNSLTGPIPDMSNLVNLRIIHLENNKLTGPI  476

Query  210  APSLGRIKSLRELFLQNNNLTGQIPGSIL  124
               LG + SL EL +QNN+LTG+IP S+L
Sbjct  477  PSYLGGLPSLLELDVQNNSLTGEIPSSLL  505



>ref|XP_004497458.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g67720-like [Cicer arietinum]
Length=940

 Score = 96.3 bits (238),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 56/139 (40%), Positives = 83/139 (60%), Gaps = 12/139 (9%)
 Frame = -2

Query  474  DW---NGDPCLPPQYSWTGVVCSGGTRIRVttlnltgmglsgmlssSIANLTALSGIWLG  304
            DW    GDPCLP  +SW  + C+   + R+ ++ L+G  L+G++   I  LT L  +WL 
Sbjct  406  DWAQEGGDPCLPVPWSW--IHCNSDQQPRIVSVLLSGKNLTGVIPLDITKLTGLVELWLD  463

Query  303  NNDLSGSTPDLSSLKRLEILHLEDNQIGGEIAPSLGRIKSLRELFLQNNNLTGQIPGSIL  124
             N L+G  PD +    L+I+HLE+NQ+ GE+  SLG +++LREL+ QNN L+G IP  IL
Sbjct  464  GNMLTGPIPDFTGCNDLKIIHLENNQLAGELPASLGNLQNLRELYAQNNKLSGTIPSEIL  523

Query  123  GRPGI-------NLRTTPG  88
             +  +       NLR+  G
Sbjct  524  SKDLVFNYSGNNNLRSGSG  542



>ref|XP_011086716.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g67720 [Sesamum indicum]
Length=928

 Score = 96.3 bits (238),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 62/163 (38%), Positives = 99/163 (61%), Gaps = 5/163 (3%)
 Frame = -2

Query  561  RVLPLGGKTHTRDVIALEKLKE-GFENPPLDWNGDPCLPPQYSWTGVVCSGGTRIRVttl  385
            R + +  KT  +DV +L  L+    ++P  +  GDPC+P  + W  V CS     R+T +
Sbjct  362  RYVEIAAKTDEQDVRSLNALRSMSMQSPWTEEAGDPCIPTNWEW--VTCSSTAPPRITKI  419

Query  384  nltgmglsgmlssSIANLTALSGIWLGNNDLSGSTPDLSSLKRLEILHLEDNQIGGEIAP  205
             L+G  ++G +   + N+ AL+ +WL  N L+ + PD+S+L  L+ILHLE+NQ+ G + P
Sbjct  420  LLSGKKVTGEIPRELNNMEALTELWLDGNSLNWTIPDMSNLVNLKILHLENNQLTGSLPP  479

Query  204  SLGRIKSLRELFLQNNNLTGQIPGSILGRPGINLRTTPGNPFL  76
             LG +  L+EL +QNN+L+G+IP S+L R  +   +  GNP L
Sbjct  480  FLGSLPYLQELHIQNNSLSGEIPPSLL-RGNLTF-SYEGNPHL  520



>ref|XP_004239170.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g67720 isoform X1 [Solanum lycopersicum]
Length=926

 Score = 96.3 bits (238),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 60/151 (40%), Positives = 91/151 (60%), Gaps = 11/151 (7%)
 Frame = -2

Query  561  RVLPLGGKTHTRDVIALEKLKEGFENPPL--DW---NGDPCLPPQYSWTGVVCSGGTRIR  397
            R + +  KT  +DV  L      F +  L  DW   +GDPC+P Q+ W  V+CS  +  R
Sbjct  361  RYVQIATKTDEQDVSTLN----AFRSMSLGSDWSDEDGDPCVPTQWEW--VICSTTSPPR  414

Query  396  VttlnltgmglsgmlssSIANLTALSGIWLGNNDLSGSTPDLSSLKRLEILHLEDNQIGG  217
            +T + L+G  ++G +   + ++  L+ +WL  N L+G  PDLS+L  L I+HLE+N++ G
Sbjct  415  ITKITLSGKNVTGEIPRELHHMEGLTELWLDGNSLTGPIPDLSNLVNLRIIHLENNKLTG  474

Query  216  EIAPSLGRIKSLRELFLQNNNLTGQIPGSIL  124
             I   LG + SL EL +QNN+LTG+IP S+L
Sbjct  475  PIPSYLGGLPSLLELDVQNNSLTGEIPSSLL  505



>ref|XP_010320968.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g67720 isoform X2 [Solanum lycopersicum]
Length=923

 Score = 95.9 bits (237),  Expect = 3e-19, Method: Composition-based stats.
 Identities = 60/151 (40%), Positives = 91/151 (60%), Gaps = 11/151 (7%)
 Frame = -2

Query  561  RVLPLGGKTHTRDVIALEKLKEGFENPPL--DW---NGDPCLPPQYSWTGVVCSGGTRIR  397
            R + +  KT  +DV  L      F +  L  DW   +GDPC+P Q+ W  V+CS  +  R
Sbjct  358  RYVQIATKTDEQDVSTLN----AFRSMSLGSDWSDEDGDPCVPTQWEW--VICSTTSPPR  411

Query  396  VttlnltgmglsgmlssSIANLTALSGIWLGNNDLSGSTPDLSSLKRLEILHLEDNQIGG  217
            +T + L+G  ++G +   + ++  L+ +WL  N L+G  PDLS+L  L I+HLE+N++ G
Sbjct  412  ITKITLSGKNVTGEIPRELHHMEGLTELWLDGNSLTGPIPDLSNLVNLRIIHLENNKLTG  471

Query  216  EIAPSLGRIKSLRELFLQNNNLTGQIPGSIL  124
             I   LG + SL EL +QNN+LTG+IP S+L
Sbjct  472  PIPSYLGGLPSLLELDVQNNSLTGEIPSSLL  502



>ref|XP_009764239.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g67720 isoform X2 [Nicotiana sylvestris]
 ref|XP_009764240.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g67720 isoform X2 [Nicotiana sylvestris]
 ref|XP_009764241.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g67720 isoform X2 [Nicotiana sylvestris]
Length=879

 Score = 95.5 bits (236),  Expect = 4e-19, Method: Composition-based stats.
 Identities = 58/147 (39%), Positives = 86/147 (59%), Gaps = 3/147 (2%)
 Frame = -2

Query  561  RVLPLGGKTHTRDVIALEKLKE-GFENPPLDWNGDPCLPPQYSWTGVVCSGGTRIRVttl  385
            R   +  KT+ +DV  L   +     +   D +GDPC+P Q+ W  V CS     R+T +
Sbjct  310  RYSQIAAKTNEQDVTILNAFRSMSLGSDWTDEDGDPCIPAQWEW--VTCSTTLPPRITKI  367

Query  384  nltgmglsgmlssSIANLTALSGIWLGNNDLSGSTPDLSSLKRLEILHLEDNQIGGEIAP  205
             L+G  + G +   + ++  L+ +WL  N L+GS PDLS+L  L  +HLEDN++ G I  
Sbjct  368  TLSGKNVKGEIPPELNHMEGLTELWLDGNSLTGSIPDLSNLVNLRTIHLEDNKLTGPIPS  427

Query  204  SLGRIKSLRELFLQNNNLTGQIPGSIL  124
             LG + SL EL +QNN+LTG+IP S+L
Sbjct  428  YLGGLPSLIELDVQNNSLTGEIPPSLL  454



>ref|XP_009764238.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g67720 isoform X1 [Nicotiana sylvestris]
Length=930

 Score = 95.5 bits (236),  Expect = 4e-19, Method: Composition-based stats.
 Identities = 58/147 (39%), Positives = 86/147 (59%), Gaps = 3/147 (2%)
 Frame = -2

Query  561  RVLPLGGKTHTRDVIALEKLKE-GFENPPLDWNGDPCLPPQYSWTGVVCSGGTRIRVttl  385
            R   +  KT+ +DV  L   +     +   D +GDPC+P Q+ W  V CS     R+T +
Sbjct  361  RYSQIAAKTNEQDVTILNAFRSMSLGSDWTDEDGDPCIPAQWEW--VTCSTTLPPRITKI  418

Query  384  nltgmglsgmlssSIANLTALSGIWLGNNDLSGSTPDLSSLKRLEILHLEDNQIGGEIAP  205
             L+G  + G +   + ++  L+ +WL  N L+GS PDLS+L  L  +HLEDN++ G I  
Sbjct  419  TLSGKNVKGEIPPELNHMEGLTELWLDGNSLTGSIPDLSNLVNLRTIHLEDNKLTGPIPS  478

Query  204  SLGRIKSLRELFLQNNNLTGQIPGSIL  124
             LG + SL EL +QNN+LTG+IP S+L
Sbjct  479  YLGGLPSLIELDVQNNSLTGEIPPSLL  505



>ref|XP_007044946.1| Leucine-rich repeat protein kinase family protein isoform 2 [Theobroma 
cacao]
 gb|EOY00778.1| Leucine-rich repeat protein kinase family protein isoform 2 [Theobroma 
cacao]
Length=880

 Score = 95.1 bits (235),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 54/145 (37%), Positives = 91/145 (63%), Gaps = 3/145 (2%)
 Frame = -2

Query  549  LGGKTHTRDVIALEKLKE-GFENPPLDWNGDPCLPPQYSWTGVVCSGGTRIRVttlnltg  373
            +  KT  RDV AL  L+    E+   +  GDPC+P  + W  V+CS     R+T + L+G
Sbjct  314  IAAKTDRRDVTALNSLRSMSAESVWANEGGDPCVPAHWEW--VICSSTAPPRITKIALSG  371

Query  372  mglsgmlssSIANLTALSGIWLGNNDLSGSTPDLSSLKRLEILHLEDNQIGGEIAPSLGR  193
              + G + S   ++  L+ +WL +N L+G  PD+S+   L+I+HLE+N++ G++   LGR
Sbjct  372  QNVKGQIPSEFNHMDELTELWLDSNSLTGPLPDMSNFINLKIVHLENNKLTGQLPSYLGR  431

Query  192  IKSLRELFLQNNNLTGQIPGSILGR  118
            + +L+EL++QNN+ +G+IP ++L R
Sbjct  432  LPNLQELYIQNNSFSGEIPQALLNR  456



>ref|XP_007044945.1| Leucine-rich repeat protein kinase family protein isoform 1 [Theobroma 
cacao]
 gb|EOY00777.1| Leucine-rich repeat protein kinase family protein isoform 1 [Theobroma 
cacao]
Length=932

 Score = 95.1 bits (235),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 54/145 (37%), Positives = 91/145 (63%), Gaps = 3/145 (2%)
 Frame = -2

Query  549  LGGKTHTRDVIALEKLKE-GFENPPLDWNGDPCLPPQYSWTGVVCSGGTRIRVttlnltg  373
            +  KT  RDV AL  L+    E+   +  GDPC+P  + W  V+CS     R+T + L+G
Sbjct  366  IAAKTDRRDVTALNSLRSMSAESVWANEGGDPCVPAHWEW--VICSSTAPPRITKIALSG  423

Query  372  mglsgmlssSIANLTALSGIWLGNNDLSGSTPDLSSLKRLEILHLEDNQIGGEIAPSLGR  193
              + G + S   ++  L+ +WL +N L+G  PD+S+   L+I+HLE+N++ G++   LGR
Sbjct  424  QNVKGQIPSEFNHMDELTELWLDSNSLTGPLPDMSNFINLKIVHLENNKLTGQLPSYLGR  483

Query  192  IKSLRELFLQNNNLTGQIPGSILGR  118
            + +L+EL++QNN+ +G+IP ++L R
Sbjct  484  LPNLQELYIQNNSFSGEIPQALLNR  508



>gb|KFK41178.1| hypothetical protein AALP_AA2G095700 [Arabis alpina]
Length=930

 Score = 94.7 bits (234),  Expect = 8e-19, Method: Composition-based stats.
 Identities = 58/149 (39%), Positives = 87/149 (58%), Gaps = 7/149 (5%)
 Frame = -2

Query  561  RVLPLGGKTHTRDVIALEKLKEGFENPPLDW---NGDPCLPPQYSWTGVVCSGGTRIRVt  391
            + L +  KT   DV  L+ L     +P  DW    GDPC+P  +SW  V CS  +  RVT
Sbjct  366  KYLQISSKTDRSDVSVLDALCS--MSPDSDWANEGGDPCIPVLWSW--VNCSSTSPPRVT  421

Query  390  tlnltgmglsgmlssSIANLTALSGIWLGNNDLSGSTPDLSSLKRLEILHLEDNQIGGEI  211
             + L+   L G + + I  + AL+ +WL  N L+G+ PDLS L  L+I+HLE+NQ+ G +
Sbjct  422  KIVLSRKNLRGEVLAEINYMEALTELWLDGNGLTGNLPDLSKLVNLKIMHLENNQLSGSL  481

Query  210  APSLGRIKSLRELFLQNNNLTGQIPGSIL  124
             P L  + +L+EL+++NN+  G IP  +L
Sbjct  482  PPYLVHLPNLQELYIENNSFRGTIPSGLL  510



>gb|KFK41177.1| hypothetical protein AALP_AA2G095700 [Arabis alpina]
Length=934

 Score = 94.7 bits (234),  Expect = 8e-19, Method: Composition-based stats.
 Identities = 58/149 (39%), Positives = 87/149 (58%), Gaps = 7/149 (5%)
 Frame = -2

Query  561  RVLPLGGKTHTRDVIALEKLKEGFENPPLDW---NGDPCLPPQYSWTGVVCSGGTRIRVt  391
            + L +  KT   DV  L+ L     +P  DW    GDPC+P  +SW  V CS  +  RVT
Sbjct  366  KYLQISSKTDRSDVSVLDALCS--MSPDSDWANEGGDPCIPVLWSW--VNCSSTSPPRVT  421

Query  390  tlnltgmglsgmlssSIANLTALSGIWLGNNDLSGSTPDLSSLKRLEILHLEDNQIGGEI  211
             + L+   L G + + I  + AL+ +WL  N L+G+ PDLS L  L+I+HLE+NQ+ G +
Sbjct  422  KIVLSRKNLRGEVLAEINYMEALTELWLDGNGLTGNLPDLSKLVNLKIMHLENNQLSGSL  481

Query  210  APSLGRIKSLRELFLQNNNLTGQIPGSIL  124
             P L  + +L+EL+++NN+  G IP  +L
Sbjct  482  PPYLVHLPNLQELYIENNSFRGTIPSGLL  510



>ref|XP_010930016.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g67720 [Elaeis guineensis]
Length=932

 Score = 94.4 bits (233),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 52/131 (40%), Positives = 81/131 (62%), Gaps = 11/131 (8%)
 Frame = -2

Query  468  NGDPCLPPQYSWTGVVCSGGTRIRVttlnltgmglsgmlssSIANLTALSGIWLGNNDLS  289
            +GDPC P  + W  + CS     R+T + L+G  LSG + + I  +  L+ +WL +N L+
Sbjct  393  DGDPCTPAHWEW--INCSSSMPPRITKIFLSGKNLSGAIPADIKQMEQLTELWLDDNSLN  450

Query  288  GSTPDLSSLKRLEILHLEDNQIGGEIAPSLGRIKSLRELFLQNNNLTGQIPGSIL-----  124
            G  PD+SSL  LE++HLE+N++ G++    G++ SLREL++QNN L+G IP ++L     
Sbjct  451  GPIPDMSSLINLEVMHLENNELTGQLPSYFGKLPSLRELYVQNNYLSGDIPPALLNGKFI  510

Query  123  ----GRPGINL  103
                G PG+ L
Sbjct  511  FNYDGNPGLRL  521



>emb|CDP13280.1| unnamed protein product [Coffea canephora]
Length=929

 Score = 94.4 bits (233),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 54/147 (37%), Positives = 89/147 (61%), Gaps = 3/147 (2%)
 Frame = -2

Query  561  RVLPLGGKTHTRDVIALEKLKE-GFENPPLDWNGDPCLPPQYSWTGVVCSGGTRIRVttl  385
            R + +  KT  +DV  L  ++    E+   D  GDPC+P  + W  V CS     R+T +
Sbjct  360  RYVEIAAKTDDKDVSTLNVIRSMSTESDWTDEQGDPCIPMPWEW--VNCSDTVPPRITII  417

Query  384  nltgmglsgmlssSIANLTALSGIWLGNNDLSGSTPDLSSLKRLEILHLEDNQIGGEIAP  205
             L+G  + G + S + N+  L+ +WL  N  +G  PDLS+L  L+I+HLE+N++ G +  
Sbjct  418  FLSGKNVKGEIPSELKNMEGLTELWLDGNFFTGPIPDLSNLVNLKIVHLENNKLTGPVPS  477

Query  204  SLGRIKSLRELFLQNNNLTGQIPGSIL  124
             +G + SL+E+++QNN+L+G+IP S+L
Sbjct  478  YIGSLPSLKEIYVQNNSLSGEIPASLL  504



>ref|XP_006391229.1| hypothetical protein EUTSA_v10018088mg [Eutrema salsugineum]
 gb|ESQ28515.1| hypothetical protein EUTSA_v10018088mg [Eutrema salsugineum]
Length=718

 Score = 93.6 bits (231),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 56/149 (38%), Positives = 88/149 (59%), Gaps = 7/149 (5%)
 Frame = -2

Query  561  RVLPLGGKTHTRDVIALEKLKEGFENPPLDW---NGDPCLPPQYSWTGVVCSGGTRIRVt  391
            + L +  +T   DV  L+ ++    +P  DW    GDPC+P  +SW  V CS  +  RVT
Sbjct  363  KYLQISVRTDRNDVSVLDAIRS--LSPDSDWANEGGDPCIPILWSW--VNCSSTSPPRVT  418

Query  390  tlnltgmglsgmlssSIANLTALSGIWLGNNDLSGSTPDLSSLKRLEILHLEDNQIGGEI  211
             + L+   L G +   I  + AL+ +WL  N+L+G  PD+S L  L+I+HLE+NQ+ G +
Sbjct  419  KIALSRKNLRGEILPDINYMEALTELWLDGNNLTGILPDMSKLVNLKIMHLENNQLSGSL  478

Query  210  APSLGRIKSLRELFLQNNNLTGQIPGSIL  124
             P L  + +L+ELF++NN+  G IP ++L
Sbjct  479  PPYLVHLPNLQELFVENNSFRGTIPSALL  507



>ref|XP_006852166.1| hypothetical protein AMTR_s00049p00092560 [Amborella trichopoda]
 gb|ERN13633.1| hypothetical protein AMTR_s00049p00092560 [Amborella trichopoda]
Length=932

 Score = 93.2 bits (230),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 61/156 (39%), Positives = 93/156 (60%), Gaps = 16/156 (10%)
 Frame = -2

Query  540  KTHTRDVIALEKLKEGFENPPLDW---NGDPCLPPQYSWTGVVCSGGTRIRVttlnltgm  370
            KT T+D  AL+ L+    +   DW    GD C+P  +SW  + C+ G+  R+T + L+G 
Sbjct  371  KTSTQDAAALDALRS--ISIGTDWMNEGGDACVPAHWSW--LDCNSGSPPRITKIFLSGK  426

Query  369  glsgmlssSIANLTALSGIWLGNNDLSGSTPDLSSLKRLEILHLEDNQIGGEIAPSLGRI  190
             LSG + S I  +  L+ +WL  N L+GS P LS+L  L +LHLE+N++ G +   LG +
Sbjct  427  NLSGEMPSEIKQMDFLTELWLNGNSLTGSIPGLSNLVSLTVLHLENNKLSGHLPSFLGEL  486

Query  189  KSLRELFLQNNNLTGQIPGSIL---------GRPGI  109
             +L+EL++QNN LTG+IP ++L         G PG+
Sbjct  487  PNLKELYVQNNLLTGEIPPALLAGKLAFYYDGNPGL  522



>gb|EPS70255.1| hypothetical protein M569_04504, partial [Genlisea aurea]
Length=562

 Score = 92.0 bits (227),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 59/147 (40%), Positives = 86/147 (59%), Gaps = 3/147 (2%)
 Frame = -2

Query  465  GDPCLPPQYSWTGVVCSGGTRIRVttlnltgmglsgmlssSIANLTALSGIWLGNNDLSG  286
            GDPCLP  ++W  V CS     R+T + L+   L+G +   + NL  L  +WL  N L G
Sbjct  20   GDPCLPVTWNW--VSCSSTAPPRITKILLSSSNLNGEIPKELNNLDGLIELWLDGNSLRG  77

Query  285  STPDLSSLKRLEILHLEDNQIGGEIAPSLGRIKSLRELFLQNNNLTGQIPGSILGRPGIN  106
              PDLS L  L+ILHLE+N+  G+I   LG++ +LREL++QNN+L+GQIP S+  +  + 
Sbjct  78   PIPDLSGLMNLKILHLENNEFSGQIPSYLGKLPNLRELYVQNNSLSGQIPPSLF-KGSLT  136

Query  105  LRTTPGNPFLSGPPA*RSVLISFSINY  25
                  NP L       SVL++  I++
Sbjct  137  TFNYSSNPHLRRASRAHSVLLAVGISF  163



>ref|XP_011094724.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g67720 [Sesamum indicum]
Length=926

 Score = 92.8 bits (229),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 54/116 (47%), Positives = 77/116 (66%), Gaps = 2/116 (2%)
 Frame = -2

Query  465  GDPCLPPQYSWTGVVCSGGTRIRVttlnltgmglsgmlssSIANLTALSGIWLGNNDLSG  286
            GDPCLP  +SW  V CS   + RVT++ L+G  LSG + +   NL  L  +WL NN LSG
Sbjct  394  GDPCLPAPWSW--VQCSSDQQPRVTSIKLSGKNLSGSIPAQFTNLDGLVELWLDNNSLSG  451

Query  285  STPDLSSLKRLEILHLEDNQIGGEIAPSLGRIKSLRELFLQNNNLTGQIPGSILGR  118
            S PD S    L+ +HLE+NQ+ G++  SL  + SLREL++QNN L+G++P ++L +
Sbjct  452  SIPDFSGCPNLKRIHLENNQLTGDLPASLADLSSLRELYVQNNMLSGEVPSALLNK  507



>ref|XP_004310014.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g67720-like [Fragaria vesca subsp. vesca]
Length=927

 Score = 92.8 bits (229),  Expect = 3e-18, Method: Composition-based stats.
 Identities = 55/160 (34%), Positives = 94/160 (59%), Gaps = 5/160 (3%)
 Frame = -2

Query  561  RVLPLGGKTHTRDVIALEKLK-EGFENPPLDWNGDPCLPPQYSWTGVVCSGGTRIRVttl  385
            + +P+  KT  +D   L  L+    E+  LD  GDPC+P  + W  V CS  T +R+T +
Sbjct  361  KYVPIAAKTDRQDFAVLNILRLMSSESLSLD-EGDPCVPTPWEW--VNCSTTTPLRITKI  417

Query  384  nltgmglsgmlssSIANLTALSGIWLGNNDLSGSTPDLSSLKRLEILHLEDNQIGGEIAP  205
            +L+G  + G +   + N+  L+ +WL  N  SG  PD+S+L  ++ILH+E+N++ G +  
Sbjct  418  DLSGRNMKGEIPLELNNMQELTELWLDGNSFSGPFPDISNLINIKILHIENNKLTGALPS  477

Query  204  SLGRIKSLRELFLQNNNLTGQIPGSIL-GRPGINLRTTPG  88
             L  + +L+EL++QNN+ +G+IP  +L G+     +  PG
Sbjct  478  YLDSLSNLQELYIQNNSFSGEIPAGLLTGKVTFEYKDNPG  517



>ref|XP_006300354.1| hypothetical protein CARUB_v10021974mg [Capsella rubella]
 gb|EOA33252.1| hypothetical protein CARUB_v10021974mg [Capsella rubella]
Length=929

 Score = 92.4 bits (228),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 58/149 (39%), Positives = 90/149 (60%), Gaps = 7/149 (5%)
 Frame = -2

Query  561  RVLPLGGKTHTRDVIALEKLKEGFENPPLDWN---GDPCLPPQYSWTGVVCSGGTRIRVt  391
            + L +  KT   DV AL+ ++    +P  DW    GDPC+P  +SW  V CS  +  RVT
Sbjct  362  KYLQISLKTDRNDVSALDAIR--LMSPDSDWANEGGDPCIPVLWSW--VNCSSTSPPRVT  417

Query  390  tlnltgmglsgmlssSIANLTALSGIWLGNNDLSGSTPDLSSLKRLEILHLEDNQIGGEI  211
             ++L+   L G +   I  + AL+ +WL  N L+G+ PD+S L  L+I+HLE+NQ+ G +
Sbjct  418  KIDLSRKNLKGEIPPGINYMEALTELWLDGNGLTGTLPDMSKLVNLKIMHLENNQLSGSL  477

Query  210  APSLGRIKSLRELFLQNNNLTGQIPGSIL  124
             P L  + +L+ELF++NN+  G IP ++L
Sbjct  478  PPYLSHLPNLQELFIENNSFRGTIPSALL  506



>gb|KHG03301.1| hypothetical protein F383_26873 [Gossypium arboreum]
Length=932

 Score = 92.4 bits (228),  Expect = 5e-18, Method: Composition-based stats.
 Identities = 57/156 (37%), Positives = 92/156 (59%), Gaps = 4/156 (3%)
 Frame = -2

Query  549  LGGKTHTRDVIALEKLKE-GFENPPLDWNGDPCLPPQYSWTGVVCSGGTRIRVttlnltg  373
            +  KT  +DV AL  ++    E+   +  GDPC+P  + W  V CS     R+T + L+G
Sbjct  365  IAAKTERQDVTALNAIRNMSAESVWANEGGDPCVPTHWEW--VNCSPTRPPRITKIALSG  422

Query  372  mglsgmlssSIANLTALSGIWLGNNDLSGSTPDLSSLKRLEILHLEDNQIGGEIAPSLGR  193
              L G + S I ++  L+ +WL  N L+G  PD+S+L  LEI+HLE+N++ G +   LGR
Sbjct  423  RNLKGQIPSEINHMEELTELWLDFNSLTGPLPDMSNLINLEIVHLENNKLTGSLPLYLGR  482

Query  192  IKSLRELFLQNNNLTGQIPGSILGRP-GINLRTTPG  88
            + +L+ L++QNN+ +G+IP ++L +    N    PG
Sbjct  483  LPNLQALYIQNNSFSGEIPAALLSKKISFNYEGNPG  518



>ref|XP_007225338.1| hypothetical protein PRUPE_ppa001029mg [Prunus persica]
 gb|EMJ26537.1| hypothetical protein PRUPE_ppa001029mg [Prunus persica]
Length=929

 Score = 92.0 bits (227),  Expect = 6e-18, Method: Composition-based stats.
 Identities = 55/143 (38%), Positives = 88/143 (62%), Gaps = 4/143 (3%)
 Frame = -2

Query  549  LGGKTHTRDVIALEKLK-EGFENPPLDWNGDPCLPPQYSWTGVVCSGGTRIRVttlnltg  373
            +  KT  +D+  L  L+    E+  +D  GDPC+P  + W  V CS  T +R+T ++L+G
Sbjct  365  IATKTDRQDLSVLNALRFMSAESLSVD-EGDPCVPTHWDW--VNCSSTTPLRITKIDLSG  421

Query  372  mglsgmlssSIANLTALSGIWLGNNDLSGSTPDLSSLKRLEILHLEDNQIGGEIAPSLGR  193
              + G +   + N+  L  +WL  N L+G  PD+SSL  L+ILHLE+N++ G +   LG 
Sbjct  422  KNVKGEIPLELNNMQELIELWLDGNYLTGPFPDISSLINLKILHLENNKLTGPLPSYLGS  481

Query  192  IKSLRELFLQNNNLTGQIPGSIL  124
            + SL+EL++QNN+ +G+IP  +L
Sbjct  482  LPSLQELYIQNNSFSGEIPAGLL  504



>ref|XP_009105317.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g67720 isoform X1 [Brassica rapa]
Length=931

 Score = 92.0 bits (227),  Expect = 7e-18, Method: Composition-based stats.
 Identities = 57/149 (38%), Positives = 87/149 (58%), Gaps = 7/149 (5%)
 Frame = -2

Query  561  RVLPLGGKTHTRDVIALEKLKEGFENPPLDW---NGDPCLPPQYSWTGVVCSGGTRIRVt  391
            + L +  KT   DV  L+ ++    +P  DW    GDPC+P  +SW  V CS  +  RVT
Sbjct  364  KYLQISLKTDKTDVSVLDAIR--LMSPDSDWANEGGDPCVPVLWSW--VSCSSTSPPRVT  419

Query  390  tlnltgmglsgmlssSIANLTALSGIWLGNNDLSGSTPDLSSLKRLEILHLEDNQIGGEI  211
             + L+   L G +   I ++ AL+ + L  N L+G+ PDLS L  L+I+HLE+NQ+ G +
Sbjct  420  KIALSRKNLRGEILPDINHMEALTELRLDGNGLTGTLPDLSKLVNLKIMHLENNQLSGSL  479

Query  210  APSLGRIKSLRELFLQNNNLTGQIPGSIL  124
               LG + +L+ELF+ NN+  G IP ++L
Sbjct  480  PAYLGHLPNLQELFINNNSFRGTIPSALL  508



>ref|XP_009605521.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g67720 isoform X2 [Nicotiana tomentosiformis]
 ref|XP_009605522.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g67720 isoform X2 [Nicotiana tomentosiformis]
Length=879

 Score = 91.7 bits (226),  Expect = 7e-18, Method: Composition-based stats.
 Identities = 57/147 (39%), Positives = 84/147 (57%), Gaps = 3/147 (2%)
 Frame = -2

Query  561  RVLPLGGKTHTRDVIALEKLKE-GFENPPLDWNGDPCLPPQYSWTGVVCSGGTRIRVttl  385
            R   +  KT  +DV  L   +     +   D +GDPC+  Q+ W  V CS     R+T +
Sbjct  310  RYAQIAAKTDEQDVTTLNAFRSMSLGSDWTDEDGDPCVGTQWEW--VTCSTTIPPRITKI  367

Query  384  nltgmglsgmlssSIANLTALSGIWLGNNDLSGSTPDLSSLKRLEILHLEDNQIGGEIAP  205
             L+G  + G +   + ++  L+ +WL  N L+GS PDLS+L  L  +HLEDN++ G I  
Sbjct  368  TLSGKNVKGEIPPELNHMEGLTELWLDGNSLTGSIPDLSNLVNLRTIHLEDNKLTGPIPS  427

Query  204  SLGRIKSLRELFLQNNNLTGQIPGSIL  124
             LG + SL EL +QNN+LTG+IP S+L
Sbjct  428  YLGGLPSLIELDVQNNSLTGEIPPSLL  454



>ref|XP_010682389.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g67720 isoform X2 [Beta vulgaris subsp. vulgaris]
Length=929

 Score = 91.7 bits (226),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 58/164 (35%), Positives = 95/164 (58%), Gaps = 5/164 (3%)
 Frame = -2

Query  561  RVLPLGGKTHTRDVIALEKLKEGFENPPLDWN-GDPCLPPQYSWTGVVCSGGTRIRVttl  385
            + + +G KT  +DVIAL  ++          + GDPC P  + W  V+CS     R+  +
Sbjct  361  KYVKIGSKTDAQDVIALNAVRAMLPASLGKQDEGDPCSPTHWEW--VICSSTAPPRILEI  418

Query  384  nltgmglsgmlssSIANLTALSGIWLGNNDLSGSTPDLSSLKRLEILHLEDNQIGGEIAP  205
            +L+   L+G +   I N+ AL+ +WL  N L+G  PD+S+L  L+I+H+E+N + G +  
Sbjct  419  HLSQRNLTGNIPPEIENMDALTDLWLDGNSLTGRIPDISNLINLKIVHIENNGLNGPLPS  478

Query  204  SLGRIKSLRELFLQNNNLTGQIPGSILGRPGINLRTTPGNPFLS  73
             LG + SL+EL++QNN   G+IP ++LG+  +      GNP L+
Sbjct  479  YLGSLPSLQELYIQNNFFNGKIPPALLGKKIV--FNYDGNPRLT  520



>ref|XP_009605520.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g67720 isoform X1 [Nicotiana tomentosiformis]
Length=930

 Score = 91.7 bits (226),  Expect = 7e-18, Method: Composition-based stats.
 Identities = 57/147 (39%), Positives = 84/147 (57%), Gaps = 3/147 (2%)
 Frame = -2

Query  561  RVLPLGGKTHTRDVIALEKLKE-GFENPPLDWNGDPCLPPQYSWTGVVCSGGTRIRVttl  385
            R   +  KT  +DV  L   +     +   D +GDPC+  Q+ W  V CS     R+T +
Sbjct  361  RYAQIAAKTDEQDVTTLNAFRSMSLGSDWTDEDGDPCVGTQWEW--VTCSTTIPPRITKI  418

Query  384  nltgmglsgmlssSIANLTALSGIWLGNNDLSGSTPDLSSLKRLEILHLEDNQIGGEIAP  205
             L+G  + G +   + ++  L+ +WL  N L+GS PDLS+L  L  +HLEDN++ G I  
Sbjct  419  TLSGKNVKGEIPPELNHMEGLTELWLDGNSLTGSIPDLSNLVNLRTIHLEDNKLTGPIPS  478

Query  204  SLGRIKSLRELFLQNNNLTGQIPGSIL  124
             LG + SL EL +QNN+LTG+IP S+L
Sbjct  479  YLGGLPSLIELDVQNNSLTGEIPPSLL  505



>ref|XP_010682388.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g67720 isoform X1 [Beta vulgaris subsp. vulgaris]
Length=943

 Score = 91.7 bits (226),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 58/164 (35%), Positives = 95/164 (58%), Gaps = 5/164 (3%)
 Frame = -2

Query  561  RVLPLGGKTHTRDVIALEKLKEGFENPPLDWN-GDPCLPPQYSWTGVVCSGGTRIRVttl  385
            + + +G KT  +DVIAL  ++          + GDPC P  + W  V+CS     R+  +
Sbjct  361  KYVKIGSKTDAQDVIALNAVRAMLPASLGKQDEGDPCSPTHWEW--VICSSTAPPRILEI  418

Query  384  nltgmglsgmlssSIANLTALSGIWLGNNDLSGSTPDLSSLKRLEILHLEDNQIGGEIAP  205
            +L+   L+G +   I N+ AL+ +WL  N L+G  PD+S+L  L+I+H+E+N + G +  
Sbjct  419  HLSQRNLTGNIPPEIENMDALTDLWLDGNSLTGRIPDISNLINLKIVHIENNGLNGPLPS  478

Query  204  SLGRIKSLRELFLQNNNLTGQIPGSILGRPGINLRTTPGNPFLS  73
             LG + SL+EL++QNN   G+IP ++LG+  +      GNP L+
Sbjct  479  YLGSLPSLQELYIQNNFFNGKIPPALLGKKIV--FNYDGNPRLT  520



>ref|XP_009105318.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g67720 isoform X2 [Brassica rapa]
Length=861

 Score = 91.7 bits (226),  Expect = 9e-18, Method: Composition-based stats.
 Identities = 57/149 (38%), Positives = 87/149 (58%), Gaps = 7/149 (5%)
 Frame = -2

Query  561  RVLPLGGKTHTRDVIALEKLKEGFENPPLDW---NGDPCLPPQYSWTGVVCSGGTRIRVt  391
            + L +  KT   DV  L+ ++    +P  DW    GDPC+P  +SW  V CS  +  RVT
Sbjct  364  KYLQISLKTDKTDVSVLDAIR--LMSPDSDWANEGGDPCVPVLWSW--VSCSSTSPPRVT  419

Query  390  tlnltgmglsgmlssSIANLTALSGIWLGNNDLSGSTPDLSSLKRLEILHLEDNQIGGEI  211
             + L+   L G +   I ++ AL+ + L  N L+G+ PDLS L  L+I+HLE+NQ+ G +
Sbjct  420  KIALSRKNLRGEILPDINHMEALTELRLDGNGLTGTLPDLSKLVNLKIMHLENNQLSGSL  479

Query  210  APSLGRIKSLRELFLQNNNLTGQIPGSIL  124
               LG + +L+ELF+ NN+  G IP ++L
Sbjct  480  PAYLGHLPNLQELFINNNSFRGTIPSALL  508



>gb|EYU25957.1| hypothetical protein MIMGU_mgv1a000970mg [Erythranthe guttata]
Length=927

 Score = 91.7 bits (226),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 62/176 (35%), Positives = 99/176 (56%), Gaps = 9/176 (5%)
 Frame = -2

Query  561  RVLPLGGKTHTRDVIALEKLKEGFENPPLDWN---GDPCLPPQYSWTGVVCSGGTRIRVt  391
            R + +  KT  +DV  L+ L    E    +W    GDPCLP  + W  + CS  +  R+T
Sbjct  365  RYVEIATKTDEKDVSGLDALLAMSEQS--EWANEGGDPCLPTNWEW--LTCSATSPPRIT  420

Query  390  tlnltgmglsgmlssSIANLTALSGIWLGNNDLSGSTPDLSSLKRLEILHLEDNQIGGEI  211
             + L+G  ++G +   + ++  L+ +WL  N   G+ PD+S L  L+ILHLE+NQ+ G +
Sbjct  421  KIFLSGKNVTGEIPREVNSMEGLTELWLDGNSFIGTIPDMSDLVNLKILHLENNQLTGSL  480

Query  210  APSLGRIKSLRELFLQNNNLTGQIPGSILGRPGINLRTTPGNPFLSGPPA*RSVLI  43
               L ++  L+EL++QNN+L+G+IP S+L R  +   +  GNP L      RS +I
Sbjct  481  PSYLSKLPYLQELYVQNNSLSGEIPSSLL-RGNLTF-SYEGNPHLKRTTKKRSRVI  534



>gb|EMS48998.1| hypothetical protein TRIUR3_02651 [Triticum urartu]
Length=346

 Score = 88.6 bits (218),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 50/82 (61%), Positives = 58/82 (71%), Gaps = 0/82 (0%)
 Frame = -2

Query  558  VLPLGGKTHTRDVIALEKLKEGFENPPLDWNGDPCLPPQYSWTGVVCSGGTRIRVttlnl  379
            V+PLGG+TH RDVI +E L  GF NPP DW+GDPCLP   SWTGV CS G   RVT LNL
Sbjct  118  VVPLGGRTHPRDVIGMEGLARGFANPPSDWSGDPCLPVGNSWTGVSCSQGALARVTALNL  177

Query  378  tgmglsgmlssSIANLTALSGI  313
            T   + G +S  IANLTA+S +
Sbjct  178  TNFSVEGSISDHIANLTAISSV  199



>ref|XP_008368257.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g67720 [Malus domestica]
Length=929

 Score = 91.3 bits (225),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 55/147 (37%), Positives = 86/147 (59%), Gaps = 4/147 (3%)
 Frame = -2

Query  561  RVLPLGGKTHTRDVIALEKLK-EGFENPPLDWNGDPCLPPQYSWTGVVCSGGTRIRVttl  385
            + + +  KT  RD+  L  L     E+  +D  GDPC P  + W  V CS     R+T +
Sbjct  361  KYVQIAAKTDRRDLAVLNVLHFMAAESLSVD-EGDPCAPTPWEW--VNCSSTAPPRITKI  417

Query  384  nltgmglsgmlssSIANLTALSGIWLGNNDLSGSTPDLSSLKRLEILHLEDNQIGGEIAP  205
            +L+G  + G +   + NL  L+ +WLG N L+G  PD+S+L  L+ILHLE+N++ G    
Sbjct  418  DLSGQNVKGEIPVELKNLQXLTELWLGGNYLTGQFPDISNLINLKILHLENNKLSGSXPS  477

Query  204  SLGRIKSLRELFLQNNNLTGQIPGSIL  124
             L  + SL+EL++QNN+ +G+IP  +L
Sbjct  478  YLASLPSLQELYIQNNSFSGEIPAGLL  504



>ref|XP_006484013.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g67720-like [Citrus sinensis]
Length=931

 Score = 90.9 bits (224),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 53/143 (37%), Positives = 87/143 (61%), Gaps = 3/143 (2%)
 Frame = -2

Query  549  LGGKTHTRDVIALEKLKE-GFENPPLDWNGDPCLPPQYSWTGVVCSGGTRIRVttlnltg  373
            +  KT  +DV+ LE L+    E+   +  GDPC+P  + W  V CS  T  R+T + L+G
Sbjct  365  IAAKTEWQDVMVLEALRSISDESERTNDRGDPCVPVPWEW--VTCSTTTPPRITKIALSG  422

Query  372  mglsgmlssSIANLTALSGIWLGNNDLSGSTPDLSSLKRLEILHLEDNQIGGEIAPSLGR  193
              L G +   + N+ AL+ +WL  N L+G  PD+S L  L+I+HLE+N++ G +   +G 
Sbjct  423  KNLKGEIPPELKNMEALTELWLDGNFLTGPLPDMSRLINLKIVHLENNELTGSLPSYMGS  482

Query  192  IKSLRELFLQNNNLTGQIPGSIL  124
            + +L+EL ++NN+  G+IP ++L
Sbjct  483  LPNLQELHIENNSFVGEIPPALL  505



>gb|AAG28906.1|AC008113_22 F12A21.14 [Arabidopsis thaliana]
Length=1184

 Score = 90.9 bits (224),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 50/149 (34%), Positives = 80/149 (54%), Gaps = 31/149 (21%)
 Frame = -2

Query  561  RVLPLGGKTHTRDVIALEKLKEGFENPPLDW---NGDPCLPPQYSWTGVVCSGGTRIRVt  391
            + LP+  KT   DV  L+ ++    +P  DW    GDPC+P  +SW  V CS  +  RV 
Sbjct  357  KYLPISVKTDRSDVSVLDAIRS--MSPDSDWASEGGDPCIPVLWSW--VNCSSTSPPRV-  411

Query  390  tlnltgmglsgmlssSIANLTALSGIWLGNNDLSGSTPDLSSLKRLEILHLEDNQIGGEI  211
                                   + +WL +N+L+G+ PD+S L  L+I+HLE+NQ+ G +
Sbjct  412  -----------------------TKMWLDDNELTGTLPDMSKLVNLKIMHLENNQLSGSL  448

Query  210  APSLGRIKSLRELFLQNNNLTGQIPGSIL  124
             P L  + +L+EL ++NN+  G+IP ++L
Sbjct  449  PPYLAHLPNLQELSIENNSFKGKIPSALL  477



>emb|CDX79713.1| BnaC03g20490D [Brassica napus]
Length=933

 Score = 90.9 bits (224),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 53/113 (47%), Positives = 74/113 (65%), Gaps = 2/113 (2%)
 Frame = -2

Query  465  GDPCLPPQYSWTGVVCSGGTRIRVttlnltgmglsgmlssSIANLTALSGIWLGNNDLSG  286
            GDPCLP  +SW  V CS   + RV T+ L+ M L+G + S +  LT L  + L  N L+G
Sbjct  399  GDPCLPSPWSW--VTCSSDPQPRVVTVKLSDMNLTGEIPSELTQLTGLVELLLDGNSLTG  456

Query  285  STPDLSSLKRLEILHLEDNQIGGEIAPSLGRIKSLRELFLQNNNLTGQIPGSI  127
            S PD S    L+I+HLE+N++ G+I  SL ++ +L EL+LQNN LTG+IP S+
Sbjct  457  SIPDFSRCLNLKIIHLENNRLTGKIPSSLAKLPNLTELYLQNNMLTGEIPSSL  509



>ref|XP_006438153.1| hypothetical protein CICLE_v10030677mg [Citrus clementina]
 gb|ESR51393.1| hypothetical protein CICLE_v10030677mg [Citrus clementina]
Length=673

 Score = 90.5 bits (223),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 53/143 (37%), Positives = 87/143 (61%), Gaps = 3/143 (2%)
 Frame = -2

Query  549  LGGKTHTRDVIALEKLKE-GFENPPLDWNGDPCLPPQYSWTGVVCSGGTRIRVttlnltg  373
            +  KT  +DV+ LE L+    E+   +  GDPC+P  + W  V CS  T  R+T + L+G
Sbjct  314  IAAKTEWQDVMVLEALRSISDESEWTNDRGDPCVPVPWEW--VTCSTTTPPRITKIALSG  371

Query  372  mglsgmlssSIANLTALSGIWLGNNDLSGSTPDLSSLKRLEILHLEDNQIGGEIAPSLGR  193
              L G +   + N+ AL+ +WL  N L+G  PD+S L  L+I+HLE+N++ G +   +G 
Sbjct  372  KNLKGEIPPELKNMEALTELWLDGNFLTGPLPDMSRLINLKIVHLENNELTGSLPSYMGS  431

Query  192  IKSLRELFLQNNNLTGQIPGSIL  124
            + +L+EL ++NN+  G+IP ++L
Sbjct  432  LPNLQELHIENNSFVGEIPPALL  454



>gb|KDO82074.1| hypothetical protein CISIN_1g002336mg [Citrus sinensis]
Length=724

 Score = 90.5 bits (223),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 53/143 (37%), Positives = 86/143 (60%), Gaps = 3/143 (2%)
 Frame = -2

Query  549  LGGKTHTRDVIALEKLKE-GFENPPLDWNGDPCLPPQYSWTGVVCSGGTRIRVttlnltg  373
            +  KT  +DV+ LE L+    E+   +  GDPC+P  + W  V CS  T  R+T + L+G
Sbjct  365  IAAKTEWQDVMVLEALRSISDESERTNDRGDPCVPVPWEW--VTCSTTTPPRITKIALSG  422

Query  372  mglsgmlssSIANLTALSGIWLGNNDLSGSTPDLSSLKRLEILHLEDNQIGGEIAPSLGR  193
              L G +   + N+ AL+ +WL  N L+G  PD+S L  L I+HLE+N++ G +   +G 
Sbjct  423  KNLKGEIPPELKNMEALTELWLDGNFLTGPLPDMSRLIDLRIVHLENNELTGSLPSYMGS  482

Query  192  IKSLRELFLQNNNLTGQIPGSIL  124
            + +L+EL ++NN+  G+IP ++L
Sbjct  483  LPNLQELHIENNSFVGEIPPALL  505



>gb|KEH35279.1| LRR receptor-like kinase [Medicago truncatula]
Length=825

 Score = 90.5 bits (223),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 53/141 (38%), Positives = 83/141 (59%), Gaps = 11/141 (8%)
 Frame = -2

Query  465  GDPCLPPQYSWTGVVCSGGTRIRVttlnltgmglsgmlssSIANLTALSGIWLGNNDLSG  286
            GDPC+P  + W  V CS  T  R+T +NL+G  L+G +   + N+ AL+ +WL  N L+G
Sbjct  394  GDPCVPTPWEW--VNCSTATPARITNINLSGRNLTGEIPRELNNMEALTELWLDRNLLTG  451

Query  285  STPDLSSLKRLEILHLEDNQIGGEIAPSLGRIKSLRELFLQNNNLTGQIPGSILG-----  121
              PD+S+L  L+I+HLE+N++ G +   LG +  L+ L++QNN+ TG IP  +L      
Sbjct  452  QLPDMSNLINLKIMHLENNKLTGPLPTYLGSLPGLQALYIQNNSFTGDIPAGLLSTKITF  511

Query  120  ----RPGINLRTTPGNPFLSG  70
                 PG++ R+    P + G
Sbjct  512  IYDDNPGLHKRSKKHFPLMIG  532



>ref|XP_006438152.1| hypothetical protein CICLE_v10030677mg [Citrus clementina]
 gb|ESR51392.1| hypothetical protein CICLE_v10030677mg [Citrus clementina]
Length=880

 Score = 90.5 bits (223),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 53/143 (37%), Positives = 87/143 (61%), Gaps = 3/143 (2%)
 Frame = -2

Query  549  LGGKTHTRDVIALEKLKE-GFENPPLDWNGDPCLPPQYSWTGVVCSGGTRIRVttlnltg  373
            +  KT  +DV+ LE L+    E+   +  GDPC+P  + W  V CS  T  R+T + L+G
Sbjct  314  IAAKTEWQDVMVLEALRSISDESEWTNDRGDPCVPVPWEW--VTCSTTTPPRITKIALSG  371

Query  372  mglsgmlssSIANLTALSGIWLGNNDLSGSTPDLSSLKRLEILHLEDNQIGGEIAPSLGR  193
              L G +   + N+ AL+ +WL  N L+G  PD+S L  L+I+HLE+N++ G +   +G 
Sbjct  372  KNLKGEIPPELKNMEALTELWLDGNFLTGPLPDMSRLINLKIVHLENNELTGSLPSYMGS  431

Query  192  IKSLRELFLQNNNLTGQIPGSIL  124
            + +L+EL ++NN+  G+IP ++L
Sbjct  432  LPNLQELHIENNSFVGEIPPALL  454



>ref|XP_002311739.2| leucine-rich repeat family protein [Populus trichocarpa]
 gb|EEE89106.2| leucine-rich repeat family protein [Populus trichocarpa]
Length=932

 Score = 90.5 bits (223),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 58/162 (36%), Positives = 90/162 (56%), Gaps = 8/162 (5%)
 Frame = -2

Query  561  RVLPLGGKTHTRDVIALEKLKEGFENPPLDW---NGDPCLPPQYSWTGVVCSGGTRIRVt  391
            + L +  KT ++DV  L  L+  F +    W    GDPC+P  + W  V CS  T  R+T
Sbjct  361  KYLKIEPKTDSKDVTVLNALR--FLSAESAWANEQGDPCVPAHWEW--VNCSSTTPPRIT  416

Query  390  tlnltgmglsgmlssSIANLTALSGIWLGNNDLSGSTPDLSSLKRLEILHLEDNQIGGEI  211
             + L+G  L G +   I N+  L+ +WL  N L+G  P +S+L  L+I+HLE+N++ G +
Sbjct  417  KIALSGKNLKGEIPPEINNMEQLTELWLDGNFLTGPIPGISNLVNLKIVHLENNKLNGPL  476

Query  210  APSLGRIKSLRELFLQNNNLTGQIPGSIL-GRPGINLRTTPG  88
               LG +  L+ L++QNN+ +G+IP   L G+   N    PG
Sbjct  477  PKYLGSLPKLQALYIQNNSFSGEIPSEFLTGKVIFNYEHNPG  518



>gb|KDO82072.1| hypothetical protein CISIN_1g002336mg [Citrus sinensis]
Length=931

 Score = 90.1 bits (222),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 53/143 (37%), Positives = 86/143 (60%), Gaps = 3/143 (2%)
 Frame = -2

Query  549  LGGKTHTRDVIALEKLKE-GFENPPLDWNGDPCLPPQYSWTGVVCSGGTRIRVttlnltg  373
            +  KT  +DV+ LE L+    E+   +  GDPC+P  + W  V CS  T  R+T + L+G
Sbjct  365  IAAKTEWQDVMVLEALRSISDESERTNDRGDPCVPVPWEW--VTCSTTTPPRITKIALSG  422

Query  372  mglsgmlssSIANLTALSGIWLGNNDLSGSTPDLSSLKRLEILHLEDNQIGGEIAPSLGR  193
              L G +   + N+ AL+ +WL  N L+G  PD+S L  L I+HLE+N++ G +   +G 
Sbjct  423  KNLKGEIPPELKNMEALTELWLDGNFLTGPLPDMSRLIDLRIVHLENNELTGSLPSYMGS  482

Query  192  IKSLRELFLQNNNLTGQIPGSIL  124
            + +L+EL ++NN+  G+IP ++L
Sbjct  483  LPNLQELHIENNSFVGEIPPALL  505



>gb|KDO82076.1| hypothetical protein CISIN_1g002336mg [Citrus sinensis]
Length=880

 Score = 90.1 bits (222),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 53/143 (37%), Positives = 86/143 (60%), Gaps = 3/143 (2%)
 Frame = -2

Query  549  LGGKTHTRDVIALEKLKE-GFENPPLDWNGDPCLPPQYSWTGVVCSGGTRIRVttlnltg  373
            +  KT  +DV+ LE L+    E+   +  GDPC+P  + W  V CS  T  R+T + L+G
Sbjct  314  IAAKTEWQDVMVLEALRSISDESERTNDRGDPCVPVPWEW--VTCSTTTPPRITKIALSG  371

Query  372  mglsgmlssSIANLTALSGIWLGNNDLSGSTPDLSSLKRLEILHLEDNQIGGEIAPSLGR  193
              L G +   + N+ AL+ +WL  N L+G  PD+S L  L I+HLE+N++ G +   +G 
Sbjct  372  KNLKGEIPPELKNMEALTELWLDGNFLTGPLPDMSRLIDLRIVHLENNELTGSLPSYMGS  431

Query  192  IKSLRELFLQNNNLTGQIPGSIL  124
            + +L+EL ++NN+  G+IP ++L
Sbjct  432  LPNLQELHIENNSFVGEIPPALL  454



>gb|KDO82071.1| hypothetical protein CISIN_1g002336mg [Citrus sinensis]
Length=935

 Score = 90.1 bits (222),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 53/143 (37%), Positives = 86/143 (60%), Gaps = 3/143 (2%)
 Frame = -2

Query  549  LGGKTHTRDVIALEKLKE-GFENPPLDWNGDPCLPPQYSWTGVVCSGGTRIRVttlnltg  373
            +  KT  +DV+ LE L+    E+   +  GDPC+P  + W  V CS  T  R+T + L+G
Sbjct  365  IAAKTEWQDVMVLEALRSISDESERTNDRGDPCVPVPWEW--VTCSTTTPPRITKIALSG  422

Query  372  mglsgmlssSIANLTALSGIWLGNNDLSGSTPDLSSLKRLEILHLEDNQIGGEIAPSLGR  193
              L G +   + N+ AL+ +WL  N L+G  PD+S L  L I+HLE+N++ G +   +G 
Sbjct  423  KNLKGEIPPELKNMEALTELWLDGNFLTGPLPDMSRLIDLRIVHLENNELTGSLPSYMGS  482

Query  192  IKSLRELFLQNNNLTGQIPGSIL  124
            + +L+EL ++NN+  G+IP ++L
Sbjct  483  LPNLQELHIENNSFVGEIPPALL  505



>ref|XP_009133111.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g67720 isoform X1 [Brassica rapa]
 ref|XP_009133112.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g67720 isoform X1 [Brassica rapa]
 ref|XP_009133113.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g67720 isoform X1 [Brassica rapa]
Length=933

 Score = 90.1 bits (222),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 52/113 (46%), Positives = 73/113 (65%), Gaps = 2/113 (2%)
 Frame = -2

Query  465  GDPCLPPQYSWTGVVCSGGTRIRVttlnltgmglsgmlssSIANLTALSGIWLGNNDLSG  286
            GDPCLP  +SW  V CS   + RV  + L+ M L+G + S +  LT L  + L  N L+G
Sbjct  399  GDPCLPSPWSW--VTCSSDPQPRVVAVKLSEMNLTGDIPSELTQLTGLVELMLDGNSLTG  456

Query  285  STPDLSSLKRLEILHLEDNQIGGEIAPSLGRIKSLRELFLQNNNLTGQIPGSI  127
            S PD S    L+I+HLE+N++ G+I  SL ++ +L EL+LQNN LTG+IP S+
Sbjct  457  SIPDFSRCLNLKIIHLENNRLTGKIPSSLAKLPNLTELYLQNNLLTGKIPSSL  509



>ref|XP_009133114.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g67720 isoform X2 [Brassica rapa]
Length=928

 Score = 90.1 bits (222),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 52/113 (46%), Positives = 73/113 (65%), Gaps = 2/113 (2%)
 Frame = -2

Query  465  GDPCLPPQYSWTGVVCSGGTRIRVttlnltgmglsgmlssSIANLTALSGIWLGNNDLSG  286
            GDPCLP  +SW  V CS   + RV  + L+ M L+G + S +  LT L  + L  N L+G
Sbjct  394  GDPCLPSPWSW--VTCSSDPQPRVVAVKLSEMNLTGDIPSELTQLTGLVELMLDGNSLTG  451

Query  285  STPDLSSLKRLEILHLEDNQIGGEIAPSLGRIKSLRELFLQNNNLTGQIPGSI  127
            S PD S    L+I+HLE+N++ G+I  SL ++ +L EL+LQNN LTG+IP S+
Sbjct  452  SIPDFSRCLNLKIIHLENNRLTGKIPSSLAKLPNLTELYLQNNLLTGKIPSSL  504



>emb|CDY46751.1| BnaA03g16950D [Brassica napus]
Length=932

 Score = 90.1 bits (222),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 52/113 (46%), Positives = 73/113 (65%), Gaps = 2/113 (2%)
 Frame = -2

Query  465  GDPCLPPQYSWTGVVCSGGTRIRVttlnltgmglsgmlssSIANLTALSGIWLGNNDLSG  286
            GDPCLP  +SW  V CS   + RV  + L+ M L+G + S +  LT L  + L  N L+G
Sbjct  399  GDPCLPSPWSW--VTCSSDPQPRVVAVKLSDMNLTGDIPSELTQLTGLVELLLDGNSLTG  456

Query  285  STPDLSSLKRLEILHLEDNQIGGEIAPSLGRIKSLRELFLQNNNLTGQIPGSI  127
            S PD S    L+I+HLE+N++ G+I  SL ++ +L EL+LQNN LTG+IP S+
Sbjct  457  SIPDFSRCLNLKIIHLENNRLTGKIPSSLAKLPNLTELYLQNNLLTGKIPSSL  509



>ref|XP_006580105.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g67720-like [Glycine max]
Length=931

 Score = 89.7 bits (221),  Expect = 4e-17, Method: Composition-based stats.
 Identities = 45/116 (39%), Positives = 75/116 (65%), Gaps = 2/116 (2%)
 Frame = -2

Query  465  GDPCLPPQYSWTGVVCSGGTRIRVttlnltgmglsgmlssSIANLTALSGIWLGNNDLSG  286
            GDPC+P  + W  V CS  T  R+T + L+   + G + S ++N+ AL+ +WL  N L+G
Sbjct  393  GDPCVPTPWEW--VNCSTTTPPRITKIILSRRNVKGEIPSELSNMEALTELWLDGNLLTG  450

Query  285  STPDLSSLKRLEILHLEDNQIGGEIAPSLGRIKSLRELFLQNNNLTGQIPGSILGR  118
              PD+S L  L+I+HLE+N++ G +   +G + SL+ LF+QNN+ +G+IP  ++ +
Sbjct  451  QLPDMSKLINLKIVHLENNKLTGRLPSDMGSLPSLQALFIQNNSFSGEIPAGLISK  506



>ref|XP_007158729.1| hypothetical protein PHAVU_002G177200g [Phaseolus vulgaris]
 gb|ESW30723.1| hypothetical protein PHAVU_002G177200g [Phaseolus vulgaris]
Length=935

 Score = 89.7 bits (221),  Expect = 4e-17, Method: Composition-based stats.
 Identities = 47/128 (37%), Positives = 78/128 (61%), Gaps = 11/128 (9%)
 Frame = -2

Query  465  GDPCLPPQYSWTGVVCSGGTRIRVttlnltgmglsgmlssSIANLTALSGIWLGNNDLSG  286
            GDPC+P  + W  V CS  T  R+T + ++   + G +   ++N+ AL+ +WL  N L+G
Sbjct  393  GDPCVPTPWEW--VNCSTTTPPRITKIIMSRRNVKGEIPPELSNMEALTELWLDGNLLTG  450

Query  285  STPDLSSLKRLEILHLEDNQIGGEIAPSLGRIKSLRELFLQNNNLTGQIPGSIL------  124
              PD+S L  L+I+HLE+N++ G ++  LG + SL+ LF+QNN+ +G+IP  ++      
Sbjct  451  PLPDMSKLINLKIVHLENNKLSGRLSSYLGSLPSLQALFIQNNSFSGEIPAGLVSEKIIF  510

Query  123  ---GRPGI  109
               G PG+
Sbjct  511  DFEGNPGL  518



>ref|XP_011029602.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g67720 isoform X1 [Populus euphratica]
Length=963

 Score = 89.7 bits (221),  Expect = 5e-17, Method: Composition-based stats.
 Identities = 57/162 (35%), Positives = 90/162 (56%), Gaps = 8/162 (5%)
 Frame = -2

Query  561  RVLPLGGKTHTRDVIALEKLKEGFENPPLDW---NGDPCLPPQYSWTGVVCSGGTRIRVt  391
            + L +  KT ++DV  L  L+  F +    W    GDPC+P  + W  V CS  +  R+T
Sbjct  361  KYLKIEPKTDSKDVTVLNALR--FLSAESAWANEQGDPCVPAHWEW--VNCSSTSPPRIT  416

Query  390  tlnltgmglsgmlssSIANLTALSGIWLGNNDLSGSTPDLSSLKRLEILHLEDNQIGGEI  211
             + L+G  L G +   I N+  L+ +WL  N L+G  P +S+L  L+I+HLE+N++ G +
Sbjct  417  KIALSGKNLKGEIPPEINNMEQLTELWLDGNFLTGPIPGISNLVNLKIVHLENNKLNGPL  476

Query  210  APSLGRIKSLRELFLQNNNLTGQIPGSIL-GRPGINLRTTPG  88
               LG +  L+ L++QNN+ +G+IP   L G+   N    PG
Sbjct  477  PKYLGSLPKLQALYIQNNSFSGEIPSEFLTGKVIFNYEHNPG  518



>gb|KHN12422.1| Putative LRR receptor-like serine/threonine-protein kinase [Glycine 
soja]
Length=933

 Score = 89.4 bits (220),  Expect = 5e-17, Method: Composition-based stats.
 Identities = 45/116 (39%), Positives = 75/116 (65%), Gaps = 2/116 (2%)
 Frame = -2

Query  465  GDPCLPPQYSWTGVVCSGGTRIRVttlnltgmglsgmlssSIANLTALSGIWLGNNDLSG  286
            GDPC+P  + W  V CS  T  R+T + L+   + G +S  ++N+ AL+ +WL  N L+G
Sbjct  395  GDPCVPTPWEW--VNCSTTTPPRITKIILSRRNVKGEISPELSNMEALTELWLDGNLLTG  452

Query  285  STPDLSSLKRLEILHLEDNQIGGEIAPSLGRIKSLRELFLQNNNLTGQIPGSILGR  118
              PD+S L  L+I+HLE+N++ G +   +G + SL+ LF+QNN+ +G+IP  ++ +
Sbjct  453  QLPDMSKLINLKIVHLENNKLTGRLPSDMGSLPSLQALFIQNNSFSGEIPAGLISK  508



>ref|XP_010043607.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein At1g24485-like 
[Eucalyptus grandis]
Length=615

 Score = 88.6 bits (218),  Expect = 5e-17, Method: Composition-based stats.
 Identities = 58/163 (36%), Positives = 78/163 (48%), Gaps = 26/163 (16%)
 Frame = -2

Query  564  FRVLPLGGKTHTRDVIALEKLKEGFENPPLDWNGDPCLPPQYSWTGVVCSGGTRIRVttl  385
            F V  L   T+++DV  L  L+  F N   DW+GDPCLP  Y+W  + CS     RV   
Sbjct  343  FYVDALTDGTNSKDVDGLSSLQTEFTNLQ-DWSGDPCLPSPYTWDWLNCSSDATPRV---  398

Query  384  nltgmglsgmlssSIANLTALSGIWLGNNDLSGSTPDLSSLKRLEILHLEDNQIGGEIAP  205
                                 + ++L   DLSG  PD SS+  +  + L +N + G I  
Sbjct  399  ---------------------TALYLSGYDLSGQLPDFSSMDAVVTIDLHNNSLSGSIPD  437

Query  204  SLGRIKSLRELFLQNNNLTGQIPGSILGRPGINLRTTPGNPFL  76
             LG + +L+EL L +N LTGQIP S+     I L T  GNP L
Sbjct  438  FLGTLPNLKELNLADNKLTGQIPSSLSKNNKIKL-TVSGNPEL  479



>ref|XP_010253497.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g67720 [Nelumbo nucifera]
Length=926

 Score = 89.4 bits (220),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 53/123 (43%), Positives = 77/123 (63%), Gaps = 5/123 (4%)
 Frame = -2

Query  483  PPLDWN---GDPCLPPQYSWTGVVCSGGTRIRVttlnltgmglsgmlssSIANLTALSGI  313
            P  DW    GDPCLP  +SW  V CS   + R+T++ L+   L+G +   +  LT L  +
Sbjct  383  PSTDWAQEGGDPCLPVPWSW--VQCSSDPQPRITSIVLSQKNLTGKIPLELTKLTGLVEL  440

Query  312  WLGNNDLSGSTPDLSSLKRLEILHLEDNQIGGEIAPSLGRIKSLRELFLQNNNLTGQIPG  133
            WL  N L+GS PD S  + L+I+HLE+NQ+ GE+  SL  + +LREL++QNN L+G +P 
Sbjct  441  WLDGNSLTGSIPDCSGCENLKIIHLENNQLTGELPSSLFHLPNLRELYVQNNMLSGTVPS  500

Query  132  SIL  124
             +L
Sbjct  501  GLL  503



>ref|XP_011029603.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g67720 isoform X2 [Populus euphratica]
Length=932

 Score = 89.4 bits (220),  Expect = 6e-17, Method: Composition-based stats.
 Identities = 57/162 (35%), Positives = 90/162 (56%), Gaps = 8/162 (5%)
 Frame = -2

Query  561  RVLPLGGKTHTRDVIALEKLKEGFENPPLDW---NGDPCLPPQYSWTGVVCSGGTRIRVt  391
            + L +  KT ++DV  L  L+  F +    W    GDPC+P  + W  V CS  +  R+T
Sbjct  361  KYLKIEPKTDSKDVTVLNALR--FLSAESAWANEQGDPCVPAHWEW--VNCSSTSPPRIT  416

Query  390  tlnltgmglsgmlssSIANLTALSGIWLGNNDLSGSTPDLSSLKRLEILHLEDNQIGGEI  211
             + L+G  L G +   I N+  L+ +WL  N L+G  P +S+L  L+I+HLE+N++ G +
Sbjct  417  KIALSGKNLKGEIPPEINNMEQLTELWLDGNFLTGPIPGISNLVNLKIVHLENNKLNGPL  476

Query  210  APSLGRIKSLRELFLQNNNLTGQIPGSIL-GRPGINLRTTPG  88
               LG +  L+ L++QNN+ +G+IP   L G+   N    PG
Sbjct  477  PKYLGSLPKLQALYIQNNSFSGEIPSEFLTGKVIFNYEHNPG  518



>ref|NP_001239648.1| probable LRR receptor-like serine/threonine-protein kinase At1g67720-like 
[Glycine max]
 gb|ACM89491.1| leucine-rich repeat family protein / protein kinase family protein 
[Glycine max]
Length=882

 Score = 89.0 bits (219),  Expect = 7e-17, Method: Composition-based stats.
 Identities = 45/116 (39%), Positives = 75/116 (65%), Gaps = 2/116 (2%)
 Frame = -2

Query  465  GDPCLPPQYSWTGVVCSGGTRIRVttlnltgmglsgmlssSIANLTALSGIWLGNNDLSG  286
            GDPC+P  + W  V CS  T  R+T + L+   + G +S  ++N+ AL+ +WL  N L+G
Sbjct  344  GDPCVPTPWEW--VNCSTTTPPRITKIILSRRNVKGEISPELSNMEALTELWLDGNLLTG  401

Query  285  STPDLSSLKRLEILHLEDNQIGGEIAPSLGRIKSLRELFLQNNNLTGQIPGSILGR  118
              PD+S L  L+I+HLE+N++ G +   +G + SL+ LF+QNN+ +G+IP  ++ +
Sbjct  402  QLPDMSKLINLKIVHLENNKLTGRLPSYMGSLPSLQALFIQNNSFSGEIPAGLISK  457



>ref|XP_002314568.2| leucine-rich repeat family protein [Populus trichocarpa]
 gb|EEF00739.2| leucine-rich repeat family protein [Populus trichocarpa]
Length=934

 Score = 89.0 bits (219),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 57/160 (36%), Positives = 93/160 (58%), Gaps = 4/160 (3%)
 Frame = -2

Query  561  RVLPLGGKTHTRDVIALEKLKE-GFENPPLDWNGDPCLPPQYSWTGVVCSGGTRIRVttl  385
            + L +  +T ++DV  L  L+    E+   +  GDPC+P  + W  V C+  T  R+T +
Sbjct  361  KYLKIEPRTDSQDVTVLNALRSLSAESAWTNEQGDPCVPAHWDW--VNCTSTTPPRITKI  418

Query  384  nltgmglsgmlssSIANLTALSGIWLGNNDLSGSTPDLSSLKRLEILHLEDNQIGGEIAP  205
             L+G  L G +   I N+  L+ +WL  N L+G  P +S+L  L+I+HLE+N++ G++  
Sbjct  419  ALSGKNLKGEIPPEINNMETLTELWLDGNFLTGPIPSISNLVNLKIVHLENNKLSGQLPK  478

Query  204  SLGRIKSLRELFLQNNNLTGQIPGSIL-GRPGINLRTTPG  88
             LG +  L+EL++QNN  +G+IP  +L G+  IN    PG
Sbjct  479  YLGSLPDLQELYIQNNYFSGEIPSGLLTGKVIINYEHNPG  518



>gb|ACM89490.1| leucine-rich repeat family protein / protein kinase family protein 
[Glycine max]
Length=875

 Score = 89.0 bits (219),  Expect = 7e-17, Method: Composition-based stats.
 Identities = 45/116 (39%), Positives = 75/116 (65%), Gaps = 2/116 (2%)
 Frame = -2

Query  465  GDPCLPPQYSWTGVVCSGGTRIRVttlnltgmglsgmlssSIANLTALSGIWLGNNDLSG  286
            GDPC+P  + W  V CS  T  R+T + L+   + G +S  ++N+ AL+ +WL  N L+G
Sbjct  344  GDPCVPTPWEW--VNCSTTTPPRITKIILSRRNVKGEISPELSNMEALTELWLDGNLLTG  401

Query  285  STPDLSSLKRLEILHLEDNQIGGEIAPSLGRIKSLRELFLQNNNLTGQIPGSILGR  118
              PD+S L  L+I+HLE+N++ G +   +G + SL+ LF+QNN+ +G+IP  ++ +
Sbjct  402  QLPDMSKLINLKIVHLENNKLTGRLPSYMGSLPSLQALFIQNNSFSGEIPAGLISK  457



>ref|XP_004978420.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g67720-like [Setaria italica]
Length=927

 Score = 89.0 bits (219),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 50/119 (42%), Positives = 73/119 (61%), Gaps = 2/119 (2%)
 Frame = -2

Query  465  GDPCLPPQYSWTGVVCSGGTRIRVttlnltgmglsgmlssSIANLTALSGIWLGNNDLSG  286
            GDPCLP  +SW  V CS     RV ++ L+G  ++G +   +  L+ L  + L  N  SG
Sbjct  396  GDPCLPASWSW--VQCSSEDAPRVFSITLSGKNITGSIPVELTKLSGLVELRLDGNSFSG  453

Query  285  STPDLSSLKRLEILHLEDNQIGGEIAPSLGRIKSLRELFLQNNNLTGQIPGSILGRPGI  109
              PD S    L+ +HLE+NQ+ GE+ PSLG + +L+EL++QNN L+GQ+P S+  R  I
Sbjct  454  QIPDFSECHNLQYIHLENNQLTGELPPSLGDLPNLKELYIQNNKLSGQVPKSLFKRSII  512



>ref|XP_006584597.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g67720-like isoform X1 [Glycine max]
Length=933

 Score = 89.0 bits (219),  Expect = 8e-17, Method: Composition-based stats.
 Identities = 45/116 (39%), Positives = 75/116 (65%), Gaps = 2/116 (2%)
 Frame = -2

Query  465  GDPCLPPQYSWTGVVCSGGTRIRVttlnltgmglsgmlssSIANLTALSGIWLGNNDLSG  286
            GDPC+P  + W  V CS  T  R+T + L+   + G +S  ++N+ AL+ +WL  N L+G
Sbjct  395  GDPCVPTPWEW--VNCSTTTPPRITKIILSRRNVKGEISPELSNMEALTELWLDGNLLTG  452

Query  285  STPDLSSLKRLEILHLEDNQIGGEIAPSLGRIKSLRELFLQNNNLTGQIPGSILGR  118
              PD+S L  L+I+HLE+N++ G +   +G + SL+ LF+QNN+ +G+IP  ++ +
Sbjct  453  QLPDMSKLINLKIVHLENNKLTGRLPSYMGSLPSLQALFIQNNSFSGEIPAGLISK  508



>ref|XP_010260164.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g67720 isoform X3 [Nelumbo nucifera]
Length=710

 Score = 88.6 bits (218),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 52/123 (42%), Positives = 78/123 (63%), Gaps = 5/123 (4%)
 Frame = -2

Query  483  PPLDWN---GDPCLPPQYSWTGVVCSGGTRIRVttlnltgmglsgmlssSIANLTALSGI  313
            P +DW    GDPCLP  +SW  V CS   + R+  ++L+   L+G +   + NL  L  +
Sbjct  384  PSVDWAQEGGDPCLPVPWSW--VQCSSDPQPRIIKISLSKHNLTGKIPLELTNLIGLVEL  441

Query  312  WLGNNDLSGSTPDLSSLKRLEILHLEDNQIGGEIAPSLGRIKSLRELFLQNNNLTGQIPG  133
            WL  N L+GS PD S    L+I+HLE+NQ+ GE+  SL ++ +LREL++QNN L+G +P 
Sbjct  442  WLDWNLLTGSIPDFSGCINLKIIHLENNQLSGELPSSLLKLPNLRELYVQNNMLSGAVPS  501

Query  132  SIL  124
            S++
Sbjct  502  SLV  504



>ref|XP_006584598.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g67720-like isoform X2 [Glycine max]
Length=926

 Score = 88.6 bits (218),  Expect = 8e-17, Method: Composition-based stats.
 Identities = 45/116 (39%), Positives = 75/116 (65%), Gaps = 2/116 (2%)
 Frame = -2

Query  465  GDPCLPPQYSWTGVVCSGGTRIRVttlnltgmglsgmlssSIANLTALSGIWLGNNDLSG  286
            GDPC+P  + W  V CS  T  R+T + L+   + G +S  ++N+ AL+ +WL  N L+G
Sbjct  395  GDPCVPTPWEW--VNCSTTTPPRITKIILSRRNVKGEISPELSNMEALTELWLDGNLLTG  452

Query  285  STPDLSSLKRLEILHLEDNQIGGEIAPSLGRIKSLRELFLQNNNLTGQIPGSILGR  118
              PD+S L  L+I+HLE+N++ G +   +G + SL+ LF+QNN+ +G+IP  ++ +
Sbjct  453  QLPDMSKLINLKIVHLENNKLTGRLPSYMGSLPSLQALFIQNNSFSGEIPAGLISK  508



>ref|XP_006391230.1| hypothetical protein EUTSA_v10018088mg [Eutrema salsugineum]
 gb|ESQ28516.1| hypothetical protein EUTSA_v10018088mg [Eutrema salsugineum]
Length=927

 Score = 88.6 bits (218),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 56/149 (38%), Positives = 88/149 (59%), Gaps = 7/149 (5%)
 Frame = -2

Query  561  RVLPLGGKTHTRDVIALEKLKEGFENPPLDWN---GDPCLPPQYSWTGVVCSGGTRIRVt  391
            + L +  +T   DV  L+ ++    +P  DW    GDPC+P  +SW  V CS  +  RVT
Sbjct  363  KYLQISVRTDRNDVSVLDAIRS--LSPDSDWANEGGDPCIPILWSW--VNCSSTSPPRVT  418

Query  390  tlnltgmglsgmlssSIANLTALSGIWLGNNDLSGSTPDLSSLKRLEILHLEDNQIGGEI  211
             + L+   L G +   I  + AL+ +WL  N+L+G  PD+S L  L+I+HLE+NQ+ G +
Sbjct  419  KIALSRKNLRGEILPDINYMEALTELWLDGNNLTGILPDMSKLVNLKIMHLENNQLSGSL  478

Query  210  APSLGRIKSLRELFLQNNNLTGQIPGSIL  124
             P L  + +L+ELF++NN+  G IP ++L
Sbjct  479  PPYLVHLPNLQELFVENNSFRGTIPSALL  507



>ref|XP_010260163.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g67720 isoform X2 [Nelumbo nucifera]
Length=771

 Score = 88.6 bits (218),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 52/123 (42%), Positives = 78/123 (63%), Gaps = 5/123 (4%)
 Frame = -2

Query  483  PPLDW---NGDPCLPPQYSWTGVVCSGGTRIRVttlnltgmglsgmlssSIANLTALSGI  313
            P +DW    GDPCLP  +SW  V CS   + R+  ++L+   L+G +   + NL  L  +
Sbjct  383  PSVDWAQEGGDPCLPVPWSW--VQCSSDPQPRIIKISLSKHNLTGKIPLELTNLIGLVEL  440

Query  312  WLGNNDLSGSTPDLSSLKRLEILHLEDNQIGGEIAPSLGRIKSLRELFLQNNNLTGQIPG  133
            WL  N L+GS PD S    L+I+HLE+NQ+ GE+  SL ++ +LREL++QNN L+G +P 
Sbjct  441  WLDWNLLTGSIPDFSGCINLKIIHLENNQLSGELPSSLLKLPNLRELYVQNNMLSGAVPS  500

Query  132  SIL  124
            S++
Sbjct  501  SLV  503



>ref|XP_010238835.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g67720 [Brachypodium distachyon]
Length=921

 Score = 88.6 bits (218),  Expect = 9e-17, Method: Composition-based stats.
 Identities = 54/136 (40%), Positives = 79/136 (58%), Gaps = 6/136 (4%)
 Frame = -2

Query  483  PPLDW---NGDPCLPPQYSWTGVVCSGGTRIRVttlnltgmglsgmlssSIANLTALSGI  313
            P   W    GDPCLP   SWT V CS     RV+++ L+G  ++G +   +  L+AL  +
Sbjct  381  PQAGWAQEGGDPCLPA--SWTWVQCSSEPAPRVSSITLSGKNITGSIPLELTKLSALVDL  438

Query  312  WLGNNDLSGSTPDLSSLKRLEILHLEDNQIGGEIAPSLGRIKSLRELFLQNNNLTGQIPG  133
             L  N  SG  PD S  + L+ +HLE+NQI G +  S+G + +L+EL++QNN L+GQIP 
Sbjct  439  KLDGNSFSGEIPDFSGCRNLQYIHLENNQITGALPSSMGDLPNLKELYVQNNRLSGQIPR  498

Query  132  SILGRPGINLRTTPGN  85
            + L + GI    +  N
Sbjct  499  A-LSKKGITFSWSGNN  513



>ref|XP_010260162.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g67720 isoform X1 [Nelumbo nucifera]
Length=772

 Score = 88.6 bits (218),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 52/123 (42%), Positives = 78/123 (63%), Gaps = 5/123 (4%)
 Frame = -2

Query  483  PPLDWN---GDPCLPPQYSWTGVVCSGGTRIRVttlnltgmglsgmlssSIANLTALSGI  313
            P +DW    GDPCLP  +SW  V CS   + R+  ++L+   L+G +   + NL  L  +
Sbjct  384  PSVDWAQEGGDPCLPVPWSW--VQCSSDPQPRIIKISLSKHNLTGKIPLELTNLIGLVEL  441

Query  312  WLGNNDLSGSTPDLSSLKRLEILHLEDNQIGGEIAPSLGRIKSLRELFLQNNNLTGQIPG  133
            WL  N L+GS PD S    L+I+HLE+NQ+ GE+  SL ++ +LREL++QNN L+G +P 
Sbjct  442  WLDWNLLTGSIPDFSGCINLKIIHLENNQLSGELPSSLLKLPNLRELYVQNNMLSGAVPS  501

Query  132  SIL  124
            S++
Sbjct  502  SLV  504



>ref|XP_004977651.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g67720-like [Setaria italica]
Length=924

 Score = 88.6 bits (218),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 49/116 (42%), Positives = 72/116 (62%), Gaps = 2/116 (2%)
 Frame = -2

Query  465  GDPCLPPQYSWTGVVCSGGTRIRVttlnltgmglsgmlssSIANLTALSGIWLGNNDLSG  286
            GDPCLP  +SW  V CS     RV ++ L+G  ++G +   +  L+ L  + L  N  SG
Sbjct  396  GDPCLPASWSW--VQCSSEDAPRVFSITLSGKNITGSIPVELTKLSGLLELRLDGNSFSG  453

Query  285  STPDLSSLKRLEILHLEDNQIGGEIAPSLGRIKSLRELFLQNNNLTGQIPGSILGR  118
              PD S    L+ +HLE+NQ+ GE+ PSLG + +L+EL++QNN L+GQ+P S+  R
Sbjct  454  QIPDFSECHNLQYIHLENNQLTGELPPSLGDLPNLKELYIQNNKLSGQVPKSLFKR  509



>ref|XP_009598261.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g05700 [Nicotiana tomentosiformis]
Length=590

 Score = 87.8 bits (216),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 52/149 (35%), Positives = 76/149 (51%), Gaps = 25/149 (17%)
 Frame = -2

Query  549  LGGKTHTRDVIALEKLKEGFENPPLDWNGDPCLPPQYSWTGVVCSGGTRIRVttlnltgm  370
            L   T+++DV +L  L++ FE    DWNGDPCLP  ++W  V CS     R+        
Sbjct  346  LSDGTNSQDVESLVSLQDEFE-VLQDWNGDPCLPTSFTWDWVNCSSDDPPRI--------  396

Query  369  glsgmlssSIANLTALSGIWLGNNDLSGSTPDLSSLKRLEILHLEDNQIGGEIAPSLGRI  190
                            + ++L   +LSGS PDLSS+  L+ + L DN + G I   LG +
Sbjct  397  ----------------TALYLSGFNLSGSLPDLSSMDALQTIDLSDNNLDGPIPDFLGTL  440

Query  189  KSLRELFLQNNNLTGQIPGSILGRPGINL  103
              L+EL L NN  +G IP S+  + G+N+
Sbjct  441  PDLKELNLANNQFSGSIPASLSNKNGLNI  469



>ref|XP_011042336.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g67720 [Populus euphratica]
Length=934

 Score = 88.2 bits (217),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 60/172 (35%), Positives = 97/172 (56%), Gaps = 4/172 (2%)
 Frame = -2

Query  540  KTHTRDVIALEKLKE-GFENPPLDWNGDPCLPPQYSWTGVVCSGGTRIRVttlnltgmgl  364
            +T ++DV  L  L+    E+      GDPC+P Q+ W  V C+  T  R+T + L+G  L
Sbjct  368  RTDSQDVTVLNALRSLSAESAWTKEQGDPCVPAQWDW--VNCTSTTPPRITKIALSGKNL  425

Query  363  sgmlssSIANLTALSGIWLGNNDLSGSTPDLSSLKRLEILHLEDNQIGGEIAPSLGRIKS  184
             G +   I N+  L+ +WL  N L+G  P +S+L  L+I+HLE+N++ G++   LG   +
Sbjct  426  KGEIPPEINNMETLTELWLDGNLLTGPIPGISNLVNLKIVHLENNKLSGQLPKYLGSFPN  485

Query  183  LRELFLQNNNLTGQIPGSIL-GRPGINLRTTPGNPFLSGPPA*RSVLISFSI  31
            L+EL++QNN  +G+IP  +L G+  IN    PG    +G      +++  SI
Sbjct  486  LQELYIQNNYFSGEIPSGLLTGKITINYEHNPGLHKAAGKKIHSKLILGISI  537



>ref|XP_011042340.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g67720 [Populus euphratica]
Length=934

 Score = 88.2 bits (217),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 60/172 (35%), Positives = 97/172 (56%), Gaps = 4/172 (2%)
 Frame = -2

Query  540  KTHTRDVIALEKLKE-GFENPPLDWNGDPCLPPQYSWTGVVCSGGTRIRVttlnltgmgl  364
            +T ++DV  L  L+    E+      GDPC+P Q+ W  V C+  T  R+T + L+G  L
Sbjct  368  RTDSQDVTVLNALRSLSAESAWTKEQGDPCVPAQWDW--VNCTSTTPPRITKIALSGKNL  425

Query  363  sgmlssSIANLTALSGIWLGNNDLSGSTPDLSSLKRLEILHLEDNQIGGEIAPSLGRIKS  184
             G +   I N+  L+ +WL  N L+G  P +S+L  L+I+HLE+N++ G++   LG   +
Sbjct  426  KGEIPPEINNMETLTELWLDGNLLTGPIPGISNLVNLKIVHLENNKLSGQLPKYLGSFPN  485

Query  183  LRELFLQNNNLTGQIPGSIL-GRPGINLRTTPGNPFLSGPPA*RSVLISFSI  31
            L+EL++QNN  +G+IP  +L G+  IN    PG    +G      +++  SI
Sbjct  486  LQELYIQNNYFSGEIPSGLLTGKITINYEHNPGLHKAAGKKIHSKLILGISI  537



>gb|KHN44396.1| Putative LRR receptor-like serine/threonine-protein kinase [Glycine 
soja]
Length=879

 Score = 88.2 bits (217),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 55/158 (35%), Positives = 88/158 (56%), Gaps = 3/158 (2%)
 Frame = -2

Query  561  RVLPLGGKTHTRDVIALEKLKEGFENPPLDWNGDPCLPPQYSWTGVVCSGGTRIRVttln  382
            + +P+  KT  +D   +   +       L   GDPC+P  + W  V CS  T  R+T +N
Sbjct  310  KYMPIASKTDRQDSNFVNAFRFLSAESVLKNEGDPCVPTPWEW--VNCSTTTPPRITKIN  367

Query  381  ltgmglsgmlssSIANLTALSGIWLGNNDLSGSTPDLSSLKRLEILHLEDNQIGGEIAPS  202
            L+   L G +   + N+ AL+ +WL  N L+G  PD+S+L  ++I+HLE+N++ G +   
Sbjct  368  LSRRNLKGEIPGKLNNMEALTELWLDGNMLTGQLPDMSNLINVKIMHLENNKLTGPLPSY  427

Query  201  LGRIKSLRELFLQNNNLTGQIPGSIL-GRPGINLRTTP  91
            LG + SL+ LF+QNN+ +G IP  +L G+   N    P
Sbjct  428  LGSLPSLQALFIQNNSFSGVIPSGLLSGKIIFNFDDNP  465



>ref|XP_003537548.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g67720-like [Glycine max]
Length=930

 Score = 88.2 bits (217),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 55/158 (35%), Positives = 88/158 (56%), Gaps = 3/158 (2%)
 Frame = -2

Query  561  RVLPLGGKTHTRDVIALEKLKEGFENPPLDWNGDPCLPPQYSWTGVVCSGGTRIRVttln  382
            + +P+  KT  +D   +   +       L   GDPC+P  + W  V CS  T  R+T +N
Sbjct  361  KYMPIASKTDRQDSNFVNAFRFLSAESVLKNEGDPCVPTPWEW--VNCSTTTPPRITKIN  418

Query  381  ltgmglsgmlssSIANLTALSGIWLGNNDLSGSTPDLSSLKRLEILHLEDNQIGGEIAPS  202
            L+   L G +   + N+ AL+ +WL  N L+G  PD+S+L  ++I+HLE+N++ G +   
Sbjct  419  LSRRNLKGEIPGKLNNMEALTELWLDGNMLTGQLPDMSNLINVKIMHLENNKLTGPLPSY  478

Query  201  LGRIKSLRELFLQNNNLTGQIPGSIL-GRPGINLRTTP  91
            LG + SL+ LF+QNN+ +G IP  +L G+   N    P
Sbjct  479  LGSLPSLQALFIQNNSFSGVIPSGLLSGKIIFNFDDNP  516



>ref|XP_010250885.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g67720 isoform X1 [Nelumbo nucifera]
Length=933

 Score = 88.2 bits (217),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 56/138 (41%), Positives = 84/138 (61%), Gaps = 7/138 (5%)
 Frame = -2

Query  540  KTHTRDVIALEKLKEGFENPPLDW---NGDPCLPPQYSWTGVVCSGGTRIRVttlnltgm  370
            KT ++D I L+ L+    +P  DW    GDPC P  + W  V+CS  T  R+T L L+  
Sbjct  367  KTESKDAITLDILRS--LSPGSDWAHVEGDPCNPAPWEW--VICSSSTPPRITKLALSEK  422

Query  369  glsgmlssSIANLTALSGIWLGNNDLSGSTPDLSSLKRLEILHLEDNQIGGEIAPSLGRI  190
             L G + + + NL +L+ +WL  N  +G  PDLS+L  L I+HLE+N + G +   L  +
Sbjct  423  NLKGKIPNELKNLDSLTELWLDGNSFTGPIPDLSNLINLTIVHLENNGLTGTLPSYLADL  482

Query  189  KSLRELFLQNNNLTGQIP  136
             SL+EL++QNN+L+G+IP
Sbjct  483  PSLKELYVQNNSLSGEIP  500



>ref|XP_008389778.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g67720 [Malus domestica]
Length=930

 Score = 88.2 bits (217),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 52/147 (35%), Positives = 88/147 (60%), Gaps = 4/147 (3%)
 Frame = -2

Query  561  RVLPLGGKTHTRDVIALEKLK-EGFENPPLDWNGDPCLPPQYSWTGVVCSGGTRIRVttl  385
            + + +  KT  +D+  L  L+    E+  +D  GDPC+P  + W  V CS    +R+T +
Sbjct  362  KYVQIAAKTDRQDLAVLNVLRFMSAESLSVD-EGDPCVPTPWEW--VNCSSTAPLRITKI  418

Query  384  nltgmglsgmlssSIANLTALSGIWLGNNDLSGSTPDLSSLKRLEILHLEDNQIGGEIAP  205
            +L+G  + G +   + N+  L+ +WL  N L+G  PD+S+L  L+ILHLE+N+  G +  
Sbjct  419  DLSGKNVKGEIPVELKNMQDLTELWLDGNYLTGQFPDISNLIYLKILHLENNKFTGALPS  478

Query  204  SLGRIKSLRELFLQNNNLTGQIPGSIL  124
             L  + SL+EL++QNN+ +G+IP  +L
Sbjct  479  YLASLPSLQELYIQNNSFSGEIPAGLL  505



>ref|XP_010250886.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g67720 isoform X2 [Nelumbo nucifera]
Length=868

 Score = 88.2 bits (217),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 56/138 (41%), Positives = 84/138 (61%), Gaps = 7/138 (5%)
 Frame = -2

Query  540  KTHTRDVIALEKLKEGFENPPLDW---NGDPCLPPQYSWTGVVCSGGTRIRVttlnltgm  370
            KT ++D I L+ L+    +P  DW    GDPC P  + W  V+CS  T  R+T L L+  
Sbjct  302  KTESKDAITLDILRS--LSPGSDWAHVEGDPCNPAPWEW--VICSSSTPPRITKLALSEK  357

Query  369  glsgmlssSIANLTALSGIWLGNNDLSGSTPDLSSLKRLEILHLEDNQIGGEIAPSLGRI  190
             L G + + + NL +L+ +WL  N  +G  PDLS+L  L I+HLE+N + G +   L  +
Sbjct  358  NLKGKIPNELKNLDSLTELWLDGNSFTGPIPDLSNLINLTIVHLENNGLTGTLPSYLADL  417

Query  189  KSLRELFLQNNNLTGQIP  136
             SL+EL++QNN+L+G+IP
Sbjct  418  PSLKELYVQNNSLSGEIP  435



>ref|XP_006410884.1| hypothetical protein EUTSA_v10016198mg [Eutrema salsugineum]
 gb|ESQ52337.1| hypothetical protein EUTSA_v10016198mg [Eutrema salsugineum]
Length=932

 Score = 87.8 bits (216),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 51/117 (44%), Positives = 73/117 (62%), Gaps = 5/117 (4%)
 Frame = -2

Query  474  DW---NGDPCLPPQYSWTGVVCSGGTRIRVttlnltgmglsgmlssSIANLTALSGIWLG  304
            DW   +GDPCLP  +SW  V C+   + RV  + L+   L+G + S +  LT L  +WL 
Sbjct  387  DWGQESGDPCLPSPWSW--VECNSDPQPRVVAVKLSTKNLTGFVPSDLTKLTGLVELWLD  444

Query  303  NNDLSGSTPDLSSLKRLEILHLEDNQIGGEIAPSLGRIKSLRELFLQNNNLTGQIPG  133
             N  +G  PD S    LEI+HLEDN++ G+I  SL ++ +L+EL+LQNN L+G+IP 
Sbjct  445  GNSFTGPIPDFSRSPNLEIIHLEDNRLSGKIPSSLAKLPNLKELYLQNNMLSGKIPS  501



>ref|XP_008807217.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g67720, partial [Phoenix dactylifera]
Length=517

 Score = 86.7 bits (213),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 47/115 (41%), Positives = 77/115 (67%), Gaps = 2/115 (2%)
 Frame = -2

Query  468  NGDPCLPPQYSWTGVVCSGGTRIRVttlnltgmglsgmlssSIANLTALSGIWLGNNDLS  289
            +GDPC+P ++ W  + CS     R+T + L+G  LSG + + I  +  L+ +WL +N L 
Sbjct  393  DGDPCIPARWEW--INCSSSMPPRITQIFLSGKNLSGAIPADIKQIEQLTELWLDDNSLD  450

Query  288  GSTPDLSSLKRLEILHLEDNQIGGEIAPSLGRIKSLRELFLQNNNLTGQIPGSIL  124
            G  PD+S+L  LE++HLE+N++ G++    G++ SLREL++QNN L+G IP ++L
Sbjct  451  GPIPDMSNLINLEVVHLENNELTGQLPSYFGKLPSLRELYVQNNYLSGDIPPALL  505



>ref|XP_010100308.1| putative LRR receptor-like serine/threonine-protein kinase [Morus 
notabilis]
 gb|EXB82442.1| putative LRR receptor-like serine/threonine-protein kinase [Morus 
notabilis]
Length=934

 Score = 87.8 bits (216),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 55/148 (37%), Positives = 88/148 (59%), Gaps = 2/148 (1%)
 Frame = -2

Query  561  RVLPLGGKTHTRDVIALEKLKEGFENPPLDWNGDPCLPPQYSWTGVVCSGGTRIRVttln  382
            + + +G KT  +D+ AL  L        L   GDPC+P  + W  V CS     R+T +N
Sbjct  362  KYVQIGAKTDKQDLAALIALCLMSPEIALTNEGDPCVPTPWDW--VNCSTNAPPRITIIN  419

Query  381  ltgmglsgmlssSIANLTALSGIWLGNNDLSGSTPDLSSLKRLEILHLEDNQIGGEIAPS  202
            L+   + G + S + N+  L+ +WL  N L+G+ PD+++L  L+ILHLE+N++ G +   
Sbjct  420  LSAKNVKGGIPSELNNMEELAELWLDGNSLTGTLPDMANLINLKILHLENNKLTGPLPSY  479

Query  201  LGRIKSLRELFLQNNNLTGQIPGSILGR  118
            LG + SL+EL++QNN+  G+IP  +L R
Sbjct  480  LGSLPSLQELYIQNNSFIGEIPPGLLAR  507



>ref|XP_008674464.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g67720 isoform X1 [Zea mays]
Length=972

 Score = 87.0 bits (214),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 50/116 (43%), Positives = 72/116 (62%), Gaps = 2/116 (2%)
 Frame = -2

Query  465  GDPCLPPQYSWTGVVCSGGTRIRVttlnltgmglsgmlssSIANLTALSGIWLGNNDLSG  286
            GDPCLP  +SW  V C+   + RV ++NL+G  L+G +   +A+L  L+ I   NN L+G
Sbjct  412  GDPCLPSPWSW--VKCNSEAQPRVVSINLSGKNLTGSIPPQVADLPCLAEIGFANNMLTG  469

Query  285  STPDLSSLKRLEILHLEDNQIGGEIAPSLGRIKSLRELFLQNNNLTGQIPGSILGR  118
              PDLS    L I+HLE+NQ+ G +    G +  L EL+L+NN L+G IP ++L R
Sbjct  470  PIPDLSGSSNLSIIHLENNQLTGTVPSYFGSLPKLSELYLENNRLSGPIPKALLSR  525



>ref|XP_009359353.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g67720 [Pyrus x bretschneideri]
Length=888

 Score = 86.7 bits (213),  Expect = 4e-16, Method: Composition-based stats.
 Identities = 47/114 (41%), Positives = 72/114 (63%), Gaps = 2/114 (2%)
 Frame = -2

Query  465  GDPCLPPQYSWTGVVCSGGTRIRVttlnltgmglsgmlssSIANLTALSGIWLGNNDLSG  286
            GDPC P  + W  V CS     R+T ++L+G  + G +   + NL  L+ +WLG N L+G
Sbjct  347  GDPCAPTPWEW--VNCSSTAPPRITKIDLSGKNVKGEIPVELKNLQELTELWLGGNYLTG  404

Query  285  STPDLSSLKRLEILHLEDNQIGGEIAPSLGRIKSLRELFLQNNNLTGQIPGSIL  124
              PD+S+L  L+ILHLE+N++ G +   L  + SL+EL +QNN+ +G+IP  +L
Sbjct  405  QFPDISNLINLKILHLENNKLSGSLPSYLASLPSLQELDIQNNSFSGEIPAGLL  458



>ref|XP_009787248.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g05700 [Nicotiana sylvestris]
Length=597

 Score = 86.3 bits (212),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 52/149 (35%), Positives = 76/149 (51%), Gaps = 25/149 (17%)
 Frame = -2

Query  549  LGGKTHTRDVIALEKLKEGFENPPLDWNGDPCLPPQYSWTGVVCSGGTRIRVttlnltgm  370
            L   T+++DV +L  L++ FE    DWNGDPCLP  ++W  V CS     R+        
Sbjct  345  LTDGTNSQDVESLVSLQDEFE-VLQDWNGDPCLPTPFTWDWVNCSSDDPPRI--------  395

Query  369  glsgmlssSIANLTALSGIWLGNNDLSGSTPDLSSLKRLEILHLEDNQIGGEIAPSLGRI  190
                            + ++L   +LSGS PDLSS+  L  + L DN + G I   LG +
Sbjct  396  ----------------TALYLSGFNLSGSLPDLSSMDALHTIDLSDNNLDGPIPDFLGTL  439

Query  189  KSLRELFLQNNNLTGQIPGSILGRPGINL  103
             +L+EL L NN  +G IP S+  + G+N+
Sbjct  440  PNLKELNLSNNQFSGSIPASLSNKNGLNI  468



>ref|XP_011006929.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g67720 [Populus euphratica]
 ref|XP_011006930.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g67720 [Populus euphratica]
Length=921

 Score = 85.9 bits (211),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 57/122 (47%), Positives = 76/122 (62%), Gaps = 6/122 (5%)
 Frame = -2

Query  474  DW---NGDPCLPPQYSWTGVVCSGGTRIRVttlnltgmglsgmlssSIANLTALSGIWLG  304
            DW    GDPCLP  +SW  V C+   R R+  L+L+   LSG + S +  LT L  +WL 
Sbjct  383  DWAQEGGDPCLPVPWSW--VQCNSEARPRIVKLSLSSKNLSGSVPSDLTKLTGLVELWLD  440

Query  303  NNDLSGSTPDLSSLKRLEILHLEDNQIGGEIAPSLGRIKSLRELFLQNNNLTGQIPGSIL  124
             N L+G  PD +    LEI+HLE+NQ+ GE+  SL  + +LREL++QNN L+G IP S L
Sbjct  441  GNSLTGPIPDFTGCTDLEIIHLENNQLTGELPSSLVNLPNLRELYVQNNMLSGTIP-SGL  499

Query  123  GR  118
            GR
Sbjct  500  GR  501



>ref|XP_006601909.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g67720-like isoform X2 [Glycine max]
Length=779

 Score = 85.9 bits (211),  Expect = 7e-16, Method: Composition-based stats.
 Identities = 49/126 (39%), Positives = 76/126 (60%), Gaps = 3/126 (2%)
 Frame = -2

Query  465  GDPCLPPQYSWTGVVCSGGTRIRVttlnltgmglsgmlssSIANLTALSGIWLGNNDLSG  286
            GDPC+P  + W  V CS  T  R+T +NL+   + G +   + N+ AL+ +WL  N L+G
Sbjct  393  GDPCVPTPWEW--VNCSTTTPPRITKINLSRRNMKGEIPRELNNMEALTELWLDGNMLTG  450

Query  285  STPDLSSLKRLEILHLEDNQIGGEIAPSLGRIKSLRELFLQNNNLTGQIPGSIL-GRPGI  109
              PD+ +L  L+I+HLE+N++ G +   LG + SL+ LF+QNN+ +G IP  +L G+   
Sbjct  451  QLPDMRNLINLKIVHLENNKLSGPLPSYLGSLPSLQALFIQNNSFSGVIPSGLLSGKIIF  510

Query  108  NLRTTP  91
            N    P
Sbjct  511  NFDDNP  516



>emb|CDX96066.1| BnaA07g26650D [Brassica napus]
Length=1027

 Score = 85.9 bits (211),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 56/149 (38%), Positives = 87/149 (58%), Gaps = 7/149 (5%)
 Frame = -2

Query  561  RVLPLGGKTHTRDVIALEKLKEGFENPPLDWN---GDPCLPPQYSWTGVVCSGGTRIRVt  391
            + L +  KT   DV  L+ ++    +P  DW    GDPC+P  +SW  V CS  +  RVT
Sbjct  365  KYLLISLKTDKTDVSVLDAIRA--MSPDSDWANEGGDPCVPVLWSW--VSCSSTSPPRVT  420

Query  390  tlnltgmglsgmlssSIANLTALSGIWLGNNDLSGSTPDLSSLKRLEILHLEDNQIGGEI  211
             + L+   + G +   I ++ AL+ + L  N L+G+ PDLS L  L+I+HLE+NQ+ G +
Sbjct  421  KIALSRKDIRGEILPEINHMEALTELRLDGNGLTGTLPDLSKLVNLKIMHLENNQLSGSL  480

Query  210  APSLGRIKSLRELFLQNNNLTGQIPGSIL  124
               LG + +L+ELF+ NN+  G IP ++L
Sbjct  481  PAYLGHLPNLQELFINNNSFRGTIPSALL  509



>gb|KHN24106.1| Putative LRR receptor-like serine/threonine-protein kinase [Glycine 
soja]
Length=929

 Score = 85.1 bits (209),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 49/126 (39%), Positives = 76/126 (60%), Gaps = 3/126 (2%)
 Frame = -2

Query  465  GDPCLPPQYSWTGVVCSGGTRIRVttlnltgmglsgmlssSIANLTALSGIWLGNNDLSG  286
            GDPC+P  + W  V CS  T  R+T +NL+   + G +   + N+ AL+ +WL  N L+G
Sbjct  393  GDPCVPTPWEW--VNCSTTTPPRITKINLSRRNMKGEIPRELNNMEALTELWLDGNMLTG  450

Query  285  STPDLSSLKRLEILHLEDNQIGGEIAPSLGRIKSLRELFLQNNNLTGQIPGSIL-GRPGI  109
              PD+ +L  L+I+HLE+N++ G +   LG + SL+ LF+QNN+ +G IP  +L G+   
Sbjct  451  QLPDMRNLINLKIVHLENNKLSGPLPSYLGSLPSLQALFIQNNSFSGVIPSGLLSGKIIF  510

Query  108  NLRTTP  91
            N    P
Sbjct  511  NFDDNP  516



>ref|XP_002322852.1| leucine-rich repeat family protein [Populus trichocarpa]
 gb|EEF04613.1| leucine-rich repeat family protein [Populus trichocarpa]
Length=921

 Score = 85.1 bits (209),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 56/122 (46%), Positives = 76/122 (62%), Gaps = 6/122 (5%)
 Frame = -2

Query  474  DW---NGDPCLPPQYSWTGVVCSGGTRIRVttlnltgmglsgmlssSIANLTALSGIWLG  304
            DW    GDPC+P  +SW  V C+   R R+  L+L+   LSG + S +  LT L  +WL 
Sbjct  383  DWAQEGGDPCMPVPWSW--VQCNSEARPRIVKLSLSSKNLSGSVPSDLTKLTGLVELWLD  440

Query  303  NNDLSGSTPDLSSLKRLEILHLEDNQIGGEIAPSLGRIKSLRELFLQNNNLTGQIPGSIL  124
             N L+G  PD +    LEI+HLE+NQ+ GE+  SL  + +LREL++QNN L+G IP S L
Sbjct  441  GNSLTGPIPDFTGCTDLEIIHLENNQLTGELPSSLLNLPNLRELYVQNNMLSGTIP-SGL  499

Query  123  GR  118
            GR
Sbjct  500  GR  501



>gb|KDO82075.1| hypothetical protein CISIN_1g002336mg [Citrus sinensis]
Length=912

 Score = 85.1 bits (209),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 53/143 (37%), Positives = 86/143 (60%), Gaps = 3/143 (2%)
 Frame = -2

Query  549  LGGKTHTRDVIALEKLKE-GFENPPLDWNGDPCLPPQYSWTGVVCSGGTRIRVttlnltg  373
            +  KT  +DV+ LE L+    E+   +  GDPC+P  + W  V CS  T  R+T + L+G
Sbjct  346  IAAKTEWQDVMVLEALRSISDESERTNDRGDPCVPVPWEW--VTCSTTTPPRITKIALSG  403

Query  372  mglsgmlssSIANLTALSGIWLGNNDLSGSTPDLSSLKRLEILHLEDNQIGGEIAPSLGR  193
              L G +   + N+ AL+ +WL  N L+G  PD+S L  L I+HLE+N++ G +   +G 
Sbjct  404  KNLKGEIPPELKNMEALTELWLDGNFLTGPLPDMSRLIDLRIVHLENNELTGSLPSYMGS  463

Query  192  IKSLRELFLQNNNLTGQIPGSIL  124
            + +L+EL ++NN+  G+IP ++L
Sbjct  464  LPNLQELHIENNSFVGEIPPALL  486



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 606761303232