BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c62318_g1_i1 len=114 path=[92:0-113]

Length=114
                                                                      Score     E

gb|EEQ24559.1|  hypothetical protein LACJE0001_1464                   63.2    4e-11   Lactobacillus jensenii 269-3
ref|WP_013086794.1|  permease                                         58.9    1e-09   
ref|WP_013085634.1|  permease                                         58.9    1e-09   
emb|CCB82280.1|  conserved protein                                    55.1    2e-08   
emb|CAR86709.1|  Conserved protein                                    52.8    1e-07   Lactobacillus rhamnosus GG
emb|CAR86198.1|  Conserved protein                                    52.4    2e-07   Lactobacillus rhamnosus GG
emb|CAR90713.1|  Conserved protein                                    50.8    9e-07   Lactobacillus rhamnosus Lc 705
emb|CDW93816.1|  conserved hypothetical protein                       42.7    5e-04   
emb|CDK36178.1|  putative transposase                                 42.7    6e-04   
emb|CBX28569.1|  hypothetical protein N47_G38930                      42.7    7e-04   



>gb|EEQ24559.1| hypothetical protein LACJE0001_1464 [Lactobacillus jensenii 269-3]
Length=174

 Score = 63.2 bits (152),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 31/37 (84%), Positives = 33/37 (89%), Gaps = 0/37 (0%)
 Frame = -3

Query  112  PLLHSSSTVSDAILRLSRRLSHQTY*TACTRFTPNKS  2
            PLLHS  TVSDA+LRLSRRLSHQTY +AC RFTPNKS
Sbjct  36   PLLHSRLTVSDAVLRLSRRLSHQTYQSACARFTPNKS  72



>ref|WP_013086794.1| permease [Lactobacillus crispatus]
 ref|YP_003602124.1| pg1 protein, homology to Homo sapiens [Lactobacillus crispatus 
ST1]
 emb|CBL51099.1| PG1 protein, homology to Homo sapiens [Lactobacillus crispatus 
ST1]
Length=144

 Score = 58.9 bits (141),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 29/37 (78%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = -3

Query  112  PLLHSSSTVSDAILRLSRRLSHQTY*TACTRFTPNKS  2
            PLLHS  TVSDA+ RLSR LSHQTY +AC RFTPNKS
Sbjct  6    PLLHSRKTVSDAVPRLSRGLSHQTYSSACARFTPNKS  42



>ref|WP_013085634.1| permease [Lactobacillus crispatus]
 ref|YP_003600533.1| pg1 protein, homology to Homo sapiens [Lactobacillus crispatus 
ST1]
 ref|YP_003600912.1| pg1 protein, homology to Homo sapiens [Lactobacillus crispatus 
ST1]
 ref|YP_003600924.1| pg1 protein, homology to Homo sapiens [Lactobacillus crispatus 
ST1]
 emb|CBL49508.1| PG1 protein, homology to Homo sapiens [Lactobacillus crispatus 
ST1]
 emb|CBL49887.1| PG1 protein, homology to Homo sapiens [Lactobacillus crispatus 
ST1]
 emb|CBL49899.1| PG1 protein, homology to Homo sapiens [Lactobacillus crispatus 
ST1]
Length=144

 Score = 58.9 bits (141),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 29/37 (78%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = -3

Query  112  PLLHSSSTVSDAILRLSRRLSHQTY*TACTRFTPNKS  2
            PLLHS  TVSDA+ RLSR LSHQTY +AC RFTPNKS
Sbjct  6    PLLHSRKTVSDAVPRLSRGLSHQTYSSACARFTPNKS  42



>emb|CCB82280.1| conserved protein [Lactobacillus pentosus MP-10]
Length=105

 Score = 55.1 bits (131),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 29/35 (83%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = -2

Query  113  SSSALKFNSF*CNSPVEPKAFTSDLLNRLHSLYAQ  9
            SSSALKF SF C S VEPKAFTSDL NRL SLYAQ
Sbjct  71   SSSALKFPSFRCTSSVEPKAFTSDLKNRLRSLYAQ  105



>emb|CAR86709.1| Conserved protein [Lactobacillus rhamnosus GG]
 emb|CAR86728.1| Conserved protein [Lactobacillus rhamnosus GG]
Length=105

 Score = 52.8 bits (125),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 27/35 (77%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = -2

Query  113  SSSALKFNSF*CNSPVEPKAFTSDLLNRLHSLYAQ  9
            SSSALKF+SF C S V+P+AFTSDL NRL SLYAQ
Sbjct  71   SSSALKFSSFRCTSSVKPRAFTSDLKNRLRSLYAQ  105



>emb|CAR86198.1| Conserved protein [Lactobacillus rhamnosus GG]
 emb|CAR87786.1| Conserved protein [Lactobacillus rhamnosus GG]
 emb|CAR88401.1| Conserved protein [Lactobacillus rhamnosus GG]
 emb|CAR89128.1| Conserved protein [Lactobacillus rhamnosus Lc 705]
 emb|CAR89647.1| Conserved protein [Lactobacillus rhamnosus Lc 705]
 emb|CAR89666.1| Conserved protein [Lactobacillus rhamnosus Lc 705]
 emb|CAR91350.1| Conserved protein [Lactobacillus rhamnosus Lc 705]
Length=105

 Score = 52.4 bits (124),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 27/35 (77%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = -2

Query  113  SSSALKFNSF*CNSPVEPKAFTSDLLNRLHSLYAQ  9
            SSSALKF SF C S V+P+AFTSDL NRL SLYAQ
Sbjct  71   SSSALKFPSFRCTSSVKPRAFTSDLKNRLRSLYAQ  105



>emb|CAR90713.1| Conserved protein [Lactobacillus rhamnosus Lc 705]
Length=105

 Score = 50.8 bits (120),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 26/35 (74%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = -2

Query  113  SSSALKFNSF*CNSPVEPKAFTSDLLNRLHSLYAQ  9
            SSS LKF SF C S V+P+AFTSDL NRL SLYAQ
Sbjct  71   SSSVLKFPSFRCTSSVKPRAFTSDLKNRLRSLYAQ  105



>emb|CDW93816.1| conserved hypothetical protein [Thiomonas sp. CB2]
Length=76

 Score = 42.7 bits (99),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 21/37 (57%), Positives = 27/37 (73%), Gaps = 0/37 (0%)
 Frame = -3

Query  112  PLLHSSSTVSDAILRLSRRLSHQTY*TACTRFTPNKS  2
            PL HSS  V++A+ RLS  +SH +Y TAC RFTP+ S
Sbjct  39   PLPHSSQAVTNAVPRLSPGISHLSYLTACARFTPSNS  75



>emb|CDK36178.1| putative transposase [Lactobacillus salivarius cp400]
 emb|CDK36154.1| putative transposase [Lactobacillus salivarius cp400]
 emb|CDK36042.1| conserved hypothetical protein [Lactobacillus salivarius cp400]
 emb|CDK35974.1| putative transposase [Lactobacillus salivarius cp400]
 emb|CDK35853.1| putative transposase [Lactobacillus salivarius cp400]
 emb|CDK35513.1| conserved hypothetical protein [Lactobacillus salivarius cp400]
Length=105

 Score = 42.7 bits (99),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 19/26 (73%), Positives = 22/26 (85%), Gaps = 0/26 (0%)
 Frame = -2

Query  86   F*CNSPVEPKAFTSDLLNRLHSLYAQ  9
            F C +PV+PKAFTSDL +RL SLYAQ
Sbjct  80   FQCTTPVKPKAFTSDLKDRLRSLYAQ  105



>emb|CBX28569.1| hypothetical protein N47_G38930 [uncultured Desulfobacterium 
sp.]
Length=114

 Score = 42.7 bits (99),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 22/34 (65%), Positives = 25/34 (74%), Gaps = 0/34 (0%)
 Frame = -2

Query  110  SSALKFNSF*CNSPVEPKAFTSDLLNRLHSLYAQ  9
            S  LK  SF C S V+P+AFTSDL NRL +LYAQ
Sbjct  81   SPILKSFSFKCTSEVKPRAFTSDLKNRLRALYAQ  114



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 521190666984