BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c62209_g1_i1 len=153 path=[131:0-152]

Length=153
                                                                      Score     E

ref|XP_004228389.1|  PREDICTED: serine carboxypeptidase-like 45       75.9    2e-14   
ref|XP_006363923.1|  PREDICTED: serine carboxypeptidase-like 45-like  75.1    3e-14   
ref|XP_006363922.1|  PREDICTED: serine carboxypeptidase-like 45-like  75.1    3e-14   
ref|XP_006363924.1|  PREDICTED: serine carboxypeptidase-like 45-like  74.7    5e-14   
gb|KHG07552.1|  Serine carboxypeptidase-like 45                       74.3    6e-14   
ref|XP_006482672.1|  PREDICTED: serine carboxypeptidase-like 46-like  74.3    6e-14   
ref|XP_006431097.1|  hypothetical protein CICLE_v10013776mg           74.3    6e-14   
gb|KDO72510.1|  hypothetical protein CISIN_1g039529mg                 73.9    7e-14   
ref|XP_009627244.1|  PREDICTED: serine carboxypeptidase-like 46       73.2    1e-13   
ref|XP_006482671.1|  PREDICTED: serine carboxypeptidase-like 44-like  73.2    2e-13   
ref|XP_009762845.1|  PREDICTED: serine carboxypeptidase-like 45       72.8    2e-13   
ref|XP_007046209.1|  Serine carboxypeptidase 46 isoform 2             72.0    3e-13   
ref|XP_007099702.1|  Serine carboxypeptidase 46                       72.0    4e-13   
ref|XP_007046208.1|  Serine carboxypeptidase 46 isoform 1             72.0    5e-13   
ref|XP_004228838.1|  PREDICTED: serine carboxypeptidase-like 45 i...  71.2    6e-13   
ref|XP_006431096.1|  hypothetical protein CICLE_v10013839mg           71.2    7e-13   
gb|KDO72509.1|  hypothetical protein CISIN_1g037032mg                 71.2    7e-13   
ref|XP_007046207.1|  Serine carboxypeptidase 46                       71.2    7e-13   
ref|XP_006380973.1|  hypothetical protein POPTR_0006s03480g           70.1    2e-12   
ref|XP_006380972.1|  hypothetical protein POPTR_0006s03480g           70.1    2e-12   
ref|XP_010068797.1|  PREDICTED: serine carboxypeptidase-like 46       68.9    5e-12   
gb|KCW64996.1|  hypothetical protein EUGRSUZ_G02538                   68.9    5e-12   
gb|KCW64994.1|  hypothetical protein EUGRSUZ_G02536                   68.9    5e-12   
ref|XP_010068795.1|  PREDICTED: serine carboxypeptidase-like 45       68.9    5e-12   
ref|XP_010068798.1|  PREDICTED: serine carboxypeptidase-like 45       68.9    5e-12   
ref|XP_011041403.1|  PREDICTED: serine carboxypeptidase-like 45       67.8    1e-11   
ref|XP_002322611.2|  hypothetical protein POPTR_0016s03390g           67.0    2e-11   Populus trichocarpa [western balsam poplar]
ref|XP_011040750.1|  PREDICTED: serine carboxypeptidase-like 45       67.4    2e-11   
gb|KEH33274.1|  serine carboxypeptidase-like protein                  67.0    2e-11   
emb|CBI22166.3|  unnamed protein product                              67.4    2e-11   
gb|KEH40983.1|  serine carboxypeptidase-like protein                  66.6    3e-11   
ref|XP_010661029.1|  PREDICTED: serine carboxypeptidase-like 45 i...  66.6    3e-11   
ref|XP_002277201.1|  PREDICTED: serine carboxypeptidase-like 45 i...  66.6    3e-11   Vitis vinifera
ref|XP_003633850.1|  PREDICTED: serine carboxypeptidase-like 46       66.6    3e-11   
ref|XP_010265020.1|  PREDICTED: serine carboxypeptidase-like 45       66.2    4e-11   
gb|KDP37688.1|  hypothetical protein JCGZ_06345                       65.9    6e-11   
gb|KHN08898.1|  Serine carboxypeptidase-like 45                       65.5    6e-11   
ref|XP_003554110.2|  PREDICTED: serine carboxypeptidase-like 45-like  65.5    7e-11   
ref|XP_010055750.1|  PREDICTED: serine carboxypeptidase-like 45 i...  65.1    9e-11   
ref|XP_004513403.1|  PREDICTED: serine carboxypeptidase-like 45-like  65.1    9e-11   
ref|XP_007224935.1|  hypothetical protein PRUPE_ppa021576mg           65.1    9e-11   
ref|XP_008218862.1|  PREDICTED: serine carboxypeptidase-like 45       65.1    1e-10   
gb|KEH37845.1|  serine carboxypeptidase-like protein                  65.1    1e-10   
gb|KHN30341.1|  Serine carboxypeptidase-like 45                       65.1    1e-10   
ref|XP_003520484.1|  PREDICTED: serine carboxypeptidase-like 45-like  65.1    1e-10   
ref|XP_010055744.1|  PREDICTED: serine carboxypeptidase-like 45 i...  64.7    1e-10   
gb|EWM28705.1|  serine carboxypeptidase ii-2                          65.1    1e-10   
ref|XP_007162065.1|  hypothetical protein PHAVU_001G120700g           64.7    1e-10   
ref|XP_010271870.1|  PREDICTED: serine carboxypeptidase-like 45 i...  64.3    2e-10   
ref|XP_010271869.1|  PREDICTED: serine carboxypeptidase-like 45 i...  64.3    2e-10   
ref|XP_002297872.2|  serine carboxypeptidase S10 family protein       64.3    2e-10   Populus trichocarpa [western balsam poplar]
ref|XP_011036159.1|  PREDICTED: serine carboxypeptidase-like 45 i...  64.3    2e-10   
ref|XP_011036160.1|  PREDICTED: serine carboxypeptidase-like 45 i...  63.9    2e-10   
ref|XP_011086871.1|  PREDICTED: serine carboxypeptidase-like 45       63.9    3e-10   
gb|KHN30342.1|  Serine carboxypeptidase-like 45                       61.6    3e-10   
ref|XP_007145476.1|  hypothetical protein PHAVU_007G242200g           63.5    3e-10   
emb|CAJ91147.1|  serine carboxypeptidase II                           61.6    4e-10   Platanus x hispanica [London plane tree]
ref|XP_002517286.1|  serine carboxypeptidase, putative                63.2    4e-10   Ricinus communis
ref|XP_006576775.1|  PREDICTED: serine carboxypeptidase-like 45-l...  63.2    4e-10   
ref|XP_011040753.1|  PREDICTED: serine carboxypeptidase-like 45       63.2    5e-10   
ref|XP_003520486.1|  PREDICTED: serine carboxypeptidase-like 45-l...  63.2    5e-10   
ref|XP_010044871.1|  PREDICTED: serine carboxypeptidase-like 45       63.2    5e-10   
gb|KHN07932.1|  Serine carboxypeptidase-like 45                       63.2    5e-10   
ref|XP_006589008.1|  PREDICTED: serine carboxypeptidase-like 45-like  63.2    5e-10   
gb|KGN59522.1|  hypothetical protein Csa_3G824190                     60.8    5e-10   
ref|XP_002520628.1|  serine carboxypeptidase, putative                62.8    7e-10   Ricinus communis
gb|EYU18606.1|  hypothetical protein MIMGU_mgv1a004861mg              62.8    8e-10   
ref|XP_006410496.1|  hypothetical protein EUTSA_v10016623mg           62.4    8e-10   
ref|XP_007162064.1|  hypothetical protein PHAVU_001G120600g           62.4    8e-10   
gb|AES62618.2|  serine carboxypeptidase-like protein                  62.8    9e-10   
ref|XP_003592367.1|  Serine carboxypeptidase-like protein             62.4    1e-09   
ref|XP_009404114.1|  PREDICTED: serine carboxypeptidase-like 45       62.0    1e-09   
ref|XP_001751694.1|  predicted protein                                62.0    1e-09   
ref|XP_004361668.1|  peptidase S10 family protein                     62.0    1e-09   
ref|XP_006829355.1|  hypothetical protein AMTR_s02986p00003470        62.0    1e-09   
ref|XP_006341487.1|  PREDICTED: serine carboxypeptidase-like 45-like  62.0    1e-09   
dbj|GAM27668.1|  hypothetical protein SAMD00019534_108440             61.6    1e-09   
ref|XP_010239839.1|  PREDICTED: serine carboxypeptidase-like 45       62.0    1e-09   
ref|XP_006430527.1|  hypothetical protein CICLE_v10011695mg           61.6    2e-09   
ref|XP_010055754.1|  PREDICTED: serine carboxypeptidase-like 45       61.6    2e-09   
ref|XP_006482059.1|  PREDICTED: serine carboxypeptidase-like 45-like  61.6    2e-09   
ref|XP_007043816.1|  Serine carboxypeptidase-like 45 isoform 1        61.6    2e-09   
ref|XP_007043818.1|  Serine carboxypeptidase-like 45 isoform 3        61.6    2e-09   
ref|XP_010256545.1|  PREDICTED: serine carboxypeptidase-like 45       61.6    2e-09   
ref|XP_002307961.1|  hypothetical protein POPTR_0006s03440g           61.6    2e-09   Populus trichocarpa [western balsam poplar]
ref|XP_008777393.1|  PREDICTED: serine carboxypeptidase-like 45 i...  61.6    2e-09   
ref|XP_001013292.1|  Serine carboxypeptidase family protein           61.6    2e-09   Tetrahymena thermophila
gb|EAR93047.2|  serine carboxypeptidase family protein                61.6    2e-09   Tetrahymena thermophila SB210
ref|XP_004492026.1|  PREDICTED: serine carboxypeptidase-like 45-like  61.6    2e-09   
ref|XP_008777392.1|  PREDICTED: serine carboxypeptidase-like 45 i...  61.6    2e-09   
emb|CBI32794.3|  unnamed protein product                              61.2    2e-09   
ref|XP_010653629.1|  PREDICTED: serine carboxypeptidase-like 45       61.2    2e-09   
ref|XP_009380118.1|  PREDICTED: serine carboxypeptidase-like 45 i...  61.2    3e-09   
ref|XP_010942380.1|  PREDICTED: serine carboxypeptidase-like 45       61.2    3e-09   
ref|XP_007203526.1|  hypothetical protein PRUPE_ppa026347mg           60.8    3e-09   
gb|KDP37687.1|  hypothetical protein JCGZ_06344                       60.8    3e-09   
gb|KCW90016.1|  hypothetical protein EUGRSUZ_A02215                   60.8    3e-09   
ref|XP_004298533.1|  PREDICTED: serine carboxypeptidase-like 45-like  60.8    3e-09   
ref|XP_004136793.1|  PREDICTED: serine carboxypeptidase-like 45-like  60.8    3e-09   
ref|XP_009355265.1|  PREDICTED: serine carboxypeptidase-like 45       60.8    3e-09   
gb|KHN20302.1|  Serine carboxypeptidase-like 45                       57.8    3e-09   
ref|XP_010023719.1|  PREDICTED: serine carboxypeptidase-like 45       60.8    3e-09   
ref|XP_010250555.1|  PREDICTED: serine carboxypeptidase-like 45       60.8    3e-09   
gb|KCW64995.1|  hypothetical protein EUGRSUZ_G02537                   60.8    3e-09   
ref|XP_009380117.1|  PREDICTED: serine carboxypeptidase-like 45 i...  60.8    3e-09   
gb|AES77859.2|  serine carboxypeptidase-like protein                  60.8    3e-09   
ref|XP_007212763.1|  hypothetical protein PRUPE_ppa025629mg           58.2    4e-09   
ref|XP_009334311.1|  PREDICTED: serine carboxypeptidase-like 45       60.8    4e-09   
ref|XP_003621641.1|  Serine carboxypeptidase-like protein             60.8    4e-09   
ref|XP_002268172.1|  PREDICTED: serine carboxypeptidase-like 45       60.8    4e-09   Vitis vinifera
ref|XP_007038111.1|  Serine carboxypeptidase-like 45 isoform 2        60.5    4e-09   
ref|XP_010469459.1|  PREDICTED: serine carboxypeptidase-like 46       60.5    4e-09   
ref|XP_010509871.1|  PREDICTED: serine carboxypeptidase-like 46       60.5    4e-09   
emb|CEI92705.1|  hypothetical protein RMCBS344292_06958               58.9    4e-09   
ref|XP_002512656.1|  serine carboxypeptidase, putative                60.5    4e-09   Ricinus communis
ref|XP_004310134.1|  PREDICTED: serine carboxypeptidase-like 45-like  60.5    4e-09   
gb|EAY93940.1|  hypothetical protein OsI_15713                        60.5    4e-09   Oryza sativa Indica Group [Indian rice]
ref|XP_009337518.1|  PREDICTED: serine carboxypeptidase-like 45       60.5    4e-09   
ref|XP_007209121.1|  hypothetical protein PRUPE_ppa005457mg           60.5    4e-09   
ref|XP_009368797.1|  PREDICTED: serine carboxypeptidase-like 45       60.5    4e-09   
ref|XP_008374178.1|  PREDICTED: serine carboxypeptidase-like 45       60.5    4e-09   
ref|XP_006844530.1|  hypothetical protein AMTR_s00016p00162700        60.5    4e-09   
ref|XP_011075459.1|  PREDICTED: serine carboxypeptidase-like 45       60.5    5e-09   
ref|XP_004975453.1|  PREDICTED: serine carboxypeptidase-like 45-like  60.5    5e-09   
ref|XP_008240683.1|  PREDICTED: serine carboxypeptidase-like 45       60.5    5e-09   
ref|XP_011040747.1|  PREDICTED: serine carboxypeptidase-like 45 i...  60.5    5e-09   
ref|XP_009759845.1|  PREDICTED: serine carboxypeptidase-like 45       60.5    5e-09   
ref|XP_008667418.1|  PREDICTED: hypothetical protein isoform X2       60.5    5e-09   
ref|XP_008667417.1|  PREDICTED: hypothetical protein isoform X1       60.5    5e-09   
tpg|DAA38059.1|  TPA: hypothetical protein ZEAMMB73_252249            60.5    5e-09   
ref|XP_011020860.1|  PREDICTED: serine carboxypeptidase-like 45       60.5    5e-09   
ref|XP_011040748.1|  PREDICTED: serine carboxypeptidase-like 45 i...  60.5    5e-09   
gb|KDP37690.1|  hypothetical protein JCGZ_06347                       60.5    5e-09   
ref|NP_001150027.1|  serine carboxypeptidase K10B2.2 precursor        60.5    5e-09   Zea mays [maize]
ref|NP_001052663.1|  Os04g0396800                                     60.5    5e-09   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002517289.1|  serine carboxypeptidase, putative                60.1    5e-09   Ricinus communis
ref|XP_007139316.1|  hypothetical protein PHAVU_008G019100g           60.1    6e-09   
ref|XP_008791046.1|  PREDICTED: serine carboxypeptidase-like 45       60.1    6e-09   
ref|XP_007038110.1|  Serine carboxypeptidase-like 45 isoform 1        60.1    6e-09   
ref|XP_009599118.1|  PREDICTED: serine carboxypeptidase-like 45       60.1    6e-09   
ref|XP_008357633.1|  PREDICTED: serine carboxypeptidase-like 45       59.3    6e-09   
ref|XP_010271867.1|  PREDICTED: serine carboxypeptidase-like 45 i...  60.1    6e-09   
gb|KHN30340.1|  Serine carboxypeptidase-like 45                       60.1    6e-09   
ref|XP_009778790.1|  PREDICTED: serine carboxypeptidase-like 45       60.1    6e-09   
ref|XP_003521119.1|  PREDICTED: serine carboxypeptidase-like 45-like  60.1    6e-09   
ref|XP_010413849.1|  PREDICTED: serine carboxypeptidase-like 46       60.1    6e-09   
ref|XP_008351704.1|  PREDICTED: serine carboxypeptidase-like 45       57.8    6e-09   
ref|XP_010249188.1|  PREDICTED: serine carboxypeptidase-like 45       60.1    6e-09   
ref|XP_003758638.1|  PREDICTED: lysosomal protective protein-like     60.1    7e-09   
ref|XP_010271868.1|  PREDICTED: serine carboxypeptidase-like 45 i...  60.1    7e-09   
gb|KHN47533.1|  Serine carboxypeptidase-like 45                       60.1    7e-09   
gb|EMS60816.1|  Serine carboxypeptidase-like 45                       60.1    7e-09   
ref|XP_008443350.1|  PREDICTED: serine carboxypeptidase-like 45       60.1    7e-09   
ref|XP_006294161.1|  hypothetical protein CARUB_v10023154mg           60.1    7e-09   
ref|XP_008378990.1|  PREDICTED: serine carboxypeptidase-like 45       59.3    7e-09   
gb|EYU21824.1|  hypothetical protein MIMGU_mgv1a006099mg              59.7    8e-09   
ref|XP_002446348.1|  hypothetical protein SORBIDRAFT_06g014580        59.7    8e-09   Sorghum bicolor [broomcorn]
ref|XP_007337695.1|  alpha/beta-hydrolase                             59.7    8e-09   
ref|XP_010271865.1|  PREDICTED: serine carboxypeptidase-like 45 i...  59.7    9e-09   
ref|XP_009109757.1|  PREDICTED: serine carboxypeptidase-like 45       59.7    1e-08   
emb|CDY11750.1|  BnaC03g58280D                                        59.7    1e-08   
ref|XP_008378883.1|  PREDICTED: serine carboxypeptidase-like 45       59.7    1e-08   
emb|CDX90124.1|  BnaA08g18600D                                        59.7    1e-08   
ref|XP_002307963.1|  hypothetical protein POPTR_0006s03490g           59.7    1e-08   Populus trichocarpa [western balsam poplar]
ref|XP_010271866.1|  PREDICTED: serine carboxypeptidase-like 45 i...  59.7    1e-08   
ref|XP_004488543.1|  PREDICTED: serine carboxypeptidase-like 45-like  59.7    1e-08   
ref|XP_004139740.1|  PREDICTED: LOW QUALITY PROTEIN: pentatricope...  60.1    1e-08   
ref|XP_011073181.1|  PREDICTED: serine carboxypeptidase-like 45       59.3    1e-08   
ref|XP_006838780.1|  hypothetical protein AMTR_s00002p00258640        59.7    1e-08   
gb|KDP23272.1|  hypothetical protein JCGZ_23105                       59.3    1e-08   
ref|XP_004171434.1|  PREDICTED: serine carboxypeptidase-like 42-like  57.0    1e-08   
ref|XP_010099600.1|  Serine carboxypeptidase-like 45                  59.3    1e-08   
gb|EAR93048.3|  serine carboxypeptidase family protein                59.3    1e-08   Tetrahymena thermophila SB210
ref|XP_001013293.2|  Serine carboxypeptidase family protein           59.3    1e-08   Tetrahymena thermophila
ref|XP_006652227.1|  PREDICTED: serine carboxypeptidase-like 45-like  59.3    1e-08   
ref|XP_004488374.1|  PREDICTED: serine carboxypeptidase-like 45-like  59.3    1e-08   
gb|EMT29573.1|  Serine carboxypeptidase-like 45                       59.3    1e-08   
ref|XP_009415855.1|  PREDICTED: serine carboxypeptidase-like 45       59.3    1e-08   
ref|XP_010549304.1|  PREDICTED: serine carboxypeptidase-like 45 i...  58.9    1e-08   
ref|XP_010549305.1|  PREDICTED: serine carboxypeptidase-like 45 i...  58.9    1e-08   
emb|CDY61693.1|  BnaC05g51120D                                        58.9    1e-08   
gb|KCW52793.1|  hypothetical protein EUGRSUZ_J02128                   58.5    2e-08   
gb|AAB80670.1|  putative serine carboxypeptidase II                   58.9    2e-08   Arabidopsis thaliana [mouse-ear cress]
ref|NP_850212.1|  serine carboxypeptidase-like 46                     58.9    2e-08   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010055727.1|  PREDICTED: serine carboxypeptidase-like 45       58.9    2e-08   
emb|CDO98312.1|  unnamed protein product                              58.9    2e-08   
ref|XP_009113703.1|  PREDICTED: serine carboxypeptidase-like 45       58.9    2e-08   
ref|XP_006415698.1|  hypothetical protein EUTSA_v10007573mg           58.9    2e-08   
ref|XP_004136677.1|  PREDICTED: serine carboxypeptidase-like 45-like  58.9    2e-08   
ref|XP_009553499.1|  serine carboxypeptidase S10                      58.9    2e-08   
ref|XP_009143848.1|  PREDICTED: serine carboxypeptidase-like 46       58.5    2e-08   
emb|CDY19500.1|  BnaC04g10990D                                        58.5    2e-08   
ref|XP_004241645.1|  PREDICTED: serine carboxypeptidase-like 45       58.5    2e-08   
ref|XP_010929656.1|  PREDICTED: serine carboxypeptidase-like 45       58.5    2e-08   
ref|XP_007368976.1|  alpha/beta-hydrolase                             58.5    2e-08   
ref|XP_004159625.1|  PREDICTED: LOW QUALITY PROTEIN: serine carbo...  58.5    2e-08   
gb|KDO83182.1|  hypothetical protein CISIN_1g012396mg                 58.2    2e-08   
ref|XP_004235841.1|  PREDICTED: serine carboxypeptidase-like 45 i...  58.5    2e-08   
ref|XP_006304410.1|  hypothetical protein CARUB_v10010972mg           58.5    2e-08   
ref|XP_007223033.1|  hypothetical protein PRUPE_ppa005360mg           58.5    2e-08   
ref|XP_008222370.1|  PREDICTED: serine carboxypeptidase-like 45 i...  58.5    2e-08   
gb|KHN13827.1|  Serine carboxypeptidase-like 45                       58.5    2e-08   
ref|XP_008222371.1|  PREDICTED: serine carboxypeptidase-like 45 i...  58.5    2e-08   
ref|XP_007223032.1|  hypothetical protein PRUPE_ppa005360mg           58.5    2e-08   
ref|XP_008035223.1|  serine carboxypeptidase                          58.5    2e-08   
ref|XP_010318664.1|  PREDICTED: serine carboxypeptidase-like 45 i...  58.5    2e-08   
ref|XP_006495375.1|  PREDICTED: serine carboxypeptidase-like 45-like  57.8    2e-08   
ref|XP_009359890.1|  PREDICTED: serine carboxypeptidase-like 45       58.5    2e-08   
gb|EMD36755.1|  hypothetical protein CERSUDRAFT_114672                58.5    2e-08   
gb|KDO83183.1|  hypothetical protein CISIN_1g012396mg                 57.8    2e-08   
ref|XP_003551804.1|  PREDICTED: serine carboxypeptidase-like 45-like  58.5    2e-08   
ref|XP_009615672.1|  PREDICTED: serine carboxypeptidase-like 45 i...  58.2    3e-08   
ref|XP_009615670.1|  PREDICTED: serine carboxypeptidase-like 45 i...  58.2    3e-08   
ref|XP_009378815.1|  PREDICTED: serine carboxypeptidase-like 45       58.2    3e-08   
gb|AAG51475.1|AC069471_6  serine carboxypeptidase II, putative        58.2    3e-08   Arabidopsis thaliana [mouse-ear cress]
ref|NP_564298.1|  serine carboxypeptidase-like 45                     58.2    3e-08   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007850141.1|  carboxypeptidase s1                              58.5    3e-08   
ref|XP_002771519.1|  hypothetical protein Pmar_PMAR000572             58.2    3e-08   Perkinsus marinus ATCC 50983
gb|KHN09723.1|  Serine carboxypeptidase-like 45                       58.2    3e-08   
ref|XP_002893504.1|  SCPL45                                           58.2    3e-08   
ref|XP_010023699.1|  PREDICTED: serine carboxypeptidase-like 45       58.2    3e-08   
ref|XP_008045018.1|  alpha/beta-hydrolase                             58.2    3e-08   
ref|XP_002881286.1|  hypothetical protein ARALYDRAFT_482299           58.2    3e-08   
ref|XP_003528093.2|  PREDICTED: serine carboxypeptidase-like 45-like  58.2    3e-08   
ref|XP_002280796.2|  PREDICTED: serine carboxypeptidase-like 45       58.2    3e-08   Vitis vinifera
emb|CDP11023.1|  unnamed protein product                              58.2    3e-08   
ref|XP_010478165.1|  PREDICTED: serine carboxypeptidase-like 45       58.2    3e-08   
ref|XP_007028219.1|  Serine carboxypeptidase-like 45                  58.5    3e-08   
ref|XP_008239549.1|  PREDICTED: serine carboxypeptidase-like 45       58.2    3e-08   
ref|XP_008390188.1|  PREDICTED: serine carboxypeptidase-like 45       58.2    3e-08   
ref|XP_006393769.1|  hypothetical protein EUTSA_v10011445mg           58.2    3e-08   
ref|XP_006438864.1|  hypothetical protein CICLE_v10031451mg           57.8    3e-08   
ref|XP_007719156.1|  carboxypeptidase D                               58.2    4e-08   
ref|XP_001031130.1|  Serine carboxypeptidase family protein           57.8    4e-08   Tetrahymena thermophila
gb|KDO83181.1|  hypothetical protein CISIN_1g012396mg                 57.8    4e-08   
ref|XP_006483005.1|  PREDICTED: serine carboxypeptidase-like 45-like  57.8    4e-08   
gb|EAR83467.2|  serine carboxypeptidase family protein                57.8    4e-08   Tetrahymena thermophila SB210
ref|XP_002511104.1|  serine carboxypeptidase, putative                57.8    4e-08   Ricinus communis
ref|XP_009355272.1|  PREDICTED: serine carboxypeptidase-like 45 i...  57.8    4e-08   
emb|CEI85808.1|  hypothetical protein RMCBS344292_00259               57.8    4e-08   
emb|CEG69308.1|  hypothetical protein RMATCC62417_05406               57.8    4e-08   
ref|XP_006477516.1|  PREDICTED: serine carboxypeptidase-like 45-like  57.0    4e-08   
ref|XP_001586512.1|  hypothetical protein SS1G_12499                  58.2    4e-08   Sclerotinia sclerotiorum 1980 UF-70
gb|EAR83465.2|  serine carboxypeptidase family protein                57.8    4e-08   Tetrahymena thermophila SB210
ref|XP_003531913.1|  PREDICTED: serine carboxypeptidase-like 45-l...  57.8    4e-08   
ref|XP_008670742.1|  PREDICTED: serine carboxypeptidase-like 45       57.8    4e-08   
ref|XP_009355270.1|  PREDICTED: serine carboxypeptidase-like 45 i...  57.8    4e-08   
ref|XP_009355271.1|  PREDICTED: serine carboxypeptidase-like 45 i...  57.8    4e-08   
gb|KHG09716.1|  Serine carboxypeptidase-like 45                       57.8    5e-08   
ref|XP_007159978.1|  hypothetical protein PHAVU_002G282700g           57.8    5e-08   
gb|EEC68261.1|  hypothetical protein OsI_36290                        57.8    5e-08   Oryza sativa Indica Group [Indian rice]
ref|NP_001176565.1|  Os11g0522900                                     57.8    5e-08   
ref|NP_001151474.1|  LOC100285107 precursor                           57.8    5e-08   Zea mays [maize]
ref|XP_008369640.1|  PREDICTED: serine carboxypeptidase-like 45       57.4    5e-08   
ref|XP_006584695.1|  PREDICTED: serine carboxypeptidase-like 45-l...  57.4    5e-08   
gb|KFK44682.1|  hypothetical protein AALP_AA1G289900                  57.4    5e-08   
ref|XP_008454133.1|  PREDICTED: serine carboxypeptidase-like 45       57.4    5e-08   
ref|XP_004152156.1|  PREDICTED: serine carboxypeptidase-like 45-like  57.4    5e-08   
ref|XP_007159977.1|  hypothetical protein PHAVU_002G282700g           57.4    5e-08   
ref|XP_003532390.1|  PREDICTED: serine carboxypeptidase-like 45-l...  57.4    5e-08   
gb|KHN08897.1|  Serine carboxypeptidase-like 45                       57.4    5e-08   
ref|XP_007395069.1|  hypothetical protein PHACADRAFT_160751           57.4    5e-08   
ref|XP_006662960.1|  PREDICTED: serine carboxypeptidase-like 45-like  57.4    5e-08   
ref|XP_009360732.1|  PREDICTED: serine carboxypeptidase-like 42       57.4    5e-08   
ref|XP_001031128.1|  Serine carboxypeptidase family protein           57.4    6e-08   Tetrahymena thermophila
ref|XP_003554111.1|  PREDICTED: serine carboxypeptidase-like 45-like  57.4    6e-08   
ref|XP_010678341.1|  PREDICTED: serine carboxypeptidase-like 45       57.4    6e-08   
gb|ELU00097.1|  hypothetical protein CAPTEDRAFT_188671                55.5    6e-08   
ref|XP_004979352.1|  PREDICTED: serine carboxypeptidase-like 45-like  57.4    6e-08   
gb|KDQ60279.1|  hypothetical protein JAAARDRAFT_205260                57.4    6e-08   
gb|EME48029.1|  hypothetical protein DOTSEDRAFT_60392                 57.4    6e-08   
gb|KEH16886.1|  serine carboxypeptidase-like protein                  56.6    7e-08   
ref|XP_007137891.1|  hypothetical protein PHAVU_009G164600g           57.0    7e-08   
gb|EMS58238.1|  Serine carboxypeptidase-like 45                       57.0    7e-08   
emb|CCM01217.1|  predicted protein                                    57.0    8e-08   
gb|EFA80920.1|  peptidase S10 family protein                          56.6    8e-08   Polysphondylium pallidum PN500
ref|XP_002186362.1|  predicted protein                                57.0    8e-08   Phaeodactylum tricornutum CCAP 1055/1
emb|CEG84413.1|  hypothetical protein RMATCC62417_18217               57.0    8e-08   
ref|XP_006863692.1|  PREDICTED: lysosomal protective protein-like     57.0    8e-08   
gb|KGN59518.1|  hypothetical protein Csa_3G823660                     56.6    9e-08   
gb|KEH35690.1|  serine carboxypeptidase-like protein                  56.6    9e-08   
gb|EYU28449.1|  hypothetical protein MIMGU_mgv1a004999mg              57.0    9e-08   
gb|EPS68641.1|  hypothetical protein M569_06128                       54.3    9e-08   
gb|EWM28739.1|  serine carboxypeptidase-like protein                  57.0    1e-07   
ref|XP_008024058.1|  hypothetical protein SETTUDRAFT_27640            57.0    1e-07   
ref|XP_005855768.1|  cathepsin a                                      54.3    1e-07   
gb|KGN44500.1|  hypothetical protein Csa_7G319000                     56.6    1e-07   
ref|XP_011042948.1|  PREDICTED: serine carboxypeptidase-like 45       56.6    1e-07   
gb|KFK42257.1|  hypothetical protein AALP_AA2G231900                  53.9    1e-07   
ref|XP_010673054.1|  PREDICTED: serine carboxypeptidase-like 45       56.6    1e-07   
ref|XP_007267387.1|  alpha/beta-hydrolase                             56.6    1e-07   
emb|CDO70247.1|  hypothetical protein BN946_scf184942.g47             56.6    1e-07   
emb|CDO78058.1|  hypothetical protein BN946_scf184826.g3              56.6    1e-07   
ref|XP_008461496.1|  PREDICTED: serine carboxypeptidase-like 42 i...  56.6    1e-07   
ref|XP_008461495.1|  PREDICTED: serine carboxypeptidase-like 42 i...  56.6    1e-07   
gb|ELW66216.1|  Lysosomal protective protein                          56.2    1e-07   
ref|XP_006148543.1|  PREDICTED: lysosomal protective protein-like     56.2    1e-07   
gb|EWM28677.1|  Peptidase S10, serine carboxypeptidase                56.6    1e-07   
ref|XP_007305848.1|  alpha/beta-hydrolase                             56.6    1e-07   
ref|XP_010463193.1|  PREDICTED: serine carboxypeptidase-like 44       56.2    1e-07   
ref|XP_005647936.1|  peptidase S10, serine carboxypeptidase           56.2    1e-07   
ref|NP_175046.1|  serine carboxypeptidase-like 44                     56.2    1e-07   
ref|XP_010048771.1|  PREDICTED: serine carboxypeptidase II-2          56.2    1e-07   
ref|XP_007379627.1|  alpha/beta-hydrolase                             56.2    1e-07   
gb|KDR67990.1|  hypothetical protein GALMADRAFT_161293                56.2    1e-07   
ref|XP_010040844.1|  PREDICTED: serine carboxypeptidase II-2-like     56.2    1e-07   
ref|XP_002783901.1|  conserved hypothetical protein                   54.3    1e-07   
gb|KCW90013.1|  hypothetical protein EUGRSUZ_A02209                   56.2    1e-07   
ref|XP_010055737.1|  PREDICTED: serine carboxypeptidase-like 45       56.2    1e-07   
gb|EUN26203.1|  hypothetical protein COCVIDRAFT_27359                 56.2    1e-07   
ref|XP_004136792.1|  PREDICTED: serine carboxypeptidase-like 45-like  56.2    2e-07   
gb|KHN31265.1|  Serine carboxypeptidase-like 45                       56.2    2e-07   
ref|XP_008722015.1|  hypothetical protein G647_00390                  56.2    2e-07   
ref|XP_010479023.1|  PREDICTED: serine carboxypeptidase-like 44       56.2    2e-07   
ref|XP_001776058.1|  predicted protein                                55.8    2e-07   
ref|XP_002777283.1|  conserved hypothetical protein                   53.9    2e-07   
ref|XP_007477593.1|  PREDICTED: lysosomal protective protein-like     55.8    2e-07   
ref|XP_006578724.1|  PREDICTED: serine carboxypeptidase-like 45-like  56.2    2e-07   
gb|EMD34742.1|  hypothetical protein CERSUDRAFT_86172                 56.2    2e-07   
ref|XP_010653630.1|  PREDICTED: serine carboxypeptidase-like 45       55.1    2e-07   
ref|XP_004371719.1|  PREDICTED: lysosomal protective protein-like     55.8    2e-07   
ref|XP_007752587.1|  carboxypeptidase D                               56.2    2e-07   
gb|KDR67991.1|  hypothetical protein GALMADRAFT_1058390               55.8    2e-07   
gb|KFK44686.1|  hypothetical protein AALP_AA1G290400                  55.5    2e-07   
ref|XP_004150367.1|  PREDICTED: serine carboxypeptidase-like 49-like  55.8    2e-07   
gb|KDD74822.1|  serine carboxypeptidase                               55.8    2e-07   
ref|XP_004618806.1|  PREDICTED: lysosomal protective protein isof...  55.8    2e-07   
ref|XP_004164209.1|  PREDICTED: serine carboxypeptidase-like 49-like  55.8    2e-07   
ref|XP_009391583.1|  PREDICTED: serine carboxypeptidase II-3          55.8    2e-07   
gb|AES71591.2|  serine carboxypeptidase-like protein                  55.8    2e-07   
ref|XP_003592243.1|  Serine carboxypeptidase II-3                     55.8    2e-07   
emb|CBI32801.3|  unnamed protein product                              55.5    2e-07   
ref|XP_011002097.1|  PREDICTED: serine carboxypeptidase-like 45       55.5    2e-07   
ref|XP_010499305.1|  PREDICTED: serine carboxypeptidase-like 45       55.8    2e-07   
ref|XP_002321745.2|  hypothetical protein POPTR_0015s11610g           55.8    2e-07   
ref|XP_009617439.1|  PREDICTED: serine carboxypeptidase-like          55.5    2e-07   
ref|XP_007028221.1|  Serine carboxypeptidase 45                       55.5    3e-07   
ref|XP_010322561.1|  PREDICTED: serine carboxypeptidase-like 46 i...  55.5    3e-07   
ref|XP_002277420.3|  PREDICTED: serine carboxypeptidase-like 45       55.5    3e-07   
ref|XP_004290564.1|  PREDICTED: serine carboxypeptidase-like 42-like  55.5    3e-07   
ref|XP_004483026.1|  PREDICTED: lysosomal protective protein-like     55.5    3e-07   
ref|XP_003630573.1|  Serine carboxypeptidase                          55.5    3e-07   
ref|XP_002772211.1|  hypothetical protein Pmar_PMAR005522             53.1    3e-07   
ref|XP_007910643.1|  PREDICTED: lysosomal protective protein          55.5    3e-07   
ref|XP_003577529.1|  PREDICTED: serine carboxypeptidase-like 45       55.5    3e-07   
ref|XP_003592237.1|  Serine carboxypeptidase II-3                     55.5    3e-07   
ref|XP_002780688.1|  conserved hypothetical protein                   53.9    3e-07   
ref|XP_008443351.1|  PREDICTED: serine carboxypeptidase-like 45       55.5    3e-07   
ref|XP_007588597.1|  putative carboxypeptidase s1 protein             55.5    3e-07   
ref|XP_004858189.1|  PREDICTED: lysosomal protective protein isof...  55.5    3e-07   
ref|XP_010460580.1|  PREDICTED: serine carboxypeptidase-like 45       55.5    3e-07   
ref|XP_008032925.1|  peptidase S10 serine carboxypeptidase            55.5    3e-07   
ref|XP_008032962.1|  alpha/beta-hydrolase                             55.5    3e-07   
ref|XP_010682654.1|  PREDICTED: serine carboxypeptidase-like 45       55.5    3e-07   
emb|CDP16350.1|  unnamed protein product                              55.5    3e-07   
ref|XP_011031665.1|  PREDICTED: serine carboxypeptidase-like          55.5    3e-07   
gb|KCW90015.1|  hypothetical protein EUGRSUZ_A02214                   55.5    3e-07   
emb|CBI32802.3|  unnamed protein product                              55.8    3e-07   
ref|XP_009123167.1|  PREDICTED: serine carboxypeptidase-like 42       55.5    3e-07   
ref|XP_008783277.1|  PREDICTED: serine carboxypeptidase II-3-like     55.5    3e-07   
ref|XP_009789305.1|  PREDICTED: serine carboxypeptidase II-2          55.1    3e-07   
ref|XP_004501743.1|  PREDICTED: serine carboxypeptidase-like 45-like  55.1    3e-07   
ref|XP_007851605.1|  carboxypeptidase s1                              55.5    3e-07   
ref|XP_001390401.1|  serine carboxypeptidase                          55.5    3e-07   
emb|CDY23340.1|  BnaA08g12060D                                        55.1    3e-07   
ref|XP_010938742.1|  PREDICTED: serine carboxypeptidase II-3-like     55.1    3e-07   
gb|EHA21285.1|  hypothetical protein ASPNIDRAFT_54734                 55.5    3e-07   
ref|XP_009630744.1|  PREDICTED: serine carboxypeptidase II-2          55.1    3e-07   
ref|XP_008084991.1|  alpha/beta-Hydrolase                             55.5    3e-07   
gb|AAQ63884.1|  putative serine carboxypeptidase                      55.1    3e-07   
ref|XP_010655923.1|  PREDICTED: serine carboxypeptidase-like 34       55.1    3e-07   
emb|CBI29056.3|  unnamed protein product                              55.1    3e-07   
ref|XP_007316955.1|  hypothetical protein SERLADRAFT_464203           55.1    3e-07   
ref|XP_010906016.1|  PREDICTED: serine carboxypeptidase II-3-like     55.1    3e-07   
gb|EWM28021.1|  pheromone processing carboxypeptidase                 55.5    4e-07   
ref|XP_002876115.1|  hypothetical protein ARALYDRAFT_485559           55.1    4e-07   
gb|KHN30339.1|  Serine carboxypeptidase-like 45                       55.1    4e-07   
ref|XP_003592239.1|  Serine carboxypeptidase-like protein             55.1    4e-07   
ref|XP_001031129.1|  Serine carboxypeptidase family protein           55.1    4e-07   
ref|XP_002311071.2|  Serine carboxypeptidase precursor family pro...  55.1    4e-07   
ref|XP_001557446.1|  hypothetical protein BC1G_03710                  55.1    4e-07   
gb|EMR82286.1|  putative carboxypeptidase s1 protein                  55.1    4e-07   
gb|KHJ76650.1|  serine carboxypeptidase                               52.8    4e-07   
ref|XP_007946322.1|  PREDICTED: lysosomal protective protein-like     55.1    4e-07   
ref|XP_006343604.1|  PREDICTED: serine carboxypeptidase II-2-like     55.1    4e-07   
ref|XP_004036721.1|  serine carboxypeptidase family protein, puta...  54.7    4e-07   
emb|CCD50959.1|  similar to carboxypeptidase, partial sequence        55.1    4e-07   
gb|ELU06391.1|  hypothetical protein CAPTEDRAFT_219421                54.7    4e-07   
ref|NP_001242846.1|  uncharacterized protein LOC100819443 precursor   55.1    4e-07   
ref|XP_010519388.1|  PREDICTED: serine carboxypeptidase-like 42       55.1    4e-07   
emb|CBI32795.3|  unnamed protein product                              54.7    4e-07   
gb|AFK34623.1|  unknown                                               52.8    4e-07   
ref|XP_004503800.1|  PREDICTED: serine carboxypeptidase-like 45-like  54.7    4e-07   
ref|XP_004242620.1|  PREDICTED: serine carboxypeptidase II-2          54.7    4e-07   
ref|XP_007769780.1|  alpha beta-hydrolase                             54.7    4e-07   
ref|XP_010653632.1|  PREDICTED: serine carboxypeptidase-like 45       54.7    5e-07   
ref|XP_009355267.1|  PREDICTED: serine carboxypeptidase-like 45 i...  54.7    5e-07   
ref|XP_007689412.1|  hypothetical protein COCMIDRAFT_99183            55.1    5e-07   
gb|EMD88593.1|  hypothetical protein COCHEDRAFT_1196555               55.1    5e-07   
ref|XP_007699867.1|  hypothetical protein COCSADRAFT_37091            55.1    5e-07   
ref|XP_009355268.1|  PREDICTED: serine carboxypeptidase-like 45 i...  54.7    5e-07   
ref|XP_002766740.1|  conserved hypothetical protein                   52.4    5e-07   
ref|XP_002277400.2|  PREDICTED: serine carboxypeptidase-like 45       54.7    5e-07   
gb|KFK27622.1|  hypothetical protein AALP_AA8G407400                  53.1    5e-07   
emb|CAN70439.1|  hypothetical protein VITISV_011900                   54.7    5e-07   
gb|EMT05424.1|  Serine carboxypeptidase II-3                          54.7    5e-07   
ref|XP_007711374.1|  hypothetical protein COCCADRAFT_93697            54.7    5e-07   
ref|XP_001802683.1|  hypothetical protein SNOG_12460                  54.7    5e-07   
ref|XP_006289997.1|  hypothetical protein CARUB_v10003627mg           54.7    5e-07   
ref|XP_002318164.2|  hypothetical protein POPTR_0012s10730g           54.7    5e-07   
ref|XP_007936558.1|  PREDICTED: lysosomal protective protein isof...  54.7    5e-07   
gb|EGO01199.1|  hypothetical protein SERLA73DRAFT_105810              54.7    5e-07   
ref|XP_007317018.1|  hypothetical protein SERLADRAFT_360894           54.7    5e-07   
ref|XP_007936557.1|  PREDICTED: lysosomal protective protein isof...  54.7    5e-07   
gb|KEP50781.1|  serine carboxypeptidase                               54.7    5e-07   
ref|XP_006858474.1|  hypothetical protein AMTR_s00071p00113850        54.7    5e-07   
ref|XP_006307408.1|  hypothetical protein CARUB_v10009034mg           54.7    6e-07   
ref|XP_006830191.1|  hypothetical protein AMTR_s00173p00045470        54.7    6e-07   
ref|XP_010910742.1|  PREDICTED: serine carboxypeptidase II-3-like     52.0    6e-07   
emb|CDY26973.1|  BnaC09g36100D                                        54.3    6e-07   
ref|XP_003602149.1|  Serine carboxypeptidase-like protein             54.3    6e-07   
gb|KFX53443.1|  Carboxypeptidase S1 like B                            54.7    6e-07   
ref|NP_001049237.1|  Os03g0192100                                     54.3    6e-07   
ref|XP_011079368.1|  PREDICTED: serine carboxypeptidase II-2          54.3    6e-07   
ref|XP_002766733.1|  conserved hypothetical protein                   53.1    6e-07   
gb|EEC74667.1|  hypothetical protein OsI_10345                        54.3    6e-07   
gb|ADE76785.1|  unknown                                               53.1    6e-07   
gb|KFK24266.1|  hypothetical protein AALP_AAs40498U001000             54.3    6e-07   
ref|XP_004342296.1|  carboxypeptidase Ylike protein                   54.3    6e-07   
gb|ABF94408.1|  Serine carboxypeptidase family protein, expressed     54.3    7e-07   
emb|CDP02851.1|  unnamed protein product                              54.3    7e-07   
ref|XP_003592238.1|  Serine carboxypeptidase II-3                     54.3    7e-07   
gb|EKG11840.1|  Peptidase S10 serine carboxypeptidase                 54.3    7e-07   
ref|XP_004490637.1|  PREDICTED: serine carboxypeptidase-like 42-l...  54.3    7e-07   
ref|XP_004490638.1|  PREDICTED: serine carboxypeptidase-like 42-l...  54.3    7e-07   
gb|EUC66134.1|  serine carboxypeptidase                               54.3    7e-07   
emb|CDY56704.1|  BnaC01g38630D                                        54.3    7e-07   
gb|KHJ99618.1|  serine carboxypeptidase                               52.8    7e-07   
gb|KIH52969.1|  serine carboxypeptidase                               52.4    7e-07   
ref|XP_002891272.1|  predicted protein                                54.3    7e-07   
gb|KIH45949.1|  serine carboxypeptidase                               53.9    7e-07   
ref|XP_003467745.1|  PREDICTED: lysosomal protective protein isof...  54.3    7e-07   
ref|XP_001013298.1|  Serine carboxypeptidase family protein           53.9    8e-07   
ref|XP_004506097.1|  PREDICTED: serine carboxypeptidase-like 48-like  54.3    8e-07   
ref|XP_009774966.1|  PREDICTED: serine carboxypeptidase-like 49       53.5    8e-07   
ref|XP_007742675.1|  carboxypeptidase D                               54.3    8e-07   
ref|XP_002766737.1|  hypothetical protein Pmar_PMAR025842             51.2    8e-07   
ref|XP_007533123.1|  PREDICTED: lysosomal protective protein isof...  54.3    8e-07   
ref|XP_004287152.1|  PREDICTED: serine carboxypeptidase-like 29-l...  53.9    8e-07   
ref|NP_197689.1|  serine carboxypeptidase-like 47                     54.3    8e-07   
ref|XP_004287151.1|  PREDICTED: serine carboxypeptidase-like 29-l...  53.9    8e-07   
ref|XP_008879470.1|  hypothetical protein H310_13662                  54.3    8e-07   
ref|XP_001936980.1|  carboxypeptidase S1                              54.3    9e-07   
ref|XP_007019398.1|  Serine carboxypeptidase-like 42 isoform 2        53.9    9e-07   
gb|KHG30064.1|  Serine carboxypeptidase-like 45                       53.9    9e-07   
ref|XP_010267214.1|  PREDICTED: serine carboxypeptidase-like          53.9    9e-07   
ref|NP_001169369.1|  uncharacterized protein LOC100383236 precursor   53.9    9e-07   
ref|XP_005108565.1|  PREDICTED: lysosomal protective protein-like...  53.1    9e-07   
gb|EAR93053.2|  serine carboxypeptidase family protein                53.9    9e-07   
ref|XP_005085045.1|  PREDICTED: lysosomal protective protein isof...  53.9    9e-07   
ref|XP_006436272.1|  hypothetical protein CICLE_v10031437mg           53.9    9e-07   
ref|XP_008373914.1|  PREDICTED: serine carboxypeptidase-like 42       53.9    9e-07   
ref|NP_178642.1|  serine carboxypeptidase-like 38                     53.9    9e-07   
ref|XP_009355269.1|  PREDICTED: serine carboxypeptidase-like 45       53.9    9e-07   
emb|CDP19962.1|  unnamed protein product                              54.3    9e-07   
ref|XP_009377699.1|  PREDICTED: serine carboxypeptidase-like 42       53.9    9e-07   
ref|XP_009377728.1|  PREDICTED: serine carboxypeptidase-like 42       53.9    9e-07   
gb|KDO48446.1|  hypothetical protein CISIN_1g016137mg                 53.5    9e-07   
ref|XP_002528403.1|  serine carboxypeptidase, putative                53.9    1e-06   
ref|XP_009141517.1|  PREDICTED: serine carboxypeptidase-like 28       53.9    1e-06   
ref|XP_004515138.1|  PREDICTED: serine carboxypeptidase-like 42-like  53.9    1e-06   
ref|XP_010938508.1|  PREDICTED: serine carboxypeptidase II-3-like...  53.5    1e-06   
ref|XP_011041420.1|  PREDICTED: serine carboxypeptidase-like 45       53.9    1e-06   
dbj|BAK01526.1|  predicted protein                                    53.9    1e-06   
ref|XP_004746367.1|  PREDICTED: lysosomal protective protein isof...  53.9    1e-06   
ref|XP_010908593.1|  PREDICTED: serine carboxypeptidase-like 42       53.1    1e-06   
ref|XP_008800209.1|  PREDICTED: serine carboxypeptidase II-3-like     53.9    1e-06   
ref|XP_002468355.1|  hypothetical protein SORBIDRAFT_01g044390        53.9    1e-06   
ref|XP_007019399.1|  Serine carboxypeptidase-like 42 isoform 3        53.5    1e-06   
ref|XP_010938507.1|  PREDICTED: serine carboxypeptidase II-3-like...  53.9    1e-06   
ref|XP_010110480.1|  Serine carboxypeptidase-like 42                  53.5    1e-06   
ref|XP_007019397.1|  Serine carboxypeptidase-like 42 isoform 1        53.9    1e-06   
ref|XP_005108564.1|  PREDICTED: lysosomal protective protein-like...  53.1    1e-06   
ref|XP_008456530.1|  PREDICTED: serine carboxypeptidase-like          53.9    1e-06   
ref|XP_006878252.1|  PREDICTED: LOW QUALITY PROTEIN: cathepsin A      53.9    1e-06   
gb|EYB23232.1|  hypothetical protein FG05_04527                       53.5    1e-06   
ref|XP_384703.1|  hypothetical protein FG04527.1                      53.5    1e-06   
emb|CDP16360.1|  unnamed protein product                              53.9    1e-06   
emb|CDP16358.1|  unnamed protein product                              53.5    1e-06   
gb|EMT08239.1|  Serine carboxypeptidase II-3                          53.5    1e-06   
ref|XP_002534550.1|  serine carboxypeptidase, putative                53.5    1e-06   
dbj|GAM34052.1|  hypothetical protein TCE0_015f01384                  53.9    1e-06   
ref|XP_008783276.1|  PREDICTED: serine carboxypeptidase II-3-like     53.5    1e-06   
ref|XP_002863806.1|  hypothetical protein ARALYDRAFT_331179           53.5    1e-06   
ref|XP_008802653.1|  PREDICTED: LOW QUALITY PROTEIN: serine carbo...  53.5    1e-06   
gb|EPS60190.1|  hypothetical protein M569_14612                       53.1    1e-06   
ref|XP_007730512.1|  carboxypeptidase D                               53.9    1e-06   
ref|XP_004746364.1|  PREDICTED: lysosomal protective protein isof...  53.9    1e-06   
ref|XP_009255115.1|  hypothetical protein FPSE_03721                  53.5    1e-06   
ref|XP_004636144.1|  PREDICTED: lysosomal protective protein          53.5    1e-06   



>ref|XP_004228389.1| PREDICTED: serine carboxypeptidase-like 45 [Solanum lycopersicum]
Length=490

 Score = 75.9 bits (185),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 34/50 (68%), Positives = 39/50 (78%), Gaps = 0/50 (0%)
 Frame = -2

Query  152  LTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVD  3
            LTLWL GG  CS    G+F EHGPF+P KDG+L+KN YSWNL SNMLYV+
Sbjct  68   LTLWLNGGPGCSSVGFGVFMEHGPFQPGKDGRLIKNKYSWNLESNMLYVE  117



>ref|XP_006363923.1| PREDICTED: serine carboxypeptidase-like 45-like [Solanum tuberosum]
Length=480

 Score = 75.1 bits (183),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 35/50 (70%), Positives = 37/50 (74%), Gaps = 0/50 (0%)
 Frame = -2

Query  152  LTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVD  3
            LTLWL GG  CS    G F EHGPFRP KDG L+KN +SWNL SNMLYVD
Sbjct  68   LTLWLNGGPGCSSVGYGAFMEHGPFRPGKDGSLIKNNFSWNLESNMLYVD  117



>ref|XP_006363922.1| PREDICTED: serine carboxypeptidase-like 45-like [Solanum tuberosum]
Length=496

 Score = 75.1 bits (183),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 34/50 (68%), Positives = 38/50 (76%), Gaps = 0/50 (0%)
 Frame = -2

Query  152  LTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVD  3
            LTLWL GG  CS    G F EHGPF+P KDG+L+KN YSWNL SNMLYV+
Sbjct  71   LTLWLNGGPGCSSVGFGAFMEHGPFQPGKDGRLIKNKYSWNLESNMLYVE  120



>ref|XP_006363924.1| PREDICTED: serine carboxypeptidase-like 45-like [Solanum tuberosum]
Length=493

 Score = 74.7 bits (182),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 33/50 (66%), Positives = 38/50 (76%), Gaps = 0/50 (0%)
 Frame = -2

Query  152  LTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVD  3
            LTLWL GG  CS    G F EHGPF+P KDG+L+KN YSWNL SNMLY++
Sbjct  68   LTLWLNGGPGCSSVGFGAFKEHGPFQPGKDGRLIKNKYSWNLESNMLYIE  117



>gb|KHG07552.1| Serine carboxypeptidase-like 45 [Gossypium arboreum]
Length=476

 Score = 74.3 bits (181),  Expect = 6e-14, Method: Composition-based stats.
 Identities = 33/50 (66%), Positives = 37/50 (74%), Gaps = 0/50 (0%)
 Frame = -2

Query  152  LTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVD  3
            LTLWL GG  CS    G F EHGPF+P +DG LVKN YSWNL SNMLY++
Sbjct  69   LTLWLNGGPGCSSLGFGAFMEHGPFQPREDGHLVKNQYSWNLESNMLYLE  118



>ref|XP_006482672.1| PREDICTED: serine carboxypeptidase-like 46-like [Citrus sinensis]
Length=477

 Score = 74.3 bits (181),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 34/50 (68%), Positives = 39/50 (78%), Gaps = 0/50 (0%)
 Frame = -2

Query  152  LTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVD  3
            LTLWL GG  CS    G+F EHGPF+P ++GKL+KN YSWNL SNMLYVD
Sbjct  68   LTLWLNGGPGCSSIGFGVFMEHGPFQPRENGKLLKNEYSWNLESNMLYVD  117



>ref|XP_006431097.1| hypothetical protein CICLE_v10013776mg [Citrus clementina]
 gb|ESR44337.1| hypothetical protein CICLE_v10013776mg [Citrus clementina]
Length=477

 Score = 74.3 bits (181),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 34/50 (68%), Positives = 39/50 (78%), Gaps = 0/50 (0%)
 Frame = -2

Query  152  LTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVD  3
            LTLWL GG  CS    G+F EHGPF+P ++GKL+KN YSWNL SNMLYVD
Sbjct  68   LTLWLNGGPGCSSIGFGVFMEHGPFQPRENGKLLKNEYSWNLESNMLYVD  117



>gb|KDO72510.1| hypothetical protein CISIN_1g039529mg [Citrus sinensis]
Length=477

 Score = 73.9 bits (180),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 34/50 (68%), Positives = 39/50 (78%), Gaps = 0/50 (0%)
 Frame = -2

Query  152  LTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVD  3
            LTLWL GG  CS    G+F EHGPF+P ++GKL+KN YSWNL SNMLYVD
Sbjct  68   LTLWLNGGPGCSSIGFGVFMEHGPFQPRENGKLLKNEYSWNLESNMLYVD  117



>ref|XP_009627244.1| PREDICTED: serine carboxypeptidase-like 46 [Nicotiana tomentosiformis]
Length=479

 Score = 73.2 bits (178),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 33/50 (66%), Positives = 37/50 (74%), Gaps = 0/50 (0%)
 Frame = -2

Query  152  LTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVD  3
            LT+WL GG  CS    G F EHGPF+P  DG L+KN YSWNLVSNMLYV+
Sbjct  70   LTVWLNGGPGCSSVGFGAFMEHGPFQPRIDGSLIKNKYSWNLVSNMLYVE  119



>ref|XP_006482671.1| PREDICTED: serine carboxypeptidase-like 44-like [Citrus sinensis]
Length=552

 Score = 73.2 bits (178),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 32/50 (64%), Positives = 38/50 (76%), Gaps = 0/50 (0%)
 Frame = -2

Query  152  LTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVD  3
            LTLWL GG  CS    G F EHGPF+P ++G+L+KN YSWNL SNMLYV+
Sbjct  67   LTLWLNGGPGCSSLGFGAFMEHGPFQPGENGQLLKNEYSWNLASNMLYVE  116



>ref|XP_009762845.1| PREDICTED: serine carboxypeptidase-like 45 [Nicotiana sylvestris]
Length=486

 Score = 72.8 bits (177),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 34/50 (68%), Positives = 37/50 (74%), Gaps = 0/50 (0%)
 Frame = -2

Query  152  LTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVD  3
            LTLWL GG  CS    G F EHGPF+P  DG L+KN YSWNLVSNMLYV+
Sbjct  70   LTLWLNGGPGCSSVGFGAFMEHGPFQPGIDGNLMKNKYSWNLVSNMLYVE  119



>ref|XP_007046209.1| Serine carboxypeptidase 46 isoform 2 [Theobroma cacao]
 gb|EOY02041.1| Serine carboxypeptidase 46 isoform 2 [Theobroma cacao]
Length=401

 Score = 72.0 bits (175),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 31/50 (62%), Positives = 37/50 (74%), Gaps = 0/50 (0%)
 Frame = -2

Query  152  LTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVD  3
            LTLWL GG  CS    G F EHGPF+P ++G L+KN YSWNL SNMLY++
Sbjct  77   LTLWLNGGPGCSSLGFGAFSEHGPFQPGENGHLIKNEYSWNLESNMLYLE  126



>ref|XP_007099702.1| Serine carboxypeptidase 46 [Theobroma cacao]
 gb|EOY20317.1| Serine carboxypeptidase 46 [Theobroma cacao]
Length=475

 Score = 72.0 bits (175),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 33/50 (66%), Positives = 37/50 (74%), Gaps = 0/50 (0%)
 Frame = -2

Query  152  LTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVD  3
            LTLWL GG  CS    G F EHGPF+P +DG L+KN YSWNL SNMLYV+
Sbjct  68   LTLWLNGGPGCSSLGFGAFMEHGPFQPGEDGTLIKNEYSWNLESNMLYVE  117



>ref|XP_007046208.1| Serine carboxypeptidase 46 isoform 1 [Theobroma cacao]
 gb|EOY02040.1| Serine carboxypeptidase 46 isoform 1 [Theobroma cacao]
Length=488

 Score = 72.0 bits (175),  Expect = 5e-13, Method: Composition-based stats.
 Identities = 31/50 (62%), Positives = 37/50 (74%), Gaps = 0/50 (0%)
 Frame = -2

Query  152  LTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVD  3
            LTLWL GG  CS    G F EHGPF+P ++G L+KN YSWNL SNMLY++
Sbjct  77   LTLWLNGGPGCSSLGFGAFSEHGPFQPGENGHLIKNEYSWNLESNMLYLE  126



>ref|XP_004228838.1| PREDICTED: serine carboxypeptidase-like 45 isoform X1 [Solanum 
lycopersicum]
Length=482

 Score = 71.2 bits (173),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 37/50 (74%), Gaps = 0/50 (0%)
 Frame = -2

Query  152  LTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVD  3
            LT+WL G   CS    G F EHGPF+P KDG+L+KN +SWNL SNMLYVD
Sbjct  70   LTIWLNGAPGCSSLGYGAFMEHGPFQPGKDGRLIKNNFSWNLESNMLYVD  119



>ref|XP_006431096.1| hypothetical protein CICLE_v10013839mg [Citrus clementina]
 gb|ESR44336.1| hypothetical protein CICLE_v10013839mg [Citrus clementina]
Length=473

 Score = 71.2 bits (173),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 38/50 (76%), Gaps = 0/50 (0%)
 Frame = -2

Query  152  LTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVD  3
            LTLWL GG  CS    G F EHGPF+P ++G+L+KN YSWNL SNMLYV+
Sbjct  67   LTLWLNGGPGCSSLGFGAFMEHGPFQPGENGQLLKNEYSWNLASNMLYVE  116



>gb|KDO72509.1| hypothetical protein CISIN_1g037032mg [Citrus sinensis]
Length=473

 Score = 71.2 bits (173),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 38/50 (76%), Gaps = 0/50 (0%)
 Frame = -2

Query  152  LTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVD  3
            LTLWL GG  CS    G F EHGPF+P ++G+L+KN YSWNL SNMLYV+
Sbjct  67   LTLWLNGGPGCSSLGFGAFMEHGPFQPGENGQLLKNEYSWNLASNMLYVE  116



>ref|XP_007046207.1| Serine carboxypeptidase 46 [Theobroma cacao]
 gb|EOY02039.1| Serine carboxypeptidase 46 [Theobroma cacao]
Length=478

 Score = 71.2 bits (173),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 34/50 (68%), Positives = 37/50 (74%), Gaps = 0/50 (0%)
 Frame = -2

Query  152  LTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVD  3
            LTLWL GG  CS    G F EHGPF+P +DG LVKN YSWNL SNMLYV+
Sbjct  66   LTLWLNGGPGCSSLGYGAFMEHGPFQPGEDGFLVKNQYSWNLESNMLYVE  115



>ref|XP_006380973.1| hypothetical protein POPTR_0006s03480g [Populus trichocarpa]
 gb|ERP58770.1| hypothetical protein POPTR_0006s03480g [Populus trichocarpa]
Length=478

 Score = 70.1 bits (170),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 30/50 (60%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = -2

Query  152  LTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVD  3
            L LWL GG  CS   VG F EHGPFRPT    LV+N YSWN  +NMLY++
Sbjct  73   LVLWLNGGPGCSSVGVGAFVEHGPFRPTTGNNLVRNEYSWNKEANMLYLE  122



>ref|XP_006380972.1| hypothetical protein POPTR_0006s03480g [Populus trichocarpa]
 gb|ERP58769.1| hypothetical protein POPTR_0006s03480g [Populus trichocarpa]
Length=467

 Score = 70.1 bits (170),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 30/50 (60%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = -2

Query  152  LTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVD  3
            L LWL GG  CS   VG F EHGPFRPT    LV+N YSWN  +NMLY++
Sbjct  73   LVLWLNGGPGCSSVGVGAFVEHGPFRPTTGNNLVRNEYSWNKEANMLYLE  122



>ref|XP_010068797.1| PREDICTED: serine carboxypeptidase-like 46 [Eucalyptus grandis]
Length=481

 Score = 68.9 bits (167),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = -2

Query  152  LTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVD  3
            LTLW  GG  CS    G F EHGPFRP  DG L KN +SWN VSNMLYV+
Sbjct  73   LTLWFNGGPGCSSLGFGAFEEHGPFRPAGDGGLTKNEFSWNKVSNMLYVE  122



>gb|KCW64996.1| hypothetical protein EUGRSUZ_G02538 [Eucalyptus grandis]
Length=480

 Score = 68.9 bits (167),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = -2

Query  152  LTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVD  3
            LTLW  GG  CS    G F EHGPFRP  DG L KN +SWN VSNMLYV+
Sbjct  72   LTLWFNGGPGCSSLGFGAFEEHGPFRPAGDGGLTKNEFSWNKVSNMLYVE  121



>gb|KCW64994.1| hypothetical protein EUGRSUZ_G02536 [Eucalyptus grandis]
Length=480

 Score = 68.9 bits (167),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = -2

Query  152  LTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVD  3
            LTLW  GG  CS    G F EHGPFRP  DG L KN +SWN VSNMLYV+
Sbjct  72   LTLWFNGGPGCSSLGFGAFEEHGPFRPAGDGGLTKNEFSWNKVSNMLYVE  121



>ref|XP_010068795.1| PREDICTED: serine carboxypeptidase-like 45 [Eucalyptus grandis]
Length=481

 Score = 68.9 bits (167),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = -2

Query  152  LTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVD  3
            LTLW  GG  CS    G F EHGPFRP  DG L KN +SWN VSNMLYV+
Sbjct  73   LTLWFNGGPGCSSLGFGAFEEHGPFRPAGDGGLTKNEFSWNKVSNMLYVE  122



>ref|XP_010068798.1| PREDICTED: serine carboxypeptidase-like 45 [Eucalyptus grandis]
Length=481

 Score = 68.9 bits (167),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = -2

Query  152  LTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVD  3
            LTLW  GG  CS    G F EHGPFRP  DG L KN +SWN VSNMLYV+
Sbjct  73   LTLWFNGGPGCSSLGFGAFEEHGPFRPAGDGGLTKNEFSWNKVSNMLYVE  122



>ref|XP_011041403.1| PREDICTED: serine carboxypeptidase-like 45 [Populus euphratica]
Length=476

 Score = 67.8 bits (164),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 29/50 (58%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = -2

Query  152  LTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVD  3
            L LWL GG  CS    G F EHGPFRP+  G LV+N YSWN  +NMLY++
Sbjct  75   LVLWLNGGPGCSSVGAGAFSEHGPFRPSGGGSLVRNDYSWNKEANMLYLE  124



>ref|XP_002322611.2| hypothetical protein POPTR_0016s03390g [Populus trichocarpa]
 gb|EEF04372.2| hypothetical protein POPTR_0016s03390g [Populus trichocarpa]
Length=442

 Score = 67.0 bits (162),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 29/50 (58%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = -2

Query  152  LTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVD  3
            L LWL GG  CS    G F EHGPFRP+  G LV+N YSWN  +NMLY++
Sbjct  67   LVLWLNGGPGCSSVGAGAFSEHGPFRPSGGGSLVRNDYSWNKEANMLYLE  116



>ref|XP_011040750.1| PREDICTED: serine carboxypeptidase-like 45 [Populus euphratica]
Length=499

 Score = 67.4 bits (163),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 28/50 (56%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = -2

Query  152  LTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVD  3
            L LWL GG  CS    G F EHGPFRPT    LV+N YSWN  +N+LY++
Sbjct  94   LVLWLNGGPGCSSVGAGAFVEHGPFRPTTGNNLVRNEYSWNKEANLLYLE  143



>gb|KEH33274.1| serine carboxypeptidase-like protein [Medicago truncatula]
Length=457

 Score = 67.0 bits (162),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 29/50 (58%), Positives = 36/50 (72%), Gaps = 1/50 (2%)
 Frame = -2

Query  152  LTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVD  3
            + LWL GG  CS    G F EHGPF+PTK+G L+KN YSWN  +NMLY++
Sbjct  75   VVLWLNGGPGCSSVGAGAFVEHGPFKPTKNG-LIKNDYSWNKEANMLYLE  123



>emb|CBI22166.3| unnamed protein product [Vitis vinifera]
Length=550

 Score = 67.4 bits (163),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 30/50 (60%), Positives = 37/50 (74%), Gaps = 0/50 (0%)
 Frame = -2

Query  152  LTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVD  3
            LTLWL GG  CS    G F E+GPF+P ++G LVKN +SWN+ SNMLYV+
Sbjct  143  LTLWLNGGPGCSSLGFGAFMENGPFQPGENGILVKNKHSWNIESNMLYVE  192



>gb|KEH40983.1| serine carboxypeptidase-like protein [Medicago truncatula]
Length=417

 Score = 66.6 bits (161),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 29/50 (58%), Positives = 36/50 (72%), Gaps = 1/50 (2%)
 Frame = -2

Query  152  LTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVD  3
            + LWL GG  CS    G F EHGPF+PT+ G LVKN +SWN V+NM+Y+D
Sbjct  75   VVLWLNGGPGCSSVGQGSFSEHGPFKPTRKG-LVKNSFSWNKVANMIYLD  123



>ref|XP_010661029.1| PREDICTED: serine carboxypeptidase-like 45 isoform X1 [Vitis 
vinifera]
Length=481

 Score = 66.6 bits (161),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 30/50 (60%), Positives = 37/50 (74%), Gaps = 0/50 (0%)
 Frame = -2

Query  152  LTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVD  3
            LTLWL GG  CS    G F E+GPF+P ++G LVKN +SWN+ SNMLYV+
Sbjct  72   LTLWLNGGPGCSSLGFGAFMENGPFQPGENGILVKNKHSWNIESNMLYVE  121



>ref|XP_002277201.1| PREDICTED: serine carboxypeptidase-like 45 isoform X2 [Vitis 
vinifera]
Length=479

 Score = 66.6 bits (161),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 30/50 (60%), Positives = 37/50 (74%), Gaps = 0/50 (0%)
 Frame = -2

Query  152  LTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVD  3
            LTLWL GG  CS    G F E+GPF+P ++G LVKN +SWN+ SNMLYV+
Sbjct  72   LTLWLNGGPGCSSLGFGAFMENGPFQPGENGILVKNKHSWNIESNMLYVE  121



>ref|XP_003633850.1| PREDICTED: serine carboxypeptidase-like 46 [Vitis vinifera]
 emb|CBI22165.3| unnamed protein product [Vitis vinifera]
Length=479

 Score = 66.6 bits (161),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 30/50 (60%), Positives = 36/50 (72%), Gaps = 0/50 (0%)
 Frame = -2

Query  152  LTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVD  3
            LTLW  GG  CS    G F E+GPF+P ++G LVKN +SWNL SNMLYV+
Sbjct  72   LTLWFNGGPGCSSLGFGAFMENGPFQPGENGILVKNKHSWNLESNMLYVE  121



>ref|XP_010265020.1| PREDICTED: serine carboxypeptidase-like 45 [Nelumbo nucifera]
Length=474

 Score = 66.2 bits (160),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = -2

Query  152  LTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVD  3
            LTLWL GG  CS    G+  EHGPF+P  +  L KN YSWNL SNMLYVD
Sbjct  73   LTLWLNGGPGCSSVGFGVLMEHGPFQPKDNRLLAKNKYSWNLESNMLYVD  122



>gb|KDP37688.1| hypothetical protein JCGZ_06345 [Jatropha curcas]
Length=468

 Score = 65.9 bits (159),  Expect = 6e-11, Method: Composition-based stats.
 Identities = 27/50 (54%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = -2

Query  152  LTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVD  3
            L LWL GG  CS    G F EHGPFRP+  G LV+N YSWN  +N++Y++
Sbjct  69   LVLWLNGGPGCSSLGAGAFSEHGPFRPSGKGNLVRNEYSWNKEANIIYLE  118



>gb|KHN08898.1| Serine carboxypeptidase-like 45 [Glycine soja]
Length=453

 Score = 65.5 bits (158),  Expect = 6e-11, Method: Composition-based stats.
 Identities = 28/50 (56%), Positives = 35/50 (70%), Gaps = 0/50 (0%)
 Frame = -2

Query  152  LTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVD  3
            L LWL GG  CS   VG F EHGPFRP+ +  L +N YSWN V+N+LY++
Sbjct  70   LVLWLNGGPGCSSIGVGAFAEHGPFRPSDNNVLQQNDYSWNKVANVLYLE  119



>ref|XP_003554110.2| PREDICTED: serine carboxypeptidase-like 45-like [Glycine max]
Length=462

 Score = 65.5 bits (158),  Expect = 7e-11, Method: Composition-based stats.
 Identities = 28/50 (56%), Positives = 35/50 (70%), Gaps = 0/50 (0%)
 Frame = -2

Query  152  LTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVD  3
            L LWL GG  CS   VG F EHGPFRP+ +  L +N YSWN V+N+LY++
Sbjct  79   LVLWLNGGPGCSSIGVGAFAEHGPFRPSDNNVLQQNDYSWNKVANVLYLE  128



>ref|XP_010055750.1| PREDICTED: serine carboxypeptidase-like 45 isoform X2 [Eucalyptus 
grandis]
Length=414

 Score = 65.1 bits (157),  Expect = 9e-11, Method: Composition-based stats.
 Identities = 29/50 (58%), Positives = 35/50 (70%), Gaps = 1/50 (2%)
 Frame = -2

Query  152  LTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVD  3
            L LWL GG  CS   VG F EHGPF+P+ D  L+KN YSWN  +NMLY++
Sbjct  80   LVLWLNGGPGCSSVGVGAFSEHGPFKPSGD-VLLKNDYSWNKEANMLYIE  128



>ref|XP_004513403.1| PREDICTED: serine carboxypeptidase-like 45-like [Cicer arietinum]
Length=462

 Score = 65.1 bits (157),  Expect = 9e-11, Method: Composition-based stats.
 Identities = 29/50 (58%), Positives = 35/50 (70%), Gaps = 1/50 (2%)
 Frame = -2

Query  152  LTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVD  3
            + LWL GG  CS   VG F EHGPF+P K G L+KN YSWN  +NMLY++
Sbjct  79   VVLWLNGGPGCSSIGVGAFVEHGPFKPAKKG-LMKNDYSWNKEANMLYLE  127



>ref|XP_007224935.1| hypothetical protein PRUPE_ppa021576mg [Prunus persica]
 gb|EMJ26134.1| hypothetical protein PRUPE_ppa021576mg [Prunus persica]
Length=438

 Score = 65.1 bits (157),  Expect = 9e-11, Method: Composition-based stats.
 Identities = 26/50 (52%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = -2

Query  152  LTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVD  3
            L +W  GG  CS    G F EHGPF+P+    L+KNPYSWN  +NMLY++
Sbjct  75   LVVWFNGGPGCSSVGEGAFVEHGPFKPSGGATLIKNPYSWNTEANMLYLE  124



>ref|XP_008218862.1| PREDICTED: serine carboxypeptidase-like 45 [Prunus mume]
Length=480

 Score = 65.1 bits (157),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 26/50 (52%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = -2

Query  152  LTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVD  3
            L +W  GG  CS    G F EHGPF+P+    L+KNPYSWN  +NMLY++
Sbjct  75   LVVWFNGGPGCSSVGEGAFVEHGPFKPSGGATLIKNPYSWNTEANMLYLE  124



>gb|KEH37845.1| serine carboxypeptidase-like protein [Medicago truncatula]
Length=464

 Score = 65.1 bits (157),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 32/51 (63%), Positives = 36/51 (71%), Gaps = 1/51 (2%)
 Frame = -2

Query  152  LTLWLGGGHDCSIATVGMFYEHGPFRPTKDG-KLVKNPYSWNLVSNMLYVD  3
            L LWL GG  CS    G F EHGPF+PT  G  LV+NPYSWN V+NMLY+D
Sbjct  83   LVLWLNGGPGCSSIGQGAFTEHGPFKPTAMGLGLVENPYSWNRVANMLYLD  133



>gb|KHN30341.1| Serine carboxypeptidase-like 45 [Glycine soja]
Length=459

 Score = 65.1 bits (157),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 28/50 (56%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = -2

Query  152  LTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVD  3
            L LWL GG  CS    G F EHGPFRP+ +  L KN YSWN  +NMLY++
Sbjct  76   LVLWLNGGPGCSSIGTGAFTEHGPFRPSDNNLLEKNDYSWNKAANMLYLE  125



>ref|XP_003520484.1| PREDICTED: serine carboxypeptidase-like 45-like [Glycine max]
Length=461

 Score = 65.1 bits (157),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 28/50 (56%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = -2

Query  152  LTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVD  3
            L LWL GG  CS    G F EHGPFRP+ +  L KN YSWN  +NMLY++
Sbjct  78   LVLWLNGGPGCSSIGTGAFTEHGPFRPSDNNLLEKNDYSWNKAANMLYLE  127



>ref|XP_010055744.1| PREDICTED: serine carboxypeptidase-like 45 isoform X1 [Eucalyptus 
grandis]
Length=477

 Score = 64.7 bits (156),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 29/50 (58%), Positives = 35/50 (70%), Gaps = 1/50 (2%)
 Frame = -2

Query  152  LTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVD  3
            L LWL GG  CS   VG F EHGPF+P+ D  L+KN YSWN  +NMLY++
Sbjct  80   LVLWLNGGPGCSSVGVGAFSEHGPFKPSGD-VLLKNDYSWNKEANMLYIE  128



>gb|EWM28705.1| serine carboxypeptidase ii-2 [Nannochloropsis gaditana]
Length=700

 Score = 65.1 bits (157),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 30/51 (59%), Positives = 35/51 (69%), Gaps = 2/51 (4%)
 Frame = -2

Query  152  LTLWLGGGHDCSIATVGMFYEHGPFRPTKDGK-LVKNPYSWNLVSNMLYVD  3
            L  W  GG  CS    G   EHGPFRP +DG+ LV+NPYSWN V+NMLYV+
Sbjct  175  LVFWTNGGPGCS-GLFGFLAEHGPFRPLEDGQTLVRNPYSWNRVANMLYVE  224



>ref|XP_007162065.1| hypothetical protein PHAVU_001G120700g [Phaseolus vulgaris]
 gb|ESW34059.1| hypothetical protein PHAVU_001G120700g [Phaseolus vulgaris]
Length=459

 Score = 64.7 bits (156),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 28/50 (56%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = -2

Query  152  LTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVD  3
            L LWL GG  CS   VG F EHGPFRP+ +  L KN YSWN  +N+LY++
Sbjct  76   LVLWLNGGPGCSSIGVGAFAEHGPFRPSDNNVLEKNDYSWNKEANVLYLE  125



>ref|XP_010271870.1| PREDICTED: serine carboxypeptidase-like 45 isoform X2 [Nelumbo 
nucifera]
Length=434

 Score = 64.3 bits (155),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 29/50 (58%), Positives = 35/50 (70%), Gaps = 1/50 (2%)
 Frame = -2

Query  152  LTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVD  3
            L LWL GG  CS   VG F EHGPF+P+ D  LV+N YSWN  +NMLY++
Sbjct  80   LVLWLNGGPGCSSVGVGAFSEHGPFKPSGD-ILVRNDYSWNREANMLYLE  128



>ref|XP_010271869.1| PREDICTED: serine carboxypeptidase-like 45 isoform X1 [Nelumbo 
nucifera]
Length=465

 Score = 64.3 bits (155),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 29/50 (58%), Positives = 35/50 (70%), Gaps = 1/50 (2%)
 Frame = -2

Query  152  LTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVD  3
            L LWL GG  CS   VG F EHGPF+P+ D  LV+N YSWN  +NMLY++
Sbjct  80   LVLWLNGGPGCSSVGVGAFSEHGPFKPSGD-ILVRNDYSWNREANMLYLE  128



>ref|XP_002297872.2| serine carboxypeptidase S10 family protein [Populus trichocarpa]
 gb|EEE82677.2| serine carboxypeptidase S10 family protein [Populus trichocarpa]
Length=454

 Score = 64.3 bits (155),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 30/50 (60%), Positives = 36/50 (72%), Gaps = 1/50 (2%)
 Frame = -2

Query  152  LTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVD  3
            L LWL GG  CS   VG F E+GPFRP+ +G LVKN YSWN  +NMLY++
Sbjct  69   LVLWLNGGPGCSSLGVGAFSENGPFRPSGEG-LVKNQYSWNREANMLYLE  117



>ref|XP_011036159.1| PREDICTED: serine carboxypeptidase-like 45 isoform X1 [Populus 
euphratica]
Length=463

 Score = 64.3 bits (155),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 30/50 (60%), Positives = 36/50 (72%), Gaps = 1/50 (2%)
 Frame = -2

Query  152  LTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVD  3
            L LWL GG  CS   VG F E+GPFRP+ +G LVKN YSWN  +NMLY++
Sbjct  77   LVLWLNGGPGCSSLGVGAFSENGPFRPSGEG-LVKNQYSWNREANMLYLE  125



>ref|XP_011036160.1| PREDICTED: serine carboxypeptidase-like 45 isoform X2 [Populus 
euphratica]
Length=462

 Score = 63.9 bits (154),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 30/50 (60%), Positives = 36/50 (72%), Gaps = 1/50 (2%)
 Frame = -2

Query  152  LTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVD  3
            L LWL GG  CS   VG F E+GPFRP+ +G LVKN YSWN  +NMLY++
Sbjct  77   LVLWLNGGPGCSSLGVGAFSENGPFRPSGEG-LVKNQYSWNREANMLYLE  125



>ref|XP_011086871.1| PREDICTED: serine carboxypeptidase-like 45 [Sesamum indicum]
Length=466

 Score = 63.9 bits (154),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 27/50 (54%), Positives = 35/50 (70%), Gaps = 0/50 (0%)
 Frame = -2

Query  152  LTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVD  3
            L LWL GG  CS   VG F E+GPFRP+ +  LV+N YSWN  +N+LY++
Sbjct  80   LVLWLNGGPGCSSLGVGAFSENGPFRPSGNAALVRNEYSWNKEANILYLE  129



>gb|KHN30342.1| Serine carboxypeptidase-like 45, partial [Glycine soja]
Length=225

 Score = 61.6 bits (148),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 26/50 (52%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = -2

Query  152  LTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVD  3
            + LWL GG  CS    G   EHGPF+P  D  LVKN YSWN V+N++Y++
Sbjct  52   VVLWLNGGPGCSFIGAGALVEHGPFKPGDDNVLVKNYYSWNKVANLIYLE  101



>ref|XP_007145476.1| hypothetical protein PHAVU_007G242200g [Phaseolus vulgaris]
 gb|ESW17470.1| hypothetical protein PHAVU_007G242200g [Phaseolus vulgaris]
Length=465

 Score = 63.5 bits (153),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 27/50 (54%), Positives = 36/50 (72%), Gaps = 1/50 (2%)
 Frame = -2

Query  152  LTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVD  3
            L LWL GG  CS    G F EHGPF+P+++G L+KN +SWN  +NMLY++
Sbjct  77   LVLWLNGGPGCSSVGAGAFVEHGPFKPSENG-LLKNEFSWNKEANMLYLE  125



>emb|CAJ91147.1| serine carboxypeptidase II [Platanus x acerifolia]
Length=252

 Score = 61.6 bits (148),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 28/50 (56%), Positives = 35/50 (70%), Gaps = 1/50 (2%)
 Frame = -2

Query  152  LTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVD  3
            L LWL GG  CS   VG F EHGPFRP+ +  L++N YSWN  +NMLY++
Sbjct  81   LVLWLNGGPGCSSIGVGAFSEHGPFRPSGE-ILIRNEYSWNKEANMLYLE  129



>ref|XP_002517286.1| serine carboxypeptidase, putative [Ricinus communis]
 gb|EEF45079.1| serine carboxypeptidase, putative [Ricinus communis]
Length=434

 Score = 63.2 bits (152),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 28/50 (56%), Positives = 32/50 (64%), Gaps = 0/50 (0%)
 Frame = -2

Query  152  LTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVD  3
            L LWL GG  CS    G F EHGPFRP+    LV N YSWN  +NMLY++
Sbjct  55   LVLWLNGGPGCSSVGAGAFSEHGPFRPSGGDNLVVNEYSWNKEANMLYLE  104



>ref|XP_006576775.1| PREDICTED: serine carboxypeptidase-like 45-like isoform X2 [Glycine 
max]
Length=426

 Score = 63.2 bits (152),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 27/50 (54%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = -2

Query  152  LTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVD  3
            + LWL GG  CS   VG   EHGPF+P  +  LVKN YSWN V+N+LY++
Sbjct  78   VVLWLNGGPGCSSIGVGALVEHGPFKPGDNNVLVKNHYSWNKVANVLYLE  127



>ref|XP_011040753.1| PREDICTED: serine carboxypeptidase-like 45 [Populus euphratica]
Length=482

 Score = 63.2 bits (152),  Expect = 5e-10, Method: Composition-based stats.
 Identities = 28/50 (56%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = -2

Query  152  LTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVD  3
            L LWL GG  CS   +G F E+GPFRP   G LV+N YSWN  +NMLY++
Sbjct  76   LVLWLNGGPGCSSFGIGAFSENGPFRPRGGGLLVRNDYSWNKEANMLYLE  125



>ref|XP_003520486.1| PREDICTED: serine carboxypeptidase-like 45-like isoform X1 [Glycine 
max]
Length=461

 Score = 63.2 bits (152),  Expect = 5e-10, Method: Composition-based stats.
 Identities = 27/50 (54%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = -2

Query  152  LTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVD  3
            + LWL GG  CS   VG   EHGPF+P  +  LVKN YSWN V+N+LY++
Sbjct  78   VVLWLNGGPGCSSIGVGALVEHGPFKPGDNNVLVKNHYSWNKVANVLYLE  127



>ref|XP_010044871.1| PREDICTED: serine carboxypeptidase-like 45 [Eucalyptus grandis]
 gb|KCW86989.1| hypothetical protein EUGRSUZ_B03549 [Eucalyptus grandis]
Length=473

 Score = 63.2 bits (152),  Expect = 5e-10, Method: Composition-based stats.
 Identities = 29/50 (58%), Positives = 35/50 (70%), Gaps = 1/50 (2%)
 Frame = -2

Query  152  LTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVD  3
            L LWL GG  CS   VG F E+GPFRP+ D  LV+N YSWN  +NMLY++
Sbjct  88   LVLWLNGGPGCSSLGVGAFSENGPFRPSGDA-LVRNEYSWNREANMLYLE  136



>gb|KHN07932.1| Serine carboxypeptidase-like 45 [Glycine soja]
Length=464

 Score = 63.2 bits (152),  Expect = 5e-10, Method: Composition-based stats.
 Identities = 27/50 (54%), Positives = 36/50 (72%), Gaps = 1/50 (2%)
 Frame = -2

Query  152  LTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVD  3
            L LWL GG  CS    G F EHGPF+P+++G L+KN +SWN  +NMLY++
Sbjct  78   LVLWLNGGPGCSSVGAGAFVEHGPFKPSENG-LLKNEHSWNKEANMLYLE  126



>ref|XP_006589008.1| PREDICTED: serine carboxypeptidase-like 45-like [Glycine max]
Length=464

 Score = 63.2 bits (152),  Expect = 5e-10, Method: Composition-based stats.
 Identities = 27/50 (54%), Positives = 36/50 (72%), Gaps = 1/50 (2%)
 Frame = -2

Query  152  LTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVD  3
            L LWL GG  CS    G F EHGPF+P+++G L+KN +SWN  +NMLY++
Sbjct  78   LVLWLNGGPGCSSVGAGAFVEHGPFKPSENG-LLKNEHSWNKEANMLYLE  126



>gb|KGN59522.1| hypothetical protein Csa_3G824190 [Cucumis sativus]
Length=215

 Score = 60.8 bits (146),  Expect = 5e-10, Method: Composition-based stats.
 Identities = 29/50 (58%), Positives = 34/50 (68%), Gaps = 1/50 (2%)
 Frame = -2

Query  152  LTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVD  3
            L LWL GG  CS   VG F EHGPFRP  D  L+ N +SWN V+N+LYV+
Sbjct  80   LLLWLDGGPGCSSLGVGAFVEHGPFRPEGD-VLIHNRFSWNNVANILYVE  128



>ref|XP_002520628.1| serine carboxypeptidase, putative [Ricinus communis]
 gb|EEF41764.1| serine carboxypeptidase, putative [Ricinus communis]
Length=467

 Score = 62.8 bits (151),  Expect = 7e-10, Method: Composition-based stats.
 Identities = 28/50 (56%), Positives = 32/50 (64%), Gaps = 0/50 (0%)
 Frame = -2

Query  152  LTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVD  3
            L LWL GG  CS    G F EHGPFRP+    LV N YSWN  +NMLY++
Sbjct  78   LVLWLNGGPGCSSLGAGAFSEHGPFRPSSGESLVINEYSWNKEANMLYLE  127



>gb|EYU18606.1| hypothetical protein MIMGU_mgv1a004861mg [Erythranthe guttata]
Length=507

 Score = 62.8 bits (151),  Expect = 8e-10, Method: Composition-based stats.
 Identities = 29/50 (58%), Positives = 35/50 (70%), Gaps = 1/50 (2%)
 Frame = -2

Query  152  LTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVD  3
            L LWL GG  CS    G F EHGPF+P+ +  LVKN YSWN V+NMLY++
Sbjct  112  LVLWLNGGPGCSSIGAGAFGEHGPFQPSGN-VLVKNNYSWNKVANMLYLE  160



>ref|XP_006410496.1| hypothetical protein EUTSA_v10016623mg [Eutrema salsugineum]
 gb|ESQ51949.1| hypothetical protein EUTSA_v10016623mg [Eutrema salsugineum]
Length=462

 Score = 62.4 bits (150),  Expect = 8e-10, Method: Composition-based stats.
 Identities = 29/50 (58%), Positives = 35/50 (70%), Gaps = 1/50 (2%)
 Frame = -2

Query  152  LTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVD  3
            L LWL GG  CS   VG F E+GPFRP K   LV+N +SWNL +NMLY++
Sbjct  77   LVLWLNGGPGCSSLGVGAFSENGPFRP-KGSDLVRNQHSWNLEANMLYLE  125



>ref|XP_007162064.1| hypothetical protein PHAVU_001G120600g [Phaseolus vulgaris]
 gb|ESW34058.1| hypothetical protein PHAVU_001G120600g [Phaseolus vulgaris]
Length=459

 Score = 62.4 bits (150),  Expect = 8e-10, Method: Composition-based stats.
 Identities = 27/50 (54%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = -2

Query  152  LTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVD  3
            + LWL GG  CS   VG   EHGPF+P     LVKN YSWN V+N+LY++
Sbjct  76   VVLWLNGGPGCSSIGVGALIEHGPFKPRDSNVLVKNHYSWNKVANVLYLE  125



>gb|AES62618.2| serine carboxypeptidase-like protein [Medicago truncatula]
Length=497

 Score = 62.8 bits (151),  Expect = 9e-10, Method: Composition-based stats.
 Identities = 29/50 (58%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = -2

Query  152  LTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVD  3
            + L L GG  CS    G F EHGPF+PTK G LVK  YSWN V+NMLY++
Sbjct  136  VVLRLNGGPGCSSIGQGAFAEHGPFKPTKKGGLVKIRYSWNRVTNMLYLE  185



>ref|XP_003592367.1| Serine carboxypeptidase-like protein [Medicago truncatula]
Length=497

 Score = 62.4 bits (150),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 29/50 (58%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = -2

Query  152  LTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVD  3
            + L L GG  CS    G F EHGPF+PTK G LVK  YSWN V+NMLY++
Sbjct  136  VVLRLNGGPGCSSIGQGAFAEHGPFKPTKKGGLVKIRYSWNRVTNMLYLE  185



>ref|XP_009404114.1| PREDICTED: serine carboxypeptidase-like 45 [Musa acuminata subsp. 
malaccensis]
Length=467

 Score = 62.0 bits (149),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 29/50 (58%), Positives = 34/50 (68%), Gaps = 1/50 (2%)
 Frame = -2

Query  152  LTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVD  3
            L LWL GG  CS   VG F E+GPFRP K   LV+N YSWN  +NMLY++
Sbjct  78   LVLWLNGGPGCSSVGVGAFSENGPFRP-KGAVLVRNEYSWNKEANMLYLE  126



>ref|XP_001751694.1| predicted protein [Physcomitrella patens]
 gb|EDQ83129.1| predicted protein [Physcomitrella patens]
Length=486

 Score = 62.0 bits (149),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 31/51 (61%), Positives = 37/51 (73%), Gaps = 1/51 (2%)
 Frame = -2

Query  152  LTLWLGGGHDCSIATVGMFYEHGPFRPTKDGK-LVKNPYSWNLVSNMLYVD  3
            LTLWL GG  CS    GM  E GPF PT +G+ L+KNPYSWN VSNML+++
Sbjct  102  LTLWLNGGPGCSSVGGGMLSELGPFYPTPNGRHLLKNPYSWNKVSNMLFLE  152



>ref|XP_004361668.1| peptidase S10 family protein [Dictyostelium fasciculatum]
 gb|EGG23817.1| peptidase S10 family protein [Dictyostelium fasciculatum]
Length=426

 Score = 62.0 bits (149),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 28/50 (56%), Positives = 36/50 (72%), Gaps = 1/50 (2%)
 Frame = -2

Query  152  LTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVD  3
              +WL GG  CS + + +FYE+GPF+  +D  L  NPYSWNLVSN+LYVD
Sbjct  69   FVIWLTGGPGCS-SEMAIFYENGPFKINEDLSLASNPYSWNLVSNILYVD  117



>ref|XP_006829355.1| hypothetical protein AMTR_s02986p00003470, partial [Amborella 
trichopoda]
 gb|ERM96771.1| hypothetical protein AMTR_s02986p00003470, partial [Amborella 
trichopoda]
Length=442

 Score = 62.0 bits (149),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 29/50 (58%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = -2

Query  152  LTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVD  3
            LTLWL GG  CS    G F EHGPF+P  +  L+ N YSWNL SN+LYV+
Sbjct  72   LTLWLNGGPGCSSLGFGAFMEHGPFQPGDNFTLIHNKYSWNLESNVLYVE  121



>ref|XP_006341487.1| PREDICTED: serine carboxypeptidase-like 45-like [Solanum tuberosum]
Length=463

 Score = 62.0 bits (149),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 29/50 (58%), Positives = 35/50 (70%), Gaps = 1/50 (2%)
 Frame = -2

Query  152  LTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVD  3
            L LWL GG  CS   VG F E+GPFRP  +G LVKN +SWN  +NMLY++
Sbjct  78   LVLWLNGGPGCSSLGVGAFSENGPFRPRGEG-LVKNEHSWNKEANMLYLE  126



>dbj|GAM27668.1| hypothetical protein SAMD00019534_108440 [Acytostelium subglobosum 
LB1]
Length=422

 Score = 61.6 bits (148),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 28/48 (58%), Positives = 37/48 (77%), Gaps = 1/48 (2%)
 Frame = -2

Query  146  LWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVD  3
            +WL GG  CS + + +FYE+GPF  ++D +LV NPYSWN V+NMLYVD
Sbjct  60   IWLTGGPGCS-SELAIFYENGPFSLSEDMQLVNNPYSWNKVANMLYVD  106



>ref|XP_010239839.1| PREDICTED: serine carboxypeptidase-like 45 [Brachypodium distachyon]
Length=465

 Score = 62.0 bits (149),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 28/50 (56%), Positives = 35/50 (70%), Gaps = 1/50 (2%)
 Frame = -2

Query  152  LTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVD  3
            L LWL GG  CS   VG F E+GPFRP+ +  LV+N YSWN  +NMLY++
Sbjct  76   LVLWLNGGPGCSSVGVGAFSENGPFRPSGNA-LVRNEYSWNKEANMLYLE  124



>ref|XP_006430527.1| hypothetical protein CICLE_v10011695mg [Citrus clementina]
 gb|ESR43767.1| hypothetical protein CICLE_v10011695mg [Citrus clementina]
Length=455

 Score = 61.6 bits (148),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 27/50 (54%), Positives = 34/50 (68%), Gaps = 1/50 (2%)
 Frame = -2

Query  152  LTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVD  3
            L LWL GG  CS    G F EHGPF+P+ D  L++N YSWN  +NMLY++
Sbjct  74   LVLWLNGGPGCSSIGAGAFCEHGPFKPSGD-TLLRNEYSWNKEANMLYLE  122



>ref|XP_010055754.1| PREDICTED: serine carboxypeptidase-like 45 [Eucalyptus grandis]
 gb|KCW90022.1| hypothetical protein EUGRSUZ_A02225 [Eucalyptus grandis]
Length=474

 Score = 61.6 bits (148),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 28/50 (56%), Positives = 34/50 (68%), Gaps = 1/50 (2%)
 Frame = -2

Query  152  LTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVD  3
            L LWL GG  CS    G F EHGPF+P+ D  L+KN YSWN  +NMLY++
Sbjct  77   LVLWLNGGPGCSSIGAGAFCEHGPFKPSGD-VLLKNDYSWNKEANMLYLE  125



>ref|XP_006482059.1| PREDICTED: serine carboxypeptidase-like 45-like [Citrus sinensis]
Length=455

 Score = 61.6 bits (148),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 27/50 (54%), Positives = 34/50 (68%), Gaps = 1/50 (2%)
 Frame = -2

Query  152  LTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVD  3
            L LWL GG  CS    G F EHGPF+P+ D  L++N YSWN  +NMLY++
Sbjct  74   LVLWLNGGPGCSSIGAGAFCEHGPFKPSGD-TLLRNEYSWNKEANMLYLE  122



>ref|XP_007043816.1| Serine carboxypeptidase-like 45 isoform 1 [Theobroma cacao]
 ref|XP_007043817.1| Serine carboxypeptidase-like 45 isoform 1 [Theobroma cacao]
 gb|EOX99647.1| Serine carboxypeptidase-like 45 isoform 1 [Theobroma cacao]
 gb|EOX99648.1| Serine carboxypeptidase-like 45 isoform 1 [Theobroma cacao]
Length=463

 Score = 61.6 bits (148),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 29/50 (58%), Positives = 35/50 (70%), Gaps = 1/50 (2%)
 Frame = -2

Query  152  LTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVD  3
            L LWL GG  CS   VG F E+GPFRP+ +  LVKN YSWN  +NMLY++
Sbjct  78   LVLWLNGGPGCSSLGVGAFSENGPFRPSGE-VLVKNEYSWNREANMLYLE  126



>ref|XP_007043818.1| Serine carboxypeptidase-like 45 isoform 3 [Theobroma cacao]
 ref|XP_007043819.1| Serine carboxypeptidase-like 45 isoform 3 [Theobroma cacao]
 gb|EOX99649.1| Serine carboxypeptidase-like 45 isoform 3 [Theobroma cacao]
 gb|EOX99650.1| Serine carboxypeptidase-like 45 isoform 3 [Theobroma cacao]
Length=462

 Score = 61.6 bits (148),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 29/50 (58%), Positives = 35/50 (70%), Gaps = 1/50 (2%)
 Frame = -2

Query  152  LTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVD  3
            L LWL GG  CS   VG F E+GPFRP+ +  LVKN YSWN  +NMLY++
Sbjct  78   LVLWLNGGPGCSSLGVGAFSENGPFRPSGE-VLVKNEYSWNREANMLYLE  126



>ref|XP_010256545.1| PREDICTED: serine carboxypeptidase-like 45 [Nelumbo nucifera]
Length=471

 Score = 61.6 bits (148),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 30/50 (60%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = -2

Query  152  LTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVD  3
            LTLWL GG  CS    G F E+GPF+    G L KN YSWNL SNMLYV+
Sbjct  72   LTLWLSGGPGCSSLGEGAFTENGPFQSKDSGHLAKNIYSWNLESNMLYVE  121



>ref|XP_002307961.1| hypothetical protein POPTR_0006s03440g [Populus trichocarpa]
 gb|EEE91484.1| hypothetical protein POPTR_0006s03440g [Populus trichocarpa]
Length=482

 Score = 61.6 bits (148),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 27/50 (54%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = -2

Query  152  LTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVD  3
            L LWL GG  CS   +G F E+GPFRP   G LV+N Y WN  +NMLY++
Sbjct  76   LVLWLNGGPGCSSFGIGAFSENGPFRPRGGGLLVRNDYRWNKEANMLYLE  125



>ref|XP_008777393.1| PREDICTED: serine carboxypeptidase-like 45 isoform X2 [Phoenix 
dactylifera]
Length=463

 Score = 61.6 bits (148),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 28/50 (56%), Positives = 35/50 (70%), Gaps = 1/50 (2%)
 Frame = -2

Query  152  LTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVD  3
            L LWL GG  CS   VG F E+GPFRP++   LV+N YSWN  +NMLY++
Sbjct  78   LVLWLNGGPGCSSVGVGAFSENGPFRPSEQ-VLVRNEYSWNKEANMLYLE  126



>ref|XP_001013292.1| Serine carboxypeptidase family protein [Tetrahymena thermophila]
Length=460

 Score = 61.6 bits (148),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 29/50 (58%), Positives = 36/50 (72%), Gaps = 1/50 (2%)
 Frame = -2

Query  152  LTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVD  3
            L LWL GG  CS + +G+F E GPFR TKD  LV NPYSWN  +++L+VD
Sbjct  58   LILWLNGGPGCS-SLLGLFQELGPFRVTKDITLVSNPYSWNNNASVLFVD  106



>gb|EAR93047.2| serine carboxypeptidase family protein [Tetrahymena thermophila 
SB210]
Length=454

 Score = 61.6 bits (148),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 29/50 (58%), Positives = 36/50 (72%), Gaps = 1/50 (2%)
 Frame = -2

Query  152  LTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVD  3
            L LWL GG  CS + +G+F E GPFR TKD  LV NPYSWN  +++L+VD
Sbjct  58   LILWLNGGPGCS-SLLGLFQELGPFRVTKDITLVSNPYSWNNNASVLFVD  106



>ref|XP_004492026.1| PREDICTED: serine carboxypeptidase-like 45-like [Cicer arietinum]
Length=462

 Score = 61.6 bits (148),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 28/50 (56%), Positives = 35/50 (70%), Gaps = 1/50 (2%)
 Frame = -2

Query  152  LTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVD  3
            L LWL GG  CS   VG F E+GPFRP  +G LV+N +SWN  +NMLY++
Sbjct  77   LVLWLNGGPGCSSIGVGAFSENGPFRPKGEG-LVRNQFSWNTEANMLYLE  125



>ref|XP_008777392.1| PREDICTED: serine carboxypeptidase-like 45 isoform X1 [Phoenix 
dactylifera]
Length=474

 Score = 61.6 bits (148),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 28/50 (56%), Positives = 35/50 (70%), Gaps = 1/50 (2%)
 Frame = -2

Query  152  LTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVD  3
            L LWL GG  CS   VG F E+GPFRP++   LV+N YSWN  +NMLY++
Sbjct  78   LVLWLNGGPGCSSVGVGAFSENGPFRPSEQ-VLVRNEYSWNKEANMLYLE  126



>emb|CBI32794.3| unnamed protein product [Vitis vinifera]
Length=453

 Score = 61.2 bits (147),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 28/50 (56%), Positives = 34/50 (68%), Gaps = 1/50 (2%)
 Frame = -2

Query  152  LTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVD  3
            L LWL GG  CS    G F EHGPF+P+ +  LV N YSWN V+NMLY++
Sbjct  68   LVLWLNGGPGCSSIGAGAFCEHGPFKPSGE-ILVNNDYSWNKVANMLYLE  116



>ref|XP_010653629.1| PREDICTED: serine carboxypeptidase-like 45 [Vitis vinifera]
Length=461

 Score = 61.2 bits (147),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 28/50 (56%), Positives = 34/50 (68%), Gaps = 1/50 (2%)
 Frame = -2

Query  152  LTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVD  3
            L LWL GG  CS    G F EHGPF+P+ +  LV N YSWN V+NMLY++
Sbjct  76   LVLWLNGGPGCSSIGAGAFCEHGPFKPSGE-ILVNNDYSWNKVANMLYLE  124



>ref|XP_009380118.1| PREDICTED: serine carboxypeptidase-like 45 isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=467

 Score = 61.2 bits (147),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 29/50 (58%), Positives = 34/50 (68%), Gaps = 1/50 (2%)
 Frame = -2

Query  152  LTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVD  3
            L LWL GG  CS   VG F E+GPFRP K   LV+N YSWN  +NMLY++
Sbjct  78   LVLWLNGGPGCSSVGVGAFSENGPFRP-KGEVLVRNEYSWNKEANMLYLE  126



>ref|XP_010942380.1| PREDICTED: serine carboxypeptidase-like 45 [Elaeis guineensis]
Length=463

 Score = 61.2 bits (147),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 28/50 (56%), Positives = 35/50 (70%), Gaps = 1/50 (2%)
 Frame = -2

Query  152  LTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVD  3
            L LWL GG  CS   VG F E+GPFRP++   LV+N YSWN  +NMLY++
Sbjct  78   LVLWLNGGPGCSSVGVGAFSENGPFRPSEQ-VLVRNEYSWNEEANMLYLE  126



>ref|XP_007203526.1| hypothetical protein PRUPE_ppa026347mg [Prunus persica]
 gb|EMJ04725.1| hypothetical protein PRUPE_ppa026347mg [Prunus persica]
Length=461

 Score = 60.8 bits (146),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 27/50 (54%), Positives = 34/50 (68%), Gaps = 1/50 (2%)
 Frame = -2

Query  152  LTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVD  3
            L LWL GG  CS    G F EHGPF+P+ D  L+KN +SWN  +NMLY++
Sbjct  76   LVLWLNGGPGCSSVGAGAFIEHGPFKPSGD-ILLKNDFSWNKEANMLYLE  124



>gb|KDP37687.1| hypothetical protein JCGZ_06344 [Jatropha curcas]
Length=463

 Score = 60.8 bits (146),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 26/50 (52%), Positives = 31/50 (62%), Gaps = 0/50 (0%)
 Frame = -2

Query  152  LTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVD  3
            L LWL GG  CS    G F EHGPFRP     L +N YSWN  +N+LY++
Sbjct  58   LVLWLNGGPGCSSVGAGAFSEHGPFRPAGGVNLTRNEYSWNKEANILYLE  107



>gb|KCW90016.1| hypothetical protein EUGRSUZ_A02215 [Eucalyptus grandis]
Length=469

 Score = 60.8 bits (146),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 28/50 (56%), Positives = 34/50 (68%), Gaps = 1/50 (2%)
 Frame = -2

Query  152  LTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVD  3
            L LWL GG  CS   +G F EHGPF+P  D  L+KN YSWN  +NMLY++
Sbjct  77   LVLWLNGGPGCSSIGLGSFSEHGPFKPRGD-VLLKNDYSWNKEANMLYLE  125



>ref|XP_004298533.1| PREDICTED: serine carboxypeptidase-like 45-like [Fragaria vesca 
subsp. vesca]
Length=466

 Score = 60.8 bits (146),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 30/51 (59%), Positives = 36/51 (71%), Gaps = 3/51 (6%)
 Frame = -2

Query  152  LTLWLGGGHDCSIATVGMFYEHGPFRPTKDGK-LVKNPYSWNLVSNMLYVD  3
            L LWL GG  CS   VG F E+GPFRP  DG+ LV+N YSWN  +NMLY++
Sbjct  81   LVLWLNGGPGCSSLGVGAFSENGPFRP--DGQVLVRNEYSWNREANMLYLE  129



>ref|XP_004136793.1| PREDICTED: serine carboxypeptidase-like 45-like [Cucumis sativus]
 ref|XP_004159657.1| PREDICTED: serine carboxypeptidase-like 45-like [Cucumis sativus]
Length=475

 Score = 60.8 bits (146),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 29/50 (58%), Positives = 34/50 (68%), Gaps = 1/50 (2%)
 Frame = -2

Query  152  LTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVD  3
            L LWL GG  CS   VG F EHGPFRP  D  L+ N +SWN V+N+LYV+
Sbjct  80   LLLWLDGGPGCSSLGVGAFVEHGPFRPEGD-VLIHNRFSWNNVANILYVE  128



>ref|XP_009355265.1| PREDICTED: serine carboxypeptidase-like 45 [Pyrus x bretschneideri]
Length=463

 Score = 60.8 bits (146),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 27/50 (54%), Positives = 36/50 (72%), Gaps = 1/50 (2%)
 Frame = -2

Query  152  LTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVD  3
            L LWL GG  CS   VG F E+GPF+P++D  L+KN +SWN  +NMLY++
Sbjct  79   LVLWLNGGPGCSSIGVGAFNENGPFQPSED-NLLKNDFSWNREANMLYLE  127



>gb|KHN20302.1| Serine carboxypeptidase-like 45 [Glycine soja]
Length=94

 Score = 57.8 bits (138),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 28/50 (56%), Positives = 34/50 (68%), Gaps = 1/50 (2%)
 Frame = -2

Query  152  LTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVD  3
            L LWL GG  CS   VG F E+GPFRP  +  L+KN YSWN  +NMLY++
Sbjct  19   LVLWLNGGPGCSSLGVGAFSENGPFRPNGE-VLIKNEYSWNKETNMLYLE  67



>ref|XP_010023719.1| PREDICTED: serine carboxypeptidase-like 45 [Eucalyptus grandis]
Length=477

 Score = 60.8 bits (146),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 28/50 (56%), Positives = 34/50 (68%), Gaps = 1/50 (2%)
 Frame = -2

Query  152  LTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVD  3
            L LWL GG  CS   +G F EHGPF+P  D  L+KN YSWN  +NMLY++
Sbjct  77   LVLWLNGGPGCSSIGLGSFSEHGPFKPRGD-VLLKNDYSWNKEANMLYLE  125



>ref|XP_010250555.1| PREDICTED: serine carboxypeptidase-like 45 [Nelumbo nucifera]
Length=498

 Score = 60.8 bits (146),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 28/50 (56%), Positives = 35/50 (70%), Gaps = 1/50 (2%)
 Frame = -2

Query  152  LTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVD  3
            L LWL GG  CS   VG F E+GPFRP+ +  LV+N YSWN  +NMLY++
Sbjct  113  LVLWLNGGPGCSSLGVGAFSENGPFRPSGE-VLVRNEYSWNREANMLYLE  161



>gb|KCW64995.1| hypothetical protein EUGRSUZ_G02537, partial [Eucalyptus grandis]
Length=477

 Score = 60.8 bits (146),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 28/50 (56%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = -2

Query  152  LTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVD  3
            + ++ G G  CS    G F EHGPFRP  DG L KN +SWN VSNMLYV+
Sbjct  96   ILIYFGLGPGCSSLGFGAFEEHGPFRPAGDGGLTKNEFSWNKVSNMLYVE  145



>ref|XP_009380117.1| PREDICTED: serine carboxypeptidase-like 45 isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=489

 Score = 60.8 bits (146),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 29/50 (58%), Positives = 34/50 (68%), Gaps = 1/50 (2%)
 Frame = -2

Query  152  LTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVD  3
            L LWL GG  CS   VG F E+GPFRP K   LV+N YSWN  +NMLY++
Sbjct  100  LVLWLNGGPGCSSVGVGAFSENGPFRP-KGEVLVRNEYSWNKEANMLYLE  148



>gb|AES77859.2| serine carboxypeptidase-like protein [Medicago truncatula]
Length=460

 Score = 60.8 bits (146),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 29/50 (58%), Positives = 34/50 (68%), Gaps = 1/50 (2%)
 Frame = -2

Query  152  LTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVD  3
            L LWL GG  CS   VG F E+GPFRP K   LVKN +SWN  +NMLY++
Sbjct  75   LVLWLNGGPGCSSLGVGAFSENGPFRP-KGEALVKNQFSWNTEANMLYLE  123



>ref|XP_007212763.1| hypothetical protein PRUPE_ppa025629mg, partial [Prunus persica]
 gb|EMJ13962.1| hypothetical protein PRUPE_ppa025629mg, partial [Prunus persica]
Length=125

 Score = 58.2 bits (139),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 27/50 (54%), Positives = 35/50 (70%), Gaps = 1/50 (2%)
 Frame = -2

Query  152  LTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVD  3
            L LWL GG DCS    G F +HGPF+P+ D  L+KN +SWN  +NMLY++
Sbjct  27   LVLWLNGGPDCSSVGAGAFIKHGPFKPSGD-ILLKNDFSWNKEANMLYLE  75



>ref|XP_009334311.1| PREDICTED: serine carboxypeptidase-like 45 [Pyrus x bretschneideri]
Length=459

 Score = 60.8 bits (146),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 30/51 (59%), Positives = 36/51 (71%), Gaps = 3/51 (6%)
 Frame = -2

Query  152  LTLWLGGGHDCSIATVGMFYEHGPFRPTKDGK-LVKNPYSWNLVSNMLYVD  3
            L LWL GG  CS   VG F E+GPFRP  DG+ LV+N YSWN  +NMLY++
Sbjct  74   LVLWLNGGPGCSSLGVGAFSENGPFRP--DGEVLVRNEYSWNREANMLYLE  122



>ref|XP_003621641.1| Serine carboxypeptidase-like protein [Medicago truncatula]
Length=489

 Score = 60.8 bits (146),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 29/50 (58%), Positives = 34/50 (68%), Gaps = 1/50 (2%)
 Frame = -2

Query  152  LTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVD  3
            L LWL GG  CS   VG F E+GPFRP K   LVKN +SWN  +NMLY++
Sbjct  75   LVLWLNGGPGCSSLGVGAFSENGPFRP-KGEALVKNQFSWNTEANMLYLE  123



>ref|XP_002268172.1| PREDICTED: serine carboxypeptidase-like 45 [Vitis vinifera]
 emb|CBI35664.3| unnamed protein product [Vitis vinifera]
Length=463

 Score = 60.8 bits (146),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 28/50 (56%), Positives = 35/50 (70%), Gaps = 1/50 (2%)
 Frame = -2

Query  152  LTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVD  3
            L LWL GG  CS   VG F E+GPFRP+ +  LV+N YSWN  +NMLY++
Sbjct  78   LVLWLNGGPGCSSLGVGAFSENGPFRPSGE-LLVRNEYSWNREANMLYLE  126



>ref|XP_007038111.1| Serine carboxypeptidase-like 45 isoform 2 [Theobroma cacao]
 gb|EOY22612.1| Serine carboxypeptidase-like 45 isoform 2 [Theobroma cacao]
Length=379

 Score = 60.5 bits (145),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 28/50 (56%), Positives = 34/50 (68%), Gaps = 1/50 (2%)
 Frame = -2

Query  152  LTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVD  3
            L LWL GG  CS   VG F E+GPFRP  +  LV+N YSWN  +NMLY++
Sbjct  64   LVLWLNGGPGCSSVGVGAFSENGPFRPNGE-VLVRNDYSWNREANMLYLE  112



>ref|XP_010469459.1| PREDICTED: serine carboxypeptidase-like 46 [Camelina sativa]
Length=466

 Score = 60.5 bits (145),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 29/50 (58%), Positives = 34/50 (68%), Gaps = 1/50 (2%)
 Frame = -2

Query  152  LTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVD  3
            L LWL GG  CS   VG F E+GPFRP K   LVKN +SWN  +NMLY++
Sbjct  79   LVLWLNGGPGCSSVGVGAFSENGPFRP-KGSVLVKNQHSWNQEANMLYLE  127



>ref|XP_010509871.1| PREDICTED: serine carboxypeptidase-like 46 [Camelina sativa]
Length=465

 Score = 60.5 bits (145),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 29/50 (58%), Positives = 34/50 (68%), Gaps = 1/50 (2%)
 Frame = -2

Query  152  LTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVD  3
            L LWL GG  CS   VG F E+GPFRP K   LVKN +SWN  +NMLY++
Sbjct  78   LVLWLNGGPGCSSVGVGAFSENGPFRP-KGSVLVKNQHSWNQEANMLYLE  126



>emb|CEI92705.1| hypothetical protein RMCBS344292_06958 [Rhizopus microsporus]
Length=239

 Score = 58.9 bits (141),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 27/50 (54%), Positives = 36/50 (72%), Gaps = 1/50 (2%)
 Frame = -2

Query  152  LTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVD  3
            LT+WL GG  CS + +G++ E+GP R + DG +  NPYSW L SNMLY+D
Sbjct  101  LTVWLNGGPGCS-SMIGLWQENGPCRASTDGSIEFNPYSWTLHSNMLYLD  149



>ref|XP_002512656.1| serine carboxypeptidase, putative [Ricinus communis]
 gb|EEF50108.1| serine carboxypeptidase, putative [Ricinus communis]
Length=458

 Score = 60.5 bits (145),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 29/50 (58%), Positives = 34/50 (68%), Gaps = 1/50 (2%)
 Frame = -2

Query  152  LTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVD  3
            L LWL GG  CS   VG F E+GPFRP+    LVKN YSWN  +NMLY++
Sbjct  73   LVLWLNGGPGCSSLGVGAFSENGPFRPSGQ-VLVKNQYSWNREANMLYLE  121



>ref|XP_004310134.1| PREDICTED: serine carboxypeptidase-like 45-like [Fragaria vesca 
subsp. vesca]
Length=458

 Score = 60.5 bits (145),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 28/50 (56%), Positives = 35/50 (70%), Gaps = 1/50 (2%)
 Frame = -2

Query  152  LTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVD  3
            L LWL GG  CS   VG F E+GPFRP+ +  LV+N YSWN  +NMLY++
Sbjct  74   LVLWLNGGPGCSSLGVGAFSENGPFRPSGE-VLVRNEYSWNREANMLYLE  122



>gb|EAY93940.1| hypothetical protein OsI_15713 [Oryza sativa Indica Group]
Length=470

 Score = 60.5 bits (145),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 28/50 (56%), Positives = 35/50 (70%), Gaps = 1/50 (2%)
 Frame = -2

Query  152  LTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVD  3
            L LWL GG  CS   VG F E+GPFRP+ +  LV+N YSWN  +NMLY++
Sbjct  81   LVLWLNGGPGCSSVGVGAFSENGPFRPSGN-VLVRNEYSWNKEANMLYLE  129



>ref|XP_009337518.1| PREDICTED: serine carboxypeptidase-like 45 [Pyrus x bretschneideri]
Length=468

 Score = 60.5 bits (145),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 30/51 (59%), Positives = 36/51 (71%), Gaps = 3/51 (6%)
 Frame = -2

Query  152  LTLWLGGGHDCSIATVGMFYEHGPFRPTKDGK-LVKNPYSWNLVSNMLYVD  3
            L LWL GG  CS   VG F E+GPFRP  DG+ LV+N YSWN  +NMLY++
Sbjct  83   LVLWLNGGPGCSSLGVGAFSENGPFRP--DGEVLVRNEYSWNREANMLYLE  131



>ref|XP_007209121.1| hypothetical protein PRUPE_ppa005457mg [Prunus persica]
 gb|EMJ10320.1| hypothetical protein PRUPE_ppa005457mg [Prunus persica]
Length=460

 Score = 60.5 bits (145),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 30/51 (59%), Positives = 36/51 (71%), Gaps = 3/51 (6%)
 Frame = -2

Query  152  LTLWLGGGHDCSIATVGMFYEHGPFRPTKDGK-LVKNPYSWNLVSNMLYVD  3
            L LWL GG  CS   VG F E+GPFRP  DG+ LV+N YSWN  +NMLY++
Sbjct  75   LVLWLNGGPGCSSLGVGAFSENGPFRP--DGEVLVRNEYSWNREANMLYLE  123



>ref|XP_009368797.1| PREDICTED: serine carboxypeptidase-like 45 [Pyrus x bretschneideri]
Length=467

 Score = 60.5 bits (145),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 30/51 (59%), Positives = 36/51 (71%), Gaps = 3/51 (6%)
 Frame = -2

Query  152  LTLWLGGGHDCSIATVGMFYEHGPFRPTKDGK-LVKNPYSWNLVSNMLYVD  3
            L LWL GG  CS   VG F E+GPFRP  DG+ LV+N YSWN  +NMLY++
Sbjct  83   LVLWLNGGPGCSSLGVGAFSENGPFRP--DGEVLVRNEYSWNREANMLYLE  131



>ref|XP_008374178.1| PREDICTED: serine carboxypeptidase-like 45 [Malus domestica]
Length=467

 Score = 60.5 bits (145),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 30/51 (59%), Positives = 36/51 (71%), Gaps = 3/51 (6%)
 Frame = -2

Query  152  LTLWLGGGHDCSIATVGMFYEHGPFRPTKDGK-LVKNPYSWNLVSNMLYVD  3
            L LWL GG  CS   VG F E+GPFRP  DG+ LV+N YSWN  +NMLY++
Sbjct  83   LVLWLNGGPGCSSLGVGAFSENGPFRP--DGEVLVRNEYSWNREANMLYLE  131



>ref|XP_006844530.1| hypothetical protein AMTR_s00016p00162700 [Amborella trichopoda]
 gb|ERN06205.1| hypothetical protein AMTR_s00016p00162700 [Amborella trichopoda]
Length=460

 Score = 60.5 bits (145),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 28/50 (56%), Positives = 35/50 (70%), Gaps = 1/50 (2%)
 Frame = -2

Query  152  LTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVD  3
            L +WL GG  CS   VG F E+GPFRP+ +  LVKN YSWN  +NMLY++
Sbjct  75   LVIWLNGGPGCSSLGVGAFSENGPFRPSGN-VLVKNHYSWNREANMLYIE  123



>ref|XP_011075459.1| PREDICTED: serine carboxypeptidase-like 45 [Sesamum indicum]
Length=472

 Score = 60.5 bits (145),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 27/50 (54%), Positives = 34/50 (68%), Gaps = 1/50 (2%)
 Frame = -2

Query  152  LTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVD  3
            L LWL GG  CS    G F EHGPF+P+ +  LV+N YSWN  +NMLY++
Sbjct  77   LVLWLNGGPGCSSVGAGAFSEHGPFQPSGN-VLVRNNYSWNKAANMLYLE  125



>ref|XP_004975453.1| PREDICTED: serine carboxypeptidase-like 45-like [Setaria italica]
Length=522

 Score = 60.5 bits (145),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 28/50 (56%), Positives = 35/50 (70%), Gaps = 1/50 (2%)
 Frame = -2

Query  152  LTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVD  3
            L LWL GG  CS   VG F E+GPFRP+ +  LV+N YSWN  +NMLY++
Sbjct  134  LVLWLNGGPGCSSVGVGAFSENGPFRPSGN-VLVRNEYSWNKEANMLYLE  182



>ref|XP_008240683.1| PREDICTED: serine carboxypeptidase-like 45 [Prunus mume]
Length=456

 Score = 60.5 bits (145),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 27/50 (54%), Positives = 34/50 (68%), Gaps = 1/50 (2%)
 Frame = -2

Query  152  LTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVD  3
            L LWL GG  CS    G F EHGPF+P+ D  L+KN +SWN  +NMLY++
Sbjct  71   LVLWLNGGPGCSSVGAGAFIEHGPFKPSGD-ILLKNDFSWNKEANMLYLE  119



>ref|XP_011040747.1| PREDICTED: serine carboxypeptidase-like 45 isoform X1 [Populus 
euphratica]
Length=467

 Score = 60.5 bits (145),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 27/50 (54%), Positives = 34/50 (68%), Gaps = 1/50 (2%)
 Frame = -2

Query  152  LTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVD  3
            L LWL GG  CS    G F EHGPF+P+ +  L+KN YSWN  +NMLY++
Sbjct  75   LVLWLNGGPGCSSIGAGAFCEHGPFKPSAE-ILLKNDYSWNKEANMLYLE  123



>ref|XP_009759845.1| PREDICTED: serine carboxypeptidase-like 45 [Nicotiana sylvestris]
Length=463

 Score = 60.5 bits (145),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 28/50 (56%), Positives = 34/50 (68%), Gaps = 1/50 (2%)
 Frame = -2

Query  152  LTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVD  3
            L LWL GG  CS   VG F E+GPFRP +   LV+N YSWN  +NMLY++
Sbjct  78   LVLWLNGGPGCSSVGVGAFSENGPFRP-RGQVLVRNEYSWNKEANMLYLE  126



>ref|XP_008667418.1| PREDICTED: hypothetical protein isoform X2 [Zea mays]
 gb|ACF78622.1| unknown [Zea mays]
 gb|ACF84275.1| unknown [Zea mays]
 tpg|DAA38061.1| TPA: serine carboxypeptidase K10B2.2 [Zea mays]
Length=471

 Score = 60.5 bits (145),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 27/50 (54%), Positives = 34/50 (68%), Gaps = 1/50 (2%)
 Frame = -2

Query  152  LTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVD  3
            L LWL GG  CS   VG F E+GPFRP+ +  L +N YSWN  +NMLY++
Sbjct  84   LVLWLNGGPGCSSVGVGAFSENGPFRPSGNA-LTRNEYSWNKEANMLYLE  132



>ref|XP_008667417.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 tpg|DAA38060.1| TPA: hypothetical protein ZEAMMB73_252249 [Zea mays]
Length=472

 Score = 60.5 bits (145),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 27/50 (54%), Positives = 34/50 (68%), Gaps = 1/50 (2%)
 Frame = -2

Query  152  LTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVD  3
            L LWL GG  CS   VG F E+GPFRP+ +  L +N YSWN  +NMLY++
Sbjct  84   LVLWLNGGPGCSSVGVGAFSENGPFRPSGNA-LTRNEYSWNKEANMLYLE  132



>tpg|DAA38059.1| TPA: hypothetical protein ZEAMMB73_252249 [Zea mays]
Length=466

 Score = 60.5 bits (145),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 27/50 (54%), Positives = 34/50 (68%), Gaps = 1/50 (2%)
 Frame = -2

Query  152  LTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVD  3
            L LWL GG  CS   VG F E+GPFRP+ +  L +N YSWN  +NMLY++
Sbjct  84   LVLWLNGGPGCSSVGVGAFSENGPFRPSGNA-LTRNEYSWNKEANMLYLE  132



>ref|XP_011020860.1| PREDICTED: serine carboxypeptidase-like 45 [Populus euphratica]
Length=463

 Score = 60.5 bits (145),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 29/50 (58%), Positives = 34/50 (68%), Gaps = 1/50 (2%)
 Frame = -2

Query  152  LTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVD  3
            L LWL GG  CS   VG F E+GPFRP+    LVKN YSWN  +NMLY++
Sbjct  77   LVLWLNGGPGCSSLGVGAFSENGPFRPSGQ-VLVKNQYSWNREANMLYLE  125



>ref|XP_011040748.1| PREDICTED: serine carboxypeptidase-like 45 isoform X2 [Populus 
euphratica]
Length=459

 Score = 60.5 bits (145),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 27/50 (54%), Positives = 34/50 (68%), Gaps = 1/50 (2%)
 Frame = -2

Query  152  LTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVD  3
            L LWL GG  CS    G F EHGPF+P+ +  L+KN YSWN  +NMLY++
Sbjct  75   LVLWLNGGPGCSSIGAGAFCEHGPFKPSAE-ILLKNDYSWNKEANMLYLE  123



>gb|KDP37690.1| hypothetical protein JCGZ_06347 [Jatropha curcas]
Length=467

 Score = 60.5 bits (145),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 27/50 (54%), Positives = 34/50 (68%), Gaps = 1/50 (2%)
 Frame = -2

Query  152  LTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVD  3
            L LWL GG  CS    G F EHGPF+P+ D  L+KN +SWN  +NMLY++
Sbjct  76   LVLWLNGGPGCSSIGAGAFCEHGPFKPSGD-ILLKNDFSWNKEANMLYLE  124



>ref|NP_001150027.1| serine carboxypeptidase K10B2.2 precursor [Zea mays]
 gb|ACG37565.1| serine carboxypeptidase K10B2.2 precursor [Zea mays]
Length=471

 Score = 60.5 bits (145),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 27/50 (54%), Positives = 34/50 (68%), Gaps = 1/50 (2%)
 Frame = -2

Query  152  LTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVD  3
            L LWL GG  CS   VG F E+GPFRP+ +  L +N YSWN  +NMLY++
Sbjct  84   LVLWLNGGPGCSSVGVGAFSENGPFRPSGNA-LTRNEYSWNKEANMLYLE  132



>ref|NP_001052663.1| Os04g0396800 [Oryza sativa Japonica Group]
 emb|CAE05146.2| OSJNBa0039C07.2 [Oryza sativa Japonica Group]
 dbj|BAF14577.1| Os04g0396800 [Oryza sativa Japonica Group]
 gb|EAZ30581.1| hypothetical protein OsJ_14632 [Oryza sativa Japonica Group]
 dbj|BAG91822.1| unnamed protein product [Oryza sativa Japonica Group]
Length=470

 Score = 60.5 bits (145),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 28/50 (56%), Positives = 35/50 (70%), Gaps = 1/50 (2%)
 Frame = -2

Query  152  LTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVD  3
            L LWL GG  CS   VG F E+GPFRP+ +  LV+N YSWN  +NMLY++
Sbjct  81   LVLWLNGGPGCSSVGVGAFSENGPFRPSGN-VLVRNEYSWNKEANMLYLE  129



>ref|XP_002517289.1| serine carboxypeptidase, putative [Ricinus communis]
 gb|EEF45082.1| serine carboxypeptidase, putative [Ricinus communis]
Length=464

 Score = 60.1 bits (144),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 29/51 (57%), Positives = 35/51 (69%), Gaps = 3/51 (6%)
 Frame = -2

Query  152  LTLWLGGGHDCSIATVGMFYEHGPFRPTKDGK-LVKNPYSWNLVSNMLYVD  3
            L LWL GG  CS    G F EHGPF+P+  GK L+KN YSWN  +NMLY++
Sbjct  74   LVLWLNGGPGCSSIGAGAFCEHGPFKPS--GKILLKNDYSWNREANMLYLE  122



>ref|XP_007139316.1| hypothetical protein PHAVU_008G019100g [Phaseolus vulgaris]
 gb|ESW11310.1| hypothetical protein PHAVU_008G019100g [Phaseolus vulgaris]
Length=461

 Score = 60.1 bits (144),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 28/50 (56%), Positives = 34/50 (68%), Gaps = 1/50 (2%)
 Frame = -2

Query  152  LTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVD  3
            L LWL GG  CS   VG F E+GPFRP K   LV+N +SWN  +NMLY++
Sbjct  76   LVLWLNGGPGCSSLGVGAFSENGPFRP-KGEALVRNQFSWNREANMLYLE  124



>ref|XP_008791046.1| PREDICTED: serine carboxypeptidase-like 45 [Phoenix dactylifera]
 ref|XP_008791047.1| PREDICTED: serine carboxypeptidase-like 45 [Phoenix dactylifera]
Length=463

 Score = 60.1 bits (144),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 28/50 (56%), Positives = 34/50 (68%), Gaps = 1/50 (2%)
 Frame = -2

Query  152  LTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVD  3
            L LWL GG  CS   VG F E+GPFRP+    LV+N YSWN  +NMLY++
Sbjct  78   LVLWLNGGPGCSSVGVGAFSENGPFRPSGQ-LLVRNEYSWNKEANMLYLE  126



>ref|XP_007038110.1| Serine carboxypeptidase-like 45 isoform 1 [Theobroma cacao]
 gb|EOY22611.1| Serine carboxypeptidase-like 45 isoform 1 [Theobroma cacao]
Length=463

 Score = 60.1 bits (144),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 28/50 (56%), Positives = 34/50 (68%), Gaps = 1/50 (2%)
 Frame = -2

Query  152  LTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVD  3
            L LWL GG  CS   VG F E+GPFRP  +  LV+N YSWN  +NMLY++
Sbjct  78   LVLWLNGGPGCSSVGVGAFSENGPFRPNGE-VLVRNDYSWNREANMLYLE  126



>ref|XP_009599118.1| PREDICTED: serine carboxypeptidase-like 45 [Nicotiana tomentosiformis]
Length=457

 Score = 60.1 bits (144),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 30/51 (59%), Positives = 36/51 (71%), Gaps = 3/51 (6%)
 Frame = -2

Query  152  LTLWLGGGHDCSIATVGMFYEHGPFRPTKDGK-LVKNPYSWNLVSNMLYVD  3
            L LWL GG  CS   VG F E+GPFRP  +G+ LVKN YSWN  +NMLY++
Sbjct  70   LVLWLNGGPGCSSLGVGAFSENGPFRP--NGQVLVKNEYSWNKEANMLYLE  118



>ref|XP_008357633.1| PREDICTED: serine carboxypeptidase-like 45 [Malus domestica]
Length=300

 Score = 59.3 bits (142),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 27/50 (54%), Positives = 35/50 (70%), Gaps = 1/50 (2%)
 Frame = -2

Query  152  LTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVD  3
            L LWL GG  CS   VG F E+GPF+P+ D  L+KN +SWN  +NMLY++
Sbjct  79   LVLWLNGGPGCSSVGVGAFNENGPFQPSGD-ILLKNDFSWNREANMLYLE  127



>ref|XP_010271867.1| PREDICTED: serine carboxypeptidase-like 45 isoform X3 [Nelumbo 
nucifera]
Length=504

 Score = 60.1 bits (144),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 29/51 (57%), Positives = 35/51 (69%), Gaps = 3/51 (6%)
 Frame = -2

Query  152  LTLWLGGGHDCSIATVGMFYEHGPFRPTKDGK-LVKNPYSWNLVSNMLYVD  3
            L LW+ GG  CS    G F EHGPFRP+  GK LV+N YSWN  +NMLY++
Sbjct  117  LVLWVNGGPGCSSIGTGAFSEHGPFRPS--GKNLVRNEYSWNKEANMLYLE  165



>gb|KHN30340.1| Serine carboxypeptidase-like 45 [Glycine soja]
Length=460

 Score = 60.1 bits (144),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 27/50 (54%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = -2

Query  152  LTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVD  3
            L LWL GG  CS   VG F EHGPFRP+ +  L  N  SWN V+N+LY++
Sbjct  77   LVLWLNGGPGCSSIGVGAFAEHGPFRPSDNNVLEINDKSWNKVANVLYLE  126



>ref|XP_009778790.1| PREDICTED: serine carboxypeptidase-like 45 [Nicotiana sylvestris]
Length=457

 Score = 60.1 bits (144),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 30/51 (59%), Positives = 36/51 (71%), Gaps = 3/51 (6%)
 Frame = -2

Query  152  LTLWLGGGHDCSIATVGMFYEHGPFRPTKDGK-LVKNPYSWNLVSNMLYVD  3
            L LWL GG  CS   VG F E+GPFRP  +G+ LVKN YSWN  +NMLY++
Sbjct  70   LVLWLNGGPGCSSLGVGAFSENGPFRP--NGQVLVKNEYSWNKEANMLYLE  118



>ref|XP_003521119.1| PREDICTED: serine carboxypeptidase-like 45-like [Glycine max]
Length=462

 Score = 60.1 bits (144),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 27/50 (54%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = -2

Query  152  LTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVD  3
            L LWL GG  CS   VG F EHGPFRP+ +  L  N  SWN V+N+LY++
Sbjct  79   LVLWLNGGPGCSSIGVGAFAEHGPFRPSDNNVLEINDKSWNKVANVLYLE  128



>ref|XP_010413849.1| PREDICTED: serine carboxypeptidase-like 46 [Camelina sativa]
Length=465

 Score = 60.1 bits (144),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 29/50 (58%), Positives = 34/50 (68%), Gaps = 1/50 (2%)
 Frame = -2

Query  152  LTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVD  3
            L LWL GG  CS   VG F E+GPFRP K   LVKN +SWN  +NMLY++
Sbjct  78   LVLWLNGGPGCSSLGVGAFSENGPFRP-KGSVLVKNQHSWNQEANMLYLE  126



>ref|XP_008351704.1| PREDICTED: serine carboxypeptidase-like 45 [Malus domestica]
Length=165

 Score = 57.8 bits (138),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 30/51 (59%), Positives = 36/51 (71%), Gaps = 3/51 (6%)
 Frame = -2

Query  152  LTLWLGGGHDCSIATVGMFYEHGPFRPTKDGK-LVKNPYSWNLVSNMLYVD  3
            L LWL GG  CS   VG F E+GPFRP  DG+ LV+N YSWN  +NMLY++
Sbjct  83   LVLWLNGGPGCSSLGVGAFSENGPFRP--DGEVLVRNEYSWNREANMLYLE  131



>ref|XP_010249188.1| PREDICTED: serine carboxypeptidase-like 45 [Nelumbo nucifera]
Length=494

 Score = 60.1 bits (144),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 28/50 (56%), Positives = 35/50 (70%), Gaps = 1/50 (2%)
 Frame = -2

Query  152  LTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVD  3
            L LWL GG  CS   VG F E+GPFRP+ +  LV+N YSWN  +NMLY++
Sbjct  109  LVLWLNGGPGCSSLGVGAFSENGPFRPSGE-VLVRNEYSWNSEANMLYLE  157



>ref|XP_003758638.1| PREDICTED: lysosomal protective protein-like [Sarcophilus harrisii]
Length=457

 Score = 60.1 bits (144),  Expect = 7e-09, Method: Composition-based stats.
 Identities = 28/50 (56%), Positives = 35/50 (70%), Gaps = 1/50 (2%)
 Frame = -2

Query  152  LTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVD  3
            L LWL GG  CS +  G+  E+GPFR   DG L  NPYSWNLV+N+LY++
Sbjct  70   LVLWLNGGPGCS-SMEGLLAENGPFRINDDGSLYMNPYSWNLVANVLYLE  118



>ref|XP_010271868.1| PREDICTED: serine carboxypeptidase-like 45 isoform X4 [Nelumbo 
nucifera]
Length=503

 Score = 60.1 bits (144),  Expect = 7e-09, Method: Composition-based stats.
 Identities = 29/51 (57%), Positives = 35/51 (69%), Gaps = 3/51 (6%)
 Frame = -2

Query  152  LTLWLGGGHDCSIATVGMFYEHGPFRPTKDGK-LVKNPYSWNLVSNMLYVD  3
            L LW+ GG  CS    G F EHGPFRP+  GK LV+N YSWN  +NMLY++
Sbjct  117  LVLWVNGGPGCSSIGTGAFSEHGPFRPS--GKNLVRNEYSWNKEANMLYLE  165



>gb|KHN47533.1| Serine carboxypeptidase-like 45 [Glycine soja]
Length=454

 Score = 60.1 bits (144),  Expect = 7e-09, Method: Composition-based stats.
 Identities = 28/50 (56%), Positives = 34/50 (68%), Gaps = 1/50 (2%)
 Frame = -2

Query  152  LTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVD  3
            L LWL GG  CS   VG F E+GPFRP   G LV+N +SWN  +NMLY++
Sbjct  76   LVLWLNGGPGCSSLGVGAFSENGPFRPKGKG-LVRNQFSWNREANMLYLE  124



>gb|EMS60816.1| Serine carboxypeptidase-like 45 [Triticum urartu]
Length=506

 Score = 60.1 bits (144),  Expect = 7e-09, Method: Composition-based stats.
 Identities = 28/50 (56%), Positives = 34/50 (68%), Gaps = 1/50 (2%)
 Frame = -2

Query  152  LTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVD  3
            L LWL GG  CS   VG F E+GPFRP+ +  LV N YSWN  +NMLY++
Sbjct  77   LVLWLNGGPGCSSVGVGAFSENGPFRPSGNA-LVGNEYSWNKEANMLYLE  125



>ref|XP_008443350.1| PREDICTED: serine carboxypeptidase-like 45 [Cucumis melo]
Length=479

 Score = 60.1 bits (144),  Expect = 7e-09, Method: Composition-based stats.
 Identities = 29/50 (58%), Positives = 33/50 (66%), Gaps = 1/50 (2%)
 Frame = -2

Query  152  LTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVD  3
            L LWL GG  CS   VG F EHGPF+   +  LVKN YSWN  +NMLYV+
Sbjct  80   LVLWLNGGPGCSSVGVGAFIEHGPFKINGE-VLVKNEYSWNTEANMLYVE  128



>ref|XP_006294161.1| hypothetical protein CARUB_v10023154mg [Capsella rubella]
 gb|EOA27059.1| hypothetical protein CARUB_v10023154mg [Capsella rubella]
Length=465

 Score = 60.1 bits (144),  Expect = 7e-09, Method: Composition-based stats.
 Identities = 29/50 (58%), Positives = 34/50 (68%), Gaps = 1/50 (2%)
 Frame = -2

Query  152  LTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVD  3
            L LWL GG  CS   VG F E+GPFRP K   LVKN +SWN  +NMLY++
Sbjct  78   LVLWLNGGPGCSSLGVGAFSENGPFRP-KGSILVKNQHSWNQEANMLYLE  126



>ref|XP_008378990.1| PREDICTED: serine carboxypeptidase-like 45 [Malus domestica]
Length=337

 Score = 59.3 bits (142),  Expect = 7e-09, Method: Composition-based stats.
 Identities = 27/50 (54%), Positives = 35/50 (70%), Gaps = 1/50 (2%)
 Frame = -2

Query  152  LTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVD  3
            L LWL GG  CS   VG F E+GPF+P+ D  L+KN +SWN  +NMLY++
Sbjct  79   LVLWLNGGPGCSSVGVGAFNENGPFQPSGD-ILLKNDFSWNREANMLYLE  127



>gb|EYU21824.1| hypothetical protein MIMGU_mgv1a006099mg [Erythranthe guttata]
Length=457

 Score = 59.7 bits (143),  Expect = 8e-09, Method: Composition-based stats.
 Identities = 28/50 (56%), Positives = 34/50 (68%), Gaps = 1/50 (2%)
 Frame = -2

Query  152  LTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVD  3
            L LWL GG  CS   VG F E+GPFRP  +  L++N YSWN  +NMLY+D
Sbjct  72   LVLWLNGGPGCSSIGVGAFSENGPFRPNVE-VLLRNEYSWNREANMLYLD  120



>ref|XP_002446348.1| hypothetical protein SORBIDRAFT_06g014580 [Sorghum bicolor]
 gb|EES10676.1| hypothetical protein SORBIDRAFT_06g014580 [Sorghum bicolor]
Length=474

 Score = 59.7 bits (143),  Expect = 8e-09, Method: Composition-based stats.
 Identities = 27/50 (54%), Positives = 34/50 (68%), Gaps = 1/50 (2%)
 Frame = -2

Query  152  LTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVD  3
            L LWL GG  CS   VG F E+GPFRP+ +  L +N YSWN  +NMLY++
Sbjct  85   LVLWLNGGPGCSSVGVGAFSENGPFRPSGNA-LTRNEYSWNKEANMLYLE  133



>ref|XP_007337695.1| alpha/beta-hydrolase [Auricularia delicata TFB-10046 SS5]
 gb|EJD54874.1| alpha/beta-hydrolase [Auricularia delicata TFB-10046 SS5]
Length=431

 Score = 59.7 bits (143),  Expect = 8e-09, Method: Composition-based stats.
 Identities = 25/50 (50%), Positives = 36/50 (72%), Gaps = 1/50 (2%)
 Frame = -2

Query  152  LTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVD  3
            + LW  GG  CS A VG++ EHGP R  +DG + +NP+SWN V+N++Y+D
Sbjct  71   VVLWTNGGPGCSSA-VGLYMEHGPCRIAQDGSVQRNPHSWNEVANIIYID  119



>ref|XP_010271865.1| PREDICTED: serine carboxypeptidase-like 45 isoform X1 [Nelumbo 
nucifera]
Length=520

 Score = 59.7 bits (143),  Expect = 9e-09, Method: Composition-based stats.
 Identities = 29/51 (57%), Positives = 35/51 (69%), Gaps = 3/51 (6%)
 Frame = -2

Query  152  LTLWLGGGHDCSIATVGMFYEHGPFRPTKDGK-LVKNPYSWNLVSNMLYVD  3
            L LW+ GG  CS    G F EHGPFRP+  GK LV+N YSWN  +NMLY++
Sbjct  117  LVLWVNGGPGCSSIGTGAFSEHGPFRPS--GKNLVRNEYSWNKEANMLYLE  165



>ref|XP_009109757.1| PREDICTED: serine carboxypeptidase-like 45 [Brassica rapa]
Length=460

 Score = 59.7 bits (143),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 29/50 (58%), Positives = 34/50 (68%), Gaps = 1/50 (2%)
 Frame = -2

Query  152  LTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVD  3
            L LWL GG  CS   VG F E+GPFRP K   LVKN +SWN  +NMLY++
Sbjct  76   LVLWLNGGPGCSSLGVGAFSENGPFRP-KGSVLVKNQHSWNQEANMLYLE  124



>emb|CDY11750.1| BnaC03g58280D [Brassica napus]
Length=461

 Score = 59.7 bits (143),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 29/50 (58%), Positives = 34/50 (68%), Gaps = 1/50 (2%)
 Frame = -2

Query  152  LTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVD  3
            L LWL GG  CS   VG F E+GPFRP K   LVKN +SWN  +NMLY++
Sbjct  76   LVLWLNGGPGCSSLGVGAFSENGPFRP-KGSVLVKNQHSWNQEANMLYLE  124



>ref|XP_008378883.1| PREDICTED: serine carboxypeptidase-like 45 [Malus domestica]
Length=462

 Score = 59.7 bits (143),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 27/50 (54%), Positives = 35/50 (70%), Gaps = 1/50 (2%)
 Frame = -2

Query  152  LTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVD  3
            L LWL GG  CS   VG F E+GPF+P+ D  L+KN +SWN  +NMLY++
Sbjct  78   LVLWLNGGPGCSSVGVGAFNENGPFQPSXD-ILLKNDFSWNRZANMLYLE  126



>emb|CDX90124.1| BnaA08g18600D [Brassica napus]
Length=460

 Score = 59.7 bits (143),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 29/50 (58%), Positives = 34/50 (68%), Gaps = 1/50 (2%)
 Frame = -2

Query  152  LTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVD  3
            L LWL GG  CS   VG F E+GPFRP K   LVKN +SWN  +NMLY++
Sbjct  76   LVLWLNGGPGCSSLGVGAFSENGPFRP-KGSVLVKNQHSWNQEANMLYLE  124



>ref|XP_002307963.1| hypothetical protein POPTR_0006s03490g [Populus trichocarpa]
 gb|EEE91486.1| hypothetical protein POPTR_0006s03490g [Populus trichocarpa]
Length=459

 Score = 59.7 bits (143),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 27/50 (54%), Positives = 34/50 (68%), Gaps = 1/50 (2%)
 Frame = -2

Query  152  LTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVD  3
            L LWL GG  CS    G F EHGPF+P+ +  L+KN YSWN  +NMLY++
Sbjct  75   LVLWLNGGPGCSSIGAGAFCEHGPFKPSGE-ILLKNDYSWNKEANMLYLE  123



>ref|XP_010271866.1| PREDICTED: serine carboxypeptidase-like 45 isoform X2 [Nelumbo 
nucifera]
Length=519

 Score = 59.7 bits (143),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 29/51 (57%), Positives = 35/51 (69%), Gaps = 3/51 (6%)
 Frame = -2

Query  152  LTLWLGGGHDCSIATVGMFYEHGPFRPTKDGK-LVKNPYSWNLVSNMLYVD  3
            L LW+ GG  CS    G F EHGPFRP+  GK LV+N YSWN  +NMLY++
Sbjct  117  LVLWVNGGPGCSSIGTGAFSEHGPFRPS--GKNLVRNEYSWNKEANMLYLE  165



>ref|XP_004488543.1| PREDICTED: serine carboxypeptidase-like 45-like [Cicer arietinum]
Length=544

 Score = 59.7 bits (143),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 28/50 (56%), Positives = 34/50 (68%), Gaps = 1/50 (2%)
 Frame = -2

Query  152  LTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVD  3
            + +WL GG  CS   +G F EHGPF+PT  G L KN YSWN  +NMLY+D
Sbjct  169  VVMWLHGGPGCSSVGLGAFQEHGPFQPTDQG-LAKNNYSWNKEANMLYLD  217



>ref|XP_004139740.1| PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing 
protein At3g09040, mitochondrial-like [Cucumis sativus]
Length=1441

 Score = 60.1 bits (144),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 29/51 (57%), Positives = 34/51 (67%), Gaps = 1/51 (2%)
 Frame = -2

Query  152   LTLWLGGGHDCSIATVGMFYEHGPFRPTKDGK-LVKNPYSWNLVSNMLYVD  3
             LTLWL GG  CS    G F E GPF P+ DG+ L KNP SWN  SN+L+V+
Sbjct  1099  LTLWLNGGPGCSSIGGGAFTELGPFYPSGDGRGLRKNPMSWNKASNLLFVE  1149



>ref|XP_011073181.1| PREDICTED: serine carboxypeptidase-like 45 [Sesamum indicum]
Length=458

 Score = 59.3 bits (142),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 29/51 (57%), Positives = 36/51 (71%), Gaps = 3/51 (6%)
 Frame = -2

Query  152  LTLWLGGGHDCSIATVGMFYEHGPFRPTKDGK-LVKNPYSWNLVSNMLYVD  3
            L LWL GG  CS   VG F E+GPFRP  +G+ L++N YSWN  +NMLY+D
Sbjct  73   LVLWLNGGPGCSSIGVGAFSENGPFRP--NGQVLLRNEYSWNREANMLYLD  121



>ref|XP_006838780.1| hypothetical protein AMTR_s00002p00258640 [Amborella trichopoda]
 gb|ERN01349.1| hypothetical protein AMTR_s00002p00258640 [Amborella trichopoda]
Length=478

 Score = 59.7 bits (143),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 28/50 (56%), Positives = 32/50 (64%), Gaps = 0/50 (0%)
 Frame = -2

Query  152  LTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVD  3
            LTLWL GG  CS   +G   EHGP+    +  LV N YSWNL SNMLYV+
Sbjct  77   LTLWLNGGPGCSSLGIGALMEHGPYLVHDNSSLVNNKYSWNLASNMLYVE  126



>gb|KDP23272.1| hypothetical protein JCGZ_23105 [Jatropha curcas]
Length=463

 Score = 59.3 bits (142),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 28/50 (56%), Positives = 35/50 (70%), Gaps = 1/50 (2%)
 Frame = -2

Query  152  LTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVD  3
            L LWL GG  CS   VG F E+GPFRP+ +  LVKN +SWN  +NMLY++
Sbjct  78   LVLWLNGGPGCSSLGVGAFSENGPFRPSGE-VLVKNQHSWNREANMLYLE  126



>ref|XP_004171434.1| PREDICTED: serine carboxypeptidase-like 42-like, partial [Cucumis 
sativus]
Length=180

 Score = 57.0 bits (136),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 29/51 (57%), Positives = 34/51 (67%), Gaps = 1/51 (2%)
 Frame = -2

Query  152  LTLWLGGGHDCSIATVGMFYEHGPFRPTKDGK-LVKNPYSWNLVSNMLYVD  3
            LTLWL GG  CS    G F E GPF P+ DG+ L KNP SWN  SN+L+V+
Sbjct  76   LTLWLNGGPGCSSIGGGAFTELGPFYPSGDGRGLRKNPMSWNKASNLLFVE  126



>ref|XP_010099600.1| Serine carboxypeptidase-like 45 [Morus notabilis]
 gb|EXB79994.1| Serine carboxypeptidase-like 45 [Morus notabilis]
Length=464

 Score = 59.3 bits (142),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 29/51 (57%), Positives = 36/51 (71%), Gaps = 3/51 (6%)
 Frame = -2

Query  152  LTLWLGGGHDCSIATVGMFYEHGPFRPTKDGK-LVKNPYSWNLVSNMLYVD  3
            L LWL GG  CS   VG F E+GPFRP  +GK L++N YSWN  +NMLY++
Sbjct  76   LVLWLNGGPGCSSLGVGAFSENGPFRP--NGKILLRNKYSWNREANMLYLE  124



>gb|EAR93048.3| serine carboxypeptidase family protein [Tetrahymena thermophila 
SB210]
Length=512

 Score = 59.3 bits (142),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 26/50 (52%), Positives = 35/50 (70%), Gaps = 1/50 (2%)
 Frame = -2

Query  152  LTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVD  3
            L LWL GG  CS + +G+F E GP++ T+D  L  NPYSWN  +N+L+VD
Sbjct  125  LILWLNGGPGCS-SMLGLFEELGPYKITQDNTLTSNPYSWNNKANVLFVD  173



>ref|XP_001013293.2| Serine carboxypeptidase family protein [Tetrahymena thermophila]
Length=445

 Score = 59.3 bits (142),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 26/50 (52%), Positives = 35/50 (70%), Gaps = 1/50 (2%)
 Frame = -2

Query  152  LTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVD  3
            L LWL GG  CS + +G+F E GP++ T+D  L  NPYSWN  +N+L+VD
Sbjct  58   LILWLNGGPGCS-SMLGLFEELGPYKITQDNTLTSNPYSWNNKANVLFVD  106



>ref|XP_006652227.1| PREDICTED: serine carboxypeptidase-like 45-like [Oryza brachyantha]
Length=467

 Score = 59.3 bits (142),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 27/50 (54%), Positives = 35/50 (70%), Gaps = 1/50 (2%)
 Frame = -2

Query  152  LTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVD  3
            L LWL GG  CS   VG F E+GPFRP+ +  LV+N YSWN  +NM+Y++
Sbjct  78   LVLWLNGGPGCSSVGVGAFSENGPFRPSGN-VLVRNEYSWNKEANMMYLE  126



>ref|XP_004488374.1| PREDICTED: serine carboxypeptidase-like 45-like [Cicer arietinum]
Length=548

 Score = 59.3 bits (142),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 28/50 (56%), Positives = 34/50 (68%), Gaps = 1/50 (2%)
 Frame = -2

Query  152  LTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVD  3
            + +WL GG  CS   +G F EHGPF+PT  G L KN YSWN  +NMLY+D
Sbjct  173  VVMWLHGGPGCSSVGLGAFQEHGPFQPTDQG-LAKNNYSWNKEANMLYLD  221



>gb|EMT29573.1| Serine carboxypeptidase-like 45 [Aegilops tauschii]
Length=560

 Score = 59.3 bits (142),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 27/50 (54%), Positives = 34/50 (68%), Gaps = 1/50 (2%)
 Frame = -2

Query  152  LTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVD  3
            L LWL GG  CS   VG F E+GPFRP+ +  L+ N YSWN  +NMLY++
Sbjct  77   LVLWLNGGPGCSSVGVGAFSENGPFRPSGNA-LMSNEYSWNKEANMLYLE  125



>ref|XP_009415855.1| PREDICTED: serine carboxypeptidase-like 45 [Musa acuminata subsp. 
malaccensis]
Length=467

 Score = 59.3 bits (142),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 28/50 (56%), Positives = 34/50 (68%), Gaps = 1/50 (2%)
 Frame = -2

Query  152  LTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVD  3
            L LWL GG  CS   VG F E+GPFRP+    LV+N YSWN  +NMLY++
Sbjct  78   LVLWLNGGPGCSSLGVGAFSENGPFRPSGQ-VLVRNEYSWNKEANMLYLE  126



>ref|XP_010549304.1| PREDICTED: serine carboxypeptidase-like 45 isoform X1 [Tarenaya 
hassleriana]
Length=467

 Score = 58.9 bits (141),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 29/50 (58%), Positives = 34/50 (68%), Gaps = 1/50 (2%)
 Frame = -2

Query  152  LTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVD  3
            L LWL GG  CS   VG F E+GPFRP K   LVKN +SWN  +NMLY++
Sbjct  81   LVLWLNGGPGCSSLGVGAFSENGPFRP-KGPILVKNEHSWNKEANMLYLE  129



>ref|XP_010549305.1| PREDICTED: serine carboxypeptidase-like 45 isoform X2 [Tarenaya 
hassleriana]
Length=466

 Score = 58.9 bits (141),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 29/50 (58%), Positives = 34/50 (68%), Gaps = 1/50 (2%)
 Frame = -2

Query  152  LTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVD  3
            L LWL GG  CS   VG F E+GPFRP K   LVKN +SWN  +NMLY++
Sbjct  81   LVLWLNGGPGCSSLGVGAFSENGPFRP-KGPILVKNEHSWNKEANMLYLE  129



>emb|CDY61693.1| BnaC05g51120D [Brassica napus]
Length=456

 Score = 58.9 bits (141),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 29/50 (58%), Positives = 34/50 (68%), Gaps = 1/50 (2%)
 Frame = -2

Query  152  LTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVD  3
            L LWL GG  CS   VG F E+GPFRP K   LVKN +SWN  +NMLY++
Sbjct  74   LVLWLNGGPGCSSLGVGAFSENGPFRP-KGPVLVKNQHSWNQEANMLYLE  122



>gb|KCW52793.1| hypothetical protein EUGRSUZ_J02128 [Eucalyptus grandis]
Length=338

 Score = 58.5 bits (140),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 25/42 (60%), Positives = 30/42 (71%), Gaps = 0/42 (0%)
 Frame = -2

Query  152  LTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNL  27
            LTLWL GG  CS    G F EHGPF+P+ +G L++N YSWNL
Sbjct  68   LTLWLNGGPGCSSLGFGTFMEHGPFKPSDNGSLIRNDYSWNL  109



>gb|AAB80670.1| putative serine carboxypeptidase II [Arabidopsis thaliana]
Length=458

 Score = 58.9 bits (141),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 28/50 (56%), Positives = 34/50 (68%), Gaps = 1/50 (2%)
 Frame = -2

Query  152  LTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVD  3
            L LWL GG  CS   VG F E+GPFRP K   LV+N +SWN  +NMLY++
Sbjct  78   LVLWLNGGPGCSSLGVGAFSENGPFRP-KGSILVRNQHSWNQEANMLYLE  126



>ref|NP_850212.1| serine carboxypeptidase-like 46 [Arabidopsis thaliana]
 sp|Q8VY01.1|SCP46_ARATH RecName: Full=Serine carboxypeptidase-like 46; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAL67013.1| putative serine carboxypeptidase II [Arabidopsis thaliana]
 gb|AEC08849.1| serine carboxypeptidase-like 46 [Arabidopsis thaliana]
Length=465

 Score = 58.9 bits (141),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 28/50 (56%), Positives = 34/50 (68%), Gaps = 1/50 (2%)
 Frame = -2

Query  152  LTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVD  3
            L LWL GG  CS   VG F E+GPFRP K   LV+N +SWN  +NMLY++
Sbjct  78   LVLWLNGGPGCSSLGVGAFSENGPFRP-KGSILVRNQHSWNQEANMLYLE  126



>ref|XP_010055727.1| PREDICTED: serine carboxypeptidase-like 45 [Eucalyptus grandis]
 gb|KCW90014.1| hypothetical protein EUGRSUZ_A02212 [Eucalyptus grandis]
Length=480

 Score = 58.9 bits (141),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 28/50 (56%), Positives = 33/50 (66%), Gaps = 1/50 (2%)
 Frame = -2

Query  152  LTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVD  3
            L LWL GG  CS    G F EHGPF+  K G LVK  YSWN V+N+LY++
Sbjct  74   LVLWLNGGPGCSSLGYGAFIEHGPFK-VKGGGLVKRDYSWNKVANLLYLE  122



>emb|CDO98312.1| unnamed protein product [Coffea canephora]
Length=454

 Score = 58.9 bits (141),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 27/50 (54%), Positives = 34/50 (68%), Gaps = 1/50 (2%)
 Frame = -2

Query  152  LTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVD  3
            L LWL GG  CS   VG F E+GPFRP   G LV+N +SWN  +N+LY++
Sbjct  69   LVLWLNGGPGCSSLGVGAFSENGPFRPNGQG-LVRNEHSWNREANVLYLE  117



>ref|XP_009113703.1| PREDICTED: serine carboxypeptidase-like 45 [Brassica rapa]
 emb|CDY46627.1| BnaA09g27540D [Brassica napus]
Length=454

 Score = 58.9 bits (141),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 29/50 (58%), Positives = 34/50 (68%), Gaps = 1/50 (2%)
 Frame = -2

Query  152  LTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVD  3
            L LWL GG  CS   VG F E+GPFRP K   LVKN +SWN  +NMLY++
Sbjct  72   LVLWLNGGPGCSSLGVGAFSENGPFRP-KGPVLVKNQHSWNQEANMLYLE  120



>ref|XP_006415698.1| hypothetical protein EUTSA_v10007573mg [Eutrema salsugineum]
 gb|ESQ34051.1| hypothetical protein EUTSA_v10007573mg [Eutrema salsugineum]
Length=463

 Score = 58.9 bits (141),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 29/50 (58%), Positives = 34/50 (68%), Gaps = 1/50 (2%)
 Frame = -2

Query  152  LTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVD  3
            L LWL GG  CS   VG F E+GPFRP K   LVKN +SWN  +NMLY++
Sbjct  78   LVLWLNGGPGCSSLGVGAFSENGPFRP-KGPVLVKNQHSWNQEANMLYLE  126



>ref|XP_004136677.1| PREDICTED: serine carboxypeptidase-like 45-like [Cucumis sativus]
 gb|KGN59516.1| hypothetical protein Csa_3G823640 [Cucumis sativus]
Length=479

 Score = 58.9 bits (141),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 28/50 (56%), Positives = 32/50 (64%), Gaps = 1/50 (2%)
 Frame = -2

Query  152  LTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVD  3
            L LWL GG  CS    G F EHGPF+   +  LVKN YSWN  +NMLYV+
Sbjct  80   LVLWLNGGPGCSSVGAGAFIEHGPFKINGE-TLVKNEYSWNTEANMLYVE  128



>ref|XP_009553499.1| serine carboxypeptidase S10 [Heterobasidion irregulare TC 32-1]
 gb|ETW75053.1| serine carboxypeptidase S10 [Heterobasidion irregulare TC 32-1]
Length=486

 Score = 58.9 bits (141),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 27/51 (53%), Positives = 36/51 (71%), Gaps = 2/51 (4%)
 Frame = -2

Query  152  LTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKL-VKNPYSWNLVSNMLYVD  3
             TLWL GG  CS + +G+F E+GP +   DG+  V NPYSWN +SNM+Y+D
Sbjct  95   FTLWLNGGPGCS-SMIGLFQENGPCKILPDGQTTVLNPYSWNSISNMIYID  144



>ref|XP_009143848.1| PREDICTED: serine carboxypeptidase-like 46 [Brassica rapa]
 emb|CDY17183.1| BnaA05g10050D [Brassica napus]
Length=462

 Score = 58.5 bits (140),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 28/50 (56%), Positives = 34/50 (68%), Gaps = 1/50 (2%)
 Frame = -2

Query  152  LTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVD  3
            L LWL GG  CS   VG F E+GPFRP K   LV+N +SWN  +NMLY++
Sbjct  77   LVLWLNGGPGCSSLGVGAFSENGPFRP-KGSVLVRNQHSWNHEANMLYLE  125



>emb|CDY19500.1| BnaC04g10990D [Brassica napus]
Length=463

 Score = 58.5 bits (140),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 28/50 (56%), Positives = 34/50 (68%), Gaps = 1/50 (2%)
 Frame = -2

Query  152  LTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVD  3
            L LWL GG  CS   VG F E+GPFRP K   LV+N +SWN  +NMLY++
Sbjct  78   LVLWLNGGPGCSSLGVGAFSENGPFRP-KGSVLVRNQHSWNHEANMLYLE  126



>ref|XP_004241645.1| PREDICTED: serine carboxypeptidase-like 45 [Solanum lycopersicum]
Length=457

 Score = 58.5 bits (140),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 28/50 (56%), Positives = 34/50 (68%), Gaps = 1/50 (2%)
 Frame = -2

Query  152  LTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVD  3
            L LWL GG  CS   VG F E+GPFRP +   LVKN +SWN  +NMLY++
Sbjct  72   LVLWLNGGPGCSSVGVGAFSENGPFRP-RGQVLVKNEHSWNKEANMLYLE  120



>ref|XP_010929656.1| PREDICTED: serine carboxypeptidase-like 45 [Elaeis guineensis]
Length=463

 Score = 58.5 bits (140),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 27/50 (54%), Positives = 34/50 (68%), Gaps = 1/50 (2%)
 Frame = -2

Query  152  LTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVD  3
            L LWL GG  CS   VG F E+GPFRP+    LV+N +SWN  +NMLY++
Sbjct  78   LVLWLNGGPGCSSVGVGAFSENGPFRPSGQ-VLVRNEFSWNKEANMLYLE  126



>ref|XP_007368976.1| alpha/beta-hydrolase [Dichomitus squalens LYAD-421 SS1]
 gb|EJF58296.1| alpha/beta-hydrolase [Dichomitus squalens LYAD-421 SS1]
Length=488

 Score = 58.5 bits (140),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 27/51 (53%), Positives = 36/51 (71%), Gaps = 2/51 (4%)
 Frame = -2

Query  152  LTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKL-VKNPYSWNLVSNMLYVD  3
             TLWL GG  CS + +G+F EHGP +   DG+  V NPYSWN +SN++Y+D
Sbjct  100  FTLWLNGGPGCS-SMIGLFQEHGPCQVNPDGQTTVLNPYSWNNLSNIIYID  149



>ref|XP_004159625.1| PREDICTED: LOW QUALITY PROTEIN: serine carboxypeptidase-like 
45-like [Cucumis sativus]
Length=479

 Score = 58.5 bits (140),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 28/50 (56%), Positives = 32/50 (64%), Gaps = 1/50 (2%)
 Frame = -2

Query  152  LTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVD  3
            L LWL GG  CS    G F EHGPF+   +  LVKN YSWN  +NMLYV+
Sbjct  80   LVLWLNGGPGCSSVGAGAFIEHGPFKINGE-TLVKNEYSWNTEANMLYVE  128



>gb|KDO83182.1| hypothetical protein CISIN_1g012396mg [Citrus sinensis]
Length=345

 Score = 58.2 bits (139),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 28/51 (55%), Positives = 36/51 (71%), Gaps = 3/51 (6%)
 Frame = -2

Query  152  LTLWLGGGHDCSIATVGMFYEHGPFRPTKDGK-LVKNPYSWNLVSNMLYVD  3
            L LWL GG  CS   VG F E+GPFRP  +G+ LV+N YSWN  +NML+++
Sbjct  78   LVLWLNGGPGCSSLGVGAFSENGPFRP--NGQVLVRNEYSWNREANMLFLE  126



>ref|XP_004235841.1| PREDICTED: serine carboxypeptidase-like 45 isoform X1 [Solanum 
lycopersicum]
Length=455

 Score = 58.5 bits (140),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 28/50 (56%), Positives = 34/50 (68%), Gaps = 1/50 (2%)
 Frame = -2

Query  152  LTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVD  3
            L LWL GG  CS   VG F E+GPFRP  +G LV N +SWN  +NMLY++
Sbjct  70   LVLWLNGGPGCSSLGVGAFSENGPFRPRGEG-LVINEHSWNKEANMLYLE  118



>ref|XP_006304410.1| hypothetical protein CARUB_v10010972mg [Capsella rubella]
 gb|EOA37308.1| hypothetical protein CARUB_v10010972mg [Capsella rubella]
Length=459

 Score = 58.5 bits (140),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 29/50 (58%), Positives = 34/50 (68%), Gaps = 1/50 (2%)
 Frame = -2

Query  152  LTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVD  3
            L LWL GG  CS   VG F E+GPFRP K   LVKN +SWN  +NMLY++
Sbjct  74   LVLWLNGGPGCSSLGVGAFSENGPFRP-KGPVLVKNQHSWNQEANMLYLE  122



>ref|XP_007223033.1| hypothetical protein PRUPE_ppa005360mg [Prunus persica]
 gb|EMJ24232.1| hypothetical protein PRUPE_ppa005360mg [Prunus persica]
Length=465

 Score = 58.5 bits (140),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 27/50 (54%), Positives = 35/50 (70%), Gaps = 1/50 (2%)
 Frame = -2

Query  152  LTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVD  3
            L LWL GG  CS   VG F E+GPFRP+ +  LV+N +SWN  +NMLY++
Sbjct  81   LVLWLNGGPGCSSLGVGAFSENGPFRPSGE-VLVRNEHSWNREANMLYLE  129



>ref|XP_008222370.1| PREDICTED: serine carboxypeptidase-like 45 isoform X1 [Prunus 
mume]
Length=465

 Score = 58.5 bits (140),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 27/50 (54%), Positives = 35/50 (70%), Gaps = 1/50 (2%)
 Frame = -2

Query  152  LTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVD  3
            L LWL GG  CS   VG F E+GPFRP+ +  LV+N +SWN  +NMLY++
Sbjct  81   LVLWLNGGPGCSSLGVGAFSENGPFRPSGE-VLVRNEHSWNREANMLYLE  129



>gb|KHN13827.1| Serine carboxypeptidase-like 45 [Glycine soja]
Length=454

 Score = 58.5 bits (140),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 28/50 (56%), Positives = 35/50 (70%), Gaps = 1/50 (2%)
 Frame = -2

Query  152  LTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVD  3
            L LWL GG  CS   VG F E+GPFRP  +G LV+N +SWN  +NMLY++
Sbjct  76   LVLWLNGGPGCSSLGVGAFSENGPFRPKGEG-LVRNQFSWNKEANMLYLE  124



>ref|XP_008222371.1| PREDICTED: serine carboxypeptidase-like 45 isoform X2 [Prunus 
mume]
Length=464

 Score = 58.5 bits (140),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 27/50 (54%), Positives = 35/50 (70%), Gaps = 1/50 (2%)
 Frame = -2

Query  152  LTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVD  3
            L LWL GG  CS   VG F E+GPFRP+ +  LV+N +SWN  +NMLY++
Sbjct  81   LVLWLNGGPGCSSLGVGAFSENGPFRPSGE-VLVRNEHSWNREANMLYLE  129



>ref|XP_007223032.1| hypothetical protein PRUPE_ppa005360mg [Prunus persica]
 gb|EMJ24231.1| hypothetical protein PRUPE_ppa005360mg [Prunus persica]
Length=464

 Score = 58.5 bits (140),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 27/50 (54%), Positives = 35/50 (70%), Gaps = 1/50 (2%)
 Frame = -2

Query  152  LTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVD  3
            L LWL GG  CS   VG F E+GPFRP+ +  LV+N +SWN  +NMLY++
Sbjct  81   LVLWLNGGPGCSSLGVGAFSENGPFRPSGE-VLVRNEHSWNREANMLYLE  129



>ref|XP_008035223.1| serine carboxypeptidase [Trametes versicolor FP-101664 SS1]
 gb|EIW62325.1| serine carboxypeptidase [Trametes versicolor FP-101664 SS1]
Length=489

 Score = 58.5 bits (140),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 30/51 (59%), Positives = 35/51 (69%), Gaps = 2/51 (4%)
 Frame = -2

Query  152  LTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVK-NPYSWNLVSNMLYVD  3
            LT+WL GG   S + +G+F EHGP R T D K V  NP SWN VSNMLY+D
Sbjct  104  LTIWLNGGPGSS-SMIGLFQEHGPCRITNDSKSVNLNPNSWNQVSNMLYID  153



>ref|XP_010318664.1| PREDICTED: serine carboxypeptidase-like 45 isoform X2 [Solanum 
lycopersicum]
Length=424

 Score = 58.5 bits (140),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 28/50 (56%), Positives = 34/50 (68%), Gaps = 1/50 (2%)
 Frame = -2

Query  152  LTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVD  3
            L LWL GG  CS   VG F E+GPFRP  +G LV N +SWN  +NMLY++
Sbjct  70   LVLWLNGGPGCSSLGVGAFSENGPFRPRGEG-LVINEHSWNKEANMLYLE  118



>ref|XP_006495375.1| PREDICTED: serine carboxypeptidase-like 45-like, partial [Citrus 
sinensis]
Length=302

 Score = 57.8 bits (138),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 28/51 (55%), Positives = 36/51 (71%), Gaps = 3/51 (6%)
 Frame = -2

Query  152  LTLWLGGGHDCSIATVGMFYEHGPFRPTKDGK-LVKNPYSWNLVSNMLYVD  3
            L LWL GG  CS   VG F E+GPFRP  +G+ LV+N YSWN  +NML+++
Sbjct  78   LVLWLNGGPGCSSLGVGAFSENGPFRP--NGQVLVRNEYSWNREANMLFLE  126



>ref|XP_009359890.1| PREDICTED: serine carboxypeptidase-like 45 [Pyrus x bretschneideri]
Length=463

 Score = 58.5 bits (140),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 28/50 (56%), Positives = 34/50 (68%), Gaps = 1/50 (2%)
 Frame = -2

Query  152  LTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVD  3
            L LWL GG  CS   VG F E+GPFRP K   LV+N +SWN  +NMLY++
Sbjct  79   LVLWLNGGPGCSSLGVGAFSENGPFRP-KGEVLVRNEHSWNTEANMLYLE  127



>gb|EMD36755.1| hypothetical protein CERSUDRAFT_114672 [Ceriporiopsis subvermispora 
B]
Length=488

 Score = 58.5 bits (140),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 27/51 (53%), Positives = 35/51 (69%), Gaps = 2/51 (4%)
 Frame = -2

Query  152  LTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKL-VKNPYSWNLVSNMLYVD  3
             TLWL GG  CS + +G+F EHGP     DG+  V NP+SWN +SN++YVD
Sbjct  102  FTLWLNGGPGCS-SMIGLFQEHGPCHVNPDGETTVLNPFSWNNISNIIYVD  151



>gb|KDO83183.1| hypothetical protein CISIN_1g012396mg [Citrus sinensis]
Length=311

 Score = 57.8 bits (138),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 28/51 (55%), Positives = 36/51 (71%), Gaps = 3/51 (6%)
 Frame = -2

Query  152  LTLWLGGGHDCSIATVGMFYEHGPFRPTKDGK-LVKNPYSWNLVSNMLYVD  3
            L LWL GG  CS   VG F E+GPFRP  +G+ LV+N YSWN  +NML+++
Sbjct  78   LVLWLNGGPGCSSLGVGAFSENGPFRP--NGQVLVRNEYSWNREANMLFLE  126



>ref|XP_003551804.1| PREDICTED: serine carboxypeptidase-like 45-like [Glycine max]
Length=461

 Score = 58.5 bits (140),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 28/50 (56%), Positives = 35/50 (70%), Gaps = 1/50 (2%)
 Frame = -2

Query  152  LTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVD  3
            L LWL GG  CS   VG F E+GPFRP  +G LV+N +SWN  +NMLY++
Sbjct  76   LVLWLNGGPGCSSLGVGAFSENGPFRPKGEG-LVRNQFSWNKEANMLYLE  124



>ref|XP_009615672.1| PREDICTED: serine carboxypeptidase-like 45 isoform X2 [Nicotiana 
tomentosiformis]
Length=463

 Score = 58.2 bits (139),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 27/50 (54%), Positives = 34/50 (68%), Gaps = 1/50 (2%)
 Frame = -2

Query  152  LTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVD  3
            L LWL GG  CS   VG F E+GPFRP +   LV+N +SWN  +NMLY++
Sbjct  78   LVLWLNGGPGCSSVGVGAFSENGPFRP-RGQVLVRNEHSWNKEANMLYLE  126



>ref|XP_009615670.1| PREDICTED: serine carboxypeptidase-like 45 isoform X1 [Nicotiana 
tomentosiformis]
Length=464

 Score = 58.2 bits (139),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 27/50 (54%), Positives = 34/50 (68%), Gaps = 1/50 (2%)
 Frame = -2

Query  152  LTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVD  3
            L LWL GG  CS   VG F E+GPFRP +   LV+N +SWN  +NMLY++
Sbjct  78   LVLWLNGGPGCSSVGVGAFSENGPFRP-RGQVLVRNEHSWNKEANMLYLE  126



>ref|XP_009378815.1| PREDICTED: serine carboxypeptidase-like 45 [Pyrus x bretschneideri]
Length=462

 Score = 58.2 bits (139),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 28/50 (56%), Positives = 34/50 (68%), Gaps = 1/50 (2%)
 Frame = -2

Query  152  LTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVD  3
            L LWL GG  CS   VG F E+GPFRP K   LV+N +SWN  +NMLY++
Sbjct  79   LVLWLNGGPGCSSLGVGAFSENGPFRP-KGEVLVRNEHSWNREANMLYLE  127



>gb|AAG51475.1|AC069471_6 serine carboxypeptidase II, putative [Arabidopsis thaliana]
Length=456

 Score = 58.2 bits (139),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 29/50 (58%), Positives = 34/50 (68%), Gaps = 1/50 (2%)
 Frame = -2

Query  152  LTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVD  3
            L LWL GG  CS   VG F E+GPFRP K   LVKN +SWN  +NMLY++
Sbjct  76   LVLWLNGGPGCSSLGVGAFSENGPFRP-KGPILVKNQHSWNQEANMLYLE  124



>ref|NP_564298.1| serine carboxypeptidase-like 45 [Arabidopsis thaliana]
 ref|NP_973926.1| serine carboxypeptidase-like 45 [Arabidopsis thaliana]
 sp|Q93Y09.1|SCP45_ARATH RecName: Full=Serine carboxypeptidase-like 45; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAL24336.1| serine carboxypeptidase II, putative [Arabidopsis thaliana]
 gb|AAP49525.1| At1g28110 [Arabidopsis thaliana]
 gb|AEE30918.1| serine carboxypeptidase-like 45 [Arabidopsis thaliana]
 gb|AEE30919.1| serine carboxypeptidase-like 45 [Arabidopsis thaliana]
Length=461

 Score = 58.2 bits (139),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 29/50 (58%), Positives = 34/50 (68%), Gaps = 1/50 (2%)
 Frame = -2

Query  152  LTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVD  3
            L LWL GG  CS   VG F E+GPFRP K   LVKN +SWN  +NMLY++
Sbjct  76   LVLWLNGGPGCSSLGVGAFSENGPFRP-KGPILVKNQHSWNQEANMLYLE  124



>ref|XP_007850141.1| carboxypeptidase s1 [Moniliophthora roreri MCA 2997]
 gb|ESK90545.1| carboxypeptidase s1 [Moniliophthora roreri MCA 2997]
Length=481

 Score = 58.5 bits (140),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 26/51 (51%), Positives = 34/51 (67%), Gaps = 2/51 (4%)
 Frame = -2

Query  152  LTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVK-NPYSWNLVSNMLYVD  3
             TLW+ GG  CS + +G+F EHGP     DGK    NP+SWN +SNM+Y+D
Sbjct  94   FTLWINGGPGCS-SMIGLFEEHGPCTVNPDGKTTTLNPFSWNNISNMIYID  143



>ref|XP_002771519.1| hypothetical protein Pmar_PMAR000572 [Perkinsus marinus ATCC 
50983]
 gb|EER03335.1| hypothetical protein Pmar_PMAR000572 [Perkinsus marinus ATCC 
50983]
Length=377

 Score = 58.2 bits (139),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 27/51 (53%), Positives = 36/51 (71%), Gaps = 2/51 (4%)
 Frame = -2

Query  152  LTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVK-NPYSWNLVSNMLYVD  3
            L LWL GG  CS + +G+F E+GP R  +DG+  K NPYSWN  +N+L+VD
Sbjct  91   LILWLNGGPGCS-SMIGLFLENGPCRLNEDGRGTKLNPYSWNTRANLLFVD  140



>gb|KHN09723.1| Serine carboxypeptidase-like 45 [Glycine soja]
Length=457

 Score = 58.2 bits (139),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 28/50 (56%), Positives = 35/50 (70%), Gaps = 1/50 (2%)
 Frame = -2

Query  152  LTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVD  3
            L LWL GG  CS   VG F E+GPFRP ++  L+KN YSWN  +NMLY++
Sbjct  70   LVLWLNGGPGCSSLGVGAFSENGPFRPNEEF-LIKNDYSWNKEANMLYLE  118



>ref|XP_002893504.1| SCPL45 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH69763.1| SCPL45 [Arabidopsis lyrata subsp. lyrata]
Length=462

 Score = 58.2 bits (139),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 29/50 (58%), Positives = 34/50 (68%), Gaps = 1/50 (2%)
 Frame = -2

Query  152  LTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVD  3
            L LWL GG  CS   VG F E+GPFRP K   LVKN +SWN  +NMLY++
Sbjct  77   LVLWLNGGPGCSSLGVGAFSENGPFRP-KGPILVKNQHSWNQEANMLYLE  125



>ref|XP_010023699.1| PREDICTED: serine carboxypeptidase-like 45 [Eucalyptus grandis]
Length=483

 Score = 58.2 bits (139),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 28/50 (56%), Positives = 32/50 (64%), Gaps = 1/50 (2%)
 Frame = -2

Query  152  LTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVD  3
            L LWL GG  CS    G F EHGPF   K G LVK  YSWN V+N+LY++
Sbjct  74   LVLWLNGGPGCSSLGYGAFIEHGPFE-VKGGGLVKRDYSWNKVANLLYLE  122



>ref|XP_008045018.1| alpha/beta-hydrolase [Trametes versicolor FP-101664 SS1]
 gb|EIW52048.1| alpha/beta-hydrolase [Trametes versicolor FP-101664 SS1]
Length=485

 Score = 58.2 bits (139),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 26/51 (51%), Positives = 36/51 (71%), Gaps = 2/51 (4%)
 Frame = -2

Query  152  LTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKL-VKNPYSWNLVSNMLYVD  3
             TLWL GG  CS + +G+F EHGP +   DG+  V NP+SWN +SN++Y+D
Sbjct  97   FTLWLNGGPGCS-SMIGLFQEHGPCQVEADGQTTVLNPFSWNNISNIIYID  146



>ref|XP_002881286.1| hypothetical protein ARALYDRAFT_482299 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH57545.1| hypothetical protein ARALYDRAFT_482299 [Arabidopsis lyrata subsp. 
lyrata]
Length=456

 Score = 58.2 bits (139),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 28/50 (56%), Positives = 34/50 (68%), Gaps = 1/50 (2%)
 Frame = -2

Query  152  LTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVD  3
            L LWL GG  CS   VG F E+GPFRP K   LV+N +SWN  +NMLY++
Sbjct  69   LVLWLNGGPGCSSLGVGAFSENGPFRP-KGSVLVRNLHSWNQEANMLYLE  117



>ref|XP_003528093.2| PREDICTED: serine carboxypeptidase-like 45-like [Glycine max]
Length=470

 Score = 58.2 bits (139),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 28/50 (56%), Positives = 35/50 (70%), Gaps = 1/50 (2%)
 Frame = -2

Query  152  LTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVD  3
            L LWL GG  CS   VG F E+GPFRP ++  L+KN YSWN  +NMLY++
Sbjct  83   LVLWLNGGPGCSSLGVGAFSENGPFRPNEEF-LIKNDYSWNKEANMLYLE  131



>ref|XP_002280796.2| PREDICTED: serine carboxypeptidase-like 45 [Vitis vinifera]
 emb|CAN81275.1| hypothetical protein VITISV_021177 [Vitis vinifera]
 emb|CBI15743.3| unnamed protein product [Vitis vinifera]
Length=462

 Score = 58.2 bits (139),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 27/50 (54%), Positives = 34/50 (68%), Gaps = 1/50 (2%)
 Frame = -2

Query  152  LTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVD  3
            L LWL GG  CS   VG F E+GPFRP  +  L++N YSWN  +NMLY++
Sbjct  78   LVLWLNGGPGCSSLGVGAFSENGPFRPNGE-FLLRNEYSWNREANMLYLE  126



>emb|CDP11023.1| unnamed protein product [Coffea canephora]
Length=487

 Score = 58.2 bits (139),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 28/51 (55%), Positives = 34/51 (67%), Gaps = 1/51 (2%)
 Frame = -2

Query  152  LTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVK-NPYSWNLVSNMLYVD  3
            L LWL GG  CS    G   E GPFRPT DGK V  NPY+WN V+N+++V+
Sbjct  103  LALWLNGGPACSSIAFGEAEEIGPFRPTADGKSVYLNPYAWNQVANIIFVE  153



>ref|XP_010478165.1| PREDICTED: serine carboxypeptidase-like 45 [Camelina sativa]
Length=491

 Score = 58.2 bits (139),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 29/50 (58%), Positives = 34/50 (68%), Gaps = 1/50 (2%)
 Frame = -2

Query  152  LTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVD  3
            L LWL GG  CS   VG F E+GPFRP K   LVKN +SWN  +NMLY++
Sbjct  106  LVLWLNGGPGCSSLGVGAFSENGPFRP-KGPILVKNHHSWNQEANMLYLE  154



>ref|XP_007028219.1| Serine carboxypeptidase-like 45 [Theobroma cacao]
 gb|EOY08721.1| Serine carboxypeptidase-like 45 [Theobroma cacao]
Length=585

 Score = 58.5 bits (140),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 28/50 (56%), Positives = 33/50 (66%), Gaps = 1/50 (2%)
 Frame = -2

Query  152  LTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVD  3
            L LWL GG   S    G F EHGPFRP+ D  L+KN YSWN  +NMLY++
Sbjct  194  LVLWLNGGPGYSSVGAGAFCEHGPFRPSAD-ILLKNEYSWNKEANMLYLE  242



>ref|XP_008239549.1| PREDICTED: serine carboxypeptidase-like 45 [Prunus mume]
Length=467

 Score = 58.2 bits (139),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 30/51 (59%), Positives = 36/51 (71%), Gaps = 3/51 (6%)
 Frame = -2

Query  152  LTLWLGGGHDCSIATVGMFYEHGPFRPTKDGK-LVKNPYSWNLVSNMLYVD  3
            L LWL GG  CS   VG F E+GPFRP  DG+ LV+N YSWN  +NMLY++
Sbjct  82   LVLWLNGGPGCSSLGVGAFSENGPFRP--DGEVLVRNEYSWNREANMLYLE  130



>ref|XP_008390188.1| PREDICTED: serine carboxypeptidase-like 45 [Malus domestica]
Length=462

 Score = 58.2 bits (139),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 28/50 (56%), Positives = 34/50 (68%), Gaps = 1/50 (2%)
 Frame = -2

Query  152  LTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVD  3
            L LWL GG  CS   VG F E+GPFRP K   LV+N +SWN  +NMLY++
Sbjct  79   LVLWLNGGPGCSSLGVGAFSENGPFRP-KGEVLVRNEHSWNREANMLYLE  127



>ref|XP_006393769.1| hypothetical protein EUTSA_v10011445mg [Eutrema salsugineum]
 gb|ESQ31055.1| hypothetical protein EUTSA_v10011445mg [Eutrema salsugineum]
Length=479

 Score = 58.2 bits (139),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 30/51 (59%), Positives = 34/51 (67%), Gaps = 1/51 (2%)
 Frame = -2

Query  152  LTLWLGGGHDCSIATVGMFYEHGPFRPTKDGK-LVKNPYSWNLVSNMLYVD  3
            LTLWL GG  CS    G F E GPF PT DG+ L +NP SWN  SN+L+VD
Sbjct  82   LTLWLNGGPGCSSIGGGAFTELGPFYPTGDGRGLRRNPKSWNKASNLLFVD  132



>ref|XP_006438864.1| hypothetical protein CICLE_v10031451mg [Citrus clementina]
 gb|ESR52104.1| hypothetical protein CICLE_v10031451mg [Citrus clementina]
Length=464

 Score = 57.8 bits (138),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 28/51 (55%), Positives = 36/51 (71%), Gaps = 3/51 (6%)
 Frame = -2

Query  152  LTLWLGGGHDCSIATVGMFYEHGPFRPTKDGK-LVKNPYSWNLVSNMLYVD  3
            L LWL GG  CS   VG F E+GPFRP  +G+ LV+N YSWN  +NML+++
Sbjct  78   LVLWLNGGPGCSSLGVGAFSENGPFRP--NGQVLVRNEYSWNREANMLFLE  126



>ref|XP_007719156.1| carboxypeptidase D [Capronia coronata CBS 617.96]
 gb|EXJ94927.1| carboxypeptidase D [Capronia coronata CBS 617.96]
Length=605

 Score = 58.2 bits (139),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 27/50 (54%), Positives = 35/50 (70%), Gaps = 1/50 (2%)
 Frame = -2

Query  152  LTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVD  3
            LT+W+ GG   S + +GMF E GP R T DG  V NPYSW+ VSNM+++D
Sbjct  90   LTIWINGGPGSS-SMIGMFQELGPCRVTADGDAVDNPYSWSSVSNMIFID  138



>ref|XP_001031130.1| Serine carboxypeptidase family protein [Tetrahymena thermophila]
Length=419

 Score = 57.8 bits (138),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 25/50 (50%), Positives = 35/50 (70%), Gaps = 1/50 (2%)
 Frame = -2

Query  152  LTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVD  3
            L LWL GG  CS + +G+F E+GPF+  +D  L  NP+SWN  +N++YVD
Sbjct  63   LVLWLNGGPGCS-SLLGLFEENGPFKINEDATLRSNPFSWNSNANLIYVD  111



>gb|KDO83181.1| hypothetical protein CISIN_1g012396mg [Citrus sinensis]
Length=464

 Score = 57.8 bits (138),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 28/51 (55%), Positives = 36/51 (71%), Gaps = 3/51 (6%)
 Frame = -2

Query  152  LTLWLGGGHDCSIATVGMFYEHGPFRPTKDGK-LVKNPYSWNLVSNMLYVD  3
            L LWL GG  CS   VG F E+GPFRP  +G+ LV+N YSWN  +NML+++
Sbjct  78   LVLWLNGGPGCSSLGVGAFSENGPFRP--NGQVLVRNEYSWNREANMLFLE  126



>ref|XP_006483005.1| PREDICTED: serine carboxypeptidase-like 45-like [Citrus sinensis]
Length=464

 Score = 57.8 bits (138),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 28/51 (55%), Positives = 36/51 (71%), Gaps = 3/51 (6%)
 Frame = -2

Query  152  LTLWLGGGHDCSIATVGMFYEHGPFRPTKDGK-LVKNPYSWNLVSNMLYVD  3
            L LWL GG  CS   VG F E+GPFRP  +G+ LV+N YSWN  +NML+++
Sbjct  78   LVLWLNGGPGCSSLGVGAFSENGPFRP--NGQVLVRNEYSWNREANMLFLE  126



>gb|EAR83467.2| serine carboxypeptidase family protein [Tetrahymena thermophila 
SB210]
Length=412

 Score = 57.8 bits (138),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 25/50 (50%), Positives = 35/50 (70%), Gaps = 1/50 (2%)
 Frame = -2

Query  152  LTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVD  3
            L LWL GG  CS + +G+F E+GPF+  +D  L  NP+SWN  +N++YVD
Sbjct  56   LVLWLNGGPGCS-SLLGLFEENGPFKINEDATLRSNPFSWNSNANLIYVD  104



>ref|XP_002511104.1| serine carboxypeptidase, putative [Ricinus communis]
 gb|EEF51706.1| serine carboxypeptidase, putative [Ricinus communis]
Length=460

 Score = 57.8 bits (138),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 29/50 (58%), Positives = 34/50 (68%), Gaps = 1/50 (2%)
 Frame = -2

Query  152  LTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVD  3
            L LWL GG  CS   VG F E+GPFRP K   LV+N YSWN  +NMLY++
Sbjct  75   LVLWLNGGPGCSSLGVGAFSENGPFRP-KGKVLVRNEYSWNKEANMLYLE  123



>ref|XP_009355272.1| PREDICTED: serine carboxypeptidase-like 45 isoform X3 [Pyrus 
x bretschneideri]
Length=461

 Score = 57.8 bits (138),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 26/50 (52%), Positives = 35/50 (70%), Gaps = 1/50 (2%)
 Frame = -2

Query  152  LTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVD  3
            L LWL GG  CS   VG F E+GPF+P+ D  L+KN +SWN  +N+LY++
Sbjct  79   LVLWLNGGPGCSSVGVGAFNENGPFQPSGD-ILLKNDFSWNREANILYLE  127



>emb|CEI85808.1| hypothetical protein RMCBS344292_00259 [Rhizopus microsporus]
Length=467

 Score = 57.8 bits (138),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 26/50 (52%), Positives = 36/50 (72%), Gaps = 1/50 (2%)
 Frame = -2

Query  152  LTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVD  3
            LT+WL GG  CS + +G++ E+GP R + DG +  NP+SW L SNMLY+D
Sbjct  101  LTVWLNGGPGCS-SMIGLWQENGPCRASTDGSIEFNPHSWTLHSNMLYLD  149



>emb|CEG69308.1| hypothetical protein RMATCC62417_05406 [Rhizopus microsporus]
Length=467

 Score = 57.8 bits (138),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 26/50 (52%), Positives = 36/50 (72%), Gaps = 1/50 (2%)
 Frame = -2

Query  152  LTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVD  3
            LT+WL GG  CS + +G++ E+GP R + DG +  NP+SW L SNMLY+D
Sbjct  101  LTVWLNGGPGCS-SMIGLWQENGPCRASTDGSIEFNPHSWTLHSNMLYLD  149



>ref|XP_006477516.1| PREDICTED: serine carboxypeptidase-like 45-like [Citrus sinensis]
Length=293

 Score = 57.0 bits (136),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 27/50 (54%), Positives = 33/50 (66%), Gaps = 1/50 (2%)
 Frame = -2

Query  152  LTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVD  3
            L LWL GG  CS   VG F E+GPFRP     LV+N YSWN  +NML+++
Sbjct  60   LVLWLNGGPGCSSLGVGAFSENGPFRPNGQ-VLVRNEYSWNREANMLFLE  108



>ref|XP_001586512.1| hypothetical protein SS1G_12499 [Sclerotinia sclerotiorum 1980]
 gb|EDN97645.1| hypothetical protein SS1G_12499 [Sclerotinia sclerotiorum 1980 
UF-70]
Length=587

 Score = 58.2 bits (139),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 27/50 (54%), Positives = 35/50 (70%), Gaps = 1/50 (2%)
 Frame = -2

Query  152  LTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVD  3
            LT+W+ GG   S + +G+F E+GP     DG +V NPYSWN VSNMLY+D
Sbjct  87   LTVWINGGPGAS-SMIGLFEENGPCYIDVDGNVVNNPYSWNNVSNMLYID  135



>gb|EAR83465.2| serine carboxypeptidase family protein [Tetrahymena thermophila 
SB210]
Length=460

 Score = 57.8 bits (138),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 25/50 (50%), Positives = 34/50 (68%), Gaps = 1/50 (2%)
 Frame = -2

Query  152  LTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVD  3
            L LWL GG  CS + +G+F E+GP++   D  L  NP+SWN  +N+LYVD
Sbjct  94   LVLWLNGGPGCS-SLLGLFEENGPYKINNDSTLRSNPFSWNSNANLLYVD  142



>ref|XP_003531913.1| PREDICTED: serine carboxypeptidase-like 45-like isoform X1 [Glycine 
max]
Length=461

 Score = 57.8 bits (138),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 28/50 (56%), Positives = 34/50 (68%), Gaps = 1/50 (2%)
 Frame = -2

Query  152  LTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVD  3
            L LWL GG  CS   VG F E+GPFRP   G LV+N +SWN  +NMLY++
Sbjct  76   LVLWLNGGPGCSSLGVGAFSENGPFRPKGKG-LVRNQFSWNREANMLYLE  124



>ref|XP_008670742.1| PREDICTED: serine carboxypeptidase-like 45 [Zea mays]
 tpg|DAA42025.1| TPA: serine carboxypeptidase 1 [Zea mays]
Length=479

 Score = 57.8 bits (138),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 27/50 (54%), Positives = 34/50 (68%), Gaps = 1/50 (2%)
 Frame = -2

Query  152  LTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVD  3
            L LWL GG  CS   VG F E+GPFRP+    LVKN YSWN  +N++Y++
Sbjct  90   LVLWLNGGPGCSSLGVGAFSENGPFRPSGQ-VLVKNEYSWNKEANVIYLE  138



>ref|XP_009355270.1| PREDICTED: serine carboxypeptidase-like 45 isoform X1 [Pyrus 
x bretschneideri]
Length=480

 Score = 57.8 bits (138),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 26/50 (52%), Positives = 35/50 (70%), Gaps = 1/50 (2%)
 Frame = -2

Query  152  LTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVD  3
            L LWL GG  CS   VG F E+GPF+P+ D  L+KN +SWN  +N+LY++
Sbjct  79   LVLWLNGGPGCSSVGVGAFNENGPFQPSGD-ILLKNDFSWNREANILYLE  127



>ref|XP_009355271.1| PREDICTED: serine carboxypeptidase-like 45 isoform X2 [Pyrus 
x bretschneideri]
Length=478

 Score = 57.8 bits (138),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 26/50 (52%), Positives = 35/50 (70%), Gaps = 1/50 (2%)
 Frame = -2

Query  152  LTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVD  3
            L LWL GG  CS   VG F E+GPF+P+ D  L+KN +SWN  +N+LY++
Sbjct  77   LVLWLNGGPGCSSVGVGAFNENGPFQPSGD-ILLKNDFSWNREANILYLE  125



>gb|KHG09716.1| Serine carboxypeptidase-like 45 [Gossypium arboreum]
Length=462

 Score = 57.8 bits (138),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 29/50 (58%), Positives = 34/50 (68%), Gaps = 1/50 (2%)
 Frame = -2

Query  152  LTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVD  3
            L LWL GG  CS   VG F E+GPFRP  +  LVKN YSWN  +NMLY++
Sbjct  77   LVLWLNGGPGCSSLGVGAFSENGPFRPNGEF-LVKNDYSWNREANMLYLE  125



>ref|XP_007159978.1| hypothetical protein PHAVU_002G282700g [Phaseolus vulgaris]
 gb|ESW31972.1| hypothetical protein PHAVU_002G282700g [Phaseolus vulgaris]
Length=468

 Score = 57.8 bits (138),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 28/50 (56%), Positives = 34/50 (68%), Gaps = 1/50 (2%)
 Frame = -2

Query  152  LTLWLGGGHDCSIATVGMFYEHGPFRPTKDGKLVKNPYSWNLVSNMLYVD  3
            L LWL GG  CS   VG F E+GPFRP  +  L+KN YSWN  +NMLY++
Sbjct  79   LVLWLNGGPGCSSLGVGAFSENGPFRPNGE-VLIKNEYSWNRETNMLYLE  127



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 522492721668