BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c6216_g1_i2 len=1447 path=[1425:0-707 2133:708-1446]

Length=1447
                                                                      Score     E

gb|KDP25216.1|  hypothetical protein JCGZ_20372                         206   3e-56   
ref|XP_002317060.1|  hypothetical protein POPTR_0011s15650g             206   1e-55   Populus trichocarpa [western balsam poplar]
ref|XP_002518922.1|  conserved hypothetical protein                     204   3e-55   Ricinus communis
ref|XP_011040588.1|  PREDICTED: protein IQ-DOMAIN 1-like                201   5e-54   
ref|XP_007051443.1|  IQ-domain 17 isoform 2                             199   2e-53   
ref|XP_007051442.1|  IQ-domain 17 isoform 1                             199   2e-53   
ref|XP_010267407.1|  PREDICTED: protein IQ-DOMAIN 1                     199   3e-53   
ref|XP_010053062.1|  PREDICTED: protein IQ-DOMAIN 1-like                197   1e-52   
ref|XP_009782146.1|  PREDICTED: protein IQ-DOMAIN 1-like                191   1e-50   
ref|XP_009625633.1|  PREDICTED: protein IQ-DOMAIN 1-like                190   2e-50   
ref|XP_009606338.1|  PREDICTED: protein IQ-DOMAIN 1                     190   4e-50   
ref|XP_010918300.1|  PREDICTED: protein IQ-DOMAIN 1-like                189   7e-50   
ref|XP_008776838.1|  PREDICTED: protein IQ-DOMAIN 1-like                189   8e-50   
gb|KHG22817.1|  Protein IQ-DOMAIN 14 -like protein                      188   2e-49   
ref|XP_011013401.1|  PREDICTED: protein IQ-DOMAIN 1-like                188   3e-49   
ref|XP_011041076.1|  PREDICTED: protein IQ-DOMAIN 1-like                188   3e-49   
emb|CBI34598.3|  unnamed protein product                                186   3e-49   
emb|CAN76669.1|  hypothetical protein VITISV_042862                     187   4e-49   Vitis vinifera
ref|XP_002300498.2|  hypothetical protein POPTR_0001s45220g             187   7e-49   Populus trichocarpa [western balsam poplar]
ref|XP_007210753.1|  hypothetical protein PRUPE_ppa021141mg             186   7e-49   
ref|XP_010660165.1|  PREDICTED: protein IQ-DOMAIN 1-like                186   7e-49   
ref|XP_009767106.1|  PREDICTED: protein IQ-DOMAIN 1                     185   3e-48   
ref|XP_002265121.1|  PREDICTED: protein IQ-DOMAIN 1                     185   3e-48   Vitis vinifera
ref|XP_009400087.1|  PREDICTED: protein IQ-DOMAIN 14-like               184   3e-48   
ref|XP_006343775.1|  PREDICTED: protein IQ-DOMAIN 14-like               184   4e-48   
ref|XP_002875013.1|  IQ-domain 17                                       182   2e-47   
ref|XP_008239264.1|  PREDICTED: protein IQ-DOMAIN 1-like                181   4e-47   
gb|EYU26081.1|  hypothetical protein MIMGU_mgv1a022919mg                174   7e-47   
gb|KHG21404.1|  Protein IQ-DOMAIN 14 -like protein                      180   9e-47   
ref|XP_009387679.1|  PREDICTED: protein IQ-DOMAIN 1-like                180   1e-46   
ref|XP_002302670.2|  hypothetical protein POPTR_0002s17930g             180   2e-46   Populus trichocarpa [western balsam poplar]
ref|XP_002529980.1|  calmodulin binding protein, putative               180   2e-46   Ricinus communis
ref|XP_004245451.1|  PREDICTED: protein IQ-DOMAIN 1-like                179   2e-46   
ref|XP_008799003.1|  PREDICTED: protein IQ-DOMAIN 1-like isoform X2     180   2e-46   
gb|KFK42501.1|  hypothetical protein AALP_AA1G001700                    179   3e-46   
ref|XP_002320895.2|  hypothetical protein POPTR_0014s10040g             179   4e-46   Populus trichocarpa [western balsam poplar]
ref|XP_011039187.1|  PREDICTED: protein IQ-DOMAIN 1 isoform X4          179   6e-46   
ref|XP_011039178.1|  PREDICTED: protein IQ-DOMAIN 1 isoform X3          178   7e-46   
dbj|BAF00832.1|  hypothetical protein                                   178   8e-46   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011039172.1|  PREDICTED: protein IQ-DOMAIN 1 isoform X2          178   8e-46   
ref|XP_011039163.1|  PREDICTED: protein IQ-DOMAIN 1 isoform X1          178   1e-45   
ref|XP_010676919.1|  PREDICTED: protein IQ-DOMAIN 1-like                176   1e-45   
ref|XP_004514932.1|  PREDICTED: protein IQ-DOMAIN 1-like                177   1e-45   
ref|XP_010906058.1|  PREDICTED: protein IQ-DOMAIN 1-like                177   2e-45   
ref|NP_567191.2|  protein IQ-domain 17                                  176   3e-45   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006287463.1|  hypothetical protein CARUB_v10000672mg             176   3e-45   
emb|CDP08623.1|  unnamed protein product                                175   8e-45   
ref|XP_010456163.1|  PREDICTED: protein IQ-DOMAIN 1-like                175   8e-45   
ref|XP_008799002.1|  PREDICTED: protein IQ-DOMAIN 1-like isoform X1     175   9e-45   
ref|XP_004309573.1|  PREDICTED: protein IQ-DOMAIN 14-like               174   1e-44   
gb|KFK30665.1|  hypothetical protein AALP_AA6G011900                    174   2e-44   
emb|CDX91859.1|  BnaC03g31610D                                          174   2e-44   
ref|XP_010428170.1|  PREDICTED: protein IQ-DOMAIN 1-like                173   4e-44   
ref|XP_011025382.1|  PREDICTED: protein IQ-DOMAIN 1                     173   4e-44   
ref|XP_008392637.1|  PREDICTED: protein IQ-DOMAIN 1-like                172   6e-44   
ref|XP_002892087.1|  T25K16.10                                          172   1e-43   
ref|XP_008374127.1|  PREDICTED: protein IQ-DOMAIN 1-like                171   2e-43   
ref|XP_009134490.1|  PREDICTED: protein IQ-DOMAIN 1                     170   4e-43   
emb|CDX90011.1|  BnaA10g00710D                                          169   7e-43   
ref|XP_010457172.1|  PREDICTED: protein IQ-DOMAIN 1-like                169   7e-43   
ref|XP_008459750.1|  PREDICTED: protein IQ-DOMAIN 1 isoform X2          169   1e-42   
ref|XP_004306620.1|  PREDICTED: protein IQ-DOMAIN 14-like               169   1e-42   
ref|XP_010480654.1|  PREDICTED: protein IQ-DOMAIN 1-like                168   2e-42   
ref|XP_008459749.1|  PREDICTED: protein IQ-DOMAIN 1 isoform X1          168   2e-42   
emb|CDY69140.1|  BnaAnng29450D                                          167   5e-42   
emb|CDY15200.1|  BnaC05g00790D                                          166   7e-42   
ref|XP_010474698.1|  PREDICTED: protein IQ-DOMAIN 1-like                166   7e-42   
gb|KGN46538.1|  hypothetical protein Csa_6G107880                       166   1e-41   
ref|XP_010940851.1|  PREDICTED: protein IQ-DOMAIN 14-like               166   1e-41   
ref|XP_007039369.1|  Iq-domain 1                                        165   3e-41   
gb|KDP47069.1|  hypothetical protein JCGZ_05096                         159   2e-39   
ref|XP_007039184.1|  IQ-domain 17, putative                             159   2e-39   
ref|XP_002444923.1|  hypothetical protein SORBIDRAFT_07g001510          159   6e-39   Sorghum bicolor [broomcorn]
ref|XP_004248424.1|  PREDICTED: protein IQ-DOMAIN 14-like               155   1e-38   
ref|XP_009412450.1|  PREDICTED: protein IQ-DOMAIN 14-like               157   2e-38   
ref|XP_010436842.1|  PREDICTED: protein IQ-DOMAIN 14-like               153   9e-38   
ref|XP_009366611.1|  PREDICTED: protein IQ-DOMAIN 1 isoform X2          154   1e-37   
ref|XP_006444739.1|  hypothetical protein CICLE_v10019596mg             154   2e-37   
ref|XP_006491358.1|  PREDICTED: protein IQ-DOMAIN 1-like                154   3e-37   
ref|XP_007135309.1|  hypothetical protein PHAVU_010G118500g             153   3e-37   
ref|XP_002317809.2|  hypothetical protein POPTR_0012s02940g             153   3e-37   Populus trichocarpa [western balsam poplar]
ref|XP_002525813.1|  conserved hypothetical protein                     153   4e-37   Ricinus communis
ref|XP_003571316.1|  PREDICTED: protein IQ-DOMAIN 14                    152   7e-37   
ref|XP_006439210.1|  hypothetical protein CICLE_v10019978mg             150   2e-36   
ref|XP_008777584.1|  PREDICTED: protein IQ-DOMAIN 1-like                150   2e-36   
ref|XP_006439211.1|  hypothetical protein CICLE_v10019978mg             150   2e-36   
ref|XP_010455460.1|  PREDICTED: protein IQ-DOMAIN 14-like               149   2e-36   
ref|XP_009366610.1|  PREDICTED: protein IQ-DOMAIN 1 isoform X1          149   5e-36   
gb|KHG01628.1|  Protein IQ-DOMAIN 1 -like protein                       149   5e-36   
ref|XP_010538858.1|  PREDICTED: protein IQ-DOMAIN 14                    148   6e-36   
emb|CDY05111.1|  BnaC03g29090D                                          148   6e-36   
ref|XP_008437775.1|  PREDICTED: protein IQ-DOMAIN 1                     148   9e-36   
ref|XP_008233057.1|  PREDICTED: protein IQ-DOMAIN 1 isoform X2          149   1e-35   
gb|KEH18583.1|  IQ calmodulin-binding motif protein                     148   1e-35   
ref|XP_008350526.1|  PREDICTED: protein IQ-DOMAIN 1-like isoform X2     148   2e-35   
ref|XP_004155200.1|  PREDICTED: protein IQ-DOMAIN 14-like               147   2e-35   
ref|XP_010690237.1|  PREDICTED: protein IQ-DOMAIN 1                     148   2e-35   
ref|XP_010421989.1|  PREDICTED: protein IQ-DOMAIN 1-like                146   3e-35   
ref|XP_010100661.1|  Protein IQ-DOMAIN 14                               147   4e-35   
ref|XP_011043708.1|  PREDICTED: protein IQ-DOMAIN 14-like isoform X2    146   5e-35   
ref|XP_011043707.1|  PREDICTED: protein IQ-DOMAIN 1-like isoform X1     146   6e-35   
emb|CBI23074.3|  unnamed protein product                                145   8e-35   
gb|KDP28424.1|  hypothetical protein JCGZ_14195                         145   1e-34   
ref|NP_192802.2|  protein IQ-domain 16                                  144   1e-34   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004134281.1|  PREDICTED: protein IQ-DOMAIN 14-like               144   1e-34   
ref|XP_006307205.1|  hypothetical protein CARUB_v10008796mg             145   2e-34   
ref|XP_006477504.1|  PREDICTED: protein IQ-DOMAIN 1-like                145   2e-34   
ref|XP_006418384.1|  hypothetical protein EUTSA_v10007299mg             144   3e-34   
ref|XP_008233056.1|  PREDICTED: protein IQ-DOMAIN 1 isoform X1          144   4e-34   
ref|XP_009361348.1|  PREDICTED: protein IQ-DOMAIN 14-like               144   4e-34   
ref|XP_007218997.1|  hypothetical protein PRUPE_ppa004080mg             144   4e-34   
ref|XP_008350469.1|  PREDICTED: protein IQ-DOMAIN 1-like isoform X1     144   5e-34   
gb|KHN06356.1|  Protein IQ-DOMAIN 14                                    143   6e-34   
gb|KHN15893.1|  Protein IQ-DOMAIN 14                                    143   6e-34   
ref|XP_009119671.1|  PREDICTED: protein IQ-DOMAIN 1                     143   8e-34   
ref|XP_006289081.1|  hypothetical protein CARUB_v10002487mg             141   1e-33   
emb|CAB40030.1|  putative protein                                       140   2e-33   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009134201.1|  PREDICTED: protein IQ-DOMAIN 14 isoform X1         140   2e-33   
emb|CDX90766.1|  BnaA03g24460D                                          140   3e-33   
ref|XP_003548183.1|  PREDICTED: protein IQ-DOMAIN 1-like                140   5e-33   
ref|XP_003529877.1|  PREDICTED: protein IQ-DOMAIN 14-like               140   7e-33   
ref|XP_009134202.1|  PREDICTED: protein IQ-DOMAIN 14 isoform X2         139   9e-33   
ref|NP_001117204.1|  protein IQ-domain 18                               140   1e-32   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006396335.1|  hypothetical protein EUTSA_v10028557mg             139   1e-32   
ref|XP_006846576.1|  hypothetical protein AMTR_s00018p00247260          139   1e-32   
ref|XP_004973025.1|  PREDICTED: protein IQ-DOMAIN 14-like               139   2e-32   
ref|XP_010662925.1|  PREDICTED: protein IQ-DOMAIN 14                    136   9e-32   
ref|XP_006397026.1|  hypothetical protein EUTSA_v10028683mg             135   2e-31   
gb|EMT06896.1|  hypothetical protein F775_20753                         130   1e-30   
dbj|BAJ90163.1|  predicted protein                                      133   2e-30   
ref|NP_001060851.1|  Os08g0115200                                       132   4e-30   Oryza sativa Japonica Group [Japonica rice]
ref|XP_011044722.1|  PREDICTED: protein IQ-DOMAIN 14-like isoform X1    130   2e-29   
ref|XP_011012588.1|  PREDICTED: protein IQ-DOMAIN 14-like isoform X1    129   3e-29   
ref|XP_010100212.1|  Protein IQ-DOMAIN 14                               129   5e-29   
ref|XP_008376803.1|  PREDICTED: protein IQ-DOMAIN 14-like               129   5e-29   
ref|XP_008343811.1|  PREDICTED: protein IQ-DOMAIN 14-like               129   5e-29   
ref|XP_002872530.1|  IQ-domain 16                                       127   8e-29   
ref|XP_007221164.1|  hypothetical protein PRUPE_ppa020552mg             128   9e-29   
ref|XP_006374090.1|  hypothetical protein POPTR_0015s00830g             125   5e-28   
ref|XP_008234658.1|  PREDICTED: protein IQ-DOMAIN 14-like               126   5e-28   
ref|XP_004309097.1|  PREDICTED: protein IQ-DOMAIN 14-like               119   1e-25   
ref|XP_010091181.1|  Protein IQ-DOMAIN 14                               119   2e-25   
ref|XP_006362642.1|  PREDICTED: uncharacterized protein LOC102594740    119   3e-25   
gb|EMS51069.1|  Protein IQ-DOMAIN 14                                    112   1e-23   
ref|XP_010424510.1|  PREDICTED: protein IQ-DOMAIN 1-like                109   1e-23   
ref|XP_010327634.1|  PREDICTED: protein IQ-DOMAIN 14-like               112   2e-23   
ref|XP_010424511.1|  PREDICTED: protein IQ-DOMAIN 1-like                108   1e-22   
ref|XP_011075903.1|  PREDICTED: protein IQ-DOMAIN 14                    109   3e-22   
ref|XP_008677708.1|  PREDICTED: uncharacterized protein LOC100501...    107   1e-21   
ref|XP_009620735.1|  PREDICTED: protein IQ-DOMAIN 14-like               107   1e-21   
gb|KDO83248.1|  hypothetical protein CISIN_1g012650mg                   106   1e-21   
gb|KDO83249.1|  hypothetical protein CISIN_1g012650mg                   106   2e-21   
ref|XP_010556621.1|  PREDICTED: LOW QUALITY PROTEIN: protein IQ-D...    103   4e-21   
ref|XP_006482962.1|  PREDICTED: protein IQ-DOMAIN 14-like isoform X2    105   5e-21   
ref|XP_006438908.1|  hypothetical protein CICLE_v10031481mg             104   6e-21   
ref|XP_006482963.1|  PREDICTED: protein IQ-DOMAIN 14-like isoform X3    104   6e-21   
ref|XP_006482964.1|  PREDICTED: protein IQ-DOMAIN 14-like isoform X4    104   6e-21   
ref|XP_006482961.1|  PREDICTED: protein IQ-DOMAIN 14-like isoform X1    104   6e-21   
ref|XP_009388573.1|  PREDICTED: protein IQ-DOMAIN 1-like isoform X2     103   2e-20   
ref|XP_010068813.1|  PREDICTED: protein IQ-DOMAIN 14-like               103   2e-20   
gb|KCW89090.1|  hypothetical protein EUGRSUZ_A01417                     102   2e-20   
ref|XP_009388572.1|  PREDICTED: protein IQ-DOMAIN 1-like isoform X1     102   4e-20   
ref|XP_009105930.1|  PREDICTED: protein IQ-DOMAIN 1 isoform X2          100   1e-19   
ref|XP_011019421.1|  PREDICTED: protein IQ-DOMAIN 1                     100   1e-19   
ref|XP_006382010.1|  hypothetical protein POPTR_0006s24310g             100   1e-19   
ref|XP_002308551.2|  calmodulin-binding family protein                  100   2e-19   Populus trichocarpa [western balsam poplar]
ref|XP_010097046.1|  Protein IQ-DOMAIN 1                                100   3e-19   
ref|XP_009403429.1|  PREDICTED: protein IQ-DOMAIN 1-like isoform X1   99.8    3e-19   
ref|XP_002513117.1|  conserved hypothetical protein                     100   4e-19   Ricinus communis
ref|XP_006374089.1|  hypothetical protein POPTR_0015s00830g           98.2    4e-19   
gb|KHG27723.1|  Protein IQ-DOMAIN 31 -like protein                    99.0    4e-19   
ref|XP_004303073.1|  PREDICTED: protein IQ-DOMAIN 14-like             99.0    6e-19   
ref|XP_009352096.1|  PREDICTED: protein IQ-DOMAIN 14                  95.5    6e-19   
ref|XP_007012312.1|  IQ-domain 6                                      99.0    7e-19   
ref|XP_002455012.1|  hypothetical protein SORBIDRAFT_03g002990        98.2    1e-18   Sorghum bicolor [broomcorn]
ref|XP_003627052.1|  IQ domain-containing protein                     97.8    1e-18   
ref|XP_010416025.1|  PREDICTED: protein IQ-DOMAIN 1-like              97.8    1e-18   
ref|XP_008385579.1|  PREDICTED: protein IQ-DOMAIN 1                   97.8    1e-18   
ref|XP_004968513.1|  PREDICTED: protein IQ-DOMAIN 1-like              97.8    1e-18   
ref|XP_009368414.1|  PREDICTED: protein IQ-DOMAIN 1-like              97.4    1e-18   
ref|XP_009403430.1|  PREDICTED: protein IQ-DOMAIN 1-like isoform X2   94.4    2e-18   
ref|XP_006352630.1|  PREDICTED: protein IQ-DOMAIN 1-like              95.9    2e-18   
ref|XP_004961360.1|  PREDICTED: protein IQ-DOMAIN 1-like              97.1    2e-18   
ref|XP_008793214.1|  PREDICTED: protein IQ-DOMAIN 1-like              97.4    2e-18   
gb|ACN34159.1|  unknown                                               97.1    2e-18   Zea mays [maize]
ref|XP_006372018.1|  hypothetical protein POPTR_0018s07550g           96.7    3e-18   
ref|XP_008672998.1|  PREDICTED: calmodulin binding protein isofor...  97.1    3e-18   
ref|XP_006645595.1|  PREDICTED: protein IQ-DOMAIN 1-like              96.7    3e-18   
ref|NP_001151471.1|  calmodulin binding protein                       96.7    3e-18   Zea mays [maize]
emb|CDX70505.1|  BnaC03g05890D                                        96.7    4e-18   
ref|XP_002976100.1|  hypothetical protein SELMODRAFT_104616           92.4    4e-18   
ref|XP_009105929.1|  PREDICTED: protein IQ-DOMAIN 1 isoform X1        95.9    5e-18   
gb|AAD03435.1|  contains similarity to IQ calmodulin-biding motif...  95.5    5e-18   Arabidopsis thaliana [mouse-ear cress]
dbj|BAJ86943.1|  predicted protein                                    95.9    6e-18   
ref|XP_002968277.1|  hypothetical protein SELMODRAFT_68032            91.7    6e-18   
emb|CDX96427.1|  BnaA07g30380D                                        93.2    6e-18   
ref|XP_002888887.1|  IQ-domain 8                                      95.5    6e-18   
emb|CDX72935.1|  BnaC06g33830D                                        93.2    8e-18   
ref|XP_010925464.1|  PREDICTED: protein IQ-DOMAIN 1-like              95.5    9e-18   
ref|XP_011088163.1|  PREDICTED: protein IQ-DOMAIN 14 isoform X1       95.5    1e-17   
ref|XP_006587682.1|  PREDICTED: protein IQ-DOMAIN 14-like isoform X2  95.5    1e-17   
ref|XP_011088170.1|  PREDICTED: protein IQ-DOMAIN 14 isoform X2       95.1    1e-17   
gb|KHN11724.1|  Protein IQ-DOMAIN 14                                  95.5    1e-17   
ref|XP_003534374.1|  PREDICTED: protein IQ-DOMAIN 14-like isoform X1  95.5    1e-17   
ref|NP_001042285.1|  Os01g0194200                                     95.1    1e-17   Oryza sativa Japonica Group [Japonica rice]
emb|CDX85648.1|  BnaA02g01650D                                        94.4    1e-17   
ref|NP_177411.1|  IQ-domain 8 protein                                 94.7    1e-17   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011005472.1|  PREDICTED: protein IQ-DOMAIN 1-like              94.4    2e-17   
ref|XP_011037796.1|  PREDICTED: protein IQ-DOMAIN 14                  94.7    2e-17   
ref|XP_002970253.1|  hypothetical protein SELMODRAFT_67789            90.1    2e-17   
ref|XP_006300492.1|  hypothetical protein CARUB_v10020371mg           94.0    2e-17   
gb|KFK41689.1|  hypothetical protein AALP_AA2G160100                  94.0    2e-17   
gb|EAY72874.1|  hypothetical protein OsI_00748                        94.4    2e-17   Oryza sativa Indica Group [Indian rice]
gb|EAZ10880.1|  hypothetical protein OsJ_00724                        94.4    2e-17   Oryza sativa Japonica Group [Japonica rice]
emb|CDX78523.1|  BnaA03g04350D                                        94.4    2e-17   
ref|XP_007008759.1|  Iq-domain 14, putative isoform 1                 94.4    2e-17   
ref|XP_009784182.1|  PREDICTED: protein IQ-DOMAIN 1                   94.0    2e-17   
ref|XP_010232214.1|  PREDICTED: protein IQ-DOMAIN 1-like              94.0    2e-17   
gb|KHG03798.1|  Protein IQ-DOMAIN 1 -like protein                     92.8    3e-17   
emb|CDO99100.1|  unnamed protein product                              94.0    4e-17   
ref|XP_010676531.1|  PREDICTED: protein IQ-DOMAIN 14                  94.0    4e-17   
emb|CDM81614.1|  unnamed protein product                              93.2    4e-17   
emb|CBI20646.3|  unnamed protein product                              92.8    4e-17   
ref|NP_001276234.1|  uncharacterized protein LOC100819346             93.2    5e-17   
ref|XP_010526054.1|  PREDICTED: protein IQ-DOMAIN 1-like              93.6    5e-17   
gb|EYU38248.1|  hypothetical protein MIMGU_mgv1a006691mg              93.2    5e-17   
gb|EYU38247.1|  hypothetical protein MIMGU_mgv1a006691mg              93.2    5e-17   
ref|XP_001763354.1|  predicted protein                                91.7    5e-17   
ref|XP_002279054.1|  PREDICTED: protein IQ-DOMAIN 1                   93.2    5e-17   Vitis vinifera
ref|XP_009354407.1|  PREDICTED: protein IQ-DOMAIN 14                  93.2    5e-17   
ref|XP_010428160.1|  PREDICTED: protein IQ-DOMAIN 1-like isoform X2   92.8    6e-17   
ref|XP_009602959.1|  PREDICTED: protein IQ-DOMAIN 1-like              92.8    6e-17   
ref|XP_006390635.1|  hypothetical protein EUTSA_v10018619mg           92.4    6e-17   
ref|XP_009630714.1|  PREDICTED: protein IQ-DOMAIN 14                  93.2    7e-17   
ref|XP_009333751.1|  PREDICTED: protein IQ-DOMAIN 1-like              93.2    7e-17   
ref|XP_003564834.1|  PREDICTED: protein IQ-DOMAIN 1-like              92.8    7e-17   
ref|XP_006287758.1|  hypothetical protein CARUB_v10000971mg           92.8    7e-17   
ref|XP_006368583.1|  calmodulin-binding family protein                92.8    8e-17   
emb|CDP04285.1|  unnamed protein product                              91.3    9e-17   
ref|XP_001772157.1|  predicted protein                                88.2    1e-16   
ref|XP_003540276.1|  PREDICTED: protein IQ-DOMAIN 1 isoformX1         91.7    1e-16   
ref|XP_001783650.1|  predicted protein                                91.7    1e-16   
ref|XP_009758266.1|  PREDICTED: protein IQ-DOMAIN 14-like             92.4    1e-16   
ref|XP_003545385.1|  PREDICTED: protein IQ-DOMAIN 1-like              91.7    1e-16   
ref|XP_006592786.1|  PREDICTED: protein IQ-DOMAIN 1 isoform X2        91.7    1e-16   
ref|XP_001781552.1|  predicted protein                                90.5    2e-16   
gb|EPS73313.1|  hypothetical protein M569_01446                       90.5    2e-16   
emb|CAN83680.1|  hypothetical protein VITISV_003845                   92.4    2e-16   Vitis vinifera
emb|CBI24678.3|  unnamed protein product                              91.3    2e-16   
gb|ACU18259.1|  unknown                                               88.6    2e-16   Glycine max [soybeans]
ref|XP_004982305.1|  PREDICTED: protein IQ-DOMAIN 1-like              90.9    2e-16   
ref|XP_010049014.1|  PREDICTED: protein IQ-DOMAIN 1                   91.3    2e-16   
ref|XP_010045169.1|  PREDICTED: protein IQ-DOMAIN 1-like isoform X2   90.9    3e-16   
ref|XP_003577271.1|  PREDICTED: protein IQ-DOMAIN 1-like isoform X1   90.9    3e-16   
ref|XP_010236999.1|  PREDICTED: protein IQ-DOMAIN 1-like isoform X2   90.9    3e-16   
ref|XP_001753107.1|  predicted protein                                86.7    3e-16   
ref|XP_006399837.1|  hypothetical protein EUTSA_v10013564mg           90.5    4e-16   
ref|XP_010045168.1|  PREDICTED: protein IQ-DOMAIN 1-like isoform X1   90.1    4e-16   
ref|XP_010262062.1|  PREDICTED: protein IQ-DOMAIN 1-like              90.1    5e-16   
gb|EYU45308.1|  hypothetical protein MIMGU_mgv1a006339mg              90.1    5e-16   
ref|XP_006601026.1|  PREDICTED: protein IQ-DOMAIN 1-like isoform X1   90.1    5e-16   
emb|CDY00196.1|  BnaA06g20970D                                        90.1    6e-16   
gb|ABF97898.1|  IQ calmodulin-binding motif family protein, expre...  89.7    6e-16   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003549344.1|  PREDICTED: protein IQ-DOMAIN 1-like              89.4    6e-16   
ref|XP_010515269.1|  PREDICTED: protein IQ-DOMAIN 1-like isoform X1   90.1    7e-16   
ref|XP_010503582.1|  PREDICTED: protein IQ-DOMAIN 1-like isoform X1   89.7    7e-16   
gb|KHG23025.1|  Protein IQ-DOMAIN 14 -like protein                    89.7    7e-16   
ref|XP_006350537.1|  PREDICTED: protein IQ-DOMAIN 1-like isoform X1   89.7    7e-16   
ref|XP_004234970.1|  PREDICTED: protein IQ-DOMAIN 1                   89.7    7e-16   
gb|EPS67207.1|  hypothetical protein M569_07568                       89.7    7e-16   
ref|XP_006291064.1|  hypothetical protein CARUB_v10017180mg           89.7    8e-16   
ref|NP_566917.1|  protein IQ-domain 21                                89.7    8e-16   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001190039.1|  protein IQ-domain 21                             89.7    8e-16   
ref|XP_006587474.1|  PREDICTED: protein IQ-DOMAIN 1-like isoform X1   89.4    9e-16   
gb|AAU89191.2|  expressed protein                                     89.7    9e-16   Oryza sativa Japonica Group [Japonica rice]
emb|CBI30057.3|  unnamed protein product                              89.4    9e-16   
ref|XP_002876133.1|  hypothetical protein ARALYDRAFT_485594           89.4    9e-16   
ref|XP_002875959.1|  IQ-domain 21                                     89.4    1e-15   
ref|XP_010669377.1|  PREDICTED: protein IQ-DOMAIN 1                   89.4    1e-15   
gb|EAY94673.1|  hypothetical protein OsI_16452                        89.4    1e-15   
ref|XP_007222395.1|  hypothetical protein PRUPE_ppa006066mg           89.0    1e-15   
emb|CDY05917.1|  BnaC08g20940D                                        89.4    1e-15   
ref|XP_006404161.1|  hypothetical protein EUTSA_v10010338mg           89.4    1e-15   
ref|XP_006426580.1|  hypothetical protein CICLE_v10027246mg           90.1    1e-15   
ref|XP_009149753.1|  PREDICTED: protein IQ-DOMAIN 14 isoform X2       89.4    1e-15   
ref|XP_010428159.1|  PREDICTED: protein IQ-DOMAIN 1-like isoform X1   88.6    1e-15   
ref|XP_009149751.1|  PREDICTED: protein IQ-DOMAIN 14 isoform X1       89.4    1e-15   
ref|XP_008465774.1|  PREDICTED: protein IQ-DOMAIN 14                  89.0    1e-15   
ref|NP_001050778.2|  Os03g0648300                                     89.4    1e-15   
ref|XP_007136839.1|  hypothetical protein PHAVU_009G078500g           89.0    1e-15   
ref|XP_009398343.1|  PREDICTED: protein IQ-DOMAIN 1-like              89.0    1e-15   
emb|CDY08120.1|  BnaA06g16060D                                        89.0    1e-15   
emb|CDO97895.1|  unnamed protein product                              88.6    2e-15   
ref|XP_008220496.1|  PREDICTED: protein IQ-DOMAIN 1                   88.6    2e-15   
ref|XP_008349279.1|  PREDICTED: protein IQ-DOMAIN 14                  88.6    2e-15   
ref|XP_007028613.1|  IQ-domain 12, putative isoform 1                 88.2    2e-15   
ref|XP_009131341.1|  PREDICTED: protein IQ-DOMAIN 1-like              88.6    2e-15   
emb|CDX86983.1|  BnaC03g52530D                                        88.6    2e-15   
ref|XP_006342967.1|  PREDICTED: protein IQ-DOMAIN 1-like              88.2    2e-15   
ref|XP_004489843.1|  PREDICTED: protein IQ-DOMAIN 1-like              87.8    2e-15   
ref|XP_010426434.1|  PREDICTED: protein IQ-DOMAIN 1-like              88.2    2e-15   
emb|CAB66405.1|  SF16-like protein                                    88.6    2e-15   
gb|EYU39780.1|  hypothetical protein MIMGU_mgv1a006393mg              88.2    3e-15   
ref|XP_010921897.1|  PREDICTED: protein IQ-DOMAIN 1-like              87.8    3e-15   
ref|XP_006340462.1|  PREDICTED: protein IQ-DOMAIN 1-like isoform X2   87.8    3e-15   
ref|XP_004247593.1|  PREDICTED: protein IQ-DOMAIN 14                  87.8    3e-15   
dbj|BAJ92558.1|  predicted protein                                    87.4    4e-15   
dbj|BAJ85087.1|  predicted protein                                    87.4    4e-15   
ref|XP_008229969.1|  PREDICTED: protein IQ-DOMAIN 1                   87.4    4e-15   
ref|XP_007161034.1|  hypothetical protein PHAVU_001G037200g           87.0    4e-15   
ref|XP_006587475.1|  PREDICTED: protein IQ-DOMAIN 1-like isoform X2   86.7    4e-15   
ref|XP_010319836.1|  PREDICTED: protein IQ-DOMAIN 1-like isoform X3   87.4    5e-15   
ref|XP_006826445.1|  hypothetical protein AMTR_s00004p00174140        87.0    5e-15   
ref|XP_008380781.1|  PREDICTED: protein IQ-DOMAIN 1-like              87.4    5e-15   
ref|XP_006421184.1|  hypothetical protein CICLE_v10005065mg           87.0    5e-15   
ref|XP_002464165.1|  hypothetical protein SORBIDRAFT_01g013400        86.7    6e-15   
ref|NP_190797.1|  protein IQ-domain 3                                 86.7    6e-15   
gb|EYU29831.1|  hypothetical protein MIMGU_mgv1a006306mg              87.0    6e-15   
ref|XP_011080039.1|  PREDICTED: protein IQ-DOMAIN 1-like              86.7    6e-15   
ref|XP_003522259.1|  PREDICTED: protein IQ-DOMAIN 1-like              87.0    6e-15   
ref|XP_006340461.1|  PREDICTED: protein IQ-DOMAIN 1-like isoform X1   87.0    6e-15   
ref|XP_006855058.1|  hypothetical protein AMTR_s00031p00107810        84.0    6e-15   
emb|CDX91120.1|  BnaC02g04770D                                        85.9    7e-15   
ref|XP_007205221.1|  hypothetical protein PRUPE_ppa005948mg           86.7    7e-15   
gb|EPS61016.1|  hypothetical protein M569_13785                       85.5    7e-15   
emb|CDP04998.1|  unnamed protein product                              87.0    7e-15   
ref|XP_006466005.1|  PREDICTED: protein IQ-DOMAIN 1-like              86.7    7e-15   
ref|XP_002277151.1|  PREDICTED: protein IQ-DOMAIN 1-like              86.3    7e-15   
ref|XP_002516085.1|  calmodulin binding protein, putative             86.7    8e-15   
ref|XP_004140342.1|  PREDICTED: uncharacterized protein LOC101203390  86.7    8e-15   
ref|XP_010906025.1|  PREDICTED: protein IQ-DOMAIN 1-like              86.3    8e-15   
ref|XP_006403817.1|  hypothetical protein EUTSA_v10010395mg           86.3    9e-15   
ref|XP_010319837.1|  PREDICTED: protein IQ-DOMAIN 1-like isoform X4   86.3    9e-15   
ref|XP_010319835.1|  PREDICTED: protein IQ-DOMAIN 1-like isoform X2   86.3    9e-15   
ref|XP_004237517.1|  PREDICTED: protein IQ-DOMAIN 1-like isoform X1   86.3    1e-14   
ref|XP_002989720.1|  hypothetical protein SELMODRAFT_447811           85.5    1e-14   
ref|XP_003539928.1|  PREDICTED: protein IQ-DOMAIN 14-like             86.3    1e-14   
ref|XP_010685364.1|  PREDICTED: protein IQ-DOMAIN 1-like              85.9    1e-14   
ref|XP_009139471.1|  PREDICTED: protein IQ-DOMAIN 1 isoform X2        86.3    1e-14   
ref|XP_009139470.1|  PREDICTED: protein IQ-DOMAIN 1 isoform X1        86.3    1e-14   
ref|XP_002993679.1|  hypothetical protein SELMODRAFT_449196           85.1    1e-14   
ref|XP_011072537.1|  PREDICTED: protein IQ-DOMAIN 1-like isoform X2   85.9    1e-14   
ref|XP_002464600.1|  hypothetical protein SORBIDRAFT_01g021660        86.3    1e-14   
gb|EMS54162.1|  Protein IQ-DOMAIN 1                                   85.9    1e-14   
gb|EYU41446.1|  hypothetical protein MIMGU_mgv1a006082mg              85.9    1e-14   
ref|XP_008776608.1|  PREDICTED: protein IQ-DOMAIN 1-like              85.9    1e-14   
ref|XP_009149200.1|  PREDICTED: protein IQ-DOMAIN 14 isoform X3       85.1    1e-14   
ref|XP_007151791.1|  hypothetical protein PHAVU_004G075300g           85.9    1e-14   
ref|XP_011072536.1|  PREDICTED: protein IQ-DOMAIN 1-like isoform X1   85.9    1e-14   
ref|XP_006491506.1|  PREDICTED: protein IQ-DOMAIN 14-like isoform X3  85.5    1e-14   
ref|XP_009779445.1|  PREDICTED: protein IQ-DOMAIN 31-like isoform X1  86.3    1e-14   
ref|XP_006664214.1|  PREDICTED: protein IQ-DOMAIN 1-like              85.9    1e-14   
ref|XP_009397417.1|  PREDICTED: protein IQ-DOMAIN 1-like isoform X1   85.5    1e-14   
ref|XP_009779448.1|  PREDICTED: protein IQ-DOMAIN 31-like isoform X2  86.3    1e-14   
gb|KHN19498.1|  Protein IQ-DOMAIN 1                                   84.7    1e-14   
ref|XP_009371968.1|  PREDICTED: protein IQ-DOMAIN 14-like             85.9    1e-14   
ref|XP_004145987.1|  PREDICTED: uncharacterized protein LOC101217049  84.0    2e-14   
gb|EMT30132.1|  hypothetical protein F775_12288                       85.9    2e-14   
ref|XP_006491504.1|  PREDICTED: protein IQ-DOMAIN 14-like isoform X1  85.5    2e-14   
ref|XP_003605985.1|  IQ domain-containing protein                     85.5    2e-14   
ref|XP_006578903.1|  PREDICTED: protein IQ-DOMAIN 1-like isoform X4   85.5    2e-14   
ref|XP_008452736.1|  PREDICTED: protein IQ-DOMAIN 1                   85.5    2e-14   
ref|XP_009629604.1|  PREDICTED: protein IQ-DOMAIN 1                   85.5    2e-14   
ref|XP_006578900.1|  PREDICTED: protein IQ-DOMAIN 1-like isoform X1   85.5    2e-14   
ref|XP_011081675.1|  PREDICTED: protein IQ-DOMAIN 1                   85.5    2e-14   
ref|XP_003605986.1|  IQ domain-containing protein                     85.5    2e-14   
emb|CDY23202.1|  BnaA04g05570D                                        85.5    2e-14   
ref|XP_008649119.1|  PREDICTED: uncharacterized protein LOC100193...  85.1    2e-14   
gb|AES88183.2|  IQ calmodulin-binding motif protein                   85.1    2e-14   
ref|XP_002315282.2|  hypothetical protein POPTR_0010s22510g           85.5    2e-14   
gb|KDO42350.1|  hypothetical protein CISIN_1g015032mg                 85.1    2e-14   
ref|XP_009757400.1|  PREDICTED: protein IQ-DOMAIN 14                  85.5    2e-14   
emb|CDX77034.1|  BnaC04g38290D                                        84.7    2e-14   
tpg|DAA50287.1|  TPA: hypothetical protein ZEAMMB73_674862            85.1    2e-14   
gb|KCW50934.1|  hypothetical protein EUGRSUZ_J00581                   85.1    2e-14   
ref|XP_010049207.1|  PREDICTED: protein IQ-DOMAIN 1                   85.1    2e-14   
ref|XP_002304100.1|  calmodulin-binding family protein                85.1    2e-14   
ref|XP_007143677.1|  hypothetical protein PHAVU_007G092300g           85.5    2e-14   
ref|XP_004141323.1|  PREDICTED: uncharacterized protein LOC101210019  85.1    2e-14   
ref|XP_008799524.1|  PREDICTED: protein IQ-DOMAIN 1                   85.5    2e-14   
ref|XP_006424069.1|  hypothetical protein CICLE_v10028475mg           85.1    2e-14   
ref|XP_009140728.1|  PREDICTED: protein IQ-DOMAIN 1                   84.7    2e-14   
ref|XP_006487845.1|  PREDICTED: protein IQ-DOMAIN 1-like isoform X1   85.1    2e-14   
ref|XP_004305720.1|  PREDICTED: uncharacterized protein LOC101299112  84.7    3e-14   
gb|KDO48967.1|  hypothetical protein CISIN_1g013629mg                 84.7    3e-14   
ref|XP_006408862.1|  hypothetical protein EUTSA_v10001997mg           84.7    3e-14   
ref|XP_006650348.1|  PREDICTED: protein IQ-DOMAIN 1-like isoform X1   84.7    3e-14   
ref|XP_006363480.1|  PREDICTED: protein IQ-DOMAIN 14-like             85.1    3e-14   
ref|XP_006487851.1|  PREDICTED: protein IQ-DOMAIN 1-like isoform X7   84.7    3e-14   
emb|CDY35313.1|  BnaA04g15340D                                        84.3    3e-14   
gb|KGN49861.1|  hypothetical protein Csa_5G139390                     84.0    3e-14   
ref|XP_010426841.1|  PREDICTED: protein IQ-DOMAIN 1-like isoform X1   84.7    3e-14   
ref|XP_010922523.1|  PREDICTED: protein IQ-DOMAIN 1-like isoform X1   85.1    3e-14   
ref|XP_010922528.1|  PREDICTED: protein IQ-DOMAIN 1-like isoform X3   85.1    3e-14   
ref|XP_010922527.1|  PREDICTED: protein IQ-DOMAIN 1-like isoform X2   85.1    3e-14   
ref|XP_010426844.1|  PREDICTED: protein IQ-DOMAIN 1-like isoform X2   84.7    3e-14   
ref|XP_008393622.1|  PREDICTED: protein IQ-DOMAIN 1                   84.7    3e-14   
emb|CDX95328.1|  BnaC04g28300D                                        84.3    4e-14   
ref|XP_006450867.1|  hypothetical protein CICLE_v10008250mg           84.3    4e-14   
ref|XP_009362115.1|  PREDICTED: protein IQ-DOMAIN 1                   84.3    4e-14   
ref|XP_009336410.1|  PREDICTED: protein IQ-DOMAIN 1-like              84.3    4e-14   
gb|KHG20484.1|  Protein IQ-DOMAIN 1 -like protein                     84.0    4e-14   
ref|XP_008437606.1|  PREDICTED: protein IQ-DOMAIN 1-like              83.6    4e-14   
ref|XP_001755683.1|  predicted protein                                80.9    4e-14   
ref|XP_007151793.1|  hypothetical protein PHAVU_004G075300g           84.3    4e-14   
ref|XP_004160378.1|  PREDICTED: protein IQ-DOMAIN 1-like              80.9    4e-14   
ref|XP_008777374.1|  PREDICTED: protein IQ-DOMAIN 14                  84.3    4e-14   
ref|XP_001758831.1|  predicted protein                                84.3    5e-14   
emb|CDY48305.1|  BnaC05g13590D                                        83.6    5e-14   
ref|XP_002513725.1|  calmodulin binding protein, putative             84.0    5e-14   
ref|XP_011009846.1|  PREDICTED: protein IQ-DOMAIN 1                   84.0    5e-14   
ref|XP_010937801.1|  PREDICTED: protein IQ-DOMAIN 1-like              84.3    5e-14   
gb|KDP42966.1|  hypothetical protein JCGZ_23908                       84.0    5e-14   
ref|XP_009782632.1|  PREDICTED: protein IQ-DOMAIN 1                   84.3    5e-14   
ref|XP_009593214.1|  PREDICTED: protein IQ-DOMAIN 31-like isoform X1  84.3    5e-14   
ref|XP_010242248.1|  PREDICTED: protein IQ-DOMAIN 1-like              84.0    5e-14   
ref|XP_009109149.1|  PREDICTED: protein IQ-DOMAIN 1-like isoform X1   83.2    5e-14   
ref|XP_009593218.1|  PREDICTED: protein IQ-DOMAIN 31-like isoform X2  84.3    5e-14   
ref|XP_006833285.1|  hypothetical protein AMTR_s00109p00027450        84.0    5e-14   
ref|XP_008369204.1|  PREDICTED: LOW QUALITY PROTEIN: protein IQ-D...  84.3    6e-14   
gb|EYU20346.1|  hypothetical protein MIMGU_mgv1a006314mg              83.6    7e-14   
ref|XP_010253551.1|  PREDICTED: protein IQ-DOMAIN 1-like              84.0    7e-14   
ref|XP_009150153.1|  PREDICTED: protein IQ-DOMAIN 1-like              83.6    7e-14   
ref|XP_010503967.1|  PREDICTED: protein IQ-DOMAIN 1-like              83.2    8e-14   
gb|KDP34082.1|  hypothetical protein JCGZ_07653                       83.2    8e-14   
ref|XP_006574456.1|  PREDICTED: uncharacterized protein LOC100810...  83.2    8e-14   
gb|KHN00271.1|  Protein IQ-DOMAIN 31                                  83.2    8e-14   
ref|NP_001242711.1|  uncharacterized protein LOC100810189             83.2    8e-14   
ref|XP_010685454.1|  PREDICTED: protein IQ-DOMAIN 1 isoform X1        83.2    8e-14   
ref|XP_002312547.2|  calmodulin-binding family protein                83.2    8e-14   
ref|XP_011026998.1|  PREDICTED: protein IQ-DOMAIN 1                   83.6    9e-14   
ref|XP_008357282.1|  PREDICTED: protein IQ-DOMAIN 1-like              83.2    9e-14   
emb|CDP08282.1|  unnamed protein product                              83.2    9e-14   
ref|XP_010685457.1|  PREDICTED: protein IQ-DOMAIN 1 isoform X2        83.2    9e-14   
ref|XP_010429636.1|  PREDICTED: protein IQ-DOMAIN 14-like             83.2    9e-14   
ref|XP_006857873.1|  hypothetical protein AMTR_s00069p00100460        83.2    9e-14   
ref|XP_002880762.1|  IQ-domain 6                                      83.2    9e-14   
ref|XP_010527048.1|  PREDICTED: protein IQ-DOMAIN 1                   83.2    9e-14   
ref|XP_002871568.1|  IQ-domain 11                                     83.2    1e-13   
ref|XP_011075970.1|  PREDICTED: protein IQ-DOMAIN 1                   83.2    1e-13   
ref|XP_010472643.1|  PREDICTED: protein IQ-DOMAIN 14-like             82.8    1e-13   
ref|XP_010417398.1|  PREDICTED: protein IQ-DOMAIN 14-like             82.8    1e-13   
ref|XP_011091033.1|  PREDICTED: protein IQ-DOMAIN 14-like             82.8    1e-13   
ref|XP_004236386.1|  PREDICTED: protein IQ-DOMAIN 1-like              83.2    1e-13   
gb|KDP29080.1|  hypothetical protein JCGZ_16469                       83.2    1e-13   
ref|XP_011026994.1|  PREDICTED: protein IQ-DOMAIN 14-like isoform X2  83.2    1e-13   
ref|XP_004292798.1|  PREDICTED: uncharacterized protein LOC101308841  83.2    1e-13   
ref|XP_008775919.1|  PREDICTED: protein IQ-DOMAIN 1-like              82.8    1e-13   
dbj|BAK04625.1|  predicted protein                                    83.2    1e-13   
ref|XP_011026988.1|  PREDICTED: protein IQ-DOMAIN 14-like isoform X1  83.2    1e-13   
ref|XP_009399005.1|  PREDICTED: protein IQ-DOMAIN 1-like isoform X1   82.8    1e-13   
ref|XP_009399007.1|  PREDICTED: protein IQ-DOMAIN 1-like isoform X2   82.8    1e-13   
ref|XP_011075368.1|  PREDICTED: protein IQ-DOMAIN 14                  82.8    1e-13   
ref|XP_010453420.1|  PREDICTED: protein IQ-DOMAIN 1-like              82.8    1e-13   
ref|XP_009372407.1|  PREDICTED: protein IQ-DOMAIN 1-like              82.8    1e-13   
gb|ABK24528.1|  unknown                                               82.8    1e-13   
ref|XP_010681705.1|  PREDICTED: protein IQ-DOMAIN 1-like              82.8    1e-13   
ref|XP_010547325.1|  PREDICTED: protein IQ-DOMAIN 14 isoform X2       82.8    1e-13   
ref|XP_010547321.1|  PREDICTED: protein IQ-DOMAIN 14 isoform X1       82.4    1e-13   
ref|XP_010557834.1|  PREDICTED: protein IQ-DOMAIN 14-like isoform X1  82.4    2e-13   
ref|XP_002276507.1|  PREDICTED: protein IQ-DOMAIN 14                  82.8    2e-13   
gb|KHG20568.1|  Protein IQ-DOMAIN 1                                   82.4    2e-13   
ref|XP_010255505.1|  PREDICTED: protein IQ-DOMAIN 1-like              82.8    2e-13   
ref|XP_010557836.1|  PREDICTED: protein IQ-DOMAIN 14-like isoform X2  82.4    2e-13   
ref|XP_003605876.1|  IQ domain-containing protein                     82.4    2e-13   
ref|XP_008391345.1|  PREDICTED: protein IQ-DOMAIN 1-like              82.4    2e-13   
ref|NP_196850.1|  protein IQ-domain 11                                82.4    2e-13   
ref|NP_180187.1|  IQ-domain 6 protein                                 82.0    2e-13   
ref|XP_007015643.1|  IQ-domain 5 isoform 1                            82.4    2e-13   
ref|XP_007145905.1|  hypothetical protein PHAVU_007G277500g           82.0    2e-13   
ref|XP_006606230.1|  PREDICTED: protein IQ-DOMAIN 1-like isoform X4   82.4    2e-13   
ref|XP_002517079.1|  calmodulin binding protein, putative             82.4    2e-13   
ref|XP_009340671.1|  PREDICTED: protein IQ-DOMAIN 1-like              82.0    2e-13   
ref|XP_010492098.1|  PREDICTED: protein IQ-DOMAIN 1-like              82.0    2e-13   
ref|XP_008367411.1|  PREDICTED: protein IQ-DOMAIN 14-like             82.8    2e-13   
ref|XP_003565979.1|  PREDICTED: protein IQ-DOMAIN 1-like              82.0    2e-13   
ref|NP_001067295.1|  Os12g0619000                                     82.0    2e-13   
ref|XP_008795399.1|  PREDICTED: protein IQ-DOMAIN 1-like              82.4    2e-13   
ref|XP_011004180.1|  PREDICTED: protein IQ-DOMAIN 1-like              82.4    2e-13   
ref|XP_009335283.1|  PREDICTED: protein IQ-DOMAIN 14-like             82.4    2e-13   
gb|KDP40224.1|  hypothetical protein JCGZ_02222                       82.0    2e-13   
ref|XP_004506232.1|  PREDICTED: protein IQ-DOMAIN 1-like isoform X1   82.0    2e-13   
ref|XP_008224258.1|  PREDICTED: protein IQ-DOMAIN 14                  82.0    2e-13   
ref|XP_006296365.1|  hypothetical protein CARUB_v10025537mg           81.6    2e-13   
ref|XP_010419924.1|  PREDICTED: protein IQ-DOMAIN 1-like              82.0    2e-13   
ref|XP_004506238.1|  PREDICTED: protein IQ-DOMAIN 1-like isoform X7   82.0    2e-13   
ref|XP_004506237.1|  PREDICTED: protein IQ-DOMAIN 1-like isoform X6   82.0    2e-13   
ref|XP_010553400.1|  PREDICTED: protein IQ-DOMAIN 1 isoform X1        82.0    2e-13   
ref|XP_010933871.1|  PREDICTED: protein IQ-DOMAIN 1-like              82.0    2e-13   
ref|XP_006858772.1|  hypothetical protein AMTR_s00066p00152910        82.0    2e-13   
ref|XP_010092431.1|  Protein IQ-DOMAIN 31                             82.0    2e-13   
ref|XP_011006951.1|  PREDICTED: protein IQ-DOMAIN 1-like              82.0    2e-13   
ref|XP_004506240.1|  PREDICTED: protein IQ-DOMAIN 1-like isoform X9   82.0    2e-13   
ref|XP_008658572.1|  PREDICTED: calmodulin binding protein isofor...  81.6    2e-13   
ref|XP_002314666.2|  calmodulin-binding family protein                82.0    2e-13   
ref|NP_001147912.1|  calmodulin binding protein                       81.6    2e-13   
ref|XP_003562047.1|  PREDICTED: protein IQ-DOMAIN 1-like              81.6    2e-13   
ref|XP_009368160.1|  PREDICTED: protein IQ-DOMAIN 14-like             82.0    3e-13   
ref|XP_008787762.1|  PREDICTED: protein IQ-DOMAIN 1-like              81.6    3e-13   
ref|XP_002314260.2|  calmodulin-binding family protein                81.6    3e-13   



>gb|KDP25216.1| hypothetical protein JCGZ_20372 [Jatropha curcas]
Length=519

 Score =   206 bits (525),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 165/413 (40%), Positives = 216/413 (52%), Gaps = 84/413 (20%)
 Frame = +3

Query  270   EIISRTPPPSR-RLLCAATVIQTAFRCYLAKRALVALKGIVKLQALIRGQNVRRQARITL  446
             EI+  T P +  R   AA +IQTAFR YLA+RAL ALKG+VKLQAL+RG NVR+QA++TL
Sbjct  110   EIVRLTRPSNFVREHWAAILIQTAFRGYLARRALRALKGLVKLQALVRGHNVRKQAKVTL  169

Query  447   KCMQALFRVQERMREQCARISQDSARKSMFSGSTNSWES---KYIRERKSIFRDHCSVGE  617
             KCMQAL RVQ+R+R+Q AR+S + +RKSMF  S   W+S   + I ER SI RD  S+ +
Sbjct  170   KCMQALVRVQDRVRDQRARLSHEGSRKSMFDESNGFWDSTCLQDISERGSISRDISSILD  229

Query  618   AWRDCPPTLQELEVMLQAQK-AAFMRERC-----PSQAWSSDTDVVDGEEREKTTPLK--  773
              W D P T +E+E ++Q++K AA  RE+       SQ W S      G+E+E     K  
Sbjct  230   NWDDRPYTSKEIEAIVQSKKEAALKREKALAYAFSSQIWRSRRSPSAGDEKEMEEGTKWL  289

Query  774   ---------QGKSRAPAIQRRNPVKSGEINV--------------RIRSLQHKSASSVQ-  881
                      +  SRA +  RR  +K+ EI+               R +S  ++   + Q 
Sbjct  290   DRWMATKQWESNSRA-STDRREAIKTVEIDTSRPYIYSTTPAAGRRSQSQNYQQRQTCQL  348

Query  882   -----apatpspakpkpVRPT---TSPGNL----------EKSHSTANTPRLCPTNRSAS  1007
                             P+ P+   T P  +          +K +S A+TP L    R   
Sbjct  349   PHSILRTHHNISFHHSPITPSPCKTKPLQVRSASPRCVKEDKCYSAAHTPSLGSRYRYGM  408

Query  1008  FAPRYSISGISPGYMAATESAKARLRSQSAPRQRPSTP-------AKRCLSYSI------  1148
              A   S S   P YMAATESAKAR+RSQSAPRQRPSTP       AK+ LSY        
Sbjct  409   GASGSSASAAMPNYMAATESAKARVRSQSAPRQRPSTPERERSGSAKKRLSYPAPEPHCS  468

Query  1149  ------------SVKNGEEGVEKRSEYWCNNNNTERESVGGEISPCSTTNSRW  1271
                         SV+    G+E RS Y    ++   ES+GGEISPCSTT+ RW
Sbjct  469   SFSQNLRSPSFKSVQAAHFGMEHRSNY----SSCYTESIGGEISPCSTTDLRW  517



>ref|XP_002317060.1| hypothetical protein POPTR_0011s15650g [Populus trichocarpa]
 gb|EEE97672.1| hypothetical protein POPTR_0011s15650g [Populus trichocarpa]
Length=552

 Score =   206 bits (523),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 168/439 (38%), Positives = 226/439 (51%), Gaps = 110/439 (25%)
 Frame = +3

Query  270   EIISRTPPPS---RRLLCAATVIQTAFRCYLAKRALVALKGIVKLQALIRGQNVRRQARI  440
             EI+  T P S   R  L AA  IQTAFR YLA+RAL ALKG+VKLQAL+RG NVR+QA++
Sbjct  117   EIVRLTRPASIFVRAKLWAAIAIQTAFRGYLARRALRALKGLVKLQALVRGHNVRKQAKL  176

Query  441   TLKCMQALFRVQERMREQCARISQDSARKSMFSGSTNSWESKY---IRERKSIFRDHCSV  611
             TL+ MQAL RVQ+R+R+  AR+S + +R+SMFS + +SWE KY   IRERKS+ RD  SV
Sbjct  177   TLQYMQALARVQDRVRDHRARLSHEGSRRSMFSETNSSWEFKYLHEIRERKSMSRDVSSV  236

Query  612   GEAWRDCPPTLQELEVMLQAQK-AAFMRERC-----PSQAWSSDTDVVDGEERE------  755
              + W D P T +E+E M++++K AA  RE+       SQ W S  +   G+E+E      
Sbjct  237   LDDWDDRPRTNEEIEAMVESKKEAALKREKALAYAFSSQIWRSRRNPSAGDEKELEDRTG  296

Query  756   -----KTTPLKQGKSRAPAIQRRNPVKSGEINV-------------RIRS---LQ-----  857
                    T   +  SRA   ++ N +K+ E++              R++S   LQ     
Sbjct  297   WLDRWMATKQWEASSRAITDRKDNSIKTVEMDTSRPFSYSTTTSSQRLQSQNHLQKQTPR  356

Query  858   HKSASSVQapatpspakpkpVRP-----------TTSPGNL---EKSHSTANTPRLCPTN  995
             H  AS +    +       P+ P           + SP  L   +K +S A+TP L    
Sbjct  357   HSIASPLHRSHSSLSLHQSPITPSPCKPRPLQVRSASPRCLKEEKKCYSAAHTPSLSSRY  416

Query  996   RSASFAPRYSISG-------ISPGYMAATESAKARLRSQSAPRQRPSTP--------AKR  1130
                +   R+ + G       I P YMAATESAKAR+R QSAPRQRPSTP        AK+
Sbjct  417   FMNNGIGRHGMVGASGGTATILPNYMAATESAKARVRPQSAPRQRPSTPERERGGSVAKK  476

Query  1131  CLSYSI-------------------------------SVKNGEEGVEKRSEYW-CNNNNT  1214
              LS+ +                               SV     G+ ++S Y+ C N   
Sbjct  477   RLSFPVQDHGPHGNGAGIIDYSSNRSFSQNLRSPSFKSVHGCHFGMGEQSNYFSCYN---  533

Query  1215  ERESVGGEISPCSTTNSRW  1271
               ES+GGEISPCSTT+ RW
Sbjct  534   --ESIGGEISPCSTTDLRW  550



>ref|XP_002518922.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF43455.1| conserved hypothetical protein [Ricinus communis]
Length=534

 Score =   204 bits (518),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 156/407 (38%), Positives = 209/407 (51%), Gaps = 94/407 (23%)
 Frame = +3

Query  315   AATVIQTAFRCYLAKRALVALKGIVKLQALIRGQNVRRQARITLKCMQALFRVQERMREQ  494
             AA +IQTAFR YLA+RAL ALKG+VKLQAL+RG NVR+QA++TLKCMQAL RVQ+R+R+Q
Sbjct  132   AAVIIQTAFRGYLARRALRALKGLVKLQALVRGHNVRKQAKLTLKCMQALVRVQDRVRDQ  191

Query  495   CARISQDSARKSMFSGSTNSWESKY---IRERKSIFRDHCSVGEAWRDCPPTLQELEVML  665
              AR+S + +RKSMF+ +   WES+Y   +RER+S+ RD   + + W D   T  ELE ++
Sbjct  192   RARLSHEGSRKSMFAETDGLWESRYLQEVRERRSLSRDLSFILDDWDDRQYTSGELEAIV  251

Query  666   QAQK-AAFMRERC-----PSQAWSSDTDVVDGEERE---------KTTPLKQGKSRAP--  794
             Q +K AA  RE+       SQ W S  +   G+E+E         +    KQ +S +   
Sbjct  252   QNKKEAALKREKALAYAFSSQIWRSRRNPSAGDEKELEERTRWLDRWMATKQWESNSSRG  311

Query  795   AIQRRNPVKSGEINVRIRSLQHKSASSVQapatpspakpkpVRPT---------------  929
             +  RR  +K+ EI+   R   + + +S    +     + K   P+               
Sbjct  312   STDRREAIKTVEIDTS-RPYSYSTPTSFVRRSQSQNHQQKQPSPSLLRAPVHHNLCLHQS  370

Query  930   --------TSPGNL----------EKSHSTANTPRLCPTNRSASFAPRYSISGISPGYMA  1055
                     T P  +          EK  S A+TP L    R    A   + +   P YMA
Sbjct  371   PITPSPCKTKPLQVRSASPRCPKEEKCFSAAHTPSLSSRYRYGMGASGVNTAAAIPNYMA  430

Query  1056  ATESAKARLRSQSAPRQRPSTP---------AKRCLSYSI--------------------  1148
             ATESAKAR+RSQSAPRQRPSTP         AK+ LSY                      
Sbjct  431   ATESAKARVRSQSAPRQRPSTPERERGGSSSAKKRLSYPAPEPHCSNIIGCSNSSFSQNL  490

Query  1149  ------SVKNGEEGVEKRSEYWCNNNNTERESVGGEISPCSTTNSRW  1271
                   SV+ G  G++ RS Y     +   ES+GGEISPCSTT+ RW
Sbjct  491   RSPSFKSVQCGLLGMDHRSNY-----SFYTESIGGEISPCSTTDLRW  532



>ref|XP_011040588.1| PREDICTED: protein IQ-DOMAIN 1-like [Populus euphratica]
Length=551

 Score =   201 bits (510),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 167/440 (38%), Positives = 225/440 (51%), Gaps = 111/440 (25%)
 Frame = +3

Query  270   EIISRTPPPS---RRLLCAATVIQTAFRCYLAKRALVALKGIVKLQALIRGQNVRRQARI  440
             EI+  T P S   R  L AA  IQTAFR YLA+RAL ALKG+VKLQAL+RG NVR+QA++
Sbjct  116   EIVRLTRPASIFVRTKLWAAIAIQTAFRGYLARRALRALKGLVKLQALVRGHNVRKQAKL  175

Query  441   TLKCMQALFRVQERMREQCARISQDSARKSMFSGSTNSWESKY---IRERKSIFRDHCSV  611
             TL+ MQAL RVQ+R+R+  AR+S + +R+SMFS + +SWE KY   IRERKS+ RD  SV
Sbjct  176   TLQYMQALARVQDRVRDHRARLSHEGSRRSMFSETNSSWEFKYLHDIRERKSMSRDVSSV  235

Query  612   GEAWRDCPPTLQELEVMLQAQK-AAFMRERC-----PSQAWSSDTDVVDGEERE------  755
                W D P T +E+E M++++K AA  RE+       SQ W S  +   G+E+E      
Sbjct  236   LNDWDDRPCTNEEIEAMVESKKEAALKREKALAYAFSSQIWRSRRNPSAGDEKELEDRTG  295

Query  756   ---KTTPLKQGKSRAPAIQRR--NPVKSGEIN---------------------VRIRSLQ  857
                +    KQ ++ + AI  R  N +K+ E++                     ++ +S +
Sbjct  296   WLDRWMAAKQWETSSGAITDRKDNSIKTVEMDTSRPFSYSTTTSSQRLQCQNHLQKQSPR  355

Query  858   HKSASSVQapatpspakpkpVRP-----------TTSPGNLE---KSHSTANTPRLCPTN  995
             H  AS +    +       P+ P           + SP  L+   K +S A+TP L    
Sbjct  356   HSIASPLHRSHSSLSLHQSPITPSPCKPKPLQVRSASPRCLKEGNKCYSAAHTPSLSSRY  415

Query  996   RSASFAPRYSISG-------ISPGYMAATESAKARLRSQSAPRQRPSTP--------AKR  1130
                +   RY + G       I P YMAATESAKAR+R QSAPRQRPSTP        AK+
Sbjct  416   FMNNGVGRYGMVGGSGCAATILPNYMAATESAKARVRPQSAPRQRPSTPERERGGSVAKK  475

Query  1131  CLSYSI-------------------------------SVKNGEEGVEKRSEYW-CNNNNT  1214
              LS+ +                               SV     G+ ++S Y+ C N   
Sbjct  476   RLSFPVQDHGPHGNGVGIIGYSSNRSFSQNLRSPSFKSVHGCHFGMGEQSNYFSCYN---  532

Query  1215  ERESVGGEISPCSTTNSRWW  1274
               ES GGEISPCSTT+  WW
Sbjct  533   --ESSGGEISPCSTTD-LWW  549



>ref|XP_007051443.1| IQ-domain 17 isoform 2 [Theobroma cacao]
 gb|EOX95600.1| IQ-domain 17 isoform 2 [Theobroma cacao]
Length=540

 Score =   199 bits (505),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 157/416 (38%), Positives = 216/416 (52%), Gaps = 93/416 (22%)
 Frame = +3

Query  297   SRRLLCAATVIQTAFRCYLAKRALVALKGIVKLQALIRGQNVRRQARITLKCMQALFRVQ  476
             +R    AA VIQTAFR YLA+RAL ALKG+VKLQAL+RG NVR+QA++TL+CMQAL RVQ
Sbjct  130   AREHHYAAIVIQTAFRGYLARRALRALKGLVKLQALVRGHNVRKQAKMTLRCMQALVRVQ  189

Query  477   ERMREQCARISQDSARKSMFSGSTNSWESKY---IRERKSIFRDHCSVGEAWRDCPPTLQ  647
              R+ +Q  R+S D +RKS FS + + WES+Y   I +RKS+ RD  S+ + W + P T++
Sbjct  190   ARVLDQRIRLSHDGSRKSAFSDTNSVWESRYLQDISDRKSLSRDGSSIADDWDERPHTIE  249

Query  648   ELEVMLQAQK-AAFMRERCPSQAWSSDT----------DVVDGEER----EKTTPLKQGK  782
             E++ MLQ +K AA  RE+  SQA+S  T          D  D E R    ++  P K   
Sbjct  250   EVKAMLQHRKEAALKREKNLSQAFSQQTRRARRSPSMGDEGDLEGRPKWLDRWMPAKPWD  309

Query  783   SRAPA-IQRRNPVKSGEINV------------RIRSLQHKSASSVQapatpspakpkpVR  923
             +R  A   +R+PVK+ E++             R  S Q+  A       +    + +   
Sbjct  310   NRGRASTDQRDPVKTVEMDTSQPYSYLAPNYRRTNSNQYHQAQPQNQRPSSPLHRAQHNA  369

Query  924   P------TTSPGNLEKSHSTANTPRLCPTNRSASFAPR-----------------YSISG  1034
             P      T SP         + +PR CP    +S + +                 YS SG
Sbjct  370   PLHHSPITPSPSKTRPIQVRSASPR-CPREERSSISSQTPSLRSNYYYTGRVGTNYSGSG  428

Query  1035  IS----PGYMAATESAKARLRSQSAPRQRPSTP-------AKRCLSYSI-----------  1148
              +    P YMAATESAKAR+RSQSAPRQRPSTP       A++ LS+ +           
Sbjct  429   NNAATLPNYMAATESAKARIRSQSAPRQRPSTPERDRTGSARKRLSFPVPEPYGVGMGYG  488

Query  1149  ------------SVKNGEEGVEKRSEYWCNNNNTERESVGGEISPCSTTNSRWW*R  1280
                         SV     G+E++S Y    ++   +S+GGEISP ST++ R W R
Sbjct  489   GYGHNLRSPSFKSVSGSRFGLEQQSNY----SSCYTDSLGGEISPSSTSDLRRWLR  540



>ref|XP_007051442.1| IQ-domain 17 isoform 1 [Theobroma cacao]
 gb|EOX95599.1| IQ-domain 17 isoform 1 [Theobroma cacao]
Length=541

 Score =   199 bits (505),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 157/416 (38%), Positives = 216/416 (52%), Gaps = 93/416 (22%)
 Frame = +3

Query  297   SRRLLCAATVIQTAFRCYLAKRALVALKGIVKLQALIRGQNVRRQARITLKCMQALFRVQ  476
             +R    AA VIQTAFR YLA+RAL ALKG+VKLQAL+RG NVR+QA++TL+CMQAL RVQ
Sbjct  131   AREHHYAAIVIQTAFRGYLARRALRALKGLVKLQALVRGHNVRKQAKMTLRCMQALVRVQ  190

Query  477   ERMREQCARISQDSARKSMFSGSTNSWESKY---IRERKSIFRDHCSVGEAWRDCPPTLQ  647
              R+ +Q  R+S D +RKS FS + + WES+Y   I +RKS+ RD  S+ + W + P T++
Sbjct  191   ARVLDQRIRLSHDGSRKSAFSDTNSVWESRYLQDISDRKSLSRDGSSIADDWDERPHTIE  250

Query  648   ELEVMLQAQK-AAFMRERCPSQAWSSDT----------DVVDGEER----EKTTPLKQGK  782
             E++ MLQ +K AA  RE+  SQA+S  T          D  D E R    ++  P K   
Sbjct  251   EVKAMLQHRKEAALKREKNLSQAFSQQTRRARRSPSMGDEGDLEGRPKWLDRWMPAKPWD  310

Query  783   SRAPA-IQRRNPVKSGEINV------------RIRSLQHKSASSVQapatpspakpkpVR  923
             +R  A   +R+PVK+ E++             R  S Q+  A       +    + +   
Sbjct  311   NRGRASTDQRDPVKTVEMDTSQPYSYLAPNYRRTNSNQYHQAQPQNQRPSSPLHRAQHNA  370

Query  924   P------TTSPGNLEKSHSTANTPRLCPTNRSASFAPR-----------------YSISG  1034
             P      T SP         + +PR CP    +S + +                 YS SG
Sbjct  371   PLHHSPITPSPSKTRPIQVRSASPR-CPREERSSISSQTPSLRSNYYYTGRVGTNYSGSG  429

Query  1035  IS----PGYMAATESAKARLRSQSAPRQRPSTP-------AKRCLSYSI-----------  1148
              +    P YMAATESAKAR+RSQSAPRQRPSTP       A++ LS+ +           
Sbjct  430   NNAATLPNYMAATESAKARIRSQSAPRQRPSTPERDRTGSARKRLSFPVPEPYGVGMGYG  489

Query  1149  ------------SVKNGEEGVEKRSEYWCNNNNTERESVGGEISPCSTTNSRWW*R  1280
                         SV     G+E++S Y    ++   +S+GGEISP ST++ R W R
Sbjct  490   GYGHNLRSPSFKSVSGSRFGLEQQSNY----SSCYTDSLGGEISPSSTSDLRRWLR  541



>ref|XP_010267407.1| PREDICTED: protein IQ-DOMAIN 1 [Nelumbo nucifera]
Length=559

 Score =   199 bits (505),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 158/412 (38%), Positives = 213/412 (52%), Gaps = 86/412 (21%)
 Frame = +3

Query  303   RLLCAATVIQTAFRCYLAKRALVALKGIVKLQALIRGQNVRRQARITLKCMQALFRVQER  482
             R  CAA VIQTAFR YLA+RAL ALKG+VKLQAL+RG NVR+QA++TL+CMQAL RVQ R
Sbjct  148   REHCAAIVIQTAFRGYLARRALRALKGLVKLQALVRGHNVRKQAKMTLRCMQALVRVQAR  207

Query  483   MREQCARISQDSARKSMFSGSTNSWESKY---IRERKSIFRDHCSVGEAWRDCPPTLQEL  653
             +R+Q  R+SQ+ +R S  S + + WES+Y   I ERKS+ RD  S+   W D P T++E+
Sbjct  208   VRDQRMRLSQEGSRMSTLSDTNSLWESRYFQDIAERKSVSRDGSSIAGDWDDRPHTVEEI  267

Query  654   EVMLQAQK-AAFMRERC-----PSQAWSSDTDVVDGEERE---------KTTPLKQGKSR  788
             + MLQ++K A+  RE+        Q W S  +   G E E         +    K  +SR
Sbjct  268   QAMLQSKKEASLKREKALAYAFSHQIWRSGRNSSIGNEEELEERPKWLDRWMAAKPWESR  327

Query  789   APA-IQRRNPVKSGEINV---------RIRSLQHK---------SASSVQapatpspakp  911
               A   +R+P+K+ EI+           IR  QH          +AS +           
Sbjct  328   GRASTDQRDPIKTVEIDTSRPFSYSIPNIRRSQHHHQQQPSIHSAASPLHRAHHNYSLLQ  387

Query  912   kpVRPT---TSPGNL----------EKSHSTANTPRLCPT------NRSASFAPRYSISG  1034
              PV P+   T P  +          E+ + TA+TP L  +       R    A   + +G
Sbjct  388   SPVTPSPSKTRPLQVRSASPRCPREERCYPTAHTPSLGSSYYYSGGTRHHMGANGGTGTG  447

Query  1035  ISPGYMAATESAKARLRSQSAPRQRPSTP-------AKRCLSYSI---------------  1148
               P YMAATESAKAR+RSQSAPRQRPSTP       AK+ LS+ +               
Sbjct  448   SMPNYMAATESAKARVRSQSAPRQRPSTPERERVGSAKKRLSFPVPDPYSGVGVGCGAGA  507

Query  1149  --------SVKNGEEGVEKRSEYWCNNNNTERESVGGEISPCSTTNSRWW*R  1280
                     S K+ + G     E   N ++   +S+GGEISP ST++ R W R
Sbjct  508   FSQNLRSPSFKSVQGGGYYGMEQQSNLSSCCTDSLGGEISPSSTSDLRRWLR  559



>ref|XP_010053062.1| PREDICTED: protein IQ-DOMAIN 1-like [Eucalyptus grandis]
 gb|KCW77309.1| hypothetical protein EUGRSUZ_D01673 [Eucalyptus grandis]
Length=536

 Score =   197 bits (500),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 161/414 (39%), Positives = 214/414 (52%), Gaps = 104/414 (25%)
 Frame = +3

Query  315   AATVIQTAFRCYLAKRALVALKGIVKLQALIRGQNVRRQARITLKCMQALFRVQERMREQ  494
             AA +IQTAFR YLA+RAL ALKG+VKLQAL+RG NVR+QA++TL+CMQAL RVQ+RMR+Q
Sbjct  132   AAVIIQTAFRGYLARRALRALKGLVKLQALVRGHNVRKQAKLTLQCMQALVRVQDRMRDQ  191

Query  495   CARISQDSARKSMFSGSTNS-WESKY---IRERKSIFRDHCSVGEAWRDCPPTLQELEVM  662
              AR+S + +RKSMF   TN+ WES Y   IRER+S+ R+     + W +    ++++E +
Sbjct  192   RARLSHEGSRKSMFDPETNNLWESSYLQDIRERRSVSRNTSCTADFWEEHSFKMEDVEAL  251

Query  663   LQAQKA-AFMRERCPSQAWS----------SDTDVVDGEEREK------TTPLKQGKSRA  791
             LQ+ K  A  RE+  SQA+S          S  +  + EER K       T + + +SRA
Sbjct  252   LQSGKEIASQREKLLSQAFSQQIWRSRRHPSAGNETELEERTKWLDRWMATKVWETESRA  311

Query  792   PAIQRRNPVKSGEINVRIRSLQHKSASSVQapatpspakpkpVRPTTSP------GNLEK  953
              +  +++P+K+ EI+   R   H   S+ +             +P+ SP        L +
Sbjct  312   -STDKKDPIKTVEIDT-SRPYSH---STPRNHRRSFHQNHFHRQPSPSPTPRSVASPLHR  366

Query  954   SHSTANTPRL-----CPTNRSA------SFAPR-------YSISGIS------------P  1043
             SHS  + P L      P+   A      S +PR       YS +               P
Sbjct  367   SHSHHSNPSLHHSPITPSPAKARPIQVRSASPRCYREDQCYSAANTPSLAFLHRNSMAVP  426

Query  1044  GYMAATESAKARLRSQSAPRQRPSTP-------AKRCLSYSI------------------  1148
              YMAATESAKAR RSQSAPRQRPSTP       AK+ LSY                    
Sbjct  427   NYMAATESAKARSRSQSAPRQRPSTPERDRTGSAKKRLSYPAPDPHGGFGAGYGPGGFSQ  486

Query  1149  --------SVKNG----EEGVEKRSEYWCNNNNTERESVGGEISPCSTTNSRWW  1274
                     SV +G      G E RS   C       ES+GGEISPCSTT+ RW+
Sbjct  487   NLRSPSFKSVYSGNYTYNYGGEHRSNLSCYG-----ESIGGEISPCSTTDLRWF  535



>ref|XP_009782146.1| PREDICTED: protein IQ-DOMAIN 1-like [Nicotiana sylvestris]
Length=518

 Score =   191 bits (485),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 122/254 (48%), Positives = 156/254 (61%), Gaps = 44/254 (17%)
 Frame = +3

Query  87   MVKKLGANSWLTALKRVFIRYPSKD----rksrhskrdeeeekkrdkgrrWLFSKTADEN  254
            M KK G +SWL+A+KR F R P+KD    +K++     EE+E+K+ + RRWLF K     
Sbjct  1    MAKKKGGSSWLSAVKRAF-RSPTKDNSCDKKAKREHELEEDEEKKREKRRWLFRKQPQNG  59

Query  255  SVGGVEII-----------------------------------SRTPPPSRRLLCAATVI  329
                 ++I                                   S  PP S R   AA +I
Sbjct  60   QQTEGKVITDPKHAIAVAAATAAAEAAVATAQAAVEIIRLTRSSNNPPSSNRQHNAAILI  119

Query  330  QTAFRCYLAKRALVALKGIVKLQALIRGQNVRRQARITLKCMQALFRVQERMREQCARIS  509
            QTAFR YLA+RAL+ALKGIVKLQALIRGQNVR+QA++TLKCMQAL RVQ R+REQ  R+S
Sbjct  120  QTAFRGYLARRALIALKGIVKLQALIRGQNVRKQAKMTLKCMQALLRVQARVREQRTRLS  179

Query  510  QDSARKSMFSGSTNSWESKY---IRERKSIFRDHCSVGEAWRDCPPTLQELEVMLQAQK-  677
             D  R+SMF+ +TN W+SKY   IR+RKS  RD  S+ + WRDCP +L ELE MLQA+K 
Sbjct  180  HDGGRRSMFAETTNLWDSKYLHDIRDRKSRSRDGSSIADDWRDCPRSLLELESMLQARKE  239

Query  678  AAFMRERCPSQAWS  719
            AAF RE+  + A++
Sbjct  240  AAFNREKSLAHAFT  253


 Score = 93.2 bits (230),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 71/155 (46%), Positives = 83/155 (54%), Gaps = 43/155 (28%)
 Frame = +3

Query  918   VRPTTSPGNLEKSHSTANTPRLCPTNRSASFAPRYSISGIS-----PGYMAATESAKARL  1082
             +RPT SP    KS STANTP L  T RS S   RYS SG       P YMAATESAKAR+
Sbjct  373   MRPT-SP---RKSQSTANTPCLRSTTRSNSIMSRYSTSGNDAAAAVPNYMAATESAKARI  428

Query  1083  RSQSAPRQRPSTP-------AKRCLSYSI----------------------SVKNGEEGV  1175
             RSQS P+QRPSTP        K+ LSY I                      S++    G+
Sbjct  429   RSQSTPKQRPSTPERERVGSVKKRLSYPIPEPYSLNATYGYSQNLRSPSFKSLQAAYMGM  488

Query  1176  EKRSEYWCNNNNTERESVGGEISPCSTTNSRWW*R  1280
             E++S Y C       +S+GGEISPCSTT+ R W R
Sbjct  489   EQQSNYSCYT-----DSLGGEISPCSTTDLRRWLR  518



>ref|XP_009625633.1| PREDICTED: protein IQ-DOMAIN 1-like [Nicotiana tomentosiformis]
Length=519

 Score =   190 bits (483),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 121/255 (47%), Positives = 158/255 (62%), Gaps = 45/255 (18%)
 Frame = +3

Query  87   MVKKLGANSWLTALKRVFIRYPSKD----rksrhskrdeeeekkrdkgrrWLFSKTADEN  254
            M KK G +SWL+A+KR F R P+KD    +K++     EE+E+K+ + RRWLF K +   
Sbjct  1    MAKKKGGSSWLSAVKRAF-RSPTKDNSCDKKAKREHELEEDEEKKREKRRWLFRKQSQNA  59

Query  255  SVGGVEII------------------------------------SRTPPPSRRLLCAATV  326
                 ++I                                    S  PP S R   AA +
Sbjct  60   QQNEGKVIADPKHAIAVAAATAAAAEAAVATAQAAVEIIRLTRSSNNPPSSNRQHNAAIL  119

Query  327  IQTAFRCYLAKRALVALKGIVKLQALIRGQNVRRQARITLKCMQALFRVQERMREQCARI  506
            IQTAFR YLA+RAL+ALKGIVKLQALIRGQNVR+QA++TLKCMQAL RVQ R+REQ AR+
Sbjct  120  IQTAFRGYLARRALIALKGIVKLQALIRGQNVRKQAKMTLKCMQALLRVQARVREQRARL  179

Query  507  SQDSARKSMFSGSTNSWESKY---IRERKSIFRDHCSVGEAWRDCPPTLQELEVMLQAQK  677
            S D  R+SMF+ +TN W+SKY   IR+RKS  RD  S+ + WRDCP +L ELE MLQA+K
Sbjct  180  SHDGGRRSMFAETTNLWDSKYLHDIRDRKSRSRDGSSIADDWRDCPRSLLELESMLQARK  239

Query  678  -AAFMRERCPSQAWS  719
             A+F +E+  + A++
Sbjct  240  EASFKQEKSLAHAFT  254


 Score = 94.0 bits (232),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 71/155 (46%), Positives = 83/155 (54%), Gaps = 43/155 (28%)
 Frame = +3

Query  918   VRPTTSPGNLEKSHSTANTPRLCPTNRSASFAPRYSISGIS-----PGYMAATESAKARL  1082
             +RPT SP    KS STANTP L  T RS S   RYS SG       P YMAATESAKAR+
Sbjct  374   MRPT-SP---RKSQSTANTPCLRSTTRSNSIMSRYSTSGNDAATAVPNYMAATESAKARI  429

Query  1083  RSQSAPRQRPSTP-------AKRCLSYSI----------------------SVKNGEEGV  1175
             RSQS P+QRPSTP        K+ LSY I                      S++    G+
Sbjct  430   RSQSTPKQRPSTPERERVGSVKKRLSYPIPEPYSLNATYGYSQNLRSPSFKSLQAAYLGI  489

Query  1176  EKRSEYWCNNNNTERESVGGEISPCSTTNSRWW*R  1280
             E++S Y C       +S+GGEISPCSTT+ R W R
Sbjct  490   EQQSNYSCYT-----DSLGGEISPCSTTDLRRWLR  519



>ref|XP_009606338.1| PREDICTED: protein IQ-DOMAIN 1 [Nicotiana tomentosiformis]
 ref|XP_009606339.1| PREDICTED: protein IQ-DOMAIN 1 [Nicotiana tomentosiformis]
Length=551

 Score =   190 bits (483),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 154/405 (38%), Positives = 211/405 (52%), Gaps = 90/405 (22%)
 Frame = +3

Query  315   AATVIQTAFRCYLAKRALVALKGIVKLQALIRGQNVRRQARITLKCMQALFRVQERMREQ  494
             AA +IQTAFR YLA+RAL ALKG+VKLQAL+RG NVR+QA++TL+CMQAL RVQ R+ +Q
Sbjct  146   AAIIIQTAFRGYLARRALKALKGLVKLQALVRGHNVRKQAKMTLRCMQALVRVQARVLDQ  205

Query  495   CARISQDSARKSMFSGSTNSWESKYIR---ERKSIFRDHCSVGEAWRDCPPTLQELEVML  665
               R SQ+ +RKS FS +++ W S+Y++   +RKS+ RD  S+ + W + P T++E++ ML
Sbjct  206   RFRQSQEGSRKSTFSDTSSMWNSQYLQDIIDRKSMSRDGSSIPDDWDERPHTIEEVKAML  265

Query  666   QAQK-AAFMRERCPSQAWS-------------SDTDVVDGEEREKTTPLKQGKS------  785
             Q +K AA  RER  S A+S             S++D   GE+ +        KS      
Sbjct  266   QKRKEAALKRERTLSDAFSQQTRRAGRNSSIGSESDF--GEKHQWMDRWMAAKSWDNSRG  323

Query  786   RAPAIQRRNPVKSGEINV------------------------RIRSLQHKSASSVQapat  893
             RA   Q  +PVK+ E++                         R  S  H+S  + Q+   
Sbjct  324   RASTDQSIDPVKTVEMDTSQPYSYLAPNLRRSDERQQHQQQQRPSSPLHRSHQN-QSFQF  382

Query  894   pspakpkpVRP----TTSP--GNLEKSHSTANTPRLCPTNRSASFAPRYSISGISPG---  1046
             P    P   RP    + SP     ++S S A TP L P N  +     +  + ++PG   
Sbjct  383   PVTPSPSKTRPIQIRSASPRCPRDDRSSSGAQTPSLRPNNNYSFNGSSHQRNRLTPGAAP  442

Query  1047  ---YMAATESAKARLRSQSAPRQRPSTP-------AKRCLSYSISVKNGE----------  1166
                YMAATESA AR+RSQSAPRQRPSTP       AK+ LSY +  + G           
Sbjct  443   IPNYMAATESALARIRSQSAPRQRPSTPERDRAGSAKKRLSYPVPDRYGNIPIGYGVGYE  502

Query  1167  -----------EGVEKRSEYWCNNNNTERESVGGEISPCSTTNSR  1268
                         GV    E   N ++   ES+GGEISP ST++ R
Sbjct  503   HSLRSPSFKSLNGVHFVYEQQSNYSSCYTESLGGEISPSSTSDLR  547



>ref|XP_010918300.1| PREDICTED: protein IQ-DOMAIN 1-like [Elaeis guineensis]
Length=533

 Score =   189 bits (480),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 162/418 (39%), Positives = 212/418 (51%), Gaps = 105/418 (25%)
 Frame = +3

Query  315   AATVIQTAFRCYLAKRALVALKGIVKLQALIRGQNVRRQARITLKCMQALFRVQERMREQ  494
             AA VIQTAFR YLA+RAL AL+G+VKLQAL+RG NVRRQA +TL+CMQAL RVQER+R+Q
Sbjct  125   AAIVIQTAFRGYLARRALKALRGLVKLQALVRGHNVRRQANMTLRCMQALVRVQERVRDQ  184

Query  495   CARISQDSARKS-----MFSGSTNSWESKYIR---ERKSI-FRDHCSVGEAWRDCPPTLQ  647
              AR+++  A +S      FS  T+ W+S+Y+    +R+S+  RD  S  + W D P T++
Sbjct  185   RARLARKGASRSSNKSATFSYDTSIWDSRYLHDLADRRSLQSRDGSSYADDWDDHPRTIE  244

Query  648   ELEVMLQAQK-AAFMRERCPS-----QAWSSDTDVVD----GEEREKTTPLKQGKSRAP-  794
             E++ MLQ++K AA  RER  S     Q W SD         GEE E+ + +  G+ R P 
Sbjct  245   EIQSMLQSRKEAAVKRERALSYAFSQQLWRSDGKTASSLSYGEEMEEESAISDGEQRPPR  304

Query  795   ---------------------AIQRRNPVKSGEI------------NVRIR----SLQHK  863
                                  A   R+P+K+ EI            NVR      S  H+
Sbjct  305   WLDRWMASRTSCDNRNSSRGRASMERDPIKTLEIDTGRPFSYSTPTNVRRHQPPASPHHR  364

Query  864   SASSVQapat---pspakpkpVRPTTSP--GNLEKSHSTANTP-----RLCPTNRSASFA  1013
             S++   +PAT    S ++   VR + SP  G  EKS ++ +TP                 
Sbjct  365   SSNHFHSPATPSPSSASRSLQVR-SASPRCGREEKSSASVHTPTSSGYYYYSGGGGQRHH  423

Query  1014  PRYSISGISPGYMAATESAKARLRSQSAPRQRPSTP--------AKRCLSY---------  1142
               +      P YMAATESAKAR RSQSAPRQRPSTP        AK+ LS+         
Sbjct  424   HHHQQQAAVPNYMAATESAKARSRSQSAPRQRPSTPEREQRSGSAKKRLSFPVPEPYIGG  483

Query  1143  ------------SISVKNGEEGVEKRSEYWCNNNNTERESVGGEISPCSTTNSRWW*R  1280
                         S    NG  GVE+ S   C       ES+ GE+SP STT+ R W R
Sbjct  484   GGGGYSQSLRSPSFKSANGRFGVEQSS---CCT-----ESIAGEVSPSSTTDLRSWLR  533



>ref|XP_008776838.1| PREDICTED: protein IQ-DOMAIN 1-like [Phoenix dactylifera]
Length=529

 Score =   189 bits (479),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 161/414 (39%), Positives = 216/414 (52%), Gaps = 101/414 (24%)
 Frame = +3

Query  315   AATVIQTAFRCYLAKRALVALKGIVKLQALIRGQNVRRQARITLKCMQALFRVQERMREQ  494
             AA VIQTAFR YLA+RAL AL+G+VKLQAL+RG NVRRQA +TL+CMQAL RVQER+R+Q
Sbjct  125   AAIVIQTAFRGYLARRALKALRGLVKLQALVRGHNVRRQANMTLRCMQALVRVQERVRDQ  184

Query  495   CARI-----SQDSARKSMFSGSTNSWESKYIRE---RKSI-FRDHCSVGEAWRDCPPTLQ  647
              AR+     S+ S + + FS  T+ W+S+Y+ +   R+S+  RD  S  + W D P T++
Sbjct  185   RARLAREGTSRSSNKSATFSCDTSIWDSRYLHDLSDRRSVQSRDGSSYADDWDDHPRTIE  244

Query  648   ELEVMLQAQK-AAFMRERCPS-----QAWSSDTDVVD----GEEREKTTPLKQGKSRAP-  794
             E++ ML+++K AA  RER  S     Q W SD         GEE ++ T +  G+ R P 
Sbjct  245   EIQSMLRSRKEAAMKRERALSYAFSQQLWRSDGKTASSLSCGEELQEDTAISDGEQRPPR  304

Query  795   ---------------------AIQRRNPVKSGEI------------NVRIR----SLQHK  863
                                  A   R+P+K+ EI            NVR      S  H+
Sbjct  305   WLDRWMASRTSCDNRNSRRGRASVDRDPIKTLEIDTARPFSYSTPTNVRRHQPPASPHHR  364

Query  864   SASSVQapat---pspakpkpVRPTTSP--GNLEKSHSTANTPRLCPTNRSASFAPRYSI  1028
             S++ + +PAT    S A+   VR + SP  G  E+S ++ +TP        +    +   
Sbjct  365   SSNHLHSPATPSPSSAARSLQVR-SASPRCGREERSSASVHTPTGSGYYYYSGGGGQRHQ  423

Query  1029  SGIS-PGYMAATESAKARLRSQSAPRQRPSTP--------AKRCLSY-------------  1142
                + P YMAATESAKAR RSQSAPRQRPSTP        AK+ LS+             
Sbjct  424   QQAAVPNYMAATESAKARSRSQSAPRQRPSTPEREQRSGSAKKRLSFPVPETYIGGGGGG  483

Query  1143  --------SISVKNGEEGVEKRSEYWCNNNNTERESVGGEISPCSTTNSRWW*R  1280
                     S    NG+ GVE+ S   C       ES+ GE+SP STT+ R W R
Sbjct  484   YSQSLRSPSFKSANGQFGVEQSSS--CT------ESIAGEVSPSSTTDLRRWLR  529



>gb|KHG22817.1| Protein IQ-DOMAIN 14 -like protein [Gossypium arboreum]
Length=519

 Score =   188 bits (477),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 153/391 (39%), Positives = 205/391 (52%), Gaps = 83/391 (21%)
 Frame = +3

Query  315   AATVIQTAFRCYLAKRALVALKGIVKLQALIRGQNVRRQARITLKCMQALFRVQER-MRE  491
             AA VIQTAFR YLA+RAL ALKG+VKLQAL+RG NVRRQA++ LKCMQ+L RVQ+R + +
Sbjct  138   AAIVIQTAFRGYLARRALRALKGLVKLQALVRGHNVRRQAKLALKCMQSLLRVQDRVLDQ  197

Query  492   QCARISQDSA-RKSMFSGSTNSWESKY---IRERKSIFRDHCSVGEAWRDCPPTLQELEV  659
             Q AR+S +   RKSMF  +   WE++Y   IR RKS+ RD     + W D P T +E+E 
Sbjct  198   QRARLSHEGYRRKSMFDETNALWETRYLQDIRRRKSMSRDMSCTTDEWDDRPQTSEEIEA  257

Query  660   MLQAQK-AAFMRERCPSQAWS----------SDTDVVDGEEREK------TTPLKQGKSR  788
             +L  +K AA  RE+  + A+S          S  D  + EER K       T      +R
Sbjct  258   LLLTKKEAALKREKALAYAFSNQIWRSRRNPSAEDEKEVEERTKWLDRWMATKQWDNNNR  317

Query  789   APAIQRRNPVKSGEINVRIRSLQHKSASSVQapatpspakpkpVRPTTSPGNL-------  947
               +  +R+ +K+ EI+     LQ  S+ +++    P         PT SP          
Sbjct  318   V-STDKRDSIKTVEIDS--YKLQSYSSPTIR---RPHSFFLNQFPPTPSPCKTKPLQVRS  371

Query  948   --------EKSH-STANTPRLCPTNRSASFAPRYSISGIS---PGYMAATESAKARLRSQ  1091
                     EK + S ANTP L  T  + +   RY ++G +   P YMAATESAKA+ RSQ
Sbjct  372   ASPRCLKEEKCYTSAANTPSLASTYCTTNGMSRY-VNGTATTVPNYMAATESAKAKARSQ  430

Query  1092  SAPRQRPSTPAKR-----------------------CLSYSISVKN--------GEEGVE  1178
             S PRQRP TP +                        C S+S ++++        G  G+E
Sbjct  431   STPRQRPLTPERERGGSLVKKRLSYPAPENHVVGIGCSSFSQNLRSPSFKSAFEGHYGME  490

Query  1179  KRSEYWCNNNNTERESVGGEISPCSTTNSRW  1271
             K S Y    ++   ES GGEISPCSTT+ RW
Sbjct  491   KESLY----SSYYTESFGGEISPCSTTDLRW  517



>ref|XP_011013401.1| PREDICTED: protein IQ-DOMAIN 1-like [Populus euphratica]
Length=549

 Score =   188 bits (477),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 154/422 (36%), Positives = 213/422 (50%), Gaps = 106/422 (25%)
 Frame = +3

Query  315   AATVIQTAFRCYLAKRALVALKGIVKLQALIRGQNVRRQARITLKCMQALFRVQERMREQ  494
             AA +IQTAFR YLA+ AL ALKG+VKLQAL+RG NVR+QA++TL+CMQAL RVQ+R+R+Q
Sbjct  131   AAIIIQTAFRGYLARGALRALKGLVKLQALVRGHNVRKQAKLTLQCMQALVRVQDRVRDQ  190

Query  495   CARISQDSARKSMFSGSTNSWESKY---IRERKSIFRDHCSVGEAWRDCPPTLQELEVML  665
               R+S + +R+SMFS + + WES+Y   IRERKS  RD  S+ + W D   T +E+E M+
Sbjct  191   RERLSHEWSRRSMFSETNSLWESRYLQDIRERKSTSRDGSSLLDDWDDRRCTNEEIEAMV  250

Query  666   QAQK-AAFMRERC-----PSQAWSSDTDVVDGEERE-----------KTTPLKQGKSRAP  794
             Q++K AA  RE+       SQ W S  +   G+E E             T   +  +RA 
Sbjct  251   QSKKEAALKREKALAYAFSSQKWRSRRNPSAGDEEELEDRTRWLDRWMATKQWETSNRAS  310

Query  795   AIQRRNPVKSGEINV--------------RIRSLQHKS--------ASSVQapatpspak  908
               ++ N +K+ E++               R +S  H+         AS +    +     
Sbjct  311   TDRKDNNIKTVEMDTSRPFSYSIATPTCQRSQSQNHQQKQPTRHSIASPLHRSYSSRSIH  370

Query  909   pkpVRPTT--------------SPGNL---EKSHSTANTPRLCPTNRSASFAPRY--SIS  1031
               P+ P T              SP  L   +K +S A+TP L  +    +   RY    +
Sbjct  371   QSPITPITPSPCKTKHLKVRSASPRCLNEGKKCYSAAHTPSLSSSYCINNGLGRYGGGSA  430

Query  1032  GISPGYMAATESAKARLRSQSAPRQRPSTP----------AKRCLSYSI-----------  1148
              I P YMAATESAKAR+RSQSAPRQRPSTP          AK+ LS+ +           
Sbjct  431   TILPNYMAATESAKARVRSQSAPRQRPSTPERERSGSVLLAKKRLSFPVPDCGPNGNGVG  490

Query  1149  --------------------SVKNGEEGVEKRSEYWCNNNNTERESVGGEISPCSTTNSR  1268
                                 SV     G+ ++S Y+    +   E +G EISPCSTT+ R
Sbjct  491   NIGYSSNSSFSQNLRSPSFKSVHGCHFGMGEQSNYF----SCYSEGIGEEISPCSTTDLR  546

Query  1269  WW  1274
             W+
Sbjct  547   WF  548



>ref|XP_011041076.1| PREDICTED: protein IQ-DOMAIN 1-like [Populus euphratica]
Length=549

 Score =   188 bits (477),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 154/422 (36%), Positives = 213/422 (50%), Gaps = 106/422 (25%)
 Frame = +3

Query  315   AATVIQTAFRCYLAKRALVALKGIVKLQALIRGQNVRRQARITLKCMQALFRVQERMREQ  494
             AA +IQTAFR YLA+ AL ALKG+VKLQAL+RG NVR+QA++TL+CMQAL RVQ+R+R+Q
Sbjct  131   AAIIIQTAFRGYLARGALRALKGLVKLQALVRGHNVRKQAKLTLQCMQALVRVQDRVRDQ  190

Query  495   CARISQDSARKSMFSGSTNSWESKY---IRERKSIFRDHCSVGEAWRDCPPTLQELEVML  665
               R+S + +R+SMFS + + WES+Y   IRERKS  RD  S+ + W D   T +E+E M+
Sbjct  191   RERLSHEWSRRSMFSETNSLWESRYLQDIRERKSTSRDGSSLLDDWDDRRCTNEEIEAMV  250

Query  666   QAQK-AAFMRERC-----PSQAWSSDTDVVDGEERE-----------KTTPLKQGKSRAP  794
             Q++K AA  RE+       SQ W S  +   G+E E             T   +  +RA 
Sbjct  251   QSKKEAALKREKALAYAFSSQKWRSRRNPSAGDEEELEDRTRWLDRWMATKQWETSNRAS  310

Query  795   AIQRRNPVKSGEINV--------------RIRSLQHKS--------ASSVQapatpspak  908
               ++ N +K+ E++               R +S  H+         AS +    +     
Sbjct  311   TDRKDNNIKTVEMDTSRPFSYSSATPTCQRSQSQNHQQKQPTRHSIASPLHRSYSSRSIH  370

Query  909   pkpVRPTT--------------SPGNL---EKSHSTANTPRLCPTNRSASFAPRY--SIS  1031
               P+ P T              SP  L   +K +S A+TP L  +    +   RY    +
Sbjct  371   QSPITPITPSPCKTKHLKVRSASPRCLNEGKKCYSAAHTPSLSSSYCINNGLGRYGGGSA  430

Query  1032  GISPGYMAATESAKARLRSQSAPRQRPSTP----------AKRCLSYSI-----------  1148
              I P YMAATESAKAR+RSQSAPRQRPSTP          AK+ LS+ +           
Sbjct  431   TILPNYMAATESAKARVRSQSAPRQRPSTPERERSGSVLLAKKRLSFPVPDCGPNGNGVG  490

Query  1149  --------------------SVKNGEEGVEKRSEYWCNNNNTERESVGGEISPCSTTNSR  1268
                                 SV     G+ ++S Y+    +   E +G EISPCSTT+ R
Sbjct  491   NIGYSSNSSFSQNLRSPSFKSVHGCHFGMGEQSNYF----SCYSEGIGEEISPCSTTDLR  546

Query  1269  WW  1274
             W+
Sbjct  547   WF  548



>emb|CBI34598.3| unnamed protein product [Vitis vinifera]
Length=473

 Score =   186 bits (473),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 141/355 (40%), Positives = 199/355 (56%), Gaps = 44/355 (12%)
 Frame = +3

Query  315   AATVIQTAFRCYLAKRALVALKGIVKLQALIRGQNVRRQARITLKCMQALFRVQERMREQ  494
             AA VIQTAFR YLA+ AL ALKG+VKLQAL+RG NVR+QA++TLKCMQAL RVQ R+R+Q
Sbjct  130   AAVVIQTAFRGYLARTALRALKGLVKLQALVRGHNVRKQAKMTLKCMQALVRVQSRVRDQ  189

Query  495   CARISQDSARKSMFSGSTNSWESKY---IRERKSIFRDHCSVGEAWRDCPPTLQELEVML  665
              AR+S + +R+SMF+ + + WES+Y   IR RKS+ RD  S+ +     P  ++E+E M 
Sbjct  190   RARLSHEGSRRSMFAETNSLWESRYLQEIRHRKSMSRDRSSIADECCGRPHEIEEIEAMF  249

Query  666   QAQK-AAFMRERCPSQAWSSDT----------DVVDGEEREK------TTPLKQGKSRAP  794
             +++K  A  RE+  + A+S             D  D EER K       T   +  SRA 
Sbjct  250   RSRKEGALKREKALAYAFSHQVWRSGRNPFAGDEEDLEERTKWLQRWMATKRWESSSRA-  308

Query  795   AIQRRNPVKSGEINVRIRSLQHKSASSVQapatpspakpkpVRPTTSPGNLEKSHSTANT  974
             +  +R+ +K+ EI+   R   + SAS+V+  +       +P  P ++     K+H   + 
Sbjct  309   STDKRDAIKTVEIDTS-RPYSY-SASNVRRSSVYQNQHLRPPTPHSTASPFHKAHHNLSL  366

Query  975   PRLCPTNRSASFAPRYSI--------SGISPGYMAATESAKARLRSQSAPRQRPSTPAKR  1130
               L P   S S      +        S + P YMAATESAKAR+RS+SAPRQ+PSTP + 
Sbjct  367   -HLSPVTPSPSKTRPLQVPSTNGDVASAVLPNYMAATESAKARVRSESAPRQKPSTPERE  425

Query  1131  ----CLSYSISVKNGEEGVEKRSEYWCNNNNTERESVGGEISPCST-TNSRWW*R  1280
                  LS S+   + +           N ++   +S+GGEISP +T T  R W R
Sbjct  426   RGGGMLSKSLRSPSFK-------SVHANLSSCYTDSLGGEISPTTTSTEQRGWLR  473



>emb|CAN76669.1| hypothetical protein VITISV_042862 [Vitis vinifera]
Length=537

 Score =   187 bits (475),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 155/405 (38%), Positives = 210/405 (52%), Gaps = 84/405 (21%)
 Frame = +3

Query  315   AATVIQTAFRCYLAKRALVALKGIVKLQALIRGQNVRRQARITLKCMQALFRVQERMREQ  494
             AA VIQTAFR YLA+ AL ALKG+VKLQAL+RG NVR+QA++TLKCMQAL RVQ R+R+Q
Sbjct  134   AAVVIQTAFRGYLARTALRALKGLVKLQALVRGHNVRKQAKMTLKCMQALVRVQSRVRDQ  193

Query  495   CARISQDSARKSMFSGSTNSWESKY---IRERKSIFRDHCSVGEAWRDCPPTLQELEVML  665
              AR+S + +R+SMF+ + + WES+Y   IR RKS+ RD  S+ +     P  ++E+E M 
Sbjct  194   RARLSHEGSRRSMFAETNSLWESRYLQEIRHRKSMSRDRSSIADECCGXPHXIEEIEAMF  253

Query  666   QAQK-AAFMRERCPSQAWSSDT----------DVVDGEEREK------TTPLKQGKSRAP  794
             +++K  A  RE+  + A+S             D  D EER K       T   +  SRA 
Sbjct  254   RSRKEGALKREKALAYAFSHQVWRSGRNPFAGDEEDLEERTKWLQRWMATKRWESSSRA-  312

Query  795   AIQRRNPVKSGEI-----------NVRIRSLQ----------HKSASSVQapatpspakp  911
             +  +R+ +K+ EI           NVR  S+           H +AS             
Sbjct  313   STDKRDAIKTVEIDTSRPYSXSASNVRRSSVYQNQHLRPPTPHSTASPFHKAHHNLSLHX  372

Query  912   kpVRP-----------TTSPGNL--EKSHSTANTPRLCPTN-------RSASFAPRYSIS  1031
              PV P           + SP  L  E+SHSTA+TP L   +       R  +       S
Sbjct  373   SPVTPSPSKTRPLQVRSASPRCLKEEESHSTAHTPNLASIHCFNGSXCRXGASTNGDVAS  432

Query  1032  GISPGYMAATESAKARLRSQSAPRQRPSTP--------AKRCLSYSI-------SVKNGE  1166
              + P YMAATESAKAR+RS+SAPRQ PSTP        A++ LSY +       +     
Sbjct  433   AVLPNYMAATESAKARVRSESAPRQXPSTPERERGGGSARKRLSYPVPEAPLSSTSTTCS  492

Query  1167  EGVEK--RSEYW----CNNNNTERESVGGEISPCST-TNSRWW*R  1280
               + K  RS  +     N ++   +S+GGEISP +T T  R W R
Sbjct  493   SMLSKSLRSPSFKSVHANXSSCYTDSLGGEISPTTTSTEQRGWLR  537



>ref|XP_002300498.2| hypothetical protein POPTR_0001s45220g [Populus trichocarpa]
 gb|EEE85303.2| hypothetical protein POPTR_0001s45220g [Populus trichocarpa]
Length=545

 Score =   187 bits (474),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 154/424 (36%), Positives = 217/424 (51%), Gaps = 109/424 (26%)
 Frame = +3

Query  309   LCAATVIQTAFRCYLAKRALVALKGIVKLQALIRGQNVRRQARITLKCMQALFRVQERMR  488
             + AA +IQTAFR YLA+ AL ALKG+VKLQAL+RG NVR+QA++TL+CM+AL RVQ+R+R
Sbjct  128   IWAAIIIQTAFRGYLARGALRALKGLVKLQALVRGHNVRKQAKLTLQCMKALVRVQDRVR  187

Query  489   EQCARISQDSARKSMFSGSTNSWESKY---IRERKSIFRDHCSVGEAWRDCPPTLQELEV  659
             +Q  R+S + +R+SMFS + + WES+Y   IRERKS  RD  S+ + W D   T +E+E 
Sbjct  188   DQRERLSHEWSRRSMFSETNSLWESRYLQDIRERKSTSRDVSSLLDDWDDRRCTNEEIEA  247

Query  660   MLQAQK-AAFMRERCPSQAWSS-------DTDVVDGEEREKTT-------PLKQGKS--R  788
             M+Q++K AA  RE+  + A+SS       +    D EE E  T         KQ ++  R
Sbjct  248   MVQSKKEAALKREKALAYAFSSQKWRSRRNPSAGDQEELEDRTRWLDRWMATKQWETSNR  307

Query  789   APAIQRRNPVKSGEINV--------------RIRSLQHKS--------ASSVQapatpsp  902
             A   ++ N +K+ E++               R +S  H+         AS +    +   
Sbjct  308   ASTDRKDNNIKTVEMDTSRPFSYSSTTPTCQRSQSQNHQQKQPTRHSIASPLHRSYSSRS  367

Query  903   akpkpVRPT-TSPGNLE-------------KSHSTANTP----RLCPTNRSASFAPRYSI  1028
                 P+ P+   P +L+             K +S A+TP    R C  N    +      
Sbjct  368   IHQSPITPSPCKPKHLQVRSASPRCLKEGNKCYSAAHTPSLSSRYCINNGLGRYGG--GS  425

Query  1029  SGISPGYMAATESAKARLRSQSAPRQRPSTP----------AKRCLSYSI----------  1148
             + I P YMAATE+AKAR+RSQSAPRQRPSTP          AK+ LS+ +          
Sbjct  426   ATILPNYMAATEAAKARVRSQSAPRQRPSTPERERSGSVLLAKKRLSFPVPDCGPNGNGV  485

Query  1149  ---------------------SVKNGEEGVEKRSEYW-CNNNNTERESVGGEISPCSTTN  1262
                                  SV     G+ ++S Y+ C N     E +G EISPCSTT+
Sbjct  486   GNIGYSSNSSFSQNLRSPSFKSVHGCHFGMREQSNYFSCYN-----EGIGEEISPCSTTD  540

Query  1263  SRWW  1274
              RW+
Sbjct  541   LRWF  544



>ref|XP_007210753.1| hypothetical protein PRUPE_ppa021141mg [Prunus persica]
 gb|EMJ11952.1| hypothetical protein PRUPE_ppa021141mg [Prunus persica]
Length=523

 Score =   186 bits (473),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 154/408 (38%), Positives = 214/408 (52%), Gaps = 101/408 (25%)
 Frame = +3

Query  315   AATVIQTAFRCYLAKRALVALKGIVKLQALIRGQNVRRQARITLKCMQALFRVQERMREQ  494
             AAT+IQTAFR YLA+RAL ALKG+VKLQAL+RG NVR+QA++TLKCMQAL RVQ+++R +
Sbjct  126   AATLIQTAFRGYLARRALRALKGLVKLQALVRGHNVRKQAKLTLKCMQALLRVQDQVRNE  185

Query  495   CARISQDSARKSMFSGSTNS-WESKYI---RERKSIFRDHCSVGEAWRDCPPTLQELEVM  662
              +R+S D  RKSMF+ +    WES+Y+   R+RKS+ R+   VG+ W +       +E M
Sbjct  186   RSRLSHDGGRKSMFAETDLPLWESRYLHDSRDRKSMSREKSRVGDDWDEG------VEAM  239

Query  663   LQAQK-AAFMRERCPSQAWS----------SDTDVVDGEEREK------TTPLKQGKSRA  791
             LQ+++ AA  RE+  + A+S          S  D  + EER K       T   +  SRA
Sbjct  240   LQSRREAALKREKALAYAFSHQIWKPRRNPSAGDEAELEERTKWLDRWMATKQFEHSSRA  299

Query  792   PAIQRRNPVKSGEINVRIRSLQHK-SASSVQapatpspakpkpV-RPTTSPGNLEKSH--  959
              +I +R+ +K+ EI+   R   +  SA +V+   + S  + +P   P  SP  L KSH  
Sbjct  300   -SIDKRDTIKTVEIDTNSRPHSYSYSAPNVRISTSHSQLQKQPAPYPIASPSPLHKSHYI  358

Query  960   ----------------------------------STANTPRLCPTNRSASFAPRYSI--S  1031
                                               S A+TP L     S S+  R S+  S
Sbjct  359   NHLSPATPSPSKPKYLKVRSASPRCLKEEKYCCSSAAHTPNLG----SNSYCFRGSMCRS  414

Query  1032  GISPGYMAATESAKARLRSQSAPRQRPSTPAKR---------------------------  1130
              I P YMAATESAKA+ RS SAPR RPSTP +                            
Sbjct  415   AI-PNYMAATESAKAKARSLSAPRTRPSTPERERGGGSAKKRLLYPVPAEALQHNSVGIG  473

Query  1131  CLSYSISVKNGE-EGVEKRSEYWCNNNNTERESVGGEISPCSTTNSRW  1271
             C S+S ++++   + V+    Y   N ++  +S+GGEISPCSTT+ RW
Sbjct  474   CSSFSHNLRSPSFKSVQNNGYYGRENLSSYTDSLGGEISPCSTTDLRW  521



>ref|XP_010660165.1| PREDICTED: protein IQ-DOMAIN 1-like [Vitis vinifera]
Length=534

 Score =   186 bits (473),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 155/405 (38%), Positives = 211/405 (52%), Gaps = 84/405 (21%)
 Frame = +3

Query  315   AATVIQTAFRCYLAKRALVALKGIVKLQALIRGQNVRRQARITLKCMQALFRVQERMREQ  494
             AA VIQTAFR YLA+ AL ALKG+VKLQAL+RG NVR+QA++TLKCMQAL RVQ R+R+Q
Sbjct  131   AAVVIQTAFRGYLARTALRALKGLVKLQALVRGHNVRKQAKMTLKCMQALVRVQSRVRDQ  190

Query  495   CARISQDSARKSMFSGSTNSWESKY---IRERKSIFRDHCSVGEAWRDCPPTLQELEVML  665
              AR+S + +R+SMF+ + + WES+Y   IR RKS+ RD  S+ +     P  ++E+E M 
Sbjct  191   RARLSHEGSRRSMFAETNSLWESRYLQEIRHRKSMSRDRSSIADECCGRPHEIEEIEAMF  250

Query  666   QAQK-AAFMRERCPSQAWSSDT----------DVVDGEEREK------TTPLKQGKSRAP  794
             +++K  A  RE+  + A+S             D  D EER K       T   +  SRA 
Sbjct  251   RSRKEGALKREKALAYAFSHQVWRSGRNPFAGDEEDLEERTKWLQRWMATKRWESSSRA-  309

Query  795   AIQRRNPVKSGEI-----------NVRIRSLQ----------HKSASSVQapatpspakp  911
             +  +R+ +K+ EI           NVR  S+           H +AS             
Sbjct  310   STDKRDAIKTVEIDTSRPYSYSASNVRRSSVYQNQHLRPPTPHSTASPFHKAHHNLSLHL  369

Query  912   kpVRP-----------TTSPGNL--EKSHSTANTPRLCPTN-------RSASFAPRYSIS  1031
              PV P           + SP  L  E+SHSTA+TP L   +       R  +       S
Sbjct  370   SPVTPSPSKTRPLQVRSASPRCLKEEESHSTAHTPNLASIHCFNGSMCRQGASTNGDVAS  429

Query  1032  GISPGYMAATESAKARLRSQSAPRQRPSTP--------AKRCLSYSI-------SVKNGE  1166
              + P YMAATESAKAR+RS+SAPRQ+PSTP        A++ LSY +       +     
Sbjct  430   AVLPNYMAATESAKARVRSESAPRQKPSTPERERGGGSARKRLSYPVPEAPLSSTSTTCS  489

Query  1167  EGVEK--RSEYW----CNNNNTERESVGGEISPCST-TNSRWW*R  1280
               + K  RS  +     N ++   +S+GGEISP +T T  R W R
Sbjct  490   SMLSKSLRSPSFKSVHANLSSCYTDSLGGEISPTTTSTEQRGWLR  534



>ref|XP_009767106.1| PREDICTED: protein IQ-DOMAIN 1 [Nicotiana sylvestris]
 ref|XP_009767107.1| PREDICTED: protein IQ-DOMAIN 1 [Nicotiana sylvestris]
Length=551

 Score =   185 bits (470),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 154/411 (37%), Positives = 213/411 (52%), Gaps = 102/411 (25%)
 Frame = +3

Query  315   AATVIQTAFRCYLAKRALVALKGIVKLQALIRGQNVRRQARITLKCMQALFRVQERMREQ  494
             AA +IQTAFR YLA+RAL ALKG+VKLQAL+RG NVR+QA +TL+CMQAL RVQ R+ +Q
Sbjct  146   AAIIIQTAFRGYLARRALKALKGLVKLQALVRGHNVRKQANMTLRCMQALVRVQARVLDQ  205

Query  495   CARISQDSARKSMFSGSTNSWESKY---IRERKSIFRDHCSVGEAWRDCPPTLQELEVML  665
               R SQ+ +RKS FS +++ W S+Y   I +RKS+ RD  S+ + W + P T++E++ ML
Sbjct  206   RFRQSQEGSRKSTFSDTSSMWNSQYLQDITDRKSMSRDGSSIPDDWDERPHTIEEVKAML  265

Query  666   QAQK-AAFMRERCPSQAWS-------------SDTDVVDGEERE------KTTPLKQGKS  785
             + +K AA  RER  S A+S             S++D   GE+ +         P    + 
Sbjct  266   RKRKEAALKRERTLSDAFSQQTRRAGRNSSIGSESDF--GEKHQWMDRWMAAKPWDNSRG  323

Query  786   RAPAIQRRNPVKSGEI-----------NVR-----IRSLQHKSASSVQapatpspakpkp  917
             RA   Q  +PVK+ E+           N+R      +  QH+  SS    +  + +   P
Sbjct  324   RASTDQSIDPVKTVEMDTSQPYSYLAPNLRRSDERQQHQQHQRPSSPLHISYQNQSFQFP  383

Query  918   VRPT---TSPGNL----------EKSHSTANTPRLCPTNRSASFAPRYSISGIS------  1040
             V P+   T P  +          ++S++ A TP L P +        YS +GIS      
Sbjct  384   VTPSPSKTRPIQVRSASPRCPRDDRSNNGAQTPSLKPNS-------NYSFNGISHQRNRP  436

Query  1041  -------PGYMAATESAKARLRSQSAPRQRPSTP-------AKRCLSYSISVKNGE----  1166
                    P YMAATESA AR+RSQSAPRQRPSTP       AK+ LS+ +  + G     
Sbjct  437   TPGAAPIPNYMAATESALARIRSQSAPRQRPSTPERDRAGSAKKRLSFPVPDRYGNIPIG  496

Query  1167  -----------------EGVEKRSEYWCNNNNTERESVGGEISPCSTTNSR  1268
                               GV    E   N ++   ES+GGEISP ST++ R
Sbjct  497   YGAGYEHSLRSPSFKSLNGVHFVYEQQSNYSSCCTESLGGEISPSSTSDLR  547



>ref|XP_002265121.1| PREDICTED: protein IQ-DOMAIN 1 [Vitis vinifera]
 emb|CBI38703.3| unnamed protein product [Vitis vinifera]
Length=557

 Score =   185 bits (469),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 157/425 (37%), Positives = 212/425 (50%), Gaps = 109/425 (26%)
 Frame = +3

Query  315   AATVIQTAFRCYLAKRALVALKGIVKLQALIRGQNVRRQARITLKCMQALFRVQERMREQ  494
             AA VIQTAFR YLAKRAL ALKG+VKLQAL+RG NVR+QA++TL+CMQAL RVQ R+ +Q
Sbjct  139   AAIVIQTAFRGYLAKRALRALKGLVKLQALVRGHNVRKQAKMTLRCMQALVRVQARVLDQ  198

Query  495   CARISQDSARKSMFSGSTNSWESKY---IRERKSIFRDHCSVGEAWRDCPPTLQELEVML  665
               R+S + +RKS FS + + WES+Y   I ERKSI R+  S+ + W + P T++E++ ML
Sbjct  199   RLRLSHEGSRKSTFSDTNSLWESRYLQDIAERKSISREGSSIADDWDERPHTIEEVKAML  258

Query  666   QAQK-AAFMRERCPSQA-----WSSDTDVVDGEERE------------KTTPLKQGKSRA  791
             Q +K AA  RE+  SQA     W +      G E E             T P  + + RA
Sbjct  259   QTRKEAALKREKNLSQALSQQIWRTGRSPSMGNEDELEEKPKWLDRWMATKPW-ESRGRA  317

Query  792   PAIQRRNPVKSGEINV------------------------------RIRSLQHKSASSVQ  881
                Q R+P+K+ EI+                                + S  H++  +V 
Sbjct  318   STDQ-RDPIKTVEIDTSQPYSYLAPNFRRSNQNQYQPNQFQRPNSHSVASPLHRAHQNVS  376

Query  882   apatpspakpkpVRP----TTSP--GNLEKSHSTANTPR----------LCPTNRSASFA  1013
                +P    P   RP    + SP  G  ++S  T+ TP           L    R A+ +
Sbjct  377   HHQSPITPSPSKTRPLQVRSASPRCGREDRSLHTSQTPSLRSNYYYNGGLHQQGRGATTS  436

Query  1014  PRYSISGISPGYMAATESAKARLRSQSAPRQRPSTP-------------AKRCLSYSI--  1148
                S     P YMAATES KAR+RSQSAPRQRPSTP             A++ LS+    
Sbjct  437   GGGSGGPALPNYMAATESTKARVRSQSAPRQRPSTPERERGGPGSVSGSARKRLSFPAPD  496

Query  1149  ---------------------SVKNGEEGVEKRSEYWCNNNNTERESVGGEISPCSTTNS  1265
                                  SV  G  G+E++S Y    ++   +S+GGEISP ST++ 
Sbjct  497   PYSGGIGYGGYGHNLRSPSFKSVGGGYLGLEQQSNY----SSCCTDSLGGEISPSSTSDL  552

Query  1266  RWW*R  1280
             R W R
Sbjct  553   RRWMR  557



>ref|XP_009400087.1| PREDICTED: protein IQ-DOMAIN 14-like [Musa acuminata subsp. malaccensis]
Length=498

 Score =   184 bits (466),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 181/497 (36%), Positives = 242/497 (49%), Gaps = 107/497 (22%)
 Frame = +3

Query  102   GANSWLTALKRVFIRYPSKDrksrhskrdeeeekkrdkgrrWLFSK--TADENSVGGVEI  275
             G++SWLTA+KR F+  PSKD + + S + EEEEK++ + RRW+F K  T ++        
Sbjct  5     GSSSWLTAVKRAFM-SPSKDSERKTSGQGEEEEKRKREKRRWMFRKPSTLEQQQQARAPT  63

Query  276   I--------------------------------SRTPPPSRRLL---CAATVIQTAFRCY  350
             +                                 R   PS   +    AA VIQTAFR Y
Sbjct  64    VVTPEERHAIALAVASAATAEAAVATAQAAAEVVRLTRPSASFVKEHYAAVVIQTAFRGY  123

Query  351   LAKRALVALKGIVKLQALIRGQNVRRQARITLKCMQALFRVQERMREQCARISQDSARK-  527
             LA+RAL ALKG+VKLQAL+RG NVR+QA +TL+CMQAL R Q R+REQ  R++Q+SA   
Sbjct  124   LARRALRALKGLVKLQALVRGHNVRKQANMTLRCMQALVRAQARVREQRMRLAQESAAAV  183

Query  528   ------SMFSGSTNSWESKYIR---ERKSIFRDHCSVGEAWRDCPPTLQELEVMLQAQK-  677
                   S FS  T+ W+SKY++   ER+S+ RD  S  + W D P T+ E++  LQ +K 
Sbjct  184   SRGSNISSFSCDTSFWDSKYLQELAERRSMSRDGSSFADDWDDRPRTMDEIQATLQRRKD  243

Query  678   AAFMRERCPSQAWSS-------------DTDVVD-----GEER----------EKTTPLK  773
             AA  RER  S A+S              D DV       GE+R           +++   
Sbjct  244   AALRRERALSYAFSHKLLRSDRSSSRLLDEDVDGEVASAGEQRPSRWMDRWIASRSSFDN  303

Query  774   QGKSRAPA-IQRRNPVKSGEINV----------RIRSLQHKSASSVQapatpspakpkpV  920
             +  SRA A +  R+P+K+ EI+             R     S   V              
Sbjct  304   RASSRARASVGYRDPIKTLEIDTSRPYSYSAPANPRRQTPPSPQPVPLHRGHHHRHQTHS  363

Query  921   RPTTSPGNLEKSHSTANTPRLC-PTNRSASFA--PRYSISGISPGYMAATESAKARLRSQ  1091
               T SP  +      + +PR     +RS S A  P Y  +   P YMAATESAKARLRSQ
Sbjct  364   PTTPSPSEMRPLQVRSASPRCGRQDHRSISTAQTPTYHPAASVPNYMAATESAKARLRSQ  423

Query  1092  SAPRQRPSTP-------AKRCLSY-------SISVKNGEEGVEKRSEYWCNNNNTERESV  1229
             SAPRQRP TP       AK+ LS+       S S K+         E   N +++  +S+
Sbjct  424   SAPRQRPGTPDRDRASSAKKRLSFPEPENLRSPSFKSA--AARFAGEPRSNVSSSCNDSL  481

Query  1230  GGEISPCSTTNSRWW*R  1280
              GE SP STT+ R W R
Sbjct  482   VGEASPSSTTDLRRWLR  498



>ref|XP_006343775.1| PREDICTED: protein IQ-DOMAIN 14-like [Solanum tuberosum]
Length=496

 Score =   184 bits (466),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 125/249 (50%), Positives = 162/249 (65%), Gaps = 35/249 (14%)
 Frame = +3

Query  87   MVKKLGANSWLTALKRVFIRYPSKD----rksrhskrdeeeekkrdkgrrWLFSK-TADE  251
            M KK G  SWL+A+KR F R P+KD    +K++     +E+E+K+ + RRWLF K + +E
Sbjct  1    MGKKKGGTSWLSAVKRAF-RSPTKDNSCDKKAKIEHELDEDEEKKREKRRWLFRKQSQNE  59

Query  252  NSV-----------------GGVEII----SRTPPPSRRLLCAATVIQTAFRCYLAKRAL  368
              V                   VEII    S   P S R   AA +IQTAFR YLA+RAL
Sbjct  60   GKVIVDPKHATAAAAVATAQAAVEIIRLTRSSNNPSSNRQHNAAVLIQTAFRGYLARRAL  119

Query  369  VALKGIVKLQALIRGQNVRRQARITLKCMQALFRVQERMREQCARISQDSARKSMFSGST  548
            +ALKGIVKLQALIRGQNVR+QA++TLKCMQAL RVQ R+REQ AR+S D  R+SMF+ +T
Sbjct  120  IALKGIVKLQALIRGQNVRKQAKMTLKCMQALLRVQARVREQRARLSHDGGRRSMFAETT  179

Query  549  NSWESKY---IRERKSIFRDHCSVGEAWRDCPPTLQELEVMLQAQK-AAFMRERCPSQAW  716
            N W+SKY   IR+RKS  RD  S+ +   DCP +L ELE MLQA+K A+F RE+  + A+
Sbjct  180  NLWDSKYLRDIRDRKSRSRDGSSIAD---DCPRSLLELESMLQARKEASFKREKSLAHAF  236

Query  717  S-SDTDVVD  740
            +  + D +D
Sbjct  237  TQQELDEMD  245


 Score = 90.1 bits (222),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 70/153 (46%), Positives = 83/153 (54%), Gaps = 44/153 (29%)
 Frame = +3

Query  918   VRPTTSPGNLEKSHSTANTPRLCPTNRSASFAPRYSISGIS---PGYMAATESAKARLRS  1088
             +RPT SP    KS STANTP L  T+RS S   RYS SG     P YMAATESAKAR+RS
Sbjct  356   MRPT-SP---RKSQSTANTPCLRSTSRSNSIMSRYSTSGNDASVPNYMAATESAKARIRS  411

Query  1089  QSAPRQRPSTP-------AKRCLSYSI----------------------SVKNGEEGVEK  1181
             QS P+QRPSTP        K+ LSY I                      S++    G+E+
Sbjct  412   QSTPKQRPSTPERERVGSVKKRLSYPIPEPYSLNAAYGYSQNLRSPSFKSLQAAYVGMEQ  471

Query  1182  RSEYWCNNNNTERESVGGEISPCSTTNSRWW*R  1280
             +S Y         +S+GGEISPCSTT+ R W R
Sbjct  472   QSCY--------TDSLGGEISPCSTTDLRRWLR  496



>ref|XP_002875013.1| IQ-domain 17 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH51272.1| IQ-domain 17 [Arabidopsis lyrata subsp. lyrata]
Length=534

 Score =   182 bits (462),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 152/425 (36%), Positives = 209/425 (49%), Gaps = 97/425 (23%)
 Frame = +3

Query  288   PPPSRRLL------------CAATVIQTAFRCYLAKRALVALKGIVKLQALIRGQNVRRQ  431
             PPP+  LL             AA VIQT FR YLA+RAL ALKG+VKLQAL+RG NVR+Q
Sbjct  113   PPPTMELLNLTRRTYTAREDYAAVVIQTGFRGYLARRALRALKGLVKLQALVRGHNVRKQ  172

Query  432   ARITLKCMQALFRVQERMREQCARISQDSARKSMFSGSTNSWESKY---IRERKSIFRDH  602
             A++TL+CMQAL RVQ R+ +Q  R+S D +RKS FS + +  ES+Y   I +R+S+ R+ 
Sbjct  173   AKMTLRCMQALVRVQSRVLDQRKRLSHDGSRKSAFSDTQSVLESRYLQDISDRRSMSREG  232

Query  603   CSVGEAWRDCPPTLQELEVMLQAQKAAFMRERCP---SQAWSSDT-----DVVDGEEREK  758
              S+ E W D P T++E++ MLQ ++   +R       SQA+S            G+E E+
Sbjct  233   SSIAEDWDDRPHTIEEVKAMLQQRRDNALRRESNNSLSQAYSHQVRRTRGSYSTGDEDEE  292

Query  759   TTP-------------------------------------LKQGKSRAPAIQRRNPVKSG  827
               P                                     L +G SR  A   RN   S 
Sbjct  293   ERPKWLDRWMASKPWDKRASTDQRVPPVYKTVEIDTSQPYLTRGNSRTGASPSRNQRPSS  352

Query  828   EINVRIRSLQHKSASSVQapatpspakpkpVRPTTSPGNLEKSHSTANTPRLCPTNRSAS  1007
                      QH  +S+  +PA   P + +   P     +    + T+NTP L  +N S +
Sbjct  353   PSRTSHHYQQHNFSSATPSPAKSRPIQIRSASPRIQRDDRSAYNYTSNTPSLR-SNYSFT  411

Query  1008  FAPRYSISGIS--------PGYMAATESAKARLRSQSAPRQRPSTP-------AKRCLSY  1142
                 YS+S  +        P YMA TESAKAR+RSQSAPRQRPSTP       A++ LS+
Sbjct  412   ARSGYSVSTATTTATNAALPNYMAITESAKARIRSQSAPRQRPSTPEKERIGSARKRLSF  471

Query  1143  SI------------------SVKNGEEG-VEKRSEYWCNNNNTERESVGGEISPCSTTNS  1265
              +                  S+   + G +E++S Y  ++  TE    GGEISP ST++ 
Sbjct  472   PVPPLPQQIDGQSLRSPSFKSIGGSQLGALEQQSNY--SSCCTESLGGGGEISPASTSDY  529

Query  1266  RWW*R  1280
             R W R
Sbjct  530   RRWLR  534



>ref|XP_008239264.1| PREDICTED: protein IQ-DOMAIN 1-like [Prunus mume]
Length=519

 Score =   181 bits (460),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 153/407 (38%), Positives = 210/407 (52%), Gaps = 100/407 (25%)
 Frame = +3

Query  315   AATVIQTAFRCYLAKRALVALKGIVKLQALIRGQNVRRQARITLKCMQALFRVQERMREQ  494
             AAT+IQTAFR YLA+RAL ALKG+VKLQAL+RG NVR+ A++TLKCMQAL RVQ+++R +
Sbjct  123   AATLIQTAFRGYLARRALRALKGLVKLQALVRGHNVRKHAKLTLKCMQALLRVQDQVRNE  182

Query  495   CARISQDSARKSMFSGSTNS-WESKY---IRERKSIFRDHCSVGEAWRDCPPTLQELEVM  662
              +R+S D  RKSM++ +    WES+Y   IR+RKS+ R+    G+ W +       +E M
Sbjct  183   RSRLSHDGGRKSMYAETDFPLWESRYLHDIRDRKSMSREKSRGGDDWDEG------VEAM  236

Query  663   LQAQK-AAFMRERCPSQAWSS-------DTDVVDGEEREKTTPLK--------QGKSRAP  794
             LQ+++ AA  RE+  + A+S        +    + E  E+T  L         +  SRA 
Sbjct  237   LQSRREAALKREKALAYAFSHQIWKPRRNPSAGEAELEERTKWLDRWMATKQFEHSSRA-  295

Query  795   AIQRRNPVKSGEINVRIRSLQHK-SASSVQapatpspakp-kpVRPTTSPGNLEKSH---  959
             +I +R+ +K+ EI+   R   +  SA +V+   + S  +      P  SP  L KSH   
Sbjct  296   SIDKRDTIKTVEIDTNSRPYSYSYSAPNVRISTSHSQLQKPPSPYPIASPSPLHKSHYIN  355

Query  960   ---------------------------------STANTPRLCPTNRSASFAPRYSI--SG  1034
                                              S A+TP L     S S+  R S+  S 
Sbjct  356   HLSTATPSPSKPKYLKVRSASPRCLKEEKYCCSSAAHTPNLG----SNSYCFRGSMCRSA  411

Query  1035  ISPGYMAATESAKARLRSQSAPRQRPSTP--------AKRCLSYSI--------SVKNG-  1163
             I P YMAATESAKA+ RS SAPR RPSTP        AK+ LSY +        SV  G 
Sbjct  412   I-PNYMAATESAKAKARSLSAPRTRPSTPERERGGGSAKKRLSYPVPAEALQHNSVGIGC  470

Query  1164  -----------EEGVEKRSEYWCNNNNTERESVGGEISPCSTTNSRW  1271
                         + V+    Y   N ++  +S+GGEISPCSTT+ RW
Sbjct  471   SSFSHNLRSPSYKSVQNNGYYGRENLSSYTDSLGGEISPCSTTDLRW  517



>gb|EYU26081.1| hypothetical protein MIMGU_mgv1a022919mg, partial [Erythranthe 
guttata]
Length=261

 Score =   174 bits (441),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 116/271 (43%), Positives = 147/271 (54%), Gaps = 77/271 (28%)
 Frame = +3

Query  96   KLGANSWLTALKRVF---IRYPSKDrksrhskrdeeeekkrdkgrrWLFSK---------  239
            K G  SWLTA+KR F   + +P +D   + +++             WLF K         
Sbjct  3    KKGGTSWLTAVKRAFRRKVDHPQEDDDEKKTEKRR-----------WLFKKHSTNNNNNA  51

Query  240  -----TADENSVGGVEIISRTPPP------------------------------------  296
                  A E S G   I  RTPPP                                    
Sbjct  52   QLSGEAAKEQSDG---IAPRTPPPPAEHMHAIAVAAATAAAAEAAVATAKAAVEIFRLTQ  108

Query  297  ---SRRLLCAATVIQTAFRCYLAKRALVALKGIVKLQALIRGQNVRRQARITLKCMQALF  467
               S R  CAA VIQTAFR YLA+RAL+ALKGIVKLQALIRGQNVR+QA +T+KCMQ L 
Sbjct  109  QPSSFRQHCAARVIQTAFRGYLARRALIALKGIVKLQALIRGQNVRKQATMTMKCMQTLL  168

Query  468  RVQERMREQCARISQDSA---RKSMFSGSTNSWESKY---IRERKSIFRDHCSVGEAWRD  629
            RVQ +MREQ AR+S + +   RKSMF+ +TN WESKY   IR+RKS  RD  S+ + WR+
Sbjct  169  RVQAKMREQRARLSHEDSGRGRKSMFAETTNLWESKYLKDIRDRKSRSRDGSSMTDDWRN  228

Query  630  CPPTLQELEVMLQAQ-KAAFMRERCPSQAWS  719
            CP TL+ELE +L+A+ +AA   E+  + A+S
Sbjct  229  CPRTLEELEAILKARNEAALTHEKSLAFAFS  259



>gb|KHG21404.1| Protein IQ-DOMAIN 14 -like protein [Gossypium arboreum]
Length=500

 Score =   180 bits (456),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 148/409 (36%), Positives = 211/409 (52%), Gaps = 85/409 (21%)
 Frame = +3

Query  288   PPPSRRLLCAATVIQTAFRCYLAKRALVALKGIVKLQALIRGQNVRRQARITLKCMQALF  467
             P   R+   AA VIQTAFR YLA+RAL ALKG+VKLQAL+RG NVR+QA++TL+CMQAL 
Sbjct  99    PSYGRKHHFAAIVIQTAFRGYLARRALRALKGLVKLQALVRGHNVRKQAKMTLRCMQALV  158

Query  468   RVQERMREQCARISQDS-ARKSMFSGSTNSWESKY---IRERKSIFRDHCSVGEAWRDCP  635
             +VQ R+ +Q  R+S D  +RKS FS   ++WES+Y   I +R+S+ R   S+ + W + P
Sbjct  159   KVQSRVLDQRMRLSHDGCSRKSAFS---DTWESRYLQDISDRRSLSRGGSSIADDWDERP  215

Query  636   PTLQELEVMLQAQK-AAFMRERCPSQAWSSD------TDVVDGEER--EKTTPLKQGKSR  788
              T++E++ MLQ +K AA  RE+  SQA S        +  + G++   ++  P K   +R
Sbjct  216   HTVEEVKAMLQHRKEAALKREKSLSQALSQQMRRARRSPSMGGQDEWLDRWMPAKPWDNR  275

Query  789   APA-IQRRNPVKSGEINV------------RIRSLQHKSASSVQapatpspakpkpVRPT  929
               A + +R+ VK+ E++             R  S  +    S         A+     P 
Sbjct  276   GRASMDQRDNVKTVEMDTSQPYSYVAPNYRRTNSNHYHQRPSSPLHRAQHNAQAFHPSPI  335

Query  930   T-SPGNLEKSHSTANTPRLCPTNRSA-------SFAPRYSISG--------------ISP  1043
             T SP         + +PR    +R++       S    Y  +G                P
Sbjct  336   TPSPSKTRPVQVQSASPRCVREDRTSFSSSQTPSLRSNYYYTGRVSTQASTSINNATTLP  395

Query  1044  GYMAATESAKARLRSQSAPRQRPSTP-------AKRCLSYSI------------------  1148
              YMAATESAKAR+RSQSAPRQRPSTP       A++ LS+ I                  
Sbjct  396   NYMAATESAKARIRSQSAPRQRPSTPEMDRIGSARKRLSFPIPEPYGIGMGYGGYGHSLR  455

Query  1149  -----SVKNGEEGVEKRSEYWCNNNNTERESVGGEISPCSTTNSRWW*R  1280
                  SV   + G+E++S Y    ++   ES+GGE+SP ST++ R W R
Sbjct  456   SPSFKSVSGSQFGLERQSNY----SSCCTESLGGEMSPSSTSDLRRWLR  500



>ref|XP_009387679.1| PREDICTED: protein IQ-DOMAIN 1-like [Musa acuminata subsp. malaccensis]
Length=537

 Score =   180 bits (457),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 157/417 (38%), Positives = 211/417 (51%), Gaps = 96/417 (23%)
 Frame = +3

Query  315   AATVIQTAFRCYLAKRALVALKGIVKLQALIRGQNVRRQARITLKCMQALFRVQERMREQ  494
             AA VIQTAFR YLA+RAL ALKG+VKLQAL+RG NVR+QA +TL+CMQAL RVQ R+R+Q
Sbjct  122   AAIVIQTAFRGYLARRALRALKGLVKLQALVRGHNVRKQANMTLRCMQALVRVQARVRDQ  181

Query  495   CARISQDS-------ARKSMFSGSTNSWESKYIR---ERKSIFRDHCSVGEAWRDCPPTL  644
               R++Q+S       + KS F+  T+ WESKY +   ER+S+ RD  S  + W D P T+
Sbjct  182   RVRLAQESSAAVSRGSNKSSFNCDTSFWESKYFQELAERRSMSRDGSSFADDWDDRPRTM  241

Query  645   QELEVMLQAQK-AAFMRERCPS-----QAWSSD-------TDVVDGE--EREKTTPLK--  773
             +E++ MLQ +K AA  RER  S     Q W SD        + VDGE    E   P +  
Sbjct  242   EEIQAMLQVRKEAALKRERALSYAFSHQLWRSDRNPSPLLDEEVDGEVASVEDKRPHRWM  301

Query  774   ------------QGKSRAPA-IQRRNPVKSGEINVRIRSLQHKSASSVQapatpspakpk  914
                         +  SRA A    R+P+K+ EI+   R   + + ++ +    P P +P 
Sbjct  302   DRWIASRPSFDNRVSSRARASTDYRDPIKTLEIDT-ARPFSYSAPANPRRQTPPPPPQPV  360

Query  915   pVRPTT-------------SP--------------------GNLEKSHSTANTPRLCPTN  995
                PT+             SP                    G  ++S ST  TP      
Sbjct  361   GQHPTSPLHRTHLHNYQAYSPATPSPSKTRPLQVRSASPRCGREDRSLSTVQTPNYHHHA  420

Query  996   RSASFAPRYS----ISGISPGYMAATESAKARLRSQSAPRQRPSTP-------AKRCLSY  1142
              ++S + R      +    P YMAATESAKAR+RSQSAPRQRP TP       AK+ LS+
Sbjct  421   AASSSSSRQHHPAPLGAAVPNYMAATESAKARVRSQSAPRQRPGTPDRDRGGSAKKRLSF  480

Query  1143  SISVKNG-----EEGVEKRSEYW------CNNNNTERESVGGEISPCSTTNSRWW*R  1280
                 + G          K +  W       N ++   +S+GGE+SP STT+ R W R
Sbjct  481   PAPDQQGCSQNLRSPSFKSAAGWFPGEQRSNVSSCCNDSLGGEVSPSSTTDLRPWLR  537



>ref|XP_002302670.2| hypothetical protein POPTR_0002s17930g [Populus trichocarpa]
 gb|EEE81943.2| hypothetical protein POPTR_0002s17930g [Populus trichocarpa]
Length=556

 Score =   180 bits (457),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 152/436 (35%), Positives = 212/436 (49%), Gaps = 128/436 (29%)
 Frame = +3

Query  315   AATVIQTAFRCYLAKRALVALKGIVKLQALIRGQNVRRQARITLKCMQALFRVQERMREQ  494
             AA VIQTAFR YLA+RAL ALKG+VKLQAL+RG NVR+QA++TL+CMQAL RVQ R+ +Q
Sbjct  135   AAIVIQTAFRGYLARRALRALKGLVKLQALVRGHNVRKQAKMTLRCMQALARVQARVLDQ  194

Query  495   CARISQDSARKSMFSGSTNSWESKY---IRERKSIFRDHCSVGEAWRDCPPTLQELEVML  665
               R+S + +RKS FS + +  ES+Y   I +RKS+ R+  S+ + W D P +++E++ ML
Sbjct  195   RVRLSHEGSRKSAFSDTNSVLESRYLQDISDRKSMSRESSSIADDWDDRPHSIEEVKAML  254

Query  666   QAQK-AAFMRERCPSQAWS--------SDTDVVDGEEREKTTPLKQ--------GKSRAP  794
             Q +K AAF RE+  SQA+S        S ++  + E +E+   L Q          SRA 
Sbjct  255   QRRKEAAFKREKTLSQAFSQQIWRNGRSPSNGNEDELQERPQWLDQWMPAKPWDNSSRAR  314

Query  795   A-IQRRNPVKSGEINV------------RIRSLQHKSASSVQapatpspakpkpVRPTTS  935
             A   +R+P+K+ EI+             R    QH       +               ++
Sbjct  315   ASTDQRDPIKTVEIDTSQPYSYLVPNFRRTNQNQHHQHQRSNSSNNGVAH--------SA  366

Query  936   PGNLEKSHSTA---NTP------------------------RLCPTNRSASFAPRYSISG  1034
             P  L ++H TA   ++P                        R C ++++ S    Y  +G
Sbjct  367   PSPLHRAHQTAPLHHSPITPSPSKTRPLQVRSASPRCAREDRSCNSSQTPSLRSNYFYNG  426

Query  1035  -------------------ISPGYMAATESAKARLRSQSAPRQRPSTP-------AKRCL  1136
                                  P YMAATESAKARLRSQSAPRQRPSTP       A++ L
Sbjct  427   SLNQHGIRGGASVSSNGNATLPNYMAATESAKARLRSQSAPRQRPSTPERDRIGSARKRL  486

Query  1137  SY------SISVKNGEE--------------------GVEKRSEY--WCNNNNTERESVG  1232
             SY       + +  G                      G+E++S Y   C       +S G
Sbjct  487   SYPAPDPCDVGIVYGGAGYGHGLRSPSFKSVSGSRLGGLEQQSNYSSCCT------DSFG  540

Query  1233  GEISPCSTTNSRWW*R  1280
             GE+SP ST + R W R
Sbjct  541   GELSPSSTNDLRRWLR  556



>ref|XP_002529980.1| calmodulin binding protein, putative [Ricinus communis]
 gb|EEF32423.1| calmodulin binding protein, putative [Ricinus communis]
Length=545

 Score =   180 bits (457),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 149/412 (36%), Positives = 206/412 (50%), Gaps = 95/412 (23%)
 Frame = +3

Query  315   AATVIQTAFRCYLAKRALVALKGIVKLQALIRGQNVRRQARITLKCMQALFRVQERMREQ  494
             AA VIQTAFR YLA+RAL ALKG+VKLQAL+RG NVR+QA++TL+CMQAL RVQ R+ +Q
Sbjct  139   AAIVIQTAFRGYLARRALRALKGLVKLQALVRGHNVRKQAKMTLRCMQALVRVQARVLDQ  198

Query  495   CARISQDSARKSMFSGSTNSWESKY---IRERKSIFRDHCSVGEAWRDCPPTLQELEVML  665
               R+S + +RKS FS + +  ES+Y   I +RKS+ R+  S+ + W +   T++E++ ML
Sbjct  199   RVRLSHEGSRKSAFSDTNSVIESRYLQDISDRKSMSREGSSIADDWDERAHTVEEVKAML  258

Query  666   QAQK-AAFMRERCPSQAWS--------SDTDVVDGEEREK---------TTPLKQGKSRA  791
             Q +K AA  RE+  SQ  S        S +   D E +E+         T P    ++RA
Sbjct  259   QHRKEAAMKREKTLSQGLSQQIWRTRRSPSIGNDDELQERPQWLDRWIATKPWDSSRARA  318

Query  792   PAIQRRNPVKSGEINV---------RIRSLQHKSASSVQapatpspakpkpVRP------  926
                Q R+P+K+ EI+            R   H      +   +    +     P      
Sbjct  319   STDQ-RDPIKTVEIDTSQPYSYLAPNFRRTNHSQYHQQRQRPSSPLHRAHQTAPHHHSPV  377

Query  927   TTSPGNLEKSHSTANTPRLCPTNR------SASFAPRYSISGIS----------------  1040
             T SP         + +PR    +R      + S    Y  +G S                
Sbjct  378   TPSPSKSRPVQVRSASPRCIREDRIYNPSQTPSLRSNYHYTGNSHQRASGSSNNSNASTA  437

Query  1041  --PGYMAATESAKARLRSQSAPRQRPSTP---------AKRCLS------YSISVKNGE-  1166
               P YMAATESAKAR+RSQSAPRQRPSTP         AK+ LS      Y++ +  G  
Sbjct  438   ALPNYMAATESAKARIRSQSAPRQRPSTPERDRVGSATAKKRLSFPVPDPYNVGMGYGHG  497

Query  1167  --------------EGVEKRSEYWCNNNNTERESVGGEISPCSTTNSRWW*R  1280
                            G+E++S Y    ++   ES+GGEISP ST++ R W R
Sbjct  498   LRSPSFKSVSGVHFGGLEQQSNY----SSCCTESLGGEISPSSTSDLRRWLR  545



>ref|XP_004245451.1| PREDICTED: protein IQ-DOMAIN 1-like [Solanum lycopersicum]
Length=489

 Score =   179 bits (454),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 124/252 (49%), Positives = 161/252 (64%), Gaps = 42/252 (17%)
 Frame = +3

Query  87   MVKKLGANSWLTALKRVFIRYPSKD----rksrhskrdeeeekkrdkgrrWLFSK-----  239
            M KK GA SWL+A+KR F R P+KD    +K++   + +E+E+K+   RRWLF K     
Sbjct  1    MGKKKGATSWLSAVKRAF-RSPTKDNSCDKKAKIEHQLDEDEEKKRDKRRWLFRKQSQSE  59

Query  240  ----------TADENSVG----GVEII----SRTPPPSRRLLCAATVIQTAFRCYLAKRA  365
                       A E +V      +EII    S    PS     AA +IQTAFR YLA+RA
Sbjct  60   GKAMVDPKHAIAPEAAVATDQAALEIIRLTRSNKYSPSNN---AAVLIQTAFRGYLARRA  116

Query  366  LVALKGIVKLQALIRGQNVRRQARITLKCMQALFRVQERMREQCARISQDSARKSMFSGS  545
            L+ALKGIVKLQALIRGQNVR+QA++TLKCMQAL RVQ R+REQ AR+S D  R+SMF+ +
Sbjct  117  LIALKGIVKLQALIRGQNVRKQAKMTLKCMQALLRVQARVREQRARLSHDGGRRSMFAET  176

Query  546  TNSWESKY---IRERKSIFRDHCSVGEAWRDCPPTLQELEVMLQAQK-AAFMRERCPSQA  713
            TN W+SKY   IR+R S  RD  S+ +   DCP +L ELE MLQA+K A+F RE+  + A
Sbjct  177  TNLWDSKYLRDIRDRNSRSRDGSSIAD---DCPRSLVELESMLQARKEASFKREKSLAHA  233

Query  714  WS----SDTDVV  737
            ++     + D+V
Sbjct  234  FTQQELDEMDIV  245



>ref|XP_008799003.1| PREDICTED: protein IQ-DOMAIN 1-like isoform X2 [Phoenix dactylifera]
Length=552

 Score =   180 bits (456),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 151/407 (37%), Positives = 212/407 (52%), Gaps = 94/407 (23%)
 Frame = +3

Query  315   AATVIQTAFRCYLAKRALVALKGIVKLQALIRGQNVRRQARITLKCMQALFRVQERMREQ  494
             AA VIQ  FR YLA+RAL AL+G+VKLQAL+RGQNVRRQA  TL+CMQAL RVQER+R+Q
Sbjct  155   AAIVIQAGFRGYLARRALKALRGLVKLQALVRGQNVRRQANTTLRCMQALVRVQERVRDQ  214

Query  495   CARISQDSA-----RKSMFSGSTNSWESKY---IRERKSIFRDHCSVGEAWRDCPPTLQE  650
              AR++++ A     + + FS  T+ W+S+Y   I +R+S+ RD     + W D P T++E
Sbjct  215   RARLAREGASWRSNKSTTFSCDTSFWDSRYLHDIADRRSMSRDGSGRADDWVDHPRTIEE  274

Query  651   LEVMLQAQK-AAFMRERCPS-----QAWSSD----TDVVDGEEREKTTPLKQGK------  782
             ++ ML+ +K AA  RER  S     Q W SD    + +  GEE+E+ + + +G+      
Sbjct  275   IQSMLEGRKEAALRRERALSYAFSQQPWRSDRKTSSGLSFGEEQEEDSAVSEGEQRPRRW  334

Query  783   ----------------SRAPAIQRRNPVKSGEINVRIRSL-------QHKSASSVQapat  893
                             SR  A   R+P+K+ EI+   RS        +H+  +S     +
Sbjct  335   LDRWMASRTSCDNRNASRGRATMERDPIKTLEIDT-ARSYSTPTTARRHQQPASPHHLHS  393

Query  894   ------pspakpkpVRPTTSP--GNLEKSHSTANTPRLCPTNRSASFAPRYSISG-----  1034
                    + ++   VR + SP  G+ E+S ++ +TP       ++S   RYS  G     
Sbjct  394   PATPSPSNASRALQVR-SASPRCGSEERSSASVHTP-------TSSGYYRYSGEGGQRRH  445

Query  1035  ----ISPGYMAATESAKARLRSQSAPRQRPSTP--------AKRCLSYSI--------SV  1154
                   P YMAATESAKARLRSQSA RQRP TP        AK+ LS+ +          
Sbjct  446   HHHPAVPNYMAATESAKARLRSQSATRQRPMTPEREQRSGLAKKRLSFPLPEPYGGGGDR  505

Query  1155  KNGEEGVEKRSEYWCNNNNTER-----ESVGGEISPCSTTNSRWW*R  1280
                 + +   S    N    E+     ES+ GE+SP STT  R W R
Sbjct  506   GGYSQSLRSPSFKSANGRIGEQSSCCTESIAGEVSPTSTTYLRRWLR  552



>gb|KFK42501.1| hypothetical protein AALP_AA1G001700 [Arabis alpina]
Length=516

 Score =   179 bits (453),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 184/527 (35%), Positives = 255/527 (48%), Gaps = 140/527 (27%)
 Frame = +3

Query  87    MVKKLGANSWLTALKRVFIRYPSKDrksrhskrdeeeekkrdkgrrWLFSKTADE-----  251
             M KK G++SWLTA+KR F R P+K ++   ++  EE+E+K+ + RRWLF K A       
Sbjct  1     MGKKNGSSSWLTAVKRAF-RSPNK-KEHHGNENIEEDEEKKREKRRWLFRKPATSQESPV  58

Query  252   --------------NSVGGVEIISRT----------------PPPSRRLLCA-----ATV  326
                           NS    EI +                  P  +RR+  A     A V
Sbjct  59    KPSPPPPPQESDKANSKTSPEIATTNAGKTPVAATSASPTVVPKVTRRVYYARENYAAVV  118

Query  327   IQTAFRCYLAKRALVALKGIVKLQALIRGQNVRRQARITLKCMQALFRVQERMREQCARI  506
             IQT+FR YLA+RAL ALKG+VKLQAL+RG NVR+QA++TL+CMQAL RVQ R+ +Q  R+
Sbjct  119   IQTSFRGYLARRALRALKGLVKLQALVRGHNVRKQAKMTLRCMQALVRVQSRVLDQRKRL  178

Query  507   SQDSARKSMFSGSTNSWESKY---IRERKSIFRDHCSVGEAWRDCPPTLQELEVMLQAQK  677
             S D +RKS FS S + +ES+Y   I +R+S+ R+  S+ E W D P T+ E++ MLQ ++
Sbjct  179   SHDGSRKSAFSDSHSGFESRYLQDISDRQSMSREGSSLAEDWDDRPHTIDEVKAMLQRRR  238

Query  678   AAFMRERCP--SQAWS-------------SDTDVVDGEEREK-------TTPLKQGKSRA  791
                +R      SQA+S              D +    EER K       T P  +  S  
Sbjct  239   DTALRHEKTNLSQAFSQQMWRTVGNQSAGGDHEAELEEERPKWLDRWMATRPWDKRASSR  298

Query  792   PAIQRRNPVKSGEI--------------------NVRIRSLQHKSASSVQapatpspakp  911
              ++    PVK+ EI                    N   R+  ++S ++  A  +P+ ++P
Sbjct  299   ASVDHTVPVKTVEIDTSQPYSRTRTGSPSRSQRPNSPSRTSHYQSRNNFSATPSPAKSRP  358

Query  912   kpVRPTT-----SPGNLEKSHS-TANTPRLCPTNRSASFAPRYSIS---------GISPG  1046
               +R  +      P +   S+S T+NTP L     + SF  R   S          + P 
Sbjct  359   IHIRSASPRCQRDPRDDRASYSYTSNTPSL---RSNYSFTARSGCSISTTMVNNASLLPN  415

Query  1047  YMAATESAKARLRSQSAPRQRPSTP-------AKRCLSYSI------------------S  1151
             YMA TESAKAR+RS SAPRQRPSTP        K+ LSY +                  S
Sbjct  416   YMANTESAKARIRSHSAPRQRPSTPERDRVGSVKKRLSYPVPPPPEYEDNNSLRSPSFKS  475

Query  1152  VKNGEEG--VEKRSEYW--CNNNNTERESVGGEISPCSTTNSRWW*R  1280
             V     G  +E++S Y   C   N      G EISP ST++ R W R
Sbjct  476   VAGSHFGGILEQQSNYSSCCTETN------GVEISPASTSDYRHWLR  516



>ref|XP_002320895.2| hypothetical protein POPTR_0014s10040g [Populus trichocarpa]
 gb|EEE99210.2| hypothetical protein POPTR_0014s10040g [Populus trichocarpa]
Length=559

 Score =   179 bits (454),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 156/442 (35%), Positives = 216/442 (49%), Gaps = 131/442 (30%)
 Frame = +3

Query  303   RLLCAATVIQTAFRCYLAKRALVALKGIVKLQALIRGQNVRRQARITLKCMQALFRVQER  482
             R   AA VIQTAFR YLA+RAL ALKG+VKLQAL+RG NVR+QA++TL+CMQAL RVQ R
Sbjct  133   RERSAAIVIQTAFRGYLARRALRALKGLVKLQALVRGHNVRKQAKMTLRCMQALVRVQAR  192

Query  483   MREQCARISQDSARKSMFSGSTNSWESKY---IRERKSIFRDHCSVGEAWRDCPPTLQEL  653
             + +Q  R+S + +R+S FS + + +ES+Y   I ERKS+ RD  S+ + W D P T++E+
Sbjct  193   VLDQRMRLSHEGSRESAFSDTNSVFESRYLQEISERKSMSRDGSSIADDWDDRPRTIEEV  252

Query  654   EVMLQAQK-AAFMRERCPSQAWS--------SDTDVVDGEEREKTTPLKQ--------GK  782
             + MLQ +K  AF RE+  SQ +S        S +   +GE +E++  L            
Sbjct  253   KAMLQRRKEVAFKREKALSQGFSQQIWRNRRSPSMGNEGELQERSQWLDHWMPAKPWDNS  312

Query  783   SRAPA-IQRRNPVKSGEINV---------------RIRSLQHKSASSVQapatpspakpk  914
             SRA A   +RNP+K+ EI                 + +  QH+ ++S+    T       
Sbjct  313   SRARASTDQRNPIKTVEIETSQPCSYLAPNFGRTNQNQYHQHQRSNSINNGVTR------  366

Query  915   pVRPTTSPGNLEKSHSTAN------TP---------------------RLCPTNRSASFA  1013
                  ++P  L ++H  A+      TP                     R C ++R+ S  
Sbjct  367   -----SAPPPLHRAHQDASLRHSPITPSPSRTRPLQVRSASPRCAREDRSCNSSRTPSLR  421

Query  1014  PRY----------------SISGIS----PGYMAATESAKARLRSQSAPRQRPSTP----  1121
               Y                S+SG +    P YMA TESAKARLRSQSAPRQRPSTP    
Sbjct  422   SNYLYNGNLKQHGIRGGAASVSGNANATLPNYMATTESAKARLRSQSAPRQRPSTPERDR  481

Query  1122  ---AKRCLSYSI-------------------------SVKNGE-EGVEKRSEYWCNNNNT  1214
                A++ L Y +                         SV      G+E++S Y     +T
Sbjct  482   VGSARKRLLYPVPDPYGVGMGYGGVGYGHGFRSPSFKSVSGSHFGGLEQQSNYSSCCTDT  541

Query  1215  ERESVGGEISPCSTTNSRWW*R  1280
                  G EISP ST++ R W R
Sbjct  542   ----FGAEISPSSTSDQRRWLR  559



>ref|XP_011039187.1| PREDICTED: protein IQ-DOMAIN 1 isoform X4 [Populus euphratica]
Length=558

 Score =   179 bits (453),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 156/440 (35%), Positives = 216/440 (49%), Gaps = 135/440 (31%)
 Frame = +3

Query  315   AATVIQTAFRCYLAKRALVALKGIVKLQALIRGQNVRRQARITLKCMQALFRVQERMREQ  494
             AA VIQTAFR YLA+RAL ALKG+VKLQAL+RG NVR+QA +TL+CMQAL RVQ R+ +Q
Sbjct  136   AAIVIQTAFRGYLARRALRALKGLVKLQALVRGHNVRKQANMTLRCMQALVRVQARVLDQ  195

Query  495   CARISQDSARKSMFSGSTNSWESKY---IRERKSIFRDHCSVGEAWRDCPPTLQELEVML  665
               R+S + +R+S FS + + +ES+Y   I ERKS+ RD  S+ + W D P T++E++ ML
Sbjct  196   RMRLSHEGSRESAFSDTNSVFESRYLQEISERKSMSRDGSSIADDWDDRPRTIEEVKAML  255

Query  666   QAQKA-AFMRERCPSQAWS--------SDTDVVDGEEREKTTPLKQ--------GKSRAP  794
             Q +K  AF RE+  SQA S        S +   +GE +E++  L            SRA 
Sbjct  256   QRRKDNAFKREKALSQASSQQIWRNRRSPSMGNEGELQERSQWLDHWMPAKPWDNSSRAR  315

Query  795   A-IQRRNPVKSGEINVRI---------------RSLQHKSASSVQapatpspakpkpVRP  926
             A   +R+P+K+ EI   +               +  QH+ ++S+    T           
Sbjct  316   ASTDQRDPIKTVEIENSLPCSYLAPNFGRTNQNQYHQHQRSNSINNGVTR----------  365

Query  927   TTSPGNLEKSHSTAN------TP---------------------RLCPTNRSASFAPRY-  1022
              ++P  L ++H  A+      TP                     R C ++R+ S    Y 
Sbjct  366   -SAPPPLHRAHQNASLHHSPITPSPSRTRPLQVRSASPRCAREDRSCNSSRTPSLRSNYL  424

Query  1023  ---------------SISGIS----PGYMAATESAKARLRSQSAPRQRPSTP-------A  1124
                            S+SG +    P YMA TESAKARLRSQSAPRQRPSTP       A
Sbjct  425   YNGNLNQHGIRGGAASVSGNANATLPNYMATTESAKARLRSQSAPRQRPSTPERDRAGSA  484

Query  1125  KRCLSYSI-------------------------SVKNGE-EGVEKRSEY--WCNNNNTER  1220
             ++ L Y +                         SV      G+E++S Y   C       
Sbjct  485   RKRLLYPVPDPYGVGMGYGGVGYGHGFRSPSFKSVSGSHFGGLEQQSNYSSCCT------  538

Query  1221  ESVGGEISPCSTTNSRWW*R  1280
             ++ GGEISP ST++ R W R
Sbjct  539   DTFGGEISPSSTSDQRRWLR  558



>ref|XP_011039178.1| PREDICTED: protein IQ-DOMAIN 1 isoform X3 [Populus euphratica]
Length=559

 Score =   178 bits (452),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 157/444 (35%), Positives = 217/444 (49%), Gaps = 135/444 (30%)
 Frame = +3

Query  303   RLLCAATVIQTAFRCYLAKRALVALKGIVKLQALIRGQNVRRQARITLKCMQALFRVQER  482
             R   AA VIQTAFR YLA+RAL ALKG+VKLQAL+RG NVR+QA +TL+CMQAL RVQ R
Sbjct  133   RERSAAIVIQTAFRGYLARRALRALKGLVKLQALVRGHNVRKQANMTLRCMQALVRVQAR  192

Query  483   MREQCARISQDSARKSMFSGSTNSWESKY---IRERKSIFRDHCSVGEAWRDCPPTLQEL  653
             + +Q  R+S + +R+S FS + + +ES+Y   I ERKS+ RD  S+ + W D P T++E+
Sbjct  193   VLDQRMRLSHEGSRESAFSDTNSVFESRYLQEISERKSMSRDGSSIADDWDDRPRTIEEV  252

Query  654   EVMLQAQKA-AFMRERCPSQAWS--------SDTDVVDGEEREKTTPLKQ--------GK  782
             + MLQ +K  AF RE+  SQA S        S +   +GE +E++  L            
Sbjct  253   KAMLQRRKDNAFKREKALSQASSQQIWRNRRSPSMGNEGELQERSQWLDHWMPAKPWDNS  312

Query  783   SRAPA-IQRRNPVKSGEINVRI---------------RSLQHKSASSVQapatpspakpk  914
             SRA A   +R+P+K+ EI   +               +  QH+ ++S+    T       
Sbjct  313   SRARASTDQRDPIKTVEIENSLPCSYLAPNFGRTNQNQYHQHQRSNSINNGVTR------  366

Query  915   pVRPTTSPGNLEKSHSTAN------TP---------------------RLCPTNRSASFA  1013
                  ++P  L ++H  A+      TP                     R C ++R+ S  
Sbjct  367   -----SAPPPLHRAHQNASLHHSPITPSPSRTRPLQVRSASPRCAREDRSCNSSRTPSLR  421

Query  1014  PRY----------------SISGIS----PGYMAATESAKARLRSQSAPRQRPSTP----  1121
               Y                S+SG +    P YMA TESAKARLRSQSAPRQRPSTP    
Sbjct  422   SNYLYNGNLNQHGIRGGAASVSGNANATLPNYMATTESAKARLRSQSAPRQRPSTPERDR  481

Query  1122  ---AKRCLSYSI-------------------------SVKNGE-EGVEKRSEY--WCNNN  1208
                A++ L Y +                         SV      G+E++S Y   C   
Sbjct  482   AGSARKRLLYPVPDPYGVGMGYGGVGYGHGFRSPSFKSVSGSHFGGLEQQSNYSSCCT--  539

Query  1209  NTERESVGGEISPCSTTNSRWW*R  1280
                 ++ GGEISP ST++ R W R
Sbjct  540   ----DTFGGEISPSSTSDQRRWLR  559



>dbj|BAF00832.1| hypothetical protein [Arabidopsis thaliana]
Length=534

 Score =   178 bits (451),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 148/403 (37%), Positives = 204/403 (51%), Gaps = 83/403 (21%)
 Frame = +3

Query  315   AATVIQTAFRCYLAKRALVALKGIVKLQALIRGQNVRRQARITLKCMQALFRVQERMREQ  494
             AA VIQT FR YLA+RAL ALKG+VKLQAL+RG NVR+QA++TL+CMQAL RVQ R+ +Q
Sbjct  134   AAVVIQTGFRGYLARRALRALKGLVKLQALVRGHNVRKQAKMTLRCMQALVRVQSRVLDQ  193

Query  495   CARISQDSARKSMFSGSTNSWESKYIRE---RKSIFRDHCSVGEAWRDCPPTLQELEVML  665
               R+S D +RKS FS + +  ES+Y++E   R+S+ R+  S+ E W D P T++E++ ML
Sbjct  194   RKRLSHDGSRKSAFSDTQSVLESRYLQEISDRRSMSREGSSIAEDWDDRPHTIEEVKAML  253

Query  666   QAQKAAFMRERCP---SQAWSSDT-----DVVDGEEREKTTPL--------KQGKSRAPA  797
             Q ++   +R       SQA+S            G+E E+  P         K    RA  
Sbjct  254   QQRRDNALRRESNNSISQAFSHQVRRTRGSYSTGDEYEEERPKWLDRWMASKPWDKRAST  313

Query  798   IQRRNPV-KSGEINVRIRSLQHKSASS-----------VQapatpspakpkpVRPTTSPG  941
              QR  PV K+ EI+     L H ++ +             +  +    +      T SP 
Sbjct  314   DQRVPPVYKTVEIDTSQPYLTHGNSRTGASPSRSQRPSSPSRTSHHYQQHNFSSATPSPA  373

Query  942   NLEKSHSTANTPRLCPTNRSA--------SFAPRYSI---SGIS-------------PGY  1049
                     + +PR+   +RSA        S    YS    SG S             P Y
Sbjct  374   KSRPIQIRSASPRIQRDDRSAYNYTSNTPSLRSNYSFTARSGYSVCTTTTTATNAALPNY  433

Query  1050  MAATESAKARLRSQSAPRQRPSTP-------AKRCLSYSI------------------SV  1154
             MA TESAKAR+RSQSAPRQRPSTP       A++ LS+ +                  S+
Sbjct  434   MAITESAKARIRSQSAPRQRPSTPEKERISSARKRLSFPVPPLPQQMDGQSLRSPSFKSI  493

Query  1155  KNGEEG-VEKRSEYWCNNNNTERESVGGEISPCSTTNSRWW*R  1280
                + G +E++S Y  ++  TE    GGEISP ST++ R W R
Sbjct  494   GGSQLGALEQQSNY--SSCCTESLGGGGEISPASTSDYRRWLR  534



>ref|XP_011039172.1| PREDICTED: protein IQ-DOMAIN 1 isoform X2 [Populus euphratica]
Length=562

 Score =   178 bits (452),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 156/444 (35%), Positives = 215/444 (48%), Gaps = 139/444 (31%)
 Frame = +3

Query  315   AATVIQTAFRCYLAKRALVALKGIVKLQALIRGQNVRRQARITLKCMQALFRVQERMREQ  494
             AA VIQTAFR YLA+RAL ALKG+VKLQAL+RG NVR+QA +TL+CMQAL RVQ R+ +Q
Sbjct  136   AAIVIQTAFRGYLARRALRALKGLVKLQALVRGHNVRKQANMTLRCMQALVRVQARVLDQ  195

Query  495   CARISQDSARKSMFSGSTNSWESKY---IRERKSIFRDHCSVGEAWRDCPPTLQELEVML  665
               R+S + +R+S FS + + +ES+Y   I ERKS+ RD  S+ + W D P T++E++ ML
Sbjct  196   RMRLSHEGSRESAFSDTNSVFESRYLQEISERKSMSRDGSSIADDWDDRPRTIEEVKAML  255

Query  666   QAQKA-AFMRERCPSQAWSSDTDVV------------DGEEREKTTPLKQ--------GK  782
             Q +K  AF RE+  SQA S  T               +GE +E++  L            
Sbjct  256   QRRKDNAFKREKALSQASSQQTVSKIWRNRRSPSMGNEGELQERSQWLDHWMPAKPWDNS  315

Query  783   SRAPA-IQRRNPVKSGEINVRI---------------RSLQHKSASSVQapatpspakpk  914
             SRA A   +R+P+K+ EI   +               +  QH+ ++S+    T       
Sbjct  316   SRARASTDQRDPIKTVEIENSLPCSYLAPNFGRTNQNQYHQHQRSNSINNGVTR------  369

Query  915   pVRPTTSPGNLEKSHSTAN------TP---------------------RLCPTNRSASFA  1013
                  ++P  L ++H  A+      TP                     R C ++R+ S  
Sbjct  370   -----SAPPPLHRAHQNASLHHSPITPSPSRTRPLQVRSASPRCAREDRSCNSSRTPSLR  424

Query  1014  PRY----------------SISGIS----PGYMAATESAKARLRSQSAPRQRPSTP----  1121
               Y                S+SG +    P YMA TESAKARLRSQSAPRQRPSTP    
Sbjct  425   SNYLYNGNLNQHGIRGGAASVSGNANATLPNYMATTESAKARLRSQSAPRQRPSTPERDR  484

Query  1122  ---AKRCLSYSI-------------------------SVKNGE-EGVEKRSEY--WCNNN  1208
                A++ L Y +                         SV      G+E++S Y   C   
Sbjct  485   AGSARKRLLYPVPDPYGVGMGYGGVGYGHGFRSPSFKSVSGSHFGGLEQQSNYSSCCT--  542

Query  1209  NTERESVGGEISPCSTTNSRWW*R  1280
                 ++ GGEISP ST++ R W R
Sbjct  543   ----DTFGGEISPSSTSDQRRWLR  562



>ref|XP_011039163.1| PREDICTED: protein IQ-DOMAIN 1 isoform X1 [Populus euphratica]
Length=563

 Score =   178 bits (451),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 157/446 (35%), Positives = 215/446 (48%), Gaps = 135/446 (30%)
 Frame = +3

Query  303   RLLCAATVIQTAFRCYLAKRALVALKGIVKLQALIRGQNVRRQARITLKCMQALFRVQER  482
             R   AA VIQTAFR YLA+RAL ALKG+VKLQAL+RG NVR+QA +TL+CMQAL RVQ R
Sbjct  133   RERSAAIVIQTAFRGYLARRALRALKGLVKLQALVRGHNVRKQANMTLRCMQALVRVQAR  192

Query  483   MREQCARISQDSARKSMFSGSTNSWESKY---IRERKSIFRDHCSVGEAWRDCPPTLQEL  653
             + +Q  R+S + +R+S FS + + +ES+Y   I ERKS+ RD  S+ + W D P T++E+
Sbjct  193   VLDQRMRLSHEGSRESAFSDTNSVFESRYLQEISERKSMSRDGSSIADDWDDRPRTIEEV  252

Query  654   EVMLQAQKA-AFMRERCPSQAWSSDTDVV------------DGEEREKTTPLKQ------  776
             + MLQ +K  AF RE+  SQA S  T               +GE +E++  L        
Sbjct  253   KAMLQRRKDNAFKREKALSQASSQQTVSKIWRNRRSPSMGNEGELQERSQWLDHWMPAKP  312

Query  777   --GKSRAPA-IQRRNPVKSGEINVRI---------------RSLQHKSASSVQapatpsp  902
                 SRA A   +R+P+K+ EI   +               +  QH+ ++S+    T   
Sbjct  313   WDNSSRARASTDQRDPIKTVEIENSLPCSYLAPNFGRTNQNQYHQHQRSNSINNGVTR--  370

Query  903   akpkpVRPTTSPGNLEKSHSTAN------TP---------------------RLCPTNRS  1001
                      ++P  L ++H  A+      TP                     R C ++R+
Sbjct  371   ---------SAPPPLHRAHQNASLHHSPITPSPSRTRPLQVRSASPRCAREDRSCNSSRT  421

Query  1002  ASFAPRY----------------SISGIS----PGYMAATESAKARLRSQSAPRQRPSTP  1121
              S    Y                S+SG +    P YMA TESAKARLRSQSAPRQRPSTP
Sbjct  422   PSLRSNYLYNGNLNQHGIRGGAASVSGNANATLPNYMATTESAKARLRSQSAPRQRPSTP  481

Query  1122  -------AKRCLSYSI-------------------------SVKNGE-EGVEKRSEYWCN  1202
                    A++ L Y +                         SV      G+E++S Y   
Sbjct  482   ERDRAGSARKRLLYPVPDPYGVGMGYGGVGYGHGFRSPSFKSVSGSHFGGLEQQSNYSSC  541

Query  1203  NNNTERESVGGEISPCSTTNSRWW*R  1280
               +T     GGEISP ST++ R W R
Sbjct  542   CTDT----FGGEISPSSTSDQRRWLR  563



>ref|XP_010676919.1| PREDICTED: protein IQ-DOMAIN 1-like [Beta vulgaris subsp. vulgaris]
Length=478

 Score =   176 bits (447),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 168/491 (34%), Positives = 238/491 (48%), Gaps = 117/491 (24%)
 Frame = +3

Query  96    KLGANSWLTALKRVFIRYPSKDr------ksrhskrdeeeekkrdkgrrWLFSKTADEN-  254
             K G  SW +A+K+VF R P+K        +     R++E+E K+ + RRW+F K    N 
Sbjct  3     KEGGTSWFSAVKKVF-RSPTKLSPKKNCKRREEFSREDEDEGKKTEKRRWIFRKLISHNQ  61

Query  255   --------------------SVGGVEIISRTPPPSRRLLCAATVIQTAFRCYLAKRALVA  374
                                 +  GV +    P    R   AA +IQT FR YLA+RAL A
Sbjct  62    HYEANVSSNEKPAKAVVVATAHIGVRVQEIIPAYLAREYYAALIIQTCFRGYLARRALRA  121

Query  375   LKGIVKLQALIRGQNVRRQARITLKCMQALFRVQERMREQCA-RISQDSARKSMFSGSTN  551
             LKGIVKLQAL+RG N+R+QA+ TLKCMQ L RVQ ++RE+   R+S D  RKSM++ S N
Sbjct  122   LKGIVKLQALVRGHNMRKQAKTTLKCMQTLVRVQAKIREKSLPRLSNDQTRKSMYAESNN  181

Query  552   SWES-KYIRERKSIFRDHCSVGEAWRDCPPTLQELEVMLQAQK-AAFMRERCPSQAWSSD  725
              W+  K I +RKS++ D  ++ + ++    T++++E +LQ++K A+  RE+  + A S  
Sbjct  182   LWDKYKDIHQRKSMYEDEHNIEDRYKVNSYTIEDIEAILQSRKDASLDREQALAYALSQQ  241

Query  726   TDVVD------GEEREKTTPLKQ---------GKSRAPAIQRRNPVKSGEI---------  833
                 D       EE + +  L Q           +R    QR   +K  E+         
Sbjct  242   IRRFDRKTCMNDEENKDSEWLSQWLESKEYSENNNRLTTTQRIEAIKDIEMESLQPHLRT  301

Query  834   -NVRIRSLQHKSASSVQapatpspakpkpVRP----TTSPGNLE---KSHSTANTPRL--  983
              + R  SL H ++S +     P+      +RP    + SP   +   +SHS ANTP L  
Sbjct  302   PSTRRHSL-HVASSPLNNTTRPTTPFLHEIRPRQVQSASPRCAKAGFRSHSAANTPSLRV  360

Query  984   -CPTNRSASFAPRYSISGISPGYMAATESAKARLRSQSAPRQRPST-------PAKRCLS  1139
              CPT               +P YMAATESAKAR R+QS PRQR ST        AK+ LS
Sbjct  361   SCPT-------------ATTPNYMAATESAKARARTQSTPRQRHSTSDRERGGSAKKRLS  407

Query  1140  YSI--------------------------SVKNGEEGVEKRSEYWCNNNNTERESVGGEI  1241
             + +                          SV+ G   VEK +   C+++ T  +  GGEI
Sbjct  408   FPLPEPHYKGSIYTDYSRFSQNLRSPSFRSVQEGLHCVEKGTT--CSSSYT--DLTGGEI  463

Query  1242  SPCSTTNSRWW  1274
             SP STT+ R W
Sbjct  464   SPASTTHLRRW  474



>ref|XP_004514932.1| PREDICTED: protein IQ-DOMAIN 1-like [Cicer arietinum]
Length=549

 Score =   177 bits (450),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 157/436 (36%), Positives = 211/436 (48%), Gaps = 100/436 (23%)
 Frame = +3

Query  267   VEIISRTPPPSR-RLLCAATVIQTAFRCYLAKRALVALKGIVKLQALIRGQNVRRQARIT  443
             VE+   T P +  R   AA VIQT+FR YLA+RAL ALKG+VKLQAL+RG NVR+QA++T
Sbjct  116   VEVARLTKPSNHAREHFAAVVIQTSFRGYLARRALRALKGLVKLQALVRGHNVRKQAKMT  175

Query  444   LKCMQALFRVQERMREQCARIS-QDSARKSMFSGSTNSWESKY---IRERKSIFRDHCSV  611
             L+CMQAL RVQ R+ +Q  R S  + +RKS FS +T+ W+S+Y   I +RKS+ R+  SV
Sbjct  176   LRCMQALVRVQARVLDQRVRSSSHEGSRKSTFSDTTSVWDSRYLQDISDRKSMSREGSSV  235

Query  612   GEAWRDCPPTLQELEVMLQAQK-AAFMRERCPSQAWS----------SDTDVVDGEEREK  758
              + W + P T++E++ MLQ +K AA  RE+  SQA+S          S  +  + EER K
Sbjct  236   ADDWDERPHTVEEVKAMLQQRKEAAMKREKSLSQAFSQQIWRNGRTSSIGNEDELEERPK  295

Query  759   -------TTPLKQGKSRAPAIQRRNPVKSGEI----------------------NVRIRS  851
                    T P  + + RA   QR +P+K+ EI                      N   + 
Sbjct  296   WLDRWMATKPW-ENRGRASTDQR-DPIKTVEIDTSQPYSYLGTNYRRSHPNYQYNPHHQP  353

Query  852   LQHKSASSVQapatpspakpkpVRPTTSPGN-------------LEKSHSTANTPRLCPT  992
              +H  AS +               P+ S                 ++S+ T+ TP L   
Sbjct  354   QRHSIASPLHRTHQNGSIHQSVTTPSPSKSRPIQVRSSSPRCVREDRSYHTSQTPSLRSN  413

Query  993   NRSASFAPRYSISGIS------------PGYMAATESAKARLRSQSAPRQRPSTP-----  1121
                     + S  G S            P YM ATESAKAR+RSQSAPRQRPSTP     
Sbjct  414   YHYNGNLYQNSRVGTSNSAATTAATTTLPNYMQATESAKARIRSQSAPRQRPSTPERDRA  473

Query  1122  --AKRCLSYSI-------SVKNGEEGVEKRS--------------EYWCNNNNTERESVG  1232
                K+ LS+          V  G  G   RS              E   N ++   ES+G
Sbjct  474   GSVKKRLSFPAPDPYNVGGVSYGNYGHSLRSPSFKSVNVVSHFGLEQQSNYSSCCTESLG  533

Query  1233  GEISPCSTTNSRWW*R  1280
             GE+SP ST + R W R
Sbjct  534   GEVSPSSTGDLRRWLR  549



>ref|XP_010906058.1| PREDICTED: protein IQ-DOMAIN 1-like [Elaeis guineensis]
Length=527

 Score =   177 bits (448),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 151/415 (36%), Positives = 206/415 (50%), Gaps = 102/415 (25%)
 Frame = +3

Query  315   AATVIQTAFRCYLAKRALVALKGIVKLQALIRGQNVRRQARITLKCMQALFRVQERMREQ  494
             AA VIQ AFR YLA+RAL AL+G+VKLQAL+RGQNVRRQA  TL+CMQAL RVQER+R+Q
Sbjct  122   AAIVIQAAFRGYLARRALKALRGLVKLQALVRGQNVRRQANTTLQCMQALVRVQERVRDQ  181

Query  495   CARISQDSAR-----KSMFSGSTNSWESKYIR---ERKSIFRDHCSVGEAWRDCPPTLQE  650
              AR++++ AR      + FS  T+ W+S Y+    +R+S+ RD  S  +   D P T++ 
Sbjct  182   RARLAREGARCRSNKSATFSCDTSFWDSPYLHDRADRRSMSRDGSSHADDRDDHPRTIEG  241

Query  651   LEVMLQAQK-AAFMRERCPS-----QAWSSDTD----VVDGEEREKTTPLKQGK------  782
             +  ML+++K AA  RER  S     Q W SD      +  GE++E+ + + +G+      
Sbjct  242   IRSMLESRKEAALKRERALSYAFSQQPWRSDRKASSWLSSGEDQEEASAVSEGEQRPSRW  301

Query  783   ----------------SRAPAIQRRNPVKSGEINVRIRSLQHKSASSVQapatps-----  899
                             SR  A   R+P+K+ EI+   R   + +  +V+     +     
Sbjct  302   LDRWMASRASCDNRNGSRGRASMERDPIKTLEIDT-ARPFSYSTPINVRRHQQLASPHHR  360

Query  900   pakpkpVRPTTSPGNLEKS-HSTANTPRLCPTNRSASFAPR------YSISGIS------  1040
              +       T SP N  KS    + +PR     RS + A        Y  SG +      
Sbjct  361   SSHHLHSPATPSPSNASKSLQVRSASPRCGKEERSPASAHTPTSSGYYHCSGGAGAQRHH  420

Query  1041  -----PGYMAATESAKARLRSQSAPRQRPSTP--------AKRCLSY-------------  1142
                  P YMAATESAKARLRSQS PRQRP TP        AK+ LS+             
Sbjct  421   HQVAVPNYMAATESAKARLRSQSTPRQRPLTPEREQRSGSAKKRLSFPLPEPYCGGGIGG  480

Query  1143  ---------SISVKNGEEGVEKRSEYWCNNNNTERESVGGEISPCSTTNSRWW*R  1280
                      S    NG  G+E+ S   C +      S+ GE+SP STT+ R W R
Sbjct  481   GYSQSLRSPSFKSANGRLGLEQLS--CCTD------SIAGEVSPSSTTDLRRWLR  527



>ref|NP_567191.2| protein IQ-domain 17 [Arabidopsis thaliana]
 gb|AEE81939.1| protein IQ-domain 17 [Arabidopsis thaliana]
Length=534

 Score =   176 bits (447),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 149/404 (37%), Positives = 207/404 (51%), Gaps = 85/404 (21%)
 Frame = +3

Query  315   AATVIQTAFRCYLAKRALVALKGIVKLQALIRGQNVRRQARITLKCMQALFRVQERMREQ  494
             AA VIQT FR YLA+RAL ALKG+VKLQAL+RG NVR+QA++TL+CMQAL RVQ R+ +Q
Sbjct  134   AAVVIQTGFRGYLARRALRALKGLVKLQALVRGHNVRKQAKMTLRCMQALVRVQSRVLDQ  193

Query  495   CARISQDSARKSMFSGSTNSWESKYIRE---RKSIFRDHCSVGEAWRDCPPTLQELEVML  665
               R+S D +RKS FS + +  ES+Y++E   R+S+ R+  S+ E W D P T++E++ ML
Sbjct  194   RKRLSHDGSRKSAFSDTQSVLESRYLQEISDRRSMSREGSSIAEDWDDRPHTIEEVKAML  253

Query  666   QAQKAAFMRERCP---SQAWSSDT-----DVVDGEEREKTTPL--------KQGKSRAPA  797
             Q ++   +R       SQA+S            G+E E+  P         K    RA  
Sbjct  254   QQRRDNALRRESNNSISQAFSHQVRRTRGSYSTGDEYEEERPKWLDRWMASKPWDKRAST  313

Query  798   IQRRNPV-KSGEINVRIRSL----------------------------QHKSASSVQapa  890
              QR  PV K+ EI+     L                            QH  +S+  +PA
Sbjct  314   DQRVPPVYKTVEIDTSQPYLTRGNSRTGASPSRSQRPSSPSRTSHHYQQHNFSSATPSPA  373

Query  891   tpspakpkpVRPTTSPGNLEKSHSTANTPRLCPTNRSASFAPRYSISGIS--------PG  1046
                P + +   P     +    + T+NTP L  +N S +    YS+   +        P 
Sbjct  374   KSRPIQIRSASPRIQRDDRSAYNYTSNTPSLR-SNYSFTARSGYSVCTTTTTATNAALPN  432

Query  1047  YMAATESAKARLRSQSAPRQRPSTP-------AKRCLSYSI------------------S  1151
             YMA TESAKAR+RSQSAPRQRPSTP       A++ LS+ +                  S
Sbjct  433   YMAITESAKARIRSQSAPRQRPSTPEKERISSARKRLSFPVPPLPQQMDGQSLRSPSFKS  492

Query  1152  VKNGEEG-VEKRSEYWCNNNNTERESVGGEISPCSTTNSRWW*R  1280
             +   + G +E++S Y  ++  TE    GGEISP ST++ R W R
Sbjct  493   IGGSQLGALEQQSNY--SSCCTESLGGGGEISPASTSDYRRWLR  534



>ref|XP_006287463.1| hypothetical protein CARUB_v10000672mg [Capsella rubella]
 gb|EOA20361.1| hypothetical protein CARUB_v10000672mg [Capsella rubella]
Length=535

 Score =   176 bits (447),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 149/402 (37%), Positives = 202/402 (50%), Gaps = 83/402 (21%)
 Frame = +3

Query  315   AATVIQTAFRCYLAKRALVALKGIVKLQALIRGQNVRRQARITLKCMQALFRVQERMREQ  494
             AA VIQT FR YLA+RAL ALKG+VKLQAL+RG NVR+QA++TL+CMQAL RVQ R+ +Q
Sbjct  137   AAVVIQTGFRGYLARRALRALKGLVKLQALVRGHNVRKQAKMTLRCMQALVRVQSRVLDQ  196

Query  495   CARISQDSARKSMFSGSTNSWESKY---IRERKSIFRDHCSVGEAWRDCPPTLQELEVML  665
               R+S D +RKS FS + +  ES+Y   I +R+S+ R+  S+ E W D P T++E++ ML
Sbjct  197   RKRLSHDGSRKSAFSDTHSVLESRYLQDISDRRSMSREGSSIAEDWDDRPHTIEEVKAML  256

Query  666   QAQKAAFMRERCP---SQAWSSDT-----DVVDGEEREKTTPL--------KQGKSRAPA  797
             Q ++   +R       SQA+S            G+E E+  P         K    RA  
Sbjct  257   QQRRDTALRRESNNSLSQAFSHQVRRTRGSYSTGDEEEEERPKWLDRWMASKPWDKRAST  316

Query  798   IQRRNPVKSGEI--------------------NVRIRSLQHKSASSVQapatpspakpkp  917
              QR    K+ EI                    N R  S    S    Q   + +   P  
Sbjct  317   DQRAPVYKTVEIDTSQPYLTRGNSRTGASPSRNQRPSSPSRTSHHYQQHNFSSATPSPAK  376

Query  918   VRP----TTSPGNLEKSHSTANTPRLCPTNRSASFAPRYSISGIS-----------PGYM  1052
              RP    + SP      + T+NTP L  +N S +    YS+   +           P YM
Sbjct  377   SRPIQIRSASPRIQRDYNYTSNTPSLR-SNYSFTARSGYSVCTTTTTATTTTNAALPNYM  435

Query  1053  AATESAKARLRSQSAPRQRPSTP-------AKRCLSYSI------------------SVK  1157
             A TESAKAR+RSQSAPRQRPSTP       A++ LS+ +                  S+ 
Sbjct  436   AITESAKARIRSQSAPRQRPSTPEKERVGSARKRLSFPVPPLPHQIDGQSLRSPSFKSIG  495

Query  1158  NGEEG-VEKRSEYWCNNNNTERESVGGEISPCSTTNSRWW*R  1280
               + G +E++S Y  ++  TE    GGEISP ST++ R W R
Sbjct  496   GSQLGALEQQSNY--SSCCTESLGGGGEISPASTSDYRRWLR  535



>emb|CDP08623.1| unnamed protein product [Coffea canephora]
Length=530

 Score =   175 bits (444),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 153/404 (38%), Positives = 203/404 (50%), Gaps = 74/404 (18%)
 Frame = +3

Query  288   PPPSR--RLLCAATVIQTAFRCYLAKRALVALKGIVKLQALIRGQNVRRQARITLKCMQA  461
             PPPS   R   AAT+IQ AFR YLA+RA  ALKG+V+LQAL+RG NVR+QA++TL+CMQA
Sbjct  128   PPPSNYAREHHAATLIQRAFRGYLARRAFRALKGLVRLQALVRGHNVRKQAKMTLRCMQA  187

Query  462   LFRVQERMREQCARISQDSARKSMFSGSTNS-WESKY---IRERKSIFRDHCSVGEAWRD  629
             L RVQ R+ +Q  R S D +R+S     TNS W S++   I +RKS+ RD  S+ + W D
Sbjct  188   LVRVQARVLDQRIRQSSDGSRRSTTFSDTNSIWSSRHPQDISDRKSMSRDGSSIPDDWDD  247

Query  630   CPP--TLQELEVMLQAQK-AAFMRERCPSQA-----WSSDTDVVDGEERE----------  755
              P   T++E++ MLQ +K AA  RER  S A     W +  +   G E E          
Sbjct  248   RPHTITIEEVKAMLQGRKEAALKRERTLSHAFSQQMWRAGRNSSFGSENELIRENHQRLD  307

Query  756   ---KTTPLKQGKSRAPAIQRRNPVKSGEINV-----------RIRSLQHKSASSVQapat  893
                   P +  + RA   Q R+ V++ EI+            R  S  H+S+   Q+  +
Sbjct  308   RWMAAKPWESSRGRASTDQ-RDSVRTVEIDTASNSRRPSQHQRPGSPLHRSSQQAQSLHS  366

Query  894   pspakpkpVRP----TTSP---GNLEKSHSTANTPRLCPTNRSASFAPRY----SISGIS  1040
             P    P   RP    + SP      E+   TA TP L       S    +     ++   
Sbjct  367   PITPSPSKTRPLQVRSASPRYAAVEERCGHTAQTPTLRSNYHHYSGGGLHQQSRGMTSAV  426

Query  1041  PGYMAATESAKARLRSQSAPRQRPSTP-------AKRCLSYSISVKNGEE----------  1169
             P YMAATESAKAR+RSQSAPRQRP+TP        K+ LS+ +    G            
Sbjct  427   PNYMAATESAKARIRSQSAPRQRPATPERERAGSVKKRLSFPVPDPYGAGTGYGDYMRSP  486

Query  1170  ------GVEKRSEYWCNNNNTERESV-GGEISPCSTTNSRWW*R  1280
                   GV    E   N ++   ES+  GEISP ST + R W R
Sbjct  487   SFKSACGVHLGFEQQSNYSSCYTESLTAGEISPSSTGDLRRWLR  530



>ref|XP_010456163.1| PREDICTED: protein IQ-DOMAIN 1-like [Camelina sativa]
Length=538

 Score =   175 bits (444),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 155/437 (35%), Positives = 212/437 (49%), Gaps = 103/437 (24%)
 Frame = +3

Query  267   VEIISRTPPPSR--------------RLLCAATVIQTAFRCYLAKRALVALKGIVKLQAL  404
             V  +S T PP++              R   AA VIQT FR YLA+RAL ALKG+VKLQAL
Sbjct  106   VSAVSETHPPTKKNELPNLTRRTYTAREDYAAVVIQTGFRGYLARRALRALKGLVKLQAL  165

Query  405   IRGQNVRRQARITLKCMQALFRVQERMREQCARISQDSARKSMFSGSTNSWESKY---IR  575
             +RG NVR+QA++TL+CMQAL RVQ R+ +Q  R+S D +RKS FS + +  ES+Y   I 
Sbjct  166   VRGHNVRKQAKMTLRCMQALVRVQSRVLDQRKRLSHDGSRKSAFSDTHSVLESRYLQDIS  225

Query  576   ERKSIFRDHCSVGEAWRDCPPTLQELEVMLQAQKAAFMRERCP---SQAWSSDT------  728
             +R+S+ R+  S+ E W D P T++E++ MLQ ++   +R       SQA+S         
Sbjct  226   DRRSMSREGSSIAEDWDDRPHTIEEVKAMLQQRRDTALRRESNNSLSQAFSHQVRRTRGS  285

Query  729   -DVVDGEEREKTTPLKQGKSRAP-----AIQRRNPV-KSGEINVR---------------  842
                 D EE E+   L +  +  P     +  +R PV K+ EI+                 
Sbjct  286   YSTGDEEEEERPRWLDRWMASKPWDKRTSTDQRAPVYKTVEIDTSQPYLTRGNSRTGASP  345

Query  843   IRSLQHKSASSVQapatpspakpkpVRPTTSPGNLEKSHSTANTPRLCPTNRSA------  1004
              RS Q  S+ S  +             P  SP         + +PR+   +RSA      
Sbjct  346   SRSNQRPSSPSRTSHHYQQQHNFSSATP--SPAKSRPIQIRSASPRIQRDDRSAYNYTSN  403

Query  1005  --SFAPRYSI---SGIS--------------PGYMAATESAKARLRSQSAPRQRPSTP--  1121
               S    YS    SG S              P YMA TESAKAR+RSQSAPRQRPSTP  
Sbjct  404   TPSLRSNYSFTARSGYSVCTATTTNTTNAALPNYMAITESAKARIRSQSAPRQRPSTPEK  463

Query  1122  -----AKRCLSYSI------------------SVKNGEEG-VEKRSEYWCNNNNTERESV  1229
                  A++ LS+ +                  S+   + G +E++S Y  ++  TE    
Sbjct  464   DRFGSARKRLSFPVPPLPHQIDGQSLRSPSFKSIGGSQLGALEQQSNY--SSCCTESLGG  521

Query  1230  GGEISPCSTTNSRWW*R  1280
             GGEISP ST++ R W R
Sbjct  522   GGEISPASTSDYRRWLR  538



>ref|XP_008799002.1| PREDICTED: protein IQ-DOMAIN 1-like isoform X1 [Phoenix dactylifera]
Length=553

 Score =   175 bits (444),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 151/408 (37%), Positives = 212/408 (52%), Gaps = 95/408 (23%)
 Frame = +3

Query  315   AATVIQTAFRCYLAKRALVALKGIVKLQALIRGQNVRRQARITLKCMQALFRVQERMREQ  494
             AA VIQ  FR YLA+RAL AL+G+VKLQAL+RGQNVRRQA  TL+CMQAL RVQER+R+Q
Sbjct  155   AAIVIQAGFRGYLARRALKALRGLVKLQALVRGQNVRRQANTTLRCMQALVRVQERVRDQ  214

Query  495   CARISQDSA-----RKSMFSGSTNSWESKY---IRERKSI-FRDHCSVGEAWRDCPPTLQ  647
              AR++++ A     + + FS  T+ W+S+Y   I +R+S+  RD     + W D P T++
Sbjct  215   RARLAREGASWRSNKSTTFSCDTSFWDSRYLHDIADRRSMQSRDGSGRADDWVDHPRTIE  274

Query  648   ELEVMLQAQK-AAFMRERCPS-----QAWSSD----TDVVDGEEREKTTPLKQGK-----  782
             E++ ML+ +K AA  RER  S     Q W SD    + +  GEE+E+ + + +G+     
Sbjct  275   EIQSMLEGRKEAALRRERALSYAFSQQPWRSDRKTSSGLSFGEEQEEDSAVSEGEQRPRR  334

Query  783   -----------------SRAPAIQRRNPVKSGEINVRIRSL-------QHKSASSVQapa  890
                              SR  A   R+P+K+ EI+   RS        +H+  +S     
Sbjct  335   WLDRWMASRTSCDNRNASRGRATMERDPIKTLEIDT-ARSYSTPTTARRHQQPASPHHLH  393

Query  891   t------pspakpkpVRPTTSP--GNLEKSHSTANTPRLCPTNRSASFAPRYSISG----  1034
             +       + ++   VR + SP  G+ E+S ++ +TP       ++S   RYS  G    
Sbjct  394   SPATPSPSNASRALQVR-SASPRCGSEERSSASVHTP-------TSSGYYRYSGEGGQRR  445

Query  1035  -----ISPGYMAATESAKARLRSQSAPRQRPSTP--------AKRCLSYSI--------S  1151
                    P YMAATESAKARLRSQSA RQRP TP        AK+ LS+ +         
Sbjct  446   HHHHPAVPNYMAATESAKARLRSQSATRQRPMTPEREQRSGLAKKRLSFPLPEPYGGGGD  505

Query  1152  VKNGEEGVEKRSEYWCNNNNTER-----ESVGGEISPCSTTNSRWW*R  1280
                  + +   S    N    E+     ES+ GE+SP STT  R W R
Sbjct  506   RGGYSQSLRSPSFKSANGRIGEQSSCCTESIAGEVSPTSTTYLRRWLR  553



>ref|XP_004309573.1| PREDICTED: protein IQ-DOMAIN 14-like [Fragaria vesca subsp. vesca]
Length=488

 Score =   174 bits (440),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 145/382 (38%), Positives = 197/382 (52%), Gaps = 82/382 (21%)
 Frame = +3

Query  315   AATVIQTAFRCYLAKRALVALKGIVKLQALIRGQNVRRQARITLKCMQALFRVQERMREQ  494
             AAT+IQTAFR YLA+RAL ALKG+VKLQAL+RG NVR+QA++TLKCMQAL RVQ+++R +
Sbjct  123   AATLIQTAFRGYLARRALRALKGLVKLQALVRGHNVRKQAKLTLKCMQALVRVQDQVRNE  182

Query  495   CARISQDSARKSMFSGSTNS-WESKY---IRERKSIFRDHCSVGEAWRDCPPTLQELEVM  662
              AR+S +  R SM S +  S WES+Y   IR+RKSI R+  S G             + +
Sbjct  183   RARLSHEGGRNSMLSETEMSLWESRYLQDIRDRKSISREKVSEGVD-----------QFL  231

Query  663   LQAQK-AAFMRERCPSQAWS----------SDTDVVDGEER----EKTTPLKQGKSRAPA  797
             LQ++K A+  RE+  + A+S          S  +  + EER    ++    K  ++   +
Sbjct  232   LQSRKEASLKREKALAYAFSHQIWRPRRHPSIGEEAELEERTKWLDRWMATKNWENYRAS  291

Query  798   IQRRNPVKSGEINVR--IRSLQHKS--------ASSVQapatpspakpkpVRPTT----S  935
               +R+ +K+ E++      S QH+         AS +      +        P T     
Sbjct  292   TDKRDSIKTVEMDTSRPYISSQHQKQPNPNAAMASPLHKSHYNNMNISLGHSPATPSPSK  351

Query  936   PGNLE------KSHSTANTPRLCPTNRSASFAPRYSIS-----GISPGYMAATESAKARL  1082
             P  L+      +  S A+TP L           RY +      G  P YMAATESAKA+ 
Sbjct  352   PRALKVRSASPRCSSAAHTPNLGSAYCFRGGMCRYGVGSNNVIGSVPNYMAATESAKAKA  411

Query  1083  RSQSAPRQRPSTP-------AKRCLSYSI------------SVKNGEEGVEKRSEYWCNN  1205
             RS SAPR RP+TP       AK+ LSY              SV+NG  G E  S Y    
Sbjct  412   RSLSAPRSRPATPDRDRGGSAKKRLSYPAPESHSLESPSFKSVQNGYYGRENLSTY----  467

Query  1206  NNTERESVGGEISPCSTTNSRW  1271
                  +S+GGEISPCSTT+ RW
Sbjct  468   ----TDSLGGEISPCSTTDLRW  485



>gb|KFK30665.1| hypothetical protein AALP_AA6G011900 [Arabis alpina]
Length=506

 Score =   174 bits (440),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 145/385 (38%), Positives = 201/385 (52%), Gaps = 67/385 (17%)
 Frame = +3

Query  315   AATVIQTAFRCYLAKRALVALKGIVKLQALIRGQNVRRQARITLKCMQALFRVQERMREQ  494
             AA +IQT FR YLA+RAL ALKG+VKLQAL+RG NVR+QA++TL+CMQAL RVQ R+ +Q
Sbjct  126   AAIIIQTGFRGYLARRALRALKGLVKLQALVRGHNVRKQAKMTLRCMQALVRVQSRVLDQ  185

Query  495   CARISQDSARKSMFSGSTNSWESKY---IRERKSIFRDHCSVGEAWRDCPPTLQELEVML  665
               R+S D +RKS FS + +  +S+Y   I +R+S+ R+  S+ E W + P T++E++ ML
Sbjct  186   RKRLSHDGSRKSAFSDTYSVLDSRYLHDISDRRSMSREGSSIAEDWDERPHTIEEVKAML  245

Query  666   QAQKAAFMRERCPSQA-----WSSDTDVVDGEEREK-------TTPLKQGKSRAPAIQRR  809
             Q ++   +R  C +Q       S      + EER K       T P  +   RA   QR 
Sbjct  246   QQRRDTALRRECSNQQIRRIRGSQSIGEEEEEERPKWLDRWMATKPWDK---RASTDQRA  302

Query  810   NPVKSGEIN------VRIRSLQHKSASSVQapatpspakpkpVRPTTSPGNLEKSHSTAN  971
                K+ EI+       R  S    S S  Q P++PS         T SP         + 
Sbjct  303   PVYKTVEIDTSQPYLTRGNSRTGASPSRNQRPSSPSRTSHHYASATPSPAKSRPIQIRSA  362

Query  972   TPRLCPTNRSA------------SFAPR--YSI-------SGISPGYMAATESAKARLRS  1088
             +PR+   +RS             SF  R  YS+       +   P YMA TESAKAR+RS
Sbjct  363   SPRIQKDDRSTYTSNTPSLRSNYSFTARSGYSVCTTTTTTNAALPNYMAITESAKARIRS  422

Query  1089  QSAPRQRPSTP-------AKRCLSYSI--------------SVKNGEEGVEKRSEYWCNN  1205
             QSAPRQRPSTP       A++ LS+ +              S+   + G  ++ +Y  ++
Sbjct  423   QSAPRQRPSTPEKERIGTARKRLSFPVPPQPIESLRSPSFKSIGGSQLGALEQ-KYNYSS  481

Query  1206  NNTERESVGGEISPCSTTNSRWW*R  1280
               TE    GGEISP ST++ R W R
Sbjct  482   CCTESIGGGGEISPASTSDYRRWLR  506



>emb|CDX91859.1| BnaC03g31610D [Brassica napus]
Length=530

 Score =   174 bits (440),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 148/405 (37%), Positives = 204/405 (50%), Gaps = 87/405 (21%)
 Frame = +3

Query  297   SRRLLCAATVIQTAFRCYLAKRALVALKGIVKLQALIRGQNVRRQARITLKCMQALFRVQ  476
             S R + AA +IQT FR YLA+RAL ALKG+VKLQAL+RG NVR+QA++TL+CMQAL RVQ
Sbjct  130   SAREIHAAIIIQTCFRGYLARRALRALKGLVKLQALVRGHNVRKQAKMTLRCMQALVRVQ  189

Query  477   ERMREQCARISQDSARKSMFSGSTNSWESKY---IRERKSIFRDHCSVGEAWRDCPPTLQ  647
              R+ +Q  R+S D  RKS FS + +  ES+Y   I +R+S+ R+  S+ E W D P T+Q
Sbjct  190   SRVLDQRKRLSHDGTRKSAFSDTHSVLESRYLQDISDRRSMPREGSSIAEDWEDRPQTIQ  249

Query  648   ELEVMLQAQKAAFMRERCPSQAWSSD------TDVVDGEEREKTTPLKQGKSRAP-----  794
             E++ MLQ +     R+   S+A+S        +  +  EE E+   L +  S  P     
Sbjct  250   EVKAMLQER-----RDNSLSKAFSQQIRRTRGSQSIGEEEEERPKWLDRWMSSKPWDKRA  304

Query  795   AIQRRNPV-KSGEIN------VRIRSLQHKSASSVQ------apatpspakpkpVRPTTS  935
             +  +R PV K+ EI+       R  S    S S  Q        +     +      T S
Sbjct  305   STDQRPPVYKTVEIDTSQPYLTRAHSRTGASPSRSQRPDTPSRTSHHYNHQHSFSSATPS  364

Query  936   PGNLEKSHSTANTPRLCPTNRSA--------------SFAPR--YSISGIS--PGYMAAT  1061
             P         + +PR+   +RSA              SF  R  YS+   +  P YMA T
Sbjct  365   PAKSRPIQIRSASPRIQRDDRSAYSYTSNTPSLRSNYSFTARSGYSVCTTTTLPNYMAIT  424

Query  1062  ESAKARLRSQSAPRQRPSTP-------AKRCLSYSI------------------------  1148
             ESAKAR+RSQSAPRQRP TP       A++ LSY +                        
Sbjct  425   ESAKARIRSQSAPRQRPLTPEKDRGGSARKRLSYPVPPQPPMEVGGGYCGDSNSQSLRSP  484

Query  1149  ---SVKNGEEG-VEKRSEYWCNNNNTERESVGGEISPCSTTNSRW  1271
                S+   + G +E++S Y  ++  TE    GGEISP ST++ RW
Sbjct  485   SLKSIGGSQLGALEQQSNY--SSCYTESVGGGGEISPASTSDRRW  527



>ref|XP_010428170.1| PREDICTED: protein IQ-DOMAIN 1-like [Camelina sativa]
Length=539

 Score =   173 bits (439),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 149/408 (37%), Positives = 198/408 (49%), Gaps = 91/408 (22%)
 Frame = +3

Query  315   AATVIQTAFRCYLAKRALVALKGIVKLQALIRGQNVRRQARITLKCMQALFRVQERMREQ  494
             AA VIQT FR YLA+RAL ALKG+VKLQAL+RG NVR+QA++TL+CMQAL RVQ R+ +Q
Sbjct  137   AAVVIQTGFRGYLARRALRALKGLVKLQALVRGHNVRKQAKMTLRCMQALVRVQSRVLDQ  196

Query  495   CARISQDSARKSMFSGSTNSWESKY---IRERKSIFRDHCSVGEAWRDCPPTLQELEVML  665
               R+S D +RKS FS + +  ES Y   I +R+S+ R+  S+ E W D P T++E++ ML
Sbjct  197   RKRLSHDGSRKSAFSDTHSVLESHYLQDISDRRSMSREGSSIAEDWDDRPHTIEEVKAML  256

Query  666   QAQKAAFMRERCP---SQAWSSDT-----DVVDGEEREKTTPL--------KQGKSRAPA  797
             Q ++   +R       SQA+S            G+E E+  P         K    RA  
Sbjct  257   QQRRDTALRRESNNSLSQAFSHQVRRTRGSYSTGDEEEEERPKWLDRWMASKPWDKRAST  316

Query  798   IQRRNPVKSGEINVR---------------IRSLQHKSASSVQapatpspakpkpVRPTT  932
              QR    K+ EI+                  RS Q  S+ S  +              T 
Sbjct  317   DQRAPVYKTVEIDTSQPYLTRGNSRTGASPSRSNQRPSSPSRTSHHYQQHNFSSA---TP  373

Query  933   SPGNLEKSHSTANTPRLCPTNRSA---------SFAPRYSI---SGIS------------  1040
             SP         + +PR    +RSA         S    YS    SG S            
Sbjct  374   SPAKSRPIQIRSASPRFQRDDRSAYNNYTSNTPSLRSNYSFTARSGYSVCTATTTNTTNA  433

Query  1041  --PGYMAATESAKARLRSQSAPRQRPSTP-------AKRCLSYSI---------------  1148
               P YMA TESAKAR+RSQSAPRQRPSTP       A++ LS+ +               
Sbjct  434   ALPNYMAITESAKARIRSQSAPRQRPSTPEKDRIGSARKRLSFPVPPLPHQIDGQSLRSP  493

Query  1149  ---SVKNGEEG-VEKRSEYWCNNNNTERESVGGEISPCSTTNSRWW*R  1280
                S+   + G +E++S Y  ++  TE    GGEISP ST++ R W R
Sbjct  494   SFKSIGGSQLGALEQQSNY--SSCCTESLGGGGEISPASTSDYRRWLR  539



>ref|XP_011025382.1| PREDICTED: protein IQ-DOMAIN 1 [Populus euphratica]
Length=548

 Score =   173 bits (439),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 148/430 (34%), Positives = 209/430 (49%), Gaps = 116/430 (27%)
 Frame = +3

Query  315   AATVIQTAFRCYLAKRALVALKGIVKLQALIRGQNVRRQARITLKCMQALFRVQERMREQ  494
             AA VIQTAFR YLA+RAL ALKG+VKLQAL+RG  VR++A++TL+CMQAL RVQ R+ +Q
Sbjct  127   AAIVIQTAFRGYLARRALRALKGLVKLQALVRGHKVRKRAKMTLRCMQALARVQARVLDQ  186

Query  495   CARISQDSARKSMFSGSTNSWESKY---IRERKSIFRDHCSVGEAWRDCPPTLQELEVML  665
               R+S + +RKS FS + +  ES+Y   I +RKS+ R+  S+ + W D P T++E++ ML
Sbjct  187   RVRLSHEGSRKSAFSDTNSVLESRYLQDISDRKSMSRESSSIADDWDDRPRTIEEVKAML  246

Query  666   QAQK-AAFMRERCPSQA-----WSSDTDVVDGEE---REKTTPLKQ--------GKSRAP  794
             Q +K AAF RE+  SQA     W +  +  +G E   +E+   L Q         +SRA 
Sbjct  247   QRRKEAAFKREKTLSQAFSQQIWRNGRNPSNGNEDELKERPQWLDQWMPAKPWDNRSRAR  306

Query  795   A-IQRRNPVKSGEINVRIRSLQ--------HKSASSVQapatpspakpkpVRPTTSPGNL  947
             A   +R+P+K+    V I + Q         +  +  Q                ++P  L
Sbjct  307   ASTDQRDPIKT----VEIDTSQPYSYLVPNFRRTNQNQHHQHQRSNSSNNGATHSAPSPL  362

Query  948   EKSHST---------------------------ANTPRLCPTNRSASFAPRYSISG----  1034
              ++H T                           A   R C ++++ S    Y  +G    
Sbjct  363   HRAHQTVPLHHSPITPSPSKTRPLQVRSASPRCAREDRSCNSSQTPSLRSNYFYNGSLNQ  422

Query  1035  ---------------ISPGYMAATESAKARLRSQSAPRQRPSTP-------AKRCLSY--  1142
                              P YMAATESAKARLRSQSAPRQRPSTP       A++ LSY  
Sbjct  423   HGIRGGASVSSNGNATLPNYMAATESAKARLRSQSAPRQRPSTPERDRAGSARKRLSYPA  482

Query  1143  ----SISVKNGEE--------------------GVEKRSEYWCNNNNTERESVGGEISPC  1250
                  + +  G                      G+E++S Y    ++   +S GGE+SP 
Sbjct  483   PDPCDVGIVYGGAGYGHGLRSPSFKSVCGSRLGGLEQQSNY----SSCCTDSFGGELSPS  538

Query  1251  STTNSRWW*R  1280
             ST + R W R
Sbjct  539   STNDLRRWLR  548



>ref|XP_008392637.1| PREDICTED: protein IQ-DOMAIN 1-like [Malus domestica]
Length=526

 Score =   172 bits (437),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 156/416 (38%), Positives = 213/416 (51%), Gaps = 90/416 (22%)
 Frame = +3

Query  270   EIISRTPPPS-RRLLCAATVIQTAFRCYLAKRALVALKGIVKLQALIRGQNVRRQARITL  446
             EI+  T P +  R   AAT+IQTAFR YLA+RAL ALKG+VKLQAL+RG NVR+QA++TL
Sbjct  109   EIVRLTRPTNFAREHYAATLIQTAFRGYLARRALRALKGLVKLQALVRGHNVRKQAKLTL  168

Query  447   KCMQALFRVQERMREQCARISQDSARKSMFSGS-TNSWESKY--IRERKSIFRDHCSVGE  617
             KCMQAL RVQ+++  + +R+S D+ R SMF+ +  + WES+   IR+RKSI R+    GE
Sbjct  169   KCMQALVRVQDQVHNERSRLSHDAGRNSMFAETGLHLWESRIQDIRDRKSISREKILSGE  228

Query  618   AWRDCPPTLQELEVMLQAQK-AAFMRERCPSQAWS----------SDTDVVDGEEREK--  758
              + D       LE + +++K AA  RE+  + A+S          S  D  + EER +  
Sbjct  229   DYWD-----DGLEPIPRSRKEAALKREKALAYAFSHQIWRPGRNPSAGDDAEIEERTRWL  283

Query  759   ----TTPLKQGKSRAPAIQRRNPVKSGEI------------NVRI-RSLQHKSASSVQap  887
                  T   +  SRA +I +R+ +K+ EI            NVRI  S Q K  +S    
Sbjct  284   ERWMATKQFENSSRA-SIDKRDSIKTVEIDKNSRPSSYTSPNVRISHSQQQKQPASYAIA  342

Query  888   at---pspakpkpVRPTT-SPGNL---------------EKSH--STANTPRLCPTNRSA  1004
             +            + P T SP  L               EK +  S A+TP L   N   
Sbjct  343   SASPLHKSQNMDHLSPATPSPSELKTLKVRSASPRCPKEEKYYCSSAAHTPSLSGFNAYC  402

Query  1005  SFAPRYSISGISPGYMAATESAKARLRSQSAPRQRPSTP--------AKRCLSYSISVK-  1157
             SF      SG +P YMAATESAKA+ +S SAPR RPSTP        AK+ LSY +  + 
Sbjct  403   SFKGAMCRSG-TPNYMAATESAKAKAQSLSAPRTRPSTPERERGGGSAKKRLSYPVPAEP  461

Query  1158  -------------------NGEEGVEKRSEYWCNNNNTERESVGGEISPCSTTNSR  1268
                                   + V+    Y   N+ +  +S+GG+ISPCSTT+ R
Sbjct  462   QPHNCVGIGYSSFSHNLRSPSFKSVQNNGYYGRENSPSYTDSIGGDISPCSTTDLR  517



>ref|XP_002892087.1| T25K16.10 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH68346.1| T25K16.10 [Arabidopsis lyrata subsp. lyrata]
Length=527

 Score =   172 bits (435),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 146/409 (36%), Positives = 200/409 (49%), Gaps = 91/409 (22%)
 Frame = +3

Query  315   AATVIQTAFRCYLAKRALVALKGIVKLQALIRGQNVRRQARITLKCMQALFRVQERMREQ  494
             AA VIQT+FR YLA+RAL ALKG+VKLQAL+RG NVR+QA++TL+CMQAL RVQ R+ +Q
Sbjct  123   AAVVIQTSFRGYLARRALRALKGLVKLQALVRGHNVRKQAKMTLRCMQALVRVQYRVLDQ  182

Query  495   CARISQDSARKSMFSGSTNSWESKYIRE---RKSIFRDHCSVGEAWRDCPPTLQELEVML  665
               R+S D +RKS FS S   +ES+Y++E   R+S+ R+  S  E W D P T+ E++ ML
Sbjct  183   RKRLSHDGSRKSAFSDSHAVYESRYLQEISDRQSMSREGSSAAEDWDDRPHTIDEVKAML  242

Query  666   QAQKAAFMRERCP--SQAWS-------------SDTDVVDGEEREK-------TTPLKQG  779
             Q ++   +R      SQA+S              D +V   EER K       T P  + 
Sbjct  243   QRRRDTALRHEKTNLSQAFSQQMWRTVRNQSVGGDHEVELEEERPKWLDRWMATRPWDKR  302

Query  780   KSRAPAIQRRNPVKSGEINVRIRSLQHKSAS-------SVQapatpspakpkpVRPTTSP  938
              S   ++ +R  VK+ EI+      + ++ S       S  +  +           T SP
Sbjct  303   ASSRASVDQRVSVKTVEIDASQPYSKTRTGSPSRIQRPSSPSRTSHHYQSRNNFSATPSP  362

Query  939   GNLEKSHSTANTPR-------------LCPTNRSASFAPRYSISGIS-------------  1040
                   H  + +PR                T+ + S    YS +  S             
Sbjct  363   AQSRPIHIRSASPRCQRDPREDRDRAAYSYTSNTPSLRSNYSFTARSGCSISTTMVNNAS  422

Query  1041  --PGYMAATESAKARLRSQSAPRQRPSTP-------AKRCLSYSI---------------  1148
               P YMA+TESAKAR+RSQSAPR RPSTP        K+ LSY +               
Sbjct  423   LLPNYMASTESAKARIRSQSAPRYRPSTPERDRAGLVKKRLSYPVPPPAEYEDNNSLRSP  482

Query  1149  ---SVKNGEEG--VEKRSEYWCNNNNTERESVGGEISPCSTTNSRWW*R  1280
                SV     G  +E++S Y    ++   ES G EISP ST++ R W R
Sbjct  483   SFKSVAGSHFGGMLEQQSNY----SSCCTESNGVEISPASTSDFRNWLR  527



>ref|XP_008374127.1| PREDICTED: protein IQ-DOMAIN 1-like [Malus domestica]
Length=517

 Score =   171 bits (433),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 152/408 (37%), Positives = 204/408 (50%), Gaps = 107/408 (26%)
 Frame = +3

Query  315   AATVIQTAFRCYLAKRALVALKGIVKLQALIRGQNVRRQARITLKCMQALFRVQERMREQ  494
             AAT+IQT FR YLA+RAL ALKG+VKLQAL+RG NVR+QA++TLKCMQAL RVQ+++R +
Sbjct  120   AATLIQTTFRGYLARRALHALKGLVKLQALVRGHNVRKQAKLTLKCMQALVRVQDQVRNE  179

Query  495   CARISQDSARKSMFSGS-TNSWESKY---IRERKSIFRDHCSVGEAWRDCPPTLQELEVM  662
              +R+S D+ R SMF+ +  + WES+Y   IR+RKSI R+  S GE + D     + LE +
Sbjct  180   RSRLSHDAGRNSMFAETGLHLWESRYLQDIRDRKSICREK-SRGEDYWD-----KGLEPV  233

Query  663   LQAQK-AAFMRERCPSQAWS----------SDTDVVDGEER----EKTTPLKQGKSRAPA  797
             L ++K AA  RE+  + A+S          S  D  + EER    E+    KQ ++R+ A
Sbjct  234   LHSRKEAALKREKALAYAFSHQIWRPERNPSSGDDAELEERTRWLERWMATKQFENRSRA  293

Query  798   -IQRRNPVKSGEINVRIR--------------SLQHKSASSVQapatpspakpkpVRPTT  932
              I +RN +K+ EI+   R                QH+   +  A A+ SP          
Sbjct  294   SIDKRNSIKTVEIDTNSRPSSCTSSNVPISSSHSQHQKQXASYAIASASPLHKSQYMNHL  353

Query  933   SPGNLEKSH----------------------STANTPRLCPTNRSASFAPRYSISGISPG  1046
             SP     S                       S A+TP L  TN    F      SG +P 
Sbjct  354   SPATPSPSKPKALKVRTASPRCPKEEKYYCSSAAHTPSLSGTNAYWGFRGAMCRSG-TPN  412

Query  1047  YMAATESAKARLRSQSAPRQRPSTP--------AKRCLSYSISVK---------------  1157
             YMAATESAKA+ RS S P+ RPSTP        AK+ L Y +S +               
Sbjct  413   YMAATESAKAKARSLSTPKTRPSTPERERGSGSAKKRLLYPVSAEPQHHNCVGIDCSSFS  472

Query  1158  -------------NGEEGVEKRSEYWCNNNNTERESVGGEISPCSTTN  1262
                          NG +G E  S Y         +++GGEISPCSTT+
Sbjct  473   QNSRSPSFKSVQNNGYDGRENLSSY--------ADTLGGEISPCSTTD  512



>ref|XP_009134490.1| PREDICTED: protein IQ-DOMAIN 1 [Brassica rapa]
Length=525

 Score =   170 bits (431),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 150/424 (35%), Positives = 207/424 (49%), Gaps = 96/424 (23%)
 Frame = +3

Query  267   VEIISRTPPP------------SRRLLCAATVIQTAFRCYLAKRALVALKGIVKLQALIR  410
             V ++S  PP             S R   AA +IQT FR YLA+RAL ALKG+VKLQAL+R
Sbjct  107   VSVVSELPPETAELPSISSRSYSARESYAAIIIQTCFRGYLARRALRALKGLVKLQALVR  166

Query  411   GQNVRRQARITLKCMQALFRVQERMREQCARISQDSARKSMFSGSTNSWESKY---IRER  581
             G NVR+QA++TL+CMQAL RVQ R+ +Q  R+S D  RKS FS + +  ES++   I +R
Sbjct  167   GHNVRKQAKMTLRCMQALVRVQSRVLDQRKRLSHDGTRKSAFSDTQSVLESRFLQDISDR  226

Query  582   KSIFRDHCSVGEAWRDCPPTLQELEVMLQAQKAAFMRERCPSQAWS--------SDTDVV  737
             +S+ R+  S+ E W + P T+QE++ MLQ +     R+   S+A+S        S +  V
Sbjct  227   RSMSREGSSIAEDWEERPQTIQEVKAMLQER-----RDNSLSKAFSQPIRRTGGSQSIGV  281

Query  738   DGEER----EKTTPLKQGKSRAPAIQRRNPVKSGEIN------VRIRSLQHKSASSVQ--  881
             D EER    ++    K    RA   QR    K+ E++       R  S    S S  Q  
Sbjct  282   DEEERPKWLDRWMSSKPWDKRASTDQRPPIYKTVEMDTSQPYLTRAHSRTGASPSRSQRP  341

Query  882   ------apatpspakpkpVRPTTSPGNLEKSHSTANTPRLCPTNRSA-------------  1004
                   +       +      T SP         + +PR+   +RSA             
Sbjct  342   DTPSRTSHHYNHQQQHSFSSATPSPAKSRPIQIRSASPRIQRDDRSAYSYTSNTPSLRSN  401

Query  1005  -SFAPR--YSISGIS--PGYMAATESAKARLRSQSAPRQRPSTP-------AKRCLSYSI  1148
              SF  R  YS+   +  P YMA TESAKAR+RS SAPRQRP TP       A++ LSY +
Sbjct  402   YSFTARSGYSVCTTTTLPNYMAITESAKARIRSHSAPRQRPLTPEKDRAGSARKRLSYPV  461

Query  1149  SVK---------------------NGEE--GVEKRSEYWCNNNNTERESVGGEISPCSTT  1259
              V+                      G +   +E++S Y  ++  TE    GGEISP ST+
Sbjct  462   PVQPPVDYGDSNSQSLRSPSLKSIGGSQLGALEQQSNY--SSCYTESVGGGGEISPASTS  519

Query  1260  NSRW  1271
             + RW
Sbjct  520   DRRW  523



>emb|CDX90011.1| BnaA10g00710D [Brassica napus]
Length=508

 Score =   169 bits (428),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 184/516 (36%), Positives = 245/516 (47%), Gaps = 126/516 (24%)
 Frame = +3

Query  87    MVKKLGANSWLTALKRVFIRYPSK-DrksrhskrdeeeekkrdkgrrWLFSKTADENSV-  260
             M KK G+ SWL+A+KR F R PSK +R   H K  EE+E+K+ + RRWLF K A ++S  
Sbjct  1     MGKKNGS-SWLSAVKRAF-RSPSKKERNDPHGKEIEEDEEKKREKRRWLFKKPATQDSPV  58

Query  261   --GGV------------------EIISRTPP-----PS--------------RRLLCA--  317
                GV                  E    TPP     PS              RR+  A  
Sbjct  59    KPSGVSPPPPPQESDNANSKTLPETAPTTPPNAGKSPSVTTSASPVAVPNVTRRIYYARE  118

Query  318   ---ATVIQTAFRCYLAKRALVALKGIVKLQALIRGQNVRRQARITLKCMQALFRVQERMR  488
                A VIQT+FR YLA+RAL ALKG+VKLQAL+RG NVR+QA++TL+CMQAL RVQ R+ 
Sbjct  119   NYAAVVIQTSFRGYLARRALRALKGLVKLQALVRGHNVRKQAKMTLRCMQALVRVQSRVL  178

Query  489   EQCARISQDSARKSMFSGSTN-SWESKY---IRERKSIFRDHCSVGEAWRDCPPTLQELE  656
             +Q  R+S D +RKS FS ST+  +ES+Y   I +R+S+ R+  SV E W D P T+ E++
Sbjct  179   DQRKRLSHDGSRKSAFSDSTHCGFESRYLQDISDRQSMSREGSSVPEDWDDRPHTIDEVK  238

Query  657   VMLQAQKAAFMRERCP--SQAWSSDTDVVDG-------------EEREK-------TTPL  770
              MLQ ++   +R      SQA+S       G             EER K       T P 
Sbjct  239   AMLQRRRDTALRHEKTNLSQAFSQQARRTSGSQSAGRDHRAELEEERPKWLDRWMATRPW  298

Query  771   KQGKSRAPAIQRRNPVKSGEINV-------RIRSLQHKSASSVQapatpspakpkpVRPT  929
              +      ++ +R  VK+ EI+        R  S       S  + ++           T
Sbjct  299   DKPPISRASVDQRVSVKTVEIDTSQPYSRARTGSPSRSQRPSSPSRSSHHYQPRSNFSAT  358

Query  930   TSPGNLEKSHSTANTPRLCPTNRSASFAPRYSISG----------ISPGYMAATESAKAR  1079
              SP      +  + +PR     R       YS +           + P YMA TESAKAR
Sbjct  359   PSPAKSRPINIRSASPRCQKDPRDDYDRAAYSYTSNTPSLRSNYTMLPNYMANTESAKAR  418

Query  1080  LRSQSAPRQRPSTP-------AKRCLSYSI------------------SVKNGEEG--VE  1178
             +RSQSAPRQRPSTP        K+ LS+ +                  SV     G  +E
Sbjct  419   IRSQSAPRQRPSTPERDRVGLVKKRLSFPVPPQPEYDDINSLRSPSFKSVAGSHFGALLE  478

Query  1179  KRSEYW--CNNNNTERESVGGEISPCSTTNSRWW*R  1280
             ++S Y   C       ES G E+SP ST++ R W R
Sbjct  479   QQSNYSSCCT------ESNGVEVSPASTSDYRNWLR  508



>ref|XP_010457172.1| PREDICTED: protein IQ-DOMAIN 1-like [Camelina sativa]
Length=530

 Score =   169 bits (429),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 167/474 (35%), Positives = 233/474 (49%), Gaps = 130/474 (27%)
 Frame = +3

Query  87    MVKKLGANSWLTALKRVFIRYPSKDrksrhskrdeeeekkrdkgrrWLFSKTADEN----  254
             M KK G++SWLTA+KR F R P+K     H+   E++E+K+ + RRWLF K A ++    
Sbjct  1     MGKKSGSSSWLTAVKRAF-RSPTK---KEHNNEVEDDEEKKREKRRWLFRKPATQDPPLM  56

Query  255   ---------SVGGVEIISRTPP----------------------------------PSR-  302
                          V + S+T P                                  P R 
Sbjct  57    PSGISPPPPPQESVNVNSQTSPETAPSNATTTTPSNAGKPSSAVSSVATSASKVVAPRRA  116

Query  303   ---RLLCAATVIQTAFRCYLAKRALVALKGIVKLQALIRGQNVRRQARITLKCMQALFRV  473
                R   AA VIQT+FR YLA+RAL ALKG+VKLQAL+RG NVR+QA++TL+CMQAL RV
Sbjct  117   YYARENYAAVVIQTSFRGYLARRALRALKGLVKLQALVRGHNVRKQAKMTLRCMQALVRV  176

Query  474   QERMREQCARISQDSARKSMFSGSTNSWESKY---IRERKSIFRDHCSVGEAWRDCPPTL  644
             Q R+ +Q  R+S D +RKS FS S   +ES+Y   I +R+S+ R+  +V E W D P T+
Sbjct  177   QSRVLDQRKRLSHDGSRKSAFSDSHTGFESRYLQDISDRQSMSREGSNVAEDWDDRPHTI  236

Query  645   QELEVMLQAQKAAFMRERCP--SQAWS-------------SDTDVVDGEEREK-------  758
              E++ MLQ ++   +R+     SQA+S              D +    EER K       
Sbjct  237   DEVKAMLQRRRDTALRQEKTNLSQAFSQQMWRAVGNQSAGGDHEAELEEERPKWLDRWMA  296

Query  759   TTPLKQGKSRAPAIQRRNPVKSGEINV-----RIR----------------SLQHKSASS  875
             T P  +  S   ++ +R  VK+ EI+      R R                S  ++S ++
Sbjct  297   TRPWDKRPSSRASVDQRISVKTVEIDTSQPYSRARTGSPSRSQRPSSPSRTSHHYQSRNN  356

Query  876   VQapatpspakpkpVRPTTSP---------GNLEKSHSTANTPRLCPTNRSASFAPRYSI  1028
               A  +P+ ++P  +R + SP         G+      T+NTP L     + SF  R   
Sbjct  357   FPATPSPAKSRPIHIR-SASPRCQRDPKEDGDQATYSYTSNTPSL---RSNYSFTARSGC  412

Query  1029  S---------GISPGYMAATESAKARLRSQSAPRQRPSTP-------AKRCLSY  1142
             S          + P YMA+TESAKAR+RSQSAP+QRPSTP        K+ LSY
Sbjct  413   SISTTMVNNASLLPNYMASTESAKARIRSQSAPKQRPSTPERDRAGSVKKRLSY  466



>ref|XP_008459750.1| PREDICTED: protein IQ-DOMAIN 1 isoform X2 [Cucumis melo]
Length=511

 Score =   169 bits (427),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 165/532 (31%), Positives = 242/532 (45%), Gaps = 160/532 (30%)
 Frame = +3

Query  96    KLGANSWLTALKRVFIRYPSKDrksrhskrdeeeekkrdkgrrWLFSKTADENSVGGVEI  275
             K G +SWLTA+KR F R P+KD   +   +             W+F K  ++      E 
Sbjct  3     KKGGSSWLTAVKRAF-RSPTKDDDEKRRDKRR-----------WIFRKPTNQQP----EP  46

Query  276   ISRTPPPSR-----------------------------------------------RLLC  314
             ++   PPS+                                               R   
Sbjct  47    LAAHQPPSKPAPALPIDSVALEDQKHALAVAEAAMVAARAAAQAVHLTRPARPGLDRHSL  106

Query  315   AATVIQTAFRCYLAKRALVALKGIVKLQALIRGQNVRRQARITLKCMQALFRVQERMREQ  494
             AA VIQTAFR YLA+RAL ALKG+VKLQAL+RG NVR+QA+ TL+CM+AL RVQE++ + 
Sbjct  107   AAIVIQTAFRGYLARRALRALKGLVKLQALVRGHNVRKQAKTTLQCMKALVRVQEKVLDH  166

Query  495   CARISQDSARKSMFSGSTNSWESKY---IRERKSI--FRDHCSVGEAWRDCPPTLQELEV  659
               R+S + +R+S FS + + +ES+Y   + ERK+I   R+  S+ E W +   T++E++ 
Sbjct  167   RMRLSLEGSRRSTFSDTNSVYESRYPQDVSERKTICVSREGSSITEDWDERAHTVEEVKA  226

Query  660   MLQAQK-AAFMRERCPSQAWS-------------SDTDVVDGEEREKTTPLK---QGKSR  788
             MLQ ++ AA  R+   S ++S             + T++ +G++       K   + ++R
Sbjct  227   MLQLRRDAALNRDNILSHSFSQQIWRTGKSPSIGNQTELEEGQKWLDQWMAKKPWESRAR  286

Query  789   APAIQRRNPVKSGEINVRIRSLQHKSASSVQapatpspakpkpVRPTTSPGNLEKSHSTA  968
             A    R  P+K+ EI+   R   + S +++        ++      ++SP +    H  +
Sbjct  287   ASTDHRPQPLKTLEIDTS-RPYSYLSPNNLHTTNYQPQSQRSNSLSSSSPLHRAHQHQFS  345

Query  969   NTP-----RLCPTNRSASFAPRY------------------------------SISGIS-  1040
              TP     R  P  RSAS  PRY                              S  G S 
Sbjct  346   ITPSPSKSRPVPQVRSAS--PRYSREDRNQINHHQITSQTPSLRSKYQYQKGGSGGGTSM  403

Query  1041  PGYMAATESAKARLRSQSAPRQRPSTPAKR------------------------CLSYSI  1148
             P YMAATESAKAR+RSQSAPRQRP+TP +                         C  Y  
Sbjct  404   PNYMAATESAKARVRSQSAPRQRPATPERERVGGTARKRLSFPVPPDPYGRIAGCSVYGN  463

Query  1149  SVKNGE--------EGVEKRSEYWCNNNNTERESVGGEISPCSTTNSRWW*R  1280
             S+K+           G+E++S Y    ++   ES GGE+SP STT+ R W R
Sbjct  464   SMKSPSFKSACGRFGGLEEQSNY----SSCYTESHGGEVSPSSTTDLRRWLR  511



>ref|XP_004306620.1| PREDICTED: protein IQ-DOMAIN 14-like [Fragaria vesca subsp. vesca]
Length=530

 Score =   169 bits (427),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 171/538 (32%), Positives = 247/538 (46%), Gaps = 153/538 (28%)
 Frame = +3

Query  96    KLGANSWLTALKRVFIRYPSKDrksrhskrdeeeekkrdkgrrWLFSKTADENSVGGVEI  275
             K G +SWLTA+KR F R P+KD +    +       ++        SK   EN+V     
Sbjct  3     KTGGSSWLTAVKRAF-RSPTKDDEDHKKREKRRWIFRKPTSLSQESSKEKTENNVSVATA  61

Query  276   --------------------------ISRTPPPS-----RRLLCAATVIQTAFRCYLAKR  362
                                       ++R   PS     ++L  AA VIQTAFR YLA+R
Sbjct  62    EQRHALDVAVATAEAAMATAQAAAVEVARLTRPSNHAREQQLQFAAIVIQTAFRGYLARR  121

Query  363   ALVALKGIVKLQALIRGQNVRRQARITLKCMQALFRVQERMREQCARISQDSARKSMFS-  539
             AL ALKG+VKLQAL+RG NVR+QA++TL+CMQAL RVQ R+ +Q  R+S + +RKS FS 
Sbjct  122   ALRALKGLVKLQALVRGHNVRKQAKMTLRCMQALVRVQARVLDQRTRLSHEGSRKSAFSD  181

Query  540   -GSTNSWESKY---IRERKSI-FRDHCSVGEAWRDCPPTLQELEVMLQAQK-AAFMRERC  701
               S ++WES+Y   I +RKSI  R+  S+ + W + P T++E++ MLQ +K AA  RE+ 
Sbjct  182   TNSNSAWESRYHQDISDRKSIQSREGSSIADDWDERPHTIEEVKAMLQHRKEAAMKREKA  241

Query  702   PSQAWS----------SDTDVVDGEEREK-------TTPLKQGKSRAPAIQRRNPVKSGE  830
              S A+S          S  +  + EE+ K         P +  ++RA +   R+P+K+ E
Sbjct  242   LSHAFSQQIWRNGRSPSMGNEDELEEKPKWLDRWMAPKPWESSRARA-STDHRDPIKTVE  300

Query  831   INVRIRSLQHKSASSVQapatpspakpkpVRPTTSPGNLEKSHSTAN-------------  971
             I+   +     S++  ++ A     + +  RP +SP + ++SH   +             
Sbjct  301   IDT-AQPYSSLSSNFRRSNANQYHQQNQQQRP-SSPLHRDRSHQNQHFHHSPITPSPSKS  358

Query  972   ---------TPRLCPTNRSA------SFAPRYSISG------------ISPGYMAA----  1058
                      +PR    +RS+      S    Y  +G             S G + A    
Sbjct  359   RPPIQVRSASPRCVREDRSSNASQTPSLRSNYYYNGGVVHQHSRGSTSTSGGNVGATLPN  418

Query  1059  ----TESAKARLRSQSAPRQRPSTPAK---------------------------------  1127
                 TESAKAR+RSQSAPRQRPSTP +                                 
Sbjct  419   YMAATESAKARIRSQSAPRQRPSTPDRDRGGGVGSVKKRLSFPAPDPYGAVGMGAYGGGG  478

Query  1128  -----RCLSYSISVKNGEEGVEKRSEYW--CNNNNTERESVGGEISPCSTTNSRWW*R  1280
                  R  S+   V     G+E++S Y   C       ES GGE+SP ST++ R W R
Sbjct  479   YVHSLRSPSFKSVVSGSHFGLEQQSNYSSCCT------ESHGGEVSPSSTSDLRRWLR  530



>ref|XP_010480654.1| PREDICTED: protein IQ-DOMAIN 1-like [Camelina sativa]
Length=528

 Score =   168 bits (425),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 129/343 (38%), Positives = 174/343 (51%), Gaps = 67/343 (20%)
 Frame = +3

Query  315   AATVIQTAFRCYLAKRALVALKGIVKLQALIRGQNVRRQARITLKCMQALFRVQERMREQ  494
             AA VIQT+FR YLA+RAL ALKG+VKLQAL+RG NVR+QA++TL+CMQAL RVQ R+ +Q
Sbjct  125   AAVVIQTSFRGYLARRALRALKGLVKLQALVRGHNVRKQAKMTLRCMQALVRVQSRVLDQ  184

Query  495   CARISQDSARKSMFSGSTNSWESKYIR---ERKSIFRDHCSVGEAWRDCPPTLQELEVML  665
               R+S D +RKS FS S   +ES+YI+   +R+S+ R+  SV E W D P T+ E++ ML
Sbjct  185   RKRLSHDGSRKSAFSDSHTGFESRYIQDISDRQSMSREGSSVAEDWDDRPHTIDEVKAML  244

Query  666   QAQKAAFMRERCP--SQAWS-------------SDTDVVDGEEREK-------TTPLKQG  779
             Q ++   +R+     SQA+S              D +    EER K       T P  + 
Sbjct  245   QRRRDTALRQEKTNLSQAFSQQMWRAVGNQSAGGDHEAELEEERPKWLDRWMATRPWDKR  304

Query  780   KSRAPAIQRRNPVKSGEINV-------RIRSLQHKSASSVQapatpspakpkpVRPTTSP  938
              S   ++ +R  VK+ EI+        R  S       S  +  +           T SP
Sbjct  305   PSSRASVDQRISVKTVEIDTSQPYSRARTGSPSRSQRPSSPSRTSHHYQSRNNFPATPSP  364

Query  939   GNLEKSHSTANTPR-------------LCPTNRSASFAPRYSISGIS-------------  1040
                   H  + +PR                T+ + S    YS +  S             
Sbjct  365   AKSRPIHIRSASPRCQRDPREDRDRAAYSYTSNTPSLRSNYSFTARSGCSISTTVVNNAS  424

Query  1041  --PGYMAATESAKARLRSQSAPRQRPSTP-------AKRCLSY  1142
               P YMA+TESAKAR+RSQSAP+QRPSTP        K+ LSY
Sbjct  425   LLPNYMASTESAKARIRSQSAPKQRPSTPERDRAGSVKKRLSY  467



>ref|XP_008459749.1| PREDICTED: protein IQ-DOMAIN 1 isoform X1 [Cucumis melo]
Length=512

 Score =   168 bits (425),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 165/533 (31%), Positives = 242/533 (45%), Gaps = 161/533 (30%)
 Frame = +3

Query  96    KLGANSWLTALKRVFIRYPSKDrksrhskrdeeeekkrdkgrrWLFSKTADENSVGGVEI  275
             K G +SWLTA+KR F R P+KD   +   +             W+F K  ++      E 
Sbjct  3     KKGGSSWLTAVKRAF-RSPTKDDDEKRRDKRR-----------WIFRKPTNQQP----EP  46

Query  276   ISRTPPPSR-----------------------------------------------RLLC  314
             ++   PPS+                                               R   
Sbjct  47    LAAHQPPSKPAPALPIDSVALEDQKHALAVAEAAMVAARAAAQAVHLTRPARPGLDRHSL  106

Query  315   AATVIQTAFRCYLAKRALVALKGIVKLQALIRGQNVRRQARITLKCMQALFRVQERMREQ  494
             AA VIQTAFR YLA+RAL ALKG+VKLQAL+RG NVR+QA+ TL+CM+AL RVQE++ + 
Sbjct  107   AAIVIQTAFRGYLARRALRALKGLVKLQALVRGHNVRKQAKTTLQCMKALVRVQEKVLDH  166

Query  495   CARISQDSARKSMFSGSTNSWESKY---IRERKSI---FRDHCSVGEAWRDCPPTLQELE  656
               R+S + +R+S FS + + +ES+Y   + ERK+I    R+  S+ E W +   T++E++
Sbjct  167   RMRLSLEGSRRSTFSDTNSVYESRYPQDVSERKTIKCVSREGSSITEDWDERAHTVEEVK  226

Query  657   VMLQAQK-AAFMRERCPSQAWS-------------SDTDVVDGEEREKTTPLK---QGKS  785
              MLQ ++ AA  R+   S ++S             + T++ +G++       K   + ++
Sbjct  227   AMLQLRRDAALNRDNILSHSFSQQIWRTGKSPSIGNQTELEEGQKWLDQWMAKKPWESRA  286

Query  786   RAPAIQRRNPVKSGEINVRIRSLQHKSASSVQapatpspakpkpVRPTTSPGNLEKSHST  965
             RA    R  P+K+ EI+   R   + S +++        ++      ++SP +    H  
Sbjct  287   RASTDHRPQPLKTLEIDTS-RPYSYLSPNNLHTTNYQPQSQRSNSLSSSSPLHRAHQHQF  345

Query  966   ANTP-----RLCPTNRSASFAPRY------------------------------SISGIS  1040
             + TP     R  P  RSAS  PRY                              S  G S
Sbjct  346   SITPSPSKSRPVPQVRSAS--PRYSREDRNQINHHQITSQTPSLRSKYQYQKGGSGGGTS  403

Query  1041  -PGYMAATESAKARLRSQSAPRQRPSTPAKR------------------------CLSYS  1145
              P YMAATESAKAR+RSQSAPRQRP+TP +                         C  Y 
Sbjct  404   MPNYMAATESAKARVRSQSAPRQRPATPERERVGGTARKRLSFPVPPDPYGRIAGCSVYG  463

Query  1146  ISVKNGE--------EGVEKRSEYWCNNNNTERESVGGEISPCSTTNSRWW*R  1280
              S+K+           G+E++S Y    ++   ES GGE+SP STT+ R W R
Sbjct  464   NSMKSPSFKSACGRFGGLEEQSNY----SSCYTESHGGEVSPSSTTDLRRWLR  512



>emb|CDY69140.1| BnaAnng29450D [Brassica napus]
Length=525

 Score =   167 bits (423),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 142/396 (36%), Positives = 199/396 (50%), Gaps = 84/396 (21%)
 Frame = +3

Query  315   AATVIQTAFRCYLAKRALVALKGIVKLQALIRGQNVRRQARITLKCMQALFRVQERMREQ  494
             AA +IQT FR YLA+RAL ALKG+VKLQAL+RG NVR+QA++TL+CMQAL RVQ R+ +Q
Sbjct  135   AAIIIQTCFRGYLARRALRALKGLVKLQALVRGHNVRKQAKMTLRCMQALVRVQSRVLDQ  194

Query  495   CARISQDSARKSMFSGSTNSWESKY---IRERKSIFRDHCSVGEAWRDCPPTLQELEVML  665
               R+S D  RKS FS + +  ES+Y   I +R+S+ R+  S+ E W + P T+QE++ ML
Sbjct  195   RKRLSHDGTRKSAFSDTHSVLESRYLQDISDRRSMSREGSSIAEDWEERPQTIQEVKAML  254

Query  666   QAQKAAFMRERCPSQAWSSD------TDVVDGEEREKTTPLKQGKSRAP-----AIQRRN  812
             Q +     R+   S+A+S        +  +  EE ++   L +  S  P     +  +R 
Sbjct  255   QER-----RDNSLSKAFSQQIRRTRGSQSIGEEEEDRPKWLDRWMSSKPWDKRASTDQRP  309

Query  813   PV-KSGEIN------VRIRSLQHKSASSVQ--------apatpspakpkpVRPTTSPGNL  947
             PV K+ EI+       R  S    S S  Q        +       +      T SP   
Sbjct  310   PVYKTVEIDTSQPYLTRAHSRTGASPSRSQRPDTPSRTSHHYNHQQQHSFSSATPSPAKS  369

Query  948   EKSHSTANTPRLCPTNRSA--------------SFAPR--YSISGIS--PGYMAATESAK  1073
                   + +PR+   +R A              SF  R  YS+   +  P YMA TESAK
Sbjct  370   RPIQIRSASPRIQRDDRFAYSYTSNTPSLRSNYSFTARSGYSVCTTTTLPNYMAITESAK  429

Query  1074  ARLRSQSAPRQRPSTP-------AKRCLSYSI----------------------SVKNGE  1166
             AR+RS SAPRQRP TP       A++ LSY +                      S+   +
Sbjct  430   ARIRSHSAPRQRPLTPEKDRAGSARKRLSYPVPLQPPVDYGDSNSQSLRSPSLKSIGGSQ  489

Query  1167  EG-VEKRSEYWCNNNNTERESVGGEISPCSTTNSRW  1271
              G +E++S Y  ++  TE    GGEISP ST++ RW
Sbjct  490   LGALEQQSNY--SSCYTESVGGGGEISPASTSDRRW  523



>emb|CDY15200.1| BnaC05g00790D [Brassica napus]
Length=511

 Score =   166 bits (421),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 182/517 (35%), Positives = 245/517 (47%), Gaps = 125/517 (24%)
 Frame = +3

Query  87    MVKKLGANSWLTALKRVFIRYPSK-DrksrhskrdeeeekkrdkgrrWLFSKTADENSV-  260
             M KK G+ SWL+A+KR F R PSK +R   H K  EE+E+K+ + RRWLF K A ++S  
Sbjct  1     MGKKNGS-SWLSAVKRAF-RSPSKKERNDPHGKEIEEDEEKKREKRRWLFKKPATQDSPV  58

Query  261   --GGV------------------EIISRTPP-----PS------------------RRLL  311
                GV                  E    TPP     PS                  RR+ 
Sbjct  59    KPSGVSPPPPPQESDNANSKTLPETAPTTPPNAGKSPSAVVSVATSASPVAVPNVTRRIY  118

Query  312   CA-----ATVIQTAFRCYLAKRALVALKGIVKLQALIRGQNVRRQARITLKCMQALFRVQ  476
              A     A VIQT+FR YLA+RAL ALKG+VKLQAL+RG NVR+QA++TL+CMQAL RVQ
Sbjct  119   YARENYAAVVIQTSFRGYLARRALRALKGLVKLQALVRGHNVRKQAKMTLRCMQALVRVQ  178

Query  477   ERMREQCARISQDSARKSMFSGSTNSWESKY---IRERKSIFRDHCSVGEAWRDCPPTLQ  647
              R+ +Q  R+S D +RKS FS +   +ES+Y   I +R+S+ R+  SV E W D P T+ 
Sbjct  179   SRVLDQRKRLSHDGSRKSAFSDTHCGFESRYLQDISDRQSMSREGSSVPEDWDDRPHTID  238

Query  648   ELEVMLQAQKAAFMRERCP--SQAWSSDTDVVDG-------------EEREK-------T  761
             E++ MLQ ++   +R      SQA+S  T    G             EER K       T
Sbjct  239   EVKAMLQRRRDTALRHEKTNLSQAFSQQTWRTTGSQSAGRDHRAELEEERPKWLDRWMAT  298

Query  762   TPLKQGKSRAPAIQRRNPVKSGEINV-------RIRSLQHKSASSVQapatpspakpkpV  920
              P  +      ++ +R  VK+ EI+        R  S       S  + ++         
Sbjct  299   RPWDKPPISRASVDQRVSVKTVEIDTSQPYSRARTGSPSRSQRPSSPSRSSHHYQPRSNF  358

Query  921   RPTTSPGNLEKSHSTANTPRLCPTNRSASFAPRYSISGISP----------GYMAATESA  1070
               T SP      +  + +PR     R       YS +  +P           YMA TESA
Sbjct  359   SATPSPAKSRPINIRSASPRCQRDPRDDYDRAAYSYTSNTPSLRSNYTMLPNYMANTESA  418

Query  1071  KARLRSQSAPRQRPSTP-------AKRCLSYSI------------------SVKNGEEG-  1172
             KAR+RSQSAPRQRPSTP        K+ LS+ +                  SV     G 
Sbjct  419   KARIRSQSAPRQRPSTPERERVGLVKKRLSFPVPPQPEYDDINSLRSPSFKSVAGSHFGA  478

Query  1173  -VEKRSEYWCNNNNTERESVGGEISPCSTTNSRWW*R  1280
              +E++S Y    ++   ES G E+SP ST++ R W R
Sbjct  479   LLEQQSNY----SSCCTESNGVEVSPASTSDYRNWLR  511



>ref|XP_010474698.1| PREDICTED: protein IQ-DOMAIN 1-like [Camelina sativa]
Length=527

 Score =   166 bits (421),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 129/343 (38%), Positives = 173/343 (50%), Gaps = 67/343 (20%)
 Frame = +3

Query  315   AATVIQTAFRCYLAKRALVALKGIVKLQALIRGQNVRRQARITLKCMQALFRVQERMREQ  494
             AA VIQT+FR YLA+RAL ALKG+VKLQAL+RG NVR+QA++TL+CMQAL RVQ R+ +Q
Sbjct  125   AAVVIQTSFRGYLARRALRALKGLVKLQALVRGHNVRKQAKMTLRCMQALVRVQSRVLDQ  184

Query  495   CARISQDSARKSMFSGSTNSWESKY---IRERKSIFRDHCSVGEAWRDCPPTLQELEVML  665
               R+S D +RKS FS S   +ES+Y   I +R+S+ R+  SV E W D P T+ E++ ML
Sbjct  185   RKRLSHDGSRKSAFSESHTGFESRYLQDISDRQSMSREGSSVAEDWDDRPHTIDEVKAML  244

Query  666   QAQKAAFMRERCP--SQAWS-------------SDTDVVDGEEREK-------TTPLKQG  779
             Q ++   +R+     SQA+S              D +    EER K       T P  + 
Sbjct  245   QRRRDTALRQEKTNLSQAFSQQMWRAVGNQSAGGDHEAELEEERPKWLDRWMATRPWDKR  304

Query  780   KSRAPAIQRRNPVKSGEINV-------RIRSLQHKSASSVQapatpspakpkpVRPTTSP  938
              S   ++ +R  VK+ EI+        R  S       S  +  +           T SP
Sbjct  305   PSSRASVDQRISVKTVEIDTSQPYSRARTGSPSRSQRPSSPSRTSHHYQSRNNFPATPSP  364

Query  939   GNLEKSHSTANTPR-------------LCPTNRSASFAPRYSISGIS-------------  1040
                   H  + +PR                T+ + S    YS +  S             
Sbjct  365   AKSRPIHIRSASPRCQRDPREDRDRAAYSYTSNTPSLRSNYSFTARSGCSISTTMVNNAS  424

Query  1041  --PGYMAATESAKARLRSQSAPRQRPSTP-------AKRCLSY  1142
               P YMA+TESAKAR+RSQSAP+QRPSTP        K+ LSY
Sbjct  425   LLPNYMASTESAKARIRSQSAPKQRPSTPERDRAGSVKKRLSY  467



>gb|KGN46538.1| hypothetical protein Csa_6G107880 [Cucumis sativus]
Length=513

 Score =   166 bits (420),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 164/534 (31%), Positives = 238/534 (45%), Gaps = 162/534 (30%)
 Frame = +3

Query  96    KLGANSWLTALKRVFIRYPSKDrksrhskrdeeeekkrdkgrrWLFSKTADENSVGGVEI  275
             K G +SWLTA+KR F R P+KD   +   +             W+F K  ++      E 
Sbjct  3     KKGGSSWLTAVKRAF-RSPTKDDDEKRRDKRR-----------WIFRKPTNQQP----EP  46

Query  276   ISRTPPPSR-----------------------------------------------RLLC  314
             ++   PPS+                                               R   
Sbjct  47    LAAHQPPSKPAPALPIDSVALEDQKHALAVAEAAMVAARAAAQAVHLTRPARPGLDRHRL  106

Query  315   AATVIQTAFRCYLAKRALVALKGIVKLQALIRGQNVRRQARITLKCMQALFRVQERMREQ  494
             AA VIQTAFR YLA+RAL ALKG+VKLQAL+RG NVR+QA+ TL+CM+AL RVQE++ + 
Sbjct  107   AAIVIQTAFRGYLARRALRALKGLVKLQALVRGHNVRKQAKTTLQCMKALVRVQEKVLDH  166

Query  495   CARISQDSARKSMFSGSTNSWESKY---IRERKSI--FRDHCSVGEAWRDCPPTLQELEV  659
               R+S + +R+S FS + + +ES+Y   + ERK+I   R+  S+ E W +   T++E++ 
Sbjct  167   RMRLSLEGSRRSTFSDTNSVYESRYPQDVSERKTICVSREGSSITEDWDERAHTVEEVKA  226

Query  660   MLQAQK-AAFMRERCPS-----QAWSSDTDVVDGEEREKTTPLK-----------QGKSR  788
             MLQ ++ AA  R+   S     Q W +      G + E     K           + ++R
Sbjct  227   MLQLRRDAALNRDNILSHSFSQQIWRTGKSPSIGNQTELEEGHKWLDQWMAKKPWESRAR  286

Query  789   APAIQRRNPVKSGEINVRIRSLQHKSASSVQapatpspakpkpVRPTTSPGNLEKSHSTA  968
             A    R  P+K+ EI+   R   + S +++        ++      ++SP +    H  +
Sbjct  287   ASIDHRPQPLKTLEIDTS-RPYSYLSPNNLHTTNYQPQSQRSNSLSSSSPLHRAHQHQFS  345

Query  969   NTP-----RLCPTNRSASFAPRYSISGIS-------------------------------  1040
              TP     R  P  RSAS  PRYS    +                               
Sbjct  346   ITPSPSKSRPVPQVRSAS--PRYSREDRNQINHHHVTSQTPSLRSKYQHQKGGGGGGTSM  403

Query  1041  PGYMAATESAKARLRSQSAPRQRPSTP----------AKRCLSYSIS------VKNGE--  1166
             P YMAATESAKAR+RSQSAPRQRP+TP          A++ LS+ +       +  G   
Sbjct  404   PNYMAATESAKARVRSQSAPRQRPATPERERVGGGGTARKRLSFPVPPDPYGRIAGGSVY  463

Query  1167  ----------------EGVEKRSEYWCNNNNTERESVGGEISPCSTTNSRWW*R  1280
                              G+E++S Y    ++   ES GGE+SP STT+ R W R
Sbjct  464   GNSMKSPSFKSACGRYGGLEEQSNY----SSCYTESHGGEVSPSSTTDLRRWLR  513



>ref|XP_010940851.1| PREDICTED: protein IQ-DOMAIN 14-like [Elaeis guineensis]
Length=510

 Score =   166 bits (419),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 155/399 (39%), Positives = 204/399 (51%), Gaps = 86/399 (22%)
 Frame = +3

Query  315   AATVIQTAFRCYLAKRALVALKGIVKLQALIRGQNVRRQARITLKCMQALFRVQERMREQ  494
             AA +IQTAFR YLA+RAL AL+G+VKLQAL+RG NVR+QA +TL+CMQAL RVQ ++R+Q
Sbjct  121   AAIIIQTAFRGYLARRALRALRGLVKLQALVRGHNVRKQANMTLRCMQALVRVQAQVRDQ  180

Query  495   CARISQDSA----RKSMFSGSTNSWESKYIRE---RKSIFRDHCSVGEAWRDCPPTLQEL  653
               R++Q++A     KS FS  T+ W+SKY++E   R+S+ R+  S  + W D P T++E+
Sbjct  181   RFRLAQEAAGCSSNKSSFSCDTSFWDSKYLQELEQRRSMSREGSSYADVWDDRPRTIEEI  240

Query  654   EVMLQAQK-AAFMRERCPS-----QAWSSDTDVVDGEEREKTTPLKQGKSRAPAIQRRNP  815
             + M+Q++K AA  RER  S     Q W  D ++    E E+     +G  R P    R  
Sbjct  241   QAMVQSRKEAALKRERALSYAFSHQFWRPDRNLSPSLE-EEVEVASRGDQRPPRWTDRWI  299

Query  816   VKSGEINVRIRSLQHKSASSVQapatpspakpkpVRPTTSPGN---------------LE  950
                   + R  S    S   +    T      +P   TT+P N               L 
Sbjct  300   ASRSSFDNRASSRGRASTDQIDPIKTLEIDPARPFSYTTNPTNPRRPPQPSSHQLSSPLG  359

Query  951   KSHSTANTPRLCPTN----RSASFAPR----------YSISGIS-------PGYMAATES  1067
             +SH +  TP    +     RSAS  PR          Y   G S       P YMAATES
Sbjct  360   RSHHSPVTPSPSKSRPLQVRSAS--PRCGREEGSSSAYYHHGASRHHRAAVPNYMAATES  417

Query  1068  AKARLRSQSAPRQRPSTPA--------KRCLS-----------YSISVKN-------GEE  1169
             AKAR RSQSAPRQRP+TP         K+ LS           YS S+++       G  
Sbjct  418   AKARARSQSAPRQRPATPERERGAGSIKKRLSFPVPEAYGYGGYSQSLRSPSFKSAVGRL  477

Query  1170  GVEKRSEY--WCNNNNTERESVGGEISPCSTTNSRWW*R  1280
             G E+RS    +CN      ES GGE+SP STT  R W R
Sbjct  478   GEEQRSNVSSFCN------ESFGGEVSPSSTTELRRWLR  510



>ref|XP_007039369.1| Iq-domain 1 [Theobroma cacao]
 gb|EOY23870.1| Iq-domain 1 [Theobroma cacao]
Length=526

 Score =   165 bits (417),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 153/400 (38%), Positives = 202/400 (51%), Gaps = 90/400 (23%)
 Frame = +3

Query  315   AATVIQTAFRCYLAKRALVALKGIVKLQALIRGQNVRRQARITLKCMQALFRVQER-MRE  491
             AA VIQTAFR YLA+RAL ALKG+VKLQAL+RG NVRRQA++ LKCMQ+L +VQ+R + +
Sbjct  129   AAIVIQTAFRRYLARRALRALKGLVKLQALVRGHNVRRQAKLALKCMQSLVQVQDRVLDQ  188

Query  492   QCARISQDSARKSMFSGSTNSWESKY---IRERKSIFRDHCSVGEAWRDCPPTLQELEVM  662
             Q AR+S +  R SMF+ +   WES+Y   IR RKS+ RD     + W D P T +E+E +
Sbjct  189   QRARLSHEGYRNSMFAETNALWESRYLQDIRSRKSMSRDMSCTTDEWDDRPQTSEEIEAI  248

Query  663   LQAQK-AAFMRERC-----PSQAWSSDTDVVDGEEREKTTPLK-----------QGKSRA  791
             LQ +K AA  RE+       +Q W S  +   G+E+E     K           +  SR 
Sbjct  249   LQNKKQAALKREKALAYAFSNQVWRSGRNPSAGDEKELEERTKWLDRWMATKRWESNSRV  308

Query  792   PAIQRRNPVKSGEINVR---------IRSLQ----------HKSASSVQapatpspakpk  914
              +   R+ +K+ EI+           IR  Q          H  AS +            
Sbjct  309   -STDIRDSIKTVEIDTYKPQSYSSPTIRKSQYQNHKQFPTSHSVASPLDREHHNFSLNQF  367

Query  915   pVRP-----------TTSPGNLEKS---HSTANTPRLCPTNRSASFAPRY-SISGISPGY  1049
             P  P           + SP  L++    +S ANTP L  T  + +   RY + +   P Y
Sbjct  368   PATPSPCKTKPLQVRSASPRCLKEEKCYYSAANTPSLASTYCTHNGISRYGNAAATVPNY  427

Query  1050  MAATESAKARLRSQSAPRQRPSTP--------AKRCLSY-------------------SI  1148
             MA TESAKA+ RSQS P+QRPSTP        AK+ LSY                   S 
Sbjct  428   MATTESAKAKARSQSTPKQRPSTPERERGGSLAKKRLSYPAPESHVGIGRSSFSQNLRSP  487

Query  1149  SVKN---GEEGVEKRSEYWCNNNNTERESVGGEISPCSTT  1259
             S K+   G  G+EK S +    ++   ES GGEISPCSTT
Sbjct  488   SFKSAFEGHYGMEKESFF----SSYHTESFGGEISPCSTT  523



>gb|KDP47069.1| hypothetical protein JCGZ_05096 [Jatropha curcas]
Length=513

 Score =   159 bits (403),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 124/324 (38%), Positives = 174/324 (54%), Gaps = 58/324 (18%)
 Frame = +3

Query  315   AATVIQTAFRCYLAKRALVALKGIVKLQALIRGQNVRRQARITLKCMQALFRVQERMREQ  494
             AA  IQTAFR YLA+RAL ALKG+VKLQAL+RG NVR++A++TL CMQAL RVQ R+R+Q
Sbjct  133   AAIAIQTAFRGYLARRALRALKGLVKLQALVRGHNVRKRAKMTLHCMQALMRVQARVRDQ  192

Query  495   CARISQDSARKSMFSGSTNSWESKYIRERKSIFRDHCSVGE---AWRDCPPTLQELEVML  665
               R+S + +  S  S   + W S +  +RKSI RD  +  +    W + P +L+E++V+L
Sbjct  193   RKRLSYEGSTNSTLSDPNSLWGSHFA-DRKSIPRDENNTTDEWVHWDENPQSLEEIQVLL  251

Query  666   QAQK-----AAFMRERCPSQAWSS-------DTDVVDGEEREKT------TPLKQGKSRA  791
             Q  K      A  RE+  + A+S        DT   +GE  EK       T  KQ ++R 
Sbjct  252   QETKEEEEEVALKREKALAHAFSHQIWMPSRDTYASEGELEEKPRWDDQWTRRKQLENRG  311

Query  792   PAI--QRRNPVKSGEINVRIRSLQHKSASSVQapatpspakpkpVRPT----TSPGNLEK  953
               +  +R + +K+ E++       HK                +  RP+    TSP    +
Sbjct  312   RTLCDERESIIKTVEVDTYSTPYTHKP---------HYHHLYQQQRPSSFSATSPLLRHQ  362

Query  954   SHSTANTPRLCPTNRSASFAPRY----------SISGIS---PGYMAATESAKARLRSQS  1094
             ++ T +  +  P  +  S +PRY          + +GI+   P YMAAT SAKARLRSQS
Sbjct  363   NNITPSPSKATPQLQVHSASPRYLREDRNNVSKTGNGIATSMPNYMAATASAKARLRSQS  422

Query  1095  APRQRPSTP--------AKRCLSY  1142
             APRQR STP        AK+ LS+
Sbjct  423   APRQRASTPEREKIGPTAKKRLSF  446



>ref|XP_007039184.1| IQ-domain 17, putative [Theobroma cacao]
 gb|EOY23685.1| IQ-domain 17, putative [Theobroma cacao]
Length=536

 Score =   159 bits (403),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 144/412 (35%), Positives = 200/412 (49%), Gaps = 97/412 (24%)
 Frame = +3

Query  303   RLLCAATVIQTAFRCYLAKRALVALKGIVKLQALIRGQNVRRQARITLKCMQALFRVQER  482
             R   AA VIQTAFR YLA+RAL ALKG+VKLQAL+RG NVR++A ITL+CM+A+ RVQ R
Sbjct  136   REHFAAIVIQTAFRGYLARRALRALKGLVKLQALVRGHNVRKRANITLRCMEAMVRVQAR  195

Query  483   MREQCARI-SQDSARKSMFSGSTNSWESKYIRERKSIFRDHCSVGEA---WRDCPPTLQE  650
             +R+Q  R+ + + +  S+FS   + W S  + +RKSI R+     +    W + P TL+E
Sbjct  196   VRDQRKRLAAHEGSTDSVFSDPNSLWSSHLV-DRKSISREESGNVDDWIRWDEHPKTLEE  254

Query  651   LEVMLQAQK-AAFMRERCPSQA-----WSSDTDVVDGEER--------EKTTPLKQGKSR  788
             ++ +LQA K AA  RE+  + A     W  D   V+ EE         ++ T  KQ +S 
Sbjct  255   IQAILQATKEAALKREKALAHAFSHQIWRIDRGAVESEEELDGNTRWVDRWTTRKQWESP  314

Query  789   A-PAIQRRNPVKSGEI----------------NVRIRSLQHKSASSVQapatpspakpkp  917
                +    +P+K+ EI                N +    Q + +S              P
Sbjct  315   GRMSCDHIDPIKTVEIDTFRPYSYSAPHSQKSNRQYHHQQRRPSSYFVTSPLHKANNSLP  374

Query  918   VRPTT--------------SPGNL--EKSHSTANTPRLCPTNRSASFAPRYSISGIS---  1040
             +R  T              SP  L  EKSH + +TP       S S+  R S +G +   
Sbjct  375   IRSITPSPSKAKPLQMYSASPRYLKEEKSHPSPHTP------NSGSYTHRMSGNGGAAAP  428

Query  1041  -PGYMAATESAKARLRSQSAPRQRPSTP-------AKRCLSYSI----------------  1148
              P YMAAT SA AR RSQSAP+QRPSTP       AK+ LS+ +                
Sbjct  429   MPNYMAATASAMARFRSQSAPKQRPSTPEREKVGSAKKRLSFPVPDQCGVDGSKDQVYDY  488

Query  1149  --------SVKNGEEGVEKRSEYWCNNNNTERESVGGEISPCSTTNSRWW*R  1280
                     S   G  G+E++S    N ++   +S+G EI P ST + R W R
Sbjct  489   NLGSPSYKSGHGGHFGMEQKS----NLSSCYADSLGEEIFPPSTNDLRKWLR  536



>ref|XP_002444923.1| hypothetical protein SORBIDRAFT_07g001510 [Sorghum bicolor]
 gb|EES14418.1| hypothetical protein SORBIDRAFT_07g001510 [Sorghum bicolor]
Length=574

 Score =   159 bits (401),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 153/443 (35%), Positives = 209/443 (47%), Gaps = 122/443 (28%)
 Frame = +3

Query  300   RRLLCAATVIQTAFRCYLAKRALVALKGIVKLQALIRGQNVRRQARITLKCMQALFRVQE  479
             RR   AA VIQTAFR YLA+RAL ALKG+VKLQAL+RG NVR+QA +TL+CMQAL RVQ 
Sbjct  138   RREHYAAVVIQTAFRGYLARRALRALKGLVKLQALVRGHNVRKQANMTLRCMQALVRVQA  197

Query  480   RMREQCARISQDS-----------------ARKSMFSGSTNS-WESKYIR---ERKSI--  590
             R+R+Q  R+SQDS                 + KS +S  T++ W+SKY     +R+S+  
Sbjct  198   RVRDQRMRLSQDSMLSMSMSGAGAGAAPCGSSKSSYSVDTSTFWDSKYAHDYADRRSVER  257

Query  591   FRDHCS-VGEAWRDCPPTLQELEVMLQAQK-AAFMRERCPSQAWSSD-------------  725
              RD  S   + W D P T++E++ MLQ +K AA  RER  S A+S               
Sbjct  258   SRDGSSFAADDWDDRPRTIEEIQAMLQTRKDAALKRERALSYAFSHQIWRNPAVAASASA  317

Query  726   ---TDVVDGEER--------------EKTTPLKQGKSRAP---AIQRRNPVKSGEINVRI  845
                 DV DG+ R               +++    G +  P   ++ +R PVK+ E++   
Sbjct  318   EEMMDVDDGKPRWAERWMASRASFDTNRSSIRGAGGAAVPGRASMDQREPVKTLEMDT-A  376

Query  846   RSLQHK-----SASSVQapatpspakpkpV--------RP-----TTSPGNLEKSH----  959
             R   +      S+S +         +   V        RP     + SP     +H    
Sbjct  377   RPFSYSTPRRGSSSPMHRAHQQQQQQHPAVATPSPVKARPPIQVRSASPRVDHHNHHRGS  436

Query  960   --STANTPRLCPTNRSASFAPRYSISGISPGYMAATESAKARLRSQSAPRQRPSTP----  1121
                 + TP L  + R AS     S +   P YMAATESAKAR+RSQSAPRQRP+TP    
Sbjct  437   GGGGSYTPSLLHSQRHAS-----SSAAAVPNYMAATESAKARVRSQSAPRQRPATPERDR  491

Query  1122  ---------------AKRCLSYSISVKNGEEGVEK-------------RSEYWCNNNNTE  1217
                            AK+ LS+   +    E                  SE     +++ 
Sbjct  492   GGGGGSAGAAAAASGAKKRLSFPAQLSAAAEYAASLRSPSFKSAAGRFSSEQRSTVSSSC  551

Query  1218  RESVGGE--ISPCSTTNSRWW*R  1280
              +SVGG+  +SP STT+ R W R
Sbjct  552   ADSVGGDVVVSPSSTTDLRRWLR  574



>ref|XP_004248424.1| PREDICTED: protein IQ-DOMAIN 14-like [Solanum lycopersicum]
Length=394

 Score =   155 bits (392),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 134/365 (37%), Positives = 182/365 (50%), Gaps = 80/365 (22%)
 Frame = +3

Query  339   FRCYLAKRALVALKGIVKLQALIRGQNVRRQARITLKCMQALFRVQERMREQCARISQDS  518
             FR YLA+RAL ALKG+VKLQAL+RG NVR+QA++TLKCMQAL RVQ R+ +Q  R S+ +
Sbjct  59    FRGYLARRALKALKGLVKLQALVRGHNVRKQAKMTLKCMQALVRVQARVLDQRFRQSEQA  118

Query  519   ARKSMFSGSTNSWESKYIRERKSIFRDHCSVGEAWRDCPPTLQELEVMLQAQK-AAFMRE  695
             +RKS  + S     S              ++ + W + P T++E++ MLQ +K AAFM  
Sbjct  119   SRKSDTTTSHQHMSS--------------TIPDDWDERPHTIEEVKAMLQKRKEAAFM--  162

Query  696   RCPSQAWSSDT-----------DVVDGEE-------------REKTTPLKQGKSRAPAIQ  803
             +C    +S  T           D   GE+             R  T P++   S+   I 
Sbjct  163   KCQGTPFSQQTRRSGRSSSIGSDADFGEKRAAAKSWDSSSRGRASTYPVEMDTSQRNLIT  222

Query  804   RRNPVKSGEINVRIRSLQHKSASSVQapatpspakpkpVRPTTSPGNLEKSHSTANTPRL  983
             R        ++ R  S  H S      P+     +P  VR + SP + +KS     TP L
Sbjct  223   R--------LHQRPTSPLHTSFQFPVTPSPSKSTRPIQVR-SASPRHDKKSQ----TPSL  269

Query  984   CPTNRSASFAPRYSISGIS--PGYMAATESAKARLRSQSAPRQRPSTP-------AKRCL  1136
              P N  +S+ P    S  +  P YMAATESA AR+RSQSAPRQRPSTP       AK+ L
Sbjct  270   RPNNNYSSYQPNRLTSSAAAIPNYMAATESALARIRSQSAPRQRPSTPERDRAGSAKKRL  329

Query  1137  SYSISVKNGE-----------------EGVEKRSEYWCNNNNTERESVGGEISPCSTTNS  1265
             S+ +  + G                   GV    E   N ++   ES+GGEISP ST++ 
Sbjct  330   SFPVPDRYGNVPSAYGHNLRSPSFKSLSGVHFGYEQQSNYSSCYTESIGGEISPSSTSDF  389

Query  1266  RWW*R  1280
             R + R
Sbjct  390   RRYLR  394



>ref|XP_009412450.1| PREDICTED: protein IQ-DOMAIN 14-like [Musa acuminata subsp. malaccensis]
Length=535

 Score =   157 bits (396),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 109/272 (40%), Positives = 153/272 (56%), Gaps = 63/272 (23%)
 Frame = +3

Query  90   VKKLGANSWLTALKRVFIRYPSKDrksrhskrdeeeekkrdkgrr-----WLFSKTADEN  254
            + K G++SWLTA+KR F R PSKD + + SK+ EE E++ ++  +     WLF K++   
Sbjct  1    MGKKGSSSWLTAVKRAF-RSPSKDSEKKASKQREEPEQEEEEKHKKEKRRWLFRKSSAHE  59

Query  255  SVGGVEIISRTPPPSRRLLC----------------------------------------  314
                    +RTPPP +  +                                         
Sbjct  60   QQPQQGQQTRTPPPPQAAVTPEQRHAIALAVASAATAEAAVATAQAAAEVVRLTQPSSSF  119

Query  315  ------AATVIQTAFRCYLAKRALVALKGIVKLQALIRGQNVRRQARITLKCMQALFRVQ  476
                  AA VIQTAFR YLA+RAL ALKG+VKLQAL+RG NVR+QA++TL+CMQAL RVQ
Sbjct  120  AKEQHYAAVVIQTAFRGYLARRALRALKGLVKLQALVRGHNVRKQAKMTLRCMQALVRVQ  179

Query  477  ERMREQCARISQDS-------ARKSMFSGSTNSWESKYIR---ERKSIFRDHCSVGEAWR  626
             R+R+Q  R++Q+S       + KS FS  T+ WESK+++   ER+S+ RD  S  + W 
Sbjct  180  ARVRDQRMRLAQESSSVVSRGSNKSSFSCDTSLWESKFLQELAERRSMSRDGSSFADDWD  239

Query  627  DCPPTLQELEVMLQAQK-AAFMRERCPSQAWS  719
            D P T++E++ MLQ++K AA  RER  S A+S
Sbjct  240  DRPRTIEEIQAMLQSRKEAALKRERALSYAFS  271


 Score = 71.2 bits (173),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 54/136 (40%), Positives = 71/136 (52%), Gaps = 28/136 (21%)
 Frame = +3

Query  939   GNLEKSHSTANTPRLCPTNRSASFAPRYSISGISPGYMAATESAKARLRSQSAPRQRPST  1118
             G  ++S ST +TP     N   + A R     + P YMAATESAKAR+RSQSAPRQRP+T
Sbjct  406   GREDRSFSTVHTPSY--HNHHGAGASRQHPPAMVPNYMAATESAKARVRSQSAPRQRPAT  463

Query  1119  P-------AKRCLSY---------------SISVKNGEEGVEKRSEYWCNNNNTERESVG  1232
             P       AK+ LS+               S     G    + RS    N +++  +S+G
Sbjct  464   PERDRAGSAKKRLSFPAPDPYGYSQSLRSPSFKSATGRFAGDPRS----NVSSSCNDSLG  519

Query  1233  GEISPCSTTNSRWW*R  1280
             GE+SP STT+ R W R
Sbjct  520   GEVSPSSTTDLRRWLR  535



>ref|XP_010436842.1| PREDICTED: protein IQ-DOMAIN 14-like [Camelina sativa]
Length=430

 Score =   153 bits (387),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 151/468 (32%), Positives = 229/468 (49%), Gaps = 113/468 (24%)
 Frame = +3

Query  87    MVKKLGANSWLTALKRVFIRYPSKDrksrhskrdeeeekkrdkgrrWLFSKTADENSVGG  266
             M KK G  SW TA+K++    PSKD   + + + E + KK +K   W+F KT  E +   
Sbjct  1     MAKKNGT-SWFTAVKKILWS-PSKDSDHKKTHKKETDYKKNEKKG-WIFRKTKLETTNSV  57

Query  267   VEIISRT-------------------------------PPPSRRLLCAATVIQTAFRCYL  353
             VE   RT                               PP   R  CAA VIQTAFR YL
Sbjct  58    VEDTVRTVLTVEAVEEEKPAVNVSAVDEAVAEIVKLKAPPGFIRRHCAAIVIQTAFRGYL  117

Query  354   AKRALVALKGIVKLQALIRGQNVRRQARITLKCMQALFRVQERM----REQCARI-----  506
             ++RAL AL+GIVKLQAL+RG NVR QA++TL+C++AL RVQ+++    ++Q +R+     
Sbjct  118   SRRALRALRGIVKLQALVRGNNVRNQAKLTLRCIKALVRVQDQVLNHHQQQRSRVLSSSP  177

Query  507   ----SQDSARKSMFSGSTNSWESKY----IRERKSIFRD--HCSVGEAWRDCPPTL--QE  650
                 + ++ R SMF+ S   W++K     IR R+S+ RD   C+  E   +   ++  ++
Sbjct  178   SRNYNIEARRNSMFAESNGFWDTKTYLQDIRSRRSLSRDMSRCTNNEFDSEETESILQKK  237

Query  651   LEVMLQAQKAA--FMRERCPSQAWSSDTDVVDGEEREKTTPLKQGKSRAPAIQRRNPVKS  824
             LE+ ++ +KA    +  +  S+++ + +   D E  E+T    Q   R  A ++ +   +
Sbjct  238   LEIAIKREKAQALALSNQIRSRSYRNQSAGDDRELLERT----QWLDRWMATKQWDDTIT  293

Query  825   GEINVR--IRSLQHKSASSVQapatpspakpkpVRPTTSPGNLEKSHSTANTPRLCPTNR  998
                NVR  I++L+                             L   H   + P   P++R
Sbjct  294   NSTNVRDQIKTLE-----------------------------LNTHHHQRSYPTTPPSSR  324

Query  999   SA------SFAPRY--SISGISPGYMAATESAKARLRSQSAPRQRPSTPAKR-CLSYSIS  1151
             ++      S +PR   S S + P YM+ATESAKA+ R+QS PR+RP T  KR C +   S
Sbjct  325   ASRSVMVRSASPRIPCSPSSVQPNYMSATESAKAKARTQSTPRRRPITAKKRLCYAEEES  384

Query  1152  VK--------NGEEGVEKRSEYWCNNNNTERESVGGEISPCSTTNSRW  1271
             ++        NG    +  S+Y C N     +   G+ISPCSTT+ RW
Sbjct  385   LRSPSFKSAYNGCLWGDHESDYSCCNG----DGYAGKISPCSTTDLRW  428



>ref|XP_009366611.1| PREDICTED: protein IQ-DOMAIN 1 isoform X2 [Pyrus x bretschneideri]
Length=543

 Score =   154 bits (390),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 91/190 (48%), Positives = 128/190 (67%), Gaps = 16/190 (8%)
 Frame = +3

Query  318  ATVIQTAFRCYLAKRALVALKGIVKLQALIRGQNVRRQARITLKCMQALFRVQERMREQC  497
            A VIQTAFR YLA+RAL ALKG+VKLQAL+RG NVR+QA++TLKCMQAL RVQ R+ +Q 
Sbjct  115  AIVIQTAFRGYLARRALRALKGLVKLQALVRGHNVRKQAKMTLKCMQALVRVQARVLDQR  174

Query  498  ARISQDSARKSMFSGSTNS-WESKY---IRERKSIFRDHCSVGEAWRDCPPTLQELEVML  665
             R+S + +R+S FS +T S WES+Y   I +RKS+ R+  S+ + W + P T++E++ ML
Sbjct  175  TRLSHEGSRQSAFSDTTGSVWESRYLQDISDRKSMSREGSSIADDWDERPHTIEEVKAML  234

Query  666  QAQKAAFMR-ERCPSQAWS----------SDTDVVDGEEREKTTPLKQGKSRA-PAIQRR  809
            Q +K A M+ E+  SQA+S          S  +  + EER K    K  ++R  P+  RR
Sbjct  235  QQRKEAAMKSEKSLSQAFSQQLWRNRRTPSMGNEDELEERPKWLAPKPWETRGRPSTDRR  294

Query  810  NPVKSGEINV  839
            +P+K+ EI+ 
Sbjct  295  DPIKTVEIDT  304


 Score = 68.2 bits (165),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 51/111 (46%), Positives = 59/111 (53%), Gaps = 36/111 (32%)
 Frame = +3

Query  1041  PGYMAATESAKARLRSQSAPRQRPSTP--------AKRCLS-----------------YS  1145
             P YMAATESAKAR+RSQSAPRQRPSTP        AK+ LS                 YS
Sbjct  438   PNYMAATESAKARIRSQSAPRQRPSTPDRERAAGSAKKRLSFPAPDPYGLAMGYGGYGYS  497

Query  1146  I------SVKNGEEGVEKRSEYWCNNNNTERESVGGEISPCSTTNSRWW*R  1280
             +      SV     G+E++S Y C       ES GGEISP ST++ R W R
Sbjct  498   LRSPSFKSVSASHFGMEQQSNYSCCT-----ESHGGEISPSSTSDLRRWLR  543



>ref|XP_006444739.1| hypothetical protein CICLE_v10019596mg [Citrus clementina]
 gb|ESR57979.1| hypothetical protein CICLE_v10019596mg [Citrus clementina]
 gb|KDO86596.1| hypothetical protein CISIN_1g009080mg [Citrus sinensis]
Length=544

 Score =   154 bits (388),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 82/151 (54%), Positives = 111/151 (74%), Gaps = 5/151 (3%)
 Frame = +3

Query  282  RTPPPSRRLLCAATVIQTAFRCYLAKRALVALKGIVKLQALIRGQNVRRQARITLKCMQA  461
            R P  + R + AA VIQTAFR YLA+RAL ALKG+VKLQAL+RG NVR+QA++TL+CMQA
Sbjct  124  RPPTFNAREIYAAIVIQTAFRGYLARRALRALKGLVKLQALVRGHNVRKQAKMTLRCMQA  183

Query  462  LFRVQERMREQCARISQDSARKSMFSGS-TNSWESKY---IRERKSIFRDHCSVGEAWRD  629
            L RVQ R+ +Q  ++SQD +RKS FS + T  WES+Y   I +R+S+ R+  S+ + W +
Sbjct  184  LVRVQARVLDQRVKLSQDGSRKSTFSDTNTTVWESRYLQDISDRRSMSREGSSIADDWDE  243

Query  630  CPPTLQELEVMLQAQK-AAFMRERCPSQAWS  719
             P T++E++VMLQ +K AA  RER  S A+S
Sbjct  244  RPHTIEEVKVMLQQRKEAALKRERTLSHAFS  274


 Score = 71.2 bits (173),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 50/112 (45%), Positives = 61/112 (54%), Gaps = 26/112 (23%)
 Frame = +3

Query  1023  SISGISPGYMAATESAKARLRSQSAPRQRPSTP-------AKRCLS------YSISVKNG  1163
             S SG  P YMAATESAKA+ RSQSAPRQRPSTP       AK+ LS      Y +++  G
Sbjct  433   SSSGTLPNYMAATESAKAKARSQSAPRQRPSTPERDRVGSAKKRLSFPVPEPYGVAMGYG  492

Query  1164  EEGVEKRS-------------EYWCNNNNTERESVGGEISPCSTTNSRWW*R  1280
               G   RS             E   N ++   +S+GGEISP ST++ R W R
Sbjct  493   NHGQNLRSPSFKSVAGSHFGLEQQSNYSSCYTDSIGGEISPSSTSDLRRWLR  544



>ref|XP_006491358.1| PREDICTED: protein IQ-DOMAIN 1-like [Citrus sinensis]
Length=550

 Score =   154 bits (388),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 82/151 (54%), Positives = 111/151 (74%), Gaps = 5/151 (3%)
 Frame = +3

Query  282  RTPPPSRRLLCAATVIQTAFRCYLAKRALVALKGIVKLQALIRGQNVRRQARITLKCMQA  461
            R P  + R + AA VIQTAFR YLA+RAL ALKG+VKLQAL+RG NVR+QA++TL+CMQA
Sbjct  130  RPPTFNAREIYAAIVIQTAFRGYLARRALRALKGLVKLQALVRGHNVRKQAKMTLRCMQA  189

Query  462  LFRVQERMREQCARISQDSARKSMFSGS-TNSWESKY---IRERKSIFRDHCSVGEAWRD  629
            L RVQ R+ +Q  ++SQD +RKS FS + T  WES+Y   I +R+S+ R+  S+ + W +
Sbjct  190  LVRVQARVLDQRVKLSQDGSRKSTFSDTNTTVWESRYLQDISDRRSMSREGSSIADDWDE  249

Query  630  CPPTLQELEVMLQAQK-AAFMRERCPSQAWS  719
             P T++E++VMLQ +K AA  RER  S A+S
Sbjct  250  RPHTIEEVKVMLQQRKEAALKRERTLSHAFS  280


 Score = 71.2 bits (173),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 50/112 (45%), Positives = 61/112 (54%), Gaps = 26/112 (23%)
 Frame = +3

Query  1023  SISGISPGYMAATESAKARLRSQSAPRQRPSTP-------AKRCLS------YSISVKNG  1163
             S SG  P YMAATESAKA+ RSQSAPRQRPSTP       AK+ LS      Y +++  G
Sbjct  439   SSSGTLPNYMAATESAKAKARSQSAPRQRPSTPERDRVGSAKKRLSFPVPEPYGVAMGYG  498

Query  1164  EEGVEKRS-------------EYWCNNNNTERESVGGEISPCSTTNSRWW*R  1280
               G   RS             E   N ++   +S+GGEISP ST++ R W R
Sbjct  499   NHGQNLRSPSFKSVAGSHFGLEQQSNYSSCYTDSIGGEISPSSTSDLRRWLR  550



>ref|XP_007135309.1| hypothetical protein PHAVU_010G118500g [Phaseolus vulgaris]
 gb|ESW07303.1| hypothetical protein PHAVU_010G118500g [Phaseolus vulgaris]
Length=546

 Score =   153 bits (387),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 99/213 (46%), Positives = 134/213 (63%), Gaps = 24/213 (11%)
 Frame = +3

Query  267  VEIISRTPPPSR-RLLCAATVIQTAFRCYLAKRALVALKGIVKLQALIRGQNVRRQARIT  443
            VE+   T P S  R   AA VIQTAFR YLAKRAL ALKG+VKLQAL+RG NVR+QA++T
Sbjct  112  VEVARLTKPASHAREHYAAVVIQTAFRGYLAKRALRALKGLVKLQALVRGHNVRKQAKMT  171

Query  444  LKCMQALFRVQERMREQCARISQDSARKSMFSGSTNSWESKY---IRERKSIFRDHCSVG  614
            L+CMQAL RVQ R+ +Q  R S D +RKS FS + + W+S+Y   I +RKSI R+  S+ 
Sbjct  172  LRCMQALVRVQARVLDQRIRSSLDGSRKSTFSDTASVWDSRYLQDISDRKSISREGSSIA  231

Query  615  EAWRDCPPTLQELEVMLQAQK-AAFMRERCPSQAW----------SSDTDVVDGEEREK-  758
            + W + P T++E++ MLQ +K AA  R++  SQA+          SS  +  + EER K 
Sbjct  232  DDWDERPHTVEEVKAMLQQRKEAAMKRDKTLSQAFSQQIWRNGRTSSIGNEDELEERPKW  291

Query  759  ------TTPLKQGKSRAPAIQRRNPVKSGEINV  839
                  T P  + + RA   Q R+P+K+ EI+ 
Sbjct  292  LDRWMATKPW-ENRGRASTDQ-RDPIKTVEIDT  322


 Score = 65.1 bits (157),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 50/107 (47%), Positives = 58/107 (54%), Gaps = 27/107 (25%)
 Frame = +3

Query  1041  PGYMAATESAKARLRSQSAPRQRPSTP-------AKRCLS------YSISVKNGEEGVEK  1181
             P YMAATESAKAR+RSQSAPRQRPSTP       AK+ LS      YS+ V  G  G   
Sbjct  440   PNYMAATESAKARIRSQSAPRQRPSTPERDRVGSAKKRLSFPAPDPYSVGVSYGNYGHSL  499

Query  1182  RS-------------EYWCNNNNTERESV-GGEISPCSTTNSRWW*R  1280
             RS             E   N ++   ES+ GGE+SP ST + R W R
Sbjct  500   RSPSFKSVSGSHFGLEQQSNYSSCCTESLGGGEVSPSSTGDLRRWLR  546



>ref|XP_002317809.2| hypothetical protein POPTR_0012s02940g [Populus trichocarpa]
 gb|EEE96029.2| hypothetical protein POPTR_0012s02940g [Populus trichocarpa]
Length=523

 Score =   153 bits (386),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 145/399 (36%), Positives = 197/399 (49%), Gaps = 78/399 (20%)
 Frame = +3

Query  288   PPPSRRLLCAATVIQTAFRCYLAKRALVALKGIVKLQALIRGQNVRRQARITLKCMQALF  467
             PP   +   AA  IQTAFR YLAKRAL ALKG+VKLQAL+RG NVR++A++TL+CMQA+ 
Sbjct  130   PPLFVKQHFAAIAIQTAFRGYLAKRALKALKGLVKLQALVRGHNVRKRAKMTLQCMQAMA  189

Query  468   RVQERMREQCARISQDSARKSMFSGSTNSWESKYIRERKSIFRDHCSVGEAWRDC---PP  638
             RVQ R+ EQ  R+S + +  S+ S   NS     + ER+S   D  S  + W  C   P 
Sbjct  190   RVQSRVCEQRRRLSYEGSANSI-SSDPNSLRGSNLAERRSTCWDGSSTADDWFHCNYHPK  248

Query  639   TLQELEVMLQAQK--AAFMRERCPSQAWSS-------DTDVVDGE--------EREKTTP  767
             TL+E++ M Q  K   A  RE+  + A+S        D+   +GE        ER  T  
Sbjct  249   TLEEIQSMFQETKEVVALKREKALAYAFSQQIWRPGRDSYASEGEVEKNPRWLERRGTIK  308

Query  768   LKQGKSRA--PAIQRRNPVKSGEINVRIRSLQHKSASSVQapatpspakpkpVRPT----  929
              ++G+  A       R+PVK+ E++      +  S SS  A         +  RP+    
Sbjct  309   EREGRGIAFRDQYHSRDPVKTVEMDTS----RPYSYSSPNAHKLHQHYHYQQHRPSSYSV  364

Query  930   TSPGNLEKSH--STANTPRLCPTN---RSASFAPRY------------SISGIS-PGYMA  1055
             TSP  L+K+H  S   TP L  T    +  S +PR+            + S  S P YM 
Sbjct  365   TSP--LQKNHNISQPTTPSLSKTRTLLQVHSSSPRFLRESRNRVMGETTPSATSKPNYMT  422

Query  1056  ATESAKARLRSQSAPRQRPSTP-------AKRCLSYSI---------SVKN---------  1160
             AT SA AR+RSQSAPRQR STP       AK+ LS+ +         S+ N         
Sbjct  423   ATASANARIRSQSAPRQRASTPEREISGSAKKRLSFPVPDPANSNEGSMVNDYNLRSPSL  482

Query  1161  -GEEGVEKRSEYWCNNNNTERESVGGEISPCSTTN-SRW  1271
              G  G     E   N ++   +S+  E+SP ST + SRW
Sbjct  483   KGIHGANMVMEQRSNMSSCYTDSIDDEVSPPSTNDLSRW  521



>ref|XP_002525813.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF36565.1| conserved hypothetical protein [Ricinus communis]
Length=526

 Score =   153 bits (386),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 120/323 (37%), Positives = 170/323 (53%), Gaps = 51/323 (16%)
 Frame = +3

Query  315   AATVIQTAFRCYLAKRALVALKGIVKLQALIRGQNVRRQARITLKCMQALFRVQERMREQ  494
             AA VIQTAFR YLAKRAL ALKG+VKLQAL+RG NVR++A++TL CMQAL RVQ R+R++
Sbjct  132   AAIVIQTAFRGYLAKRALRALKGLVKLQALVRGHNVRKRAKMTLHCMQALMRVQARVRDE  191

Query  495   CARISQDSARKSMFSG-STNSWESKYIRERKSIFRDHCSVGEAW----RDCPPTLQELEV  659
               R+S + +  S+ S  S + W S     RKSI RD  S+   W     +   +L+E++ 
Sbjct  192   RNRLSYEGSTNSITSDPSISLWGSNLADNRKSISRDLNSIANDWIHLADEHQESLEEIQE  251

Query  660   MLQ-AQKAAFMRERCPSQAWSS-------DTDVVDGEEREKTT------PLK---QGKSR  788
             MLQ  ++ A  RE+  + A+S        DT   +GE  EK+       P++   + + R
Sbjct  252   MLQETEEVAVKREKALAHAFSHQIWRPSRDTYASEGELEEKSRRHHDHWPVRIQWENRGR  311

Query  789   APAIQRRNPVKSGEINV---------------RIRSLQHKSASSVQapa-----tpspak  908
             A +   R+P+K  E++                + R  Q +  SS    +       +   
Sbjct  312   A-STDYRDPIKIVEVDTSQPYTFSTPSIGRSHQDRHYQQQRPSSYSVASPLPRPHNNFPL  370

Query  909   pkpVRPTTSPGNLEKSHSTANTPRLCPTNRSASFAPRYS-ISGIS-----PGYMAATESA  1070
                + P  S     + HS   +PR    +R+      Y+ IS ++     P YMAAT SA
Sbjct  371   QSLITPFPSKTKALQVHSA--SPRCLRQDRNHDINATYTPISAVATTNSMPNYMAATASA  428

Query  1071  KARLRSQSAPRQRPSTPAKRCLS  1139
             KAR RSQS PRQRPSTP +  +S
Sbjct  429   KARFRSQSVPRQRPSTPEREKMS  451



>ref|XP_003571316.1| PREDICTED: protein IQ-DOMAIN 14 [Brachypodium distachyon]
Length=583

 Score =   152 bits (385),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 126/337 (37%), Positives = 168/337 (50%), Gaps = 65/337 (19%)
 Frame = +3

Query  303   RLLCAATVIQTAFRCYLAKRALVALKGIVKLQALIRGQNVRRQARITLKCMQALFRVQER  482
             R   AA +IQTAFR YLA+RAL ALKG+VKLQAL+RG NVR+QA +TL+CMQAL RVQ R
Sbjct  151   REHYAAILIQTAFRGYLARRALRALKGLVKLQALVRGHNVRKQANMTLRCMQALVRVQAR  210

Query  483   MREQCARISQDS--------------ARKSMFSGSTNS-WESKYIR---ERKSI--FRDH  602
             +R+Q  R+SQDS              + KS +S  T++ W+SKY     +R+S+   RD 
Sbjct  211   VRDQRMRLSQDSLSFSGAGHGANGNGSSKSSYSVDTSAFWDSKYTHDYADRRSMERSRDG  270

Query  603   CS--VGEAWRDCPPTLQELEVMLQAQK-AAFMRERCPSQAWS---------SDTDVVDGE  746
              S    E W D P T++E++ MLQ +K AA  RER  S A+S         S  + +DGE
Sbjct  271   SSFAAAEDWDDRPRTIEEIQAMLQTRKDAALKRERALSYAFSHQIWRNPAPSVEEEMDGE  330

Query  747   E--------------------REKTTPLKQGKSRAPAIQRRNPVKSGEINVR---IRSLQ  857
             +                    R        G++       +  VK+ E++       S  
Sbjct  331   QPRWADRWMASRASFDTNRSSRTAAAAAAPGRASTDHRAHQQHVKTLEMDTSRPFSYSTP  390

Query  858   HKSASSVQapatpspakpkpVRPTTSPGNLEKSHSTANTPRLCPTNRSASFAP-------  1016
              +     Q         P   R T SPG   K+          P     S+ P       
Sbjct  391   RRQQQQQQQAPAHGSGSPMHHRATPSPG---KARPPVQVRSASPRANGGSYTPSLHSQRL  447

Query  1017  RYSISGISPGYMAATESAKARLRSQSAPRQRPSTPAK  1127
             +++ S   P YMAATESAKAR+RS SAPRQRP+TP +
Sbjct  448   QHASSAAVPNYMAATESAKARVRSHSAPRQRPATPER  484



>ref|XP_006439210.1| hypothetical protein CICLE_v10019978mg [Citrus clementina]
 gb|ESR52450.1| hypothetical protein CICLE_v10019978mg [Citrus clementina]
Length=439

 Score =   150 bits (378),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 131/376 (35%), Positives = 183/376 (49%), Gaps = 67/376 (18%)
 Frame = +3

Query  267   VEIISRTPPPSRRLL---CAATVIQTAFRCYLAKRALVALKGIVKLQALIRGQNVRRQAR  437
             +EI+  + P S   +    AATVIQT+FR YLA+RAL ALKG+VKLQAL+RGQNVR QA+
Sbjct  71    MEIVRHSRPASSNYVREHYAATVIQTSFRGYLARRALRALKGLVKLQALVRGQNVRHQAK  130

Query  438   ITLKCMQALFRVQERMREQCARISQDSARKSMFSGSTNSWESKY---IRERKSIFRDHCS  608
             +TLK +QAL R Q+ +R+Q  R S + +R+S+F+ + + W+SK    I+ RKS+  ++ +
Sbjct  131   LTLKRVQALVRAQDMVRDQRTRFSHEGSRRSLFAETNDFWDSKNLHDIKSRKSMSSNNNA  190

Query  609   VGEA----WRDCPPTLQELE--VMLQAQKAAFMRERCPSQAWSSDTDVVDGEERE-----  755
              G      W D P T Q ++  VM + +  A+      +Q W S  +   G+ERE     
Sbjct  191   SGTITIADWNDHPCTSQGIKEAVMKREKTLAYA---FSNQVWRSRRNPSAGDERELDERT  247

Query  756   -------KTTPLKQGKSRAPAIQRRNPVKSGEINVRIRSLQHKSASSVQapatpspakpk  914
                     T   +   +RA   +R + +K+ E +      Q++             +   
Sbjct  248   KWLDRWMATKQWENSATRASTDRRDHIMKTVETDASRPKYQNQKQPRPPPIQVRLASPRS  307

Query  915   pVRPTTSPGNLEKSHSTANTPRLCPTNRSASFAPRYSISGISPGYMAATESAKARLRSQS  1094
              ++  T       S S A TP L     + S           P YMAATESAKA+ RSQS
Sbjct  308   FLKEQT-------SFSAAQTPTLNGVAAATS---------TMPNYMAATESAKAKARSQS  351

Query  1095  APRQRPST---------PAKRCLSYSI---------------SVKNGEEGVEKRSEYWCN  1202
             APRQR ST           K+ LSY                 SV  G  G     E   N
Sbjct  352   APRQRASTSMLPRERSGSVKKRLSYPAPEPHCCQNSRSSSFKSVPAGCGGYSSGMEQLSN  411

Query  1203  NNNTERESVGGEISPC  1250
              ++   ES GGEISPC
Sbjct  412   YSSCYAESYGGEISPC  427



>ref|XP_008777584.1| PREDICTED: protein IQ-DOMAIN 1-like [Phoenix dactylifera]
Length=514

 Score =   150 bits (380),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 146/395 (37%), Positives = 197/395 (50%), Gaps = 78/395 (20%)
 Frame = +3

Query  315   AATVIQTAFRCYLAKRALVALKGIVKLQALIRGQNVRRQARITLKCMQALFRVQERMREQ  494
             AA VIQTAFR YLA+RAL AL+G+VKLQAL+RG NVR+QA +TL+CMQAL RVQ ++R+Q
Sbjct  125   AAIVIQTAFRGYLARRALRALRGLVKLQALVRGHNVRKQANMTLRCMQALVRVQAQLRDQ  184

Query  495   CARISQD----SARKSMFSGSTNSWESKYIRE---RKSIFRDHCSVGEAWRDCPPTLQEL  653
               R++Q+    S+ KS  S  T+ W+ KY++E   R+S+ R+  S  + W D P T++++
Sbjct  185   RVRLAQEATGCSSNKSSVSCDTSFWDPKYLQELEQRRSMSREGSSYADEWDDRPRTIEDI  244

Query  654   EVMLQAQK-AAFMRERCPS-----QAWSSDTDVVDGEEREKTTPLKQGKSRAPAIQRRNP  815
             + M+Q +K AA  RER  S     Q W  D ++    E E+     +G  R P    R  
Sbjct  245   QAMVQCRKEAALKRERALSYAFSHQFWRPDRNLSPSLEEEEEV-ASRGDQRPPRWTDRWI  303

Query  816   VKSGEINVRIRSLQHKSASSVQapatpspakpkpVRPTTSPGNLEKSHSTANTPRLCPTN  995
                   + R  S    S   +    T    + +P   TT+  N  +    ++    CP  
Sbjct  304   ASRSSFDNRASSRGRASTDQIDPIKTLEIDQARPFSYTTTTTNHRRPPQPSSHQLSCPLG  363

Query  996   RSA-----------------SFAPR----------YSISGIS-------PGYMAATESAK  1073
             RS                  S +PR          Y   G S       P YMAATESAK
Sbjct  364   RSHHSPVTPSPSKSRPLQVRSASPRCGREEGSCSAYYHHGASRHHRAAVPNYMAATESAK  423

Query  1074  ARLRSQSAPRQRPSTP--------AKRCLS-----------YSISVKN-------GEEGV  1175
             AR RSQSAPRQRP+TP         K+ LS           YS S+++       G  G 
Sbjct  424   ARARSQSAPRQRPATPELERGAGSVKKRLSFPVPEAYGYGGYSQSLRSPSFKSAAGRLGA  483

Query  1176  EKRSEYWCNNNNTERESVGGEISPCSTTNSRWW*R  1280
             E+RS    + N+    S GGE+SP STT  R W R
Sbjct  484   EQRSIVSSSCND----SFGGEVSPSSTTELRRWLR  514



>ref|XP_006439211.1| hypothetical protein CICLE_v10019978mg [Citrus clementina]
 gb|ESR52451.1| hypothetical protein CICLE_v10019978mg [Citrus clementina]
Length=476

 Score =   150 bits (378),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 131/376 (35%), Positives = 183/376 (49%), Gaps = 67/376 (18%)
 Frame = +3

Query  267   VEIISRTPPPSRRLL---CAATVIQTAFRCYLAKRALVALKGIVKLQALIRGQNVRRQAR  437
             +EI+  + P S   +    AATVIQT+FR YLA+RAL ALKG+VKLQAL+RGQNVR QA+
Sbjct  108   MEIVRHSRPASSNYVREHYAATVIQTSFRGYLARRALRALKGLVKLQALVRGQNVRHQAK  167

Query  438   ITLKCMQALFRVQERMREQCARISQDSARKSMFSGSTNSWESKY---IRERKSIFRDHCS  608
             +TLK +QAL R Q+ +R+Q  R S + +R+S+F+ + + W+SK    I+ RKS+  ++ +
Sbjct  168   LTLKRVQALVRAQDMVRDQRTRFSHEGSRRSLFAETNDFWDSKNLHDIKSRKSMSSNNNA  227

Query  609   VGEA----WRDCPPTLQELE--VMLQAQKAAFMRERCPSQAWSSDTDVVDGEERE-----  755
              G      W D P T Q ++  VM + +  A+      +Q W S  +   G+ERE     
Sbjct  228   SGTITIADWNDHPCTSQGIKEAVMKREKTLAYA---FSNQVWRSRRNPSAGDERELDERT  284

Query  756   -------KTTPLKQGKSRAPAIQRRNPVKSGEINVRIRSLQHKSASSVQapatpspakpk  914
                     T   +   +RA   +R + +K+ E +      Q++             +   
Sbjct  285   KWLDRWMATKQWENSATRASTDRRDHIMKTVETDASRPKYQNQKQPRPPPIQVRLASPRS  344

Query  915   pVRPTTSPGNLEKSHSTANTPRLCPTNRSASFAPRYSISGISPGYMAATESAKARLRSQS  1094
              ++  T       S S A TP L     + S           P YMAATESAKA+ RSQS
Sbjct  345   FLKEQT-------SFSAAQTPTLNGVAAATS---------TMPNYMAATESAKAKARSQS  388

Query  1095  APRQRPST---------PAKRCLSYSI---------------SVKNGEEGVEKRSEYWCN  1202
             APRQR ST           K+ LSY                 SV  G  G     E   N
Sbjct  389   APRQRASTSMLPRERSGSVKKRLSYPAPEPHCCQNSRSSSFKSVPAGCGGYSSGMEQLSN  448

Query  1203  NNNTERESVGGEISPC  1250
              ++   ES GGEISPC
Sbjct  449   YSSCYAESYGGEISPC  464



>ref|XP_010455460.1| PREDICTED: protein IQ-DOMAIN 14-like [Camelina sativa]
Length=430

 Score =   149 bits (376),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 153/468 (33%), Positives = 227/468 (49%), Gaps = 113/468 (24%)
 Frame = +3

Query  87    MVKKLGANSWLTALKRVFIRYPSKDrksrhskrdeeeekkrdkgrrWLFSKTADENSVGG  266
             M KK G  SW TA+K++    PSKD   + + + + + KK +K   W+F KT  E S   
Sbjct  1     MAKKNGT-SWFTAVKKILWS-PSKDSDHKKTHKKDTDYKKNEKKG-WIFRKTKLETSNSV  57

Query  267   VEIISRT-------------------------------PPPSRRLLCAATVIQTAFRCYL  353
             VE   RT                               PP   R  CAA VIQTAFR YL
Sbjct  58    VEDTIRTVLTVETVEEEKPAVNVSAVDEAVAEIVKLKAPPGFIRRHCAAIVIQTAFRGYL  117

Query  354   AKRALVALKGIVKLQALIRGQNVRRQARITLKCMQALFRVQERM----REQCARI-----  506
             ++RAL AL+GIVKLQAL+RG NVR QA++TL+C++AL RVQ+++    ++Q +R+     
Sbjct  118   SRRALRALRGIVKLQALVRGNNVRNQAKLTLRCIKALVRVQDQVLNHHQQQRSRVLSSSP  177

Query  507   ----SQDSARKSMFSGSTNSWESKY----IRERKSIFRD--HCSVGEAWRDCPPTL--QE  650
                 + ++ R SMF+ S   W++K     IR R+S+ RD   C+  E   +   ++  ++
Sbjct  178   SRNYNIEARRNSMFAESNGFWDTKTYLQDIRSRRSLSRDMSRCTNNEFDSEETESILQKK  237

Query  651   LEVMLQAQK--AAFMRERCPSQAWSSDTDVVDGEEREKTTPLKQGKSRAPAIQRRNPVKS  824
             LE+ ++ +K  A  +  +  S+++ + +   D E  E+T    Q   R  A ++ +   +
Sbjct  238   LEIAIKREKAQALALSNQIRSRSYQNQSAGDDRELLERT----QWLDRWMATKQWDDTIT  293

Query  825   GEINVR--IRSLQ---HKSASSVQapatpspakpkpVRPTTSPGNLEKSHSTANTPRLCP  989
                NVR  I++L+   H    S                P T P               C 
Sbjct  294   NSTNVRDQIKTLELNIHHHQRSY---------------PATPPS--------------CR  324

Query  990   TNRSA---SFAPRY--SISGISPGYMAATESAKARLRSQSAPRQRPSTPAKR-CLSYSIS  1151
              +RS    S +PR   S S + P YM+ATESAKA+ R+QS PR+RP T  KR C +   S
Sbjct  325   ASRSVMVRSASPRIPCSPSSVQPNYMSATESAKAKARTQSTPRRRPITAKKRLCYAEEES  384

Query  1152  VK--------NGEEGVEKRSEYWCNNNNTERESVGGEISPCSTTNSRW  1271
             ++        NG    +  S+Y C       +   G+ISPCSTT+ RW
Sbjct  385   LRSPSFKSAYNGCLWGDHESDYSCCYG----DGYAGKISPCSTTDLRW  428



>ref|XP_009366610.1| PREDICTED: protein IQ-DOMAIN 1 isoform X1 [Pyrus x bretschneideri]
Length=544

 Score =   149 bits (377),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 91/191 (48%), Positives = 128/191 (67%), Gaps = 17/191 (9%)
 Frame = +3

Query  318  ATVIQTAFRCYLAKRALVALKGIVKLQALIRGQNVRRQARITLKCMQALFRVQERMREQC  497
            A VIQTAFR YLA+RAL ALKG+VKLQAL+RG NVR+QA++TLKCMQAL RVQ R+ +Q 
Sbjct  115  AIVIQTAFRGYLARRALRALKGLVKLQALVRGHNVRKQAKMTLKCMQALVRVQARVLDQR  174

Query  498  ARISQDSARKSMFSGSTNS-WESKY---IRERKSI-FRDHCSVGEAWRDCPPTLQELEVM  662
             R+S + +R+S FS +T S WES+Y   I +RKS+  R+  S+ + W + P T++E++ M
Sbjct  175  TRLSHEGSRQSAFSDTTGSVWESRYLQDISDRKSMQSREGSSIADDWDERPHTIEEVKAM  234

Query  663  LQAQKAAFMR-ERCPSQAWS----------SDTDVVDGEEREKTTPLKQGKSRA-PAIQR  806
            LQ +K A M+ E+  SQA+S          S  +  + EER K    K  ++R  P+  R
Sbjct  235  LQQRKEAAMKSEKSLSQAFSQQLWRNRRTPSMGNEDELEERPKWLAPKPWETRGRPSTDR  294

Query  807  RNPVKSGEINV  839
            R+P+K+ EI+ 
Sbjct  295  RDPIKTVEIDT  305


 Score = 68.2 bits (165),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 51/111 (46%), Positives = 59/111 (53%), Gaps = 36/111 (32%)
 Frame = +3

Query  1041  PGYMAATESAKARLRSQSAPRQRPSTP--------AKRCLS-----------------YS  1145
             P YMAATESAKAR+RSQSAPRQRPSTP        AK+ LS                 YS
Sbjct  439   PNYMAATESAKARIRSQSAPRQRPSTPDRERAAGSAKKRLSFPAPDPYGLAMGYGGYGYS  498

Query  1146  I------SVKNGEEGVEKRSEYWCNNNNTERESVGGEISPCSTTNSRWW*R  1280
             +      SV     G+E++S Y C       ES GGEISP ST++ R W R
Sbjct  499   LRSPSFKSVSASHFGMEQQSNYSCCT-----ESHGGEISPSSTSDLRRWLR  544



>gb|KHG01628.1| Protein IQ-DOMAIN 1 -like protein [Gossypium arboreum]
Length=539

 Score =   149 bits (377),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 136/372 (37%), Positives = 193/372 (52%), Gaps = 59/372 (16%)
 Frame = +3

Query  303   RLLCAATVIQTAFRCYLAKRALVALKGIVKLQALIRGQNVRRQARITLKCMQALFRVQER  482
             R   AA VIQTAFR YLAKRAL ALKG+VKLQAL+RG NVR++A ITL+CM+A+ RVQ R
Sbjct  133   REHFAAIVIQTAFRGYLAKRALRALKGLVKLQALVRGHNVRKRANITLRCMEAMARVQAR  192

Query  483   MREQCARIS-QDSARKSMFSGS-TNSWESKYIRERKSIF-RDHCSVGEAWR----DCPPT  641
             +R+Q  R+S  + +  S+FS   TN+  S Y+ ++ SI+ R+     + WR    + P T
Sbjct  193   VRDQRKRLSVHERSMDSIFSDHRTNTLWSSYLADKNSIYSREESKYDDDWRTHWDEHPKT  252

Query  642   LQELEVMLQAQKAAFM-RERCPSQA-----WSSD------TDVVDGEER--EKTTPLKQG  779
             L+E++ +LQ  K A M RE+  +QA     W+ D       D VDG+ R  ++ T  KQ 
Sbjct  253   LKEIQAILQKTKQATMKREKALAQAFSNQIWTGDRNTVESEDEVDGKTRWVDRWTTRKQW  312

Query  780   KSRA-PAIQRRNPVKSGEI----------------NVRIRSLQHKSASSVQapatpspak  908
             +S    +    +P+K+ EI                N +    Q + +S   A        
Sbjct  313   ESTGRMSSDHIDPIKTVEIDTSRPYSYSAPHSQNPNSQYHYQQRRPSSFSVASPLHKTIN  372

Query  909   pkpVRPTT-SPGNLEKSHSTANTPRLCPTNR---SASFAPR----YSISGIS---PGYMA  1055
               P+R  T SP   +     + +PR     R   S +  P     + +SG +   P YMA
Sbjct  373   GLPIRSITPSPSKAKPLQIYSASPRYLKEERFPPSPAHTPNTGSYHRVSGNAAAMPNYMA  432

Query  1056  ATESAKARLRSQSAPRQRP-STP-------AKRCLSYSISVKNGEEGVEKRSEYWCNN--  1205
             AT SA AR+RSQSAP+QR  STP       AK+CL +    ++G E   K   Y+  N  
Sbjct  433   ATASAMARVRSQSAPKQRHCSTPEREKVGSAKKCLLFPAPEQSGVEESIKDEVYYDYNLG  492

Query  1206  NNTERESVGGEI  1241
             + + + S GG  
Sbjct  493   SPSYKSSHGGHF  504



>ref|XP_010538858.1| PREDICTED: protein IQ-DOMAIN 14 [Tarenaya hassleriana]
Length=438

 Score =   148 bits (374),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 155/467 (33%), Positives = 223/467 (48%), Gaps = 103/467 (22%)
 Frame = +3

Query  87    MVKKLGANSWLTALKRVFIRYPSKDrksrhskrdeeeekkrdkgrr--------WLFSKT  242
             M KK G++SW +A+K+ F R PS+D   + ++  EE+++   +           WLF K 
Sbjct  1     MAKKNGSSSWFSAVKKAF-RSPSRDSDKKRNQSREEQDEHDHQQEDSKKREKRGWLFRKA  59

Query  243   ADEN-SVGGVEIISRTP-----------------------------PPSRRLLCAATVIQ  332
               E  SV    ++  +P                             P   R   AA +IQ
Sbjct  60    KPEAASVPDTVVVGTSPKTIVEDKTAVAVTAADSAAAEIVKLSTATPGFIRRHWAAIIIQ  119

Query  333   TAFRCYLAKRALVALKGIVKLQALIRGQNVRRQARITLKCMQALFRVQER-MREQCARIS  509
             TAFR YLA+RAL ALKGIV+LQAL+RG NVRRQA++TLKC+QAL RVQ+R +  Q +R+S
Sbjct  120   TAFRGYLARRALRALKGIVQLQALVRGHNVRRQAKMTLKCIQALVRVQDRVLNHQRSRVS  179

Query  510   QDSARKS--MFSGSTNSWESKYIRE---RKSIFRD-HCSVGEAWRDCPPTLQELEVMLQA  671
               +  +   MF+ ST   +SK+++E   R+S+ RD  CS    W D   T QE E +LQ 
Sbjct  180   SSNESRRNSMFAESTVFLDSKHLQELRNRRSLSRDMSCSTASEWDDRILTNQETESILQK  239

Query  672   Q-KAAFMRERCPSQAWSSDTDVVDGEE---REKTTPLKQGK--SRAPAIQRRNPVKSGEI  833
             + +AA  RE+  + A+S+      G      ++T  L+  K   R  A ++ +   S   
Sbjct  240   KLEAALKREKALAYAFSNQIRRRSGRNPSAGDETELLESTKWLDRWMATKQWDDTMSSRA  299

Query  834   NVRIRSLQHKSASSVQapatpspakpkpVRPTTSPGNLEKSHSTANTPRLCPTN-RSASF  1010
             ++      HK                  VRP+ +P           + R+ PT  RSAS 
Sbjct  300   SI---DHHHK------------------VRPSPAP---------PPSCRVRPTAVRSASP  329

Query  1011  APRYSISG------ISPGYMAATESAKARLRSQSAPRQR---PSTPAKRCLSYSISVKNG  1163
                Y  S       + P YM ATESAKAR R QS PR+R     +  K+ LSY+     G
Sbjct  330   RVPYRPSSPLPSPVVRPNYMTATESAKARARPQSTPRRRVGGDCSSVKKRLSYAEDEDKG  389

Query  1164  EEGVEKRSE-------YWCNNNNTER----ESVGGEISPCSTTNSRW  1271
              + +   S        +W ++ +       +   GEISPCSTT+ RW
Sbjct  390   YDRLRSPSFKSAYNGCFWGDHESDYSCCYADGFAGEISPCSTTDLRW  436



>emb|CDY05111.1| BnaC03g29090D [Brassica napus]
Length=429

 Score =   148 bits (374),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 149/467 (32%), Positives = 220/467 (47%), Gaps = 112/467 (24%)
 Frame = +3

Query  87    MVKKLGANSWLTALKRVFIRYPSKDrksrhskrdeeeekkrdkgrrWLFSKTADENS---  257
             M KK G  SWLTA+K++    PSKD   +  +++ +  K++ + + W+F KT  EN+   
Sbjct  1     MAKKNG-TSWLTAVKKILWS-PSKDSDKKSHQKEADYNKQKKEKKGWIFRKTKVENTDSV  58

Query  258   ----------------VGGVEIISRTPPPSRRLLCAATVIQTAFRCYLAKRALVALKGIV  389
                             V  V  ++ TP   RR   AA +IQTAFR YLAKRA  ALKGIV
Sbjct  59    TDTIPKAEKEEKDKPAVAEVVKLTATPGFIRRHW-AAIIIQTAFRGYLAKRAFGALKGIV  117

Query  390   KLQALIRGQNVRRQARITLKCMQALFRVQERM------REQCARI----------SQDSA  521
             KLQAL+RG NVR QA+ TL+C++AL RVQ+++      ++Q +R+            ++ 
Sbjct  118   KLQALVRGHNVRNQAKHTLRCIKALVRVQDQVLSHHHQQQQRSRVLSSSPSSNCYDIEAR  177

Query  522   RKSMFSGSTNSWESKY----IRERKSIFRDHCSVGEAWRDCPPTLQELEVMLQAQ-KAAF  686
             R SMF+ S   W+SK     IR R+S+ RD   +     +     +E + +LQ + K A 
Sbjct  178   RNSMFAESNGFWDSKTYLQDIRSRRSLSRD---MSRCTNEFVVNQEESQSILQKRLKIAI  234

Query  687   MRERCPSQAWSSDT------DVVDGEERE---------KTTPLKQGKSRAPAIQRRNPVK  821
              RE+  + A S+        +   G++RE         +    KQ  +       R+ VK
Sbjct  235   EREKAHALALSNQIRSRSYRNQSAGDDRELLERTRWLDRWMATKQWDNTITIPTTRDQVK  294

Query  822   SGEINVRIRSLQHKSASSVQapatpspakpkpVRPTTSPGNLEKSHSTANTPRLCPTNRS  1001
             + E++  I +  H   S                 P T P               C   R+
Sbjct  295   TLEMDTNIATTTHHHRSY----------------PATPPS--------------CRATRT  324

Query  1002  A---SFAPRYSISG----ISPGYMAATESAKARLRSQSAPRQRPSTPAKRCLSY------  1142
                 S +PR   S     + P YM+ATESAKA+ R+QS PR+RP   AK+ L Y      
Sbjct  325   FGIRSASPRIPCSSPSPMVQPNYMSATESAKAKARTQSTPRRRPVITAKKRLCYAEEGSV  384

Query  1143  -SISVKNGEEGV---EKRSEYWCNNNNTERESVGGEISPCSTTNSRW  1271
              S S+K+        E  S+Y C       + + G++SPCST++ RW
Sbjct  385   RSPSLKSAYNVCLCGEHESDYSCCYG----DGLAGKVSPCSTSDLRW  427



>ref|XP_008437775.1| PREDICTED: protein IQ-DOMAIN 1 [Cucumis melo]
Length=467

 Score =   148 bits (374),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 151/475 (32%), Positives = 219/475 (46%), Gaps = 86/475 (18%)
 Frame = +3

Query  90    VKKLGANSWLTALKRVFIRYPSKDrksrhskrdeeeekkrdkgrrWLFSKTADENSVGGV  269
             + K G +SWLTA+KR F R PSKD   + +++     ++       +  +T    S    
Sbjct  1     MGKKGGSSWLTAVKRAF-RSPSKDEDHKKTEKRRWGFRRSTNPHDPVTHQTPSNPSSDAA  59

Query  270   E-----------------------IISRTPPPSRRLLCAATVIQTAFRCYLAKRALVALK  380
                                       S  P    R   AA +IQTAFR YLA+RAL ALK
Sbjct  60    LAAAVATAEAAMATAQAAVQVARLTTSTRPSNHARDYYAAILIQTAFRGYLARRALRALK  119

Query  381   GIVKLQALIRGQNVRRQARITLKCMQALFRVQERMREQCARISQDSARKSMFSGSTNSWE  560
             G+VKLQAL+RG NVR+QA++TL+CMQAL RVQ R+ +Q  R+S + +  S  S  + +  
Sbjct  120   GLVKLQALVRGHNVRKQAKMTLRCMQALVRVQARVLDQRMRLSHEGSGNSTLSDPSTALG  179

Query  561   SKYI-----RERKSIFRDHCSVGEAWRDC-PPTLQELEVMLQAQKAAFMRERCPSQAWSS  722
             S+Y+     R+  ++ RD     + WR    P++   + +   ++  ++ +    QAW S
Sbjct  180   SRYLQYLSDRKEFAMKRDRNLSQQIWRRGRSPSMGSGDDL--EERPKWLDQWNSRQAWES  237

Query  723   -------DTDVVDGEEREKTTPLKQGKSR----APAIQRRNPVKSGEINVRIRSLQHKSA  869
                      D +   E +   P  +  S     A  +QR NP        R++   +   
Sbjct  238   RGRASTDQRDPIKTVEIDTFQPYTRTSSNFRRMAQNLQRTNPHSGSSPLNRMQQNVYSFH  297

Query  870   SSVQapatpspakpkpVRPTTSPGNL--EKSHSTANTP----------RLCPTNRSASFA  1013
              S   P+         VR + SP  +  +KS++T+ TP           L    RS + +
Sbjct  298   QSPATPSPSKTRPMLQVR-SASPRFVREDKSNNTSQTPSLRSNYYYSGNLVQQGRSGASS  356

Query  1014  PRYSISGISPGYMAATESAKARLRSQSAPRQRPSTP-----------AKRCLSYSI----  1148
                      P YMAATESAKARLRSQSAPRQR STP           AK+ LS+ +    
Sbjct  357   SYGGEGNCLPNYMAATESAKARLRSQSAPRQRASTPEREREKGGVGCAKKRLSFPVADPI  416

Query  1149  -----------SVKNGEEGVEKRSEYWCNNNNTERESVGGEISPCSTTNSRWW*R  1280
                        SV     G+E++S Y    ++   ES+GGEISP ST++ R W R
Sbjct  417   GHGVLRSPSFKSVSGTYLGMEQQSNY----SSCCTESLGGEISPSSTSDLRRWLR  467



>ref|XP_008233057.1| PREDICTED: protein IQ-DOMAIN 1 isoform X2 [Prunus mume]
Length=528

 Score =   149 bits (375),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 76/138 (55%), Positives = 103/138 (75%), Gaps = 4/138 (3%)
 Frame = +3

Query  318  ATVIQTAFRCYLAKRALVALKGIVKLQALIRGQNVRRQARITLKCMQALFRVQERMREQC  497
            A VIQTAFR YLA+RAL ALKG+VKLQAL+RG NVR+QA++TLKCMQAL RVQ R+ +Q 
Sbjct  113  AIVIQTAFRGYLARRALRALKGLVKLQALVRGHNVRKQAKMTLKCMQALVRVQARVLDQR  172

Query  498  ARISQDSARKSMFSGSTNSWESKY---IRERKSIFRDHCSVGEAWRDCPPTLQELEVMLQ  668
             R+S + +RKS FS + + WES+Y   I +RKS+ R+  S+ + W + P T++E++ MLQ
Sbjct  173  TRLSHEGSRKSAFSDTNSVWESRYLQDISDRKSMSREGSSIADDWDERPHTIEEVKAMLQ  232

Query  669  AQK-AAFMRERCPSQAWS  719
             +K AA  RE+  S A+S
Sbjct  233  HRKDAAMKREKALSHAFS  250


 Score = 66.2 bits (160),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 48/107 (45%), Positives = 58/107 (54%), Gaps = 27/107 (25%)
 Frame = +3

Query  1041  PGYMAATESAKARLRSQSAPRQRPSTP--------AKRCLS------YSISVKNGEEGVE  1178
             P YMAATESAKAR+RSQSAPRQRPSTP        AK+ LS      Y +++  G  G  
Sbjct  422   PNYMAATESAKARIRSQSAPRQRPSTPDRERGAGSAKKRLSFPAPDPYGVAMGYGSYGHS  481

Query  1179  KRS-------------EYWCNNNNTERESVGGEISPCSTTNSRWW*R  1280
              RS             E   N ++   ES GGE+SP ST++ R W R
Sbjct  482   LRSPSFKSVAASHFGVEQQSNYSSCCTESHGGEVSPSSTSDLRRWLR  528



>gb|KEH18583.1| IQ calmodulin-binding motif protein [Medicago truncatula]
Length=552

 Score =   148 bits (374),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 105/267 (39%), Positives = 148/267 (55%), Gaps = 60/267 (22%)
 Frame = +3

Query  96   KLGANSWLTALKRVFIRYPSKDrksrh-----skrdeeeekkrdkgrrWLFSKTADENSV  260
            K G++SWLTA+KR F R P+KD + R          EE+E+K+ + RRW+F K  +  +V
Sbjct  3    KKGSSSWLTAVKRAF-RSPTKDSEKRSGRRREDCDQEEDEEKKREKRRWIFRKPVNHETV  61

Query  261  GGVE----------------IISRTPPPSRRLLC--------------------------  314
               +                + SRT    +  L                           
Sbjct  62   NNTQQSTPTKLKHDVVTATSVASRTDQDEKHALAVAMATAEAARATAQAAVEVARLTKSS  121

Query  315  -------AATVIQTAFRCYLAKRALVALKGIVKLQALIRGQNVRRQARITLKCMQALFRV  473
                   AA VIQT+FR YLA+RAL ALKG+VKLQAL+RG NVR+QA++TL+CMQAL RV
Sbjct  122  NHAREHYAAVVIQTSFRGYLARRALRALKGLVKLQALVRGHNVRKQAKMTLRCMQALVRV  181

Query  474  QERMREQCAR-ISQDSARKSMFSGSTNSWESKY---IRERKSIFRDHCSVGEAWRDCPPT  641
            Q R+ +Q  R  S + +RKS FS + + W+S+Y   I +RKS+ R+  S+ + W D P T
Sbjct  182  QARVLDQRIRSTSHEGSRKSTFSDTASVWDSRYLQDISDRKSLSREGSSIADDWDDRPHT  241

Query  642  LQELEVMLQAQK-AAFMRERCPSQAWS  719
            ++E++ MLQ +K AA  RE+  SQA+S
Sbjct  242  VEEVKAMLQQRKEAAMKREKSLSQAFS  268


 Score = 62.0 bits (149),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 47/119 (39%), Positives = 57/119 (48%), Gaps = 41/119 (34%)
 Frame = +3

Query  1029  SGISPGYMAATESAKARLRSQSAPRQRPSTP-------AKRCLSY---------------  1142
             S   P YM ATESAKAR+RSQSAPRQRPSTP        K+ LS+               
Sbjct  440   SATLPNYMQATESAKARIRSQSAPRQRPSTPERDRSGSVKKRLSFPAPDPYNVGGVGYGN  499

Query  1143  -----------SISVKNGEEGVEKRSEYW--CNNNNTERESVGGEISPCSTTNSRWW*R  1280
                        S++V     G+E+ S Y   C       ES+GGE+SP ST + R W R
Sbjct  500   YGHSLRSPSFKSVNVAASHYGLEQNSNYSSCCT------ESLGGEVSPSSTGDLRRWLR  552



>ref|XP_008350526.1| PREDICTED: protein IQ-DOMAIN 1-like isoform X2 [Malus domestica]
Length=535

 Score =   148 bits (374),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 101/251 (40%), Positives = 138/251 (55%), Gaps = 56/251 (22%)
 Frame = +3

Query  102  GANSWLTALKRVFIRYPSKDrksrhskrdeeeekkrdkgrrWLFSK--------------  239
            G  SWLTA+KR F R P+KD + +  +              W+F K              
Sbjct  5    GGTSWLTAVKRAF-RSPTKDDEDQKKREKRR----------WIFRKPTSLNQQETVTQEA  53

Query  240  ---------TADENSV----------------GGVEIISRTPPPSR-RLLCAATVIQTAF  341
                      AD+  V                   E++  T P +  R    A VIQTAF
Sbjct  54   AAEQKHVXAAADQKHVLSVAVATAEAAMATAHAAAEVVRLTRPSNHARENYYAIVIQTAF  113

Query  342  RCYLAKRALVALKGIVKLQALIRGQNVRRQARITLKCMQALFRVQERMREQCARISQDSA  521
            R YLA+RAL ALKG+VKLQAL+RG NVR+QA++TLKCMQAL RVQ R+ +Q  R+S + +
Sbjct  114  RGYLARRALRALKGLVKLQALVRGHNVRKQAKMTLKCMQALVRVQSRVLDQRTRLSHEGS  173

Query  522  RKSMFSGSTNS-WESKY---IRERKSIFRDHCSVGEAWRDCPPTLQELEVMLQAQK-AAF  686
            RKS FS +T+  WES+Y   I +RKS+ R+  S+ + W + P T++E++ MLQ +K AA 
Sbjct  174  RKSXFSDTTSRVWESQYLQDISDRKSLSREGSSIADDWDERPHTIEEVKAMLQHRKEAAM  233

Query  687  MRERCPSQAWS  719
             RE+  SQA+S
Sbjct  234  KREKSLSQAFS  244


 Score = 69.3 bits (168),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 50/112 (45%), Positives = 63/112 (56%), Gaps = 28/112 (25%)
 Frame = +3

Query  1029  SGIS-PGYMAATESAKARLRSQSAPRQRPSTP--------AKRCLSY------SISVKNG  1163
             SG++ P YMAATESAKAR+RSQSAPRQRPSTP        AK+ LS+       +++  G
Sbjct  424   SGVALPNYMAATESAKARIRSQSAPRQRPSTPDRERAAGSAKKRLSFPAPDPHGLAIGYG  483

Query  1164  EEGVEKRS-------------EYWCNNNNTERESVGGEISPCSTTNSRWW*R  1280
               G   RS             E   N ++   ES GGE+SPCST++ R W R
Sbjct  484   GYGHSLRSPSFKSVSASHFGVEQQSNYSSCCTESHGGEVSPCSTSDLRRWLR  535



>ref|XP_004155200.1| PREDICTED: protein IQ-DOMAIN 14-like [Cucumis sativus]
 gb|KGN56344.1| hypothetical protein Csa_3G116810 [Cucumis sativus]
Length=469

 Score =   147 bits (372),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 155/484 (32%), Positives = 224/484 (46%), Gaps = 102/484 (21%)
 Frame = +3

Query  90    VKKLGANSWLTALKRVFIRYPSKDrksrhskrdeeeekkrdkgrrWLFSKTADENSV---  260
             + K G +SWLTA+KR F R PSKD   + +++     ++       +  +T    S    
Sbjct  1     MGKKGGSSWLTAVKRAF-RSPSKDEDHKKTEKRRWGFRRSTNLHDQVTHQTPSNPSSDAA  59

Query  261   ----------------GGVEIISRT----PPPSRRLLCAATVIQTAFRCYLAKRALVALK  380
                               V++   T    P  + R   AA +IQTAFR YLA+RAL ALK
Sbjct  60    LAAAVATAEAAMVTAQAAVQVARLTTSTRPSNNARDHYAAILIQTAFRGYLARRALRALK  119

Query  381   GIVKLQALIRGQNVRRQARITLKCMQALFRVQERMREQCARISQDSARKSMFSGSTNSWE  560
             G+VKLQAL+RG NVR+QA++TL+CMQAL RVQ R+ +Q  R+S + +  S  S  + +  
Sbjct  120   GLVKLQALVRGHNVRKQAKMTLRCMQALVRVQARVLDQRMRLSHEESGNSTLSDPSTALG  179

Query  561   SKYI-----RERKSIFRDHCSVGEAWRDC-PPTLQELEVMLQAQKAAFMRERCPSQAWSS  722
             S+Y+     R+  ++ RD     + WR    P++   + +   ++  ++ +    +AW S
Sbjct  180   SRYLQYLSDRKEFAMKRDRNLSQQIWRRGRSPSMGSGDDL--EERPKWLDQWNSRKAWES  237

Query  723   -------DTDVVDGEEREKTTPLKQGKSR----APAIQRRNPVKSGE-----INVRIRSL  854
                      D +   E +   P  +  S     A  +QR NP  SG      +   + S 
Sbjct  238   RGRASTDQRDPIKTVEIDTFQPYTRTSSNFRRMAQNLQRTNP-HSGSSPLNRMQQNVYSF  296

Query  855   QHKSASSVQapatpspakpkpVRPTTSPGNL--EKSHSTANTP----------RLCPTNR  998
              H  A+    P+         VR + SP  +  +KS +T+ TP           L    R
Sbjct  297   HHSPAT----PSPSKTRPMLQVR-SASPRFVREDKSDNTSQTPSLRSNYYYSGNLVQQGR  351

Query  999   SASFAPRYSISGISPGYMAATESAKARLRSQSAPRQRPSTP-------------AKRCLS  1139
             S + +         P YMAATESAKARLRSQSAPRQR STP             AK+ LS
Sbjct  352   SGASSSYGGDGNCLPNYMAATESAKARLRSQSAPRQRASTPEREREREKGGVGCAKKRLS  411

Query  1140  YSI---------------SVKNGEEGVEKRSEY--WCNNNNTERESVGGEISPCSTTNSR  1268
             + +               SV     G+E++S Y   C       ES+GGEISP ST++ R
Sbjct  412   FPVADPIGHGVLRSPSFKSVSGTYLGMEQQSNYSSCCT------ESLGGEISPSSTSDLR  465

Query  1269  WW*R  1280
              W R
Sbjct  466   RWLR  469



>ref|XP_010690237.1| PREDICTED: protein IQ-DOMAIN 1 [Beta vulgaris subsp. vulgaris]
Length=574

 Score =   148 bits (373),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 87/167 (52%), Positives = 114/167 (68%), Gaps = 13/167 (8%)
 Frame = +3

Query  291  PPSRRLLCAATVIQTAFRCYLAKRALVALKGIVKLQALIRGQNVRRQARITLKCMQALFR  470
            PP  R  CAAT+IQTAFR YLA+RAL ALKG+VKLQAL+RG NVR+QA++TLKCMQAL R
Sbjct  138  PP--REDCAATLIQTAFRGYLARRALRALKGLVKLQALVRGHNVRKQAKMTLKCMQALVR  195

Query  471  VQERMREQCARISQDSARKSMFSGSTNSWESKY---IRERKSI--FRDHCSVGEAWRDCP  635
            VQ R+ +Q  R+S D +RKS FS + +  ES+Y   I ER+S+   R+  S+ + W + P
Sbjct  196  VQARVLDQRMRLSHDGSRKSTFSDTNSIVESRYLQDIAERRSLSHSREPSSLADDWDERP  255

Query  636  PTLQELEVMLQAQK-AAFMRERCPSQA-----WSSDTDVVDGEEREK  758
             T++E++ MLQ +K AA  RE+  S A     W SD   V  EE E+
Sbjct  256  HTIEEVKAMLQNRKDAALKREKSLSHAFSHQMWRSDRSSVGEEELEE  302


 Score = 62.0 bits (149),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 50/120 (42%), Positives = 64/120 (53%), Gaps = 40/120 (33%)
 Frame = +3

Query  1023  SISGISPGYMAATESAKARLRSQSAPRQRPSTP------------AKRCLSY--------  1142
             S  G  P YMAATESAKARLR+QSAPRQRPSTP            AK+ LS+        
Sbjct  461   SSGGPKPNYMAATESAKARLRTQSAPRQRPSTPERDRGGPGAGAGAKKRLSFPNPDPYSG  520

Query  1143  --------------SISVKNGEEGVEKRSEYWCNNNNTERESVGGEISPCSTTNSRWW*R  1280
                           S++V+ G   +E++S Y    ++   +S+GGEISP STT+ R W R
Sbjct  521   MGYGSYNLRSPSFKSVNVQLGM--MEQQSNY----SSCCTDSLGGEISPSSTTDLRRWLR  574



>ref|XP_010421989.1| PREDICTED: protein IQ-DOMAIN 1-like [Camelina sativa]
Length=429

 Score =   146 bits (368),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 151/467 (32%), Positives = 225/467 (48%), Gaps = 112/467 (24%)
 Frame = +3

Query  87    MVKKLGANSWLTALKRVFIRYPSKDrksrhskrdeeeekkrdkgrrWLFSKTADENSVGG  266
             M KK G  SW TA+K++    PSKD   + + + E + KK +K   W+F KT  E +   
Sbjct  1     MAKKNGT-SWFTAVKKILWS-PSKDSDHKKTHKKETDYKKNEKKG-WIFRKTKLETTNSV  57

Query  267   VEIISR-------------------------------TPPPSRRLLCAATVIQTAFRCYL  353
             VE   R                                PP   R  CAA VIQTAFR YL
Sbjct  58    VEDTVRKVLTVETVEEEKPAVNVSAVDEAVAEIVKLKAPPGFIRRHCAAIVIQTAFRGYL  117

Query  354   AKRALVALKGIVKLQALIRGQNVRRQARITLKCMQALFRVQERM---REQCARI------  506
             ++RAL AL+GIVKLQAL+RG NVR QA++TL+C++AL RVQ+++    +Q +R+      
Sbjct  118   SRRALRALRGIVKLQALVRGNNVRNQAKLTLRCIKALVRVQDQVLNHHQQRSRVLSSSPS  177

Query  507   ---SQDSARKSMFSGSTNSWESKY----IRERKSIFRD--HCSVGEAWRDCPPTL--QEL  653
                + ++ R SMF+ S   W++K     IR R+S+ RD   C+  E   +   ++  ++L
Sbjct  178   RNYNIEARRNSMFAESNGFWDTKTYLQDIRSRRSLSRDMSRCTNNEFDSEETESILQKKL  237

Query  654   EVMLQAQK--AAFMRERCPSQAWSSDTDVVDGEEREKTTPLKQGKSRAPAIQRRNPVKSG  827
             E+ ++ +K  A  +  +  S+++ + +   D E  E+T    Q   R  A ++ +   + 
Sbjct  238   EIAIKREKAQALALSNQIRSRSYQNQSAGDDRELLERT----QWLDRWMATKQWDDTITN  293

Query  828   EINVR--IRSLQ---HKSASSVQapatpspakpkpVRPTTSPGNLEKSHSTANTPRLCPT  992
               NVR  I++L+   H    S                P T P               C  
Sbjct  294   STNVRDQIKTLELNIHHHQRSY---------------PATPPS--------------CRA  324

Query  993   NRSA---SFAPRY--SISGISPGYMAATESAKARLRSQSAPRQRPSTPAKR-CLSYSISV  1154
             +RS    S +PR   S S + P YM+ATESAKA+ R+QS PR+RP T  KR C +   S+
Sbjct  325   SRSVMVRSASPRIPCSPSSVQPNYMSATESAKAKARTQSTPRRRPITAKKRLCYAEEESL  384

Query  1155  K--------NGEEGVEKRSEYWCNNNNTERESVGGEISPCSTTNSRW  1271
             +        NG    +  S+Y C       +   G++SPCSTT+ RW
Sbjct  385   RSPSFKSAYNGCLWGDHESDYSCCYG----DGYAGKLSPCSTTDLRW  427



>ref|XP_010100661.1| Protein IQ-DOMAIN 14 [Morus notabilis]
 gb|EXB83823.1| Protein IQ-DOMAIN 14 [Morus notabilis]
Length=516

 Score =   147 bits (370),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 76/139 (55%), Positives = 104/139 (75%), Gaps = 4/139 (3%)
 Frame = +3

Query  315  AATVIQTAFRCYLAKRALVALKGIVKLQALIRGQNVRRQARITLKCMQALFRVQERMREQ  494
            AA VIQTAFR YLA+RAL ALKG+VKLQAL+RG NVR+QA++TL+CMQAL RVQ R+ +Q
Sbjct  107  AAIVIQTAFRGYLARRALRALKGLVKLQALVRGHNVRKQAKMTLRCMQALVRVQARVLDQ  166

Query  495  CARISQDSARKSMFSGSTNSWESKY---IRERKSIFRDHCSVGEAWRDCPPTLQELEVML  665
              R+S D +RKS FS + + W+S+Y   I +RKS+ R+  S+ + W + P T++E++ ML
Sbjct  167  RMRLSHDGSRKSTFSDTNSVWDSRYLQDISDRKSMSREGSSIADDWDERPHTVEEVKAML  226

Query  666  QAQK-AAFMRERCPSQAWS  719
            Q +K  A  RE+  SQA+S
Sbjct  227  QHRKEVAMKREKKLSQAFS  245


 Score = 60.5 bits (145),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 49/109 (45%), Positives = 59/109 (54%), Gaps = 33/109 (30%)
 Frame = +3

Query  1041  PGYMAATESAKARLRSQSAPRQRPSTP---------AKRCLSY-----------------  1142
             P YMAATESAKAR RSQSAPRQRPSTP         AK+ LS+                 
Sbjct  412   PNYMAATESAKARSRSQSAPRQRPSTPERDRGVGSAAKKRLSFPAPPEPHYCYGHSLRSP  471

Query  1143  SISVKNGEE--GVEKRSEYWCNNNNTERESVGG-EISPCSTTNSRWW*R  1280
             S    NG    G+E++S Y    ++   +S+GG EISP STT+ R W R
Sbjct  472   SFKSVNGSHFGGLEQQSNY----SSCCTDSLGGCEISPSSTTDLRRWLR  516



>ref|XP_011043708.1| PREDICTED: protein IQ-DOMAIN 14-like isoform X2 [Populus euphratica]
Length=524

 Score =   146 bits (369),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 143/400 (36%), Positives = 196/400 (49%), Gaps = 79/400 (20%)
 Frame = +3

Query  288   PPPSRRLLCAATVIQTAFRCYLAKRALVALKGIVKLQALIRGQNVRRQARITLKCMQALF  467
             PP   +   AA  IQTAFR YLAKRAL ALKG+VKLQAL+RG NVR++A++TL+CMQA+ 
Sbjct  130   PPLFVKQHFAAIAIQTAFRGYLAKRALKALKGLVKLQALVRGHNVRKRAKMTLQCMQAMA  189

Query  468   RVQERMREQCARISQDSARKSMFSGSTNSWESKYIRERKSIFRDHCSVGEAWRD---CPP  638
             RVQ R+ EQ  R+S +    S+ S   NS+    + ERKS   D  S  + W      P 
Sbjct  190   RVQSRVCEQRRRLSYEGNTNSI-SSDQNSFRGSNLAERKSTCWDGSSTADDWFHRNYHPK  248

Query  639   TLQELEVMLQAQK--AAFMRERCPSQAWSS-------DTDVVDGE--------EREKTTP  767
             TL+E++ M Q +K   +  RE+  + A+S        D+   +GE        ER  T  
Sbjct  249   TLEEIQPMFQEKKEMVSLKREKALAYAFSQQIWRPGRDSYASEGEVEKNPRWLERRGTIK  308

Query  768   LKQGKSRA--PAIQRRNPVKSGEINVRIRSLQHKSASSVQapatpspakpkpVRPT----  929
               +G+  A       R+PVK+ E++      +  S SS  A         +  RP+    
Sbjct  309   DWEGRGIAFRDQYHSRDPVKTVEMDTS----RPYSYSSPNAHKLHQHYHYQQHRPSSYSV  364

Query  930   TSPGNLEKSH---STANTPRLCPTN---RSASFAPRY------SISGIS-------PGYM  1052
             TSP  L+K+H   S   TP L  T    +  S +PR+       + G +       P YM
Sbjct  365   TSP--LQKNHYNLSQPTTPSLSKTRTLLQVHSSSPRFLRESRNHVMGETTPSATSKPNYM  422

Query  1053  AATESAKARLRSQSAPRQRPSTP-------AKRCLSYSI---------SVKN--------  1160
             AAT SAKAR+RSQSAPR R STP       AK+ LS+ +         S+ N        
Sbjct  423   AATASAKARIRSQSAPRPRASTPEREISGSAKKRLSFPVPDPATSNEGSMVNDYNLRSPS  482

Query  1161  --GEEGVEKRSEYWCNNNNTERESVGGEISPCSTTN-SRW  1271
               G  G     E   N ++   +S+  E+SP  T + SRW
Sbjct  483   LKGIHGANMVMEQRSNMSSCYTDSIDDEVSPPPTNDLSRW  522



>ref|XP_011043707.1| PREDICTED: protein IQ-DOMAIN 1-like isoform X1 [Populus euphratica]
Length=560

 Score =   146 bits (369),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 143/400 (36%), Positives = 196/400 (49%), Gaps = 79/400 (20%)
 Frame = +3

Query  288   PPPSRRLLCAATVIQTAFRCYLAKRALVALKGIVKLQALIRGQNVRRQARITLKCMQALF  467
             PP   +   AA  IQTAFR YLAKRAL ALKG+VKLQAL+RG NVR++A++TL+CMQA+ 
Sbjct  130   PPLFVKQHFAAIAIQTAFRGYLAKRALKALKGLVKLQALVRGHNVRKRAKMTLQCMQAMA  189

Query  468   RVQERMREQCARISQDSARKSMFSGSTNSWESKYIRERKSIFRDHCSVGEAWRD---CPP  638
             RVQ R+ EQ  R+S +    S+ S   NS+    + ERKS   D  S  + W      P 
Sbjct  190   RVQSRVCEQRRRLSYEGNTNSI-SSDQNSFRGSNLAERKSTCWDGSSTADDWFHRNYHPK  248

Query  639   TLQELEVMLQAQK--AAFMRERCPSQAWSS-------DTDVVDGE--------EREKTTP  767
             TL+E++ M Q +K   +  RE+  + A+S        D+   +GE        ER  T  
Sbjct  249   TLEEIQPMFQEKKEMVSLKREKALAYAFSQQIWRPGRDSYASEGEVEKNPRWLERRGTIK  308

Query  768   LKQGKSRA--PAIQRRNPVKSGEINVRIRSLQHKSASSVQapatpspakpkpVRPT----  929
               +G+  A       R+PVK+ E++      +  S SS  A         +  RP+    
Sbjct  309   DWEGRGIAFRDQYHSRDPVKTVEMDTS----RPYSYSSPNAHKLHQHYHYQQHRPSSYSV  364

Query  930   TSPGNLEKSH---STANTPRLCPTN---RSASFAPRY------SISGIS-------PGYM  1052
             TSP  L+K+H   S   TP L  T    +  S +PR+       + G +       P YM
Sbjct  365   TSP--LQKNHYNLSQPTTPSLSKTRTLLQVHSSSPRFLRESRNHVMGETTPSATSKPNYM  422

Query  1053  AATESAKARLRSQSAPRQRPSTP-------AKRCLSYSI---------SVKN--------  1160
             AAT SAKAR+RSQSAPR R STP       AK+ LS+ +         S+ N        
Sbjct  423   AATASAKARIRSQSAPRPRASTPEREISGSAKKRLSFPVPDPATSNEGSMVNDYNLRSPS  482

Query  1161  --GEEGVEKRSEYWCNNNNTERESVGGEISPCSTTN-SRW  1271
               G  G     E   N ++   +S+  E+SP  T + SRW
Sbjct  483   LKGIHGANMVMEQRSNMSSCYTDSIDDEVSPPPTNDLSRW  522



>emb|CBI23074.3| unnamed protein product [Vitis vinifera]
Length=426

 Score =   145 bits (365),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 145/419 (35%), Positives = 198/419 (47%), Gaps = 83/419 (20%)
 Frame = +3

Query  87    MVKKLGANSWLTALKRVFIRYPSKDrksrhskrdeeeekkrdkgrrWLFSKTADENSVGG  266
             M K  GA SWLTA+KR F R PSK       + ++EEE+K+   RRW+F K ++ N  G 
Sbjct  1     MGKIGGAGSWLTAVKRAF-RSPSK-----REEHEQEEEEKKRGKRRWIFRKHSNNNETGK  54

Query  267   VEI--------------------------ISRTPPPSRRLLCAATVIQTAFRCYLAKRAL  368
                                          ++R P    R  CAA VIQTAFR YLA++AL
Sbjct  55    RHAIAVAMATAAAAEAAVATAKAAVEVARLTRRPSIFVREHCAAIVIQTAFRGYLARKAL  114

Query  369   VALKGIVKLQALIRGQNVRRQARITLKCMQALFRVQERMREQCARISQDSARK--SMFSG  542
              ALKG+VKLQAL+RG NVR++A+ TL+CMQAL RVQ R+ +Q  R+S     K  S+FS 
Sbjct  115   RALKGLVKLQALVRGHNVRKRAKKTLRCMQALVRVQARVCDQRKRLSLSHEEKIDSIFSD  174

Query  543   STNSWESKYIRERKSIFRDHCSVGEAWRDCPPTLQ-ELEVMLQAQKAAFMRERCPSQAWS  719
              ++ WES  +  RKS+          W D P T + E E +  A      R     Q  +
Sbjct  175   PSSLWESNLL-NRKSM------SAWDWDDHPHTKKREEEALAHAFAHQIWRSSRKDQYHA  227

Query  720   SDTDVVDGEEREKTTPLKQGKSRAPAIQRRNPVKSGEINVRIRSLQHKSASSVQapatps  899
             S+ ++ D   R               + RR   K  E   R    Q +   +V+   +  
Sbjct  228   SEGELEDKPRR---------------LDRRMVTKHWESTGRSSCDQREHIKTVEVDTSQP  272

Query  900   pakpkpV--RP--------TTSPGNLE---------KSHSTANTPRLCPTNRSASFAPRY  1022
              +   P+  RP        T SP  ++         + HS A TP+L        ++   
Sbjct  273   YSYSTPIFQRPFHQPPSPITPSPYKIKLFQAHSASPRCHSAAQTPKLGSIYYHGMWSSSS  332

Query  1023  SISGISPGYMAATESAKARLRSQSAPRQRPSTP-------AKRCLSYSISVKNGEEGVE  1178
             + +   P YMA+TESAKAR RSQSAPRQR STP       A++ LS+      G  G+E
Sbjct  333   AGAAAMPNYMASTESAKARARSQSAPRQRASTPERDRPGSARKRLSFPDPDPFGATGIE  391



>gb|KDP28424.1| hypothetical protein JCGZ_14195 [Jatropha curcas]
Length=533

 Score =   145 bits (367),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 121/314 (39%), Positives = 169/314 (54%), Gaps = 67/314 (21%)
 Frame = +3

Query  96   KLGANSWLTALKRVFIRYPSKDrksrhs-----krdeeeekkrdkgrrWLFSKTADENSV  260
            K G +SWLTA+KR F R P+K+   R S        EE+E+K+ + RRW+F K  ++ +V
Sbjct  3    KKGGSSWLTAVKRAF-RSPTKEIDKRVSRRREDHDQEEDEEKKREKRRWIFRKPTNQEAV  61

Query  261  -------------GG-------------------VEIISRTPPPSRRLL---------CA  317
                         GG                      I++ P    RL           A
Sbjct  62   TPPKTATDKAYSSGGSAAPTDHVSTAAAEHKHAIAVAIAQAPAQVARLTRSSYHARENYA  121

Query  318  ATVIQTAFRCYLAKRALVALKGIVKLQALIRGQNVRRQARITLKCMQALFRVQERMREQC  497
            A VIQTAFR YLA+RAL ALKG+VKLQAL+RG NVR+QA++TL+CMQAL RVQ R+ +Q 
Sbjct  122  AIVIQTAFRGYLARRALRALKGLVKLQALVRGHNVRKQAKMTLRCMQALVRVQARVLDQR  181

Query  498  ARISQDSARKSMFSGSTNSWESKY---IRERKSIFRDHCSVGEAWRDCPPTLQELEVMLQ  668
             R+S + +RKS FS + +  ES+Y   I +RKS+ R+  S+ + W + P T++E++ MLQ
Sbjct  182  VRLSHEGSRKSTFSDTNSVIESRYLQDISDRKSMSREGSSIADDWDERPHTIEEVKAMLQ  241

Query  669  AQK-AAFMRERCPSQA-----WSSDTDVVDGEERE---------KTTPLKQ-GKSRAPA-  797
             +K AA  RE+  S A     W++      G E E         + TP K    SRA A 
Sbjct  242  HRKEAAMKREKTLSHAFSQQIWTTRRSPSIGTEDELQERPQWLDRWTPAKPWDSSRARAS  301

Query  798  IQRRNPVKSGEINV  839
              +R P+K+ EI+ 
Sbjct  302  TDQREPIKTVEIDT  315


 Score = 65.9 bits (159),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 50/114 (44%), Positives = 62/114 (54%), Gaps = 41/114 (36%)
 Frame = +3

Query  1041  PGYMAATESAKARLRSQSAPRQRPSTP-------AKRCLSY-------------------  1142
             P YMAATESAKAR+RSQSAPRQRPSTP       AK+ LS+                   
Sbjct  427   PNYMAATESAKARVRSQSAPRQRPSTPERDRVGSAKKRLSFPAPDPYSAGIGYGGGFGHG  486

Query  1143  -------SIS-VKNGEEGVEKRSEYWCNNNNTERESVGGEISPCSTTNSRWW*R  1280
                    S+S V+ G  G+E++S Y C       ES+GGE+SP ST++ R W R
Sbjct  487   LRSPSFKSVSAVQFG--GLEQQSNYSCCT-----ESLGGEVSPSSTSDLRRWLR  533



>ref|NP_192802.2| protein IQ-domain 16 [Arabidopsis thaliana]
 gb|AAQ22614.1| At4g10640 [Arabidopsis thaliana]
 dbj|BAF00278.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE82912.1| protein IQ-domain 16 [Arabidopsis thaliana]
Length=423

 Score =   144 bits (363),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 156/461 (34%), Positives = 221/461 (48%), Gaps = 106/461 (23%)
 Frame = +3

Query  87    MVKKLGANSWLTALKRVFIRYPSKDrksrhskrdeeeekkrdkgrrWLFSKTADE--NSV  260
             M KK G  SW TA+K++    PSKD   +     E + K+++K   W+F KT  E  NSV
Sbjct  1     MAKKNGT-SWFTAVKKILWS-PSKDSDKKTHHHKETDIKRKEKKG-WIFRKTKLETTNSV  57

Query  261   -------------------------GGVEIISRTPPPSR-RLLCAATVIQTAFRCYLAKR  362
                                      G  EI+  T  P   R   AA +IQTAFR YL++R
Sbjct  58    LQHTVRTVEAEEKEKPPVIVSSVEEGVTEIVKLTATPGFIRRHWAAIIIQTAFRGYLSRR  117

Query  363   ALVALKGIVKLQALIRGQNVRRQARITLKCMQALFRVQERM----REQCARI--------  506
             AL ALKGIVKLQAL+RG NVR QA++TL+C++AL RVQ+++    ++Q +R+        
Sbjct  118   ALRALKGIVKLQALVRGNNVRNQAKLTLRCIKALVRVQDQVLNHHQQQRSRVLLSPPSRN  177

Query  507   -SQDSARKSMFSGSTNSWESKY----IRERKSIFRDHCSVGEAWRDCPPTLQELEVMLQA  671
              + ++ R SMF+ S   W++K     IR R+S+ RD       +       +E E++LQ 
Sbjct  178   YNIEARRNSMFAESNGFWDTKTYLQDIRSRRSLSRDMNRCNNEFYS-----EETELILQK  232

Query  672   Q-KAAFMRERCPSQAWS------SDTDVVDGEEREKTTPLKQGKSRAPAIQRRNPVKSGE  830
             + + A  RE+  + A S      S  +   G++RE      Q   R  A ++ +   +  
Sbjct  233   KLEIAIKREKAQALALSNQIRSRSSRNQSAGDDRE-LLERTQWLDRWMATKQWDDTITNS  291

Query  831   INVR--IRSLQHKSASSVQapatpspakpkpVRPTTSPGNLEKSHSTANTPRLCPTNRSA  1004
              NVR  I++L+  +    Q              P T P               C  +RS 
Sbjct  292   TNVRDPIKTLEAVTTHHHQRSY-----------PATPPS--------------CRASRSV  326

Query  1005  ---SFAPRY--SISGISPGYMAATESAKARLRSQSAPRQRPSTPAKRCLSY-------SI  1148
                S +PR   S S + P YM+ATESAKA+ R+QS PR+RP T  KR L Y       S 
Sbjct  327   MVRSASPRIPCSPSSMQPNYMSATESAKAKARTQSTPRRRPMTAKKR-LCYAEEESLRSP  385

Query  1149  SVKNGEEGVEKRSEYWCNNNNTERESVGGEISPCSTTNSRW  1271
             S K+   G +  S+Y C       +   G+ISPCSTT  RW
Sbjct  386   SFKSCLWG-DHESDYSCCYG----DGFAGKISPCSTTELRW  421



>ref|XP_004134281.1| PREDICTED: protein IQ-DOMAIN 14-like [Cucumis sativus]
Length=399

 Score =   144 bits (362),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 134/386 (35%), Positives = 189/386 (49%), Gaps = 78/386 (20%)
 Frame = +3

Query  315   AATVIQTAFRCYLAKRALVALKGIVKLQALIRGQNVRRQARITLKCMQALFRVQERMREQ  494
             AA +IQTAFR YLA+RAL ALKG+VKLQAL+RG NVR+QA++TL+CMQAL RVQ R+ +Q
Sbjct  28    AAILIQTAFRGYLARRALRALKGLVKLQALVRGHNVRKQAKMTLRCMQALVRVQARVLDQ  87

Query  495   CARISQDSARKSMFSGSTNSWESKYI-----RERKSIFRDHCSVGEAWRDC-PPTLQELE  656
               R+S + +  S  S  + +  S+Y+     R+  ++ RD     + WR    P++   +
Sbjct  88    RMRLSHEESGNSTLSDPSTALGSRYLQYLSDRKEFAMKRDRNLSQQIWRRGRSPSMGSGD  147

Query  657   VMLQAQKAAFMRERCPSQAWSS-------DTDVVDGEEREKTTPLKQGKSR----APAIQ  803
              +   ++  ++ +    +AW S         D +   E +   P  +  S     A  +Q
Sbjct  148   DL--EERPKWLDQWNSRKAWESRGRASTDQRDPIKTVEIDTFQPYTRTSSNFRRMAQNLQ  205

Query  804   RRNPVKSGE-----INVRIRSLQHKSASSVQapatpspakpkpVRPTTSPGNL--EKSHS  962
             R NP  SG      +   + S  H  A+    P+         VR + SP  +  +KS +
Sbjct  206   RTNP-HSGSSPLNRMQQNVYSFHHSPAT----PSPSKTRPMLQVR-SASPRFVREDKSDN  259

Query  963   TANTP----------RLCPTNRSASFAPRYSISGISPGYMAATESAKARLRSQSAPRQRP  1112
             T+ TP           L    RS + +         P YMAATESAKARLRSQSAPRQR 
Sbjct  260   TSQTPSLRSNYYYSGNLVQQGRSGASSSYGGDGNCLPNYMAATESAKARLRSQSAPRQRA  319

Query  1113  STP-------------AKRCLSYSI---------------SVKNGEEGVEKRSEY--WCN  1202
             STP             AK+ LS+ +               SV     G+E++S Y   C 
Sbjct  320   STPEREREREKGGVGCAKKRLSFPVADPIGHGVLRSPSFKSVSGTYLGMEQQSNYSSCCT  379

Query  1203  NNNTERESVGGEISPCSTTNSRWW*R  1280
                   ES+GGEISP ST++ R W R
Sbjct  380   ------ESLGGEISPSSTSDLRRWLR  399



>ref|XP_006307205.1| hypothetical protein CARUB_v10008796mg [Capsella rubella]
 gb|EOA40103.1| hypothetical protein CARUB_v10008796mg [Capsella rubella]
Length=538

 Score =   145 bits (365),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 104/255 (41%), Positives = 141/255 (55%), Gaps = 56/255 (22%)
 Frame = +3

Query  87   MVKKLGANSWLTALKRVFIRYPSKDrksrhskrdeeeekkrdkgrrWLFSKTADE-----  251
            M KK G++SWLTA+KR F R PSK     H+   EE+E+K+ + RRWLF K A +     
Sbjct  1    MGKKSGSSSWLTAVKRAF-RSPSK---KEHNNEVEEDEEKKREKRRWLFRKPATQESSLK  56

Query  252  ------------------NSVGGVEIISRTPP----------------------PSR---  302
                              N        + TPP                      P R   
Sbjct  57   SSSISPPPVPPPQESDNVNPETAPSNTTTTPPSNAGKSASAVSSVVTSASKAVAPRRAYY  116

Query  303  -RLLCAATVIQTAFRCYLAKRALVALKGIVKLQALIRGQNVRRQARITLKCMQALFRVQE  479
             R   AA VIQT+FR YLA+RAL ALKG+VKLQAL+RG NVR+QA++TL+CMQAL RVQ 
Sbjct  117  ARENYAAVVIQTSFRGYLARRALRALKGLVKLQALVRGHNVRKQAKMTLRCMQALVRVQS  176

Query  480  RMREQCARISQDSARKSMFSGSTNSWESKY---IRERKSIFRDHCSVGEAWRDCPPTLQE  650
            R+ +Q  R+S D +RKS FS S   ++S+Y   I +R+S+ R+  S+ E W D P T+ E
Sbjct  177  RVLDQRKRLSHDGSRKSAFSDSHTGFDSRYLQDISDRQSMSREGSSIAEDWDDRPHTIDE  236

Query  651  LEVMLQAQKAAFMRE  695
            ++ MLQ ++   +R+
Sbjct  237  VKAMLQRRRDTALRQ  251


 Score = 52.0 bits (123),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 44/109 (40%), Positives = 55/109 (50%), Gaps = 35/109 (32%)
 Frame = +3

Query  1041  PGYMAATESAKARLRSQSAPRQRPSTP-------AKRCLSYSI-----------------  1148
             P YMA+TESAKAR+RSQSAPRQRP+TP        K+ LSY I                 
Sbjct  436   PNYMASTESAKARIRSQSAPRQRPATPERDRAGSVKKRLSYPIPPPPEYEDNNSLRSPSF  495

Query  1149  -SVKNGEEG--VEKRSEYW--CNNNNTERESVGGEISPCSTTNSRWW*R  1280
              SV     G  ++++S Y   C       ES G E+ P ST++ R W R
Sbjct  496   KSVAGSHFGGMLDQQSNYSSCCT------ESNGVEVPPASTSDFRNWLR  538



>ref|XP_006477504.1| PREDICTED: protein IQ-DOMAIN 1-like [Citrus sinensis]
 gb|KDO76749.1| hypothetical protein CISIN_1g047872mg [Citrus sinensis]
Length=508

 Score =   145 bits (365),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 135/393 (34%), Positives = 191/393 (49%), Gaps = 69/393 (18%)
 Frame = +3

Query  267   VEIISRTPPPSR---RLLCAATVIQTAFRCYLAKRALVALKGIVKLQALIRGQNVRRQAR  437
             +EI+  + P S    R   AATVIQT+FR YLA+RAL ALKG+VKLQAL+RGQNVR QA+
Sbjct  108   MEIVRHSRPASSYYVREHYAATVIQTSFRGYLARRALRALKGLVKLQALVRGQNVRHQAK  167

Query  438   ITLKCMQALFRVQERMREQCARISQDSARKSMFSGSTNSWESKY---IRERKSIFRDHCS  608
             +TLK +QAL R Q+ +R+Q  R S + +R+S+F+ + + W+SK    I+ RKS+  ++ +
Sbjct  168   LTLKRVQALVRAQDMVRDQRTRFSHEGSRRSLFAETNDFWDSKNLHDIKSRKSMSSNNNA  227

Query  609   VGEA----WRDCPPTLQELE--VMLQAQKAAFMRERCPSQAWSSDTDVVDGEERE-----  755
              G      W D P T Q ++  VM + +  A+      +Q W S  +   G+ERE     
Sbjct  228   SGTITIADWNDHPCTRQGIKEAVMKREKTLAYA---FSNQVWRSRRNPSAGDERELDERT  284

Query  756   -------KTTPLKQGKSRAPAIQRRNPVKSGEINVRIRSLQHKS----------ASSVQa  884
                     T   +   +RA   +R + +K+ E +      Q++           AS +  
Sbjct  285   KWLDRWMATKQWENSATRASTDRRDHIMKTVETDASWPKYQNQKQPRPPVSIGIASPLHR  344

Query  885   patpspakpkpVRPTTSPGNLEKSHSTANTPR-LCPTNRSASFAPRYSISGIS------P  1043
                       P   T SP   +     + +PR       S S A   +++G++      P
Sbjct  345   AQPNLFFHQSPAL-TPSPRKTKPIQVRSASPRSFLKEQTSFSAAQTPTLNGVAAATSTMP  403

Query  1044  GYMAATESAKARLRSQSAPRQRPST---------PAKRCLSYSI---------------S  1151
              YMAATESAKA+ RSQSAPRQ  ST           K+ LSY                 S
Sbjct  404   NYMAATESAKAKARSQSAPRQGASTSMLPRERSGSVKKRLSYPAPEPHCCQNSRSSSFKS  463

Query  1152  VKNGEEGVEKRSEYWCNNNNTERESVGGEISPC  1250
             V  G  G     E   N ++   ES GGEISPC
Sbjct  464   VPAGCGGYSSGIEQLSNYSSCYAESYGGEISPC  496



>ref|XP_006418384.1| hypothetical protein EUTSA_v10007299mg [Eutrema salsugineum]
 gb|ESQ36737.1| hypothetical protein EUTSA_v10007299mg [Eutrema salsugineum]
Length=543

 Score =   144 bits (364),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 72/130 (55%), Positives = 95/130 (73%), Gaps = 3/130 (2%)
 Frame = +3

Query  315  AATVIQTAFRCYLAKRALVALKGIVKLQALIRGQNVRRQARITLKCMQALFRVQERMREQ  494
            AA VIQT+FR YLAKRAL ALKG+VKLQAL+RG NVR+QA++TL+CMQAL RVQ R+ +Q
Sbjct  128  AAVVIQTSFRGYLAKRALRALKGLVKLQALVRGHNVRKQAKMTLRCMQALVRVQSRVLDQ  187

Query  495  CARISQDSARKSMFSGSTNSWESKY---IRERKSIFRDHCSVGEAWRDCPPTLQELEVML  665
              R+S D +RKS FS S   +ES+Y   I +R+S+ R+  SV E W D P T+ E++ ML
Sbjct  188  RKRLSHDGSRKSAFSDSQTGFESRYLHDISDRQSMSREGSSVAEDWDDRPHTIDEVKAML  247

Query  666  QAQKAAFMRE  695
            Q ++   +R 
Sbjct  248  QRRRDTALRH  257


 Score = 57.0 bits (136),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 44/108 (41%), Positives = 57/108 (53%), Gaps = 32/108 (30%)
 Frame = +3

Query  1041  PGYMAATESAKARLRSQSAPRQRPSTP-------AKRCLSYSI-----------------  1148
             P YMA TESAKAR+RSQSAPRQRPSTP        K+ LS+ +                 
Sbjct  440   PNYMANTESAKARIRSQSAPRQRPSTPERDRVGLVKKRLSFPVPPQPEYEDNNSSLRSPS  499

Query  1149  --SVKNGEEG--VEKRSEYWCNNNNTERESVGGEISPCSTTNSRWW*R  1280
               SV     G  +E++S Y    ++   ES+G +ISP ST++ R W R
Sbjct  500   FKSVAGSHFGGLLEQQSNY----SSCCTESIGVDISPASTSDFRNWLR  543



>ref|XP_008233056.1| PREDICTED: protein IQ-DOMAIN 1 isoform X1 [Prunus mume]
Length=529

 Score =   144 bits (363),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 76/139 (55%), Positives = 103/139 (74%), Gaps = 5/139 (4%)
 Frame = +3

Query  318  ATVIQTAFRCYLAKRALVALKGIVKLQALIRGQNVRRQARITLKCMQALFRVQERMREQC  497
            A VIQTAFR YLA+RAL ALKG+VKLQAL+RG NVR+QA++TLKCMQAL RVQ R+ +Q 
Sbjct  113  AIVIQTAFRGYLARRALRALKGLVKLQALVRGHNVRKQAKMTLKCMQALVRVQARVLDQR  172

Query  498  ARISQDSARKSMFSGSTNSWESKY---IRERKSI-FRDHCSVGEAWRDCPPTLQELEVML  665
             R+S + +RKS FS + + WES+Y   I +RKS+  R+  S+ + W + P T++E++ ML
Sbjct  173  TRLSHEGSRKSAFSDTNSVWESRYLQDISDRKSMQSREGSSIADDWDERPHTIEEVKAML  232

Query  666  QAQK-AAFMRERCPSQAWS  719
            Q +K AA  RE+  S A+S
Sbjct  233  QHRKDAAMKREKALSHAFS  251


 Score = 66.2 bits (160),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 48/107 (45%), Positives = 58/107 (54%), Gaps = 27/107 (25%)
 Frame = +3

Query  1041  PGYMAATESAKARLRSQSAPRQRPSTP--------AKRCLS------YSISVKNGEEGVE  1178
             P YMAATESAKAR+RSQSAPRQRPSTP        AK+ LS      Y +++  G  G  
Sbjct  423   PNYMAATESAKARIRSQSAPRQRPSTPDRERGAGSAKKRLSFPAPDPYGVAMGYGSYGHS  482

Query  1179  KRS-------------EYWCNNNNTERESVGGEISPCSTTNSRWW*R  1280
              RS             E   N ++   ES GGE+SP ST++ R W R
Sbjct  483   LRSPSFKSVAASHFGVEQQSNYSSCCTESHGGEVSPSSTSDLRRWLR  529



>ref|XP_009361348.1| PREDICTED: protein IQ-DOMAIN 14-like [Pyrus x bretschneideri]
Length=546

 Score =   144 bits (363),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 120/334 (36%), Positives = 168/334 (50%), Gaps = 72/334 (22%)
 Frame = +3

Query  315   AATVIQTAFRCYLAKRALVALKGIVKLQALIRGQNVRRQARITLKCMQALFRVQERMREQ  494
             AA VIQTAFR YLA+RAL ALKG+VKLQAL+RG NVR++A++TL+CMQAL RVQ+R+ +Q
Sbjct  135   AAIVIQTAFRGYLARRALRALKGLVKLQALVRGHNVRKRAKMTLQCMQALVRVQDRVLDQ  194

Query  495   -CARISQDSARKSMFSGSTNSWESKYIRERKSIFR-DHCSVGE---AWRDC-PPTLQELE  656
                R+S + + +S+FS  T  W S +   R+SI + D  S  +    W D  P TL++++
Sbjct  195   RTKRLSHEGSAESIFSDPTGLWGSHFSDRRESISKNDERSAADDLIHWDDVKPKTLEQIQ  254

Query  657   VMLQAQK-AAFMRERCPSQAWSSDTDV-------------------VDGEEREKTTPLKQ  776
              MLQ  K AA  RER  S A++    V                   +DG  R K   +  
Sbjct  255   AMLQKTKQAALKRERSTSLAYAFSNQVFDLPQYAGEHEELGEKFNLLDGWTRRKQCEINA  314

Query  777   GKSRAPAIQRRNPVKSGEINVRIRSLQHKSASS--------------VQapatpspakpk  914
             G++   +  +R+P+K+ EI+    S  H  +S+               Q+       + +
Sbjct  315   GRA---SCDQRDPIKTVEIDT---SRPHSYSSTPNSNSRTKRSDQCNYQSHHLQYNYQQQ  368

Query  915   pVRPTTSPGNLEKSHSTANT------------PRLCPTNRS------ASFAPRYSISGIS  1040
              V P + P    +S  T  T            PR    +        AS  P  ++   +
Sbjct  369   RVHPQSYPVASPQSPVTPFTFVARNLQVHSASPRCLRGDHRINHPMPASHTPNLNLGSTN  428

Query  1041  --------PGYMAATESAKARLRSQSAPRQRPST  1118
                     P YMAAT SAKAR+RSQSAPRQR ST
Sbjct  429   YDHGLMGVPNYMAATASAKARIRSQSAPRQRRST  462



>ref|XP_007218997.1| hypothetical protein PRUPE_ppa004080mg [Prunus persica]
 gb|EMJ20196.1| hypothetical protein PRUPE_ppa004080mg [Prunus persica]
Length=531

 Score =   144 bits (362),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 76/139 (55%), Positives = 103/139 (74%), Gaps = 5/139 (4%)
 Frame = +3

Query  318  ATVIQTAFRCYLAKRALVALKGIVKLQALIRGQNVRRQARITLKCMQALFRVQERMREQC  497
            A VIQTAFR YLA+RAL ALKG+VKLQAL+RG NVR+QA++TLKCMQAL RVQ R+ +Q 
Sbjct  113  AIVIQTAFRGYLARRALRALKGLVKLQALVRGHNVRKQAKMTLKCMQALVRVQARVLDQR  172

Query  498  ARISQDSARKSMFSGSTNSWESKY---IRERKSI-FRDHCSVGEAWRDCPPTLQELEVML  665
             R+S + +RKS FS + + WES+Y   I +RKS+  R+  S+ + W + P T++E++ ML
Sbjct  173  TRLSHEGSRKSAFSDTNSVWESRYLQDISDRKSMQSREGSSIADDWDERPHTIEEVKAML  232

Query  666  QAQK-AAFMRERCPSQAWS  719
            Q +K AA  RE+  S A+S
Sbjct  233  QHRKDAAMKREKALSHAFS  251


 Score = 66.2 bits (160),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 49/111 (44%), Positives = 58/111 (52%), Gaps = 35/111 (32%)
 Frame = +3

Query  1041  PGYMAATESAKARLRSQSAPRQRPSTP--------AKRCLSYSI----------------  1148
             P YMAATESAKAR+RSQSAPRQRPSTP        AK+ LS+                  
Sbjct  425   PNYMAATESAKARIRSQSAPRQRPSTPDRERGAGSAKKRLSFPAPDPYGVAMGYGGYGHS  484

Query  1149  -------SVKNGEEGVEKRSEYWCNNNNTERESVGGEISPCSTTNSRWW*R  1280
                    SV     GVE+RS Y    ++   ES GGE+SP ST++ R W R
Sbjct  485   LRSPSFKSVATSHFGVEQRSNY----SSCCTESHGGEVSPSSTSDLRRWLR  531



>ref|XP_008350469.1| PREDICTED: protein IQ-DOMAIN 1-like isoform X1 [Malus domestica]
Length=536

 Score =   144 bits (362),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 101/252 (40%), Positives = 138/252 (55%), Gaps = 57/252 (23%)
 Frame = +3

Query  102  GANSWLTALKRVFIRYPSKDrksrhskrdeeeekkrdkgrrWLFSK--------------  239
            G  SWLTA+KR F R P+KD + +  +              W+F K              
Sbjct  5    GGTSWLTAVKRAF-RSPTKDDEDQKKREKRR----------WIFRKPTSLNQQETVTQEA  53

Query  240  ---------TADENSV----------------GGVEIISRTPPPSR-RLLCAATVIQTAF  341
                      AD+  V                   E++  T P +  R    A VIQTAF
Sbjct  54   AAEQKHVXAAADQKHVLSVAVATAEAAMATAHAAAEVVRLTRPSNHARENYYAIVIQTAF  113

Query  342  RCYLAKRALVALKGIVKLQALIRGQNVRRQARITLKCMQALFRVQERMREQCARISQDSA  521
            R YLA+RAL ALKG+VKLQAL+RG NVR+QA++TLKCMQAL RVQ R+ +Q  R+S + +
Sbjct  114  RGYLARRALRALKGLVKLQALVRGHNVRKQAKMTLKCMQALVRVQSRVLDQRTRLSHEGS  173

Query  522  RKSMFSGSTNS-WESKY---IRERKSI-FRDHCSVGEAWRDCPPTLQELEVMLQAQK-AA  683
            RKS FS +T+  WES+Y   I +RKS+  R+  S+ + W + P T++E++ MLQ +K AA
Sbjct  174  RKSXFSDTTSRVWESQYLQDISDRKSLQSREGSSIADDWDERPHTIEEVKAMLQHRKEAA  233

Query  684  FMRERCPSQAWS  719
              RE+  SQA+S
Sbjct  234  MKREKSLSQAFS  245


 Score = 69.3 bits (168),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 50/112 (45%), Positives = 63/112 (56%), Gaps = 28/112 (25%)
 Frame = +3

Query  1029  SGIS-PGYMAATESAKARLRSQSAPRQRPSTP--------AKRCLSY------SISVKNG  1163
             SG++ P YMAATESAKAR+RSQSAPRQRPSTP        AK+ LS+       +++  G
Sbjct  425   SGVALPNYMAATESAKARIRSQSAPRQRPSTPDRERAAGSAKKRLSFPAPDPHGLAIGYG  484

Query  1164  EEGVEKRS-------------EYWCNNNNTERESVGGEISPCSTTNSRWW*R  1280
               G   RS             E   N ++   ES GGE+SPCST++ R W R
Sbjct  485   GYGHSLRSPSFKSVSASHFGVEQQSNYSSCCTESHGGEVSPCSTSDLRRWLR  536



>gb|KHN06356.1| Protein IQ-DOMAIN 14 [Glycine soja]
Length=534

 Score =   143 bits (361),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 107/258 (41%), Positives = 145/258 (56%), Gaps = 51/258 (20%)
 Frame = +3

Query  87   MVKKLGANSWLTALKRVFIRYPSKDrksrhs-----krdeeeekkrdkgrrWLFSKTA--  245
            M KK   +SWLTA+KR F R P+KD   R          EE+E+K+ + RRW+F KT   
Sbjct  1    MGKKGSGSSWLTAVKRAF-RSPTKDSDKRSGRRREDCDQEEDEEKKREKRRWIFRKTHMS  59

Query  246  ----------------DENSVGGVEIISRT-------------------PPPSRRLLCAA  320
                            D  + GG    SRT                   P    R   AA
Sbjct  60   HEGGNNNNNTQQKLKHDVAASGGG---SRTDQDQKHAVAAAVEVARLSKPASHAREHYAA  116

Query  321  TVIQTAFRCYLAKRALVALKGIVKLQALIRGQNVRRQARITLKCMQALFRVQERMREQCA  500
             VIQTAFR YLA+RAL ALKG+VKLQAL+RG NVR+QA++TL+CMQAL RVQ R+ +Q  
Sbjct  117  VVIQTAFRGYLARRALRALKGLVKLQALVRGHNVRKQAKMTLRCMQALVRVQARVLDQRI  176

Query  501  RISQDSARKSMFSGSTNSWESKY---IRERKSIFRDHCSVGEAWRDCPPTLQELEVMLQA  671
            R S + +RKS FS + + W+S+Y   I +RKSI R+  S+ + W +   +++E++ ML  
Sbjct  177  RSSLEGSRKSTFSDTASVWDSRYLQDISDRKSISREGSSITDDWDERHHSVEEVKAMLMQ  236

Query  672  QK--AAFMRERCPSQAWS  719
            +K  AA  R++  SQA+S
Sbjct  237  RKEAAAMKRDKTLSQAFS  254


 Score = 64.7 bits (156),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 49/110 (45%), Positives = 57/110 (52%), Gaps = 30/110 (27%)
 Frame = +3

Query  1041  PGYMAATESAKARLRSQSAPRQRPSTP-------AKRCLS------YSISVKNGEEGVEK  1181
             P YMAATESAKAR+RSQSAPRQRPSTP       AK+ LS      Y + V  G  G   
Sbjct  425   PNYMAATESAKARIRSQSAPRQRPSTPERDRVGSAKKRLSFPAPDPYGVGVSYGNYGHSL  484

Query  1182  RS--------------EYWCNNNNTERESV---GGEISPCSTTNSRWW*R  1280
             RS              E   N ++   ES+   GGE+SP ST + R W R
Sbjct  485   RSPSFKSVSGSHFGGLEQQSNYSSCYTESIGGGGGEVSPSSTGDLRRWLR  534



>gb|KHN15893.1| Protein IQ-DOMAIN 14 [Glycine soja]
Length=540

 Score =   143 bits (361),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 122/318 (38%), Positives = 168/318 (53%), Gaps = 70/318 (22%)
 Frame = +3

Query  87   MVKKLGANSWLTALKRVFIRYPSKDrksrhs-----krdeeeekkrdkgrrWLFSKT---  242
            M KK   +SWLTA+KR F R P+KD   R          EE+E+K+ + RRW+F KT   
Sbjct  1    MGKKGSGSSWLTAVKRAF-RSPTKDSDKRSGRRREDCDQEEDEEKKREKRRWIFRKTHMS  59

Query  243  ---ADENS-----------VGGVEIISRT-----------------------PPPSRRLL  311
                + NS           V      SRT                       P    R  
Sbjct  60   HEGVNNNSNHTTQQKVQHDVAASGGGSRTDQDQKHALAVAMAAAVEVARLSKPASHAREH  119

Query  312  CAATVIQTAFRCYLAKRALVALKGIVKLQALIRGQNVRRQARITLKCMQALFRVQERMRE  491
             AA VIQTAFR YLA+RAL ALKG+VKLQAL+RG NVR+QA++TL+CMQAL RVQ R+ +
Sbjct  120  FAAVVIQTAFRGYLARRALRALKGLVKLQALVRGHNVRKQAKMTLRCMQALVRVQARVLD  179

Query  492  QCARISQDSARKSMFSGSTNSWESKY---IRERKSIFRDHCSVGEAWRDCPPTLQELEVM  662
            Q  R S + +RKS FS + + W+S+Y   I +RKSI R+  S+ + W +   +++E++ M
Sbjct  180  QRIRSSLEGSRKSTFSDTASVWDSRYLQDISDRKSISREGSSIADDWDERHHSVEEVKAM  239

Query  663  LQAQK--AAFMRERCPSQAW----------SSDTDVVDGEEREK-------TTPLKQGKS  785
            L  +K  AA  R++  SQA+          SS  +  + EER K       T P  + + 
Sbjct  240  LMQRKEAAAMKRDKTLSQAFSEQIWRNGRTSSIGNEDELEERPKWLHRWMATKPW-ENRG  298

Query  786  RAPAIQRRNPVKSGEINV  839
            RA   Q R+P+K+ EI+ 
Sbjct  299  RASTDQ-RDPIKTVEIDT  315


 Score = 64.3 bits (155),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 49/110 (45%), Positives = 57/110 (52%), Gaps = 30/110 (27%)
 Frame = +3

Query  1041  PGYMAATESAKARLRSQSAPRQRPSTP-------AKRCLS------YSISVKNGEEGVEK  1181
             P YMAATESAKAR+RSQSAPRQRPSTP       AK+ LS      Y + V  G  G   
Sbjct  431   PNYMAATESAKARIRSQSAPRQRPSTPERDRVGSAKKRLSFPAPDPYGVGVSYGNYGHSL  490

Query  1182  RS--------------EYWCNNNNTERESV---GGEISPCSTTNSRWW*R  1280
             RS              E   N ++   ES+   GGE+SP ST + R W R
Sbjct  491   RSPSFKSVSGSHFGGLEQQSNYSSCYTESIGGGGGEVSPSSTGDLRRWLR  540



>ref|XP_009119671.1| PREDICTED: protein IQ-DOMAIN 1 [Brassica rapa]
Length=526

 Score =   143 bits (360),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 117/266 (44%), Positives = 154/266 (58%), Gaps = 54/266 (20%)
 Frame = +3

Query  87   MVKKLGANSWLTALKRVFIRYPSK-DrksrhskrdeeeekkrdkgrrWLFSKTADENSV-  260
            M KK G+ SWL+A+KR F R PSK +R   H K  EE+E+K+ + RRWLF K A ++S  
Sbjct  1    MGKKNGS-SWLSAVKRAF-RSPSKKERNDPHGKEIEEDEEKKREKRRWLFKKPATQDSPV  58

Query  261  --GGV------------------EIISRTPP-----PS--------------RRLLCA--  317
               GV                  E    TPP     PS              RR+  A  
Sbjct  59   KPSGVSPPPPPQESDNANSKTLPETAPTTPPNVGKSPSVTTSASPVAVPNVTRRIYYARE  118

Query  318  ---ATVIQTAFRCYLAKRALVALKGIVKLQALIRGQNVRRQARITLKCMQALFRVQERMR  488
               A VIQT+FR YLA+RAL ALKG+VKLQAL+RG NVR+QA++TL+CMQAL RVQ R+ 
Sbjct  119  NYAAVVIQTSFRGYLARRALRALKGLVKLQALVRGHNVRKQAKMTLRCMQALVRVQSRVL  178

Query  489  EQCARISQDSARKSMFSGSTN-SWESKY---IRERKSIFRDHCSVGEAWRDCPPTLQELE  656
            +Q  R+S D +RKS FS ST+  +ES+Y   I +R+S+ R+  SV E W D P T+ E++
Sbjct  179  DQRKRLSHDGSRKSAFSDSTHCGFESRYLQDISDRQSMSREGSSVPEDWDDRPHTIDEVK  238

Query  657  VMLQAQKAAFMRERCP--SQAWSSDT  728
             MLQ ++   +R      SQA+S  T
Sbjct  239  AMLQRRRDTALRHEKTNLSQAFSQQT  264


 Score = 55.5 bits (132),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 44/107 (41%), Positives = 56/107 (52%), Gaps = 31/107 (29%)
 Frame = +3

Query  1041  PGYMAATESAKARLRSQSAPRQRPSTP-------AKRCLSYSI-----------------  1148
             P YMA TESAKAR+RSQSAPRQRPSTP        K+ LS+ +                 
Sbjct  424   PNYMANTESAKARIRSQSAPRQRPSTPERDRVGLVKKRLSFPVPPQPEYDDINSLRSPSF  483

Query  1149  -SVKNGEEG--VEKRSEYWCNNNNTERESVGGEISPCSTTNSRWW*R  1280
              SV     G  +E++S Y    ++   ES G E+SP ST++ R W R
Sbjct  484   KSVAGSHFGALLEQQSNY----SSCCTESNGVEVSPASTSDYRNWLR  526



>ref|XP_006289081.1| hypothetical protein CARUB_v10002487mg [Capsella rubella]
 gb|EOA21979.1| hypothetical protein CARUB_v10002487mg [Capsella rubella]
Length=421

 Score =   141 bits (355),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 129/371 (35%), Positives = 182/371 (49%), Gaps = 72/371 (19%)
 Frame = +3

Query  270   EIIS-RTPPPSRRLLCAATVIQTAFRCYLAKRALVALKGIVKLQALIRGQNVRRQARITL  446
             EI+  +TPP   R  CAA +IQTAFR YL++RAL ALKGIVKLQAL+RG NVR QA++TL
Sbjct  84    EIVKLKTPPGFIRRHCAAIIIQTAFRGYLSRRALRALKGIVKLQALVRGNNVRNQAKLTL  143

Query  447   KCMQALFRVQERM----REQCARI-----------SQDSARKSMFSGSTNSWESKY----  569
             +C++AL RVQ+++    ++Q +R             Q++ R SMF+ S   W++K     
Sbjct  144   RCIKALVRVQDQVLNHHQQQRSRFLSSSSPTPSRNVQEARRNSMFAESNGFWDTKTYLQD  203

Query  570   IRERKSIFRD--HCSVGEAWRDCPPTLQELEVMLQAQ-KAAFMRERCPSQAWSSDTDVVD  740
             IR R+S+ RD   C+  E         +E E +LQ + + A  RE+  + A S+      
Sbjct  204   IRSRRSLSRDMSRCTNNEF------DSEETESILQKKLEIAIKREKAQALALSNQI----  253

Query  741   GEEREKTTPLKQGKSRAPAIQRRNPVKSGEINVRIRSLQHKSASSVQapatpspakpkpV  920
                            R+ + + ++     E+  R + L    A+               V
Sbjct  254   ---------------RSRSYRNQSAGDDRELLERTQWLDRWMAT------KQWDDTITNV  292

Query  921   RPTTSPGNLEKSHSTANTPRLCPTNRSA---SFAPRY--SISGISPGYMAATESAKARLR  1085
             R  T         S   TP  C  +RS    S +PR   S S   P YM+ATESAKA+ R
Sbjct  293   RDPTKTLEFTNQRSYPATPPSCRASRSVMVRSASPRIPCSPSSGQPNYMSATESAKAKAR  352

Query  1086  SQSAPRQRPSTPAKR-CLSYSISVK--------NGEEGVEKRSEYWCNNNNTERESVGGE  1238
             +QS PR+RP T  KR C +   S++        NG    +  S+Y C       +   G 
Sbjct  353   TQSTPRRRPVTAKKRLCYAEEESLRSPSFKSAYNGCLWGDHESDYSCCYG----DGFTGR  408

Query  1239  ISPCSTTNSRW  1271
             ISPCSTT+ RW
Sbjct  409   ISPCSTTDLRW  419



>emb|CAB40030.1| putative protein [Arabidopsis thaliana]
 emb|CAB81165.1| putative protein [Arabidopsis thaliana]
Length=407

 Score =   140 bits (354),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 151/456 (33%), Positives = 215/456 (47%), Gaps = 112/456 (25%)
 Frame = +3

Query  87    MVKKLGANSWLTALKRVFIRYPSKDrksrhskrdeeeekkrdkgrrWLFSKTADE--NSV  260
             M KK G  SW TA+K++    PSKD   +     E + K+++K   W+F KT  E  NSV
Sbjct  1     MAKKNGT-SWFTAVKKILWS-PSKDSDKKTHHHKETDIKRKEKKG-WIFRKTKLETTNSV  57

Query  261   -------------------------GGVEIISRTPPPSR-RLLCAATVIQTAFRCYLAKR  362
                                      G  EI+  T  P   R   AA +IQTAFR YL++R
Sbjct  58    LQHTVRTVEAEEKEKPPVIVSSVEEGVTEIVKLTATPGFIRRHWAAIIIQTAFRGYLSRR  117

Query  363   ALVALKGIVKLQALIRGQNVRRQARITLKCMQALFRVQERM----REQCARI--------  506
             AL ALKGIVKLQAL+RG NVR QA++TL+C++AL RVQ+++    ++Q +R+        
Sbjct  118   ALRALKGIVKLQALVRGNNVRNQAKLTLRCIKALVRVQDQVLNHHQQQRSRVLLSPPSRN  177

Query  507   -SQDSARKSMFSGSTNSWESKY----IRERKSIFRDHCSVGEAWRDCPPTLQELEVMLQA  671
              + ++ R SMF+ S   W++K     IR R+S+ RD       +       +E E++LQ 
Sbjct  178   YNIEARRNSMFAESNGFWDTKTYLQDIRSRRSLSRDMNRCNNEFYS-----EETELILQK  232

Query  672   Q-KAAFMRERCPSQAWS------SDTDVVDGEEREKTTPLKQGKSRAPAIQRRNPVKSGE  830
             + + A  RE+  + A S      S  +   G++RE      Q   R  A ++ +   +  
Sbjct  233   KLEIAIKREKAQALALSNQIRSRSSRNQSAGDDRE-LLERTQWLDRWMATKQWDDTITNS  291

Query  831   INVR--IRSLQHKSASSVQapatpspakpkpVRPTTSPGNLEKSHSTANTPRLCPTNRSA  1004
              NVR  I++L+  +    Q              P T P               C  +RS 
Sbjct  292   TNVRDPIKTLEAVTTHHHQRSY-----------PATPPS--------------CRASRS-  325

Query  1005  SFAPRYSISGISPGYMAATESAKARLRSQSAPRQRPSTPAKRCLSY-------SISVKNG  1163
                       + P YM+ATESAKA+ R+QS PR+RP T  KR L Y       S S K+ 
Sbjct  326   ----------VMPNYMSATESAKAKARTQSTPRRRPMTAKKR-LCYAEEESLRSPSFKSC  374

Query  1164  EEGVEKRSEYWCNNNNTERESVGGEISPCSTTNSRW  1271
               G +  S+Y C       +   G+ISPCSTT  RW
Sbjct  375   LWG-DHESDYSCCYG----DGFAGKISPCSTTELRW  405



>ref|XP_009134201.1| PREDICTED: protein IQ-DOMAIN 14 isoform X1 [Brassica rapa]
Length=433

 Score =   140 bits (354),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 149/469 (32%), Positives = 221/469 (47%), Gaps = 112/469 (24%)
 Frame = +3

Query  87    MVKKLGANSWLTALKRVFIRYPSKDrksrhskrdeeeekkrdkgrrWLFSKTADENS---  257
             M KK G  SWLT +K++    PSKD   +  K++ +  K++ + + W+F KT  EN+   
Sbjct  1     MAKKNG-TSWLTVVKKILWS-PSKDSDKKSYKKEADYNKQKKEKKGWIFRKTKVENTDSV  58

Query  258   ----------------VGGVEIISRTPPPSRRLLCAATVIQTAFRCYLAKRALVALKGIV  389
                             V  +  ++ TP   RR   AA +IQTAFR YLAKRA  ALKGIV
Sbjct  59    TDTIPKAEKEEKDKPAVAEIVKLTATPGFLRRHW-AAIIIQTAFRGYLAKRAFGALKGIV  117

Query  390   KLQALIRGQNVRRQARITLKCMQALFRVQE-------------------RMREQCARISQ  512
             KLQAL+RG NVR QA+ TL+C++AL RVQ+                        C  I  
Sbjct  118   KLQALVRGHNVRNQAKHTLRCIKALVRVQDQVLSHHHQQQQQRSRVLSSSPSSNCYDI--  175

Query  513   DSARKSMFSGSTNSWESKY----IRERKSIFRDHCSVGEAW----RDCPPTLQE-LEVML  665
             ++ R SMF+ S   W+SK     IR R+S+ RD       +     +   +LQ+ LE+ +
Sbjct  176   EARRNSMFAESNGFWDSKTYLQDIRSRRSLSRDMSRCTNEFVVNQEESQSSLQKRLEIAI  235

Query  666   QAQKAA--FMRERCPSQAWSSDTDVVDGEEREKTTPL------KQGKSRAPAIQRRNPVK  821
             + +KA    +  +  S+++ + +   D E  E+T  L      KQ  +       R+ VK
Sbjct  236   EREKAHALALSNQIRSRSYRNQSAGDDRELLERTKWLDRWMATKQWDNTITIPTTRDQVK  295

Query  822   SGEINVRIRSLQHKSASSVQapatpspakpkpVRPTTSPGNLEKSHSTANTPRLCPTNRS  1001
             + E++  I                           +T+  +  +S+    TP  C   R+
Sbjct  296   TLEMDTNI---------------------------STTTTHHHRSYPA--TPPSCRATRT  326

Query  1002  A---SFAPRYSISG----ISPGYMAATESAKARLRSQSAPRQRPSTPAKRCLSY------  1142
                 S +PR   S     + P YM+ATESAKA+ R+QS PR+RP  PAK+ L Y      
Sbjct  327   FGVRSASPRIPCSSPSSMVQPNYMSATESAKAKARTQSTPRRRPVIPAKKRLCYAEEGSL  386

Query  1143  ---SISVKNGEEGV---EKRSEYWCNNNNTERESVGGEISPCSTTNSRW  1271
                S S+K+   G    E  S+Y C       + + G++SPCST++ RW
Sbjct  387   SLRSPSLKSAYNGCLWGEHESDYSCCYG----DGLAGKVSPCSTSDLRW  431



>emb|CDX90766.1| BnaA03g24460D [Brassica napus]
Length=431

 Score =   140 bits (353),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 145/466 (31%), Positives = 221/466 (47%), Gaps = 108/466 (23%)
 Frame = +3

Query  87    MVKKLGANSWLTALKRVFIRYPSKDrksrhskrdeeeekkrdkgrrWLFSKTADENS---  257
             M KK G  SWLT +K++   +       + S + E +  K+ + + W+F KT  EN+   
Sbjct  1     MAKKNG-TSWLTVVKKIL--WSPSKDSDKKSYKKEADYNKKKEKKGWIFRKTKVENTDSV  57

Query  258   ----------------VGGVEIISRTPPPSRRLLCAATVIQTAFRCYLAKRALVALKGIV  389
                             V  +  ++ TP   RR   AA +IQTAFR YLAKRA  ALKGIV
Sbjct  58    TDTIPKAEKEEKDKPAVAEIVKLTATPGFLRRHW-AAIIIQTAFRGYLAKRAFGALKGIV  116

Query  390   KLQALIRGQNVRRQARITLKCMQALFRVQERM------REQCARI----------SQDSA  521
             KLQAL+RG NVR QA+ TL+C++AL RV +++      ++Q +R+            ++ 
Sbjct  117   KLQALVRGHNVRNQAKHTLRCIKALVRVHDQVLSHHHQQQQRSRVLSSSPSSNCYDIEAR  176

Query  522   RKSMFSGSTNSWESKY----IRERKSIFRDHCSVGEAW----RDCPPTLQE-LEVMLQAQ  674
             R SMF+ S   W+SK     IR R+S+ RD       +     +    LQ+ LE+ ++ +
Sbjct  177   RNSMFAESNGFWDSKTYLQDIRSRRSLSRDMSRCTNEFVVNQEESQSILQKRLEIAIERE  236

Query  675   KAA--FMRERCPSQAWSSDTDVVDGEEREKTTPL------KQGKSRAPAIQRRNPVKSGE  830
             KA    +  +  S+++ + +   D E  E+T  L      KQ  +       R+ VK+ E
Sbjct  237   KAHALALSNQIRSRSYRNQSAGDDRELLERTKWLDRWMATKQWDNTITIPTTRDQVKTLE  296

Query  831   INVRIRSLQHKSASSVQapatpspakpkpVRPTTSPGNLEKSHSTANTPRLCPTNRSA--  1004
             ++  I                           +T+  +  +S+    TP  C   R+   
Sbjct  297   MDTNI---------------------------STTTTHHHRSYPA--TPPSCRATRTFGV  327

Query  1005  -SFAPRYSISG----ISPGYMAATESAKARLRSQSAPRQRPSTPAKRCLSY---------  1142
              S +PR   S     + P YM+ATESAKA+ R+QS PR+RP  PAK+ L Y         
Sbjct  328   RSASPRIPCSSPSSMVQPNYMSATESAKAKARTQSTPRRRPVIPAKKRLCYAEEGSLSLR  387

Query  1143  SISVKNGEEGV---EKRSEYWCNNNNTERESVGGEISPCSTTNSRW  1271
             S S+K+   G    E  S+Y C       + + G++SPCST++ RW
Sbjct  388   SPSLKSAYNGCLWGEHESDYSCCYG----DGLAGKVSPCSTSDLRW  429



>ref|XP_003548183.1| PREDICTED: protein IQ-DOMAIN 1-like [Glycine max]
Length=550

 Score =   140 bits (354),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 90/206 (44%), Positives = 127/206 (62%), Gaps = 24/206 (12%)
 Frame = +3

Query  288  PPPSRRLLCAATVIQTAFRCYLAKRALVALKGIVKLQALIRGQNVRRQARITLKCMQALF  467
            P    R   AA VIQTAFR YLA+RAL ALKG+VKLQAL+RG NVR+QA++TL+CMQAL 
Sbjct  122  PASHAREHFAAVVIQTAFRGYLARRALRALKGLVKLQALVRGHNVRKQAKMTLRCMQALV  181

Query  468  RVQERMREQCARISQDSARKSMFSGSTNSWESKY---IRERKSIFRDHCSVGEAWRDCPP  638
            RVQ R+ +Q  R S + +RKS FS + + W+S+Y   I +RKSI R+  S+ + W +   
Sbjct  182  RVQARVLDQRIRSSLEGSRKSTFSDTASVWDSRYLQDISDRKSISREGSSIADDWDERHH  241

Query  639  TLQELEVMLQAQK--AAFMRERCPSQAW----------SSDTDVVDGEEREK-------T  761
            +++E++ ML  +K  AA  R++  SQA+          SS  +  + EER K       T
Sbjct  242  SVEEVKAMLMQRKEAAAMKRDKTLSQAFSEQIWRNGRTSSIGNEDELEERPKWLDRWMAT  301

Query  762  TPLKQGKSRAPAIQRRNPVKSGEINV  839
             P  + + RA   Q R+P+K+ EI+ 
Sbjct  302  KPW-ENRGRASTDQ-RDPIKTVEIDT  325


 Score = 64.7 bits (156),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 49/110 (45%), Positives = 57/110 (52%), Gaps = 30/110 (27%)
 Frame = +3

Query  1041  PGYMAATESAKARLRSQSAPRQRPSTP-------AKRCLS------YSISVKNGEEGVEK  1181
             P YMAATESAKAR+RSQSAPRQRPSTP       AK+ LS      Y + V  G  G   
Sbjct  441   PNYMAATESAKARIRSQSAPRQRPSTPERDRVGSAKKRLSFPAPDPYGVGVSYGNYGHSL  500

Query  1182  RS--------------EYWCNNNNTERESV---GGEISPCSTTNSRWW*R  1280
             RS              E   N ++   ES+   GGE+SP ST + R W R
Sbjct  501   RSPSFKSVSGSHFGGLEQQSNYSSCYTESIGGGGGEVSPSSTGDLRRWLR  550



>ref|XP_003529877.1| PREDICTED: protein IQ-DOMAIN 14-like [Glycine max]
Length=546

 Score =   140 bits (353),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 76/149 (51%), Positives = 104/149 (70%), Gaps = 5/149 (3%)
 Frame = +3

Query  288  PPPSRRLLCAATVIQTAFRCYLAKRALVALKGIVKLQALIRGQNVRRQARITLKCMQALF  467
            P    R   AA VIQTAFR YLA+RAL ALKG+VKLQAL+RG NVR+QA++TL+CMQAL 
Sbjct  120  PASHAREHYAAVVIQTAFRGYLARRALRALKGLVKLQALVRGHNVRKQAKMTLRCMQALV  179

Query  468  RVQERMREQCARISQDSARKSMFSGSTNSWESKY---IRERKSIFRDHCSVGEAWRDCPP  638
            RVQ R+ +Q  R S + +RKS FS + + W+S+Y   I +RKSI R+  S+ + W +   
Sbjct  180  RVQARVLDQRIRSSLEGSRKSTFSDTASVWDSRYLQDISDRKSISREGSSITDDWDERHH  239

Query  639  TLQELEVMLQAQK--AAFMRERCPSQAWS  719
            T++E++ ML  +K  AA  R++  SQA+S
Sbjct  240  TVEEVKAMLMQRKEAAAMKRDKTLSQAFS  268


 Score = 62.8 bits (151),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 48/108 (44%), Positives = 57/108 (53%), Gaps = 28/108 (26%)
 Frame = +3

Query  1041  PGYMAATESAKARLRSQSAPRQRPSTP-------AKRCLS------YSISVKNGEEGVEK  1181
             P YMAATESAKAR+RSQSAPRQRPSTP       AK+ LS      Y + V  G  G   
Sbjct  439   PNYMAATESAKARIRSQSAPRQRPSTPERDRVGSAKKRLSFPAPDPYGVGVSYGNYGHSL  498

Query  1182  RS--------------EYWCNNNNTERESV-GGEISPCSTTNSRWW*R  1280
             RS              E   N ++   ES+ GG++SP ST + R W R
Sbjct  499   RSPSFKSVSGSHFGGLEQQSNYSSCCTESIGGGQVSPSSTGDLRRWLR  546



>ref|XP_009134202.1| PREDICTED: protein IQ-DOMAIN 14 isoform X2 [Brassica rapa]
Length=432

 Score =   139 bits (349),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 146/469 (31%), Positives = 217/469 (46%), Gaps = 113/469 (24%)
 Frame = +3

Query  87    MVKKLGANSWLTALKRVFIRYPSKDrksrhskrdeeeekkrdkgrrWLFSKTADENS---  257
             M KK G  SWLT +K++   +       + S + E +  K+ + + W+F KT  EN+   
Sbjct  1     MAKKNG-TSWLTVVKKIL--WSPSKDSDKKSYKKEADYNKKKEKKGWIFRKTKVENTDSV  57

Query  258   ----------------VGGVEIISRTPPPSRRLLCAATVIQTAFRCYLAKRALVALKGIV  389
                             V  +  ++ TP   RR   AA +IQTAFR YLAKRA  ALKGIV
Sbjct  58    TDTIPKAEKEEKDKPAVAEIVKLTATPGFLRRHW-AAIIIQTAFRGYLAKRAFGALKGIV  116

Query  390   KLQALIRGQNVRRQARITLKCMQALFRVQE-------------------RMREQCARISQ  512
             KLQAL+RG NVR QA+ TL+C++AL RVQ+                        C  I  
Sbjct  117   KLQALVRGHNVRNQAKHTLRCIKALVRVQDQVLSHHHQQQQQRSRVLSSSPSSNCYDI--  174

Query  513   DSARKSMFSGSTNSWESKY----IRERKSIFRDHCSVGEAW----RDCPPTLQE-LEVML  665
             ++ R SMF+ S   W+SK     IR R+S+ RD       +     +   +LQ+ LE+ +
Sbjct  175   EARRNSMFAESNGFWDSKTYLQDIRSRRSLSRDMSRCTNEFVVNQEESQSSLQKRLEIAI  234

Query  666   QAQKAA--FMRERCPSQAWSSDTDVVDGEEREKTTPL------KQGKSRAPAIQRRNPVK  821
             + +KA    +  +  S+++ + +   D E  E+T  L      KQ  +       R+ VK
Sbjct  235   EREKAHALALSNQIRSRSYRNQSAGDDRELLERTKWLDRWMATKQWDNTITIPTTRDQVK  294

Query  822   SGEINVRIRSLQHKSASSVQapatpspakpkpVRPTTSPGNLEKSHSTANTPRLCPTNRS  1001
             + E++  I                           +T+  +  +S+    TP  C   R+
Sbjct  295   TLEMDTNI---------------------------STTTTHHHRSYPA--TPPSCRATRT  325

Query  1002  A---SFAPRYSISG----ISPGYMAATESAKARLRSQSAPRQRPSTPAKRCLSY------  1142
                 S +PR   S     + P YM+ATESAKA+ R+QS PR+RP  PAK+ L Y      
Sbjct  326   FGVRSASPRIPCSSPSSMVQPNYMSATESAKAKARTQSTPRRRPVIPAKKRLCYAEEGSL  385

Query  1143  ---SISVKNGEEGV---EKRSEYWCNNNNTERESVGGEISPCSTTNSRW  1271
                S S+K+   G    E  S+Y C       + + G++SPCST++ RW
Sbjct  386   SLRSPSLKSAYNGCLWGEHESDYSCCYG----DGLAGKVSPCSTSDLRW  430



>ref|NP_001117204.1| protein IQ-domain 18 [Arabidopsis thaliana]
 gb|AAF26462.1|AC007323_3 T25K16.10 [Arabidopsis thaliana]
 gb|AEE27239.1| protein IQ-domain 18 [Arabidopsis thaliana]
Length=527

 Score =   140 bits (352),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 69/130 (53%), Positives = 95/130 (73%), Gaps = 3/130 (2%)
 Frame = +3

Query  315  AATVIQTAFRCYLAKRALVALKGIVKLQALIRGQNVRRQARITLKCMQALFRVQERMREQ  494
            AA VIQT+FR YLA+RAL ALKG+VKLQAL+RG NVR+QA++TL+CMQAL RVQ R+ +Q
Sbjct  123  AAVVIQTSFRGYLARRALRALKGLVKLQALVRGHNVRKQAKMTLRCMQALVRVQSRVLDQ  182

Query  495  CARISQDSARKSMFSGSTNSWESKYIR---ERKSIFRDHCSVGEAWRDCPPTLQELEVML  665
              R+S D +RKS FS S   +ES+Y++   +R+S+ R+  S  E W D P T+  ++VML
Sbjct  183  RKRLSHDGSRKSAFSDSHAVFESRYLQDLSDRQSMSREGSSAAEDWDDRPHTIDAVKVML  242

Query  666  QAQKAAFMRE  695
            Q ++   +R 
Sbjct  243  QRRRDTALRH  252


 Score = 56.6 bits (135),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 45/107 (42%), Positives = 56/107 (52%), Gaps = 31/107 (29%)
 Frame = +3

Query  1041  PGYMAATESAKARLRSQSAPRQRPSTP-------AKRCLSYSI-----------------  1148
             P YMA+TESAKAR+RS SAPRQRPSTP        K+ LSY +                 
Sbjct  425   PNYMASTESAKARIRSHSAPRQRPSTPERDRAGLVKKRLSYPVPPPAEYEDNNSLRSPSF  484

Query  1149  -SVKNGEEG--VEKRSEYWCNNNNTERESVGGEISPCSTTNSRWW*R  1280
              SV     G  +E++S Y    ++   ES G EISP ST++ R W R
Sbjct  485   KSVAGSHFGGMLEQQSNY----SSCCTESNGVEISPASTSDFRNWLR  527



>ref|XP_006396335.1| hypothetical protein EUTSA_v10028557mg [Eutrema salsugineum]
 gb|ESQ37788.1| hypothetical protein EUTSA_v10028557mg [Eutrema salsugineum]
Length=550

 Score =   139 bits (351),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 68/129 (53%), Positives = 95/129 (74%), Gaps = 3/129 (2%)
 Frame = +3

Query  315  AATVIQTAFRCYLAKRALVALKGIVKLQALIRGQNVRRQARITLKCMQALFRVQERMREQ  494
            AA VIQT FR YLA+RAL ALKG+VKLQAL+RG NVR+QA++TL+CMQAL RVQ R+ +Q
Sbjct  133  AAIVIQTGFRGYLARRALRALKGLVKLQALVRGHNVRKQAKMTLRCMQALVRVQSRVLDQ  192

Query  495  CARISQDSARKSMFSGSTNSWESKY---IRERKSIFRDHCSVGEAWRDCPPTLQELEVML  665
              R+S D +RKS FS + +  ES+Y   I +R+S+ R+  S+ E W + P T++E++ ML
Sbjct  193  RKRLSHDGSRKSAFSDTHSVLESRYLQDISDRRSMSREGSSIAEDWDERPHTIEEVKAML  252

Query  666  QAQKAAFMR  692
            Q ++   +R
Sbjct  253  QQRRDTALR  261


 Score = 55.8 bits (133),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 46/117 (39%), Positives = 58/117 (50%), Gaps = 41/117 (35%)
 Frame = +3

Query  1041  PGYMAATESAKARLRSQSAPRQRPSTP-------AKRCLSYSI-----------------  1148
             P YMA TESAKAR+RSQSAPRQRPSTP       A++ LS+ +                 
Sbjct  438   PNYMAITESAKARIRSQSAPRQRPSTPEKDRTGSARKRLSFPVPPQPPVEVGGGYYGNSN  497

Query  1149  ----------SVKNGEEG-VEKRSEYW--CNNNNTERESVGGEISPCSTTNSRWW*R  1280
                       S+   + G +E++S Y   C    TE    GGEISP ST++ R W R
Sbjct  498   SQSLRSPSFKSIGGSQLGALEQQSNYSSCC----TESLGGGGEISPASTSDYRRWLR  550



>ref|XP_006846576.1| hypothetical protein AMTR_s00018p00247260 [Amborella trichopoda]
 gb|ERN08251.1| hypothetical protein AMTR_s00018p00247260 [Amborella trichopoda]
Length=473

 Score =   139 bits (350),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 135/403 (33%), Positives = 190/403 (47%), Gaps = 90/403 (22%)
 Frame = +3

Query  303   RLLCAATVIQTAFRCYLAKRALVALKGIVKLQALIRGQNVRRQARITLKCMQALFRVQER  482
             R   AA  IQTAFR YLA+RAL ALKG+V+LQAL+RG NVR++A +TL+CMQAL RVQ R
Sbjct  83    REYYAAIKIQTAFRGYLARRALRALKGLVRLQALVRGHNVRKKANMTLRCMQALVRVQSR  142

Query  483   MREQCARISQDSARKSMFSGSTNSWESKYIRERKSIFRDHCSVGEAWRDCPPTLQELEVM  662
             +R+Q  R++++    + F+   N WE+   +             + W D   T+QE+   
Sbjct  143   VRDQRLRLAEE----NRFTAR-NFWETTERKSISRDRSRSSITDD-WDDRRHTIQEIHAK  196

Query  663   LQAQK-AAFMRERC-----PSQAWSSDTD---VVDGEER---------EKTTPLKQGKSR  788
             LQ++K AA  RE+        Q W S  +   +V+GEE          E+   L+  +SR
Sbjct  197   LQSKKDAALKREKALAYAFSHQLWRSGRNPCPIVEGEEDMSNWSSNWLERWMALRPWESR  256

Query  789   APA-IQRRNPVKSGEINVRIRSLQHKSASSVQapatpspakpkpV-----RPTTSPGNLE  950
             + A    R+P+K+ E++++ RS    +    Q+     P     V     R      +L 
Sbjct  257   SRASTDHRDPIKTVEVDMQ-RSRSSATHEIYQSRKDQHPTSSCGVSSPLHRTHIHHSSLN  315

Query  951   KSHSTANTPRLCPTN-RSAS--------------FAPRYSISG--------ISPGYMAAT  1061
             +S  T ++ +  PT  RSAS              + P  + +G          P YMA T
Sbjct  316   QSPVTPSSSKTRPTQVRSASSRCTRTTEEEKNLVYTPASNYNGHYRTDYVQAVPNYMAPT  375

Query  1062  ESAKARLRSQSAPRQRPSTP-------AKRCLSYSI-----------------------S  1151
             ESAKARLRSQSAPRQRP TP        ++ LS+ +                       S
Sbjct  376   ESAKARLRSQSAPRQRPGTPERERGSSVRKRLSFPVPPNTYSALSSSGFSQSLRSPSFKS  435

Query  1152  VKNGEEGVEKRSEYWCNNNNTERESVGGEISPCSTTNSRWW*R  1280
             V  G  G +  +   C       ES  GE SP ST + R W R
Sbjct  436   VPPGALGFDHSNFSSCT------ESFAGETSPSSTGDLRRWLR  472



>ref|XP_004973025.1| PREDICTED: protein IQ-DOMAIN 14-like [Setaria italica]
Length=572

 Score =   139 bits (350),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 132/338 (39%), Positives = 179/338 (53%), Gaps = 68/338 (20%)
 Frame = +3

Query  315   AATVIQTAFRCYLAKRALVALKGIVKLQALIRGQNVRRQARITLKCMQALFRVQERMREQ  494
             AA  IQTAFR YLA+RAL AL+G+VKLQAL+RG NVR+QA +TL+CMQAL RVQ R+R+Q
Sbjct  148   AAVAIQTAFRGYLARRALRALRGLVKLQALVRGHNVRKQANMTLRCMQALVRVQARVRDQ  207

Query  495   CARISQDSARKSMFS----------GSTNS---------WESKYIR---ERKSI--FRDH  602
               R+SQDS   SM +          GS+ S         W+SKY     +R+S+   RD 
Sbjct  208   RMRLSQDSMSLSMSAAAAAAGAAPCGSSKSSYSVDTSTFWDSKYTHDYADRRSVERSRDG  267

Query  603   CS-VGEAWRDCPPTLQELEVMLQAQK-AAFMRERCPSQAWS----------SDTDVVDGE  746
              S   + W D P T++E++ +LQ +K AA  RER  S A+S          ++   VDG+
Sbjct  268   SSFAADDWDDRPRTIEEIQALLQTRKDAALKRERALSYAFSHQLWRNPAPAAEEMDVDGQ  327

Query  747   ----EREKTTPLKQGKSRA------------PAIQRRNPVKSGEINVRIRSLQH-----K  863
                 ER   +      SR+             ++  R PVK+ EI+   R L +     +
Sbjct  328   PRWAERWMASRASFDTSRSTIRGAAGAAPGRASMDHREPVKTLEIDT-ARPLSYSTPRRQ  386

Query  864   SASSVQapatpspakpkpVRPTTSPGNLEKS-HSTANTPRLC-PTNRSASFAP-----RY  1022
             + SS             PV P  SPG         + +PR+        S+ P     R+
Sbjct  387   APSSSPMHRAHHGHGHSPVTP--SPGKARPPIQVRSASPRVDRGGGGGGSYTPSLHSQRH  444

Query  1023  SISGISPGYMAATESAKARLRSQSAPRQRPSTPAKRCL  1136
             + +G+ P YMAATESAKAR+RSQSAPRQRP+TP +  L
Sbjct  445   AAAGV-PNYMAATESAKARVRSQSAPRQRPATPERDRL  481



>ref|XP_010662925.1| PREDICTED: protein IQ-DOMAIN 14 [Vitis vinifera]
Length=462

 Score =   136 bits (343),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 118/330 (36%), Positives = 162/330 (49%), Gaps = 51/330 (15%)
 Frame = +3

Query  276   ISRTPPPSRRLLCAATVIQTAFRCYLAKRALVALKGIVKLQALIRGQNVRRQARITLKCM  455
             ++R P    R  CAA VIQTAFR YLA++AL ALKG+VKLQAL+RG NVR++A+ TL+CM
Sbjct  120   LTRRPSIFVREHCAAIVIQTAFRGYLARKALRALKGLVKLQALVRGHNVRKRAKKTLRCM  179

Query  456   QALFRVQERMREQCARISQDSARK--SMFSGSTNSWESKYIRERKSIFRDHCSVGEAWRD  629
             QAL RVQ R+ +Q  R+S     K  S+FS  ++ WES  +  RKS+          W D
Sbjct  180   QALVRVQARVCDQRKRLSLSHEEKIDSIFSDPSSLWESNLL-NRKSM------SAWDWDD  232

Query  630   CPPTLQ-ELEVMLQAQKAAFMRERCPSQAWSSDTDVVDGEEREKTTPLKQGKSRAPAIQR  806
              P T + E E +  A      R     Q  +S+ ++ D   R               + R
Sbjct  233   HPHTKKREEEALAHAFAHQIWRSSRKDQYHASEGELEDKPRR---------------LDR  277

Query  807   RNPVKSGEINVRIRSLQHKSASSVQapatpspakpkpV--RP--------TTSPGNLE--  950
             R   K  E   R    Q +   +V+   +   +   P+  RP        T SP  ++  
Sbjct  278   RMVTKHWESTGRSSCDQREHIKTVEVDTSQPYSYSTPIFQRPFHQPPSPITPSPYKIKLF  337

Query  951   -------KSHSTANTPRLCPTNRSASFAPRYSISGISPGYMAATESAKARLRSQSAPRQR  1109
                    + HS A TP+L        ++   + +   P YMA+TESAKAR RSQSAPRQR
Sbjct  338   QAHSASPRCHSAAQTPKLGSIYYHGMWSSSSAGAAAMPNYMASTESAKARARSQSAPRQR  397

Query  1110  PSTP-------AKRCLSYSISVKNGEEGVE  1178
              STP       A++ LS+      G  G+E
Sbjct  398   ASTPERDRPGSARKRLSFPDPDPFGATGIE  427



>ref|XP_006397026.1| hypothetical protein EUTSA_v10028683mg [Eutrema salsugineum]
 gb|ESQ38479.1| hypothetical protein EUTSA_v10028683mg [Eutrema salsugineum]
Length=424

 Score =   135 bits (340),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 140/442 (32%), Positives = 206/442 (47%), Gaps = 67/442 (15%)
 Frame = +3

Query  87    MVKKLGANSWLTALKRVFIRYPSKDrksrhskrdeeeekkrdkgrrWLFSKTA--DENSV  260
             M KK G  SW TA+K++    P+KD   +  +++ +   K+ + + W+F KT     NSV
Sbjct  1     MAKKNGT-SWFTAVKKILWS-PTKDSDKKTHRKETDHYNKKKEKKGWIFRKTKLPTTNSV  58

Query  261   GGV------------------------EIISRTPPPSR-RLLCAATVIQTAFRCYLAKRA  365
              G                         EI+  T  P   R   AA +IQTAFR YLAK+A
Sbjct  59    TGTIPAAKTEEEDKPAVTISAVDKAVAEIVKLTATPDFIRRHWAAIIIQTAFRGYLAKKA  118

Query  366   LVALKGIVKLQALIRGQNVRRQARITLKCMQALFRVQERMREQCARISQDSARKSMFSGS  545
             L AL+GIVKLQAL+RG NVR QA++TL+C++AL RVQ+++     +  Q   R  + S S
Sbjct  119   LRALRGIVKLQALVRGNNVRNQAKLTLRCIKALVRVQDQVLNDHHQQQQQQQRSRVLSSS  178

Query  546   TNSWESKYIRERKSIFRDHCSVGEAWRDCPPTLQELEVMLQAQKAAFMRE--RCPSQAWS  719
               +        R S+F +    GE      P LQ++       + +  R+  RC ++  S
Sbjct  179   PTTNCYNIEARRNSMFAESNGFGER----KPYLQDIR-----SRRSLSRDMSRCTNEFNS  229

Query  720   SDTDVVDGEEREKTTPLKQGKSRAPAIQRRNPVKSGEINVRIRSLQHKSASSVQapatps  899
              +T+ +     E     ++ ++ A + Q R+     +     R L  ++    Q  AT  
Sbjct  230   EETESILQRRLEIAIMREKAQALALSNQIRSRSYRNQSVGDDRELLERTKWLDQWMATKQ  289

Query  900   pakpkpVRPTTSPGNLEKSHSTANTPRLCPTNRSA---SFAPRYSISG-----ISPGYMA  1055
                     P     NL++S+    TP  C   R+    S +PR   S      + P YM 
Sbjct  290   WDDSITKDPI---KNLDRSYPA--TPPSCRATRTFGVRSASPRIPCSSSPSSMVQPNYMT  344

Query  1056  ATESAKARLRSQSAPRQRPSTPAKRCLSY-------SISVKNGEEGV---EKRSEYWCNN  1205
             ATESAKA+ R+QS PR+RP    K+ L Y       S S K+   G    +  S+Y C  
Sbjct  345   ATESAKAKARTQSTPRRRPVGTVKKRLCYAEEDSLRSPSFKSAYNGCLWGDHESDYSCCY  404

Query  1206  NNTERESVGGEISPCSTTNSRW  1271
                  +   G+ISPCSTT+ RW
Sbjct  405   G----DGFAGKISPCSTTDLRW  422



>gb|EMT06896.1| hypothetical protein F775_20753 [Aegilops tauschii]
Length=331

 Score =   130 bits (328),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 89/201 (44%), Positives = 119/201 (59%), Gaps = 34/201 (17%)
 Frame = +3

Query  315  AATVIQTAFRCYLAKRALVALKGIVKLQALIRGQNVRRQARITLKCMQALFRVQERMREQ  494
            AA V+QTAFR YLA+RAL ALKG+VKLQAL+RG NVR+QA +TL+CMQAL RVQ R+R+Q
Sbjct  132  AAIVVQTAFRGYLARRALRALKGLVKLQALVRGHNVRKQANMTLRCMQALVRVQARVRDQ  191

Query  495  CARISQD----------SARKSMFSGSTNS-WESKYIR---ERKSI--FRDHCSV-GEAW  623
              R+SQ+           + KS +S  T++ W+SKY +   ER+S+   RD  S   E W
Sbjct  192  RMRLSQESLSAAGAAACGSSKSSYSVDTSAFWDSKYTQEYAERRSVERSRDGSSFAAEDW  251

Query  624  RDCPPTLQELEVMLQAQK-AAFMRERCPSQAWSSDTDVV---------DGEEREKTTPLK  773
             D P T++E++ MLQ +K AA  RER  S A+S    ++         D EER       
Sbjct  252  DDRPRTIEEIQAMLQTRKDAALKRERALSYAFSHQCSILLFAVVWLLKDLEERRAV----  307

Query  774  QGKSRAPAIQRRNPVKSGEIN  836
               SR    +RR     GE++
Sbjct  308  ---SRGGDERRRAAALGGEVD  325



>dbj|BAJ90163.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=546

 Score =   133 bits (335),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 81/157 (52%), Positives = 106/157 (68%), Gaps = 18/157 (11%)
 Frame = +3

Query  303  RLLCAATVIQTAFRCYLAKRALVALKGIVKLQALIRGQNVRRQARITLKCMQALFRVQER  482
            R   AA V+QTAFR YLA+RAL ALKG+VKLQAL+RG NVR+QA +TL+CMQAL RVQ R
Sbjct  128  REHYAAIVVQTAFRGYLARRALRALKGLVKLQALVRGHNVRKQANMTLRCMQALVRVQAR  187

Query  483  MREQCARISQDS----------ARKSMFSGSTNS-WESKYIR---ERKSI--FRDHCS-V  611
            +R+Q  R+SQ+S          + KS +S  T++ W+SKY +   ER+S+   RD  S  
Sbjct  188  VRDQRMRLSQESLSAAGAAGCGSSKSSYSVDTSALWDSKYTQEYAERRSVERSRDGSSFA  247

Query  612  GEAWRDCPPTLQELEVMLQAQK-AAFMRERCPSQAWS  719
             E W D P T++E++ MLQ +K AA  RER  S A+S
Sbjct  248  AEDWDDRPRTIEEIQAMLQTRKDAALKRERALSYAFS  284


 Score = 57.4 bits (137),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 49/124 (40%), Positives = 63/124 (51%), Gaps = 39/124 (31%)
 Frame = +3

Query  1017  RYSISG-ISPGYMAATESAKARLRSQSAPRQRPSTP----------------AKRCLSY-  1142
             R++ SG + P YMAATESAKAR+RSQSAPRQRP+TP                AK+ LS+ 
Sbjct  426   RHASSGSVVPNYMAATESAKARIRSQSAPRQRPATPERDRPQTAYNNPAGGSAKKRLSFP  485

Query  1143  -----------------SISVKNGEEGVEKRSEYWCNNNNTERESVGGE-ISPCSTTNSR  1268
                              S     G    E+RS     ++ +  ES+GGE +SP STT+ R
Sbjct  486   VPQDPYGVGYAQSLRSPSFKSATGRFTSEQRSTV---SSLSCAESIGGEPVSPSSTTDLR  542

Query  1269  WW*R  1280
              W R
Sbjct  543   RWLR  546



>ref|NP_001060851.1| Os08g0115200 [Oryza sativa Japonica Group]
 dbj|BAD10560.1| calmodulin-binding protein family-like [Oryza sativa Japonica 
Group]
 dbj|BAF22765.1| Os08g0115200 [Oryza sativa Japonica Group]
 gb|EAZ41306.1| hypothetical protein OsJ_25818 [Oryza sativa Japonica Group]
Length=543

 Score =   132 bits (331),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 78/160 (49%), Positives = 103/160 (64%), Gaps = 25/160 (16%)
 Frame = +3

Query  315  AATVIQTAFRCYLAKRALVALKGIVKLQALIRGQNVRRQARITLKCMQALFRVQERMREQ  494
            AA V+QTAFR YLA+RAL ALKG+VKLQAL+RG NVR+QA +TL+CMQAL RVQ R+R+Q
Sbjct  127  AAIVVQTAFRGYLARRALRALKGLVKLQALVRGHNVRKQANMTLRCMQALVRVQARVRDQ  186

Query  495  CARISQD--------------SARKSMFSGSTNS-WESKYIR-----ERKSIFRDH----  602
              R+SQD               + KS +S  T++ W+SKY       +R+SI R      
Sbjct  187  RMRLSQDSISLSAAAASAAPCGSSKSSYSVDTSTFWDSKYTHDFAAADRRSIERSRDGSS  246

Query  603  CSVGEAWRDCPPTLQELEVMLQAQK-AAFMRERCPSQAWS  719
             + G+ W D P T++E++ MLQ +K AA  RER  S A+S
Sbjct  247  FAAGDDWDDRPRTIEEIQAMLQTRKDAALKRERALSYAFS  286


 Score = 58.5 bits (140),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 45/113 (40%), Positives = 59/113 (52%), Gaps = 37/113 (33%)
 Frame = +3

Query  1041  PGYMAATESAKARLRSQSAPRQRPSTP---------------AKRCLSYSISVK------  1157
             P YMAATESAKAR+RSQSAPRQRP+TP               AK+ LS+ + +       
Sbjct  435   PNYMAATESAKARVRSQSAPRQRPATPERDRMSFGGGGGGGGAKKRLSFPVPIDPYGAYA  494

Query  1158  -----------NGEEGVEKRSEYWCNNNNTERESVGGEI-SPCSTTNSRWW*R  1280
                         G    E+RS    N +++  ES+GG++ SP STT+ R W R
Sbjct  495   QSLRSPSFKSAAGRFSSEQRS----NVSSSCAESLGGDVVSPSSTTDLRRWLR  543



>ref|XP_011044722.1| PREDICTED: protein IQ-DOMAIN 14-like isoform X1 [Populus euphratica]
Length=507

 Score =   130 bits (326),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 116/325 (36%), Positives = 157/325 (48%), Gaps = 53/325 (16%)
 Frame = +3

Query  288   PPPSRRLLCAATVIQTAFRCYLAKRALVALKGIVKLQALIRGQNVRRQARITLKCMQALF  467
             PP   +   AA  IQ AFR YLA+RA  ALKG+VK+QAL+RG NVR++A + L+CMQA+ 
Sbjct  128   PPLLAKQHFAAIAIQKAFRGYLARRARRALKGLVKMQALVRGHNVRKRANMILQCMQAMV  187

Query  468   RVQERMREQCARISQDSARKSMFSGSTNSWESKYIRERKSIFRDHCSVGEAWRDC----P  635
             RVQ R+ +     S + +  S+ S   + W S  + ERKS  RD  S  + W  C    P
Sbjct  188   RVQSRVLD-----SYEGSTNSVSSDQNSLWGSN-LSERKSTCRDASSTADDWVHCNNYKP  241

Query  636   PTLQELEVMLQAQK--AAFMRERCPSQAWSS-------DTDVVDGEEREKTTPLKQGKSR  788
              TL+E++ MLQ  K   A  RE+  + A+S        D+   +GE  E    L + ++R
Sbjct  242   KTLEEIQEMLQETKEVVALKREKALAYAFSQQIWKPGRDSYASEGEVEENPRWLDRWRTR  301

Query  789   APAIQR------------RNPVKSGE----------------INVRIRSLQHK--SASSV  878
                 +R            R+PVK+ E                 N +    QH+  S S  
Sbjct  302   KEWERRGSGALCDQLYHSRDPVKTVERDTSRPYSYSTPNAYNFNHQYHYQQHRPSSYSVA  361

Query  879   QapatpspakpkpVRPTTSPG-NLEKSHSTANTPRLCPTNRSASFAPRYSISGISPGYMA  1055
                        +PV P+ S    L + HS   +PR     R+         S   P YMA
Sbjct  362   SPLQKNHNTLSQPVTPSLSKTRTLLQVHSA--SPRCLGEGRNHVMEATNPSSASMPNYMA  419

Query  1056  ATESAKARL-RSQSAPRQRPSTPAK  1127
             AT SAKAR+ RSQSAPRQR STP +
Sbjct  420   ATASAKARIRRSQSAPRQRASTPER  444



>ref|XP_011012588.1| PREDICTED: protein IQ-DOMAIN 14-like isoform X1 [Populus euphratica]
Length=507

 Score =   129 bits (324),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 115/325 (35%), Positives = 157/325 (48%), Gaps = 53/325 (16%)
 Frame = +3

Query  288   PPPSRRLLCAATVIQTAFRCYLAKRALVALKGIVKLQALIRGQNVRRQARITLKCMQALF  467
             PP   +   AA  IQ AFR YLA+RA  ALKG+VK+QAL+RG NVR++A + L+CMQA+ 
Sbjct  128   PPLLAKQHFAAIAIQKAFRGYLARRARRALKGLVKMQALVRGHNVRKRANMILQCMQAMV  187

Query  468   RVQERMREQCARISQDSARKSMFSGSTNSWESKYIRERKSIFRDHCSVGEAWRDC----P  635
             RVQ R+ +     S + +  S+ S   + W S  + ERKS  RD  S  + W  C    P
Sbjct  188   RVQSRVLD-----SYEGSTNSISSDQNSLWGSN-LSERKSTCRDASSTADDWVHCNNYKP  241

Query  636   PTLQELEVMLQAQK--AAFMRERCPSQAWSS-------DTDVVDGEEREKTTPLKQGKSR  788
              TL+E++ MLQ  K   A  RE+  + A+S        D+   +GE  E    L + ++R
Sbjct  242   KTLEEIQEMLQETKEVVALKREKALAYAFSQQIWKPGRDSYASEGEVEENPRWLDRWRTR  301

Query  789   APAIQR------------RNPVKSGE----------------INVRIRSLQHK--SASSV  878
                 +R            R+PVK+ E                 N +    QH+  S S  
Sbjct  302   KEWERRGSGALCDQLYHSRDPVKTVERDTSRPYSYSTPNAYNFNHQYHYQQHRPSSYSVA  361

Query  879   QapatpspakpkpVRPTTSPG-NLEKSHSTANTPRLCPTNRSASFAPRYSISGISPGYMA  1055
                        +P+ P+ S    L + HS   +PR     R+         S   P YMA
Sbjct  362   SPLQKNHNTLSQPITPSLSKTRTLLQVHSA--SPRCLGEGRNHVMEATNPSSASMPNYMA  419

Query  1056  ATESAKARL-RSQSAPRQRPSTPAK  1127
             AT SAKAR+ RSQSAPRQR STP +
Sbjct  420   ATASAKARIRRSQSAPRQRASTPER  444



>ref|XP_010100212.1| Protein IQ-DOMAIN 14 [Morus notabilis]
 gb|EXB81883.1| Protein IQ-DOMAIN 14 [Morus notabilis]
Length=554

 Score =   129 bits (324),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 106/274 (39%), Positives = 142/274 (52%), Gaps = 63/274 (23%)
 Frame = +3

Query  87   MVKKLGANSWLTALKRVFIRYPSKDrksrh-----skrdeeeekkrdkgrrWLF------  233
            M KK G  SWLT +K+ F R P+KD + +         ++E+E K+ + RRWLF      
Sbjct  1    MAKKSGTTSWLTVVKKAF-RSPTKDSEKKSCRRRDENHEQEDEAKKREKRRWLFRRPVVH  59

Query  234  --------SKTADENSVGGVEIISR-----------------------------------  284
                    S T D +     + ISR                                   
Sbjct  60   VQQCEPKTSSTNDHDDHVETKDISRVYMVAADQQRHAIAVAAAAEAAAVTAQAAVEIARL  119

Query  285  TPPPSR--RLLCAATVIQTAFRCYLAKRALVALKGIVKLQALIRGQNVRRQARITLKCMQ  458
            T P S   R   A  VIQTAFR YLA+RAL ALKGIVKLQAL+RGQN+R+QA++TLKCMQ
Sbjct  120  TRPASNFVRQQYAVVVIQTAFRGYLARRALRALKGIVKLQALVRGQNMRKQAKLTLKCMQ  179

Query  459  ALFRVQERMREQCARISQDSARKSMFSGSTNSWESKYIRE----RKSIFRDHCSVGEAWR  626
            AL RVQ+R+  Q AR+S +  RKSM +      +S Y+ +    R S+ R+     E  R
Sbjct  180  ALVRVQDRVSHQRARLSLEGRRKSMLAEVNTLCDSAYLHDIRNRRVSLSRETSRCVEYDR  239

Query  627  -DCPPTLQELEVMLQAQK-AAFMRERCPSQAWSS  722
             DCP T +E+E  LQ++K AA  RE+  + A+S+
Sbjct  240  DDCPQTSEEIEAKLQSRKEAALKREKALAYAFSN  273



>ref|XP_008376803.1| PREDICTED: protein IQ-DOMAIN 14-like [Malus domestica]
Length=548

 Score =   129 bits (324),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 85/202 (42%), Positives = 118/202 (58%), Gaps = 27/202 (13%)
 Frame = +3

Query  315  AATVIQTAFRCYLAKRALVALKGIVKLQALIRGQNVRRQARITLKCMQALFRVQERMREQ  494
            AA VIQTAFR YLA+RAL ALKG+VKLQAL+RG NVR++A++TL+CMQAL RVQ R+ +Q
Sbjct  135  AAIVIQTAFRGYLARRALRALKGLVKLQALVRGHNVRKRAKMTLQCMQALVRVQARVLDQ  194

Query  495  -CARISQDSARKSMFSGSTNSWESKYIRERKSIFRD-HCSVGE---AWRDC-PPTLQELE  656
               R+S + +  S+FS  T  W S +   R+SI ++   S  +    W D  P TL++++
Sbjct  195  RTKRLSHEGSADSIFSDPTGLWGSHFSDRRESISKNKERSAADDLIHWDDVKPKTLEQIQ  254

Query  657  VMLQAQK-AAFMRERCPSQAW-----------SSDTDVVDGEEREKTTPLKQGKSR----  788
             MLQ  K AA  RER  S A+           S D D  + EE E+   L  G +R    
Sbjct  255  AMLQKTKQAALKRERSTSLAYAFSNQRWRSRGSGDEDAGEHEELEEKFDLLDGWTRRKQC  314

Query  789  -----APAIQRRNPVKSGEINV  839
                   +  +R+P+K+ EI+ 
Sbjct  315  EINGGRASCDQRDPIKTVEIDT  336



>ref|XP_008343811.1| PREDICTED: protein IQ-DOMAIN 14-like [Malus domestica]
 ref|XP_008343812.1| PREDICTED: protein IQ-DOMAIN 14-like [Malus domestica]
Length=544

 Score =   129 bits (323),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 117/333 (35%), Positives = 156/333 (47%), Gaps = 69/333 (21%)
 Frame = +3

Query  315   AATVIQTAFRCYLAKRALVALKGIVKLQALIRGQNVRRQARITLKCMQALFRVQERMREQ  494
             AA VIQTAFR  LA+RAL ALKG+VKLQAL+RG NVR++A++TL+CMQAL RVQ R+ +Q
Sbjct  130   AAIVIQTAFRGCLARRALRALKGLVKLQALVRGXNVRKRAKMTLQCMQALVRVQARVLDQ  189

Query  495   -CARISQDSARKSMFSGSTNSWESKYIRERKSIFRDHCSVGE----AWRDC-PPTLQELE  656
                R+S + +  S+FS       + +   RKSI +D  S        W +  P TL+++E
Sbjct  190   RTKRLSHEGSADSIFSDPNGLCGAHFSDRRKSISKDEESSALDDLIHWDNLKPKTLEQIE  249

Query  657   VMLQAQK-AAFMRERCPSQAWS----------SDTDVVDGEEREKTTPLKQGKSR-----  788
              MLQ  K AA   ER  S A++          SD D  + EE E+   L  G +R     
Sbjct  250   AMLQKTKQAALKSERSTSLAYAFSSQKLSSGSSDEDAXEHEELEEKFNLLDGWTRRRQRE  309

Query  789   ----APAIQRRNPVKSGEI--------------NVRIR-SLQHKSASSVQapatpspakp  911
                   +  +R+P+K+ EI              N RI+ S Q+   S            P
Sbjct  310   INPGRASFXQRDPIKTVEIDTSRPYSYSSTPNSNSRIKXSDQYNYQSHHLQYNYQQQRAP  369

Query  912   kpVRPTTSP-------------------------GNLEKSHSTANTPRLCPTNRSASFAP  1016
                 P  SP                         G+   +H     P   P     S   
Sbjct  370   PQSYPVASPQSPVTPFTSMARNLQVHSASPRCLRGDQRINHPMP--PPHTPNQNLGSTNY  427

Query  1017  RYSISGISPGYMAATESAKARLRSQSAPRQRPS  1115
              + + G+ P YMA T SAKAR+RSQS PRQR S
Sbjct  428   NHGLMGV-PNYMAXTASAKARIRSQSTPRQRHS  459



>ref|XP_002872530.1| IQ-domain 16 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH48789.1| IQ-domain 16 [Arabidopsis lyrata subsp. lyrata]
Length=427

 Score =   127 bits (319),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 142/457 (31%), Positives = 218/457 (48%), Gaps = 94/457 (21%)
 Frame = +3

Query  87    MVKKLGANSWLTALKRVFIRYPSKDrksrhskrdeeeekkrdkgrrWLFSKT--------  242
             M KK G  SW TA+K++    PSKD   +   ++ + +++++K   W+F KT        
Sbjct  1     MAKKNGT-SWFTAVKKILWS-PSKDSDKKTHHKETDYKQRKEKKG-WIFRKTKLETTNSL  57

Query  243   ------------------------ADENSVGGVEIISRTPPPSRRLLCAATVIQTAFRCY  350
                                     A +++V  +  ++ TP   RR   A  +IQTAFR Y
Sbjct  58    VKDSVRTVPTVEIDEEEKPTVTVSAVDDAVSEIVKLTATPGYIRRHWAAIIIIQTAFRGY  117

Query  351   LAKRALVALKGIVKLQALIRGQNVRRQARITLKCMQALFRVQERM----REQCARI----  506
             LA+RAL AL+GIVKLQAL+RG NVR QA++TL+C++AL RVQ+++    ++Q +R+    
Sbjct  118   LARRALRALRGIVKLQALVRGNNVRNQAKLTLRCIKALVRVQDQVLNHHQQQRSRLLASS  177

Query  507   -----SQDSARKSMFSGSTNSWESKY----IRERKSIFRDHCSVGEAWRDCPPTLQELEV  659
                  + ++ R SMF+ S   W++K     IR R+S+ RD       +       +E E+
Sbjct  178   PSSNCNMEARRNSMFAESNGFWDTKTYLQDIRSRRSLSRDMSRCNAEFNS-----EETEL  232

Query  660   MLQAQ-KAAFMRERCPSQAWSSDTDVVDGEEREKTTPLKQGKSRAPAIQRRNPVKSGEIN  836
             +LQ + + A  RE+  + A S+                     R+ + + ++     E+ 
Sbjct  233   ILQKKLEIAIKREKAQALALSNQI-------------------RSRSYRNQSAGDDRELL  273

Query  837   VRIRSLQHKSASSVQapatpspakpkpVRPTTSPGNLEKSHSTANTPRLCPTNRSA---S  1007
              R + L    A+        +     P++   +        S   TP  C T RS    S
Sbjct  274   ERTQWLDRWMATKQWDDTITNSTTRAPIKTFETVTTHHHQRSYPATPPSCRTLRSFAVRS  333

Query  1008  FAPRY--SISGISPGYMAATESAKARLRSQSAPRQRPSTPAKRCLSY-------SISVKN  1160
              +PR   S S + P YM+ATESAKA+ R+QS PR+RP   AK+ L Y       S S K+
Sbjct  334   ASPRIPCSPSSMQPNYMSATESAKAKARTQSTPRRRPVGTAKKRLCYADEDSLRSPSFKS  393

Query  1161  GEEGVEKRSEYWCNNNNTERESVGGEISPCSTTNSRW  1271
                G +  S+Y C       +   G+ISPCSTT  RW
Sbjct  394   CLWG-DHESDYSCCYG----DGFAGKISPCSTTELRW  425



>ref|XP_007221164.1| hypothetical protein PRUPE_ppa020552mg [Prunus persica]
 gb|EMJ22363.1| hypothetical protein PRUPE_ppa020552mg [Prunus persica]
Length=556

 Score =   128 bits (322),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 88/202 (44%), Positives = 118/202 (58%), Gaps = 27/202 (13%)
 Frame = +3

Query  315  AATVIQTAFRCYLAKRALVALKGIVKLQALIRGQNVRRQARITLKCMQALFRVQERMREQ  494
            AA VIQTAFR YLA+RAL ALKG+VKLQAL+RG NVR++ ++TLKCMQAL RVQ R+ +Q
Sbjct  136  AAIVIQTAFRGYLARRALRALKGLVKLQALVRGHNVRKRTKMTLKCMQALVRVQARVLDQ  195

Query  495  -CARISQDSARKSMFSGSTNSWESKYIRERKSIFRDHCS--VGE--AWRDC-PPTLQELE  656
               R+S + +  S+FS   + W S +   RKSI +D  S  V +   W D  P TL++++
Sbjct  196  RTKRLSYEGSADSIFSDPNSLWGSHFSDRRKSISKDEESGTVDDLIHWDDVHPKTLEQIQ  255

Query  657  VMLQAQK-AAFMRERC------PSQAW---SSDTDV-VDGEEREKTTPLKQG--------  779
             ML   K AA  RER        +Q W   S D DV  + EE E+   L  G        
Sbjct  256  AMLHKTKQAALKRERSTISCAFSNQKWKTGSGDQDVGHEHEELEEKFNLLDGWTRRKQCE  315

Query  780  --KSRAPAIQRRNPVKSGEINV  839
                RA   Q+R+P+K+ E++ 
Sbjct  316  NFAGRASCDQQRDPIKTVEMDT  337


 Score = 52.4 bits (124),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 48/120 (40%), Positives = 60/120 (50%), Gaps = 22/120 (18%)
 Frame = +3

Query  981   LCPTNRSASFAPRYSISGISPGYMAATESAKARLRSQSAPRQRPST-------PAKRCLS  1139
             L  TN +  F    S S + P YMAAT SAKARLRSQSAPRQR ST        A++ LS
Sbjct  439   LGSTNFNNGFVGVMSGSEV-PNYMAATASAKARLRSQSAPRQRHSTHDREKPGSARKRLS  497

Query  1140  YSISVKNGEEGVEKRSEYWCNNNN-------TERESV-----GGEISPCSTTN-SRWW*R  1280
             + +   NG      +S  + NN N         R S+      GE SP S+ +  R+W R
Sbjct  498   FPVP-DNGTSDSNLKSPRYNNNMNGGHAVRLEHRASMSSCFTDGETSPTSSGDLKRYWLR  556



>ref|XP_006374090.1| hypothetical protein POPTR_0015s00830g [Populus trichocarpa]
 gb|ERP51887.1| hypothetical protein POPTR_0015s00830g [Populus trichocarpa]
Length=492

 Score =   125 bits (314),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 112/323 (35%), Positives = 153/323 (47%), Gaps = 53/323 (16%)
 Frame = +3

Query  288   PPPSRRLLCAATVIQTAFRCYLAKRALVALKGIVKLQALIRGQNVRRQARITLKCMQALF  467
             PP   +   AA  IQ AFR YLA+RAL ALKG+VK+QAL+RG NVR++A + L+CMQ + 
Sbjct  103   PPLLAKQHFAAIAIQKAFRGYLARRALRALKGLVKMQALVRGHNVRKRANMILQCMQTMV  162

Query  468   RVQERMREQCARISQDSARKSMFSGSTNSWESKYIRERKSIFRDHCSVGEAWRDC----P  635
             RVQ R+ +     S + +  S+ S   + W S  + ERKS  RD  S  + W  C    P
Sbjct  163   RVQSRVLD-----SYEGSTNSISSDQNSLWGSN-LAERKSTCRDASSSADDWVHCNNYKP  216

Query  636   PTLQELEVMLQAQKAAFMRERCPSQAWSS-------DTDVVDGEEREKTTPLKQGKSRAP  794
              TL+E++   +    A  RE+  + A+S        D+   +GE  E    L   ++R  
Sbjct  217   KTLEEIQETKEV--VALKREKALAYAFSQQIWKPGRDSYASEGEVEENPRWLDTWRTRKE  274

Query  795   AIQR------------RNPVKS-----------------GEINVRIRSLQHK--SASSVQ  881
               +R            R+PVKS                  + N +    QH+  S S   
Sbjct  275   WERRGSGALCDQLYPSRDPVKSTVERDTSRPYSYSTPNAHKFNHQYHYQQHRPSSYSVAS  334

Query  882   apatpspakpkpVRPTTSPGN-LEKSHSTANTPRLCPTNRSASFAPRYSISGISPGYMAA  1058
                       +PV P+ S    L + HS   +PR     R+         S   P YMAA
Sbjct  335   PLQKNHNTLSQPVTPSLSKTRALLQVHSA--SPRCLGEGRNHVMEATNPSSASMPNYMAA  392

Query  1059  TESAKARLRSQSAPRQRPSTPAK  1127
             T SAKAR+RSQSAPRQR STP +
Sbjct  393   TASAKARIRSQSAPRQRASTPER  415



>ref|XP_008234658.1| PREDICTED: protein IQ-DOMAIN 14-like [Prunus mume]
Length=554

 Score =   126 bits (316),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 87/204 (43%), Positives = 121/204 (59%), Gaps = 29/204 (14%)
 Frame = +3

Query  315  AATVIQTAFRCYLAKRALVALKGIVKLQALIRGQNVRRQARITLKCMQALFRVQERMREQ  494
            AA VIQTAFR YLA+RAL ALKG+VKLQAL+RG NVR++A++TL+CMQAL RVQ R+ +Q
Sbjct  132  AAIVIQTAFRGYLARRALRALKGLVKLQALVRGHNVRKRAKMTLQCMQALVRVQARVLDQ  191

Query  495  -CARISQDSARKSMFSGSTNSWESKYIRERKSIFRDHCS--VGE--AWRDC-PPTLQELE  656
               R+S + +  S+FS   + W S +   R+SI +D  S  V +   W D  P TL++++
Sbjct  192  RTKRLSYEGSADSIFSDPNSLWGSHFSDRRESISKDEESGTVDDLIHWDDVHPKTLEQIQ  251

Query  657  VMLQAQK-AAFMRERC------PSQAW---SSDTDVVDGEEREKT----------TPLKQ  776
             ML   K AA  RER        +Q W   + D DV  G E E+           T  KQ
Sbjct  252  AMLHKTKQAALKRERSTISCAFSNQKWKTGNGDQDVNVGHEHEELEEKFNLLDGWTRRKQ  311

Query  777  GKS---RAPAIQRRNPVKSGEINV  839
             ++   RA   Q+R+P+K+ E++ 
Sbjct  312  CENFAGRASCDQQRDPIKTVEMDT  335


 Score = 52.4 bits (124),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 48/120 (40%), Positives = 60/120 (50%), Gaps = 22/120 (18%)
 Frame = +3

Query  981   LCPTNRSASFAPRYSISGISPGYMAATESAKARLRSQSAPRQRPST-------PAKRCLS  1139
             L  TN +  F    S S + P YMAAT SAKARLRSQSAPRQR ST        A++ LS
Sbjct  437   LGSTNYNNGFVGVMSGSEV-PNYMAATASAKARLRSQSAPRQRHSTHDREKPGSARKRLS  495

Query  1140  YSISVKNGEEGVEKRSEYWCNNNN-------TERESV-----GGEISPCSTTN-SRWW*R  1280
             + +   NG      +S  + NN N         R S+      GE SP S+ +  R+W R
Sbjct  496   FPVP-DNGTSDSNLKSPRYNNNMNGGHAVRLEHRASMSSCFTDGETSPTSSGDLKRYWLR  554



>ref|XP_004309097.1| PREDICTED: protein IQ-DOMAIN 14-like [Fragaria vesca subsp. vesca]
Length=526

 Score =   119 bits (297),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 111/301 (37%), Positives = 144/301 (48%), Gaps = 47/301 (16%)
 Frame = +3

Query  315   AATVIQTAFRCYLAKRALVALKGIVKLQALIRGQNVRRQARITLKCMQALFRVQERMREQ  494
             AA  IQTAFR YLA+RAL ALK +VKLQAL+RG NVR++A++TL+CMQAL RVQ R+ +Q
Sbjct  163   AAIAIQTAFRGYLARRALRALKALVKLQALVRGHNVRKRAKMTLQCMQALVRVQARVLDQ  222

Query  495   -CARISQDSARKSMFSGSTNSWESKYIRERKSIFRDHCSVGEAWRDC-PPTLQELEVMLQ  668
                R+S D +  SM   S     SK   E +S   D       W D  P TL+ ++ MLQ
Sbjct  223   RTKRLSHDGSLDSMSHFSDKKSISK---EEQSSTLDDDEDCVHWDDLQPKTLEHIQAMLQ  279

Query  669   AQK--AAFMRERCPSQAWSSDT---------DVVDGEEREKTTPLKQGKSRAPAIQRRNP  815
               K  AA  RER       S+T         D++DG  R K    +    RA   QR +P
Sbjct  280   KVKKAAASNRERTTLAYALSNTNQEELEEKFDMLDGWTRRK----QWENGRASYDQRADP  335

Query  816   -VKSGEINV-------RIRSLQHKSASSVQapatpspakpkpVRPTTSPGNLEKSHSTAN  971
              VK+ E++           +L+                  +   P  +P        +  
Sbjct  336   IVKTVEMDTSTPYFYSSTPNLKRPEYQYHCHQYQQQQRLHQYSYPVATP-------QSPT  388

Query  972   TP--RLCPTNRSASFAPRYSISGISPG----------YMAATESAKARLRSQSAPRQRPS  1115
             TP   L    +  S +P   I     G          YMAAT SAKAR+RSQSAPR RP+
Sbjct  389   TPFASLTRIAQVQSASPHCYIRETGHGNAMGGSEVPNYMAATASAKARIRSQSAPRHRPA  448

Query  1116  T  1118
             T
Sbjct  449   T  449



>ref|XP_010091181.1| Protein IQ-DOMAIN 14 [Morus notabilis]
 gb|EXB43108.1| Protein IQ-DOMAIN 14 [Morus notabilis]
Length=581

 Score =   119 bits (297),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 112/318 (35%), Positives = 151/318 (47%), Gaps = 71/318 (22%)
 Frame = +3

Query  315   AATVIQTAFRCYLAKRALVALKGIVKLQALIRGQNVRRQARITLKCMQALFRVQERMREQ  494
             +A  IQTAFR YLA+RAL ALKG+VKLQAL+RG NVR++A +TL+CMQA+ RVQ R+ +Q
Sbjct  149   SAIAIQTAFRGYLARRALRALKGLVKLQALVRGHNVRKRAEMTLQCMQAMLRVQARVLDQ  208

Query  495   --CARISQDSARKSMFSGSTNSWESKYIRERKSIFRDHCSVG-EAWRDCPPTLQELEVML  665
                 R+S +       S S N      +  RKS+ R+  S   E W D       +E +L
Sbjct  209   RIAKRLSYEGTSVDSLSRSPND----RVGIRKSLAREESSFNSEEWDD-------IEALL  257

Query  666   -QAQKAAFMRERCPSQAWSSDTDVVDGEEREKTTPLKQG------------KSRAPAIQR  806
              + ++AA  RE   S A+S      D E+ E + P  +G            K R    Q 
Sbjct  258   AKTREAALKRESALSHAFSHQMWRTDCEQAE-SEPDPEGWIRRSKQFSWESKGRTSCDQI  316

Query  807   RNPVKSGEINV--------------------------------RIRSLQHKSASSVQapa  890
               P+K+ EI+                                  + SL HKS  S    +
Sbjct  317   IEPIKTVEIDTYGPCSYSTPISQNRSQYYHHSSYQQQQSPHLYSLTSLAHKSHDS--NFS  374

Query  891   tpspakpkpVRPTTSPGNLEKSHSTANTPRLCPTNRSASF----APRYSISGISPGYMAA  1058
               SP    P RP  +  N+   H +  +PR   TN  A          + + ++P YMA+
Sbjct  375   LQSPFTQSPARPRNAHNNI---HQSVISPRF--TNARADIRNNNNNNNNNNPMTPNYMAS  429

Query  1059  TESAKARLRSQSAPRQRP  1112
             T S KARLRSQSAPRQRP
Sbjct  430   TASVKARLRSQSAPRQRP  447



>ref|XP_006362642.1| PREDICTED: uncharacterized protein LOC102594740 [Solanum tuberosum]
Length=714

 Score =   119 bits (298),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 117/345 (34%), Positives = 158/345 (46%), Gaps = 72/345 (21%)
 Frame = +3

Query  267   VEIISRTPPPSR-RLLCAATVIQTAFRCYLAKRALVALKGIVKLQALIRGQNVRRQARIT  443
             ++I   T PP   +  CA  VIQT FR YLA++AL ALKG+VKLQALIRG NVR++A+IT
Sbjct  369   IDITQLTQPPILVKQQCAILVIQTTFRGYLARKALGALKGVVKLQALIRGHNVRKRAQIT  428

Query  444   LKCMQALFRVQ-----ERMREQCARISQDSARK---SMFSGSTNSWESKYIRERKSIFRD  599
             L+CMQ+L RVQ     +R R  C  IS DS  K   S+     N  ES  I +      D
Sbjct  429   LQCMQSLVRVQNQVCDQRRRLSCEGISCDSMFKEPKSILELHLNDKESNSINQASIPDND  488

Query  600   HCSVGEAWRDCPPTLQELEVMLQ-AQKAAFMRERCPSQA-----WSSDTD----------  731
                      D    L+++E +L  A+ AA  RE   + A     W+S+ D          
Sbjct  489   -------GYDHLHALEKIEALLHKAKVAAKKRENTLAHAFSRKMWTSNKDEDSSSNTELD  541

Query  732   -------VVDGEEREKTTPLKQGKSRAPAIQRRNPVKSGEINV-----------------  839
                    V+D + R+ T       SRA   Q R+ +K+ EI+                  
Sbjct  542   EDLRVFDVIDEKNRKST-------SRASCDQPRDRIKNIEIDTACSYSNSDTEFWRLHHQ  594

Query  840   RIRSLQHKSASSVQapatpspakpkpVRPTTSPGNLEKSHSTANTPRL----CPTNRSAS  1007
                  Q K  SS   P+  S        P T P  ++     + +PR        +R A 
Sbjct  595   YYHDHQQKFYSSYVVPSPLSHRANINALPMTPPLKMKNIQVHSASPRYRREENNHHRMAL  654

Query  1008  FAPRYSISG-----ISPGYMAATESAKARLRSQSAPRQRPSTPAK  1127
              + R +++        P YMAAT SA+AR RSQS PRQ P TP +
Sbjct  655   LSHRANVNSSPTAVDQPSYMAATASARARERSQSTPRQIPMTPER  699



>gb|EMS51069.1| Protein IQ-DOMAIN 14 [Triticum urartu]
Length=444

 Score =   112 bits (281),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 90/229 (39%), Positives = 119/229 (52%), Gaps = 64/229 (28%)
 Frame = +3

Query  87   MVKKLGANSWLTALKRVFIRYPSKDrksrhskrdeeeekkrdkgrrWLFSKTADENSVGG  266
            M  K G +SWLTA+KR F R PSK+   + S R  E                ADE+    
Sbjct  1    MGNKKGGSSWLTAVKRAF-RSPSKEDSPKKSARLRE-------------DPDADEDK---  43

Query  267  VEIISRTPPPSRRLLCAATVIQTAFRCYLAKRALVALKGIVKLQALIRGQNVRRQARITL  446
                                         A+RAL ALKG+VKLQAL+RG NVR+QA +TL
Sbjct  44   -----------------------------ARRALRALKGLVKLQALVRGHNVRKQANMTL  74

Query  447  KCMQALFRVQERMREQCARISQD----------SARKSMFSGSTNS-WESKYIR---ERK  584
            +CMQAL RVQ R+R+Q  R+SQ+           + KS +S  T++ W+SKY +   ER+
Sbjct  75   RCMQALVRVQARVRDQRMRLSQESLSAAGAAACGSSKSSYSVDTSAFWDSKYTQEYAERR  134

Query  585  SI--FRDHCS-VGEAWRDCPPTLQELEVMLQAQK-AAFMRERCPSQAWS  719
            S+   RD  S   E W D P T++E++ MLQ +K AA  RER  S A+S
Sbjct  135  SVERSRDGSSFAAEDWDDRPRTIEEIQAMLQTRKDAALKRERALSYAFS  183


 Score = 55.5 bits (132),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 49/123 (40%), Positives = 62/123 (50%), Gaps = 38/123 (31%)
 Frame = +3

Query  1017  RYSISGIS-PGYMAATESAKARLRSQSAPRQRPSTP---------------AKRCLSY--  1142
             R++ SG + P YMAATESAKAR+RSQSAPRQRP+TP               AK+ L +  
Sbjct  325   RHASSGSAVPNYMAATESAKARIRSQSAPRQRPATPERDRPQTAYNPAGGSAKKRLGFPV  384

Query  1143  ----------------SISVKNGEEGVEKRSEYWCNNNNTERESVGGE-ISPCSTTNSRW  1271
                             S     G    E+RS     ++ +  ESVGGE +SP STT+ R 
Sbjct  385   PQDPYGVGYAQSLRSPSFKSATGRFTSEQRS---TVSSLSCAESVGGEPVSPSSTTDLRR  441

Query  1272  W*R  1280
             W R
Sbjct  442   WLR  444



>ref|XP_010424510.1| PREDICTED: protein IQ-DOMAIN 1-like [Camelina sativa]
Length=269

 Score =   109 bits (273),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 91/249 (37%), Positives = 135/249 (54%), Gaps = 54/249 (22%)
 Frame = +3

Query  87   MVKKLGANSWLTALKRVFIRYPSKDrksrhskrdeeeekkrdkgrrWLFSKTADE--NSV  260
            M KK G  SW TA+K++    PSKD   + + + E + KK +K   W+F KT  E  NSV
Sbjct  1    MAKKNGT-SWFTAVKKILW-SPSKDSDHKKTHKKETDYKKNEKKG-WIFRKTKLETTNSV  57

Query  261  ----------------------------GGVEIIS-RTPPPSRRLLCAATVIQTAFRCYL  353
                                           EI+  + PP   R  CAA VIQTAFR YL
Sbjct  58   VEDTVRKVLTVETVEEEKPAVNVSAVDEAVAEIVKLKAPPGFIRRHCAAIVIQTAFRGYL  117

Query  354  AKRALVALKGIVKLQALIRGQNVRRQARITLKCMQALFRVQERM---REQCARI------  506
            ++RAL AL+GIVKLQAL+RG NVR QA++TL+C++AL RVQ+++    +Q +R+      
Sbjct  118  SRRALRALRGIVKLQALVRGNNVRNQAKLTLRCIKALVRVQDQVLNHHQQRSRVLSSSPS  177

Query  507  ---SQDSARKSMFSGSTNSWESKY----IRERKSIFRD--HCSVGEAWRDCPPTL--QEL  653
               + ++ R SMF+ S   W++K     IR R+S+ RD   C+  E   +   ++  ++L
Sbjct  178  RNYNIEARRNSMFAESNGFWDTKTYLQDIRSRRSLSRDMSRCTNNEFDSEETESILQKKL  237

Query  654  EVMLQAQKA  680
            E+ ++ +KA
Sbjct  238  EIAIKREKA  246



>ref|XP_010327634.1| PREDICTED: protein IQ-DOMAIN 14-like [Solanum lycopersicum]
Length=506

 Score =   112 bits (281),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 109/330 (33%), Positives = 157/330 (48%), Gaps = 56/330 (17%)
 Frame = +3

Query  288   PPPSRRLLCAATVIQTAFRCYLAKRALVALKGIVKLQALIRGQNVRRQARITLKCMQALF  467
             PP   +  CA  +IQT FR YLA++AL ALKG+VKLQALIRG NVR++A+ITL+CMQ+L 
Sbjct  168   PPILVKQQCAILIIQTTFRGYLARKALGALKGVVKLQALIRGHNVRKRAQITLQCMQSLV  227

Query  468   RVQERMREQCARISQDSAR-KSMFSGSTNSWESKYIRERKSIFRDHCSVGEAW------R  626
             RVQ ++ +Q  R+S +     SMF       E K I E     ++  S+ +A+       
Sbjct  228   RVQTQVCDQRRRLSCEGISCGSMFK------EPKSILELHLNDKESNSMNQAYIPDKDGY  281

Query  627   DCPPTLQELEVMLQ-AQKAAFMRERCPSQA-----WSSDTDVVDGEEREKTTPL------  770
             D    L+++E +L  A++A   RE   + A     W+S+ D       E    L      
Sbjct  282   DHLHALEKIEALLHKAKEATKKRENTLAHAFSRKMWTSNKDEDSSYNAELDEDLRVFDLI  341

Query  771   ----KQGKSRAPAIQRRNPVKSGEINV-----------------RIRSLQHKSASSVQap  887
                 ++  SRA   Q R+ +K+ EI+                    R  Q K  SS   P
Sbjct  342   DEKNRKSISRASCDQPRDRIKNIEIDTACSYSDSDTEFWRLHHQYYRDHQQKFYSSYVVP  401

Query  888   atpspakpkpVRPTTSPGNLEKSHSTANTPRL-----CPTNRSASFAPRYSI-----SGI  1037
             +  S  +       T P  ++     + +PR         +R A  + R ++     +  
Sbjct  402   SPLSHREDINGLLMTPPLKMKNIQVHSASPRYRREEKSHHHRMALLSHRANVNSSPTAAD  461

Query  1038  SPGYMAATESAKARLRSQSAPRQRPSTPAK  1127
              P YMAAT SA+AR RSQS PRQ P TP +
Sbjct  462   QPSYMAATASARARERSQSTPRQIPMTPER  491



>ref|XP_010424511.1| PREDICTED: protein IQ-DOMAIN 1-like [Camelina sativa]
Length=375

 Score =   108 bits (270),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 123/390 (32%), Positives = 180/390 (46%), Gaps = 104/390 (27%)
 Frame = +3

Query  87    MVKKLGANSWLTALKRVFIRYPSKDrksrhskrdeeeekkrdkgrrWLFSKTADENSVGG  266
             M KK G  SW TA+K++    PSKD   + + + E + KK +K   W+F KT  E +   
Sbjct  1     MAKKNGT-SWFTAVKKILWS-PSKDSDHKKTHKKETDYKKNEKKG-WIFRKTKLETTNSV  57

Query  267   VEIISR-------------------------------TPPPSRRLLCAATVIQTAFRCYL  353
             VE   R                                PP   R  CAA VIQTAFR YL
Sbjct  58    VEDTVRKVLTVETVEEEKPAVNVSAVDEAVAEIVKLKAPPGFIRRHCAAIVIQTAFRGYL  117

Query  354   AKRALVALKGIVKLQALIRGQNVRRQARITLKCMQALFRVQERM---REQCARI------  506
             ++RAL AL+GIVKLQAL+RG NVR QA++TL+C++AL RVQ+++    +Q +R+      
Sbjct  118   SRRALRALRGIVKLQALVRGNNVRNQAKLTLRCIKALVRVQDQVLNHHQQRSRVLSSSPS  177

Query  507   ---SQDSARKSMFSGSTNSWESKY----IRERKSIFRD--HCSVGEAWRDCPPTLQELEV  659
                + ++ R SMF+ S   W++K     IR R+S+ RD   C+  E         +E E 
Sbjct  178   RNYNIEARRNSMFAESNGFWDTKTYLQDIRSRRSLSRDMSRCTNNEF------DSEETES  231

Query  660   MLQAQ-KAAFMRERCPSQAWSS--------DTDVVDGEEREKTTPLKQGKSRAPAIQRRN  812
             +LQ + + A  RE+  + A S+        +    D E  E+T    Q   R  A ++ +
Sbjct  232   ILQKKLEIAIKREKAQALALSNQIRSRSYRNQSAGDDELLERT----QWLDRWMATKQWD  287

Query  813   PVKSGEINVR--IRSLQHKSASSVQapatpspakpkpVRPTTSPGNLEKSHSTANTPRLC  986
                +   NVR  I++L+  +    ++             PTT P               C
Sbjct  288   DTITNSTNVRDQIKTLELNTHHHQRSY------------PTTPPS--------------C  321

Query  987   PTNRSA---SFAPRY--SISGISPGYMAAT  1061
               +RS    S +PR   S S + P YM+AT
Sbjct  322   RASRSVMVRSASPRIPCSPSSVQPNYMSAT  351



>ref|XP_011075903.1| PREDICTED: protein IQ-DOMAIN 14 [Sesamum indicum]
 ref|XP_011075905.1| PREDICTED: protein IQ-DOMAIN 14 [Sesamum indicum]
Length=505

 Score =   109 bits (272),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 110/349 (32%), Positives = 162/349 (46%), Gaps = 81/349 (23%)
 Frame = +3

Query  315   AATVIQTAFRCYLAKRALVALKGIVKLQALIRGQNVRRQARITLKCMQALFRVQERMREQ  494
             AA VIQT FR YLA+RAL+ALKG+VKLQALIRG NVRR+A++TL+C+Q+L RVQ ++ +Q
Sbjct  143   AAVVIQTIFRGYLARRALLALKGVVKLQALIRGHNVRRRAKMTLQCIQSLVRVQAQVCDQ  202

Query  495   CARIS-QDSARKSMFSGSTNSWESKYIRERKSIFRDHCSVGEAWRDCPPTLQELEVMLQA  671
               R+S + ++  SMF  +  S        RKS  R+  S          TL+E+E +++ 
Sbjct  203   RRRLSCEATSPGSMFRQANVS--------RKSTSRNMSS----------TLEEIESLIEK  244

Query  672   QKAAFMRER------CPSQAWSSDTDVVDGEEREKTTPLKQGKSR----------APAIQ  803
              K   ++           Q W+SD D +     +      +G  R               
Sbjct  245   AKECSLKHGKTLAHVLSQQMWTSDEDQISDNNCQGLEEEHRGSGRKVIYPWFRKDGNLCN  304

Query  804   RRNPVKSGEINV-RIRSLQHKSASSVQapatpspakpkpVRPTTSPGNLEKSHSTANTPR  980
             +R PVK+ EI++ R  S    ++  ++        +        SP + +  +   ++P+
Sbjct  305   QRIPVKTVEIDISRPYSFTSPNSYKLRDHHQNDHEQCLDSYVVRSPLHGKHQNLCVHSPK  364

Query  981   L-----------------------------CPTNRSASFAPRYSISGIS-----PGYMAA  1058
                                            PT  S  F  R SIS  S     P YMAA
Sbjct  365   TPSSSKIKPVQVHSRSPSYQMEERNYQTAETPTPHSIYFH-RMSISENSCPLPRPNYMAA  423

Query  1059  TESAKARLRSQSAPRQRP-STP-------AKRCLSYSISVKNGEEGVEK  1181
             T SA AR+RS S+PRQR  S+P       AK+ LS+ ++  +G  G  K
Sbjct  424   TASAIARVRSHSSPRQRTFSSPSREQTGSAKKRLSFPVA--DGHNGDNK  470



>ref|XP_008677708.1| PREDICTED: uncharacterized protein LOC100501224 isoform X1 [Zea 
mays]
 gb|AFW61388.1| hypothetical protein ZEAMMB73_252988 [Zea mays]
Length=544

 Score =   107 bits (268),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 78/169 (46%), Positives = 106/169 (63%), Gaps = 25/169 (15%)
 Frame = +3

Query  288  PPPSRRLLCAATVIQTAFRCYLAKRALVALKGIVKLQALIRGQNVRRQARITLKCMQALF  467
            P  +RR   AA  IQTAFR YLA+RAL AL+G+VKLQAL+RG NVR+QA +TL+CMQAL 
Sbjct  116  PSFARRDHHAAVAIQTAFRGYLARRALRALRGLVKLQALVRGHNVRKQANMTLRCMQALV  175

Query  468  RVQERMREQCARISQDS-----------------ARKSMFSGSTNS-WESKYIR---ERK  584
            RVQ R+R++  R+SQ+S                 + KS +S  T++ W+ KY     +R+
Sbjct  176  RVQARVRDRRMRLSQESVLSMSGGGGGAGAAPCGSSKSSYSVDTSAFWDPKYAHDYADRR  235

Query  585  SI--FRDHCS-VGEAWRDCPPTLQELEVMLQAQK-AAFMRERCPSQAWS  719
            S+   RD  S   + W D P T++E++ MLQ +K AA  RER  S A+S
Sbjct  236  SVERSRDGSSFAADDWDDRPRTIEEIQAMLQTRKDAALKRERALSYAFS  284


 Score = 52.4 bits (124),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 28/47 (60%), Positives = 35/47 (74%), Gaps = 7/47 (15%)
 Frame = +3

Query  1041  PGYMAATESAKARLRSQSAPRQRPSTP-------AKRCLSYSISVKN  1160
             P YMAATESAKAR+RSQSAPRQRP+TP       AK+ LS+   +++
Sbjct  436   PNYMAATESAKARVRSQSAPRQRPATPERERDRGAKKRLSFPAQLQH  482



>ref|XP_009620735.1| PREDICTED: protein IQ-DOMAIN 14-like [Nicotiana tomentosiformis]
Length=482

 Score =   107 bits (266),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 107/333 (32%), Positives = 163/333 (49%), Gaps = 69/333 (21%)
 Frame = +3

Query  327   IQTAFRCYLAKRALVALKGIVKLQALIRGQNVRRQARITLKCMQALFRVQERMREQCARI  506
             IQTAFR YLA++AL ALKG+VKLQALIRG NVR++A++TL+CMQ+L RVQ ++ +Q  R+
Sbjct  144   IQTAFRGYLARKALRALKGLVKLQALIRGHNVRKRAKMTLQCMQSLVRVQTQVCDQRRRL  203

Query  507   SQDSARKSMFSGSTNSWESKYIRERKSIFRDHCS---------VGEAWRDCPPTLQELEV  659
             S +     +  GST        RE KSI   H S         V + + D    ++++E 
Sbjct  204   SCE----GISCGST-------FREAKSILELHLSDTSKNQVSTVDDRY-DHSHAIEKVEA  251

Query  660   MLQAQK-AAFMRERCPSQAWSS-------DTDVVDGEEREKT------TPLKQGK--SRA  791
             +LQ +K AA  RE   + A+S        D D    +E ++       T ++  +  SRA
Sbjct  252   LLQKEKEAAKQRENTLAFAFSQKMWTANKDEDTSSNKELDEDMRVFHKTDVRNCRTLSRA  311

Query  792   PAIQRRNPVKSGEINV---------------------RIRSLQHKSASSVQapatpspak  908
                Q R+ +K+ E++                      + + L   +  +       +   
Sbjct  312   SCDQPRDRMKNIEVDTTCSYSDSDSDFWRLQNQFYQDQQQKLCSYAVPAPFRRVQQNLPI  371

Query  909   pkpVRPTTSPGNLEKSHSTANTPRLCPTNRSASFAPRYSISGISPGYMAATESAKARLRS  1088
                + PT+   N++   ++    R   ++R   F+ R +     P YMAAT SAKAR RS
Sbjct  372   HSSITPTSKMKNIQVHSASPRCRREERSHRMTLFSHRAN----EPNYMAATASAKARERS  427

Query  1089  QSAPRQRPSTP-------AKRCLSYSISVKNGE  1166
             QSAPR+ P TP       AK+ LS+ +   + E
Sbjct  428   QSAPRRMPLTPEREKTSAAKKRLSFPVQGTSNE  460



>gb|KDO83248.1| hypothetical protein CISIN_1g012650mg [Citrus sinensis]
Length=459

 Score =   106 bits (265),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 103/304 (34%), Positives = 139/304 (46%), Gaps = 68/304 (22%)
 Frame = +3

Query  315   AATVIQTAFRCYLAKRALVALKGIVKLQALIRGQNVRRQARITLKCMQALFRVQERMREQ  494
             AAT IQ+ FR YLA++AL ALKGIVKLQALIRG+NVRRQA  TLKC+Q++  +Q      
Sbjct  128   AATRIQSIFRGYLARKALRALKGIVKLQALIRGRNVRRQAFTTLKCLQSIVNIQ------  181

Query  495   CARISQDSARKSMFSGSTNSWESKYIRE-RKSIFRDHCSVGEAWRDCPPTLQELEVMLQA  671
                 SQ  A++   +GS +  E+K ++  R  I +   S    W D   T QE + M  +
Sbjct  182   ----SQVCAKRCQKAGSWHCDENKQLQTLRDKIIKMDSSCQRRWDDSTLTKQEADAMFLS  237

Query  672   QK-AAFMRERCPSQAWSS-----------------------DTDVVDGEEREKTTPLKQG  779
             +K AA  RER    A+S                        DT V+  +E E    +   
Sbjct  238   KKEAAIRRERIKEYAFSHRKSADSEQNKVNGRWRYWLEQWVDTQVMKSKELEDLDSIWTT  297

Query  780   KSRAPAIQRRNPVKSGEINVRIRSLQHKSASSVQapatpspakpkpVRPTTSPGNLEKS-  956
              +  P   R   +  G   +R+++LQ K                  +    SP    +  
Sbjct  298   ANGNP---REEYIGKG---LRLKNLQTK----------------YHIDGLDSPVLFSRRS  335

Query  957   -HSTANTPRLCPTNRSASFAPRYSISGISPGYMAATESAKARLRSQSAPRQRPSTPAKRC  1133
              H   N+          SFA     S + P YMAATESAKA+ RS S+P+ RP T     
Sbjct  336   LHRKQNS-----LGDEKSFAS----SPVVPTYMAATESAKAKARSMSSPKIRPGTFDSYS  386

Query  1134  LSYS  1145
              SYS
Sbjct  387   ESYS  390



>gb|KDO83249.1| hypothetical protein CISIN_1g012650mg [Citrus sinensis]
Length=458

 Score =   106 bits (265),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 103/304 (34%), Positives = 139/304 (46%), Gaps = 68/304 (22%)
 Frame = +3

Query  315   AATVIQTAFRCYLAKRALVALKGIVKLQALIRGQNVRRQARITLKCMQALFRVQERMREQ  494
             AAT IQ+ FR YLA++AL ALKGIVKLQALIRG+NVRRQA  TLKC+Q++  +Q      
Sbjct  127   AATRIQSIFRGYLARKALRALKGIVKLQALIRGRNVRRQAFTTLKCLQSIVNIQ------  180

Query  495   CARISQDSARKSMFSGSTNSWESKYIRE-RKSIFRDHCSVGEAWRDCPPTLQELEVMLQA  671
                 SQ  A++   +GS +  E+K ++  R  I +   S    W D   T QE + M  +
Sbjct  181   ----SQVCAKRCQKAGSWHCDENKQLQTLRDKIIKMDSSCQRRWDDSTLTKQEADAMFLS  236

Query  672   QK-AAFMRERCPSQAWSS-----------------------DTDVVDGEEREKTTPLKQG  779
             +K AA  RER    A+S                        DT V+  +E E    +   
Sbjct  237   KKEAAIRRERIKEYAFSHRKSADSEQNKVNGRWRYWLEQWVDTQVMKSKELEDLDSIWTT  296

Query  780   KSRAPAIQRRNPVKSGEINVRIRSLQHKSASSVQapatpspakpkpVRPTTSPGNLEKS-  956
              +  P   R   +  G   +R+++LQ K                  +    SP    +  
Sbjct  297   ANGNP---REEYIGKG---LRLKNLQTK----------------YHIDGLDSPVLFSRRS  334

Query  957   -HSTANTPRLCPTNRSASFAPRYSISGISPGYMAATESAKARLRSQSAPRQRPSTPAKRC  1133
              H   N+          SFA     S + P YMAATESAKA+ RS S+P+ RP T     
Sbjct  335   LHRKQNS-----LGDEKSFAS----SPVVPTYMAATESAKAKARSMSSPKIRPGTFDSYS  385

Query  1134  LSYS  1145
              SYS
Sbjct  386   ESYS  389



>ref|XP_010556621.1| PREDICTED: LOW QUALITY PROTEIN: protein IQ-DOMAIN 1 [Tarenaya 
hassleriana]
Length=362

 Score =   103 bits (258),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 110/368 (30%), Positives = 163/368 (44%), Gaps = 93/368 (25%)
 Frame = +3

Query  438   ITLKCMQALFRVQERMREQCARISQDSARKSMFSGSTNSWESKY---IRERKSIFRDHCS  608
             +TL+CMQAL RVQ R+ +Q  R+S D +RKS FS + + ++S+Y   I + KS+ R+  S
Sbjct  1     MTLRCMQALVRVQARVLDQRKRLSHDGSRKSAFSDTHSVFDSRYFPDISDGKSMSREGSS  60

Query  609   VGEAWRDCPPTLQELEVMLQAQK--------AAFMRERCPSQAWSSDTDVVDGEEREK--  758
             + E W + P T++E++ MLQ ++         AF ++   S    S  +  + EER K  
Sbjct  61    IAEDWDERPHTIEEVKAMLQQRRDTNCRXLSHAFSQQMWRSGGSQSAGEYYEPEERPKWL  120

Query  759   -----TTPLKQGKSRAPAIQRRNPVKSGEIN-------------VRIRSLQHKSASSVQa  884
                  + P    ++RA +  +R PVK+ E++              R R+  H   +   +
Sbjct  121   DRWMASRPW-DNRARA-STDQRVPVKTVEMDTSQPYSYLAAPSYTRPRTPSHSHPNQRPS  178

Query  885   patpspakpkpVRPTT-SPGNLEKSHSTANTPRLCPTNRSASFA-------PRYSISGIS  1040
               + +        P T SP         + +PR    +RS  +          YS +  S
Sbjct  179   SPSRTSHHHHHQLPATPSPAKSRPMQVRSASPRCQRDDRSYQYTSNTPSLRSNYSFTSRS  238

Query  1041  --------------PGYMAATESAKARLRSQSAPRQRPSTP--------AKRCLSYSISV  1154
                           P YMA TESAKAR+RSQSAPR RPSTP        A++ LS+ +  
Sbjct  239   GCSTTLSTSATATLPNYMATTESAKARIRSQSAPRPRPSTPEKDRAGSAARKRLSFPVPQ  298

Query  1155  KNGEEGVEKRSEYWCNNNNTER--------------------------ESVGGEISPCST  1256
                  G      Y  NNN + R                          ES+GGEISP ST
Sbjct  299   PPEHSG----GHYGNNNNYSLRSPSFKSASGSRFGAMEQQSNYSSCCTESLGGEISPSST  354

Query  1257  TNSRWW*R  1280
             ++ R W R
Sbjct  355   SDFRRWLR  362



>ref|XP_006482962.1| PREDICTED: protein IQ-DOMAIN 14-like isoform X2 [Citrus sinensis]
Length=460

 Score =   105 bits (261),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 102/303 (34%), Positives = 137/303 (45%), Gaps = 67/303 (22%)
 Frame = +3

Query  315   AATVIQTAFRCYLAKRALVALKGIVKLQALIRGQNVRRQARITLKCMQALFRVQERMREQ  494
             AAT IQ+ FR YLA++AL ALKGIVKLQALIRG+NVRRQA  TLKC+Q++  +Q      
Sbjct  130   AATRIQSIFRGYLARKALRALKGIVKLQALIRGRNVRRQAFTTLKCLQSIVNIQ------  183

Query  495   CARISQDSARKSMFSGSTNSWESKYIRE-RKSIFRDHCSVGEAWRDCPPTLQELEVMLQA  671
                 SQ  A++   +GS +  E+K ++  R  I +   S    W D   T QE + M  +
Sbjct  184   ----SQVCAKRCQKAGSWHYDENKQLQTLRDKIIKMDSSCQRRWDDSTLTKQEADAMFLS  239

Query  672   QK-AAFMRERCPSQAWSS----------------------DTDVVDGEEREKTTPLKQGK  782
             +K AA  RER    A+S                       DT V   +E E    +    
Sbjct  240   KKEAAIRRERIKEYAFSHRSADSEQNKVNGRWRYWLEQWVDTQVRKSKELEDLDSIWTTS  299

Query  783   SRAPAIQRRNPVKSGEINVRIRSLQHKSASSVQapatpspakpkpVRPTTSPGNLEKS--  956
             +  P  + R         +R+++LQ K                  +    SP    +   
Sbjct  300   NGNPREEYRGK------GLRLKNLQTK----------------YHIDGLDSPVLFSRRSL  337

Query  957   HSTANTPRLCPTNRSASFAPRYSISGISPGYMAATESAKARLRSQSAPRQRPSTPAKRCL  1136
             H   N+          SFA     S + P YMAATESAKA+ RS S+P+ RP T      
Sbjct  338   HRKQNS-----LGDEKSFAS----SPVVPTYMAATESAKAKARSMSSPKIRPGTFDSYSE  388

Query  1137  SYS  1145
             SYS
Sbjct  389   SYS  391



>ref|XP_006438908.1| hypothetical protein CICLE_v10031481mg [Citrus clementina]
 gb|ESR52148.1| hypothetical protein CICLE_v10031481mg [Citrus clementina]
Length=459

 Score =   104 bits (260),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 102/304 (34%), Positives = 137/304 (45%), Gaps = 68/304 (22%)
 Frame = +3

Query  315   AATVIQTAFRCYLAKRALVALKGIVKLQALIRGQNVRRQARITLKCMQALFRVQERMREQ  494
             AAT IQ+ FR YLA++AL ALKGIVKLQALIRG+NVRRQA  TLKC+Q++  +Q      
Sbjct  128   AATRIQSIFRGYLARKALRALKGIVKLQALIRGRNVRRQAFTTLKCLQSIVNIQ------  181

Query  495   CARISQDSARKSMFSGSTNSWESKYIRE-RKSIFRDHCSVGEAWRDCPPTLQELEVMLQA  671
                 SQ  A++   +GS +  E+K ++  R  I +   S    W D   T QE + M  +
Sbjct  182   ----SQVCAKRCQKAGSWHYDENKQLQTLRDKIIKMDSSCQRRWDDSTLTKQEADAMFLS  237

Query  672   QK-AAFMRERCPSQAWSS-----------------------DTDVVDGEEREKTTPLKQG  779
             +K AA  RER    A+S                        DT V   +E E    +   
Sbjct  238   KKEAAIRRERIKEYAFSHRKSADSEQNKVNGRWRYWLEQWVDTQVRKSKELEDLDSIWTT  297

Query  780   KSRAPAIQRRNPVKSGEINVRIRSLQHKSASSVQapatpspakpkpVRPTTSPGNLEKS-  956
              +  P  + R         +R+++LQ K                  +    SP    +  
Sbjct  298   SNGNPREEYRGK------GLRLKNLQTK----------------YHIDGLDSPVLFSRRS  335

Query  957   -HSTANTPRLCPTNRSASFAPRYSISGISPGYMAATESAKARLRSQSAPRQRPSTPAKRC  1133
              H   N+          SFA     S + P YMAATESAKA+ RS S+P+ RP T     
Sbjct  336   LHRKQNS-----LGDEKSFAS----SPVVPTYMAATESAKAKARSMSSPKIRPGTFDSYS  386

Query  1134  LSYS  1145
              SYS
Sbjct  387   ESYS  390



>ref|XP_006482963.1| PREDICTED: protein IQ-DOMAIN 14-like isoform X3 [Citrus sinensis]
Length=459

 Score =   104 bits (260),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 102/304 (34%), Positives = 137/304 (45%), Gaps = 68/304 (22%)
 Frame = +3

Query  315   AATVIQTAFRCYLAKRALVALKGIVKLQALIRGQNVRRQARITLKCMQALFRVQERMREQ  494
             AAT IQ+ FR YLA++AL ALKGIVKLQALIRG+NVRRQA  TLKC+Q++  +Q      
Sbjct  128   AATRIQSIFRGYLARKALRALKGIVKLQALIRGRNVRRQAFTTLKCLQSIVNIQ------  181

Query  495   CARISQDSARKSMFSGSTNSWESKYIRE-RKSIFRDHCSVGEAWRDCPPTLQELEVMLQA  671
                 SQ  A++   +GS +  E+K ++  R  I +   S    W D   T QE + M  +
Sbjct  182   ----SQVCAKRCQKAGSWHYDENKQLQTLRDKIIKMDSSCQRRWDDSTLTKQEADAMFLS  237

Query  672   QK-AAFMRERCPSQAWSS-----------------------DTDVVDGEEREKTTPLKQG  779
             +K AA  RER    A+S                        DT V   +E E    +   
Sbjct  238   KKEAAIRRERIKEYAFSHRKSADSEQNKVNGRWRYWLEQWVDTQVRKSKELEDLDSIWTT  297

Query  780   KSRAPAIQRRNPVKSGEINVRIRSLQHKSASSVQapatpspakpkpVRPTTSPGNLEKS-  956
              +  P  + R         +R+++LQ K                  +    SP    +  
Sbjct  298   SNGNPREEYRGK------GLRLKNLQTK----------------YHIDGLDSPVLFSRRS  335

Query  957   -HSTANTPRLCPTNRSASFAPRYSISGISPGYMAATESAKARLRSQSAPRQRPSTPAKRC  1133
              H   N+          SFA     S + P YMAATESAKA+ RS S+P+ RP T     
Sbjct  336   LHRKQNS-----LGDEKSFAS----SPVVPTYMAATESAKAKARSMSSPKIRPGTFDSYS  386

Query  1134  LSYS  1145
              SYS
Sbjct  387   ESYS  390



>ref|XP_006482964.1| PREDICTED: protein IQ-DOMAIN 14-like isoform X4 [Citrus sinensis]
Length=458

 Score =   104 bits (260),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 102/304 (34%), Positives = 137/304 (45%), Gaps = 68/304 (22%)
 Frame = +3

Query  315   AATVIQTAFRCYLAKRALVALKGIVKLQALIRGQNVRRQARITLKCMQALFRVQERMREQ  494
             AAT IQ+ FR YLA++AL ALKGIVKLQALIRG+NVRRQA  TLKC+Q++  +Q      
Sbjct  127   AATRIQSIFRGYLARKALRALKGIVKLQALIRGRNVRRQAFTTLKCLQSIVNIQ------  180

Query  495   CARISQDSARKSMFSGSTNSWESKYIRE-RKSIFRDHCSVGEAWRDCPPTLQELEVMLQA  671
                 SQ  A++   +GS +  E+K ++  R  I +   S    W D   T QE + M  +
Sbjct  181   ----SQVCAKRCQKAGSWHYDENKQLQTLRDKIIKMDSSCQRRWDDSTLTKQEADAMFLS  236

Query  672   QK-AAFMRERCPSQAWSS-----------------------DTDVVDGEEREKTTPLKQG  779
             +K AA  RER    A+S                        DT V   +E E    +   
Sbjct  237   KKEAAIRRERIKEYAFSHRKSADSEQNKVNGRWRYWLEQWVDTQVRKSKELEDLDSIWTT  296

Query  780   KSRAPAIQRRNPVKSGEINVRIRSLQHKSASSVQapatpspakpkpVRPTTSPGNLEKS-  956
              +  P  + R         +R+++LQ K                  +    SP    +  
Sbjct  297   SNGNPREEYRGK------GLRLKNLQTK----------------YHIDGLDSPVLFSRRS  334

Query  957   -HSTANTPRLCPTNRSASFAPRYSISGISPGYMAATESAKARLRSQSAPRQRPSTPAKRC  1133
              H   N+          SFA     S + P YMAATESAKA+ RS S+P+ RP T     
Sbjct  335   LHRKQNS-----LGDEKSFAS----SPVVPTYMAATESAKAKARSMSSPKIRPGTFDSYS  385

Query  1134  LSYS  1145
              SYS
Sbjct  386   ESYS  389



>ref|XP_006482961.1| PREDICTED: protein IQ-DOMAIN 14-like isoform X1 [Citrus sinensis]
Length=461

 Score =   104 bits (260),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 102/304 (34%), Positives = 137/304 (45%), Gaps = 68/304 (22%)
 Frame = +3

Query  315   AATVIQTAFRCYLAKRALVALKGIVKLQALIRGQNVRRQARITLKCMQALFRVQERMREQ  494
             AAT IQ+ FR YLA++AL ALKGIVKLQALIRG+NVRRQA  TLKC+Q++  +Q      
Sbjct  130   AATRIQSIFRGYLARKALRALKGIVKLQALIRGRNVRRQAFTTLKCLQSIVNIQ------  183

Query  495   CARISQDSARKSMFSGSTNSWESKYIRE-RKSIFRDHCSVGEAWRDCPPTLQELEVMLQA  671
                 SQ  A++   +GS +  E+K ++  R  I +   S    W D   T QE + M  +
Sbjct  184   ----SQVCAKRCQKAGSWHYDENKQLQTLRDKIIKMDSSCQRRWDDSTLTKQEADAMFLS  239

Query  672   QK-AAFMRERCPSQAWSS-----------------------DTDVVDGEEREKTTPLKQG  779
             +K AA  RER    A+S                        DT V   +E E    +   
Sbjct  240   KKEAAIRRERIKEYAFSHRKSADSEQNKVNGRWRYWLEQWVDTQVRKSKELEDLDSIWTT  299

Query  780   KSRAPAIQRRNPVKSGEINVRIRSLQHKSASSVQapatpspakpkpVRPTTSPGNLEKS-  956
              +  P  + R         +R+++LQ K                  +    SP    +  
Sbjct  300   SNGNPREEYRGK------GLRLKNLQTK----------------YHIDGLDSPVLFSRRS  337

Query  957   -HSTANTPRLCPTNRSASFAPRYSISGISPGYMAATESAKARLRSQSAPRQRPSTPAKRC  1133
              H   N+          SFA     S + P YMAATESAKA+ RS S+P+ RP T     
Sbjct  338   LHRKQNS-----LGDEKSFAS----SPVVPTYMAATESAKAKARSMSSPKIRPGTFDSYS  388

Query  1134  LSYS  1145
              SYS
Sbjct  389   ESYS  392



>ref|XP_009388573.1| PREDICTED: protein IQ-DOMAIN 1-like isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=446

 Score =   103 bits (256),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 65/169 (38%), Positives = 95/169 (56%), Gaps = 17/169 (10%)
 Frame = +3

Query  258  VGGVEIISRTPPPSRRLLC---AATVIQTAFRCYLAKRALVALKGIVKLQALIRGQNVRR  428
               V  + R PP   +++    AA  IQTAFR +LA+RAL ALKGIV+LQA++RG+ VR+
Sbjct  77   TAAVATVVRAPPKDFKVVSQEWAAIRIQTAFRAFLARRALKALKGIVRLQAIVRGRQVRK  136

Query  429  QARITLKCMQALFRVQERMREQCARISQDS-ARKSMFSGSTNSWESKYIRERKSIFRDHC  605
            QA +TL+CMQAL RVQ R+R +  R+S +  A + M             R ++ + +D  
Sbjct  137  QAAVTLRCMQALVRVQARIRARRVRMSTEGQAVQRMLEAH---------RSKQDLLKD--  185

Query  606  SVGEAWRDCPPTLQELEVMLQA-QKAAFMRERCPSQAWSSDTDVVDGEE  749
               E W D   TL+++   LQ  Q+ A  RER  + A S    ++  +E
Sbjct  186  -AEEGWCDSQGTLEKIRTRLQMRQEGALKRERAIAYAMSQQVHMLTVKE  233



>ref|XP_010068813.1| PREDICTED: protein IQ-DOMAIN 14-like [Eucalyptus grandis]
Length=457

 Score =   103 bits (256),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 107/297 (36%), Positives = 151/297 (51%), Gaps = 36/297 (12%)
 Frame = +3

Query  312   CAATVIQTAFRCYLAKRALVALKGIVKLQALIRGQNVRRQARITLKCMQALFRVQERMRE  491
             CAA VIQT+FR YLA+RAL AL+G+VKLQA++RG+NVR++A +TLKCMQAL RVQ ++ E
Sbjct  119   CAAIVIQTSFRGYLARRALRALRGLVKLQAIVRGRNVRKRAEMTLKCMQALVRVQAQVCE  178

Query  492   QCARISQDSARKS--------MFSGSTNSWESKYI-RERKSIFRDHCSVGEAWRDCPPTL  644
             Q  R+S   A  +         F  S +S + K   R+ KS+    C      R  P  L
Sbjct  179   QRNRLSASDAASTNCRFPEFGSFWSSIDSLDIKLAPRDGKSV---SCDRSNHRR--PYKL  233

Query  645   QELEVMLQAQKA-----------AFMRERCPSQAWSSDTDVVDGEEREKT--TPLKQGKS  785
              E + ML+ +K            AF +++     WS  +  +   E E T  TP +  + 
Sbjct  234   AETKSMLEKRKEVAWKSENDLAFAFSQQKI----WSDCSKDLLASEEEPTLDTPRRPDQR  289

Query  786   RAPAIQRRNPVKSGE-INVRIRSLQHKSASSVQapatpspakpkpVRPTTSPGNLEKSHS  962
                + Q R     GE I +     +    SS+   +         +  ++SP  +    +
Sbjct  290   ITGSSQSRISRDQGEAIKIIEIDTRGHHPSSISYQSPIKSRHHAQIIQSSSPSLIGYHRN  349

Query  963   TANTPRLCPTNRSASFAPRYSIS--GISPGYMAATESAKARLRSQSAPRQRPSTPAK  1127
                +P+       +S  PR S S  G+ P YMAAT SAK+RLRSQSAPRQR  TP +
Sbjct  350   RQESPQA--PGYGSSPEPRLSGSSAGLKPNYMAATASAKSRLRSQSAPRQRIPTPLR  404



>gb|KCW89090.1| hypothetical protein EUGRSUZ_A01417 [Eucalyptus grandis]
Length=372

 Score =   102 bits (253),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 97/274 (35%), Positives = 138/274 (50%), Gaps = 38/274 (14%)
 Frame = +3

Query  312   CAATVIQTAFRCYLAKRALVALKGIVKLQALIRGQNVRRQARITLKCMQALFRVQERMRE  491
             CAA VIQT+FR YLA+RAL AL+G+VKLQA++RG+NVR++A +TLKCMQAL RVQ ++ E
Sbjct  82    CAAIVIQTSFRGYLARRALRALRGLVKLQAIVRGRNVRKRAEMTLKCMQALVRVQAQVCE  141

Query  492   QCARISQDSARKSMFSGSTNSWESKYIRERKSIFRDHCSVGEAWRDCPPTLQELEVMLQA  671
             Q  R+S   A       STN    ++     SI      + + W DC   L     +   
Sbjct  142   QRNRLSASDA------ASTNCRFPEFGSFWSSIDSLDIKLAKIWSDCSKDL-----LASE  190

Query  672   QKAAFMRERCPSQAWSSDTDVVDGEEREKTTPLKQGKSRAPAIQRRNPVKSGEINVRIRS  851
             ++      R P Q        + G  + + +   QG++          +K  EI+ R   
Sbjct  191   EEPTLDTPRRPDQR-------ITGSSQSRIS-RDQGEA----------IKIIEIDTR---  229

Query  852   LQHKSASSVQapatpspakpkpVRPTTSPGNLEKSHSTANTPRLCPTNRSASFAPRYSIS  1031
                   SS+   +         +  ++SP  +    +   +P+       +S  PR S S
Sbjct  230   --GHHPSSISYQSPIKSRHHAQIIQSSSPSLIGYHRNRQESPQA--PGYGSSPEPRLSGS  285

Query  1032  --GISPGYMAATESAKARLRSQSAPRQRPSTPAK  1127
               G+ P YMAAT SAK+RLRSQSAPRQR  TP +
Sbjct  286   SAGLKPNYMAATASAKSRLRSQSAPRQRIPTPLR  319



>ref|XP_009388572.1| PREDICTED: protein IQ-DOMAIN 1-like isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=449

 Score =   102 bits (254),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 64/159 (40%), Positives = 91/159 (57%), Gaps = 17/159 (11%)
 Frame = +3

Query  258  VGGVEIISRTPPPSRRLLC---AATVIQTAFRCYLAKRALVALKGIVKLQALIRGQNVRR  428
               V  + R PP   +++    AA  IQTAFR +LA+RAL ALKGIV+LQA++RG+ VR+
Sbjct  77   TAAVATVVRAPPKDFKVVSQEWAAIRIQTAFRAFLARRALKALKGIVRLQAIVRGRQVRK  136

Query  429  QARITLKCMQALFRVQERMREQCARISQDS-ARKSMFSGSTNSWESKYIRERKSIFRDHC  605
            QA +TL+CMQAL RVQ R+R +  R+S +  A + M             R ++ + +D  
Sbjct  137  QAAVTLRCMQALVRVQARIRARRVRMSTEGQAVQRMLEAH---------RSKQDLLKD--  185

Query  606  SVGEAWRDCPPTLQELEVMLQA-QKAAFMRERCPSQAWS  719
               E W D   TL+++   LQ  Q+ A  RER  + A S
Sbjct  186  -AEEGWCDSQGTLEKIRTRLQMRQEGALKRERAIAYAMS  223



>ref|XP_009105930.1| PREDICTED: protein IQ-DOMAIN 1 isoform X2 [Brassica rapa]
Length=411

 Score =   100 bits (248),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 62/160 (39%), Positives = 83/160 (52%), Gaps = 19/160 (12%)
 Frame = +3

Query  234  SKTADENSVGGVEIISRTPPPSRRLL---CAATVIQTAFRCYLAKRALVALKGIVKLQAL  404
            S +AD++    V  + R PP    L+    AAT IQ AFR +LA++AL ALK +V++QA+
Sbjct  68   SFSADDSFAASVAAVIRAPPKDFLLVKREWAATRIQAAFRSFLARQALRALKAVVRIQAI  127

Query  405  IRGQNVRRQARITLKCMQALFRVQERMREQCARISQDSARKSMFSGSTNSWESKYIRERK  584
             RG+ VR+QA +TL+CMQAL RVQ R+R  C R   D       S   N           
Sbjct  128  FRGRQVRKQADVTLRCMQALVRVQARVRAHCNRTPSDGQELEKPSEEKN-----------  176

Query  585  SIFRDHCSVGEAWRDCPPTLQELEVMLQA-QKAAFMRERC  701
                D     E W D P ++ E+   LQ  Q+ A  RER 
Sbjct  177  ----DPAKQAEGWCDSPGSVNEVRTKLQMRQEGAIKRERA  212



>ref|XP_011019421.1| PREDICTED: protein IQ-DOMAIN 1 [Populus euphratica]
Length=450

 Score =   100 bits (250),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 64/147 (44%), Positives = 88/147 (60%), Gaps = 17/147 (12%)
 Frame = +3

Query  276  ISRTPPPSRRLL---CAATVIQTAFRCYLAKRALVALKGIVKLQALIRGQNVRRQARITL  446
            + R PP   R++    AA  IQTAFR +LA+RAL ALKG+V+LQAL+RG+ VR+QA +TL
Sbjct  78   VVRAPPKDFRVVRQEWAAIRIQTAFRGFLARRALRALKGVVRLQALVRGRQVRKQAAVTL  137

Query  447  KCMQALFRVQERMREQCARIS-QDSARKSMFSGSTNSWESKYIRERKSIFRDHCSVGEAW  623
            KCMQAL RVQ  +R +  R+S +  A ++M +           R  K+    H    E W
Sbjct  138  KCMQALVRVQAHVRARRVRMSLEGQAVQNMLNE----------RRSKADLLKHAE--EGW  185

Query  624  RDCPPTLQELEVMLQA-QKAAFMRERC  701
             D   TL++++  LQ  Q+ AF RER 
Sbjct  186  CDRKGTLEDVKSKLQMRQEGAFKRERA  212



>ref|XP_006382010.1| hypothetical protein POPTR_0006s24310g [Populus trichocarpa]
 gb|ERP59807.1| hypothetical protein POPTR_0006s24310g [Populus trichocarpa]
Length=450

 Score =   100 bits (250),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 64/147 (44%), Positives = 88/147 (60%), Gaps = 17/147 (12%)
 Frame = +3

Query  276  ISRTPPPSRRLL---CAATVIQTAFRCYLAKRALVALKGIVKLQALIRGQNVRRQARITL  446
            + R PP   R++    AA  IQTAFR +LA+RAL ALKG+V+LQAL+RG+ VR+QA +TL
Sbjct  78   VVRAPPKDFRVVRQEWAAIRIQTAFRGFLARRALRALKGVVRLQALVRGRQVRKQAAVTL  137

Query  447  KCMQALFRVQERMREQCARIS-QDSARKSMFSGSTNSWESKYIRERKSIFRDHCSVGEAW  623
            KCMQAL RVQ  +R +  R+S +  A ++M +           R  K+    H    E W
Sbjct  138  KCMQALVRVQAHVRARRVRMSLEGQAVQNMLNE----------RRSKADLLKHAE--EGW  185

Query  624  RDCPPTLQELEVMLQA-QKAAFMRERC  701
             D   TL++++  LQ  Q+ AF RER 
Sbjct  186  CDRKGTLEDVKSKLQMRQEGAFKRERA  212



>ref|XP_002308551.2| calmodulin-binding family protein [Populus trichocarpa]
 gb|EEE92074.2| calmodulin-binding family protein [Populus trichocarpa]
Length=449

 Score =   100 bits (249),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 64/147 (44%), Positives = 88/147 (60%), Gaps = 17/147 (12%)
 Frame = +3

Query  276  ISRTPPPSRRLL---CAATVIQTAFRCYLAKRALVALKGIVKLQALIRGQNVRRQARITL  446
            + R PP   R++    AA  IQTAFR +LA+RAL ALKG+V+LQAL+RG+ VR+QA +TL
Sbjct  78   VVRAPPKDFRVVRQEWAAIRIQTAFRGFLARRALRALKGVVRLQALVRGRQVRKQAAVTL  137

Query  447  KCMQALFRVQERMREQCARIS-QDSARKSMFSGSTNSWESKYIRERKSIFRDHCSVGEAW  623
            KCMQAL RVQ  +R +  R+S +  A ++M +           R  K+    H    E W
Sbjct  138  KCMQALVRVQAHVRARRVRMSLEGQAVQNMLNE----------RRSKADLLKHAE--EGW  185

Query  624  RDCPPTLQELEVMLQA-QKAAFMRERC  701
             D   TL++++  LQ  Q+ AF RER 
Sbjct  186  CDRKGTLEDVKSKLQMRQEGAFKRERA  212



>ref|XP_010097046.1| Protein IQ-DOMAIN 1 [Morus notabilis]
 gb|EXB66847.1| Protein IQ-DOMAIN 1 [Morus notabilis]
Length=450

 Score =   100 bits (248),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 65/160 (41%), Positives = 92/160 (58%), Gaps = 18/160 (11%)
 Frame = +3

Query  237  KTADENSVGGVEIISRTPPPSRRLL---CAATVIQTAFRCYLAKRALVALKGIVKLQALI  407
            + AD  S     ++ R PP   +++    AA  IQTAFR +LA+RAL ALKG+V+LQAL+
Sbjct  64   RMADAFSAAMATVV-RAPPRDFKVVRQEWAAIRIQTAFRGFLARRALRALKGVVRLQALV  122

Query  408  RGQNVRRQARITLKCMQALFRVQERMREQCARIS-QDSARKSMFSGSTNSWESKYIRERK  584
            RG+ VR+QA +TL+CMQAL RVQ R+R +  R+S +  A + M             R + 
Sbjct  123  RGRQVRKQAAVTLRCMQALVRVQARVRARHVRMSIEGQAVQQMLDEH---------RSQA  173

Query  585  SIFRDHCSVGEAWRDCPPTLQELEVMLQA-QKAAFMRERC  701
             I +      E W D   TL++++  LQ  Q+ AF RER 
Sbjct  174  EILKQ---AEEGWCDSMGTLEDIQAKLQMRQEGAFKRERA  210



>ref|XP_009403429.1| PREDICTED: protein IQ-DOMAIN 1-like isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=451

 Score = 99.8 bits (247),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 68/180 (38%), Positives = 96/180 (53%), Gaps = 19/180 (11%)
 Frame = +3

Query  258  VGGVEIISRTPPPSRRLLC---AATVIQTAFRCYLAKRALVALKGIVKLQALIRGQNVRR  428
               V  + R PP   R++    AA  IQTAFR +LA+RAL ALKGIV+LQA++RG+ VR 
Sbjct  77   TAAVATVIRAPPKDFRVVSQEWAALRIQTAFRGFLARRALKALKGIVRLQAIVRGRQVRN  136

Query  429  QARITLKCMQALFRVQERMREQCARISQDS-ARKSMFSGSTNSWESKYIRERKSIFRDHC  605
            QA +TL+CMQAL RVQ R+R +  R+S +  A + M             R ++ + ++  
Sbjct  137  QAAVTLRCMQALVRVQARIRARRVRMSTEGQAVQKMLEAR---------RSQQDLLKE--  185

Query  606  SVGEAWRDCPPTLQELEVMLQA-QKAAFMRERCPSQAWSSD--TDVVDGEEREKTTPLKQ  776
               E W D   TL+ +   LQ  Q+    RER  + A S +     V+G   + T  LK 
Sbjct  186  -AEEGWCDSQGTLEAIRARLQKRQEGVLKRERAIAYAMSQEQSKSTVNGRPNQTTASLKH  244



>ref|XP_002513117.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF49620.1| conserved hypothetical protein [Ricinus communis]
Length=510

 Score =   100 bits (248),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 99/293 (34%), Positives = 141/293 (48%), Gaps = 46/293 (16%)
 Frame = +3

Query  315   AATVIQTAFRCYLAKRALVALKGIVKLQALIRGQNVRRQARITLKCMQALFRVQERMREQ  494
             AA  IQTAFR +LA++AL ALKGIVKLQA+IRG+NVRRQA  TLKC+Q++  +Q      
Sbjct  183   AAIKIQTAFRGFLARKALHALKGIVKLQAIIRGRNVRRQAMNTLKCLQSIVNIQ------  236

Query  495   CARISQDSARK-SMFSGSTNSWESKYIRERKS-IFRDHCSVGEAWRDCPPTLQELEVMLQ  668
                 SQ SA++  M  G+ +S E+K  ++    I +   +    W     T +E E +  
Sbjct  237   ----SQVSAKRIQMVEGTCDSDENKQFQQMSDKIIKMDTNSQRRWDGSIFTKEEAEALFL  292

Query  669   AQK-AAFMRERCPSQAWS------SDTDVVDGEER---EKTTPLKQGKSRAPAIQRRNPV  818
             ++K AA  RER    A++      S+ + V+G  R   E+    +  KS+          
Sbjct  293   SKKDAAIKRERIREYAFNHRNSAESERNKVNGRWRYWLEQWVDTQVSKSKELEDLDTVLT  352

Query  819   KSGEINVRIRSLQHKSASSVQapatpspakpkpVRPTTSPGNLEKSHSTANTPRLCPTNR  998
              + +  V  R  Q K                  +R      N+E   S    P+     +
Sbjct  353   STPKPRVEYRGKQLK------------------LRGLQRQYNIEGLDSPLAAPKRSFHRK  394

Query  999   SASFAPR--YSISGISPGYMAATESAKARLRSQSAPRQRPSTPAKRCLSYSIS  1151
               S      +S S I P YMAATESAKA+ RS S+P+ RP +    C +YS S
Sbjct  395   QCSLGEDNSFSRSPIVPTYMAATESAKAKARSLSSPKLRPGS----CDAYSDS  443



>ref|XP_006374089.1| hypothetical protein POPTR_0015s00830g [Populus trichocarpa]
 gb|ERP51886.1| hypothetical protein POPTR_0015s00830g [Populus trichocarpa]
Length=357

 Score = 98.2 bits (243),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 65/167 (39%), Positives = 92/167 (55%), Gaps = 19/167 (11%)
 Frame = +3

Query  288  PPPSRRLLCAATVIQTAFRCYLAKRALVALKGIVKLQALIRGQNVRRQARITLKCMQALF  467
            PP   +   AA  IQ AFR YLA+RAL ALKG+VK+QAL+RG NVR++A + L+CMQ + 
Sbjct  103  PPLLAKQHFAAIAIQKAFRGYLARRALRALKGLVKMQALVRGHNVRKRANMILQCMQTMV  162

Query  468  RVQERMREQCARISQDSARKSMFSGSTNSWESKYIRERKSIFRDHCSVGEAWRDC----P  635
            RVQ R+ +     S + +  S+ S   + W S  + ERKS  RD  S  + W  C    P
Sbjct  163  RVQSRVLD-----SYEGSTNSISSDQNSLWGSN-LAERKSTCRDASSSADDWVHCNNYKP  216

Query  636  PTLQELEVMLQAQKAAFMRERCPSQAWSS-------DTDVVDGEERE  755
             TL+E++   +    A  RE+  + A+S        D+   +GE  E
Sbjct  217  KTLEEIQETKEV--VALKREKALAYAFSQQIWKPGRDSYASEGEVEE  261



>gb|KHG27723.1| Protein IQ-DOMAIN 31 -like protein [Gossypium arboreum]
Length=404

 Score = 99.0 bits (245),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 91/276 (33%), Positives = 117/276 (42%), Gaps = 76/276 (28%)
 Frame = +3

Query  312   CAATVIQTAFRCYLAKRALVALKGIVKLQALIRGQNVRRQARITLKCMQALFRVQERMRE  491
              AA +IQ  FR YLA++AL ALKGIVKLQAL+RG  VRRQA +TLKCMQAL   Q R R 
Sbjct  110   AAAKMIQAVFRSYLARKALKALKGIVKLQALVRGHLVRRQASVTLKCMQALVTAQARARA  169

Query  492   QCARISQDSARKSMFSGSTNSWESKYIRERKSIFRDHCSVGEAWRDCPPTLQELEVMLQA  671
             Q  R+ +DS   S                R+S  R                         
Sbjct  170   QRIRMVEDSRPAS---------------RRQSPHR-------------------------  189

Query  672   QKAAFMRERCPSQAWSSDTDVVDG--EEREKTTPLKQGKSRAPAIQRRNPVKSGEINVRI  845
                   R   P Q        +D   EE  K   +  G S+A ++Q RN           
Sbjct  190   ------RSTTPDQRLRHGYHEIDSGVEENIKIVEIDHGDSKA-SLQSRNSY---------  233

Query  846   RSLQHKSASSVQapatpspakpkpVRPTTSPGNLEKSHSTANTPRLCPTNRSASFAPRYS  1025
              S++H+  S+ QA    S      + P    G+ E    T            A  +P Y+
Sbjct  234   -SMEHR-FSNHQASPVTSSYLADQISPGACSGHFEDHFFTV-----------AQSSPHYA  280

Query  1026  IS-----GISPGYMAATESAKARLRSQSAPRQRPST  1118
              S        P YMA TES++A+ RSQSAP+ RP +
Sbjct  281   ESETFEYSFCPNYMANTESSRAKARSQSAPKSRPDS  316



>ref|XP_004303073.1| PREDICTED: protein IQ-DOMAIN 14-like [Fragaria vesca subsp. vesca]
Length=454

 Score = 99.0 bits (245),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 86/283 (30%), Positives = 133/283 (47%), Gaps = 46/283 (16%)
 Frame = +3

Query  315   AATVIQTAFRCYLAKRALVALKGIVKLQALIRGQNVRRQARITLKCMQALFRVQERMREQ  494
             AA  IQTAFR YLAK+AL ALKGIVKLQA+IRG+ VRRQA  TLKC+Q++  +Q  +   
Sbjct  120   AAVKIQTAFRGYLAKKALRALKGIVKLQAIIRGRAVRRQAMTTLKCLQSIINIQSHV---  176

Query  495   CARISQDSARKSMFSGSTNSWESKYIRERKSIFRDHCSVGEAWRDCPPTLQELEVMLQAQ  674
             CAR  Q    K   +   + ++ ++   R  I R   +    W D   + +E E +  ++
Sbjct  177   CARRFQT---KEGDTYHYDEYDDQFKNLRDKIIRMDSNSQRRWDDRLVSKEEAEALCLSK  233

Query  675   KAAFMRERCPSQAWSSDTDVVDGEER----------EKTTPLKQGKSR-------APAIQ  803
             K A ++     + W S     + E +          ++    +  KS+         A +
Sbjct  234   KEAMIKRERIKEYWYSHRKSAESERKKVNGRWRYWLDQWVDTQISKSKELEDLDTVLAAK  293

Query  804   RRNPVKSGEINVRIRSLQHKSASSVQapatpspakpkpVRPTTSPGNLEKSHSTANTPRL  983
             R+     G+ + R+R+LQ +++  V                  + G      S+ +  + 
Sbjct  294   RKEEFGGGKQD-RLRNLQRQNSHLV------------------NEGMDSPRKSSLHHRKQ  334

Query  984   CPTNRSASFAPRYSISGISPGYMAATESAKARLRSQSAPRQRP  1112
             C      SF      S + P YMAAT+SAK + RS S+P+ RP
Sbjct  335   CSLGDETSFKR----SPVVPTYMAATKSAKLKARSLSSPKLRP  373



>ref|XP_009352096.1| PREDICTED: protein IQ-DOMAIN 14 [Pyrus x bretschneideri]
Length=222

 Score = 95.5 bits (236),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 49/84 (58%), Positives = 64/84 (76%), Gaps = 1/84 (1%)
 Frame = +3

Query  315  AATVIQTAFRCYLAKRALVALKGIVKLQALIRGQNVRRQARITLKCMQALFRVQERMREQ  494
            AA VIQTAFR  LA+RAL ALKG+VKLQAL+RG NVR++A++TL+CMQAL RVQ+R+ +Q
Sbjct  135  AAIVIQTAFRGCLARRALRALKGLVKLQALVRGHNVRKRAKMTLQCMQALVRVQDRVLDQ  194

Query  495  -CARISQDSARKSMFSGSTNSWES  563
               R+S + +  S+FS     W S
Sbjct  195  RTKRLSHEGSADSIFSDPDGLWRS  218



>ref|XP_007012312.1| IQ-domain 6 [Theobroma cacao]
 gb|EOY29931.1| IQ-domain 6 [Theobroma cacao]
Length=481

 Score = 99.0 bits (245),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 63/146 (43%), Positives = 84/146 (58%), Gaps = 15/146 (10%)
 Frame = +3

Query  276  ISRTPPPSRRLL---CAATVIQTAFRCYLAKRALVALKGIVKLQALIRGQNVRRQARITL  446
            + R PP   R++    AA  IQTAFR +LA+RAL ALKGIV+LQAL+RG+ VR+QA +TL
Sbjct  106  VVRAPPKDFRVVRQEWAAIRIQTAFRGFLARRALRALKGIVRLQALVRGRQVRKQAAVTL  165

Query  447  KCMQALFRVQERMREQCARISQDSARKSMFSGSTNSWESKYIRERKSIFRDHCSVGEAWR  626
            +CMQAL RVQ R+R    R+S +                K + ER+S         + W 
Sbjct  166  RCMQALVRVQARVRACRVRMSTEGQA-----------VQKMLDERRSKADILKEAEDGWC  214

Query  627  DCPPTLQELEVMLQA-QKAAFMRERC  701
            D   TL +++  LQ  Q+ AF RER 
Sbjct  215  DSKGTLDDIKAKLQMRQEGAFKRERA  240



>ref|XP_002455012.1| hypothetical protein SORBIDRAFT_03g002990 [Sorghum bicolor]
 gb|EES00132.1| hypothetical protein SORBIDRAFT_03g002990 [Sorghum bicolor]
Length=444

 Score = 98.2 bits (243),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 64/160 (40%), Positives = 92/160 (58%), Gaps = 19/160 (12%)
 Frame = +3

Query  273  IISRTPPPSRRLLC-----AATVIQTAFRCYLAKRALVALKGIVKLQALIRGQNVRRQAR  437
            + + T  P+R  +      AA  IQTAFR +LA+RAL ALKG+V+LQA++RG+ VR+QA 
Sbjct  90   VATVTRAPARDFMAVRQEWAAIRIQTAFRGFLARRALRALKGLVRLQAIVRGRQVRKQAA  149

Query  438  ITLKCMQALFRVQERMREQCARISQDS-ARKSMFSGSTNSWESKYIRERKSIFRDHCSVG  614
            +TL+CMQAL RVQ R+R +  R+S +  A + +             R +  I R+     
Sbjct  150  VTLRCMQALVRVQARIRARRVRMSTEGQAVQKLLEAR---------RTQMDILRE---AE  197

Query  615  EAWRDCPPTLQELEVMLQA-QKAAFMRERCPSQAWSSDTD  731
            E W D   TL+++ V LQ  Q+ A  RER  + A+S   D
Sbjct  198  EGWCDSQGTLEQVRVKLQKRQEGAIKRERAIAYAYSQQAD  237



>ref|XP_003627052.1| IQ domain-containing protein [Medicago truncatula]
 gb|AET01528.1| IQ calmodulin-binding motif protein [Medicago truncatula]
Length=414

 Score = 97.8 bits (242),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 97/303 (32%), Positives = 137/303 (45%), Gaps = 53/303 (17%)
 Frame = +3

Query  315   AATVIQTAFRCYLAKRALVALKGIVKLQALIRGQNVRRQARITLKCMQALFRVQERMREQ  494
             AA  IQT FR YLA++AL ALKG+VK+QAL+RG  VR++A  TL  MQALFR Q  +R Q
Sbjct  128   AAVKIQTFFRGYLARKALRALKGLVKIQALVRGYLVRKRAAATLHSMQALFRAQTSVRTQ  187

Query  495   CARISQDSARKSMFSGSTNSWESKYIRE---RKSIFRDHCSVGEAWRDCPPTLQELEVML  665
                     AR+SM      S ES+++ E   RKS+ R   +  E      PT  E  +  
Sbjct  188   -------RARRSM------SKESRFLPEIIARKSLERYDETRSEFHSKRLPTSYETSLNG  234

Query  666   QAQKAAFMRERCPSQAWSSDTDVVDGEEREKTTPLKQ-GKSRAPAIQRRNPVKSGEINVR  842
                ++  + E         DT     + R  ++ + + G+   P     +P+  G I+V 
Sbjct  235   YDDQSPKIVE--------IDTCKTRSKSRRFSSAMSECGEELPPFHALSSPIPPGRISVP  286

Query  843   IRSLQHKSASSVQapatpspakpkpVRPTTSPGNLEKSH--STANTPRLCPTNRSASFAP  1016
                  H+                          NLE+    +T NTPR   ++      P
Sbjct  287   DCRNHHQHQQEFDWYF----------------NNLEECRYPTTHNTPRFSNSSTRPPNTP  330

Query  1017  RYSISGIS----------PGYMAATESAKARLRSQSAPRQRPSTPAKRCLSYSISVKNGE  1166
               S+ G            P YMA T+S KA+LRS SAP+QRP    +  L+  +S +N  
Sbjct  331   SKSVCGGDIFRPYYYSNFPNYMANTQSFKAKLRSHSAPKQRPEVKKRLSLNEMMSARNSI  390

Query  1167  EGV  1175
              GV
Sbjct  391   SGV  393



>ref|XP_010416025.1| PREDICTED: protein IQ-DOMAIN 1-like [Camelina sativa]
Length=417

 Score = 97.8 bits (242),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 61/160 (38%), Positives = 84/160 (53%), Gaps = 17/160 (11%)
 Frame = +3

Query  234  SKTADENSVGGVEIISRTPPPSRRLL---CAATVIQTAFRCYLAKRALVALKGIVKLQAL  404
            S +ADE+    V  + R PP    L+    AAT IQ +FR +LA++AL ALK +V++QA+
Sbjct  66   SFSADESFTAAVAAVIRAPPKDFFLVKREWAATRIQASFRAFLARQALRALKAVVRIQAI  125

Query  405  IRGQNVRRQARITLKCMQALFRVQERMREQCARISQDSARKSMFSGSTNSWESKYIRERK  584
             RG+ VR+QA +TL+CMQAL RVQ R+R  C R   D       S   N   +K      
Sbjct  126  FRGRQVRKQADVTLRCMQALVRVQARVRAHCNRGPSDGQESQKPSDQRNDDPAKQAE---  182

Query  585  SIFRDHCSVGEAWRDCPPTLQELEVMLQA-QKAAFMRERC  701
                      + W D P ++ E+   LQ  Q+ A  RER 
Sbjct  183  ----------KGWCDSPGSINEVRTKLQMRQEGAIKRERA  212



>ref|XP_008385579.1| PREDICTED: protein IQ-DOMAIN 1 [Malus domestica]
 ref|XP_008385580.1| PREDICTED: protein IQ-DOMAIN 1 [Malus domestica]
 ref|XP_008359181.1| PREDICTED: protein IQ-DOMAIN 1-like [Malus domestica]
 ref|XP_008359182.1| PREDICTED: protein IQ-DOMAIN 1-like [Malus domestica]
Length=433

 Score = 97.8 bits (242),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 62/158 (39%), Positives = 92/158 (58%), Gaps = 12/158 (8%)
 Frame = +3

Query  231  FSKTADENSVGGVEIISRTPPPSRRLLCAATVIQTAFRCYLAKRALVALKGIVKLQALIR  410
             +  A ++S G ++I +     + R   AAT IQT FR +LA+RAL ALKG+V+LQAL+R
Sbjct  67   LNTDALDSSSGSLQIHNAQSEQNVREEWAATRIQTTFRGFLARRALRALKGLVRLQALVR  126

Query  411  GQNVRRQARITLKCMQALFRVQERMREQCARISQDSARKSMFSGSTNSWESKYIRERKSI  590
            G  VR+QA ITL+CMQAL RVQ R+R +  R++ +            + E + +RE    
Sbjct  127  GHAVRKQAAITLRCMQALVRVQARVRARHVRLALEGQMAQQRLQQQLANEVR-VRE----  181

Query  591  FRDHCSVGEAWRDCPPTLQELEV-MLQAQKAAFMRERC  701
                  + E W D   ++QE++  +L+ Q+AA  RER 
Sbjct  182  ------IEEGWCDSVGSVQEIQAKLLKRQEAAAKRERA  213



>ref|XP_004968513.1| PREDICTED: protein IQ-DOMAIN 1-like [Setaria italica]
Length=442

 Score = 97.8 bits (242),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 61/141 (43%), Positives = 85/141 (60%), Gaps = 14/141 (10%)
 Frame = +3

Query  315  AATVIQTAFRCYLAKRALVALKGIVKLQALIRGQNVRRQARITLKCMQALFRVQERMREQ  494
            AA  IQTAFR +LA+RAL ALKG+V+LQA++RG+ VR+QA +TL+CMQAL RVQ R+R +
Sbjct  108  AAIRIQTAFRGFLARRALRALKGLVRLQAIVRGRQVRKQAAVTLRCMQALVRVQARIRAR  167

Query  495  CARISQDS-ARKSMFSGSTNSWESKYIRERKSIFRDHCSVGEAWRDCPPTLQELEVMLQA  671
              R+S +  A + +             R +  I R+     E W D   TL+E+ V LQ 
Sbjct  168  RVRMSTEGQAVQKLLEAR---------RTQMDILRE---AEEGWCDSQGTLEEVRVKLQK  215

Query  672  -QKAAFMRERCPSQAWSSDTD  731
             Q+ A  RER  + ++S   D
Sbjct  216  RQEGAIKRERAIAYSYSQQLD  236



>ref|XP_009368414.1| PREDICTED: protein IQ-DOMAIN 1-like [Pyrus x bretschneideri]
 ref|XP_009368423.1| PREDICTED: protein IQ-DOMAIN 1-like [Pyrus x bretschneideri]
 ref|XP_009368429.1| PREDICTED: protein IQ-DOMAIN 1-like [Pyrus x bretschneideri]
 ref|XP_009368436.1| PREDICTED: protein IQ-DOMAIN 1-like [Pyrus x bretschneideri]
Length=433

 Score = 97.4 bits (241),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 63/162 (39%), Positives = 94/162 (58%), Gaps = 12/162 (7%)
 Frame = +3

Query  231  FSKTADENSVGGVEIISRTPPPSRRLLCAATVIQTAFRCYLAKRALVALKGIVKLQALIR  410
             +  A ++S G ++I +     + R   AAT IQT FR +LA+RAL ALKG+V+LQAL+R
Sbjct  67   LNTDAVDSSSGSLQIHNAQSEQNVREEWAATRIQTTFRGFLARRALRALKGLVRLQALVR  126

Query  411  GQNVRRQARITLKCMQALFRVQERMREQCARISQDSARKSMFSGSTNSWESKYIRERKSI  590
            G  VR+QA ITL+CMQAL RVQ R+R +  R++ +            + E + +RE    
Sbjct  127  GHAVRKQAAITLRCMQALVRVQARVRARHVRLALEGQTVQQRLQQQLANEVR-VRE----  181

Query  591  FRDHCSVGEAWRDCPPTLQELEV-MLQAQKAAFMRERCPSQA  713
                  + E W D   ++QE++  +L+ Q+AA  RER  + A
Sbjct  182  ------IEEGWCDSVGSVQEIQAKLLKRQEAAAKRERAMAYA  217



>ref|XP_009403430.1| PREDICTED: protein IQ-DOMAIN 1-like isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=225

 Score = 94.4 bits (233),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 63/158 (40%), Positives = 89/158 (56%), Gaps = 17/158 (11%)
 Frame = +3

Query  267  VEIISRTPPPSRRLLC---AATVIQTAFRCYLAKRALVALKGIVKLQALIRGQNVRRQAR  437
            V  + R PP   R++    AA  IQTAFR +LA+RAL ALKGIV+LQA++RG+ VR QA 
Sbjct  80   VATVIRAPPKDFRVVSQEWAALRIQTAFRGFLARRALKALKGIVRLQAIVRGRQVRNQAA  139

Query  438  ITLKCMQALFRVQERMREQCARISQDS-ARKSMFSGSTNSWESKYIRERKSIFRDHCSVG  614
            +TL+CMQAL RVQ R+R +  R+S +  A + M             R ++ + ++     
Sbjct  140  VTLRCMQALVRVQARIRARRVRMSTEGQAVQKMLEAR---------RSQQDLLKE---AE  187

Query  615  EAWRDCPPTLQELEVMLQA-QKAAFMRERCPSQAWSSD  725
            E W D   TL+ +   LQ  Q+    RER  + A S +
Sbjct  188  EGWCDSQGTLEAIRARLQKRQEGVLKRERAIAYAMSQE  225



>ref|XP_006352630.1| PREDICTED: protein IQ-DOMAIN 1-like [Solanum tuberosum]
Length=332

 Score = 95.9 bits (237),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 108/343 (31%), Positives = 156/343 (45%), Gaps = 73/343 (21%)
 Frame = +3

Query  438   ITLKCMQALFRVQERMREQCARISQDSARKSMFSGSTNSWESKYIRERKSIFRDHCSVGE  617
             +TLKCMQAL RVQ R+ +Q  R S+  +RKS FS  T+S+   Y++    + RD  ++ +
Sbjct  1     MTLKCMQALVRVQARVLDQRFRQSEQGSRKSTFS-DTSSYH--YLQH---MSRDGSTIPD  54

Query  618   AWRDCPPTLQELEVMLQAQKAAFMRERCPSQAWSSDT-----------DVVDGEEREK--  758
              W + P T++E++ MLQ +K A ++  C   A+S  T           D   GE+ ++  
Sbjct  55    DWDERPHTIEEVKAMLQKRKEAALK--CRRTAFSQQTRRSGKNSSIGSDADFGEKHQRME  112

Query  759   ---TTPLKQGKSRAPAIQRRNPVKSGEINV------RIRSLQHKSASSVQapatpspakp  911
                T       SR  A    +PVK+ E++        +R L  +          PS    
Sbjct  113   QYWTAAKSWDSSRGRAST--DPVKTVEMDTSQPLPPNLRRLDERQHQHQHQHQRPSSPLH  170

Query  912   kpVR-PTT-SPGNLEKSHSTANTPRLCPTNRSASFAPRYSISGIS--------------P  1043
                + P T SP         + +PR CP +  A      S +  S              P
Sbjct  171   TSFQFPVTPSPSKSRPIQVRSASPR-CPRDEKAQTPSLRSNNNYSSHQRNRLTSSAAAIP  229

Query  1044  GYMAATESAKARLRSQSAPRQRPSTP-------AKRCLSYSISVKNGE------------  1166
              YMAATESA +R+RSQSAPRQRPSTP       AK+ LS+ +  + G             
Sbjct  230   NYMAATESALSRIRSQSAPRQRPSTPERDRAGSAKKRLSFPVPDRYGNVPSGYGHSLRSP  289

Query  1167  -----EGVEKRSEYWCNNNNTERESVGGEISPCSTTNSRWW*R  1280
                   GV    E   N ++   ES+GGEISP ST++ R + R
Sbjct  290   SFKSLSGVHFGYEQQSNYSSCYTESLGGEISPSSTSDLRRYLR  332



>ref|XP_004961360.1| PREDICTED: protein IQ-DOMAIN 1-like [Setaria italica]
Length=420

 Score = 97.1 bits (240),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 65/150 (43%), Positives = 87/150 (58%), Gaps = 18/150 (12%)
 Frame = +3

Query  276  ISRTPPPSRRLL---CAATVIQTAFRCYLAKRALVALKGIVKLQALIRGQNVRRQARITL  446
            + R PP   RL+    AA  IQTAFR +LA+RAL AL+GIV+LQAL+RG+ VR+Q  +TL
Sbjct  71   VVRAPPRDFRLIRQEWAAVRIQTAFRAFLARRALKALRGIVRLQALVRGRLVRKQLAVTL  130

Query  447  KCMQALFRVQERMREQCARISQDSARKSMFSGSTNSWESKYIRERKSIFRDHCSVGEAWR  626
            KCM AL RVQER REQ AR S D        GS ++     ++ R +  +D     E W 
Sbjct  131  KCMHALLRVQERAREQRARSSADG------HGSQDA-----LKGRATSTKD---AEEQWC  176

Query  627  DCPPTLQELEVMLQA-QKAAFMRERCPSQA  713
            D   ++ E++  L    + A  RER  + A
Sbjct  177  DRQGSVDEVKSKLHMKHEGAAKRERAIAYA  206



>ref|XP_008793214.1| PREDICTED: protein IQ-DOMAIN 1-like [Phoenix dactylifera]
Length=464

 Score = 97.4 bits (241),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 60/135 (44%), Positives = 84/135 (62%), Gaps = 14/135 (10%)
 Frame = +3

Query  315  AATVIQTAFRCYLAKRALVALKGIVKLQALIRGQNVRRQARITLKCMQALFRVQERMREQ  494
            AA  IQTAFR +LA+RAL ALKG+V+LQA++RG+ VR+QA +TL+CMQAL RVQ R+R +
Sbjct  98   AAIRIQTAFRGFLARRALRALKGLVRLQAIVRGRQVRKQAAVTLRCMQALVRVQARIRAR  157

Query  495  CARISQDS-ARKSMFSGSTNSWESKYIRERKSIFRDHCSVGEAWRDCPPTLQELEVMLQA  671
              R+S +  A + M     N+ +   ++E +          E W D   TL+E+  MLQ 
Sbjct  158  RVRMSTEGQAVQKMLEAHRNNMDP--LKEAE----------EGWCDSQGTLEEVRAMLQM  205

Query  672  -QKAAFMRERCPSQA  713
             Q+ A  RER  + A
Sbjct  206  RQEGAIKRERALAYA  220



>gb|ACN34159.1| unknown [Zea mays]
Length=426

 Score = 97.1 bits (240),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 60/141 (43%), Positives = 85/141 (60%), Gaps = 14/141 (10%)
 Frame = +3

Query  315  AATVIQTAFRCYLAKRALVALKGIVKLQALIRGQNVRRQARITLKCMQALFRVQERMREQ  494
            AA  +QTAFR +LA+RAL ALKG+V+LQA++RG+ VR+QA +TL+CMQAL RVQ R+R +
Sbjct  96   AAIRVQTAFRGFLARRALRALKGLVRLQAIVRGRQVRKQAAVTLRCMQALVRVQARIRAR  155

Query  495  CARISQDS-ARKSMFSGSTNSWESKYIRERKSIFRDHCSVGEAWRDCPPTLQELEVMLQA  671
              R+S +  A + +             R +  I R+     E W D   TL+++ V LQ 
Sbjct  156  RVRMSTEGQAVQKLLEAR---------RTQMDILRE---AEEGWCDSQGTLEQVRVKLQK  203

Query  672  -QKAAFMRERCPSQAWSSDTD  731
             Q+ A  RER  + A+S   D
Sbjct  204  RQEGAIKRERAIAYAYSQQAD  224



>ref|XP_006372018.1| hypothetical protein POPTR_0018s07550g [Populus trichocarpa]
 gb|ERP49815.1| hypothetical protein POPTR_0018s07550g [Populus trichocarpa]
Length=413

 Score = 96.7 bits (239),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 61/147 (41%), Positives = 85/147 (58%), Gaps = 17/147 (12%)
 Frame = +3

Query  276  ISRTPPPSRRLL---CAATVIQTAFRCYLAKRALVALKGIVKLQALIRGQNVRRQARITL  446
            + R PP   R++    AA  IQTAFR +LA+RAL ALK +V+LQA++RG+ VR+QA + L
Sbjct  75   VVRAPPKGFRVVRQEWAAIRIQTAFRGFLARRALRALKAVVRLQAIVRGRQVRKQAAVML  134

Query  447  KCMQALFRVQERMREQCARIS-QDSARKSMFSGSTNSWESKYIRERKSIFRDHCSVGEAW  623
             CMQAL RVQ R+R    R+S +  A ++M +           R  K+    H    E W
Sbjct  135  WCMQALVRVQARVRAHPVRMSIEGQAVQNMLNE----------RHSKADLLKHAE--EGW  182

Query  624  RDCPPTLQELEVMLQA-QKAAFMRERC  701
             D   TL++++  LQ  Q+ AF RER 
Sbjct  183  CDGKGTLEDVKSKLQMRQEGAFKRERA  209



>ref|XP_008672998.1| PREDICTED: calmodulin binding protein isoform X4 [Zea mays]
Length=450

 Score = 97.1 bits (240),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 60/141 (43%), Positives = 85/141 (60%), Gaps = 14/141 (10%)
 Frame = +3

Query  315  AATVIQTAFRCYLAKRALVALKGIVKLQALIRGQNVRRQARITLKCMQALFRVQERMREQ  494
            AA  +QTAFR +LA+RAL ALKG+V+LQA++RG+ VR+QA +TL+CMQAL RVQ R+R +
Sbjct  120  AAIRVQTAFRGFLARRALRALKGLVRLQAIVRGRQVRKQAAVTLRCMQALVRVQARIRAR  179

Query  495  CARISQDS-ARKSMFSGSTNSWESKYIRERKSIFRDHCSVGEAWRDCPPTLQELEVMLQA  671
              R+S +  A + +             R +  I R+     E W D   TL+++ V LQ 
Sbjct  180  RVRMSTEGQAVQKLLEAR---------RTQMDILRE---AEEGWCDSQGTLEQVRVKLQK  227

Query  672  -QKAAFMRERCPSQAWSSDTD  731
             Q+ A  RER  + A+S   D
Sbjct  228  RQEGAIKRERAIAYAYSQQAD  248



>ref|XP_006645595.1| PREDICTED: protein IQ-DOMAIN 1-like [Oryza brachyantha]
Length=442

 Score = 96.7 bits (239),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 60/137 (44%), Positives = 84/137 (61%), Gaps = 14/137 (10%)
 Frame = +3

Query  315  AATVIQTAFRCYLAKRALVALKGIVKLQALIRGQNVRRQARITLKCMQALFRVQERMREQ  494
            A+  IQTAFR +LA+RAL ALKG+V+LQA++RG+ VR+QA +TL+CMQAL RVQ R+R +
Sbjct  110  ASIRIQTAFRGFLARRALRALKGLVRLQAIVRGRQVRKQAAVTLRCMQALVRVQARIRAR  169

Query  495  CARISQDS-ARKSMFSGSTNSWESKYIRERKSIFRDHCSVGEAWRDCPPTLQELEVMLQA  671
              R+S +  A + +             R +  I RD     E W D   TL+++ V LQ 
Sbjct  170  RVRMSTEGQAVQKLLEAR---------RTKLDILRD---AEEGWCDSQGTLEDVRVKLQK  217

Query  672  -QKAAFMRERCPSQAWS  719
             Q+ A  RER  + A+S
Sbjct  218  RQEGAIKRERAIAYAYS  234



>ref|NP_001151471.1| calmodulin binding protein [Zea mays]
 gb|ACN26775.1| unknown [Zea mays]
 gb|ACN28305.1| unknown [Zea mays]
 tpg|DAA52999.1| TPA: calmodulin binding protein [Zea mays]
Length=441

 Score = 96.7 bits (239),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 60/141 (43%), Positives = 85/141 (60%), Gaps = 14/141 (10%)
 Frame = +3

Query  315  AATVIQTAFRCYLAKRALVALKGIVKLQALIRGQNVRRQARITLKCMQALFRVQERMREQ  494
            AA  +QTAFR +LA+RAL ALKG+V+LQA++RG+ VR+QA +TL+CMQAL RVQ R+R +
Sbjct  111  AAIRVQTAFRGFLARRALRALKGLVRLQAIVRGRQVRKQAAVTLRCMQALVRVQARIRAR  170

Query  495  CARISQDS-ARKSMFSGSTNSWESKYIRERKSIFRDHCSVGEAWRDCPPTLQELEVMLQA  671
              R+S +  A + +             R +  I R+     E W D   TL+++ V LQ 
Sbjct  171  RVRMSTEGQAVQKLLEAR---------RTQMDILRE---AEEGWCDSQGTLEQVRVKLQK  218

Query  672  -QKAAFMRERCPSQAWSSDTD  731
             Q+ A  RER  + A+S   D
Sbjct  219  RQEGAIKRERAIAYAYSQQAD  239



>emb|CDX70505.1| BnaC03g05890D [Brassica napus]
Length=446

 Score = 96.7 bits (239),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 91/279 (33%), Positives = 135/279 (48%), Gaps = 26/279 (9%)
 Frame = +3

Query  312   CAATVIQTAFRCYLAKRALVALKGIVKLQALIRGQNVRRQARITLKCMQALFRVQERMRE  491
              AAT IQTAFR +LA++AL ALKGIVKLQA IRG+ VRRQA  TLKC+Q++  +Q ++  
Sbjct  113   LAATRIQTAFRGHLARKALRALKGIVKLQAYIRGRAVRRQAMTTLKCLQSVVNIQSQV--  170

Query  492   QCARISQDSARKSMFSGSTNSWESKYIRERKSIFRDHCSVGEAWRDCPPTLQELE-VMLQ  668
              C + +Q   R     GS   +E  ++   ++I +   +  + W D   T +E   V++ 
Sbjct  171   -CGKRTQIPPR-----GSQRDYEESHMFS-ENILKVDTNGQKRWDDSLLTKEEARAVVMG  223

Query  669   AQKAAFMRERCPSQAWSSDTDVVDGEEREKTTPLKQGKSRAPAIQRRNPVKSGEINVRIR  848
              ++AA  RER    A  +     +  ++   T  K         QR    KS E+     
Sbjct  224   KREAALRRERIKEYA-VTHRKSAESYQKRSNTKWKYWLDEWVDTQR---TKSKELEDLDL  279

Query  849   SLQHKSASSVQapatpspakpkpVRPTTSPGNLEKSHSTANTPRLCPTNRSASFAPRYSI  1028
             SL+ K+                     +SP  L    ++ N  R    +      P  ++
Sbjct  280   SLRTKTKDETMNKTPR----------NSSPRRL--VSNSNNHRRQASISEEEQQNPVAAV  327

Query  1029  SGISPGYMAATESAKARLRSQSAPRQRPSTPAKRCLSYS  1145
             +  +P YM ATESAKA+ RS S+PR RP +   +  SYS
Sbjct  328   TVNTPTYMVATESAKAKSRSLSSPRIRPRSFDTQSESYS  366



>ref|XP_002976100.1| hypothetical protein SELMODRAFT_104616, partial [Selaginella 
moellendorffii]
 gb|EFJ23005.1| hypothetical protein SELMODRAFT_104616, partial [Selaginella 
moellendorffii]
Length=197

 Score = 92.4 bits (228),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 58/139 (42%), Positives = 82/139 (59%), Gaps = 12/139 (9%)
 Frame = +3

Query  315  AATVIQTAFRCYLAKRALVALKGIVKLQALIRGQNVRRQARITLKCMQALFRVQERMREQ  494
            AA  IQ+AFR +L++RAL ALKG+V+LQAL+RG  VR+QA +TL+CMQAL RVQ R+R +
Sbjct  24   AAIRIQSAFRSFLSRRALRALKGLVRLQALVRGHLVRKQAAVTLRCMQALVRVQARVRAR  83

Query  495  CARISQDSARKSMFSGSTNSWESKYIRERKSIFRDHCSVGEAWRDCPPTLQELEV-MLQA  671
              R+S++        G    W    I +R+ +          W  C  T +E+E  + Q 
Sbjct  84   QVRMSEE--------GQQVRWR---IEQRRMLEAQRHQAELGWCACHGTKEEIEAKLFQK  132

Query  672  QKAAFMRERCPSQAWSSDT  728
            Q+AA  RER  + A+S   
Sbjct  133  QEAAVKRERALAYAFSHQV  151



>ref|XP_009105929.1| PREDICTED: protein IQ-DOMAIN 1 isoform X1 [Brassica rapa]
Length=412

 Score = 95.9 bits (237),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 62/161 (39%), Positives = 83/161 (52%), Gaps = 20/161 (12%)
 Frame = +3

Query  234  SKTADENSVGGVEIISRTPPPSRRLL---CAATVIQTAFRCYLAKRALVALKGIVKLQAL  404
            S +AD++    V  + R PP    L+    AAT IQ AFR +LA++AL ALK +V++QA+
Sbjct  68   SFSADDSFAASVAAVIRAPPKDFLLVKREWAATRIQAAFRSFLARQALRALKAVVRIQAI  127

Query  405  IRGQNVRRQARITLKCMQALFRVQERMREQCARISQDSARKSMFSGSTNSWESKYIRERK  584
             RG+ VR+QA +TL+CMQAL RVQ R+R  C R   D       S   N           
Sbjct  128  FRGRQVRKQADVTLRCMQALVRVQARVRAHCNRTPSDGQELEKPSEEKN-----------  176

Query  585  SIFRDHCSVGE-AWRDCPPTLQELEVMLQA-QKAAFMRERC  701
                D     E  W D P ++ E+   LQ  Q+ A  RER 
Sbjct  177  ----DPAKQAEKGWCDSPGSVNEVRTKLQMRQEGAIKRERA  213



>gb|AAD03435.1| contains similarity to IQ calmodulin-biding motifs (Pfam:PF00612, 
Score=18.3, E=0.11, N=2) [Arabidopsis thaliana]
Length=393

 Score = 95.5 bits (236),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 70/163 (43%), Positives = 92/163 (56%), Gaps = 31/163 (19%)
 Frame = +3

Query  87   MVKKLGANSWLTALKRVFIRYPSKDrksrhskrdeeeekkrdkgrrWLFSKTADE--NSV  260
            M KK G  SW TA+K++    PSKD   +     E + K+++K   W+F KT  E  NSV
Sbjct  1    MAKKNG-TSWFTAVKKILWS-PSKDSDKKTHHHKETDIKRKEKKG-WIFRKTKLETTNSV  57

Query  261  -------------------------GGVEIISRTPPPSR-RLLCAATVIQTAFRCYLAKR  362
                                     G  EI+  T  P   R   AA +IQTAFR YL++R
Sbjct  58   LQHTVRTVEAEEKEKPPVIVSSVEEGVTEIVKLTATPGFIRRHWAAIIIQTAFRGYLSRR  117

Query  363  ALVALKGIVKLQALIRGQNVRRQARITLKCMQALFRVQERMRE  491
            AL ALKGIVKLQAL+RG NVR QA++TL+C++AL RVQ++ R+
Sbjct  118  ALRALKGIVKLQALVRGNNVRNQAKLTLRCIKALVRVQDQSRD  160


 Score = 61.2 bits (147),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 49/112 (44%), Positives = 61/112 (54%), Gaps = 18/112 (16%)
 Frame = +3

Query  972   TPRLCPTNRSA---SFAPRY--SISGISPGYMAATESAKARLRSQSAPRQRPSTPAKRCL  1136
             TP  C  +RS    S +PR   S S + P YM+ATESAKA+ R+QS PR+RP T  KR L
Sbjct  286   TPPSCRASRSVMVRSASPRIPCSPSSMQPNYMSATESAKAKARTQSTPRRRPMTAKKR-L  344

Query  1137  SY-------SISVKNGEEGVEKRSEYWCNNNNTERESVGGEISPCSTTNSRW  1271
              Y       S S K+   G +  S+Y C   +       G+ISPCSTT  RW
Sbjct  345   CYAEEESLRSPSFKSCLWG-DHESDYSCCYGD----GFAGKISPCSTTELRW  391



>dbj|BAJ86943.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=437

 Score = 95.9 bits (237),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 58/130 (45%), Positives = 78/130 (60%), Gaps = 12/130 (9%)
 Frame = +3

Query  315  AATVIQTAFRCYLAKRALVALKGIVKLQALIRGQNVRRQARITLKCMQALFRVQERMREQ  494
            AA  IQTAFR +LA+RAL ALKG+V+LQA++RG+ VR+QA +TL+CMQAL RVQ R+R +
Sbjct  109  AAIRIQTAFRGFLARRALRALKGLVRLQAIVRGRQVRKQAAVTLRCMQALVRVQARIRAR  168

Query  495  CARISQDSARKSMFSGSTNSWESKYIRERKSIFRDHCSVGEAWRDCPPTLQELEVMLQA-  671
              R+S +                K I+ R++         E W D   TL+E+ V LQ  
Sbjct  169  RVRMSTEGQA-----------VQKLIQARRTKLDILREAEEGWCDSQGTLEEVRVKLQKR  217

Query  672  QKAAFMRERC  701
            Q+ A  RER 
Sbjct  218  QEGAIKRERA  227



>ref|XP_002968277.1| hypothetical protein SELMODRAFT_68032, partial [Selaginella moellendorffii]
 gb|EFJ30531.1| hypothetical protein SELMODRAFT_68032, partial [Selaginella moellendorffii]
Length=180

 Score = 91.7 bits (226),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 58/139 (42%), Positives = 82/139 (59%), Gaps = 12/139 (9%)
 Frame = +3

Query  315  AATVIQTAFRCYLAKRALVALKGIVKLQALIRGQNVRRQARITLKCMQALFRVQERMREQ  494
            AA  IQ+AFR +L++RAL ALKG+V+LQAL+RG  VR+QA +TL+CMQAL RVQ R+R +
Sbjct  7    AAIRIQSAFRSFLSRRALRALKGLVRLQALVRGHLVRKQAAVTLRCMQALVRVQARVRAR  66

Query  495  CARISQDSARKSMFSGSTNSWESKYIRERKSIFRDHCSVGEAWRDCPPTLQELEV-MLQA  671
              R+S++        G    W    I +R+ +          W  C  T +E+E  + Q 
Sbjct  67   QVRMSEE--------GQQVRWR---IEQRRMLEAQRHQAELGWCACHGTKEEIEAKLFQK  115

Query  672  QKAAFMRERCPSQAWSSDT  728
            Q+AA  RER  + A+S   
Sbjct  116  QEAAVKRERALAYAFSHQV  134



>emb|CDX96427.1| BnaA07g30380D [Brassica napus]
Length=243

 Score = 93.2 bits (230),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 62/161 (39%), Positives = 83/161 (52%), Gaps = 20/161 (12%)
 Frame = +3

Query  234  SKTADENSVGGVEIISRTPPPSRRLL---CAATVIQTAFRCYLAKRALVALKGIVKLQAL  404
            S +AD++    V  + R PP    L+    AAT IQ AFR +LA++AL ALK +V++QA+
Sbjct  68   SFSADDSFAASVAAVIRAPPRDFLLVKREWAATRIQAAFRAFLARQALRALKAVVRIQAI  127

Query  405  IRGQNVRRQARITLKCMQALFRVQERMREQCARISQDSARKSMFSGSTNSWESKYIRERK  584
             RG+ VR+QA +TL+CMQAL RVQ R+R  C R   D       S   N           
Sbjct  128  FRGRQVRKQADVTLRCMQALVRVQARVRAHCNRTPSDGQELEKPSEEKN-----------  176

Query  585  SIFRDHCSVGE-AWRDCPPTLQELEVMLQA-QKAAFMRERC  701
                D     E  W D P ++ E+   LQ  Q+ A  RER 
Sbjct  177  ----DPAKQAEKGWCDSPGSVNEVRTKLQMRQEGAIKRERA  213



>ref|XP_002888887.1| IQ-domain 8 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH65146.1| IQ-domain 8 [Arabidopsis lyrata subsp. lyrata]
Length=414

 Score = 95.5 bits (236),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 61/160 (38%), Positives = 83/160 (52%), Gaps = 17/160 (11%)
 Frame = +3

Query  234  SKTADENSVGGVEIISRTPPPSRRLL---CAATVIQTAFRCYLAKRALVALKGIVKLQAL  404
            S +ADE+    V  + R PP    L+    AAT IQ AFR +LA++AL ALK +V++QA+
Sbjct  65   SFSADESFTAAVAAVIRAPPKDFFLVKREWAATRIQAAFRAFLARQALRALKAVVRIQAI  124

Query  405  IRGQNVRRQARITLKCMQALFRVQERMREQCARISQDSARKSMFSGSTNSWESKYIRERK  584
             RG+ VR+QA +TL+CMQAL RVQ R+R  C R   D       S       +K      
Sbjct  125  FRGRQVRKQADVTLRCMQALVRVQARVRAHCNRGPSDGLELQKPSDQQKDDPAKQAE---  181

Query  585  SIFRDHCSVGEAWRDCPPTLQELEVMLQA-QKAAFMRERC  701
                      + W D P ++ E+   LQ  Q+ A  RER 
Sbjct  182  ----------KGWCDSPGSINEVRTKLQMRQEGAIKRERA  211



>emb|CDX72935.1| BnaC06g33830D [Brassica napus]
Length=263

 Score = 93.2 bits (230),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 62/160 (39%), Positives = 83/160 (52%), Gaps = 20/160 (13%)
 Frame = +3

Query  234  SKTADENSVGGVEIISRTPPPSRRLL---CAATVIQTAFRCYLAKRALVALKGIVKLQAL  404
            S +AD++    V  + R PP    L+    AAT IQ AFR +LA++AL ALK +V++QA+
Sbjct  68   SFSADDSFAASVAAVIRAPPKDFLLVKREWAATRIQAAFRSFLARQALRALKAVVRIQAI  127

Query  405  IRGQNVRRQARITLKCMQALFRVQERMREQCARISQDSARKSMFSGSTNSWESKYIRERK  584
             RG+ VR+QA +TL+CMQAL RVQ R+R  C R   D       S   N           
Sbjct  128  FRGRQVRKQADVTLRCMQALVRVQARVRAHCNRAPSDGQELEKPSEEKN-----------  176

Query  585  SIFRDHCSVGE-AWRDCPPTLQELEVMLQA-QKAAFMRER  698
                D     E  W D P ++ E+   LQ  Q+ A  RER
Sbjct  177  ----DPAKQAEKGWCDSPGSVNEVRTKLQMRQEGAIKRER  212



>ref|XP_010925464.1| PREDICTED: protein IQ-DOMAIN 1-like [Elaeis guineensis]
Length=458

 Score = 95.5 bits (236),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 61/138 (44%), Positives = 84/138 (61%), Gaps = 14/138 (10%)
 Frame = +3

Query  315  AATVIQTAFRCYLAKRALVALKGIVKLQALIRGQNVRRQARITLKCMQALFRVQERMREQ  494
            AA  IQTAFR +LA+RAL ALKG+V+LQA++RG+ VR+QA +TL+CMQAL RVQ R+R +
Sbjct  98   AAIRIQTAFRGFLARRALRALKGLVRLQAIVRGRQVRKQAAVTLRCMQALVRVQARIRAR  157

Query  495  CARISQDS-ARKSMFSGSTNSWESKYIRERKSIFRDHCSVGEAWRDCPPTLQELEVMLQA  671
              R+S +  A + M     N  +   ++E +          E W D   TL+E+   LQ 
Sbjct  158  RVRLSTEGQAVQKMIEAYRNKMDP--LKEAE----------EGWCDSQGTLEEVRAKLQM  205

Query  672  -QKAAFMRERCPSQAWSS  722
             Q+ A  RER  + A SS
Sbjct  206  RQEGAIKRERALAYALSS  223



>ref|XP_011088163.1| PREDICTED: protein IQ-DOMAIN 14 isoform X1 [Sesamum indicum]
Length=453

 Score = 95.5 bits (236),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 96/286 (34%), Positives = 139/286 (49%), Gaps = 54/286 (19%)
 Frame = +3

Query  315   AATVIQTAFRCYLAKRALVALKGIVKLQALIRGQNVRRQARITLKCMQALFRVQ-ERMRE  491
             AAT IQ AFR YLA++AL ALKG+VKLQALIRG  VR+QA  TLKC+Q++  +Q E   +
Sbjct  118   AATKIQAAFRGYLARKALRALKGVVKLQALIRGWAVRQQAINTLKCLQSIVNIQSEVCSK  177

Query  492   QCARISQDSARKSMFSGSTNSWESKYIRERKSIFRDHCSVGEAWRDCPPTLQELEVM-LQ  668
             +C RI  +S            ++S+  RE K I  D  +  + W D   T +E++ + L 
Sbjct  178   RCERIKDNS--------HCQEYKSQDFRE-KDIKVD-LNSQKRWDDSTLTKEEVKTLFLN  227

Query  669   AQKAAFMRERCP----SQAWSSDTD--------------VVDGEEREKTTPLKQGKSRAP  794
              ++A+  RER      S   S++T+               VD +  +   P    ++ + 
Sbjct  228   KREASIKRERVKEYYLSHRRSAETEREKVYGRRRYWLEQWVDAQLAKSDNPGNLNRTSSA  287

Query  795   AIQRRNPVKSGEINVRIRSLQHKSASSVQapatpspakpkpVRPTTSPGNLEKSHSTANT  974
               + R+ V  G  N+R   LQ +  + +    T  P +    R   S G+          
Sbjct  288   NARNRDEVGGGLPNLRY--LQKQYQAEISDSPTYIPRRSYHHRKQRSIGD----------  335

Query  975   PRLCPTNRSASFAPRYSISGISPGYMAATESAKARLRSQSAPRQRP  1112
                      +SFA   SI    P YMA+TESAKA+ RS S+PR RP
Sbjct  336   --------DSSFAGSPSI----PAYMASTESAKAKARSLSSPRLRP  369



>ref|XP_006587682.1| PREDICTED: protein IQ-DOMAIN 14-like isoform X2 [Glycine max]
 ref|XP_006587683.1| PREDICTED: protein IQ-DOMAIN 14-like isoform X3 [Glycine max]
 ref|XP_006587684.1| PREDICTED: protein IQ-DOMAIN 14-like isoform X4 [Glycine max]
Length=469

 Score = 95.5 bits (236),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 96/317 (30%), Positives = 142/317 (45%), Gaps = 75/317 (24%)
 Frame = +3

Query  315   AATVIQTAFRCYLAKRALVALKGIVKLQALIRGQNVRRQARITLKCMQALFRVQERMREQ  494
             AA  IQTAFR YLAK+AL ALKGIVKLQA+IRG+ VRRQA  TLKC+Q++  +Q ++   
Sbjct  131   AAIKIQTAFRGYLAKKALRALKGIVKLQAIIRGRAVRRQAMSTLKCLQSIVSIQSQV---  187

Query  495   CARISQDSARKSMFSGSTNSWESKYIRERKS-IFRDHCSVGEAWRDCPPTLQELEVMLQA  671
             CAR      R  M  G  +  E++ +++ K  I R   +    W +     +E++    +
Sbjct  188   CAR------RLQMVEGRCDYSENEDMQDSKDKIIRMDSNSERKWDESTVLKEEVDTSCTS  241

Query  672   QKAAFM-RERCPSQAWSS-----------------------DTDVVDGEEREKTTPLKQG  779
             +K   + RER    +++                        DT +   +E E    +   
Sbjct  242   KKETILKRERIKEYSFNHRRSAESERSKVNGRWRYWLEQWVDTQLSKSKELEDLDSVFSS  301

Query  780   KSRAPAIQRRNPVKSGEINVRIRSLQHKSASSVQapatpspakpkpVRPTTSPGNLEKSH  959
              SRA         + G   +++ S+ ++  S V+                 SP       
Sbjct  302   HSRAGE-------EYGGRQLKLTSINNQRQSPVEG--------------LDSP-------  333

Query  960   STANTPRLCPTNRSASFAPRYSISG--ISPGYMAATESAKARLRSQSAPRQRPS------  1115
              T  + R  P  R  S    +S S    +P YMAATESAKA+ RS S+P+ R        
Sbjct  334   -TLGSRRSFPHRRQCSVGEDHSFSSSPATPAYMAATESAKAKARSTSSPKIRTGGNVDMN  392

Query  1116  ----TPAKRCLSYSISV  1154
                 +P K+ LS S S+
Sbjct  393   SDSYSPCKKKLSISSSI  409



>ref|XP_011088170.1| PREDICTED: protein IQ-DOMAIN 14 isoform X2 [Sesamum indicum]
Length=452

 Score = 95.1 bits (235),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 96/286 (34%), Positives = 139/286 (49%), Gaps = 54/286 (19%)
 Frame = +3

Query  315   AATVIQTAFRCYLAKRALVALKGIVKLQALIRGQNVRRQARITLKCMQALFRVQ-ERMRE  491
             AAT IQ AFR YLA++AL ALKG+VKLQALIRG  VR+QA  TLKC+Q++  +Q E   +
Sbjct  117   AATKIQAAFRGYLARKALRALKGVVKLQALIRGWAVRQQAINTLKCLQSIVNIQSEVCSK  176

Query  492   QCARISQDSARKSMFSGSTNSWESKYIRERKSIFRDHCSVGEAWRDCPPTLQELEVM-LQ  668
             +C RI  +S            ++S+  RE K I  D  +  + W D   T +E++ + L 
Sbjct  177   RCERIKDNS--------HCQEYKSQDFRE-KDIKVD-LNSQKRWDDSTLTKEEVKTLFLN  226

Query  669   AQKAAFMRERCP----SQAWSSDTD--------------VVDGEEREKTTPLKQGKSRAP  794
              ++A+  RER      S   S++T+               VD +  +   P    ++ + 
Sbjct  227   KREASIKRERVKEYYLSHRRSAETEREKVYGRRRYWLEQWVDAQLAKSDNPGNLNRTSSA  286

Query  795   AIQRRNPVKSGEINVRIRSLQHKSASSVQapatpspakpkpVRPTTSPGNLEKSHSTANT  974
               + R+ V  G  N+R   LQ +  + +    T  P +    R   S G+          
Sbjct  287   NARNRDEVGGGLPNLRY--LQKQYQAEISDSPTYIPRRSYHHRKQRSIGD----------  334

Query  975   PRLCPTNRSASFAPRYSISGISPGYMAATESAKARLRSQSAPRQRP  1112
                      +SFA   SI    P YMA+TESAKA+ RS S+PR RP
Sbjct  335   --------DSSFAGSPSI----PAYMASTESAKAKARSLSSPRLRP  368



>gb|KHN11724.1| Protein IQ-DOMAIN 14 [Glycine soja]
Length=469

 Score = 95.5 bits (236),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 96/317 (30%), Positives = 142/317 (45%), Gaps = 75/317 (24%)
 Frame = +3

Query  315   AATVIQTAFRCYLAKRALVALKGIVKLQALIRGQNVRRQARITLKCMQALFRVQERMREQ  494
             AA  IQTAFR YLAK+AL ALKGIVKLQA+IRG+ VRRQA  TLKC+Q++  +Q ++   
Sbjct  131   AAIKIQTAFRGYLAKKALRALKGIVKLQAIIRGRAVRRQAMSTLKCLQSIVSIQSQV---  187

Query  495   CARISQDSARKSMFSGSTNSWESKYIRERKS-IFRDHCSVGEAWRDCPPTLQELEVMLQA  671
             CAR      R  M  G  +  E++ +++ K  I R   +    W +     +E++    +
Sbjct  188   CAR------RLQMVEGRCDYSENEDMQDSKDKIIRMDSNSERKWDESTVLKEEVDTSCTS  241

Query  672   QKAAFM-RERCPSQAWSS-----------------------DTDVVDGEEREKTTPLKQG  779
             +K   + RER    +++                        DT +   +E E    +   
Sbjct  242   KKETILKRERIKEYSFNHRRSAESERSKVNGRWRYWLEQWVDTQLSKSKELEDLDSVFSS  301

Query  780   KSRAPAIQRRNPVKSGEINVRIRSLQHKSASSVQapatpspakpkpVRPTTSPGNLEKSH  959
              SRA         + G   +++ S+ ++  S V+                 SP       
Sbjct  302   HSRAGE-------EYGGRQLKLTSINNQRQSPVEG--------------LDSP-------  333

Query  960   STANTPRLCPTNRSASFAPRYSISG--ISPGYMAATESAKARLRSQSAPRQRPS------  1115
              T  + R  P  R  S    +S S    +P YMAATESAKA+ RS S+P+ R        
Sbjct  334   -TLGSRRSFPHRRQCSVGEDHSFSSSPATPAYMAATESAKAKARSTSSPKIRTGGNVDMN  392

Query  1116  ----TPAKRCLSYSISV  1154
                 +P K+ LS S S+
Sbjct  393   SDSYSPCKKKLSISSSI  409



>ref|XP_003534374.1| PREDICTED: protein IQ-DOMAIN 14-like isoform X1 [Glycine max]
Length=468

 Score = 95.5 bits (236),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 96/317 (30%), Positives = 142/317 (45%), Gaps = 75/317 (24%)
 Frame = +3

Query  315   AATVIQTAFRCYLAKRALVALKGIVKLQALIRGQNVRRQARITLKCMQALFRVQERMREQ  494
             AA  IQTAFR YLAK+AL ALKGIVKLQA+IRG+ VRRQA  TLKC+Q++  +Q ++   
Sbjct  130   AAIKIQTAFRGYLAKKALRALKGIVKLQAIIRGRAVRRQAMSTLKCLQSIVSIQSQV---  186

Query  495   CARISQDSARKSMFSGSTNSWESKYIRERKS-IFRDHCSVGEAWRDCPPTLQELEVMLQA  671
             CAR      R  M  G  +  E++ +++ K  I R   +    W +     +E++    +
Sbjct  187   CAR------RLQMVEGRCDYSENEDMQDSKDKIIRMDSNSERKWDESTVLKEEVDTSCTS  240

Query  672   QKAAFM-RERCPSQAWSS-----------------------DTDVVDGEEREKTTPLKQG  779
             +K   + RER    +++                        DT +   +E E    +   
Sbjct  241   KKETILKRERIKEYSFNHRRSAESERSKVNGRWRYWLEQWVDTQLSKSKELEDLDSVFSS  300

Query  780   KSRAPAIQRRNPVKSGEINVRIRSLQHKSASSVQapatpspakpkpVRPTTSPGNLEKSH  959
              SRA         + G   +++ S+ ++  S V+                 SP       
Sbjct  301   HSRAGE-------EYGGRQLKLTSINNQRQSPVEG--------------LDSP-------  332

Query  960   STANTPRLCPTNRSASFAPRYSISG--ISPGYMAATESAKARLRSQSAPRQRPS------  1115
              T  + R  P  R  S    +S S    +P YMAATESAKA+ RS S+P+ R        
Sbjct  333   -TLGSRRSFPHRRQCSVGEDHSFSSSPATPAYMAATESAKAKARSTSSPKIRTGGNVDMN  391

Query  1116  ----TPAKRCLSYSISV  1154
                 +P K+ LS S S+
Sbjct  392   SDSYSPCKKKLSISSSI  408



>ref|NP_001042285.1| Os01g0194200 [Oryza sativa Japonica Group]
 dbj|BAB12717.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAB16858.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF04199.1| Os01g0194200 [Oryza sativa Japonica Group]
Length=442

 Score = 95.1 bits (235),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 59/141 (42%), Positives = 85/141 (60%), Gaps = 14/141 (10%)
 Frame = +3

Query  315  AATVIQTAFRCYLAKRALVALKGIVKLQALIRGQNVRRQARITLKCMQALFRVQERMREQ  494
            AA  +QTAFR +LA+RAL ALKG+V+LQA++RG+ VR+QA +TL+CMQAL RVQ R+R +
Sbjct  111  AAIRVQTAFRGFLARRALRALKGLVRLQAIVRGRQVRKQAAVTLRCMQALVRVQARIRAR  170

Query  495  CARISQDS-ARKSMFSGSTNSWESKYIRERKSIFRDHCSVGEAWRDCPPTLQELEVMLQA  671
              R+S +  A + +             R +  I R+     E W D   TL+++ V LQ 
Sbjct  171  RVRMSTEGQAVQKLLEAR---------RTKLDILRE---AEEGWCDSQGTLEDVRVKLQK  218

Query  672  -QKAAFMRERCPSQAWSSDTD  731
             Q+ A  RER  + A+S   +
Sbjct  219  RQEGAIKRERAIAYAYSQQIE  239



>emb|CDX85648.1| BnaA02g01650D [Brassica napus]
Length=395

 Score = 94.4 bits (233),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 93/288 (32%), Positives = 136/288 (47%), Gaps = 38/288 (13%)
 Frame = +3

Query  309   LCAATVIQTAFRCYLAKRALVALKGIVKLQALIRGQNVRRQARITLKCMQALFRVQERM-  485
             + AAT IQTAFR YLA++AL ALKGIVKLQA IRG+ VRRQA  TLKC+Q++  +Q ++ 
Sbjct  102   VLAATRIQTAFRGYLARKALRALKGIVKLQAYIRGRAVRRQAMTTLKCLQSVVNIQSQVC  161

Query  486   --REQCARIS----QDSARKSMFSGSTNSWESKYIRERKSIFRDHCSVGEAWRDCPPTLQ  647
               R Q  R S    ++S    MFS +T               +   +  + W D   T +
Sbjct  162   ASRTQLPRGSHRDYEESNTSHMFSENT--------------LKVDTNGQKRWDDSLLTKE  207

Query  648   ELE-VMLQAQKAAFMRERCPSQAWSSDTDVVDGEEREKTTPLKQGKSRAPAIQRRNPVKS  824
             E + V++  ++A+  RER    A +        ++R++ T  K         QR    KS
Sbjct  208   EAKAVVMSKREASLRRERTKEYAVTHRKSAESYQKRDRNTKWKYWLDEWVDTQR---TKS  264

Query  825   GEINVRIRSLQHKSASSVQapatpspakpkpVRPTTSPGNLEKSHSTANTPRLCPTNRSA  1004
              E+     SL+ K                      +SP  L   ++  N  R    +   
Sbjct  265   KELEDLDLSLKPKPKDETMNKTPR----------NSSPRRLASFNN--NHRRQVSISEEE  312

Query  1005  SFAPRYSISGISPGYMAATESAKARLRS-QSAPRQRPSTPAKRCLSYS  1145
                P  +++ ++P YM ATESAKA+ RS  S+PR R  +   +  SYS
Sbjct  313   EQNPGGAVTVVTPTYMVATESAKAKSRSLMSSPRIRSRSFDTQLESYS  360



>ref|NP_177411.1| IQ-domain 8 protein [Arabidopsis thaliana]
 gb|AAG51853.1|AC010926_16 hypothetical protein; 51860-53619 [Arabidopsis thaliana]
 gb|AAR07516.1| At1g72670 [Arabidopsis thaliana]
 dbj|BAD43672.1| unknown protein [Arabidopsis thaliana]
 gb|AEE35359.1| IQ-domain 8 protein [Arabidopsis thaliana]
Length=414

 Score = 94.7 bits (234),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 60/160 (38%), Positives = 83/160 (52%), Gaps = 17/160 (11%)
 Frame = +3

Query  234  SKTADENSVGGVEIISRTPPPSRRLL---CAATVIQTAFRCYLAKRALVALKGIVKLQAL  404
            S +AD++    V  + R PP    L+    AAT IQ AFR +LA++AL ALK +V++QA+
Sbjct  65   SFSADDSFTAAVAAVIRAPPKDFFLVKREWAATRIQAAFRAFLARQALRALKAVVRIQAI  124

Query  405  IRGQNVRRQARITLKCMQALFRVQERMREQCARISQDSARKSMFSGSTNSWESKYIRERK  584
             RG+ VR+QA +TL+CMQAL RVQ R+R  C R   D       S       +K      
Sbjct  125  FRGRQVRKQADVTLRCMQALVRVQARVRAHCNRGPSDGQELEKPSDQQKDDPAKQAE---  181

Query  585  SIFRDHCSVGEAWRDCPPTLQELEVMLQA-QKAAFMRERC  701
                      + W D P ++ E+   LQ  Q+ A  RER 
Sbjct  182  ----------KGWCDSPGSINEVRTKLQMRQEGAIKRERA  211



>ref|XP_011005472.1| PREDICTED: protein IQ-DOMAIN 1-like [Populus euphratica]
Length=431

 Score = 94.4 bits (233),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 60/147 (41%), Positives = 86/147 (59%), Gaps = 17/147 (12%)
 Frame = +3

Query  276  ISRTPPPSRRLL---CAATVIQTAFRCYLAKRALVALKGIVKLQALIRGQNVRRQARITL  446
            + R PP   R++    AA  IQTAFR +LA+RAL ALKG+V+LQA++RG+ VR+QA + L
Sbjct  75   VVRAPPKGFRVVREEWAAIRIQTAFRGFLARRALRALKGVVRLQAIVRGRLVRKQAAVML  134

Query  447  KCMQALFRVQERMREQCARIS-QDSARKSMFSGSTNSWESKYIRERKSIFRDHCSVGEAW  623
            +CM+AL RVQ R+R    R+S +  A ++M +           R  K+    H    E W
Sbjct  135  RCMRALVRVQARVRAHPVRMSIEGQAVQNMLNE----------RHSKADLLKHAE--EEW  182

Query  624  RDCPPTLQELEVMLQA-QKAAFMRERC  701
             D   TL++++  LQ  Q+ A  RER 
Sbjct  183  CDGTGTLEDVKSKLQMRQEGALKRERA  209



>ref|XP_011037796.1| PREDICTED: protein IQ-DOMAIN 14 [Populus euphratica]
Length=464

 Score = 94.7 bits (234),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 89/280 (32%), Positives = 129/280 (46%), Gaps = 20/280 (7%)
 Frame = +3

Query  315   AATVIQTAFRCYLAKRALVALKGIVKLQALIRGQNVRRQARITLKCMQALFRVQERMREQ  494
             AA  IQ  FR YLA++AL ALKGIVKLQA+IRG+NVRRQA  TLKC+Q++  +Q ++   
Sbjct  132   AAIKIQATFRGYLARKALRALKGIVKLQAIIRGRNVRRQAMTTLKCLQSIVNIQSQV---  188

Query  495   CARISQDSARKSMFSGSTNSWESKYIRE-RKSIFRDHCSVGEAWRDCPPTLQELEVMLQA  671
             CA+      R  M  G+    E+K +      I +   +    W     T +E +    +
Sbjct  189   CAK------RIQMVEGAWTCSENKQLENLSDKIIKMDMNSERRWDGSLLTKEEADASFLS  242

Query  672   QKAAFMRERCPSQAWSSDTDVVDGEEREKTTPLKQGKSRAPAIQRRNPVKSGEINVRIRS  851
             +K A +R     + W    +  +  E E++ P  + +           VKS E+      
Sbjct  243   KKEAAIRRERIREYW---FNRRNSAESERSKPSGRWRYWLDQWVDTQLVKSKELEDLDSV  299

Query  852   LQHKSASSVQapatpspakpkpVRPTTSPGNLEKSHSTANTPRLCPTNRSASFAPR--YS  1025
             L       V         K   +R      +L+   S  + PR     +  S      +S
Sbjct  300   LTSNPKPGVD-----YRGKQIKLRGLQRLYHLDSVDSPISAPRKSFHRKQCSLGEDNSFS  354

Query  1026  ISGISPGYMAATESAKARLRSQSAPRQRPSTPAKRCLSYS  1145
              S + P YMAATESAKA+ RS S+P+ RP +      SYS
Sbjct  355   RSPVVPTYMAATESAKAKTRSMSSPKLRPGSFDAYSDSYS  394



>ref|XP_002970253.1| hypothetical protein SELMODRAFT_67789, partial [Selaginella moellendorffii]
 ref|XP_002978411.1| hypothetical protein SELMODRAFT_57847, partial [Selaginella moellendorffii]
 gb|EFJ20397.1| hypothetical protein SELMODRAFT_57847, partial [Selaginella moellendorffii]
 gb|EFJ28383.1| hypothetical protein SELMODRAFT_67789, partial [Selaginella moellendorffii]
Length=170

 Score = 90.1 bits (222),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 60/137 (44%), Positives = 81/137 (59%), Gaps = 13/137 (9%)
 Frame = +3

Query  312  CAATVIQTAFRCYLAKRALVALKGIVKLQALIRGQNVRRQARITLKCMQALFRVQERMRE  491
             AA  IQTAFR YLA+RAL ALKG+V+LQAL+RG +VRRQA  TL+CMQAL RVQ ++R 
Sbjct  5    WAAIKIQTAFRGYLARRALRALKGLVRLQALVRGHSVRRQAVTTLRCMQALVRVQAKVRA  64

Query  492  QCARISQDSARKSMFSGSTNSWESKYIRERKSIFRDHCSVGEAWRDCPPTLQELEVMLQA  671
            +   +S++  ++          E   ++       D    G  W D   T QEL+  +Q 
Sbjct  65   RRISLSEEGRKQ----------EDLLLKPSMVSSLDPNFYG--WNDSTQTTQELQAKMQT  112

Query  672  -QKAAFMRERCPSQAWS  719
             Q+AA  RER  + A+S
Sbjct  113  RQEAAIKRERALAYAFS  129



>ref|XP_006300492.1| hypothetical protein CARUB_v10020371mg [Capsella rubella]
 gb|EOA33390.1| hypothetical protein CARUB_v10020371mg [Capsella rubella]
Length=415

 Score = 94.0 bits (232),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 59/162 (36%), Positives = 87/162 (54%), Gaps = 21/162 (13%)
 Frame = +3

Query  234  SKTADENSVGGVEIISRTPPPSRRLL---CAATVIQTAFRCYLAKRALVALKGIVKLQAL  404
            S +AD++    V  + R PP    L+    AAT IQ AFR +LA++AL ALK +V++QA+
Sbjct  65   SFSADDSFTAAVAAVIRAPPKDFFLVKREWAATRIQAAFRAFLARQALRALKAVVRIQAI  124

Query  405  IRGQNVRRQARITLKCMQALFRVQERMREQCARISQDSARKSMFSGSTNSWESKYIRERK  584
             RG+ VR+QA +TL+CMQAL RVQ R+R  C R   D                + +++  
Sbjct  125  FRGRQVRKQADVTLRCMQALVRVQARVRAHCNRGPSD---------------VQEVQKPS  169

Query  585  SIFRDHCS--VGEAWRDCPPTLQELEVMLQA-QKAAFMRERC  701
               +D  +    + W D P ++ E+   LQ  Q+ A  RER 
Sbjct  170  DQLKDDPAKQAEKGWCDSPGSVNEVRTKLQMRQEGAIKRERA  211



>gb|KFK41689.1| hypothetical protein AALP_AA2G160100 [Arabis alpina]
Length=414

 Score = 94.0 bits (232),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 61/160 (38%), Positives = 85/160 (53%), Gaps = 18/160 (11%)
 Frame = +3

Query  234  SKTADENSVGGVEIISRTPPPSRRLL---CAATVIQTAFRCYLAKRALVALKGIVKLQAL  404
            S +AD++    V  + R PP    ++    AAT IQ AFR +LA++AL ALK +V++QA+
Sbjct  68   SFSADDSFTAAVAAVIRAPPRDFFVVKREWAATRIQAAFRAFLARQALRALKAVVRIQAI  127

Query  405  IRGQNVRRQARITLKCMQALFRVQERMREQCARISQDSARKSMFSGSTNSWESKYIRERK  584
             RG+ VR+QA +TL+CMQAL RVQ R+R  C R+  D              E +   E K
Sbjct  128  FRGRQVRKQADVTLRCMQALVRVQARVRAHCNRVPLDGQ------------ELQKPSETK  175

Query  585  SIFRDHCSVGEAWRDCPPTLQELEVMLQA-QKAAFMRERC  701
                     G  W D P ++ E+   LQ  Q+ A  RER 
Sbjct  176  DDPAKQAEKG--WCDSPGSVNEVRTKLQMRQEGAIKRERA  213



>gb|EAY72874.1| hypothetical protein OsI_00748 [Oryza sativa Indica Group]
Length=455

 Score = 94.4 bits (233),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 59/141 (42%), Positives = 85/141 (60%), Gaps = 14/141 (10%)
 Frame = +3

Query  315  AATVIQTAFRCYLAKRALVALKGIVKLQALIRGQNVRRQARITLKCMQALFRVQERMREQ  494
            AA  +QTAFR +LA+RAL ALKG+V+LQA++RG+ VR+QA +TL+CMQAL RVQ R+R +
Sbjct  111  AAIRVQTAFRGFLARRALRALKGLVRLQAIVRGRQVRKQAAVTLRCMQALVRVQARIRAR  170

Query  495  CARISQDS-ARKSMFSGSTNSWESKYIRERKSIFRDHCSVGEAWRDCPPTLQELEVMLQA  671
              R+S +  A + +             R +  I R+     E W D   TL+++ V LQ 
Sbjct  171  RVRMSTEGQAVQKLLEAR---------RTKLDILRE---AEEGWCDSQGTLEDVRVKLQK  218

Query  672  -QKAAFMRERCPSQAWSSDTD  731
             Q+ A  RER  + A+S   +
Sbjct  219  RQEGAIKRERAIAYAYSQQIE  239



>gb|EAZ10880.1| hypothetical protein OsJ_00724 [Oryza sativa Japonica Group]
Length=455

 Score = 94.4 bits (233),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 59/141 (42%), Positives = 85/141 (60%), Gaps = 14/141 (10%)
 Frame = +3

Query  315  AATVIQTAFRCYLAKRALVALKGIVKLQALIRGQNVRRQARITLKCMQALFRVQERMREQ  494
            AA  +QTAFR +LA+RAL ALKG+V+LQA++RG+ VR+QA +TL+CMQAL RVQ R+R +
Sbjct  111  AAIRVQTAFRGFLARRALRALKGLVRLQAIVRGRQVRKQAAVTLRCMQALVRVQARIRAR  170

Query  495  CARISQDS-ARKSMFSGSTNSWESKYIRERKSIFRDHCSVGEAWRDCPPTLQELEVMLQA  671
              R+S +  A + +             R +  I R+     E W D   TL+++ V LQ 
Sbjct  171  RVRMSTEGQAVQKLLEAR---------RTKLDILRE---AEEGWCDSQGTLEDVRVKLQK  218

Query  672  -QKAAFMRERCPSQAWSSDTD  731
             Q+ A  RER  + A+S   +
Sbjct  219  RQEGAIKRERAIAYAYSQQIE  239



>emb|CDX78523.1| BnaA03g04350D [Brassica napus]
Length=446

 Score = 94.4 bits (233),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 90/279 (32%), Positives = 133/279 (48%), Gaps = 26/279 (9%)
 Frame = +3

Query  312   CAATVIQTAFRCYLAKRALVALKGIVKLQALIRGQNVRRQARITLKCMQALFRVQERMRE  491
              AA  IQTAFR +LA++AL ALKGIVKLQA IRG+ VRRQA  TLKC+Q++  +Q ++  
Sbjct  113   LAAARIQTAFRGHLARKALRALKGIVKLQAYIRGRAVRRQAMTTLKCLQSVVNIQSQV--  170

Query  492   QCARISQDSARKSMFSGSTNSWESKYIRERKSIFRDHCSVGEAWRDCPPTLQELE-VMLQ  668
              C + +Q   R     GS   +E  ++   ++I +   +  + W D   T +E   V++ 
Sbjct  171   -CGKRTQIPPR-----GSHRDYEESHMFS-ENILKVDTNGQKRWDDSLLTKEEARAVVMS  223

Query  669   AQKAAFMRERCPSQAWSSDTDVVDGEEREKTTPLKQGKSRAPAIQRRNPVKSGEINVRIR  848
              ++AA  RER    A  +     +  ++   T  K         QR    KS E+     
Sbjct  224   KREAALRRERIKEYA-VTHRKSAESYQKRSNTKWKYWLDEWVDTQR---TKSKELEDLDL  279

Query  849   SLQHKSASSVQapatpspakpkpVRPTTSPGNLEKSHSTANTPRLCPTNRSASFAPRYSI  1028
             SL+ K                      +SP  L    ++ N  R    +      P  ++
Sbjct  280   SLRTKPKEETMNKTPR----------NSSPRRL--VSNSNNHKRQASISEEEPQNPVAAV  327

Query  1029  SGISPGYMAATESAKARLRSQSAPRQRPSTPAKRCLSYS  1145
             +  +P YM ATESAKA+ RS S+PR RP +   +  SYS
Sbjct  328   TVTTPTYMVATESAKAKSRSLSSPRIRPRSFDTQSESYS  366



>ref|XP_007008759.1| Iq-domain 14, putative isoform 1 [Theobroma cacao]
 ref|XP_007008760.1| Iq-domain 14, putative isoform 1 [Theobroma cacao]
 gb|EOY17569.1| Iq-domain 14, putative isoform 1 [Theobroma cacao]
 gb|EOY17570.1| Iq-domain 14, putative isoform 1 [Theobroma cacao]
Length=467

 Score = 94.4 bits (233),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 92/283 (33%), Positives = 136/283 (48%), Gaps = 26/283 (9%)
 Frame = +3

Query  315   AATVIQTAFRCYLAKRALVALKGIVKLQALIRGQNVRRQARITLKCMQALFRVQERMREQ  494
             AA  IQ  FR YLA++AL ALKGIV LQA+IRG  VRRQA  TLKC+Q++  +Q ++   
Sbjct  135   AAIKIQATFRGYLARKALRALKGIVMLQAIIRGWAVRRQAMNTLKCLQSIVSIQSQV---  191

Query  495   CARISQDSARKSMFSGSTNSWESKYIRERKS-IFRDHCSVGEAWRDCPPTLQELEVMLQA  671
             CAR      R  M  G   S E K +   K  I +   +  + W D   T +E + M+ +
Sbjct  192   CAR------RFEMAEGIWQSDEDKQLLTLKDKIIKVDTNSHKRWDDSILTKEEADAMVLS  245

Query  672   QK-AAFMRERCPSQAWSSDTDVVDGEEREKTTPLKQGKSRAPAIQRRNPVKSGEINVRIR  848
             +K AA  RER    ++             K+T  +Q K         +     +++ + +
Sbjct  246   KKEAAIKRERIKEYSYV----------HRKSTESEQNKGNGGLKYWLDQWVDTQVS-KSK  294

Query  849   SLQHKSASSVQapatpspakpkpVRPTTSP--GNLEKSHSTANTPRLCPTNRSASFAPR-  1019
              L+   +     P      + K +R  T P   ++E   S    PR     +  S     
Sbjct  295   ELEDLDSVWNSNPKPAEENRAKQLRLKTFPRQYHMEGLDSPLLVPRRSFHRKQCSLGEDN  354

Query  1020  -YSISGISPGYMAATESAKARLRSQSAPRQRPSTPAKRCLSYS  1145
              +S S + P YMAAT+SAKA++RS S+P+ RP +   +  SYS
Sbjct  355   SFSTSPVVPTYMAATQSAKAKVRSMSSPKLRPGSFDTQSESYS  397



>ref|XP_009784182.1| PREDICTED: protein IQ-DOMAIN 1 [Nicotiana sylvestris]
Length=419

 Score = 94.0 bits (232),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 59/136 (43%), Positives = 81/136 (60%), Gaps = 16/136 (12%)
 Frame = +3

Query  315  AATVIQTAFRCYLAKRALVALKGIVKLQALIRGQNVRRQARITLKCMQALFRVQERMREQ  494
            AA  IQ AFR +LA+RAL ALK +V+LQA+ RG+ VR+QA +TLKCMQAL RVQ RMR Q
Sbjct  95   AAIRIQAAFRGFLARRALRALKAVVRLQAIFRGRQVRKQAAMTLKCMQALVRVQARMRAQ  154

Query  495  CARIS--QDSARKSMFSGSTNSWESKYIRERKSIFRDHCSVGEAWRDCPPTLQELEVMLQ  668
            C + S   D+ + S+   + NS ++  I++ +            W D P T+ E+   L+
Sbjct  155  CTQTSLVGDAMKGSL---ADNSSQADPIKQAEG----------GWCDSPGTVDEVRSKLK  201

Query  669  A-QKAAFMRERCPSQA  713
              Q  A  RER  + A
Sbjct  202  MRQVGAIKRERAIAYA  217



>ref|XP_010232214.1| PREDICTED: protein IQ-DOMAIN 1-like [Brachypodium distachyon]
Length=426

 Score = 94.0 bits (232),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 59/155 (38%), Positives = 86/155 (55%), Gaps = 15/155 (10%)
 Frame = +3

Query  267  VEIISRTPPPSRRLL---CAATVIQTAFRCYLAKRALVALKGIVKLQALIRGQNVRRQAR  437
            V  + R PP   R++    AA  IQTAFR +LA+RAL ALKGIV+LQAL+RG+ VR+Q  
Sbjct  68   VAAVVRAPPKDFRVIRQEWAAVRIQTAFRGFLARRALRALKGIVRLQALVRGRRVRKQLA  127

Query  438  ITLKCMQALFRVQERMREQCARISQDSARKSMFSGSTNSWESKYIRERKSIFRDHCSVGE  617
            +T+KCMQAL RVQ R R++  R+S D          + S  +  ++E ++          
Sbjct  128  VTVKCMQALVRVQARARDRRTRLSADGHDSQDLHADSGS-HADPVKEAET----------  176

Query  618  AWRDCPPTLQELEVMLQAQK-AAFMRERCPSQAWS  719
             W D   T+ ++   +  ++  A  RER  + A S
Sbjct  177  GWCDSQGTVDDVRSKIHMRREGAIKRERAIAYALS  211



>gb|KHG03798.1| Protein IQ-DOMAIN 1 -like protein [Gossypium arboreum]
Length=355

 Score = 92.8 bits (229),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 56/130 (43%), Positives = 76/130 (58%), Gaps = 12/130 (9%)
 Frame = +3

Query  315  AATVIQTAFRCYLAKRALVALKGIVKLQALIRGQNVRRQARITLKCMQALFRVQERMREQ  494
            AA  IQTAFR +LA+RAL ALKGIV+LQAL+RG+ VR+QA +TL+CMQAL RVQ R+R +
Sbjct  47   AAIHIQTAFRGFLARRALRALKGIVRLQALVRGRQVRKQATVTLRCMQALVRVQSRVRAR  106

Query  495  CARISQDSARKSMFSGSTNSWESKYIRERKSIFRDHCSVGEAWRDCPPTLQELEVMLQAQ  674
              R+S +           +S        +  I +      + W D   TL++ +  LQ +
Sbjct  107  RVRMSTEGRAVQKILDECHS--------KDDILKQ---AEDGWCDSKGTLEDAKTKLQMK  155

Query  675  K-AAFMRERC  701
               AF RER 
Sbjct  156  HGGAFKRERA  165



>emb|CDO99100.1| unnamed protein product [Coffea canephora]
Length=465

 Score = 94.0 bits (232),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 85/285 (30%), Positives = 127/285 (45%), Gaps = 62/285 (22%)
 Frame = +3

Query  312   CAATVIQTAFRCYLAKRALVALKGIVKLQALIRGQNVRRQARITLKCMQALFRVQERMRE  491
              AA  IQ+ FR YLA++AL ALKG+VKLQAL+RG  VR+QA  TL+CMQAL  VQ R R 
Sbjct  144   AAAIKIQSVFRAYLARKALNALKGLVKLQALVRGHLVRKQATATLRCMQALVTVQARARA  203

Query  492   QCARISQDSARKSMFSGSTNSWESKYIRERKSIFRDHCSVGEAWRDCPPTLQELEVMLQA  671
             Q  +++Q+S                                      P  L++       
Sbjct  204   QRIQMAQESK-------------------------------------PNNLKQFHHRKST  226

Query  672   QKAAFMRERCPSQAWSSDTDVVDG-EEREKTTPLKQGKSRAPAIQRRNPVKSGEINVRIR  848
             Q+  F      SQ++    D   G EE  K   +  G  +     R +   +G+      
Sbjct  227   QENRF------SQSYQ---DFDKGMEENVKIVEMDIGDPKGSTKSRNSYSNNGQTERTDH  277

Query  849   SLQHKSASSVQapatpspakpkpVRPTTSPGNLEKSH--STANTPRLC-------PTNRS  1001
              +    A S Q   +P P+    + P    G+ E+    ++ ++P+ C       P+  +
Sbjct  278   RISTHRAYSNQEQISPLPSAITDLSPRACSGHFEEYSFGTSQSSPQYCSAISKPDPSKGA  337

Query  1002  ASFA------PRYSISGISPGYMAATESAKARLRSQSAPRQRPST  1118
              S+A        Y+     P YMA TES++A++RS SAP+QRP +
Sbjct  338   FSYARSEYGDSLYNEYPFYPSYMANTESSRAKVRSHSAPKQRPES  382



>ref|XP_010676531.1| PREDICTED: protein IQ-DOMAIN 14 [Beta vulgaris subsp. vulgaris]
Length=510

 Score = 94.0 bits (232),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 94/311 (30%), Positives = 147/311 (47%), Gaps = 42/311 (14%)
 Frame = +3

Query  300   RRLLCAATVIQTAFRCYLAKRALVALKGIVKLQALIRGQNVRRQARITLKCMQALFRVQE  479
             + + CA  VIQ+ FR YLA+RAL ALKG+VKLQAL+RG  +RR+   T++CMQA+ R Q 
Sbjct  136   KEIWCATVVIQSHFRGYLARRALRALKGLVKLQALVRGHIMRRKTAETMRCMQAMLRAQA  195

Query  480   RMREQCARISQD--SARKS---MFSGSTNSWESKYIRERKSIFRDHCSVGEAWRDCPPTL  644
             R R   + I +   S+ KS      G     + + +   KSI +DH  + +  R+   + 
Sbjct  196   RARSIRSYIPETPFSSSKSCPIFHPGPLTPDKFEQVVRAKSIKQDH--LPKIKRNSSKSS  253

Query  645   QELEVMLQAQ---KAAFMRERCPSQAW-------SSDTDVVDGEEREKTTPLKQGKSRAP  794
               +  M Q +    +++   R     W       S+ T + D +  ++   +  GK    
Sbjct  254   SRMNTMSQERPNFGSSWSDSRVDDPMWDPRGATSSTRTCLTDDDRADRILEIDTGKPHYS  313

Query  795   AIQRRNPVKSGEINVRIRSLQHKSASSVQapatpspak------pkpVRPTTSPGNL---  947
             + +R     S    +    + H   +S  +    +          + ++P   P  +   
Sbjct  314   SRRRSLFETSYSGLLTSDQVSHSLTTSKDSTTHQTVHSPASCEVVQTLKPLLLPQEIVDD  373

Query  948   EKSHSTA-NTPRLC-------PTNRSASFAP------RYSISGIS--PGYMAATESAKAR  1079
               S+ TA N+P+ C        ++R  SF P      R  +SG S  P YMA TESAKA+
Sbjct  374   NNSYCTAENSPQYCSAASQGGSSSRRGSFTPTKSDGCRSFLSGYSDCPSYMAYTESAKAK  433

Query  1080  LRSQSAPRQRP  1112
             +RS SAP+QRP
Sbjct  434   MRSLSAPKQRP  444



>emb|CDM81614.1| unnamed protein product [Triticum aestivum]
Length=434

 Score = 93.2 bits (230),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 57/130 (44%), Positives = 77/130 (59%), Gaps = 12/130 (9%)
 Frame = +3

Query  315  AATVIQTAFRCYLAKRALVALKGIVKLQALIRGQNVRRQARITLKCMQALFRVQERMREQ  494
            AA  IQTAFR +LA+RAL ALKG+V+LQA++RG+ VR+QA +TL+CMQAL RVQ R+R +
Sbjct  108  AAIRIQTAFRGFLARRALRALKGLVRLQAIVRGRQVRKQAAVTLRCMQALVRVQARIRAR  167

Query  495  CARISQDSARKSMFSGSTNSWESKYIRERKSIFRDHCSVGEAWRDCPPTLQELEVMLQA-  671
              R+S +                K I+ R++         E W D   TL+ + V LQ  
Sbjct  168  RVRMSTEGQA-----------VQKLIQARRTKLDILREAEEGWCDSQGTLEAVRVKLQKR  216

Query  672  QKAAFMRERC  701
            Q+ A  RER 
Sbjct  217  QEGAIKRERA  226



>emb|CBI20646.3| unnamed protein product [Vitis vinifera]
Length=404

 Score = 92.8 bits (229),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 69/167 (41%), Positives = 95/167 (57%), Gaps = 21/167 (13%)
 Frame = +3

Query  231  FSKTADENSVG------GVEIISRTPPPSRRLL---CAATVIQTAFRCYLAKRALVALKG  383
            +S+ +D +SVG       V  + R PP   R++    AA  IQTAFR +LA+RAL ALKG
Sbjct  56   YSEGSDSSSVGTDAFTAAVATVVRAPPKDFRVVRQEWAAIRIQTAFRGFLARRALRALKG  115

Query  384  IVKLQALIRGQNVRRQARITLKCMQALFRVQERMREQCARISQDSARKSMFSGSTNSWES  563
            +V+LQAL+RG+ VR+QA +TL+CMQAL RVQ R+R +  R+S +                
Sbjct  116  VVRLQALVRGRQVRKQAAVTLRCMQALVRVQARVRARRVRMSMEGQAV-----------Q  164

Query  564  KYIRERKSIFRDHCSVGEAWRDCPPTLQELEVMLQA-QKAAFMRERC  701
            K + ER+S         E W D   TL +++  LQ  Q+ AF RER 
Sbjct  165  KLLDERRSQADLLKEAEEGWCDSKGTLADVKTKLQMRQEGAFKRERA  211



>ref|NP_001276234.1| uncharacterized protein LOC100819346 [Glycine max]
 gb|AFR23355.1| IQ-DOMAIN 1-like isoform 3 [Glycine max]
Length=424

 Score = 93.2 bits (230),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 58/138 (42%), Positives = 83/138 (60%), Gaps = 16/138 (12%)
 Frame = +3

Query  315  AATVIQTAFRCYLAKRALVALKGIVKLQALIRGQNVRRQARITLKCMQALFRVQERMREQ  494
            AA  IQTAFR +LA+RAL ALKG+V+LQAL+RG  VR+QA ITL+CMQAL RVQ R+R +
Sbjct  91   AAIHIQTAFRGFLARRALRALKGVVRLQALVRGHAVRKQAAITLRCMQALVRVQARVRAR  150

Query  495  --CARISQDSARKSMFSGSTNSWESKYIRERKSIFRDHCSVGEAWRDCPPTLQELEV-ML  665
              C  +   ++++       N      +RE          + E W D   +++E++  +L
Sbjct  151  XVCMALETQASQQKHQQNLAN---EARVRE----------IEEGWCDSVGSVEEIQAKLL  197

Query  666  QAQKAAFMRERCPSQAWS  719
            + Q+AA  RER  + A S
Sbjct  198  KRQEAAAKRERAMAYALS  215



>ref|XP_010526054.1| PREDICTED: protein IQ-DOMAIN 1-like [Tarenaya hassleriana]
Length=483

 Score = 93.6 bits (231),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 58/129 (45%), Positives = 79/129 (61%), Gaps = 12/129 (9%)
 Frame = +3

Query  315  AATVIQTAFRCYLAKRALVALKGIVKLQALIRGQNVRRQARITLKCMQALFRVQERMREQ  494
            AA  IQTAFR +LA+RAL ALKGIV+LQAL+RG+ VR+QA +TL+CMQAL RVQ R+R +
Sbjct  132  AAIRIQTAFRGFLARRALRALKGIVRLQALVRGRQVRKQAAVTLRCMQALVRVQARVRAR  191

Query  495  CARISQDSARKSMFSGSTNSWESKYIRERKSIFRDHCSVGEAWRDCPPTLQELEVMLQA-  671
              R+S +   K++          K + E +S         E W     T+ +++  LQ  
Sbjct  192  HVRMSVEG--KAV---------QKLLDEHRSKADLLKEAEEGWCGSKGTVDDIKTKLQLR  240

Query  672  QKAAFMRER  698
            Q+ AF RER
Sbjct  241  QEGAFKRER  249



>gb|EYU38248.1| hypothetical protein MIMGU_mgv1a006691mg [Erythranthe guttata]
Length=434

 Score = 93.2 bits (230),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 95/279 (34%), Positives = 130/279 (47%), Gaps = 50/279 (18%)
 Frame = +3

Query  315   AATVIQTAFRCYLAKRALVALKGIVKLQALIRGQNVRRQARITLKCMQALFRVQERMREQ  494
             AA  IQ AFR YLA++AL ALKG+VKLQALIRG  VR+QA  TLKC+Q++  +Q  +   
Sbjct  112   AAIKIQAAFRGYLARKALRALKGVVKLQALIRGWAVRQQALNTLKCLQSIVNIQSEVY--  169

Query  495   CARISQDSARKSMFSGSTNSWESKYIRERKSIFRDHCSVGEAWRDCPPTLQELEVMLQAQ  674
                    S R+   S     ++S+ +RE K I  D  S  + W D   T +EL+ +L  +
Sbjct  170   -------SKRRIEDSLHCQEYKSQNLRE-KDIKVDLNS-QKRWDDSTLTKEELKALLLTK  220

Query  675   K-AAFMRERCPS------QAWSSDTDVVDGEER---EKTTPLKQGKSRAPAIQRRNPVKS  824
             + A+  RER         ++  ++ D   G  R   E+    +  KS  P    RN  ++
Sbjct  221   RDASIKRERVKEYYLNHRRSAETERDKAYGRRRYWLEQWVDAQLAKSDTP----RNLDRN  276

Query  825   GEINVRIRSLQHKSASSVQapatpspakpkpVRPTTSPGNLEKSHSTANTPRLCPTNRSA  1004
                N R R ++H                             E S S A  PR    +R  
Sbjct  277   LSANDRNREIRH----------------------LPKQNQTEMSDSPAYVPRRSHHHRKQ  314

Query  1005  -SFAPRYSISGIS--PGYMAATESAKARLRSQSAPRQRP  1112
              S     S  G    P YMA+TESAKA+ RS S+PR RP
Sbjct  315   RSIGEDNSFLGSPSIPAYMASTESAKAKARSLSSPRLRP  353



>gb|EYU38247.1| hypothetical protein MIMGU_mgv1a006691mg [Erythranthe guttata]
Length=435

 Score = 93.2 bits (230),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 95/279 (34%), Positives = 130/279 (47%), Gaps = 50/279 (18%)
 Frame = +3

Query  315   AATVIQTAFRCYLAKRALVALKGIVKLQALIRGQNVRRQARITLKCMQALFRVQERMREQ  494
             AA  IQ AFR YLA++AL ALKG+VKLQALIRG  VR+QA  TLKC+Q++  +Q  +   
Sbjct  113   AAIKIQAAFRGYLARKALRALKGVVKLQALIRGWAVRQQALNTLKCLQSIVNIQSEVY--  170

Query  495   CARISQDSARKSMFSGSTNSWESKYIRERKSIFRDHCSVGEAWRDCPPTLQELEVMLQAQ  674
                    S R+   S     ++S+ +RE K I  D  S  + W D   T +EL+ +L  +
Sbjct  171   -------SKRRIEDSLHCQEYKSQNLRE-KDIKVDLNS-QKRWDDSTLTKEELKALLLTK  221

Query  675   K-AAFMRERCPS------QAWSSDTDVVDGEER---EKTTPLKQGKSRAPAIQRRNPVKS  824
             + A+  RER         ++  ++ D   G  R   E+    +  KS  P    RN  ++
Sbjct  222   RDASIKRERVKEYYLNHRRSAETERDKAYGRRRYWLEQWVDAQLAKSDTP----RNLDRN  277

Query  825   GEINVRIRSLQHKSASSVQapatpspakpkpVRPTTSPGNLEKSHSTANTPRLCPTNRSA  1004
                N R R ++H                             E S S A  PR    +R  
Sbjct  278   LSANDRNREIRH----------------------LPKQNQTEMSDSPAYVPRRSHHHRKQ  315

Query  1005  -SFAPRYSISGIS--PGYMAATESAKARLRSQSAPRQRP  1112
              S     S  G    P YMA+TESAKA+ RS S+PR RP
Sbjct  316   RSIGEDNSFLGSPSIPAYMASTESAKAKARSLSSPRLRP  354



>ref|XP_001763354.1| predicted protein [Physcomitrella patens]
 gb|EDQ71884.1| predicted protein [Physcomitrella patens]
Length=338

 Score = 91.7 bits (226),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 65/138 (47%), Positives = 87/138 (63%), Gaps = 15/138 (11%)
 Frame = +3

Query  315  AATVIQTAFRCYLAKRALVALKGIVKLQALIRGQNVRRQARITLKCMQALFRVQERMREQ  494
            AA  IQTAFR YLA+RAL ALKG+V+LQAL+RG  VRRQA ITL+CMQAL RVQ R+R +
Sbjct  6    AAIRIQTAFRAYLARRALRALKGLVRLQALVRGHTVRRQATITLRCMQALVRVQARVRAR  65

Query  495  CARISQD--SARKSMFSGSTNSWESKYIRERKSIFRDHCSVGEAWRDCPPTLQELEV-ML  665
              R+S++  + +K +       WE + +  R        S+   W D   T+QE +V +L
Sbjct  66   RVRMSEEGRAVQKQL-------WERRQLESRP-----RKSLDGGWNDSTQTMQEEQVKLL  113

Query  666  QAQKAAFMRERCPSQAWS  719
              Q+AA  RER  + A+S
Sbjct  114  NKQEAAMKRERALAYAFS  131



>ref|XP_002279054.1| PREDICTED: protein IQ-DOMAIN 1 [Vitis vinifera]
Length=449

 Score = 93.2 bits (230),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 69/167 (41%), Positives = 95/167 (57%), Gaps = 21/167 (13%)
 Frame = +3

Query  231  FSKTADENSVG------GVEIISRTPPPSRRLL---CAATVIQTAFRCYLAKRALVALKG  383
            +S+ +D +SVG       V  + R PP   R++    AA  IQTAFR +LA+RAL ALKG
Sbjct  56   YSEGSDSSSVGTDAFTAAVATVVRAPPKDFRVVRQEWAAIRIQTAFRGFLARRALRALKG  115

Query  384  IVKLQALIRGQNVRRQARITLKCMQALFRVQERMREQCARISQDSARKSMFSGSTNSWES  563
            +V+LQAL+RG+ VR+QA +TL+CMQAL RVQ R+R +  R+S +                
Sbjct  116  VVRLQALVRGRQVRKQAAVTLRCMQALVRVQARVRARRVRMSMEGQAV-----------Q  164

Query  564  KYIRERKSIFRDHCSVGEAWRDCPPTLQELEVMLQA-QKAAFMRERC  701
            K + ER+S         E W D   TL +++  LQ  Q+ AF RER 
Sbjct  165  KLLDERRSQADLLKEAEEGWCDSKGTLADVKTKLQMRQEGAFKRERA  211



>ref|XP_009354407.1| PREDICTED: protein IQ-DOMAIN 14 [Pyrus x bretschneideri]
 ref|XP_009354409.1| PREDICTED: protein IQ-DOMAIN 14 [Pyrus x bretschneideri]
 ref|XP_009354410.1| PREDICTED: protein IQ-DOMAIN 14 [Pyrus x bretschneideri]
Length=468

 Score = 93.2 bits (230),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 96/299 (32%), Positives = 135/299 (45%), Gaps = 46/299 (15%)
 Frame = +3

Query  315   AATVIQTAFRCYLAKRALVALKGIVKLQALIRGQNVRRQARITLKCMQALFRVQERMREQ  494
             A   IQTAFR YLA++AL ALKGIVKLQA+IRG+ VRRQA  TLKC+Q++  +Q      
Sbjct  131   AVVKIQTAFRGYLARKALRALKGIVKLQAIIRGRAVRRQAMTTLKCLQSIINIQSHA---  187

Query  495   CARISQDSARKSMFSGSTNSWESKYIRERKSIFRDHCSVGEAWRDCPPTLQELEVMLQAQ  674
             CAR  Q +   + +      +E+     R  I R   +    W D   + +E E M  ++
Sbjct  188   CARRLQ-TIEDAYYGDEHIEFENL----RDKIIRMDSNSERRWDDSVTSQKEAEAMFLSK  242

Query  675   KAAFM-RERCPSQAWS------SDTDVVDGEERE-----KTTPLKQGKSRAP-----AIQ  803
             K A + RER    ++S      S+ + V+G  R        T L + K         A  
Sbjct  243   KEAMLKRERIREYSYSHRKSAESERNKVNGRWRYWLDQWVDTQLTKSKELEDLDTVFASN  302

Query  804   RRNPVKSGEINVRIRSLQHKSASSVQapatpspakpkpVRPTTSPGNLEKSHSTANTPRL  983
              R   + GE  +R+R+ Q +                  +    SP  + +  S     + 
Sbjct  303   ARQKEEFGEKQLRMRNFQKQ---------------KIQIEGMDSPVFVPRRSSYHK--KQ  345

Query  984   CPTNRSASFAPRYSISGISPGYMAATESAKARLRSQSAPRQRPSTPAKRCLSYSISVKN  1160
             C       FA     S + P YMAAT+SAKA+ RS S+P+ R         SYS   KN
Sbjct  346   CSLGDENLFAS----SPVVPTYMAATKSAKAKTRSLSSPKVRAGNFDTCSESYSPCKKN  400



>ref|XP_010428160.1| PREDICTED: protein IQ-DOMAIN 1-like isoform X2 [Camelina sativa]
Length=416

 Score = 92.8 bits (229),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 64/161 (40%), Positives = 88/161 (55%), Gaps = 20/161 (12%)
 Frame = +3

Query  234  SKTADENSVGGVEIISRTPPPSRRLL---CAATVIQTAFRCYLAKRALVALKGIVKLQAL  404
            S +AD++    V  + R PP    L+    AAT IQ +FR +LA++AL ALK +V++QA+
Sbjct  67   SFSADDSFTAAVAAVVRAPPKDFFLVKREWAATRIQASFRAFLARQALRALKAVVRIQAI  126

Query  405  IRGQNVRRQARITLKCMQALFRVQERMREQCARISQDSARKSMFSGSTNSWE-SKYIRER  581
             RG+ VR+QA +TL+CMQAL RVQ R+R  C R            G +N  E  K   +R
Sbjct  127  FRGRQVRKQADVTLRCMQALVRVQARVRAHCNR------------GPSNEQELQKPSDQR  174

Query  582  KSIFRDHCSVGEAWRDCPPTLQELEVMLQA-QKAAFMRERC  701
            K    D     E W D P ++ E+   LQ  Q+ A  RER 
Sbjct  175  KD---DPAKQAEGWCDSPGSINEVRTKLQMRQEGAIKRERA  212



>ref|XP_009602959.1| PREDICTED: protein IQ-DOMAIN 1-like [Nicotiana tomentosiformis]
Length=419

 Score = 92.8 bits (229),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 58/136 (43%), Positives = 81/136 (60%), Gaps = 16/136 (12%)
 Frame = +3

Query  315  AATVIQTAFRCYLAKRALVALKGIVKLQALIRGQNVRRQARITLKCMQALFRVQERMREQ  494
            AA  IQ AFR +LA+RAL ALK +V+LQA+ RG+ VR+QA +TLKCMQAL RVQ RMR Q
Sbjct  95   AAIRIQAAFRGFLARRALRALKALVRLQAIFRGRQVRKQAAMTLKCMQALVRVQARMRAQ  154

Query  495  CARIS--QDSARKSMFSGSTNSWESKYIRERKSIFRDHCSVGEAWRDCPPTLQELEVMLQ  668
            C + S   D+ + S+   + NS ++  +++ +            W D P T+ E+   L+
Sbjct  155  CTQTSLEGDAMKGSL---ADNSSQADPVKQAEG----------GWCDSPGTVDEVRSKLK  201

Query  669  A-QKAAFMRERCPSQA  713
              Q  A  RER  + A
Sbjct  202  MRQVGAIKRERAIAYA  217



>ref|XP_006390635.1| hypothetical protein EUTSA_v10018619mg [Eutrema salsugineum]
 gb|ESQ27921.1| hypothetical protein EUTSA_v10018619mg [Eutrema salsugineum]
Length=416

 Score = 92.4 bits (228),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 60/161 (37%), Positives = 86/161 (53%), Gaps = 20/161 (12%)
 Frame = +3

Query  234  SKTADENSVGGVEIISRTPPPSRRLL---CAATVIQTAFRCYLAKRALVALKGIVKLQAL  404
            S +AD++    V  + R PP    L+    AAT IQ AFR +LA++AL ALK +V++QA+
Sbjct  67   SFSADDSFTAAVAAVIRAPPKDFFLVKREWAATRIQAAFRAFLARQALRALKAVVRIQAI  126

Query  405  IRGQNVRRQARITLKCMQALFRVQERMREQCARISQDSARKSMFSGSTNSWESKYIRERK  584
             RG+ VR+QA +TL+CMQAL RVQ R+R  C R               +  E + +++  
Sbjct  127  FRGRQVRKQADVTLRCMQALVRVQARVRAHCNR---------------DPSEGQDLQKPP  171

Query  585  SIFRDHCSVGE-AWRDCPPTLQELEVMLQA-QKAAFMRERC  701
                D     E  W D P ++ E+   LQ  Q+ A  RER 
Sbjct  172  EPKDDPAKQAEKGWCDSPGSVNEVRTKLQMRQEGAIKRERA  212



>ref|XP_009630714.1| PREDICTED: protein IQ-DOMAIN 14 [Nicotiana tomentosiformis]
Length=510

 Score = 93.2 bits (230),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 106/333 (32%), Positives = 152/333 (46%), Gaps = 73/333 (22%)
 Frame = +3

Query  315   AATVIQTAFRCYLAKRALVALKGIVKLQALIRGQNVRRQARITLKCMQALFRVQERMREQ  494
             AA VIQ+ FR YL++RAL ALKG+VKLQAL+RG  VR+Q    L+ MQA+ R Q R R  
Sbjct  164   AAVVIQSHFRAYLSRRALRALKGLVKLQALVRGHIVRQQTADYLRQMQAMIRAQSRAR--  221

Query  495   CARISQDSARKSMFSGSTNSWESKYIRERKSIFRDHCSVGEAWRDCPPTLQELEVMLQA-  671
                     A +S  SGS +S         KS+   H          P T ++ E +++A 
Sbjct  222   --------AGRSQVSGSPHS-------STKSVQFLHAG--------PTTPEKFEHVIRAR  258

Query  672   ---QKAAFMRERCPS----------------QAWSSDTDVVDGEEREKTTPLKQGKSRAP  794
                    FM +R  S                Q  S+ T+  D E+ +K   +  GK  A 
Sbjct  259   SMKHDETFMLKRNTSKSNWKVIDSEKARIRPQGSSARTNSFDDEKSDKILEIDTGKQYAT  318

Query  795   AIQRRNPVKSGEINVRIRSLQH-----KSASSVQapatpspakpkpVRPTTSPGNLEKS-  956
               Q RN   S  +++      +     K +++ Q   +PS    +P+ P      LE++ 
Sbjct  319   PKQ-RNLFHSSHLSLNSDQYSYSLTTSKESTAHQTVPSPSSCGNQPLSPLKFNEELEEAC  377

Query  957   -HSTANTPRL------------CPTNRSASFAPRYSISGIS--PGYMAATESAKARLRSQ  1091
               +  N+P+              P   + S   R  +SG S  P YM+ TESAKA++RS 
Sbjct  378   FCTADNSPQFYSASSKGGSSKRGPFTPTKSDGSRSCLSGYSDHPNYMSYTESAKAKVRSM  437

Query  1092  SAPRQRP----STPAKR--CLSYSISVKNGEEG  1172
             SAP+QRP    S+  KR     YS S  N ++G
Sbjct  438   SAPKQRPHYERSSSIKRYSIHGYSESRTNSQKG  470



>ref|XP_009333751.1| PREDICTED: protein IQ-DOMAIN 1-like [Pyrus x bretschneideri]
Length=490

 Score = 93.2 bits (230),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 54/131 (41%), Positives = 83/131 (63%), Gaps = 9/131 (7%)
 Frame = +3

Query  312  CAATVIQTAFRCYLAKRALVALKGIVKLQALIRGQNVRRQARITLKCMQALFRVQERMRE  491
             AA  IQTAFR ++A+RAL AL+G+V+L++L++GQ+V+RQA  TL+CMQ L RVQ  +R 
Sbjct  128  VAAIKIQTAFRGHMARRALRALRGLVRLKSLLQGQSVKRQATTTLRCMQTLARVQSEIRA  187

Query  492  QCARISQDSARKSMFSGSTNSWESKYIRERKSIFRDHCSVGEAWRDCPPTLQELEVMLQ-  668
            +  R+S+++             + K  +E + I +D  S+GE W D   + +++E  LQ 
Sbjct  188  RRIRMSEEN------QAFQRQLQQKQEKELEKIKKD--SMGEDWDDSIQSKEQVEAKLQM  239

Query  669  AQKAAFMRERC  701
             Q+AA  RER 
Sbjct  240  KQEAAMRRERA  250



>ref|XP_003564834.1| PREDICTED: protein IQ-DOMAIN 1-like [Brachypodium distachyon]
Length=439

 Score = 92.8 bits (229),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 59/142 (42%), Positives = 82/142 (58%), Gaps = 13/142 (9%)
 Frame = +3

Query  318  ATV-IQTAFRCYLAKRALVALKGIVKLQALIRGQNVRRQARITLKCMQALFRVQERMREQ  494
            AT+ IQTAFR +LA+RAL ALKG+V+LQA++RG+ VR+QA +TL+CMQAL RVQ R+R +
Sbjct  110  ATIRIQTAFRGFLARRALRALKGLVRLQAIVRGRQVRKQAAVTLRCMQALVRVQARIRAR  169

Query  495  CARISQDSARKSMFSGSTNSWESKYIRERKSIFRDHCSVGEAWRDCPPTLQELEVMLQA-  671
              R+S +                K I  R++         E W D   TL+ + V LQ  
Sbjct  170  RVRMSTEGQA-----------VQKLIDARRTKLDILREAEEGWCDSQGTLEAVRVKLQKR  218

Query  672  QKAAFMRERCPSQAWSSDTDVV  737
            Q+ A  RER  +  +S   + V
Sbjct  219  QEGAIKRERAIAYVYSQQLEGV  240



>ref|XP_006287758.1| hypothetical protein CARUB_v10000971mg [Capsella rubella]
 ref|XP_006287759.1| hypothetical protein CARUB_v10000971mg [Capsella rubella]
 gb|EOA20656.1| hypothetical protein CARUB_v10000971mg [Capsella rubella]
 gb|EOA20657.1| hypothetical protein CARUB_v10000971mg [Capsella rubella]
Length=441

 Score = 92.8 bits (229),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 93/294 (32%), Positives = 142/294 (48%), Gaps = 56/294 (19%)
 Frame = +3

Query  309   LCAATVIQTAFRCYLAKRALVALKGIVKLQALIRGQNVRRQARITLKCMQALFRVQERMR  488
             + AAT IQTAFR +LA++AL ALKGIVKLQA IRG+ VRRQA  TLKC+Q++  +Q ++ 
Sbjct  111   VHAATRIQTAFRGHLARKALRALKGIVKLQAYIRGRAVRRQAMTTLKCLQSVVNIQSQV-  169

Query  489   EQCARISQDSARKSMFSGSTNSWESKYIRERKSIFRDHCSVGEAWRDCPPTLQELEVMLQ  668
               C + +Q      +  G+   +E   I    ++  D  S  + W D   T +E E ++ 
Sbjct  170   --CGKRTQ------IPRGAHREYEEGNISNENNLKVDTNS-QKRWDDSLLTKEEAEAVVM  220

Query  669   AQKAAFMRERCPSQAWSSDTDVVDGEEREKTTPLKQGKSRAPAIQRRNPVK-----SGEI  833
             ++K A +R                  ER K   +   KS A + Q+R+  K        +
Sbjct  221   SKKEASLR-----------------RERIKEYAVTHRKS-AESYQKRSNTKWKYWLDEWV  262

Query  834   NVRI---RSLQHKSASSVQapatpspakpkpVRPTTSPGNLEKSHSTAN-TPRLCPTN--  995
             + ++   + L+    SS               +P   P N ++  +  N +PR    N  
Sbjct  263   DTQLTKSKELEDLDFSS-------------RTKPKEEPLNEKQLKTPRNSSPRRLVNNHR  309

Query  996   RSASFAPRY----SISGISPGYMAATESAKARLRSQSAPRQRPSTPAKRCLSYS  1145
             R  S +       +++  +P YM ATESAKA+ RS S+PR RP +   +  SYS
Sbjct  310   RQVSISEEEQSPATVAVTTPTYMVATESAKAKSRSLSSPRIRPRSFDTQSESYS  363



>ref|XP_006368583.1| calmodulin-binding family protein [Populus trichocarpa]
 gb|ERP65152.1| calmodulin-binding family protein [Populus trichocarpa]
Length=464

 Score = 92.8 bits (229),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 90/281 (32%), Positives = 130/281 (46%), Gaps = 22/281 (8%)
 Frame = +3

Query  315   AATVIQTAFRCYLAKRALVALKGIVKLQALIRGQNVRRQARITLKCMQALFRVQERMREQ  494
             AA  IQ  FR YLA++AL ALKGIVKLQA+IRG+NVRRQA  TLKC+Q++  +Q ++   
Sbjct  132   AAIKIQATFRGYLARKALRALKGIVKLQAIIRGRNVRRQAMTTLKCLQSIVNIQSQV---  188

Query  495   CARISQDSARKSMFSGSTNSWESKYIRE-RKSIFRDHCSVGEAWRDCPPTLQE-LEVMLQ  668
             CA+      R  M  G+    E+K +      I +   +    W     T +E +   L 
Sbjct  189   CAK------RIQMVEGAWTCSENKQLENLSDKIIKMDMNSERRWDSSLLTKEEAVASFLS  242

Query  669   AQKAAFMRERCPSQAWSSDTDVVDGEEREKTTPLKQGKSRAPAIQRRNPVKSGEINVRIR  848
              ++AA  RER   + W    +  +  E E++ P  + +           VKS E+     
Sbjct  243   KKEAAIKRERI-REYW---FNRRNSAESERSKPSGRWRYWLDQWVDTQLVKSKELEDLDS  298

Query  849   SLQHKSASSVQapatpspakpkpVRPTTSPGNLEKSHSTANTPRLCPTNRSASFAPR--Y  1022
              L       V+            +R      +L+   S  + PR     +  S      +
Sbjct  299   VLTSNPKPGVEYRGKQIK-----LRGLQRLYHLDSVDSPISAPRKSFHRKQCSLGEDNSF  353

Query  1023  SISGISPGYMAATESAKARLRSQSAPRQRPSTPAKRCLSYS  1145
             S S + P YMA TESAKA+ RS S+P+ RP +      SYS
Sbjct  354   SRSPVVPTYMATTESAKAKTRSMSSPKLRPGSFDAYSDSYS  394



>emb|CDP04285.1| unnamed protein product [Coffea canephora]
Length=371

 Score = 91.3 bits (225),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 53/139 (38%), Positives = 86/139 (62%), Gaps = 14/139 (10%)
 Frame = +3

Query  312  CAATVIQTAFRCYLAKRALVALKGIVKLQALIRGQNVRRQARITLKCMQALFRVQERMRE  491
             AA  IQTAFR Y+A+RAL AL+G+V+L+ +++GQ+V+RQA  TL+CMQAL RVQ ++  
Sbjct  117  IAAIKIQTAFRGYMARRALRALRGLVRLKTMVQGQSVKRQATTTLRCMQALARVQSQIHA  176

Query  492  QCARISQDSARKSMFSGSTNSWESKYIRER--KSIFRDHCSVGEAWRDCPPTLQELEVML  665
            +  R+S++           N    + I+++  K + +   S+G+ W D   + ++ E  L
Sbjct  177  RRIRMSEE-----------NEALQRQIQQKREKELEKLRTSIGDNWNDSTQSKEQHEATL  225

Query  666  QA-QKAAFMRERCPSQAWS  719
            Q+  +AA  RER  + A+S
Sbjct  226  QSKHEAAIRRERALAYAYS  244



>ref|XP_001772157.1| predicted protein [Physcomitrella patens]
 gb|EDQ62970.1| predicted protein [Physcomitrella patens]
Length=169

 Score = 88.2 bits (217),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 45/68 (66%), Positives = 54/68 (79%), Gaps = 0/68 (0%)
 Frame = +3

Query  315  AATVIQTAFRCYLAKRALVALKGIVKLQALIRGQNVRRQARITLKCMQALFRVQERMREQ  494
            AA  IQTAFR +LA+RAL ALKG+V+LQAL+RG  VRRQA ITL+CMQAL RVQ R+R +
Sbjct  1    AALRIQTAFRGFLARRALRALKGLVRLQALVRGHTVRRQAAITLRCMQALVRVQARIRAR  60

Query  495  CARISQDS  518
              R+SQ  
Sbjct  61   RVRMSQQG  68



>ref|XP_003540276.1| PREDICTED: protein IQ-DOMAIN 1 isoformX1 [Glycine max]
Length=421

 Score = 91.7 bits (226),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 58/138 (42%), Positives = 83/138 (60%), Gaps = 16/138 (12%)
 Frame = +3

Query  315  AATVIQTAFRCYLAKRALVALKGIVKLQALIRGQNVRRQARITLKCMQALFRVQERMREQ  494
            AA  IQTAFR +LA+RAL ALKG+V+LQAL+RG  VR+QA ITL+CMQAL RVQ R+R +
Sbjct  94   AAIRIQTAFRGFLARRALRALKGVVRLQALVRGHAVRKQAAITLRCMQALVRVQARVRAR  153

Query  495  --CARISQDSARKSMFSGSTNSWESKYIRERKSIFRDHCSVGEAWRDCPPTLQELEV-ML  665
              C  +   ++++       N      +RE +          E W D   +++E++  +L
Sbjct  154  HVCMALETQASQQKHQQNLAN---EARVRETE----------EGWCDSVGSVEEIQAKIL  200

Query  666  QAQKAAFMRERCPSQAWS  719
            + Q+AA  RER  + A S
Sbjct  201  KRQEAAAKRERAMAYALS  218



>ref|XP_001783650.1| predicted protein [Physcomitrella patens]
 gb|EDQ51545.1| predicted protein [Physcomitrella patens]
Length=403

 Score = 91.7 bits (226),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 65/145 (45%), Positives = 85/145 (59%), Gaps = 18/145 (12%)
 Frame = +3

Query  312  CAATVIQTAFRCYLAKRALVALKGIVKLQALIRGQNVRRQARITLKCMQALFRVQERMRE  491
             AAT IQ AFR YLA+RAL ALKG+V+LQAL+RG  VRRQA ITL+CMQAL RVQ R+R 
Sbjct  9    LAATRIQAAFRAYLARRALRALKGLVRLQALVRGHTVRRQATITLRCMQALVRVQARVRA  68

Query  492  QCARISQDSARKSMFSGSTNSWESKYIRERKSI-FRDHCSVGEAWRDCPPTLQELEVMLQ  668
            +  R+S++                + +RER+ +  R   S    W D   T +E++  LQ
Sbjct  69   RRVRMSEEGQAV-----------QRQLRERRQLECRPRRSTDGGWDDSTQTAEEIQAKLQ  117

Query  669  A-QKAAFMRERC-----PSQAWSSD  725
            + Q+AA  RER        Q W +D
Sbjct  118  SKQEAALKRERALAYGFSHQLWRAD  142



>ref|XP_009758266.1| PREDICTED: protein IQ-DOMAIN 14-like [Nicotiana sylvestris]
Length=493

 Score = 92.4 bits (228),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 73/195 (37%), Positives = 107/195 (55%), Gaps = 35/195 (18%)
 Frame = +3

Query  327  IQTAFRCYLAKRALVALKGIVKLQALIRGQNVRRQARITLKCMQALFRVQERMREQCARI  506
            IQTAFR YLA++AL ALKG+VKLQALIRG NVR++A+ITL+CMQ+L RVQ ++ +Q  R+
Sbjct  148  IQTAFRGYLARKALRALKGVVKLQALIRGHNVRKRAKITLQCMQSLVRVQTQVCDQRRRL  207

Query  507  SQDSARKSMFSGSTNSWESKYIRERKSIFRDH--------CSVGEAWRDCPPTLQELEVM  662
            S +     +  GST        R+ K I   H         S      D    L+++E +
Sbjct  208  SCE----GISCGST-------FRKSKIILDLHLSDTSTNQASTANYRYDHSHALEKVEAL  256

Query  663  LQ-AQKAAFMRERCPSQAWSS-------DTDVVDGEEREKT------TPLKQGK--SRAP  794
            LQ A++AA  RE   + A+S        D D    +E ++       T ++ G+  SRA 
Sbjct  257  LQKAKEAAKQRENTLAFAFSQKMWTANKDEDASSNKELDEDLRVFHRTDVRNGRTLSRAS  316

Query  795  AIQRRNPVKSGEINV  839
              Q R+ +K+ E++ 
Sbjct  317  FDQPRDRIKNIEVDT  331



>ref|XP_003545385.1| PREDICTED: protein IQ-DOMAIN 1-like [Glycine max]
 gb|KHN17246.1| Protein IQ-DOMAIN 1 [Glycine soja]
Length=417

 Score = 91.7 bits (226),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 66/162 (41%), Positives = 96/162 (59%), Gaps = 17/162 (10%)
 Frame = +3

Query  231  FSKTADENSVGGVEIISRTPPPSRRLL---CAATVIQTAFRCYLAKRALVALKGIVKLQA  401
            ++  A ++    V  + R PP   +LL    AAT IQTAFR +LA+RAL ALKG+V+LQA
Sbjct  45   YASVASDSFNAAVATVVRAPPKDFKLLKQEWAATRIQTAFRAFLARRALRALKGVVRLQA  104

Query  402  LIRGQNVRRQARITLKCMQALFRVQERMREQCARIS-QDSARKSMFSGSTNSWESKYIRE  578
            L+RG+ VR+QA +TL+CMQAL RVQ R+R +  R+S +  A ++M            + E
Sbjct  105  LVRGRLVRKQAAVTLRCMQALVRVQARVRARRVRMSIEGQAVQNM------------LNE  152

Query  579  RKSIFRDHCSVGEAWRDCPPTLQELEVMLQA-QKAAFMRERC  701
            R++         E W D   +L++++  LQ  Q+ AF RER 
Sbjct  153  RRTKAELIKQAEEGWCDSKGSLEDVKTKLQMRQEGAFKRERA  194



>ref|XP_006592786.1| PREDICTED: protein IQ-DOMAIN 1 isoform X2 [Glycine max]
 ref|XP_006592787.1| PREDICTED: protein IQ-DOMAIN 1 isoform X3 [Glycine max]
 ref|XP_006592788.1| PREDICTED: protein IQ-DOMAIN 1 isoform X4 [Glycine max]
Length=422

 Score = 91.7 bits (226),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 58/138 (42%), Positives = 83/138 (60%), Gaps = 16/138 (12%)
 Frame = +3

Query  315  AATVIQTAFRCYLAKRALVALKGIVKLQALIRGQNVRRQARITLKCMQALFRVQERMREQ  494
            AA  IQTAFR +LA+RAL ALKG+V+LQAL+RG  VR+QA ITL+CMQAL RVQ R+R +
Sbjct  94   AAIRIQTAFRGFLARRALRALKGVVRLQALVRGHAVRKQAAITLRCMQALVRVQARVRAR  153

Query  495  --CARISQDSARKSMFSGSTNSWESKYIRERKSIFRDHCSVGEAWRDCPPTLQELEV-ML  665
              C  +   ++++       N      +RE +          E W D   +++E++  +L
Sbjct  154  HVCMALETQASQQKHQQNLAN---EARVRETE----------EGWCDSVGSVEEIQAKIL  200

Query  666  QAQKAAFMRERCPSQAWS  719
            + Q+AA  RER  + A S
Sbjct  201  KRQEAAAKRERAMAYALS  218



>ref|XP_001781552.1| predicted protein [Physcomitrella patens]
 gb|EDQ53603.1| predicted protein [Physcomitrella patens]
Length=360

 Score = 90.5 bits (223),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 101/350 (29%), Positives = 157/350 (45%), Gaps = 76/350 (22%)
 Frame = +3

Query  309   LCAATVIQTAFRCYLAKRALVALKGIVKLQALIRGQNVRRQARITLKCMQALFRVQERMR  488
             + AA  IQTAFR YLA+RAL ALKG+V+LQAL+RG  VRRQA ITL+CMQAL RVQ R+R
Sbjct  17    VWAAIKIQTAFRAYLARRALRALKGLVRLQALVRGHTVRRQATITLRCMQALVRVQARVR  76

Query  489   EQCARISQDSA----------------RKSMFSGSTNSWESKYIRERKSIFRDHCSV---  611
              +  R+S++                  RKS+  G  +S ++ +  + K + +   ++   
Sbjct  77    ARRVRMSEEGQAVQRQLWERRQLESRPRKSLDGGWNDSTQTIHAEKVKILNKQEAAMKRE  136

Query  612   --------GEAWRDCPPTLQELEVMLQAQKA----AFMRERCPSQAWSSDTDVVDGEERE  755
                      + W+  P    +L +  +  K      ++     ++ W + T  +   + +
Sbjct  137   RALAYAFSHQLWKSAPNQTSQLHIDCEPDKLHWGWCWLERWMAARPWRNRTFDISAPKDQ  196

Query  756   KTTPLKQGKSRAPAIQRRNPVKSGEINVRIRSLQHKSASSVQapatpspakpkpVRPT--  929
             +    + G     AI+  +   +G          H S S++Q   +    +P    P+  
Sbjct  197   RLHSAQNG-----AIRSESYSSNGPSMFTSNGHNHFSPSTMQRTTSQGALQPPATPPSGH  251

Query  930   ---------TSPGNL-------EKSHSTANTPRLCPTNRSASFAPRYSISGI--------  1037
                       SP NL       E   + + T R  P+  +  F   YS +G         
Sbjct  252   KATPSLIRSASPRNLIRREELEEGGSAVSTTARSSPS--AFRFGTCYSHAGSIRDDESLA  309

Query  1038  ----SPGYMAATESAKARLRSQSAPRQRPST--------PAKRCLSYSIS  1151
                  P YM AT+SA+A++RS S P+QRP T         AK+ LS+ IS
Sbjct  310   SCPSVPNYMQATQSARAKVRSHSQPKQRPGTLEKDGSWGSAKKRLSFPIS  359



>gb|EPS73313.1| hypothetical protein M569_01446, partial [Genlisea aurea]
Length=373

 Score = 90.5 bits (223),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 58/149 (39%), Positives = 82/149 (55%), Gaps = 15/149 (10%)
 Frame = +3

Query  267  VEIISRTPPPSRRLL---CAATVIQTAFRCYLAKRALVALKGIVKLQALIRGQNVRRQAR  437
            V  + R  P   R +    AA  IQTAF+ +LA+RAL ALK +VKLQA++RG+ VR+QA 
Sbjct  78   VATVVRAHPKDFRAVKREWAAIRIQTAFKGFLARRALRALKALVKLQAIVRGRQVRKQAA  137

Query  438  ITLKCMQALFRVQERMREQCARISQDSARKSMFSGSTNSWESKYIRERKSIFRDHCSVGE  617
            +TL+CMQAL R+Q R+R    R+S++                K + ER+ +        E
Sbjct  138  VTLRCMQALVRLQARVRAHRVRMSEEGQA-----------VQKMLDERRGMDEQLKMAEE  186

Query  618  AWRDCPPTLQELEVMLQ-AQKAAFMRERC  701
             W D   TL+E++  +Q  Q  A  RER 
Sbjct  187  GWCDSRGTLEEVKAKIQLKQVGAVKRERA  215



>emb|CAN83680.1| hypothetical protein VITISV_003845 [Vitis vinifera]
Length=992

 Score = 92.4 bits (228),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 69/167 (41%), Positives = 95/167 (57%), Gaps = 21/167 (13%)
 Frame = +3

Query  231  FSKTADENSVG------GVEIISRTPPPSRRLL---CAATVIQTAFRCYLAKRALVALKG  383
            +S+ +D +SVG       V  + R PP   R++    AA  IQTAFR +LA+RAL ALKG
Sbjct  599  YSEGSDSSSVGTDAFTAAVATVVRAPPKGFRVVRQEWAAIRIQTAFRGFLARRALRALKG  658

Query  384  IVKLQALIRGQNVRRQARITLKCMQALFRVQERMREQCARISQDSARKSMFSGSTNSWES  563
            +V+LQAL+RG+ VR+QA +TL+CMQAL RVQ R+R +  R+S +                
Sbjct  659  VVRLQALVRGRQVRKQAAVTLRCMQALVRVQARVRARRVRMSMEGQAV-----------Q  707

Query  564  KYIRERKSIFRDHCSVGEAWRDCPPTLQELEVMLQA-QKAAFMRERC  701
            K + ER+S         E W D   TL +++  LQ  Q+ AF RER 
Sbjct  708  KLLDERRSQADLLKEAEEGWCDSKGTLADVKTKLQMRQEGAFKRERA  754



>emb|CBI24678.3| unnamed protein product [Vitis vinifera]
Length=435

 Score = 91.3 bits (225),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 89/306 (29%), Positives = 141/306 (46%), Gaps = 40/306 (13%)
 Frame = +3

Query  270   EIISRTPPPSRRLLCAATVIQTAFRCYLAKRALVALKGIVKLQALIRGQNVRRQARITLK  449
             E+  R  P  R    AA  IQTA+R Y+A+R+  AL+G+V+LQ ++RGQNV+RQ    +K
Sbjct  142   EVSYRPEPTLRNHHIAAIRIQTAYRGYMARRSFRALRGLVRLQGVVRGQNVKRQTTNAMK  201

Query  450   CMQALFRVQERMREQCARISQDSA--RKSMFSG------STNSWESKYIRERKSIFRDHC  605
             CMQ L RVQ +++ +  ++ ++ A  R+S +        S   W S    E         
Sbjct  202   CMQLLVRVQSQIQSRRIQMLENQALQRQSQYKNDKELESSIGKWASSQPSE--------A  253

Query  606   SVGEAWRDCPPTLQELEVMLQAQ-KAAFMRERCPSQAWSSDTDVVDGEEREKTTPLKQGK  782
                E W D   T +++E  LQ + +A   RER  + A+S         +  K TP    K
Sbjct  254   GNNEDWDDSQLTKEQIEARLQKKVEAVIKRERAMAYAYS--------HQLWKATP----K  301

Query  783   SRAPAIQRRNPVKSGEINVRIRSLQHKSASSVQapatpspakpkpVRPTTSPGNLEKSHS  962
             S   +I     ++SG        L+ +   +    +              SP N + S +
Sbjct  302   SAQASIMD---IRSGGFPWWWNWLERQLPPANPPESNRVSGLTILSHSHQSPQNQQASAA  358

Query  963   TANTPRLCPTNRSASFAPRYSISGISPGYMAATESAKARLRSQSAPRQR----PSTPAKR  1130
              +        + S +  P +S+    P YM  T SAKA++R+ S P++R    PS  +KR
Sbjct  359   DSTFDVPLRDDDSLTSCPPFSV----PNYMTPTVSAKAKVRANSNPKERYPVTPSAESKR  414

Query  1131  CLSYSI  1148
              LS+ +
Sbjct  415   RLSFPL  420



>gb|ACU18259.1| unknown [Glycine max]
Length=247

 Score = 88.6 bits (218),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 60/142 (42%), Positives = 87/142 (61%), Gaps = 21/142 (15%)
 Frame = +3

Query  315  AATVIQTAFRCYLAKRALVALKGIVKLQALIRGQNVRRQARITLKCMQALFRVQERMREQ  494
            AA  IQTAFR +LA+RAL ALKG+V+LQAL+RG  VR+QA ITL+CMQAL RVQ R+R +
Sbjct  94   AAIRIQTAFRGFLARRALRALKGVVRLQALVRGHAVRKQAAITLRCMQALVRVQARVRAR  153

Query  495  --CARISQDSARKSMFSGSTNSWESKYIRERKSIFRDHCSVGEAWRDCPPTLQELEV-ML  665
              C  +   ++++       N  E++ +RE +          E W D   +++E++  +L
Sbjct  154  HVCMALETQASQQKHQQNLAN--EAR-VRETE----------EGWCDSVGSVEEIQAKIL  200

Query  666  QAQKAAFMRERCPS-----QAW  716
            + Q+AA  RER  +     QAW
Sbjct  201  KRQEAAAKRERAMAYALSHQAW  222



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3911414158386