BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c6205_g1_i1 len=267 path=[245:0-266]

Length=267
                                                                      Score     E

ref|XP_006347839.1|  PREDICTED: mitochondrial import inner membra...    105   2e-24   
ref|XP_009779771.1|  PREDICTED: mitochondrial import inner membra...    102   2e-23   
emb|CDP03742.1|  unnamed protein product                                101   5e-23   
ref|XP_009606174.1|  PREDICTED: mitochondrial import inner membra...  99.8    1e-22   
ref|XP_009616195.1|  PREDICTED: mitochondrial import inner membra...    100   2e-22   
ref|XP_004230147.1|  PREDICTED: mitochondrial import inner membra...  99.8    2e-22   
ref|XP_009616194.1|  PREDICTED: mitochondrial import inner membra...  94.7    1e-20   
ref|XP_009606173.1|  PREDICTED: mitochondrial import inner membra...  94.4    1e-20   
ref|XP_007200990.1|  hypothetical protein PRUPE_ppa004998mg           92.8    6e-20   
ref|XP_011088685.1|  PREDICTED: mitochondrial import inner membra...  92.4    1e-19   
ref|XP_011088686.1|  PREDICTED: mitochondrial import inner membra...  92.0    1e-19   
ref|XP_008235680.1|  PREDICTED: mitochondrial import inner membra...  92.0    1e-19   
ref|XP_002278528.1|  PREDICTED: mitochondrial import inner membra...  90.5    4e-19   Vitis vinifera
emb|CBI37117.3|  unnamed protein product                              90.5    5e-19   
ref|XP_008382863.1|  PREDICTED: mitochondrial import inner membra...  89.7    9e-19   
gb|KDO60500.1|  hypothetical protein CISIN_1g011958mg                 87.8    1e-18   
gb|KDO60499.1|  hypothetical protein CISIN_1g011958mg                 87.8    1e-18   
ref|XP_006443840.1|  hypothetical protein CICLE_v10019992mg           87.8    2e-18   
gb|KDO60495.1|  hypothetical protein CISIN_1g011958mg                 87.8    3e-18   
ref|XP_009369483.1|  PREDICTED: mitochondrial import inner membra...  87.8    3e-18   
gb|KDO60496.1|  hypothetical protein CISIN_1g011958mg                 87.8    4e-18   
ref|XP_006443839.1|  hypothetical protein CICLE_v10019992mg           87.8    4e-18   
gb|KDO60498.1|  hypothetical protein CISIN_1g011958mg                 87.4    4e-18   
ref|XP_010105638.1|  Mitochondrial import inner membrane transloc...  87.4    6e-18   
ref|XP_004170047.1|  PREDICTED: uncharacterized protein LOC101231997  86.3    1e-17   
gb|KHG20040.1|  Mitochondrial import inner membrane translocase s...  85.5    3e-17   
ref|XP_008467188.1|  PREDICTED: mitochondrial import inner membra...  85.1    3e-17   
ref|XP_008467190.1|  PREDICTED: mitochondrial import inner membra...  84.7    4e-17   
gb|KGN51539.1|  hypothetical protein Csa_5G576810                     84.0    4e-17   
ref|XP_011092940.1|  PREDICTED: mitochondrial import inner membra...  85.1    5e-17   
ref|XP_004289941.1|  PREDICTED: mitochondrial import inner membra...  84.7    5e-17   
gb|KDP26532.1|  hypothetical protein JCGZ_17690                       84.7    5e-17   
gb|KDO60497.1|  hypothetical protein CISIN_1g011958mg                 84.3    6e-17   
ref|XP_004296689.1|  PREDICTED: mitochondrial import inner membra...  82.0    5e-16   
ref|XP_007050300.1|  Translocase inner membrane subunit 44-1 isof...  81.6    5e-16   
gb|KCW84738.1|  hypothetical protein EUGRSUZ_B01552                   81.6    6e-16   
ref|XP_007050298.1|  Translocase inner membrane subunit 44-2 isof...  81.6    7e-16   
ref|XP_011028804.1|  PREDICTED: mitochondrial import inner membra...  81.6    7e-16   
ref|XP_002300777.1|  mitochondrial import inner membrane transloc...  81.6    7e-16   Populus trichocarpa [western balsam poplar]
ref|XP_010505134.1|  PREDICTED: mitochondrial import inner membra...  81.3    8e-16   
ref|XP_006295848.1|  hypothetical protein CARUB_v10024977mg           81.3    8e-16   
ref|XP_010509513.1|  PREDICTED: mitochondrial import inner membra...  80.9    1e-15   
gb|EYU42231.1|  hypothetical protein MIMGU_mgv1a005119mg              80.5    2e-15   
ref|XP_002886284.1|  mitochondrial import inner membrane transloc...  80.1    2e-15   
ref|XP_011004058.1|  PREDICTED: mitochondrial import inner membra...  80.1    2e-15   
ref|XP_009354947.1|  PREDICTED: mitochondrial import inner membra...  80.1    2e-15   
ref|XP_011025982.1|  PREDICTED: mitochondrial import inner membra...  80.1    2e-15   
ref|XP_009775475.1|  PREDICTED: mitochondrial import inner membra...  79.0    6e-15   
gb|EYU40469.1|  hypothetical protein MIMGU_mgv1a005111mg              79.0    7e-15   
ref|XP_010262322.1|  PREDICTED: mitochondrial import inner membra...  77.8    2e-14   
ref|XP_006857281.1|  hypothetical protein AMTR_s00067p00028100        75.5    1e-13   
ref|XP_002307643.1|  mitochondrial import inner membrane transloc...  75.1    1e-13   Populus trichocarpa [western balsam poplar]
sp|Q1PF33.1|TI441_ARATH  RecName: Full=Mitochondrial import inner...  72.8    8e-13   Arabidopsis thaliana [mouse-ear cress]
gb|KFK40424.1|  hypothetical protein AALP_AA3G372000                  72.8    8e-13   
ref|XP_006408974.1|  hypothetical protein EUTSA_v10001977mg           72.4    1e-12   
ref|XP_002524608.1|  mitochondrial import inner membrane transloc...  72.0    1e-12   Ricinus communis
ref|NP_181151.3|  translocase inner membrane subunit 44-2             72.0    2e-12   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002881425.1|  attim44-2                                        71.2    3e-12   
gb|AAM15344.1|  hypothetical protein                                  71.2    3e-12   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010415621.1|  PREDICTED: mitochondrial import inner membra...  70.9    4e-12   
ref|XP_010489028.1|  PREDICTED: mitochondrial import inner membra...  70.9    5e-12   
ref|NP_565473.1|  translocase inner membrane subunit 44-1             70.5    6e-12   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010467806.1|  PREDICTED: mitochondrial import inner membra...  69.3    1e-11   
emb|CDY05768.1|  BnaC07g00350D                                        68.9    2e-11   
ref|XP_004515202.1|  PREDICTED: mitochondrial import inner membra...  67.4    6e-11   
ref|XP_010528436.1|  PREDICTED: mitochondrial import inner membra...  67.0    8e-11   
ref|XP_007148627.1|  hypothetical protein PHAVU_005G002100g           65.9    2e-10   
ref|XP_009102019.1|  PREDICTED: mitochondrial import inner membra...  65.5    3e-10   
emb|CDY03300.1|  BnaC09g10480D                                        65.1    3e-10   
ref|XP_009112672.1|  PREDICTED: mitochondrial import inner membra...  65.1    4e-10   
emb|CDY39780.1|  BnaA09g10320D                                        64.3    6e-10   
ref|XP_004981398.1|  PREDICTED: mitochondrial import inner membra...  63.9    1e-09   
ref|NP_001131676.1|  uncharacterized protein LOC100193036             63.2    2e-09   Zea mays [maize]
ref|XP_003596691.1|  Mitochondrial import inner membrane transloc...  63.2    2e-09   
emb|CDY31958.1|  BnaA07g00370D                                        63.2    2e-09   
ref|XP_006299774.1|  hypothetical protein CARUB_v10015970mg           62.8    3e-09   
ref|XP_008785775.1|  PREDICTED: mitochondrial import inner membra...  62.8    3e-09   
gb|KEH30606.1|  import inner membrane translocase subunit TIM44-2     62.8    3e-09   
gb|KEH30605.1|  import inner membrane translocase subunit TIM44-2     62.8    3e-09   
gb|KEH30609.1|  import inner membrane translocase subunit TIM44-2     62.0    4e-09   
ref|XP_002463439.1|  hypothetical protein SORBIDRAFT_02g043830        62.0    5e-09   Sorghum bicolor [broomcorn]
ref|NP_001059443.1|  Os07g0409700                                     61.2    8e-09   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009411915.1|  PREDICTED: mitochondrial import inner membra...  60.5    2e-08   
ref|XP_009411916.1|  PREDICTED: mitochondrial import inner membra...  60.5    2e-08   
ref|XP_010696497.1|  PREDICTED: mitochondrial import inner membra...  59.3    4e-08   
ref|XP_003605359.1|  Mitochondrial import inner membrane transloc...  58.9    6e-08   
gb|AES87556.2|  import inner membrane translocase subunit TIM44-2     58.5    6e-08   
ref|XP_006657708.1|  PREDICTED: mitochondrial import inner membra...  58.2    1e-07   
gb|KHN24793.1|  Mitochondrial import inner membrane translocase s...  57.4    2e-07   
ref|XP_003522818.1|  PREDICTED: mitochondrial import inner membra...  57.4    2e-07   
ref|XP_010911925.1|  PREDICTED: mitochondrial import inner membra...  55.1    1e-06   
ref|XP_010911926.1|  PREDICTED: mitochondrial import inner membra...  54.7    2e-06   
ref|XP_003562644.1|  PREDICTED: mitochondrial import inner membra...  53.5    4e-06   
dbj|BAJ91902.1|  predicted protein                                    51.2    2e-05   
gb|EMT23052.1|  Mitochondrial import inner membrane translocase s...  50.1    7e-05   
gb|EMS55855.1|  Mitochondrial import inner membrane translocase s...  49.7    8e-05   
ref|XP_002977178.1|  hypothetical protein SELMODRAFT_176052           47.0    7e-04   



>ref|XP_006347839.1| PREDICTED: mitochondrial import inner membrane translocase subunit 
TIM44-2-like [Solanum tuberosum]
Length=497

 Score =   105 bits (261),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 70/91 (77%), Positives = 76/91 (84%), Gaps = 2/91 (2%)
 Frame = +1

Query  1    QLLVPQQV--GRGATSLRLVQAYGYAGNRQFSVFNEFSQKFKGEFNRNKEFQQSvkelke  174
            ++L PQQV  GR AT+LR V A GY G R F VFNEFS+K KGE + N+EFQQSVK LKE
Sbjct  20   RILAPQQVVSGRVATNLRFVGADGYLGIRHFGVFNEFSKKVKGEVDSNQEFQQSVKVLKE  79

Query  175  kaeelkgvkeDLKTRTKQTTEQLYKHVDGVW  267
            KAEELKGVKEDLKTRTKQTTEQLYKHVDGVW
Sbjct  80   KAEELKGVKEDLKTRTKQTTEQLYKHVDGVW  110



>ref|XP_009779771.1| PREDICTED: mitochondrial import inner membrane translocase subunit 
TIM44-2 [Nicotiana sylvestris]
Length=496

 Score =   102 bits (254),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 70/92 (76%), Positives = 76/92 (83%), Gaps = 3/92 (3%)
 Frame = +1

Query  1    QLLVPQQV--GRGATSLRLVQA-YGYAGNRQFSVFNEFSQKFKGEFNRNKEFQQSvkelk  171
            ++L PQQV  GR AT+LRLV A   Y G R F VFNEFS+K KGE +RN+EFQQSVK LK
Sbjct  20   RILAPQQVVYGRVATNLRLVGADRHYPGIRNFGVFNEFSKKVKGEVDRNQEFQQSVKVLK  79

Query  172  ekaeelkgvkeDLKTRTKQTTEQLYKHVDGVW  267
            EKAEELK VKEDLKTRTKQTTEQLYKHVDGVW
Sbjct  80   EKAEELKEVKEDLKTRTKQTTEQLYKHVDGVW  111



>emb|CDP03742.1| unnamed protein product [Coffea canephora]
Length=496

 Score =   101 bits (252),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 69/90 (77%), Positives = 74/90 (82%), Gaps = 1/90 (1%)
 Frame = +1

Query  1    QLLVPQQVGRGATSLRLV-QAYGYAGNRQFSVFNEFSQKFKGEFNRNKEFQQSvkelkek  177
            QLL PQ V  GAT LRL  Q  G+   RQFSVFNEFS K KGE ++N++FQQSVKELKEK
Sbjct  20   QLLAPQMVSSGATRLRLTTQVNGFGVRRQFSVFNEFSNKIKGEASKNQDFQQSVKELKEK  79

Query  178  aeelkgvkeDLKTRTKQTTEQLYKHVDGVW  267
            AEELKGVKEDLK RTKQTTEQLYKHVDGVW
Sbjct  80   AEELKGVKEDLKARTKQTTEQLYKHVDGVW  109



>ref|XP_009606174.1| PREDICTED: mitochondrial import inner membrane translocase subunit 
TIM44-2-like isoform X2 [Nicotiana tomentosiformis]
Length=446

 Score = 99.8 bits (247),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 70/92 (76%), Positives = 77/92 (84%), Gaps = 3/92 (3%)
 Frame = +1

Query  1    QLLVPQQV--GRGATSLRLVQA-YGYAGNRQFSVFNEFSQKFKGEFNRNKEFQQSvkelk  171
            ++L PQQV  GR AT+LRLV A   Y G R F VFNEFS+K KGE +RN+EF+QSVK LK
Sbjct  20   RILAPQQVVYGRIATNLRLVGADRHYLGIRNFGVFNEFSKKVKGEVDRNQEFKQSVKVLK  79

Query  172  ekaeelkgvkeDLKTRTKQTTEQLYKHVDGVW  267
            EKAEELKGVKEDLKTRTKQTTEQLYKHVDGVW
Sbjct  80   EKAEELKGVKEDLKTRTKQTTEQLYKHVDGVW  111



>ref|XP_009616195.1| PREDICTED: mitochondrial import inner membrane translocase subunit 
TIM44-2 isoform X2 [Nicotiana tomentosiformis]
Length=496

 Score =   100 bits (248),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 70/92 (76%), Positives = 77/92 (84%), Gaps = 3/92 (3%)
 Frame = +1

Query  1    QLLVPQQV--GRGATSLRLVQA-YGYAGNRQFSVFNEFSQKFKGEFNRNKEFQQSvkelk  171
            ++L PQQV  GR AT+LRLV A   Y G R F VFNEFS+K KGE +RN+EF+QSVK LK
Sbjct  20   RILAPQQVVYGRIATNLRLVGADRHYLGIRNFGVFNEFSKKVKGEVDRNQEFKQSVKVLK  79

Query  172  ekaeelkgvkeDLKTRTKQTTEQLYKHVDGVW  267
            EKAEELKGVKEDLKTRTKQTTEQLYKHVDGVW
Sbjct  80   EKAEELKGVKEDLKTRTKQTTEQLYKHVDGVW  111



>ref|XP_004230147.1| PREDICTED: mitochondrial import inner membrane translocase subunit 
TIM44-2 [Solanum lycopersicum]
Length=498

 Score = 99.8 bits (247),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 68/91 (75%), Positives = 74/91 (81%), Gaps = 2/91 (2%)
 Frame = +1

Query  1    QLLVPQQV--GRGATSLRLVQAYGYAGNRQFSVFNEFSQKFKGEFNRNKEFQQSvkelke  174
            ++L PQQV  GR  T+LR V A  Y G R F VFNEFS+K KGE + N+EFQQSVK LKE
Sbjct  20   RILAPQQVVLGRVTTNLRFVGADRYLGIRHFGVFNEFSKKVKGEVDSNQEFQQSVKVLKE  79

Query  175  kaeelkgvkeDLKTRTKQTTEQLYKHVDGVW  267
            KAEELKGVKEDLKTRTKQTTEQLYKHVDGVW
Sbjct  80   KAEELKGVKEDLKTRTKQTTEQLYKHVDGVW  110



>ref|XP_009616194.1| PREDICTED: mitochondrial import inner membrane translocase subunit 
TIM44-2 isoform X1 [Nicotiana tomentosiformis]
Length=504

 Score = 94.7 bits (234),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 70/100 (70%), Positives = 77/100 (77%), Gaps = 11/100 (11%)
 Frame = +1

Query  1    QLLVPQQV----------GRGATSLRLVQA-YGYAGNRQFSVFNEFSQKFKGEFNRNKEF  147
            ++L PQQV          GR AT+LRLV A   Y G R F VFNEFS+K KGE +RN+EF
Sbjct  20   RILAPQQVLVWGWGVVVYGRIATNLRLVGADRHYLGIRNFGVFNEFSKKVKGEVDRNQEF  79

Query  148  QQSvkelkekaeelkgvkeDLKTRTKQTTEQLYKHVDGVW  267
            +QSVK LKEKAEELKGVKEDLKTRTKQTTEQLYKHVDGVW
Sbjct  80   KQSVKVLKEKAEELKGVKEDLKTRTKQTTEQLYKHVDGVW  119



>ref|XP_009606173.1| PREDICTED: mitochondrial import inner membrane translocase subunit 
TIM44-2-like isoform X1 [Nicotiana tomentosiformis]
Length=454

 Score = 94.4 bits (233),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 70/100 (70%), Positives = 77/100 (77%), Gaps = 11/100 (11%)
 Frame = +1

Query  1    QLLVPQQV----------GRGATSLRLVQA-YGYAGNRQFSVFNEFSQKFKGEFNRNKEF  147
            ++L PQQV          GR AT+LRLV A   Y G R F VFNEFS+K KGE +RN+EF
Sbjct  20   RILAPQQVLVWGWGVVVYGRIATNLRLVGADRHYLGIRNFGVFNEFSKKVKGEVDRNQEF  79

Query  148  QQSvkelkekaeelkgvkeDLKTRTKQTTEQLYKHVDGVW  267
            +QSVK LKEKAEELKGVKEDLKTRTKQTTEQLYKHVDGVW
Sbjct  80   KQSVKVLKEKAEELKGVKEDLKTRTKQTTEQLYKHVDGVW  119



>ref|XP_007200990.1| hypothetical protein PRUPE_ppa004998mg [Prunus persica]
 gb|EMJ02189.1| hypothetical protein PRUPE_ppa004998mg [Prunus persica]
Length=482

 Score = 92.8 bits (229),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 64/89 (72%), Positives = 74/89 (83%), Gaps = 2/89 (2%)
 Frame = +1

Query  1    QLLVPQQVGRGATSLRLVQAYGYAGNRQFSVFNEFSQKFKGEFNRNKEFQQSvkelkeka  180
            QL + QQV   +T +RL+ A GY+G+R+FSVFNEFS++ KGE  +N EFQQSVKELKEKA
Sbjct  20   QLTLQQQVS--STRIRLISANGYSGSRRFSVFNEFSKQVKGEATKNPEFQQSVKELKEKA  77

Query  181  eelkgvkeDLKTRTKQTTEQLYKHVDGVW  267
            EELKGVKEDLK RTKQTTEQLYK VDG W
Sbjct  78   EELKGVKEDLKVRTKQTTEQLYKQVDGAW  106



>ref|XP_011088685.1| PREDICTED: mitochondrial import inner membrane translocase subunit 
TIM44-2-like isoform X1 [Sesamum indicum]
Length=495

 Score = 92.4 bits (228),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 61/89 (69%), Positives = 69/89 (78%), Gaps = 0/89 (0%)
 Frame = +1

Query  1    QLLVPQQVGRGATSLRLVQAYGYAGNRQFSVFNEFSQKFKGEFNRNKEFQQSvkelkeka  180
            QLL+ QQV    T L  V   GY+  R+F V NEFS+K KGE  RN++FQQS+KE+KEKA
Sbjct  21   QLLMSQQVSSRRTRLPAVPPNGYSFRREFGVLNEFSKKIKGEVERNQDFQQSIKEIKEKA  80

Query  181  eelkgvkeDLKTRTKQTTEQLYKHVDGVW  267
            E LKGVKEDLK RTKQTTEQLYKHVDGVW
Sbjct  81   EGLKGVKEDLKVRTKQTTEQLYKHVDGVW  109



>ref|XP_011088686.1| PREDICTED: mitochondrial import inner membrane translocase subunit 
TIM44-2-like isoform X2 [Sesamum indicum]
Length=471

 Score = 92.0 bits (227),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 61/89 (69%), Positives = 69/89 (78%), Gaps = 0/89 (0%)
 Frame = +1

Query  1    QLLVPQQVGRGATSLRLVQAYGYAGNRQFSVFNEFSQKFKGEFNRNKEFQQSvkelkeka  180
            QLL+ QQV    T L  V   GY+  R+F V NEFS+K KGE  RN++FQQS+KE+KEKA
Sbjct  21   QLLMSQQVSSRRTRLPAVPPNGYSFRREFGVLNEFSKKIKGEVERNQDFQQSIKEIKEKA  80

Query  181  eelkgvkeDLKTRTKQTTEQLYKHVDGVW  267
            E LKGVKEDLK RTKQTTEQLYKHVDGVW
Sbjct  81   EGLKGVKEDLKVRTKQTTEQLYKHVDGVW  109



>ref|XP_008235680.1| PREDICTED: mitochondrial import inner membrane translocase subunit 
TIM44-2 [Prunus mume]
Length=482

 Score = 92.0 bits (227),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 63/87 (72%), Positives = 72/87 (83%), Gaps = 1/87 (1%)
 Frame = +1

Query  7    LVPQQVGRGATSLRLVQAYGYAGNRQFSVFNEFSQKFKGEFNRNKEFQQSvkelkekaee  186
            L PQQ    +T +RL+ A GY+G+R+FSVFNEFS++ KGE  +N EFQQSVKELKEKAEE
Sbjct  21   LTPQQ-QVSSTRIRLISANGYSGSRRFSVFNEFSKQVKGEATKNPEFQQSVKELKEKAEE  79

Query  187  lkgvkeDLKTRTKQTTEQLYKHVDGVW  267
            LKGVKEDLK RTKQTTEQLYK VDG W
Sbjct  80   LKGVKEDLKVRTKQTTEQLYKQVDGAW  106



>ref|XP_002278528.1| PREDICTED: mitochondrial import inner membrane translocase subunit 
TIM44-2 [Vitis vinifera]
Length=485

 Score = 90.5 bits (223),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 60/75 (80%), Positives = 64/75 (85%), Gaps = 0/75 (0%)
 Frame = +1

Query  43   LRLVQAYGYAGNRQFSVFNEFSQKFKGEFNRNKEFQQSvkelkekaeelkgvkeDLKTRT  222
            LRL+   G +G R FSVFNEFS K KGE NRN EFQQ+VKELKEKAEELKGVKE+LK RT
Sbjct  32   LRLISPNGCSGYRGFSVFNEFSNKIKGEVNRNSEFQQTVKELKEKAEELKGVKEELKVRT  91

Query  223  KQTTEQLYKHVDGVW  267
            KQTTEQLYKHVDGVW
Sbjct  92   KQTTEQLYKHVDGVW  106



>emb|CBI37117.3| unnamed protein product [Vitis vinifera]
Length=484

 Score = 90.5 bits (223),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 60/75 (80%), Positives = 64/75 (85%), Gaps = 0/75 (0%)
 Frame = +1

Query  43   LRLVQAYGYAGNRQFSVFNEFSQKFKGEFNRNKEFQQSvkelkekaeelkgvkeDLKTRT  222
            LRL+   G +G R FSVFNEFS K KGE NRN EFQQ+VKELKEKAEELKGVKE+LK RT
Sbjct  32   LRLISPNGCSGYRGFSVFNEFSNKIKGEVNRNSEFQQTVKELKEKAEELKGVKEELKVRT  91

Query  223  KQTTEQLYKHVDGVW  267
            KQTTEQLYKHVDGVW
Sbjct  92   KQTTEQLYKHVDGVW  106



>ref|XP_008382863.1| PREDICTED: mitochondrial import inner membrane translocase subunit 
TIM44-2-like [Malus domestica]
Length=488

 Score = 89.7 bits (221),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 63/89 (71%), Positives = 71/89 (80%), Gaps = 2/89 (2%)
 Frame = +1

Query  1    QLLVPQQVGRGATSLRLVQAYGYAGNRQFSVFNEFSQKFKGEFNRNKEFQQSvkelkeka  180
             L   QQV  G   +RL+ + GY GNR+FSVFNEFS++FKGE  +N EFQQSVKELKEKA
Sbjct  20   HLTSQQQVSSG--RVRLISSNGYLGNRRFSVFNEFSKQFKGEATKNHEFQQSVKELKEKA  77

Query  181  eelkgvkeDLKTRTKQTTEQLYKHVDGVW  267
            EELKGVKEDLK RTKQT+EQLYK VDG W
Sbjct  78   EELKGVKEDLKVRTKQTSEQLYKRVDGAW  106



>gb|KDO60500.1| hypothetical protein CISIN_1g011958mg [Citrus sinensis]
Length=310

 Score = 87.8 bits (216),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 58/79 (73%), Positives = 65/79 (82%), Gaps = 0/79 (0%)
 Frame = +1

Query  31   GATSLRLVQAYGYAGNRQFSVFNEFSQKFKGEFNRNKEFQQSvkelkekaeelkgvkeDL  210
             +T LRLV A GY+ NRQFSVF EFS+K KGE   N EF+ SVKELK+KAEE+KGVKE+L
Sbjct  28   SSTRLRLVSANGYSSNRQFSVFKEFSKKIKGEAESNPEFKHSVKELKKKAEEIKGVKEEL  87

Query  211  KTRTKQTTEQLYKHVDGVW  267
            K RTKQTTEQLYK VDGVW
Sbjct  88   KERTKQTTEQLYKQVDGVW  106



>gb|KDO60499.1| hypothetical protein CISIN_1g011958mg [Citrus sinensis]
Length=337

 Score = 87.8 bits (216),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 58/79 (73%), Positives = 65/79 (82%), Gaps = 0/79 (0%)
 Frame = +1

Query  31   GATSLRLVQAYGYAGNRQFSVFNEFSQKFKGEFNRNKEFQQSvkelkekaeelkgvkeDL  210
             +T LRLV A GY+ NRQFSVF EFS+K KGE   N EF+ SVKELK+KAEE+KGVKE+L
Sbjct  28   SSTRLRLVSANGYSSNRQFSVFKEFSKKIKGEAESNPEFKHSVKELKKKAEEIKGVKEEL  87

Query  211  KTRTKQTTEQLYKHVDGVW  267
            K RTKQTTEQLYK VDGVW
Sbjct  88   KERTKQTTEQLYKQVDGVW  106



>ref|XP_006443840.1| hypothetical protein CICLE_v10019992mg [Citrus clementina]
 gb|ESR57080.1| hypothetical protein CICLE_v10019992mg [Citrus clementina]
Length=409

 Score = 87.8 bits (216),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 58/79 (73%), Positives = 65/79 (82%), Gaps = 0/79 (0%)
 Frame = +1

Query  31   GATSLRLVQAYGYAGNRQFSVFNEFSQKFKGEFNRNKEFQQSvkelkekaeelkgvkeDL  210
             +T LRLV A GY+ NRQFSVF EFS+K KGE   N EF+ SVKELK+KAEE+KGVKE+L
Sbjct  28   SSTRLRLVSANGYSSNRQFSVFKEFSKKIKGEAESNPEFKHSVKELKKKAEEIKGVKEEL  87

Query  211  KTRTKQTTEQLYKHVDGVW  267
            K RTKQTTEQLYK VDGVW
Sbjct  88   KERTKQTTEQLYKQVDGVW  106



>gb|KDO60495.1| hypothetical protein CISIN_1g011958mg [Citrus sinensis]
Length=474

 Score = 87.8 bits (216),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 58/79 (73%), Positives = 65/79 (82%), Gaps = 0/79 (0%)
 Frame = +1

Query  31   GATSLRLVQAYGYAGNRQFSVFNEFSQKFKGEFNRNKEFQQSvkelkekaeelkgvkeDL  210
             +T LRLV A GY+ NRQFSVF EFS+K KGE   N EF+ SVKELK+KAEE+KGVKE+L
Sbjct  28   SSTRLRLVSANGYSSNRQFSVFKEFSKKIKGEAESNPEFKHSVKELKKKAEEIKGVKEEL  87

Query  211  KTRTKQTTEQLYKHVDGVW  267
            K RTKQTTEQLYK VDGVW
Sbjct  88   KERTKQTTEQLYKQVDGVW  106



>ref|XP_009369483.1| PREDICTED: mitochondrial import inner membrane translocase subunit 
TIM44-2-like [Pyrus x bretschneideri]
Length=488

 Score = 87.8 bits (216),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 61/84 (73%), Positives = 70/84 (83%), Gaps = 2/84 (2%)
 Frame = +1

Query  16   QQVGRGATSLRLVQAYGYAGNRQFSVFNEFSQKFKGEFNRNKEFQQSvkelkekaeelkg  195
            QQV   +  +RL+ A GY GNR+FSVFNEFS++FKGE  +N +FQQSVKELKEKAEELKG
Sbjct  25   QQVS--SARVRLISANGYLGNRRFSVFNEFSKQFKGEATKNPQFQQSVKELKEKAEELKG  82

Query  196  vkeDLKTRTKQTTEQLYKHVDGVW  267
            VKEDLK RTKQT+EQLYK VDG W
Sbjct  83   VKEDLKVRTKQTSEQLYKRVDGAW  106



>gb|KDO60496.1| hypothetical protein CISIN_1g011958mg [Citrus sinensis]
Length=474

 Score = 87.8 bits (216),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 58/79 (73%), Positives = 65/79 (82%), Gaps = 0/79 (0%)
 Frame = +1

Query  31   GATSLRLVQAYGYAGNRQFSVFNEFSQKFKGEFNRNKEFQQSvkelkekaeelkgvkeDL  210
             +T LRLV A GY+ NRQFSVF EFS+K KGE   N EF+ SVKELK+KAEE+KGVKE+L
Sbjct  28   SSTRLRLVSANGYSSNRQFSVFKEFSKKIKGEAESNPEFKHSVKELKKKAEEIKGVKEEL  87

Query  211  KTRTKQTTEQLYKHVDGVW  267
            K RTKQTTEQLYK VDGVW
Sbjct  88   KERTKQTTEQLYKQVDGVW  106



>ref|XP_006443839.1| hypothetical protein CICLE_v10019992mg [Citrus clementina]
 ref|XP_006479542.1| PREDICTED: mitochondrial import inner membrane translocase subunit 
TIM44-2-like [Citrus sinensis]
 gb|ESR57079.1| hypothetical protein CICLE_v10019992mg [Citrus clementina]
Length=474

 Score = 87.8 bits (216),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 58/79 (73%), Positives = 65/79 (82%), Gaps = 0/79 (0%)
 Frame = +1

Query  31   GATSLRLVQAYGYAGNRQFSVFNEFSQKFKGEFNRNKEFQQSvkelkekaeelkgvkeDL  210
             +T LRLV A GY+ NRQFSVF EFS+K KGE   N EF+ SVKELK+KAEE+KGVKE+L
Sbjct  28   SSTRLRLVSANGYSSNRQFSVFKEFSKKIKGEAESNPEFKHSVKELKKKAEEIKGVKEEL  87

Query  211  KTRTKQTTEQLYKHVDGVW  267
            K RTKQTTEQLYK VDGVW
Sbjct  88   KERTKQTTEQLYKQVDGVW  106



>gb|KDO60498.1| hypothetical protein CISIN_1g011958mg [Citrus sinensis]
Length=443

 Score = 87.4 bits (215),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 58/79 (73%), Positives = 65/79 (82%), Gaps = 0/79 (0%)
 Frame = +1

Query  31   GATSLRLVQAYGYAGNRQFSVFNEFSQKFKGEFNRNKEFQQSvkelkekaeelkgvkeDL  210
             +T LRLV A GY+ NRQFSVF EFS+K KGE   N EF+ SVKELK+KAEE+KGVKE+L
Sbjct  28   SSTRLRLVSANGYSSNRQFSVFKEFSKKIKGEAESNPEFKHSVKELKKKAEEIKGVKEEL  87

Query  211  KTRTKQTTEQLYKHVDGVW  267
            K RTKQTTEQLYK VDGVW
Sbjct  88   KERTKQTTEQLYKQVDGVW  106



>ref|XP_010105638.1| Mitochondrial import inner membrane translocase subunit TIM44 
[Morus notabilis]
 gb|EXC05426.1| Mitochondrial import inner membrane translocase subunit TIM44 
[Morus notabilis]
Length=481

 Score = 87.4 bits (215),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 59/87 (68%), Positives = 68/87 (78%), Gaps = 0/87 (0%)
 Frame = +1

Query  7    LVPQQVGRGATSLRLVQAYGYAGNRQFSVFNEFSQKFKGEFNRNKEFQQSvkelkekaee  186
            L   Q    ++ L L  A G++GNR+FSVFNEFS++ KGE N+N EFQQSVKELK+KA E
Sbjct  21   LTHSQPQASSSRLLLPPANGFSGNRRFSVFNEFSKQVKGEANKNSEFQQSVKELKDKARE  80

Query  187  lkgvkeDLKTRTKQTTEQLYKHVDGVW  267
            LKGVKEDLK RTKQTTEQLYK VDG W
Sbjct  81   LKGVKEDLKVRTKQTTEQLYKQVDGAW  107



>ref|XP_004170047.1| PREDICTED: uncharacterized protein LOC101231997 [Cucumis sativus]
Length=484

 Score = 86.3 bits (212),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 59/81 (73%), Positives = 67/81 (83%), Gaps = 0/81 (0%)
 Frame = +1

Query  25   GRGATSLRLVQAYGYAGNRQFSVFNEFSQKFKGEFNRNKEFQQSvkelkekaeelkgvke  204
            G   T  +L+   GY+ NR+FSVFNEFS+K KGE ++N EFQQSVKELKEKAEELKGVKE
Sbjct  25   GSSCTRSQLLLPSGYSINRRFSVFNEFSKKVKGEADKNTEFQQSVKELKEKAEELKGVKE  84

Query  205  DLKTRTKQTTEQLYKHVDGVW  267
            DLK RTKQTTEQ+YK VDGVW
Sbjct  85   DLKVRTKQTTEQIYKQVDGVW  105



>gb|KHG20040.1| Mitochondrial import inner membrane translocase subunit TIM44 
[Gossypium arboreum]
Length=475

 Score = 85.5 bits (210),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 50/75 (67%), Positives = 57/75 (76%), Gaps = 7/75 (9%)
 Frame = +1

Query  43   LRLVQAYGYAGNRQFSVFNEFSQKFKGEFNRNKEFQQSvkelkekaeelkgvkeDLKTRT  222
            LRL+   GY+ NRQFSVFNEFS+K KGE NRN++F+QS        EELKG  E+LK RT
Sbjct  31   LRLLSGKGYSRNRQFSVFNEFSKKIKGEANRNQDFKQS-------VEELKGKAEELKVRT  83

Query  223  KQTTEQLYKHVDGVW  267
            KQTTEQLYK VDGVW
Sbjct  84   KQTTEQLYKQVDGVW  98



>ref|XP_008467188.1| PREDICTED: mitochondrial import inner membrane translocase subunit 
TIM44-2-like isoform X1 [Cucumis melo]
 ref|XP_008467189.1| PREDICTED: mitochondrial import inner membrane translocase subunit 
TIM44-2-like isoform X1 [Cucumis melo]
Length=484

 Score = 85.1 bits (209),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 59/81 (73%), Positives = 66/81 (81%), Gaps = 0/81 (0%)
 Frame = +1

Query  25   GRGATSLRLVQAYGYAGNRQFSVFNEFSQKFKGEFNRNKEFQQSvkelkekaeelkgvke  204
            G   T  + +   GY+ NR+FSVFNEFS+K KGE ++N EFQQSVKELKEKAEELKGVKE
Sbjct  25   GSSCTRSQFLLPSGYSINRKFSVFNEFSKKVKGEADKNTEFQQSVKELKEKAEELKGVKE  84

Query  205  DLKTRTKQTTEQLYKHVDGVW  267
            DLK RTKQTTEQLYK VDGVW
Sbjct  85   DLKVRTKQTTEQLYKQVDGVW  105



>ref|XP_008467190.1| PREDICTED: mitochondrial import inner membrane translocase subunit 
TIM44-2-like isoform X2 [Cucumis melo]
Length=460

 Score = 84.7 bits (208),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 59/81 (73%), Positives = 66/81 (81%), Gaps = 0/81 (0%)
 Frame = +1

Query  25   GRGATSLRLVQAYGYAGNRQFSVFNEFSQKFKGEFNRNKEFQQSvkelkekaeelkgvke  204
            G   T  + +   GY+ NR+FSVFNEFS+K KGE ++N EFQQSVKELKEKAEELKGVKE
Sbjct  25   GSSCTRSQFLLPSGYSINRKFSVFNEFSKKVKGEADKNTEFQQSVKELKEKAEELKGVKE  84

Query  205  DLKTRTKQTTEQLYKHVDGVW  267
            DLK RTKQTTEQLYK VDGVW
Sbjct  85   DLKVRTKQTTEQLYKQVDGVW  105



>gb|KGN51539.1| hypothetical protein Csa_5G576810 [Cucumis sativus]
Length=380

 Score = 84.0 bits (206),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 58/78 (74%), Positives = 66/78 (85%), Gaps = 0/78 (0%)
 Frame = +1

Query  34   ATSLRLVQAYGYAGNRQFSVFNEFSQKFKGEFNRNKEFQQSvkelkekaeelkgvkeDLK  213
             T  +L+   GY+ NR+FSVFNEFS+K KGE ++N EFQQSVKELKEKAEELKGVKEDLK
Sbjct  71   CTRSQLLLPSGYSINRRFSVFNEFSKKVKGEADKNTEFQQSVKELKEKAEELKGVKEDLK  130

Query  214  TRTKQTTEQLYKHVDGVW  267
             RTKQTTEQ+YK VDGVW
Sbjct  131  VRTKQTTEQIYKQVDGVW  148



>ref|XP_011092940.1| PREDICTED: mitochondrial import inner membrane translocase subunit 
TIM44-2-like [Sesamum indicum]
Length=498

 Score = 85.1 bits (209),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 59/89 (66%), Positives = 68/89 (76%), Gaps = 0/89 (0%)
 Frame = +1

Query  1    QLLVPQQVGRGATSLRLVQAYGYAGNRQFSVFNEFSQKFKGEFNRNKEFQQSvkelkeka  180
            QLL  Q +     SL+L         R+FSVF+EFS+K KGE +RN+EFQQSVKE+KEKA
Sbjct  23   QLLASQHIYSRLPSLQLFPPNRIFFRREFSVFDEFSKKIKGEIDRNREFQQSVKEIKEKA  82

Query  181  eelkgvkeDLKTRTKQTTEQLYKHVDGVW  267
            E+LKGVKEDLK RTKQTTEQLY HVDGVW
Sbjct  83   EDLKGVKEDLKARTKQTTEQLYTHVDGVW  111



>ref|XP_004289941.1| PREDICTED: mitochondrial import inner membrane translocase subunit 
TIM44-2-like [Fragaria vesca subsp. vesca]
Length=482

 Score = 84.7 bits (208),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 57/88 (65%), Positives = 71/88 (81%), Gaps = 1/88 (1%)
 Frame = +1

Query  4    LLVPQQVGRGATSLRLVQAYGYAGNRQFSVFNEFSQKFKGEFNRNKEFQQSvkelkekae  183
            +L  QQ   G T++RL+ A GY+GNR+FSVFNEFS++ K E N+N  F+++VKELK++ E
Sbjct  18   VLRSQQQASG-TNIRLLSANGYSGNRRFSVFNEFSKQVKEETNKNPHFKKTVKELKKQVE  76

Query  184  elkgvkeDLKTRTKQTTEQLYKHVDGVW  267
            ELKGVKEDLK RTKQTTEQLYK VDG W
Sbjct  77   ELKGVKEDLKVRTKQTTEQLYKQVDGAW  104



>gb|KDP26532.1| hypothetical protein JCGZ_17690 [Jatropha curcas]
Length=489

 Score = 84.7 bits (208),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 56/68 (82%), Positives = 60/68 (88%), Gaps = 0/68 (0%)
 Frame = +1

Query  64   GYAGNRQFSVFNEFSQKFKGEFNRNKEFQQSvkelkekaeelkgvkeDLKTRTKQTTEQL  243
            GY G R+F VFNEFS+K KGE  RN EFQQSVK+LKEKAEELKGVK+DLK RTKQTTEQL
Sbjct  44   GYLGYRRFGVFNEFSKKVKGEATRNPEFQQSVKDLKEKAEELKGVKDDLKVRTKQTTEQL  103

Query  244  YKHVDGVW  267
            YKHVDGVW
Sbjct  104  YKHVDGVW  111



>gb|KDO60497.1| hypothetical protein CISIN_1g011958mg [Citrus sinensis]
Length=463

 Score = 84.3 bits (207),  Expect = 6e-17, Method: Composition-based stats.
 Identities = 58/78 (74%), Positives = 65/78 (83%), Gaps = 0/78 (0%)
 Frame = +1

Query  34   ATSLRLVQAYGYAGNRQFSVFNEFSQKFKGEFNRNKEFQQSvkelkekaeelkgvkeDLK  213
            +T LRLV A GY+ NRQFSVF EFS+K KGE   N EF+ SVKELK+KAEE+KGVKE+LK
Sbjct  29   STRLRLVSANGYSSNRQFSVFKEFSKKIKGEAESNPEFKHSVKELKKKAEEIKGVKEELK  88

Query  214  TRTKQTTEQLYKHVDGVW  267
             RTKQTTEQLYK VDGVW
Sbjct  89   ERTKQTTEQLYKQVDGVW  106



>ref|XP_004296689.1| PREDICTED: mitochondrial import inner membrane translocase subunit 
TIM44-2-like [Fragaria vesca subsp. vesca]
Length=480

 Score = 82.0 bits (201),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 53/77 (69%), Positives = 66/77 (86%), Gaps = 0/77 (0%)
 Frame = +1

Query  37   TSLRLVQAYGYAGNRQFSVFNEFSQKFKGEFNRNKEFQQSvkelkekaeelkgvkeDLKT  216
            T +RL+   GY+GNR++SVFNEFS++ K E N+N +F+++VKELKE+ EELKGVKEDLK 
Sbjct  26   TKIRLLLGNGYSGNRRYSVFNEFSKQVKEETNKNPQFKKTVKELKEQVEELKGVKEDLKV  85

Query  217  RTKQTTEQLYKHVDGVW  267
            RTKQTTEQLYK VDGVW
Sbjct  86   RTKQTTEQLYKQVDGVW  102



>ref|XP_007050300.1| Translocase inner membrane subunit 44-1 isoform 3 [Theobroma 
cacao]
 gb|EOX94457.1| Translocase inner membrane subunit 44-1 isoform 3 [Theobroma 
cacao]
Length=461

 Score = 81.6 bits (200),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 48/75 (64%), Positives = 54/75 (72%), Gaps = 7/75 (9%)
 Frame = +1

Query  43   LRLVQAYGYAGNRQFSVFNEFSQKFKGEFNRNKEFQQSvkelkekaeelkgvkeDLKTRT  222
            LRL+   GY+ NR+FSVFNEFS K KGE NRN EF+QS        EELKG  E+LK RT
Sbjct  31   LRLLSGNGYSSNRRFSVFNEFSNKIKGEANRNPEFKQS-------VEELKGKAEELKVRT  83

Query  223  KQTTEQLYKHVDGVW  267
            KQTT+QLYK VDG W
Sbjct  84   KQTTQQLYKQVDGAW  98



>gb|KCW84738.1| hypothetical protein EUGRSUZ_B01552 [Eucalyptus grandis]
Length=459

 Score = 81.6 bits (200),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 55/78 (71%), Positives = 67/78 (86%), Gaps = 0/78 (0%)
 Frame = +1

Query  34   ATSLRLVQAYGYAGNRQFSVFNEFSQKFKGEFNRNKEFQQSvkelkekaeelkgvkeDLK  213
            ++ LRL+ A G++ NR++SVFNEFS+K KGE + N EFQ+SVK+LKEKAEELKGVKE+LK
Sbjct  49   SSRLRLITAGGHSCNRRYSVFNEFSKKVKGEASGNPEFQKSVKQLKEKAEELKGVKEELK  108

Query  214  TRTKQTTEQLYKHVDGVW  267
             RTKQTT QL KHVDGVW
Sbjct  109  VRTKQTTGQLCKHVDGVW  126



>ref|XP_007050298.1| Translocase inner membrane subunit 44-2 isoform 1 [Theobroma 
cacao]
 gb|EOX94455.1| Translocase inner membrane subunit 44-2 isoform 1 [Theobroma 
cacao]
Length=476

 Score = 81.6 bits (200),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 48/75 (64%), Positives = 54/75 (72%), Gaps = 7/75 (9%)
 Frame = +1

Query  43   LRLVQAYGYAGNRQFSVFNEFSQKFKGEFNRNKEFQQSvkelkekaeelkgvkeDLKTRT  222
            LRL+   GY+ NR+FSVFNEFS K KGE NRN EF+QS        EELKG  E+LK RT
Sbjct  31   LRLLSGNGYSSNRRFSVFNEFSNKIKGEANRNPEFKQS-------VEELKGKAEELKVRT  83

Query  223  KQTTEQLYKHVDGVW  267
            KQTT+QLYK VDG W
Sbjct  84   KQTTQQLYKQVDGAW  98



>ref|XP_011028804.1| PREDICTED: mitochondrial import inner membrane translocase subunit 
TIM44-2 [Populus euphratica]
Length=484

 Score = 81.6 bits (200),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 57/77 (74%), Positives = 66/77 (86%), Gaps = 2/77 (3%)
 Frame = +1

Query  43   LRLVQAYG--YAGNRQFSVFNEFSQKFKGEFNRNKEFQQSvkelkekaeelkgvkeDLKT  216
            L+++  +G  Y G R+FSVFNEFS K KGE +RN+EF+QSVKELKEKAEELKG KE+LK 
Sbjct  31   LQVLSNHGCTYYGYRRFSVFNEFSNKVKGEADRNQEFKQSVKELKEKAEELKGAKEELKV  90

Query  217  RTKQTTEQLYKHVDGVW  267
            RTKQTTEQLYKHVDGVW
Sbjct  91   RTKQTTEQLYKHVDGVW  107



>ref|XP_002300777.1| mitochondrial import inner membrane translocase subunit TIM44 
family protein [Populus trichocarpa]
 gb|EEE80050.1| mitochondrial import inner membrane translocase subunit TIM44 
family protein [Populus trichocarpa]
Length=484

 Score = 81.6 bits (200),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 57/77 (74%), Positives = 66/77 (86%), Gaps = 2/77 (3%)
 Frame = +1

Query  43   LRLVQAYG--YAGNRQFSVFNEFSQKFKGEFNRNKEFQQSvkelkekaeelkgvkeDLKT  216
            L+++  +G  Y G R+FSVFNEFS K KGE +RN+EF+QSVKELKEKAEELKG KE+LK 
Sbjct  31   LQVLSNHGCTYYGYRRFSVFNEFSNKVKGEADRNQEFKQSVKELKEKAEELKGAKEELKV  90

Query  217  RTKQTTEQLYKHVDGVW  267
            RTKQTTEQLYKHVDGVW
Sbjct  91   RTKQTTEQLYKHVDGVW  107



>ref|XP_010505134.1| PREDICTED: mitochondrial import inner membrane translocase subunit 
TIM44-2-like [Camelina sativa]
Length=483

 Score = 81.3 bits (199),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 59/89 (66%), Positives = 71/89 (80%), Gaps = 1/89 (1%)
 Frame = +1

Query  1    QLLVPQQVGRGATSLRLVQAYGYAGNRQFSVFNEFSQKFKGEFNRNKEFQQSvkelkeka  180
            QL   ++VG G   L L+Q  GYA +R+FSVF++FS+K +GE   N EFQ++VKELKE+A
Sbjct  20   QLTHQRRVGAGRLGL-LLQGNGYASHRRFSVFSDFSKKIRGEAESNPEFQKTVKELKERA  78

Query  181  eelkgvkeDLKTRTKQTTEQLYKHVDGVW  267
            EELKGVKEDLK RTKQTTEQLYK VDGVW
Sbjct  79   EELKGVKEDLKVRTKQTTEQLYKQVDGVW  107



>ref|XP_006295848.1| hypothetical protein CARUB_v10024977mg [Capsella rubella]
 gb|EOA28746.1| hypothetical protein CARUB_v10024977mg [Capsella rubella]
Length=473

 Score = 81.3 bits (199),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 54/80 (68%), Positives = 64/80 (80%), Gaps = 0/80 (0%)
 Frame = +1

Query  28   RGATSLRLVQAYGYAGNRQFSVFNEFSQKFKGEFNRNKEFQQSvkelkekaeelkgvkeD  207
            R    L L+Q  GYA +R FSVF+EFS+K +GE + N EFQ++VKELKE+A+ELK VKED
Sbjct  26   RVGARLGLLQGNGYASHRLFSVFSEFSKKIRGEADSNPEFQKTVKELKERAQELKSVKED  85

Query  208  LKTRTKQTTEQLYKHVDGVW  267
            LK RTKQTTEQLYK VDGVW
Sbjct  86   LKVRTKQTTEQLYKQVDGVW  105



>ref|XP_010509513.1| PREDICTED: mitochondrial import inner membrane translocase subunit 
TIM44-2 [Camelina sativa]
Length=480

 Score = 80.9 bits (198),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 58/89 (65%), Positives = 70/89 (79%), Gaps = 1/89 (1%)
 Frame = +1

Query  1    QLLVPQQVGRGATSLRLVQAYGYAGNRQFSVFNEFSQKFKGEFNRNKEFQQSvkelkeka  180
            QL   ++VG G   L L+Q  GYA +R+FSVF++FS+K +GE   N EFQ++VKELKE+A
Sbjct  20   QLTHQRRVGAGRLGL-LLQGNGYASHRRFSVFSDFSKKIRGEAESNPEFQKTVKELKERA  78

Query  181  eelkgvkeDLKTRTKQTTEQLYKHVDGVW  267
            EE KGVKEDLK RTKQTTEQLYK VDGVW
Sbjct  79   EEFKGVKEDLKVRTKQTTEQLYKQVDGVW  107



>gb|EYU42231.1| hypothetical protein MIMGU_mgv1a005119mg [Erythranthe guttata]
Length=496

 Score = 80.5 bits (197),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 57/89 (64%), Positives = 67/89 (75%), Gaps = 0/89 (0%)
 Frame = +1

Query  1    QLLVPQQVGRGATSLRLVQAYGYAGNRQFSVFNEFSQKFKGEFNRNKEFQQSvkelkeka  180
            QLL  QQV       +LV        R+FSVFNEFS+K KGE + N+E +QS+K++KEKA
Sbjct  22   QLLASQQVTGRWPMPQLVSPNSQLFRREFSVFNEFSKKMKGEVDSNEELKQSIKQIKEKA  81

Query  181  eelkgvkeDLKTRTKQTTEQLYKHVDGVW  267
            EELKGVKEDLK RTKQTTE+LYKHVDGVW
Sbjct  82   EELKGVKEDLKIRTKQTTEKLYKHVDGVW  110



>ref|XP_002886284.1| mitochondrial import inner membrane translocase subunit TIM44 
[Arabidopsis lyrata subsp. lyrata]
 gb|EFH62543.1| mitochondrial import inner membrane translocase subunit TIM44 
[Arabidopsis lyrata subsp. lyrata]
Length=477

 Score = 80.1 bits (196),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 54/87 (62%), Positives = 67/87 (77%), Gaps = 0/87 (0%)
 Frame = +1

Query  7    LVPQQVGRGATSLRLVQAYGYAGNRQFSVFNEFSQKFKGEFNRNKEFQQSvkelkekaee  186
            L  Q+V RG T    + A GY+ +R+FSVF+EFS+  +GE + N EFQ++VKE KE+AEE
Sbjct  21   LFHQRVLRGNTRSEFLPAIGYSSHRRFSVFSEFSKNIRGEADSNPEFQRTVKEFKERAEE  80

Query  187  lkgvkeDLKTRTKQTTEQLYKHVDGVW  267
             KGVKEDLK RTKQTT+QLYK VDGVW
Sbjct  81   FKGVKEDLKVRTKQTTDQLYKQVDGVW  107



>ref|XP_011004058.1| PREDICTED: mitochondrial import inner membrane translocase subunit 
TIM44-2-like isoform X1 [Populus euphratica]
 ref|XP_011004059.1| PREDICTED: mitochondrial import inner membrane translocase subunit 
TIM44-2-like isoform X2 [Populus euphratica]
Length=485

 Score = 80.1 bits (196),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 61/89 (69%), Positives = 74/89 (83%), Gaps = 4/89 (4%)
 Frame = +1

Query  7    LVPQQVGRGATSLRLVQAYG--YAGNRQFSVFNEFSQKFKGEFNRNKEFQQSvkelkeka  180
            L+ +QV   ++ L++V +YG  Y+G R+FSVFNEFS+K KGE  RN EF+QSVKELKEKA
Sbjct  21   LISKQVP--SSRLQVVSSYGCPYSGYRRFSVFNEFSKKVKGEAQRNLEFKQSVKELKEKA  78

Query  181  eelkgvkeDLKTRTKQTTEQLYKHVDGVW  267
            EELKGVKE+LK RTKQTTE+LYKHVD VW
Sbjct  79   EELKGVKEELKVRTKQTTEKLYKHVDCVW  107



>ref|XP_009354947.1| PREDICTED: mitochondrial import inner membrane translocase subunit 
TIM44-2-like [Pyrus x bretschneideri]
Length=488

 Score = 80.1 bits (196),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 54/74 (73%), Positives = 62/74 (84%), Gaps = 0/74 (0%)
 Frame = +1

Query  46   RLVQAYGYAGNRQFSVFNEFSQKFKGEFNRNKEFQQSvkelkekaeelkgvkeDLKTRTK  225
            RL+ A G+  NR+FS+FNEFS++ KGE  +N EFQQSVKELKEKAEELKGVK+D K RTK
Sbjct  33   RLISANGFLWNRRFSIFNEFSKQVKGEATKNPEFQQSVKELKEKAEELKGVKDDFKVRTK  92

Query  226  QTTEQLYKHVDGVW  267
            QTTEQLYK VDG W
Sbjct  93   QTTEQLYKQVDGAW  106



>ref|XP_011025982.1| PREDICTED: mitochondrial import inner membrane translocase subunit 
TIM44-2-like [Populus euphratica]
Length=485

 Score = 80.1 bits (196),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 61/89 (69%), Positives = 74/89 (83%), Gaps = 4/89 (4%)
 Frame = +1

Query  7    LVPQQVGRGATSLRLVQAYG--YAGNRQFSVFNEFSQKFKGEFNRNKEFQQSvkelkeka  180
            L+ +QV   ++ L++V +YG  Y+G R+FSVFNEFS+K KGE  RN EF+QSVKELKEKA
Sbjct  21   LITKQVP--SSRLQVVSSYGCPYSGYRRFSVFNEFSKKVKGEAQRNLEFKQSVKELKEKA  78

Query  181  eelkgvkeDLKTRTKQTTEQLYKHVDGVW  267
            EELKGVKE+LK RTKQTTE+LYKHVD VW
Sbjct  79   EELKGVKEELKVRTKQTTEKLYKHVDCVW  107



>ref|XP_009775475.1| PREDICTED: mitochondrial import inner membrane translocase subunit 
TIM44-2-like [Nicotiana sylvestris]
Length=453

 Score = 79.0 bits (193),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 57/88 (65%), Positives = 68/88 (77%), Gaps = 6/88 (7%)
 Frame = +1

Query  4    LLVPQQVGRGATSLRLVQAYGYAGNRQFSVFNEFSQKFKGEFNRNKEFQQSvkelkekae  183
            L+ PQQV      +RL+ A  Y G R ++VFNEFS++ +GE  RN+EFQ+SVK+LKEKAE
Sbjct  22   LVPPQQV------VRLIGAERYVGIRPYTVFNEFSKQVRGEVYRNQEFQRSVKQLKEKAE  75

Query  184  elkgvkeDLKTRTKQTTEQLYKHVDGVW  267
            ELKGVKED KTR KQTT  LYKHVDGVW
Sbjct  76   ELKGVKEDFKTRMKQTTGTLYKHVDGVW  103



>gb|EYU40469.1| hypothetical protein MIMGU_mgv1a005111mg [Erythranthe guttata]
Length=496

 Score = 79.0 bits (193),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 56/89 (63%), Positives = 66/89 (74%), Gaps = 0/89 (0%)
 Frame = +1

Query  1    QLLVPQQVGRGATSLRLVQAYGYAGNRQFSVFNEFSQKFKGEFNRNKEFQQSvkelkeka  180
            QLL  QQV       +LV        R+FSVFNEFS+K KGE + N+E +QS+K++KEKA
Sbjct  22   QLLASQQVTGRWPMPQLVSPNSQLFRREFSVFNEFSKKMKGEVDSNEELKQSIKQIKEKA  81

Query  181  eelkgvkeDLKTRTKQTTEQLYKHVDGVW  267
            EELKGVKEDLK RTKQTTE+LYKHVDG W
Sbjct  82   EELKGVKEDLKIRTKQTTEKLYKHVDGAW  110



>ref|XP_010262322.1| PREDICTED: mitochondrial import inner membrane translocase subunit 
TIM44-2 [Nelumbo nucifera]
Length=485

 Score = 77.8 bits (190),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 53/77 (69%), Positives = 61/77 (79%), Gaps = 0/77 (0%)
 Frame = +1

Query  37   TSLRLVQAYGYAGNRQFSVFNEFSQKFKGEFNRNKEFQQSvkelkekaeelkgvkeDLKT  216
            T LRL    GY+  R+FSVFNEFS++ KGE   N +FQ+S+KELKEK EELKGVKE+LK 
Sbjct  29   TRLRLPSRNGYSACRRFSVFNEFSKQVKGEAKCNPDFQKSIKELKEKTEELKGVKEELKV  88

Query  217  RTKQTTEQLYKHVDGVW  267
            RTKQTTEQLYKH D VW
Sbjct  89   RTKQTTEQLYKHADSVW  105



>ref|XP_006857281.1| hypothetical protein AMTR_s00067p00028100 [Amborella trichopoda]
 gb|ERN18748.1| hypothetical protein AMTR_s00067p00028100 [Amborella trichopoda]
Length=480

 Score = 75.5 bits (184),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 48/74 (65%), Positives = 60/74 (81%), Gaps = 0/74 (0%)
 Frame = +1

Query  46   RLVQAYGYAGNRQFSVFNEFSQKFKGEFNRNKEFQQSvkelkekaeelkgvkeDLKTRTK  225
            R + A G + +R+FSVFNEFS++FKG+ N N EFQ+++K+LKEKA  LK VKE+LK RTK
Sbjct  31   RSICAPGVSASRRFSVFNEFSKQFKGQANSNPEFQKTIKDLKEKAGGLKEVKEELKVRTK  90

Query  226  QTTEQLYKHVDGVW  267
            QTTEQLYK VD VW
Sbjct  91   QTTEQLYKRVDDVW  104



>ref|XP_002307643.1| mitochondrial import inner membrane translocase subunit TIM44 
family protein [Populus trichocarpa]
 gb|EEE94639.1| mitochondrial import inner membrane translocase subunit TIM44 
family protein [Populus trichocarpa]
Length=485

 Score = 75.1 bits (183),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 57/80 (71%), Positives = 67/80 (84%), Gaps = 2/80 (3%)
 Frame = +1

Query  34   ATSLRLVQAYG--YAGNRQFSVFNEFSQKFKGEFNRNKEFQQSvkelkekaeelkgvkeD  207
            ++ L++V  YG  Y+G R+FSVFNEFS+K KGE   N EF+QSVKELKEKAEELKGVKE+
Sbjct  28   SSRLQVVSNYGCPYSGYRRFSVFNEFSKKVKGEAQINLEFKQSVKELKEKAEELKGVKEE  87

Query  208  LKTRTKQTTEQLYKHVDGVW  267
            LK RTKQTTE+LYKHVD VW
Sbjct  88   LKVRTKQTTEKLYKHVDCVW  107



>sp|Q1PF33.1|TI441_ARATH RecName: Full=Mitochondrial import inner membrane translocase 
subunit TIM44-1; Flags: Precursor [Arabidopsis thaliana]
 gb|ABE65836.1| mitochondrial import inner membrane translocase subunit TIM44 
[Arabidopsis thaliana]
Length=474

 Score = 72.8 bits (177),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 48/84 (57%), Positives = 60/84 (71%), Gaps = 0/84 (0%)
 Frame = +1

Query  16   QQVGRGATSLRLVQAYGYAGNRQFSVFNEFSQKFKGEFNRNKEFQQSvkelkekaeelkg  195
            Q+V R       + A GY  +R+FSVF EFS+  +GE + N EF+++VKELKE+ EE KG
Sbjct  24   QRVLRANARSEFLPAIGYTSHRRFSVFTEFSKNIRGEAHSNPEFERTVKELKERTEEFKG  83

Query  196  vkeDLKTRTKQTTEQLYKHVDGVW  267
            V EDLK RTKQTTE+LYK  DGVW
Sbjct  84   VTEDLKVRTKQTTEKLYKQADGVW  107



>gb|KFK40424.1| hypothetical protein AALP_AA3G372000 [Arabis alpina]
Length=476

 Score = 72.8 bits (177),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 49/80 (61%), Positives = 61/80 (76%), Gaps = 0/80 (0%)
 Frame = +1

Query  28   RGATSLRLVQAYGYAGNRQFSVFNEFSQKFKGEFNRNKEFQQSvkelkekaeelkgvkeD  207
            R    L  + A G+A NR+FSVF++FS+K KGE   N EFQ++VKE KEKA+E KGVK+D
Sbjct  26   RVGARLGFMPANGFAINRRFSVFSDFSKKIKGEVESNPEFQKTVKEFKEKADEFKGVKDD  85

Query  208  LKTRTKQTTEQLYKHVDGVW  267
            LK RTK+ +EQLYK VDGVW
Sbjct  86   LKVRTKEKSEQLYKQVDGVW  105



>ref|XP_006408974.1| hypothetical protein EUTSA_v10001977mg [Eutrema salsugineum]
 ref|XP_006408975.1| hypothetical protein EUTSA_v10001977mg [Eutrema salsugineum]
 gb|ESQ50427.1| hypothetical protein EUTSA_v10001977mg [Eutrema salsugineum]
 gb|ESQ50428.1| hypothetical protein EUTSA_v10001977mg [Eutrema salsugineum]
Length=467

 Score = 72.4 bits (176),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 52/80 (65%), Positives = 61/80 (76%), Gaps = 0/80 (0%)
 Frame = +1

Query  28   RGATSLRLVQAYGYAGNRQFSVFNEFSQKFKGEFNRNKEFQQSvkelkekaeelkgvkeD  207
            R    L  +   GYA +R+FSVF+EFS+K +GE   N EFQ++VKELKEK EELKGVKED
Sbjct  26   RVGARLGFLPTNGYALHRRFSVFSEFSKKIRGEAESNPEFQRTVKELKEKTEELKGVKED  85

Query  208  LKTRTKQTTEQLYKHVDGVW  267
            LK RTK+ TEQLYK VDGVW
Sbjct  86   LKVRTKEKTEQLYKQVDGVW  105



>ref|XP_002524608.1| mitochondrial import inner membrane translocase subunit tim44, 
putative [Ricinus communis]
 gb|EEF37816.1| mitochondrial import inner membrane translocase subunit tim44, 
putative [Ricinus communis]
Length=486

 Score = 72.0 bits (175),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 58/90 (64%), Positives = 65/90 (72%), Gaps = 5/90 (6%)
 Frame = +1

Query  7    LVPQQVGRGATSLRLVQAYGYAGN---RQFSVFNEFSQKFKGEFNRNKEFQQSvkelkek  177
            L  QQ  R  T LRL        N   R F VF+EFS+K KGE  R++EFQQSVKELK+K
Sbjct  21   LTSQQGSR--TRLRLPSTLPNGKNMGYRGFGVFSEFSKKVKGEVTRSQEFQQSVKELKDK  78

Query  178  aeelkgvkeDLKTRTKQTTEQLYKHVDGVW  267
            AEELKGVKEDL+ RTK+TTEQLYKHVDG W
Sbjct  79   AEELKGVKEDLRIRTKETTEQLYKHVDGAW  108



>ref|NP_181151.3| translocase inner membrane subunit 44-2 [Arabidopsis thaliana]
 sp|Q5XF06.1|TI442_ARATH RecName: Full=Mitochondrial import inner membrane translocase 
subunit TIM44-2; Flags: Precursor [Arabidopsis thaliana]
 gb|AAU94373.1| At2g36070 [Arabidopsis thaliana]
 gb|AEC09202.1| translocase inner membrane subunit 44-2 [Arabidopsis thaliana]
Length=469

 Score = 72.0 bits (175),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 50/80 (63%), Positives = 63/80 (79%), Gaps = 0/80 (0%)
 Frame = +1

Query  28   RGATSLRLVQAYGYAGNRQFSVFNEFSQKFKGEFNRNKEFQQSvkelkekaeelkgvkeD  207
            R    L L+Q  G+A +R+FSVF+EFS+K +GE + N EFQ++VKE KE+AEEL+GVKED
Sbjct  26   RVGARLGLLQGNGFASHRRFSVFSEFSKKIRGEADSNPEFQKTVKEFKERAEELQGVKED  85

Query  208  LKTRTKQTTEQLYKHVDGVW  267
            LK RTKQTTE+LYK   GVW
Sbjct  86   LKVRTKQTTEKLYKQGQGVW  105



>ref|XP_002881425.1| attim44-2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH57684.1| attim44-2 [Arabidopsis lyrata subsp. lyrata]
Length=469

 Score = 71.2 bits (173),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 47/80 (59%), Positives = 60/80 (75%), Gaps = 0/80 (0%)
 Frame = +1

Query  28   RGATSLRLVQAYGYAGNRQFSVFNEFSQKFKGEFNRNKEFQQSvkelkekaeelkgvkeD  207
            R    L L+   G+A +R+FSVF+EFS+K +GE + N EFQ++VKE KE+A ELK ++ED
Sbjct  26   RVGARLGLLSGNGFASHRRFSVFSEFSKKIRGEADSNPEFQKTVKEFKERAGELKDIRED  85

Query  208  LKTRTKQTTEQLYKHVDGVW  267
            LK RTKQTTEQLYK   GVW
Sbjct  86   LKARTKQTTEQLYKQGHGVW  105



>gb|AAM15344.1| hypothetical protein [Arabidopsis thaliana]
Length=499

 Score = 71.2 bits (173),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 49/75 (65%), Positives = 62/75 (83%), Gaps = 0/75 (0%)
 Frame = +1

Query  43   LRLVQAYGYAGNRQFSVFNEFSQKFKGEFNRNKEFQQSvkelkekaeelkgvkeDLKTRT  222
            L L+Q  G+A +R+FSVF+EFS+K +GE + N EFQ++VKE KE+AEEL+GVKEDLK RT
Sbjct  99   LGLLQGNGFASHRRFSVFSEFSKKIRGEADSNPEFQKTVKEFKERAEELQGVKEDLKVRT  158

Query  223  KQTTEQLYKHVDGVW  267
            KQTTE+LYK   GVW
Sbjct  159  KQTTEKLYKQGQGVW  173



>ref|XP_010415621.1| PREDICTED: mitochondrial import inner membrane translocase subunit 
TIM44-1-like [Camelina sativa]
Length=473

 Score = 70.9 bits (172),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 49/72 (68%), Positives = 59/72 (82%), Gaps = 0/72 (0%)
 Frame = +1

Query  52   VQAYGYAGNRQFSVFNEFSQKFKGEFNRNKEFQQSvkelkekaeelkgvkeDLKTRTKQT  231
            + A GYA +R+FSV +EFS+  +GE   N EF+++VKELKE+AEELKGVKEDLK RTKQT
Sbjct  34   LPAIGYASHRRFSVLSEFSKNIRGEAESNPEFKRTVKELKERAEELKGVKEDLKVRTKQT  93

Query  232  TEQLYKHVDGVW  267
            TEQLY  VDGVW
Sbjct  94   TEQLYNKVDGVW  105



>ref|XP_010489028.1| PREDICTED: mitochondrial import inner membrane translocase subunit 
TIM44-1-like [Camelina sativa]
Length=473

 Score = 70.9 bits (172),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 47/72 (65%), Positives = 58/72 (81%), Gaps = 0/72 (0%)
 Frame = +1

Query  52   VQAYGYAGNRQFSVFNEFSQKFKGEFNRNKEFQQSvkelkekaeelkgvkeDLKTRTKQT  231
            + A GYA +R+FSV +EFS+  +GE   N EF++++KELKE+AEELKGVK DLK RTKQT
Sbjct  34   LPAIGYASHRRFSVLSEFSKNIRGEAESNPEFKRTMKELKERAEELKGVKGDLKVRTKQT  93

Query  232  TEQLYKHVDGVW  267
            TEQLY  VDGVW
Sbjct  94   TEQLYNKVDGVW  105



>ref|NP_565473.1| translocase inner membrane subunit 44-1 [Arabidopsis thaliana]
 gb|AAD25651.2| putative mitochondrial inner membrane translocating protein [Arabidopsis 
thaliana]
 gb|AEC07020.1| translocase inner membrane subunit 44-1 [Arabidopsis thaliana]
Length=472

 Score = 70.5 bits (171),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 45/72 (63%), Positives = 56/72 (78%), Gaps = 0/72 (0%)
 Frame = +1

Query  52   VQAYGYAGNRQFSVFNEFSQKFKGEFNRNKEFQQSvkelkekaeelkgvkeDLKTRTKQT  231
            + A GY  +R+FSVF EFS+  +GE + N EF+++VKELKE+ EE KGV EDLK RTKQT
Sbjct  34   LPAIGYTSHRRFSVFTEFSKNIRGEAHSNPEFERTVKELKERTEEFKGVTEDLKVRTKQT  93

Query  232  TEQLYKHVDGVW  267
            TE+LYK  DGVW
Sbjct  94   TEKLYKQADGVW  105



>ref|XP_010467806.1| PREDICTED: mitochondrial import inner membrane translocase subunit 
TIM44-1-like [Camelina sativa]
Length=473

 Score = 69.3 bits (168),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 48/68 (71%), Positives = 57/68 (84%), Gaps = 0/68 (0%)
 Frame = +1

Query  64   GYAGNRQFSVFNEFSQKFKGEFNRNKEFQQSvkelkekaeelkgvkeDLKTRTKQTTEQL  243
            GYA +R+FSV +EFS+  +GE   N EF+++VKELKE+AEELKGVKEDLK RTKQTTEQL
Sbjct  38   GYASHRRFSVLSEFSKNIRGEAESNPEFKRTVKELKERAEELKGVKEDLKVRTKQTTEQL  97

Query  244  YKHVDGVW  267
            Y  VDGVW
Sbjct  98   YNKVDGVW  105



>emb|CDY05768.1| BnaC07g00350D [Brassica napus]
Length=461

 Score = 68.9 bits (167),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 48/74 (65%), Positives = 60/74 (81%), Gaps = 0/74 (0%)
 Frame = +1

Query  46   RLVQAYGYAGNRQFSVFNEFSQKFKGEFNRNKEFQQSvkelkekaeelkgvkeDLKTRTK  225
            R + A GY+ NR+FS+F++ S+K +GE   N EFQ++VKELKEKAEELK VKEDLK +TK
Sbjct  48   RFMPAIGYSINRRFSIFSDLSKKIRGEAESNPEFQKTVKELKEKAEELKVVKEDLKVKTK  107

Query  226  QTTEQLYKHVDGVW  267
            + TEQLYK VDGVW
Sbjct  108  EKTEQLYKQVDGVW  121



>ref|XP_004515202.1| PREDICTED: mitochondrial import inner membrane translocase subunit 
TIM44-2-like [Cicer arietinum]
Length=472

 Score = 67.4 bits (163),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 50/66 (76%), Positives = 55/66 (83%), Gaps = 0/66 (0%)
 Frame = +1

Query  70   AGNRQFSVFNEFSQKFKGEFNRNKEFQQSvkelkekaeelkgvkeDLKTRTKQTTEQLYK  249
            A  R +SVFNEFS+K K E  RNKEFQQ+VKELKEKAEELKGVKEDLK +TKQ TEQLY+
Sbjct  33   ADRRGYSVFNEFSKKIKDEAVRNKEFQQTVKELKEKAEELKGVKEDLKVKTKQKTEQLYR  92

Query  250  HVDGVW  267
             VDG W
Sbjct  93   QVDGAW  98



>ref|XP_010528436.1| PREDICTED: mitochondrial import inner membrane translocase subunit 
TIM44-2-like [Tarenaya hassleriana]
Length=484

 Score = 67.0 bits (162),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 50/75 (67%), Positives = 58/75 (77%), Gaps = 0/75 (0%)
 Frame = +1

Query  43   LRLVQAYGYAGNRQFSVFNEFSQKFKGEFNRNKEFQQSvkelkekaeelkgvkeDLKTRT  222
            L L+ A+G    R FSVF EFS+K KGE   N EFQ++VKELKE+AEELKGVKE LK RT
Sbjct  31   LGLLPAHGSLNPRPFSVFGEFSKKIKGEAESNPEFQRTVKELKERAEELKGVKEGLKERT  90

Query  223  KQTTEQLYKHVDGVW  267
            KQTTEQL+K  +GVW
Sbjct  91   KQTTEQLHKQAEGVW  105



>ref|XP_007148627.1| hypothetical protein PHAVU_005G002100g [Phaseolus vulgaris]
 gb|ESW20621.1| hypothetical protein PHAVU_005G002100g [Phaseolus vulgaris]
Length=479

 Score = 65.9 bits (159),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 49/67 (73%), Positives = 56/67 (84%), Gaps = 0/67 (0%)
 Frame = +1

Query  67   YAGNRQFSVFNEFSQKFKGEFNRNKEFQQSvkelkekaeelkgvkeDLKTRTKQTTEQLY  246
            +   R +SVFNEFS+K KGE  RN+EFQQSVKELKEKA+ELKGVKE+LK RTKQ TE+LY
Sbjct  39   WEDRRSYSVFNEFSKKIKGEAVRNQEFQQSVKELKEKADELKGVKEELKERTKQKTEKLY  98

Query  247  KHVDGVW  267
            K VD VW
Sbjct  99   KQVDEVW  105



>ref|XP_009102019.1| PREDICTED: mitochondrial import inner membrane translocase subunit 
TIM44-2-like [Brassica rapa]
Length=462

 Score = 65.5 bits (158),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 48/70 (69%), Positives = 59/70 (84%), Gaps = 0/70 (0%)
 Frame = +1

Query  58   AYGYAGNRQFSVFNEFSQKFKGEFNRNKEFQQSvkelkekaeelkgvkeDLKTRTKQTTE  237
            A G + NR+FS+F++FS+K +GE   N EFQ++VKELKEKAEELKGVKEDLK +TK+ TE
Sbjct  37   AIGCSINRRFSIFSDFSKKIRGEAESNPEFQKTVKELKEKAEELKGVKEDLKVKTKEKTE  96

Query  238  QLYKHVDGVW  267
            QLYK VDGVW
Sbjct  97   QLYKQVDGVW  106



>emb|CDY03300.1| BnaC09g10480D [Brassica napus]
Length=446

 Score = 65.1 bits (157),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 48/80 (60%), Positives = 60/80 (75%), Gaps = 2/80 (3%)
 Frame = +1

Query  28   RGATSLRLVQAYGYAGNRQFSVFNEFSQKFKGEFNRNKEFQQSvkelkekaeelkgvkeD  207
            R    L  + A G+  +RQFSVF++ S+K +GE   N EFQ++VKEL+EKA+EL GVKED
Sbjct  22   RVGARLGFMPANGF--HRQFSVFSDLSKKIRGEAESNPEFQRTVKELQEKAQELNGVKED  79

Query  208  LKTRTKQTTEQLYKHVDGVW  267
            LK RTK+ TEQLYK VDGVW
Sbjct  80   LKVRTKEKTEQLYKQVDGVW  99



>ref|XP_009112672.1| PREDICTED: mitochondrial import inner membrane translocase subunit 
TIM44-2-like [Brassica rapa]
Length=454

 Score = 65.1 bits (157),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 48/80 (60%), Positives = 60/80 (75%), Gaps = 1/80 (1%)
 Frame = +1

Query  28   RGATSLRLVQAYGYAGNRQFSVFNEFSQKFKGEFNRNKEFQQSvkelkekaeelkgvkeD  207
            R  T L  + A G+   RQFSVF++ ++K +GE   N EFQ++VKE+KEKA+EL GVKED
Sbjct  26   RVGTRLGFMPANGFQ-RRQFSVFSDLTKKIRGEAESNPEFQRTVKEIKEKAQELNGVKED  84

Query  208  LKTRTKQTTEQLYKHVDGVW  267
            LK RTK+ TEQLYK VDGVW
Sbjct  85   LKVRTKEKTEQLYKQVDGVW  104



>emb|CDY39780.1| BnaA09g10320D [Brassica napus]
Length=454

 Score = 64.3 bits (155),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 45/63 (71%), Positives = 53/63 (84%), Gaps = 0/63 (0%)
 Frame = +1

Query  79   RQFSVFNEFSQKFKGEFNRNKEFQQSvkelkekaeelkgvkeDLKTRTKQTTEQLYKHVD  258
            RQFSVF++ S+K +GE   N EFQ++VKELKEKA+EL GVKEDLK RTK+ TEQLYK VD
Sbjct  42   RQFSVFSDLSKKIRGEAESNPEFQRTVKELKEKAQELNGVKEDLKVRTKEKTEQLYKQVD  101

Query  259  GVW  267
            GVW
Sbjct  102  GVW  104



>ref|XP_004981398.1| PREDICTED: mitochondrial import inner membrane translocase subunit 
TIM44-2-like [Setaria italica]
Length=474

 Score = 63.9 bits (154),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 43/82 (52%), Positives = 55/82 (67%), Gaps = 5/82 (6%)
 Frame = +1

Query  28   RGATS--LRLVQAYGYAGNRQFSVFNEFSQKFKGEFNRNKEFQQSvkelkekaeelkgvk  201
            R ATS  ++ +  Y +  NR  SVFNEFS++ KGE   N EFQ+S   +KE  E++  VK
Sbjct  20   RLATSANVQAITGYRHLNNRNLSVFNEFSKQLKGEAKSNPEFQKS---MKEFGEKIGVVK  76

Query  202  eDLKTRTKQTTEQLYKHVDGVW  267
            EDLK RTK+TTE +YK VD VW
Sbjct  77   EDLKVRTKKTTETIYKSVDDVW  98



>ref|NP_001131676.1| uncharacterized protein LOC100193036 [Zea mays]
 gb|ACF80193.1| unknown [Zea mays]
 tpg|DAA41828.1| TPA: hypothetical protein ZEAMMB73_813206 [Zea mays]
Length=474

 Score = 63.2 bits (152),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 40/69 (58%), Positives = 49/69 (71%), Gaps = 3/69 (4%)
 Frame = +1

Query  61   YGYAGNRQFSVFNEFSQKFKGEFNRNKEFQQSvkelkekaeelkgvkeDLKTRTKQTTEQ  240
            Y +  NR  SVFNEFS++ KGE   N EFQ+S   +KE +E+L  VKEDLK RTK+TTE 
Sbjct  33   YRHLNNRNLSVFNEFSKQLKGEAKSNPEFQKS---MKEFSEKLDVVKEDLKVRTKKTTET  89

Query  241  LYKHVDGVW  267
            +YK VD VW
Sbjct  90   IYKRVDDVW  98



>ref|XP_003596691.1| Mitochondrial import inner membrane translocase subunit TIM44 
[Medicago truncatula]
 gb|AES66942.1| import inner membrane translocase subunit TIM44-2 [Medicago truncatula]
Length=463

 Score = 63.2 bits (152),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 52/76 (68%), Positives = 57/76 (75%), Gaps = 0/76 (0%)
 Frame = +1

Query  40   SLRLVQAYGYAGNRQFSVFNEFSQKFKGEFNRNKEFQQSvkelkekaeelkgvkeDLKTR  219
            SL L Q  G    R++ VFNEFS K K E  +N EFQ+SVKELKEKAEELKGVKE LK +
Sbjct  16   SLILPQQQGVKTIRRYGVFNEFSNKVKDETVKNPEFQKSVKELKEKAEELKGVKEGLKEK  75

Query  220  TKQTTEQLYKHVDGVW  267
            TKQTTEQLYK  DGVW
Sbjct  76   TKQTTEQLYKQFDGVW  91



>emb|CDY31958.1| BnaA07g00370D [Brassica napus]
Length=462

 Score = 63.2 bits (152),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 47/70 (67%), Positives = 58/70 (83%), Gaps = 0/70 (0%)
 Frame = +1

Query  58   AYGYAGNRQFSVFNEFSQKFKGEFNRNKEFQQSvkelkekaeelkgvkeDLKTRTKQTTE  237
            A G + NR+FS+F++ S+K +GE   N EFQ++VKELKEKAEELKGVKEDLK +TK+ TE
Sbjct  37   AIGCSINRRFSIFSDLSKKIRGEAESNPEFQKTVKELKEKAEELKGVKEDLKVKTKEKTE  96

Query  238  QLYKHVDGVW  267
            QLYK VDGVW
Sbjct  97   QLYKQVDGVW  106



>ref|XP_006299774.1| hypothetical protein CARUB_v10015970mg [Capsella rubella]
 gb|EOA32672.1| hypothetical protein CARUB_v10015970mg [Capsella rubella]
Length=471

 Score = 62.8 bits (151),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 50/87 (57%), Positives = 63/87 (72%), Gaps = 2/87 (2%)
 Frame = +1

Query  7    LVPQQVGRGATSLRLVQAYGYAGNRQFSVFNEFSQKFKGEFNRNKEFQQSvkelkekaee  186
            L+ Q++ R       + A GYA +RQFS+ ++FS+    E + N EF++ VKELKE+AEE
Sbjct  21   LLHQRLVRANVRSEFLPAIGYASHRQFSILSDFSKNI--EADSNSEFERRVKELKERAEE  78

Query  187  lkgvkeDLKTRTKQTTEQLYKHVDGVW  267
            LKGVKEDLK RTKQTTEQLY  VDGVW
Sbjct  79   LKGVKEDLKVRTKQTTEQLYNQVDGVW  105



>ref|XP_008785775.1| PREDICTED: mitochondrial import inner membrane translocase subunit 
TIM44-2-like [Phoenix dactylifera]
 ref|XP_008785777.1| PREDICTED: mitochondrial import inner membrane translocase subunit 
TIM44-2-like [Phoenix dactylifera]
 ref|XP_008785778.1| PREDICTED: mitochondrial import inner membrane translocase subunit 
TIM44-2-like [Phoenix dactylifera]
 ref|XP_008785779.1| PREDICTED: mitochondrial import inner membrane translocase subunit 
TIM44-2-like [Phoenix dactylifera]
Length=483

 Score = 62.8 bits (151),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 39/63 (62%), Positives = 48/63 (76%), Gaps = 3/63 (5%)
 Frame = +1

Query  79   RQFSVFNEFSQKFKGEFNRNKEFQQSvkelkekaeelkgvkeDLKTRTKQTTEQLYKHVD  258
            RQFSVFNEFS++ KGE   N EFQQS   +KE  E++  VKEDLK RTK+T+++LYK VD
Sbjct  39   RQFSVFNEFSKQLKGEAKSNPEFQQS---VKELNEKIGVVKEDLKVRTKKTSDKLYKSVD  95

Query  259  GVW  267
             VW
Sbjct  96   DVW  98



>gb|KEH30606.1| import inner membrane translocase subunit TIM44-2 [Medicago truncatula]
Length=429

 Score = 62.8 bits (151),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 55/88 (63%), Positives = 61/88 (69%), Gaps = 6/88 (7%)
 Frame = +1

Query  4    LLVPQQVGRGATSLRLVQAYGYAGNRQFSVFNEFSQKFKGEFNRNKEFQQSvkelkekae  183
            L++P Q  R      LV   GY      SVFNEFS+K K E  RN EFQQSVKELKEKAE
Sbjct  17   LILPLQGFRPRLFFNLVDRRGY------SVFNEFSKKVKDETLRNPEFQQSVKELKEKAE  70

Query  184  elkgvkeDLKTRTKQTTEQLYKHVDGVW  267
            ELKGVKE LK +TKQTTEQLY+  DG+W
Sbjct  71   ELKGVKEGLKEKTKQTTEQLYRQFDGMW  98



>gb|KEH30605.1| import inner membrane translocase subunit TIM44-2 [Medicago truncatula]
Length=459

 Score = 62.8 bits (151),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 55/88 (63%), Positives = 61/88 (69%), Gaps = 6/88 (7%)
 Frame = +1

Query  4    LLVPQQVGRGATSLRLVQAYGYAGNRQFSVFNEFSQKFKGEFNRNKEFQQSvkelkekae  183
            L++P Q  R      LV   GY      SVFNEFS+K K E  RN EFQQSVKELKEKAE
Sbjct  17   LILPLQGFRPRLFFNLVDRRGY------SVFNEFSKKVKDETLRNPEFQQSVKELKEKAE  70

Query  184  elkgvkeDLKTRTKQTTEQLYKHVDGVW  267
            ELKGVKE LK +TKQTTEQLY+  DG+W
Sbjct  71   ELKGVKEGLKEKTKQTTEQLYRQFDGMW  98



>gb|KEH30609.1| import inner membrane translocase subunit TIM44-2 [Medicago truncatula]
Length=426

 Score = 62.0 bits (149),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 55/88 (63%), Positives = 61/88 (69%), Gaps = 6/88 (7%)
 Frame = +1

Query  4    LLVPQQVGRGATSLRLVQAYGYAGNRQFSVFNEFSQKFKGEFNRNKEFQQSvkelkekae  183
            L++P Q  R      LV   GY      SVFNEFS+K K E  RN EFQQSVKELKEKAE
Sbjct  17   LILPLQGFRPRLFFNLVDRRGY------SVFNEFSKKVKDETLRNPEFQQSVKELKEKAE  70

Query  184  elkgvkeDLKTRTKQTTEQLYKHVDGVW  267
            ELKGVKE LK +TKQTTEQLY+  DG+W
Sbjct  71   ELKGVKEGLKEKTKQTTEQLYRQFDGMW  98



>ref|XP_002463439.1| hypothetical protein SORBIDRAFT_02g043830 [Sorghum bicolor]
 gb|EER99960.1| hypothetical protein SORBIDRAFT_02g043830 [Sorghum bicolor]
Length=474

 Score = 62.0 bits (149),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 40/69 (58%), Positives = 48/69 (70%), Gaps = 3/69 (4%)
 Frame = +1

Query  61   YGYAGNRQFSVFNEFSQKFKGEFNRNKEFQQSvkelkekaeelkgvkeDLKTRTKQTTEQ  240
            Y +  NR  SVFNEFS++ KGE   N EFQ+S   +KE  E+L  VKEDLK RTK+TTE 
Sbjct  33   YRHLNNRNLSVFNEFSKQLKGEAKSNPEFQKS---MKEFGEKLGVVKEDLKVRTKKTTET  89

Query  241  LYKHVDGVW  267
            +YK VD VW
Sbjct  90   IYKSVDDVW  98



>ref|NP_001059443.1| Os07g0409700 [Oryza sativa Japonica Group]
 dbj|BAD30582.1| mitochondrial inner membrane translocating protein-like protein 
[Oryza sativa Japonica Group]
 dbj|BAF21357.1| Os07g0409700 [Oryza sativa Japonica Group]
 dbj|BAG89637.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG92892.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC81899.1| hypothetical protein OsI_25725 [Oryza sativa Indica Group]
 gb|EEE67014.1| hypothetical protein OsJ_23936 [Oryza sativa Japonica Group]
Length=475

 Score = 61.2 bits (147),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 45/81 (56%), Positives = 55/81 (68%), Gaps = 5/81 (6%)
 Frame = +1

Query  28   RGATSLRL--VQAYGYAGNRQFSVFNEFSQKFKGEFNRNKEFQQSvkelkekaeelkgvk  201
            R A S+R+  V  Y +  NR  SVFNEFS++ KGE   N EFQ+S   +KE +E+L GVK
Sbjct  20   RLAASVRVQGVTGYRHLNNRNLSVFNEFSKQLKGEAKSNPEFQKS---MKEFSEKLSGVK  76

Query  202  eDLKTRTKQTTEQLYKHVDGV  264
            EDLK RTKQT E +YK VD V
Sbjct  77   EDLKVRTKQTAETIYKSVDDV  97



>ref|XP_009411915.1| PREDICTED: mitochondrial import inner membrane translocase subunit 
TIM44-2-like isoform X1 [Musa acuminata subsp. malaccensis]
Length=482

 Score = 60.5 bits (145),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 35/75 (47%), Positives = 55/75 (73%), Gaps = 3/75 (4%)
 Frame = +1

Query  43   LRLVQAYGYAGNRQFSVFNEFSQKFKGEFNRNKEFQQSvkelkekaeelkgvkeDLKTRT  222
            +++++   ++  R+FS+FNEFS++ KGE   N EFQQS   +K+  E++  VKED+K RT
Sbjct  27   VQVIKGNRHSSYRRFSIFNEFSKQLKGEAKSNTEFQQS---MKDLNEKIGVVKEDIKVRT  83

Query  223  KQTTEQLYKHVDGVW  267
            ++TTE+LY+ VD VW
Sbjct  84   QKTTEKLYRTVDDVW  98



>ref|XP_009411916.1| PREDICTED: mitochondrial import inner membrane translocase subunit 
TIM44-2-like isoform X2 [Musa acuminata subsp. malaccensis]
Length=482

 Score = 60.5 bits (145),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 35/75 (47%), Positives = 55/75 (73%), Gaps = 3/75 (4%)
 Frame = +1

Query  43   LRLVQAYGYAGNRQFSVFNEFSQKFKGEFNRNKEFQQSvkelkekaeelkgvkeDLKTRT  222
            +++++   ++  R+FS+FNEFS++ KGE   N EFQQS   +K+  E++  VKED+K RT
Sbjct  27   VQVIKGNRHSSYRRFSIFNEFSKQLKGEAKSNTEFQQS---MKDLNEKIGVVKEDIKVRT  83

Query  223  KQTTEQLYKHVDGVW  267
            ++TTE+LY+ VD VW
Sbjct  84   QKTTEKLYRTVDDVW  98



>ref|XP_010696497.1| PREDICTED: mitochondrial import inner membrane translocase subunit 
TIM44-2-like [Beta vulgaris subsp. vulgaris]
Length=459

 Score = 59.3 bits (142),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 50/77 (65%), Positives = 57/77 (74%), Gaps = 2/77 (3%)
 Frame = +1

Query  43   LRLVQAYGYAGN--RQFSVFNEFSQKFKGEFNRNKEFQQSvkelkekaeelkgvkeDLKT  216
            +R +Q  G   N     SV + FS K KGE + NKEFQQSVK+LKEKAEELKGVKEDLK 
Sbjct  5    IRRIQNLGIQFNPLNPPSVRHYFSNKIKGEASSNKEFQQSVKQLKEKAEELKGVKEDLKV  64

Query  217  RTKQTTEQLYKHVDGVW  267
            R KQT+EQL+KHV GVW
Sbjct  65   RVKQTSEQLHKHVGGVW  81



>ref|XP_003605359.1| Mitochondrial import inner membrane translocase subunit TIM44 
[Medicago truncatula]
Length=433

 Score = 58.9 bits (141),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 51/88 (58%), Positives = 62/88 (70%), Gaps = 6/88 (7%)
 Frame = +1

Query  4    LLVPQQVGRGATSLRLVQAYGYAGNRQFSVFNEFSQKFKGEFNRNKEFQQSvkelkekae  183
            L++PQQ   G  +   V +    G   +SVFNEFS+K K E  +N EFQ+SVKELKEKAE
Sbjct  18   LILPQQ---GVKTRLFVNSVDRRG---YSVFNEFSKKVKDETVKNPEFQKSVKELKEKAE  71

Query  184  elkgvkeDLKTRTKQTTEQLYKHVDGVW  267
            ELKG+KE LK +TKQTTEQLY+  D VW
Sbjct  72   ELKGIKEGLKEKTKQTTEQLYRQFDSVW  99



>gb|AES87556.2| import inner membrane translocase subunit TIM44-2 [Medicago truncatula]
Length=437

 Score = 58.5 bits (140),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 51/88 (58%), Positives = 62/88 (70%), Gaps = 6/88 (7%)
 Frame = +1

Query  4    LLVPQQVGRGATSLRLVQAYGYAGNRQFSVFNEFSQKFKGEFNRNKEFQQSvkelkekae  183
            L++PQQ   G  +   V +    G   +SVFNEFS+K K E  +N EFQ+SVKELKEKAE
Sbjct  18   LILPQQ---GVKTRLFVNSVDRRG---YSVFNEFSKKVKDETVKNPEFQKSVKELKEKAE  71

Query  184  elkgvkeDLKTRTKQTTEQLYKHVDGVW  267
            ELKG+KE LK +TKQTTEQLY+  D VW
Sbjct  72   ELKGIKEGLKEKTKQTTEQLYRQFDSVW  99



>ref|XP_006657708.1| PREDICTED: mitochondrial import inner membrane translocase subunit 
TIM44-2-like [Oryza brachyantha]
Length=475

 Score = 58.2 bits (139),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 43/81 (53%), Positives = 55/81 (68%), Gaps = 5/81 (6%)
 Frame = +1

Query  28   RGATSLRL--VQAYGYAGNRQFSVFNEFSQKFKGEFNRNKEFQQSvkelkekaeelkgvk  201
            R AT++R+  V  Y +  NR  SVFNEFS++ KGE   N EFQ+S   +KE +E+L GVK
Sbjct  20   RLATNVRVQGVTGYRHLNNRNLSVFNEFSKQLKGEAKSNPEFQKS---MKEFSEKLSGVK  76

Query  202  eDLKTRTKQTTEQLYKHVDGV  264
            ED K RTK+T E +YK VD V
Sbjct  77   EDFKVRTKKTAETIYKSVDDV  97



>gb|KHN24793.1| Mitochondrial import inner membrane translocase subunit TIM44 
[Glycine soja]
Length=473

 Score = 57.4 bits (137),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 45/64 (70%), Positives = 54/64 (84%), Gaps = 0/64 (0%)
 Frame = +1

Query  67   YAGNRQFSVFNEFSQKFKGEFNRNKEFQQSvkelkekaeelkgvkeDLKTRTKQTTEQLY  246
            +   R++SVFNEFS+  KG+  RN+EFQQSVKELKEKA+ELKGVKE+LK RTKQ TE+LY
Sbjct  33   WEDRRRYSVFNEFSKNIKGQAVRNQEFQQSVKELKEKADELKGVKEELKERTKQKTEKLY  92

Query  247  KHVD  258
            K VD
Sbjct  93   KQVD  96



>ref|XP_003522818.1| PREDICTED: mitochondrial import inner membrane translocase subunit 
TIM44-2-like [Glycine max]
Length=473

 Score = 57.4 bits (137),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 45/64 (70%), Positives = 54/64 (84%), Gaps = 0/64 (0%)
 Frame = +1

Query  67   YAGNRQFSVFNEFSQKFKGEFNRNKEFQQSvkelkekaeelkgvkeDLKTRTKQTTEQLY  246
            +   R++SVFNEFS+  KG+  RN+EFQQSVKELKEKA+ELKGVKE+LK RTKQ TE+LY
Sbjct  33   WEDRRRYSVFNEFSKNIKGQAVRNQEFQQSVKELKEKADELKGVKEELKERTKQKTEKLY  92

Query  247  KHVD  258
            K VD
Sbjct  93   KQVD  96



>ref|XP_010911925.1| PREDICTED: mitochondrial import inner membrane translocase subunit 
TIM44-2 isoform X1 [Elaeis guineensis]
Length=483

 Score = 55.1 bits (131),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 38/71 (54%), Positives = 48/71 (68%), Gaps = 3/71 (4%)
 Frame = +1

Query  46   RLVQAYGYAGNRQFSVFNEFSQKFKGEFNRNKEFQQSvkelkekaeelkgvkeDLKTRTK  225
            R    +G    RQFSVFNEFS++ KGE   N EFQQS   +KE  E++  VKED K RTK
Sbjct  28   RPAMVHGNLRARQFSVFNEFSKQLKGEAKSNPEFQQS---VKELNEKIGVVKEDFKVRTK  84

Query  226  QTTEQLYKHVD  258
            +T+E+LYK +D
Sbjct  85   KTSEKLYKSMD  95



>ref|XP_010911926.1| PREDICTED: mitochondrial import inner membrane translocase subunit 
TIM44-2 isoform X2 [Elaeis guineensis]
Length=460

 Score = 54.7 bits (130),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 38/71 (54%), Positives = 48/71 (68%), Gaps = 3/71 (4%)
 Frame = +1

Query  46   RLVQAYGYAGNRQFSVFNEFSQKFKGEFNRNKEFQQSvkelkekaeelkgvkeDLKTRTK  225
            R    +G    RQFSVFNEFS++ KGE   N EFQQS   +KE  E++  VKED K RTK
Sbjct  28   RPAMVHGNLRARQFSVFNEFSKQLKGEAKSNPEFQQS---VKELNEKIGVVKEDFKVRTK  84

Query  226  QTTEQLYKHVD  258
            +T+E+LYK +D
Sbjct  85   KTSEKLYKSMD  95



>ref|XP_003562644.1| PREDICTED: mitochondrial import inner membrane translocase subunit 
TIM44-2-like [Brachypodium distachyon]
Length=474

 Score = 53.5 bits (127),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 43/81 (53%), Positives = 52/81 (64%), Gaps = 5/81 (6%)
 Frame = +1

Query  28   RGATSLRLVQAYGYA--GNRQFSVFNEFSQKFKGEFNRNKEFQQSvkelkekaeelkgvk  201
            R ATS+ +  A GY    NR  SVFNEFS+  KGE   N EFQ+S   +KE +E+L  VK
Sbjct  20   RLATSVNVQTAAGYRHLNNRNLSVFNEFSKHLKGEAKSNPEFQKS---MKEFSEKLGVVK  76

Query  202  eDLKTRTKQTTEQLYKHVDGV  264
            EDLK RTK+T E + K VD V
Sbjct  77   EDLKVRTKKTAETISKSVDDV  97



>dbj|BAJ91902.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ96444.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=481

 Score = 51.2 bits (121),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 40/79 (51%), Positives = 52/79 (66%), Gaps = 6/79 (8%)
 Frame = +1

Query  37   TSLRLV---QAYGYAGNRQFSVFNEFSQKFKGEFNRNKEFQQSvkelkekaeelkgvkeD  207
            ++LRL      Y +  NR  SVFNEFS++ KGE   N EFQ+S   +KE +E+L  VKED
Sbjct  17   SALRLATNANGYMHLNNRNLSVFNEFSKQLKGEAKSNPEFQKS---MKEFSEKLGVVKED  73

Query  208  LKTRTKQTTEQLYKHVDGV  264
            LK RTK+TTE + K V+ V
Sbjct  74   LKVRTKKTTETISKSVEDV  92



>gb|EMT23052.1| Mitochondrial import inner membrane translocase subunit tim44 
[Aegilops tauschii]
Length=547

 Score = 50.1 bits (118),  Expect = 7e-05, Method: Composition-based stats.
 Identities = 36/75 (48%), Positives = 50/75 (67%), Gaps = 3/75 (4%)
 Frame = +1

Query  40   SLRLVQAYGYAGNRQFSVFNEFSQKFKGEFNRNKEFQQSvkelkekaeelkgvkeDLKTR  219
            +++ V  Y +  NR  SVFNEFS++ KGE   N EFQ+S   +KE +E+L  VKEDLK R
Sbjct  26   NVQAVTGYRHLNNRNLSVFNEFSKQLKGEAKSNPEFQKS---MKEFSEKLGVVKEDLKVR  82

Query  220  TKQTTEQLYKHVDGV  264
            T++T E + K V+ V
Sbjct  83   TQKTAETISKSVEDV  97



>gb|EMS55855.1| Mitochondrial import inner membrane translocase subunit TIM44 
[Triticum urartu]
Length=547

 Score = 49.7 bits (117),  Expect = 8e-05, Method: Composition-based stats.
 Identities = 36/75 (48%), Positives = 50/75 (67%), Gaps = 3/75 (4%)
 Frame = +1

Query  40   SLRLVQAYGYAGNRQFSVFNEFSQKFKGEFNRNKEFQQSvkelkekaeelkgvkeDLKTR  219
            +++ V  Y +  NR  SVFNEFS++ KGE   N EFQ+S   +KE +E+L  VKEDLK R
Sbjct  26   NVQAVTGYRHLNNRNLSVFNEFSKQLKGEAKSNPEFQKS---MKEFSEKLGVVKEDLKVR  82

Query  220  TKQTTEQLYKHVDGV  264
            T++T E + K V+ V
Sbjct  83   TQKTAETISKSVEDV  97



>ref|XP_002977178.1| hypothetical protein SELMODRAFT_176052 [Selaginella moellendorffii]
 gb|EFJ21787.1| hypothetical protein SELMODRAFT_176052 [Selaginella moellendorffii]
Length=432

 Score = 47.0 bits (110),  Expect = 7e-04, Method: Composition-based stats.
 Identities = 32/61 (52%), Positives = 40/61 (66%), Gaps = 7/61 (11%)
 Frame = +1

Query  79   RQFSVFNEFSQKFKGEFNRNKEFQQSvkelkekaeelkgvkeDLKTRTKQTTEQLYKHVD  258
            R  S+F E S+K KGE + N E Q+S+KE KEKA+       D K+RTK+T E LYKHVD
Sbjct  28   RNQSIFQEISKKLKGEIDSNPELQKSIKEFKEKAD-------DFKSRTKETAEHLYKHVD  80

Query  259  G  261
             
Sbjct  81   A  81



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 532749597990