BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c6184_g1_i1 len=554 path=[1:0-553]

Length=554
                                                                      Score     E

ref|XP_009777506.1|  PREDICTED: protein ECERIFERUM 1-like               246   3e-75   
ref|XP_009612939.1|  PREDICTED: protein ECERIFERUM 1-like isoform X1    247   1e-74   
ref|XP_009586975.1|  PREDICTED: protein ECERIFERUM 1-like               242   1e-72   
ref|XP_009787252.1|  PREDICTED: protein ECERIFERUM 1-like isoform X2    241   1e-72   
ref|XP_009787251.1|  PREDICTED: protein ECERIFERUM 1-like isoform X1    241   2e-72   
ref|XP_011085147.1|  PREDICTED: protein ECERIFERUM 1-like               238   5e-71   
emb|CBI16764.3|  unnamed protein product                                227   5e-71   
emb|CBI16759.3|  unnamed protein product                                224   7e-70   
gb|KHN33999.1|  Protein WAX2                                            223   2e-69   
ref|XP_010661477.1|  PREDICTED: protein ECERIFERUM 1-like               226   2e-69   
ref|XP_006361513.1|  PREDICTED: protein ECERIFERUM 1-like               231   2e-68   
ref|XP_006357723.1|  PREDICTED: protein ECERIFERUM 1-like               230   2e-68   
gb|KHN40120.1|  Protein WAX2                                            230   2e-68   
ref|XP_002263787.2|  PREDICTED: protein ECERIFERUM 1-like               229   7e-68   Vitis vinifera
emb|CBI16761.3|  unnamed protein product                                229   8e-68   
ref|XP_004234847.1|  PREDICTED: protein ECERIFERUM 1-like               229   9e-68   
ref|XP_003521032.2|  PREDICTED: protein ECERIFERUM 1-like               230   1e-67   
ref|XP_006354616.1|  PREDICTED: protein ECERIFERUM 1-like               229   1e-67   
ref|XP_003633900.1|  PREDICTED: protein ECERIFERUM 1-like               228   2e-67   
ref|XP_002262647.1|  PREDICTED: protein ECERIFERUM 1                    226   6e-67   Vitis vinifera
ref|XP_002265685.2|  PREDICTED: protein ECERIFERUM 1-like               226   8e-67   Vitis vinifera
ref|XP_009600723.1|  PREDICTED: protein ECERIFERUM 1-like               226   1e-66   
ref|XP_003529007.1|  PREDICTED: protein ECERIFERUM 1-like               225   2e-66   
ref|XP_009614034.1|  PREDICTED: protein ECERIFERUM 1-like               226   2e-66   
ref|XP_004229696.2|  PREDICTED: protein ECERIFERUM 1-like               228   3e-66   
ref|XP_009625188.1|  PREDICTED: protein ECERIFERUM 1-like               225   3e-66   
gb|EMS51792.1|  Protein WAX2                                            220   3e-66   
ref|XP_006354678.1|  PREDICTED: protein ECERIFERUM 1-like               224   3e-66   
emb|CAN60676.1|  hypothetical protein VITISV_029045                     223   4e-66   Vitis vinifera
ref|XP_010479259.1|  PREDICTED: protein ECERIFERUM 1-like               213   9e-66   
emb|CDP09363.1|  unnamed protein product                                223   9e-66   
ref|XP_007134354.1|  hypothetical protein PHAVU_010G040500g             223   9e-66   
ref|XP_002262785.1|  PREDICTED: protein ECERIFERUM 1                    223   1e-65   Vitis vinifera
ref|XP_010052747.1|  PREDICTED: protein ECERIFERUM 1-like isoform X2    223   2e-65   
ref|XP_009384064.1|  PREDICTED: protein ECERIFERUM 1-like               223   2e-65   
ref|XP_009793428.1|  PREDICTED: protein ECERIFERUM 1-like               223   2e-65   
ref|XP_010054532.1|  PREDICTED: protein ECERIFERUM 1-like               221   2e-65   
ref|XP_010496699.1|  PREDICTED: protein ECERIFERUM 1-like               213   2e-65   
ref|XP_010052746.1|  PREDICTED: protein ECERIFERUM 1-like isoform X1    223   2e-65   
ref|XP_006647531.1|  PREDICTED: protein ECERIFERUM 1-like               222   2e-65   
ref|XP_009760058.1|  PREDICTED: protein ECERIFERUM 1-like isoform X2    222   3e-65   
ref|XP_009760057.1|  PREDICTED: protein ECERIFERUM 1-like isoform X1    222   3e-65   
ref|XP_009760059.1|  PREDICTED: protein ECERIFERUM 1-like isoform X3    222   3e-65   
ref|XP_004307281.1|  PREDICTED: protein ECERIFERUM 1-like               222   4e-65   
emb|CAN81825.1|  hypothetical protein VITISV_014168                     229   4e-65   Vitis vinifera
ref|XP_002265189.2|  PREDICTED: protein ECERIFERUM 1                    221   4e-65   Vitis vinifera
emb|CBI16760.3|  unnamed protein product                                229   4e-65   
gb|EEC73617.1|  hypothetical protein OsI_08114                          221   5e-65   Oryza sativa Indica Group [Indian rice]
ref|NP_001047459.1|  Os02g0621300                                       221   6e-65   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007008729.1|  Fatty acid hydroxylase superfamily isoform 1       221   8e-65   
ref|XP_004229695.1|  PREDICTED: protein ECERIFERUM 1-like isoform X2    221   1e-64   
ref|XP_006445500.1|  hypothetical protein CICLE_v10019279mg             221   1e-64   
ref|XP_010324966.1|  PREDICTED: protein ECERIFERUM 1-like isoform X1    221   1e-64   
ref|XP_004510150.1|  PREDICTED: protein ECERIFERUM 1-like               220   1e-64   
dbj|BAJ85405.1|  predicted protein                                      216   1e-64   
ref|XP_003626834.1|  gl1-like protein                                   220   2e-64   
ref|XP_008232283.1|  PREDICTED: protein ECERIFERUM 1-like               219   2e-64   
ref|XP_009339873.1|  PREDICTED: LOW QUALITY PROTEIN: protein ECER...    210   2e-64   
ref|XP_004976194.1|  PREDICTED: protein ECERIFERUM 1-like               219   3e-64   
ref|XP_003575378.1|  PREDICTED: protein ECERIFERUM 1-like               219   3e-64   
gb|KCW76793.1|  hypothetical protein EUGRSUZ_D011441                    207   4e-64   
ref|XP_011093465.1|  PREDICTED: protein ECERIFERUM 1-like               219   4e-64   
ref|XP_006306971.1|  hypothetical protein CARUB_v10008547mg             219   5e-64   
ref|XP_004510149.1|  PREDICTED: protein ECERIFERUM 1-like isoform X3    214   7e-64   
gb|ACJ85705.1|  unknown                                                 212   1e-63   Medicago truncatula
ref|XP_002892018.1|  hypothetical protein ARALYDRAFT_887207             213   1e-63   
ref|XP_002448160.1|  hypothetical protein SORBIDRAFT_06g022320          217   2e-63   Sorghum bicolor [broomcorn]
gb|EYU40308.1|  hypothetical protein MIMGU_mgv1a002952mg                217   2e-63   
ref|XP_008232262.1|  PREDICTED: protein ECERIFERUM 1-like               217   2e-63   
dbj|BAA11024.1|  possible aldehyde decarbonylase                        216   3e-63   Arabidopsis thaliana [mouse-ear cress]
gb|AAC24374.1|  CER1 protein                                            216   3e-63   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009376851.1|  PREDICTED: protein ECERIFERUM 1-like               217   3e-63   
ref|XP_008361247.1|  PREDICTED: protein ECERIFERUM 1-like               215   4e-63   
gb|EMT33049.1|  Protein WAX2                                            216   4e-63   
ref|XP_010496714.1|  PREDICTED: protein ECERIFERUM 1 isoform X2         216   5e-63   
ref|XP_010496480.1|  PREDICTED: protein ECERIFERUM 1-like               216   5e-63   
ref|XP_004307280.1|  PREDICTED: protein ECERIFERUM 1-like               216   5e-63   
gb|ACA14353.1|  TCER1                                                   216   5e-63   Triticum aestivum [Canadian hard winter wheat]
ref|XP_010496713.1|  PREDICTED: protein ECERIFERUM 1 isoform X1         216   6e-63   
ref|XP_004166202.1|  PREDICTED: protein ECERIFERUM 1-like               204   6e-63   
ref|XP_006354618.1|  PREDICTED: protein ECERIFERUM 1-like isoform X2    215   7e-63   
ref|XP_006418509.1|  hypothetical protein EUTSA_v10009534mg             216   8e-63   
ref|XP_006354617.1|  PREDICTED: protein ECERIFERUM 1-like isoform X1    216   8e-63   
ref|XP_006428971.1|  hypothetical protein CICLE_v10011291mg             216   8e-63   
ref|XP_009337262.1|  PREDICTED: protein ECERIFERUM 1-like               216   8e-63   
ref|NP_171723.2|  protein ECERIFERUM 1                                  216   9e-63   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008375723.1|  PREDICTED: protein ECERIFERUM 1-like               215   1e-62   
gb|AIE57503.1|  CER1                                                    215   1e-62   
ref|XP_008364777.1|  PREDICTED: protein ECERIFERUM 1-like               215   1e-62   
ref|NP_001184890.1|  protein ECERIFERUM 1                               215   1e-62   
ref|XP_006365794.1|  PREDICTED: protein ECERIFERUM 1-like               215   1e-62   
gb|KHG03871.1|  Protein WAX2 -like protein                              214   1e-62   
gb|KHN30013.1|  Protein WAX2                                            215   2e-62   
gb|KEH17984.1|  fatty acid hydroxylase superfamily protein              215   3e-62   
ref|XP_010255640.1|  PREDICTED: protein ECERIFERUM 1-like               214   3e-62   
ref|XP_010054531.1|  PREDICTED: protein ECERIFERUM 1-like               214   3e-62   
ref|XP_004510147.1|  PREDICTED: protein ECERIFERUM 1-like isoform X1    214   3e-62   
gb|KFK42594.1|  hypothetical protein AALP_AA1G015600                    213   7e-62   
ref|XP_009337266.1|  PREDICTED: protein ECERIFERUM 1-like               209   8e-62   
gb|EMS58602.1|  Protein WAX2                                            202   8e-62   
ref|XP_010520222.1|  PREDICTED: protein ECERIFERUM 1-like               213   1e-61   
dbj|BAK01778.1|  predicted protein                                      207   2e-61   
ref|XP_010920377.1|  PREDICTED: protein ECERIFERUM 1-like               210   2e-61   
ref|XP_008338420.1|  PREDICTED: protein ECERIFERUM 1-like               212   2e-61   
gb|EEE57393.1|  hypothetical protein OsJ_07566                          211   3e-61   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009339872.1|  PREDICTED: protein ECERIFERUM 1-like               207   4e-61   
gb|EMS48098.1|  Protein WAX2                                            211   4e-61   
ref|XP_010052731.1|  PREDICTED: protein ECERIFERUM 1-like               211   6e-61   
ref|XP_010054526.1|  PREDICTED: protein ECERIFERUM 1-like               209   6e-61   
ref|XP_008356893.1|  PREDICTED: protein ECERIFERUM 1-like               205   7e-61   
ref|XP_004252845.1|  PREDICTED: protein ECERIFERUM 1                    210   7e-61   
ref|XP_010052726.1|  PREDICTED: protein ECERIFERUM 1-like               210   9e-61   
gb|AAB87721.1|  maize gl1 homolog                                       210   9e-61   Arabidopsis thaliana [mouse-ear cress]
emb|CDP09364.1|  unnamed protein product                                210   1e-60   
ref|XP_009758897.1|  PREDICTED: uncharacterized protein LOC104211529    213   1e-60   
ref|XP_007134355.1|  hypothetical protein PHAVU_010G040600g             209   1e-60   
gb|ABD28319.2|  Sterol desaturase                                       207   1e-60   Medicago truncatula
ref|XP_004170720.1|  PREDICTED: protein ECERIFERUM 1-like               207   2e-60   
ref|XP_011093466.1|  PREDICTED: protein ECERIFERUM 1-like               209   2e-60   
ref|XP_008232261.1|  PREDICTED: protein ECERIFERUM 1-like               209   2e-60   
ref|XP_003574039.1|  PREDICTED: protein ECERIFERUM 1-like               208   4e-60   
ref|XP_010097746.1|  Protein WAX2                                       208   5e-60   
ref|XP_010247895.1|  PREDICTED: protein ECERIFERUM 1-like               207   7e-60   
ref|XP_008438252.1|  PREDICTED: protein ECERIFERUM 1-like               207   9e-60   
ref|XP_009118866.1|  PREDICTED: protein ECERIFERUM 1                    207   1e-59   
gb|AAD29719.1|AF143746_1  CER1                                          207   1e-59   Oryza sativa [red rice]
ref|XP_006583526.1|  PREDICTED: protein ECERIFERUM 1-like isoform X2    205   1e-59   
gb|KHN40121.1|  Protein WAX2                                            207   2e-59   
gb|EEC67150.1|  hypothetical protein OsI_33995                          206   2e-59   Oryza sativa Indica Group [Indian rice]
ref|XP_009337264.1|  PREDICTED: protein ECERIFERUM 1-like isoform X2    206   2e-59   
ref|XP_010691966.1|  PREDICTED: protein ECERIFERUM 1-like               206   2e-59   
ref|XP_004133955.1|  PREDICTED: protein ECERIFERUM 1-like               206   2e-59   
ref|XP_009337263.1|  PREDICTED: protein ECERIFERUM 1-like isoform X1    206   2e-59   
ref|XP_003530144.1|  PREDICTED: protein ECERIFERUM 1-like isoform X1    206   2e-59   
ref|XP_003625020.1|  Protein WAX2                                       206   2e-59   
ref|XP_007218863.1|  hypothetical protein PRUPE_ppa002893mg             206   2e-59   
gb|KGN56664.1|  hypothetical protein Csa_3G127750                       206   3e-59   
ref|XP_008438263.1|  PREDICTED: protein ECERIFERUM 1-like isoform X2    206   3e-59   
ref|XP_008438262.1|  PREDICTED: protein ECERIFERUM 1-like isoform X1    206   3e-59   
ref|XP_008438253.1|  PREDICTED: protein ECERIFERUM 1-like               206   3e-59   
gb|AHD24918.1|  CER1                                                    206   3e-59   
ref|XP_007220536.1|  hypothetical protein PRUPE_ppa002824mg             206   3e-59   
ref|XP_010691968.1|  PREDICTED: protein ECERIFERUM 1-like isoform X1    206   4e-59   
ref|XP_010539481.1|  PREDICTED: protein CER1-like 2                     207   4e-59   
ref|XP_004134362.1|  PREDICTED: protein ECERIFERUM 1-like               206   4e-59   
gb|AES88379.2|  fatty acid hydroxylase superfamily protein              205   5e-59   
gb|EYU42308.1|  hypothetical protein MIMGU_mgv1a002931mg                205   6e-59   
ref|XP_007041185.1|  Fatty acid hydroxylase superfamily isoform 1       205   7e-59   
ref|XP_007041186.1|  Fatty acid hydroxylase superfamily isoform 2       205   7e-59   
ref|XP_003606182.1|  Protein WAX2                                       204   7e-59   
gb|EPS60467.1|  hypothetical protein M569_14337                         205   8e-59   
gb|AFW72383.1|  hypothetical protein ZEAMMB73_077345                    193   8e-59   
ref|NP_001169009.1|  hypothetical protein                               193   8e-59   Zea mays [maize]
ref|XP_009586962.1|  PREDICTED: protein ECERIFERUM 1-like               204   9e-59   
gb|KCW76761.1|  hypothetical protein EUGRSUZ_D01120                     204   9e-59   
ref|XP_009797701.1|  PREDICTED: protein ECERIFERUM 1-like               204   1e-58   
ref|XP_002464501.1|  hypothetical protein SORBIDRAFT_01g019590          204   1e-58   Sorghum bicolor [broomcorn]
emb|CDY38059.1|  BnaCnng09200D                                          206   1e-58   
gb|EMT06855.1|  Protein WAX2                                            204   1e-58   
gb|ABG66131.1|  CER1 protein, putative, expressed                       192   2e-58   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010535407.1|  PREDICTED: protein ECERIFERUM 1-like isoform X2    203   2e-58   
ref|XP_008245903.1|  PREDICTED: protein ECERIFERUM 1-like isoform X1    204   2e-58   
gb|EMT07276.1|  Protein WAX2                                            203   2e-58   
ref|XP_007015842.1|  CER1 protein isoform 1                             204   2e-58   
ref|XP_006354619.1|  PREDICTED: protein ECERIFERUM 1-like isoform X1    204   2e-58   
ref|XP_006354620.1|  PREDICTED: protein ECERIFERUM 1-like isoform X2    204   3e-58   
gb|KHG15491.1|  Protein WAX2 -like protein                              203   3e-58   
gb|AFW68611.1|  hypothetical protein ZEAMMB73_227989                    199   3e-58   
ref|XP_010535406.1|  PREDICTED: protein ECERIFERUM 1-like isoform X1    203   3e-58   
ref|XP_007218858.1|  hypothetical protein PRUPE_ppa002770mg             203   3e-58   
ref|XP_007220541.1|  hypothetical protein PRUPE_ppa002903mg             203   3e-58   
ref|XP_003580122.1|  PREDICTED: protein ECERIFERUM 1-like               203   4e-58   
gb|KDO85386.1|  hypothetical protein CISIN_1g006590mg                   200   5e-58   
ref|XP_002526511.1|  sterol desaturase, putative                        202   5e-58   Ricinus communis
ref|XP_006661851.1|  PREDICTED: protein ECERIFERUM 1-like               203   5e-58   
gb|EYU40310.1|  hypothetical protein MIMGU_mgv1a003047mg                202   5e-58   
ref|XP_007041192.1|  CER1 protein                                       202   5e-58   
ref|XP_006445498.1|  hypothetical protein CICLE_v10019265mg             201   6e-58   
gb|KDO85384.1|  hypothetical protein CISIN_1g006590mg                   201   6e-58   
gb|EYU40309.1|  hypothetical protein MIMGU_mgv1a003047mg                202   6e-58   
emb|CAE03390.2|  OSJNBa0004N05.14                                       202   7e-58   Oryza sativa Japonica Group [Japonica rice]
gb|ACG35856.1|  CER1                                                    202   8e-58   Zea mays [maize]
ref|XP_004493412.1|  PREDICTED: protein ECERIFERUM 1-like               201   1e-57   
gb|AES88391.2|  fatty acid hydroxylase superfamily protein              201   1e-57   
ref|XP_004982905.1|  PREDICTED: protein ECERIFERUM 1-like               201   2e-57   
gb|KDO85383.1|  hypothetical protein CISIN_1g006590mg                   201   2e-57   
ref|XP_003625022.1|  Protein WAX2                                       201   2e-57   
ref|NP_001146661.1|  uncharacterized protein LOC100280261               201   2e-57   Zea mays [maize]
ref|XP_007041196.1|  CER1 protein                                       201   3e-57   
ref|XP_011012757.1|  PREDICTED: protein ECERIFERUM 1-like               200   4e-57   
ref|XP_007015845.1|  CER1 protein                                       200   4e-57   
gb|KDO85382.1|  hypothetical protein CISIN_1g006590mg                   200   4e-57   
ref|XP_010276559.1|  PREDICTED: protein ECERIFERUM 1-like               200   5e-57   
gb|KGN56666.1|  hypothetical protein Csa_3G127770                       200   5e-57   
gb|AAC24373.1|  CER1-like protein                                       199   5e-57   Arabidopsis thaliana [mouse-ear cress]
emb|CBI16766.3|  unnamed protein product                                192   6e-57   
ref|NP_171721.3|  protein CER1-like 1                                   200   6e-57   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010496697.1|  PREDICTED: protein CER1-like 1                     200   6e-57   
ref|XP_010936012.1|  PREDICTED: protein ECERIFERUM 1-like isoform X2    200   6e-57   
ref|NP_973742.1|  protein CER1-like 1                                   200   7e-57   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006445499.1|  hypothetical protein CICLE_v10019265mg             200   7e-57   
ref|XP_006464362.1|  PREDICTED: protein ECERIFERUM 1-like isoform X2    200   7e-57   
ref|XP_006464361.1|  PREDICTED: protein ECERIFERUM 1-like isoform X1    200   8e-57   
ref|XP_010255639.1|  PREDICTED: protein ECERIFERUM 1-like isoform X2    199   1e-56   
ref|XP_002526512.1|  sterol desaturase, putative                        199   1e-56   Ricinus communis
ref|XP_010041339.1|  PREDICTED: protein ECERIFERUM 1-like               193   1e-56   
ref|XP_010255638.1|  PREDICTED: protein ECERIFERUM 1-like isoform X1    199   2e-56   
gb|KCW44429.1|  hypothetical protein EUGRSUZ_L02074                     194   2e-56   
ref|XP_009376850.1|  PREDICTED: protein ECERIFERUM 1-like               198   3e-56   
ref|XP_003625024.1|  Protein WAX2                                       198   3e-56   
ref|XP_004145021.1|  PREDICTED: protein ECERIFERUM 1-like               197   4e-56   
ref|XP_006306552.1|  hypothetical protein CARUB_v10012639mg             197   5e-56   
ref|XP_006306997.1|  hypothetical protein CARUB_v10008574mg             197   5e-56   
ref|XP_006375527.1|  hypothetical protein POPTR_0014s15110g             197   5e-56   
ref|XP_002320584.1|  ECERIFERUM 1 family protein                        197   7e-56   Populus trichocarpa [western balsam poplar]
ref|XP_006375524.1|  hypothetical protein POPTR_0014s15080g             196   9e-56   
ref|XP_006375521.1|  hypothetical protein POPTR_0014s15050g             196   1e-55   
ref|XP_008796440.1|  PREDICTED: uncharacterized protein LOC103711898    202   1e-55   
ref|XP_006418508.1|  hypothetical protein EUTSA_v10007056mg             196   1e-55   
ref|XP_011005107.1|  PREDICTED: protein ECERIFERUM 1-like               196   1e-55   
ref|XP_010255641.1|  PREDICTED: protein ECERIFERUM 1-like               196   1e-55   
ref|XP_008344085.1|  PREDICTED: protein ECERIFERUM 1-like               196   2e-55   
ref|XP_011085187.1|  PREDICTED: protein ECERIFERUM 1-like               196   2e-55   
gb|KDP34470.1|  hypothetical protein JCGZ_12753                         188   2e-55   
ref|XP_009410811.1|  PREDICTED: protein ECERIFERUM 1-like               196   2e-55   
gb|KFK42593.1|  hypothetical protein AALP_AA1G015500                    195   3e-55   
gb|ACR38546.1|  unknown                                                 195   4e-55   Zea mays [maize]
gb|KFK36660.1|  hypothetical protein AALP_AA4G153400                    195   4e-55   
ref|XP_004953128.1|  PREDICTED: protein ECERIFERUM 1-like               195   4e-55   
ref|NP_001064826.1|  Os10g0471100                                       195   4e-55   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002454185.1|  hypothetical protein SORBIDRAFT_04g026320          194   6e-55   Sorghum bicolor [broomcorn]
emb|CAA65199.1|  CER1-like                                              194   6e-55   Arabidopsis thaliana [mouse-ear cress]
emb|CAA65200.1|  CER1-like                                              194   6e-55   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010480305.1|  PREDICTED: protein CER1-like 1 isoform X1          194   1e-54   
ref|XP_010479268.1|  PREDICTED: protein CER1-like 1                     194   1e-54   
ref|XP_010920316.1|  PREDICTED: protein ECERIFERUM 1-like               194   1e-54   
ref|XP_010480306.1|  PREDICTED: protein CER1-like 1 isoform X2          194   1e-54   
ref|XP_008460068.1|  PREDICTED: protein ECERIFERUM 1-like               193   1e-54   
ref|XP_010276564.1|  PREDICTED: protein ECERIFERUM 1-like               193   2e-54   
ref|XP_010511349.1|  PREDICTED: protein CER1-like 1                     193   3e-54   
gb|EMT04955.1|  Protein WAX2                                            192   3e-54   
gb|KHG12604.1|  Protein WAX2 -like protein                              192   3e-54   
ref|XP_004308720.1|  PREDICTED: protein ECERIFERUM 1-like               192   5e-54   
ref|XP_004302222.1|  PREDICTED: protein ECERIFERUM 1-like               191   5e-54   
emb|CDY55894.1|  BnaA04g29150D                                          191   9e-54   
ref|XP_010493027.1|  PREDICTED: protein CER1-like 1                     191   1e-53   
ref|NP_001118464.1|  protein CER1-like 2                                188   2e-53   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006857470.1|  hypothetical protein AMTR_s00067p00188650          190   2e-53   
gb|EMS58051.1|  Protein WAX2                                            190   2e-53   
ref|XP_009141690.1|  PREDICTED: protein CER1-like 2 isoform X3          188   1e-52   
ref|XP_009141689.1|  PREDICTED: protein CER1-like 2 isoform X2          188   1e-52   
ref|XP_009141688.1|  PREDICTED: protein CER1-like 2 isoform X1          188   1e-52   
ref|XP_006295717.1|  hypothetical protein CARUB_v10024836mg             188   1e-52   
emb|CDX79754.1|  BnaC03g20900D                                          188   2e-52   
ref|XP_010414811.1|  PREDICTED: protein CER1-like 1 isoform X2          188   2e-52   
ref|NP_181306.3|  protein CER1-like 2                                   187   2e-52   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010414810.1|  PREDICTED: protein CER1-like 1 isoform X1          188   2e-52   
ref|XP_004954341.1|  PREDICTED: protein ECERIFERUM 1-like               187   2e-52   
gb|AAC23640.1|  CER1-like protein                                       187   2e-52   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010517046.1|  PREDICTED: protein CER1-like 2 isoform X1          187   3e-52   
gb|EMT15823.1|  Protein WAX2                                            176   3e-52   
emb|CDX93353.1|  BnaC04g45430D                                          187   3e-52   
emb|CDX93352.1|  BnaC04g45440D                                          187   4e-52   
ref|XP_003574037.1|  PREDICTED: protein ECERIFERUM 1-like               186   5e-52   
gb|EPS71900.1|  hypothetical protein M569_02856                         186   5e-52   
ref|XP_010936011.1|  PREDICTED: protein ECERIFERUM 1-like isoform X1    186   5e-52   
ref|XP_010505369.1|  PREDICTED: protein CER1-like 2                     186   6e-52   
ref|XP_006410962.1|  hypothetical protein EUTSA_v10016375mg             186   1e-51   
gb|EAY87991.1|  hypothetical protein OsI_09413                          184   3e-51   Oryza sativa Indica Group [Indian rice]
ref|XP_009141683.1|  PREDICTED: protein CER1-like 2                     184   4e-51   
emb|CDY55893.1|  BnaA04g29140D                                          184   4e-51   
emb|CDX74937.1|  BnaA05g06830D                                          184   4e-51   
emb|CDX91381.1|  BnaC04g07690D                                          184   5e-51   
gb|EMS68717.1|  Protein WAX2                                            184   5e-51   
gb|ABF51011.1|  putative aldehyde decarbonylase enzyme CER1;1           183   6e-51   Hordeum vulgare [barley]
dbj|BAK00236.1|  predicted protein                                      183   6e-51   
ref|XP_009143457.1|  PREDICTED: protein CER1-like 2                     184   6e-51   
gb|AFW64028.1|  hypothetical protein ZEAMMB73_844277                    183   8e-51   
ref|NP_001048490.1|  Os02g0814200                                       183   8e-51   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008676841.1|  PREDICTED: uncharacterized protein LOC100273...    183   9e-51   
ref|XP_010509285.1|  PREDICTED: protein CER1-like 2                     183   9e-51   
ref|XP_002881545.1|  hypothetical protein ARALYDRAFT_321478             183   1e-50   
ref|XP_002454767.1|  hypothetical protein SORBIDRAFT_04g036940          183   1e-50   
dbj|BAJ85488.1|  predicted protein                                      183   1e-50   
gb|ABG47420.1|  putative CER1                                           183   1e-50   
ref|XP_009133199.1|  PREDICTED: protein CER1-like 2                     182   2e-50   
gb|ACG47659.1|  CER1                                                    182   3e-50   
ref|XP_003570374.1|  PREDICTED: protein ECERIFERUM 1-like               181   3e-50   
ref|XP_004253318.1|  PREDICTED: protein CER1-like 2                     181   4e-50   
gb|ABG66132.1|  CER1 protein, putative, expressed                       180   1e-49   
ref|XP_002443046.1|  hypothetical protein SORBIDRAFT_08g006860          168   7e-49   
gb|EMS48099.1|  Protein WAX2                                            175   5e-48   
gb|EMS58604.1|  Protein WAX2                                            174   1e-47   
gb|EPS65064.1|  hypothetical protein M569_09713                         173   4e-47   
ref|XP_007041184.1|  Fatty acid hydroxylase superfamily                 176   4e-47   
gb|KDO47517.1|  hypothetical protein CISIN_1g039554mg                   160   7e-46   
ref|XP_008676840.1|  PREDICTED: uncharacterized protein LOC100273...    169   1e-45   
ref|XP_007008730.1|  Fatty acid hydroxylase superfamily isoform 2       167   2e-45   
gb|KDO85387.1|  hypothetical protein CISIN_1g006590mg                   166   1e-44   
ref|XP_004168237.1|  PREDICTED: protein ECERIFERUM 1-like               165   3e-44   
ref|XP_009779400.1|  PREDICTED: protein ECERIFERUM 1-like               166   4e-44   
ref|XP_007041188.1|  Fatty acid hydroxylase superfamily isoform 4       162   1e-43   
ref|XP_007041189.1|  Fatty acid hydroxylase superfamily isoform 5       162   1e-43   
gb|EMT22938.1|  hypothetical protein F775_42817                         157   2e-43   
ref|XP_007041187.1|  Fatty acid hydroxylase superfamily isoform 3       161   3e-43   
gb|KDP28917.1|  hypothetical protein JCGZ_14688                         161   4e-43   
ref|XP_006480707.1|  PREDICTED: protein ECERIFERUM 1-like isoform X2    160   9e-43   
gb|ACN31737.1|  unknown                                                 159   5e-42   
ref|XP_007015843.1|  CER1 protein isoform 2                             157   5e-42   
ref|XP_008232308.1|  PREDICTED: protein ECERIFERUM 1-like               157   1e-41   
ref|XP_006464363.1|  PREDICTED: protein ECERIFERUM 1-like isoform X3    157   2e-41   
ref|XP_002892019.1|  hypothetical protein ARALYDRAFT_470048             155   6e-41   
gb|EMT15793.1|  Protein WAX2                                            154   6e-41   
gb|EMT04858.1|  Protein WAX2                                            154   1e-40   
gb|EYU42307.1|  hypothetical protein MIMGU_mgv1a003396mg                153   4e-40   
ref|XP_003606194.1|  Protein WAX2                                       152   8e-40   
emb|CDX79753.1|  BnaC03g20890D                                          144   9e-40   
ref|XP_008245904.1|  PREDICTED: protein ECERIFERUM 1-like isoform X2    151   2e-39   
ref|XP_009614891.1|  PREDICTED: LOW QUALITY PROTEIN: protein ECER...    140   9e-37   
ref|XP_010517047.1|  PREDICTED: protein CER1-like 2 isoform X2          142   3e-36   
ref|XP_007220698.1|  hypothetical protein PRUPE_ppa020996mg             139   1e-35   
ref|XP_006857475.1|  hypothetical protein AMTR_s00067p00190600          140   1e-35   
ref|XP_001783415.1|  predicted protein                                  140   2e-35   
ref|XP_010042043.1|  PREDICTED: protein ECERIFERUM 1-like               137   3e-35   
ref|XP_002989550.1|  hypothetical protein SELMODRAFT_129942             138   8e-35   
ref|XP_002964260.1|  hypothetical protein SELMODRAFT_230422             136   4e-34   
ref|XP_009621541.1|  PREDICTED: protein ECERIFERUM 1-like               127   6e-34   
ref|XP_010097743.1|  Protein WAX2                                       134   5e-33   
ref|XP_007041194.1|  CER1 protein                                       127   6e-31   
ref|XP_002509294.1|  predicted protein                                  127   1e-30   
ref|XP_003081883.1|  faceless pollen-1 (ISS)                            127   2e-30   
gb|ABD28314.2|  possible aldehyde decarbonylase-related, putative       116   6e-30   
emb|CEF99557.1|  Uncharacterised domain Wax2, C-terminal                124   1e-29   
ref|XP_009793431.1|  PREDICTED: protein ECERIFERUM 1-like               116   1e-29   
ref|XP_010691969.1|  PREDICTED: protein ECERIFERUM 1-like isoform X2    120   7e-29   
ref|XP_001420263.1|  predicted protein                                  121   1e-28   
ref|XP_004231132.1|  PREDICTED: protein ECERIFERUM 1-like               112   2e-28   
ref|XP_007041193.1|  Fatty acid hydroxylase superfamily                 110   1e-27   
gb|EEC73225.1|  hypothetical protein OsI_07312                          106   1e-25   
ref|XP_002270946.1|  PREDICTED: protein ECERIFERUM 3                    111   7e-25   
ref|XP_006652506.1|  PREDICTED: protein ECERIFERUM 1-like               109   1e-24   
ref|XP_007221983.1|  hypothetical protein PRUPE_ppa002836mg             110   2e-24   
gb|ADE75704.1|  unknown                                                 110   2e-24   
emb|CAH68010.1|  OSIGBa0157K09-H0214G12.21                              102   2e-24   
dbj|BAH00848.1|  unnamed protein product                                102   2e-24   
ref|XP_008223563.1|  PREDICTED: protein ECERIFERUM 3 isoform X2         108   5e-24   
ref|XP_008223562.1|  PREDICTED: protein ECERIFERUM 3 isoform X1         108   7e-24   
gb|EEE61327.1|  hypothetical protein OsJ_15439                          107   1e-23   
gb|EEC77626.1|  hypothetical protein OsI_16615                          106   2e-23   
gb|KCW76789.1|  hypothetical protein EUGRSUZ_D011433                  97.8    7e-23   
ref|XP_004309858.1|  PREDICTED: protein ECERIFERUM 3-like               105   7e-23   
gb|KEH32582.1|  fatty acid hydroxylase superfamily protein              103   3e-22   
ref|XP_010103144.1|  Protein WAX2                                       103   3e-22   
ref|XP_007154834.1|  hypothetical protein PHAVU_003G1516000g            101   3e-22   
ref|XP_007154833.1|  hypothetical protein PHAVU_003G1516000g            101   4e-22   
ref|XP_011082697.1|  PREDICTED: protein ECERIFERUM 3-like               103   4e-22   
ref|XP_002891510.1|  hypothetical protein ARALYDRAFT_891841           98.6    7e-22   
ref|XP_004507787.1|  PREDICTED: protein ECERIFERUM 3-like               102   8e-22   
emb|CBI25242.3|  unnamed protein product                                101   2e-21   
ref|XP_002270033.2|  PREDICTED: protein ECERIFERUM 3-like               101   2e-21   
ref|XP_001756318.1|  predicted protein                                  101   2e-21   
ref|XP_003542310.1|  PREDICTED: protein ECERIFERUM 3-like               101   2e-21   
ref|XP_001781794.1|  predicted protein                                  100   4e-21   
ref|XP_010047031.1|  PREDICTED: protein ECERIFERUM 3                    100   6e-21   
ref|XP_011073243.1|  PREDICTED: protein ECERIFERUM 3-like isoform X3  99.4    7e-21   
ref|XP_002270075.1|  PREDICTED: protein ECERIFERUM 3-like             99.8    9e-21   
emb|CBI25244.3|  unnamed protein product                              99.4    9e-21   
ref|XP_011073241.1|  PREDICTED: protein ECERIFERUM 3-like isoform X1  99.4    1e-20   
ref|XP_011073242.1|  PREDICTED: protein ECERIFERUM 3-like isoform X2  99.4    1e-20   
ref|XP_003549515.1|  PREDICTED: protein ECERIFERUM 3-like             97.4    6e-20   
gb|KHN17538.1|  Protein WAX2                                          97.1    6e-20   
ref|XP_004956872.1|  PREDICTED: protein ECERIFERUM 3-like             96.7    9e-20   
ref|XP_009788358.1|  PREDICTED: protein ECERIFERUM 3-like             96.7    1e-19   
ref|XP_009609208.1|  PREDICTED: protein ECERIFERUM 3-like isoform X2  96.7    1e-19   
ref|XP_010278025.1|  PREDICTED: protein ECERIFERUM 3                  96.3    1e-19   
ref|XP_009609207.1|  PREDICTED: protein ECERIFERUM 3-like isoform X1  96.3    1e-19   
ref|XP_010097741.1|  Protein WAX2                                     95.1    1e-19   
gb|KHG04939.1|  Protein WAX2                                          95.9    2e-19   
ref|XP_006343719.1|  PREDICTED: protein ECERIFERUM 3-like             95.5    3e-19   
emb|CDP02895.1|  unnamed protein product                              95.1    3e-19   
ref|XP_010929211.1|  PREDICTED: protein ECERIFERUM 3-like isoform X2  94.4    4e-19   
ref|XP_010929210.1|  PREDICTED: protein ECERIFERUM 3-like isoform X1  94.7    4e-19   
ref|XP_008804903.1|  PREDICTED: protein ECERIFERUM 3-like isoform X2  94.4    5e-19   
ref|XP_007509665.1|  predicted protein                                94.7    5e-19   
ref|XP_004242647.1|  PREDICTED: protein ECERIFERUM 3                  94.4    6e-19   
ref|XP_008804902.1|  PREDICTED: protein ECERIFERUM 3-like isoform X1  94.4    6e-19   
gb|KCW76788.1|  hypothetical protein EUGRSUZ_D011432                  88.6    8e-19   
ref|XP_001782380.1|  predicted protein                                94.0    9e-19   
ref|XP_007013964.1|  Fatty acid hydroxylase superfamily               94.0    9e-19   
ref|XP_006350059.1|  PREDICTED: protein ECERIFERUM 3-like             93.6    1e-18   
ref|XP_010914063.1|  PREDICTED: protein ECERIFERUM 3 isoform X2       93.2    1e-18   
gb|KGN58637.1|  hypothetical protein Csa_3G708180                     87.4    2e-18   
ref|XP_010914062.1|  PREDICTED: protein ECERIFERUM 3 isoform X1       92.8    2e-18   
ref|XP_010904609.1|  PREDICTED: protein ECERIFERUM 3-like             92.4    2e-18   
ref|NP_001141595.1|  uncharacterized protein LOC100273712             92.0    3e-18   
ref|XP_011012180.1|  PREDICTED: protein ECERIFERUM 3-like             91.7    3e-18   
gb|KDP38762.1|  hypothetical protein JCGZ_04115                       91.7    4e-18   
ref|XP_009622102.1|  PREDICTED: protein ECERIFERUM 3-like             89.4    4e-18   
ref|XP_002973631.1|  hypothetical protein SELMODRAFT_99824            88.2    5e-18   
ref|XP_008794400.1|  PREDICTED: protein ECERIFERUM 3-like             90.9    9e-18   
ref|XP_010318689.1|  PREDICTED: protein ECERIFERUM 3 isoform X3       90.9    1e-17   
ref|XP_004235875.1|  PREDICTED: protein ECERIFERUM 3 isoform X1       90.5    1e-17   
ref|XP_010318688.1|  PREDICTED: protein ECERIFERUM 3 isoform X2       90.5    1e-17   
ref|XP_009798188.1|  PREDICTED: protein ECERIFERUM 3-like             90.1    1e-17   
ref|XP_003578148.1|  PREDICTED: protein ECERIFERUM 3-like             90.1    2e-17   
ref|XP_010536953.1|  PREDICTED: LOW QUALITY PROTEIN: protein ECER...  89.0    4e-17   
gb|KHG27245.1|  Protein WAX2                                          89.0    4e-17   
ref|XP_002325096.1|  hypothetical protein POPTR_0018s10830g           89.0    5e-17   
gb|EEC73226.1|  hypothetical protein OsI_07314                        87.8    5e-17   
gb|KHG30512.1|  Protein WAX2 -like protein                            88.6    6e-17   
gb|KHG27244.1|  Protein WAX2                                          88.6    6e-17   
ref|XP_010041960.1|  PREDICTED: protein ECERIFERUM 1-like             85.9    6e-17   
ref|XP_011018104.1|  PREDICTED: protein ECERIFERUM 3                  88.2    7e-17   
ref|XP_002975687.1|  hypothetical protein SELMODRAFT_103982           88.2    7e-17   
gb|AFW64026.1|  hypothetical protein ZEAMMB73_844277                  88.2    8e-17   
gb|EYU21788.1|  hypothetical protein MIMGU_mgv1a025856mg              87.8    1e-16   
gb|KDO62362.1|  hypothetical protein CISIN_1g006768mg                 87.0    1e-16   
ref|XP_006453492.1|  hypothetical protein CICLE_v10007738mg           87.0    2e-16   
gb|KDO62360.1|  hypothetical protein CISIN_1g006768mg                 87.0    2e-16   
ref|XP_006341693.1|  PREDICTED: protein ECERIFERUM 3-like             87.0    2e-16   
ref|XP_011079338.1|  PREDICTED: protein ECERIFERUM 3-like             86.7    2e-16   
ref|NP_001063227.1|  Os09g0426800                                     86.3    4e-16   
ref|XP_002960347.1|  hypothetical protein SELMODRAFT_437448           85.9    4e-16   
ref|XP_006279594.1|  hypothetical protein CARUB_v10026077mg           85.9    4e-16   
ref|XP_002308430.2|  hypothetical protein POPTR_0006s19140g           85.9    5e-16   
gb|EAZ44800.1|  hypothetical protein OsJ_29433                        85.9    5e-16   
ref|XP_002967368.1|  hypothetical protein SELMODRAFT_408343           85.5    6e-16   
ref|XP_010452800.1|  PREDICTED: protein ECERIFERUM 3-like             85.1    9e-16   
ref|XP_003061467.1|  predicted protein                                84.7    1e-15   
ref|XP_010545442.1|  PREDICTED: protein ECERIFERUM 3 isoform X2       84.3    1e-15   
ref|XP_009400348.1|  PREDICTED: protein ECERIFERUM 3-like             84.3    2e-15   
ref|XP_010545441.1|  PREDICTED: protein ECERIFERUM 3 isoform X1       84.3    2e-15   
gb|ABC87808.1|  TCER1                                                 81.6    2e-15   
ref|XP_011070158.1|  PREDICTED: protein ECERIFERUM 3-like             84.0    2e-15   
gb|EYU24562.1|  hypothetical protein MIMGU_mgv1a002930mg              83.6    3e-15   
ref|XP_004973574.1|  PREDICTED: protein ECERIFERUM 3-like             83.6    3e-15   
ref|XP_009387452.1|  PREDICTED: protein ECERIFERUM 3-like isoform X2  83.6    3e-15   
ref|XP_009387450.1|  PREDICTED: protein ECERIFERUM 3-like isoform X1  83.6    3e-15   
dbj|BAK02959.1|  predicted protein                                    83.2    4e-15   
ref|XP_009766364.1|  PREDICTED: protein ECERIFERUM 3-like             82.8    5e-15   
ref|XP_009387454.1|  PREDICTED: protein ECERIFERUM 3-like isoform X4  82.8    5e-15   
ref|XP_009387453.1|  PREDICTED: protein ECERIFERUM 3-like isoform X3  82.8    6e-15   
ref|XP_009587593.1|  PREDICTED: protein ECERIFERUM 3-like             82.8    6e-15   
ref|XP_008658046.1|  PREDICTED: uncharacterized protein LOC100192...  82.0    9e-15   
gb|AFW87578.1|  hypothetical protein ZEAMMB73_499314                  81.3    9e-15   
ref|XP_010443488.1|  PREDICTED: protein ECERIFERUM 3-like             81.3    2e-14   
dbj|BAJ87617.1|  predicted protein                                    81.3    2e-14   
dbj|BAJ85039.1|  predicted protein                                    81.3    2e-14   
ref|XP_002864528.1|  hypothetical protein ARALYDRAFT_495876           81.3    2e-14   
ref|NP_001266321.1|  gl1 protein                                      81.3    2e-14   
ref|NP_200588.2|  protein ECERIFERUM 3                                80.9    2e-14   
gb|KDO42774.1|  hypothetical protein CISIN_1g0165312mg                75.9    3e-14   
dbj|BAJ85064.1|  predicted protein                                    80.5    3e-14   
gb|KDO42775.1|  hypothetical protein CISIN_1g0165312mg                73.9    4e-14   
ref|XP_009390985.1|  PREDICTED: protein ECERIFERUM 3-like             80.1    4e-14   
ref|XP_010483318.1|  PREDICTED: protein ECERIFERUM 3                  80.1    4e-14   
gb|AEQ39063.1|  putative sterol desaturase                            77.8    4e-14   
emb|CDX88639.1|  BnaA03g10100D                                        79.7    6e-14   
ref|XP_002528208.1|  sterol desaturase, putative                      79.3    7e-14   
emb|CDY11848.1|  BnaC03g12740D                                        79.0    9e-14   
ref|XP_002961424.1|  hypothetical protein SELMODRAFT_164680           79.0    1e-13   
ref|XP_009132107.1|  PREDICTED: protein ECERIFERUM 3-like             79.0    1e-13   
ref|XP_004965700.1|  PREDICTED: protein ECERIFERUM 3-like             78.6    1e-13   
ref|XP_002990278.1|  hypothetical protein SELMODRAFT_185167           78.2    2e-13   
emb|CDO98263.1|  unnamed protein product                              78.2    2e-13   
ref|NP_001058237.1|  Os06g0653000                                     77.8    3e-13   
ref|XP_002437383.1|  hypothetical protein SORBIDRAFT_10g025920        77.4    4e-13   
ref|XP_010687696.1|  PREDICTED: protein ECERIFERUM 3                  77.0    5e-13   
ref|XP_008643558.1|  PREDICTED: uncharacterized protein LOC100280...  76.6    7e-13   
ref|XP_004149879.1|  PREDICTED: protein ECERIFERUM 3-like             75.9    1e-12   
gb|ACN25333.1|  unknown                                               75.5    1e-12   
gb|EYU37115.1|  hypothetical protein MIMGU_mgv1a021583mg              75.5    2e-12   
gb|KEH23596.1|  fatty acid hydroxylase superfamily protein            75.1    2e-12   
ref|XP_006401167.1|  hypothetical protein EUTSA_v10012960mg           75.1    2e-12   
gb|EPS72440.1|  hypothetical protein M569_02318                       73.6    4e-12   
gb|EYU34298.1|  hypothetical protein MIMGU_mgv1a0095731mg             72.8    4e-12   
ref|XP_006845484.1|  hypothetical protein AMTR_s00019p00142280        73.2    7e-12   
emb|CDY02769.1|  BnaC02g11200D                                        73.6    8e-12   
emb|CDY51280.1|  BnaA10g11680D                                        72.8    1e-11   
ref|XP_009120300.1|  PREDICTED: protein ECERIFERUM 3-like isoform X2  72.8    1e-11   
ref|XP_009120299.1|  PREDICTED: protein ECERIFERUM 3-like isoform X1  72.8    1e-11   
gb|AGT16346.1|  glossy1 protein                                       72.8    1e-11   
ref|XP_009132284.1|  PREDICTED: protein ECERIFERUM 3-like             72.4    1e-11   
gb|EMT23422.1|  Protein WAX2                                          72.8    1e-11   
emb|CDY11847.1|  BnaC03g12730D                                        72.4    2e-11   
ref|XP_003570600.1|  PREDICTED: protein ECERIFERUM 3-like             72.0    2e-11   
ref|XP_009417462.1|  PREDICTED: protein ECERIFERUM 3-like             71.6    3e-11   
emb|CDX88640.1|  BnaA03g10090D                                        71.2    3e-11   
ref|XP_004951702.1|  PREDICTED: protein ECERIFERUM 3-like isoform X3  70.9    5e-11   
ref|XP_004510148.1|  PREDICTED: protein ECERIFERUM 1-like isoform X2  70.1    7e-11   
emb|CDY50795.1|  BnaCnng19590D                                        70.1    8e-11   
gb|KHG04940.1|  Protein WAX2                                          69.7    1e-10   
ref|NP_001046080.1|  Os02g0178800                                     69.7    1e-10   
gb|EEC72610.1|  hypothetical protein OsI_06088                        69.7    1e-10   
emb|CDX88642.1|  BnaA03g10070D                                        69.7    1e-10   
gb|ACN25689.1|  unknown                                               69.3    2e-10   
gb|AAA33934.1|  lipid transfer protein                                68.6    2e-10   
ref|XP_002891509.1|  hypothetical protein ARALYDRAFT_891838           64.3    2e-10   
ref|XP_006657201.1|  PREDICTED: protein ECERIFERUM 3-like             68.6    3e-10   
ref|XP_002451653.1|  hypothetical protein SORBIDRAFT_04g005330        68.2    4e-10   



>ref|XP_009777506.1| PREDICTED: protein ECERIFERUM 1-like [Nicotiana sylvestris]
Length=524

 Score =   246 bits (628),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 122/155 (79%), Positives = 135/155 (87%), Gaps = 1/155 (1%)
 Frame = -3

Query  483  MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKY-LTDSPNERDPNillifpfllIRML  307
            MAS+PGILTEWPWTWLG+FKYVVLAPFVAHS + + L+    +RD    +IFPFLL RM+
Sbjct  1    MASKPGILTEWPWTWLGNFKYVVLAPFVAHSIHSFFLSKDEKQRDIVNFIIFPFLLSRMI  60

Query  306  HNQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHM  127
            HNQ+WISLSRYRTAKGDNRIVDK IEF+QVDRERNWDDQII NGLLFY+GY KL  +HH+
Sbjct  61   HNQIWISLSRYRTAKGDNRIVDKSIEFDQVDRERNWDDQIIFNGLLFYYGYMKLEQSHHI  120

Query  126  PIWRTDGIILTALIHTGPVEFLYYWLHRALHHHIL  22
            P WRTDGIILTALIH GPVEFLYYWLHRALHHH L
Sbjct  121  PFWRTDGIILTALIHIGPVEFLYYWLHRALHHHFL  155



>ref|XP_009612939.1| PREDICTED: protein ECERIFERUM 1-like isoform X1 [Nicotiana tomentosiformis]
Length=626

 Score =   247 bits (630),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 123/155 (79%), Positives = 140/155 (90%), Gaps = 1/155 (1%)
 Frame = -3

Query  483  MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKY-LTDSPNERDPNillifpfllIRML  307
            MAS+PGILTEWPWTWLG+FKYVVLAP+VAHS + + +++  ++RD   L+IFPFLL RML
Sbjct  1    MASKPGILTEWPWTWLGNFKYVVLAPYVAHSLHSFFMSEDESKRDITYLIIFPFLLFRML  60

Query  306  HNQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHM  127
            HNQ+WISLSRYRTAKGDNRIVDK IEF+QVDRERNWDDQIILNGLLFY+GY KL  +HHM
Sbjct  61   HNQIWISLSRYRTAKGDNRIVDKSIEFDQVDRERNWDDQIILNGLLFYYGYTKLEQSHHM  120

Query  126  PIWRTDGIILTALIHTGPVEFLYYWLHRALHHHIL  22
            PIWRTDGII+TAL+ TGPVEFLYYWLHRALHHH L
Sbjct  121  PIWRTDGIIMTALLQTGPVEFLYYWLHRALHHHFL  155



>ref|XP_009586975.1| PREDICTED: protein ECERIFERUM 1-like [Nicotiana tomentosiformis]
Length=625

 Score =   242 bits (617),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 119/155 (77%), Positives = 135/155 (87%), Gaps = 1/155 (1%)
 Frame = -3

Query  483  MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKY-LTDSPNERDPNillifpfllIRML  307
            MAS+PGILTEWPWTWLG+FKYVVLAPFVAHS + + L+    ++D    +IFPFLL RM+
Sbjct  1    MASKPGILTEWPWTWLGNFKYVVLAPFVAHSIHSFFLSKDEKQKDIVKFIIFPFLLSRMI  60

Query  306  HNQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHM  127
            HNQ+WIS+SRYRTAKGDNRIVDK IEF+QVDRERNWDDQII NGLLFY+GY KL  +HH+
Sbjct  61   HNQIWISISRYRTAKGDNRIVDKSIEFDQVDRERNWDDQIIFNGLLFYYGYMKLEQSHHI  120

Query  126  PIWRTDGIILTALIHTGPVEFLYYWLHRALHHHIL  22
            P WRTDGIILTALIH GPVEFLYYWLHR+LHHH L
Sbjct  121  PFWRTDGIILTALIHIGPVEFLYYWLHRSLHHHFL  155



>ref|XP_009787252.1| PREDICTED: protein ECERIFERUM 1-like isoform X2 [Nicotiana sylvestris]
Length=590

 Score =   241 bits (615),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 120/155 (77%), Positives = 138/155 (89%), Gaps = 1/155 (1%)
 Frame = -3

Query  483  MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKY-LTDSPNERDPNillifpfllIRML  307
            MAS+PGILTEWPWTWLG+FKYVVLAP+V HS   + +++  ++RD   L+IFPFLL RML
Sbjct  1    MASKPGILTEWPWTWLGNFKYVVLAPYVTHSLNSFFMSEDESKRDMTYLIIFPFLLFRML  60

Query  306  HNQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHM  127
            HNQ+WIS+SRYRTAKGDNRIVDK IEF+Q+DRERNWDDQIILNGLLFY+GY KL  +HHM
Sbjct  61   HNQIWISVSRYRTAKGDNRIVDKTIEFDQIDRERNWDDQIILNGLLFYYGYTKLEQSHHM  120

Query  126  PIWRTDGIILTALIHTGPVEFLYYWLHRALHHHIL  22
            PIWRTDGII+TAL+H GPVEFLYYWLHRALHHH L
Sbjct  121  PIWRTDGIIMTALLHIGPVEFLYYWLHRALHHHYL  155



>ref|XP_009787251.1| PREDICTED: protein ECERIFERUM 1-like isoform X1 [Nicotiana sylvestris]
Length=626

 Score =   241 bits (615),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 120/155 (77%), Positives = 138/155 (89%), Gaps = 1/155 (1%)
 Frame = -3

Query  483  MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKY-LTDSPNERDPNillifpfllIRML  307
            MAS+PGILTEWPWTWLG+FKYVVLAP+V HS   + +++  ++RD   L+IFPFLL RML
Sbjct  1    MASKPGILTEWPWTWLGNFKYVVLAPYVTHSLNSFFMSEDESKRDMTYLIIFPFLLFRML  60

Query  306  HNQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHM  127
            HNQ+WIS+SRYRTAKGDNRIVDK IEF+Q+DRERNWDDQIILNGLLFY+GY KL  +HHM
Sbjct  61   HNQIWISVSRYRTAKGDNRIVDKTIEFDQIDRERNWDDQIILNGLLFYYGYTKLEQSHHM  120

Query  126  PIWRTDGIILTALIHTGPVEFLYYWLHRALHHHIL  22
            PIWRTDGII+TAL+H GPVEFLYYWLHRALHHH L
Sbjct  121  PIWRTDGIIMTALLHIGPVEFLYYWLHRALHHHYL  155



>ref|XP_011085147.1| PREDICTED: protein ECERIFERUM 1-like [Sesamum indicum]
Length=623

 Score =   238 bits (606),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 118/154 (77%), Positives = 131/154 (85%), Gaps = 0/154 (0%)
 Frame = -3

Query  483  MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpfllIRMLH  304
            MAS+PGILT+WPWTWLGSFKYVVLAP+V HSTY Y+    +ERD +  +IFPFLL RMLH
Sbjct  1    MASKPGILTDWPWTWLGSFKYVVLAPWVIHSTYSYMVKDKSERDFSQFVIFPFLLSRMLH  60

Query  303  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  124
            NQ+WISLSRYRTAKG+NRIVDK IEFEQVDRERNWDDQII NG+LFY G   +   HHMP
Sbjct  61   NQIWISLSRYRTAKGNNRIVDKNIEFEQVDRERNWDDQIIFNGILFYVGQKYITQAHHMP  120

Query  123  IWRTDGIILTALIHTGPVEFLYYWLHRALHHHIL  22
             WRTDG+ILT L+H GPVEFLYYWLHRALHHH L
Sbjct  121  WWRTDGVILTILLHAGPVEFLYYWLHRALHHHFL  154



>emb|CBI16764.3| unnamed protein product [Vitis vinifera]
Length=246

 Score =   227 bits (578),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 114/154 (74%), Positives = 127/154 (82%), Gaps = 0/154 (0%)
 Frame = -3

Query  483  MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpfllIRMLH  304
            MAS+PGILT+WPW  LGSFKYV+LAP+V HS Y  +     ERDP  +L FPFLL R LH
Sbjct  1    MASKPGILTDWPWKSLGSFKYVILAPWVVHSIYSLIIKDGKERDPVYVLFFPFLLWRTLH  60

Query  303  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  124
            NQ+WISLSRYRTAKG+NRIVDK IEFEQVDRE NWDDQI+LNG+LFY GY  LP   HMP
Sbjct  61   NQIWISLSRYRTAKGNNRIVDKSIEFEQVDRESNWDDQILLNGILFYVGYMILPGAAHMP  120

Query  123  IWRTDGIILTALIHTGPVEFLYYWLHRALHHHIL  22
            IWRTDG++LT L+H GPVEFLYYWLHRALHHH L
Sbjct  121  IWRTDGVLLTILLHMGPVEFLYYWLHRALHHHYL  154



>emb|CBI16759.3| unnamed protein product [Vitis vinifera]
Length=256

 Score =   224 bits (571),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 112/154 (73%), Positives = 129/154 (84%), Gaps = 0/154 (0%)
 Frame = -3

Query  483  MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpfllIRMLH  304
            MAS+PGILT+WPWT LG+FKYVVLAP+  H+ + +L     ERD    LIFPFLL RMLH
Sbjct  1    MASKPGILTDWPWTPLGNFKYVVLAPWAIHAIHSFLVKDEKERDVAHFLIFPFLLWRMLH  60

Query  303  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  124
            NQLWISLSR+RTAKG+NRIVDKGIEFEQVDRERNWDDQII NG++FY  Y+ LP   HMP
Sbjct  61   NQLWISLSRHRTAKGNNRIVDKGIEFEQVDRERNWDDQIIFNGIIFYIAYFILPGASHMP  120

Query  123  IWRTDGIILTALIHTGPVEFLYYWLHRALHHHIL  22
            +WR DG+++T L+HTGPVEFLYYWLHRALHHH L
Sbjct  121  LWRVDGVVITILLHTGPVEFLYYWLHRALHHHYL  154



>gb|KHN33999.1| Protein WAX2 [Glycine soja]
Length=246

 Score =   223 bits (568),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 105/154 (68%), Positives = 129/154 (84%), Gaps = 0/154 (0%)
 Frame = -3

Query  483  MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpfllIRMLH  304
            MAS+PGILT WPW  LG FK+V+L P++AHSTY +L     ERD    LIFP++++RMLH
Sbjct  1    MASKPGILTNWPWKPLGCFKWVILTPWIAHSTYSFLVSDTKERDLGYFLIFPYMMVRMLH  60

Query  303  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  124
            +Q+WI+LSR+RTAKG NRIVDKGIEFEQVDRE NWDDQI+ NG++FY GY  +P + HMP
Sbjct  61   DQVWITLSRHRTAKGKNRIVDKGIEFEQVDRESNWDDQILFNGIIFYIGYMLVPESSHMP  120

Query  123  IWRTDGIILTALIHTGPVEFLYYWLHRALHHHIL  22
            +WRTDG+++TAL+H GPVEFLYYWLHRALHHH L
Sbjct  121  LWRTDGVLITALLHAGPVEFLYYWLHRALHHHFL  154



>ref|XP_010661477.1| PREDICTED: protein ECERIFERUM 1-like [Vitis vinifera]
Length=354

 Score =   226 bits (576),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 114/154 (74%), Positives = 127/154 (82%), Gaps = 0/154 (0%)
 Frame = -3

Query  483  MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpfllIRMLH  304
            MAS+PGILT+WPW  LGSFKYV+LAP+V HS Y  +     ERDP  +L FPFLL R LH
Sbjct  1    MASKPGILTDWPWKSLGSFKYVILAPWVVHSIYSLIIKDGKERDPVYVLFFPFLLWRTLH  60

Query  303  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  124
            NQ+WISLSRYRTAKG+NRIVDK IEFEQVDRE NWDDQI+LNG+LFY GY  LP   HMP
Sbjct  61   NQIWISLSRYRTAKGNNRIVDKSIEFEQVDRESNWDDQILLNGILFYVGYMILPGAAHMP  120

Query  123  IWRTDGIILTALIHTGPVEFLYYWLHRALHHHIL  22
            IWRTDG++LT L+H GPVEFLYYWLHRALHHH L
Sbjct  121  IWRTDGVLLTILLHMGPVEFLYYWLHRALHHHYL  154



>ref|XP_006361513.1| PREDICTED: protein ECERIFERUM 1-like [Solanum tuberosum]
Length=626

 Score =   231 bits (588),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 117/155 (75%), Positives = 131/155 (85%), Gaps = 1/155 (1%)
 Frame = -3

Query  483  MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNER-DPNillifpfllIRML  307
            MAS+PGILTEWPWTWLG+FKYVVLAPFV  S    L      + D   L+IFPFLL RML
Sbjct  1    MASKPGILTEWPWTWLGNFKYVVLAPFVGRSIQSLLNREDGSKIDIGYLIIFPFLLFRML  60

Query  306  HNQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHM  127
            HNQ+WISLSRYRTAKGDNRI+DK IEF+QVDRERNWDDQI+LNGLLFY+GY KL  +H++
Sbjct  61   HNQIWISLSRYRTAKGDNRILDKTIEFDQVDRERNWDDQILLNGLLFYYGYMKLEQSHYL  120

Query  126  PIWRTDGIILTALIHTGPVEFLYYWLHRALHHHIL  22
            PIWR+DGIILT L+H GPVEFLYYWLHRALHHH L
Sbjct  121  PIWRSDGIILTTLLHIGPVEFLYYWLHRALHHHFL  155



>ref|XP_006357723.1| PREDICTED: protein ECERIFERUM 1-like [Solanum tuberosum]
Length=626

 Score =   230 bits (587),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 117/155 (75%), Positives = 131/155 (85%), Gaps = 1/155 (1%)
 Frame = -3

Query  483  MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNER-DPNillifpfllIRML  307
            MAS+PGILTEWPWTWLG+FKYVVLAPFV  S    L      + D   L+IFPFLL RML
Sbjct  1    MASKPGILTEWPWTWLGNFKYVVLAPFVGRSIQSLLNREDGSKIDIGYLIIFPFLLFRML  60

Query  306  HNQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHM  127
            HNQ+WISLSRYRTAKGDNRI+DK IEF+QVDRERNWDDQI+LNGLLFY+GY KL  +H++
Sbjct  61   HNQIWISLSRYRTAKGDNRILDKTIEFDQVDRERNWDDQILLNGLLFYYGYMKLEQSHYL  120

Query  126  PIWRTDGIILTALIHTGPVEFLYYWLHRALHHHIL  22
            PIWR+DGIILT L+H GPVEFLYYWLHRALHHH L
Sbjct  121  PIWRSDGIILTTLLHIGPVEFLYYWLHRALHHHFL  155



>gb|KHN40120.1| Protein WAX2 [Glycine soja]
Length=627

 Score =   230 bits (587),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 107/154 (69%), Positives = 130/154 (84%), Gaps = 0/154 (0%)
 Frame = -3

Query  483  MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpfllIRMLH  304
            MAS+PGILT WPW  LGSFK+V+L P++AHSTY +L   P ERD    LIFP +++RMLH
Sbjct  1    MASKPGILTNWPWKPLGSFKWVILTPWIAHSTYSFLVSEPKERDLTYFLIFPLMMVRMLH  60

Query  303  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  124
            +Q+WI+LSR+RTAKG NRIVDKGIEFEQVDRE NWDDQI+ NG++FY GY  +P + HMP
Sbjct  61   DQVWITLSRHRTAKGKNRIVDKGIEFEQVDRESNWDDQILFNGIIFYIGYMLVPESSHMP  120

Query  123  IWRTDGIILTALIHTGPVEFLYYWLHRALHHHIL  22
            +WRTDG+++TAL+H GPVEFLYYWLHRALHHH L
Sbjct  121  LWRTDGVLITALLHAGPVEFLYYWLHRALHHHFL  154



>ref|XP_002263787.2| PREDICTED: protein ECERIFERUM 1-like [Vitis vinifera]
Length=619

 Score =   229 bits (583),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 113/154 (73%), Positives = 129/154 (84%), Gaps = 0/154 (0%)
 Frame = -3

Query  483  MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpfllIRMLH  304
            MAS+PGILT+WPWT LG+FKYVVLAP+  H+ Y +L     ERD    LIFPFLL RMLH
Sbjct  1    MASKPGILTDWPWTPLGNFKYVVLAPWAIHAMYSFLVKDEKERDVAHFLIFPFLLWRMLH  60

Query  303  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  124
            NQLWISLSR+RTAKG+NRIVDKGIEFEQVDRERNWDDQII NG++FY  Y+ LP   HMP
Sbjct  61   NQLWISLSRHRTAKGNNRIVDKGIEFEQVDRERNWDDQIIFNGIIFYVAYFTLPGASHMP  120

Query  123  IWRTDGIILTALIHTGPVEFLYYWLHRALHHHIL  22
            +WR DG+++T L+HTGPVEFLYYWLHRALHHH L
Sbjct  121  LWRADGVVVTILLHTGPVEFLYYWLHRALHHHYL  154



>emb|CBI16761.3| unnamed protein product [Vitis vinifera]
Length=631

 Score =   229 bits (584),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 113/154 (73%), Positives = 129/154 (84%), Gaps = 0/154 (0%)
 Frame = -3

Query  483  MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpfllIRMLH  304
            MAS+PGILT+WPWT LG+FKYVVLAP+  H+ Y +L     ERD    LIFPFLL RMLH
Sbjct  1    MASKPGILTDWPWTPLGNFKYVVLAPWAIHAMYSFLVKDEKERDVAHFLIFPFLLWRMLH  60

Query  303  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  124
            NQLWISLSR+RTAKG+NRIVDKGIEFEQVDRERNWDDQII NG++FY  Y+ LP   HMP
Sbjct  61   NQLWISLSRHRTAKGNNRIVDKGIEFEQVDRERNWDDQIIFNGIIFYVAYFTLPGASHMP  120

Query  123  IWRTDGIILTALIHTGPVEFLYYWLHRALHHHIL  22
            +WR DG+++T L+HTGPVEFLYYWLHRALHHH L
Sbjct  121  LWRADGVVVTILLHTGPVEFLYYWLHRALHHHYL  154



>ref|XP_004234847.1| PREDICTED: protein ECERIFERUM 1-like [Solanum lycopersicum]
Length=626

 Score =   229 bits (583),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 116/155 (75%), Positives = 131/155 (85%), Gaps = 1/155 (1%)
 Frame = -3

Query  483  MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNER-DPNillifpfllIRML  307
            MAS+PGILTEWPWTWLG+FKYVVLAPFV  S    L      + D   L+IFPFLL RML
Sbjct  1    MASKPGILTEWPWTWLGNFKYVVLAPFVGRSIESLLNREDGSKIDIGYLIIFPFLLFRML  60

Query  306  HNQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHM  127
            HNQ+WISLSRY+TAKGDNRI+DK IEF+QVDRERNWDDQI+LNGLLFY+GY KL  +H++
Sbjct  61   HNQIWISLSRYKTAKGDNRILDKTIEFDQVDRERNWDDQILLNGLLFYYGYMKLEQSHYL  120

Query  126  PIWRTDGIILTALIHTGPVEFLYYWLHRALHHHIL  22
            PIWR+DGIILT L+H GPVEFLYYWLHRALHHH L
Sbjct  121  PIWRSDGIILTTLLHIGPVEFLYYWLHRALHHHFL  155



>ref|XP_003521032.2| PREDICTED: protein ECERIFERUM 1-like [Glycine max]
Length=684

 Score =   230 bits (586),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 107/154 (69%), Positives = 130/154 (84%), Gaps = 0/154 (0%)
 Frame = -3

Query  483  MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpfllIRMLH  304
            MAS+PGILT WPW  LGSFK+V+L P++AHSTY +L   P ERD    LIFP +++RMLH
Sbjct  1    MASKPGILTNWPWKPLGSFKWVILTPWIAHSTYSFLVSEPKERDLTYFLIFPLMMVRMLH  60

Query  303  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  124
            +Q+WI+LSR+RTAKG NRIVDKGIEFEQVDRE NWDDQI+ NG++FY GY  +P + HMP
Sbjct  61   DQVWITLSRHRTAKGKNRIVDKGIEFEQVDRESNWDDQILFNGIIFYIGYMLVPESSHMP  120

Query  123  IWRTDGIILTALIHTGPVEFLYYWLHRALHHHIL  22
            +WRTDG+++TAL+H GPVEFLYYWLHRALHHH L
Sbjct  121  LWRTDGVLITALLHAGPVEFLYYWLHRALHHHFL  154



>ref|XP_006354616.1| PREDICTED: protein ECERIFERUM 1-like [Solanum tuberosum]
Length=628

 Score =   229 bits (583),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 111/155 (72%), Positives = 129/155 (83%), Gaps = 1/155 (1%)
 Frame = -3

Query  483  MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKY-LTDSPNERDPNillifpfllIRML  307
            MAS+PGILTEWPWT LG+FKY+VLAPFV HSTY Y ++    +RD   ++I P LL R++
Sbjct  1    MASKPGILTEWPWTCLGNFKYLVLAPFVCHSTYTYFMSKDERQRDIVYIIILPLLLSRII  60

Query  306  HNQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHM  127
            HNQ+WISLSRYRTAKG+NRIVDK IEF+QVDRE NWDDQII NGLL+Y GY  L   HHM
Sbjct  61   HNQIWISLSRYRTAKGNNRIVDKSIEFDQVDRESNWDDQIIFNGLLYYIGYLMLEQAHHM  120

Query  126  PIWRTDGIILTALIHTGPVEFLYYWLHRALHHHIL  22
            P+WRTDGII+  L+H+GPVEFLYYWLHRALHHH L
Sbjct  121  PVWRTDGIIIIGLLHSGPVEFLYYWLHRALHHHFL  155



>ref|XP_003633900.1| PREDICTED: protein ECERIFERUM 1-like [Vitis vinifera]
Length=619

 Score =   228 bits (580),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 112/154 (73%), Positives = 129/154 (84%), Gaps = 0/154 (0%)
 Frame = -3

Query  483  MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpfllIRMLH  304
            MAS+PGILT+WPWT LG+FKYVVLAP+  H+ + +L     ERD    LIFPFLL RMLH
Sbjct  1    MASKPGILTDWPWTPLGNFKYVVLAPWAIHAIHSFLVKDEKERDVAHFLIFPFLLSRMLH  60

Query  303  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  124
            NQLWISLSR+RTAKG+NRIVDKGIEFEQVDRERNWDDQII NG++FY  Y+ LP   HMP
Sbjct  61   NQLWISLSRHRTAKGNNRIVDKGIEFEQVDRERNWDDQIIFNGIIFYIAYFILPGASHMP  120

Query  123  IWRTDGIILTALIHTGPVEFLYYWLHRALHHHIL  22
            +WR DG+++T L+HTGPVEFLYYWLHRALHHH L
Sbjct  121  LWRADGVVITILLHTGPVEFLYYWLHRALHHHYL  154



>ref|XP_002262647.1| PREDICTED: protein ECERIFERUM 1 [Vitis vinifera]
 emb|CBI38119.3| unnamed protein product [Vitis vinifera]
Length=620

 Score =   226 bits (577),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 112/154 (73%), Positives = 127/154 (82%), Gaps = 0/154 (0%)
 Frame = -3

Query  483  MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpfllIRMLH  304
            MAS+PGILT+WPW  LGSFKYV+LAP+V HS Y  +     ERDP  +L FPFLL R LH
Sbjct  1    MASKPGILTDWPWKSLGSFKYVILAPWVVHSIYTLIIKDGKERDPVYVLFFPFLLWRTLH  60

Query  303  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  124
            NQ+WISL+RYRTAKG+NRIVDK IEFEQVDRE NWDDQI+LNG+LFY GY  LP   HMP
Sbjct  61   NQIWISLARYRTAKGNNRIVDKSIEFEQVDRESNWDDQILLNGILFYVGYMILPGAAHMP  120

Query  123  IWRTDGIILTALIHTGPVEFLYYWLHRALHHHIL  22
            +WRTDG++LT L+H GPVEFLYYWLHRALHHH L
Sbjct  121  LWRTDGVLLTILLHMGPVEFLYYWLHRALHHHYL  154



>ref|XP_002265685.2| PREDICTED: protein ECERIFERUM 1-like [Vitis vinifera]
Length=619

 Score =   226 bits (576),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 112/154 (73%), Positives = 129/154 (84%), Gaps = 0/154 (0%)
 Frame = -3

Query  483  MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpfllIRMLH  304
            MAS+PGILT+WPWT LG+FKYVVLAP+  H+ + +L     ERD    LIFPFLL RMLH
Sbjct  1    MASKPGILTDWPWTPLGNFKYVVLAPWAIHAIHSFLVKDEKERDVAHFLIFPFLLWRMLH  60

Query  303  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  124
            NQLWISLSR+RTAKG+NRIVDKGIEFEQVDRERNWDDQII NG++FY  Y+ LP   HMP
Sbjct  61   NQLWISLSRHRTAKGNNRIVDKGIEFEQVDRERNWDDQIIFNGIIFYIAYFILPGASHMP  120

Query  123  IWRTDGIILTALIHTGPVEFLYYWLHRALHHHIL  22
            +WR DG+++T L+HTGPVEFLYYWLHRALHHH L
Sbjct  121  LWRVDGVVITILLHTGPVEFLYYWLHRALHHHYL  154



>ref|XP_009600723.1| PREDICTED: protein ECERIFERUM 1-like [Nicotiana tomentosiformis]
Length=657

 Score =   226 bits (576),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 109/155 (70%), Positives = 130/155 (84%), Gaps = 1/155 (1%)
 Frame = -3

Query  483  MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKY-LTDSPNERDPNillifpfllIRML  307
            MAS+PGILTEWPWT+LG+FKY+VLAPFV HS Y Y ++   ++RD   L+I P LL R++
Sbjct  31   MASKPGILTEWPWTFLGNFKYLVLAPFVGHSIYTYFMSKDESQRDIGYLIILPLLLSRVI  90

Query  306  HNQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHM  127
            HNQ+WISLSRYRTAKG+NRIVDK IEF+Q+DRE NWDDQII NGL++Y GY  L   HH+
Sbjct  91   HNQIWISLSRYRTAKGNNRIVDKSIEFDQIDRESNWDDQIIFNGLIYYIGYLLLEQAHHL  150

Query  126  PIWRTDGIILTALIHTGPVEFLYYWLHRALHHHIL  22
            P+WRTDGII+ AL+H GPVEFLYYWLHRALHHH L
Sbjct  151  PLWRTDGIIIIALLHIGPVEFLYYWLHRALHHHFL  185



>ref|XP_003529007.1| PREDICTED: protein ECERIFERUM 1-like [Glycine max]
Length=624

 Score =   225 bits (574),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 105/154 (68%), Positives = 129/154 (84%), Gaps = 0/154 (0%)
 Frame = -3

Query  483  MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpfllIRMLH  304
            MAS+PGILT WPW  LG FK+V+L P++AHSTY +L     ERD    LIFP++++RMLH
Sbjct  1    MASKPGILTNWPWKPLGCFKWVILTPWIAHSTYSFLVSDAKERDLGYFLIFPYMMVRMLH  60

Query  303  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  124
            +Q+WI+LSR+RTAKG NRIVDKGIEFEQVDRE NWDDQI+ NG++FY GY  +P + HMP
Sbjct  61   DQVWITLSRHRTAKGKNRIVDKGIEFEQVDRESNWDDQILFNGIIFYIGYMLVPESSHMP  120

Query  123  IWRTDGIILTALIHTGPVEFLYYWLHRALHHHIL  22
            +WRTDG+++TAL+H GPVEFLYYWLHRALHHH L
Sbjct  121  LWRTDGVLITALLHAGPVEFLYYWLHRALHHHFL  154



>ref|XP_009614034.1| PREDICTED: protein ECERIFERUM 1-like [Nicotiana tomentosiformis]
Length=657

 Score =   226 bits (575),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 109/155 (70%), Positives = 130/155 (84%), Gaps = 1/155 (1%)
 Frame = -3

Query  483  MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKY-LTDSPNERDPNillifpfllIRML  307
            MAS+PGILTEWPWT+LG+FKY+VLAPFV HS Y Y ++   ++RD   ++I P LL R++
Sbjct  31   MASKPGILTEWPWTFLGNFKYLVLAPFVGHSIYTYFMSKDESQRDIVYIIILPLLLSRVI  90

Query  306  HNQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHM  127
            HNQ+WISLSRYRTAKG+NRIVDK IEF+QVDRE NWDDQII NGL++Y GY  L   HH+
Sbjct  91   HNQIWISLSRYRTAKGNNRIVDKSIEFDQVDRESNWDDQIIFNGLIYYIGYLLLEQAHHL  150

Query  126  PIWRTDGIILTALIHTGPVEFLYYWLHRALHHHIL  22
            P+WRTDGII+ AL+H GPVEFLYYWLHRALHHH L
Sbjct  151  PLWRTDGIIIIALLHIGPVEFLYYWLHRALHHHFL  185



>ref|XP_004229696.2| PREDICTED: protein ECERIFERUM 1-like [Solanum lycopersicum]
Length=918

 Score =   228 bits (582),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 108/155 (70%), Positives = 129/155 (83%), Gaps = 1/155 (1%)
 Frame = -3

Query  483  MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKY-LTDSPNERDPNillifpfllIRML  307
            MAS+PGILTEWPWT+LG+FKY+VLAPFV HSTY Y ++    +RD   ++I P L  R++
Sbjct  1    MASKPGILTEWPWTFLGNFKYLVLAPFVCHSTYTYFMSKDERQRDIVYIIILPLLFSRII  60

Query  306  HNQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHM  127
            HNQ+WISLSRYRTAKG+NRIVDK IEF+QVDRE NWDDQII NGLL+Y GY  L   HH+
Sbjct  61   HNQIWISLSRYRTAKGNNRIVDKSIEFDQVDRESNWDDQIIFNGLLYYIGYLMLEQAHHL  120

Query  126  PIWRTDGIILTALIHTGPVEFLYYWLHRALHHHIL  22
            P+WR+DGII+  L+H+GPVEFLYYWLHRALHHH L
Sbjct  121  PLWRSDGIIIIGLLHSGPVEFLYYWLHRALHHHFL  155



>ref|XP_009625188.1| PREDICTED: protein ECERIFERUM 1-like [Nicotiana tomentosiformis]
Length=626

 Score =   225 bits (573),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 107/155 (69%), Positives = 129/155 (83%), Gaps = 1/155 (1%)
 Frame = -3

Query  483  MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKY-LTDSPNERDPNillifpfllIRML  307
            MA++PGILTEWPW  LG+FKY++LAPFV HS Y + +    ++RD   ++I P LL R++
Sbjct  1    MATKPGILTEWPWARLGNFKYLLLAPFVGHSIYSFFMGKDESQRDIAYIIILPLLLSRVI  60

Query  306  HNQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHM  127
            HNQ+WISLSRYRT KGDNRI+DK IEF+QVDRERNWDDQIILNG++FY  Y K   THH+
Sbjct  61   HNQIWISLSRYRTTKGDNRILDKSIEFDQVDRERNWDDQIILNGMVFYVAYLKFQQTHHL  120

Query  126  PIWRTDGIILTALIHTGPVEFLYYWLHRALHHHIL  22
            P+WRTDGII+TAL+H GPVEFLYYWLHRALHHH L
Sbjct  121  PLWRTDGIIITALMHIGPVEFLYYWLHRALHHHFL  155



>gb|EMS51792.1| Protein WAX2 [Triticum urartu]
Length=423

 Score =   220 bits (560),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 104/161 (65%), Positives = 124/161 (77%), Gaps = 0/161 (0%)
 Frame = -3

Query  483  MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpfllIRMLH  304
            MA+RPG LTEWPW  +G+FKY+V+AP V H  Y+ +T    + D    LI P L +RM+H
Sbjct  1    MATRPGPLTEWPWQRMGNFKYLVMAPVVVHGAYRVMTKGWGDIDLAYSLILPSLALRMIH  60

Query  303  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  124
            NQ+WISLSRY+TA+  +RIVD+GIEFEQVDRER WDDQI+ NGLLFY GY  +P     P
Sbjct  61   NQIWISLSRYQTARSKHRIVDRGIEFEQVDRERGWDDQIVFNGLLFYAGYLAMPSVRRFP  120

Query  123  IWRTDGIILTALIHTGPVEFLYYWLHRALHHHILYSRYHSH  1
            +WRTDG + TAL+H GPVEFLYYW HRALHHH LYSRYHSH
Sbjct  121  LWRTDGAVATALLHAGPVEFLYYWFHRALHHHFLYSRYHSH  161



>ref|XP_006354678.1| PREDICTED: protein ECERIFERUM 1-like [Solanum tuberosum]
Length=626

 Score =   224 bits (572),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 106/155 (68%), Positives = 131/155 (85%), Gaps = 1/155 (1%)
 Frame = -3

Query  483  MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKY-LTDSPNERDPNillifpfllIRML  307
            MA++PGILTEWPW  LG+ KY+VLAPFV HS Y + +    ++RD + + IF ++++RM+
Sbjct  1    MATKPGILTEWPWASLGNLKYLVLAPFVGHSIYSFFMGKEESQRDFSYIFIFFYIVMRMV  60

Query  306  HNQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHM  127
            H+Q+WISLSRYRTAKGDNRI+D+ IEF+QVDRE NWDDQIILNG++FY GY K   THH+
Sbjct  61   HHQMWISLSRYRTAKGDNRILDRSIEFDQVDRETNWDDQIILNGVVFYIGYLKFAETHHL  120

Query  126  PIWRTDGIILTALIHTGPVEFLYYWLHRALHHHIL  22
            P+WR DGII+TALIHTGPVEFLYYWLHRALHHH L
Sbjct  121  PLWRIDGIIITALIHTGPVEFLYYWLHRALHHHFL  155



>emb|CAN60676.1| hypothetical protein VITISV_029045 [Vitis vinifera]
Length=557

 Score =   223 bits (568),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 111/154 (72%), Positives = 126/154 (82%), Gaps = 0/154 (0%)
 Frame = -3

Query  483  MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpfllIRMLH  304
            MAS+PGILT+WPW  LGSFKYV+LAP+V HS Y  +     ERDP  +L FPFLL R LH
Sbjct  1    MASKPGILTDWPWKSLGSFKYVILAPWVVHSIYTLIIKDGKERDPVYVLFFPFLLWRALH  60

Query  303  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  124
            NQ+WISL+RYRTAKG+NRIVDK IEFEQVDRE NWDDQI+LNG+LFY  Y  LP   HMP
Sbjct  61   NQIWISLARYRTAKGNNRIVDKSIEFEQVDRESNWDDQILLNGILFYVVYMILPGVAHMP  120

Query  123  IWRTDGIILTALIHTGPVEFLYYWLHRALHHHIL  22
            +WRTDG++LT L+H GPVEFLYYWLHRALHHH L
Sbjct  121  LWRTDGVLLTILLHMGPVEFLYYWLHRALHHHYL  154



>ref|XP_010479259.1| PREDICTED: protein ECERIFERUM 1-like [Camelina sativa]
Length=246

 Score =   213 bits (543),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 103/154 (67%), Positives = 127/154 (82%), Gaps = 0/154 (0%)
 Frame = -3

Query  483  MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpfllIRMLH  304
            MA++PG+LT+WPWT LGSFKY+V+AP+V HSTY+++TD P +RD    L+FPFLL R+LH
Sbjct  1    MATKPGVLTDWPWTPLGSFKYIVVAPWVVHSTYRFVTDDPEKRDIGYSLVFPFLLFRILH  60

Query  303  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  124
            NQ+WISLSRY T+KG  RIVDKGI+F QVDRE NWDDQI+ NG+LFY G   LP    +P
Sbjct  61   NQVWISLSRYYTSKGKRRIVDKGIDFNQVDRETNWDDQILFNGVLFYTGICLLPEAKQLP  120

Query  123  IWRTDGIILTALIHTGPVEFLYYWLHRALHHHIL  22
             WRTDG+++ AL+H GPVEFLYYWLH+ALHHH L
Sbjct  121  WWRTDGVLMAALLHAGPVEFLYYWLHKALHHHYL  154



>emb|CDP09363.1| unnamed protein product [Coffea canephora]
Length=611

 Score =   223 bits (569),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 113/161 (70%), Positives = 131/161 (81%), Gaps = 1/161 (1%)
 Frame = -3

Query  483  MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpfllIRMLH  304
            MAS+PGIL +WPWT LG+FKYVVLAP+V H TY Y+    ++R+  + L+ PFLL+RMLH
Sbjct  1    MASKPGILYDWPWTPLGNFKYVVLAPWVIHHTYPYMVKDASDRNLPMFLVLPFLLLRMLH  60

Query  303  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  124
            NQ+WIS SRYRTAKG NRIVDK IEFEQ+DRERNWDD II NG++FY     L  T  MP
Sbjct  61   NQIWISYSRYRTAKGTNRIVDKSIEFEQIDRERNWDDNIIFNGIVFYM-VATLKNTADMP  119

Query  123  IWRTDGIILTALIHTGPVEFLYYWLHRALHHHILYSRYHSH  1
            IWRTDG+I+T L+H GPVEFLYYWLHRALHHH LYSRYHSH
Sbjct  120  IWRTDGVIITILLHVGPVEFLYYWLHRALHHHFLYSRYHSH  160



>ref|XP_007134354.1| hypothetical protein PHAVU_010G040500g [Phaseolus vulgaris]
 gb|ESW06348.1| hypothetical protein PHAVU_010G040500g [Phaseolus vulgaris]
Length=622

 Score =   223 bits (569),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 108/154 (70%), Positives = 124/154 (81%), Gaps = 0/154 (0%)
 Frame = -3

Query  483  MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpfllIRMLH  304
            MASRPGILT+WPW  LGSFKYVVLAP+V HSTY  L    NERD    LI P LL RM+H
Sbjct  1    MASRPGILTDWPWKPLGSFKYVVLAPWVIHSTYSMLVKDKNERDVGTFLILPLLLWRMVH  60

Query  303  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  124
            NQ+WI+LSRYRTAKG+ RIVDKG+EF+QVDRER WDDQI+ NGLL+Y   Y LP   H+P
Sbjct  61   NQIWITLSRYRTAKGNGRIVDKGLEFDQVDREREWDDQILFNGLLYYLACYTLPGASHLP  120

Query  123  IWRTDGIILTALIHTGPVEFLYYWLHRALHHHIL  22
            +WRT+G+++  LIH GPVEFLYYWLHRALHHH L
Sbjct  121  LWRTEGLVMAMLIHAGPVEFLYYWLHRALHHHFL  154



>ref|XP_002262785.1| PREDICTED: protein ECERIFERUM 1 [Vitis vinifera]
 emb|CBI38118.3| unnamed protein product [Vitis vinifera]
Length=620

 Score =   223 bits (569),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 111/154 (72%), Positives = 126/154 (82%), Gaps = 0/154 (0%)
 Frame = -3

Query  483  MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpfllIRMLH  304
            MAS+PGILT+WPW  LGSFKYV+LAP+V HS Y  +     ERDP  +L FPFLL R LH
Sbjct  1    MASKPGILTDWPWKSLGSFKYVILAPWVVHSIYTLIIKDGKERDPVYVLFFPFLLWRALH  60

Query  303  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  124
            NQ+WISL+RYRTAKG+NRIVDK IEFEQVDRE NWDDQI+LNG+LFY  Y  LP   HMP
Sbjct  61   NQIWISLARYRTAKGNNRIVDKSIEFEQVDRESNWDDQILLNGILFYVVYMILPGVAHMP  120

Query  123  IWRTDGIILTALIHTGPVEFLYYWLHRALHHHIL  22
            +WRTDG++LT L+H GPVEFLYYWLHRALHHH L
Sbjct  121  LWRTDGVLLTILLHMGPVEFLYYWLHRALHHHYL  154



>ref|XP_010052747.1| PREDICTED: protein ECERIFERUM 1-like isoform X2 [Eucalyptus grandis]
Length=620

 Score =   223 bits (567),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 111/161 (69%), Positives = 131/161 (81%), Gaps = 0/161 (0%)
 Frame = -3

Query  483  MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpfllIRMLH  304
            MAS+PG+LT+WPW  LG FKY+VLAP+V HSTY ++     ERD    LIFPFLL RM+H
Sbjct  1    MASKPGLLTDWPWKPLGIFKYMVLAPWVIHSTYVFVNSEGRERDLFTFLIFPFLLWRMVH  60

Query  303  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  124
            NQ+W++LSRYR A+G+ RI+DKGIEF QVDRERNWDDQI+LNGL+FY G   LP    +P
Sbjct  61   NQIWMTLSRYRNARGNGRIIDKGIEFGQVDRERNWDDQILLNGLIFYIGAMTLPGASRLP  120

Query  123  IWRTDGIILTALIHTGPVEFLYYWLHRALHHHILYSRYHSH  1
            +WR DG+I TAL+H GPVEFLYYWLHRALHHH LYSRYHSH
Sbjct  121  MWRFDGVITTALLHMGPVEFLYYWLHRALHHHYLYSRYHSH  161



>ref|XP_009384064.1| PREDICTED: protein ECERIFERUM 1-like [Musa acuminata subsp. malaccensis]
Length=625

 Score =   223 bits (567),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 107/161 (66%), Positives = 128/161 (80%), Gaps = 0/161 (0%)
 Frame = -3

Query  483  MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpfllIRMLH  304
            MASRPG+ TEWPW  LG+FKY+VLAP+  HS Y  ++    E D   L+I P LL+RMLH
Sbjct  1    MASRPGLFTEWPWQRLGNFKYLVLAPWSLHSLYLAVSKERKELDLTYLIILPSLLLRMLH  60

Query  303  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  124
            NQ+WISL+R++ A+  NRIVDK IEFEQVDRERNWDDQII NG+LFY GY+ +P   ++P
Sbjct  61   NQVWISLARFQNARSKNRIVDKSIEFEQVDRERNWDDQIIFNGILFYLGYFYIPGATNLP  120

Query  123  IWRTDGIILTALIHTGPVEFLYYWLHRALHHHILYSRYHSH  1
            +WRTDG +L AL+H GPVEFLYYW HRALHHH LYSRYHSH
Sbjct  121  VWRTDGALLMALLHMGPVEFLYYWFHRALHHHFLYSRYHSH  161



>ref|XP_009793428.1| PREDICTED: protein ECERIFERUM 1-like [Nicotiana sylvestris]
Length=627

 Score =   223 bits (567),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 106/155 (68%), Positives = 130/155 (84%), Gaps = 1/155 (1%)
 Frame = -3

Query  483  MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKY-LTDSPNERDPNillifpfllIRML  307
            MAS+PGILT+WPWT+LG+FKY+VLAPFV HS Y Y ++   ++RD   ++I P LL R++
Sbjct  1    MASKPGILTDWPWTFLGNFKYLVLAPFVGHSIYTYFMSKDESQRDIIYIIILPLLLSRVI  60

Query  306  HNQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHM  127
            HNQ+WISLSRYRTA+G+NRIVD+ IEF+QVDRE NWDDQII NGL++Y GY  L   HH+
Sbjct  61   HNQIWISLSRYRTARGNNRIVDRSIEFDQVDRESNWDDQIIFNGLIYYIGYLLLEQAHHL  120

Query  126  PIWRTDGIILTALIHTGPVEFLYYWLHRALHHHIL  22
            P+WRTDGII+ AL+H GPVEFLYYWLHRALHHH L
Sbjct  121  PLWRTDGIIIIALLHIGPVEFLYYWLHRALHHHFL  155



>ref|XP_010054532.1| PREDICTED: protein ECERIFERUM 1-like [Eucalyptus grandis]
 gb|KCW76800.1| hypothetical protein EUGRSUZ_D01151 [Eucalyptus grandis]
Length=536

 Score =   221 bits (562),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 111/161 (69%), Positives = 131/161 (81%), Gaps = 0/161 (0%)
 Frame = -3

Query  483  MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpfllIRMLH  304
            MAS+PG+LT+WPW  LG+FKY+VLAP+V HSTY ++     ERD    LIFPFLL RM+H
Sbjct  1    MASKPGLLTDWPWKPLGNFKYMVLAPWVIHSTYVFVNSEERERDLFTFLIFPFLLWRMVH  60

Query  303  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  124
            NQ+WI+LSRYR A+G+ RI+DKGIEF QVDRERNWDDQI+LNGL+FY G   L     +P
Sbjct  61   NQIWITLSRYRNARGNGRIIDKGIEFVQVDRERNWDDQILLNGLIFYIGAMTLAGAPRLP  120

Query  123  IWRTDGIILTALIHTGPVEFLYYWLHRALHHHILYSRYHSH  1
            +WR DG+I TAL+H GPVEFLYYWLHRALHHH LYSRYHSH
Sbjct  121  MWRFDGVITTALLHMGPVEFLYYWLHRALHHHYLYSRYHSH  161



>ref|XP_010496699.1| PREDICTED: protein ECERIFERUM 1-like [Camelina sativa]
Length=255

 Score =   213 bits (542),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 103/154 (67%), Positives = 126/154 (82%), Gaps = 0/154 (0%)
 Frame = -3

Query  483  MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpfllIRMLH  304
            MA++PG+LT+WPWT LGSFKY+V+AP+V HSTY+++TD P  RD    L+FPFLL R+LH
Sbjct  1    MATKPGVLTDWPWTPLGSFKYIVVAPWVVHSTYRFVTDDPETRDIGYSLVFPFLLFRILH  60

Query  303  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  124
            NQ+WISLSRY T+KG  RIVDKGI+F QVDRE NWDDQI+ NG+LFY G   LP    +P
Sbjct  61   NQVWISLSRYYTSKGKRRIVDKGIDFNQVDRETNWDDQILFNGVLFYTGICLLPEAKQLP  120

Query  123  IWRTDGIILTALIHTGPVEFLYYWLHRALHHHIL  22
             WRTDG+++ AL+H GPVEFLYYWLH+ALHHH L
Sbjct  121  WWRTDGVLMAALLHAGPVEFLYYWLHKALHHHYL  154



>ref|XP_010052746.1| PREDICTED: protein ECERIFERUM 1-like isoform X1 [Eucalyptus grandis]
 gb|KCW76818.1| hypothetical protein EUGRSUZ_D01172 [Eucalyptus grandis]
Length=627

 Score =   223 bits (567),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 111/161 (69%), Positives = 131/161 (81%), Gaps = 0/161 (0%)
 Frame = -3

Query  483  MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpfllIRMLH  304
            MAS+PG+LT+WPW  LG FKY+VLAP+V HSTY ++     ERD    LIFPFLL RM+H
Sbjct  1    MASKPGLLTDWPWKPLGIFKYMVLAPWVIHSTYVFVNSEGRERDLFTFLIFPFLLWRMVH  60

Query  303  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  124
            NQ+W++LSRYR A+G+ RI+DKGIEF QVDRERNWDDQI+LNGL+FY G   LP    +P
Sbjct  61   NQIWMTLSRYRNARGNGRIIDKGIEFGQVDRERNWDDQILLNGLIFYIGAMTLPGASRLP  120

Query  123  IWRTDGIILTALIHTGPVEFLYYWLHRALHHHILYSRYHSH  1
            +WR DG+I TAL+H GPVEFLYYWLHRALHHH LYSRYHSH
Sbjct  121  MWRFDGVITTALLHMGPVEFLYYWLHRALHHHYLYSRYHSH  161



>ref|XP_006647531.1| PREDICTED: protein ECERIFERUM 1-like [Oryza brachyantha]
Length=619

 Score =   222 bits (566),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 106/161 (66%), Positives = 128/161 (80%), Gaps = 0/161 (0%)
 Frame = -3

Query  483  MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpfllIRMLH  304
            MA+RPG LTEWPW  LG+FKYVV+AP V H  ++ ++    + D    LI P LL+RM+H
Sbjct  1    MATRPGPLTEWPWQRLGNFKYVVMAPVVVHGAHRVVSKGWGDIDLAYSLILPSLLLRMIH  60

Query  303  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  124
            NQ+WISLSRY+TA+  +RIVD+GIEF+QVDRER WDDQI+ NGLLFY GY  +P    MP
Sbjct  61   NQIWISLSRYQTARSKHRIVDRGIEFDQVDRERGWDDQILFNGLLFYVGYLAMPSVRRMP  120

Query  123  IWRTDGIILTALIHTGPVEFLYYWLHRALHHHILYSRYHSH  1
            +WRTDG ++TAL+HTGPVEFLYYW HRALHHH LYSRYHSH
Sbjct  121  LWRTDGAVMTALVHTGPVEFLYYWFHRALHHHFLYSRYHSH  161



>ref|XP_009760058.1| PREDICTED: protein ECERIFERUM 1-like isoform X2 [Nicotiana sylvestris]
Length=622

 Score =   222 bits (565),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 105/155 (68%), Positives = 129/155 (83%), Gaps = 1/155 (1%)
 Frame = -3

Query  483  MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKY-LTDSPNERDPNillifpfllIRML  307
            MA++PGILTEWPW  LG+FKY++LAPFV HS Y + ++   ++RD + + I P+LL RM+
Sbjct  1    MATKPGILTEWPWARLGNFKYLLLAPFVGHSIYSFIMSKDESQRDISYIFILPYLLSRMI  60

Query  306  HNQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHM  127
            HNQ+W SLSRYRTAKG+NRI+DK IEF+QVDRE NWDDQIILNG++FY  Y K   THH+
Sbjct  61   HNQIWTSLSRYRTAKGNNRILDKSIEFDQVDRETNWDDQIILNGVVFYIAYLKFQQTHHL  120

Query  126  PIWRTDGIILTALIHTGPVEFLYYWLHRALHHHIL  22
            P+WRTDGII+TAL+H GPVEFLYYWLHRA HHH L
Sbjct  121  PLWRTDGIIITALMHIGPVEFLYYWLHRAFHHHFL  155



>ref|XP_009760057.1| PREDICTED: protein ECERIFERUM 1-like isoform X1 [Nicotiana sylvestris]
Length=623

 Score =   222 bits (565),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 105/155 (68%), Positives = 129/155 (83%), Gaps = 1/155 (1%)
 Frame = -3

Query  483  MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKY-LTDSPNERDPNillifpfllIRML  307
            MA++PGILTEWPW  LG+FKY++LAPFV HS Y + ++   ++RD + + I P+LL RM+
Sbjct  1    MATKPGILTEWPWARLGNFKYLLLAPFVGHSIYSFIMSKDESQRDISYIFILPYLLSRMI  60

Query  306  HNQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHM  127
            HNQ+W SLSRYRTAKG+NRI+DK IEF+QVDRE NWDDQIILNG++FY  Y K   THH+
Sbjct  61   HNQIWTSLSRYRTAKGNNRILDKSIEFDQVDRETNWDDQIILNGVVFYIAYLKFQQTHHL  120

Query  126  PIWRTDGIILTALIHTGPVEFLYYWLHRALHHHIL  22
            P+WRTDGII+TAL+H GPVEFLYYWLHRA HHH L
Sbjct  121  PLWRTDGIIITALMHIGPVEFLYYWLHRAFHHHFL  155



>ref|XP_009760059.1| PREDICTED: protein ECERIFERUM 1-like isoform X3 [Nicotiana sylvestris]
Length=618

 Score =   222 bits (565),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 105/155 (68%), Positives = 129/155 (83%), Gaps = 1/155 (1%)
 Frame = -3

Query  483  MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKY-LTDSPNERDPNillifpfllIRML  307
            MA++PGILTEWPW  LG+FKY++LAPFV HS Y + ++   ++RD + + I P+LL RM+
Sbjct  1    MATKPGILTEWPWARLGNFKYLLLAPFVGHSIYSFIMSKDESQRDISYIFILPYLLSRMI  60

Query  306  HNQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHM  127
            HNQ+W SLSRYRTAKG+NRI+DK IEF+QVDRE NWDDQIILNG++FY  Y K   THH+
Sbjct  61   HNQIWTSLSRYRTAKGNNRILDKSIEFDQVDRETNWDDQIILNGVVFYIAYLKFQQTHHL  120

Query  126  PIWRTDGIILTALIHTGPVEFLYYWLHRALHHHIL  22
            P+WRTDGII+TAL+H GPVEFLYYWLHRA HHH L
Sbjct  121  PLWRTDGIIITALMHIGPVEFLYYWLHRAFHHHFL  155



>ref|XP_004307281.1| PREDICTED: protein ECERIFERUM 1-like [Fragaria vesca subsp. vesca]
Length=625

 Score =   222 bits (565),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 108/154 (70%), Positives = 126/154 (82%), Gaps = 0/154 (0%)
 Frame = -3

Query  483  MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpfllIRMLH  304
            MAS PGILT+WPWT LGSFKYVVLAP+V HSTY ++ +   +RD +  LI P +L RMLH
Sbjct  1    MASTPGILTDWPWTPLGSFKYVVLAPWVVHSTYSFMVNEGPDRDLSYFLILPLMLWRMLH  60

Query  303  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  124
            NQLWISLSRYRTAKG  RIVDKG+EFEQVDRERNWDDQII NG+LFY G   LP   ++P
Sbjct  61   NQLWISLSRYRTAKGKGRIVDKGLEFEQVDRERNWDDQIIFNGILFYLGSRHLPGGSNLP  120

Query  123  IWRTDGIILTALIHTGPVEFLYYWLHRALHHHIL  22
            +W+ DG+++T L+H GPVEFLYYWLHRALHHH L
Sbjct  121  MWKADGLVITFLLHAGPVEFLYYWLHRALHHHFL  154



>emb|CAN81825.1| hypothetical protein VITISV_014168 [Vitis vinifera]
Length=2166

 Score =   229 bits (583),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 112/154 (73%), Positives = 127/154 (82%), Gaps = 0/154 (0%)
 Frame = -3

Query  483  MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpfllIRMLH  304
            MAS+PGILT+WPW  LGSFKYV+LAP+V HS Y  +     ERDP  +L FPFLL R LH
Sbjct  1    MASKPGILTDWPWKSLGSFKYVILAPWVVHSIYTLIIKDGKERDPVYVLFFPFLLWRTLH  60

Query  303  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  124
            NQ+WISL+RYRTAKG+NRIVDK IEFEQVDRE NWDDQI+LNG+LFY GY  LP   HMP
Sbjct  61   NQIWISLARYRTAKGNNRIVDKSIEFEQVDRESNWDDQILLNGILFYVGYMILPGAAHMP  120

Query  123  IWRTDGIILTALIHTGPVEFLYYWLHRALHHHIL  22
            +WRTDG++LT L+H GPVEFLYYWLHRALHHH L
Sbjct  121  LWRTDGVLLTILLHMGPVEFLYYWLHRALHHHYL  154



>ref|XP_002265189.2| PREDICTED: protein ECERIFERUM 1 [Vitis vinifera]
 emb|CBI16762.3| unnamed protein product [Vitis vinifera]
Length=619

 Score =   221 bits (564),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 109/154 (71%), Positives = 127/154 (82%), Gaps = 0/154 (0%)
 Frame = -3

Query  483  MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpfllIRMLH  304
            MAS+PGILT+WPWT LG+FKYVVLAP+  H+ Y ++     ERD +  LIFPFLL RMLH
Sbjct  1    MASKPGILTDWPWTPLGNFKYVVLAPWAIHAIYSFVVKDEKERDISHFLIFPFLLWRMLH  60

Query  303  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  124
            NQLWISLSR+RTAKG+NRIVDKGIEFEQVDRERNWDDQII NG++FY  Y+ +P   HMP
Sbjct  61   NQLWISLSRHRTAKGNNRIVDKGIEFEQVDRERNWDDQIIFNGIIFYITYFTVPGGTHMP  120

Query  123  IWRTDGIILTALIHTGPVEFLYYWLHRALHHHIL  22
             WR DG+++T L+H GPVEFLYYW HRALHHH L
Sbjct  121  FWRADGVVITILLHMGPVEFLYYWFHRALHHHYL  154



>emb|CBI16760.3| unnamed protein product [Vitis vinifera]
Length=2763

 Score =   229 bits (583),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 112/154 (73%), Positives = 129/154 (84%), Gaps = 0/154 (0%)
 Frame = -3

Query  483  MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpfllIRMLH  304
            MAS+PGILT+WPWT LG+FKYVVLAP+  H+ + +L     ERD    LIFPFLL RMLH
Sbjct  1    MASKPGILTDWPWTPLGNFKYVVLAPWAIHAIHSFLVKDEKERDVAHFLIFPFLLSRMLH  60

Query  303  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  124
            NQLWISLSR+RTAKG+NRIVDKGIEFEQVDRERNWDDQII NG++FY  Y+ LP   HMP
Sbjct  61   NQLWISLSRHRTAKGNNRIVDKGIEFEQVDRERNWDDQIIFNGIIFYIAYFILPGASHMP  120

Query  123  IWRTDGIILTALIHTGPVEFLYYWLHRALHHHIL  22
            +WR DG+++T L+HTGPVEFLYYWLHRALHHH L
Sbjct  121  LWRADGVVITILLHTGPVEFLYYWLHRALHHHYL  154



>gb|EEC73617.1| hypothetical protein OsI_08114 [Oryza sativa Indica Group]
Length=619

 Score =   221 bits (564),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 106/161 (66%), Positives = 128/161 (80%), Gaps = 0/161 (0%)
 Frame = -3

Query  483  MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpfllIRMLH  304
            MA+RPG LTEWPW  LG+FKYVV+AP VAH   + + +   + D    LI P LL+RM+H
Sbjct  1    MATRPGPLTEWPWHRLGNFKYVVMAPVVAHGARRVMRNGWGDLDIAFSLILPSLLLRMIH  60

Query  303  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  124
            NQ+WISLSRY+TA+  +RIVD+GIEF+QVDRER WDDQI+ NGL+FY GY  +P    MP
Sbjct  61   NQIWISLSRYQTARSKHRIVDRGIEFDQVDRERGWDDQILFNGLVFYAGYLAMPSVRRMP  120

Query  123  IWRTDGIILTALIHTGPVEFLYYWLHRALHHHILYSRYHSH  1
            +WRTDG ++TAL+HTGPVEFLYYW HRALHHH LYSRYHSH
Sbjct  121  VWRTDGAVVTALVHTGPVEFLYYWFHRALHHHFLYSRYHSH  161



>ref|NP_001047459.1| Os02g0621300 [Oryza sativa Japonica Group]
 dbj|BAD21539.1| putative CER1 protein [Oryza sativa Japonica Group]
 dbj|BAD21579.1| putative CER1 protein [Oryza sativa Japonica Group]
 dbj|BAF09373.1| Os02g0621300 [Oryza sativa Japonica Group]
Length=619

 Score =   221 bits (564),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 106/161 (66%), Positives = 128/161 (80%), Gaps = 0/161 (0%)
 Frame = -3

Query  483  MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpfllIRMLH  304
            MA+RPG LTEWPW  LG+FKYVV+AP VAH   + + +   + D    LI P LL+RM+H
Sbjct  1    MATRPGPLTEWPWHRLGNFKYVVMAPVVAHGARRVMRNGWGDLDIAFSLILPSLLLRMIH  60

Query  303  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  124
            NQ+WISLSRY+TA+  +RIVD+GIEF+QVDRER WDDQI+ NGL+FY GY  +P    MP
Sbjct  61   NQIWISLSRYQTARSKHRIVDRGIEFDQVDRERGWDDQILFNGLVFYAGYLAMPSVRRMP  120

Query  123  IWRTDGIILTALIHTGPVEFLYYWLHRALHHHILYSRYHSH  1
            +WRTDG ++TAL+HTGPVEFLYYW HRALHHH LYSRYHSH
Sbjct  121  VWRTDGAVVTALVHTGPVEFLYYWFHRALHHHFLYSRYHSH  161



>ref|XP_007008729.1| Fatty acid hydroxylase superfamily isoform 1 [Theobroma cacao]
 gb|EOY17539.1| Fatty acid hydroxylase superfamily isoform 1 [Theobroma cacao]
Length=623

 Score =   221 bits (563),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 105/154 (68%), Positives = 127/154 (82%), Gaps = 0/154 (0%)
 Frame = -3

Query  483  MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpfllIRMLH  304
            MAS+PGILT+WPWT LGSFKY++L P++  S Y ++ +  NERD + L IFPF+L RM H
Sbjct  1    MASKPGILTDWPWTPLGSFKYIILVPWITESIYSFIANDENERDFSNLSIFPFMLWRMFH  60

Query  303  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  124
            NQ+WISLSRYRTA G NRIVDKG+EF+QVDRERNWDDQI+ N +LFY G   +P + H+P
Sbjct  61   NQIWISLSRYRTATGSNRIVDKGLEFDQVDRERNWDDQILFNAILFYLGNKYVPGSSHLP  120

Query  123  IWRTDGIILTALIHTGPVEFLYYWLHRALHHHIL  22
            +WRTDG+ILT L+H GPVEFLYYWLHRALHHH L
Sbjct  121  LWRTDGVILTILLHAGPVEFLYYWLHRALHHHFL  154



>ref|XP_004229695.1| PREDICTED: protein ECERIFERUM 1-like isoform X2 [Solanum lycopersicum]
Length=625

 Score =   221 bits (562),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 102/155 (66%), Positives = 130/155 (84%), Gaps = 1/155 (1%)
 Frame = -3

Query  483  MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKY-LTDSPNERDPNillifpfllIRML  307
            MA++PGILTEWPW  LG+FKY+VLAPFV HS Y + ++   ++RD + + IF ++++RM+
Sbjct  1    MATKPGILTEWPWASLGNFKYLVLAPFVGHSIYSFFISKEESQRDFSYIFIFLYIVMRMV  60

Query  306  HNQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHM  127
            H+Q+WISLSRYR+AKGDNRI+D+ IEF+QVDRE NWDDQII NG+ FY  Y K   THH+
Sbjct  61   HHQMWISLSRYRSAKGDNRILDRSIEFDQVDRETNWDDQIIFNGVAFYIAYLKFSETHHL  120

Query  126  PIWRTDGIILTALIHTGPVEFLYYWLHRALHHHIL  22
            P+WR DGII+TAL+HTGPVEFLYYW+HRALHHH L
Sbjct  121  PLWRIDGIIITALLHTGPVEFLYYWIHRALHHHFL  155



>ref|XP_006445500.1| hypothetical protein CICLE_v10019279mg [Citrus clementina]
 ref|XP_006464360.1| PREDICTED: protein ECERIFERUM 1-like [Citrus sinensis]
 gb|ESR58740.1| hypothetical protein CICLE_v10019279mg [Citrus clementina]
 gb|KDO85379.1| hypothetical protein CISIN_1g006722mg [Citrus sinensis]
Length=633

 Score =   221 bits (562),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 109/154 (71%), Positives = 123/154 (80%), Gaps = 0/154 (0%)
 Frame = -3

Query  483  MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpfllIRMLH  304
            MAS+PG LT+WPWT LG+FKYVVLAP++ HSTY ++     ER+    +IFP +L RMLH
Sbjct  1    MASKPGFLTDWPWTPLGNFKYVVLAPWIIHSTYSFIVKDEKERELAYFVIFPLMLWRMLH  60

Query  303  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  124
            NQ+WIS SRYRTAKG NRIVDK IEFEQVDRERNWDDQII NG+LFY     LP    MP
Sbjct  61   NQIWISFSRYRTAKGSNRIVDKAIEFEQVDRERNWDDQIIFNGVLFYVFVKILPGASQMP  120

Query  123  IWRTDGIILTALIHTGPVEFLYYWLHRALHHHIL  22
            IWR DG+ILTAL+H GPVEFLYYWLHRALHHH L
Sbjct  121  IWRLDGVILTALLHAGPVEFLYYWLHRALHHHYL  154



>ref|XP_010324966.1| PREDICTED: protein ECERIFERUM 1-like isoform X1 [Solanum lycopersicum]
Length=626

 Score =   221 bits (562),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 102/155 (66%), Positives = 130/155 (84%), Gaps = 1/155 (1%)
 Frame = -3

Query  483  MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKY-LTDSPNERDPNillifpfllIRML  307
            MA++PGILTEWPW  LG+FKY+VLAPFV HS Y + ++   ++RD + + IF ++++RM+
Sbjct  1    MATKPGILTEWPWASLGNFKYLVLAPFVGHSIYSFFISKEESQRDFSYIFIFLYIVMRMV  60

Query  306  HNQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHM  127
            H+Q+WISLSRYR+AKGDNRI+D+ IEF+QVDRE NWDDQII NG+ FY  Y K   THH+
Sbjct  61   HHQMWISLSRYRSAKGDNRILDRSIEFDQVDRETNWDDQIIFNGVAFYIAYLKFSETHHL  120

Query  126  PIWRTDGIILTALIHTGPVEFLYYWLHRALHHHIL  22
            P+WR DGII+TAL+HTGPVEFLYYW+HRALHHH L
Sbjct  121  PLWRIDGIIITALLHTGPVEFLYYWIHRALHHHFL  155



>ref|XP_004510150.1| PREDICTED: protein ECERIFERUM 1-like [Cicer arietinum]
Length=626

 Score =   220 bits (561),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 110/154 (71%), Positives = 126/154 (82%), Gaps = 0/154 (0%)
 Frame = -3

Query  483  MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpfllIRMLH  304
            MASRPGILT+WPW  LGSFKYV+LAP+V HSTY  L    NERD +  LIFPFLL RMLH
Sbjct  1    MASRPGILTDWPWKPLGSFKYVILAPWVVHSTYSVLVKDKNERDISTFLIFPFLLWRMLH  60

Query  303  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  124
            NQ+WIS SRYRTAKG+NRIVDKGIEF+QVDRER+WDDQI+ NGLL+Y   Y L     +P
Sbjct  61   NQIWISFSRYRTAKGNNRIVDKGIEFDQVDRERDWDDQILFNGLLYYLACYTLKGASRVP  120

Query  123  IWRTDGIILTALIHTGPVEFLYYWLHRALHHHIL  22
            +W T+G+I+T L+H GPVEFLYYWLHRALHHH L
Sbjct  121  LWNTEGVIITILLHAGPVEFLYYWLHRALHHHFL  154



>dbj|BAJ85405.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=436

 Score =   216 bits (550),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 102/161 (63%), Positives = 124/161 (77%), Gaps = 0/161 (0%)
 Frame = -3

Query  483  MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpfllIRMLH  304
            MA+RPG LTEWPW  +G+FKY+V+AP V H  Y+ +     + D    LI P L +RM+H
Sbjct  1    MATRPGPLTEWPWQRMGNFKYLVMAPVVVHGAYRVMNKGWGDIDLAYALILPSLALRMIH  60

Query  303  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  124
            NQ+WISLSRY+TA+  +RIVD+GIEF+QVDRER WDDQI+ NGLLFY GY  +P    +P
Sbjct  61   NQIWISLSRYQTARSKHRIVDRGIEFDQVDRERGWDDQIVFNGLLFYVGYLAIPNVRGLP  120

Query  123  IWRTDGIILTALIHTGPVEFLYYWLHRALHHHILYSRYHSH  1
            +WRTDG + TAL+H GPVEFLYYW HRALHHH LYSRYHSH
Sbjct  121  LWRTDGAVATALLHAGPVEFLYYWFHRALHHHFLYSRYHSH  161



>ref|XP_003626834.1| gl1-like protein [Medicago truncatula]
 gb|AET01310.1| fatty acid hydroxylase superfamily protein [Medicago truncatula]
Length=622

 Score =   220 bits (560),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 102/154 (66%), Positives = 130/154 (84%), Gaps = 0/154 (0%)
 Frame = -3

Query  483  MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpfllIRMLH  304
            MAS+PGILT+WPWT LG FK+V+L PF+A STY ++ +SP E+D +  LIFP++++RMLH
Sbjct  1    MASKPGILTDWPWTPLGRFKWVILTPFIAKSTYNFIVNSPEEKDLSNFLIFPYMMVRMLH  60

Query  303  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  124
            +Q+WISLSR+RTAKG NRIVDK IEFEQVDRE NWDDQI+ N L+FY G + +P +  +P
Sbjct  61   DQVWISLSRHRTAKGKNRIVDKAIEFEQVDRESNWDDQILFNALIFYIGQWLVPESQKLP  120

Query  123  IWRTDGIILTALIHTGPVEFLYYWLHRALHHHIL  22
            IWRT G+++T L+H+GPVEFLYYWLHRALHHH L
Sbjct  121  IWRTSGVVMTILLHSGPVEFLYYWLHRALHHHFL  154



>ref|XP_008232283.1| PREDICTED: protein ECERIFERUM 1-like [Prunus mume]
Length=624

 Score =   219 bits (559),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 106/161 (66%), Positives = 127/161 (79%), Gaps = 0/161 (0%)
 Frame = -3

Query  483  MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpfllIRMLH  304
            MAS PGILT+WPWT LGSFK+V+LAP+V HST+ ++ +   ERD +  LI   +L R+LH
Sbjct  1    MASVPGILTDWPWTALGSFKHVILAPWVIHSTWLFVANDGKERDISYFLILALVLWRILH  60

Query  303  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  124
            NQ+WISLSRYRTAKG+ RI+DKG+EFEQVDRE NWDDQI+ N LLFY G   LP   H P
Sbjct  61   NQIWISLSRYRTAKGNGRILDKGLEFEQVDRENNWDDQILFNALLFYTGSRYLPGGQHAP  120

Query  123  IWRTDGIILTALIHTGPVEFLYYWLHRALHHHILYSRYHSH  1
             WR +G++LT ++H GPVEFLYYW HRALHHH LYSRY SH
Sbjct  121  FWRAEGLLLTIVLHAGPVEFLYYWFHRALHHHYLYSRYQSH  161



>ref|XP_009339873.1| PREDICTED: LOW QUALITY PROTEIN: protein ECERIFERUM 1-like [Pyrus 
x bretschneideri]
Length=261

 Score =   210 bits (535),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 105/154 (68%), Positives = 124/154 (81%), Gaps = 0/154 (0%)
 Frame = -3

Query  483  MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpfllIRMLH  304
            MA+ PGILT+WPWT LGSFK+VV+AP++ H  Y Y  +   ++D +  LIFPF+L R LH
Sbjct  1    MATTPGILTDWPWTPLGSFKHVVVAPWIIHGAYSYFVNDKKDKDLSYFLIFPFMLWRFLH  60

Query  303  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  124
            NQLWISLSRYRTA G+ RIVDKG+EFEQVDRE+NWDDQI+ NG+LFY G   LP   ++P
Sbjct  61   NQLWISLSRYRTATGNGRIVDKGLEFEQVDREKNWDDQILFNGILFYLGSRHLPGAANLP  120

Query  123  IWRTDGIILTALIHTGPVEFLYYWLHRALHHHIL  22
             WRTDGIILT L+H GPVEFLYYWLHRALHHH L
Sbjct  121  YWRTDGIILTILLHAGPVEFLYYWLHRALHHHFL  154



>ref|XP_004976194.1| PREDICTED: protein ECERIFERUM 1-like [Setaria italica]
Length=619

 Score =   219 bits (559),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 104/161 (65%), Positives = 125/161 (78%), Gaps = 0/161 (0%)
 Frame = -3

Query  483  MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpfllIRMLH  304
            MA+RPG LTEWPW W+GSFKY+VLAP V H+ ++  T    + DP  + + P LL+RM+H
Sbjct  1    MATRPGPLTEWPWQWMGSFKYLVLAPAVLHTAHRVATKGWGDLDPAYITMLPALLLRMIH  60

Query  303  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  124
            NQ+WISLSRY+TA+  N IVD+ IEFEQVDRER+WDDQII NGL FY  Y  +P    +P
Sbjct  61   NQIWISLSRYQTARRKNVIVDRSIEFEQVDRERSWDDQIIFNGLEFYLAYAMIPNVRLLP  120

Query  123  IWRTDGIILTALIHTGPVEFLYYWLHRALHHHILYSRYHSH  1
            +WRTDG I+T L+H GPVEFLYYW HRALHHH LYSRYHSH
Sbjct  121  VWRTDGAIITVLLHMGPVEFLYYWFHRALHHHFLYSRYHSH  161



>ref|XP_003575378.1| PREDICTED: protein ECERIFERUM 1-like [Brachypodium distachyon]
Length=619

 Score =   219 bits (559),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 105/161 (65%), Positives = 126/161 (78%), Gaps = 0/161 (0%)
 Frame = -3

Query  483  MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpfllIRMLH  304
            MA+RPG LTEWPW  LG+FKY+V+AP V H  ++ +T    + D    LI P LL+RM+H
Sbjct  1    MATRPGPLTEWPWQRLGNFKYLVMAPVVVHGAHRVMTKGWGDIDLAYALILPSLLLRMIH  60

Query  303  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  124
            NQ+WISLSRY+TA+  +RIVD+GIEF+QVDRER WDDQII NGLLFY GY  +P     P
Sbjct  61   NQIWISLSRYQTARSKHRIVDRGIEFDQVDRERGWDDQIIFNGLLFYAGYLAMPSVRGFP  120

Query  123  IWRTDGIILTALIHTGPVEFLYYWLHRALHHHILYSRYHSH  1
            +WRTDG ++TAL+H GPVEFLYYW HRALHHH LYSRYHSH
Sbjct  121  LWRTDGAVMTALLHAGPVEFLYYWFHRALHHHFLYSRYHSH  161



>gb|KCW76793.1| hypothetical protein EUGRSUZ_D011441, partial [Eucalyptus grandis]
Length=171

 Score =   207 bits (526),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 100/154 (65%), Positives = 127/154 (82%), Gaps = 0/154 (0%)
 Frame = -3

Query  483  MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpfllIRMLH  304
            MAS+PGILT+WPW  LGSFKY++LAP++AH TY+++   P ERD +  LI PFLL R++H
Sbjct  1    MASKPGILTDWPWKPLGSFKYMILAPWMAHGTYQFIAKGPGERDFSYFLILPFLLERIIH  60

Query  303  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  124
            NQ+WISLSR+RTAKG+NRI+D+GIEFEQVDRE NWDDQI+L G+L Y   + +P   H+P
Sbjct  61   NQIWISLSRHRTAKGNNRILDRGIEFEQVDRESNWDDQILLTGILLYMTNWTIPQASHLP  120

Query  123  IWRTDGIILTALIHTGPVEFLYYWLHRALHHHIL  22
            +W+TDG+I+T LIH   VE+LYYWLHRALHHH L
Sbjct  121  LWKTDGVIITVLIHALVVEYLYYWLHRALHHHFL  154



>ref|XP_011093465.1| PREDICTED: protein ECERIFERUM 1-like [Sesamum indicum]
Length=624

 Score =   219 bits (558),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 109/154 (71%), Positives = 125/154 (81%), Gaps = 0/154 (0%)
 Frame = -3

Query  483  MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpfllIRMLH  304
            MAS+PGILTEWPWT LG+FKYVVLAP+V HSTY Y+T   +ERD + LLI P LL R++H
Sbjct  1    MASKPGILTEWPWTRLGNFKYVVLAPWVVHSTYSYMTKDESERDLSYLLILPLLLSRVIH  60

Query  303  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  124
            NQ+WISLSRYRTAKG+NRIVDK IEFEQVDRERNWDDQIIL+G + Y G   +   H +P
Sbjct  61   NQIWISLSRYRTAKGNNRIVDKSIEFEQVDRERNWDDQIILSGFVLYLGSRHIQAAHCLP  120

Query  123  IWRTDGIILTALIHTGPVEFLYYWLHRALHHHIL  22
             WRTDG+I T L H GPVEF+YYW HRALHHH L
Sbjct  121  WWRTDGVIWTFLFHAGPVEFIYYWFHRALHHHFL  154



>ref|XP_006306971.1| hypothetical protein CARUB_v10008547mg [Capsella rubella]
 gb|EOA39869.1| hypothetical protein CARUB_v10008547mg [Capsella rubella]
Length=647

 Score =   219 bits (558),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 107/169 (63%), Positives = 133/169 (79%), Gaps = 0/169 (0%)
 Frame = -3

Query  528  KNTAIQDHKSIVLPKMASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDP  349
            K++    H +I    MA++PG+LT+WPWT LGSFKY+V+AP+V HSTY+++TD P +RD 
Sbjct  9    KHSDSHTHITIFDGIMATKPGVLTDWPWTSLGSFKYIVVAPWVVHSTYRFVTDDPEKRDL  68

Query  348  NillifpfllIRMLHNQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLL  169
               L+FPFLL R+LHNQ+WISLSRY TAKG  RIVDKGI+F QVDRE NWDDQI+ NG+L
Sbjct  69   GYSLVFPFLLFRILHNQVWISLSRYYTAKGKRRIVDKGIDFNQVDRETNWDDQILFNGVL  128

Query  168  FYWGYYKLPITHHMPIWRTDGIILTALIHTGPVEFLYYWLHRALHHHIL  22
            FY G   LP    +P WRTDG+++ AL+H GPVEFLYYWLH+ALHHH L
Sbjct  129  FYTGICLLPEAKQLPWWRTDGVLMAALLHAGPVEFLYYWLHKALHHHFL  177



>ref|XP_004510149.1| PREDICTED: protein ECERIFERUM 1-like isoform X3 [Cicer arietinum]
Length=423

 Score =   214 bits (544),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 103/154 (67%), Positives = 127/154 (82%), Gaps = 0/154 (0%)
 Frame = -3

Query  483  MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpfllIRMLH  304
            MAS+PGILT WPWT LGSFK+V+L P+VAHSTY +  +   ERD +  LIFP+L++RMLH
Sbjct  1    MASKPGILTNWPWTPLGSFKWVILTPWVAHSTYSFFVNGSEERDLSNFLIFPYLMVRMLH  60

Query  303  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  124
            +Q+WISLSR+RTAKG +RIVDK IEFEQVDRE NWDDQI+ NG++FY G   +  +  +P
Sbjct  61   DQIWISLSRHRTAKGKSRIVDKSIEFEQVDRESNWDDQILFNGVIFYIGQMFIEESRKLP  120

Query  123  IWRTDGIILTALIHTGPVEFLYYWLHRALHHHIL  22
            IWRTDG+I+T L+H GPVEFLYYWLH+ALHHH L
Sbjct  121  IWRTDGVIITILLHAGPVEFLYYWLHKALHHHFL  154



>gb|ACJ85705.1| unknown [Medicago truncatula]
 gb|AFK48448.1| unknown [Medicago truncatula]
Length=385

 Score =   212 bits (540),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 106/154 (69%), Positives = 126/154 (82%), Gaps = 0/154 (0%)
 Frame = -3

Query  483  MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpfllIRMLH  304
            MASRPGILT+WPW  LGSFKYVVLAP+V HSTY  +    +ERD +  LIFPFLL R+LH
Sbjct  1    MASRPGILTDWPWKPLGSFKYVVLAPWVIHSTYSLIVKDKSERDVSAFLIFPFLLWRVLH  60

Query  303  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  124
            NQ+WISLSRYRT+KG+NRI+DKGIEF+QVDRE++WDDQI+ NGLL+Y   Y L     +P
Sbjct  61   NQIWISLSRYRTSKGNNRILDKGIEFDQVDREKDWDDQILFNGLLYYLACYTLEGASRLP  120

Query  123  IWRTDGIILTALIHTGPVEFLYYWLHRALHHHIL  22
            +WRTDG+I+  L+H G VEFLYYWLHRALHHH L
Sbjct  121  LWRTDGVIIAILLHAGAVEFLYYWLHRALHHHFL  154



>ref|XP_002892018.1| hypothetical protein ARALYDRAFT_887207 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH68277.1| hypothetical protein ARALYDRAFT_887207 [Arabidopsis lyrata subsp. 
lyrata]
Length=432

 Score =   213 bits (543),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 102/154 (66%), Positives = 125/154 (81%), Gaps = 0/154 (0%)
 Frame = -3

Query  483  MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpfllIRMLH  304
            MA++PG+LT+WPWT LGSFKY+V+AP+  HSTY+++TD P +RD    L+FPFLL R+LH
Sbjct  1    MATKPGVLTDWPWTPLGSFKYIVIAPWAVHSTYRFVTDDPEKRDLGYSLVFPFLLFRILH  60

Query  303  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  124
            NQ+WISLSRY T+ G  RIVDKGI+F QVDRE NWDDQI+ NG+LFY G   LP    +P
Sbjct  61   NQVWISLSRYYTSSGKRRIVDKGIDFNQVDRETNWDDQILFNGVLFYTGICLLPEAKQLP  120

Query  123  IWRTDGIILTALIHTGPVEFLYYWLHRALHHHIL  22
             WRTDG+++ ALIH GPVEFLYYWLH+ALHHH L
Sbjct  121  WWRTDGVLMAALIHAGPVEFLYYWLHKALHHHFL  154



>ref|XP_002448160.1| hypothetical protein SORBIDRAFT_06g022320 [Sorghum bicolor]
 gb|EES12488.1| hypothetical protein SORBIDRAFT_06g022320 [Sorghum bicolor]
Length=619

 Score =   217 bits (553),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 103/161 (64%), Positives = 123/161 (76%), Gaps = 0/161 (0%)
 Frame = -3

Query  483  MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpfllIRMLH  304
            MA+RPG LTEWPW W+G+FKY+VL P V H+ ++  T    + DP    + P LL+RM+H
Sbjct  1    MATRPGPLTEWPWQWMGNFKYLVLVPAVLHTAHRVATKGWGDLDPAYATMLPALLLRMIH  60

Query  303  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  124
            NQ+WISLSRY+TA+  N IVD+ IEFEQVDRER+WDDQII NGL FY  Y  +P    +P
Sbjct  61   NQIWISLSRYQTARRKNVIVDRSIEFEQVDRERSWDDQIIFNGLEFYLAYAMIPNVRLLP  120

Query  123  IWRTDGIILTALIHTGPVEFLYYWLHRALHHHILYSRYHSH  1
            IWRTDG I+T L+H GPVEFLYYW HRALHHH LYSRYHSH
Sbjct  121  IWRTDGAIVTVLLHMGPVEFLYYWFHRALHHHFLYSRYHSH  161



>gb|EYU40308.1| hypothetical protein MIMGU_mgv1a002952mg [Erythranthe guttata]
Length=622

 Score =   217 bits (553),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 106/154 (69%), Positives = 126/154 (82%), Gaps = 0/154 (0%)
 Frame = -3

Query  483  MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpfllIRMLH  304
            MAS+PGILTEWPWT+LG+FKY+V+AP+V HSTY Y+    NERD    +IFPFL+ RM+H
Sbjct  1    MASKPGILTEWPWTFLGNFKYLVIAPWVIHSTYSYMVKDKNERDLTQFIIFPFLISRMIH  60

Query  303  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  124
            NQ+WIS SRYRTAKG NRIVDK IEF+QVDRERNWDDQII NG+LFY G   +   H++P
Sbjct  61   NQVWISFSRYRTAKGANRIVDKNIEFDQVDRERNWDDQIIFNGILFYVGQMYIKEAHNLP  120

Query  123  IWRTDGIILTALIHTGPVEFLYYWLHRALHHHIL  22
             WRT G++ T L+H GPVE+LYYWLHRALHHH L
Sbjct  121  WWRTMGVVWTILLHAGPVEYLYYWLHRALHHHYL  154



>ref|XP_008232262.1| PREDICTED: protein ECERIFERUM 1-like [Prunus mume]
Length=623

 Score =   217 bits (553),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 102/161 (63%), Positives = 125/161 (78%), Gaps = 0/161 (0%)
 Frame = -3

Query  483  MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpfllIRMLH  304
            MAS PGILTEWPW  LGS KYV+LAP++ HST+ ++ +   ERD +  L+   +L R++H
Sbjct  1    MASVPGILTEWPWKPLGSLKYVILAPWIIHSTWLFVANDAKERDVSYFLMLGVVLWRIIH  60

Query  303  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  124
            NQ+WISLSRYRTAKG+ RI+D+G+EFEQVDRE NWDDQI+ N LLFY G   LP   H P
Sbjct  61   NQIWISLSRYRTAKGNGRILDRGLEFEQVDRENNWDDQILFNALLFYTGSRYLPGGQHAP  120

Query  123  IWRTDGIILTALIHTGPVEFLYYWLHRALHHHILYSRYHSH  1
             WR +G++LT ++H GPVEFLYYW HRALHHH LYSRY SH
Sbjct  121  FWRAEGLLLTIVLHAGPVEFLYYWFHRALHHHYLYSRYQSH  161



>dbj|BAA11024.1| possible aldehyde decarbonylase [Arabidopsis thaliana]
Length=567

 Score =   216 bits (549),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 103/154 (67%), Positives = 126/154 (82%), Gaps = 0/154 (0%)
 Frame = -3

Query  483  MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpfllIRMLH  304
            MA++PG+LT+WPWT LGSFKY+V+AP+  HSTY+++TD P +RD    L+FPFLL R+LH
Sbjct  1    MATKPGVLTDWPWTPLGSFKYIVIAPWAVHSTYRFVTDDPEKRDLGYFLVFPFLLFRILH  60

Query  303  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  124
            NQ+WISLSRY T+ G  RIVDKGI+F QVDRE NWDDQI+ NG+LFY G   LP    +P
Sbjct  61   NQVWISLSRYYTSSGKRRIVDKGIDFNQVDRETNWDDQILFNGVLFYIGINLLPEAKQLP  120

Query  123  IWRTDGIILTALIHTGPVEFLYYWLHRALHHHIL  22
             WRTDG+++ ALIHTGPVEFLYYWLH+ALHHH L
Sbjct  121  WWRTDGVLMAALIHTGPVEFLYYWLHKALHHHFL  154



>gb|AAC24374.1| CER1 protein [Arabidopsis thaliana]
Length=580

 Score =   216 bits (550),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 103/154 (67%), Positives = 126/154 (82%), Gaps = 0/154 (0%)
 Frame = -3

Query  483  MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpfllIRMLH  304
            MA++PG+LT+WPWT LGSFKY+V+AP+  HSTY+++TD P +RD    L+FPFLL R+LH
Sbjct  1    MATKPGVLTDWPWTPLGSFKYIVIAPWAVHSTYRFVTDDPEKRDLGYFLVFPFLLFRILH  60

Query  303  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  124
            NQ+WISLSRY T+ G  RIVDKGI+F QVDRE NWDDQI+ NG+LFY G   LP    +P
Sbjct  61   NQVWISLSRYYTSSGKRRIVDKGIDFNQVDRETNWDDQILFNGVLFYIGINLLPEAKQLP  120

Query  123  IWRTDGIILTALIHTGPVEFLYYWLHRALHHHIL  22
             WRTDG+++ ALIHTGPVEFLYYWLH+ALHHH L
Sbjct  121  WWRTDGVLMAALIHTGPVEFLYYWLHKALHHHFL  154



>ref|XP_009376851.1| PREDICTED: protein ECERIFERUM 1-like [Pyrus x bretschneideri]
Length=623

 Score =   217 bits (552),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 105/154 (68%), Positives = 125/154 (81%), Gaps = 0/154 (0%)
 Frame = -3

Query  483  MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpfllIRMLH  304
            MA+ PGILTEWPWT LGSFK+VV+AP++ HSTY Y  +   ++D +  LIFP +L R +H
Sbjct  1    MATTPGILTEWPWTPLGSFKHVVVAPWIIHSTYSYFANDEEDKDLSYFLIFPLILWRFVH  60

Query  303  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  124
            NQLWISLSRYRTAKG+ RIVDKG+EFEQVDRERNWDDQI+ N +LFY G   LP   ++P
Sbjct  61   NQLWISLSRYRTAKGNGRIVDKGLEFEQVDRERNWDDQILFNSILFYLGSRHLPGASNLP  120

Query  123  IWRTDGIILTALIHTGPVEFLYYWLHRALHHHIL  22
            +WRTDG+ILT L+H GPVEFLYYW HRALHHH L
Sbjct  121  MWRTDGVILTILLHAGPVEFLYYWFHRALHHHFL  154



>ref|XP_008361247.1| PREDICTED: protein ECERIFERUM 1-like [Malus domestica]
Length=561

 Score =   215 bits (548),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 106/154 (69%), Positives = 125/154 (81%), Gaps = 0/154 (0%)
 Frame = -3

Query  483  MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpfllIRMLH  304
            MA+ PGILT+WPWT LGSFK+VV+AP++ H  Y Y  +   ++D +  LIFPF+L R LH
Sbjct  1    MATTPGILTDWPWTPLGSFKHVVVAPWIIHGAYSYFVNDEKDKDLSYFLIFPFMLWRFLH  60

Query  303  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  124
            NQLWISLSRYRTAKG+ RIVDKG+EFEQVDRERNWDDQI+ NG+LFY G   LP   ++P
Sbjct  61   NQLWISLSRYRTAKGNGRIVDKGLEFEQVDRERNWDDQILFNGILFYLGSRHLPGATNLP  120

Query  123  IWRTDGIILTALIHTGPVEFLYYWLHRALHHHIL  22
             WRTDG+ILT L+H GPVEFLYYWLHRALHHH L
Sbjct  121  FWRTDGVILTILLHAGPVEFLYYWLHRALHHHFL  154



>gb|EMT33049.1| Protein WAX2 [Aegilops tauschii]
Length=619

 Score =   216 bits (550),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 102/161 (63%), Positives = 122/161 (76%), Gaps = 0/161 (0%)
 Frame = -3

Query  483  MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpfllIRMLH  304
            MA+RPG LTEWPW  +G+FKY+V+AP V H  Y+ +     + D    LI P L +RM+H
Sbjct  1    MATRPGPLTEWPWQRMGNFKYLVMAPVVVHGAYRVMNKGWGDIDLAYSLILPSLALRMIH  60

Query  303  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  124
            NQ+WISLSRY+TA+  +RIVD+ IEFEQVDRER WDDQI+ NGLLFY GY  +P     P
Sbjct  61   NQIWISLSRYQTARSKHRIVDRDIEFEQVDRERGWDDQIVFNGLLFYVGYLAMPSVRRFP  120

Query  123  IWRTDGIILTALIHTGPVEFLYYWLHRALHHHILYSRYHSH  1
            +WRTDG + TAL+H GPVEFLYYW HRALHHH LYSRYHSH
Sbjct  121  LWRTDGAVATALLHAGPVEFLYYWFHRALHHHFLYSRYHSH  161



>ref|XP_010496714.1| PREDICTED: protein ECERIFERUM 1 isoform X2 [Camelina sativa]
Length=625

 Score =   216 bits (550),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 103/154 (67%), Positives = 127/154 (82%), Gaps = 0/154 (0%)
 Frame = -3

Query  483  MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpfllIRMLH  304
            MA++PG+LT+WPWT LGSFKY+V+AP+V HSTY+++TD P +RD    L+FPFLL R+LH
Sbjct  1    MATKPGVLTDWPWTPLGSFKYIVVAPWVVHSTYRFVTDDPEKRDIGYSLVFPFLLFRILH  60

Query  303  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  124
            NQ+WISLSRY T+KG  RIVDKGI+F QVDRE NWDDQI+ NG+LFY G   LP    +P
Sbjct  61   NQVWISLSRYYTSKGKRRIVDKGIDFNQVDRETNWDDQILFNGVLFYTGICLLPEAKQLP  120

Query  123  IWRTDGIILTALIHTGPVEFLYYWLHRALHHHIL  22
             WRTDG+++ AL+H GPVEFLYYWLH+ALHHH L
Sbjct  121  WWRTDGVLMAALLHAGPVEFLYYWLHKALHHHYL  154



>ref|XP_010496480.1| PREDICTED: protein ECERIFERUM 1-like [Camelina sativa]
Length=625

 Score =   216 bits (550),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 103/154 (67%), Positives = 127/154 (82%), Gaps = 0/154 (0%)
 Frame = -3

Query  483  MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpfllIRMLH  304
            MA++PG+LT+WPWT LGSFKY+V+AP+V HSTY+++TD P +RD    L+FPFLL R+LH
Sbjct  1    MATKPGVLTDWPWTPLGSFKYIVVAPWVVHSTYRFVTDDPEKRDIGYSLVFPFLLFRILH  60

Query  303  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  124
            NQ+WISLSRY T+KG  RIVDKGI+F QVDRE NWDDQI+ NG+LFY G   LP    +P
Sbjct  61   NQVWISLSRYYTSKGKRRIVDKGIDFNQVDRETNWDDQILFNGVLFYTGICLLPEAKQLP  120

Query  123  IWRTDGIILTALIHTGPVEFLYYWLHRALHHHIL  22
             WRTDG+++ AL+H GPVEFLYYWLH+ALHHH L
Sbjct  121  WWRTDGVLMAALLHAGPVEFLYYWLHKALHHHYL  154



>ref|XP_004307280.1| PREDICTED: protein ECERIFERUM 1-like [Fragaria vesca subsp. vesca]
Length=623

 Score =   216 bits (550),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 105/154 (68%), Positives = 125/154 (81%), Gaps = 0/154 (0%)
 Frame = -3

Query  483  MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpfllIRMLH  304
            MAS PGILTEWPWT LGSFKYVV+APF  HSTY ++ +   ++D +  LIFP++L RMLH
Sbjct  1    MASNPGILTEWPWTRLGSFKYVVVAPFAIHSTYSFIVNEWEDKDLSYFLIFPYMLFRMLH  60

Query  303  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  124
            NQLWISLSRYRT+KG  RI+DKG+EFEQVDRERNWDDQII N +LFY G  +L    ++P
Sbjct  61   NQLWISLSRYRTSKGSGRIIDKGLEFEQVDRERNWDDQIIFNAILFYIGRMRLDGGRNVP  120

Query  123  IWRTDGIILTALIHTGPVEFLYYWLHRALHHHIL  22
            +WR DG ++T L+H GPVEFLYYWLHRALHHH L
Sbjct  121  LWRADGFVITFLLHAGPVEFLYYWLHRALHHHYL  154



>gb|ACA14353.1| TCER1 [Triticum aestivum]
Length=619

 Score =   216 bits (550),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 101/161 (63%), Positives = 122/161 (76%), Gaps = 0/161 (0%)
 Frame = -3

Query  483  MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpfllIRMLH  304
            MA+RPG LTEWPW  +G+FKY+V+AP V H  Y+ +     + D    LI P L +RM+H
Sbjct  1    MATRPGPLTEWPWQRMGNFKYLVMAPVVVHGAYRVMNKGWGDIDLAYSLILPSLALRMIH  60

Query  303  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  124
            NQ+WI LSRY+TA+  +RIVD+GIEF+QVDRER WDDQI+ NGLLFY GY  +P     P
Sbjct  61   NQIWIGLSRYQTARSKHRIVDRGIEFDQVDRERGWDDQIVFNGLLFYVGYLAMPSVRRFP  120

Query  123  IWRTDGIILTALIHTGPVEFLYYWLHRALHHHILYSRYHSH  1
            +WRTDG + TAL+H GPVEFLYYW HRALHHH LYSRYHSH
Sbjct  121  LWRTDGAVATALLHAGPVEFLYYWFHRALHHHFLYSRYHSH  161



>ref|XP_010496713.1| PREDICTED: protein ECERIFERUM 1 isoform X1 [Camelina sativa]
Length=625

 Score =   216 bits (550),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 103/154 (67%), Positives = 127/154 (82%), Gaps = 0/154 (0%)
 Frame = -3

Query  483  MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpfllIRMLH  304
            MA++PG+LT+WPWT LGSFKY+V+AP+V HSTY+++TD P +RD    L+FPFLL R+LH
Sbjct  1    MATKPGVLTDWPWTPLGSFKYIVVAPWVVHSTYRFVTDDPEKRDIGYSLVFPFLLFRILH  60

Query  303  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  124
            NQ+WISLSRY T+KG  RIVDKGI+F QVDRE NWDDQI+ NG+LFY G   LP    +P
Sbjct  61   NQVWISLSRYYTSKGKRRIVDKGIDFNQVDRETNWDDQILFNGVLFYTGICLLPEAKQLP  120

Query  123  IWRTDGIILTALIHTGPVEFLYYWLHRALHHHIL  22
             WRTDG+++ AL+H GPVEFLYYWLH+ALHHH L
Sbjct  121  WWRTDGVLMAALLHAGPVEFLYYWLHKALHHHYL  154



>ref|XP_004166202.1| PREDICTED: protein ECERIFERUM 1-like, partial [Cucumis sativus]
Length=172

 Score =   204 bits (518),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 104/154 (68%), Positives = 124/154 (81%), Gaps = 0/154 (0%)
 Frame = -3

Query  483  MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpfllIRMLH  304
            MAS PGILT+WPW  LGSFKYV+LAP+V HS Y+Y+     ERD + L+IFPFLL R++H
Sbjct  1    MASTPGILTDWPWKPLGSFKYVILAPWVVHSIYQYVVKDETERDVSCLVIFPFLLWRIIH  60

Query  303  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  124
            NQ+WISLSRYRTAKG+ RI+DKGIEF+QVDRE NWDDQI+L GLL Y   Y +     +P
Sbjct  61   NQIWISLSRYRTAKGNARILDKGIEFDQVDREGNWDDQILLTGLLLYVVSYVMEEASKLP  120

Query  123  IWRTDGIILTALIHTGPVEFLYYWLHRALHHHIL  22
            +WRTDG+I+  L+H GPVEFLYYWLHRALHHH L
Sbjct  121  LWRTDGMIIIFLLHIGPVEFLYYWLHRALHHHYL  154



>ref|XP_006354618.1| PREDICTED: protein ECERIFERUM 1-like isoform X2 [Solanum tuberosum]
Length=589

 Score =   215 bits (547),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 104/155 (67%), Positives = 125/155 (81%), Gaps = 1/155 (1%)
 Frame = -3

Query  483  MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKY-LTDSPNERDPNillifpfllIRML  307
            MA++PGILTEWPW  LG+ KY+VLAPF  HS Y + ++   ++RD   +L+ PF L RM+
Sbjct  1    MATKPGILTEWPWAGLGNLKYLVLAPFACHSIYTFFMSRDESQRDMFYILVLPFTLSRMI  60

Query  306  HNQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHM  127
            H QLWIS+SRYRTAKG+NRI+DK IEF+QVDRE NWDDQIIL GL++Y GY  +   HHM
Sbjct  61   HYQLWISISRYRTAKGNNRIIDKSIEFDQVDRESNWDDQIILFGLVYYIGYLIVEQAHHM  120

Query  126  PIWRTDGIILTALIHTGPVEFLYYWLHRALHHHIL  22
            P+WRTDGII+TALIH GPVEFLYYW HRALHHH L
Sbjct  121  PVWRTDGIIITALIHIGPVEFLYYWFHRALHHHFL  155



>ref|XP_006418509.1| hypothetical protein EUTSA_v10009534mg [Eutrema salsugineum]
 gb|ESQ36862.1| hypothetical protein EUTSA_v10009534mg [Eutrema salsugineum]
Length=615

 Score =   216 bits (549),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 103/154 (67%), Positives = 127/154 (82%), Gaps = 0/154 (0%)
 Frame = -3

Query  483  MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpfllIRMLH  304
            MA++PGILT+WPWT LGSFKYVV+AP+  HSTYK++TD P ++D    L+FPFLL+R+LH
Sbjct  1    MATKPGILTDWPWTPLGSFKYVVIAPWAVHSTYKFVTDDPEKKDLGYFLVFPFLLLRILH  60

Query  303  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  124
            NQ+WISLSRY TAKG  RI+DKGI+F QVDRE NWDDQI+ NGL FY G   LP    +P
Sbjct  61   NQVWISLSRYCTAKGKRRILDKGIDFNQVDRETNWDDQILFNGLWFYIGMRLLPQGKQLP  120

Query  123  IWRTDGIILTALIHTGPVEFLYYWLHRALHHHIL  22
            +WRTDG+++ A++H GPVEFLYYWLH+ALHHH L
Sbjct  121  LWRTDGVLMAAVLHAGPVEFLYYWLHKALHHHFL  154



>ref|XP_006354617.1| PREDICTED: protein ECERIFERUM 1-like isoform X1 [Solanum tuberosum]
Length=623

 Score =   216 bits (549),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 104/155 (67%), Positives = 125/155 (81%), Gaps = 1/155 (1%)
 Frame = -3

Query  483  MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKY-LTDSPNERDPNillifpfllIRML  307
            MA++PGILTEWPW  LG+ KY+VLAPF  HS Y + ++   ++RD   +L+ PF L RM+
Sbjct  1    MATKPGILTEWPWAGLGNLKYLVLAPFACHSIYTFFMSRDESQRDMFYILVLPFTLSRMI  60

Query  306  HNQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHM  127
            H QLWIS+SRYRTAKG+NRI+DK IEF+QVDRE NWDDQIIL GL++Y GY  +   HHM
Sbjct  61   HYQLWISISRYRTAKGNNRIIDKSIEFDQVDRESNWDDQIILFGLVYYIGYLIVEQAHHM  120

Query  126  PIWRTDGIILTALIHTGPVEFLYYWLHRALHHHIL  22
            P+WRTDGII+TALIH GPVEFLYYW HRALHHH L
Sbjct  121  PVWRTDGIIITALIHIGPVEFLYYWFHRALHHHFL  155



>ref|XP_006428971.1| hypothetical protein CICLE_v10011291mg [Citrus clementina]
 ref|XP_006480706.1| PREDICTED: protein ECERIFERUM 1-like isoform X1 [Citrus sinensis]
 gb|ESR42211.1| hypothetical protein CICLE_v10011291mg [Citrus clementina]
Length=627

 Score =   216 bits (549),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 112/155 (72%), Positives = 128/155 (83%), Gaps = 1/155 (1%)
 Frame = -3

Query  483  MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpfllIRMLH  304
            MAS+PGILT+WPWT LG+FKY+VLAP++ HSTY ++     ERD    LIFPFLL RMLH
Sbjct  1    MASKPGILTDWPWTPLGNFKYIVLAPWIIHSTYSFMVKDEKERDLLNFLIFPFLLWRMLH  60

Query  303  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYK-LPITHHM  127
            NQ+WISLSRYRTAKG NRIVDK IEFEQVDRERNWDDQIIL+G+LFY  + K LP    +
Sbjct  61   NQIWISLSRYRTAKGRNRIVDKPIEFEQVDRERNWDDQIILSGILFYVVFGKMLPGGTQL  120

Query  126  PIWRTDGIILTALIHTGPVEFLYYWLHRALHHHIL  22
            PIWR DG+IL AL+H GPVEF+YYWLHRALHHH L
Sbjct  121  PIWRLDGVILMALLHAGPVEFVYYWLHRALHHHYL  155



>ref|XP_009337262.1| PREDICTED: protein ECERIFERUM 1-like [Pyrus x bretschneideri]
Length=623

 Score =   216 bits (549),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 107/154 (69%), Positives = 125/154 (81%), Gaps = 0/154 (0%)
 Frame = -3

Query  483  MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpfllIRMLH  304
            MA+ PGILT+WPWT LGSFK+VV+AP++ H  Y Y  +   ++D +  LIFPF+L R LH
Sbjct  1    MATTPGILTDWPWTPLGSFKHVVVAPWIIHGAYSYFVNDKKDKDLSYFLIFPFMLWRFLH  60

Query  303  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  124
            NQLWISLSRYRTAKG+ RIVDKG+EFEQVDRERNWDDQI+ NG+LFY G   LP   ++P
Sbjct  61   NQLWISLSRYRTAKGNGRIVDKGLEFEQVDRERNWDDQILFNGILFYLGSRHLPGAANLP  120

Query  123  IWRTDGIILTALIHTGPVEFLYYWLHRALHHHIL  22
             WRTDGIILT L+H GPVEFLYYWLHRALHHH L
Sbjct  121  YWRTDGIILTILLHAGPVEFLYYWLHRALHHHFL  154



>ref|NP_171723.2| protein ECERIFERUM 1 [Arabidopsis thaliana]
 sp|F4HVY0.1|CER1_ARATH RecName: Full=Protein ECERIFERUM 1 [Arabidopsis thaliana]
 gb|AEE27401.1| protein ECERIFERUM 1 [Arabidopsis thaliana]
Length=625

 Score =   216 bits (549),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 103/154 (67%), Positives = 126/154 (82%), Gaps = 0/154 (0%)
 Frame = -3

Query  483  MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpfllIRMLH  304
            MA++PG+LT+WPWT LGSFKY+V+AP+  HSTY+++TD P +RD    L+FPFLL R+LH
Sbjct  1    MATKPGVLTDWPWTPLGSFKYIVIAPWAVHSTYRFVTDDPEKRDLGYFLVFPFLLFRILH  60

Query  303  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  124
            NQ+WISLSRY T+ G  RIVDKGI+F QVDRE NWDDQI+ NG+LFY G   LP    +P
Sbjct  61   NQVWISLSRYYTSSGKRRIVDKGIDFNQVDRETNWDDQILFNGVLFYIGINLLPEAKQLP  120

Query  123  IWRTDGIILTALIHTGPVEFLYYWLHRALHHHIL  22
             WRTDG+++ ALIHTGPVEFLYYWLH+ALHHH L
Sbjct  121  WWRTDGVLMAALIHTGPVEFLYYWLHKALHHHFL  154



>ref|XP_008375723.1| PREDICTED: protein ECERIFERUM 1-like [Malus domestica]
Length=623

 Score =   215 bits (548),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 106/154 (69%), Positives = 125/154 (81%), Gaps = 0/154 (0%)
 Frame = -3

Query  483  MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpfllIRMLH  304
            MA+ PGILT+WPWT LGSFK+VV+AP++ H  Y Y  +   ++D +  LIFPF+L R LH
Sbjct  1    MATTPGILTDWPWTPLGSFKHVVVAPWIIHGAYSYFVNDEKDKDLSYFLIFPFMLWRFLH  60

Query  303  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  124
            NQLWISLSRYRTAKG+ RIVDKG+EFEQVDRERNWDDQI+ NG+LFY G   LP   ++P
Sbjct  61   NQLWISLSRYRTAKGNGRIVDKGLEFEQVDRERNWDDQILFNGILFYLGSRHLPGATNLP  120

Query  123  IWRTDGIILTALIHTGPVEFLYYWLHRALHHHIL  22
             WRTDG+ILT L+H GPVEFLYYWLHRALHHH L
Sbjct  121  FWRTDGVILTILLHAGPVEFLYYWLHRALHHHFL  154



>gb|AIE57503.1| CER1 [Camelina sativa]
Length=625

 Score =   215 bits (548),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 103/154 (67%), Positives = 126/154 (82%), Gaps = 0/154 (0%)
 Frame = -3

Query  483  MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpfllIRMLH  304
            MA++PG+LT+WPWT LGSFKY+V+AP+V HSTY+++TD P  RD    L+FPFLL R+LH
Sbjct  1    MATKPGVLTDWPWTPLGSFKYIVVAPWVVHSTYRFVTDDPETRDIGYSLVFPFLLFRILH  60

Query  303  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  124
            NQ+WISLSRY T+KG  RIVDKGI+F QVDRE NWDDQI+ NG+LFY G   LP    +P
Sbjct  61   NQVWISLSRYYTSKGKRRIVDKGIDFNQVDRETNWDDQILFNGVLFYTGICLLPEAKQLP  120

Query  123  IWRTDGIILTALIHTGPVEFLYYWLHRALHHHIL  22
             WRTDG+++ AL+H GPVEFLYYWLH+ALHHH L
Sbjct  121  WWRTDGVLMAALLHAGPVEFLYYWLHKALHHHYL  154



>ref|XP_008364777.1| PREDICTED: protein ECERIFERUM 1-like [Malus domestica]
Length=623

 Score =   215 bits (548),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 106/154 (69%), Positives = 125/154 (81%), Gaps = 0/154 (0%)
 Frame = -3

Query  483  MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpfllIRMLH  304
            MA+ PGILT+WPWT LGSFK+VV+AP++ H  Y Y  +   ++D +  LIFPF+L R LH
Sbjct  1    MATTPGILTDWPWTPLGSFKHVVVAPWIIHGAYSYFVNDEKDKDLSYFLIFPFMLWRFLH  60

Query  303  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  124
            NQLWISLSRYRTAKG+ RIVDKG+EFEQVDRERNWDDQI+ NG+LFY G   LP   ++P
Sbjct  61   NQLWISLSRYRTAKGNGRIVDKGLEFEQVDRERNWDDQILFNGILFYLGSRHLPGATNLP  120

Query  123  IWRTDGIILTALIHTGPVEFLYYWLHRALHHHIL  22
             WRTDG+ILT L+H GPVEFLYYWLHRALHHH L
Sbjct  121  FWRTDGVILTILLHAGPVEFLYYWLHRALHHHFL  154



>ref|NP_001184890.1| protein ECERIFERUM 1 [Arabidopsis thaliana]
 gb|AEE27402.1| protein ECERIFERUM 1 [Arabidopsis thaliana]
Length=630

 Score =   215 bits (548),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 103/154 (67%), Positives = 126/154 (82%), Gaps = 0/154 (0%)
 Frame = -3

Query  483  MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpfllIRMLH  304
            MA++PG+LT+WPWT LGSFKY+V+AP+  HSTY+++TD P +RD    L+FPFLL R+LH
Sbjct  1    MATKPGVLTDWPWTPLGSFKYIVIAPWAVHSTYRFVTDDPEKRDLGYFLVFPFLLFRILH  60

Query  303  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  124
            NQ+WISLSRY T+ G  RIVDKGI+F QVDRE NWDDQI+ NG+LFY G   LP    +P
Sbjct  61   NQVWISLSRYYTSSGKRRIVDKGIDFNQVDRETNWDDQILFNGVLFYIGINLLPEAKQLP  120

Query  123  IWRTDGIILTALIHTGPVEFLYYWLHRALHHHIL  22
             WRTDG+++ ALIHTGPVEFLYYWLH+ALHHH L
Sbjct  121  WWRTDGVLMAALIHTGPVEFLYYWLHKALHHHFL  154



>ref|XP_006365794.1| PREDICTED: protein ECERIFERUM 1-like [Solanum tuberosum]
Length=625

 Score =   215 bits (547),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 104/154 (68%), Positives = 124/154 (81%), Gaps = 4/154 (3%)
 Frame = -3

Query  483  MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpfllIRMLH  304
            MAS+PGILTEWPW  LG+FKY+VL PFV HS Y +L     E D   + I PFLL R +H
Sbjct  1    MASKPGILTEWPWANLGNFKYLVLVPFVGHSIYSFL----REGDIGYIAILPFLLFRFIH  56

Query  303  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  124
            NQ+WISLSR+RTAKG+NRIVD+ IEF+QVDRE +WDDQII NGLL+Y GY ++   HH+P
Sbjct  57   NQIWISLSRHRTAKGNNRIVDRSIEFDQVDRENSWDDQIIFNGLLYYIGYLRMEQVHHLP  116

Query  123  IWRTDGIILTALIHTGPVEFLYYWLHRALHHHIL  22
            +WRTDG+I+TALIH GPVEF+YYW HRALHHH L
Sbjct  117  LWRTDGLIITALIHIGPVEFIYYWFHRALHHHFL  150



>gb|KHG03871.1| Protein WAX2 -like protein [Gossypium arboreum]
Length=599

 Score =   214 bits (546),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 101/156 (65%), Positives = 122/156 (78%), Gaps = 0/156 (0%)
 Frame = -3

Query  483  MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpfllIRMLH  304
            MAS+PGILT+WPWT LGSFKY++L P+V  + +  +   P E D     + PF+L RMLH
Sbjct  1    MASKPGILTDWPWTPLGSFKYIILGPWVMETIHSIMVKDPQEWDLTNFTVIPFMLWRMLH  60

Query  303  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  124
            NQLWIS SRYRTAKG NRIVDKGIEF+QVDRE+NWDDQI+ NG+LF+     +P   H+P
Sbjct  61   NQLWISFSRYRTAKGTNRIVDKGIEFDQVDREKNWDDQILFNGILFFLANKYVPGASHLP  120

Query  123  IWRTDGIILTALIHTGPVEFLYYWLHRALHHHILYS  16
            +WRTDG+I+T L+H GPVEFLYYW HRALHHH LYS
Sbjct  121  LWRTDGVIITMLLHVGPVEFLYYWFHRALHHHYLYS  156



>gb|KHN30013.1| Protein WAX2 [Glycine soja]
Length=621

 Score =   215 bits (547),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 106/154 (69%), Positives = 126/154 (82%), Gaps = 0/154 (0%)
 Frame = -3

Query  483  MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpfllIRMLH  304
            MASRPGILT+WPW  LGSFKY++LAP+V HS+Y  L    +ERD +  LIFPFLL RMLH
Sbjct  1    MASRPGILTDWPWKPLGSFKYLLLAPWVVHSSYSVLVKDKSERDISTFLIFPFLLWRMLH  60

Query  303  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  124
            NQ+WI+LSRYRTAKG+ RIVDKGIEF+QVDRER+WDDQI+ NGLL+Y   Y L     +P
Sbjct  61   NQIWITLSRYRTAKGNARIVDKGIEFDQVDRERDWDDQILFNGLLYYLASYTLSGASRIP  120

Query  123  IWRTDGIILTALIHTGPVEFLYYWLHRALHHHIL  22
            +WRTDG+++  L+H GPVEFLYYWLHRALHHH L
Sbjct  121  LWRTDGVVMAILLHAGPVEFLYYWLHRALHHHFL  154



>gb|KEH17984.1| fatty acid hydroxylase superfamily protein [Medicago truncatula]
Length=658

 Score =   215 bits (547),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 109/174 (63%), Positives = 132/174 (76%), Gaps = 0/174 (0%)
 Frame = -3

Query  543  ALRSIKNTAIQDHKSIVLPKMASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSP  364
             + S  +T  Q   +     MASRPGILT+WPW  LGSFKYVVLAP+V HSTY  +    
Sbjct  17   CMYSKTHTHTQKENTCASTIMASRPGILTDWPWKPLGSFKYVVLAPWVIHSTYSLIVKDK  76

Query  363  NERDPNillifpfllIRMLHNQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQII  184
            +ERD +  LIFPFLL R+LHNQ+WISLSRYRT+KG+NRI+DKGIEF+QVDRE++WDDQI+
Sbjct  77   SERDVSTFLIFPFLLWRVLHNQIWISLSRYRTSKGNNRILDKGIEFDQVDREKDWDDQIL  136

Query  183  LNGLLFYWGYYKLPITHHMPIWRTDGIILTALIHTGPVEFLYYWLHRALHHHIL  22
             NGLL+Y   Y L     +P+WRTDG+I+  L+H G VEFLYYWLHRALHHH L
Sbjct  137  FNGLLYYLACYTLEGASRLPLWRTDGVIIAILLHAGAVEFLYYWLHRALHHHFL  190



>ref|XP_010255640.1| PREDICTED: protein ECERIFERUM 1-like [Nelumbo nucifera]
Length=627

 Score =   214 bits (545),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 111/161 (69%), Positives = 125/161 (78%), Gaps = 0/161 (0%)
 Frame = -3

Query  483  MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpfllIRMLH  304
            MAS+PG LT WPW  LG+FKYVVLAP+V HS Y+++T   NERD   LL FPFLL RMLH
Sbjct  1    MASKPGPLTNWPWQKLGNFKYVVLAPWVVHSIYQFVTKDENERDVGYLLTFPFLLSRMLH  60

Query  303  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  124
            +QLWISL+RY+TAK  +RIV KGIEFEQVDRERNWDDQIILNG++ Y      P    +P
Sbjct  61   SQLWISLARYQTAKSKHRIVHKGIEFEQVDRERNWDDQIILNGIVNYIIPQIFPGASRLP  120

Query  123  IWRTDGIILTALIHTGPVEFLYYWLHRALHHHILYSRYHSH  1
            +WR DGI L  L H GPVEFLYYWLHR LHHH LYSRYHSH
Sbjct  121  MWRWDGIFLVILFHAGPVEFLYYWLHRVLHHHFLYSRYHSH  161



>ref|XP_010054531.1| PREDICTED: protein ECERIFERUM 1-like [Eucalyptus grandis]
 gb|KCW76798.1| hypothetical protein EUGRSUZ_D01149 [Eucalyptus grandis]
Length=620

 Score =   214 bits (544),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 102/154 (66%), Positives = 125/154 (81%), Gaps = 0/154 (0%)
 Frame = -3

Query  483  MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpfllIRMLH  304
            MAS+PGILTEWPW  LGSFKY++LAP+  H TY++++    ERD +  L+ PFLL R+LH
Sbjct  1    MASKPGILTEWPWKPLGSFKYMILAPWAIHGTYQFISKGAGERDSSYFLVLPFLLARLLH  60

Query  303  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  124
            NQ+WIS SR+R AKG+NRIVD+GIEFEQVDRE NWDDQI+LNG+LFY  +  +P   H+P
Sbjct  61   NQIWISYSRHRIAKGNNRIVDRGIEFEQVDRESNWDDQILLNGILFYVSHMIIPQASHLP  120

Query  123  IWRTDGIILTALIHTGPVEFLYYWLHRALHHHIL  22
            +WRTDG+I+T LIH   VEFLYYWLHRALHHH L
Sbjct  121  LWRTDGVIITVLIHASVVEFLYYWLHRALHHHFL  154



>ref|XP_004510147.1| PREDICTED: protein ECERIFERUM 1-like isoform X1 [Cicer arietinum]
Length=622

 Score =   214 bits (544),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 103/154 (67%), Positives = 127/154 (82%), Gaps = 0/154 (0%)
 Frame = -3

Query  483  MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpfllIRMLH  304
            MAS+PGILT WPWT LGSFK+V+L P+VAHSTY +  +   ERD +  LIFP+L++RMLH
Sbjct  1    MASKPGILTNWPWTPLGSFKWVILTPWVAHSTYSFFVNGSEERDLSNFLIFPYLMVRMLH  60

Query  303  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  124
            +Q+WISLSR+RTAKG +RIVDK IEFEQVDRE NWDDQI+ NG++FY G   +  +  +P
Sbjct  61   DQIWISLSRHRTAKGKSRIVDKSIEFEQVDRESNWDDQILFNGVIFYIGQMFIEESRKLP  120

Query  123  IWRTDGIILTALIHTGPVEFLYYWLHRALHHHIL  22
            IWRTDG+I+T L+H GPVEFLYYWLH+ALHHH L
Sbjct  121  IWRTDGVIITILLHAGPVEFLYYWLHKALHHHFL  154



>gb|KFK42594.1| hypothetical protein AALP_AA1G015600 [Arabis alpina]
Length=624

 Score =   213 bits (542),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 102/154 (66%), Positives = 125/154 (81%), Gaps = 0/154 (0%)
 Frame = -3

Query  483  MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpfllIRMLH  304
            MA++PGILT+WPWT LGSFKY+V+AP+  HS YK +TD   + D    L+ PFLL+R+LH
Sbjct  1    MATKPGILTDWPWTPLGSFKYIVIAPWAIHSIYKLVTDDLEKIDLGYSLVLPFLLLRVLH  60

Query  303  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  124
            NQ+WISLSRY T KG+ RIVDKGI+F QVDRE NWDDQI+ NG+LFY G   LP   H+P
Sbjct  61   NQVWISLSRYYTVKGERRIVDKGIDFNQVDRETNWDDQILFNGVLFYTGISLLPEAKHLP  120

Query  123  IWRTDGIILTALIHTGPVEFLYYWLHRALHHHIL  22
            +WRTDG+++TAL+H GPVEFLYYWLH+ALHHH L
Sbjct  121  VWRTDGVLMTALLHAGPVEFLYYWLHKALHHHFL  154



>ref|XP_009337266.1| PREDICTED: protein ECERIFERUM 1-like [Pyrus x bretschneideri]
Length=446

 Score =   209 bits (532),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 104/154 (68%), Positives = 123/154 (80%), Gaps = 0/154 (0%)
 Frame = -3

Query  483  MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpfllIRMLH  304
            MA+ PGILT+WPWT LGSFK+VV+AP++ H  Y Y  +   ++D +  LIFPF+L R LH
Sbjct  1    MATTPGILTDWPWTPLGSFKHVVVAPWIIHGAYSYFVNDKKDKDLSYFLIFPFMLWRFLH  60

Query  303  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  124
            NQLWISLSRYRTA G+ RIVDKG+EFEQVDRE+NWDDQI+ NG+LFY G   LP   ++P
Sbjct  61   NQLWISLSRYRTATGNGRIVDKGLEFEQVDREKNWDDQILFNGILFYLGSRHLPGAANLP  120

Query  123  IWRTDGIILTALIHTGPVEFLYYWLHRALHHHIL  22
             WRT GIILT L+H GPVEFLYYWLHRALHHH L
Sbjct  121  YWRTYGIILTILLHAGPVEFLYYWLHRALHHHFL  154



>gb|EMS58602.1| Protein WAX2 [Triticum urartu]
Length=222

 Score =   202 bits (515),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 96/161 (60%), Positives = 122/161 (76%), Gaps = 0/161 (0%)
 Frame = -3

Query  483  MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpfllIRMLH  304
            MA+ PG+ +EWPW  LGSFKYVVLAP+VAH   +  T    E D   L+I P +++R LH
Sbjct  1    MATNPGLFSEWPWKMLGSFKYVVLAPWVAHGIQQVATKGWREADLGYLVILPSMILRGLH  60

Query  303  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  124
            NQ WI++SR + A+G  +IVD+GIEFEQ+DRERNWDDQIIL+ +L + G   LP   ++P
Sbjct  61   NQAWITVSRLQNARGKRQIVDRGIEFEQIDRERNWDDQIILSAILLFLGALHLPGGQNLP  120

Query  123  IWRTDGIILTALIHTGPVEFLYYWLHRALHHHILYSRYHSH  1
            +WRTDG +L AL+H GPVEF+YYW HRALHHH LY+RYHSH
Sbjct  121  LWRTDGAVLLALLHAGPVEFVYYWFHRALHHHFLYTRYHSH  161



>ref|XP_010520222.1| PREDICTED: protein ECERIFERUM 1-like [Tarenaya hassleriana]
Length=631

 Score =   213 bits (541),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 102/154 (66%), Positives = 124/154 (81%), Gaps = 0/154 (0%)
 Frame = -3

Query  483  MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpfllIRMLH  304
            MA++PGILTEWPWT LG FK+V++AP+V  STYK++    +ERD    L+FP LL R++H
Sbjct  1    MATKPGILTEWPWTSLGRFKFVIVAPWVVDSTYKFMRGEESERDLVYFLVFPMLLSRIIH  60

Query  303  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  124
            N LWISLSRY TAKG+ RIVDKGI+F QVDRE NWDDQI+ NG+LFY GY  LP    +P
Sbjct  61   NLLWISLSRYVTAKGNRRIVDKGIDFNQVDRETNWDDQILFNGVLFYIGYTFLPEAKKLP  120

Query  123  IWRTDGIILTALIHTGPVEFLYYWLHRALHHHIL  22
            +WRTDG+++ AL+H GPVEFLYYWLHRALHHH L
Sbjct  121  MWRTDGVVMAALLHAGPVEFLYYWLHRALHHHFL  154



>dbj|BAK01778.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=424

 Score =   207 bits (528),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 97/161 (60%), Positives = 124/161 (77%), Gaps = 0/161 (0%)
 Frame = -3

Query  483  MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpfllIRMLH  304
            MA+RPG LTEWPW W+GSFKY+VLAP   H+ ++ +T    + +     + P LL+RM+H
Sbjct  1    MATRPGPLTEWPWQWMGSFKYLVLAPAALHTAHRLVTKGWGDMNLAYATMLPALLLRMIH  60

Query  303  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  124
            NQ+WISLSR++TA+  + IVD+ +EF+QVDRE +WDDQII NGL FY  Y  +P    MP
Sbjct  61   NQIWISLSRHQTARRKHIIVDRSLEFDQVDRESSWDDQIIFNGLFFYLAYVAVPNVSQMP  120

Query  123  IWRTDGIILTALIHTGPVEFLYYWLHRALHHHILYSRYHSH  1
            +WRT+G+I+TAL+H GPVEFLYYW HRALHHH LYSRYHSH
Sbjct  121  VWRTEGVIITALLHIGPVEFLYYWFHRALHHHFLYSRYHSH  161



>ref|XP_010920377.1| PREDICTED: protein ECERIFERUM 1-like [Elaeis guineensis]
Length=519

 Score =   210 bits (534),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 101/161 (63%), Positives = 125/161 (78%), Gaps = 0/161 (0%)
 Frame = -3

Query  483  MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpfllIRMLH  304
            MASRPGILTEWPW  LG+FKYV++AP+V H  +   T    E D   L IF  LL+R+LH
Sbjct  1    MASRPGILTEWPWQGLGNFKYVIMAPWVVHGLHMVATKGWRETDLTFLSIFASLLLRILH  60

Query  303  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  124
            NQ+WISL+R++ A+ ++RIVDK IEFEQVDRERNWDDQI+ NG L + G+  +P   ++P
Sbjct  61   NQVWISLARFQNARSNHRIVDKSIEFEQVDRERNWDDQILFNGWLLHLGHTFIPGARNLP  120

Query  123  IWRTDGIILTALIHTGPVEFLYYWLHRALHHHILYSRYHSH  1
            +WRTDG ++ AL+H GPVEFLYYW HRALHHH LYSRYHSH
Sbjct  121  LWRTDGAVIAALLHMGPVEFLYYWFHRALHHHFLYSRYHSH  161



>ref|XP_008338420.1| PREDICTED: protein ECERIFERUM 1-like [Malus domestica]
Length=623

 Score =   212 bits (539),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 103/154 (67%), Positives = 123/154 (80%), Gaps = 0/154 (0%)
 Frame = -3

Query  483  MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpfllIRMLH  304
            MA+ PGILTEWPWT LGSFK+VV+AP++ H TY Y  +   ++D +  LIFP +L R +H
Sbjct  1    MATTPGILTEWPWTPLGSFKHVVVAPWIIHGTYSYFANDEEDKDLSYFLIFPLILWRFVH  60

Query  303  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  124
            NQLWISLSRYRTAKG+ RIVDK +EFEQVDRERNWDDQI+ N +LFY G   LP   ++P
Sbjct  61   NQLWISLSRYRTAKGNGRIVDKSLEFEQVDRERNWDDQILFNSILFYLGSRHLPGASNLP  120

Query  123  IWRTDGIILTALIHTGPVEFLYYWLHRALHHHIL  22
            +WRTDG+ILT L+H GPVEFLYYW HRALHHH L
Sbjct  121  MWRTDGVILTILLHAGPVEFLYYWFHRALHHHFL  154



>gb|EEE57393.1| hypothetical protein OsJ_07566 [Oryza sativa Japonica Group]
Length=619

 Score =   211 bits (537),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 102/161 (63%), Positives = 124/161 (77%), Gaps = 0/161 (0%)
 Frame = -3

Query  483  MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpfllIRMLH  304
            MA+RPG   EW    LG+FKYVV+AP VAH   + + +   + D    LI P LL+RM+H
Sbjct  1    MATRPGPFYEWALDRLGNFKYVVMAPVVAHGARRVMRNGWGDLDIAFSLILPSLLLRMIH  60

Query  303  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  124
            NQ+WISLSRY+TA+  +RIVD+GIEF+QVDRER WDDQI+ NGL+FY GY  +P    MP
Sbjct  61   NQIWISLSRYQTARSKHRIVDRGIEFDQVDRERGWDDQILFNGLVFYAGYLAMPSVRRMP  120

Query  123  IWRTDGIILTALIHTGPVEFLYYWLHRALHHHILYSRYHSH  1
            +WRTDG ++TAL+HTGPVEFLYYW HRALHHH LYSRYHSH
Sbjct  121  VWRTDGAVVTALVHTGPVEFLYYWFHRALHHHFLYSRYHSH  161



>ref|XP_009339872.1| PREDICTED: protein ECERIFERUM 1-like [Pyrus x bretschneideri]
Length=429

 Score =   207 bits (526),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 104/154 (68%), Positives = 124/154 (81%), Gaps = 1/154 (1%)
 Frame = -3

Query  483  MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpfllIRMLH  304
            MA+ PGILT+WPWT LGSFK+VV+AP++ H  Y Y  +   ++D +  LIFPF+L R LH
Sbjct  1    MATTPGILTDWPWTPLGSFKHVVVAPWIIHGAYSYFVNDEKDKDLSYFLIFPFMLWRFLH  60

Query  303  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  124
            NQLWISLSRYRTAKG+ RIVDKG+EFEQVDRERNWDDQI+ N +LFY G + LP   ++P
Sbjct  61   NQLWISLSRYRTAKGNGRIVDKGLEFEQVDRERNWDDQILFNAILFYLGRH-LPGAVNLP  119

Query  123  IWRTDGIILTALIHTGPVEFLYYWLHRALHHHIL  22
             WRTDG+ILT L+H GPVEFLYYW HRALHHH L
Sbjct  120  FWRTDGVILTILLHAGPVEFLYYWFHRALHHHFL  153



>gb|EMS48098.1| Protein WAX2 [Triticum urartu]
Length=654

 Score =   211 bits (538),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 99/161 (61%), Positives = 123/161 (76%), Gaps = 0/161 (0%)
 Frame = -3

Query  483  MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpfllIRMLH  304
            MA+RPG LTEWPW W+GSFKY+VLAP   H+ ++ +T    +       + P LL+RM+H
Sbjct  1    MATRPGPLTEWPWQWMGSFKYLVLAPAALHTAHRVVTKGWGDMSLAYAAMLPALLLRMIH  60

Query  303  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  124
            NQ+WISLSR++TA+  + IVD+G+EF+QVDRE +WDDQII NGL FY  Y  +P    MP
Sbjct  61   NQIWISLSRHQTARRKHIIVDRGLEFDQVDRESSWDDQIIFNGLFFYLAYAAVPNVSRMP  120

Query  123  IWRTDGIILTALIHTGPVEFLYYWLHRALHHHILYSRYHSH  1
            +WRTDG I+TAL+H GPVEFLYYW HRALHHH LYSRYHSH
Sbjct  121  VWRTDGAIITALLHIGPVEFLYYWFHRALHHHFLYSRYHSH  161



>ref|XP_010052731.1| PREDICTED: protein ECERIFERUM 1-like [Eucalyptus grandis]
 gb|KCW76801.1| hypothetical protein EUGRSUZ_D01152 [Eucalyptus grandis]
Length=627

 Score =   211 bits (536),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 104/154 (68%), Positives = 128/154 (83%), Gaps = 0/154 (0%)
 Frame = -3

Query  483  MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpfllIRMLH  304
            MAS+PG+LT+WPW  LGSFKY+VLAP+V +STY ++  +  ERD +  LIFPFLL RM+H
Sbjct  1    MASKPGLLTDWPWKPLGSFKYLVLAPWVVYSTYVFVNSNGRERDMSTFLIFPFLLWRMVH  60

Query  303  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  124
            +Q+WI+LSRYR A+G+ RIVDKGIEFEQVDRER+WDDQI+ NGL+FY G   L    H+P
Sbjct  61   SQIWITLSRYRNARGNGRIVDKGIEFEQVDRERDWDDQILFNGLIFYIGAMTLAGGSHLP  120

Query  123  IWRTDGIILTALIHTGPVEFLYYWLHRALHHHIL  22
            +WR+DG+I TAL+H GPVEFLYYWLHRALHHH L
Sbjct  121  MWRSDGVITTALLHMGPVEFLYYWLHRALHHHYL  154



>ref|XP_010054526.1| PREDICTED: protein ECERIFERUM 1-like [Eucalyptus grandis]
Length=542

 Score =   209 bits (532),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 102/162 (63%), Positives = 128/162 (79%), Gaps = 0/162 (0%)
 Frame = -3

Query  486  KMASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpfllIRML  307
            + AS+PGILT+WPW  LGSFKYV+LAP+V H TY+++   P E D +  LI PFLL RML
Sbjct  65   ETASKPGILTDWPWKPLGSFKYVILAPWVVHGTYQFIAKGPGEWDFSYFLILPFLLERML  124

Query  306  HNQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHM  127
            HNQ+WISLSR+ TAKG+N I+D+GIEFEQVDRE NWDDQI+L  ++ Y  ++ +P   H+
Sbjct  125  HNQIWISLSRHGTAKGNNGILDRGIEFEQVDRESNWDDQILLTAIILYMFHWAIPQASHL  184

Query  126  PIWRTDGIILTALIHTGPVEFLYYWLHRALHHHILYSRYHSH  1
            P+W+TDG+I+T L+H   VE LYYWLHRALHHH LYSRYHS 
Sbjct  185  PLWKTDGVIITFLVHALVVESLYYWLHRALHHHFLYSRYHSQ  226



>ref|XP_008356893.1| PREDICTED: protein ECERIFERUM 1-like [Malus domestica]
Length=375

 Score =   205 bits (521),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 105/154 (68%), Positives = 124/154 (81%), Gaps = 1/154 (1%)
 Frame = -3

Query  483  MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpfllIRMLH  304
            MA+ PGILT+WPWT LGSFK+VV+AP++ H  Y Y  +   ++D +  LIFPF+L R LH
Sbjct  1    MATTPGILTDWPWTPLGSFKHVVVAPWIIHGAYSYFVNBEKDKDLSYFLIFPFMLWRFLH  60

Query  303  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  124
            NQLWISLSRYRTAKG+ RIVDKG+EFEQVDRERNWDDQI+ N +LFY G + LP   ++P
Sbjct  61   NQLWISLSRYRTAKGNGRIVDKGLEFEQVDRERNWDDQILFNXILFYLGRH-LPGAVNLP  119

Query  123  IWRTDGIILTALIHTGPVEFLYYWLHRALHHHIL  22
             WRTDG ILT L+H GPVEFLYYWLHRALHHH L
Sbjct  120  FWRTDGXILTILLHAGPVEFLYYWLHRALHHHFL  153



>ref|XP_004252845.1| PREDICTED: protein ECERIFERUM 1 [Solanum lycopersicum]
Length=620

 Score =   210 bits (535),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 102/154 (66%), Positives = 122/154 (79%), Gaps = 4/154 (3%)
 Frame = -3

Query  483  MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpfllIRMLH  304
            MAS+PGIL+EWPW  LG+FKY+VLAPFV HS Y +L D     D   + I PFLL R +H
Sbjct  1    MASKPGILSEWPWANLGNFKYLVLAPFVGHSIYSFLRDG----DIGYIAILPFLLFRFIH  56

Query  303  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  124
            NQ+WISLSR+RTAKG+NRIVD+ IEF+QVDRE NWDDQII NGLL+Y GY ++   HH+P
Sbjct  57   NQIWISLSRHRTAKGNNRIVDRSIEFDQVDRENNWDDQIIFNGLLYYVGYLRMEQVHHLP  116

Query  123  IWRTDGIILTALIHTGPVEFLYYWLHRALHHHIL  22
            +WR+ G I+TAL H GPVEF+YYW HRALHHH L
Sbjct  117  LWRSGGFIVTALAHIGPVEFIYYWFHRALHHHFL  150



>ref|XP_010052726.1| PREDICTED: protein ECERIFERUM 1-like [Eucalyptus grandis]
Length=620

 Score =   210 bits (534),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 100/154 (65%), Positives = 127/154 (82%), Gaps = 0/154 (0%)
 Frame = -3

Query  483  MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpfllIRMLH  304
            MAS+PGILT+WPW  LGSFKY++LAP++AH TY+++   P ERD +  LI PFLL R++H
Sbjct  1    MASKPGILTDWPWKPLGSFKYMILAPWMAHGTYQFIAKGPGERDFSYFLILPFLLERIIH  60

Query  303  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  124
            NQ+WISLSR+RTAKG+NRI+D+GIEFEQVDRE NWDDQI+L G+L Y   + +P   H+P
Sbjct  61   NQIWISLSRHRTAKGNNRILDRGIEFEQVDRESNWDDQILLTGILLYMTNWTIPQASHLP  120

Query  123  IWRTDGIILTALIHTGPVEFLYYWLHRALHHHIL  22
            +W+TDG+I+T LIH   VE+LYYWLHRALHHH L
Sbjct  121  LWKTDGVIITVLIHALVVEYLYYWLHRALHHHFL  154



>gb|AAB87721.1| maize gl1 homolog [Arabidopsis thaliana]
Length=625

 Score =   210 bits (535),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 101/154 (66%), Positives = 125/154 (81%), Gaps = 0/154 (0%)
 Frame = -3

Query  483  MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpfllIRMLH  304
            MA++PG+LT+WPWT LGSFKY+V+AP+  HSTY+++TD P +RD    L+FPFLL R+LH
Sbjct  1    MATKPGVLTDWPWTPLGSFKYIVIAPWAVHSTYRFVTDDPEKRDLGYFLVFPFLLFRILH  60

Query  303  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  124
            NQ+WISLSRY T+ G  RIVDKGI+F QVDRE NWDDQI+ NG+LFY G   L     +P
Sbjct  61   NQVWISLSRYYTSSGKRRIVDKGIDFNQVDRETNWDDQILFNGVLFYIGINLLAEGKQLP  120

Query  123  IWRTDGIILTALIHTGPVEFLYYWLHRALHHHIL  22
             WRTDG+++ ALIHTGPVEFLYYW+H+ALHHH L
Sbjct  121  WWRTDGVLMGALIHTGPVEFLYYWVHKALHHHFL  154



>emb|CDP09364.1| unnamed protein product [Coffea canephora]
Length=616

 Score =   210 bits (534),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 108/154 (70%), Positives = 124/154 (81%), Gaps = 0/154 (0%)
 Frame = -3

Query  483  MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpfllIRMLH  304
            MA+ PG+LT+WPWT LG FKYVVLAP+VAHS Y   T   +ERD   LLI PFLL RMLH
Sbjct  1    MATTPGLLTDWPWTPLGRFKYVVLAPWVAHSIYSNATKGESERDLTNLLILPFLLWRMLH  60

Query  303  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  124
            +Q+WIS+SR+RTA G NRIVDK IEFEQVDRE NWDDQIILNG+LFY     L     +P
Sbjct  61   DQIWISISRHRTANGKNRIVDKTIEFEQVDRESNWDDQIILNGILFYIFNNLLSNASRLP  120

Query  123  IWRTDGIILTALIHTGPVEFLYYWLHRALHHHIL  22
            +WRTDG+ILT+L+H+GPVEFLYYWLHRALHHH L
Sbjct  121  LWRTDGVILTSLLHSGPVEFLYYWLHRALHHHFL  154



>ref|XP_009758897.1| PREDICTED: uncharacterized protein LOC104211529 [Nicotiana sylvestris]
Length=1039

 Score =   213 bits (543),  Expect = 1e-60, Method: Composition-based stats.
 Identities = 99/162 (61%), Positives = 124/162 (77%), Gaps = 1/162 (1%)
 Frame = -3

Query  504  KSIVLPKMASRPGILTEWPWTWLGSFKYVVLAPFVAHSTY-KYLTDSPNERDPNillifp  328
            K  +   MAS+PGI+T+WPWT+LG+FKY+VLAPFV HS Y  +++      D   ++I P
Sbjct  788  KKKLYKSMASKPGIITDWPWTFLGNFKYLVLAPFVGHSIYTNFMSKDERHGDIVYIIILP  847

Query  327  fllIRMLHNQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYK  148
             LL  ++HNQ+WISLSRYRTAK +NRIVDK IEF+QVDRE NWDDQI+ N L++Y GY  
Sbjct  848  LLLSIVIHNQIWISLSRYRTAKDNNRIVDKSIEFDQVDRESNWDDQILFNRLIYYIGYLL  907

Query  147  LPITHHMPIWRTDGIILTALIHTGPVEFLYYWLHRALHHHIL  22
            L   HH+P+WRTDGI++ AL+H G VEFLYYWLHRALHHH  
Sbjct  908  LEQAHHLPLWRTDGIVMIALLHIGFVEFLYYWLHRALHHHFF  949



>ref|XP_007134355.1| hypothetical protein PHAVU_010G040600g [Phaseolus vulgaris]
 gb|ESW06349.1| hypothetical protein PHAVU_010G040600g [Phaseolus vulgaris]
Length=625

 Score =   209 bits (533),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 98/154 (64%), Positives = 125/154 (81%), Gaps = 0/154 (0%)
 Frame = -3

Query  483  MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpfllIRMLH  304
            MAS+PGILT WPW  LGSFK+V+L P++ HSTY ++ + P +R+    LIFP++L+RMLH
Sbjct  1    MASKPGILTHWPWEPLGSFKWVILTPWIVHSTYSFIVNDPKDRELAYFLIFPYMLVRMLH  60

Query  303  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  124
            +Q+WI+LSR+R AKG +RIVDKGIEFEQVDRE NWDDQI+ NG+LFY G+  +P    MP
Sbjct  61   DQIWITLSRHRNAKGKSRIVDKGIEFEQVDRESNWDDQILFNGILFYAGHMLIPEASKMP  120

Query  123  IWRTDGIILTALIHTGPVEFLYYWLHRALHHHIL  22
             WR DG+++TA++H G VEFLYYWLHRALHHH L
Sbjct  121  FWRMDGVVITAVLHAGAVEFLYYWLHRALHHHFL  154



>gb|ABD28319.2| Sterol desaturase [Medicago truncatula]
Length=493

 Score =   207 bits (526),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 100/154 (65%), Positives = 127/154 (82%), Gaps = 3/154 (2%)
 Frame = -3

Query  483  MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpfllIRMLH  304
            MAS+PGILT+WPW  LGSFK+++L+P++AHS Y ++     ERDP   +IFPF+LIRMLH
Sbjct  10   MASKPGILTDWPWKPLGSFKFMILSPWIAHSMYSFIW---GERDPVYHVIFPFMLIRMLH  66

Query  303  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  124
            NQ+WIS+SRY+TAKG ++IVDKG+EFEQVDRE NWDDQI+   L++Y GY   P+  ++P
Sbjct  67   NQIWISISRYQTAKGKSKIVDKGLEFEQVDRETNWDDQILFTALVYYIGYMIFPMASNLP  126

Query  123  IWRTDGIILTALIHTGPVEFLYYWLHRALHHHIL  22
             WR DG+ILTA++H GPVEFLYYWLHRALHHH L
Sbjct  127  WWRIDGVILTAILHAGPVEFLYYWLHRALHHHYL  160



>ref|XP_004170720.1| PREDICTED: protein ECERIFERUM 1-like, partial [Cucumis sativus]
Length=507

 Score =   207 bits (527),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 101/154 (66%), Positives = 124/154 (81%), Gaps = 0/154 (0%)
 Frame = -3

Query  483  MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpfllIRMLH  304
            MAS PGILT+WPWT LG+FKYVVLAP   +S Y+Y+     ERD + L+I P LL RM+H
Sbjct  1    MASTPGILTDWPWTPLGTFKYVVLAPGFIYSIYQYIVKDEAERDTSSLVIIPLLLWRMIH  60

Query  303  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  124
            NQ+WIS+SR+RTAKG+ RIVDKG+EF+QVDRERNWDDQI+LNG+LFY          ++P
Sbjct  61   NQIWISISRHRTAKGNARIVDKGLEFDQVDRERNWDDQILLNGVLFYLVSNLTAKGRNLP  120

Query  123  IWRTDGIILTALIHTGPVEFLYYWLHRALHHHIL  22
            +WRTDG+++T L+H GPVEFLYYWLHRALHHH L
Sbjct  121  LWRTDGVVITFLLHAGPVEFLYYWLHRALHHHYL  154



>ref|XP_011093466.1| PREDICTED: protein ECERIFERUM 1-like [Sesamum indicum]
Length=620

 Score =   209 bits (532),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 105/154 (68%), Positives = 117/154 (76%), Gaps = 0/154 (0%)
 Frame = -3

Query  483  MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpfllIRMLH  304
            MASRPGILTEWPWTWLG+FKYVVLAP+V H+TY Y     +ERD    LI P LL RMLH
Sbjct  1    MASRPGILTEWPWTWLGNFKYVVLAPWVVHATYSYTMKEEDERDVAYFLILPLLLSRMLH  60

Query  303  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  124
            NQ+WISLSRY+TAKG+NRIVDK IEFEQV      DDQIILNG+LFY G   +   H +P
Sbjct  61   NQIWISLSRYQTAKGNNRIVDKSIEFEQVXXXXXXDDQIILNGILFYLGSRHMQAAHRLP  120

Query  123  IWRTDGIILTALIHTGPVEFLYYWLHRALHHHIL  22
             WR DG+I T L H GPVEF+YYW HRALHHH L
Sbjct  121  WWRADGVIWTFLFHAGPVEFIYYWFHRALHHHFL  154



>ref|XP_008232261.1| PREDICTED: protein ECERIFERUM 1-like [Prunus mume]
Length=623

 Score =   209 bits (532),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 99/154 (64%), Positives = 126/154 (82%), Gaps = 0/154 (0%)
 Frame = -3

Query  483  MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpfllIRMLH  304
            MAS PGILT+WPWT LG+FK+V+LAP++ H  Y ++ +   E+D +  LIFPF+L RM+H
Sbjct  1    MASTPGILTDWPWTPLGNFKHVILAPWIIHGAYSFVVNDGKEKDLSYFLIFPFMLWRMIH  60

Query  303  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  124
            NQ+WI+LSRY+TAKG+ RIVDK +EFEQVDRERNWDDQI+ NG+LFY G   +P    +P
Sbjct  61   NQIWITLSRYQTAKGNGRIVDKPLEFEQVDRERNWDDQIVFNGILFYLGSRHMPGAQQLP  120

Query  123  IWRTDGIILTALIHTGPVEFLYYWLHRALHHHIL  22
            +WRTDG++LT L+H GPVE+LYYWLHRALHHH L
Sbjct  121  LWRTDGVLLTILLHAGPVEYLYYWLHRALHHHFL  154



>ref|XP_003574039.1| PREDICTED: protein ECERIFERUM 1-like [Brachypodium distachyon]
Length=619

 Score =   208 bits (530),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 100/161 (62%), Positives = 122/161 (76%), Gaps = 0/161 (0%)
 Frame = -3

Query  483  MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpfllIRMLH  304
            MA+ PG L+EWPW  LGSFKY+VLAP+VAH  ++  T    E D   + I P +L+R LH
Sbjct  1    MATNPGFLSEWPWKRLGSFKYLVLAPWVAHGFHQLATKGWRETDLGYIAILPSMLLRALH  60

Query  303  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  124
            NQ WI++SR + A+G  +IVD+GIEFEQVDRERNWDDQIIL+ +LFY G   LP   H+P
Sbjct  61   NQAWITVSRLQNARGRKQIVDRGIEFEQVDRERNWDDQIILSAILFYLGALHLPGGQHLP  120

Query  123  IWRTDGIILTALIHTGPVEFLYYWLHRALHHHILYSRYHSH  1
            +WRTDG +L AL+H GPVE LYYW HRALHHH LY+RYHSH
Sbjct  121  LWRTDGAVLVALLHAGPVELLYYWFHRALHHHFLYTRYHSH  161



>ref|XP_010097746.1| Protein WAX2 [Morus notabilis]
 gb|EXB70701.1| Protein WAX2 [Morus notabilis]
Length=618

 Score =   208 bits (529),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 102/155 (66%), Positives = 127/155 (82%), Gaps = 1/155 (1%)
 Frame = -3

Query  483  MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLT-DSPNERDPNillifpfllIRML  307
            MA+ PGILT+WPW  LGSFKYV+LAP+V + T+ +LT D P +RD +  LIFP +L RM+
Sbjct  1    MATTPGILTDWPWKHLGSFKYVILAPWVINGTHSFLTKDDPQDRDLSYFLIFPLMLWRMI  60

Query  306  HNQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHM  127
            HNQ+WISLSRYRTAKG+NRI+DKG+EF+QVDRERNWDDQI+ N ++FY G   LP   ++
Sbjct  61   HNQIWISLSRYRTAKGNNRILDKGLEFDQVDRERNWDDQILFNAIIFYLGSQLLPGGSNL  120

Query  126  PIWRTDGIILTALIHTGPVEFLYYWLHRALHHHIL  22
            P+W+TDG+ILT L+H   VEFLYYWLHRALHHH L
Sbjct  121  PMWKTDGVILTILLHASVVEFLYYWLHRALHHHFL  155



>ref|XP_010247895.1| PREDICTED: protein ECERIFERUM 1-like [Nelumbo nucifera]
Length=623

 Score =   207 bits (528),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 101/161 (63%), Positives = 125/161 (78%), Gaps = 0/161 (0%)
 Frame = -3

Query  483  MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpfllIRMLH  304
            MA  PG LT++PW  LG+FKYVVLAP++ HSTY+++T    ERD    L+ P+LL R++H
Sbjct  1    MALSPGPLTKYPWEKLGNFKYVVLAPWIVHSTYQFVTKDEKERDLAYFLMLPYLLSRVIH  60

Query  303  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  124
             Q+WISL+RY TAK  +RIVDKGIEFEQVDRERNWDD II NG+++Y     LP    MP
Sbjct  61   AQIWISLARYMTAKSKHRIVDKGIEFEQVDRERNWDDNIIFNGIIYYLAITLLPGASRMP  120

Query  123  IWRTDGIILTALIHTGPVEFLYYWLHRALHHHILYSRYHSH  1
            ++R DGI++ AL+H GPVEFLYYW HRALHHHILY+ YHSH
Sbjct  121  MFRWDGILIAALVHVGPVEFLYYWFHRALHHHILYTGYHSH  161



>ref|XP_008438252.1| PREDICTED: protein ECERIFERUM 1-like [Cucumis melo]
Length=635

 Score =   207 bits (528),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 103/154 (67%), Positives = 125/154 (81%), Gaps = 0/154 (0%)
 Frame = -3

Query  483  MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpfllIRMLH  304
            MAS PGILT+WPW  LGSFKYV+LAP+V HS Y+Y+     ERD + L+IFPFLL R++H
Sbjct  1    MASTPGILTDWPWKTLGSFKYVILAPWVVHSIYQYVVKDETERDVSSLVIFPFLLWRIIH  60

Query  303  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  124
            NQ+WIS+SRYRTAKG+ RI+DKGIEF+QVDRE NWDDQI+LNGLL Y   Y +     +P
Sbjct  61   NQIWISVSRYRTAKGNARILDKGIEFDQVDREGNWDDQILLNGLLLYIVSYVMEEASKLP  120

Query  123  IWRTDGIILTALIHTGPVEFLYYWLHRALHHHIL  22
            +WRTDG+++  L+H GPVEFLYYWLHRALHHH L
Sbjct  121  LWRTDGMVIIFLLHIGPVEFLYYWLHRALHHHYL  154



>ref|XP_009118866.1| PREDICTED: protein ECERIFERUM 1 [Brassica rapa]
Length=644

 Score =   207 bits (528),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 99/154 (64%), Positives = 123/154 (80%), Gaps = 2/154 (1%)
 Frame = -3

Query  483  MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpfllIRMLH  304
            MA++PGILT+WPWT LG+FKY+V+AP+  HSTY+++TD P   D    L+ PFLL R+LH
Sbjct  17   MATKPGILTDWPWTPLGNFKYIVIAPWAVHSTYRFVTDDP--VDLGYSLVLPFLLFRILH  74

Query  303  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  124
            NQ+WISLSRY T KG  RI+DKGI+F QVDRE NWDDQI+ NGLLFY G   LP    +P
Sbjct  75   NQVWISLSRYYTTKGKRRILDKGIDFNQVDRETNWDDQILFNGLLFYIGIMLLPQAKQLP  134

Query  123  IWRTDGIILTALIHTGPVEFLYYWLHRALHHHIL  22
            +WRTDG+++ A++H GPVEFLYYWLH+ALHHH L
Sbjct  135  LWRTDGVLMAAMLHAGPVEFLYYWLHKALHHHFL  168



>gb|AAD29719.1|AF143746_1 CER1 [Oryza sativa Indica Group]
Length=621

 Score =   207 bits (527),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 101/161 (63%), Positives = 122/161 (76%), Gaps = 0/161 (0%)
 Frame = -3

Query  483  MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpfllIRMLH  304
            MA+ PG+ TEWPW  LGSFKYV+LAP+VAH  Y+  T    E D   + I P LL+RMLH
Sbjct  1    MATNPGLFTEWPWKKLGSFKYVLLAPWVAHGWYEVATKGRREVDLGYIAILPSLLLRMLH  60

Query  303  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  124
            NQ WI++SR + A+G  +IV +GIEF+QVDRERNWDDQIIL+G+L Y G   +P   H+P
Sbjct  61   NQAWITISRLQNARGRRQIVRRGIEFDQVDRERNWDDQIILSGILLYLGALYVPGGQHLP  120

Query  123  IWRTDGIILTALIHTGPVEFLYYWLHRALHHHILYSRYHSH  1
            +WRTDG  L AL+H GPVEFLYYW HRALHHH LY+RYHSH
Sbjct  121  LWRTDGAGLIALLHAGPVEFLYYWFHRALHHHFLYTRYHSH  161



>ref|XP_006583526.1| PREDICTED: protein ECERIFERUM 1-like isoform X2 [Glycine max]
Length=522

 Score =   205 bits (522),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 103/154 (67%), Positives = 119/154 (77%), Gaps = 0/154 (0%)
 Frame = -3

Query  483  MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpfllIRMLH  304
            MAS+PGILT+WPW  LGSFKYV+LAP V HS Y  L    +ERD    LI PFLL RMLH
Sbjct  1    MASKPGILTDWPWKPLGSFKYVILAPSVVHSLYSMLAKDKSERDITNFLILPFLLWRMLH  60

Query  303  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  124
            NQ+WI+LSR+RTAKG+ RIVDKGIEF+QVDRERNWDDQI+L GL +Y   Y       +P
Sbjct  61   NQIWITLSRHRTAKGNGRIVDKGIEFDQVDRERNWDDQILLTGLTYYLSNYIFAGASRIP  120

Query  123  IWRTDGIILTALIHTGPVEFLYYWLHRALHHHIL  22
            +WRTD  ++T L+H GPVEFLYYWLHRALHHH L
Sbjct  121  LWRTDAAVVTILLHMGPVEFLYYWLHRALHHHFL  154



>gb|KHN40121.1| Protein WAX2 [Glycine soja]
Length=624

 Score =   207 bits (526),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 99/154 (64%), Positives = 121/154 (79%), Gaps = 0/154 (0%)
 Frame = -3

Query  483  MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpfllIRMLH  304
            MASRPGIL++WPW  LGSFKY++LAP + HS+Y  +    +E+D    LI PFLL RMLH
Sbjct  1    MASRPGILSDWPWKPLGSFKYMLLAPCIVHSSYSMMVKDNSEKDMFNFLILPFLLWRMLH  60

Query  303  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  124
            NQ+WI+ SRYRTAKG+ RIVDKGIEF+QVDRERNWDDQI+ +GL+FY   Y      H+P
Sbjct  61   NQIWITFSRYRTAKGNARIVDKGIEFDQVDRERNWDDQILFSGLIFYLANYVFAGASHIP  120

Query  123  IWRTDGIILTALIHTGPVEFLYYWLHRALHHHIL  22
            +W+TDG ++  L+H GPVEFLYYWLHRALHHH L
Sbjct  121  LWKTDGAVMAILLHMGPVEFLYYWLHRALHHHFL  154



>gb|EEC67150.1| hypothetical protein OsI_33995 [Oryza sativa Indica Group]
Length=621

 Score =   206 bits (525),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 101/161 (63%), Positives = 122/161 (76%), Gaps = 0/161 (0%)
 Frame = -3

Query  483  MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpfllIRMLH  304
            MA+ PG+ TEWPW  LGSFKYV+LAP+VAH  Y+  T    E D   + I P LL+RMLH
Sbjct  1    MATNPGLFTEWPWKKLGSFKYVLLAPWVAHGWYEVATKGRREVDLGYIAILPSLLLRMLH  60

Query  303  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  124
            NQ WI++SR + A+G  +IV +GIEF+QVDRERNWDDQIIL+G+L Y G   +P   H+P
Sbjct  61   NQAWITISRLQNARGRRQIVRRGIEFDQVDRERNWDDQIILSGILLYLGALYVPGGQHLP  120

Query  123  IWRTDGIILTALIHTGPVEFLYYWLHRALHHHILYSRYHSH  1
            +WRTDG  L AL+H GPVEFLYYW HRALHHH LY+RYHSH
Sbjct  121  LWRTDGAGLIALLHAGPVEFLYYWFHRALHHHFLYTRYHSH  161



>ref|XP_009337264.1| PREDICTED: protein ECERIFERUM 1-like isoform X2 [Pyrus x bretschneideri]
Length=616

 Score =   206 bits (525),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 104/154 (68%), Positives = 124/154 (81%), Gaps = 1/154 (1%)
 Frame = -3

Query  483  MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpfllIRMLH  304
            MA+ PGILT+WPWT LGSFK+VV+AP++ H  Y Y  +   ++D +  LIFPF+L R LH
Sbjct  1    MATTPGILTDWPWTPLGSFKHVVVAPWIIHGAYSYFVNDEKDKDLSYFLIFPFMLWRFLH  60

Query  303  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  124
            NQLWISLSRYRTAKG+ RIVDKG+EFEQVDRERNWDDQI+ N +LFY G + LP   ++P
Sbjct  61   NQLWISLSRYRTAKGNGRIVDKGLEFEQVDRERNWDDQILFNAILFYLGRH-LPGAVNLP  119

Query  123  IWRTDGIILTALIHTGPVEFLYYWLHRALHHHIL  22
             WRTDG+ILT L+H GPVEFLYYWL RALHHH L
Sbjct  120  FWRTDGVILTILLHAGPVEFLYYWLPRALHHHFL  153



>ref|XP_010691966.1| PREDICTED: protein ECERIFERUM 1-like [Beta vulgaris subsp. vulgaris]
Length=619

 Score =   206 bits (525),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 101/154 (66%), Positives = 120/154 (78%), Gaps = 1/154 (1%)
 Frame = -3

Query  483  MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpfllIRMLH  304
            MAS+PGILT WPW  LGSFKYV++APF+ HS Y Y+  +  ERD   + + PF+L RMLH
Sbjct  1    MASKPGILTHWPWEPLGSFKYVIVAPFLVHSIYLYVVGA-EERDLTYIAVVPFMLWRMLH  59

Query  303  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  124
            NQ+WIS SRYRTAKG+N IVD+ +EFEQVDRERNWDDQI+LNG+LFY GY+ L     +P
Sbjct  60   NQIWISFSRYRTAKGNNLIVDRSLEFEQVDRERNWDDQILLNGMLFYAGYWVLEAAKSLP  119

Query  123  IWRTDGIILTALIHTGPVEFLYYWLHRALHHHIL  22
            +WR DG I   L+H GPVEFLYYW HRALHHH L
Sbjct  120  LWRFDGFIQIFLLHMGPVEFLYYWFHRALHHHYL  153



>ref|XP_004133955.1| PREDICTED: protein ECERIFERUM 1-like [Cucumis sativus]
 gb|KGN56665.1| hypothetical protein Csa_3G127760 [Cucumis sativus]
Length=624

 Score =   206 bits (525),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 101/154 (66%), Positives = 124/154 (81%), Gaps = 0/154 (0%)
 Frame = -3

Query  483  MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpfllIRMLH  304
            MAS PGILT+WPWT LG+FKYVVLAP   +S Y+Y+     ERD + L+I P LL RM+H
Sbjct  1    MASTPGILTDWPWTPLGTFKYVVLAPGFIYSIYQYIVKDEAERDTSSLVIIPLLLWRMIH  60

Query  303  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  124
            NQ+WIS+SR+RTAKG+ RIVDKG+EF+QVDRERNWDDQI+LNG+LFY          ++P
Sbjct  61   NQIWISISRHRTAKGNARIVDKGLEFDQVDRERNWDDQILLNGVLFYLVSNLTAKGRNLP  120

Query  123  IWRTDGIILTALIHTGPVEFLYYWLHRALHHHIL  22
            +WRTDG+++T L+H GPVEFLYYWLHRALHHH L
Sbjct  121  LWRTDGVVITFLLHAGPVEFLYYWLHRALHHHYL  154



>ref|XP_009337263.1| PREDICTED: protein ECERIFERUM 1-like isoform X1 [Pyrus x bretschneideri]
Length=622

 Score =   206 bits (525),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 104/154 (68%), Positives = 124/154 (81%), Gaps = 1/154 (1%)
 Frame = -3

Query  483  MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpfllIRMLH  304
            MA+ PGILT+WPWT LGSFK+VV+AP++ H  Y Y  +   ++D +  LIFPF+L R LH
Sbjct  1    MATTPGILTDWPWTPLGSFKHVVVAPWIIHGAYSYFVNDEKDKDLSYFLIFPFMLWRFLH  60

Query  303  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  124
            NQLWISLSRYRTAKG+ RIVDKG+EFEQVDRERNWDDQI+ N +LFY G + LP   ++P
Sbjct  61   NQLWISLSRYRTAKGNGRIVDKGLEFEQVDRERNWDDQILFNAILFYLGRH-LPGAVNLP  119

Query  123  IWRTDGIILTALIHTGPVEFLYYWLHRALHHHIL  22
             WRTDG+ILT L+H GPVEFLYYWL RALHHH L
Sbjct  120  FWRTDGVILTILLHAGPVEFLYYWLPRALHHHFL  153



>ref|XP_003530144.1| PREDICTED: protein ECERIFERUM 1-like isoform X1 [Glycine max]
Length=625

 Score =   206 bits (525),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 103/154 (67%), Positives = 119/154 (77%), Gaps = 0/154 (0%)
 Frame = -3

Query  483  MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpfllIRMLH  304
            MAS+PGILT+WPW  LGSFKYV+LAP V HS Y  L    +ERD    LI PFLL RMLH
Sbjct  1    MASKPGILTDWPWKPLGSFKYVILAPSVVHSLYSMLAKDKSERDITNFLILPFLLWRMLH  60

Query  303  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  124
            NQ+WI+LSR+RTAKG+ RIVDKGIEF+QVDRERNWDDQI+L GL +Y   Y       +P
Sbjct  61   NQIWITLSRHRTAKGNGRIVDKGIEFDQVDRERNWDDQILLTGLTYYLSNYIFAGASRIP  120

Query  123  IWRTDGIILTALIHTGPVEFLYYWLHRALHHHIL  22
            +WRTD  ++T L+H GPVEFLYYWLHRALHHH L
Sbjct  121  LWRTDAAVVTILLHMGPVEFLYYWLHRALHHHFL  154



>ref|XP_003625020.1| Protein WAX2 [Medicago truncatula]
 gb|AES81238.1| fatty acid hydroxylase superfamily protein [Medicago truncatula]
Length=615

 Score =   206 bits (524),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 100/154 (65%), Positives = 127/154 (82%), Gaps = 3/154 (2%)
 Frame = -3

Query  483  MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpfllIRMLH  304
            MAS+PGILT+WPW  LGSFK+++L+P++AHS Y ++     ERDP   +IFPF+LIRMLH
Sbjct  1    MASKPGILTDWPWKPLGSFKFMILSPWIAHSMYSFIW---GERDPVYHVIFPFMLIRMLH  57

Query  303  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  124
            NQ+WIS+SRY+TAKG ++IVDKG+EFEQVDRE NWDDQI+   L++Y GY   P+  ++P
Sbjct  58   NQIWISISRYQTAKGKSKIVDKGLEFEQVDRETNWDDQILFTALVYYIGYMIFPMASNLP  117

Query  123  IWRTDGIILTALIHTGPVEFLYYWLHRALHHHIL  22
             WR DG+ILTA++H GPVEFLYYWLHRALHHH L
Sbjct  118  WWRIDGVILTAILHAGPVEFLYYWLHRALHHHYL  151



>ref|XP_007218863.1| hypothetical protein PRUPE_ppa002893mg [Prunus persica]
 gb|EMJ20062.1| hypothetical protein PRUPE_ppa002893mg [Prunus persica]
Length=623

 Score =   206 bits (525),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 98/154 (64%), Positives = 126/154 (82%), Gaps = 0/154 (0%)
 Frame = -3

Query  483  MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpfllIRMLH  304
            MAS PGILT+WPWT LG+FK+V+LAP++ H  Y ++ +   E+D +  LIFPF+L RM+H
Sbjct  1    MASTPGILTDWPWTPLGNFKHVILAPWIIHGAYSFVVNDGKEKDLSYFLIFPFMLWRMIH  60

Query  303  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  124
            NQ+WI+LSRY+TAKG+ RIVDK +EFEQVDRERNWDDQI+ NG+LF  G   +P   ++P
Sbjct  61   NQIWITLSRYQTAKGNGRIVDKPLEFEQVDRERNWDDQIVFNGILFCLGSRHMPGAQNLP  120

Query  123  IWRTDGIILTALIHTGPVEFLYYWLHRALHHHIL  22
            +WRTDG++LT L+H GPVE+LYYWLHRALHHH L
Sbjct  121  LWRTDGVLLTILLHAGPVEYLYYWLHRALHHHFL  154



>gb|KGN56664.1| hypothetical protein Csa_3G127750 [Cucumis sativus]
Length=634

 Score =   206 bits (525),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 104/154 (68%), Positives = 124/154 (81%), Gaps = 0/154 (0%)
 Frame = -3

Query  483  MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpfllIRMLH  304
            MAS PGILT+WPW  LGSFKYV+LAP+V HS Y+Y+     ERD + L+IFPFLL R++H
Sbjct  1    MASTPGILTDWPWKPLGSFKYVILAPWVVHSIYQYVVKDETERDVSCLVIFPFLLWRIIH  60

Query  303  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  124
            NQ+WISLSRYRTAKG+ RI+DKGIEF+QVDRE NWDDQI+L GLL Y   Y +     +P
Sbjct  61   NQIWISLSRYRTAKGNARILDKGIEFDQVDREGNWDDQILLTGLLLYVVSYVMEEASKLP  120

Query  123  IWRTDGIILTALIHTGPVEFLYYWLHRALHHHIL  22
            +WRTDG+I+  L+H GPVEFLYYWLHRALHHH L
Sbjct  121  LWRTDGMIIIFLLHIGPVEFLYYWLHRALHHHYL  154



>ref|XP_008438263.1| PREDICTED: protein ECERIFERUM 1-like isoform X2 [Cucumis melo]
Length=620

 Score =   206 bits (524),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 103/154 (67%), Positives = 121/154 (79%), Gaps = 0/154 (0%)
 Frame = -3

Query  483  MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpfllIRMLH  304
            MAS PGILT+WPW  LGSFKY+VLAP V HS Y Y+     ERD + L IFPFLL RM+H
Sbjct  1    MASTPGILTDWPWKPLGSFKYLVLAPGVIHSLYHYIAKDETERDISYLFIFPFLLWRMIH  60

Query  303  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  124
            +Q+WIS SRYRTAKG  RIVDKG+EFEQVDRERNWDDQI+LNG+LFY     +    ++P
Sbjct  61   SQIWISFSRYRTAKGTARIVDKGVEFEQVDRERNWDDQILLNGVLFYIASNCIEKASNLP  120

Query  123  IWRTDGIILTALIHTGPVEFLYYWLHRALHHHIL  22
            +WRTDG+++  L+H GPVEFLYYW HRALHHH L
Sbjct  121  LWRTDGVVMVFLLHAGPVEFLYYWFHRALHHHYL  154



>ref|XP_008438262.1| PREDICTED: protein ECERIFERUM 1-like isoform X1 [Cucumis melo]
Length=621

 Score =   206 bits (524),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 103/154 (67%), Positives = 121/154 (79%), Gaps = 0/154 (0%)
 Frame = -3

Query  483  MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpfllIRMLH  304
            MAS PGILT+WPW  LGSFKY+VLAP V HS Y Y+     ERD + L IFPFLL RM+H
Sbjct  1    MASTPGILTDWPWKPLGSFKYLVLAPGVIHSLYHYIAKDETERDISYLFIFPFLLWRMIH  60

Query  303  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  124
            +Q+WIS SRYRTAKG  RIVDKG+EFEQVDRERNWDDQI+LNG+LFY     +    ++P
Sbjct  61   SQIWISFSRYRTAKGTARIVDKGVEFEQVDRERNWDDQILLNGVLFYIASNCIEKASNLP  120

Query  123  IWRTDGIILTALIHTGPVEFLYYWLHRALHHHIL  22
            +WRTDG+++  L+H GPVEFLYYW HRALHHH L
Sbjct  121  LWRTDGVVMVFLLHAGPVEFLYYWFHRALHHHYL  154



>ref|XP_008438253.1| PREDICTED: protein ECERIFERUM 1-like [Cucumis melo]
Length=624

 Score =   206 bits (524),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 100/154 (65%), Positives = 124/154 (81%), Gaps = 0/154 (0%)
 Frame = -3

Query  483  MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpfllIRMLH  304
            MAS PGILT+WPWT LG+FKYVVLAP   +S Y+Y+     ERD + L++ P LL RM+H
Sbjct  1    MASTPGILTDWPWTPLGTFKYVVLAPGFIYSIYQYIVRDEAERDTSSLVVIPLLLWRMIH  60

Query  303  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  124
            NQ+WIS+SR+RTAKG+ RIVDKG+EF+QVDRERNWDDQI+LNG+LFY          ++P
Sbjct  61   NQIWISISRHRTAKGNARIVDKGLEFDQVDRERNWDDQILLNGVLFYLVANLTAKGRNLP  120

Query  123  IWRTDGIILTALIHTGPVEFLYYWLHRALHHHIL  22
            +WRTDG+++T L+H GPVEFLYYWLHRALHHH L
Sbjct  121  LWRTDGVVITFLLHAGPVEFLYYWLHRALHHHYL  154



>gb|AHD24918.1| CER1 [Brassica napus]
Length=628

 Score =   206 bits (524),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 100/154 (65%), Positives = 122/154 (79%), Gaps = 2/154 (1%)
 Frame = -3

Query  483  MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpfllIRMLH  304
            MA++PGILT+WPWT LG+FKY+V+AP+  HSTYK++TD P   D    L+ PFLL R+LH
Sbjct  1    MATKPGILTDWPWTPLGNFKYIVIAPWAVHSTYKFVTDDP--VDLGYSLVLPFLLFRILH  58

Query  303  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  124
            NQ+WISLSRY T KG  RI+DKGI+F QVDRE NWDDQI+ NGLLFY G   LP    +P
Sbjct  59   NQVWISLSRYYTTKGKRRILDKGIDFNQVDRETNWDDQILFNGLLFYIGIMLLPQAKQLP  118

Query  123  IWRTDGIILTALIHTGPVEFLYYWLHRALHHHIL  22
             WRTDG+++ A++H GPVEFLYYWLH+ALHHH L
Sbjct  119  WWRTDGVLMAAMLHAGPVEFLYYWLHKALHHHFL  152



>ref|XP_007220536.1| hypothetical protein PRUPE_ppa002824mg [Prunus persica]
 gb|EMJ21735.1| hypothetical protein PRUPE_ppa002824mg [Prunus persica]
Length=629

 Score =   206 bits (524),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 100/154 (65%), Positives = 120/154 (78%), Gaps = 0/154 (0%)
 Frame = -3

Query  483  MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpfllIRMLH  304
            MAS PGILT+WPWT LGSFK+V+LAP+V HST+  + +   ERD +  LI   +L R+LH
Sbjct  1    MASVPGILTDWPWTALGSFKHVILAPWVIHSTWLLVANDGKERDISYFLILAVVLWRILH  60

Query  303  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  124
            NQ+WISLSRYRTAKG+ RI+DKG+EFEQVDRE NWDDQI+ N LLFY G   LP   H P
Sbjct  61   NQIWISLSRYRTAKGNGRILDKGLEFEQVDRENNWDDQILFNALLFYTGSRYLPGGQHAP  120

Query  123  IWRTDGIILTALIHTGPVEFLYYWLHRALHHHIL  22
             WR +G++LT ++H GPVEFLYYW HRALHHH L
Sbjct  121  FWRAEGLLLTIVLHAGPVEFLYYWFHRALHHHYL  154



>ref|XP_010691968.1| PREDICTED: protein ECERIFERUM 1-like isoform X1 [Beta vulgaris 
subsp. vulgaris]
Length=620

 Score =   206 bits (523),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 104/161 (65%), Positives = 121/161 (75%), Gaps = 1/161 (1%)
 Frame = -3

Query  483  MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpfllIRMLH  304
            MA  PGILT WPW  LG+FKYV++APF  HS Y Y+  S  +RD   L I PF+L RMLH
Sbjct  1    MAFTPGILTHWPWECLGNFKYVIVAPFAIHSIYLYVVGS-EDRDLGYLAIIPFMLWRMLH  59

Query  303  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  124
            NQ+WIS SRYRTAKG+N IVDK +EFEQVDRERNWDDQI+LN + FY     +    ++P
Sbjct  60   NQIWISFSRYRTAKGNNLIVDKSLEFEQVDRERNWDDQILLNVIAFYLANRGMETAKNVP  119

Query  123  IWRTDGIILTALIHTGPVEFLYYWLHRALHHHILYSRYHSH  1
             +R DG+I   L+H GPVEFLYYWLHRALHHH LYSRYHSH
Sbjct  120  FFRMDGLIYAFLLHMGPVEFLYYWLHRALHHHFLYSRYHSH  160



>ref|XP_010539481.1| PREDICTED: protein CER1-like 2 [Tarenaya hassleriana]
Length=707

 Score =   207 bits (526),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 101/155 (65%), Positives = 117/155 (75%), Gaps = 0/155 (0%)
 Frame = -3

Query  486  KMASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpfllIRML  307
            +MASRPGILT+WPW  LGSFKY+V+AP++  S Y Y T S  ERD   LLI   +  RM+
Sbjct  86   EMASRPGILTDWPWKALGSFKYLVVAPWIVESIYSYGTKSEEERDLGNLLIAALMAWRMV  145

Query  306  HNQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHM  127
            H+Q+WISLSR+RTAKG  RIVDK IEF+QVDRER WDDQII N LL Y G   LP +   
Sbjct  146  HSQIWISLSRHRTAKGSRRIVDKPIEFDQVDRERTWDDQIIFNALLMYLGNKFLPGSSRA  205

Query  126  PIWRTDGIILTALIHTGPVEFLYYWLHRALHHHIL  22
            P+WRTDG +L AL+H GPVEFLYYW HRALHHH L
Sbjct  206  PLWRTDGAVLMALLHAGPVEFLYYWFHRALHHHFL  240



>ref|XP_004134362.1| PREDICTED: protein ECERIFERUM 1-like [Cucumis sativus]
Length=634

 Score =   206 bits (524),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 104/154 (68%), Positives = 124/154 (81%), Gaps = 0/154 (0%)
 Frame = -3

Query  483  MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpfllIRMLH  304
            MAS PGILT+WPW  LGSFKYV+LAP+V HS Y+Y+     ERD + L+IFPFLL R++H
Sbjct  1    MASTPGILTDWPWKPLGSFKYVILAPWVVHSIYQYVVKDETERDVSCLVIFPFLLWRIIH  60

Query  303  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  124
            NQ+WISLSRYRTAKG+ RI+DKGIEF+QVDRE NWDDQI+L GLL Y   Y +     +P
Sbjct  61   NQIWISLSRYRTAKGNARILDKGIEFDQVDREGNWDDQILLTGLLLYVVSYVMEEASKLP  120

Query  123  IWRTDGIILTALIHTGPVEFLYYWLHRALHHHIL  22
            +WRTDG+I+  L+H GPVEFLYYWLHRALHHH L
Sbjct  121  LWRTDGMIIIFLLHIGPVEFLYYWLHRALHHHYL  154



>gb|AES88379.2| fatty acid hydroxylase superfamily protein [Medicago truncatula]
Length=600

 Score =   205 bits (521),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 99/154 (64%), Positives = 125/154 (81%), Gaps = 3/154 (2%)
 Frame = -3

Query  483  MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpfllIRMLH  304
            MAS+PGILT WPW  LGSFK+V+L+P++AHS Y ++     E+DP+  +IFP++ +RMLH
Sbjct  1    MASKPGILTNWPWKPLGSFKFVILSPWIAHSIYSFIW---VEQDPSYYIIFPYMFVRMLH  57

Query  303  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  124
            +Q+WIS+SRY+TAKG NRIVDK +EFEQVDRE NWDDQI+L  L FY  Y   P+  ++P
Sbjct  58   SQIWISISRYQTAKGKNRIVDKCLEFEQVDRETNWDDQILLTALTFYILYTIFPMAANLP  117

Query  123  IWRTDGIILTALIHTGPVEFLYYWLHRALHHHIL  22
             WRTDG++LTAL+H GPVEFLYYWLHRALHHH L
Sbjct  118  WWRTDGVVLTALLHAGPVEFLYYWLHRALHHHYL  151



>gb|EYU42308.1| hypothetical protein MIMGU_mgv1a002931mg [Erythranthe guttata]
 gb|EYU42309.1| hypothetical protein MIMGU_mgv1a002931mg [Erythranthe guttata]
Length=624

 Score =   205 bits (522),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 100/154 (65%), Positives = 119/154 (77%), Gaps = 0/154 (0%)
 Frame = -3

Query  483  MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpfllIRMLH  304
            MAS+PGILTEWPWTWLG+FKY+VLAP+   +TY +LT   N +  +  L+ P L+ R +H
Sbjct  1    MASKPGILTEWPWTWLGNFKYLVLAPWAVPATYSFLTKDDNRKYLSSFLVLPLLISRAVH  60

Query  303  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  124
            N +WISLSRYRTAKG+NRIVDK IEFEQVDRERNWDDQIILNG++ Y     +     +P
Sbjct  61   NLIWISLSRYRTAKGNNRIVDKSIEFEQVDRERNWDDQIILNGIIMYTAIMFIKYAQRVP  120

Query  123  IWRTDGIILTALIHTGPVEFLYYWLHRALHHHIL  22
             W TDG+I T L+H GPVEFLYYWLHRALHHH L
Sbjct  121  WWSTDGLIWTFLLHAGPVEFLYYWLHRALHHHFL  154



>ref|XP_007041185.1| Fatty acid hydroxylase superfamily isoform 1 [Theobroma cacao]
 gb|EOX97016.1| Fatty acid hydroxylase superfamily isoform 1 [Theobroma cacao]
Length=612

 Score =   205 bits (521),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 103/156 (66%), Positives = 125/156 (80%), Gaps = 3/156 (2%)
 Frame = -3

Query  483  MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNil--lifpfllIRM  310
            MA++PG+LT+WPW  LG+FKY +L P+V HSTY  L  S  E++ N+   LIFPFL+ R+
Sbjct  1    MATKPGVLTDWPWKHLGNFKYAILTPWVIHSTYSLLM-SKGEKEANLTYHLIFPFLMTRV  59

Query  309  LHNQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHH  130
            LHNQ+WIS+SRYRTAKG NRIVDKGI+FEQVDRE NWDDQIILNG+L Y     +P   H
Sbjct  60   LHNQIWISVSRYRTAKGKNRIVDKGIDFEQVDRESNWDDQIILNGILLYLTNMIMPGASH  119

Query  129  MPIWRTDGIILTALIHTGPVEFLYYWLHRALHHHIL  22
            +P+WR+DG I+  L+HTGPVEFLYYWLHRALHHH L
Sbjct  120  LPLWRSDGFIIVILLHTGPVEFLYYWLHRALHHHFL  155



>ref|XP_007041186.1| Fatty acid hydroxylase superfamily isoform 2 [Theobroma cacao]
 gb|EOX97017.1| Fatty acid hydroxylase superfamily isoform 2 [Theobroma cacao]
Length=620

 Score =   205 bits (521),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 103/156 (66%), Positives = 125/156 (80%), Gaps = 3/156 (2%)
 Frame = -3

Query  483  MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNil--lifpfllIRM  310
            MA++PG+LT+WPW  LG+FKY +L P+V HSTY  L  S  E++ N+   LIFPFL+ R+
Sbjct  1    MATKPGVLTDWPWKHLGNFKYAILTPWVIHSTYSLLM-SKGEKEANLTYHLIFPFLMTRV  59

Query  309  LHNQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHH  130
            LHNQ+WIS+SRYRTAKG NRIVDKGI+FEQVDRE NWDDQIILNG+L Y     +P   H
Sbjct  60   LHNQIWISVSRYRTAKGKNRIVDKGIDFEQVDRESNWDDQIILNGILLYLTNMIMPGASH  119

Query  129  MPIWRTDGIILTALIHTGPVEFLYYWLHRALHHHIL  22
            +P+WR+DG I+  L+HTGPVEFLYYWLHRALHHH L
Sbjct  120  LPLWRSDGFIIVILLHTGPVEFLYYWLHRALHHHFL  155



>ref|XP_003606182.1| Protein WAX2 [Medicago truncatula]
Length=594

 Score =   204 bits (520),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 99/154 (64%), Positives = 125/154 (81%), Gaps = 3/154 (2%)
 Frame = -3

Query  483  MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpfllIRMLH  304
            MAS+PGILT WPW  LGSFK+V+L+P++AHS Y ++     E+DP+  +IFP++ +RMLH
Sbjct  1    MASKPGILTNWPWKPLGSFKFVILSPWIAHSIYSFIW---VEQDPSYYIIFPYMFVRMLH  57

Query  303  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  124
            +Q+WIS+SRY+TAKG NRIVDK +EFEQVDRE NWDDQI+L  L FY  Y   P+  ++P
Sbjct  58   SQIWISISRYQTAKGKNRIVDKCLEFEQVDRETNWDDQILLTALTFYILYTIFPMAANLP  117

Query  123  IWRTDGIILTALIHTGPVEFLYYWLHRALHHHIL  22
             WRTDG++LTAL+H GPVEFLYYWLHRALHHH L
Sbjct  118  WWRTDGVVLTALLHAGPVEFLYYWLHRALHHHYL  151



>gb|EPS60467.1| hypothetical protein M569_14337, partial [Genlisea aurea]
Length=623

 Score =   205 bits (521),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 97/154 (63%), Positives = 120/154 (78%), Gaps = 0/154 (0%)
 Frame = -3

Query  483  MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpfllIRMLH  304
            MAS PGILT+WPWTWLG++KY+V+APF   STY ++T   +ERD +  LI P +L R++H
Sbjct  1    MASNPGILTDWPWTWLGNYKYIVMAPFAVRSTYAFITKEAHERDLSNFLILPMMLWRVVH  60

Query  303  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  124
            N LWIS SRY+TAKG NRIVDK I+FEQVDRE NWDDQI+ NGLL Y G + +  +H++P
Sbjct  61   NLLWISFSRYKTAKGSNRIVDKNIDFEQVDREANWDDQILFNGLLLYVGQHYMRRSHNLP  120

Query  123  IWRTDGIILTALIHTGPVEFLYYWLHRALHHHIL  22
             W   G+I T ++H GPVEFLYYWLHRALHHH L
Sbjct  121  FWNAGGVIWTFVLHAGPVEFLYYWLHRALHHHFL  154



>gb|AFW72383.1| hypothetical protein ZEAMMB73_077345 [Zea mays]
Length=172

 Score =   193 bits (490),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 94/154 (61%), Positives = 114/154 (74%), Gaps = 0/154 (0%)
 Frame = -3

Query  483  MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpfllIRMLH  304
            MA+RPG LTEWPW  LG+FKY+V+AP   H   + +     + D    LI P LL+RM+H
Sbjct  1    MATRPGPLTEWPWQRLGNFKYLVMAPVAVHGARRVVARGWGDIDLAFALILPSLLLRMVH  60

Query  303  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  124
            NQ+WIS +RY+TA+  +RIVD+GIEF+QVDRER WDDQIILNGLLFY GY  +P    MP
Sbjct  61   NQIWISAARYQTARSKHRIVDRGIEFDQVDRERGWDDQIILNGLLFYVGYLAIPSARRMP  120

Query  123  IWRTDGIILTALIHTGPVEFLYYWLHRALHHHIL  22
             WR+DG +  AL+H GPVEFLYYW HRALHHH L
Sbjct  121  AWRSDGAVAMALLHAGPVEFLYYWFHRALHHHFL  154



>ref|NP_001169009.1| hypothetical protein [Zea mays]
 gb|ACN31395.1| unknown [Zea mays]
 gb|AFW72381.1| hypothetical protein ZEAMMB73_077345 [Zea mays]
Length=174

 Score =   193 bits (490),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 94/154 (61%), Positives = 114/154 (74%), Gaps = 0/154 (0%)
 Frame = -3

Query  483  MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpfllIRMLH  304
            MA+RPG LTEWPW  LG+FKY+V+AP   H   + +     + D    LI P LL+RM+H
Sbjct  1    MATRPGPLTEWPWQRLGNFKYLVMAPVAVHGARRVVARGWGDIDLAFALILPSLLLRMVH  60

Query  303  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  124
            NQ+WIS +RY+TA+  +RIVD+GIEF+QVDRER WDDQIILNGLLFY GY  +P    MP
Sbjct  61   NQIWISAARYQTARSKHRIVDRGIEFDQVDRERGWDDQIILNGLLFYVGYLAIPSARRMP  120

Query  123  IWRTDGIILTALIHTGPVEFLYYWLHRALHHHIL  22
             WR+DG +  AL+H GPVEFLYYW HRALHHH L
Sbjct  121  AWRSDGAVAMALLHAGPVEFLYYWFHRALHHHFL  154



>ref|XP_009586962.1| PREDICTED: protein ECERIFERUM 1-like [Nicotiana tomentosiformis]
Length=617

 Score =   204 bits (520),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 102/154 (66%), Positives = 120/154 (78%), Gaps = 0/154 (0%)
 Frame = -3

Query  483  MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpfllIRMLH  304
            MA+ PG LT+WPW  LGSFKYV+LAP++AHS Y   T   +E D   LLI PFLL RMLH
Sbjct  1    MATTPGFLTDWPWKHLGSFKYVILAPWIAHSVYCLATKEQHETDSTNLLILPFLLSRMLH  60

Query  303  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  124
            NQLWIS SRYRTAKG+NRIVDKGIEF+QVDRE NWDDQIILNG+L Y          ++P
Sbjct  61   NQLWISFSRYRTAKGNNRIVDKGIEFDQVDRESNWDDQIILNGILLYVFNTMSSAASNLP  120

Query  123  IWRTDGIILTALIHTGPVEFLYYWLHRALHHHIL  22
            +WR+DG+I++  +H GPVEFLYYWLHR+LHHH L
Sbjct  121  LWRSDGVIMSIFLHAGPVEFLYYWLHRSLHHHYL  154



>gb|KCW76761.1| hypothetical protein EUGRSUZ_D01120 [Eucalyptus grandis]
Length=568

 Score =   204 bits (518),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 97/154 (63%), Positives = 124/154 (81%), Gaps = 0/154 (0%)
 Frame = -3

Query  483  MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpfllIRMLH  304
            MAS+PGILT+WPW  LGSFKY +LAP+V   T++++   P ERD +  LI PF+L RMLH
Sbjct  1    MASKPGILTDWPWKPLGSFKYAILAPWVVQGTHQFIAKGPGERDFSYFLILPFILERMLH  60

Query  303  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  124
            NQ+WISLSR+RTAKG+NRI+++GIEFEQVDRE NWDDQI+L  +L Y  ++ +P   H+P
Sbjct  61   NQIWISLSRHRTAKGNNRILERGIEFEQVDRESNWDDQILLTAILLYMVHWAIPQASHLP  120

Query  123  IWRTDGIILTALIHTGPVEFLYYWLHRALHHHIL  22
            +W+TDG+I+T LIH   VE+LYYWLHRALHHH L
Sbjct  121  LWKTDGVIITFLIHAFVVEYLYYWLHRALHHHFL  154



>ref|XP_009797701.1| PREDICTED: protein ECERIFERUM 1-like [Nicotiana sylvestris]
Length=617

 Score =   204 bits (519),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 101/154 (66%), Positives = 120/154 (78%), Gaps = 0/154 (0%)
 Frame = -3

Query  483  MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpfllIRMLH  304
            MA+ PG LT+WPW  LGSFKYV+LAP++AHS Y   T    ERD   LLI PFLL RM+H
Sbjct  1    MATTPGFLTDWPWKHLGSFKYVILAPWIAHSFYCLATKEQEERDSTNLLIVPFLLSRMVH  60

Query  303  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  124
            NQLWIS SRYRTAKG+NRIVDKGIEF+QVDRE NWDDQIILNG+L Y          ++P
Sbjct  61   NQLWISFSRYRTAKGNNRIVDKGIEFDQVDRESNWDDQIILNGILLYVFNTMTSAATNLP  120

Query  123  IWRTDGIILTALIHTGPVEFLYYWLHRALHHHIL  22
            +W+++G+I++  +H GPVEFLYYWLHRALHHH L
Sbjct  121  LWKSEGVIMSIFLHAGPVEFLYYWLHRALHHHYL  154



>ref|XP_002464501.1| hypothetical protein SORBIDRAFT_01g019590 [Sorghum bicolor]
 gb|EER91499.1| hypothetical protein SORBIDRAFT_01g019590 [Sorghum bicolor]
Length=619

 Score =   204 bits (519),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 96/161 (60%), Positives = 123/161 (76%), Gaps = 0/161 (0%)
 Frame = -3

Query  483  MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpfllIRMLH  304
            MA+ PG+ TEWPW  LG+FKY+++AP+VAH  Y   T      D   + IFP LL+RML 
Sbjct  1    MATNPGLFTEWPWKKLGNFKYLLVAPWVAHGVYLVATKGWKAADLGYMAIFPSLLLRMLQ  60

Query  303  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  124
            NQ+WI++SR + A+G  +IVD+GIEFEQVDRERNWDDQI+L+G+L Y G+  +P   H+P
Sbjct  61   NQVWITVSRLQNARGRRQIVDRGIEFEQVDRERNWDDQILLSGILMYLGFMYIPGGQHLP  120

Query  123  IWRTDGIILTALIHTGPVEFLYYWLHRALHHHILYSRYHSH  1
            +WRTDG +L AL+H GPVE +YYW HRALHHH LY+RYHSH
Sbjct  121  LWRTDGAVLIALLHAGPVELIYYWFHRALHHHFLYTRYHSH  161



>emb|CDY38059.1| BnaCnng09200D [Brassica napus]
Length=829

 Score =   206 bits (524),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 100/154 (65%), Positives = 122/154 (79%), Gaps = 2/154 (1%)
 Frame = -3

Query  483  MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpfllIRMLH  304
            MA++PGILT+WPWT LG+FKY+V+AP+  HSTYK++TD P   D    L+ PFLL R+LH
Sbjct  202  MATKPGILTDWPWTPLGNFKYIVIAPWAVHSTYKFVTDDP--VDLGYSLVLPFLLFRILH  259

Query  303  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  124
            NQ+WISLSRY T KG  RI+DKGI+F QVDRE NWDDQI+ NGLLFY G   LP    +P
Sbjct  260  NQVWISLSRYYTTKGKRRILDKGIDFNQVDRETNWDDQILFNGLLFYIGIMLLPQAKQLP  319

Query  123  IWRTDGIILTALIHTGPVEFLYYWLHRALHHHIL  22
             WRTDG+++ A++H GPVEFLYYWLH+ALHHH L
Sbjct  320  WWRTDGVLMAAMLHAGPVEFLYYWLHKALHHHFL  353



>gb|EMT06855.1| Protein WAX2 [Aegilops tauschii]
Length=619

 Score =   204 bits (519),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 96/161 (60%), Positives = 122/161 (76%), Gaps = 0/161 (0%)
 Frame = -3

Query  483  MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpfllIRMLH  304
            MA+ PG+ +EWPW  LGSFKYVVLAP+VAH   +  T    E D   L+I P +++R LH
Sbjct  1    MATTPGLFSEWPWKRLGSFKYVVLAPWVAHGVQQVATKGWREADLGYLVILPSMMLRGLH  60

Query  303  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  124
            NQ WI++SR + A+G  +IVD+GIEFEQ+DRERNWDDQIIL+ +LF+ G   LP   ++P
Sbjct  61   NQAWITVSRLQNARGKRQIVDRGIEFEQIDRERNWDDQIILSAILFFLGALHLPGAQNLP  120

Query  123  IWRTDGIILTALIHTGPVEFLYYWLHRALHHHILYSRYHSH  1
            +WRTDG +L AL+H GPVE +YYW HRALHHH LY+RYHSH
Sbjct  121  LWRTDGAVLIALLHAGPVELIYYWFHRALHHHFLYTRYHSH  161



>gb|ABG66131.1| CER1 protein, putative, expressed [Oryza sativa Japonica Group]
 dbj|BAH00316.1| unnamed protein product [Oryza sativa Japonica Group]
Length=174

 Score =   192 bits (488),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 96/156 (62%), Positives = 117/156 (75%), Gaps = 0/156 (0%)
 Frame = -3

Query  483  MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpfllIRMLH  304
            MA+ PG+ TEWPW  LGSFKYV+LAP+VAH  Y+  T    E D   + I P LL+RMLH
Sbjct  1    MATNPGLFTEWPWKKLGSFKYVLLAPWVAHGWYEVATKGWREVDLGYIAILPSLLLRMLH  60

Query  303  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  124
            NQ WI++SR + A+G  +IV +GIEF+QVDRERNWDDQIIL+G+L Y G   +P   H+P
Sbjct  61   NQAWITISRLQNARGRRQIVRRGIEFDQVDRERNWDDQIILSGILLYLGALYVPGGQHLP  120

Query  123  IWRTDGIILTALIHTGPVEFLYYWLHRALHHHILYS  16
            +WRTDG  L AL+H GPVEFLYYW HRALHHH LY+
Sbjct  121  LWRTDGAGLIALLHAGPVEFLYYWFHRALHHHFLYT  156



>ref|XP_010535407.1| PREDICTED: protein ECERIFERUM 1-like isoform X2 [Tarenaya hassleriana]
Length=584

 Score =   203 bits (517),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 100/154 (65%), Positives = 121/154 (79%), Gaps = 0/154 (0%)
 Frame = -3

Query  483  MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpfllIRMLH  304
            MA++PGILT+WPWT LG +K+V+LAP+  HSTYK +     ERD    LIFP+LL+RMLH
Sbjct  1    MATKPGILTDWPWTPLGRYKFVILAPWAVHSTYKLMKGGEEERDWGYFLIFPYLLLRMLH  60

Query  303  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  124
            N +WISLSRY TA+G  RI+DKGI+F QVDRE NWDDQI+ NG+LFY GY  +     MP
Sbjct  61   NLVWISLSRYVTARGKRRILDKGIDFNQVDRETNWDDQILFNGVLFYVGYILMEGAKQMP  120

Query  123  IWRTDGIILTALIHTGPVEFLYYWLHRALHHHIL  22
            +WRTDG ++TAL+H GPVE LYYWLHRALHHH L
Sbjct  121  LWRTDGAVMTALLHAGPVELLYYWLHRALHHHFL  154



>ref|XP_008245903.1| PREDICTED: protein ECERIFERUM 1-like isoform X1 [Prunus mume]
Length=624

 Score =   204 bits (518),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 96/154 (62%), Positives = 119/154 (77%), Gaps = 0/154 (0%)
 Frame = -3

Query  483  MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpfllIRMLH  304
            MAS PGILTEWPW  LGS KYV+LAP+V HST+ ++ +   ERD +  L+   +L R++H
Sbjct  1    MASVPGILTEWPWKRLGSLKYVILAPWVIHSTWLFVANDAKERDVSYFLMLGVVLWRIIH  60

Query  303  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  124
            NQ+WISLSRY+TAKG+ RI+D+G+EFEQVDRE NWDDQI+ N LLFY G   LP   H P
Sbjct  61   NQIWISLSRYQTAKGNGRILDRGLEFEQVDRENNWDDQILFNALLFYTGSRYLPGGQHAP  120

Query  123  IWRTDGIILTALIHTGPVEFLYYWLHRALHHHIL  22
             WR +G++LT ++H GPVEFLYYW HRALHHH L
Sbjct  121  FWRAEGLLLTIVLHAGPVEFLYYWFHRALHHHYL  154



>gb|EMT07276.1| Protein WAX2 [Aegilops tauschii]
Length=604

 Score =   203 bits (517),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 98/161 (61%), Positives = 120/161 (75%), Gaps = 0/161 (0%)
 Frame = -3

Query  483  MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpfllIRMLH  304
            MA+RPG LTEWPW W+GSFKY+V AP    + Y+ +T    + +     I P LL+RMLH
Sbjct  1    MATRPGPLTEWPWHWMGSFKYLVFAPVALQTAYRVVTKGWGDMNLAYAAILPALLLRMLH  60

Query  303  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  124
            NQ+WISLSR++TA+  + IVD+ +EFEQVDRER+WDDQIIL+GL FY  Y  +P    MP
Sbjct  61   NQIWISLSRHQTARRKHIIVDRSLEFEQVDRERSWDDQIILSGLYFYLAYAAIPSVRLMP  120

Query  123  IWRTDGIILTALIHTGPVEFLYYWLHRALHHHILYSRYHSH  1
            +W T G I+ AL+H GPVEFLYYW HRALHHH LYSRYHSH
Sbjct  121  MWETKGAIIMALLHAGPVEFLYYWFHRALHHHFLYSRYHSH  161



>ref|XP_007015842.1| CER1 protein isoform 1 [Theobroma cacao]
 gb|EOY33461.1| CER1 protein isoform 1 [Theobroma cacao]
Length=618

 Score =   204 bits (518),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 100/161 (62%), Positives = 127/161 (79%), Gaps = 0/161 (0%)
 Frame = -3

Query  483  MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpfllIRMLH  304
            MA++PGIL++WPW  +G+FKY +L P   +STY ++T + NER+  + L+FPFLL R  H
Sbjct  1    MATKPGILSDWPWQSIGNFKYALLVPGAIYSTYSFITTAENERNLFMFLVFPFLLFRFAH  60

Query  303  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  124
             QLWIS+SRYRTAKG+NRIVDK ++FEQVDRER+WDDQI+LNG+LFY     L    +MP
Sbjct  61   YQLWISVSRYRTAKGNNRIVDKSLDFEQVDRERSWDDQIVLNGILFYAAGVVLRDQFNMP  120

Query  123  IWRTDGIILTALIHTGPVEFLYYWLHRALHHHILYSRYHSH  1
             ++ DG I+T L+H GP EFLYYWLHRALHHH LY+RYHSH
Sbjct  121  FFKADGTIITLLLHWGPAEFLYYWLHRALHHHYLYARYHSH  161



>ref|XP_006354619.1| PREDICTED: protein ECERIFERUM 1-like isoform X1 [Solanum tuberosum]
Length=623

 Score =   204 bits (518),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 99/155 (64%), Positives = 120/155 (77%), Gaps = 1/155 (1%)
 Frame = -3

Query  483  MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKY-LTDSPNERDPNillifpfllIRML  307
            MA++PGILT  PW  LG+ KY+VLAPF  HS Y + ++   +ERD   +L+ P  L RM+
Sbjct  1    MANKPGILTNCPWACLGNLKYLVLAPFACHSIYTFFMSKDESERDMFYILLLPLTLFRMV  60

Query  306  HNQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHM  127
            H Q+WISLSRYRTAKG+NRI+D+ IEF+QVDRE NWDD+IIL GL +Y GY  L   HHM
Sbjct  61   HYQIWISLSRYRTAKGNNRILDRSIEFDQVDRESNWDDEIILFGLAYYIGYLILEQAHHM  120

Query  126  PIWRTDGIILTALIHTGPVEFLYYWLHRALHHHIL  22
            P+WRTDGII+ AL+H GPVE LYYWLHRALHHH L
Sbjct  121  PMWRTDGIIIIALLHIGPVELLYYWLHRALHHHFL  155



>ref|XP_006354620.1| PREDICTED: protein ECERIFERUM 1-like isoform X2 [Solanum tuberosum]
Length=623

 Score =   204 bits (518),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 99/155 (64%), Positives = 120/155 (77%), Gaps = 1/155 (1%)
 Frame = -3

Query  483  MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKY-LTDSPNERDPNillifpfllIRML  307
            MA++PGILT  PW  LG+ KY+VLAPF  HS Y + ++   +ERD   +L+ P  L RM+
Sbjct  1    MANKPGILTNCPWACLGNLKYLVLAPFACHSIYTFFMSKDESERDMFYILLLPLTLFRMV  60

Query  306  HNQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHM  127
            H Q+WISLSRYRTAKG+NRI+D+ IEF+QVDRE NWDD+IIL GL +Y GY  L   HHM
Sbjct  61   HYQIWISLSRYRTAKGNNRILDRSIEFDQVDRESNWDDEIILFGLAYYIGYLILEQAHHM  120

Query  126  PIWRTDGIILTALIHTGPVEFLYYWLHRALHHHIL  22
            P+WRTDGII+ AL+H GPVE LYYWLHRALHHH L
Sbjct  121  PMWRTDGIIIIALLHIGPVELLYYWLHRALHHHFL  155



>gb|KHG15491.1| Protein WAX2 -like protein [Gossypium arboreum]
Length=612

 Score =   203 bits (517),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 99/154 (64%), Positives = 122/154 (79%), Gaps = 1/154 (1%)
 Frame = -3

Query  483  MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpfllIRMLH  304
            MAS+PGILT+WPW  LGSFKY++L P +    Y ++ +   + D + L++FPF+L RMLH
Sbjct  1    MASKPGILTDWPWKPLGSFKYILLVPLITEHIYSFM-EKDEDIDVSKLVLFPFMLWRMLH  59

Query  303  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  124
            NQLWISLSRY TAKG N+IVDKGIEF+QVDRER+WDDQI+ N +LFYWG   +P   H+P
Sbjct  60   NQLWISLSRYLTAKGTNKIVDKGIEFDQVDRERDWDDQIMFNAILFYWGNKYVPGGSHLP  119

Query  123  IWRTDGIILTALIHTGPVEFLYYWLHRALHHHIL  22
             WR DG+I+T L+H GPVEFLYYWLHRALHHH L
Sbjct  120  FWRLDGVIITMLLHAGPVEFLYYWLHRALHHHYL  153



>gb|AFW68611.1| hypothetical protein ZEAMMB73_227989 [Zea mays]
Length=419

 Score =   199 bits (506),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 97/161 (60%), Positives = 119/161 (74%), Gaps = 0/161 (0%)
 Frame = -3

Query  483  MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpfllIRMLH  304
            MA+ PG+ TEWPW  LG+FKY++LAP+VAH  Y   T      D   + I P LL+R LH
Sbjct  1    MATNPGLFTEWPWKKLGNFKYLLLAPWVAHGGYLAATKGWRAADLGYVAILPSLLLRALH  60

Query  303  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  124
            NQ WI+ SR ++A+G  ++VD+GIEFEQVDRERNWDDQI+L+G+L Y G   LP   H+P
Sbjct  61   NQAWITASRLQSARGRRQVVDRGIEFEQVDRERNWDDQILLSGILLYLGSTYLPGGQHLP  120

Query  123  IWRTDGIILTALIHTGPVEFLYYWLHRALHHHILYSRYHSH  1
            +WR DG  L AL+H GPVE +YYWLHRALHHH LYSRYHSH
Sbjct  121  LWRADGAALIALLHAGPVELVYYWLHRALHHHFLYSRYHSH  161



>ref|XP_010535406.1| PREDICTED: protein ECERIFERUM 1-like isoform X1 [Tarenaya hassleriana]
Length=628

 Score =   203 bits (517),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 100/154 (65%), Positives = 121/154 (79%), Gaps = 0/154 (0%)
 Frame = -3

Query  483  MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpfllIRMLH  304
            MA++PGILT+WPWT LG +K+V+LAP+  HSTYK +     ERD    LIFP+LL+RMLH
Sbjct  1    MATKPGILTDWPWTPLGRYKFVILAPWAVHSTYKLMKGGEEERDWGYFLIFPYLLLRMLH  60

Query  303  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  124
            N +WISLSRY TA+G  RI+DKGI+F QVDRE NWDDQI+ NG+LFY GY  +     MP
Sbjct  61   NLVWISLSRYVTARGKRRILDKGIDFNQVDRETNWDDQILFNGVLFYVGYILMEGAKQMP  120

Query  123  IWRTDGIILTALIHTGPVEFLYYWLHRALHHHIL  22
            +WRTDG ++TAL+H GPVE LYYWLHRALHHH L
Sbjct  121  LWRTDGAVMTALLHAGPVELLYYWLHRALHHHFL  154



>ref|XP_007218858.1| hypothetical protein PRUPE_ppa002770mg [Prunus persica]
 gb|EMJ20057.1| hypothetical protein PRUPE_ppa002770mg [Prunus persica]
Length=635

 Score =   203 bits (517),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 95/154 (62%), Positives = 119/154 (77%), Gaps = 0/154 (0%)
 Frame = -3

Query  483  MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpfllIRMLH  304
            MAS PGILTEWPW  LGS KYV+LAP++ HST+ ++ +   ERD +  L+   +L R++H
Sbjct  1    MASVPGILTEWPWKALGSLKYVILAPWIIHSTWLFVANDAKERDVSYFLLLGVVLWRIIH  60

Query  303  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  124
            NQ+WISLSRYRTAKG+ RI+D+G+EFEQVDRE NWDDQI+ N LLFY G   LP    +P
Sbjct  61   NQIWISLSRYRTAKGNGRILDRGLEFEQVDRENNWDDQILFNALLFYTGSRYLPGAQKLP  120

Query  123  IWRTDGIILTALIHTGPVEFLYYWLHRALHHHIL  22
            +WR  G++LT ++H GPVEFLYYW HRALHHH L
Sbjct  121  LWRAHGVLLTIVLHAGPVEFLYYWFHRALHHHYL  154



>ref|XP_007220541.1| hypothetical protein PRUPE_ppa002903mg [Prunus persica]
 gb|EMJ21740.1| hypothetical protein PRUPE_ppa002903mg [Prunus persica]
Length=623

 Score =   203 bits (517),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 95/154 (62%), Positives = 119/154 (77%), Gaps = 0/154 (0%)
 Frame = -3

Query  483  MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpfllIRMLH  304
            MAS PGILTEWPW  LGS KYV+LAP++ HST+ ++ +   ERD +  L+   +L R++H
Sbjct  1    MASVPGILTEWPWKALGSLKYVILAPWIIHSTWLFVANDAKERDVSYFLLLGVVLWRIIH  60

Query  303  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  124
            NQ+WISLSRYRTAKG+ RI+D+G+EFEQVDRE NWDDQI+ N LLFY G   LP    +P
Sbjct  61   NQIWISLSRYRTAKGNGRILDRGLEFEQVDRENNWDDQILFNALLFYTGSRYLPGAQKLP  120

Query  123  IWRTDGIILTALIHTGPVEFLYYWLHRALHHHIL  22
            +WR  G++LT ++H GPVEFLYYW HRALHHH L
Sbjct  121  LWRAHGVLLTIVLHAGPVEFLYYWFHRALHHHYL  154



>ref|XP_003580122.1| PREDICTED: protein ECERIFERUM 1-like [Brachypodium distachyon]
Length=620

 Score =   203 bits (516),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 97/161 (60%), Positives = 119/161 (74%), Gaps = 0/161 (0%)
 Frame = -3

Query  483  MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpfllIRMLH  304
            MA RPG LTEWPW W+GSFKY+VLAP   H+ +   T      +P    I P LL+RM+H
Sbjct  1    MAKRPGPLTEWPWKWMGSFKYLVLAPVAVHTAHMLATKGRGGINPAQATILPILLLRMMH  60

Query  303  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  124
            +Q+WISLSR++TA+  + IVD+ +EFEQVDRER+WDDQII +GLL Y  Y  +P    +P
Sbjct  61   SQIWISLSRHQTARRKHIIVDRSLEFEQVDRERSWDDQIIFSGLLSYMAYLAIPNVSLIP  120

Query  123  IWRTDGIILTALIHTGPVEFLYYWLHRALHHHILYSRYHSH  1
            +W T G I+TAL+H GPVEFLYYW HRALHHH LYSRYHSH
Sbjct  121  VWSTKGAIITALLHIGPVEFLYYWFHRALHHHFLYSRYHSH  161



>gb|KDO85386.1| hypothetical protein CISIN_1g006590mg [Citrus sinensis]
Length=495

 Score =   200 bits (509),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 103/155 (66%), Positives = 125/155 (81%), Gaps = 1/155 (1%)
 Frame = -3

Query  483  MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpfllIRMLH  304
            MAS+PGILTEWPW  LGS+K+VVLAP+  HS Y ++    +ERD    LIFPFLL+RMLH
Sbjct  1    MASKPGILTEWPWKPLGSYKHVVLAPWAMHSIYCFIGSRKSERDYAYFLIFPFLLLRMLH  60

Query  303  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITH-HM  127
            +Q+WISLSRYRTAK +NRIVDK IEF+QVDRERNWDDQI+ NGL+FY     +P ++ ++
Sbjct  61   DQIWISLSRYRTAKRNNRIVDKAIEFDQVDRERNWDDQIVFNGLIFYIVRMLIPPSYSNL  120

Query  126  PIWRTDGIILTALIHTGPVEFLYYWLHRALHHHIL  22
              WR+DG+ILT L+H GPVEFLYYW HRALHHH L
Sbjct  121  RFWRSDGVILTILVHMGPVEFLYYWFHRALHHHYL  155



>ref|XP_002526511.1| sterol desaturase, putative [Ricinus communis]
 gb|EEF35902.1| sterol desaturase, putative [Ricinus communis]
Length=617

 Score =   202 bits (515),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 97/154 (63%), Positives = 122/154 (79%), Gaps = 0/154 (0%)
 Frame = -3

Query  483  MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpfllIRMLH  304
            MASRPGILT+WPW  LG FKYV+LAP+V HS Y ++     ERD   +LIFP +L+R+LH
Sbjct  1    MASRPGILTDWPWKSLGDFKYVILAPWVVHSIYSFVVKEEKERDLTSVLIFPSILLRLLH  60

Query  303  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  124
            NQ+WIS+SRY+TAKG  R+VDK IEF+QVDRER+WDDQ++L G++ Y     +    +MP
Sbjct  61   NQIWISVSRYQTAKGKKRVVDKCIEFDQVDRERDWDDQVLLYGIITYSINMGVAGASNMP  120

Query  123  IWRTDGIILTALIHTGPVEFLYYWLHRALHHHIL  22
            IWRTDG++LT ++H GPVEFLYYWLHRALHHH L
Sbjct  121  IWRTDGVVLTMILHAGPVEFLYYWLHRALHHHYL  154



>ref|XP_006661851.1| PREDICTED: protein ECERIFERUM 1-like [Oryza brachyantha]
Length=635

 Score =   203 bits (516),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 107/175 (61%), Positives = 127/175 (73%), Gaps = 14/175 (8%)
 Frame = -3

Query  483  MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYK------------YLTDSPNE--RDPN  346
            MA+ PG+ TEWPW  LGSFKYV+LAP+VAH  Y+            YL   P+   RD  
Sbjct  1    MATNPGLFTEWPWKKLGSFKYVLLAPWVAHGWYEVATKGWRAADLGYLAILPSLLLRDLA  60

Query  345  illifpfllIRMLHNQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLF  166
              LI P LL+RM+HNQ+WISLSRY+TA+  +RIVD+GIEF+QVDRERNWDDQIIL+G L 
Sbjct  61   YSLILPSLLLRMIHNQIWISLSRYQTARSKHRIVDRGIEFDQVDRERNWDDQIILSGFLL  120

Query  165  YWGYYKLPITHHMPIWRTDGIILTALIHTGPVEFLYYWLHRALHHHILYSRYHSH  1
            Y G   LP    +P+WR DG  + AL+H GPVEFLYYWLHRALHHH LY+RYHSH
Sbjct  121  YLGALYLPGGQRLPLWRADGAAVIALLHAGPVEFLYYWLHRALHHHWLYTRYHSH  175



>gb|EYU40310.1| hypothetical protein MIMGU_mgv1a003047mg [Erythranthe guttata]
Length=608

 Score =   202 bits (515),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 99/163 (61%), Positives = 126/163 (77%), Gaps = 2/163 (1%)
 Frame = -3

Query  483  MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTD--SPNERDPNillifpfllIRM  310
            MA++PG+LT+WPW  LGSFKY++LAP+   S Y    +     ERD   LL+ PF++ R+
Sbjct  1    MATKPGVLTDWPWKHLGSFKYMILAPWAMQSIYSIAKNKNGEKERDYINLLVIPFMVSRI  60

Query  309  LHNQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHH  130
            LHNQ+WIS+SR+RTAKG+NRI+D+ IEFEQVDRE NWDD I+L+G+LFY+    L     
Sbjct  61   LHNQIWISISRHRTAKGNNRILDRTIEFEQVDRESNWDDNILLSGILFYFFNSTLRSASF  120

Query  129  MPIWRTDGIILTALIHTGPVEFLYYWLHRALHHHILYSRYHSH  1
            +PIWR DGII+T L+H GPVE+LYYWLHR LHHH LY+RYHSH
Sbjct  121  LPIWRNDGIIITILLHAGPVEYLYYWLHRGLHHHFLYTRYHSH  163



>ref|XP_007041192.1| CER1 protein [Theobroma cacao]
 gb|EOX97023.1| CER1 protein [Theobroma cacao]
Length=595

 Score =   202 bits (514),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 107/181 (59%), Positives = 126/181 (70%), Gaps = 27/181 (15%)
 Frame = -3

Query  483  MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpfllIRMLH  304
            MA++PGILT WPW  LG+FKYV+LAP+V HS Y + T + NER     LIFPFLL R+LH
Sbjct  1    MATKPGILTNWPWESLGNFKYVILAPWVVHSAYSWATKAGNERGLANFLIFPFLLTRILH  60

Query  303  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNW-------------------------  199
            NQ+WIS SRYRTAKG+NRI+DKGI+FEQVDRE NW                         
Sbjct  61   NQIWISYSRYRTAKGNNRIIDKGIDFEQVDRESNWSISILHCCLIASDLDTNMLKMMDMF  120

Query  198  --DDQIILNGLLFYWGYYKLPITHHMPIWRTDGIILTALIHTGPVEFLYYWLHRALHHHI  25
              DDQIIL+G++ Y G   LP   H PIWR+DG+I+T L+HTGPVEFLYYWLHRALHHH 
Sbjct  121  GRDDQIILSGIILYLGNMILPEASHFPIWRSDGVIITILLHTGPVEFLYYWLHRALHHHY  180

Query  24   L  22
            L
Sbjct  181  L  181



>ref|XP_006445498.1| hypothetical protein CICLE_v10019265mg [Citrus clementina]
 gb|ESR58738.1| hypothetical protein CICLE_v10019265mg [Citrus clementina]
Length=533

 Score =   201 bits (511),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 103/155 (66%), Positives = 125/155 (81%), Gaps = 1/155 (1%)
 Frame = -3

Query  483  MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpfllIRMLH  304
            MAS+PGILTEWPW  LGS+K+VVLAP+  HS Y ++    +ERD    LIFPFLL+RMLH
Sbjct  1    MASKPGILTEWPWKPLGSYKHVVLAPWAMHSIYCFIGSRKSERDYAYFLIFPFLLLRMLH  60

Query  303  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITH-HM  127
            +Q+WISLSRYRTAK +NRIVDK IEF+QVDRERNWDDQI+ NGL+FY     +P ++ ++
Sbjct  61   DQIWISLSRYRTAKRNNRIVDKAIEFDQVDRERNWDDQIVFNGLIFYIVRMLIPPSYSNL  120

Query  126  PIWRTDGIILTALIHTGPVEFLYYWLHRALHHHIL  22
              WR+DG+ILT L+H GPVEFLYYW HRALHHH L
Sbjct  121  RFWRSDGVILTILVHMGPVEFLYYWFHRALHHHYL  155



>gb|KDO85384.1| hypothetical protein CISIN_1g006590mg [Citrus sinensis]
 gb|KDO85385.1| hypothetical protein CISIN_1g006590mg [Citrus sinensis]
Length=533

 Score =   201 bits (511),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 103/155 (66%), Positives = 125/155 (81%), Gaps = 1/155 (1%)
 Frame = -3

Query  483  MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpfllIRMLH  304
            MAS+PGILTEWPW  LGS+K+VVLAP+  HS Y ++    +ERD    LIFPFLL+RMLH
Sbjct  1    MASKPGILTEWPWKPLGSYKHVVLAPWAMHSIYCFIGSRKSERDYAYFLIFPFLLLRMLH  60

Query  303  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITH-HM  127
            +Q+WISLSRYRTAK +NRIVDK IEF+QVDRERNWDDQI+ NGL+FY     +P ++ ++
Sbjct  61   DQIWISLSRYRTAKRNNRIVDKAIEFDQVDRERNWDDQIVFNGLIFYIVRMLIPPSYSNL  120

Query  126  PIWRTDGIILTALIHTGPVEFLYYWLHRALHHHIL  22
              WR+DG+ILT L+H GPVEFLYYW HRALHHH L
Sbjct  121  RFWRSDGVILTILVHMGPVEFLYYWFHRALHHHYL  155



>gb|EYU40309.1| hypothetical protein MIMGU_mgv1a003047mg [Erythranthe guttata]
Length=612

 Score =   202 bits (514),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 99/163 (61%), Positives = 126/163 (77%), Gaps = 2/163 (1%)
 Frame = -3

Query  483  MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTD--SPNERDPNillifpfllIRM  310
            MA++PG+LT+WPW  LGSFKY++LAP+   S Y    +     ERD   LL+ PF++ R+
Sbjct  1    MATKPGVLTDWPWKHLGSFKYMILAPWAMQSIYSIAKNKNGEKERDYINLLVIPFMVSRI  60

Query  309  LHNQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHH  130
            LHNQ+WIS+SR+RTAKG+NRI+D+ IEFEQVDRE NWDD I+L+G+LFY+    L     
Sbjct  61   LHNQIWISISRHRTAKGNNRILDRTIEFEQVDRESNWDDNILLSGILFYFFNSTLRSASF  120

Query  129  MPIWRTDGIILTALIHTGPVEFLYYWLHRALHHHILYSRYHSH  1
            +PIWR DGII+T L+H GPVE+LYYWLHR LHHH LY+RYHSH
Sbjct  121  LPIWRNDGIIITILLHAGPVEYLYYWLHRGLHHHFLYTRYHSH  163



>emb|CAE03390.2| OSJNBa0004N05.14 [Oryza sativa Japonica Group]
Length=597

 Score =   202 bits (514),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 97/161 (60%), Positives = 121/161 (75%), Gaps = 0/161 (0%)
 Frame = -3

Query  483  MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpfllIRMLH  304
            MA+RPG LTEWPW W+G +KY+VLAP   H+ ++  T    + DP    + P LL+RM+H
Sbjct  1    MATRPGPLTEWPWQWMGGYKYLVLAPVAMHTAHRLATKGWGDFDPAYTFMLPTLLLRMIH  60

Query  303  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  124
            NQ+WISLSRY+TA+  + IVD+ ++FEQVDR    DDQIILNGLLFY GY  +P    MP
Sbjct  61   NQIWISLSRYQTARRKHLIVDRSLDFEQVDRVLYLDDQIILNGLLFYLGYAIIPNFRLMP  120

Query  123  IWRTDGIILTALIHTGPVEFLYYWLHRALHHHILYSRYHSH  1
            +WRT+G ++T L+H GPVEFLYYW HRALHHH LYSRYHSH
Sbjct  121  VWRTNGALITILLHMGPVEFLYYWFHRALHHHFLYSRYHSH  161



>gb|ACG35856.1| CER1 [Zea mays]
Length=619

 Score =   202 bits (514),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 97/161 (60%), Positives = 120/161 (75%), Gaps = 0/161 (0%)
 Frame = -3

Query  483  MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpfllIRMLH  304
            MA+ PG+ TEWPW  LG+FKY++LAP+VAH  Y+  T      D   + I P LL+R LH
Sbjct  1    MATNPGLFTEWPWKKLGNFKYLLLAPWVAHGGYQAATKGWRAADLGYVAILPSLLLRALH  60

Query  303  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  124
            NQ WI+ SR ++A+G  ++VD+GIEFEQVDRERNWDDQI+L+G+L Y G   LP   H+P
Sbjct  61   NQAWITASRLQSARGRRQVVDRGIEFEQVDRERNWDDQILLSGILLYLGSTYLPGGQHLP  120

Query  123  IWRTDGIILTALIHTGPVEFLYYWLHRALHHHILYSRYHSH  1
            +WR DG  L AL+H GPVE +YYWLHRALHHH LYSRYHSH
Sbjct  121  LWRADGAALIALLHAGPVELVYYWLHRALHHHFLYSRYHSH  161



>ref|XP_004493412.1| PREDICTED: protein ECERIFERUM 1-like [Cicer arietinum]
Length=620

 Score =   201 bits (512),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 95/154 (62%), Positives = 123/154 (80%), Gaps = 3/154 (2%)
 Frame = -3

Query  483  MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpfllIRMLH  304
            MAS+PGILT WPW  LGSFK V+++P++AHS Y ++     ERDP   LIFP +  R+LH
Sbjct  1    MASKPGILTNWPWKPLGSFKLVIISPWIAHSIYSFIK---GERDPVYQLIFPHIFFRLLH  57

Query  303  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  124
            +Q+WIS+SRY+TAKG ++IVDKG+EFEQVDRE NWDDQI+   L+ Y GY  +P++ ++P
Sbjct  58   SQIWISVSRYQTAKGKSKIVDKGLEFEQVDRETNWDDQILFTALITYIGYTIMPMSANLP  117

Query  123  IWRTDGIILTALIHTGPVEFLYYWLHRALHHHIL  22
             WRTDG++ TA++H GPVEFLYYWLHRALHHH L
Sbjct  118  WWRTDGVVFTAILHAGPVEFLYYWLHRALHHHYL  151



>gb|AES88391.2| fatty acid hydroxylase superfamily protein [Medicago truncatula]
Length=615

 Score =   201 bits (512),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 99/154 (64%), Positives = 123/154 (80%), Gaps = 3/154 (2%)
 Frame = -3

Query  483  MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpfllIRMLH  304
            MAS+ GILT WPW  LGS K+V+L+P++AHS Y ++     ERDP   LIFP++L+RMLH
Sbjct  1    MASKAGILTNWPWKPLGSLKFVILSPWIAHSIYSFIWV---ERDPTYYLIFPYILVRMLH  57

Query  303  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  124
            NQ+WIS+SRY+TAKG  RIVDKG+EF+QVDRE NWDDQI+   L+FY  Y   P+  ++P
Sbjct  58   NQIWISISRYQTAKGKRRIVDKGLEFDQVDRETNWDDQILFTALMFYILYTIFPMAANLP  117

Query  123  IWRTDGIILTALIHTGPVEFLYYWLHRALHHHIL  22
             WRTDG+ILTA++H GPVEFLYYWLHRALHHH L
Sbjct  118  WWRTDGVILTAILHAGPVEFLYYWLHRALHHHYL  151



>ref|XP_004982905.1| PREDICTED: protein ECERIFERUM 1-like [Setaria italica]
Length=619

 Score =   201 bits (511),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 96/161 (60%), Positives = 121/161 (75%), Gaps = 0/161 (0%)
 Frame = -3

Query  483  MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpfllIRMLH  304
            MA+ PG+ TEWPW  LG+FKY++LAP+VAH  Y   T      D   L I P LL+R+LH
Sbjct  1    MATNPGLFTEWPWKKLGNFKYLLLAPWVAHGGYLAATKGWRAADVGYLAILPSLLLRVLH  60

Query  303  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  124
            NQ+WI++SR + A+   +IVD+GIEFEQVDRERNWDDQI+L+G+L Y G   +P   H+P
Sbjct  61   NQVWITVSRVQNARSRRQIVDRGIEFEQVDRERNWDDQILLSGILLYLGALYVPGGQHLP  120

Query  123  IWRTDGIILTALIHTGPVEFLYYWLHRALHHHILYSRYHSH  1
            +WR DG +L AL+H GPVEF+YYW HRALHHH LY+RYHSH
Sbjct  121  LWRADGFLLIALLHAGPVEFIYYWFHRALHHHFLYTRYHSH  161



>gb|KDO85383.1| hypothetical protein CISIN_1g006590mg [Citrus sinensis]
Length=602

 Score =   201 bits (510),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 103/155 (66%), Positives = 125/155 (81%), Gaps = 1/155 (1%)
 Frame = -3

Query  483  MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpfllIRMLH  304
            MAS+PGILTEWPW  LGS+K+VVLAP+  HS Y ++    +ERD    LIFPFLL+RMLH
Sbjct  1    MASKPGILTEWPWKPLGSYKHVVLAPWAMHSIYCFIGSRKSERDYAYFLIFPFLLLRMLH  60

Query  303  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITH-HM  127
            +Q+WISLSRYRTAK +NRIVDK IEF+QVDRERNWDDQI+ NGL+FY     +P ++ ++
Sbjct  61   DQIWISLSRYRTAKRNNRIVDKAIEFDQVDRERNWDDQIVFNGLIFYIVRMLIPPSYSNL  120

Query  126  PIWRTDGIILTALIHTGPVEFLYYWLHRALHHHIL  22
              WR+DG+ILT L+H GPVEFLYYW HRALHHH L
Sbjct  121  RFWRSDGVILTILVHMGPVEFLYYWFHRALHHHYL  155



>ref|XP_003625022.1| Protein WAX2 [Medicago truncatula]
 gb|ABD28316.1| Sterol desaturase [Medicago truncatula]
 gb|AES81240.1| fatty acid hydroxylase superfamily protein [Medicago truncatula]
Length=617

 Score =   201 bits (510),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 98/154 (64%), Positives = 121/154 (79%), Gaps = 3/154 (2%)
 Frame = -3

Query  483  MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpfllIRMLH  304
            MAS+PGILT WPW  LGSFK+V+L P++ HS Y ++     ERDP   LI PF+L+RMLH
Sbjct  1    MASKPGILTNWPWKPLGSFKFVILIPWIGHSIYSFIWV---ERDPIQYLICPFILVRMLH  57

Query  303  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  124
            NQ+WIS+SRY TA+G ++IVDK +EFEQVDRE NWDDQI+   LL+Y GY   P+  ++P
Sbjct  58   NQIWISISRYETARGKSKIVDKSLEFEQVDRETNWDDQILFTALLYYIGYMIFPMASNLP  117

Query  123  IWRTDGIILTALIHTGPVEFLYYWLHRALHHHIL  22
             WR DG+ILTA++H GPVEFLYYWLHRALHHH L
Sbjct  118  WWRIDGVILTAILHAGPVEFLYYWLHRALHHHYL  151



>ref|NP_001146661.1| uncharacterized protein LOC100280261 [Zea mays]
 gb|ACL54484.1| unknown [Zea mays]
 gb|AFW68612.1| CER1 [Zea mays]
Length=619

 Score =   201 bits (511),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 97/161 (60%), Positives = 119/161 (74%), Gaps = 0/161 (0%)
 Frame = -3

Query  483  MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpfllIRMLH  304
            MA+ PG+ TEWPW  LG+FKY++LAP+VAH  Y   T      D   + I P LL+R LH
Sbjct  1    MATNPGLFTEWPWKKLGNFKYLLLAPWVAHGGYLAATKGWRAADLGYVAILPSLLLRALH  60

Query  303  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  124
            NQ WI+ SR ++A+G  ++VD+GIEFEQVDRERNWDDQI+L+G+L Y G   LP   H+P
Sbjct  61   NQAWITASRLQSARGRRQVVDRGIEFEQVDRERNWDDQILLSGILLYLGSTYLPGGQHLP  120

Query  123  IWRTDGIILTALIHTGPVEFLYYWLHRALHHHILYSRYHSH  1
            +WR DG  L AL+H GPVE +YYWLHRALHHH LYSRYHSH
Sbjct  121  LWRADGAALIALLHAGPVELVYYWLHRALHHHFLYSRYHSH  161



>ref|XP_007041196.1| CER1 protein [Theobroma cacao]
 gb|EOX97027.1| CER1 protein [Theobroma cacao]
Length=627

 Score =   201 bits (510),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 108/181 (60%), Positives = 125/181 (69%), Gaps = 27/181 (15%)
 Frame = -3

Query  483  MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpfllIRMLH  304
            MA++PGILT WPW  LG+FKYV+LAP+V HS Y + T + NER     LIFPFLL R+LH
Sbjct  1    MATKPGILTNWPWESLGNFKYVILAPWVVHSAYSWATKAGNERGLFNFLIFPFLLTRILH  60

Query  303  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNW-------------------------  199
            NQ+WIS SRYRTAKG NRIVDKGI+FEQVDRE NW                         
Sbjct  61   NQIWISYSRYRTAKGSNRIVDKGIDFEQVDRESNWSISILHCCLIAYDLGTNMRKLMDMF  120

Query  198  --DDQIILNGLLFYWGYYKLPITHHMPIWRTDGIILTALIHTGPVEFLYYWLHRALHHHI  25
              DDQIILNG++ Y     LP   H+PIWR+DG+I+T L+HTGPVEFLYYWLHRALHHH 
Sbjct  121  GRDDQIILNGIILYLTIMILPGASHLPIWRSDGVIITILLHTGPVEFLYYWLHRALHHHY  180

Query  24   L  22
            L
Sbjct  181  L  181



>ref|XP_011012757.1| PREDICTED: protein ECERIFERUM 1-like [Populus euphratica]
Length=622

 Score =   200 bits (509),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 99/144 (69%), Positives = 118/144 (82%), Gaps = 2/144 (1%)
 Frame = -3

Query  483  MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpfllIRMLH  304
            MASRPGILT+WPW  LGSFK+++LAP+V HSTY ++    +E+D +  L FP LL RMLH
Sbjct  1    MASRPGILTDWPWKPLGSFKHLILAPWVIHSTYSFMIQ--DEKDLSTFLAFPLLLWRMLH  58

Query  303  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  124
            NQLWISLSRYRTAKG+NRIVDK IEF+QVDRE NWDDQI+ NG+LFY G   +P   H+P
Sbjct  59   NQLWISLSRYRTAKGNNRIVDKAIEFDQVDRESNWDDQILFNGILFYVGIKTIPGASHLP  118

Query  123  IWRTDGIILTALIHTGPVEFLYYW  52
            +WR DG+I+TALIH GPVEFLYYW
Sbjct  119  LWRLDGVIITALIHMGPVEFLYYW  142



>ref|XP_007015845.1| CER1 protein [Theobroma cacao]
 gb|EOY33464.1| CER1 protein [Theobroma cacao]
Length=618

 Score =   200 bits (509),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 99/161 (61%), Positives = 128/161 (80%), Gaps = 0/161 (0%)
 Frame = -3

Query  483  MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpfllIRMLH  304
            MAS+PGILT+ PW  +G FKY +L P   +STY ++T + NER+  + L+FPFLL R+ H
Sbjct  1    MASKPGILTDSPWQSIGYFKYALLVPGAIYSTYSFITTAENERNLFMFLVFPFLLFRLAH  60

Query  303  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  124
            +QLWIS+SRYRTAKG+NRIVDK ++FEQVDRER+WDDQ+++NG+LFY     L    +MP
Sbjct  61   HQLWISVSRYRTAKGNNRIVDKSLDFEQVDRERSWDDQMVVNGILFYAAGVVLRDQFNMP  120

Query  123  IWRTDGIILTALIHTGPVEFLYYWLHRALHHHILYSRYHSH  1
             ++ DG I+T L+H GPVEF+YYWLHRALHHH LY+RYHSH
Sbjct  121  FFKADGTIITLLLHWGPVEFVYYWLHRALHHHYLYARYHSH  161



>gb|KDO85382.1| hypothetical protein CISIN_1g006590mg [Citrus sinensis]
Length=627

 Score =   200 bits (509),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 103/155 (66%), Positives = 125/155 (81%), Gaps = 1/155 (1%)
 Frame = -3

Query  483  MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpfllIRMLH  304
            MAS+PGILTEWPW  LGS+K+VVLAP+  HS Y ++    +ERD    LIFPFLL+RMLH
Sbjct  1    MASKPGILTEWPWKPLGSYKHVVLAPWAMHSIYCFIGSRKSERDYAYFLIFPFLLLRMLH  60

Query  303  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITH-HM  127
            +Q+WISLSRYRTAK +NRIVDK IEF+QVDRERNWDDQI+ NGL+FY     +P ++ ++
Sbjct  61   DQIWISLSRYRTAKRNNRIVDKAIEFDQVDRERNWDDQIVFNGLIFYIVRMLIPPSYSNL  120

Query  126  PIWRTDGIILTALIHTGPVEFLYYWLHRALHHHIL  22
              WR+DG+ILT L+H GPVEFLYYW HRALHHH L
Sbjct  121  RFWRSDGVILTILVHMGPVEFLYYWFHRALHHHYL  155



>ref|XP_010276559.1| PREDICTED: protein ECERIFERUM 1-like [Nelumbo nucifera]
Length=624

 Score =   200 bits (509),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 106/158 (67%), Positives = 122/158 (77%), Gaps = 8/158 (5%)
 Frame = -3

Query  483  MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpfllIRMLH  304
            MAS PG LT WPW  LG+FKY+VLAP+V HSTY ++T    ERD    L FPFLL RMLH
Sbjct  1    MASTPGPLTNWPWKKLGNFKYLVLAPWVIHSTYSFMTKDETERDVGNFLTFPFLLFRMLH  60

Query  303  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITH---  133
            +Q+WISL+RY+TAK  +RIV KGIEFEQVDRERNWDDQIILNGLL    YY +PI +   
Sbjct  61   SQIWISLARYQTAKSKHRIVHKGIEFEQVDRERNWDDQIILNGLL----YYIVPIFYSKA  116

Query  132  -HMPIWRTDGIILTALIHTGPVEFLYYWLHRALHHHIL  22
              +P+WR DG+IL  L+H GPVEFLYYWLHRALHHH L
Sbjct  117  ARLPVWRWDGVILIMLLHAGPVEFLYYWLHRALHHHFL  154



>gb|KGN56666.1| hypothetical protein Csa_3G127770 [Cucumis sativus]
Length=608

 Score =   200 bits (508),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 102/154 (66%), Positives = 121/154 (79%), Gaps = 0/154 (0%)
 Frame = -3

Query  483  MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpfllIRMLH  304
            MAS PGI T+WPW  LGSFKY+VLAP V HS Y Y+     ERD + LLIFPFLL RM+H
Sbjct  1    MASTPGIFTDWPWKPLGSFKYLVLAPGVIHSFYHYIAKDWTERDISYLLIFPFLLWRMIH  60

Query  303  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  124
            +Q+WIS SR+RTAKG  RIVDKG+EFEQVDRERNWDDQI+LNG+LFY     +    ++P
Sbjct  61   SQIWISFSRHRTAKGTARIVDKGVEFEQVDRERNWDDQILLNGVLFYITSNCIEKASNLP  120

Query  123  IWRTDGIILTALIHTGPVEFLYYWLHRALHHHIL  22
            +WRTDG+++  L+H GPVEFLYYW HRALHHH L
Sbjct  121  LWRTDGVVMVFLLHAGPVEFLYYWFHRALHHHYL  154



>gb|AAC24373.1| CER1-like protein [Arabidopsis thaliana]
Length=604

 Score =   199 bits (507),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 97/154 (63%), Positives = 116/154 (75%), Gaps = 0/154 (0%)
 Frame = -3

Query  483  MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpfllIRMLH  304
            MASRPG LTEWPW+ LGSFKY+++AP V  S + Y+T    E+D + L+I   +L R++H
Sbjct  1    MASRPGALTEWPWSPLGSFKYLLVAPLVMASMHSYVTAVDEEKDLSRLMIVVLMLWRIVH  60

Query  303  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  124
            +Q+WIS+SR RTAKG N+IVDK IEFEQVDRER WDDQ+I N LL Y    KLP   H+P
Sbjct  61   SQIWISVSRQRTAKGTNKIVDKPIEFEQVDRERTWDDQVIFNTLLMYLANIKLPGASHLP  120

Query  123  IWRTDGIILTALIHTGPVEFLYYWLHRALHHHIL  22
             WR DG IL AL+H GPVEFLYYW HRALHHH L
Sbjct  121  PWRLDGAILMALLHAGPVEFLYYWFHRALHHHFL  154



>emb|CBI16766.3| unnamed protein product [Vitis vinifera]
Length=292

 Score =   192 bits (488),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 102/165 (62%), Positives = 118/165 (72%), Gaps = 6/165 (4%)
 Frame = -3

Query  516  IQDHKSIVLPKMASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNill  337
            I    +I+   MAS+PGILT+WPW  LGSFK         +  Y  +     ERDP  +L
Sbjct  21   ILASSNIIEVYMASKPGILTDWPWKSLGSFK------IQYYYIYSLIIKDGKERDPVYVL  74

Query  336  ifpfllIRMLHNQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWG  157
             F FLL R LHNQ+WISLSRYRTAKG+NRIVDK  +FEQVDRE NW DQI+LN +LFY G
Sbjct  75   FFLFLLWRTLHNQIWISLSRYRTAKGNNRIVDKSNKFEQVDRESNWVDQILLNRILFYVG  134

Query  156  YYKLPITHHMPIWRTDGIILTALIHTGPVEFLYYWLHRALHHHIL  22
            Y  LP   HMP+WRTDG++LT L+H GPVEFLYYWLHRALHHH L
Sbjct  135  YMILPGAAHMPLWRTDGVLLTILLHMGPVEFLYYWLHRALHHHYL  179



>ref|NP_171721.3| protein CER1-like 1 [Arabidopsis thaliana]
 sp|F4HVX7.1|CERL1_ARATH RecName: Full=Protein CER1-like 1 [Arabidopsis thaliana]
 gb|AEE27399.1| protein CER1-like 1 [Arabidopsis thaliana]
Length=627

 Score =   200 bits (508),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 97/154 (63%), Positives = 116/154 (75%), Gaps = 0/154 (0%)
 Frame = -3

Query  483  MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpfllIRMLH  304
            MASRPG LTEWPW+ LGSFKY+++AP V  S + Y+T    E+D + L+I   +L R++H
Sbjct  1    MASRPGALTEWPWSPLGSFKYLLVAPLVMASMHSYVTAVDEEKDLSRLMIVVLMLWRIVH  60

Query  303  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  124
            +Q+WIS+SR RTAKG N+IVDK IEFEQVDRER WDDQ+I N LL Y    KLP   H+P
Sbjct  61   SQIWISVSRQRTAKGTNKIVDKPIEFEQVDRERTWDDQVIFNTLLMYLANIKLPGASHLP  120

Query  123  IWRTDGIILTALIHTGPVEFLYYWLHRALHHHIL  22
             WR DG IL AL+H GPVEFLYYW HRALHHH L
Sbjct  121  PWRLDGAILMALLHAGPVEFLYYWFHRALHHHFL  154



>ref|XP_010496697.1| PREDICTED: protein CER1-like 1 [Camelina sativa]
Length=629

 Score =   200 bits (508),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 96/154 (62%), Positives = 118/154 (77%), Gaps = 0/154 (0%)
 Frame = -3

Query  483  MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpfllIRMLH  304
            MAS+PG LTEWPW+ LGSFKY+++APFV  S + Y+T +  E+D + L+I   +L R++H
Sbjct  1    MASKPGALTEWPWSPLGSFKYLLVAPFVMASMHSYVTVADEEKDFSRLMIVALMLWRIVH  60

Query  303  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  124
            +Q+WIS+SR RTAKG  +IVDK IEFEQVDRER WDDQII N LL Y    KLP   H+P
Sbjct  61   SQIWISVSRQRTAKGTRKIVDKPIEFEQVDRERTWDDQIIFNTLLMYLANIKLPGASHLP  120

Query  123  IWRTDGIILTALIHTGPVEFLYYWLHRALHHHIL  22
            +WR DG +L AL+H GPVEFLYYW HRALHHH L
Sbjct  121  LWRLDGALLMALLHAGPVEFLYYWFHRALHHHFL  154



>ref|XP_010936012.1| PREDICTED: protein ECERIFERUM 1-like isoform X2 [Elaeis guineensis]
Length=624

 Score =   200 bits (508),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 102/161 (63%), Positives = 127/161 (79%), Gaps = 0/161 (0%)
 Frame = -3

Query  483  MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpfllIRMLH  304
            MAS+PG LT+WPW  LG+FKYV+LAP+VAHS +K++  S  +RD    LIFP LL+R+L+
Sbjct  1    MASQPGPLTQWPWQKLGNFKYVLLAPWVAHSMHKFMAASGEKRDMINFLIFPILLLRLLY  60

Query  303  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  124
            +QLWI+ SRY+TAK  +RIVDK ++F+QVDRERNWDDQIIL  LL Y G   +P   H+P
Sbjct  61   SQLWITFSRYQTAKSKHRIVDKSLDFDQVDRERNWDDQIILTALLMYMGNMVVPGASHLP  120

Query  123  IWRTDGIILTALIHTGPVEFLYYWLHRALHHHILYSRYHSH  1
             W T G+ +T L+H GPVEF+YYWLHRALHHH LYSRYHSH
Sbjct  121  WWETRGVAITILLHMGPVEFIYYWLHRALHHHFLYSRYHSH  161



>ref|NP_973742.1| protein CER1-like 1 [Arabidopsis thaliana]
 gb|AEE27398.1| protein CER1-like 1 [Arabidopsis thaliana]
Length=623

 Score =   200 bits (508),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 97/154 (63%), Positives = 116/154 (75%), Gaps = 0/154 (0%)
 Frame = -3

Query  483  MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpfllIRMLH  304
            MASRPG LTEWPW+ LGSFKY+++AP V  S + Y+T    E+D + L+I   +L R++H
Sbjct  1    MASRPGALTEWPWSPLGSFKYLLVAPLVMASMHSYVTAVDEEKDLSRLMIVVLMLWRIVH  60

Query  303  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  124
            +Q+WIS+SR RTAKG N+IVDK IEFEQVDRER WDDQ+I N LL Y    KLP   H+P
Sbjct  61   SQIWISVSRQRTAKGTNKIVDKPIEFEQVDRERTWDDQVIFNTLLMYLANIKLPGASHLP  120

Query  123  IWRTDGIILTALIHTGPVEFLYYWLHRALHHHIL  22
             WR DG IL AL+H GPVEFLYYW HRALHHH L
Sbjct  121  PWRLDGAILMALLHAGPVEFLYYWFHRALHHHFL  154



>ref|XP_006445499.1| hypothetical protein CICLE_v10019265mg [Citrus clementina]
 gb|ESR58739.1| hypothetical protein CICLE_v10019265mg [Citrus clementina]
Length=639

 Score =   200 bits (508),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 103/155 (66%), Positives = 125/155 (81%), Gaps = 1/155 (1%)
 Frame = -3

Query  483  MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpfllIRMLH  304
            MAS+PGILTEWPW  LGS+K+VVLAP+  HS Y ++    +ERD    LIFPFLL+RMLH
Sbjct  1    MASKPGILTEWPWKPLGSYKHVVLAPWAMHSIYCFIGSRKSERDYAYFLIFPFLLLRMLH  60

Query  303  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITH-HM  127
            +Q+WISLSRYRTAK +NRIVDK IEF+QVDRERNWDDQI+ NGL+FY     +P ++ ++
Sbjct  61   DQIWISLSRYRTAKRNNRIVDKAIEFDQVDRERNWDDQIVFNGLIFYIVRMLIPPSYSNL  120

Query  126  PIWRTDGIILTALIHTGPVEFLYYWLHRALHHHIL  22
              WR+DG+ILT L+H GPVEFLYYW HRALHHH L
Sbjct  121  RFWRSDGVILTILVHMGPVEFLYYWFHRALHHHYL  155



>ref|XP_006464362.1| PREDICTED: protein ECERIFERUM 1-like isoform X2 [Citrus sinensis]
 gb|KDO85381.1| hypothetical protein CISIN_1g006590mg [Citrus sinensis]
Length=638

 Score =   200 bits (508),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 103/155 (66%), Positives = 125/155 (81%), Gaps = 1/155 (1%)
 Frame = -3

Query  483  MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpfllIRMLH  304
            MAS+PGILTEWPW  LGS+K+VVLAP+  HS Y ++    +ERD    LIFPFLL+RMLH
Sbjct  1    MASKPGILTEWPWKPLGSYKHVVLAPWAMHSIYCFIGSRKSERDYAYFLIFPFLLLRMLH  60

Query  303  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITH-HM  127
            +Q+WISLSRYRTAK +NRIVDK IEF+QVDRERNWDDQI+ NGL+FY     +P ++ ++
Sbjct  61   DQIWISLSRYRTAKRNNRIVDKAIEFDQVDRERNWDDQIVFNGLIFYIVRMLIPPSYSNL  120

Query  126  PIWRTDGIILTALIHTGPVEFLYYWLHRALHHHIL  22
              WR+DG+ILT L+H GPVEFLYYW HRALHHH L
Sbjct  121  RFWRSDGVILTILVHMGPVEFLYYWFHRALHHHYL  155



>ref|XP_006464361.1| PREDICTED: protein ECERIFERUM 1-like isoform X1 [Citrus sinensis]
 gb|KDO85380.1| hypothetical protein CISIN_1g006590mg [Citrus sinensis]
Length=639

 Score =   200 bits (508),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 103/155 (66%), Positives = 125/155 (81%), Gaps = 1/155 (1%)
 Frame = -3

Query  483  MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpfllIRMLH  304
            MAS+PGILTEWPW  LGS+K+VVLAP+  HS Y ++    +ERD    LIFPFLL+RMLH
Sbjct  1    MASKPGILTEWPWKPLGSYKHVVLAPWAMHSIYCFIGSRKSERDYAYFLIFPFLLLRMLH  60

Query  303  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITH-HM  127
            +Q+WISLSRYRTAK +NRIVDK IEF+QVDRERNWDDQI+ NGL+FY     +P ++ ++
Sbjct  61   DQIWISLSRYRTAKRNNRIVDKAIEFDQVDRERNWDDQIVFNGLIFYIVRMLIPPSYSNL  120

Query  126  PIWRTDGIILTALIHTGPVEFLYYWLHRALHHHIL  22
              WR+DG+ILT L+H GPVEFLYYW HRALHHH L
Sbjct  121  RFWRSDGVILTILVHMGPVEFLYYWFHRALHHHYL  155



>ref|XP_010255639.1| PREDICTED: protein ECERIFERUM 1-like isoform X2 [Nelumbo nucifera]
Length=654

 Score =   199 bits (507),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 99/154 (64%), Positives = 124/154 (81%), Gaps = 0/154 (0%)
 Frame = -3

Query  483  MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpfllIRMLH  304
            MA+ PG LT WPW  LGSFKYVVLAP+VAHS Y ++T  P +RD   LLI P+LL R++H
Sbjct  94   MATTPGPLTSWPWQKLGSFKYVVLAPWVAHSIYSFVTKDPKDRDLTNLLILPYLLWRLVH  153

Query  303  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  124
            +Q WI+L+R++TAK  +RI+DKGIEFEQVDRERNWDD I+LNG+LFY     L  + ++P
Sbjct  154  HQAWITLARHQTAKSKHRILDKGIEFEQVDRERNWDDLILLNGILFYMANLILNESKNLP  213

Query  123  IWRTDGIILTALIHTGPVEFLYYWLHRALHHHIL  22
            +WRTDG++L+ L+H GPVEFLYYWLHRALHHH L
Sbjct  214  MWRTDGVVLSFLLHMGPVEFLYYWLHRALHHHFL  247



>ref|XP_002526512.1| sterol desaturase, putative [Ricinus communis]
 gb|EEF35903.1| sterol desaturase, putative [Ricinus communis]
Length=622

 Score =   199 bits (506),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 101/154 (66%), Positives = 121/154 (79%), Gaps = 2/154 (1%)
 Frame = -3

Query  483  MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpfllIRMLH  304
            MAS PG+ +EWPW  LGSFK+VVLAP+V +  Y  +     E++    LIFPFLL RM+H
Sbjct  1    MASMPGVFSEWPWKPLGSFKHVVLAPWVINHIYSIVVK--GEKENPSYLIFPFLLWRMVH  58

Query  303  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  124
            NQLWISLSRYRTAKG+NRI+DKGIEF+QVDRERNWDDQ++LNG+LFY G   +P  + MP
Sbjct  59   NQLWISLSRYRTAKGNNRIIDKGIEFDQVDRERNWDDQVLLNGILFYVGAMVIPQANRMP  118

Query  123  IWRTDGIILTALIHTGPVEFLYYWLHRALHHHIL  22
            +WR D II+T L+H GPVEFLYYW HR LHHH L
Sbjct  119  MWRADSIIITILLHIGPVEFLYYWFHRLLHHHYL  152



>ref|XP_010041339.1| PREDICTED: protein ECERIFERUM 1-like, partial [Eucalyptus grandis]
Length=355

 Score =   193 bits (490),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 95/154 (62%), Positives = 118/154 (77%), Gaps = 16/154 (10%)
 Frame = -3

Query  483  MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpfllIRMLH  304
            MAS+PGILT+WPW  LGSFKYV+LAP++AH TY++                PFLL RMLH
Sbjct  1    MASKPGILTDWPWKPLGSFKYVILAPWMAHGTYQF----------------PFLLERMLH  44

Query  303  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  124
            NQ+WISLSR+RTAKG+NRI+D+GIEFEQVDRE NWDDQI+L  +L Y  ++ +P   H+P
Sbjct  45   NQIWISLSRHRTAKGNNRILDRGIEFEQVDRESNWDDQILLTAILLYMTHWTIPQASHLP  104

Query  123  IWRTDGIILTALIHTGPVEFLYYWLHRALHHHIL  22
             W+TDG+I+T LIH   VE++YYWLHRALHHH L
Sbjct  105  FWKTDGVIITVLIHALVVEYIYYWLHRALHHHFL  138



>ref|XP_010255638.1| PREDICTED: protein ECERIFERUM 1-like isoform X1 [Nelumbo nucifera]
Length=713

 Score =   199 bits (507),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 99/154 (64%), Positives = 124/154 (81%), Gaps = 0/154 (0%)
 Frame = -3

Query  483  MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpfllIRMLH  304
            MA+ PG LT WPW  LGSFKYVVLAP+VAHS Y ++T  P +RD   LLI P+LL R++H
Sbjct  94   MATTPGPLTSWPWQKLGSFKYVVLAPWVAHSIYSFVTKDPKDRDLTNLLILPYLLWRLVH  153

Query  303  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  124
            +Q WI+L+R++TAK  +RI+DKGIEFEQVDRERNWDD I+LNG+LFY     L  + ++P
Sbjct  154  HQAWITLARHQTAKSKHRILDKGIEFEQVDRERNWDDLILLNGILFYMANLILNESKNLP  213

Query  123  IWRTDGIILTALIHTGPVEFLYYWLHRALHHHIL  22
            +WRTDG++L+ L+H GPVEFLYYWLHRALHHH L
Sbjct  214  MWRTDGVVLSFLLHMGPVEFLYYWLHRALHHHFL  247



>gb|KCW44429.1| hypothetical protein EUGRSUZ_L02074 [Eucalyptus grandis]
Length=398

 Score =   194 bits (492),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 95/154 (62%), Positives = 118/154 (77%), Gaps = 16/154 (10%)
 Frame = -3

Query  483  MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpfllIRMLH  304
            MAS+PGILT+WPW  LGSFKYV+LAP++AH TY++                PFLL RMLH
Sbjct  1    MASKPGILTDWPWKPLGSFKYVILAPWMAHGTYQF----------------PFLLERMLH  44

Query  303  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  124
            NQ+WISLSR+RTAKG+NRI+D+GIEFEQVDRE NWDDQI+L  +L Y  ++ +P   H+P
Sbjct  45   NQIWISLSRHRTAKGNNRILDRGIEFEQVDRESNWDDQILLTAILLYMTHWTIPQASHLP  104

Query  123  IWRTDGIILTALIHTGPVEFLYYWLHRALHHHIL  22
             W+TDG+I+T LIH   VE++YYWLHRALHHH L
Sbjct  105  FWKTDGVIITVLIHALVVEYIYYWLHRALHHHFL  138



>ref|XP_009376850.1| PREDICTED: protein ECERIFERUM 1-like [Pyrus x bretschneideri]
Length=620

 Score =   198 bits (503),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 95/154 (62%), Positives = 119/154 (77%), Gaps = 0/154 (0%)
 Frame = -3

Query  483  MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpfllIRMLH  304
            MAS PGILT+WPW  LGSFKY+++AP+V HST  ++ +   ERD    LIFP +L RM+H
Sbjct  1    MASMPGILTDWPWKPLGSFKYLIMAPWVIHSTLLFMVNGGKERDITYFLIFPLMLWRMIH  60

Query  303  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  124
            NQ+WI+LSRYRTAKG+ RI+DKG+EF+QVDRERNWDDQI+ NG L Y          ++P
Sbjct  61   NQIWITLSRYRTAKGNGRILDKGLEFDQVDRERNWDDQILFNGALMYLSNRLFSGAQNVP  120

Query  123  IWRTDGIILTALIHTGPVEFLYYWLHRALHHHIL  22
            +WRTDG++ T L+H GPVE+LYYW HRALHHH L
Sbjct  121  LWRTDGVVSTILLHAGPVEYLYYWFHRALHHHYL  154



>ref|XP_003625024.1| Protein WAX2 [Medicago truncatula]
 gb|ABN07985.1| Sterol desaturase [Medicago truncatula]
 gb|AES81242.1| fatty acid hydroxylase superfamily protein [Medicago truncatula]
Length=617

 Score =   198 bits (503),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 96/154 (62%), Positives = 122/154 (79%), Gaps = 3/154 (2%)
 Frame = -3

Query  483  MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpfllIRMLH  304
            MAS+PGILT WPW  LGSFK+V++ P++AHS Y ++     ERDP   +IFPF L+RMLH
Sbjct  1    MASKPGILTNWPWEPLGSFKFVIVIPWIAHSIYTFIW---GERDPVYYIIFPFALVRMLH  57

Query  303  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  124
            NQ+W S+SRY+TAKG NRIVDKG+EFEQVDRE +WDDQ++   L++   Y+  P+  ++P
Sbjct  58   NQIWTSVSRYQTAKGKNRIVDKGLEFEQVDRETHWDDQMLFTVLVYCIAYFIFPMASNLP  117

Query  123  IWRTDGIILTALIHTGPVEFLYYWLHRALHHHIL  22
             WR DG+ILTA++H GPVEFLYYWLHRALHHH L
Sbjct  118  WWRIDGVILTAILHAGPVEFLYYWLHRALHHHYL  151



>ref|XP_004145021.1| PREDICTED: protein ECERIFERUM 1-like [Cucumis sativus]
 ref|XP_004153200.1| PREDICTED: protein ECERIFERUM 1-like [Cucumis sativus]
 gb|KGN46281.1| hypothetical protein Csa_6G079750 [Cucumis sativus]
Length=618

 Score =   197 bits (502),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 98/154 (64%), Positives = 123/154 (80%), Gaps = 1/154 (1%)
 Frame = -3

Query  483  MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpfllIRMLH  304
            MAS+PGILT+WPW  LGSFK+V+L P+V HS+Y Y      +RD + +LIFPFL++RM+H
Sbjct  1    MASKPGILTDWPWKPLGSFKFVILTPWVIHSSYLYFKGG-EKRDLSYILIFPFLVLRMIH  59

Query  303  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  124
            NQ+WISLSRY+TAKG  RIVDK IEFEQVDRE +WDDQI+ NGLLF  G   +    ++P
Sbjct  60   NQIWISLSRYQTAKGTKRIVDKPIEFEQVDRESSWDDQILFNGLLFCLGRMVVEKGENLP  119

Query  123  IWRTDGIILTALIHTGPVEFLYYWLHRALHHHIL  22
            +WRT+G+++ AL+H GPVEFLYYW HRALHHH L
Sbjct  120  LWRTNGVVIAALLHAGPVEFLYYWFHRALHHHFL  153



>ref|XP_006306552.1| hypothetical protein CARUB_v10012639mg [Capsella rubella]
 gb|EOA39450.1| hypothetical protein CARUB_v10012639mg [Capsella rubella]
Length=626

 Score =   197 bits (502),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 96/154 (62%), Positives = 115/154 (75%), Gaps = 0/154 (0%)
 Frame = -3

Query  483  MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpfllIRMLH  304
            MASRPG LTEWPW+ LG FKY+++APF   S + Y+T    E+D   +LI   +L RM+H
Sbjct  1    MASRPGFLTEWPWSPLGGFKYLLVAPFALASMHSYITAEEEEKDLGRMLIVALMLWRMVH  60

Query  303  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  124
             Q+WIS+SR +TAKG N+IVDK IEFEQVDRER+WDDQII N LL Y    KLP +  +P
Sbjct  61   CQIWISVSRQKTAKGRNKIVDKPIEFEQVDRERSWDDQIIFNTLLMYLLNNKLPGSSRLP  120

Query  123  IWRTDGIILTALIHTGPVEFLYYWLHRALHHHIL  22
            +WR DG IL AL+H GPVEFLYYW HRALHHH L
Sbjct  121  LWRLDGAILIALLHAGPVEFLYYWFHRALHHHFL  154



>ref|XP_006306997.1| hypothetical protein CARUB_v10008574mg [Capsella rubella]
 gb|EOA39895.1| hypothetical protein CARUB_v10008574mg [Capsella rubella]
Length=629

 Score =   197 bits (502),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 95/154 (62%), Positives = 118/154 (77%), Gaps = 0/154 (0%)
 Frame = -3

Query  483  MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpfllIRMLH  304
            MASRPG LTEWPW+ LG+FKY+++APFV  S + Y+T +  E+D + L+I   +L R++H
Sbjct  1    MASRPGALTEWPWSPLGNFKYLLVAPFVMASMHTYVTVADEEKDLSRLMIVALMLWRIIH  60

Query  303  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  124
            +Q+WIS+SR RTAKG  +IVDK IEFEQVDRER WDDQII N LL Y    KLP   H+P
Sbjct  61   SQIWISVSRQRTAKGTRKIVDKPIEFEQVDRERTWDDQIIFNTLLMYLANIKLPGASHLP  120

Query  123  IWRTDGIILTALIHTGPVEFLYYWLHRALHHHIL  22
            +WR DG +L AL+H GPVEFLYYW HRALHH+ L
Sbjct  121  LWRLDGALLMALLHAGPVEFLYYWFHRALHHYFL  154



>ref|XP_006375527.1| hypothetical protein POPTR_0014s15110g [Populus trichocarpa]
 gb|ERP53324.1| hypothetical protein POPTR_0014s15110g [Populus trichocarpa]
Length=622

 Score =   197 bits (501),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 99/144 (69%), Positives = 119/144 (83%), Gaps = 2/144 (1%)
 Frame = -3

Query  483  MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpfllIRMLH  304
            MASRPGILT+WPW  LGSFK+V+LAP V H+ Y ++    +E+D +  LIFP LL R+LH
Sbjct  1    MASRPGILTDWPWKPLGSFKHVILAPCVIHNIYAFMVK--DEKDLSSFLIFPILLWRVLH  58

Query  303  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  124
            NQLWISLSRYRTAKG+NRI+DKGIEF+QVDRERNWDDQI+ NG+LFY     +P   ++P
Sbjct  59   NQLWISLSRYRTAKGNNRIIDKGIEFDQVDRERNWDDQILFNGILFYVSSKIIPGASYLP  118

Query  123  IWRTDGIILTALIHTGPVEFLYYW  52
            +WR DG+ILTALIHTGPVEFLYYW
Sbjct  119  MWRLDGVILTALIHTGPVEFLYYW  142



>ref|XP_002320584.1| ECERIFERUM 1 family protein [Populus trichocarpa]
 gb|EEE98899.1| ECERIFERUM 1 family protein [Populus trichocarpa]
Length=622

 Score =   197 bits (500),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 97/144 (67%), Positives = 118/144 (82%), Gaps = 2/144 (1%)
 Frame = -3

Query  483  MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpfllIRMLH  304
            MASRPGILT+WPW  LGSFK+V+LAP+V HSTY ++    + +D +  L FP LL RMLH
Sbjct  1    MASRPGILTDWPWKPLGSFKHVILAPWVIHSTYSFMIK--DGKDLSTFLAFPLLLWRMLH  58

Query  303  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  124
            NQLWISLSRYRTAKG+NRI+DK IEF+QVDRE +WDDQI+ NG+LFY G + +P   H+P
Sbjct  59   NQLWISLSRYRTAKGNNRIIDKAIEFDQVDRESSWDDQILFNGILFYVGIHTIPGASHLP  118

Query  123  IWRTDGIILTALIHTGPVEFLYYW  52
            +WR DG+I+TALIH GPVEFLYYW
Sbjct  119  MWRLDGVIITALIHMGPVEFLYYW  142



>ref|XP_006375524.1| hypothetical protein POPTR_0014s15080g [Populus trichocarpa]
 gb|ERP53321.1| hypothetical protein POPTR_0014s15080g [Populus trichocarpa]
Length=584

 Score =   196 bits (498),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 99/144 (69%), Positives = 117/144 (81%), Gaps = 2/144 (1%)
 Frame = -3

Query  483  MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpfllIRMLH  304
            MASRPGILT+WPW  LGSFK+V+LAP V H+ Y ++    +E+D    LIFP LL R+LH
Sbjct  1    MASRPGILTDWPWKPLGSFKHVILAPCVIHNIYAFMVK--DEKDLPSFLIFPILLWRVLH  58

Query  303  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  124
            NQLWISLSRYRTAKG+NRI+DKGIEF+QVDRE NWDDQI+ NG+LFY G   +P   H+P
Sbjct  59   NQLWISLSRYRTAKGNNRIIDKGIEFDQVDRESNWDDQILFNGILFYVGSKIIPGASHLP  118

Query  123  IWRTDGIILTALIHTGPVEFLYYW  52
            +WR DG+ILTALIH GPVEFLYYW
Sbjct  119  MWRLDGVILTALIHMGPVEFLYYW  142



>ref|XP_006375521.1| hypothetical protein POPTR_0014s15050g [Populus trichocarpa]
 gb|ERP53318.1| hypothetical protein POPTR_0014s15050g [Populus trichocarpa]
Length=588

 Score =   196 bits (498),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 99/144 (69%), Positives = 117/144 (81%), Gaps = 2/144 (1%)
 Frame = -3

Query  483  MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpfllIRMLH  304
            MASRPGILT+WPW  LGSFK+V+LAP V H+ Y ++    +E+D    LIFP LL R+LH
Sbjct  1    MASRPGILTDWPWKPLGSFKHVILAPCVIHNIYAFMVK--DEKDLPSFLIFPILLWRVLH  58

Query  303  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  124
            NQLWISLSRYRTAKG+NRI+DKGIEF+QVDRE NWDDQI+ NG+LFY G   +P   H+P
Sbjct  59   NQLWISLSRYRTAKGNNRIIDKGIEFDQVDRESNWDDQILFNGILFYVGSKIIPGASHLP  118

Query  123  IWRTDGIILTALIHTGPVEFLYYW  52
            +WR DG+ILTALIH GPVEFLYYW
Sbjct  119  MWRLDGVILTALIHMGPVEFLYYW  142



>ref|XP_008796440.1| PREDICTED: uncharacterized protein LOC103711898 [Phoenix dactylifera]
Length=2179

 Score =   202 bits (513),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 100/161 (62%), Positives = 126/161 (78%), Gaps = 0/161 (0%)
 Frame = -3

Query  483  MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpfllIRMLH  304
            MAS+PG LT+WPW  LG+FKYV+LAP+VAHS +K++ DS  +RD    LIFP LL+R+L+
Sbjct  1    MASQPGPLTQWPWQRLGNFKYVLLAPWVAHSMHKFMADSGEQRDMTNFLIFPILLLRLLY  60

Query  303  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  124
            +QLWI+ SR++TAK  +RIVDK ++F+QVDRERNWDDQIIL  L  Y     +P   H+P
Sbjct  61   SQLWITFSRFQTAKSKHRIVDKSLDFDQVDRERNWDDQIILTALFMYMANMVVPGASHLP  120

Query  123  IWRTDGIILTALIHTGPVEFLYYWLHRALHHHILYSRYHSH  1
             W T G++L  L+H GPVEF+YYWLHRALHHH LYSRYHSH
Sbjct  121  WWETRGVVLIILLHMGPVEFIYYWLHRALHHHFLYSRYHSH  161


 Score = 78.2 bits (191),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 32/49 (65%), Positives = 39/49 (80%), Gaps = 0/49 (0%)
 Frame = -3

Query  147   LPITHHMPIWRTDGIILTALIHTGPVEFLYYWLHRALHHHILYSRYHSH  1
             +P   H+P W + G++L  L+H GPVEF+YYWLHRALHHH LYSRYHSH
Sbjct  1671  VPGASHLPWWESRGVVLIILLHMGPVEFIYYWLHRALHHHFLYSRYHSH  1719



>ref|XP_006418508.1| hypothetical protein EUTSA_v10007056mg [Eutrema salsugineum]
 gb|ESQ36861.1| hypothetical protein EUTSA_v10007056mg [Eutrema salsugineum]
Length=631

 Score =   196 bits (499),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 94/154 (61%), Positives = 114/154 (74%), Gaps = 0/154 (0%)
 Frame = -3

Query  483  MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpfllIRMLH  304
            MASRPG LTEWPW+ LGSFKY+++AP V  S + Y+T    E+D   L I   +L R++H
Sbjct  1    MASRPGALTEWPWSSLGSFKYLLVAPLVMASMHSYVTAEDEEKDLGRLAIVALMLWRIVH  60

Query  303  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  124
            +Q+WIS++R RTA G  +IVDK IEFEQVDRER WDDQII N LL Y   +KLP +  +P
Sbjct  61   SQIWISVARQRTAMGRKKIVDKPIEFEQVDRERTWDDQIIFNTLLMYLANFKLPGSCRLP  120

Query  123  IWRTDGIILTALIHTGPVEFLYYWLHRALHHHIL  22
            +WR DG IL AL+H GPVEFLYYW HRALHHH L
Sbjct  121  LWRLDGAILMALLHAGPVEFLYYWFHRALHHHFL  154



>ref|XP_011005107.1| PREDICTED: protein ECERIFERUM 1-like [Populus euphratica]
Length=622

 Score =   196 bits (499),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 97/144 (67%), Positives = 116/144 (81%), Gaps = 2/144 (1%)
 Frame = -3

Query  483  MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpfllIRMLH  304
            MASRPGILT+WPW  LGSFK V+LAP+V HSTY ++    +E+D +  L+F  LL RM+H
Sbjct  1    MASRPGILTDWPWKPLGSFKRVILAPWVIHSTYSFMVK--DEKDLSTFLMFLILLWRMIH  58

Query  303  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  124
             QLWISLSRYRTAKG+NRI+DKGIEF+QVDRE NWDDQI+ NG+L Y G   +P   ++P
Sbjct  59   TQLWISLSRYRTAKGNNRIIDKGIEFDQVDRESNWDDQILFNGILLYVGRKIIPGASYLP  118

Query  123  IWRTDGIILTALIHTGPVEFLYYW  52
            IWR DG+ILTALIH GPVEFLYYW
Sbjct  119  IWRLDGVILTALIHMGPVEFLYYW  142



>ref|XP_010255641.1| PREDICTED: protein ECERIFERUM 1-like [Nelumbo nucifera]
Length=623

 Score =   196 bits (498),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 101/154 (66%), Positives = 121/154 (79%), Gaps = 0/154 (0%)
 Frame = -3

Query  483  MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpfllIRMLH  304
            MASRPG LT WPW  LG+FKYV+LAP+  HST++++T    ERD    L+FPFLL RMLH
Sbjct  1    MASRPGPLTNWPWKKLGNFKYVILAPWAVHSTHQFVTKDEKERDLGYSLVFPFLLWRMLH  60

Query  303  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  124
             Q+WISL+R RTA+  +RIV KGIEFEQVDRERNWDDQII NG+L+Y     LP    +P
Sbjct  61   AQIWISLARNRTAESKHRIVHKGIEFEQVDRERNWDDQIIFNGILYYLAINLLPGASRIP  120

Query  123  IWRTDGIILTALIHTGPVEFLYYWLHRALHHHIL  22
            ++R DGI+LT+L+H G VEFLYYWLHRALHHHIL
Sbjct  121  MFRWDGILLTSLLHAGLVEFLYYWLHRALHHHIL  154



>ref|XP_008344085.1| PREDICTED: protein ECERIFERUM 1-like [Malus domestica]
Length=620

 Score =   196 bits (498),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 94/154 (61%), Positives = 120/154 (78%), Gaps = 0/154 (0%)
 Frame = -3

Query  483  MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpfllIRMLH  304
            MAS PGILT+WPW  LGSFKY+++AP+V HST  ++ +   +RD   +LIFP +L RM+H
Sbjct  1    MASMPGILTDWPWKPLGSFKYLIMAPWVIHSTMLFMMNDGKDRDIAYILIFPLMLWRMIH  60

Query  303  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  124
            NQ+WI+LSRYRTAKG+ RI+DKG+EF+QVDRERNWDDQI+ NG L Y          ++P
Sbjct  61   NQIWITLSRYRTAKGNGRILDKGLEFDQVDRERNWDDQILFNGTLMYLSNRLFSGAQNVP  120

Query  123  IWRTDGIILTALIHTGPVEFLYYWLHRALHHHIL  22
            +WRTDG++ T L+H GPVE+LYYW HRALHHH L
Sbjct  121  LWRTDGVVATILLHAGPVEYLYYWFHRALHHHYL  154



>ref|XP_011085187.1| PREDICTED: protein ECERIFERUM 1-like [Sesamum indicum]
Length=597

 Score =   196 bits (497),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 98/154 (64%), Positives = 120/154 (78%), Gaps = 0/154 (0%)
 Frame = -3

Query  483  MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpfllIRMLH  304
            MA++PG LT+WPW  LGSFKY++LAP+   S Y+  T+   ERD   LLI PFLL R LH
Sbjct  1    MATKPGFLTDWPWKHLGSFKYIILAPWGMQSIYRAATEGEKERDYTNLLIIPFLLWRALH  60

Query  303  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  124
            NQ+WIS+SRYRTAKG+NRIV + IEFEQVDRE NWDDQI+LNG+L Y+    L     +P
Sbjct  61   NQIWISISRYRTAKGNNRIVHRSIEFEQVDRESNWDDQILLNGILLYFFNTILGKPAFLP  120

Query  123  IWRTDGIILTALIHTGPVEFLYYWLHRALHHHIL  22
            +WRTDG+I+T L+H GPVE++YYWLHRALHHH L
Sbjct  121  VWRTDGVIITILLHVGPVEYIYYWLHRALHHHYL  154



>gb|KDP34470.1| hypothetical protein JCGZ_12753 [Jatropha curcas]
Length=281

 Score =   188 bits (477),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 93/154 (60%), Positives = 112/154 (73%), Gaps = 0/154 (0%)
 Frame = -3

Query  483  MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpfllIRMLH  304
            MAS+PGILTEWPW  LGSFKY++L P++A S Y +      ERD    +IFP L++R LH
Sbjct  1    MASKPGILTEWPWRSLGSFKYLILGPWIAQSIYSFTVKEEKERDLFNFIIFPVLILRFLH  60

Query  303  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  124
            NQ+WIS SRY TAKG  RIVDK IEFEQ++RE NWDDQIIL G+L Y     +      P
Sbjct  61   NQIWISFSRYLTAKGRKRIVDKDIEFEQLERESNWDDQIILQGILSYILNKAITGASKFP  120

Query  123  IWRTDGIILTALIHTGPVEFLYYWLHRALHHHIL  22
            +WRTD +++  L+H GPVEFLYYWLHRALHHH L
Sbjct  121  LWRTDSVVIIILLHAGPVEFLYYWLHRALHHHFL  154



>ref|XP_009410811.1| PREDICTED: protein ECERIFERUM 1-like [Musa acuminata subsp. malaccensis]
Length=620

 Score =   196 bits (497),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 98/161 (61%), Positives = 119/161 (74%), Gaps = 0/161 (0%)
 Frame = -3

Query  483  MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpfllIRMLH  304
            MAS+PG LT+WPW  LG+ KYV+LAP +AHS +K++T  P +RD    LI P LL+R+LH
Sbjct  1    MASQPGPLTQWPWQRLGNMKYVLLAPLLAHSVHKFMTVKPEDRDMFNFLIIPSLLMRLLH  60

Query  303  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  124
             QLWI+LSR +TA   + IVDK ++FEQVDRERNWDDQII   +L Y     +P   H+P
Sbjct  61   AQLWITLSRMKTANSKHSIVDKSLDFEQVDRERNWDDQIIFTAILAYVVNKVIPGASHLP  120

Query  123  IWRTDGIILTALIHTGPVEFLYYWLHRALHHHILYSRYHSH  1
             W T G IL +L+H GPVEFLYYW HRALHHH LYSRYHSH
Sbjct  121  WWNTRGAILISLLHIGPVEFLYYWFHRALHHHYLYSRYHSH  161



>gb|KFK42593.1| hypothetical protein AALP_AA1G015500 [Arabis alpina]
Length=628

 Score =   195 bits (496),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 96/154 (62%), Positives = 114/154 (74%), Gaps = 0/154 (0%)
 Frame = -3

Query  483  MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpfllIRMLH  304
            MASRPG LTEWPW+ LGSFKY+++AP V  S + Y+T   +E+D   LLI   +L R++H
Sbjct  1    MASRPGALTEWPWSPLGSFKYLLVAPLVIASMHSYVTSEEDEKDLGRLLIVALMLWRIVH  60

Query  303  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  124
            + +WIS+SR RTAKG  +IVDK IEFEQVDRER WDDQII N LL Y    KLP    +P
Sbjct  61   SLIWISVSRQRTAKGRKKIVDKPIEFEQVDRERTWDDQIIFNTLLMYLAIMKLPGAARLP  120

Query  123  IWRTDGIILTALIHTGPVEFLYYWLHRALHHHIL  22
            +WR DG IL AL+H GPVEFLYYW HRALHHH L
Sbjct  121  LWRPDGAILMALLHAGPVEFLYYWFHRALHHHFL  154



>gb|ACR38546.1| unknown [Zea mays]
 gb|AFW72382.1| hypothetical protein ZEAMMB73_077345 [Zea mays]
Length=623

 Score =   195 bits (495),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 94/154 (61%), Positives = 114/154 (74%), Gaps = 0/154 (0%)
 Frame = -3

Query  483  MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpfllIRMLH  304
            MA+RPG LTEWPW  LG+FKY+V+AP   H   + +     + D    LI P LL+RM+H
Sbjct  1    MATRPGPLTEWPWQRLGNFKYLVMAPVAVHGARRVVARGWGDIDLAFALILPSLLLRMVH  60

Query  303  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  124
            NQ+WIS +RY+TA+  +RIVD+GIEF+QVDRER WDDQIILNGLLFY GY  +P    MP
Sbjct  61   NQIWISAARYQTARSKHRIVDRGIEFDQVDRERGWDDQIILNGLLFYVGYLAIPSARRMP  120

Query  123  IWRTDGIILTALIHTGPVEFLYYWLHRALHHHIL  22
             WR+DG +  AL+H GPVEFLYYW HRALHHH L
Sbjct  121  AWRSDGAVAMALLHAGPVEFLYYWFHRALHHHFL  154



>gb|KFK36660.1| hypothetical protein AALP_AA4G153400 [Arabis alpina]
Length=625

 Score =   195 bits (495),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 97/154 (63%), Positives = 112/154 (73%), Gaps = 4/154 (3%)
 Frame = -3

Query  483  MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpfllIRMLH  304
            MASRPG LTEWPWT LGSFKY+VLAP V  S Y Y T     RD   L I    + R++H
Sbjct  1    MASRPGFLTEWPWTPLGSFKYLVLAPLVMDSIYSYAT----LRDHEKLFIVAVTVWRIVH  56

Query  303  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  124
            +Q WIS SRYRTAKG  RIV+K IEF+QVDRER WDDQ+ILN LLFY     +  T+ +P
Sbjct  57   SQAWISFSRYRTAKGTKRIVNKSIEFDQVDRERTWDDQVILNTLLFYLVKVYVTGTNTLP  116

Query  123  IWRTDGIILTALIHTGPVEFLYYWLHRALHHHIL  22
             WRTDG +LTA++H GPVEF+YYW HRALHHH L
Sbjct  117  FWRTDGAVLTAILHAGPVEFIYYWFHRALHHHFL  150



>ref|XP_004953128.1| PREDICTED: protein ECERIFERUM 1-like [Setaria italica]
Length=620

 Score =   195 bits (495),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 97/155 (63%), Positives = 115/155 (74%), Gaps = 1/155 (1%)
 Frame = -3

Query  483  MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSP-NERDPNillifpfllIRML  307
            MA+RPG LTEWPW  LG+FKYVV+AP V H + +        E D    LI P LL+RM+
Sbjct  1    MATRPGPLTEWPWQRLGNFKYVVMAPVVVHGSRRVAGAGGWGELDLAFALILPSLLLRMV  60

Query  306  HNQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHM  127
            HNQ+WIS +RY+TA+  +RIVD+GI+F+QVDRER WDDQIILNGLLFY  Y  +P   HM
Sbjct  61   HNQIWISAARYQTARSKHRIVDRGIDFDQVDRERGWDDQIILNGLLFYVAYLLIPSARHM  120

Query  126  PIWRTDGIILTALIHTGPVEFLYYWLHRALHHHIL  22
            P WRTDG +  AL+H GPVEFLYYW HRALHHH L
Sbjct  121  PAWRTDGAVAMALLHAGPVEFLYYWFHRALHHHFL  155



>ref|NP_001064826.1| Os10g0471100 [Oryza sativa Japonica Group]
 gb|AAG21908.1|AC026815_12 putative CER1 [Oryza sativa Japonica Group]
 gb|AAP54228.1| CER1 protein, putative, expressed [Oryza sativa Japonica Group]
 dbj|BAF26740.1| Os10g0471100 [Oryza sativa Japonica Group]
 gb|EEE51118.1| hypothetical protein OsJ_31858 [Oryza sativa Japonica Group]
Length=621

 Score =   195 bits (495),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 96/156 (62%), Positives = 117/156 (75%), Gaps = 0/156 (0%)
 Frame = -3

Query  483  MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpfllIRMLH  304
            MA+ PG+ TEWPW  LGSFKYV+LAP+VAH  Y+  T    E D   + I P LL+RMLH
Sbjct  1    MATNPGLFTEWPWKKLGSFKYVLLAPWVAHGWYEVATKGWREVDLGYIAILPSLLLRMLH  60

Query  303  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  124
            NQ WI++SR + A+G  +IV +GIEF+QVDRERNWDDQIIL+G+L Y G   +P   H+P
Sbjct  61   NQAWITISRLQNARGRRQIVRRGIEFDQVDRERNWDDQIILSGILLYLGALYVPGGQHLP  120

Query  123  IWRTDGIILTALIHTGPVEFLYYWLHRALHHHILYS  16
            +WRTDG  L AL+H GPVEFLYYW HRALHHH LY+
Sbjct  121  LWRTDGAGLIALLHAGPVEFLYYWFHRALHHHFLYT  156



>ref|XP_002454185.1| hypothetical protein SORBIDRAFT_04g026320 [Sorghum bicolor]
 gb|EES07161.1| hypothetical protein SORBIDRAFT_04g026320 [Sorghum bicolor]
Length=619

 Score =   194 bits (494),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 95/154 (62%), Positives = 113/154 (73%), Gaps = 0/154 (0%)
 Frame = -3

Query  483  MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpfllIRMLH  304
            MA+RPG LTEWPW  LG+FKY+V+ P V     + +     + D    LI P LL+RM H
Sbjct  1    MATRPGPLTEWPWQRLGNFKYLVMGPVVVDGARRVVARGWGDIDLAFALILPSLLLRMAH  60

Query  303  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  124
            NQ+WIS +RY+TA+  +RIVD+GIEFEQVDRER WDDQIILNGLLFY GY  +P   H+P
Sbjct  61   NQIWISAARYQTARSKHRIVDRGIEFEQVDRERGWDDQIILNGLLFYAGYLAIPSARHLP  120

Query  123  IWRTDGIILTALIHTGPVEFLYYWLHRALHHHIL  22
             WRTDG  + AL+H GPVEFLYYW HRALHHH L
Sbjct  121  AWRTDGAAVMALLHAGPVEFLYYWFHRALHHHFL  154



>emb|CAA65199.1| CER1-like [Arabidopsis thaliana]
Length=622

 Score =   194 bits (494),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 94/154 (61%), Positives = 113/154 (73%), Gaps = 0/154 (0%)
 Frame = -3

Query  483  MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpfllIRMLH  304
            MASRPG LTEWPW+ LGSFKY+++AP V  S + Y+T    E+D + L+I   +L R++H
Sbjct  1    MASRPGALTEWPWSPLGSFKYLLVAPLVMASMHSYVTAVDEEKDLSRLMIVVLMLWRIVH  60

Query  303  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  124
            +Q+WIS+SR RT KG N+IVDK IEFEQVDRER WDDQ+I N LL Y    KLP   H+P
Sbjct  61   SQIWISVSRQRTGKGTNKIVDKPIEFEQVDRERTWDDQVIFNTLLMYLANIKLPGASHLP  120

Query  123  IWRTDGIILTALIHTGPVEFLYYWLHRALHHHIL  22
             WR DG IL  L+H GPVEFLYYW HR LHHH L
Sbjct  121  PWRVDGGILMVLLHAGPVEFLYYWFHRGLHHHFL  154



>emb|CAA65200.1| CER1-like [Arabidopsis thaliana]
Length=623

 Score =   194 bits (494),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 94/154 (61%), Positives = 113/154 (73%), Gaps = 0/154 (0%)
 Frame = -3

Query  483  MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpfllIRMLH  304
            MASRPG LTEWPW+ LGSFKY+++AP V  S + Y+T    E+D + L+I   +L R++H
Sbjct  1    MASRPGALTEWPWSPLGSFKYLLVAPLVMASMHSYVTAVDEEKDLSRLMIVVLMLWRIVH  60

Query  303  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  124
            +Q+WIS+SR RT KG N+IVDK IEFEQVDRER WDDQ+I N LL Y    KLP   H+P
Sbjct  61   SQIWISVSRQRTGKGTNKIVDKPIEFEQVDRERTWDDQVIFNTLLMYLANIKLPGASHLP  120

Query  123  IWRTDGIILTALIHTGPVEFLYYWLHRALHHHIL  22
             WR DG IL  L+H GPVEFLYYW HR LHHH L
Sbjct  121  PWRVDGGILMVLLHAGPVEFLYYWFHRGLHHHFL  154



>ref|XP_010480305.1| PREDICTED: protein CER1-like 1 isoform X1 [Camelina sativa]
Length=629

 Score =   194 bits (493),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 93/154 (60%), Positives = 113/154 (73%), Gaps = 0/154 (0%)
 Frame = -3

Query  483  MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpfllIRMLH  304
            MASRPG+LTEWPW+ LG FKY+++ P    S Y Y+T    E+D   +LI   +L R++H
Sbjct  1    MASRPGVLTEWPWSPLGGFKYLLVVPLAIGSIYSYMTAEEEEKDLGRMLIVALMLWRIVH  60

Query  303  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  124
            +Q+WIS+SR +TAKG  +IVDK IEFEQVDRER+WDDQII N L  Y    KLP +  +P
Sbjct  61   SQIWISVSRKKTAKGTKKIVDKPIEFEQVDRERSWDDQIIFNTLFMYLLNSKLPGSSRVP  120

Query  123  IWRTDGIILTALIHTGPVEFLYYWLHRALHHHIL  22
            IWR DG IL AL+H GPVEFLYYW HRALHHH L
Sbjct  121  IWRLDGAILIALVHAGPVEFLYYWFHRALHHHFL  154



>ref|XP_010479268.1| PREDICTED: protein CER1-like 1 [Camelina sativa]
 ref|XP_010496715.1| PREDICTED: protein CER1-like 1 [Camelina sativa]
Length=630

 Score =   194 bits (493),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 95/155 (61%), Positives = 118/155 (76%), Gaps = 1/155 (1%)
 Frame = -3

Query  483  MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNE-RDPNillifpfllIRML  307
            MAS+PG LTEWPW+ LGSFKY+++APFV  S + Y+T +  + +D + L+I   +L R++
Sbjct  1    MASKPGALTEWPWSPLGSFKYLLVAPFVMASMHSYVTVADEDHKDFSRLMIVVLMLWRIV  60

Query  306  HNQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHM  127
            H+Q+WIS+SR RTAKG  +IVDK IEFEQVDRER WDDQII N LL Y    KLP   H+
Sbjct  61   HSQIWISVSRQRTAKGTTKIVDKPIEFEQVDRERTWDDQIIFNTLLMYLANIKLPGASHL  120

Query  126  PIWRTDGIILTALIHTGPVEFLYYWLHRALHHHIL  22
            P+WR DG +L AL+H GPVEFLYYW HRALHHH L
Sbjct  121  PLWRLDGALLMALLHAGPVEFLYYWFHRALHHHFL  155



>ref|XP_010920316.1| PREDICTED: protein ECERIFERUM 1-like [Elaeis guineensis]
Length=618

 Score =   194 bits (492),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 103/161 (64%), Positives = 124/161 (77%), Gaps = 0/161 (0%)
 Frame = -3

Query  483  MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpfllIRMLH  304
            MASRPGILTEWPW  LG+FKYV++AP+V H  +   T    E D + L IFP LL+RMLH
Sbjct  1    MASRPGILTEWPWHRLGNFKYVIMAPWVLHGLHMMATKGWRETDLSYLTIFPSLLLRMLH  60

Query  303  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  124
            NQ+WISL+R++ A+  +RIVDK IEFEQVDRERNWDDQI+L G L Y G+  +P   + P
Sbjct  61   NQVWISLARFQNARSKHRIVDKSIEFEQVDRERNWDDQILLYGWLLYLGHTFIPGAQNAP  120

Query  123  IWRTDGIILTALIHTGPVEFLYYWLHRALHHHILYSRYHSH  1
            +WRTDG ++  L+H GPVEFLYYW HRALHHH LYSRYHSH
Sbjct  121  LWRTDGAVIAVLLHMGPVEFLYYWFHRALHHHFLYSRYHSH  161



>ref|XP_010480306.1| PREDICTED: protein CER1-like 1 isoform X2 [Camelina sativa]
Length=625

 Score =   194 bits (492),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 93/154 (60%), Positives = 113/154 (73%), Gaps = 0/154 (0%)
 Frame = -3

Query  483  MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpfllIRMLH  304
            MASRPG+LTEWPW+ LG FKY+++ P    S Y Y+T    E+D   +LI   +L R++H
Sbjct  1    MASRPGVLTEWPWSPLGGFKYLLVVPLAIGSIYSYMTAEEEEKDLGRMLIVALMLWRIVH  60

Query  303  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  124
            +Q+WIS+SR +TAKG  +IVDK IEFEQVDRER+WDDQII N L  Y    KLP +  +P
Sbjct  61   SQIWISVSRKKTAKGTKKIVDKPIEFEQVDRERSWDDQIIFNTLFMYLLNSKLPGSSRVP  120

Query  123  IWRTDGIILTALIHTGPVEFLYYWLHRALHHHIL  22
            IWR DG IL AL+H GPVEFLYYW HRALHHH L
Sbjct  121  IWRLDGAILIALVHAGPVEFLYYWFHRALHHHFL  154



>ref|XP_008460068.1| PREDICTED: protein ECERIFERUM 1-like [Cucumis melo]
 gb|ADN34102.1| sterol desaturase [Cucumis melo subsp. melo]
Length=618

 Score =   193 bits (491),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 97/154 (63%), Positives = 121/154 (79%), Gaps = 1/154 (1%)
 Frame = -3

Query  483  MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpfllIRMLH  304
            MAS+PGILT+WPW  LG +K+V+L P+V HST  Y  +   + D + +LIFPFLL+RM+H
Sbjct  1    MASKPGILTDWPWKPLGKYKFVILTPWVIHSTSLYFREE-EKGDLSYILIFPFLLLRMIH  59

Query  303  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  124
            NQ+WISLSRY+TAKG  RIVDK IEFEQVDRE +WDDQI+ NGLLF  G   +    ++P
Sbjct  60   NQIWISLSRYQTAKGTKRIVDKPIEFEQVDRESSWDDQILFNGLLFCLGRMVVEKGEYLP  119

Query  123  IWRTDGIILTALIHTGPVEFLYYWLHRALHHHIL  22
            +WRTDG+++ AL+H GPVEFLYYW HRALHHH L
Sbjct  120  LWRTDGVVMAALLHAGPVEFLYYWFHRALHHHFL  153



>ref|XP_010276564.1| PREDICTED: protein ECERIFERUM 1-like [Nelumbo nucifera]
Length=620

 Score =   193 bits (490),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 97/154 (63%), Positives = 122/154 (79%), Gaps = 0/154 (0%)
 Frame = -3

Query  483  MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpfllIRMLH  304
            MA+ PG LT WPW  LG+FKY+VLAP+VAHS Y +++  P + D   LLIFP+LL RMLH
Sbjct  1    MATTPGPLTNWPWQKLGNFKYLVLAPWVAHSIYSFVSKGPKDGDWTNLLIFPYLLWRMLH  60

Query  303  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  124
            +Q WI+L+RY+TAK  +RI+D+GIEFEQVDRERNWDD I+LNG+LFY          ++P
Sbjct  61   HQAWITLARYQTAKSKHRILDRGIEFEQVDRERNWDDLILLNGILFYMTNLMYDEAKNLP  120

Query  123  IWRTDGIILTALIHTGPVEFLYYWLHRALHHHIL  22
            +WRTDG++L+ L+H GPVEFLYYWLHRALHHH L
Sbjct  121  LWRTDGVVLSFLLHAGPVEFLYYWLHRALHHHFL  154



>ref|XP_010511349.1| PREDICTED: protein CER1-like 1 [Camelina sativa]
Length=629

 Score =   193 bits (490),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 92/154 (60%), Positives = 112/154 (73%), Gaps = 0/154 (0%)
 Frame = -3

Query  483  MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpfllIRMLH  304
            MASRPG+LTEWPW+  G FKY+++ P    S Y Y+T    E+D   +LI   +L R++H
Sbjct  1    MASRPGVLTEWPWSPFGGFKYLLVVPLAIASIYSYMTAEEEEKDLGRMLIVALMLWRIVH  60

Query  303  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  124
            +Q+WIS+SR +TAKG  +IVDK IEFEQVDRER+WDDQII N L  Y    KLP +  +P
Sbjct  61   SQIWISVSRQKTAKGTKKIVDKPIEFEQVDRERSWDDQIIFNTLFMYLLNSKLPGSSRIP  120

Query  123  IWRTDGIILTALIHTGPVEFLYYWLHRALHHHIL  22
            IWR DG IL AL+H GPVEFLYYW HRALHHH L
Sbjct  121  IWRLDGAILIALVHAGPVEFLYYWFHRALHHHFL  154



>gb|EMT04955.1| Protein WAX2 [Aegilops tauschii]
Length=580

 Score =   192 bits (488),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 92/161 (57%), Positives = 116/161 (72%), Gaps = 0/161 (0%)
 Frame = -3

Query  483  MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpfllIRMLH  304
            MA+RPG LTEWPW W+GSFKY+VLAP   H+ +  +T    + +     + P LL+R+ H
Sbjct  1    MATRPGPLTEWPWHWMGSFKYLVLAPAALHTAHSVVTKGWGDMNLVYAAMLPALLLRLFH  60

Query  303  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  124
            NQ+WISLSR++TA+  + IVD+ +EF+QVDRER+WDDQ IL  L FY  Y  +P    MP
Sbjct  61   NQIWISLSRHQTARRKHIIVDRSLEFDQVDRERSWDDQAILATLFFYVAYAAIPSVRLMP  120

Query  123  IWRTDGIILTALIHTGPVEFLYYWLHRALHHHILYSRYHSH  1
            +W T G I  AL+H GPVEF+YYW HRALHHH LYSRYHSH
Sbjct  121  MWETKGAIAIALLHVGPVEFIYYWFHRALHHHFLYSRYHSH  161



>gb|KHG12604.1| Protein WAX2 -like protein [Gossypium arboreum]
Length=619

 Score =   192 bits (489),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 94/162 (58%), Positives = 124/162 (77%), Gaps = 1/162 (1%)
 Frame = -3

Query  483  MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYL-TDSPNERDPNillifpfllIRML  307
            MAS+PG+L++WPW  +G+FKY ++ P   +STY ++     NER+  + L+ PFL+ R++
Sbjct  1    MASKPGVLSDWPWKSMGNFKYALVVPGAIYSTYSFIRCKDENERNWFMFLVLPFLVFRLI  60

Query  306  HNQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHM  127
            H QLWIS SRYRTAKG+NRI+DK I+F+QVDRER+WDDQIILNG+LFY     L    +M
Sbjct  61   HYQLWISYSRYRTAKGNNRILDKSIDFDQVDRERSWDDQIILNGILFYGAGIVLKDQFNM  120

Query  126  PIWRTDGIILTALIHTGPVEFLYYWLHRALHHHILYSRYHSH  1
            P ++ DG ++  L+H GP EFLYYWLHRALHHH LY+RYHSH
Sbjct  121  PFFKADGTLIILLLHWGPAEFLYYWLHRALHHHYLYARYHSH  162



>ref|XP_004308720.1| PREDICTED: protein ECERIFERUM 1-like [Fragaria vesca subsp. vesca]
Length=614

 Score =   192 bits (487),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 102/154 (66%), Positives = 121/154 (79%), Gaps = 3/154 (2%)
 Frame = -3

Query  483  MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpfllIRMLH  304
            MAS PGILT+WPWT LGSFKYVVLAP+V HSTY Y+       D   +LI PF L RMLH
Sbjct  1    MASTPGILTDWPWTPLGSFKYVVLAPWVIHSTYSYMFGEEGT-DLFYILILPFQLWRMLH  59

Query  303  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  124
            NQ+WISLSRY+TA+G + I+DKG+EFEQVDRER+WDDQII NG+LFY G   L +   + 
Sbjct  60   NQIWISLSRYQTARGKS-IIDKGLEFEQVDRERDWDDQIIFNGMLFYVGRCIL-LQTDLQ  117

Query  123  IWRTDGIILTALIHTGPVEFLYYWLHRALHHHIL  22
            IWR DG+++T L+H GPVE+LYYWLHRALHHH L
Sbjct  118  IWRGDGLVMTILLHAGPVEYLYYWLHRALHHHFL  151



>ref|XP_004302222.1| PREDICTED: protein ECERIFERUM 1-like [Fragaria vesca subsp. vesca]
Length=596

 Score =   191 bits (486),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 103/154 (67%), Positives = 120/154 (78%), Gaps = 3/154 (2%)
 Frame = -3

Query  483  MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpfllIRMLH  304
            MAS PGILT+WPWT LG FKYVVLAP+V HSTY Y+       D   +L+ PFLL RMLH
Sbjct  1    MASTPGILTDWPWTPLGKFKYVVLAPWVIHSTYSYMFGE-ESTDLFYILVLPFLLWRMLH  59

Query  303  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  124
            NQ+WISLSRY+TAKG   I+DKG+EFEQVDRER+WDDQII NG+LFY     L  T  +P
Sbjct  60   NQIWISLSRYQTAKG-KAIIDKGLEFEQVDRERDWDDQIIFNGILFYVSRCVLFKTD-LP  117

Query  123  IWRTDGIILTALIHTGPVEFLYYWLHRALHHHIL  22
            IWR DG+++T L+H GPVE+LYYWLHRALHHH L
Sbjct  118  IWRGDGLVMTILLHAGPVEYLYYWLHRALHHHFL  151



>emb|CDY55894.1| BnaA04g29150D [Brassica napus]
Length=616

 Score =   191 bits (485),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 94/154 (61%), Positives = 112/154 (73%), Gaps = 4/154 (3%)
 Frame = -3

Query  483  MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpfllIRMLH  304
            MASRPG+LT+WPWT LGSFKY+VLAP V  S Y Y T     RD   LL+   ++ R++H
Sbjct  1    MASRPGLLTDWPWTPLGSFKYLVLAPLVIDSIYSYAT----MRDHEKLLVVALMVWRIVH  56

Query  303  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  124
            +Q+WIS SRYRTAKG  RIVDK IEF+QVDRER WDDQII N L+ Y     +  T  +P
Sbjct  57   SQVWISFSRYRTAKGTKRIVDKSIEFDQVDRERTWDDQIIFNTLIAYLAKVYMIRTDSLP  116

Query  123  IWRTDGIILTALIHTGPVEFLYYWLHRALHHHIL  22
             WR DG++L AL+H GPVEF+YYW HRALHHH L
Sbjct  117  FWRLDGLVLVALLHAGPVEFIYYWFHRALHHHFL  150



>ref|XP_010493027.1| PREDICTED: protein CER1-like 1 [Camelina sativa]
Length=629

 Score =   191 bits (484),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 93/154 (60%), Positives = 113/154 (73%), Gaps = 0/154 (0%)
 Frame = -3

Query  483  MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpfllIRMLH  304
            MASRPG+LTEWPW+ LG FKY+++AP    S + Y+T    E+D   LLI   +L R++H
Sbjct  1    MASRPGVLTEWPWSPLGGFKYLLVAPLAMASMHSYVTAQEEEKDLASLLIVALMLWRIVH  60

Query  303  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  124
            +Q+WIS+SR +TAKG  +IVDK IEF+QVDRER+WDDQII N L  Y    KLP    MP
Sbjct  61   SQIWISVSRQKTAKGRKKIVDKPIEFDQVDRERSWDDQIIFNTLYMYLLNSKLPGCSRMP  120

Query  123  IWRTDGIILTALIHTGPVEFLYYWLHRALHHHIL  22
            +WR DG IL AL+H GPVEFLYYW HRALHHH L
Sbjct  121  LWRLDGAILIALLHAGPVEFLYYWFHRALHHHFL  154



>ref|NP_001118464.1| protein CER1-like 2 [Arabidopsis thaliana]
 gb|AEC09437.1| protein CER1-like 2 [Arabidopsis thaliana]
Length=493

 Score =   188 bits (478),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 94/154 (61%), Positives = 112/154 (73%), Gaps = 4/154 (3%)
 Frame = -3

Query  483  MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpfllIRMLH  304
            MASRPG LT+WPWT LGSFKY++LAP V  S Y Y T     RD   LLI    + R++H
Sbjct  1    MASRPGFLTDWPWTPLGSFKYLLLAPLVFDSIYSYATI----RDHEKLLIVAVTVWRIVH  56

Query  303  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  124
            +Q+WISLSRY+TAKG  RI++K IEF+QVDRER WDDQII N L+ Y     +  T  +P
Sbjct  57   SQIWISLSRYQTAKGTKRILNKSIEFDQVDRERTWDDQIIFNTLIVYLTKVYVSGTSTIP  116

Query  123  IWRTDGIILTALIHTGPVEFLYYWLHRALHHHIL  22
             WRTDG+IL AL+H GPVEF+YYW HRALHHH L
Sbjct  117  FWRTDGVILVALLHAGPVEFIYYWFHRALHHHFL  150



>ref|XP_006857470.1| hypothetical protein AMTR_s00067p00188650 [Amborella trichopoda]
 gb|ERN18937.1| hypothetical protein AMTR_s00067p00188650 [Amborella trichopoda]
Length=621

 Score =   190 bits (483),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 85/161 (53%), Positives = 116/161 (72%), Gaps = 0/161 (0%)
 Frame = -3

Query  483  MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpfllIRMLH  304
            MAS+PG LT+WPW  LG+FKY+V+ P   H+ Y+       +RD   ++     L R++H
Sbjct  1    MASKPGPLTDWPWKKLGNFKYMVIVPCAIHAVYRIYGAQKQKRDHATIISLGLFLSRIIH  60

Query  303  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  124
            +QLWI+LSR++TA+  +RI  +GI+FEQVDRERNWDDQ IL+ ++FY G   LP   ++P
Sbjct  61   DQLWITLSRFQTARSKHRIQSRGIDFEQVDRERNWDDQAILHAIIFYIGELFLPGAQNLP  120

Query  123  IWRTDGIILTALIHTGPVEFLYYWLHRALHHHILYSRYHSH  1
            +W T G+I+  L H GPVE++YYW HRALHHH LY+RYHSH
Sbjct  121  LWNTKGVIIAVLCHAGPVEYIYYWAHRALHHHFLYTRYHSH  161



>gb|EMS58051.1| Protein WAX2 [Triticum urartu]
Length=605

 Score =   190 bits (482),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 91/161 (57%), Positives = 115/161 (71%), Gaps = 0/161 (0%)
 Frame = -3

Query  483  MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpfllIRMLH  304
            MA+RPG LTEWPW W+GSFKY+VLAP   H+ +   T    + +     + P LL+R+ H
Sbjct  1    MATRPGPLTEWPWHWMGSFKYLVLAPAALHTAHSVGTKGWGDMNLVYAAMLPALLLRLFH  60

Query  303  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  124
            NQ+WISLSR++TA+  + IVD+ +EF+QVDRER+WDDQ IL  L FY  Y  +P    MP
Sbjct  61   NQIWISLSRHQTARRKHIIVDRSLEFDQVDRERSWDDQAILATLFFYVAYAAIPSVRLMP  120

Query  123  IWRTDGIILTALIHTGPVEFLYYWLHRALHHHILYSRYHSH  1
            +W   G I+ AL+H GPVEF+YYW HRALHHH LYSRYHSH
Sbjct  121  MWEAKGAIIMALLHVGPVEFIYYWFHRALHHHFLYSRYHSH  161



>ref|XP_009141690.1| PREDICTED: protein CER1-like 2 isoform X3 [Brassica rapa]
Length=592

 Score =   188 bits (477),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 93/154 (60%), Positives = 111/154 (72%), Gaps = 4/154 (3%)
 Frame = -3

Query  483  MASRPGILTEWPWTWLGSFKYVVLAPFVAHSTYKYLTDSPNERDPNillifpfllIRMLH  304
            MASRPG+LT+WPWT LGSFKY+VLAP V  S Y Y T     RD   LL+   ++ R++H
Sbjct  1    MASRPGLLTDWPWTPLGSFKYLVLAPLVIDSIYSYAT----MRDHEKLLVVALMVWRIVH  56

Query  303  NQLWISLSRYRTAKGDNRIVDKGIEFEQVDRERNWDDQIILNGLLFYWGYYKLPITHHMP  124
            +Q+WIS SRYRTAKG  RIVDK IEF+QVDRER WDDQII N L+ Y     +  T  +P
Sbjct  57   SQVWISFSRYRTAKGTKRIVDKSIEFDQVDRERTWDDQIIFNTLIAYLAKVYMIRTDSLP  116

Query  123  IWRTDGIILTALIHTGPVEFLYYWLHRALHHHIL  22
             WR DG++L AL+H GP EF+YYW HRALHHH L
Sbjct  117  FWRLDGLVLVALLHAGPGEFIYYWFHRALHHHFL  150



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 571442019030