BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c6183_g1_i1 len=685 path=[753:0-662 24:663-684]

Length=685
                                                                      Score     E

emb|CDO99148.1|  unnamed protein product                                204   1e-61   
ref|XP_011091113.1|  PREDICTED: auxin-responsive protein IAA14          204   1e-61   
ref|XP_002284133.1|  PREDICTED: auxin-responsive protein IAA14          204   2e-61   Vitis vinifera
emb|CBI26357.3|  unnamed protein product                                192   9e-57   
ref|XP_007034956.1|  Indole-3-acetic acid 7 isoform 1                   188   4e-55   
gb|ADJ68049.1|  auxin responsive protein                                186   1e-54   
ref|XP_011073485.1|  PREDICTED: auxin-responsive protein IAA14          186   2e-54   
ref|XP_009591035.1|  PREDICTED: auxin-responsive protein IAA7-like      184   7e-54   
ref|XP_009611797.1|  PREDICTED: auxin-responsive protein IAA14          183   2e-53   
gb|KDP40274.1|  hypothetical protein JCGZ_02272                         183   3e-53   
ref|XP_009777122.1|  PREDICTED: auxin-responsive protein IAA14-like     181   5e-53   
ref|XP_011030586.1|  PREDICTED: auxin-responsive protein IAA14-li...    181   3e-52   
ref|XP_011030585.1|  PREDICTED: auxin-responsive protein IAA14-li...    181   3e-52   
gb|AEE25653.1|  auxin-responsive protein                                180   3e-52   
gb|KHF98789.1|  Auxin-responsive IAA14 -like protein                    179   1e-51   
ref|XP_008224185.1|  PREDICTED: auxin-responsive protein IAA14          178   3e-51   
ref|XP_011027545.1|  PREDICTED: auxin-responsive protein IAA14 is...    177   4e-51   
ref|XP_011027555.1|  PREDICTED: auxin-responsive protein IAA14 is...    177   4e-51   
ref|XP_007034957.1|  Indole-3-acetic acid inducible 14 isoform 2        176   5e-51   
ref|XP_007223810.1|  hypothetical protein PRUPE_ppa010698mg             176   8e-51   
gb|AFZ78617.1|  hypothetical protein                                    176   2e-50   
ref|XP_002311658.1|  aux/IAA family protein                             176   2e-50   Populus trichocarpa [western balsam poplar]
gb|KHN05057.1|  Auxin-responsive protein IAA14                          176   2e-50   
gb|AFK42031.1|  unknown                                                 174   3e-50   
ref|XP_009776553.1|  PREDICTED: auxin-responsive protein IAA14-like     175   3e-50   
gb|KEH42779.1|  auxin-responsive AUX/IAA family protein                 173   5e-50   
gb|KHG01271.1|  Auxin-responsive IAA14 -like protein                    174   6e-50   
ref|NP_001240213.1|  auxin-induced protein ali50                        174   8e-50   
gb|KFK39592.1|  hypothetical protein AALP_AA3G264300                    174   8e-50   
ref|XP_003591806.1|  Indoleacetic acid-induced-like protein             173   2e-49   
gb|KEH42778.1|  auxin-responsive AUX/IAA family protein                 173   2e-49   
ref|XP_003556389.2|  PREDICTED: auxin-responsive protein IAA14-like     175   2e-49   
dbj|BAH15071.1|  indole-3-acetic acid 14 transcription factor like      172   3e-49   Malus prunifolia
ref|XP_004172452.1|  PREDICTED: auxin-responsive protein IAA14-like     173   3e-49   
gb|KHN30563.1|  Auxin-responsive protein IAA14                          172   3e-49   
gb|AFK37379.1|  unknown                                                 172   4e-49   
ref|XP_007143877.1|  hypothetical protein PHAVU_007G109500g             172   5e-49   
ref|XP_008465181.1|  PREDICTED: auxin-responsive protein IAA14-like     172   5e-49   
ref|NP_001266070.1|  IAA14                                              171   8e-49   
ref|NP_001280875.1|  auxin-responsive protein IAA14-like                171   1e-48   
ref|XP_009337294.1|  PREDICTED: auxin-responsive protein IAA14-like     170   4e-48   
ref|XP_008362015.1|  PREDICTED: auxin-responsive protein IAA14-like     169   5e-48   
ref|XP_004495391.1|  PREDICTED: auxin-responsive protein IAA14-li...    169   6e-48   
ref|XP_004495392.1|  PREDICTED: auxin-responsive protein IAA14-li...    169   7e-48   
ref|XP_006362195.1|  PREDICTED: auxin-responsive protein IAA14-like     168   1e-47   
gb|EYU32514.1|  hypothetical protein MIMGU_mgv1a012542mg                168   2e-47   
ref|NP_974355.1|  auxin-responsive protein IAA7                         166   2e-47   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010024036.1|  PREDICTED: auxin-responsive protein IAA14-like     167   3e-47   
ref|XP_008438588.1|  PREDICTED: auxin-responsive protein IAA14-like     167   4e-47   
ref|XP_006298251.1|  hypothetical protein CARUB_v10014321mg             168   4e-47   
gb|AAM65301.1|  indoleacetic acid (IAA)-inducible gene (IAA7)           167   5e-47   Arabidopsis thaliana [mouse-ear cress]
ref|NP_188945.1|  auxin-responsive protein IAA7                         167   6e-47   Arabidopsis thaliana [mouse-ear cress]
gb|KFK24541.1|  hypothetical protein AALP_AAs58011U000100               166   7e-47   
ref|XP_002883395.1|  hypothetical protein ARALYDRAFT_319024             166   1e-46   
ref|XP_004134096.1|  PREDICTED: auxin-responsive protein IAA14-li...    166   1e-46   
ref|XP_010087762.1|  Auxin-responsive protein IAA7                      167   1e-46   
ref|XP_010512022.1|  PREDICTED: auxin-responsive protein IAA7           166   1e-46   
gb|ADL70640.1|  indole-3-acetic acid inducible 14                       163   1e-46   
gb|ADL70639.1|  indole-3-acetic acid inducible 14                       163   1e-46   
gb|ADL70642.1|  indole-3-acetic acid inducible 14                       163   2e-46   
ref|XP_010488346.1|  PREDICTED: auxin-responsive protein IAA7-like      165   2e-46   
ref|XP_010552451.1|  PREDICTED: auxin-responsive protein IAA14-like     164   3e-46   
gb|ADB93627.2|  indole-3-acetic acid inducible 14                       162   4e-46   Arabidopsis thaliana [mouse-ear cress]
gb|ADB93628.1|  indole-3-acetic acid inducible 14                       162   5e-46   Arabidopsis thaliana [mouse-ear cress]
emb|CDY63910.1|  BnaC01g43640D                                          164   5e-46   
gb|ADB93625.2|  indole-3-acetic acid inducible 14                       162   5e-46   Arabidopsis thaliana [mouse-ear cress]
gb|ADB93629.2|  indole-3-acetic acid inducible 14                       162   5e-46   Arabidopsis thaliana [mouse-ear cress]
gb|AFK44393.1|  unknown                                                 164   6e-46   
ref|XP_010466604.1|  PREDICTED: auxin-responsive protein IAA7-like      163   1e-45   
gb|ADL70641.1|  indole-3-acetic acid inducible 14                       162   1e-45   
ref|XP_002315736.1|  aux/IAA family protein                             164   2e-45   Populus trichocarpa [western balsam poplar]
emb|CAB46059.1|  IAA7 like protein                                      162   2e-45   Arabidopsis thaliana [mouse-ear cress]
ref|NP_193191.2|  auxin-responsive protein IAA14                        162   2e-45   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009135842.1|  PREDICTED: auxin-responsive protein IAA7-like      162   2e-45   
ref|XP_008341049.1|  PREDICTED: auxin-responsive protein IAA7-like      160   2e-45   
ref|XP_006406100.1|  hypothetical protein EUTSA_v10021428mg             162   4e-45   
emb|CDY10349.1|  BnaC05g29300D                                          161   8e-45   
emb|CAC84710.1|  aux/IAA protein                                        162   9e-45   Populus tremula x Populus tremuloides
gb|EYU33008.1|  hypothetical protein MIMGU_mgv1a012321mg                161   1e-44   
ref|NP_001288823.1|  auxin-responsive protein IAA7                      160   1e-44   
ref|XP_010440448.1|  PREDICTED: auxin-responsive protein IAA14-like     160   2e-44   
ref|XP_006414696.1|  hypothetical protein EUTSA_v10026031mg             160   2e-44   
gb|AFS44507.1|  auxin repressor                                         159   2e-44   
ref|XP_004288427.1|  PREDICTED: auxin-responsive protein IAA14-like     159   3e-44   
ref|XP_010435110.1|  PREDICTED: auxin-responsive protein IAA14          159   4e-44   
ref|XP_002868277.1|  hypothetical protein ARALYDRAFT_493451             158   6e-44   
gb|KDO53919.1|  hypothetical protein CISIN_1g026811mg                   157   6e-44   
ref|XP_009107777.1|  PREDICTED: auxin-responsive protein IAA14          158   8e-44   
emb|CDY47148.1|  BnaA08g05350D                                          158   1e-43   
ref|XP_006420094.1|  hypothetical protein CICLE_v10005789mg             157   1e-43   
gb|AAM21317.1|AF373100_1  auxin-regulated protein                       158   1e-43   Populus tremula x Populus tremuloides
emb|CDY62130.1|  BnaC08g47390D                                          157   2e-43   
ref|XP_004134097.1|  PREDICTED: auxin-responsive protein IAA14-li...    156   2e-43   
ref|XP_006284476.1|  hypothetical protein CARUB_v10005662mg             157   3e-43   
ref|NP_001268036.1|  uncharacterized protein LOC100250231               156   4e-43   
ref|XP_002319075.1|  hypothetical protein POPTR_0013s03870g             157   4e-43   Populus trichocarpa [western balsam poplar]
ref|XP_002531288.1|  Auxin-responsive protein IAA16, putative           157   5e-43   Ricinus communis
ref|XP_011032399.1|  PREDICTED: auxin-responsive protein IAA16-like     156   5e-43   
ref|XP_010450026.1|  PREDICTED: auxin-responsive protein IAA14-like     155   6e-43   
ref|XP_002281771.1|  PREDICTED: auxin-responsive protein IAA16-like     156   7e-43   Vitis vinifera
ref|XP_010532600.1|  PREDICTED: auxin-responsive protein IAA14          155   7e-43   
ref|XP_007030567.1|  Indoleacetic acid-induced protein 16               156   8e-43   
ref|XP_011038568.1|  PREDICTED: auxin-responsive protein IAA16-like     156   8e-43   
emb|CAN72026.1|  hypothetical protein VITISV_014421                     155   2e-42   Vitis vinifera
ref|XP_006382798.1|  hypothetical protein POPTR_0005s05560g             155   3e-42   
ref|XP_010551700.1|  PREDICTED: auxin-responsive protein IAA14          153   8e-42   
dbj|BAH56942.1|  AT4G14550                                              151   1e-41   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010274203.1|  PREDICTED: auxin-responsive protein IAA16-like     153   1e-41   
gb|ABH01143.1|  auxin-regulated protein                                 152   5e-41   Populus tomentosa [Chinese white poplar]
ref|XP_010102292.1|  Auxin-responsive protein IAA16                     151   7e-41   
gb|AEE25654.1|  auxin-responsive protein                                150   7e-41   
ref|XP_010278165.1|  PREDICTED: auxin-responsive protein IAA16-like     150   1e-40   
ref|NP_001266049.1|  IAA9 protein                                       150   2e-40   
gb|KHG19190.1|  Auxin-responsive IAA16 -like protein                    149   2e-40   
ref|NP_001275398.1|  auxin/indole-3-acetic acid 3                       149   3e-40   
gb|AFZ78616.1|  hypothetical protein                                    147   6e-40   
gb|EYU46510.1|  hypothetical protein MIMGU_mgv1a013084mg                148   6e-40   
emb|CAN63268.1|  hypothetical protein VITISV_013635                     148   7e-40   Vitis vinifera
gb|AEE25650.1|  auxin-responsive protein                                148   8e-40   
ref|XP_002520980.1|  Auxin-induced protein AUX28, putative              147   3e-39   Ricinus communis
gb|KDP23667.1|  hypothetical protein JCGZ_23500                         146   5e-39   
ref|XP_007050422.1|  Indole-3-acetic acid inducible 14 isoform 2        146   8e-39   
ref|XP_009610435.1|  PREDICTED: auxin-responsive protein IAA16          145   1e-38   
gb|EPS64756.1|  hypothetical protein M569_10024                         144   2e-38   
ref|XP_007050421.1|  Indole-3-acetic acid inducible 14 isoform 1        145   2e-38   
ref|XP_002306817.1|  hypothetical protein POPTR_0005s23980g             143   3e-38   Populus trichocarpa [western balsam poplar]
ref|XP_002517023.1|  Auxin-responsive protein IAA7, putative            142   4e-38   Ricinus communis
gb|AAD32146.1|AF123508_1  Nt-iaa28 deduced protein                      144   4e-38   Nicotiana tabacum [American tobacco]
ref|XP_006471686.1|  PREDICTED: auxin-responsive protein IAA16-li...    142   4e-38   
ref|XP_009761467.1|  PREDICTED: auxin-responsive protein IAA16          143   5e-38   
ref|NP_001288939.1|  auxin-responsive protein IAA16                     143   6e-38   
ref|XP_006383686.1|  auxin-induced protein aux28                        143   6e-38   
ref|XP_006432921.1|  hypothetical protein CICLE_v10002290mg             142   6e-38   
ref|XP_002302075.1|  auxin-induced protein aux28                        143   6e-38   Populus trichocarpa [western balsam poplar]
ref|XP_011079949.1|  PREDICTED: auxin-induced protein AUX28-like        143   7e-38   
emb|CAC84711.1|  aux/IAA protein                                        142   9e-38   Populus tremula x Populus tremuloides
gb|KDO48906.1|  hypothetical protein CISIN_1g026005mg                   142   9e-38   
gb|KDO48907.1|  hypothetical protein CISIN_1g026005mg                   142   1e-37   
ref|XP_010679165.1|  PREDICTED: auxin-responsive protein IAA14-like     143   1e-37   
emb|CAH59413.1|  auxin resistance protein                               142   1e-37   Plantago major [cart-track plant]
ref|XP_010936171.1|  PREDICTED: auxin-responsive protein IAA30-like     142   1e-37   
ref|XP_006432923.1|  hypothetical protein CICLE_v10002290mg             142   1e-37   
ref|XP_011042427.1|  PREDICTED: auxin-induced protein AUX28-like        142   2e-37   
ref|NP_001280973.1|  auxin-responsive protein IAA16                     142   2e-37   
gb|KDO48905.1|  hypothetical protein CISIN_1g026005mg                   142   2e-37   
emb|CDY32537.1|  BnaA09g50590D                                          141   3e-37   
emb|CDY15493.1|  BnaA08g27770D                                          141   3e-37   
ref|XP_009118658.1|  PREDICTED: auxin-responsive protein IAA17-like     141   3e-37   
ref|XP_006304183.1|  hypothetical protein CARUB_v10010236mg             141   3e-37   
gb|KHG04941.1|  Auxin-induced AUX28                                     141   3e-37   
emb|CDY50750.1|  BnaAnng10570D                                          142   3e-37   
gb|EPS60474.1|  hypothetical protein M569_14329                         140   4e-37   
ref|XP_009111119.1|  PREDICTED: auxin-responsive protein IAA17          140   5e-37   
ref|XP_006408158.1|  hypothetical protein EUTSA_v10021441mg             140   6e-37   
ref|NP_001275031.1|  auxin-responsive protein IAA14-like                139   7e-37   
ref|XP_006408159.1|  hypothetical protein EUTSA_v10021441mg             140   8e-37   
dbj|BAG55005.1|  auxin-responsive Aux/IAA gene family member            139   9e-37   Ipomoea nil [qian niu]
ref|XP_009364490.1|  PREDICTED: auxin-responsive protein IAA16          140   9e-37   
ref|XP_002889499.1|  hypothetical protein ARALYDRAFT_470401             139   1e-36   
ref|XP_006838867.1|  hypothetical protein AMTR_s00002p00266760          139   1e-36   
ref|XP_008218270.1|  PREDICTED: auxin-responsive protein IAA16          140   1e-36   
ref|XP_010457463.1|  PREDICTED: auxin-responsive protein IAA17          139   1e-36   
ref|XP_009398568.1|  PREDICTED: auxin-responsive protein IAA30-like     139   2e-36   
gb|KDO48908.1|  hypothetical protein CISIN_1g026005mg                   137   2e-36   
ref|XP_011026048.1|  PREDICTED: auxin-induced protein AUX28-like        139   2e-36   
emb|CDY63072.1|  BnaCnng41350D                                          142   2e-36   
ref|XP_009124981.1|  PREDICTED: auxin-responsive protein IAA16-like     139   2e-36   
emb|CDY10068.1|  BnaC08g43830D                                          138   3e-36   
ref|XP_010483317.1|  PREDICTED: auxin-responsive protein IAA17-like     138   4e-36   
ref|XP_010475075.1|  PREDICTED: auxin-responsive protein IAA17-like     138   5e-36   
ref|XP_007205640.1|  hypothetical protein PRUPE_ppa009254mg             139   6e-36   
ref|XP_006298436.1|  hypothetical protein CARUB_v10014507mg             138   6e-36   
ref|XP_010917602.1|  PREDICTED: auxin-responsive protein IAA30 is...    137   8e-36   
ref|XP_006418149.1|  hypothetical protein EUTSA_v10008679mg             137   8e-36   
dbj|BAJ34138.1|  unnamed protein product                                137   9e-36   
ref|XP_010917600.1|  PREDICTED: auxin-responsive protein IAA30 is...    137   1e-35   
gb|AAM64837.1|  putative auxin-induced protein, IAA17/AXR3-1            136   1e-35   Arabidopsis thaliana [mouse-ear cress]
ref|NP_171921.1|  auxin-responsive protein IAA17                        136   2e-35   Arabidopsis thaliana [mouse-ear cress]
emb|CDY30017.1|  BnaC01g39910D                                          136   2e-35   
gb|KDO68557.1|  hypothetical protein CISIN_1g026823mg                   136   3e-35   
ref|NP_001266039.1|  IAA7 protein                                       135   3e-35   
emb|CDX89832.1|  BnaA10g02500D                                          135   4e-35   
ref|XP_002884465.1|  indoleacetic acid-induced protein 16               135   4e-35   
ref|XP_009119323.1|  PREDICTED: auxin-responsive protein IAA17-like     135   4e-35   
ref|XP_006443921.1|  hypothetical protein CICLE_v10022032mg             135   4e-35   
ref|NP_187124.1|  auxin-responsive protein IAA16                        135   5e-35   Arabidopsis thaliana [mouse-ear cress]
gb|KFK37887.1|  hypothetical protein AALP_AA3G042100                    135   6e-35   
emb|CDY41894.1|  BnaC05g47100D                                          135   6e-35   
gb|ADL70687.1|  indole-3-acetic acid inducible 17                       132   6e-35   
ref|XP_010923479.1|  PREDICTED: auxin-responsive protein IAA30-li...    134   8e-35   
gb|ADL70685.1|  indole-3-acetic acid inducible 17                       132   9e-35   
gb|ADL70689.1|  indole-3-acetic acid inducible 17                       132   9e-35   
gb|ADL70684.1|  indole-3-acetic acid inducible 17                       132   9e-35   
ref|XP_004302055.1|  PREDICTED: auxin-responsive protein IAA16-like     135   1e-34   
ref|XP_010418365.1|  PREDICTED: auxin-responsive protein IAA16          134   1e-34   
gb|ADB93635.1|  indole-3-acetic acid inducible 17                       132   1e-34   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010463960.1|  PREDICTED: auxin-responsive protein IAA16-like     134   1e-34   
ref|XP_010485858.1|  PREDICTED: auxin-responsive protein IAA16-like     134   1e-34   
ref|XP_009418923.1|  PREDICTED: auxin-responsive protein IAA30-like     134   1e-34   
emb|CDY18214.1|  BnaC05g02370D                                          134   1e-34   
ref|XP_010923478.1|  PREDICTED: auxin-responsive protein IAA30-li...    134   1e-34   
gb|ACL81167.1|  auxin-responsive protein IAA1                           134   2e-34   Mirabilis jalapa
ref|XP_007147174.1|  hypothetical protein PHAVU_006G102100g             134   3e-34   
ref|XP_006575865.1|  PREDICTED: auxin-induced protein AUX28-like        131   4e-34   
ref|XP_009413916.1|  PREDICTED: auxin-responsive protein IAA30-like     133   4e-34   
gb|EYU30526.1|  hypothetical protein MIMGU_mgv1a012831mg                133   4e-34   
ref|NP_001237212.1|  uncharacterized protein LOC100499872               132   4e-34   
gb|AAC49055.1|  IAA14                                                   130   4e-34   Arabidopsis thaliana [mouse-ear cress]
gb|AAC39440.1|  IAA17/AXR3-1 protein                                    132   4e-34   Arabidopsis thaliana [mouse-ear cress]
gb|KHN18836.1|  Auxin-induced protein AUX28                             133   5e-34   
ref|XP_006605305.1|  PREDICTED: uncharacterized protein LOC100499...    132   5e-34   
gb|ACU18407.1|  unknown                                                 133   5e-34   Glycine max [soybeans]
dbj|BAI94494.1|  Aux/IAA protein                                        132   5e-34   
ref|XP_010550916.1|  PREDICTED: LOW QUALITY PROTEIN: auxin-respon...    132   5e-34   
ref|XP_006418150.1|  hypothetical protein EUTSA_v10008679mg             132   7e-34   
ref|XP_008810170.1|  PREDICTED: auxin-responsive protein IAA30-like     132   8e-34   
ref|NP_001239753.1|  uncharacterized protein LOC100781847               132   8e-34   
ref|XP_010556884.1|  PREDICTED: auxin-responsive protein IAA17          132   1e-33   
ref|XP_006432922.1|  hypothetical protein CICLE_v10002290mg             131   2e-33   
gb|ABR08763.1|  auxin-resistance protein 3                              128   3e-33   Arabidopsis thaliana [mouse-ear cress]
gb|KDO48904.1|  hypothetical protein CISIN_1g026005mg                   130   3e-33   
gb|ABR08758.1|  auxin-resistance protein 3                              127   3e-33   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004156465.1|  PREDICTED: LOW QUALITY PROTEIN: auxin-respon...    130   4e-33   
ref|XP_008788131.1|  PREDICTED: auxin-responsive protein IAA30-like     130   5e-33   
ref|XP_011082603.1|  PREDICTED: auxin-responsive protein IAA14-like     129   5e-33   
ref|XP_004289900.1|  PREDICTED: auxin-induced protein AUX28-like        130   5e-33   
ref|NP_001241599.1|  uncharacterized protein LOC100803065               130   8e-33   
ref|XP_004150437.1|  PREDICTED: LOW QUALITY PROTEIN: auxin-respon...    130   8e-33   
gb|KHN22078.1|  Auxin-responsive protein IAA16                          129   8e-33   
ref|XP_007162490.1|  hypothetical protein PHAVU_001G156600g             129   1e-32   
gb|KGN60808.1|  hypothetical protein Csa_2G010920                       128   2e-32   
gb|ABM53874.1|  IAA6                                                    125   3e-32   Cestrum elegans
ref|XP_004493739.1|  PREDICTED: auxin-induced protein AUX28-like        128   4e-32   
ref|XP_004495802.1|  PREDICTED: auxin-responsive protein IAA16-like     127   6e-32   
gb|AFK36684.1|  unknown                                                 125   7e-32   
ref|XP_006443920.1|  hypothetical protein CICLE_v10022032mg             127   7e-32   
gb|ABD98055.1|  auxin-regulated protein                                 127   8e-32   Striga asiatica [witchweed]
ref|XP_008462707.1|  PREDICTED: auxin-induced protein AUX28-like ...    126   1e-31   
ref|XP_008462706.1|  PREDICTED: auxin-responsive protein IAA16-li...    126   1e-31   
ref|XP_007144686.1|  hypothetical protein PHAVU_007G176600g             126   1e-31   
gb|KDP21369.1|  hypothetical protein JCGZ_21840                         127   1e-31   
ref|XP_010025014.1|  PREDICTED: auxin-responsive protein IAA16-like     127   1e-31   
ref|XP_008455992.1|  PREDICTED: auxin-responsive protein IAA16 is...    126   2e-31   
gb|AAM96891.1|  auxin-responsive protein IAA1                           125   2e-31   Mirabilis jalapa
gb|AFK36086.1|  unknown                                                 126   2e-31   
ref|XP_008455985.1|  PREDICTED: auxin-responsive protein IAA16 is...    125   2e-31   
gb|KFK31703.1|  hypothetical protein AALP_AA6G148100                    125   2e-31   
gb|AFK44192.1|  unknown                                                 125   4e-31   
emb|CBI35213.3|  unnamed protein product                                123   4e-31   
gb|AGV54230.1|  auxin-induced protein AUX28                             125   4e-31   
ref|XP_003521268.1|  PREDICTED: auxin-induced protein AUX28-like        125   5e-31   
gb|ACJ83896.1|  unknown                                                 125   5e-31   Medicago truncatula
ref|XP_009420668.1|  PREDICTED: auxin-responsive protein IAA30-like     125   6e-31   
gb|KHN02537.1|  Auxin-induced protein AUX28                             124   1e-30   
ref|NP_001236693.1|  auxin-induced protein AUX28                        124   1e-30   
ref|XP_009417112.1|  PREDICTED: auxin-responsive protein IAA30-like     124   1e-30   
ref|XP_009354870.1|  PREDICTED: auxin-induced protein AUX28-like        124   2e-30   
ref|XP_004142529.1|  PREDICTED: auxin-responsive protein IAA16-like     123   2e-30   
gb|AGV54609.1|  auxin-induced protein                                   124   2e-30   
gb|ACU21378.1|  unknown                                                 122   4e-30   Glycine max [soybeans]
ref|XP_009367750.1|  PREDICTED: auxin-induced protein AUX28-like        122   5e-30   
ref|XP_008372303.1|  PREDICTED: auxin-induced protein AUX28-like        122   6e-30   
gb|KEH43016.1|  auxin-responsive AUX/IAA family protein                 122   6e-30   
gb|KEH43017.1|  auxin-responsive AUX/IAA family protein                 122   1e-29   
ref|XP_008382962.1|  PREDICTED: auxin-induced protein AUX28-like        121   1e-29   
ref|XP_004172702.1|  PREDICTED: auxin-induced protein AUX28-like        120   1e-29   
ref|NP_001267662.1|  auxin-induced protein AUX28-like                   120   3e-29   
ref|XP_008451270.1|  PREDICTED: auxin-induced protein AUX28-like        119   6e-29   
gb|ADL36587.1|  ARF domain class transcription factor                   117   8e-29   
dbj|BAK01326.1|  predicted protein                                      119   9e-29   
dbj|BAJ84870.1|  predicted protein                                      119   9e-29   
gb|AAC36584.1|  putative IAA-related protein                            116   2e-28   Pisum sativum [garden pea]
ref|XP_010674855.1|  PREDICTED: auxin-induced protein AUX28             119   2e-28   
ref|XP_004963100.1|  PREDICTED: auxin-responsive protein IAA30-like     118   3e-28   
gb|AFK42876.1|  unknown                                                 118   3e-28   
gb|ABY65168.1|  At1g04250-like protein                                  114   3e-28   Arabidopsis lyrata [lyrate rockcress]
gb|ACJ84642.1|  unknown                                                 118   3e-28   Medicago truncatula
ref|XP_010038039.1|  PREDICTED: auxin-induced protein AUX28-like        118   4e-28   
gb|ABY65124.1|  At1g04250                                               112   7e-28   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003521753.1|  PREDICTED: auxin-responsive protein IAA16-like     116   7e-28   
gb|ACU19136.1|  unknown                                                 116   9e-28   
emb|CDP06818.1|  unnamed protein product                                116   9e-28   
gb|KHN31465.1|  Auxin-responsive protein IAA16                          116   1e-27   
ref|XP_008235328.1|  PREDICTED: auxin-induced protein AUX28-like        116   1e-27   
gb|AFK43673.1|  unknown                                                 116   2e-27   
ref|XP_002443496.1|  hypothetical protein SORBIDRAFT_08g020580          116   2e-27   
ref|XP_010522504.1|  PREDICTED: auxin-responsive protein IAA17-like     114   4e-27   
gb|EMT20161.1|  Auxin-responsive protein IAA30                          117   4e-27   
ref|XP_009774251.1|  PREDICTED: auxin-responsive protein IAA16-like     113   6e-27   
gb|ACF87179.1|  unknown                                                 114   1e-26   
ref|XP_009398379.1|  PREDICTED: auxin-responsive protein IAA30-like     113   1e-26   
ref|XP_002464208.1|  hypothetical protein SORBIDRAFT_01g014130          113   2e-26   
emb|CDY10694.1|  BnaA05g16680D                                          110   3e-26   
ref|XP_007201400.1|  hypothetical protein PRUPE_ppa010342mg             112   3e-26   
dbj|BAJ97201.1|  predicted protein                                      112   4e-26   
tpg|DAA55065.1|  TPA: hypothetical protein ZEAMMB73_489535              111   6e-26   
emb|CBW30571.1|  auxin-responsive protein iaa27                         111   6e-26   
gb|AAD32147.1|AF123509_1  Nt-iaa4.1 deduced protein                     110   9e-26   
ref|XP_002299625.1|  auxin-induced protein IAA4                         110   9e-26   
gb|ACF88333.1|  unknown                                                 111   1e-25   
ref|NP_001067209.1|  Os12g0601300                                       111   1e-25   
gb|AFZ78621.1|  hypothetical protein                                    109   2e-25   
ref|XP_002517529.1|  Auxin-responsive protein IAA1, putative            109   2e-25   
ref|XP_007024033.1|  AUX/IAA transcriptional regulator family pro...    108   4e-25   
ref|XP_011045352.1|  PREDICTED: auxin-responsive protein IAA1           108   4e-25   
ref|XP_004982377.1|  PREDICTED: auxin-responsive protein IAA30-li...    109   5e-25   
ref|XP_007201398.1|  hypothetical protein PRUPE_ppa010342mg             107   6e-25   
ref|NP_001050713.2|  Os03g0633500                                       108   6e-25   
sp|Q75GK0.1|IAA11_ORYSJ  RecName: Full=Auxin-responsive protein I...    108   7e-25   
dbj|BAP05448.1|  auxin-responsive protein                               104   8e-25   
ref|XP_006366663.1|  PREDICTED: auxin-responsive protein IAA16-like     107   9e-25   
ref|NP_001266055.1|  IAA10 protein                                      107   1e-24   
ref|XP_003579189.1|  PREDICTED: auxin-responsive protein IAA30-like     108   1e-24   
ref|NP_001150626.1|  IAA30 - auxin-responsive Aux/IAA family member     108   2e-24   
tpg|DAA55064.1|  TPA: hypothetical protein ZEAMMB73_489535              106   2e-24   
ref|XP_010249884.1|  PREDICTED: auxin-responsive protein IAA1           107   2e-24   
gb|EMS64858.1|  Auxin-responsive protein IAA30                          108   2e-24   
ref|XP_004981820.1|  PREDICTED: auxin-responsive protein IAA13-li...    107   2e-24   
ref|XP_004981819.1|  PREDICTED: auxin-responsive protein IAA13-li...    107   3e-24   
ref|XP_011081682.1|  PREDICTED: auxin-responsive protein IAA14          105   3e-24   
gb|ADC29391.2|  indole-3-acetic acid inducible 8                        106   3e-24   
gb|EEE53551.1|  hypothetical protein OsJ_36765                          105   5e-24   
ref|XP_010254225.1|  PREDICTED: auxin-responsive protein IAA1-like      105   5e-24   
gb|ADL70565.1|  indole-3-acetic acid inducible 8                        106   5e-24   
ref|XP_003554705.1|  PREDICTED: auxin-responsive protein IAA16-li...    106   5e-24   
ref|XP_004982378.1|  PREDICTED: auxin-responsive protein IAA30-li...    106   5e-24   
gb|ADL70561.1|  indole-3-acetic acid inducible 8                        106   6e-24   
gb|ADC29393.2|  indole-3-acetic acid inducible 8                        106   6e-24   
gb|ADL70564.1|  indole-3-acetic acid inducible 8                        106   6e-24   
gb|ACU19616.1|  unknown                                                 105   6e-24   
gb|ADL70573.1|  indole-3-acetic acid inducible 8                        106   6e-24   
gb|ABD98054.1|  auxin-regulated protein                                 107   7e-24   
gb|ADL70563.1|  indole-3-acetic acid inducible 8                        106   7e-24   
gb|ADL70566.1|  indole-3-acetic acid inducible 8                        106   7e-24   
gb|ADL70567.1|  indole-3-acetic acid inducible 8                        106   7e-24   
gb|ADL70569.1|  indole-3-acetic acid inducible 8                        106   7e-24   
gb|ADL70572.1|  indole-3-acetic acid inducible 8                        106   7e-24   
ref|XP_002878628.1|  indoleacetic acid-induced protein 8                107   8e-24   
gb|EMS50778.1|  Auxin-responsive protein IAA30                          106   8e-24   
gb|ADL70571.1|  indole-3-acetic acid inducible 8                        106   9e-24   
gb|ADC29390.2|  indole-3-acetic acid inducible 8                        105   9e-24   
ref|XP_004982376.1|  PREDICTED: auxin-responsive protein IAA30-li...    106   9e-24   
ref|XP_008809254.1|  PREDICTED: auxin-responsive protein IAA1-like      104   1e-23   
gb|ADL70570.1|  indole-3-acetic acid inducible 8                        106   1e-23   
ref|NP_850028.1|  auxin-responsive protein IAA8                         106   1e-23   
emb|CAE00638.1|  IAA1 protein                                           105   1e-23   
dbj|BAK05607.1|  predicted protein                                      105   1e-23   
gb|ABY65138.1|  At1g04250                                               100   1e-23   
ref|NP_001189579.1|  auxin-responsive protein IAA8                      106   2e-23   
ref|NP_179852.1|  auxin-responsive protein IAA8                         106   2e-23   
ref|XP_008802939.1|  PREDICTED: auxin-responsive protein IAA17-like     105   2e-23   
ref|NP_001267710.1|  auxin-responsive protein IAA9-like                 105   3e-23   
gb|ADL70568.1|  indole-3-acetic acid inducible 8                        103   3e-23   
gb|ADL70562.1|  indole-3-acetic acid inducible 8                        103   3e-23   
ref|XP_008444965.1|  PREDICTED: auxin-responsive protein IAA9-like      105   3e-23   
emb|CAD30274.1|  IAA16 protein                                          103   3e-23   
ref|XP_010249636.1|  PREDICTED: auxin-responsive protein IAA27          104   6e-23   
ref|XP_007201399.1|  hypothetical protein PRUPE_ppa010342mg             103   7e-23   
gb|ADC29392.2|  indole-3-acetic acid inducible 8                        102   7e-23   
gb|EAZ27868.1|  hypothetical protein OsJ_11821                          103   8e-23   
ref|XP_006294567.1|  hypothetical protein CARUB_v10023602mg             103   1e-22   
ref|XP_009366395.1|  PREDICTED: auxin-responsive protein IAA8-like      103   1e-22   
ref|XP_006294565.1|  hypothetical protein CARUB_v10023602mg             103   1e-22   
ref|XP_010925112.1|  PREDICTED: auxin-responsive protein IAA1-like      102   1e-22   
emb|CAN77436.1|  hypothetical protein VITISV_007399                     103   1e-22   
gb|AAM12952.1|  auxin-regulated protein                                 103   2e-22   
gb|ABK24636.1|  unknown                                                 103   2e-22   
ref|XP_010664066.1|  PREDICTED: aux/IAA protein isoform X1              103   2e-22   
emb|CBI19314.3|  unnamed protein product                                103   2e-22   
ref|XP_010472259.1|  PREDICTED: auxin-responsive protein IAA8-like      103   2e-22   
ref|XP_009112194.1|  PREDICTED: auxin-responsive protein IAA9-lik...    102   2e-22   
ref|XP_010925905.1|  PREDICTED: auxin-responsive protein IAA17-like     103   2e-22   
ref|XP_006833393.1|  hypothetical protein AMTR_s00109p00120700          103   2e-22   
gb|AAL92850.1|  Aux/IAA protein                                         103   2e-22   
ref|XP_002514266.1|  Auxin-responsive protein IAA27, putative           102   2e-22   
ref|XP_010417025.1|  PREDICTED: auxin-responsive protein IAA8-like      103   2e-22   
ref|XP_009608764.1|  PREDICTED: auxin-responsive protein IAA8-like      102   3e-22   
ref|NP_001268170.1|  Aux/IAA protein                                    102   3e-22   
ref|XP_009112193.1|  PREDICTED: auxin-responsive protein IAA9-lik...    102   3e-22   
ref|XP_009789143.1|  PREDICTED: auxin-responsive protein IAA8-like      102   3e-22   
emb|CDX89499.1|  BnaC04g35180D                                          101   4e-22   
ref|XP_009140376.1|  PREDICTED: auxin-responsive protein IAA8           101   4e-22   
ref|XP_011072281.1|  PREDICTED: auxin-responsive protein IAA1-like      100   4e-22   
ref|XP_010429195.1|  PREDICTED: auxin-responsive protein IAA8           102   4e-22   
ref|XP_004150556.1|  PREDICTED: auxin-responsive protein IAA27-like     102   4e-22   
gb|ADL70681.1|  indole-3-acetic acid inducible 16                     99.0    4e-22   
ref|XP_003637871.1|  Auxin-responsive aux/iaa gene family member        100   5e-22   
ref|XP_003612933.1|  Auxin-responsive protein (Aux/IAA)                 102   5e-22   
gb|ABM53872.1|  IAA4                                                  98.6    6e-22   
emb|CAD10639.1|  IAA9 protein                                           102   6e-22   
gb|ABB55368.1|  Aux/IAA protein-like                                    102   6e-22   
ref|NP_001275473.1|  Aux/IAA protein                                    102   6e-22   
ref|XP_008378626.1|  PREDICTED: auxin-responsive protein IAA8-like      102   6e-22   
gb|ADL70749.1|  indole-3-acetic acid inducible 27                       100   6e-22   
gb|KHG03466.1|  Auxin-responsive IAA27 -like protein                    101   6e-22   
gb|ADL70756.1|  indole-3-acetic acid inducible 27                       100   7e-22   
gb|ADL70750.1|  indole-3-acetic acid inducible 27                       100   7e-22   
gb|ADL70755.1|  indole-3-acetic acid inducible 27                       100   7e-22   
ref|XP_006433732.1|  hypothetical protein CICLE_v10001479mg             101   7e-22   
gb|ADC29389.2|  indole-3-acetic acid inducible 8                        100   8e-22   
gb|ADL70757.1|  indole-3-acetic acid inducible 27                       100   8e-22   
gb|EPS59988.1|  auxin-regulated protein                                 101   8e-22   
gb|KEH27147.1|  auxin response factor                                   100   8e-22   
gb|AFK45766.1|  unknown                                                 100   9e-22   
gb|ADL70753.1|  indole-3-acetic acid inducible 27                       100   9e-22   
gb|ABI36493.1|  AUX/IAA16 A                                           98.2    9e-22   
ref|XP_007018336.1|  Aux/IAA protein isoform 1                          101   9e-22   
emb|CDY25617.1|  BnaA04g13090D                                          100   9e-22   
emb|CDY18679.1|  BnaA09g07160D                                          101   9e-22   
ref|XP_007205358.1|  hypothetical protein PRUPE_ppa007194mg             101   9e-22   
gb|ADL70758.1|  indole-3-acetic acid inducible 27                       100   1e-21   
ref|XP_008236708.1|  PREDICTED: auxin-responsive protein IAA9           101   1e-21   
ref|NP_001280795.1|  auxin-responsive protein IAA8-like                 101   1e-21   
gb|ADL70759.1|  indole-3-acetic acid inducible 27                       100   1e-21   
gb|AFK38170.1|  unknown                                                 101   1e-21   
gb|ADB93660.2|  indole-3-acetic acid inducible 27                       100   1e-21   
gb|ADB93662.1|  indole-3-acetic acid inducible 27                       100   1e-21   
ref|XP_006284170.1|  hypothetical protein CARUB_v10005309mg             100   1e-21   
gb|ADL70754.1|  indole-3-acetic acid inducible 27                       100   1e-21   
ref|XP_008338995.1|  PREDICTED: auxin-responsive protein IAA9-lik...    101   1e-21   
gb|KDP37176.1|  hypothetical protein JCGZ_06232                       99.4    1e-21   
gb|ADL70760.1|  indole-3-acetic acid inducible 27                     99.8    1e-21   
ref|XP_008339000.1|  PREDICTED: auxin-responsive protein IAA8-lik...    101   1e-21   
ref|XP_002867425.1|  phytochrome-associated protein 2                   100   1e-21   
gb|ADB93663.1|  indole-3-acetic acid inducible 27                       100   1e-21   
gb|ADB93661.1|  indole-3-acetic acid inducible 27                       100   1e-21   
ref|XP_009390697.1|  PREDICTED: auxin-responsive protein IAA17-like     100   1e-21   
ref|XP_009793769.1|  PREDICTED: auxin-responsive protein IAA27-like     100   1e-21   
ref|NP_194637.1|  phytochrome-associated protein 2                      100   1e-21   
ref|XP_004512542.1|  PREDICTED: auxin-responsive protein IAA8-like      100   1e-21   
ref|XP_011073641.1|  PREDICTED: auxin-responsive protein IAA9-like      100   1e-21   
gb|ADL70752.1|  indole-3-acetic acid inducible 27                     99.8    1e-21   
gb|ADL70751.1|  indole-3-acetic acid inducible 27                       100   1e-21   
gb|ADL70748.1|  indole-3-acetic acid inducible 27                       100   1e-21   
ref|XP_009344514.1|  PREDICTED: auxin-responsive protein IAA9           100   1e-21   
gb|ADL36578.1|  ARF domain class transcription factor                   100   2e-21   
ref|XP_006404728.1|  hypothetical protein EUTSA_v10000236mg             100   2e-21   
ref|XP_007158315.1|  hypothetical protein PHAVU_002G142500g             100   2e-21   
ref|XP_007013106.1|  Phytochrome-associated protein 2 isoform 1         100   2e-21   
gb|EYU44549.1|  hypothetical protein MIMGU_mgv1a010252mg                100   2e-21   
gb|ABY48132.1|  GH1 protein                                             100   2e-21   
ref|XP_008783241.1|  PREDICTED: auxin-responsive protein IAA17-li...    100   2e-21   
gb|ADL70671.1|  indole-3-acetic acid inducible 16                     97.8    2e-21   
gb|EYU44548.1|  hypothetical protein MIMGU_mgv1a010252mg                100   2e-21   
ref|XP_008783242.1|  PREDICTED: auxin-responsive protein IAA17-li...    100   2e-21   
ref|XP_010433139.1|  PREDICTED: auxin-responsive protein IAA27-like     100   2e-21   
gb|AGV54485.1|  auxin-responsive protein                                100   2e-21   
emb|CAI77628.1|  Aux/IAA protein                                        100   2e-21   
ref|XP_010254042.1|  PREDICTED: auxin-responsive protein IAA27-like     100   2e-21   
ref|XP_010320058.1|  PREDICTED: auxin-responsive protein (Aux/IAA...    100   2e-21   
gb|ADL70672.1|  indole-3-acetic acid inducible 16                     97.4    2e-21   
ref|NP_001265888.1|  auxin-responsive protein (Aux/IAA)                 100   2e-21   
ref|XP_006427106.1|  hypothetical protein CICLE_v10026522mg           98.2    2e-21   
gb|AAP44405.1|  auxin-induced protein 2                                 100   2e-21   
ref|NP_001290520.1|  auxin-responsive protein IAA1                    98.6    2e-21   
ref|XP_009611025.1|  PREDICTED: auxin-responsive protein IAA17-like   98.2    2e-21   
ref|XP_006664171.1|  PREDICTED: auxin-responsive protein IAA30-like   99.0    3e-21   
ref|XP_004288310.1|  PREDICTED: auxin-responsive protein IAA9-like      100   3e-21   
emb|CBI36106.3|  unnamed protein product                              99.8    3e-21   
ref|XP_009794203.1|  PREDICTED: auxin-responsive protein IAA8-like    96.3    3e-21   
gb|EYU24679.1|  hypothetical protein MIMGU_mgv1a023210mg              96.3    3e-21   
ref|XP_010447892.1|  PREDICTED: auxin-responsive protein IAA27        99.8    3e-21   
ref|XP_009421456.1|  PREDICTED: auxin-responsive protein IAA21-like   99.8    3e-21   
ref|XP_010915883.1|  PREDICTED: auxin-responsive protein IAA17-like   99.8    3e-21   
ref|XP_007225724.1|  hypothetical protein PRUPE_ppa006744mg             100   3e-21   
gb|KDP33705.1|  hypothetical protein JCGZ_07276                       99.4    3e-21   
ref|XP_010438351.1|  PREDICTED: auxin-responsive protein IAA27-like   99.4    4e-21   
gb|KHG13564.1|  Auxin-responsive IAA9 -like protein                   99.8    4e-21   
ref|XP_004490496.1|  PREDICTED: auxin-responsive protein IAA9-like    99.8    4e-21   
ref|NP_001266077.1|  IAA15                                            98.6    4e-21   
ref|XP_010526458.1|  PREDICTED: auxin-responsive protein IAA27        99.0    4e-21   
ref|XP_009388718.1|  PREDICTED: auxin-responsive protein IAA17-like   99.4    4e-21   
ref|NP_001266034.1|  IAA6 protein                                     99.0    4e-21   
ref|XP_008219180.1|  PREDICTED: auxin-responsive protein IAA8-like    99.8    4e-21   
ref|XP_007225727.1|  hypothetical protein PRUPE_ppa006744mg           99.8    4e-21   
ref|XP_010691372.1|  PREDICTED: auxin-responsive protein IAA27-like   99.4    5e-21   
ref|XP_010098105.1|  Auxin-responsive protein IAA27                   99.4    5e-21   
emb|CAC85936.1|  putative auxin induced transcription factor Aux/IAA  99.0    5e-21   
gb|AEI70507.1|  auxin-responsive protein                              99.4    5e-21   
ref|XP_002438435.1|  hypothetical protein SORBIDRAFT_10g019590        98.2    5e-21   
ref|XP_004171845.1|  PREDICTED: auxin-responsive protein IAA27-like   98.6    5e-21   
ref|XP_002509993.1|  Auxin-responsive protein IAA19, putative         99.4    5e-21   
ref|XP_010275506.1|  PREDICTED: auxin-responsive protein IAA9 iso...  99.4    5e-21   
gb|KDP41528.1|  hypothetical protein JCGZ_15935                       99.4    5e-21   
ref|XP_009406220.1|  PREDICTED: auxin-responsive protein IAA21-like   98.6    5e-21   
ref|XP_010275505.1|  PREDICTED: auxin-responsive protein IAA9 iso...  99.8    5e-21   
ref|XP_010275504.1|  PREDICTED: auxin-responsive protein IAA9 iso...  99.8    5e-21   
ref|XP_010254653.1|  PREDICTED: auxin-responsive protein IAA9-like    99.4    5e-21   
ref|XP_010547581.1|  PREDICTED: auxin-responsive protein IAA9-lik...  99.0    6e-21   
ref|XP_006850381.1|  hypothetical protein AMTR_s00184p00030540        99.4    6e-21   
ref|XP_010547580.1|  PREDICTED: auxin-responsive protein IAA9-lik...  99.0    6e-21   
ref|XP_007156440.1|  hypothetical protein PHAVU_003G286200g           99.0    6e-21   
ref|XP_006465436.1|  PREDICTED: auxin-responsive protein IAA17-like   97.1    7e-21   
ref|XP_007024230.1|  Phytochrome-associated protein 2 isoform 3       98.2    7e-21   
ref|XP_008462746.1|  PREDICTED: auxin-responsive protein IAA27        98.6    8e-21   
ref|XP_008793078.1|  PREDICTED: auxin-responsive protein IAA27-li...  98.6    8e-21   
ref|XP_008793077.1|  PREDICTED: auxin-responsive protein IAA27-li...  98.6    8e-21   
gb|KFK29453.1|  hypothetical protein AALP_AA7G136400                  98.2    8e-21   
ref|XP_010924571.1|  PREDICTED: auxin-responsive protein IAA27-like   98.6    8e-21   
ref|XP_011099452.1|  PREDICTED: auxin-responsive protein IAA9-like    98.6    9e-21   



>emb|CDO99148.1| unnamed protein product [Coffea canephora]
Length=239

 Score =   204 bits (519),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 130/171 (76%), Positives = 146/171 (85%), Gaps = 7/171 (4%)
 Frame = +1

Query  184  MGSMLAE-HGGLNLKATElclglpgggggN--ESESLKVTGKRGFSETVDLKLNLQSAAD  354
            M +ML E HGGLNLKATELCLGLPGGGG    ++ESLK+TGKRGFSETVDLKLNLQ   +
Sbjct  1    MTTMLGEEHGGLNLKATELCLGLPGGGGCAGADTESLKITGKRGFSETVDLKLNLQPN-E  59

Query  355  SSLDLKEKMKSPSKEPNKDPIKPPS-KAQVVGWPPVRNYRKNIMAQksspeeaageksgg  531
              +DLKEKMK+P+KE  KDP+KPP+ KAQVVGWPPVR++RKNIMAQKS+ EEAA EK+G 
Sbjct  60   PVVDLKEKMKAPAKEATKDPVKPPAAKAQVVGWPPVRSFRKNIMAQKSNTEEAAAEKAGS  119

Query  532  ggpaaFVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQG  684
                 FVKV MDGAPYLRKVDLKMY+SYQ+LSDALAKMFSSFTMGNYG QG
Sbjct  120  SAA--FVKVSMDGAPYLRKVDLKMYKSYQELSDALAKMFSSFTMGNYGPQG  168



>ref|XP_011091113.1| PREDICTED: auxin-responsive protein IAA14 [Sesamum indicum]
Length=241

 Score =   204 bits (519),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 125/175 (71%), Positives = 140/175 (80%), Gaps = 7/175 (4%)
 Frame = +1

Query  166  MEVGRKMGSMLAEHGGLNLKATElclglpgggggNESESLKVTGKRGFSETVDLKLNLQS  345
            MEVGRKMG +LAE  GLNLK TELCLGLPGGGGG +    K+TGKRGFSETVDLKLNLQ 
Sbjct  1    MEVGRKMGGLLAEEQGLNLKETELCLGLPGGGGGAD----KITGKRGFSETVDLKLNLQP  56

Query  346  AADSSLDLKEK--MKSPSKEPNKDPIKPPSKAQVVGWPPVRNYRKNIMAQksspeeaage  519
               ++LDLKE   M  P   P KDP+KPP+KAQVVGWPPVR++RKNIMA + S +E A +
Sbjct  57   NESAALDLKETSAMDKPVLPP-KDPVKPPAKAQVVGWPPVRSFRKNIMAHQKSSDEEAEK  115

Query  520  ksggggpaaFVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQG  684
             +     AAFVKV MDGAPYLRKVDLKMY+SYQ+LSDALAKMFSSFTMGNYG QG
Sbjct  116  AACSSPTAAFVKVSMDGAPYLRKVDLKMYKSYQELSDALAKMFSSFTMGNYGTQG  170



>ref|XP_002284133.1| PREDICTED: auxin-responsive protein IAA14 [Vitis vinifera]
Length=243

 Score =   204 bits (518),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 127/178 (71%), Positives = 140/178 (79%), Gaps = 11/178 (6%)
 Frame = +1

Query  166  MEVGRKMGSMLAEHGGLNLKATElclglpgggggNESESLKVTGKRGFSETVDLKLNLQS  345
            MEVGRKM SML    G + K TELCLGLPGGGG  E+E+LK +GKRGFSETVDLKLNLQS
Sbjct  1    MEVGRKMSSMLGAERGFDFKETELCLGLPGGGG-GEAETLKASGKRGFSETVDLKLNLQS  59

Query  346  AADSSLDLKEKMKSPSKEPN-----KDPIKPPSKAQVVGWPPVRNYRKNIMAQksspeea  510
              +S +DL E +K P KE N     KDP KPP+KAQVVGWPPVR++RKNIMAQK+S EE 
Sbjct  60   K-ESVVDLNENVKCPPKEKNLLPCTKDPAKPPAKAQVVGWPPVRSFRKNIMAQKNSSEEG  118

Query  511  ageksggggpaaFVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQG  684
                SG      FVKVCMDGAPYLRKVDLKMY+SYQ+LSDAL KMFSSFTMGNYGAQG
Sbjct  119  EKGSSGAA----FVKVCMDGAPYLRKVDLKMYKSYQELSDALGKMFSSFTMGNYGAQG  172



>emb|CBI26357.3| unnamed protein product [Vitis vinifera]
Length=237

 Score =   192 bits (487),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 121/172 (70%), Positives = 134/172 (78%), Gaps = 11/172 (6%)
 Frame = +1

Query  184  MGSMLAEHGGLNLKATElclglpgggggNESESLKVTGKRGFSETVDLKLNLQSAADSSL  363
            M SML    G + K TELCLGLPGGGG  E+E+LK +GKRGFSETVDLKLNLQS  +S +
Sbjct  1    MSSMLGAERGFDFKETELCLGLPGGGG-GEAETLKASGKRGFSETVDLKLNLQSK-ESVV  58

Query  364  DLKEKMKSPSKEPN-----KDPIKPPSKAQVVGWPPVRNYRKNIMAQksspeeaageksg  528
            DL E +K P KE N     KDP KPP+KAQVVGWPPVR++RKNIMAQK+S EE     SG
Sbjct  59   DLNENVKCPPKEKNLLPCTKDPAKPPAKAQVVGWPPVRSFRKNIMAQKNSSEEGEKGSSG  118

Query  529  gggpaaFVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQG  684
                  FVKVCMDGAPYLRKVDLKMY+SYQ+LSDAL KMFSSFTMGNYGAQG
Sbjct  119  AA----FVKVCMDGAPYLRKVDLKMYKSYQELSDALGKMFSSFTMGNYGAQG  166



>ref|XP_007034956.1| Indole-3-acetic acid 7 isoform 1 [Theobroma cacao]
 gb|EOY05882.1| Indole-3-acetic acid 7 isoform 1 [Theobroma cacao]
Length=254

 Score =   188 bits (477),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 118/185 (64%), Positives = 136/185 (74%), Gaps = 14/185 (8%)
 Frame = +1

Query  166  MEVGRKMGSMLAEHGGLNLKATE------lclglpgggggNESESLKVTGKRGFSETVDL  327
            MEV RKM +ML     LN K TE         G  GGGGGNE E+ K TGKRGFSETVDL
Sbjct  1    MEVSRKMANMLGAERDLNFKETELCLGLPGGGGGGGGGGGNEVETPKTTGKRGFSETVDL  60

Query  328  KLNLQSAADSSLDLKEKMKSPSKEPN------KDPIKPPSKAQVVGWPPVRNYRKNIMAQ  489
            KLNLQS  ++ +DL + +++ SKE        KDP KPP+KAQVVGWPPVR+YRKNIMA 
Sbjct  61   KLNLQSK-ETGMDLNKNIENGSKEKTLLPACTKDPAKPPAKAQVVGWPPVRSYRKNIMAN  119

Query  490  ksspeeaageksggggpaaFVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMGN  669
            + +  E + +K+  GG A FVKV MDGAPYLRKVDLKMY+SYQ+LSDALAKMFSSFTMGN
Sbjct  120  QKNSCEESDKKASSGGAA-FVKVSMDGAPYLRKVDLKMYKSYQELSDALAKMFSSFTMGN  178

Query  670  YGAQG  684
            YGAQG
Sbjct  179  YGAQG  183



>gb|ADJ68049.1| auxin responsive protein [Catharanthus roseus]
Length=242

 Score =   186 bits (472),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 122/168 (73%), Positives = 137/168 (82%), Gaps = 8/168 (5%)
 Frame = +1

Query  202  EHGGLNLKATElclglpgggggNESE----SLKVTGKRGFSETVDLKLNLQSAADSSLDL  369
            E  GLNLK TELCLGLPGGGGG   E    S+++TGKRGFSETVDLKLNLQS   SS+DL
Sbjct  2    EVHGLNLKETELCLGLPGGGGGGTGEITDQSMRITGKRGFSETVDLKLNLQSNDQSSVDL  61

Query  370  KEKMKSP-SKEPN-KDPIKPPSKAQVVGWPPVRNYRKNIMAQksspeeaagek--sgggg  537
             EK+K+P SKE N KDP+KPP+KAQVVGWPPVR +RKNIMAQK++ E  AGEK  S    
Sbjct  62   NEKVKNPPSKETNSKDPVKPPAKAQVVGWPPVRAFRKNIMAQKNNTEVEAGEKGSSSSSS  121

Query  538  paaFVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQ  681
              AFVKV MDGAPYLRKVDLK+Y+SYQ+L+DALAKMFSSFTMGNYG Q
Sbjct  122  SVAFVKVSMDGAPYLRKVDLKIYKSYQELADALAKMFSSFTMGNYGTQ  169



>ref|XP_011073485.1| PREDICTED: auxin-responsive protein IAA14 [Sesamum indicum]
Length=251

 Score =   186 bits (472),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 123/184 (67%), Positives = 140/184 (76%), Gaps = 15/184 (8%)
 Frame = +1

Query  166  MEVGRKMGSMLAEH--GGLNLKATElclglpgggggNES---ESLKVTGKRGFSETVDLK  330
            MEVGR M  MLAE    GLNLK TELCLGLPGGGGG ES   + +K+TGKRGFSETVDLK
Sbjct  1    MEVGRNMAGMLAEEHDDGLNLKETELCLGLPGGGGGGESTATDPIKITGKRGFSETVDLK  60

Query  331  LNL-QSAADSSLDLKEKMKSPSKE----PNKDPIKPPSKAQVVGWPPVRNYRKNIMAQks  495
            L L QS   ++LDLKE +K+ S E    P KDPIKPP+KAQVVGWPPVR++RKN M+ + 
Sbjct  61   LKLHQSNEPAALDLKENIKNSSHENPMLPPKDPIKPPAKAQVVGWPPVRSFRKNAMSHQK  120

Query  496  speeaageksggggpaaFVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTM-GNY  672
            S +E A    G      FVKV MDGAPYLRKVDLKMY+SYQ+LSDAL KMFS+FTM GNY
Sbjct  121  SDKEEAACSGGAA----FVKVSMDGAPYLRKVDLKMYKSYQELSDALVKMFSAFTMAGNY  176

Query  673  GAQG  684
            G+QG
Sbjct  177  GSQG  180



>ref|XP_009591035.1| PREDICTED: auxin-responsive protein IAA7-like [Nicotiana tomentosiformis]
Length=225

 Score =   184 bits (467),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 96/141 (68%), Positives = 114/141 (81%), Gaps = 8/141 (6%)
 Frame = +1

Query  277  ESLKVTGKRGFSETVDLKLNLQSA-ADSSLDLKEKMKSPSKEP----NKDPIKPPSKAQV  441
            E  K+ GKRGFSETVDLKLN Q+  + S++DLKEK+K+P+ +     NKD +KPP+KAQV
Sbjct  17   ERDKIKGKRGFSETVDLKLNFQTNDSSSAMDLKEKIKTPTTKEIANCNKDSVKPPAKAQV  76

Query  442  VGWPPVRNYRKNIMAQksspeeaageksggggpaaFVKVCMDGAPYLRKVDLKMYESYQQ  621
            VGWPPVR++RKN+MAQK++ EE     +       FVKVCMDGAPYLRKVDLKMY+SYQQ
Sbjct  77   VGWPPVRSFRKNVMAQKNNTEETEKSSATAVA---FVKVCMDGAPYLRKVDLKMYKSYQQ  133

Query  622  LSDALAKMFSSFTMGNYGAQG  684
            LSDALAKMFSSFTMGNYGAQG
Sbjct  134  LSDALAKMFSSFTMGNYGAQG  154



>ref|XP_009611797.1| PREDICTED: auxin-responsive protein IAA14 [Nicotiana tomentosiformis]
Length=243

 Score =   183 bits (465),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 119/180 (66%), Positives = 129/180 (72%), Gaps = 15/180 (8%)
 Frame = +1

Query  166  MEVGRKMGSMLAEHGGLNLKATElclg----lpgggggNESESLKVTGKRGFSETVDLKL  333
            MEV RKM         LNLK TELCLG           +++    +  KRGFSETVDLKL
Sbjct  1    MEVSRKMD--------LNLKETELCLGLPGGEVRAAIADQNNIDSINKKRGFSETVDLKL  52

Query  334  NLQSAADSSLDLK-EKMKSPSKEP-NKDPIKPPSKAQVVGWPPVRNYRKNIMAQksspee  507
            NLQS   S LDLK +KMK+PSKE  NKD  KPP+KAQVVGWPPVR++RKNIMAQK S   
Sbjct  53   NLQSNDSSGLDLKKDKMKNPSKETCNKDSAKPPAKAQVVGWPPVRSFRKNIMAQKGSSIC  112

Query  508  aageksgg-ggpaaFVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQG  684
               E S G    AAFVKV MDGAPYLRKVDLKMY+SYQQLSDALAKMFSSFTMGNYGAQG
Sbjct  113  EESENSKGGSSSAAFVKVSMDGAPYLRKVDLKMYKSYQQLSDALAKMFSSFTMGNYGAQG  172



>gb|KDP40274.1| hypothetical protein JCGZ_02272 [Jatropha curcas]
Length=241

 Score =   183 bits (464),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 111/169 (66%), Positives = 125/169 (74%), Gaps = 13/169 (8%)
 Frame = +1

Query  199  AEHGGLNLKATElclglpgggggNESESLKVTGKRGFSETVDLKLNLQSAADSSLDLKEK  378
             E   LN K TELCLGLPGGG   E E+ K TGKRGF+ETVDLKLNLQ A D  +DL E 
Sbjct  8    GERADLNFKETELCLGLPGGGK-TEVETPKATGKRGFAETVDLKLNLQ-AKDGVMDLNEN  65

Query  379  MKSPSKEPN-------KDPIKPPSKAQVVGWPPVRNYRKNIMAQksspeeaageksgggg  537
            +K+ SK+ N       KDP KPP+KAQVVGWPPVR+YRKNIMA + +  +   +      
Sbjct  66   IKNASKDKNHLPTSTIKDPAKPPAKAQVVGWPPVRSYRKNIMANQKNNSDEGEKSLSAA-  124

Query  538  paaFVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQG  684
               FVKVCMDGAPYLRKVDLKMY+SYQ+LSDALAKMFSSFTMGNYGAQG
Sbjct  125  ---FVKVCMDGAPYLRKVDLKMYKSYQELSDALAKMFSSFTMGNYGAQG  170



>ref|XP_009777122.1| PREDICTED: auxin-responsive protein IAA14-like [Nicotiana sylvestris]
Length=223

 Score =   181 bits (460),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 94/140 (67%), Positives = 112/140 (80%), Gaps = 8/140 (6%)
 Frame = +1

Query  277  ESLKVTGKRGFSETVDLKLNLQSA-ADSSLDLKEKMKSPSKE---PNKDPIKPPSKAQVV  444
            E  K+ GKRGFSETVDLKLN Q+  + S++DLKEK+K+P+ +    NKD +KPP+KAQVV
Sbjct  17   ERDKIKGKRGFSETVDLKLNFQTNDSSSAMDLKEKIKTPTTKEIASNKDSVKPPAKAQVV  76

Query  445  GWPPVRNYRKNIMAQksspeeaageksggggpaaFVKVCMDGAPYLRKVDLKMYESYQQL  624
            GWPPVR++RKN+MAQK++ E      +       FVKVCMDGAPYLRKVDLKMY+SYQQL
Sbjct  77   GWPPVRSFRKNVMAQKNNTEAEKSNATAAA----FVKVCMDGAPYLRKVDLKMYKSYQQL  132

Query  625  SDALAKMFSSFTMGNYGAQG  684
            SDALAKMFSSFTMGNYG QG
Sbjct  133  SDALAKMFSSFTMGNYGPQG  152



>ref|XP_011030586.1| PREDICTED: auxin-responsive protein IAA14-like isoform X2 [Populus 
euphratica]
Length=248

 Score =   181 bits (458),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 113/170 (66%), Positives = 128/170 (75%), Gaps = 11/170 (6%)
 Frame = +1

Query  202  EHGGLNLKATElclgl-pgggggNESESLKVTGKRGFSETVDLKLNLQSAADSSLDLKEK  378
            E   LN K TELCLGL    G  NE E+ K TGKRGF+ETVDLKLNLQ A +  +DL E 
Sbjct  10   ERADLNYKETELCLGLPGAVGVKNEVETHKATGKRGFAETVDLKLNLQ-AKEGVMDLNEN  68

Query  379  MKS-PSKEPN-------KDPIKPPSKAQVVGWPPVRNYRKNIMAQksspeeaageksggg  534
            +K+  SK+ N       KDP KPP+KAQVVGWPPVR+YRKN++AQK++ EE     +GG 
Sbjct  69   IKNIASKDKNQLPAATIKDPAKPPAKAQVVGWPPVRSYRKNVLAQKNASEEGEKASTGGS  128

Query  535  gpaaFVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQG  684
              A FVKVCMDGAPYLRKVDLKMY SYQ+LSDALAKMFSSFTMGNYGAQG
Sbjct  129  SAA-FVKVCMDGAPYLRKVDLKMYRSYQELSDALAKMFSSFTMGNYGAQG  177



>ref|XP_011030585.1| PREDICTED: auxin-responsive protein IAA14-like isoform X1 [Populus 
euphratica]
Length=250

 Score =   181 bits (458),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 113/170 (66%), Positives = 128/170 (75%), Gaps = 11/170 (6%)
 Frame = +1

Query  202  EHGGLNLKATElclgl-pgggggNESESLKVTGKRGFSETVDLKLNLQSAADSSLDLKEK  378
            E   LN K TELCLGL    G  NE E+ K TGKRGF+ETVDLKLNLQ A +  +DL E 
Sbjct  10   ERADLNYKETELCLGLPGAVGVKNEVETHKATGKRGFAETVDLKLNLQ-AKEGVMDLNEN  68

Query  379  MKS-PSKEPN-------KDPIKPPSKAQVVGWPPVRNYRKNIMAQksspeeaageksggg  534
            +K+  SK+ N       KDP KPP+KAQVVGWPPVR+YRKN++AQK++ EE     +GG 
Sbjct  69   IKNIASKDKNQLPAATIKDPAKPPAKAQVVGWPPVRSYRKNVLAQKNASEEGEKASTGGS  128

Query  535  gpaaFVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQG  684
              A FVKVCMDGAPYLRKVDLKMY SYQ+LSDALAKMFSSFTMGNYGAQG
Sbjct  129  SAA-FVKVCMDGAPYLRKVDLKMYRSYQELSDALAKMFSSFTMGNYGAQG  177



>gb|AEE25653.1| auxin-responsive protein [Gossypium hirsutum]
Length=249

 Score =   180 bits (457),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 114/184 (62%), Positives = 131/184 (71%), Gaps = 17/184 (9%)
 Frame = +1

Query  166  MEVGRKMGSMLAEHGGLNLKATElclg----lpgggggNESESL---KVTGKRGFSETVD  324
            MEVGRKM +ML     LN K TELCLG    +     GNE+ES    K  GKRGFSETVD
Sbjct  1    MEVGRKMANMLGTEHDLNFKETELCLGLPGGIAVVAAGNETESSSSPKTNGKRGFSETVD  60

Query  325  LKLNLQSAADSSLDLKEKMK-SPSKEPN---KDPIKPPSKAQVVGWPPVRNYRKNIMAQk  492
            LKLNLQS  +S++DL + +  + SKE +   KDP KPP+KAQVVGWPPVR+YRKNIMA +
Sbjct  61   LKLNLQSK-ESTMDLNKNLDDNGSKEKSGSAKDPAKPPAKAQVVGWPPVRSYRKNIMANQ  119

Query  493  sspeeaageksggggpaaFVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMGNY  672
             +  E +G           VKV MDGAPYLRKVDLKMY+SYQ+LSDALAKMFSSFTMGNY
Sbjct  120  KNSSEESGNSGAA-----LVKVSMDGAPYLRKVDLKMYKSYQELSDALAKMFSSFTMGNY  174

Query  673  GAQG  684
            G QG
Sbjct  175  GPQG  178



>gb|KHF98789.1| Auxin-responsive IAA14 -like protein [Gossypium arboreum]
Length=249

 Score =   179 bits (453),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 113/184 (61%), Positives = 131/184 (71%), Gaps = 17/184 (9%)
 Frame = +1

Query  166  MEVGRKMGSMLAEHGGLNLKATElclg----lpgggggNESESL---KVTGKRGFSETVD  324
            MEVGRKM +ML     LN K TELCLG    +     GNE+ES    K  GKRGFSETVD
Sbjct  1    MEVGRKMANMLGTEHDLNFKETELCLGLPGGIAVVAAGNETESSSSPKTNGKRGFSETVD  60

Query  325  LKLNLQSAADSSLDLKEKMK-SPSKEPN---KDPIKPPSKAQVVGWPPVRNYRKNIMAQk  492
            LKLNLQS  +S++DL + +  + SKE +   KDP KPP+KAQ+VGWPPVR+YRKNIMA +
Sbjct  61   LKLNLQSK-ESTMDLNKNLDDNGSKEKSGSAKDPAKPPAKAQMVGWPPVRSYRKNIMANQ  119

Query  493  sspeeaageksggggpaaFVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMGNY  672
             +  E +G           VKV MDGAPYLRKVDLKMY+SYQ+LSDALAKMFSSFTMGNY
Sbjct  120  KNSSEESGNSGAA-----LVKVSMDGAPYLRKVDLKMYKSYQELSDALAKMFSSFTMGNY  174

Query  673  GAQG  684
            G QG
Sbjct  175  GPQG  178



>ref|XP_008224185.1| PREDICTED: auxin-responsive protein IAA14 [Prunus mume]
Length=248

 Score =   178 bits (451),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 119/178 (67%), Positives = 134/178 (75%), Gaps = 13/178 (7%)
 Frame = +1

Query  172  VGRKMGSMLAEHGGLNLKATElclglpgggggNESESLKVTGKRGFSETVDLKLNLQSAA  351
            V RKM +ML     LNLK TELCLGLPGGG   E E+ + TGKRGFSET+DLKLNLQS  
Sbjct  6    VSRKMPNMLGVERDLNLKETELCLGLPGGGTVPEPETPRATGKRGFSETIDLKLNLQSKE  65

Query  352  DSSLDLKEKMKS-PSKEPN------KDPIKPPSKAQVVGWPPVRNYRKNIMAQksspeea  510
            D    L +K+K+  SKE N      K P KPP+KAQVVGWPPVR+YRKNIMAQKSS EE+
Sbjct  66   D----LNDKVKNNASKEKNNLLTCTKYPAKPPAKAQVVGWPPVRSYRKNIMAQKSSSEES  121

Query  511  ageksggggpaaFVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQG  684
              + SG      FVKVCMDGAPYLRKVDLKMY+SYQ+LS++LAKMFSSFTMG YG QG
Sbjct  122  TEKGSGCSAA--FVKVCMDGAPYLRKVDLKMYKSYQELSNSLAKMFSSFTMGYYGPQG  177



>ref|XP_011027545.1| PREDICTED: auxin-responsive protein IAA14 isoform X1 [Populus 
euphratica]
 ref|XP_011029890.1| PREDICTED: auxin-responsive protein IAA14-like isoform X1 [Populus 
euphratica]
Length=250

 Score =   177 bits (450),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 115/172 (67%), Positives = 129/172 (75%), Gaps = 12/172 (7%)
 Frame = +1

Query  199  AEHGGLNLKATElclgl-pgggggNESES-LKVTGKRGFSETVDLKLNLQSAADSSLDLK  372
            AE   LN K TELCLGL    G  NE E+  K TGKRGF+ETVDLKLNLQ A +  +DL 
Sbjct  8    AERTDLNYKETELCLGLPGAVGAKNEVETPSKATGKRGFAETVDLKLNLQ-AKEGVMDLN  66

Query  373  EKMKS-PSKEPN-------KDPIKPPSKAQVVGWPPVRNYRKNIMAQksspeeaageksg  528
            E +K+  SK+ N       KDP KPP+KAQVVGWPPVR+YRKN+MAQK++ EE     +G
Sbjct  67   ENIKNITSKDKNHLPAVTIKDPAKPPAKAQVVGWPPVRSYRKNVMAQKNASEEGEKASTG  126

Query  529  gggpaaFVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQG  684
            G   A FVKVCMDGAPYLRKVDLKMY SYQ+LSDALAKMFSSFTMGNYGAQG
Sbjct  127  GSSAA-FVKVCMDGAPYLRKVDLKMYRSYQELSDALAKMFSSFTMGNYGAQG  177



>ref|XP_011027555.1| PREDICTED: auxin-responsive protein IAA14 isoform X2 [Populus 
euphratica]
 ref|XP_011029891.1| PREDICTED: auxin-responsive protein IAA14-like isoform X2 [Populus 
euphratica]
Length=248

 Score =   177 bits (450),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 115/172 (67%), Positives = 129/172 (75%), Gaps = 12/172 (7%)
 Frame = +1

Query  199  AEHGGLNLKATElclgl-pgggggNESES-LKVTGKRGFSETVDLKLNLQSAADSSLDLK  372
            AE   LN K TELCLGL    G  NE E+  K TGKRGF+ETVDLKLNLQ A +  +DL 
Sbjct  8    AERTDLNYKETELCLGLPGAVGAKNEVETPSKATGKRGFAETVDLKLNLQ-AKEGVMDLN  66

Query  373  EKMKS-PSKEPN-------KDPIKPPSKAQVVGWPPVRNYRKNIMAQksspeeaageksg  528
            E +K+  SK+ N       KDP KPP+KAQVVGWPPVR+YRKN+MAQK++ EE     +G
Sbjct  67   ENIKNITSKDKNHLPAVTIKDPAKPPAKAQVVGWPPVRSYRKNVMAQKNASEEGEKASTG  126

Query  529  gggpaaFVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQG  684
            G   A FVKVCMDGAPYLRKVDLKMY SYQ+LSDALAKMFSSFTMGNYGAQG
Sbjct  127  GSSAA-FVKVCMDGAPYLRKVDLKMYRSYQELSDALAKMFSSFTMGNYGAQG  177



>ref|XP_007034957.1| Indole-3-acetic acid inducible 14 isoform 2, partial [Theobroma 
cacao]
 gb|EOY05883.1| Indole-3-acetic acid inducible 14 isoform 2, partial [Theobroma 
cacao]
Length=204

 Score =   176 bits (445),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 99/145 (68%), Positives = 116/145 (80%), Gaps = 8/145 (6%)
 Frame = +1

Query  268  NESESLKVTGKRGFSETVDLKLNLQSAADSSLDLKEKMKSPSKEPN------KDPIKPPS  429
            NE E+ K TGKRGFSETVDLKLNLQS  ++ +DL + +++ SKE        KDP KPP+
Sbjct  4    NEVETPKTTGKRGFSETVDLKLNLQSK-ETGMDLNKNIENGSKEKTLLPACTKDPAKPPA  62

Query  430  KAQVVGWPPVRNYRKNIMAQksspeeaageksggggpaaFVKVCMDGAPYLRKVDLKMYE  609
            KAQVVGWPPVR+YRKNIMA + +  E + +K+  GG A FVKV MDGAPYLRKVDLKMY+
Sbjct  63   KAQVVGWPPVRSYRKNIMANQKNSCEESDKKASSGGAA-FVKVSMDGAPYLRKVDLKMYK  121

Query  610  SYQQLSDALAKMFSSFTMGNYGAQG  684
            SYQ+LSDALAKMFSSFTMGNYGAQG
Sbjct  122  SYQELSDALAKMFSSFTMGNYGAQG  146



>ref|XP_007223810.1| hypothetical protein PRUPE_ppa010698mg [Prunus persica]
 gb|EMJ25009.1| hypothetical protein PRUPE_ppa010698mg [Prunus persica]
Length=239

 Score =   176 bits (447),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 116/173 (67%), Positives = 131/173 (76%), Gaps = 11/173 (6%)
 Frame = +1

Query  184  MGSMLAEHGGLNLKATElclglpgggggNESESLKVTGKRGFSETVDLKLNLQSAADSSL  363
            M +ML     LNLK TELCLGLPGGG   E E+ + TGKRGFSET+DLKLNLQS  D + 
Sbjct  1    MPNMLGVERDLNLKETELCLGLPGGGTVPEPETPRATGKRGFSETIDLKLNLQSKEDLND  60

Query  364  DLKEKMKSPSKEPN------KDPIKPPSKAQVVGWPPVRNYRKNIMAQksspeeaageks  525
            ++K      SKE N      KDP KPP+KAQVVGWPPVR+YRKNIMAQKSS EE+  + S
Sbjct  61   NVK---NIASKEKNNLLTCTKDPAKPPAKAQVVGWPPVRSYRKNIMAQKSSSEESTEKGS  117

Query  526  ggggpaaFVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQG  684
            G      FVKVCMDGAPYLRKVDLKMY+SYQ+LS++LAKMFSSFTMG YGAQG
Sbjct  118  GCSAA--FVKVCMDGAPYLRKVDLKMYKSYQELSNSLAKMFSSFTMGYYGAQG  168



>gb|AFZ78617.1| hypothetical protein [Populus tomentosa]
Length=248

 Score =   176 bits (446),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 114/171 (67%), Positives = 128/171 (75%), Gaps = 12/171 (7%)
 Frame = +1

Query  202  EHGGLNLKATElclgl-pgggggNESESL-KVTGKRGFSETVDLKLNLQSAADSSLDLKE  375
            E   LN K TELCLGL    G  NE E+  K TGKRGF+ETVDLKLNLQ A D  +DL +
Sbjct  9    ERTDLNYKETELCLGLPGAVGVKNEVETPNKATGKRGFAETVDLKLNLQ-AKDGVMDLND  67

Query  376  KMKS-PSKEPN-------KDPIKPPSKAQVVGWPPVRNYRKNIMAQksspeeaageksgg  531
             +K+  SK+ N       KDP KPP+KAQVVGWPPVR+YRKN+MAQK++ EE     +GG
Sbjct  68   NIKNITSKDKNHLPAAAIKDPAKPPAKAQVVGWPPVRSYRKNVMAQKNASEEGEKTSTGG  127

Query  532  ggpaaFVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQG  684
               A FVKVCMDGAPYLRKVDLKMY SYQ+LSDALAKMFSSFTMGNYGAQG
Sbjct  128  SSAA-FVKVCMDGAPYLRKVDLKMYRSYQELSDALAKMFSSFTMGNYGAQG  177



>ref|XP_002311658.1| aux/IAA family protein [Populus trichocarpa]
 gb|ABK95711.1| unknown [Populus trichocarpa]
 gb|EEE89025.1| aux/IAA family protein [Populus trichocarpa]
Length=248

 Score =   176 bits (445),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 114/171 (67%), Positives = 128/171 (75%), Gaps = 12/171 (7%)
 Frame = +1

Query  202  EHGGLNLKATElclgl-pgggggNESESL-KVTGKRGFSETVDLKLNLQSAADSSLDLKE  375
            E   LN K TELCLGL    G  NE E+  K TGKRGF+ETVDLKLNLQ A +  +DL E
Sbjct  9    ERTDLNYKETELCLGLPGAVGAKNEVETPNKATGKRGFAETVDLKLNLQ-AKEGVMDLNE  67

Query  376  KMKS-PSKEPN-------KDPIKPPSKAQVVGWPPVRNYRKNIMAQksspeeaageksgg  531
             +K+  SK+ N       KDP KPP+KAQVVGWPPVR+YRKN+MAQK++ EE     +GG
Sbjct  68   NIKNITSKDKNHLPAVTIKDPAKPPAKAQVVGWPPVRSYRKNVMAQKNASEEGEKASTGG  127

Query  532  ggpaaFVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQG  684
               A FVKVCMDGAPYLRKVDLKMY SYQ+LSDALAKMFSSFTMGNYGAQG
Sbjct  128  SSAA-FVKVCMDGAPYLRKVDLKMYRSYQELSDALAKMFSSFTMGNYGAQG  177



>gb|KHN05057.1| Auxin-responsive protein IAA14 [Glycine soja]
Length=245

 Score =   176 bits (445),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 112/178 (63%), Positives = 128/178 (72%), Gaps = 15/178 (8%)
 Frame = +1

Query  184  MGSMLAEHGGLNLKATElclglpggggg-------NESESLKVTGKRGFSETVDLKLNLQ  342
            M +ML +  GLNLK TELCLGLPGG          +E E+ + TGKRGFSETVDLKLNL 
Sbjct  1    MATMLTKEHGLNLKETELCLGLPGGELCLGLPGGGSEVETPRATGKRGFSETVDLKLNLH  60

Query  343  SAADSSLDLKEKMKSPSKEPN--KDPIKPPSKAQVVGWPPVRNYRKNIMA--Qksspeea  510
            S  D    L E +K+ SKE    KDP KPP+KAQVVGWPPVR+YRKN+MA  + S+ + A
Sbjct  61   SKED----LNENLKNVSKEKTLLKDPAKPPAKAQVVGWPPVRSYRKNMMAVQKVSTEDVA  116

Query  511  ageksggggpaaFVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQG  684
                S      AFVKV MDGAPYLRKVDL MY+SY++LSDALAKMFSSFTMGNYGAQG
Sbjct  117  EKTTSSTANSGAFVKVSMDGAPYLRKVDLTMYKSYKELSDALAKMFSSFTMGNYGAQG  174



>gb|AFK42031.1| unknown [Medicago truncatula]
Length=214

 Score =   174 bits (441),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 105/163 (64%), Positives = 119/163 (73%), Gaps = 9/163 (6%)
 Frame = +1

Query  211  GLNLKATEl-----clglpgggggNESESLKVTGKRGFSETVDLKLNLQSAADSSLDLKE  375
            GLNLK TEL       G  GGGGG+E E+ + +GKRGFSETVDLKLNLQ+  D    L E
Sbjct  7    GLNLKETELCLGLPGGGGGGGGGGSEVETPRASGKRGFSETVDLKLNLQTKED----LNE  62

Query  376  KMKSPSKEPNKDPIKPPSKAQVVGWPPVRNYRKNIMAQksspeeaageksggggpaaFVK  555
            K  S  K   KDP KPP+KAQVVGWPPVR+YRKN+MAQK +  E   + +     AAFVK
Sbjct  63   KSASKEKTLLKDPAKPPAKAQVVGWPPVRSYRKNMMAQKVNNTEDTEKTTSNTTAAAFVK  122

Query  556  VCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQG  684
            V MDGAPYLRKVDL MY++Y+ LSDALAKMFSSFT GNYGAQG
Sbjct  123  VSMDGAPYLRKVDLTMYKTYKDLSDALAKMFSSFTTGNYGAQG  165



>ref|XP_009776553.1| PREDICTED: auxin-responsive protein IAA14-like [Nicotiana sylvestris]
Length=244

 Score =   175 bits (443),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 99/135 (73%), Positives = 105/135 (78%), Gaps = 6/135 (4%)
 Frame = +1

Query  289  VTGKRGFSETVDLKLNLQSAADSSLDLKEKMKSPSKEP-NKDPIKPPSKAQVVGWPPVRN  465
            +T KRGFSETVDLKLNLQS  D S   KEK+K+PSKE  NKD  KPP+K QVVGWPPVR+
Sbjct  42   ITKKRGFSETVDLKLNLQSNLDLS---KEKIKNPSKETCNKDSAKPPAKTQVVGWPPVRS  98

Query  466  YRKNIMAQksspeeaageksg--gggpaaFVKVCMDGAPYLRKVDLKMYESYQQLSDALA  639
            YRKNIMAQK        E S       AAFVKV MDGAPYLRKVDLKMY+SYQQLSDALA
Sbjct  99   YRKNIMAQKGGSICEESENSKGGICSSAAFVKVSMDGAPYLRKVDLKMYKSYQQLSDALA  158

Query  640  KMFSSFTMGNYGAQG  684
             MFSSFTMGNYGAQG
Sbjct  159  NMFSSFTMGNYGAQG  173



>gb|KEH42779.1| auxin-responsive AUX/IAA family protein [Medicago truncatula]
Length=204

 Score =   173 bits (439),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 105/163 (64%), Positives = 119/163 (73%), Gaps = 9/163 (6%)
 Frame = +1

Query  211  GLNLKATEl-----clglpgggggNESESLKVTGKRGFSETVDLKLNLQSAADSSLDLKE  375
            GLNLK TEL       G  GGGGG+E E+ + +GKRGFSETVDLKLNLQ+  D    L E
Sbjct  7    GLNLKETELCLGLPGGGGGGGGGGSEVETPRASGKRGFSETVDLKLNLQTKED----LNE  62

Query  376  KMKSPSKEPNKDPIKPPSKAQVVGWPPVRNYRKNIMAQksspeeaageksggggpaaFVK  555
            K  S  K   KDP KPP+KAQVVGWPPVR+YRKN+MAQK +  E   + +     AAFVK
Sbjct  63   KSASKEKTLLKDPAKPPAKAQVVGWPPVRSYRKNMMAQKVNNTEDTEKTTSNTTAAAFVK  122

Query  556  VCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQG  684
            V MDGAPYLRKVDL MY++Y+ LSDALAKMFSSFT GNYGAQG
Sbjct  123  VSMDGAPYLRKVDLTMYKTYKDLSDALAKMFSSFTTGNYGAQG  165



>gb|KHG01271.1| Auxin-responsive IAA14 -like protein [Gossypium arboreum]
Length=248

 Score =   174 bits (442),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 98/141 (70%), Positives = 115/141 (82%), Gaps = 3/141 (2%)
 Frame = +1

Query  268  NESESL-KVTGKRGFSETVDLKLNLQSAADSSLDLKEKMKSPSKEPNKDPIKPPSKAQVV  444
            NE ES  K TGKRG+SETVDLKLNLQS  +  +DL + +++ SKE N  P KPP+KAQV+
Sbjct  38   NEVESSPKTTGKRGYSETVDLKLNLQSK-EGCMDLNQNLENGSKEKNHHPAKPPAKAQVL  96

Query  445  GWPPVRNYRKNIMA-QksspeeaageksggggpaaFVKVCMDGAPYLRKVDLKMYESYQQ  621
            GWPPVR+YRKNIMA QK++ +E +   S G G AAFVKVCMDGAPYLRKVDLKMY SYQ+
Sbjct  97   GWPPVRSYRKNIMANQKNNSDEISDRASSGSGGAAFVKVCMDGAPYLRKVDLKMYNSYQK  156

Query  622  LSDALAKMFSSFTMGNYGAQG  684
            LSDALAKMFSSFTMG+YG +G
Sbjct  157  LSDALAKMFSSFTMGSYGCEG  177



>ref|NP_001240213.1| auxin-induced protein ali50 [Glycine max]
 gb|ACR39367.1| Aux/IAA protein [Glycine max]
Length=239

 Score =   174 bits (441),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 107/172 (62%), Positives = 122/172 (71%), Gaps = 9/172 (5%)
 Frame = +1

Query  184  MGSMLAEHGGLNLKATElclglpgggggNESESLKVTGKRGFSETVDLKLNLQSAADSSL  363
            M +ML    GL+L   E  L L   GGG+E E+ + TGKRGFSETVDLKLNLQ+  D   
Sbjct  1    MTTMLTNEHGLSLNLKETELCLGLPGGGSEVETPRATGKRGFSETVDLKLNLQTKED---  57

Query  364  DLKEKMKSPSKEPN--KDPIKPPSKAQVVGWPPVRNYRKNIMAQksspeeaageksgggg  537
             L E +K+ SKE    KDP KPP+KAQVVGWPPVR+YRKN+MA +    E   EK+    
Sbjct  58   -LNENLKNVSKEKTLLKDPAKPPAKAQVVGWPPVRSYRKNMMAVQKVSNEEVAEKTTSST  116

Query  538  pa---aFVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQG  684
             A   AFVKV MDGAPYLRKVDL MY+SY+ LSDALAKMFSSFTMGNYGAQG
Sbjct  117  IANSGAFVKVSMDGAPYLRKVDLTMYKSYKDLSDALAKMFSSFTMGNYGAQG  168



>gb|KFK39592.1| hypothetical protein AALP_AA3G264300 [Arabis alpina]
Length=235

 Score =   174 bits (440),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 103/158 (65%), Positives = 115/158 (73%), Gaps = 1/158 (1%)
 Frame = +1

Query  214  LNLKATElclglpgggggNESESLKVTG-KRGFSETVDLKLNLQSAADSSLDLKEKMKSP  390
            +NLKATELCLGLPGG    ES +    G KRGFSETVDL LNLQS  + ++DL     +P
Sbjct  6    MNLKATELCLGLPGGTEAVESPAKSAVGNKRGFSETVDLMLNLQSNKEEAVDLNNIAAAP  65

Query  391  SKEPNKDPIKPPSKAQVVGWPPVRNYRKNIMAQksspeeaageksggggpaaFVKVCMDG  570
             +   KDP KPP+KAQVVGWPPVRNYRKN+M Q+ +           G  AA VKV MDG
Sbjct  66   KESLLKDPTKPPAKAQVVGWPPVRNYRKNMMTQQKTTGSEEASSDKAGTGAALVKVSMDG  125

Query  571  APYLRKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQG  684
            APYLRKVDL MY+SYQ LSDALAKMFSSFTMGNYGAQG
Sbjct  126  APYLRKVDLNMYKSYQDLSDALAKMFSSFTMGNYGAQG  163



>ref|XP_003591806.1| Indoleacetic acid-induced-like protein [Medicago truncatula]
 gb|AES62057.1| auxin-responsive AUX/IAA family protein [Medicago truncatula]
Length=236

 Score =   173 bits (438),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 105/163 (64%), Positives = 119/163 (73%), Gaps = 9/163 (6%)
 Frame = +1

Query  211  GLNLKATEl-----clglpgggggNESESLKVTGKRGFSETVDLKLNLQSAADSSLDLKE  375
            GLNLK TEL       G  GGGGG+E E+ + +GKRGFSETVDLKLNLQ+  D    L E
Sbjct  7    GLNLKETELCLGLPGGGGGGGGGGSEVETPRASGKRGFSETVDLKLNLQTKED----LNE  62

Query  376  KMKSPSKEPNKDPIKPPSKAQVVGWPPVRNYRKNIMAQksspeeaageksggggpaaFVK  555
            K  S  K   KDP KPP+KAQVVGWPPVR+YRKN+MAQK +  E   + +     AAFVK
Sbjct  63   KSASKEKTLLKDPAKPPAKAQVVGWPPVRSYRKNMMAQKVNNTEDTEKTTSNTTAAAFVK  122

Query  556  VCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQG  684
            V MDGAPYLRKVDL MY++Y+ LSDALAKMFSSFT GNYGAQG
Sbjct  123  VSMDGAPYLRKVDLTMYKTYKDLSDALAKMFSSFTTGNYGAQG  165



>gb|KEH42778.1| auxin-responsive AUX/IAA family protein [Medicago truncatula]
Length=239

 Score =   173 bits (438),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 105/163 (64%), Positives = 119/163 (73%), Gaps = 9/163 (6%)
 Frame = +1

Query  211  GLNLKATEl-----clglpgggggNESESLKVTGKRGFSETVDLKLNLQSAADSSLDLKE  375
            GLNLK TEL       G  GGGGG+E E+ + +GKRGFSETVDLKLNLQ+  D    L E
Sbjct  7    GLNLKETELCLGLPGGGGGGGGGGSEVETPRASGKRGFSETVDLKLNLQTKED----LNE  62

Query  376  KMKSPSKEPNKDPIKPPSKAQVVGWPPVRNYRKNIMAQksspeeaageksggggpaaFVK  555
            K  S  K   KDP KPP+KAQVVGWPPVR+YRKN+MAQK +  E   + +     AAFVK
Sbjct  63   KSASKEKTLLKDPAKPPAKAQVVGWPPVRSYRKNMMAQKVNNTEDTEKTTSNTTAAAFVK  122

Query  556  VCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQG  684
            V MDGAPYLRKVDL MY++Y+ LSDALAKMFSSFT GNYGAQG
Sbjct  123  VSMDGAPYLRKVDLTMYKTYKDLSDALAKMFSSFTTGNYGAQG  165



>ref|XP_003556389.2| PREDICTED: auxin-responsive protein IAA14-like [Glycine max]
Length=331

 Score =   175 bits (444),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 111/181 (61%), Positives = 127/181 (70%), Gaps = 17/181 (9%)
 Frame = +1

Query  181  KMGSMLAEHGGLNLKATE---------lclglpgggggNESESLKVTGKRGFSETVDLKL  333
            +M +ML +  GLNLK TE            G  GGGGG E E+ + TGKRGFSETVDLKL
Sbjct  84   EMATMLTKEHGLNLKETELCLGLPGGGGGGGGGGGGGGGEVETPRATGKRGFSETVDLKL  143

Query  334  NLQSAADSSLDLKEKMKSPSKEPN--KDPIKPPSKAQVVGWPPVRNYRKNIMA--Qkssp  501
            NL S  D    L E +K+ SKE    KDP KPP+KAQVVGWPPVR+YRKN+MA  + S+ 
Sbjct  144  NLHSKED----LNENLKNVSKEKTLLKDPAKPPAKAQVVGWPPVRSYRKNMMAVQKVSTE  199

Query  502  eeaageksggggpaaFVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQ  681
            + A    S    P AFVKV MDGAPYLRKVDL MY+SY++LSDALAKMFSSFTMGNYGAQ
Sbjct  200  DVAEKTTSSTANPGAFVKVSMDGAPYLRKVDLTMYKSYKELSDALAKMFSSFTMGNYGAQ  259

Query  682  G  684
            G
Sbjct  260  G  260



>dbj|BAH15071.1| indole-3-acetic acid 14 transcription factor like [Malus prunifolia]
Length=243

 Score =   172 bits (437),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 110/172 (64%), Positives = 125/172 (73%), Gaps = 5/172 (3%)
 Frame = +1

Query  184  MGSMLAEHGGLNLKATElclgl--pgggggNESESLKVTGKRGFSETVDLKLNLQSAADS  357
            M SML     LNL+  ELCLGL   G     E E+ K TGKRGFSET+DLKLNLQS  D 
Sbjct  1    MMSMLGVERDLNLREAELCLGLPGGGTTTVAEPETAKTTGKRGFSETIDLKLNLQSKEDL  60

Query  358  SLDLKE---KMKSPSKEPNKDPIKPPSKAQVVGWPPVRNYRKNIMAQksspeeaageksg  528
            + ++K    K K+      KDP KPP+KAQVVGWPPVR+YRKN+MAQK++ EE   + S 
Sbjct  61   NDNVKNIASKDKNNFLSCTKDPSKPPAKAQVVGWPPVRSYRKNVMAQKNTSEEKTKKASA  120

Query  529  gggpaaFVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQG  684
            GG  AAFVKVCMDGAPYLRKVDLKMY SYQ+LS+ALAKMFSSFT G YG QG
Sbjct  121  GGCTAAFVKVCMDGAPYLRKVDLKMYRSYQELSNALAKMFSSFTTGYYGDQG  172



>ref|XP_004172452.1| PREDICTED: auxin-responsive protein IAA14-like [Cucumis sativus]
 gb|KGN61643.1| hypothetical protein Csa_2G200420 [Cucumis sativus]
Length=256

 Score =   173 bits (438),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 98/149 (66%), Positives = 110/149 (74%), Gaps = 14/149 (9%)
 Frame = +1

Query  280  SLKVTGKRGFSETVDLKLNLQS-------AADSSLDLKEKMKSPSKEPN-------KDPI  417
            SLK +GKRGFSETVDLKLNLQS            +DL E +K+ S   +       KDP 
Sbjct  37   SLKASGKRGFSETVDLKLNLQSKDGGGGVGVGVGVDLNENIKNVSTNVDGEKSLCSKDPA  96

Query  418  KPPSKAQVVGWPPVRNYRKNIMAQksspeeaageksggggpaaFVKVCMDGAPYLRKVDL  597
            KPP+KAQVVGWPPVR+YRKN+MAQK++      EK  GG  AAFVKVCMDGAPYLRKVDL
Sbjct  97   KPPAKAQVVGWPPVRSYRKNVMAQKNTSGGEGTEKGNGGSSAAFVKVCMDGAPYLRKVDL  156

Query  598  KMYESYQQLSDALAKMFSSFTMGNYGAQG  684
            KMY+SYQ+LSDALAKMFSSFTMG YG QG
Sbjct  157  KMYQSYQELSDALAKMFSSFTMGEYGTQG  185



>gb|KHN30563.1| Auxin-responsive protein IAA14 [Glycine soja]
Length=233

 Score =   172 bits (436),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 106/169 (63%), Positives = 120/169 (71%), Gaps = 9/169 (5%)
 Frame = +1

Query  193  MLAEHGGLNLKATElclglpgggggNESESLKVTGKRGFSETVDLKLNLQSAADSSLDLK  372
            ML    GL+L   E  L L   GGG+E E+ + TGKRGFSETVDLKLNLQ+  D    L 
Sbjct  1    MLTNEHGLSLNLKETELCLGLPGGGSEVETPRATGKRGFSETVDLKLNLQTKED----LN  56

Query  373  EKMKSPSKEPN--KDPIKPPSKAQVVGWPPVRNYRKNIMAQksspeeaageksggggpa-  543
            E +K+ SKE    KDP KPP+KAQVVGWPPVR+YRKN+MA +    E   EK+     A 
Sbjct  57   ENLKNVSKEKTLLKDPAKPPAKAQVVGWPPVRSYRKNMMAVQKVSTEEVAEKTTSSTTAN  116

Query  544  --aFVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQG  684
              AFVKV MDGAPYLRKVDL MY+SY+ LSDALAKMFSSFTMGNYGAQG
Sbjct  117  SGAFVKVSMDGAPYLRKVDLTMYKSYKDLSDALAKMFSSFTMGNYGAQG  165



>gb|AFK37379.1| unknown [Medicago truncatula]
Length=236

 Score =   172 bits (435),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 103/163 (63%), Positives = 119/163 (73%), Gaps = 9/163 (6%)
 Frame = +1

Query  211  GLNLKATEl-----clglpgggggNESESLKVTGKRGFSETVDLKLNLQSAADSSLDLKE  375
            GLNLK TEL       G  GGGGG+E E+ + +GKRGFSETVDLKLNLQ+  D    L E
Sbjct  7    GLNLKETELCLGLPGGGGGGGGGGSEVETPRASGKRGFSETVDLKLNLQTKED----LNE  62

Query  376  KMKSPSKEPNKDPIKPPSKAQVVGWPPVRNYRKNIMAQksspeeaageksggggpaaFVK  555
            K  S  K   KDP KPP+KAQVVGWPPVR+Y+KN+MAQK +  E   + +     A FVK
Sbjct  63   KSASKEKTLLKDPAKPPAKAQVVGWPPVRSYKKNMMAQKVNNTEDTEKTTSNTTAAVFVK  122

Query  556  VCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQG  684
            V MDGAPYLRKVDL MY++Y+ LSDALAKMFSSFT+GNYGAQG
Sbjct  123  VSMDGAPYLRKVDLTMYKTYKDLSDALAKMFSSFTIGNYGAQG  165



>ref|XP_007143877.1| hypothetical protein PHAVU_007G109500g [Phaseolus vulgaris]
 gb|ESW15871.1| hypothetical protein PHAVU_007G109500g [Phaseolus vulgaris]
Length=244

 Score =   172 bits (435),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 107/177 (60%), Positives = 124/177 (70%), Gaps = 14/177 (8%)
 Frame = +1

Query  184  MGSMLAEHGGLNLKATE--------lclglpgggggNESESLKVTGKRGFSETVDLKLNL  339
            M +ML +   LNLK TE           G  GGGGG+E E+ + TGKRGFSETVDLKLNL
Sbjct  1    MATMLGKEHHLNLKETELCLGLPGAGGGGGSGGGGGSEVETPRATGKRGFSETVDLKLNL  60

Query  340  QSAADSSLDLKEKMKSPSKEPN--KDPIKPPSKAQVVGWPPVRNYRKNIMAQksspeeaa  513
            Q+  D    L E +K+  +E    KDP K P+KAQVVGWPPVR+YRKN+M QK S E+ A
Sbjct  61   QAKED----LNENLKNAPEEKTLLKDPTKQPAKAQVVGWPPVRSYRKNMMTQKVSTEDGA  116

Query  514  geksggggpaaFVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQG  684
             + +      AFVKV MDGAPYLRKVDL MY+SY+ LSDALAKMFSSFTMGNYGAQG
Sbjct  117  EKTTSSTASGAFVKVSMDGAPYLRKVDLTMYKSYKDLSDALAKMFSSFTMGNYGAQG  173



>ref|XP_008465181.1| PREDICTED: auxin-responsive protein IAA14-like [Cucumis melo]
Length=256

 Score =   172 bits (436),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 97/149 (65%), Positives = 109/149 (73%), Gaps = 14/149 (9%)
 Frame = +1

Query  280  SLKVTGKRGFSETVDLKLNLQS-------AADSSLDLKEKMKSPSKEPN-------KDPI  417
            SLK +GKRGFSETVDLKLNLQS            +DL E +K+ S   +       KDP 
Sbjct  37   SLKSSGKRGFSETVDLKLNLQSKDGGGGGGVGVGVDLNENVKNVSTNVDGEKSLCSKDPA  96

Query  418  KPPSKAQVVGWPPVRNYRKNIMAQksspeeaageksggggpaaFVKVCMDGAPYLRKVDL  597
            KPP+KAQVVGWPPVR+YRKN+MAQK++      EK   G  AAFVKVCMDGAPYLRKVDL
Sbjct  97   KPPAKAQVVGWPPVRSYRKNVMAQKNTSGGEGAEKGSSGSSAAFVKVCMDGAPYLRKVDL  156

Query  598  KMYESYQQLSDALAKMFSSFTMGNYGAQG  684
            KMY+SYQ+LSDALAKMFSSFTMG YG QG
Sbjct  157  KMYQSYQELSDALAKMFSSFTMGEYGTQG  185



>ref|NP_001266070.1| IAA14 [Solanum lycopersicum]
 gb|AEX00357.1| IAA14 [Solanum lycopersicum]
Length=236

 Score =   171 bits (433),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 96/140 (69%), Positives = 108/140 (77%), Gaps = 13/140 (9%)
 Frame = +1

Query  286  KVTGKRGFSETVDLKLNLQSAAD--SSLDLKEKMKS---PSKE--PNKDPIKPPSKAQVV  444
            KV GKRGFSETVDLKLN   A+D  S      KMKS    +KE   NKDPIKPP+KAQVV
Sbjct  32   KVNGKRGFSETVDLKLNFHQASDDISCAMENNKMKSSVTTTKEVVCNKDPIKPPAKAQVV  91

Query  445  GWPPVRNYRKNIMAQksspeeaageksggggpaaFVKVCMDGAPYLRKVDLKMYESYQQL  624
            GWPPVR++RKN+MAQKS+ EE+    +       FVKVCMDGAPYLRKVDLKMY+SYQ+L
Sbjct  92   GWPPVRSFRKNVMAQKSNTEESEKTTAA------FVKVCMDGAPYLRKVDLKMYKSYQEL  145

Query  625  SDALAKMFSSFTMGNYGAQG  684
            SDALAKMFSSFT GNYG+QG
Sbjct  146  SDALAKMFSSFTNGNYGSQG  165



>ref|NP_001280875.1| auxin-responsive protein IAA14-like [Malus domestica]
 gb|ADL36585.1| ARF domain class transcription factor [Malus domestica]
Length=244

 Score =   171 bits (433),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 113/173 (65%), Positives = 128/173 (74%), Gaps = 6/173 (3%)
 Frame = +1

Query  184  MGSMLAEHGGLNLKATElclgl--pgggggNESESLKVTGKRGFSETVDLKLNLQSAADS  357
            M SML     LNL+ TELCLGL   G     E E+ K TGKRGFSET+DLKLNLQS  D 
Sbjct  1    MMSMLGVERDLNLRETELCLGLPGGGTTTVAEPETAKTTGKRGFSETIDLKLNLQSKEDL  60

Query  358  SLDLKE---KMKSPSKEPNKDPIKPPSKAQVVGWPPVRNYRKNIMAQksspeeaageksg  528
            + ++K    K K+      KDP KPP+KAQVVGWPPVR+YRKNIMAQK++ EE   + SG
Sbjct  61   NDNVKNIASKDKNNFLSCTKDPSKPPAKAQVVGWPPVRSYRKNIMAQKNTSEEKTKKASG  120

Query  529  gg-gpaaFVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQG  684
            GG   AAFVKVCMDGAPYLRKVDLKMY+SYQ+LS+ALAKMFSSFT G YG QG
Sbjct  121  GGGCTAAFVKVCMDGAPYLRKVDLKMYKSYQELSNALAKMFSSFTTGYYGTQG  173



>ref|XP_009337294.1| PREDICTED: auxin-responsive protein IAA14-like [Pyrus x bretschneideri]
Length=244

 Score =   170 bits (430),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 112/173 (65%), Positives = 128/173 (74%), Gaps = 6/173 (3%)
 Frame = +1

Query  184  MGSMLAEHGGLNLKATElclgl--pgggggNESESLKVTGKRGFSETVDLKLNLQSAADS  357
            M SML     LNL+ TELCLGL   G     E E+ K TGKRGFSETVDLKLNLQS  D 
Sbjct  1    MTSMLGVERDLNLRETELCLGLPGGGTTTVAEPETAKTTGKRGFSETVDLKLNLQSKEDL  60

Query  358  SLDLKE---KMKSPSKEPNKDPIKPPSKAQVVGWPPVRNYRKNIMAQksspeeaageksg  528
            + ++K    K K+      KDP KPP+KAQVVGWPPVR+YRKNIM+QK++ EE   + SG
Sbjct  61   NDNVKNIASKDKNNLLSCTKDPSKPPAKAQVVGWPPVRSYRKNIMSQKNTSEEKTEKASG  120

Query  529  gg-gpaaFVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQG  684
            GG   AAFVKVCMDGAPYLRKVDLKMY+SYQ+LS+AL+KMFSSFT G YG QG
Sbjct  121  GGGCSAAFVKVCMDGAPYLRKVDLKMYKSYQELSNALSKMFSSFTTGYYGTQG  173



>ref|XP_008362015.1| PREDICTED: auxin-responsive protein IAA14-like [Malus domestica]
Length=244

 Score =   169 bits (429),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 115/176 (65%), Positives = 130/176 (74%), Gaps = 12/176 (7%)
 Frame = +1

Query  184  MGSMLAEHGGLNLKATElclglpgggggNESE-SLKVTGKRGFSETVDLKLNLQSAADSS  360
            M SML     LNL+ TELCLGLPGGG    +E   K TGKRGFSETVDLKL LQS  D +
Sbjct  1    MTSMLGVECDLNLRETELCLGLPGGGTSTVAEPETKATGKRGFSETVDLKLKLQSKDDLN  60

Query  361  LDLKEKMKSPSKEPN------KDPIKPPSKAQVVGWPPVRNYRKNIMAQksspeeaagek  522
             ++K      S+E N      KDP KPP+KAQVVGWPPVR+YRKNIMAQK++ EE   + 
Sbjct  61   DNVKN---IASREKNDLLSCTKDPAKPPAKAQVVGWPPVRSYRKNIMAQKNTSEENTEKA  117

Query  523  sggg--gpaaFVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQG  684
            + GG    AAFVKVCMDGAPYLRKVDLKMY+SYQ+LS+ALAKMFSSFT G YGAQG
Sbjct  118  TVGGGGCSAAFVKVCMDGAPYLRKVDLKMYKSYQELSNALAKMFSSFTTGYYGAQG  173



>ref|XP_004495391.1| PREDICTED: auxin-responsive protein IAA14-like isoform X1 [Cicer 
arietinum]
Length=244

 Score =   169 bits (428),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 100/172 (58%), Positives = 120/172 (70%), Gaps = 8/172 (5%)
 Frame = +1

Query  184  MGSMLAEHGGLNLKATEl-clglpgggggNESESLKVTGKRGFSETVDLKLNLQSAADSS  360
            M +++ +  GLNLK TEL      GGG G+E E+ +  GKRGFSETVDLKLNLQS  +  
Sbjct  1    MATLIGKESGLNLKETELCLGLPGGGGSGSEVETQRAAGKRGFSETVDLKLNLQSNKE--  58

Query  361  LDLKEKMKSPSKEPN--KDPIKPPSKAQVVGWPPVRNYRKNIMAQksspeea--ageksg  528
             DL +  K+ SK+    KDP KPP+KAQVVGWPPVR+YRKN+MAQK +  +     + + 
Sbjct  59   -DLNDNSKNVSKDKTLLKDPAKPPAKAQVVGWPPVRSYRKNMMAQKVNNSDQDGNEKTTS  117

Query  529  gggpaaFVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQG  684
                  FVKV MDGAPYLRKVDL MY +Y+ LSDALAKMFSSFT G YGAQG
Sbjct  118  STTAGTFVKVSMDGAPYLRKVDLTMYNTYKDLSDALAKMFSSFTTGKYGAQG  169



>ref|XP_004495392.1| PREDICTED: auxin-responsive protein IAA14-like isoform X2 [Cicer 
arietinum]
Length=240

 Score =   169 bits (427),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 99/172 (58%), Positives = 119/172 (69%), Gaps = 8/172 (5%)
 Frame = +1

Query  184  MGSMLAEHGGLNLKATE-lclglpgggggNESESLKVTGKRGFSETVDLKLNLQSAADSS  360
            M +++ +  GLNLK TE       GGG G+E E+ +  GKRGFSETVDLKLNLQS  +  
Sbjct  1    MATLIGKESGLNLKETELCLGLPGGGGSGSEVETQRAAGKRGFSETVDLKLNLQSNKE--  58

Query  361  LDLKEKMKSPSKEPN--KDPIKPPSKAQVVGWPPVRNYRKNIMAQksspeea--ageksg  528
             DL +  K+ SK+    KDP KPP+KAQVVGWPPVR+YRKN+MAQK +  +     + + 
Sbjct  59   -DLNDNSKNVSKDKTLLKDPAKPPAKAQVVGWPPVRSYRKNMMAQKVNNSDQDGNEKTTS  117

Query  529  gggpaaFVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQG  684
                  FVKV MDGAPYLRKVDL MY +Y+ LSDALAKMFSSFT G YGAQG
Sbjct  118  STTAGTFVKVSMDGAPYLRKVDLTMYNTYKDLSDALAKMFSSFTTGKYGAQG  169



>ref|XP_006362195.1| PREDICTED: auxin-responsive protein IAA14-like [Solanum tuberosum]
Length=238

 Score =   168 bits (426),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 94/140 (67%), Positives = 106/140 (76%), Gaps = 13/140 (9%)
 Frame = +1

Query  286  KVTGKRGFSETVDLKLNLQSAAD--SSLDLKEKMK---SPSKE--PNKDPIKPPSKAQVV  444
            K+ GKRGFSETVDLKLN   A D  S      KMK   + +KE   NKDPIKPP+KAQVV
Sbjct  34   KINGKRGFSETVDLKLNFHQANDDISCAMENNKMKNSVTTTKEVVCNKDPIKPPAKAQVV  93

Query  445  GWPPVRNYRKNIMAQksspeeaageksggggpaaFVKVCMDGAPYLRKVDLKMYESYQQL  624
            GWPPVR++RKN+MAQKS+ EE+            FVKVCMDGAPYLRKVDLKMY+SYQ+L
Sbjct  94   GWPPVRSFRKNVMAQKSNTEESEKTTVA------FVKVCMDGAPYLRKVDLKMYKSYQEL  147

Query  625  SDALAKMFSSFTMGNYGAQG  684
            SDALAKMFSSFT GNYG+QG
Sbjct  148  SDALAKMFSSFTNGNYGSQG  167



>gb|EYU32514.1| hypothetical protein MIMGU_mgv1a012542mg [Erythranthe guttata]
Length=247

 Score =   168 bits (425),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 113/180 (63%), Positives = 131/180 (73%), Gaps = 16/180 (9%)
 Frame = +1

Query  172  VGRKMGSMLAEHGGLNLKATElclglpgggggNESESLKVTGKRGFSETVDLKLNLQS-A  348
            VGRKM  +     GLN   TELCLGLPGGGGG  ++ +K TGKRGFSETVDLKLNLQS  
Sbjct  4    VGRKMAGL----HGLNFMETELCLGLPGGGGGESTDPIKTTGKRGFSETVDLKLNLQSNE  59

Query  349  ADSSLDLKEKMKSPSKE-----PNKDPIKPPSKAQVVGWPPVRNYRKNIMAQksspe---  504
              SS DL   +   S E     P KDPIKPP+KAQVVGWPPVR++RKNI++ + S     
Sbjct  60   PPSSSDL---INISSTEINAMLPPKDPIKPPAKAQVVGWPPVRSFRKNIISHQKSSSPAD  116

Query  505  eaageksggggpaaFVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQG  684
            +   +K+     AAFVKV MDGAPYLRKVDLKMY +YQ+LSDALAKMFSSFTMGNYG++G
Sbjct  117  QQDSDKAAAACSAAFVKVSMDGAPYLRKVDLKMYGAYQELSDALAKMFSSFTMGNYGSEG  176



>ref|NP_974355.1| auxin-responsive protein IAA7 [Arabidopsis thaliana]
 gb|AEE76709.1| auxin-responsive protein IAA7 [Arabidopsis thaliana]
Length=210

 Score =   166 bits (421),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 106/166 (64%), Positives = 117/166 (70%), Gaps = 9/166 (5%)
 Frame = +1

Query  214  LNLKATElclglpgggggNESESLKVTG-KRGFSETVDLKLNLQSAADSSLDLKEKMKSP  390
            +NLKATELCLGLPGG    ES +    G KRGFSETVDL LNLQS  + S+DLK     P
Sbjct  6    MNLKATELCLGLPGGAEAVESPAKSAVGSKRGFSETVDLMLNLQSNKEGSVDLKNVSAVP  65

Query  391  SKEPN-KDPIKPPSKAQVVGWPPVRNYRKNIMAQksspeeaageksggggpaa-------  546
             ++   KDP KPP+KAQVVGWPPVRNYRKN+M Q+ +   A    S   G          
Sbjct  66   KEKTTLKDPSKPPAKAQVVGWPPVRNYRKNMMTQQKTSSGAEEASSEKAGNFGGGAAGAG  125

Query  547  FVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQG  684
             VKV MDGAPYLRKVDLKMY+SYQ LSDALAKMFSSFTMGNYGAQG
Sbjct  126  LVKVSMDGAPYLRKVDLKMYKSYQDLSDALAKMFSSFTMGNYGAQG  171



>ref|XP_010024036.1| PREDICTED: auxin-responsive protein IAA14-like [Eucalyptus grandis]
 gb|KCW60450.1| hypothetical protein EUGRSUZ_H03170 [Eucalyptus grandis]
Length=243

 Score =   167 bits (423),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 111/165 (67%), Positives = 122/165 (74%), Gaps = 10/165 (6%)
 Frame = +1

Query  214  LNLKATElclglpgggggNESESLKVTGKRGFSET-VDLKLNLQSA-ADSSLDLKEKMKS  387
            LN K TELCLGLPGGGGG E E+ + TGKRGFSET VDLKLNLQ+  A S +DLKE MKS
Sbjct  10   LNFKETELCLGLPGGGGGAEVEAPRATGKRGFSETEVDLKLNLQAKDASSVVDLKEAMKS  69

Query  388  PSK------EPNKDPIKPPSKAQVVGWPPVRNYRKNIMAQksspeeaageksggggpaaF  549
              K       P KDP KPP+KAQVVGWPPVR+YRKN+M   +       E+      AAF
Sbjct  70   NEKTLLAGASPAKDPAKPPAKAQVVGWPPVRSYRKNMMV--AQKSTDPEEEKEKAAAAAF  127

Query  550  VKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQG  684
            VKV MDGAPYLRKVDLK Y SY+QLSDAL KMFSSFTMG+YGAQG
Sbjct  128  VKVSMDGAPYLRKVDLKNYSSYKQLSDALGKMFSSFTMGSYGAQG  172



>ref|XP_008438588.1| PREDICTED: auxin-responsive protein IAA14-like [Cucumis melo]
Length=237

 Score =   167 bits (422),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 106/179 (59%), Positives = 120/179 (67%), Gaps = 19/179 (11%)
 Frame = +1

Query  166  MEVGRKMGSMLAEHGGLNLKATElclglpgggggNESESLKVTGKRGFSETVDLKLNLQS  345
            MEV RKM +ML     L L             GG E E+ K  GKRGFSETVDLKLN+QS
Sbjct  1    MEVSRKMVNMLETDLCLGLPG-----------GGAEPETPKANGKRGFSETVDLKLNIQS  49

Query  346  AADSSLDLKEKMKSPSKE-----PNKDPIKPPSKAQVVGWPPVRNYRKNIMAQksspeea  510
                ++DL  K    S +      +KDP KPP+KAQVVGWPPVR+YRKN M+QKS     
Sbjct  50   KTGVTVDLTPKNSDTSTDEENLITSKDPAKPPAKAQVVGWPPVRSYRKNAMSQKSPDSGE  109

Query  511  ageksggggpaaFVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTM-GNYGAQG  684
             G  SGG     FVKVCMDGAPYLRKVDLKMY+SYQ+LS+ALAKMFSSFTM G+YGAQG
Sbjct  110  KGGSSGGSAM--FVKVCMDGAPYLRKVDLKMYKSYQELSNALAKMFSSFTMAGDYGAQG  166



>ref|XP_006298251.1| hypothetical protein CARUB_v10014321mg [Capsella rubella]
 gb|EOA31149.1| hypothetical protein CARUB_v10014321mg [Capsella rubella]
Length=285

 Score =   168 bits (426),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 92/134 (69%), Positives = 98/134 (73%), Gaps = 5/134 (4%)
 Frame = +1

Query  289  VTGKRGFSETVDLKLNLQSAADSSLDLKEKMKSPSKEPN--KDPIKPPSKAQVVGWPPVR  462
            V  KRGFSETVDL LNLQS  + S+DL     SP KE N  KDP KPP+KAQVVGWPPVR
Sbjct  83   VGSKRGFSETVDLMLNLQSNKEGSVDLNNVAASP-KEKNLIKDPAKPPAKAQVVGWPPVR  141

Query  463  NYRKNIMAQksspeeaageksggggpaaFVKVCMDGAPYLRKVDLKMYESYQQLSDALAK  642
            NYRKNIM Q+ +           G     VKV MDGAPYLRKVDLKMY+SYQ LSDALAK
Sbjct  142  NYRKNIMTQQKTSGTEEASSEKAGAG--LVKVSMDGAPYLRKVDLKMYKSYQDLSDALAK  199

Query  643  MFSSFTMGNYGAQG  684
            MFSSFTMGNYGAQG
Sbjct  200  MFSSFTMGNYGAQG  213



>gb|AAM65301.1| indoleacetic acid (IAA)-inducible gene (IAA7) [Arabidopsis thaliana]
Length=238

 Score =   167 bits (422),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 106/166 (64%), Positives = 117/166 (70%), Gaps = 9/166 (5%)
 Frame = +1

Query  214  LNLKATElclglpgggggNESESLKVTG-KRGFSETVDLKLNLQSAADSSLDLKEKMKSP  390
            +NLKATELCLGLPGG    ES +    G KRGFSETVDL LNLQS  + S+DLK     P
Sbjct  1    MNLKATELCLGLPGGAEAVESPAKSAVGSKRGFSETVDLMLNLQSNKEGSVDLKNVSAVP  60

Query  391  SKEPN-KDPIKPPSKAQVVGWPPVRNYRKNIMAQksspeeaageksggggpaa-------  546
             ++   KDP KPP+KAQVVGWPPVRNYRKN+M Q+ +   A    S   G          
Sbjct  61   KEKTTLKDPSKPPAKAQVVGWPPVRNYRKNMMTQQKTSSGAEEASSEKAGNFGGGAAGAG  120

Query  547  FVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQG  684
             VKV MDGAPYLRKVDLKMY+SYQ LSDALAKMFSSFTMGNYGAQG
Sbjct  121  LVKVSMDGAPYLRKVDLKMYKSYQDLSDALAKMFSSFTMGNYGAQG  166



>ref|NP_188945.1| auxin-responsive protein IAA7 [Arabidopsis thaliana]
 sp|Q38825.1|IAA7_ARATH RecName: Full=Auxin-responsive protein IAA7; AltName: Full=Auxin 
resistant 2; AltName: Full=Indoleacetic acid-induced protein 
7 [Arabidopsis thaliana]
 gb|AAG48759.1|AF332395_1 indoleacetic acid-inducible protein IAA7 [Arabidopsis thaliana]
 gb|AAC49048.1| IAA7 [Arabidopsis thaliana]
 dbj|BAB02096.1| auxin-responsive protein IAA7 [Arabidopsis thaliana]
 gb|AAK96842.1| auxin-responsive protein IAA7 [Arabidopsis thaliana]
 gb|AAL66876.1| auxin-responsive protein IAA7 [Arabidopsis thaliana]
 gb|AEE76710.1| auxin-responsive protein IAA7 [Arabidopsis thaliana]
Length=243

 Score =   167 bits (422),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 106/166 (64%), Positives = 117/166 (70%), Gaps = 9/166 (5%)
 Frame = +1

Query  214  LNLKATElclglpgggggNESESLKVTG-KRGFSETVDLKLNLQSAADSSLDLKEKMKSP  390
            +NLKATELCLGLPGG    ES +    G KRGFSETVDL LNLQS  + S+DLK     P
Sbjct  6    MNLKATELCLGLPGGAEAVESPAKSAVGSKRGFSETVDLMLNLQSNKEGSVDLKNVSAVP  65

Query  391  SKEPN-KDPIKPPSKAQVVGWPPVRNYRKNIMAQksspeeaageksggggpaa-------  546
             ++   KDP KPP+KAQVVGWPPVRNYRKN+M Q+ +   A    S   G          
Sbjct  66   KEKTTLKDPSKPPAKAQVVGWPPVRNYRKNMMTQQKTSSGAEEASSEKAGNFGGGAAGAG  125

Query  547  FVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQG  684
             VKV MDGAPYLRKVDLKMY+SYQ LSDALAKMFSSFTMGNYGAQG
Sbjct  126  LVKVSMDGAPYLRKVDLKMYKSYQDLSDALAKMFSSFTMGNYGAQG  171



>gb|KFK24541.1| hypothetical protein AALP_AAs58011U000100 [Arabis alpina]
Length=230

 Score =   166 bits (420),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 112/159 (70%), Positives = 119/159 (75%), Gaps = 2/159 (1%)
 Frame = +1

Query  214  LNLKATElclglpgggggNESESLKVTG-KRGFSETVDLKLNLQSAADSSLDLKEKMKSP  390
            +NLK TELCLGLPGG    ES +    G KRGFSETVDLKLNLQS   + +DL     S 
Sbjct  1    MNLKETELCLGLPGGLETVESPAKSGVGNKRGFSETVDLKLNLQSNKQAPIDLNVAGTSR  60

Query  391  SKEPNKDPIKPPSKAQVVGWPPVRNYRKNIMA-QksspeeaageksggggpaaFVKVCMD  567
             K   KDP KPP+KAQVVGWPPVRNYRKNIMA QKSS E       GGGG  AFVKV MD
Sbjct  61   EKTLLKDPSKPPAKAQVVGWPPVRNYRKNIMANQKSSEEAEEAMSGGGGGTVAFVKVSMD  120

Query  568  GAPYLRKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQG  684
            GAPYLRKVDLKMY SY+ LSDALAKMFSSFTMG+YGAQG
Sbjct  121  GAPYLRKVDLKMYNSYKDLSDALAKMFSSFTMGSYGAQG  159



>ref|XP_002883395.1| hypothetical protein ARALYDRAFT_319024 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH59654.1| hypothetical protein ARALYDRAFT_319024 [Arabidopsis lyrata subsp. 
lyrata]
Length=242

 Score =   166 bits (420),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 103/165 (62%), Positives = 115/165 (70%), Gaps = 8/165 (5%)
 Frame = +1

Query  214  LNLKATElclglpgggggNESESLKVTG-KRGFSETVDLKLNLQSAADSSLDLKEKMKSP  390
            +NLKATELCLGLPGG    ES +    G KRGFSETVDL LNLQS  + S+DL     +P
Sbjct  6    MNLKATELCLGLPGGAEAVESPAKSAVGSKRGFSETVDLMLNLQSNKEGSVDLNNVAAAP  65

Query  391  SKEPN-KDPIKPPSKAQVVGWPPVRNYRKNIMAQksspeeaageksggggpaa------F  549
             ++   KDP KPP+KAQVVGWPPVRNYRKN+M Q+ +           G           
Sbjct  66   KEKTTLKDPSKPPTKAQVVGWPPVRNYRKNMMTQQKTSGVEEASSEKAGSGGGGAAGAGL  125

Query  550  VKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQG  684
            VKV MDGAPYLRKVDLKMY+SYQ LSDALAKMFSSFTMGNYGAQG
Sbjct  126  VKVSMDGAPYLRKVDLKMYKSYQDLSDALAKMFSSFTMGNYGAQG  170



>ref|XP_004134096.1| PREDICTED: auxin-responsive protein IAA14-like isoform 1 [Cucumis 
sativus]
 ref|XP_004162257.1| PREDICTED: LOW QUALITY PROTEIN: auxin-responsive protein IAA14-like 
[Cucumis sativus]
 gb|KGN56916.1| hypothetical protein Csa_3G143570 [Cucumis sativus]
Length=237

 Score =   166 bits (419),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 106/179 (59%), Positives = 121/179 (68%), Gaps = 19/179 (11%)
 Frame = +1

Query  166  MEVGRKMGSMLAEHGGLNLKATElclglpgggggNESESLKVTGKRGFSETVDLKLNLQS  345
            MEV RKM +ML     L L             GG E E+ K  GKRGFSETVDLKLN+QS
Sbjct  1    MEVSRKMVNMLETDLCLGLPG-----------GGAEPETPKANGKRGFSETVDLKLNIQS  49

Query  346  AADSSLDLKEKMKSPSKE-----PNKDPIKPPSKAQVVGWPPVRNYRKNIMAQksspeea  510
                ++DL  +    S +      +KDP KPP+KAQVVGWPPVR+YRKN M+QKSS    
Sbjct  50   KPGVTVDLTPQNNDTSTDEESLIASKDPAKPPAKAQVVGWPPVRSYRKNAMSQKSSEAGE  109

Query  511  ageksggggpaaFVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTM-GNYGAQG  684
             G  SGG     FVKVCMDGAPYLRKVDLKMY+SYQ+LS+ALAKMFSSFTM G+YGAQG
Sbjct  110  KGGSSGGSAM--FVKVCMDGAPYLRKVDLKMYKSYQELSNALAKMFSSFTMAGDYGAQG  166



>ref|XP_010087762.1| Auxin-responsive protein IAA7 [Morus notabilis]
 gb|EXB29843.1| Auxin-responsive protein IAA7 [Morus notabilis]
Length=304

 Score =   167 bits (424),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 97/144 (67%), Positives = 106/144 (74%), Gaps = 12/144 (8%)
 Frame = +1

Query  289  VTGKRGFSETVDLKLNL--QSAADSSLDLKEKMKS-PSKEPN-----KDPIKPPSKAQVV  444
             TGKRG+SETVDLKLNL  QS  +   ++  K  S P KE N     KDP KPP+KAQVV
Sbjct  41   TTGKRGYSETVDLKLNLHRQSVKEDLNEINIKSTSAPPKEKNLLPCTKDPAKPPAKAQVV  100

Query  445  GWPPVRNYRKNIMAQksspeeaag----eksggggpaaFVKVCMDGAPYLRKVDLKMYES  612
            GWPPVR+YRKNIMAQK S  E +       S      AFVKVCMDGAPYLRKVDLKMY+S
Sbjct  101  GWPPVRSYRKNIMAQKMSTNEESSPHEKTSSSSNSAGAFVKVCMDGAPYLRKVDLKMYKS  160

Query  613  YQQLSDALAKMFSSFTMGNYGAQG  684
            YQ+LSDALAKMFSSFTMGNYGAQG
Sbjct  161  YQELSDALAKMFSSFTMGNYGAQG  184



>ref|XP_010512022.1| PREDICTED: auxin-responsive protein IAA7 [Camelina sativa]
Length=242

 Score =   166 bits (419),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 105/166 (63%), Positives = 117/166 (70%), Gaps = 10/166 (6%)
 Frame = +1

Query  214  LNLKATElclglpgggggNESESLKVTG-KRGFSETVDLKLNLQSAADSSLDLKEKMKSP  390
            +NLKATELCLGLPGG    ES +    G KRGFSETVDL LNLQS  + S+DL   + + 
Sbjct  6    MNLKATELCLGLPGGAEAVESPAKSAVGSKRGFSETVDLMLNLQSNKEGSVDLNN-VAAS  64

Query  391  SKEPN--KDPIKPPSKAQVVGWPPVRNYRKNIMAQksspeeaageksggggpaa------  546
            +KE    KDP KPP+KAQVVGWPPVRNYRKNIM Q+ +           G  +       
Sbjct  65   TKEKTLLKDPAKPPAKAQVVGWPPVRNYRKNIMTQQKASGTEEASSEKAGSGSGGAAGAG  124

Query  547  FVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQG  684
             VKV MDGAPYLRKVDLKMY+SYQ LSDALAKMFSSFTMGNYGAQG
Sbjct  125  LVKVSMDGAPYLRKVDLKMYKSYQDLSDALAKMFSSFTMGNYGAQG  170



>gb|ADL70640.1| indole-3-acetic acid inducible 14 [Arabidopsis thaliana]
Length=172

 Score =   163 bits (413),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 107/158 (68%), Positives = 114/158 (72%), Gaps = 2/158 (1%)
 Frame = +1

Query  214  LNLKATElclglpgggggNESESLKVTG-KRGFSETVDLKLNLQSAADSSLDLKEKMKSP  390
            +NLK TELCLGLPGG    ES +    G KRGFSETVDLKLNLQS     +DL       
Sbjct  1    MNLKETELCLGLPGGTETVESPAKSGVGNKRGFSETVDLKLNLQSNKQGHVDLNTNGAPK  60

Query  391  SKEPNKDPIKPPSKAQVVGWPPVRNYRKNIMAQksspeeaageksggggpaaFVKVCMDG  570
             K   KDP KPP+KAQVVGWPPVRNYRKN+MA      EA    S GGG  AFVKV MDG
Sbjct  61   EKTFLKDPSKPPAKAQVVGWPPVRNYRKNVMAN-QKSGEAEEAMSSGGGTVAFVKVSMDG  119

Query  571  APYLRKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQG  684
            APYLRKVDLKMY SY+ LSDALAKMFSSFTMG+YGAQG
Sbjct  120  APYLRKVDLKMYNSYKDLSDALAKMFSSFTMGSYGAQG  157



>gb|ADL70639.1| indole-3-acetic acid inducible 14 [Arabidopsis thaliana]
Length=171

 Score =   163 bits (413),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 107/158 (68%), Positives = 114/158 (72%), Gaps = 2/158 (1%)
 Frame = +1

Query  214  LNLKATElclglpgggggNESESLKVTG-KRGFSETVDLKLNLQSAADSSLDLKEKMKSP  390
            +NLK TELCLGLPGG    ES +    G KRGFSETVDLKLNLQS     +DL       
Sbjct  1    MNLKETELCLGLPGGTETVESPAKSGVGNKRGFSETVDLKLNLQSNKQGHVDLNTNGAPK  60

Query  391  SKEPNKDPIKPPSKAQVVGWPPVRNYRKNIMAQksspeeaageksggggpaaFVKVCMDG  570
             K   KDP KPP+KAQVVGWPPVRNYRKN+MA      EA    S GGG  AFVKV MDG
Sbjct  61   EKTFLKDPSKPPAKAQVVGWPPVRNYRKNVMAN-QKSGEAEEAMSSGGGTVAFVKVSMDG  119

Query  571  APYLRKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQG  684
            APYLRKVDLKMY SY+ LSDALAKMFSSFTMG+YGAQG
Sbjct  120  APYLRKVDLKMYTSYKDLSDALAKMFSSFTMGSYGAQG  157



>gb|ADL70642.1| indole-3-acetic acid inducible 14 [Arabidopsis thaliana]
 gb|ADL70650.1| indole-3-acetic acid inducible 14 [Arabidopsis thaliana]
Length=172

 Score =   163 bits (413),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 107/158 (68%), Positives = 114/158 (72%), Gaps = 2/158 (1%)
 Frame = +1

Query  214  LNLKATElclglpgggggNESESLKVTG-KRGFSETVDLKLNLQSAADSSLDLKEKMKSP  390
            +NLK TELCLGLPGG    ES +    G KRGFSETVDLKLNLQS     +DL       
Sbjct  1    MNLKETELCLGLPGGTETVESPAKSGVGNKRGFSETVDLKLNLQSNKQGHVDLNTNGAPK  60

Query  391  SKEPNKDPIKPPSKAQVVGWPPVRNYRKNIMAQksspeeaageksggggpaaFVKVCMDG  570
             K   KDP KPP+KAQVVGWPPVRNYRKN+MA      EA    S GGG  AFVKV MDG
Sbjct  61   EKTFLKDPSKPPAKAQVVGWPPVRNYRKNVMAN-QKSGEAEEAMSSGGGTVAFVKVSMDG  119

Query  571  APYLRKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQG  684
            APYLRKVDLKMY SY+ LSDALAKMFSSFTMG+YGAQG
Sbjct  120  APYLRKVDLKMYTSYKDLSDALAKMFSSFTMGSYGAQG  157



>ref|XP_010488346.1| PREDICTED: auxin-responsive protein IAA7-like [Camelina sativa]
Length=242

 Score =   165 bits (417),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 104/166 (63%), Positives = 117/166 (70%), Gaps = 10/166 (6%)
 Frame = +1

Query  214  LNLKATElclglpgggggNESESLKVTG-KRGFSETVDLKLNLQSAADSSLDLKEKMKSP  390
            +NL+ATELCLGLPGG    ES +    G KRGFSETVDL LNLQS  + S+DL   + + 
Sbjct  6    MNLRATELCLGLPGGAEAVESPAKSAVGSKRGFSETVDLMLNLQSNKEGSVDLN-NVAAS  64

Query  391  SKEPN--KDPIKPPSKAQVVGWPPVRNYRKNIMAQksspeeaageksggggpaa------  546
            +KE    KDP KPP+KAQVVGWPPVRNYRKNIM Q+ +           G  +       
Sbjct  65   TKEKTLLKDPAKPPAKAQVVGWPPVRNYRKNIMTQQKASGTEEASSEKAGSGSGGAAGAG  124

Query  547  FVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQG  684
             VKV MDGAPYLRKVDLKMY+SYQ LSDALAKMFSSFTMGNYGAQG
Sbjct  125  LVKVSMDGAPYLRKVDLKMYKSYQDLSDALAKMFSSFTMGNYGAQG  170



>ref|XP_010552451.1| PREDICTED: auxin-responsive protein IAA14-like [Tarenaya hassleriana]
Length=235

 Score =   164 bits (416),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 88/138 (64%), Positives = 100/138 (72%), Gaps = 5/138 (4%)
 Frame = +1

Query  271  ESESLKVTGKRGFSETVDLKLNLQSAADSSLDLKEKMKSPSKEPNKDPIKPPSKAQVVGW  450
            ES +     KRGFSETVDLKLNLQ+  +  +DL    K  S   +KD  KPP+KAQVVGW
Sbjct  32   ESPAKAAGNKRGFSETVDLKLNLQTNKEGVVDLNNVAKDKSLLVSKDHAKPPAKAQVVGW  91

Query  451  PPVRNYRKNIMAQksspeeaageksggggpaaFVKVCMDGAPYLRKVDLKMYESYQQLSD  630
            PPVRNYRKN+MA + S      + +       FVKV MDGAPYLRKVDLKMY+SYQ+LSD
Sbjct  92   PPVRNYRKNMMAHQKSSAVEEEKAAAA-----FVKVSMDGAPYLRKVDLKMYKSYQELSD  146

Query  631  ALAKMFSSFTMGNYGAQG  684
            ALAKMFSSFTMGNYGAQG
Sbjct  147  ALAKMFSSFTMGNYGAQG  164



>gb|ADB93627.2| indole-3-acetic acid inducible 14 [Arabidopsis thaliana]
Length=191

 Score =   162 bits (411),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 107/158 (68%), Positives = 114/158 (72%), Gaps = 2/158 (1%)
 Frame = +1

Query  214  LNLKATElclglpgggggNESESLKVTG-KRGFSETVDLKLNLQSAADSSLDLKEKMKSP  390
            +NLK TELCLGLPGG    ES +    G KRGFSETVDLKLNLQS     +DL       
Sbjct  1    MNLKETELCLGLPGGTETVESPAKSGVGNKRGFSETVDLKLNLQSNKQGHVDLNTNGAPK  60

Query  391  SKEPNKDPIKPPSKAQVVGWPPVRNYRKNIMAQksspeeaageksggggpaaFVKVCMDG  570
             K   KDP KPP+KAQVVGWPPVRNYRKN+MA      EA    S GGG  AFVKV MDG
Sbjct  61   EKTFLKDPSKPPAKAQVVGWPPVRNYRKNVMAN-QKSGEAEEAMSSGGGTVAFVKVSMDG  119

Query  571  APYLRKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQG  684
            APYLRKVDLKMY SY+ LSDALAKMFSSFTMG+YGAQG
Sbjct  120  APYLRKVDLKMYTSYKDLSDALAKMFSSFTMGSYGAQG  157



>gb|ADB93628.1| indole-3-acetic acid inducible 14 [Arabidopsis thaliana]
 gb|ADL70647.1| indole-3-acetic acid inducible 14 [Arabidopsis thaliana]
 gb|ADL70648.1| indole-3-acetic acid inducible 14 [Arabidopsis thaliana]
 gb|ADL70649.1| indole-3-acetic acid inducible 14 [Arabidopsis thaliana]
 gb|ADL70651.1| indole-3-acetic acid inducible 14 [Arabidopsis thaliana]
Length=189

 Score =   162 bits (411),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 107/158 (68%), Positives = 114/158 (72%), Gaps = 2/158 (1%)
 Frame = +1

Query  214  LNLKATElclglpgggggNESESLKVTG-KRGFSETVDLKLNLQSAADSSLDLKEKMKSP  390
            +NLK TELCLGLPGG    ES +    G KRGFSETVDLKLNLQS     +DL       
Sbjct  1    MNLKETELCLGLPGGTETVESPAKSGVGNKRGFSETVDLKLNLQSNKQGHVDLNTNGAPK  60

Query  391  SKEPNKDPIKPPSKAQVVGWPPVRNYRKNIMAQksspeeaageksggggpaaFVKVCMDG  570
             K   KDP KPP+KAQVVGWPPVRNYRKN+MA      EA    S GGG  AFVKV MDG
Sbjct  61   EKTFLKDPSKPPAKAQVVGWPPVRNYRKNVMAN-QKSGEAEEAMSSGGGTVAFVKVSMDG  119

Query  571  APYLRKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQG  684
            APYLRKVDLKMY SY+ LSDALAKMFSSFTMG+YGAQG
Sbjct  120  APYLRKVDLKMYTSYKDLSDALAKMFSSFTMGSYGAQG  157



>emb|CDY63910.1| BnaC01g43640D [Brassica napus]
 emb|CDY30781.1| BnaC07g16810D [Brassica napus]
Length=240

 Score =   164 bits (415),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 100/164 (61%), Positives = 112/164 (68%), Gaps = 7/164 (4%)
 Frame = +1

Query  214  LNLKATElclglpgggggNESESLKVTG-KRGFSETVDLKLNLQSAADSSLDLKEKMKSP  390
            +NLKATELCL LPGG    ++ +    G KRGFSETVDL LNLQS  + ++DL     S 
Sbjct  6    MNLKATELCLSLPGGAETLDTPAKSAVGNKRGFSETVDLMLNLQSNKERAIDLNNATASK  65

Query  391  SKEPNKDPIKPPSKAQVVGWPPVRNYRKNIMAQksspeeaageksg------gggpaaFV  552
             K   KDP+KPP+KAQVVGWPPVRNYRKNIM  + +                G   A  V
Sbjct  66   QKTLLKDPVKPPAKAQVVGWPPVRNYRKNIMTNQKTSGADEASSEKAGNGGGGATGATLV  125

Query  553  KVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQG  684
            KV MDGAPYLRKV LKMY+SYQ LSDALAKMFSSFTMGNYGAQG
Sbjct  126  KVSMDGAPYLRKVHLKMYKSYQDLSDALAKMFSSFTMGNYGAQG  169



>gb|ADB93625.2| indole-3-acetic acid inducible 14 [Arabidopsis thaliana]
 gb|ADB93626.2| indole-3-acetic acid inducible 14 [Arabidopsis thaliana]
 gb|ADL70643.1| indole-3-acetic acid inducible 14 [Arabidopsis thaliana]
 gb|ADL70644.1| indole-3-acetic acid inducible 14 [Arabidopsis thaliana]
 gb|ADL70645.1| indole-3-acetic acid inducible 14 [Arabidopsis thaliana]
 gb|ADL70646.1| indole-3-acetic acid inducible 14 [Arabidopsis thaliana]
Length=190

 Score =   162 bits (411),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 107/158 (68%), Positives = 114/158 (72%), Gaps = 2/158 (1%)
 Frame = +1

Query  214  LNLKATElclglpgggggNESESLKVTG-KRGFSETVDLKLNLQSAADSSLDLKEKMKSP  390
            +NLK TELCLGLPGG    ES +    G KRGFSETVDLKLNLQS     +DL       
Sbjct  1    MNLKETELCLGLPGGTETVESPAKSGVGNKRGFSETVDLKLNLQSNKQGHVDLNTNGAPK  60

Query  391  SKEPNKDPIKPPSKAQVVGWPPVRNYRKNIMAQksspeeaageksggggpaaFVKVCMDG  570
             K   KDP KPP+KAQVVGWPPVRNYRKN+MA      EA    S GGG  AFVKV MDG
Sbjct  61   EKTFLKDPSKPPAKAQVVGWPPVRNYRKNVMAN-QKSGEAEEAMSSGGGTVAFVKVSMDG  119

Query  571  APYLRKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQG  684
            APYLRKVDLKMY SY+ LSDALAKMFSSFTMG+YGAQG
Sbjct  120  APYLRKVDLKMYTSYKDLSDALAKMFSSFTMGSYGAQG  157



>gb|ADB93629.2| indole-3-acetic acid inducible 14 [Arabidopsis thaliana]
Length=190

 Score =   162 bits (411),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 107/158 (68%), Positives = 114/158 (72%), Gaps = 2/158 (1%)
 Frame = +1

Query  214  LNLKATElclglpgggggNESESLKVTG-KRGFSETVDLKLNLQSAADSSLDLKEKMKSP  390
            +NLK TELCLGLPGG    ES +    G KRGFSETVDLKLNLQS     +DL       
Sbjct  1    MNLKETELCLGLPGGTETIESPAKSGVGNKRGFSETVDLKLNLQSNKQGHVDLNTNGAPK  60

Query  391  SKEPNKDPIKPPSKAQVVGWPPVRNYRKNIMAQksspeeaageksggggpaaFVKVCMDG  570
             K   KDP KPP+KAQVVGWPPVRNYRKN+MA      EA    S GGG  AFVKV MDG
Sbjct  61   EKTFLKDPSKPPAKAQVVGWPPVRNYRKNVMAN-QKSGEAEEAMSSGGGTVAFVKVSMDG  119

Query  571  APYLRKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQG  684
            APYLRKVDLKMY SY+ LSDALAKMFSSFTMG+YGAQG
Sbjct  120  APYLRKVDLKMYTSYKDLSDALAKMFSSFTMGSYGAQG  157



>gb|AFK44393.1| unknown [Lotus japonicus]
Length=242

 Score =   164 bits (415),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 107/175 (61%), Positives = 126/175 (72%), Gaps = 12/175 (7%)
 Frame = +1

Query  184  MGSMLAE-HGGLNLKATElc----lglpgggggNESESLKVTGKRGFSETVDLKLNLQSA  348
            M ++L +    LNLK TELC     G  GGGG ++ E+ +  GKRGFSETVDLKLNLQS 
Sbjct  1    MATLLGKVQNDLNLKETELCLGLPGGGGGGGGSDQVETPRSNGKRGFSETVDLKLNLQSK  60

Query  349  ADSSLDLKEKMKSPSKEPN--KDPIKPPSKAQVVGWPPVRNYRKNIMAQksspeeaagek  522
             D    L + +K+ SKE    KDP KPP+KAQVVGWPPVR+YRKN+M QK + E+   EK
Sbjct  61   ED----LNDDVKNVSKEKTLLKDPAKPPAKAQVVGWPPVRSYRKNMMVQKVNNEDQGTEK  116

Query  523  sggggpa-aFVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQG  684
            +       AF KV MDGAPYLRKVDL MY+SY++LSDALAKMFSSFTMGNYGAQG
Sbjct  117  TTSSTAGGAFAKVSMDGAPYLRKVDLTMYKSYKELSDALAKMFSSFTMGNYGAQG  171



>ref|XP_010466604.1| PREDICTED: auxin-responsive protein IAA7-like [Camelina sativa]
Length=242

 Score =   163 bits (413),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 104/166 (63%), Positives = 116/166 (70%), Gaps = 10/166 (6%)
 Frame = +1

Query  214  LNLKATElclglpgggggNESESLKVTG-KRGFSETVDLKLNLQSAADSSLDLKEKMKSP  390
            +NLKATELCLGLPGG    ES +    G KR FSETVDL LNLQS  + S+DL   + + 
Sbjct  6    MNLKATELCLGLPGGAEAVESPAKSAVGSKRSFSETVDLMLNLQSNKEGSVDLNN-VAAS  64

Query  391  SKEPN--KDPIKPPSKAQVVGWPPVRNYRKNIMAQksspeeaageksggggpaa------  546
            +KE    KDP KPP+KAQVVGWPPVRNYRKNIM Q+ +           G  +       
Sbjct  65   TKEKTLLKDPAKPPAKAQVVGWPPVRNYRKNIMTQQKASGTEEASSEKAGSGSGGAAGAG  124

Query  547  FVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQG  684
             VKV MDGAPYLRKVDLKMY+SYQ LSDALAKMFSSFTMGNYGAQG
Sbjct  125  LVKVSMDGAPYLRKVDLKMYKSYQDLSDALAKMFSSFTMGNYGAQG  170



>gb|ADL70641.1| indole-3-acetic acid inducible 14 [Arabidopsis thaliana]
Length=190

 Score =   162 bits (409),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 106/158 (67%), Positives = 113/158 (72%), Gaps = 2/158 (1%)
 Frame = +1

Query  214  LNLKATElclglpgggggNESESLKVTG-KRGFSETVDLKLNLQSAADSSLDLKEKMKSP  390
            +NLK TELCLGLPG     ES +    G KRGFSETVDLKLNLQS     +DL       
Sbjct  1    MNLKETELCLGLPGCTETVESPAKSGVGNKRGFSETVDLKLNLQSNKQGHVDLNVNGAPK  60

Query  391  SKEPNKDPIKPPSKAQVVGWPPVRNYRKNIMAQksspeeaageksggggpaaFVKVCMDG  570
             K   KDP KPP+KAQVVGWPPVRNYRKN+MA      EA    S GGG  AFVKV MDG
Sbjct  61   EKTFLKDPSKPPAKAQVVGWPPVRNYRKNVMAN-QKSGEAEEAMSSGGGTVAFVKVSMDG  119

Query  571  APYLRKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQG  684
            APYLRKVDLKMY SY+ LSDALAKMFSSFTMG+YGAQG
Sbjct  120  APYLRKVDLKMYTSYKDLSDALAKMFSSFTMGSYGAQG  157



>ref|XP_002315736.1| aux/IAA family protein [Populus trichocarpa]
 gb|EEF01907.1| aux/IAA family protein [Populus trichocarpa]
Length=277

 Score =   164 bits (414),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 114/198 (58%), Positives = 130/198 (66%), Gaps = 38/198 (19%)
 Frame = +1

Query  202  EHGGLNLKATElclgl-pgggggNESESL-KVTGKRGFSETVDLKLNLQSAADSSLDLKE  375
            E   LN K TELCLGL    G  NE E+  K TGKRGF+ETVDLKLNLQ A +  +DL E
Sbjct  10   EMADLNYKETELCLGLPGAVGVKNEVETPNKATGKRGFAETVDLKLNLQ-AKEGVMDLNE  68

Query  376  KMKS-PSKEPN-------KDPIKPPSKAQVVGWPPVRNYRKNIMAQkss-----------  498
             +K+  SK+ N       KDP KPP+KAQVVGWPPVR+YRKN++AQK++           
Sbjct  69   NIKNIASKDKNHLPADTIKDPAKPPAKAQVVGWPPVRSYRKNVLAQKNASEEGFRAQVVG  128

Query  499  ----------------peeaageksggggpaaFVKVCMDGAPYLRKVDLKMYESYQQLSD  630
                              E   + S GG  AAFVKVCMDGAPYLRKVDLKMY+SYQ+LSD
Sbjct  129  WPPLRSYRKNVLTQKNASEEGDKASTGGSSAAFVKVCMDGAPYLRKVDLKMYKSYQELSD  188

Query  631  ALAKMFSSFTMGNYGAQG  684
            ALAKMFSSFTMGNYGAQG
Sbjct  189  ALAKMFSSFTMGNYGAQG  206



>emb|CAB46059.1| IAA7 like protein [Arabidopsis thaliana]
 emb|CAB78497.1| IAA7 like protein [Arabidopsis thaliana]
Length=234

 Score =   162 bits (410),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 107/158 (68%), Positives = 114/158 (72%), Gaps = 2/158 (1%)
 Frame = +1

Query  214  LNLKATElclglpgggggNESESLKVTG-KRGFSETVDLKLNLQSAADSSLDLKEKMKSP  390
            +NLK TELCLGLPGG    ES +    G KRGFSETVDLKLNLQS     +DL       
Sbjct  1    MNLKETELCLGLPGGTETVESPAKSGVGNKRGFSETVDLKLNLQSNKQGHVDLNTNGAPK  60

Query  391  SKEPNKDPIKPPSKAQVVGWPPVRNYRKNIMAQksspeeaageksggggpaaFVKVCMDG  570
             K   KDP KPP+KAQVVGWPPVRNYRKN+MA      EA    S GGG  AFVKV MDG
Sbjct  61   EKTFLKDPSKPPAKAQVVGWPPVRNYRKNVMAN-QKSGEAEEAMSSGGGTVAFVKVSMDG  119

Query  571  APYLRKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQG  684
            APYLRKVDLKMY SY+ LSDALAKMFSSFTMG+YGAQG
Sbjct  120  APYLRKVDLKMYTSYKDLSDALAKMFSSFTMGSYGAQG  157



>ref|NP_193191.2| auxin-responsive protein IAA14 [Arabidopsis thaliana]
 sp|Q38832.2|IAA14_ARATH RecName: Full=Auxin-responsive protein IAA14; AltName: Full=Indoleacetic 
acid-induced protein 14; AltName: Full=Protein SOLITARY 
ROOT [Arabidopsis thaliana]
 gb|AAG50096.1|AF334718_1 IAA14 [Arabidopsis thaliana]
 dbj|BAF00338.1| IAA14 [Arabidopsis thaliana]
 dbj|BAH30518.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE83459.1| auxin-responsive protein IAA14 [Arabidopsis thaliana]
Length=228

 Score =   162 bits (410),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 107/158 (68%), Positives = 114/158 (72%), Gaps = 2/158 (1%)
 Frame = +1

Query  214  LNLKATElclglpgggggNESESLKVTG-KRGFSETVDLKLNLQSAADSSLDLKEKMKSP  390
            +NLK TELCLGLPGG    ES +    G KRGFSETVDLKLNLQS     +DL       
Sbjct  1    MNLKETELCLGLPGGTETVESPAKSGVGNKRGFSETVDLKLNLQSNKQGHVDLNTNGAPK  60

Query  391  SKEPNKDPIKPPSKAQVVGWPPVRNYRKNIMAQksspeeaageksggggpaaFVKVCMDG  570
             K   KDP KPP+KAQVVGWPPVRNYRKN+MA      EA    S GGG  AFVKV MDG
Sbjct  61   EKTFLKDPSKPPAKAQVVGWPPVRNYRKNVMAN-QKSGEAEEAMSSGGGTVAFVKVSMDG  119

Query  571  APYLRKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQG  684
            APYLRKVDLKMY SY+ LSDALAKMFSSFTMG+YGAQG
Sbjct  120  APYLRKVDLKMYTSYKDLSDALAKMFSSFTMGSYGAQG  157



>ref|XP_009135842.1| PREDICTED: auxin-responsive protein IAA7-like [Brassica rapa]
 emb|CDX92973.1| BnaA03g36950D [Brassica napus]
Length=237

 Score =   162 bits (410),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 102/160 (64%), Positives = 113/160 (71%), Gaps = 3/160 (2%)
 Frame = +1

Query  214  LNLKATElclglpgggggNESES-LKVTGKRGFSETVDLKLNLQSAADSSLDLKEKMKSP  390
            +NL ATELCLGLPGG    ES +   V  KRGFSET+DL LNLQ   + ++DL     S 
Sbjct  6    MNLNATELCLGLPGGTKAVESPAKSSVRNKRGFSETMDLMLNLQCNKEETVDLNNATASK  65

Query  391  SKEPNKDPIKPPSKAQVVGWPPVRNYRKNIMAQksspeeaageksgggg--paaFVKVCM  564
             K   KDP KPP+KAQVVGWPPVRNYRKN+M Q+ +  E        G    AA VKV M
Sbjct  66   EKTLLKDPAKPPAKAQVVGWPPVRNYRKNMMTQQKTSGEEEASSEKAGNGGGAALVKVSM  125

Query  565  DGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQG  684
            DGAPYLRKVDL MY+SYQ LSDALAKMFSSFTMGNYGAQG
Sbjct  126  DGAPYLRKVDLTMYKSYQDLSDALAKMFSSFTMGNYGAQG  165



>ref|XP_008341049.1| PREDICTED: auxin-responsive protein IAA7-like [Malus domestica]
Length=173

 Score =   160 bits (405),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 110/170 (65%), Positives = 125/170 (74%), Gaps = 12/170 (7%)
 Frame = +1

Query  184  MGSMLAEHGGLNLKATElclglpgggggNESE-SLKVTGKRGFSETVDLKLNLQSAADSS  360
            M SML     LNL+ TELCLGLPGGG    +E   K TGKRGFSETVDLKL LQS  D +
Sbjct  1    MTSMLGVECDLNLRETELCLGLPGGGTSTVAEPETKATGKRGFSETVDLKLKLQSKDDLN  60

Query  361  LDLKEKMKSPSKEPN------KDPIKPPSKAQVVGWPPVRNYRKNIMAQksspeeaagek  522
             ++K      S+E N      KDP KPP+KAQVVGWPPVR+YRKNIMAQK++ EE   + 
Sbjct  61   DNVKN---IASREKNDLLSCTKDPAKPPAKAQVVGWPPVRSYRKNIMAQKNTSEENTEKA  117

Query  523  sggg--gpaaFVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMG  666
            + GG    AAFVKVCMDGAPYLRKVDLKMY+SYQ+LS+ALAKMFSSFT G
Sbjct  118  TVGGGGCSAAFVKVCMDGAPYLRKVDLKMYKSYQELSNALAKMFSSFTTG  167



>ref|XP_006406100.1| hypothetical protein EUTSA_v10021428mg [Eutrema salsugineum]
 dbj|BAJ33997.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ47553.1| hypothetical protein EUTSA_v10021428mg [Eutrema salsugineum]
Length=239

 Score =   162 bits (409),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 107/162 (66%), Positives = 121/162 (75%), Gaps = 5/162 (3%)
 Frame = +1

Query  214  LNLKATElclglpgggggNESESLKVTG-KRGFSETVDLKLNLQSAADSSLDLKEKMKSP  390
            +NLKAT+LCLGLPGG    ES +    G KRGFSETVDL LNLQS  + ++DL     +P
Sbjct  6    MNLKATDLCLGLPGGAEAVESPAKSAVGNKRGFSETVDLMLNLQSNKEGTVDLNNVSAAP  65

Query  391  -SKEPNKDPIKPPSKAQVVGWPPVRNYRKNIMAQkssp---eeaageksggggpaaFVKV  558
              K   KD  KPP+KAQVVGWPPVRNYRKNIM Q+ +    E ++ +   GGG AA VKV
Sbjct  66   KEKTLLKDHSKPPAKAQVVGWPPVRNYRKNIMTQQKTSGVEEASSEKAGSGGGAAALVKV  125

Query  559  CMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQG  684
             MDGAPYLRKVDLKMY+SYQ LSDALAKMFSSFTMGNYGAQG
Sbjct  126  SMDGAPYLRKVDLKMYKSYQDLSDALAKMFSSFTMGNYGAQG  167



>emb|CDY10349.1| BnaC05g29300D [Brassica napus]
Length=246

 Score =   161 bits (407),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 103/164 (63%), Positives = 115/164 (70%), Gaps = 10/164 (6%)
 Frame = +1

Query  220  LKATElclglpgggggNESESLKVTG-KRGFSETVDLKLNLQSAADSSLDLKEKMKSPSK  396
            L ATELCLGLPGG   NE+ +    G KRGFSETVDL LNLQS  + ++DL   + S SK
Sbjct  12   LYATELCLGLPGGAEANENLAKSAVGNKRGFSETVDLMLNLQSNKEGAVDLNN-VASASK  70

Query  397  EPN--KDPIKPPSKAQVVGWPPVRNYRKNIMAQksspeeaageksggggpaa------FV  552
            E    KDP KPP+KAQVVGWPPVRNYRKNI+ Q+ +  +        G           V
Sbjct  71   ETTLLKDPAKPPAKAQVVGWPPVRNYRKNIITQQKTSGKEEASSEKAGNSGGGASGAALV  130

Query  553  KVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQG  684
            KV MDGAPYLRKVDLKMY+SYQ LSDALAKMFSSFTMGNYGAQG
Sbjct  131  KVSMDGAPYLRKVDLKMYKSYQDLSDALAKMFSSFTMGNYGAQG  174



>emb|CAC84710.1| aux/IAA protein [Populus tremula x Populus tremuloides]
Length=277

 Score =   162 bits (409),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 111/198 (56%), Positives = 127/198 (64%), Gaps = 38/198 (19%)
 Frame = +1

Query  202  EHGGLNLKATElclgl-pgggggNESESL-KVTGKRGFSETVDLKLNLQSAADSSLDLKE  375
            E   LN KATELCLGL    G  NE E+  K TGKRGF+ETVDLKLNLQ A +  +DL E
Sbjct  10   ERADLNYKATELCLGLPGAVGVKNEVETPNKATGKRGFAETVDLKLNLQ-AKEGVMDLNE  68

Query  376  KMKSPSKEPN--------KDPIKPPSKAQVVGWPPVRNYRKNIMAQkss-----------  498
             + + + E          KDP KPP+KAQVVGWPPVR+YRKN++AQK++           
Sbjct  69   NINNIASEDKNHLPSATIKDPAKPPAKAQVVGWPPVRSYRKNVLAQKNASEEGFGAQVEG  128

Query  499  ----------------peeaageksggggpaaFVKVCMDGAPYLRKVDLKMYESYQQLSD  630
                              E   + S GG  AAFVKVCMDGAPYLRKVDLKMY+SYQ+LSD
Sbjct  129  WPPVRSYRKNVLVQKNASEEGEKASTGGCSAAFVKVCMDGAPYLRKVDLKMYKSYQELSD  188

Query  631  ALAKMFSSFTMGNYGAQG  684
            ALAKMFSS TMGNYGAQG
Sbjct  189  ALAKMFSSLTMGNYGAQG  206



>gb|EYU33008.1| hypothetical protein MIMGU_mgv1a012321mg [Erythranthe guttata]
Length=254

 Score =   161 bits (407),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 109/186 (59%), Positives = 126/186 (68%), Gaps = 16/186 (9%)
 Frame = +1

Query  166  MEVGRKMGSMLAEHGGLNLKATElclglpgggggNESESLKVTGKRGFSETVDLKLNLQS  345
            MEV RKM   +AE  GLN K TELCLGLPGGGGG E +++K+ GKRGFSETVDLKLNLQS
Sbjct  1    MEVCRKM---VAEERGLNFKETELCLGLPGGGGGGEPDAVKINGKRGFSETVDLKLNLQS  57

Query  346  AADSSLDLKEKMKSPSKEPNKDPIKPPS-------------KAQVVGWPPVRNYRKNIMA  486
               +S DL       + + N    K  +             KAQVVGWPPVR++RKNI+ 
Sbjct  58   NDSASTDLNNGGGGGAMKNNNSAEKTAANMVPPKDPVKPPAKAQVVGWPPVRSFRKNIVM  117

Query  487  QksspeeaageksggggpaaFVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMG  666
                   +  E  GGG  AAFVKV MDGAPYLRKVDLKMY+SYQ+ SDALAKMFSSFTMG
Sbjct  118  SHQKNSSSDEEAGGGGAAAAFVKVSMDGAPYLRKVDLKMYKSYQEFSDALAKMFSSFTMG  177

Query  667  NYGAQG  684
             YG++G
Sbjct  178  KYGSEG  183



>ref|NP_001288823.1| auxin-responsive protein IAA7 [Brassica rapa]
 dbj|BAF81520.1| auxin-responsive protein IAA [Brassica rapa]
Length=242

 Score =   160 bits (406),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 102/166 (61%), Positives = 116/166 (70%), Gaps = 10/166 (6%)
 Frame = +1

Query  214  LNLKATElclglpgggggNES-ESLKVTGKRGFSETVDLKLNLQSAADSSLDLKEKMKSP  390
            +NLKATELCLGLPGG   NE+ E   V  KRGFSETVDL LNLQS  + ++DL   + S 
Sbjct  6    INLKATELCLGLPGGAEANENLEKSAVGNKRGFSETVDLMLNLQSNKEGAVDLNN-VASA  64

Query  391  SKEPN--KDPIKPPSKAQVVGWPPVRNYRKNIMAQksspeeaageksggggpaa------  546
            SK+    KDP KPP+KAQVVGWPPVRNYRKNI+ Q+ +  +        G          
Sbjct  65   SKDKTLLKDPAKPPAKAQVVGWPPVRNYRKNIITQQKTSGKEEASSEKAGNSGGGASGAA  124

Query  547  FVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQG  684
             VKV MDGAPYLRKVDLKMY+SY+  SDALAKMFSSFTMG YGAQG
Sbjct  125  LVKVSMDGAPYLRKVDLKMYKSYKDFSDALAKMFSSFTMGKYGAQG  170



>ref|XP_010440448.1| PREDICTED: auxin-responsive protein IAA14-like [Camelina sativa]
Length=225

 Score =   160 bits (404),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 90/132 (68%), Positives = 94/132 (71%), Gaps = 1/132 (1%)
 Frame = +1

Query  289  VTGKRGFSETVDLKLNLQSAADSSLDLKEKMKSPSKEPNKDPIKPPSKAQVVGWPPVRNY  468
            V  KRGFSETVDLKLNLQS      DL        K   KDP KPP+KAQVVGWPPVRNY
Sbjct  24   VGNKRGFSETVDLKLNLQSNKQGHGDLNVAGSIKEKTLLKDPAKPPAKAQVVGWPPVRNY  83

Query  469  RKNIMAQksspeeaageksggggpaaFVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMF  648
            RKN+MA      E     S  GG  AFVKV MDGAPYLRKVDLKMY SY+ LSDALAKMF
Sbjct  84   RKNVMAN-QKNGETDEAMSSAGGTVAFVKVSMDGAPYLRKVDLKMYNSYKNLSDALAKMF  142

Query  649  SSFTMGNYGAQG  684
            SSFTMG+YGAQG
Sbjct  143  SSFTMGSYGAQG  154



>ref|XP_006414696.1| hypothetical protein EUTSA_v10026031mg [Eutrema salsugineum]
 gb|ESQ56149.1| hypothetical protein EUTSA_v10026031mg [Eutrema salsugineum]
Length=257

 Score =   160 bits (405),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 90/134 (67%), Positives = 99/134 (74%), Gaps = 4/134 (3%)
 Frame = +1

Query  289  VTGKRGFSETVDLKLNLQSAADSSLDLKEKMKSPSKEPNKDPIKPPSKAQVVGWPPVRNY  468
            V  KRGFSETVD KLNLQS     +DL   +    KE  KDP KPP+KAQVVGWPPVRNY
Sbjct  55   VGNKRGFSETVDFKLNLQSNKQGHVDLN--VTVAHKEKTKDPAKPPAKAQVVGWPPVRNY  112

Query  469  RKNIMAQksspeeaageksgggg--paaFVKVCMDGAPYLRKVDLKMYESYQQLSDALAK  642
            RK++MA + S E       GGG     AFVKV MDGAPYLRKVDLKMY+SY+ LSDALAK
Sbjct  113  RKSVMAHQKSSEVEEASSCGGGRGGTVAFVKVSMDGAPYLRKVDLKMYKSYKDLSDALAK  172

Query  643  MFSSFTMGNYGAQG  684
            MFSSFTMG+YGAQG
Sbjct  173  MFSSFTMGSYGAQG  186



>gb|AFS44507.1| auxin repressor, partial [Fragaria x ananassa]
Length=231

 Score =   159 bits (403),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 91/138 (66%), Positives = 106/138 (77%), Gaps = 12/138 (9%)
 Frame = +1

Query  286  KVTGKRGFSETVDLKLNLQSAADSSLDLKEKMKS-PSKEPN----KDPIKPPSKAQVVGW  450
            K TGKRGFSETVDLKLNL   A+  L + E +K+  S+E N    KDP KPP+KAQVVGW
Sbjct  30   KATGKRGFSETVDLKLNLH--ANEGL-MNESVKNVSSREKNLPCIKDPAKPPAKAQVVGW  86

Query  451  PPVRNYRKNIMAQksspeeaageksggggpaaFVKVCMDGAPYLRKVDLKMYESYQQLSD  630
            PPVR+YRKN+MAQKS+ EE++           FVKVCMDGAPYLRKVDLKMY+SY++LSD
Sbjct  87   PPVRSYRKNVMAQKSTGEESSTTTEKAA----FVKVCMDGAPYLRKVDLKMYKSYKELSD  142

Query  631  ALAKMFSSFTMGNYGAQG  684
            AL+KMFSSFT G YG QG
Sbjct  143  ALSKMFSSFTTGYYGTQG  160



>ref|XP_004288427.1| PREDICTED: auxin-responsive protein IAA14-like [Fragaria vesca 
subsp. vesca]
Length=238

 Score =   159 bits (403),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 91/138 (66%), Positives = 107/138 (78%), Gaps = 12/138 (9%)
 Frame = +1

Query  286  KVTGKRGFSETVDLKLNLQSAADSSLDLKEKMKS-PSKEPN----KDPIKPPSKAQVVGW  450
            K TGKRGFSETVDLKLNL   A+  L + E +K+  S+E N    KDP KPP+KAQVVGW
Sbjct  37   KATGKRGFSETVDLKLNLH--ANEGL-MNESVKNVSSREKNLPCIKDPAKPPAKAQVVGW  93

Query  451  PPVRNYRKNIMAQksspeeaageksggggpaaFVKVCMDGAPYLRKVDLKMYESYQQLSD  630
            PPVR++RKN+MAQKS+ EE++           FVKVCMDGAPYLRKVDLKMY+SY++LSD
Sbjct  94   PPVRSFRKNVMAQKSTGEESSTTTEKAA----FVKVCMDGAPYLRKVDLKMYKSYKELSD  149

Query  631  ALAKMFSSFTMGNYGAQG  684
            AL+KMFSSFT G YGAQG
Sbjct  150  ALSKMFSSFTTGYYGAQG  167



>ref|XP_010435110.1| PREDICTED: auxin-responsive protein IAA14 [Camelina sativa]
Length=228

 Score =   159 bits (401),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 90/132 (68%), Positives = 94/132 (71%), Gaps = 1/132 (1%)
 Frame = +1

Query  289  VTGKRGFSETVDLKLNLQSAADSSLDLKEKMKSPSKEPNKDPIKPPSKAQVVGWPPVRNY  468
            V  KRGFSETVDLKLNLQS      DL        K   KDP KPP+KAQVVGWPPVRNY
Sbjct  27   VGNKRGFSETVDLKLNLQSNKQGHGDLNVAGSIKEKTLLKDPAKPPAKAQVVGWPPVRNY  86

Query  469  RKNIMAQksspeeaageksggggpaaFVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMF  648
            RKN+MA      E     S  GG  AFVKV MDGAPYLRKVDLKMY SY+ LSDALAKMF
Sbjct  87   RKNVMAN-HKNGEPDEAMSSAGGTVAFVKVSMDGAPYLRKVDLKMYNSYKDLSDALAKMF  145

Query  649  SSFTMGNYGAQG  684
            SSFTMG+YGAQG
Sbjct  146  SSFTMGSYGAQG  157



>ref|XP_002868277.1| hypothetical protein ARALYDRAFT_493451 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH44536.1| hypothetical protein ARALYDRAFT_493451 [Arabidopsis lyrata subsp. 
lyrata]
Length=228

 Score =   158 bits (400),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 106/158 (67%), Positives = 114/158 (72%), Gaps = 2/158 (1%)
 Frame = +1

Query  214  LNLKATElclglpgggggNESESLKVTG-KRGFSETVDLKLNLQSAADSSLDLKEKMKSP  390
            +NLK TELCLGLPGG    E  S    G KRGFSETV LKLNLQS     +DL       
Sbjct  1    MNLKETELCLGLPGGAETVECPSKSGVGNKRGFSETVGLKLNLQSNKQGPVDLNVNGAPK  60

Query  391  SKEPNKDPIKPPSKAQVVGWPPVRNYRKNIMAQksspeeaageksggggpaaFVKVCMDG  570
             K   KDP KPP+KAQVVGWPPVRNYRKN+MA + S E      SGGG  A FVKV MDG
Sbjct  61   EKTFLKDPSKPPAKAQVVGWPPVRNYRKNVMANQKSGEAEEAMSSGGGTVA-FVKVSMDG  119

Query  571  APYLRKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQG  684
            APYLRKVDLKMY+SY+ LSDALAKMFSSFTMG+YGAQG
Sbjct  120  APYLRKVDLKMYKSYKDLSDALAKMFSSFTMGSYGAQG  157



>gb|KDO53919.1| hypothetical protein CISIN_1g026811mg [Citrus sinensis]
Length=200

 Score =   157 bits (398),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 87/139 (63%), Positives = 102/139 (73%), Gaps = 23/139 (17%)
 Frame = +1

Query  286  KVTGKRGFSET--VDLKLNLQSAADSSLDLKEKMKSP---SKEPNKDPIKPPS-KAQVVG  447
            K + KRGF ET  +DLKLNLQS  +SS+DL E  K+P   +K  +KDP KP + KAQVVG
Sbjct  40   KASNKRGFCETAVIDLKLNLQSK-ESSVDLNENFKNPPSNNKNHDKDPAKPSANKAQVVG  98

Query  448  WPPVRNYRKNIMAQksspeeaageksggggpaaFVKVCMDGAPYLRKVDLKMYESYQQLS  627
            WPPVR+YRKN MA+ ++                FVKVCMDGAPYLRKVDLK Y+SYQ+LS
Sbjct  99   WPPVRSYRKNAMAETAA----------------FVKVCMDGAPYLRKVDLKTYKSYQELS  142

Query  628  DALAKMFSSFTMGNYGAQG  684
            DALAKMFSSFTMGNYG+QG
Sbjct  143  DALAKMFSSFTMGNYGSQG  161



>ref|XP_009107777.1| PREDICTED: auxin-responsive protein IAA14 [Brassica rapa]
Length=233

 Score =   158 bits (399),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 84/129 (65%), Positives = 96/129 (74%), Gaps = 0/129 (0%)
 Frame = +1

Query  298  KRGFSETVDLKLNLQSAADSSLDLKEKMKSPSKEPNKDPIKPPSKAQVVGWPPVRNYRKN  477
            KRGFSE V+LKL L S  + S+DL        K  +KDP KPP+KAQVVGWPPVRNYRK+
Sbjct  34   KRGFSEIVELKLGLHSTKEGSVDLNVAGAPKEKTLHKDPSKPPAKAQVVGWPPVRNYRKS  93

Query  478  IMAQksspeeaageksggggpaaFVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSF  657
            +M  +   E        GGG  AFVKV MDGAPYLRKVDLKMY+SY++LSDALAKMFSSF
Sbjct  94   VMTHQKCSEVEEASSDRGGGTVAFVKVSMDGAPYLRKVDLKMYKSYKELSDALAKMFSSF  153

Query  658  TMGNYGAQG  684
            TMG+YGAQG
Sbjct  154  TMGSYGAQG  162



>emb|CDY47148.1| BnaA08g05350D [Brassica napus]
Length=233

 Score =   158 bits (399),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 84/129 (65%), Positives = 95/129 (74%), Gaps = 0/129 (0%)
 Frame = +1

Query  298  KRGFSETVDLKLNLQSAADSSLDLKEKMKSPSKEPNKDPIKPPSKAQVVGWPPVRNYRKN  477
            KRGFSE V+LKL L S  + S+DL        K  +KDP KPP+KAQVVGWPPVRNYRK+
Sbjct  34   KRGFSEIVELKLGLHSTKEGSVDLNVAGAPKEKTLHKDPSKPPAKAQVVGWPPVRNYRKS  93

Query  478  IMAQksspeeaageksggggpaaFVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSF  657
            +M  +   E        GGG  AFVKV MDGAPYLRKVDLKMY SY++LSDALAKMFSSF
Sbjct  94   VMTHQKCSEVEEASSDRGGGTVAFVKVSMDGAPYLRKVDLKMYTSYKELSDALAKMFSSF  153

Query  658  TMGNYGAQG  684
            TMG+YGAQG
Sbjct  154  TMGSYGAQG  162



>ref|XP_006420094.1| hypothetical protein CICLE_v10005789mg [Citrus clementina]
 ref|XP_006489503.1| PREDICTED: auxin-responsive protein IAA14-like [Citrus sinensis]
 gb|ESR33334.1| hypothetical protein CICLE_v10005789mg [Citrus clementina]
 gb|KDO53918.1| hypothetical protein CISIN_1g026811mg [Citrus sinensis]
Length=232

 Score =   157 bits (398),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 87/139 (63%), Positives = 102/139 (73%), Gaps = 23/139 (17%)
 Frame = +1

Query  286  KVTGKRGFSET--VDLKLNLQSAADSSLDLKEKMKSP---SKEPNKDPIKPPS-KAQVVG  447
            K + KRGF ET  +DLKLNLQS  +SS+DL E  K+P   +K  +KDP KP + KAQVVG
Sbjct  40   KASNKRGFCETAVIDLKLNLQSK-ESSVDLNENFKNPPSNNKNHDKDPAKPSANKAQVVG  98

Query  448  WPPVRNYRKNIMAQksspeeaageksggggpaaFVKVCMDGAPYLRKVDLKMYESYQQLS  627
            WPPVR+YRKN MA+ ++                FVKVCMDGAPYLRKVDLK Y+SYQ+LS
Sbjct  99   WPPVRSYRKNAMAETAA----------------FVKVCMDGAPYLRKVDLKTYKSYQELS  142

Query  628  DALAKMFSSFTMGNYGAQG  684
            DALAKMFSSFTMGNYG+QG
Sbjct  143  DALAKMFSSFTMGNYGSQG  161



>gb|AAM21317.1|AF373100_1 auxin-regulated protein [Populus tremula x Populus tremuloides]
Length=249

 Score =   158 bits (399),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 93/147 (63%), Positives = 112/147 (76%), Gaps = 11/147 (7%)
 Frame = +1

Query  268  NESESLKVTGKRGFSETVDLKLNL---QSAADSS----LDLKEKMKSPSKEPNKDPIKPP  426
            N+SE+ K  GKRGFSETVDLKLNL   ++  D S    + +KEK  +P   PN DP KPP
Sbjct  35   NDSEAAKSNGKRGFSETVDLKLNLSTKETGKDGSDQEKVVMKEKTVAP--RPN-DPAKPP  91

Query  427  SKAQVVGWPPVRNYRKNIMA-QksspeeaageksggggpaaFVKVCMDGAPYLRKVDLKM  603
            SKAQVVGWPP+R++RKN+MA QK+S +E     S G   AAFVKV MDGAPYLRKVDLK+
Sbjct  92   SKAQVVGWPPIRSFRKNVMAVQKNSNDEGEKASSSGATGAAFVKVSMDGAPYLRKVDLKL  151

Query  604  YESYQQLSDALAKMFSSFTMGNYGAQG  684
            Y+SY++LSDAL KMFSSFT+GN G+QG
Sbjct  152  YKSYRELSDALGKMFSSFTIGNCGSQG  178



>emb|CDY62130.1| BnaC08g47390D [Brassica napus]
Length=233

 Score =   157 bits (397),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 84/129 (65%), Positives = 94/129 (73%), Gaps = 0/129 (0%)
 Frame = +1

Query  298  KRGFSETVDLKLNLQSAADSSLDLKEKMKSPSKEPNKDPIKPPSKAQVVGWPPVRNYRKN  477
            KRGFSE V+LKL L S    S+DL        K  +KDP KPP+KAQVVGWPPVRNYRK+
Sbjct  34   KRGFSEIVELKLGLHSTKQGSVDLNVAGAPKEKTLHKDPSKPPAKAQVVGWPPVRNYRKS  93

Query  478  IMAQksspeeaageksggggpaaFVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSF  657
            +M  +   E        GGG  AFVKV MDGAPYLRKVDLKMY SY++LSDALAKMFSSF
Sbjct  94   VMTHQKCSEVEEASSDRGGGTVAFVKVSMDGAPYLRKVDLKMYTSYKELSDALAKMFSSF  153

Query  658  TMGNYGAQG  684
            TMG+YGAQG
Sbjct  154  TMGSYGAQG  162



>ref|XP_004134097.1| PREDICTED: auxin-responsive protein IAA14-like isoform 2 [Cucumis 
sativus]
Length=220

 Score =   156 bits (395),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 100/171 (58%), Positives = 114/171 (67%), Gaps = 18/171 (11%)
 Frame = +1

Query  166  MEVGRKMGSMLAEHGGLNLKATElclglpgggggNESESLKVTGKRGFSETVDLKLNLQS  345
            MEV RKM +ML     L L             GG E E+ K  GKRGFSETVDLKLN+QS
Sbjct  1    MEVSRKMVNMLETDLCLGLPG-----------GGAEPETPKANGKRGFSETVDLKLNIQS  49

Query  346  AADSSLDLKEKMKSPSKE-----PNKDPIKPPSKAQVVGWPPVRNYRKNIMAQksspeea  510
                ++DL  +    S +      +KDP KPP+KAQVVGWPPVR+YRKN M+QKSS    
Sbjct  50   KPGVTVDLTPQNNDTSTDEESLIASKDPAKPPAKAQVVGWPPVRSYRKNAMSQKSSEAGE  109

Query  511  ageksggggpaaFVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTM  663
             G  SGG     FVKVCMDGAPYLRKVDLKMY+SYQ+LS+ALAKMFSSFTM
Sbjct  110  KGGSSGGSAM--FVKVCMDGAPYLRKVDLKMYKSYQELSNALAKMFSSFTM  158



>ref|XP_006284476.1| hypothetical protein CARUB_v10005662mg [Capsella rubella]
 gb|EOA17374.1| hypothetical protein CARUB_v10005662mg [Capsella rubella]
Length=228

 Score =   157 bits (396),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 103/158 (65%), Positives = 111/158 (70%), Gaps = 2/158 (1%)
 Frame = +1

Query  214  LNLKATElclglpgggggNESESLKVTG-KRGFSETVDLKLNLQSAADSSLDLKEKMKSP  390
            +NLK TELCLGLPGG    ES +    G KRGFSETVDLKLNLQS      DL       
Sbjct  1    MNLKETELCLGLPGGAETVESPAKSGVGNKRGFSETVDLKLNLQSNKQGHGDLNVSGSIK  60

Query  391  SKEPNKDPIKPPSKAQVVGWPPVRNYRKNIMAQksspeeaageksggggpaaFVKVCMDG  570
             K   +DP KPP+KAQVVGWPPVRNYRK +MA      E     S GGG  AFVKV MDG
Sbjct  61   EKTLLQDPTKPPTKAQVVGWPPVRNYRKTVMA-TQKNGETEETMSSGGGTIAFVKVSMDG  119

Query  571  APYLRKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQG  684
            APYLRKVDL+MY SY+ LSDALAKMFSSFTMG+YGAQG
Sbjct  120  APYLRKVDLRMYNSYKDLSDALAKMFSSFTMGSYGAQG  157



>ref|NP_001268036.1| uncharacterized protein LOC100250231 [Vitis vinifera]
 gb|ADR80321.1| indole-3-acetic acid-induced protein 16 [Vitis vinifera]
Length=238

 Score =   156 bits (395),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 88/134 (66%), Positives = 102/134 (76%), Gaps = 6/134 (4%)
 Frame = +1

Query  286  KVTGKRGFSETVDLKLNLQSAADSSLDLKEKMKSPSK-EPNKDPIKPPSKAQVVGWPPVR  462
            K +GKRGFSETVDLKLNL S  DS  D  EKMK  S   P+ DP KPP+KAQVVGWPPVR
Sbjct  39   KTSGKRGFSETVDLKLNLLSK-DSVADQAEKMKEKSALPPSNDPAKPPAKAQVVGWPPVR  97

Query  463  NYRKNIMAQksspeeaageksggggpaaFVKVCMDGAPYLRKVDLKMYESYQQLSDALAK  642
            ++RKNI+      ++ + E+      AAFVKV MDGAPYLRKVDLKMY+SYQ+LSDAL K
Sbjct  98   SFRKNILT----VQKNSSEEEKASSSAAFVKVSMDGAPYLRKVDLKMYKSYQELSDALGK  153

Query  643  MFSSFTMGNYGAQG  684
            MFSSFT+GN G+QG
Sbjct  154  MFSSFTIGNCGSQG  167



>ref|XP_002319075.1| hypothetical protein POPTR_0013s03870g [Populus trichocarpa]
 gb|EEE94998.1| hypothetical protein POPTR_0013s03870g [Populus trichocarpa]
Length=246

 Score =   157 bits (396),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 83/144 (58%), Positives = 102/144 (71%), Gaps = 7/144 (5%)
 Frame = +1

Query  268  NESESLKVTGKRGFSETVDLKLNLQS-----AADSSLDLKEKMKSPSKEPNKDPIKPPSK  432
            N+ E  K  GKRGFSETVDLKLNL +       D    +KEK  +P    + DP KPP+K
Sbjct  34   NDGEVAKSNGKRGFSETVDLKLNLSTKESGKGGDEEKVMKEKTVAPPA--STDPAKPPAK  91

Query  433  AQVVGWPPVRNYRKNIMAQksspeeaageksggggpaaFVKVCMDGAPYLRKVDLKMYES  612
            AQVVGWPP+R++RKN+MA + +  +   +    G   AFVKV MDGAPYLRKVDLK+Y+S
Sbjct  92   AQVVGWPPIRSFRKNVMAVQKNSNDNGEKSGSSGTGVAFVKVSMDGAPYLRKVDLKLYKS  151

Query  613  YQQLSDALAKMFSSFTMGNYGAQG  684
            YQ+LSDAL KMFSSFT+GN G+QG
Sbjct  152  YQELSDALGKMFSSFTIGNCGSQG  175



>ref|XP_002531288.1| Auxin-responsive protein IAA16, putative [Ricinus communis]
 gb|EEF31101.1| Auxin-responsive protein IAA16, putative [Ricinus communis]
Length=257

 Score =   157 bits (396),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 98/172 (57%), Positives = 120/172 (70%), Gaps = 15/172 (9%)
 Frame = +1

Query  214  LNLKATElclglpgggggNESESLKVTGKRGFSETVDLKLNLQSAADSSLDL---KEKMK  384
            +N + TEL LGLPGG   N+SE  KV GKRGFSETVDLKLNL +   S  D+   +E MK
Sbjct  15   INFEETELRLGLPGGSNVNDSEFAKVNGKRGFSETVDLKLNLSTKEPSGKDVIVGEETMK  74

Query  385  SPSKEPN--KDPIKPPSKAQVVGWPPVRNYRKNIMA----------Qksspeeaageksg  528
              +  P+   DP KPP+KAQVVGWPP+R++RKN+MA          + ++    A   + 
Sbjct  75   EKATVPSSSNDPAKPPAKAQVVGWPPIRSFRKNVMAVQKNSTDEGEKGTATSAPAAAATS  134

Query  529  gggpaaFVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQG  684
            G   AAFVKV MDGAPYLRKVDLK+Y+SYQ+LSDAL KMFSSFT+GN G+QG
Sbjct  135  GSTSAAFVKVSMDGAPYLRKVDLKLYKSYQELSDALGKMFSSFTIGNCGSQG  186



>ref|XP_011032399.1| PREDICTED: auxin-responsive protein IAA16-like [Populus euphratica]
Length=249

 Score =   156 bits (395),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 91/147 (62%), Positives = 111/147 (76%), Gaps = 11/147 (7%)
 Frame = +1

Query  268  NESESLKVTGKRGFSETVDLKLNL---QSAADSS----LDLKEKMKSPSKEPNKDPIKPP  426
            N++E+ K  GKRGFSETVDLKLNL   ++  D S    +  KEK  +P   PN DP KPP
Sbjct  35   NDAEAAKSNGKRGFSETVDLKLNLSTKETGKDGSDQEKVATKEKTVAP--RPN-DPAKPP  91

Query  427  SKAQVVGWPPVRNYRKNIMA-QksspeeaageksggggpaaFVKVCMDGAPYLRKVDLKM  603
            SKAQVVGWPP+R++RKN+MA QK++ +E     S G   AAFVKV MDGAPYLRKVDLK+
Sbjct  92   SKAQVVGWPPIRSFRKNVMAVQKNNNDEGEKASSSGTTGAAFVKVSMDGAPYLRKVDLKL  151

Query  604  YESYQQLSDALAKMFSSFTMGNYGAQG  684
            Y+SY++LSDAL KMFSSFT+GN G+QG
Sbjct  152  YKSYRELSDALGKMFSSFTIGNCGSQG  178



>ref|XP_010450026.1| PREDICTED: auxin-responsive protein IAA14-like [Camelina sativa]
Length=225

 Score =   155 bits (393),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 89/132 (67%), Positives = 93/132 (70%), Gaps = 1/132 (1%)
 Frame = +1

Query  289  VTGKRGFSETVDLKLNLQSAADSSLDLKEKMKSPSKEPNKDPIKPPSKAQVVGWPPVRNY  468
            V  KRGFSETVDLKLNLQS      DL        K   KDP KPP+KAQVVGWPPVRNY
Sbjct  24   VGNKRGFSETVDLKLNLQSNKQGHGDLNVAGSIKEKTLLKDPSKPPAKAQVVGWPPVRNY  83

Query  469  RKNIMAQksspeeaageksggggpaaFVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMF  648
            RKN+MA      E     S  GG  AFVKV MDGAPYLRKVDLKMY SY+ LSDALAKMF
Sbjct  84   RKNVMAN-QKNGETDEAMSSAGGTVAFVKVSMDGAPYLRKVDLKMYNSYKDLSDALAKMF  142

Query  649  SSFTMGNYGAQG  684
            SSFTM +YGAQG
Sbjct  143  SSFTMESYGAQG  154



>ref|XP_002281771.1| PREDICTED: auxin-responsive protein IAA16-like [Vitis vinifera]
Length=244

 Score =   156 bits (394),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 106/183 (58%), Positives = 126/183 (69%), Gaps = 20/183 (11%)
 Frame = +1

Query  166  MEVGRKMGSMLAEHG---GLNLKATElclglpgggggNESESLKVTGKRGFSETVDLKLN  336
            MEV RKM +M  E      LNL+ATEL LGLPGG     SE  +V  KRGFSETVDLKLN
Sbjct  1    MEVARKMATMHGEEREKPDLNLEATELRLGLPGG-----SEGSEVVRKRGFSETVDLKLN  55

Query  337  LQSAADSSLDLKEKMKSPSKEPNK-------DPIKPPSKAQVVGWPPVRNYRKNIMAQks  495
            L S  ++ +D   K+KS  KE +K       DP +PP+KAQVVGWPPVR++RKN++A   
Sbjct  56   L-SGKEAGVD-DNKVKSLQKEKSKSLLPCGNDPARPPAKAQVVGWPPVRSFRKNMLA---  110

Query  496  speeaageksggggpaaFVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMGNYG  675
              +  + E       AAFVKV MDGAPYLRKVDLKMY SYQ+LS+AL  MFSSFT+GNYG
Sbjct  111  GQKGGSEEGEKVSCNAAFVKVSMDGAPYLRKVDLKMYTSYQELSNALGNMFSSFTIGNYG  170

Query  676  AQG  684
            +QG
Sbjct  171  SQG  173



>ref|XP_010532600.1| PREDICTED: auxin-responsive protein IAA14 [Tarenaya hassleriana]
Length=229

 Score =   155 bits (393),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 89/137 (65%), Positives = 100/137 (73%), Gaps = 11/137 (8%)
 Frame = +1

Query  280  SLKVTG-KRGFSETVDLKLNLQS-AADSSLDLKEKMKSPSKEPNKDPIKPPSKAQVVGWP  453
            S K  G KRGFSETVDLKLNLQ+   +  +DL    K      +KDP KPPSKAQVVGWP
Sbjct  31   SAKAAGNKRGFSETVDLKLNLQTNKQEGVMDLTNASKV-----SKDPAKPPSKAQVVGWP  85

Query  454  PVRNYRKNIMAQksspeeaageksggggpaaFVKVCMDGAPYLRKVDLKMYESYQQLSDA  633
            PVRNYRKN+MA + +      EK+       FVKV MDGAPYLRKVDLKM++SYQ LSDA
Sbjct  86   PVRNYRKNVMANQKNSAMEEEEKAAAA----FVKVSMDGAPYLRKVDLKMHKSYQDLSDA  141

Query  634  LAKMFSSFTMGNYGAQG  684
            LAKMFSSFTMG+YGAQG
Sbjct  142  LAKMFSSFTMGSYGAQG  158



>ref|XP_007030567.1| Indoleacetic acid-induced protein 16 [Theobroma cacao]
 gb|EOY11069.1| Indoleacetic acid-induced protein 16 [Theobroma cacao]
Length=249

 Score =   156 bits (394),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 86/147 (59%), Positives = 103/147 (70%), Gaps = 8/147 (5%)
 Frame = +1

Query  268  NESESLKVTGKRGFSETVDLKLNLQSAADSSLDLKEKMKSPSKEPNK--DPIKPPSKAQV  441
            N+ E  K  GKRGFSETVDLKLNL +A ++  D  EK+K  S    +  DP KPP+KAQV
Sbjct  32   NDGEMTKNNGKRGFSETVDLKLNLSTAKEAVADEAEKVKKKSTVAPRSADPAKPPAKAQV  91

Query  442  VGWPPVRNYRKNIMA------QksspeeaageksggggpaaFVKVCMDGAPYLRKVDLKM  603
            VGWPPVR++RKNIMA           +  +   +     AAFVKV MDGAPYLRKVDLK+
Sbjct  92   VGWPPVRSFRKNIMAVQKNSSDVEGEKAGSSNTTTATVAAAFVKVSMDGAPYLRKVDLKL  151

Query  604  YESYQQLSDALAKMFSSFTMGNYGAQG  684
            Y+SYQ+LSDAL KMFSSFT+GN G+QG
Sbjct  152  YKSYQELSDALGKMFSSFTIGNCGSQG  178



>ref|XP_011038568.1| PREDICTED: auxin-responsive protein IAA16-like [Populus euphratica]
Length=246

 Score =   156 bits (394),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 84/142 (59%), Positives = 104/142 (73%), Gaps = 3/142 (2%)
 Frame = +1

Query  268  NESESLKVTGKRGFSETVDLKLNLQSAADSSLDLKEK-MKSPSKEP--NKDPIKPPSKAQ  438
            N+ E  K  GKRGFSETVDLKLNL +       ++EK MK  +  P  + DP KPP+KAQ
Sbjct  34   NDGEVAKSNGKRGFSETVDLKLNLSTKESGKGVVEEKVMKEKTVAPPASTDPAKPPAKAQ  93

Query  439  VVGWPPVRNYRKNIMAQksspeeaageksggggpaaFVKVCMDGAPYLRKVDLKMYESYQ  618
            VVGWPP+R++RKN+MA + +  +   +   GG   AFVKV MDGAPYLRKVDLK+Y+SYQ
Sbjct  94   VVGWPPIRSFRKNVMAVQKNSNDNGEKSGSGGAGVAFVKVSMDGAPYLRKVDLKLYKSYQ  153

Query  619  QLSDALAKMFSSFTMGNYGAQG  684
            +LSDAL KMFSSFT+GN G+QG
Sbjct  154  ELSDALGKMFSSFTIGNCGSQG  175



>emb|CAN72026.1| hypothetical protein VITISV_014421 [Vitis vinifera]
Length=285

 Score =   155 bits (393),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 88/134 (66%), Positives = 102/134 (76%), Gaps = 6/134 (4%)
 Frame = +1

Query  286  KVTGKRGFSETVDLKLNLQSAADSSLDLKEKMKSPSK-EPNKDPIKPPSKAQVVGWPPVR  462
            K +GKRGFSETVDLKLNL S  DS  D  EKMK  S   P+ DP KPP+KAQVVGWPPVR
Sbjct  39   KSSGKRGFSETVDLKLNLLSK-DSVADQAEKMKEKSALPPSNDPAKPPAKAQVVGWPPVR  97

Query  463  NYRKNIMAQksspeeaageksggggpaaFVKVCMDGAPYLRKVDLKMYESYQQLSDALAK  642
            ++RKNI+      ++ + E+      AAFVKV MDGAPYLRKVDLKMY+SYQ+LSDAL K
Sbjct  98   SFRKNILT----VQKNSSEEEKASSSAAFVKVSMDGAPYLRKVDLKMYKSYQELSDALGK  153

Query  643  MFSSFTMGNYGAQG  684
            MFSSFT+GN G+QG
Sbjct  154  MFSSFTIGNCGSQG  167



>ref|XP_006382798.1| hypothetical protein POPTR_0005s05560g [Populus trichocarpa]
 gb|ABK94241.1| unknown [Populus trichocarpa]
 gb|ERP60595.1| hypothetical protein POPTR_0005s05560g [Populus trichocarpa]
Length=250

 Score =   155 bits (391),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 91/148 (61%), Positives = 110/148 (74%), Gaps = 12/148 (8%)
 Frame = +1

Query  268  NESESLKVTGKRGFSETVDLKLNL---QSAADSS----LDLKEKMKSPSKEPNKDPIKPP  426
            N+ E+ K  GKRGFSETVDLKLNL   ++  D S    + +KEK  +P   PN DP KPP
Sbjct  35   NDGEAAKGNGKRGFSETVDLKLNLSTKETGKDGSDQEKVVMKEKTVAP--RPN-DPAKPP  91

Query  427  SKAQVVGWPPVRNYRKNIMA--QksspeeaageksggggpaaFVKVCMDGAPYLRKVDLK  600
            SKAQVVGWPP+R++RKN+MA  + S+ E      SG  G AAFVKV MDGAPYLRKVDLK
Sbjct  92   SKAQVVGWPPIRSFRKNVMAVQKNSNDEGEKASSSGTTGTAAFVKVSMDGAPYLRKVDLK  151

Query  601  MYESYQQLSDALAKMFSSFTMGNYGAQG  684
            +Y+SY++LSDAL KMFSSFT+GN G+QG
Sbjct  152  LYKSYRELSDALGKMFSSFTIGNCGSQG  179



>ref|XP_010551700.1| PREDICTED: auxin-responsive protein IAA14 [Tarenaya hassleriana]
Length=234

 Score =   153 bits (386),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 85/138 (62%), Positives = 98/138 (71%), Gaps = 8/138 (6%)
 Frame = +1

Query  274  SESLKVTGKRGFSETVDLKLNLQSAADSSL-DLKEKMKSPSKEPNKDPIKPPSKAQVVGW  450
            +++  V  KRGFSETVDLKLNLQ+  +  + DL            KD  KPP+KAQVVGW
Sbjct  33   AKAATVGNKRGFSETVDLKLNLQTNEEGRVVDLNAGDPKNFAGATKDKNKPPAKAQVVGW  92

Query  451  PPVRNYRKNIMAQksspeeaageksggggpaaFVKVCMDGAPYLRKVDLKMYESYQQLSD  630
            PPVRNYRKN+MAQ+ S      EK+       FVKV MDGAPYLRKVDLK+Y+ YQ LSD
Sbjct  93   PPVRNYRKNMMAQQKSSSAVEEEKA-------FVKVSMDGAPYLRKVDLKIYQCYQDLSD  145

Query  631  ALAKMFSSFTMGNYGAQG  684
            ALAKMFSSFTMGNYG+QG
Sbjct  146  ALAKMFSSFTMGNYGSQG  163



>dbj|BAH56942.1| AT4G14550 [Arabidopsis thaliana]
Length=183

 Score =   151 bits (381),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 102/152 (67%), Positives = 108/152 (71%), Gaps = 2/152 (1%)
 Frame = +1

Query  214  LNLKATElclglpgggggNESESLKVTG-KRGFSETVDLKLNLQSAADSSLDLKEKMKSP  390
            +NLK TELCLGLPGG    ES +    G KRGFSETVDLKLNLQS     +DL       
Sbjct  1    MNLKETELCLGLPGGTETVESPAKSGVGNKRGFSETVDLKLNLQSNKQGHVDLNTNGAPK  60

Query  391  SKEPNKDPIKPPSKAQVVGWPPVRNYRKNIMAQksspeeaageksggggpaaFVKVCMDG  570
             K   KDP KPP+KAQVVGWPPVRNYRKN+MA      EA    S GGG  AFVKV MDG
Sbjct  61   EKTFLKDPSKPPAKAQVVGWPPVRNYRKNVMAN-QKSGEAEEAMSSGGGTVAFVKVSMDG  119

Query  571  APYLRKVDLKMYESYQQLSDALAKMFSSFTMG  666
            APYLRKVDLKMY SY+ LSDALAKMFSSFTMG
Sbjct  120  APYLRKVDLKMYTSYKDLSDALAKMFSSFTMG  151



>ref|XP_010274203.1| PREDICTED: auxin-responsive protein IAA16-like [Nelumbo nucifera]
Length=252

 Score =   153 bits (386),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 104/186 (56%), Positives = 121/186 (65%), Gaps = 18/186 (10%)
 Frame = +1

Query  166  MEVGRKMGSMLA---EHGGLNLKATE----lclglpgggggNESESLKVTG-KRGFSETV  321
            MEV RKM S L    +   LN + TE    L  G  GG G     + K+ G KRGF+ETV
Sbjct  1    MEVCRKMASRLGGGPDEYSLNFEETELRLGLPGGGGGGDGDTTPSATKINGAKRGFAETV  60

Query  322  DLKLNLQSAADSSLDLKEKMKSPSKEPN-----KDPIKPPSKAQVVGWPPVRNYRKNIMA  486
            DLKLNL +  +S LD  EK  SP KE N      DP KPP+KAQVVGWPPVR++RKNI++
Sbjct  61   DLKLNLPTK-ESVLDPAEKKNSP-KEKNLLPCSNDPAKPPAKAQVVGWPPVRSFRKNILS  118

Query  487  QksspeeaageksggggpaaFVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMG  666
                 + +  E       AAFVKV MDGAPYLRKVDLKMY+SYQ+LSDAL KMFSSFT+G
Sbjct  119  ---VHKSSTEEGEKVSSSAAFVKVSMDGAPYLRKVDLKMYKSYQELSDALGKMFSSFTIG  175

Query  667  NYGAQG  684
            N G QG
Sbjct  176  NCGPQG  181



>gb|ABH01143.1| auxin-regulated protein [Populus tomentosa]
Length=258

 Score =   152 bits (383),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 92/148 (62%), Positives = 110/148 (74%), Gaps = 11/148 (7%)
 Frame = +1

Query  268  NESESLKVTGKRG--FSETVDLKLNLQSAADSSLDLKEKMKSPSKE------PNKDPIKP  423
            N+ E+ K  GKRG  FSETVDLKLNL S  D+  D  ++ K+  KE      PN DP KP
Sbjct  35   NDPEAAKSNGKRGQRFSETVDLKLNL-STKDTGKDGSDQEKAAMKEKAVAPRPN-DPAKP  92

Query  424  PSKAQVVGWPPVRNYRKNIMA-QksspeeaageksggggpaaFVKVCMDGAPYLRKVDLK  600
            PSKAQVVGWPP+R++RKN+MA QK+S +E     S G   AAFVKV MDGAPYLRKVDLK
Sbjct  93   PSKAQVVGWPPIRSFRKNVMAVQKNSNDEGEKASSSGATGAAFVKVSMDGAPYLRKVDLK  152

Query  601  MYESYQQLSDALAKMFSSFTMGNYGAQG  684
            +Y+SY++LSDAL KMFSSFT+GN G+QG
Sbjct  153  LYKSYRELSDALGKMFSSFTIGNCGSQG  180



>ref|XP_010102292.1| Auxin-responsive protein IAA16 [Morus notabilis]
 gb|EXB93235.1| Auxin-responsive protein IAA16 [Morus notabilis]
Length=257

 Score =   151 bits (381),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 85/143 (59%), Positives = 107/143 (75%), Gaps = 7/143 (5%)
 Frame = +1

Query  277  ESLKVTGKRGFSETVDLKLNLQSAADSSLDL--KEKMKSPSKEPNKDPIKPPSKAQVVGW  450
            E+ K  GKRGF ETVDLKLNL S    SLD   K+++K+    P+ D +KPP+KAQVVGW
Sbjct  44   EATKNNGKRGFPETVDLKLNLSSKDSGSLDQVDKKEIKTSPVSPSTDSVKPPAKAQVVGW  103

Query  451  PPVRNYRKNIMAQksspeeaageksggggpaa-----FVKVCMDGAPYLRKVDLKMYESY  615
            PPVR++RKNI++ + +  +    K+GGGG  +     FVKV MDGAPYLRKVDLK+Y+SY
Sbjct  104  PPVRSFRKNIVSAQKNSGDHEAVKAGGGGGGSSSSAAFVKVSMDGAPYLRKVDLKLYKSY  163

Query  616  QQLSDALAKMFSSFTMGNYGAQG  684
            Q+LSDAL KMFSSFT+GN G+QG
Sbjct  164  QELSDALGKMFSSFTIGNCGSQG  186



>gb|AEE25654.1| auxin-responsive protein [Gossypium hirsutum]
Length=246

 Score =   150 bits (380),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 88/148 (59%), Positives = 104/148 (70%), Gaps = 13/148 (9%)
 Frame = +1

Query  268  NESESLKVTGKRGFSETVDLKLNLQSAADSSLDLKEKMKSPSKEPNKDPIKPPSKAQVVG  447
            N+ E+ K  GKRGFSETV+LKLNL S    + D  +KMK  S   + DP KPP+KAQVVG
Sbjct  32   NDGETTKNNGKRGFSETVNLKLNLSSKETVAED-SDKMKEKS---STDPAKPPAKAQVVG  87

Query  448  WPPVRNYRKNIMAQksspeeaageksggggp---------aaFVKVCMDGAPYLRKVDLK  600
            WPPVR++RKNIMA + +  E  G     G           AAFVKV MDGAPYLRKVDLK
Sbjct  88   WPPVRSFRKNIMAVQKASSEEEGGSKKAGNSAAAITTTTAAAFVKVSMDGAPYLRKVDLK  147

Query  601  MYESYQQLSDALAKMFSSFTMGNYGAQG  684
            +Y+SYQQLSDAL+KMFSSFT+GN G+ G
Sbjct  148  LYKSYQQLSDALSKMFSSFTIGNCGSHG  175



>ref|XP_010278165.1| PREDICTED: auxin-responsive protein IAA16-like [Nelumbo nucifera]
Length=251

 Score =   150 bits (379),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 111/185 (60%), Positives = 127/185 (69%), Gaps = 17/185 (9%)
 Frame = +1

Query  166  MEVGRKMGSMLA---EHGGLNLKATElclglpgggggNESESL----KVTGKRGFSETVD  324
            MEV RKM +ML    +   LN + TEL LGLPGGGGG+E ES     K  GKRGF ETVD
Sbjct  1    MEVCRKMANMLGAERDEYSLNFEETELRLGLPGGGGGSEGESTPSPTKNGGKRGFCETVD  60

Query  325  LKLNLQSAADSSLDLKEKMKSPSKEPNKDPI-----KPPSKAQVVGWPPVRNYRKNIMAQ  489
            LKLNL S  +S +D  EK  SP KE N  P      KPP+KAQVVGWPPVR++RKNI++ 
Sbjct  61   LKLNLPSK-ESVMDPSEKKNSP-KEKNLLPCTNDLAKPPAKAQVVGWPPVRSFRKNILS-  117

Query  490  ksspeeaageksggggpaaFVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMGN  669
                + +  E       AAFVKV MDGAPYLRKVDLKMY+SYQ+LSDAL KMFSSFT+GN
Sbjct  118  --VQKSSTEEGEKVSSSAAFVKVSMDGAPYLRKVDLKMYKSYQELSDALGKMFSSFTIGN  175

Query  670  YGAQG  684
             G QG
Sbjct  176  CGPQG  180



>ref|NP_001266049.1| IAA9 protein [Solanum lycopersicum]
 gb|AEX00359.1| IAA16 [Solanum lycopersicum]
Length=251

 Score =   150 bits (378),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 92/150 (61%), Positives = 106/150 (71%), Gaps = 12/150 (8%)
 Frame = +1

Query  268  NESESL-KVTGKRGFSETVDLKLNLQSAADSSL----------DLKEKMKSPSKEPNKDP  414
            NE ES  K  GKR FSETVDLKLNL ++ DS+L          ++KEK  +     + DP
Sbjct  32   NELESSNKNNGKRVFSETVDLKLNLSNSKDSTLMDNININQVDNMKEKKNNIVVPSSNDP  91

Query  415  IKPPSKAQVVGWPPVRNYRKNIMAQksspeeaageksggggpaaFVKVCMDGAPYLRKVD  594
             KPP+KAQVVGWPPVR++RKN+M         AGE SG G  AAFVKV +DGAPYLRKVD
Sbjct  92   AKPPAKAQVVGWPPVRSFRKNVMT-VQKNTTGAGEISGTGTGAAFVKVSVDGAPYLRKVD  150

Query  595  LKMYESYQQLSDALAKMFSSFTMGNYGAQG  684
            LKMY+SYQQLSDAL KMFSSFT+GN G QG
Sbjct  151  LKMYKSYQQLSDALGKMFSSFTIGNCGTQG  180



>gb|KHG19190.1| Auxin-responsive IAA16 -like protein [Gossypium arboreum]
Length=246

 Score =   149 bits (377),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 88/151 (58%), Positives = 104/151 (69%), Gaps = 19/151 (13%)
 Frame = +1

Query  268  NESESLKVTGKRGFSETVDLKLNLQS---AADSSLDLKEKMKSPSKEPNKDPIKPPSKAQ  438
            NE E+ K  GKRGFSETV+LKLNL S    A+ S ++KEK  +       D  KPP+KAQ
Sbjct  32   NEGETTKNNGKRGFSETVNLKLNLSSKETVAEDSDEMKEKSST-------DTAKPPAKAQ  84

Query  439  VVGWPPVRNYRKNIMAQksspeeaageksggggp---------aaFVKVCMDGAPYLRKV  591
            VVGWPPVR++RKNIMA + +  E  G     G           AAFVKV MDGAPYLRKV
Sbjct  85   VVGWPPVRSFRKNIMAVQKASSEEEGGSKKAGNSAAATTTTTAAAFVKVSMDGAPYLRKV  144

Query  592  DLKMYESYQQLSDALAKMFSSFTMGNYGAQG  684
            DLK+Y+SYQQLSDAL+KMFSSFT+GN G+ G
Sbjct  145  DLKLYKSYQQLSDALSKMFSSFTIGNCGSHG  175



>ref|NP_001275398.1| auxin/indole-3-acetic acid 3 [Solanum tuberosum]
 gb|ACV31209.1| auxin/indole-3-acetic acid 3 [Solanum tuberosum]
Length=249

 Score =   149 bits (376),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 91/148 (61%), Positives = 105/148 (71%), Gaps = 10/148 (7%)
 Frame = +1

Query  268  NESESL-KVTGKRGFSETVDLKLNLQSAADSSL--------DLKEKMKSPSKEPNKDPIK  420
            NE ES  K  GKR FSETVDLKLNL ++ DS+L        ++KEK  +     + DP K
Sbjct  32   NEVESTNKNNGKRVFSETVDLKLNLSNSKDSTLMDNINQVDNMKEKKNNIVVPSSNDPAK  91

Query  421  PPSKAQVVGWPPVRNYRKNIMAQksspeeaageksggggpaaFVKVCMDGAPYLRKVDLK  600
             P+KAQVVGWPPVR++RKN+M         AGE SG G  AAFVKV +DGAPYLRKVDLK
Sbjct  92   SPAKAQVVGWPPVRSFRKNVMT-VQKNTTGAGESSGTGTGAAFVKVSVDGAPYLRKVDLK  150

Query  601  MYESYQQLSDALAKMFSSFTMGNYGAQG  684
            MY+SYQQLSDAL KMFSSFT+GN G QG
Sbjct  151  MYKSYQQLSDALGKMFSSFTIGNCGTQG  178



>gb|AFZ78616.1| hypothetical protein [Populus tomentosa]
Length=211

 Score =   147 bits (372),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 104/192 (54%), Positives = 120/192 (63%), Gaps = 38/192 (20%)
 Frame = +1

Query  202  EHGGLNLKATElclgl-pgggggNESESL-KVTGKRGFSETVDLKLNLQSAADSSLDLKE  375
            E   LN K TELCLGL    G  NE E+  K TGKRGF+ETVDLKLNLQ A +  +DL E
Sbjct  10   ERADLNYKETELCLGLPGAVGVKNEVETPNKATGKRGFAETVDLKLNLQ-AKEGVMDLNE  68

Query  376  KMKSPSKEPN--------KDPIKPPSKAQVVGWPPVRNYRKNIMAQkss-----------  498
             + + + E          KDP KPP+KAQVVGWPPVR+YRKN++AQK++           
Sbjct  69   NINNIASEDKNHLPSATIKDPAKPPAKAQVVGWPPVRSYRKNVLAQKNASEEGFGAQVEG  128

Query  499  ----------------peeaageksggggpaaFVKVCMDGAPYLRKVDLKMYESYQQLSD  630
                              E   + S GG  AAFVKVCMDGAPYLRKVDLKMY+SYQ+LSD
Sbjct  129  WPPVRSYRKNVLVQKNASEEGEKASTGGCSAAFVKVCMDGAPYLRKVDLKMYKSYQELSD  188

Query  631  ALAKMFSSFTMG  666
            ALAKMFSSFTM 
Sbjct  189  ALAKMFSSFTMA  200



>gb|EYU46510.1| hypothetical protein MIMGU_mgv1a013084mg [Erythranthe guttata]
Length=231

 Score =   148 bits (373),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 87/139 (63%), Positives = 101/139 (73%), Gaps = 12/139 (9%)
 Frame = +1

Query  295  GKRGFSETVDLKLNLQSAA---DSSLDLKE------KMKSPSKEPNKDPIKPPSKAQVVG  447
            GKRGFSETVDLKLNL SA    DS++DLKE      K   PS  P  D +KPP+KAQVVG
Sbjct  25   GKRGFSETVDLKLNLSSAEIGLDSAIDLKENNFNKEKNLLPSSSPT-DSVKPPAKAQVVG  83

Query  448  WPPVRNYRKNIMAQksspeeaageksggggpaaFVKVCMDGAPYLRKVDLKMYESYQQLS  627
            WPPVR++RKN+MA        + E   G G AAFVKV MDGAPYLRKVDLKMY++Y++LS
Sbjct  84   WPPVRSFRKNVMA--VQKRTDSDEAEKGTGGAAFVKVSMDGAPYLRKVDLKMYKTYKELS  141

Query  628  DALAKMFSSFTMGNYGAQG  684
            DAL KMFSSFT+G   +QG
Sbjct  142  DALGKMFSSFTIGKCDSQG  160



>emb|CAN63268.1| hypothetical protein VITISV_013635 [Vitis vinifera]
 emb|CBI17932.3| unnamed protein product [Vitis vinifera]
Length=235

 Score =   148 bits (373),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 98/164 (60%), Positives = 117/164 (71%), Gaps = 17/164 (10%)
 Frame = +1

Query  214  LNLKATElclglpgggggNESESLKVTGKRGFSETVDLKLNLQSAADSSLDLKEKMKSPS  393
            LNL+ATEL LGLPGG     SE  +V  KRGFSETVDLKLNL S  ++ +D   K+KS  
Sbjct  11   LNLEATELRLGLPGG-----SEGSEVVRKRGFSETVDLKLNL-SGKEAGVD-DNKVKSLQ  63

Query  394  KEPNK-------DPIKPPSKAQVVGWPPVRNYRKNIMAQksspeeaageksggggpaaFV  552
            KE +K       DP +PP+KAQVVGWPPVR++RKN++A     +  + E       AAFV
Sbjct  64   KEKSKSLLPCGNDPARPPAKAQVVGWPPVRSFRKNMLA---GQKGGSEEGEKVSCNAAFV  120

Query  553  KVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQG  684
            KV MDGAPYLRKVDLKMY SYQ+LS+AL  MFSSFT+GNYG+QG
Sbjct  121  KVSMDGAPYLRKVDLKMYTSYQELSNALGNMFSSFTIGNYGSQG  164



>gb|AEE25650.1| auxin-responsive protein [Gossypium hirsutum]
Length=253

 Score =   148 bits (374),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 85/140 (61%), Positives = 98/140 (70%), Gaps = 11/140 (8%)
 Frame = +1

Query  286  KVTGKRGFSETVDLKLNLQSAADSS-LDLK-EKMKSPSKEPN-----KDPIKPPSKAQVV  444
            +V  KRGFSETVDLKLNL S  D+S +D   EK+K   +E N      DP KPP+KAQVV
Sbjct  47   EVVRKRGFSETVDLKLNLSSKQDTSGIDPNDEKVKGLHQEKNLLLSAIDPAKPPAKAQVV  106

Query  445  GWPPVRNYRKNIMAQksspeeaageksggggpaaFVKVCMDGAPYLRKVDLKMYESYQQL  624
            GWPPVR++RKN++A               G  AA VKV MDGAPYLRKVDL+MY SY QL
Sbjct  107  GWPPVRSFRKNMLA----TTTQKSSSEESGEKAALVKVSMDGAPYLRKVDLRMYTSYHQL  162

Query  625  SDALAKMFSSFTMGNYGAQG  684
            SDALAKMFSSFT+GN G+QG
Sbjct  163  SDALAKMFSSFTIGNCGSQG  182



>ref|XP_002520980.1| Auxin-induced protein AUX28, putative [Ricinus communis]
 gb|EEF41397.1| Auxin-induced protein AUX28, putative [Ricinus communis]
Length=244

 Score =   147 bits (370),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 81/143 (57%), Positives = 101/143 (71%), Gaps = 8/143 (6%)
 Frame = +1

Query  268  NESESLKVTGKRGFSETVDLKLNLQSAADSSLDLKEKMKSPSKEPN----KDPIKPPSKA  435
            N +   +V  KRGFSETVDLKLNL S+ +  +D  +  K+ S+E N     DP KPP+KA
Sbjct  35   NTASEGEVARKRGFSETVDLKLNL-SSKEPGIDPNDNTKTISRENNLLSADDPAKPPAKA  93

Query  436  QVVGWPPVRNYRKNIMAQksspeeaageksggggpaaFVKVCMDGAPYLRKVDLKMYESY  615
            QVVGWPPVR++RK+++      + +  E    G    FVKV MDGAPYLRKVDLKMY+SY
Sbjct  94   QVVGWPPVRSFRKHMLT---VQKSSNEETEKLGLNPTFVKVSMDGAPYLRKVDLKMYKSY  150

Query  616  QQLSDALAKMFSSFTMGNYGAQG  684
            Q+LSDAL KMFSSFT+GN G+QG
Sbjct  151  QELSDALGKMFSSFTIGNCGSQG  173



>gb|KDP23667.1| hypothetical protein JCGZ_23500 [Jatropha curcas]
Length=248

 Score =   146 bits (368),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 83/135 (61%), Positives = 100/135 (74%), Gaps = 8/135 (6%)
 Frame = +1

Query  295  GKRGFSETVDLKLNLQSAADSSLDLKEKMKSPSKEPN-KDPIKPPSKAQVVGWPPVRNYR  471
            GKRGFSETVDLKLNL +        +EKMK  +  P+  DP KPP+KAQVVGWPP+R++R
Sbjct  46   GKRGFSETVDLKLNLSTKESGK---EEKMKEKTDVPSSNDPAKPPAKAQVVGWPPIRSFR  102

Query  472  KNIMA----QksspeeaageksggggpaaFVKVCMDGAPYLRKVDLKMYESYQQLSDALA  639
            KN+M+         E+AA   + G   AAFVKV MDGAPYLRKVDLK+Y+SYQ+LSDAL 
Sbjct  103  KNVMSVQKSNGDEAEKAATATAAGSSSAAFVKVSMDGAPYLRKVDLKLYKSYQELSDALG  162

Query  640  KMFSSFTMGNYGAQG  684
            KMFSSFT+GN G+QG
Sbjct  163  KMFSSFTIGNCGSQG  177



>ref|XP_007050422.1| Indole-3-acetic acid inducible 14 isoform 2, partial [Theobroma 
cacao]
 gb|EOX94579.1| Indole-3-acetic acid inducible 14 isoform 2, partial [Theobroma 
cacao]
Length=260

 Score =   146 bits (368),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 84/135 (62%), Positives = 100/135 (74%), Gaps = 7/135 (5%)
 Frame = +1

Query  286  KVTGKRGFSETVDLKLNLQSAADSSLDLKEKMKS--PSKEPNKDPIKPPSKAQVVGWPPV  459
            +V  KRGFSETVDLKLNL S   S +D  EK K+  P      DP KPP+KAQVVGWPPV
Sbjct  92   EVARKRGFSETVDLKLNLSSKESSGVDPNEKEKNLLPCA---TDPAKPPAKAQVVGWPPV  148

Query  460  RNYRKNIMAQksspeeaageksggggpaaFVKVCMDGAPYLRKVDLKMYESYQQLSDALA  639
            R++RKN+ A  +    +   + GG G AAFVKV MDGAPYLRKVDL+MY++Y +LSDALA
Sbjct  149  RSFRKNMFA--TQKSSSEESEKGGAGNAAFVKVSMDGAPYLRKVDLRMYKTYLELSDALA  206

Query  640  KMFSSFTMGNYGAQG  684
            KMFSSFT+GN G+QG
Sbjct  207  KMFSSFTIGNCGSQG  221



>ref|XP_009610435.1| PREDICTED: auxin-responsive protein IAA16 [Nicotiana tomentosiformis]
Length=240

 Score =   145 bits (365),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 87/141 (62%), Positives = 105/141 (74%), Gaps = 6/141 (4%)
 Frame = +1

Query  268  NESE-SLKVTGKRGFSETVDLKLNLQSAADSSLDLK-EKMKSPSKEPNKDPIKPPSKAQV  441
            NE E + K  GKR FSETVDLKLNL S+ DS++D + +KMK        DP KPP+KAQV
Sbjct  33   NEGEMTSKNNGKRVFSETVDLKLNL-SSKDSTVDNQVDKMKEKKNIAPTDPSKPPAKAQV  91

Query  442  VGWPPVRNYRKNIMAQksspeeaageksggggpaaFVKVCMDGAPYLRKVDLKMYESYQQ  621
            VGWPPVR++RKN++   +  +++ G     GG AAFVKV +DGAPYLRKVDLKMY+SYQQ
Sbjct  92   VGWPPVRSFRKNVL---NVQKKSTGNGESSGGGAAFVKVSVDGAPYLRKVDLKMYKSYQQ  148

Query  622  LSDALAKMFSSFTMGNYGAQG  684
            LSDAL KMFSSFT+GN G  G
Sbjct  149  LSDALGKMFSSFTIGNCGNHG  169



>gb|EPS64756.1| hypothetical protein M569_10024, partial [Genlisea aurea]
Length=214

 Score =   144 bits (362),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 84/139 (60%), Positives = 96/139 (69%), Gaps = 15/139 (11%)
 Frame = +1

Query  286  KVTGKRGFSETVDLKLNLQSAADSSLDLKEKMKSPSKE----PNKDPIKPPSKAQVVGWP  453
            KVTGKRGF +TVDLKL LQS  D S   +E + +PS +    P K   KPPSKAQVVGWP
Sbjct  14   KVTGKRGFFQTVDLKLKLQS--DQSDLEEENLTTPSSDKPHLPPKHLSKPPSKAQVVGWP  71

Query  454  PVRNYRKNIMAQksspeeaageksggggpaaFVKVCMDGAPYLRKVDLKMYESYQQLSDA  633
            PVR++RKN++  + S        S       +VKV MDGAPYLRKVDLK Y SYQQLSDA
Sbjct  72   PVRSFRKNVICNRKSSSVEESTGS-------YVKVSMDGAPYLRKVDLKTYGSYQQLSDA  124

Query  634  LAKMFSSFTM--GNYGAQG  684
            LAKMFSSFTM  GNYG +G
Sbjct  125  LAKMFSSFTMNEGNYGVEG  143



>ref|XP_007050421.1| Indole-3-acetic acid inducible 14 isoform 1 [Theobroma cacao]
 gb|EOX94578.1| Indole-3-acetic acid inducible 14 isoform 1 [Theobroma cacao]
Length=305

 Score =   145 bits (367),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 84/135 (62%), Positives = 100/135 (74%), Gaps = 7/135 (5%)
 Frame = +1

Query  286  KVTGKRGFSETVDLKLNLQSAADSSLDLKEKMKS--PSKEPNKDPIKPPSKAQVVGWPPV  459
            +V  KRGFSETVDLKLNL S   S +D  EK K+  P      DP KPP+KAQVVGWPPV
Sbjct  105  EVARKRGFSETVDLKLNLSSKESSGVDPNEKEKNLLPCAT---DPAKPPAKAQVVGWPPV  161

Query  460  RNYRKNIMAQksspeeaageksggggpaaFVKVCMDGAPYLRKVDLKMYESYQQLSDALA  639
            R++RKN+ A  +    +   + GG G AAFVKV MDGAPYLRKVDL+MY++Y +LSDALA
Sbjct  162  RSFRKNMFA--TQKSSSEESEKGGAGNAAFVKVSMDGAPYLRKVDLRMYKTYLELSDALA  219

Query  640  KMFSSFTMGNYGAQG  684
            KMFSSFT+GN G+QG
Sbjct  220  KMFSSFTIGNCGSQG  234



>ref|XP_002306817.1| hypothetical protein POPTR_0005s23980g [Populus trichocarpa]
 gb|EEE93813.1| hypothetical protein POPTR_0005s23980g [Populus trichocarpa]
Length=229

 Score =   143 bits (361),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 77/129 (60%), Positives = 90/129 (70%), Gaps = 0/129 (0%)
 Frame = +1

Query  298  KRGFSETVDLKLNLQSAADSSLDLKEKMKSPSKEPNKDPIKPPSKAQVVGWPPVRNYRKN  477
            KRGFSETVDLKLNL S         EK +        DP KPP+KAQVVGWPPVR++RKN
Sbjct  36   KRGFSETVDLKLNLSSKEGGIDPNHEKTQREKNLLATDPAKPPAKAQVVGWPPVRSFRKN  95

Query  478  IMAQksspeeaageksggggpaaFVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSF  657
            ++A + S  +        GG A FVKV MDGAPYLRKVDLKMY++Y +LSDAL KMFSSF
Sbjct  96   MLAVQKSSTDQESTDKVPGGNATFVKVSMDGAPYLRKVDLKMYKTYHELSDALGKMFSSF  155

Query  658  TMGNYGAQG  684
            T+GN G+ G
Sbjct  156  TIGNCGSHG  164



>ref|XP_002517023.1| Auxin-responsive protein IAA7, putative [Ricinus communis]
 gb|EEF45186.1| Auxin-responsive protein IAA7, putative [Ricinus communis]
Length=181

 Score =   142 bits (357),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 78/115 (68%), Positives = 89/115 (77%), Gaps = 12/115 (10%)
 Frame = +1

Query  361  LDLKEK-MKSPSKEPN------KDPIKPPSKAQVVGWPPVRNYRKNIMAQksspeeaage  519
            +DL +  +K+ SK+ N      KDP KPP+KAQVVGWPPVR+YRKNIMAQK++ EE    
Sbjct  1    MDLNDNNIKNASKDKNHLPASIKDPAKPPAKAQVVGWPPVRSYRKNIMAQKNTSEEGEKA  60

Query  520  ksggggpaaFVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQG  684
             S       FVKVCMDGAPYLRKVDLKMY+SYQ+LSDALAKMFSSFTMGNYG QG
Sbjct  61   SSAA-----FVKVCMDGAPYLRKVDLKMYKSYQELSDALAKMFSSFTMGNYGTQG  110



>gb|AAD32146.1|AF123508_1 Nt-iaa28 deduced protein [Nicotiana tabacum]
Length=240

 Score =   144 bits (362),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 85/141 (60%), Positives = 102/141 (72%), Gaps = 6/141 (4%)
 Frame = +1

Query  268  NESE-SLKVTGKRGFSETVDLKLNLQSAADSSLDLK-EKMKSPSKEPNKDPIKPPSKAQV  441
            NE E + K  GKR FSETVDLKLNL S+ DS++D + + +K        DP KPP+KAQV
Sbjct  33   NEGEMTSKNNGKRVFSETVDLKLNL-SSKDSTVDNQVDNIKEKKNIAPTDPAKPPAKAQV  91

Query  442  VGWPPVRNYRKNIMAQksspeeaageksggggpaaFVKVCMDGAPYLRKVDLKMYESYQQ  621
            VGWPPVR++RKN++      + + G     GG AAFVKV +DGAPYLRKVDLKMY+SYQQ
Sbjct  92   VGWPPVRSFRKNVLT---VQKNSTGNGESSGGGAAFVKVSVDGAPYLRKVDLKMYKSYQQ  148

Query  622  LSDALAKMFSSFTMGNYGAQG  684
            LSDAL KMFSSFT+GN G  G
Sbjct  149  LSDALGKMFSSFTIGNCGTHG  169



>ref|XP_006471686.1| PREDICTED: auxin-responsive protein IAA16-like isoform X3 [Citrus 
sinensis]
Length=217

 Score =   142 bits (359),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 82/133 (62%), Positives = 96/133 (72%), Gaps = 4/133 (3%)
 Frame = +1

Query  298  KRGFSETV-DLKLNLQSAADSSLDL--KEKMKSPSKEPNKDPIKPPSKAQVVGWPPVRNY  468
            KRGF++TV DLKLNL +     +D+  K K KS S     D  KPP+KAQVVGWPPVR++
Sbjct  42   KRGFADTVVDLKLNLSTKESGGIDVIQKTKGKSASATGATDLSKPPAKAQVVGWPPVRSF  101

Query  469  RKNIMA-QksspeeaageksggggpaaFVKVCMDGAPYLRKVDLKMYESYQQLSDALAKM  645
            RKNIMA QK + E      S      AFVKV MDGAPYLRKVDLK+Y+SYQ+LSDAL KM
Sbjct  102  RKNIMAVQKDNEEGDNKASSSSSSNVAFVKVSMDGAPYLRKVDLKLYKSYQELSDALGKM  161

Query  646  FSSFTMGNYGAQG  684
            FSSFT+GN G+QG
Sbjct  162  FSSFTIGNCGSQG  174



>ref|XP_009761467.1| PREDICTED: auxin-responsive protein IAA16 [Nicotiana sylvestris]
Length=240

 Score =   143 bits (361),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 85/141 (60%), Positives = 102/141 (72%), Gaps = 6/141 (4%)
 Frame = +1

Query  268  NESE-SLKVTGKRGFSETVDLKLNLQSAADSSLDLK-EKMKSPSKEPNKDPIKPPSKAQV  441
            NE E + K  GKR FSETVDLKLNL S+ DS++D + + +K        DP KPP+KAQV
Sbjct  33   NEGEMTSKNNGKRVFSETVDLKLNL-SSKDSTVDNQVDNIKEKKNIAPTDPAKPPAKAQV  91

Query  442  VGWPPVRNYRKNIMAQksspeeaageksggggpaaFVKVCMDGAPYLRKVDLKMYESYQQ  621
            VGWPPVR++RKN++      + + G     GG AAFVKV +DGAPYLRKVDLKMY+SYQQ
Sbjct  92   VGWPPVRSFRKNVLT---VQKNSTGNGESSGGGAAFVKVSVDGAPYLRKVDLKMYKSYQQ  148

Query  622  LSDALAKMFSSFTMGNYGAQG  684
            LSDAL KMFSSFT+GN G  G
Sbjct  149  LSDALGKMFSSFTIGNCGTHG  169



>ref|NP_001288939.1| auxin-responsive protein IAA16 [Brassica rapa]
 gb|ABV89663.1| indoleacetic acid-induced protein 16 [Brassica rapa]
Length=231

 Score =   143 bits (360),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 79/149 (53%), Positives = 100/149 (67%), Gaps = 25/149 (17%)
 Frame = +1

Query  280  SLKVTGKRGFSETVDLKLNLQSAADSSL------DLKEKMKSPSKEPNKDPIKPPSKAQV  441
            ++K  GKRGFSETVDLKLNL S A  S+      ++KEK+           +KPP+KAQV
Sbjct  23   AMKNNGKRGFSETVDLKLNLSSTALDSVSGVDLENMKEKV-----------VKPPAKAQV  71

Query  442  VGWPPVRNYRKNIMA--------QksspeeaageksggggpaaFVKVCMDGAPYLRKVDL  597
            VGWPPVR++RKN+M+             E+ +         AA+VKV MDGAPYLRK+DL
Sbjct  72   VGWPPVRSFRKNVMSGQKPTAGDATEGTEKTSSSNGATSSAAAYVKVSMDGAPYLRKIDL  131

Query  598  KMYESYQQLSDALAKMFSSFTMGNYGAQG  684
            K+Y++YQ LSDAL+KMFSSFT+GNYG QG
Sbjct  132  KLYKTYQDLSDALSKMFSSFTLGNYGPQG  160



>ref|XP_006383686.1| auxin-induced protein aux28 [Populus trichocarpa]
 gb|ERP61483.1| auxin-induced protein aux28 [Populus trichocarpa]
Length=237

 Score =   143 bits (360),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 77/129 (60%), Positives = 90/129 (70%), Gaps = 0/129 (0%)
 Frame = +1

Query  298  KRGFSETVDLKLNLQSAADSSLDLKEKMKSPSKEPNKDPIKPPSKAQVVGWPPVRNYRKN  477
            KRGFSETVDLKLNL S         EK +        DP KPP+KAQVVGWPPVR++RKN
Sbjct  36   KRGFSETVDLKLNLSSKEGGIDPNHEKTQREKNLLATDPAKPPAKAQVVGWPPVRSFRKN  95

Query  478  IMAQksspeeaageksggggpaaFVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSF  657
            ++A + S  +        GG A FVKV MDGAPYLRKVDLKMY++Y +LSDAL KMFSSF
Sbjct  96   MLAVQKSSTDQESTDKVPGGNATFVKVSMDGAPYLRKVDLKMYKTYHELSDALGKMFSSF  155

Query  658  TMGNYGAQG  684
            T+GN G+ G
Sbjct  156  TIGNCGSHG  164



>ref|XP_006432921.1| hypothetical protein CICLE_v10002290mg [Citrus clementina]
 gb|ESR46161.1| hypothetical protein CICLE_v10002290mg [Citrus clementina]
Length=213

 Score =   142 bits (358),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 82/133 (62%), Positives = 96/133 (72%), Gaps = 4/133 (3%)
 Frame = +1

Query  298  KRGFSETV-DLKLNLQSAADSSLDL--KEKMKSPSKEPNKDPIKPPSKAQVVGWPPVRNY  468
            KRGF++TV DLKLNL +     +D+  K K KS S     D  KPP+KAQVVGWPPVR++
Sbjct  42   KRGFADTVVDLKLNLSTKESGGIDVIQKTKGKSASATGATDLSKPPAKAQVVGWPPVRSF  101

Query  469  RKNIMA-QksspeeaageksggggpaaFVKVCMDGAPYLRKVDLKMYESYQQLSDALAKM  645
            RKNIMA QK + E      S      AFVKV MDGAPYLRKVDLK+Y+SYQ+LSDAL KM
Sbjct  102  RKNIMAVQKDNEEGDNKASSSSSSNVAFVKVSMDGAPYLRKVDLKLYKSYQELSDALGKM  161

Query  646  FSSFTMGNYGAQG  684
            FSSFT+GN G+QG
Sbjct  162  FSSFTIGNCGSQG  174



>ref|XP_002302075.1| auxin-induced protein aux28 [Populus trichocarpa]
 gb|EEE81348.1| auxin-induced protein aux28 [Populus trichocarpa]
 gb|AFZ78622.1| hypothetical protein [Populus tomentosa]
Length=237

 Score =   143 bits (360),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 79/132 (60%), Positives = 92/132 (70%), Gaps = 4/132 (3%)
 Frame = +1

Query  298  KRGFSETVDLKLNLQSAADSSLDLKEKMKSPSKEPN---KDPIKPPSKAQVVGWPPVRNY  468
            KRGFSETVDLKL L S    +    EK  S  +E N    DP KPP+KAQVVGWPPVR++
Sbjct  34   KRGFSETVDLKLKLSSKESGADPNHEKTSSLQREKNLLATDPAKPPAKAQVVGWPPVRSF  93

Query  469  RKNIMAQksspeeaageksggggpaaFVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMF  648
            RKN++A           +   GG A FVKV MDGAPYLRKVDLKMY++YQ+LSDAL KMF
Sbjct  94   RKNMLA-VQKSSTDQECEKVPGGNATFVKVSMDGAPYLRKVDLKMYKTYQELSDALGKMF  152

Query  649  SSFTMGNYGAQG  684
            SSFT+GN G+ G
Sbjct  153  SSFTIGNCGSHG  164



>ref|XP_011079949.1| PREDICTED: auxin-induced protein AUX28-like [Sesamum indicum]
Length=244

 Score =   143 bits (360),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 85/137 (62%), Positives = 100/137 (73%), Gaps = 9/137 (7%)
 Frame = +1

Query  295  GKRGFSETVDLKLNLQSAADSSLD---LKEKMKSPSKE----PNKDPIKPPSKAQVVGWP  453
            GKRG+ ETVDLKLNL +    +LD   LKEK  S  K     PN D +KPP+KAQVVGWP
Sbjct  39   GKRGYEETVDLKLNLSTKDVGNLDQSDLKEKTLSKEKNLLPCPN-DSVKPPAKAQVVGWP  97

Query  454  PVRNYRKNIMAQksspeeaageksggggpaaFVKVCMDGAPYLRKVDLKMYESYQQLSDA  633
            PVR++RKN+MA      ++   + G GG AAFVKV MDGAPYLRKVDLKMY+SYQ+LSDA
Sbjct  98   PVRSFRKNVMA-VQKVSDSEETEKGSGGAAAFVKVSMDGAPYLRKVDLKMYKSYQELSDA  156

Query  634  LAKMFSSFTMGNYGAQG  684
            L KMFSSFT+G   +QG
Sbjct  157  LGKMFSSFTIGKCDSQG  173



>emb|CAC84711.1| aux/IAA protein [Populus tremula x Populus tremuloides]
Length=229

 Score =   142 bits (358),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 76/129 (59%), Positives = 89/129 (69%), Gaps = 0/129 (0%)
 Frame = +1

Query  298  KRGFSETVDLKLNLQSAADSSLDLKEKMKSPSKEPNKDPIKPPSKAQVVGWPPVRNYRKN  477
            KRGFSETVDLKLNL S         EK +        DP KPP+KAQVVGWPPVR++RKN
Sbjct  36   KRGFSETVDLKLNLSSKEGGIDPNHEKTRREKNLLATDPAKPPAKAQVVGWPPVRSFRKN  95

Query  478  IMAQksspeeaageksggggpaaFVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSF  657
            ++A + S  +        GG A FVKV MDGAPYLRKVDL MY++Y +LSDAL KMFSSF
Sbjct  96   MLAVQKSSTDQESTNKVPGGNATFVKVSMDGAPYLRKVDLNMYKTYHELSDALGKMFSSF  155

Query  658  TMGNYGAQG  684
            T+GN G+ G
Sbjct  156  TIGNCGSHG  164



>gb|KDO48906.1| hypothetical protein CISIN_1g026005mg [Citrus sinensis]
Length=217

 Score =   142 bits (357),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 81/133 (61%), Positives = 96/133 (72%), Gaps = 4/133 (3%)
 Frame = +1

Query  298  KRGFSETV-DLKLNLQSAADSSLDLKEKMK--SPSKEPNKDPIKPPSKAQVVGWPPVRNY  468
            KRGF++TV DLKLNL +     +D+ EK K  S S     D  KPP+K+QVVGWPPVR++
Sbjct  42   KRGFADTVVDLKLNLSTKESGGIDVIEKTKGKSASATGATDLSKPPAKSQVVGWPPVRSF  101

Query  469  RKNIMA-QksspeeaageksggggpaaFVKVCMDGAPYLRKVDLKMYESYQQLSDALAKM  645
            RKNIMA QK + E      S      AFVKV MDGAPYLRKVDLK+Y+SYQ+LSDAL KM
Sbjct  102  RKNIMAVQKDNEEGDNKASSSSSSNVAFVKVSMDGAPYLRKVDLKLYKSYQELSDALGKM  161

Query  646  FSSFTMGNYGAQG  684
            FSSFT+GN G+QG
Sbjct  162  FSSFTIGNCGSQG  174



>gb|KDO48907.1| hypothetical protein CISIN_1g026005mg [Citrus sinensis]
Length=213

 Score =   142 bits (357),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 81/133 (61%), Positives = 96/133 (72%), Gaps = 4/133 (3%)
 Frame = +1

Query  298  KRGFSETV-DLKLNLQSAADSSLDLKEKMK--SPSKEPNKDPIKPPSKAQVVGWPPVRNY  468
            KRGF++TV DLKLNL +     +D+ EK K  S S     D  KPP+K+QVVGWPPVR++
Sbjct  42   KRGFADTVVDLKLNLSTKESGGIDVIEKTKGKSASATGATDLSKPPAKSQVVGWPPVRSF  101

Query  469  RKNIMA-QksspeeaageksggggpaaFVKVCMDGAPYLRKVDLKMYESYQQLSDALAKM  645
            RKNIMA QK + E      S      AFVKV MDGAPYLRKVDLK+Y+SYQ+LSDAL KM
Sbjct  102  RKNIMAVQKDNEEGDNKASSSSSSNVAFVKVSMDGAPYLRKVDLKLYKSYQELSDALGKM  161

Query  646  FSSFTMGNYGAQG  684
            FSSFT+GN G+QG
Sbjct  162  FSSFTIGNCGSQG  174



>ref|XP_010679165.1| PREDICTED: auxin-responsive protein IAA14-like [Beta vulgaris 
subsp. vulgaris]
Length=278

 Score =   143 bits (361),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 86/159 (54%), Positives = 101/159 (64%), Gaps = 27/159 (17%)
 Frame = +1

Query  289  VTGKRGFSETVDLKLNL------------------QSAADSSLDLKEKM--------KSP  390
            V  KRGFSETVDLKLN                   Q+A  + LDL +          K  
Sbjct  49   VGNKRGFSETVDLKLNFSTNNNKNDHNNNINSGKEQTATSAPLDLMKNDNKADVSADKEI  108

Query  391  SKEPNKDPIKPPSKAQVVGWPPVRNYRKNIMA-QksspeeaageksggggpaaFVKVCMD  567
            S + N D +KPP+KAQVVGWPPVR+YRKN++A QK++    +  +    G  A VKV MD
Sbjct  109  SSKVNADSVKPPAKAQVVGWPPVRSYRKNMLAVQKTTGGPDSETEKPMNGGGALVKVSMD  168

Query  568  GAPYLRKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQG  684
            GAPYLRKVDLKMY+SYQ LSDAL KMFSSFT+GNYGAQG
Sbjct  169  GAPYLRKVDLKMYKSYQDLSDALGKMFSSFTLGNYGAQG  207



>emb|CAH59413.1| auxin resistance protein [Plantago major]
Length=227

 Score =   142 bits (357),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 78/130 (60%), Positives = 92/130 (71%), Gaps = 10/130 (8%)
 Frame = +1

Query  295  GKRGFSETVDLKLNLQSAADSSLDLKEKMKSPSKEPNKDPIKPPSKAQVVGWPPVRNYRK  474
            GKRG+ +TVDLKLNL     SS DL  +      + N  P+KPP+KAQVVGWPPVRN+RK
Sbjct  37   GKRGYEQTVDLKLNL-----SSKDLPNQTDLAENKKNDQPVKPPAKAQVVGWPPVRNFRK  91

Query  475  NIMAQksspeeaageksggggpaaFVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSS  654
            N+MA      +   +    GG AAFVKV MDGAPYLRKVDLKMY++Y++LSDAL KMFSS
Sbjct  92   NVMA-----VQKTEKAEESGGSAAFVKVSMDGAPYLRKVDLKMYKTYEELSDALGKMFSS  146

Query  655  FTMGNYGAQG  684
            FTM    AQG
Sbjct  147  FTMSKCDAQG  156



>ref|XP_010936171.1| PREDICTED: auxin-responsive protein IAA30-like [Elaeis guineensis]
Length=251

 Score =   142 bits (359),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 104/180 (58%), Positives = 120/180 (67%), Gaps = 15/180 (8%)
 Frame = +1

Query  184  MGSMLA---EHGGLNLKATElclglpgggggNESESLKVTGKRGFSETVDLKLNLQSAAD  354
            M S+L    E  GL L+ TEL LGLPGGGGG    S K +GKRGFSET+DLKL L + AD
Sbjct  1    MASLLVRGKEDYGLGLEETELRLGLPGGGGGEGDVS-KNSGKRGFSETIDLKLKLHTVAD  59

Query  355  SS---LDLKEKMK-SPSKEPN-----KDPIKPPS-KAQVVGWPPVRNYRKNIMAQksspe  504
            S    ++  EKMK SP  + N      DP KPP+ KAQVVGWPPVR++RKN+MA  S   
Sbjct  60   SKEVVMEASEKMKRSPPSQNNILTCTNDPEKPPAPKAQVVGWPPVRSFRKNMMASHSDKG  119

Query  505  eaageksggggpaaFVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQG  684
                 +      A FVKV MDGAPYLRKVDLKMY SY++LS AL KMFSSFT GN G+QG
Sbjct  120  SKEAGEKSSNSAA-FVKVSMDGAPYLRKVDLKMYSSYKELSMALEKMFSSFTSGNCGSQG  178



>ref|XP_006432923.1| hypothetical protein CICLE_v10002290mg [Citrus clementina]
 ref|XP_006471684.1| PREDICTED: auxin-responsive protein IAA16-like isoform X1 [Citrus 
sinensis]
 gb|ESR46163.1| hypothetical protein CICLE_v10002290mg [Citrus clementina]
Length=245

 Score =   142 bits (359),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 82/133 (62%), Positives = 96/133 (72%), Gaps = 4/133 (3%)
 Frame = +1

Query  298  KRGFSETV-DLKLNLQSAADSSLDL--KEKMKSPSKEPNKDPIKPPSKAQVVGWPPVRNY  468
            KRGF++TV DLKLNL +     +D+  K K KS S     D  KPP+KAQVVGWPPVR++
Sbjct  42   KRGFADTVVDLKLNLSTKESGGIDVIQKTKGKSASATGATDLSKPPAKAQVVGWPPVRSF  101

Query  469  RKNIMA-QksspeeaageksggggpaaFVKVCMDGAPYLRKVDLKMYESYQQLSDALAKM  645
            RKNIMA QK + E      S      AFVKV MDGAPYLRKVDLK+Y+SYQ+LSDAL KM
Sbjct  102  RKNIMAVQKDNEEGDNKASSSSSSNVAFVKVSMDGAPYLRKVDLKLYKSYQELSDALGKM  161

Query  646  FSSFTMGNYGAQG  684
            FSSFT+GN G+QG
Sbjct  162  FSSFTIGNCGSQG  174



>ref|XP_011042427.1| PREDICTED: auxin-induced protein AUX28-like [Populus euphratica]
Length=237

 Score =   142 bits (357),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 76/129 (59%), Positives = 90/129 (70%), Gaps = 0/129 (0%)
 Frame = +1

Query  298  KRGFSETVDLKLNLQSAADSSLDLKEKMKSPSKEPNKDPIKPPSKAQVVGWPPVRNYRKN  477
            KRGFSETVDLKLNL S         EK +        DP KPP+KAQVVGWPPVR++RKN
Sbjct  36   KRGFSETVDLKLNLSSKEGGIDPNHEKTQREKNLLATDPAKPPAKAQVVGWPPVRSFRKN  95

Query  478  IMAQksspeeaageksggggpaaFVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSF  657
            ++A + S  +        GG A FVKV MDGAPYLRKVDLKMY++Y +LSDAL +MFSSF
Sbjct  96   MLAVQKSSTDQESTDKVPGGNATFVKVSMDGAPYLRKVDLKMYKTYHELSDALGEMFSSF  155

Query  658  TMGNYGAQG  684
            T+GN G+ G
Sbjct  156  TIGNCGSHG  164



>ref|NP_001280973.1| auxin-responsive protein IAA16 [Malus domestica]
 gb|ABI36494.1| AUX/IAA16 B [Malus domestica]
Length=251

 Score =   142 bits (358),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 84/146 (58%), Positives = 104/146 (71%), Gaps = 11/146 (8%)
 Frame = +1

Query  271  ESESLKVTGKRGFSETVDLKLNL----QSAADSS--LDLK-EKMKSPSKEPNKDPIKP-P  426
            + E+ K TGKRGF+ETVDLKLN+    QSA D    +D+K EK  +P    N DP KP  
Sbjct  38   DGEASKNTGKRGFAETVDLKLNISSEDQSAGDEDQVVDMKKEKDVAPVPRSN-DPTKPHA  96

Query  427  SKAQVVGWPPVRNYRKNIMAQksspeeaageksggggpaaFVKVCMDGAPYLRKVDLKMY  606
            +KAQVVGWPPVR++R NI+A     + +   +      AAFVKV MDGAPYLRKVDLK+Y
Sbjct  97   AKAQVVGWPPVRSFRXNILA--VQKDVSDEGEKTNSXSAAFVKVSMDGAPYLRKVDLKLY  154

Query  607  ESYQQLSDALAKMFSSFTMGNYGAQG  684
            +SYQ+LS AL KMFSSFT+G+YG+QG
Sbjct  155  KSYQELSTALGKMFSSFTIGSYGSQG  180



>gb|KDO48905.1| hypothetical protein CISIN_1g026005mg [Citrus sinensis]
Length=245

 Score =   142 bits (357),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 81/133 (61%), Positives = 96/133 (72%), Gaps = 4/133 (3%)
 Frame = +1

Query  298  KRGFSETV-DLKLNLQSAADSSLDLKEKMK--SPSKEPNKDPIKPPSKAQVVGWPPVRNY  468
            KRGF++TV DLKLNL +     +D+ EK K  S S     D  KPP+K+QVVGWPPVR++
Sbjct  42   KRGFADTVVDLKLNLSTKESGGIDVIEKTKGKSASATGATDLSKPPAKSQVVGWPPVRSF  101

Query  469  RKNIMA-QksspeeaageksggggpaaFVKVCMDGAPYLRKVDLKMYESYQQLSDALAKM  645
            RKNIMA QK + E      S      AFVKV MDGAPYLRKVDLK+Y+SYQ+LSDAL KM
Sbjct  102  RKNIMAVQKDNEEGDNKASSSSSSNVAFVKVSMDGAPYLRKVDLKLYKSYQELSDALGKM  161

Query  646  FSSFTMGNYGAQG  684
            FSSFT+GN G+QG
Sbjct  162  FSSFTIGNCGSQG  174



>emb|CDY32537.1| BnaA09g50590D [Brassica napus]
Length=228

 Score =   141 bits (355),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 82/137 (60%), Positives = 96/137 (70%), Gaps = 13/137 (9%)
 Frame = +1

Query  289  VTG-KRGFSETVDLKLNLQSAADSSLDLK--EKMKSPSKEPN---KDPIKPPSKAQVVGW  450
            VTG KRGFSETVDLKLNL +  +S+   K  + + S SKE +   KDP KPP+KAQVVGW
Sbjct  27   VTGTKRGFSETVDLKLNLNNEPESNEGSKTHDVVTSVSKEKSSSPKDPAKPPAKAQVVGW  86

Query  451  PPVRNYRKNIMAQksspeeaageksggggpaaFVKVCMDGAPYLRKVDLKMYESYQQLSD  630
            PPVR+YRKN+M     P       S       FVKV MDGAPYLRKVDLKMY+SY +LS+
Sbjct  87   PPVRSYRKNVMGSCQKPSGGTETAS-------FVKVSMDGAPYLRKVDLKMYKSYDELSN  139

Query  631  ALAKMFSSFTMGNYGAQ  681
            AL+ MFSSFTMG YG +
Sbjct  140  ALSNMFSSFTMGKYGGE  156



>emb|CDY15493.1| BnaA08g27770D [Brassica napus]
Length=229

 Score =   141 bits (355),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 88/162 (54%), Positives = 105/162 (65%), Gaps = 16/162 (10%)
 Frame = +1

Query  211  GLNLKATElclglpgggggNESESLKVTGKRGFSETVDLKLNLQSAADS-----SLDLKE  375
            GLNL+ TELCLGLPG     ++ S     KRGFSETVDLKLNL +  +S     S D+  
Sbjct  6    GLNLRETELCLGLPG----GDTASPLTGTKRGFSETVDLKLNLNNEPESKEGSKSHDVVS  61

Query  376  KMKSPSKEPNKDPIKPPSKAQVVGWPPVRNYRKNIMAQksspeeaageksggggpaaFVK  555
             +        KDP KPP+KAQVVGWPPVR+YRKN+M        +A   +       FVK
Sbjct  62   AISKEKSSCTKDPTKPPAKAQVVGWPPVRSYRKNVMGSCQKSSSSADTAA-------FVK  114

Query  556  VCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQ  681
            V MDGAPYLRK+DLKMY+SY +LSDAL+ MFSSFTMG  G +
Sbjct  115  VSMDGAPYLRKIDLKMYKSYDELSDALSNMFSSFTMGKNGGE  156



>ref|XP_009118658.1| PREDICTED: auxin-responsive protein IAA17-like [Brassica rapa]
Length=228

 Score =   141 bits (355),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 82/137 (60%), Positives = 96/137 (70%), Gaps = 13/137 (9%)
 Frame = +1

Query  289  VTG-KRGFSETVDLKLNLQSAADSSLDLK--EKMKSPSKEPN---KDPIKPPSKAQVVGW  450
            VTG KRGFSETVDLKLNL +  +S+   K  + + S SKE +   KDP KPP+KAQVVGW
Sbjct  27   VTGTKRGFSETVDLKLNLNNEPESNEGSKTHDVVTSVSKEKSSSPKDPAKPPAKAQVVGW  86

Query  451  PPVRNYRKNIMAQksspeeaageksggggpaaFVKVCMDGAPYLRKVDLKMYESYQQLSD  630
            PPVR+YRKN+M     P       S       FVKV MDGAPYLRKVDLKMY+SY +LS+
Sbjct  87   PPVRSYRKNVMGSCQKPSGGTETAS-------FVKVSMDGAPYLRKVDLKMYKSYDELSN  139

Query  631  ALAKMFSSFTMGNYGAQ  681
            AL+ MFSSFTMG YG +
Sbjct  140  ALSNMFSSFTMGKYGGE  156



>ref|XP_006304183.1| hypothetical protein CARUB_v10010236mg [Capsella rubella]
 gb|EOA37081.1| hypothetical protein CARUB_v10010236mg [Capsella rubella]
Length=224

 Score =   141 bits (355),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 78/137 (57%), Positives = 92/137 (67%), Gaps = 18/137 (13%)
 Frame = +1

Query  289  VTG-KRGFSETVDLKLNLQSAAD-----SSLDLKEKMKSPSKEPNKDPIKPPSKAQVVGW  450
            VTG KRGFSETVDLKLNL +  +     ++LD KEK        +KDP KPP+KAQVVGW
Sbjct  27   VTGNKRGFSETVDLKLNLNNEPENKEGSTTLDSKEKSSC-----SKDPAKPPAKAQVVGW  81

Query  451  PPVRNYRKNIMAQksspeeaageksggggpaaFVKVCMDGAPYLRKVDLKMYESYQQLSD  630
            PPVR+YRKN+M             +       FVKV MDGAPYLRKVDL+MY+SY +LS 
Sbjct  82   PPVRSYRKNVMVSCQKASSGPEAAA-------FVKVSMDGAPYLRKVDLRMYKSYDELST  134

Query  631  ALAKMFSSFTMGNYGAQ  681
            AL+ MFSSFTMG YG +
Sbjct  135  ALSNMFSSFTMGKYGGE  151



>gb|KHG04941.1| Auxin-induced AUX28 [Gossypium arboreum]
Length=235

 Score =   141 bits (355),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 93/174 (53%), Positives = 109/174 (63%), Gaps = 12/174 (7%)
 Frame = +1

Query  166  MEVGRKMGSMLAEHGGLNLKATElclglpgggggNESESLKVTGKRGFSETVDLKLNLQS  345
            MEVG KMG M  E   +  K  E                 +V  KR FS TVDLKLNL S
Sbjct  1    MEVGVKMG-MKGEGDEVGGKEKEKMGYEETELRLGLPGDGEVVRKRDFSHTVDLKLNLIS  59

Query  346  AADSSLDLKEKMKSPSKEPNKDPIKPP-SKAQVVGWPPVRNYRKNIMAQksspeeaagek  522
               S  D K+K   PS   + DP KPP +KAQVVGWPPVR++RKN++A      + +   
Sbjct  60   T--SPTDDKDKNIVPS---HLDPAKPPPAKAQVVGWPPVRSFRKNMLA-----TQKSSGS  109

Query  523  sggggpaaFVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQG  684
               G  AAFVKV MDGAPYLRKVDL+MY++YQQLSDALAKMFSSFT+GN G+QG
Sbjct  110  EDSGEKAAFVKVSMDGAPYLRKVDLRMYKTYQQLSDALAKMFSSFTIGNCGSQG  163



>emb|CDY50750.1| BnaAnng10570D [Brassica napus]
Length=291

 Score =   142 bits (359),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 79/149 (53%), Positives = 100/149 (67%), Gaps = 25/149 (17%)
 Frame = +1

Query  280  SLKVTGKRGFSETVDLKLNLQSAADSSL------DLKEKMKSPSKEPNKDPIKPPSKAQV  441
            ++K  GKRGFSETVDLKLNL S A  S+      ++KEK+           +KPP+KAQV
Sbjct  83   AMKNNGKRGFSETVDLKLNLSSTALDSVSGVDLENMKEKV-----------VKPPAKAQV  131

Query  442  VGWPPVRNYRKNIMA--------QksspeeaageksggggpaaFVKVCMDGAPYLRKVDL  597
            VGWPPVR++RKN+M+             E+ +         AA+VKV MDGAPYLRK+DL
Sbjct  132  VGWPPVRSFRKNVMSGQKPTAGDAAEGTEKTSSSNGATSSAAAYVKVSMDGAPYLRKIDL  191

Query  598  KMYESYQQLSDALAKMFSSFTMGNYGAQG  684
            K+Y++YQ LSDAL+KMFSSFT+GNYG QG
Sbjct  192  KLYKTYQDLSDALSKMFSSFTIGNYGPQG  220



>gb|EPS60474.1| hypothetical protein M569_14329, partial [Genlisea aurea]
Length=212

 Score =   140 bits (352),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 78/131 (60%), Positives = 94/131 (72%), Gaps = 2/131 (2%)
 Frame = +1

Query  292  TGKRGFSETVDLKLNLQSAADSSLDLKEKMKSPSKEPNKDPIKPPSKAQVVGWPPVRNYR  471
             GKRGF+ETVDLKLNL +A + +LD KEK K  + + + D  KPP KAQVVGWPPVR +R
Sbjct  28   CGKRGFAETVDLKLNL-AAKEMNLD-KEKEKKKNLQISADSSKPPMKAQVVGWPPVRAFR  85

Query  472  KNIMAQksspeeaageksggggpaaFVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFS  651
            +N +  +    E A E        A VKV MDGAPYLRK+DLKMY++YQQLSDALAKMFS
Sbjct  86   RNAICSQKKSTEPAEETEKASPSPALVKVSMDGAPYLRKIDLKMYKTYQQLSDALAKMFS  145

Query  652  SFTMGNYGAQG  684
            SFT+G   +QG
Sbjct  146  SFTIGKCESQG  156



>ref|XP_009111119.1| PREDICTED: auxin-responsive protein IAA17 [Brassica rapa]
Length=229

 Score =   140 bits (354),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 91/163 (56%), Positives = 107/163 (66%), Gaps = 18/163 (11%)
 Frame = +1

Query  211  GLNLKATElclglpgggggNESESLKVTG-KRGFSETVDLKLNLQSAADS-----SLDLK  372
            GLNL+ TELCLGLPGG   +      VTG KRGFSETVDLKLNL +  +S     S D+ 
Sbjct  6    GLNLRETELCLGLPGGDTASP-----VTGTKRGFSETVDLKLNLNNEPESKEGSKSHDVV  60

Query  373  EKMKSPSKEPNKDPIKPPSKAQVVGWPPVRNYRKNIMAQksspeeaageksggggpaaFV  552
              +        KDP KPP+KAQVVGWPPVR+YRKN+M        +A   +       FV
Sbjct  61   SAISKEKSSCPKDPTKPPAKAQVVGWPPVRSYRKNVMGSCQKSSSSADTAA-------FV  113

Query  553  KVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQ  681
            KV MDGAPYLRK+DLKMY+SY +LSDAL+ MFSSFTMG  G +
Sbjct  114  KVSMDGAPYLRKIDLKMYKSYDELSDALSNMFSSFTMGKNGGE  156



>ref|XP_006408158.1| hypothetical protein EUTSA_v10021441mg [Eutrema salsugineum]
 gb|ESQ49611.1| hypothetical protein EUTSA_v10021441mg [Eutrema salsugineum]
Length=223

 Score =   140 bits (352),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 80/150 (53%), Positives = 97/150 (65%), Gaps = 28/150 (19%)
 Frame = +1

Query  286  KVTGKRGFSETVDLKLNLQSAADSSL------DLKEKMKSPSKEPNKDPIKPPSKAQVVG  447
            K  GKRGFSETVDLKLNL S A  S+      +LKEK+           +KPP+K QVVG
Sbjct  25   KNNGKRGFSETVDLKLNLSSTALDSVSEVDIQNLKEKV-----------VKPPAKTQVVG  73

Query  448  WPPVRNYRKNIMAQksspeeaag-----------eksggggpaaFVKVCMDGAPYLRKVD  594
            WPPVR++RKN+M+ +    E A              S      A+VKV MDGAPYLRK+D
Sbjct  74   WPPVRSFRKNVMSGQKQTTEVAAEGTEKTCGSSGATSSANAAVAYVKVSMDGAPYLRKID  133

Query  595  LKMYESYQQLSDALAKMFSSFTMGNYGAQG  684
            LK+Y++YQ LSDAL+KMFSSFT+GNYG QG
Sbjct  134  LKLYKTYQDLSDALSKMFSSFTIGNYGPQG  163



>ref|NP_001275031.1| auxin-responsive protein IAA14-like [Solanum tuberosum]
 gb|ABK41009.1| auxin/indole-3-acetic acid [Solanum tuberosum]
Length=213

 Score =   139 bits (351),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 78/129 (60%), Positives = 92/129 (71%), Gaps = 11/129 (9%)
 Frame = +1

Query  298  KRGFSETVDLKLNLQSAADSSLDLKEKMKSPSKEPNKDPIKPPSKAQVVGWPPVRNYRKN  477
            KRGFS+TVDLKLNL + + +  +      S         +KPP+KAQVVGWPPVR++RKN
Sbjct  25   KRGFSQTVDLKLNLDNPSININNTSSNNDS---------LKPPTKAQVVGWPPVRSFRKN  75

Query  478  IMAQksspeeaageksggggpaaFVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSF  657
            IM+QK +      EK        FVKV MDGAPYLRKVDLKMY+SYQQLSD+L KMFSSF
Sbjct  76   IMSQKGNNNVEISEKGEKTIA--FVKVSMDGAPYLRKVDLKMYKSYQQLSDSLTKMFSSF  133

Query  658  TMGNYGAQG  684
            TMGNYG+QG
Sbjct  134  TMGNYGSQG  142



>ref|XP_006408159.1| hypothetical protein EUTSA_v10021441mg [Eutrema salsugineum]
 gb|ESQ49612.1| hypothetical protein EUTSA_v10021441mg [Eutrema salsugineum]
Length=234

 Score =   140 bits (352),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 80/150 (53%), Positives = 97/150 (65%), Gaps = 28/150 (19%)
 Frame = +1

Query  286  KVTGKRGFSETVDLKLNLQSAADSSL------DLKEKMKSPSKEPNKDPIKPPSKAQVVG  447
            K  GKRGFSETVDLKLNL S A  S+      +LKEK+           +KPP+K QVVG
Sbjct  25   KNNGKRGFSETVDLKLNLSSTALDSVSEVDIQNLKEKV-----------VKPPAKTQVVG  73

Query  448  WPPVRNYRKNIMAQksspeeaag-----------eksggggpaaFVKVCMDGAPYLRKVD  594
            WPPVR++RKN+M+ +    E A              S      A+VKV MDGAPYLRK+D
Sbjct  74   WPPVRSFRKNVMSGQKQTTEVAAEGTEKTCGSSGATSSANAAVAYVKVSMDGAPYLRKID  133

Query  595  LKMYESYQQLSDALAKMFSSFTMGNYGAQG  684
            LK+Y++YQ LSDAL+KMFSSFT+GNYG QG
Sbjct  134  LKLYKTYQDLSDALSKMFSSFTIGNYGPQG  163



>dbj|BAG55005.1| auxin-responsive Aux/IAA gene family member [Ipomoea nil]
Length=225

 Score =   139 bits (351),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 96/165 (58%), Positives = 115/165 (70%), Gaps = 20/165 (12%)
 Frame = +1

Query  214  LNLKATElclglpgggggNESESLKVTGKRGFSETVDLKLNLQSAADSSLDLKEKMK---  384
            LN +ATEL LGLPGGGGGN+ E++K  GKR FS+TVDLKL L S+ +S++D  E +K   
Sbjct  2    LNFEATELRLGLPGGGGGNDGEAVKSNGKRAFSDTVDLKLKL-SSKESNVDQVENLKDNN  60

Query  385  -----SPSKEPNKDPIKPPSKAQVVGWPPVRNYRKNIMAQksspeeaageksggggpaaF  549
                 SPS     D  KPP+KAQVVGWPPVR+YRKNI++               GG AA 
Sbjct  61   NNVVTSPS-----DSTKPPAKAQVVGWPPVRSYRKNILS------GQKAAGESSGGGAAL  109

Query  550  VKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQG  684
            VKV +DGAPYLRKVDLKMY+SY +LS+AL KMFSSFT+GN G  G
Sbjct  110  VKVSVDGAPYLRKVDLKMYKSYHELSEALGKMFSSFTIGNCGTHG  154



>ref|XP_009364490.1| PREDICTED: auxin-responsive protein IAA16 [Pyrus x bretschneideri]
Length=252

 Score =   140 bits (353),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 81/146 (55%), Positives = 101/146 (69%), Gaps = 11/146 (8%)
 Frame = +1

Query  271  ESESLKVTGKRGFSETVDLKLNLQSAADSSLD-------LKEKMKSPSKEPNKDPIKPPS  429
            + E+ K TGKRGF+ETVDLKLN+ S   S+ D        KEK  +P    N +P KPP+
Sbjct  38   DGEASKNTGKRGFAETVDLKLNISSEDQSAGDEDQVEEMKKEKNVAPVPRSN-NPTKPPA  96

Query  430  -KAQVVGWPPVRNYRKNIMAQksspeeaageksggggpaaFVKVCMDGAPYLRKVDLKMY  606
             KAQ VGWPPVR++RKNI+A       +   +      AAFVKV +DGAPYLRKVDLK+Y
Sbjct  97   AKAQAVGWPPVRSFRKNILA--VQKNGSEEGEKTNSITAAFVKVSVDGAPYLRKVDLKLY  154

Query  607  ESYQQLSDALAKMFSSFTMGNYGAQG  684
            +SYQ+LS AL+KMFSSFT+GN G+QG
Sbjct  155  KSYQELSTALSKMFSSFTIGNCGSQG  180



>ref|XP_002889499.1| hypothetical protein ARALYDRAFT_470401 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH65758.1| hypothetical protein ARALYDRAFT_470401 [Arabidopsis lyrata subsp. 
lyrata]
Length=229

 Score =   139 bits (351),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 78/142 (55%), Positives = 92/142 (65%), Gaps = 23/142 (16%)
 Frame = +1

Query  289  VTG-KRGFSETVDLKLNLQSAADS----------SLDLKEKMKSPSKEPNKDPIKPPSKA  435
            VTG KRGFSETVDLKLNL +  ++          + D KEK   P     KDP KPPSKA
Sbjct  27   VTGNKRGFSETVDLKLNLNNEPENKEGSTTHDVVTFDSKEKSSCP-----KDPAKPPSKA  81

Query  436  QVVGWPPVRNYRKNIMAQksspeeaageksggggpaaFVKVCMDGAPYLRKVDLKMYESY  615
            QVVGWPPVR+YRKN+M             +       FVKV MDGAPYLRKVDL+MY+SY
Sbjct  82   QVVGWPPVRSYRKNVMVSCQKSSGGPEAAA-------FVKVSMDGAPYLRKVDLRMYKSY  134

Query  616  QQLSDALAKMFSSFTMGNYGAQ  681
             +LS+AL+ MFSSFTMG +G +
Sbjct  135  DELSNALSNMFSSFTMGKHGGE  156



>ref|XP_006838867.1| hypothetical protein AMTR_s00002p00266760 [Amborella trichopoda]
 gb|ERN01436.1| hypothetical protein AMTR_s00002p00266760 [Amborella trichopoda]
Length=238

 Score =   139 bits (351),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 90/168 (54%), Positives = 110/168 (65%), Gaps = 17/168 (10%)
 Frame = +1

Query  214  LNLKATElclglpgggggNESESLKVTGKRGFSETVDLKLNLQSAA----------DSSL  363
            LN +ATEL LG PG    N   + K  GKRGFSETVDLKLNL   A          D+ +
Sbjct  7    LNFEATELRLGPPG----NGDSAGKGIGKRGFSETVDLKLNLMEPAPLDVPASTVKDTGV  62

Query  364  DLKEKMKSPSKEPNKDPIKPPS-KAQVVGWPPVRNYRKNIMAQksspeeaageksggggp  540
            DL EK++  +     DP KPP+ KAQVVGWPPVR++R+N++A +SS      E+      
Sbjct  63   DLTEKLRGSNAV--ADPAKPPAHKAQVVGWPPVRSFRRNMLATQSSKGNNRSEEGEKNAG  120

Query  541  aaFVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQG  684
            A +VKV MDGAPYLRKVDL MY+SYQ LS++L KMFS FTMG  G+QG
Sbjct  121  ATYVKVSMDGAPYLRKVDLNMYKSYQDLSNSLEKMFSCFTMGQCGSQG  168



>ref|XP_008218270.1| PREDICTED: auxin-responsive protein IAA16 [Prunus mume]
Length=256

 Score =   140 bits (352),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 84/150 (56%), Positives = 98/150 (65%), Gaps = 13/150 (9%)
 Frame = +1

Query  271  ESESLKVTGKRGFSETVDLKLNLQS---AADSSLDL--------KEKMKSPSKEPNKDPI  417
            + E+ K  GKRGFSETVDLKLN+ S   +AD S D         +EK  +       DP 
Sbjct  37   DGEAAKNNGKRGFSETVDLKLNISSQDQSADRSADQDQQLMELKREKNAAAPAPSANDPS  96

Query  418  KPP-SKAQVVGWPPVRNYRKNIMAQksspeeaageksggggpaaFVKVCMDGAPYLRKVD  594
            KPP SKAQVVGWPPVR++RKNI+           EK      AAFVKV MDGAPYLRKVD
Sbjct  97   KPPASKAQVVGWPPVRSFRKNIVT-VQKKSSEEAEKGNSNISAAFVKVSMDGAPYLRKVD  155

Query  595  LKMYESYQQLSDALAKMFSSFTMGNYGAQG  684
            LK+Y+SYQ+LS AL KMFSSFT+GN G+ G
Sbjct  156  LKLYKSYQELSTALGKMFSSFTIGNCGSDG  185



>ref|XP_010457463.1| PREDICTED: auxin-responsive protein IAA17 [Camelina sativa]
Length=229

 Score =   139 bits (350),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 77/142 (54%), Positives = 92/142 (65%), Gaps = 23/142 (16%)
 Frame = +1

Query  289  VTG-KRGFSETVDLKLNLQSAADS----------SLDLKEKMKSPSKEPNKDPIKPPSKA  435
            VTG KRGFSETVDLKLNL +  ++          + D K+K   P     KDP KPP+KA
Sbjct  27   VTGNKRGFSETVDLKLNLNNEPENKEGSTTHGVVTFDSKDKSSCP-----KDPAKPPAKA  81

Query  436  QVVGWPPVRNYRKNIMAQksspeeaageksggggpaaFVKVCMDGAPYLRKVDLKMYESY  615
            QVVGWPPVR+YRKN+M             +       FVKV MDGAPYLRKVDL+MY+SY
Sbjct  82   QVVGWPPVRSYRKNVMVSCQKSSSGPEAAA-------FVKVSMDGAPYLRKVDLRMYKSY  134

Query  616  QQLSDALAKMFSSFTMGNYGAQ  681
             +LS+AL+ MFSSFTMG YG +
Sbjct  135  DELSNALSNMFSSFTMGKYGGE  156



>ref|XP_009398568.1| PREDICTED: auxin-responsive protein IAA30-like [Musa acuminata 
subsp. malaccensis]
Length=248

 Score =   139 bits (351),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 85/142 (60%), Positives = 98/142 (69%), Gaps = 7/142 (5%)
 Frame = +1

Query  277  ESLKVTGKRGFSETVDLKLNLQSAADSSLDLKEKMK-SPSKE----PNKDPIKPPS-KAQ  438
            ++ K +GKR F ETVDLKL LQ+  D      EKMK SPS +       DP +P + KAQ
Sbjct  35   DATKNSGKRAFEETVDLKLKLQTTVDVEEVAAEKMKRSPSHKNVAASATDPERPRAPKAQ  94

Query  439  VVGWPPVRNYRKNIMAQksspeeaageksggggpaaFVKVCMDGAPYLRKVDLKMYESYQ  618
            VVGWPPVR+YRKNI+A   S + +  E    G  AAFVKVCMDGAPYLRKVDLKMY SYQ
Sbjct  95   VVGWPPVRSYRKNILA-VQSEKASKEEGEKPGNTAAFVKVCMDGAPYLRKVDLKMYRSYQ  153

Query  619  QLSDALAKMFSSFTMGNYGAQG  684
            +LS AL KMFSSFT  N G+QG
Sbjct  154  ELSMALEKMFSSFTSANCGSQG  175



>gb|KDO48908.1| hypothetical protein CISIN_1g026005mg [Citrus sinensis]
Length=171

 Score =   137 bits (345),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 78/129 (60%), Positives = 92/129 (71%), Gaps = 4/129 (3%)
 Frame = +1

Query  298  KRGFSETV-DLKLNLQSAADSSLDLKEKMK--SPSKEPNKDPIKPPSKAQVVGWPPVRNY  468
            KRGF++TV DLKLNL +     +D+ EK K  S S     D  KPP+K+QVVGWPPVR++
Sbjct  42   KRGFADTVVDLKLNLSTKESGGIDVIEKTKGKSASATGATDLSKPPAKSQVVGWPPVRSF  101

Query  469  RKNIMA-QksspeeaageksggggpaaFVKVCMDGAPYLRKVDLKMYESYQQLSDALAKM  645
            RKNIMA QK + E      S      AFVKV MDGAPYLRKVDLK+Y+SYQ+LSDAL KM
Sbjct  102  RKNIMAVQKDNEEGDNKASSSSSSNVAFVKVSMDGAPYLRKVDLKLYKSYQELSDALGKM  161

Query  646  FSSFTMGNY  672
            FSSFT+G Y
Sbjct  162  FSSFTIGTY  170



>ref|XP_011026048.1| PREDICTED: auxin-induced protein AUX28-like [Populus euphratica]
Length=237

 Score =   139 bits (350),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 77/132 (58%), Positives = 92/132 (70%), Gaps = 4/132 (3%)
 Frame = +1

Query  298  KRGFSETVDLKLNLQSAADSSLDLKEKMKSPSKEPN---KDPIKPPSKAQVVGWPPVRNY  468
            KRGFSETVDLKL L S    +    EK +S  +E N    DP KPP+KAQVVGWPPVR++
Sbjct  34   KRGFSETVDLKLKLSSKERGAGPNHEKTRSLQREKNILATDPAKPPAKAQVVGWPPVRSF  93

Query  469  RKNIMAQksspeeaageksggggpaaFVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMF  648
            RKN++A           +   GG A FVKV MDGAPYLRKVDLKMY++YQ+LS AL +MF
Sbjct  94   RKNMLA-VQKSSTDQECEKVPGGNATFVKVSMDGAPYLRKVDLKMYKTYQELSGALEEMF  152

Query  649  SSFTMGNYGAQG  684
            SSFT+GN G+ G
Sbjct  153  SSFTIGNCGSHG  164



>emb|CDY63072.1| BnaCnng41350D [Brassica napus]
Length=398

 Score =   142 bits (359),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 96/168 (57%), Positives = 108/168 (64%), Gaps = 28/168 (17%)
 Frame = +1

Query  211  GLNLKATElclglpgggggNESESLKVTG-KRGFSETVDLKLNLQSAADS----------  357
            GLNL+ TELCLGLPGG   +      VTG KRGFSETVDLKLNL S  +S          
Sbjct  170  GLNLRETELCLGLPGGDTAS-----PVTGTKRGFSETVDLKLNLNSEPESKEGSKSHDVV  224

Query  358  SLDLKEKMKSPSKEPNKDPIKPPSKAQVVGWPPVRNYRKNIMAQksspeeaageksgggg  537
            S   KEK   P     KDP KP +KAQVVGWPPVR+YRKN+M        +A   +    
Sbjct  225  SAVFKEKSSCP-----KDPTKPLAKAQVVGWPPVRSYRKNVMGSCQKSSSSAETAA----  275

Query  538  paaFVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQ  681
               FVKV MDGAPYLRKVDLKMY+SY +LSDAL+ MFSSFTMGN G +
Sbjct  276  ---FVKVSMDGAPYLRKVDLKMYKSYDELSDALSNMFSSFTMGNNGGE  320



>ref|XP_009124981.1| PREDICTED: auxin-responsive protein IAA16-like [Brassica rapa]
 emb|CDY21111.1| BnaA01g33420D [Brassica napus]
Length=236

 Score =   139 bits (349),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 81/152 (53%), Positives = 102/152 (67%), Gaps = 30/152 (20%)
 Frame = +1

Query  286  KVTGKRGFSETVDLKLNLQSAADSSL------DLKEKMKSPSKEPNKDPIKPPSKAQVVG  447
            K  GKRGFSETVDLKLNL S A  S+      ++KEK+           +KPP+KAQVVG
Sbjct  25   KNNGKRGFSETVDLKLNLSSTAMGSVSEVDLVNMKEKV-----------VKPPAKAQVVG  73

Query  448  WPPVRNYRKNIMA-------------QksspeeaageksggggpaaFVKVCMDGAPYLRK  588
            WPPVR++RKN+M+             +K+S    A   +  G  AA+VKV MDGAPYLRK
Sbjct  74   WPPVRSFRKNVMSGPKPTTGDAVQATEKTSGSNGATSSASIGATAAYVKVSMDGAPYLRK  133

Query  589  VDLKMYESYQQLSDALAKMFSSFTMGNYGAQG  684
            +DLK+Y++YQ LSDAL+KMFSSFT+G+YG QG
Sbjct  134  IDLKLYKTYQDLSDALSKMFSSFTIGSYGPQG  165



>emb|CDY10068.1| BnaC08g43830D [Brassica napus]
Length=228

 Score =   138 bits (348),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 80/137 (58%), Positives = 95/137 (69%), Gaps = 13/137 (9%)
 Frame = +1

Query  289  VTG-KRGFSETVDLKLNLQSAADSSLDLK--EKMKSPSKEPN---KDPIKPPSKAQVVGW  450
            VTG KRGFSETVDLKLNL +  + +   K  + + S SKE +   KDP KPP+KAQVVGW
Sbjct  27   VTGTKRGFSETVDLKLNLNNEPEINEGSKPHDVVTSVSKEKSSSPKDPAKPPAKAQVVGW  86

Query  451  PPVRNYRKNIMAQksspeeaageksggggpaaFVKVCMDGAPYLRKVDLKMYESYQQLSD  630
            PPVR+YRKN+M     P       +       FVKV MDGAPYLRKVDLKMY+SY +LS+
Sbjct  87   PPVRSYRKNVMGSYQKPSGGTETAA-------FVKVSMDGAPYLRKVDLKMYKSYDELSN  139

Query  631  ALAKMFSSFTMGNYGAQ  681
            AL+ MFSSFTMG YG +
Sbjct  140  ALSNMFSSFTMGKYGGE  156



>ref|XP_010483317.1| PREDICTED: auxin-responsive protein IAA17-like [Camelina sativa]
Length=229

 Score =   138 bits (347),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 76/142 (54%), Positives = 92/142 (65%), Gaps = 23/142 (16%)
 Frame = +1

Query  289  VTG-KRGFSETVDLKLNLQSAADS----------SLDLKEKMKSPSKEPNKDPIKPPSKA  435
            VTG KRGFSETVDLKLNL +  ++          + D K+K   P     KDP KPP+KA
Sbjct  27   VTGNKRGFSETVDLKLNLNNEPENKEGSTTHGVVTFDSKDKSSCP-----KDPAKPPAKA  81

Query  436  QVVGWPPVRNYRKNIMAQksspeeaageksggggpaaFVKVCMDGAPYLRKVDLKMYESY  615
            QVVGWPPVR+YRKN+M             +       FVKV MDGAPYLRKVDL+MY+SY
Sbjct  82   QVVGWPPVRSYRKNVMVSCQKSSSGPEAAA-------FVKVSMDGAPYLRKVDLRMYKSY  134

Query  616  QQLSDALAKMFSSFTMGNYGAQ  681
             +LS+AL+ MFSSFT+G YG +
Sbjct  135  DELSNALSNMFSSFTLGKYGGE  156



>ref|XP_010475075.1| PREDICTED: auxin-responsive protein IAA17-like [Camelina sativa]
Length=230

 Score =   138 bits (347),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 78/142 (55%), Positives = 94/142 (66%), Gaps = 22/142 (15%)
 Frame = +1

Query  289  VTG-KRGFSETVDLKLNLQSAADS----------SLDLKEKMKSPSKEPNKDPIKPPSKA  435
            VTG KRGFSETVDLKLNL +  ++          + D K+K+ S  K    DP KPP+KA
Sbjct  27   VTGNKRGFSETVDLKLNLNNEPENKEGSTTHGVVTFDSKDKISSCPK----DPAKPPAKA  82

Query  436  QVVGWPPVRNYRKNIMAQksspeeaageksggggpaaFVKVCMDGAPYLRKVDLKMYESY  615
            QVVGWPPVR+YRKN+M     P       +       FVKV MDGAPYLRKVDL+MY+SY
Sbjct  83   QVVGWPPVRSYRKNVMVSCQKPSSGPEAAA-------FVKVSMDGAPYLRKVDLRMYKSY  135

Query  616  QQLSDALAKMFSSFTMGNYGAQ  681
             +LS+AL+ MFSSFTMG YG +
Sbjct  136  DELSNALSNMFSSFTMGKYGGE  157



>ref|XP_007205640.1| hypothetical protein PRUPE_ppa009254mg [Prunus persica]
 gb|EMJ06839.1| hypothetical protein PRUPE_ppa009254mg [Prunus persica]
Length=299

 Score =   139 bits (351),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 86/149 (58%), Positives = 101/149 (68%), Gaps = 12/149 (8%)
 Frame = +1

Query  271  ESESLKVTGKRGFSETVDLKLNLQSAADSS---------LDLK-EKMKSPSKEPNKDPIK  420
            + E+ K  GKRGFSETVDLKLN+ S  +++         L+LK EK  +       DP K
Sbjct  81   DGEAAKNNGKRGFSETVDLKLNISSQDETADEDDQDQQLLELKKEKNAAAPAPGANDPSK  140

Query  421  PP-SKAQVVGWPPVRNYRKNIMAQksspeeaageksggggpaaFVKVCMDGAPYLRKVDL  597
            PP SKAQVVGWPPVR++RKNI A         GEKS     AAFVKV MDGAPYLRKVDL
Sbjct  141  PPASKAQVVGWPPVRSFRKNI-ATVQKKSSDEGEKSNSNISAAFVKVSMDGAPYLRKVDL  199

Query  598  KMYESYQQLSDALAKMFSSFTMGNYGAQG  684
            K+Y+SYQ+LS AL KMFSSFT+GN G+ G
Sbjct  200  KLYKSYQELSTALGKMFSSFTIGNCGSDG  228



>ref|XP_006298436.1| hypothetical protein CARUB_v10014507mg [Capsella rubella]
 gb|EOA31334.1| hypothetical protein CARUB_v10014507mg [Capsella rubella]
Length=241

 Score =   138 bits (347),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 92/179 (51%), Positives = 114/179 (64%), Gaps = 32/179 (18%)
 Frame = +1

Query  214  LNLKATElclglpgggggNESESLKVTGKRGFSETVDLKLNLQSAADSSL------DLKE  375
            +N +ATEL LGLPGG  G +  ++K  GKRGFSETVDLKLNL S A  S+      D+KE
Sbjct  2    INFEATELRLGLPGGNHGGDMAAVKNNGKRGFSETVDLKLNLSSTAMDSVSGAQLEDIKE  61

Query  376  KMKSPSKEPNKDPIKPPSKAQVVGWPPVRNYRKNIMA----------------Qksspee  507
            K          D +KPP+K QVVGWPPVR++RKN+M+                  SS   
Sbjct  62   K----------DVVKPPAKTQVVGWPPVRSFRKNVMSGQKPITGDAVEGNDKTSGSSGAT  111

Query  508  aageksggggpaaFVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQG  684
            ++         AA+VKV MDGAPYLRK+DLK+Y++YQ LSDAL+KMFSSFT+GN G QG
Sbjct  112  SSASACAAAAAAAYVKVSMDGAPYLRKIDLKLYKTYQDLSDALSKMFSSFTIGNCGPQG  170



>ref|XP_010917602.1| PREDICTED: auxin-responsive protein IAA30 isoform X2 [Elaeis 
guineensis]
Length=238

 Score =   137 bits (346),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 80/140 (57%), Positives = 97/140 (69%), Gaps = 11/140 (8%)
 Frame = +1

Query  286  KVTGKRGFSETVDLKLNLQSAADSSLDLK-EKMKSPSKEPN-----KDPIKPPS-KAQVV  444
            + T KRGFSET+DLKL LQ+     ++ + EKMK  + + N      DP KPP+ KAQVV
Sbjct  30   EATKKRGFSETIDLKLKLQTVDSKDIEAEAEKMKRSASQKNLLACSNDPEKPPAPKAQVV  89

Query  445  GWPPVRNYRKNIMAQksspeeaageksggggpaaFVKVCMDGAPYLRKVDLKMYESYQQL  624
            GWPPVR++RKNIM+     +   G K  G   A FVKV MDGAPYLRK+DLKMY SYQ+L
Sbjct  90   GWPPVRSFRKNIMS----VQSDKGNKEEGEKSATFVKVSMDGAPYLRKIDLKMYRSYQEL  145

Query  625  SDALAKMFSSFTMGNYGAQG  684
            S AL KMFSSFT+GN  +QG
Sbjct  146  SVALEKMFSSFTIGNCSSQG  165



>ref|XP_006418149.1| hypothetical protein EUTSA_v10008679mg [Eutrema salsugineum]
 dbj|BAJ33922.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ36502.1| hypothetical protein EUTSA_v10008679mg [Eutrema salsugineum]
Length=226

 Score =   137 bits (345),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 82/143 (57%), Positives = 95/143 (66%), Gaps = 28/143 (20%)
 Frame = +1

Query  289  VTG-KRGFSETVDLKLNLQSA-----ADSSLDL------KEKMKSPSKEPNKDPIKPPSK  432
            VTG KRGFSETVDLKLNL +        ++ D+      KEK  SP     KDP KPP+K
Sbjct  27   VTGNKRGFSETVDLKLNLNNEPANKEGCTTHDVVTNSVSKEKSSSP-----KDPAKPPAK  81

Query  433  AQVVGWPPVRNYRKNIMAQksspeeaageksggggpaaFVKVCMDGAPYLRKVDLKMYES  612
            AQVVGWPPVR+YRKN++      E AA           FVKV MDGAPYLRKVDLKMY+S
Sbjct  82   AQVVGWPPVRSYRKNVLVSSQKSEAAA-----------FVKVSMDGAPYLRKVDLKMYKS  130

Query  613  YQQLSDALAKMFSSFTMGNYGAQ  681
            Y +LS+AL+ MFSSFTMG YG +
Sbjct  131  YDELSNALSNMFSSFTMGKYGGE  153



>dbj|BAJ34138.1| unnamed protein product [Thellungiella halophila]
Length=234

 Score =   137 bits (345),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 79/150 (53%), Positives = 96/150 (64%), Gaps = 28/150 (19%)
 Frame = +1

Query  286  KVTGKRGFSETVDLKLNLQSAADSSL------DLKEKMKSPSKEPNKDPIKPPSKAQVVG  447
            K  GKRGFSETVDLKLNL S A  S+      +LK K+           +KPP+K QVVG
Sbjct  25   KNNGKRGFSETVDLKLNLSSTALDSVSEVDIQNLKGKV-----------VKPPAKTQVVG  73

Query  448  WPPVRNYRKNIMAQksspeeaag-----------eksggggpaaFVKVCMDGAPYLRKVD  594
            WPPVR++RKN+M+ +    E A              S      A+VKV MDGAPYLRK+D
Sbjct  74   WPPVRSFRKNVMSGQKQTTEVAAEGTEKTCGSSGATSSANAAVAYVKVSMDGAPYLRKID  133

Query  595  LKMYESYQQLSDALAKMFSSFTMGNYGAQG  684
            LK+Y++YQ LSDAL+KMFSSFT+GNYG QG
Sbjct  134  LKLYKTYQDLSDALSKMFSSFTIGNYGPQG  163



>ref|XP_010917600.1| PREDICTED: auxin-responsive protein IAA30 isoform X1 [Elaeis 
guineensis]
Length=246

 Score =   137 bits (345),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 80/140 (57%), Positives = 97/140 (69%), Gaps = 11/140 (8%)
 Frame = +1

Query  286  KVTGKRGFSETVDLKLNLQSAADSSLDLK-EKMKSPSKEPN-----KDPIKPPS-KAQVV  444
            + T KRGFSET+DLKL LQ+     ++ + EKMK  + + N      DP KPP+ KAQVV
Sbjct  30   EATKKRGFSETIDLKLKLQTVDSKDIEAEAEKMKRSASQKNLLACSNDPEKPPAPKAQVV  89

Query  445  GWPPVRNYRKNIMAQksspeeaageksggggpaaFVKVCMDGAPYLRKVDLKMYESYQQL  624
            GWPPVR++RKNIM+     +   G K  G   A FVKV MDGAPYLRK+DLKMY SYQ+L
Sbjct  90   GWPPVRSFRKNIMS----VQSDKGNKEEGEKSATFVKVSMDGAPYLRKIDLKMYRSYQEL  145

Query  625  SDALAKMFSSFTMGNYGAQG  684
            S AL KMFSSFT+GN  +QG
Sbjct  146  SVALEKMFSSFTIGNCSSQG  165



>gb|AAM64837.1| putative auxin-induced protein, IAA17/AXR3-1 [Arabidopsis thaliana]
Length=228

 Score =   136 bits (343),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 76/142 (54%), Positives = 91/142 (64%), Gaps = 23/142 (16%)
 Frame = +1

Query  289  VTG-KRGFSETVDLKLNLQSAADS----------SLDLKEKMKSPSKEPNKDPIKPPSKA  435
            VTG KRGFSETVDLKLNL +   +          + D KEK   P     KDP KPP+KA
Sbjct  26   VTGNKRGFSETVDLKLNLNNEPANKEGSTTHDVVTFDSKEKSACP-----KDPAKPPAKA  80

Query  436  QVVGWPPVRNYRKNIMAQksspeeaageksggggpaaFVKVCMDGAPYLRKVDLKMYESY  615
            QVVGWPPVR+YRKN+M             +       FVKV MDGAPYLRK+DL+MY+SY
Sbjct  81   QVVGWPPVRSYRKNVMVSCQKSSGGPEAAA-------FVKVSMDGAPYLRKIDLRMYKSY  133

Query  616  QQLSDALAKMFSSFTMGNYGAQ  681
             +LS+AL+ MFSSFTMG +G +
Sbjct  134  DELSNALSNMFSSFTMGKHGGE  155



>ref|NP_171921.1| auxin-responsive protein IAA17 [Arabidopsis thaliana]
 sp|P93830.2|IAA17_ARATH RecName: Full=Auxin-responsive protein IAA17; AltName: Full=Auxin 
response 3; AltName: Full=Indoleacetic acid-induced protein 
17 [Arabidopsis thaliana]
 gb|AAG53997.1|AF336916_1 auxin-induced protein, IAA17/AXR3-1 [Arabidopsis thaliana]
 gb|AAB84354.1| IAA17 [Arabidopsis thaliana]
 gb|AAC39439.1| IAA17/AXR3 protein [Arabidopsis thaliana]
 gb|AAB70451.2| Identical to Arabidopsis gb|AF040632 and gb|U49073 IAA17/AXR3 
gene. ESTs gb|H36782 and gb|F14074 come from this gene [Arabidopsis 
thaliana]
 gb|AAL49831.1| auxin-induced protein IAA17/AXR3-1 [Arabidopsis thaliana]
 gb|AAM51258.1| auxin-induced protein IAA17/AXR3-1 [Arabidopsis thaliana]
 gb|AEE27674.1| auxin-responsive protein IAA17 [Arabidopsis thaliana]
 gb|AGZ13682.1| IAA17 [Cloning vector pAW8ENdeI-cHAIAA17]
 gb|AGZ59820.1| IAA17 [Cloning vector pAW8ENdeI-cHAIAA17-spo5DSR]
Length=229

 Score =   136 bits (343),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 76/142 (54%), Positives = 91/142 (64%), Gaps = 23/142 (16%)
 Frame = +1

Query  289  VTG-KRGFSETVDLKLNLQSAADS----------SLDLKEKMKSPSKEPNKDPIKPPSKA  435
            VTG KRGFSETVDLKLNL +   +          + D KEK   P     KDP KPP+KA
Sbjct  27   VTGNKRGFSETVDLKLNLNNEPANKEGSTTHDVVTFDSKEKSACP-----KDPAKPPAKA  81

Query  436  QVVGWPPVRNYRKNIMAQksspeeaageksggggpaaFVKVCMDGAPYLRKVDLKMYESY  615
            QVVGWPPVR+YRKN+M             +       FVKV MDGAPYLRK+DL+MY+SY
Sbjct  82   QVVGWPPVRSYRKNVMVSCQKSSGGPEAAA-------FVKVSMDGAPYLRKIDLRMYKSY  134

Query  616  QQLSDALAKMFSSFTMGNYGAQ  681
             +LS+AL+ MFSSFTMG +G +
Sbjct  135  DELSNALSNMFSSFTMGKHGGE  156



>emb|CDY30017.1| BnaC01g39910D [Brassica napus]
Length=237

 Score =   136 bits (343),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 81/152 (53%), Positives = 100/152 (66%), Gaps = 30/152 (20%)
 Frame = +1

Query  286  KVTGKRGFSETVDLKLNLQSAA---DSSLDL---KEKMKSPSKEPNKDPIKPPSKAQVVG  447
            K  GKRGFSETVDLKLNL S A    S LDL   KEK+           +KPP+KAQVVG
Sbjct  25   KNNGKRGFSETVDLKLNLSSTAMDSVSELDLVNMKEKV-----------VKPPAKAQVVG  73

Query  448  WPPVRNYRKNIMA-------------QksspeeaageksggggpaaFVKVCMDGAPYLRK  588
            WPPVR++RKN+M+             + +S    A   +  G  AA+VK+ MDGAPYLRK
Sbjct  74   WPPVRSFRKNVMSGPKPTTGDAFQATENTSSSNGATSSASIGATAAYVKISMDGAPYLRK  133

Query  589  VDLKMYESYQQLSDALAKMFSSFTMGNYGAQG  684
            +DLK+Y++YQ LSD L+KMFSSFT+G+YG QG
Sbjct  134  IDLKLYKAYQDLSDTLSKMFSSFTIGSYGPQG  165



>gb|KDO68557.1| hypothetical protein CISIN_1g026823mg [Citrus sinensis]
Length=232

 Score =   136 bits (342),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 80/135 (59%), Positives = 90/135 (67%), Gaps = 12/135 (9%)
 Frame = +1

Query  298  KRGFSETVDLKLNLQSAADSSLDLKEKMKSPSKEPN------KDPIKPPSKAQVVGWPPV  459
            KRGFSETVDLKLNL     SS D  EK+KS  KE N        P KPP+K QVVGWPPV
Sbjct  33   KRGFSETVDLKLNL-----SSKDTSEKVKSFQKEKNPLPRATDPPAKPPAKTQVVGWPPV  87

Query  460  RNYRKNIMAQksspeeaageksggggpaaFVKVCMDGAPYLRKVDLKMYESYQQLSDALA  639
            R++RKN++               GG  AAFVKV MDGAPYLRKVDL+MY +YQ L  AL 
Sbjct  88   RSFRKNMLG-VVQKSSGEESDMAGGNNAAFVKVSMDGAPYLRKVDLRMYNTYQDLYHALG  146

Query  640  KMFSSFTMGNYGAQG  684
            KMFSSFT+GN G+QG
Sbjct  147  KMFSSFTIGNCGSQG  161



>ref|NP_001266039.1| IAA7 protein [Solanum lycopersicum]
 gb|AEX00351.1| IAA7 [Solanum lycopersicum]
Length=218

 Score =   135 bits (341),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 75/132 (57%), Positives = 95/132 (72%), Gaps = 9/132 (7%)
 Frame = +1

Query  298  KRGFSETVDLKLNLQSAAD-SSLDLKEKMKSPSKEPNKDPIKPPSKAQVVGWPPVRNYRK  474
            KRGFS+TVDLKLNL    +  S+++     +P K+ + +  KPP+KAQVVGWPPVR++RK
Sbjct  22   KRGFSQTVDLKLNLHHNDNIPSMNIN----NPPKDNSSN--KPPTKAQVVGWPPVRSFRK  75

Query  475  NIMAQk--sspeeaageksggggpaaFVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMF  648
            N+++QK  ++               AFVKV MDGAPYLRKVDLKMY+SYQQLS +L  MF
Sbjct  76   NMLSQKGNNNNNNNEEISEKDEKTIAFVKVSMDGAPYLRKVDLKMYKSYQQLSHSLTNMF  135

Query  649  SSFTMGNYGAQG  684
            SSFTMGNYG+QG
Sbjct  136  SSFTMGNYGSQG  147



>emb|CDX89832.1| BnaA10g02500D [Brassica napus]
Length=224

 Score =   135 bits (340),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 76/133 (57%), Positives = 88/133 (66%), Gaps = 12/133 (9%)
 Frame = +1

Query  298  KRGFSETVDLKLNLQSAADSSLDLK--EKMKSPSKEPN---KDPIKPPSKAQVVGWPPVR  462
            KRGFSETVDLKLNL +  +S    K  + + S SKE N   KDP KPP+KAQVVGWPPVR
Sbjct  26   KRGFSETVDLKLNLNNEPESKEVSKTHDVVISVSKEKNTCPKDPTKPPAKAQVVGWPPVR  85

Query  463  NYRKNIMAQksspeeaageksggggpaaFVKVCMDGAPYLRKVDLKMYESYQQLSDALAK  642
            +YRKN+M                     FVKV MDGAPYLRKVDLKMY+SY +LS+AL+ 
Sbjct  86   SYRKNVMGSCQKSNGVTETAV-------FVKVSMDGAPYLRKVDLKMYKSYDELSNALSN  138

Query  643  MFSSFTMGNYGAQ  681
            MF SFTMG  G +
Sbjct  139  MFGSFTMGKNGGE  151



>ref|XP_002884465.1| indoleacetic acid-induced protein 16 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH60724.1| indoleacetic acid-induced protein 16 [Arabidopsis lyrata subsp. 
lyrata]
Length=236

 Score =   135 bits (341),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 77/152 (51%), Positives = 96/152 (63%), Gaps = 30/152 (20%)
 Frame = +1

Query  286  KVTGKRGFSETVDLKLNLQSAADSSL------DLKEKMKSPSKEPNKDPIKPPSKAQVVG  447
            K  GKRGFSETVDLKLNL S A  S+      ++KEK+           +KPP+KAQVVG
Sbjct  25   KYNGKRGFSETVDLKLNLSSTAMDSVSKVDLENMKEKV-----------VKPPAKAQVVG  73

Query  448  WPPVRNYRKNIMAQksspeeaage-------------ksggggpaaFVKVCMDGAPYLRK  588
            WPPVR++RKN+M+ +      A                +      A+VKV MDGAPYLRK
Sbjct  74   WPPVRSFRKNVMSGQKPTTGDATVGNDKTSGSSGATSSASVCAAVAYVKVSMDGAPYLRK  133

Query  589  VDLKMYESYQQLSDALAKMFSSFTMGNYGAQG  684
            +DLK+Y++YQ LSDAL+KMFSSFT+G YG QG
Sbjct  134  IDLKLYKTYQDLSDALSKMFSSFTIGTYGPQG  165



>ref|XP_009119323.1| PREDICTED: auxin-responsive protein IAA17-like [Brassica rapa]
Length=224

 Score =   135 bits (340),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 76/133 (57%), Positives = 88/133 (66%), Gaps = 12/133 (9%)
 Frame = +1

Query  298  KRGFSETVDLKLNLQSAADSSLDLK--EKMKSPSKEPN---KDPIKPPSKAQVVGWPPVR  462
            KRGFSETVDLKLNL +  +S    K  + + S SKE N   KDP KPP+KAQVVGWPPVR
Sbjct  26   KRGFSETVDLKLNLNNEPESKEVSKTHDVVISVSKEKNTCPKDPTKPPAKAQVVGWPPVR  85

Query  463  NYRKNIMAQksspeeaageksggggpaaFVKVCMDGAPYLRKVDLKMYESYQQLSDALAK  642
            +YRKN+M                     FVKV MDGAPYLRKVDLKMY+SY +LS+AL+ 
Sbjct  86   SYRKNVMGSCQKSNGVTETAV-------FVKVSMDGAPYLRKVDLKMYKSYDELSNALSN  138

Query  643  MFSSFTMGNYGAQ  681
            MF SFTMG  G +
Sbjct  139  MFGSFTMGKNGGE  151



>ref|XP_006443921.1| hypothetical protein CICLE_v10022032mg [Citrus clementina]
 ref|XP_006479598.1| PREDICTED: auxin-induced protein AUX28-like [Citrus sinensis]
 gb|ESR57161.1| hypothetical protein CICLE_v10022032mg [Citrus clementina]
Length=232

 Score =   135 bits (341),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 77/131 (59%), Positives = 91/131 (69%), Gaps = 4/131 (3%)
 Frame = +1

Query  298  KRGFSETVDLKLNLQSAADSSLDLK--EKMKSPSKEPNKDPIKPPSKAQVVGWPPVRNYR  471
            KRGFSETVDLKLNL S+ D+S  +K  +K K P       P KPP+K QVVGWPPVR++R
Sbjct  33   KRGFSETVDLKLNL-SSKDTSEKVKSFQKEKHPLPRATDPPAKPPAKTQVVGWPPVRSFR  91

Query  472  KNIMAQksspeeaageksggggpaaFVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFS  651
            KN++               GG  AAFVKV MDGAPYLRKVDL+MY +Y+ L DAL KMFS
Sbjct  92   KNMLG-VVQKSSGEESDMAGGNNAAFVKVSMDGAPYLRKVDLRMYNTYKDLYDALGKMFS  150

Query  652  SFTMGNYGAQG  684
            SFT+GN G+QG
Sbjct  151  SFTIGNCGSQG  161



>ref|NP_187124.1| auxin-responsive protein IAA16 [Arabidopsis thaliana]
 sp|O24407.1|IAA16_ARATH RecName: Full=Auxin-responsive protein IAA16; AltName: Full=Indoleacetic 
acid-induced protein 16 [Arabidopsis thaliana]
 gb|AAF04899.1|AC011437_14 auxin-induced protein [Arabidopsis thaliana]
 gb|AAG48764.1|AF332400_1 auxin-induced protein IAA16 [Arabidopsis thaliana]
 gb|AAK53004.1|AF375420_1 AT3g04730/F7O18_22 [Arabidopsis thaliana]
 gb|AAB84353.1| IAA16 [Arabidopsis thaliana]
 gb|AAM64751.1| auxin-induced protein [Arabidopsis thaliana]
 gb|AAN38694.1| At3g04730/F7O18_22 [Arabidopsis thaliana]
 dbj|BAF01307.1| auxin-induced protein [Arabidopsis thaliana]
 gb|AEE74127.1| auxin-responsive protein IAA16 [Arabidopsis thaliana]
Length=236

 Score =   135 bits (340),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 78/152 (51%), Positives = 98/152 (64%), Gaps = 30/152 (20%)
 Frame = +1

Query  286  KVTGKRGFSETVDLKLNLQSAADSSL------DLKEKMKSPSKEPNKDPIKPPSKAQVVG  447
            K  GKRGFSETVDLKLNL S A  S+      ++KEK+           +KPP+KAQVVG
Sbjct  25   KNNGKRGFSETVDLKLNLSSTAMDSVSKVDLENMKEKV-----------VKPPAKAQVVG  73

Query  448  WPPVRNYRKNIMAQksspeeaage-------------ksggggpaaFVKVCMDGAPYLRK  588
            WPPVR++RKN+M+ +      A E              +      A+VKV MDGAPYLRK
Sbjct  74   WPPVRSFRKNVMSGQKPTTGDATEGNDKTSGSSGATSSASACATVAYVKVSMDGAPYLRK  133

Query  589  VDLKMYESYQQLSDALAKMFSSFTMGNYGAQG  684
            +DLK+Y++YQ LS+AL+KMFSSFT+GNYG QG
Sbjct  134  IDLKLYKTYQDLSNALSKMFSSFTIGNYGPQG  165



>gb|KFK37887.1| hypothetical protein AALP_AA3G042100 [Arabis alpina]
Length=232

 Score =   135 bits (339),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 80/146 (55%), Positives = 98/146 (67%), Gaps = 22/146 (15%)
 Frame = +1

Query  286  KVTGKRGFSETVDLKLNLQSAADSSLDLKEKMKSPSKEPNKDPIKPPSKAQVVGWPPVRN  465
            K  GKRGFSETVDLKLNL S   S ++L E MK       +  +KPP+KAQVVGWPPVR+
Sbjct  25   KNNGKRGFSETVDLKLNLSSTV-SEVEL-ENMK-------EKVVKPPAKAQVVGWPPVRS  75

Query  466  YRKNIMAQksspeeaageks-------------ggggpaaFVKVCMDGAPYLRKVDLKMY  606
            +RKN+M+ +      A E +               G   A+VKV MDGAPYLRK+DLK+Y
Sbjct  76   FRKNVMSGQKPTTGDAVEGTDKTSGSSGATSSASAGTTVAYVKVSMDGAPYLRKIDLKLY  135

Query  607  ESYQQLSDALAKMFSSFTMGNYGAQG  684
            ++YQ LSDAL+KMFSSFT+GNYG QG
Sbjct  136  KTYQDLSDALSKMFSSFTIGNYGPQG  161



>emb|CDY41894.1| BnaC05g47100D [Brassica napus]
Length=231

 Score =   135 bits (339),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 76/149 (51%), Positives = 99/149 (66%), Gaps = 25/149 (17%)
 Frame = +1

Query  280  SLKVTGKRGFSETVDLKLNLQSAADSSL------DLKEKMKSPSKEPNKDPIKPPSKAQV  441
            ++K  GKRGFSETVDLKLNL S A  S+      ++KEK+           +KPP+KAQV
Sbjct  23   AMKNNGKRGFSETVDLKLNLSSTAMDSVSGVDLENMKEKV-----------VKPPAKAQV  71

Query  442  VGWPPVRNYRKNIMAQksspeeaageksggggpaa--------FVKVCMDGAPYLRKVDL  597
            VGWPPVR++RKN+M+ +      A E +     +         +VKV +DGAPYLRK+DL
Sbjct  72   VGWPPVRSFRKNVMSGQKPTAGDAAEGTEKTSSSNAATSSAAAYVKVSLDGAPYLRKIDL  131

Query  598  KMYESYQQLSDALAKMFSSFTMGNYGAQG  684
            K+Y++YQ LSDAL+KMFSSFT+GN G QG
Sbjct  132  KLYKTYQDLSDALSKMFSSFTIGNCGPQG  160



>gb|ADL70687.1| indole-3-acetic acid inducible 17 [Arabidopsis thaliana]
 gb|ADL70690.1| indole-3-acetic acid inducible 17 [Arabidopsis thaliana]
Length=132

 Score =   132 bits (331),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 74/136 (54%), Positives = 87/136 (64%), Gaps = 23/136 (17%)
 Frame = +1

Query  289  VTG-KRGFSETVDLKLNLQSAADS----------SLDLKEKMKSPSKEPNKDPIKPPSKA  435
            VTG KRGFSETVDLKLNL +   +          + D KEK   P     KDP KPP+KA
Sbjct  9    VTGNKRGFSETVDLKLNLNNEPANKEGSTTHDVVTFDSKEKSACP-----KDPAKPPAKA  63

Query  436  QVVGWPPVRNYRKNIMAQksspeeaageksggggpaaFVKVCMDGAPYLRKVDLKMYESY  615
            QVVGWPPVR+YRKN+M             +       FVKV MDGAPYLRK+DL+MY+SY
Sbjct  64   QVVGWPPVRSYRKNVMVSCQKSSGGPEAAA-------FVKVSMDGAPYLRKIDLRMYKSY  116

Query  616  QQLSDALAKMFSSFTM  663
             +LS+AL+ MFSSFTM
Sbjct  117  DELSNALSNMFSSFTM  132



>ref|XP_010923479.1| PREDICTED: auxin-responsive protein IAA30-like isoform X2 [Elaeis 
guineensis]
Length=232

 Score =   134 bits (338),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 79/142 (56%), Positives = 94/142 (66%), Gaps = 10/142 (7%)
 Frame = +1

Query  286  KVTGKRGFSETVDLKLNLQSAADS---SLDLKEKMKSPSKEPN-----KDPIKPPS-KAQ  438
            K +GKRGFSET+DLKL L +  DS    +++ +KMK    + N      DP KP + KAQ
Sbjct  37   KNSGKRGFSETIDLKLKLHTVVDSKEVEMEVWDKMKRLPSQKNLLPCTNDPEKPSAPKAQ  96

Query  439  VVGWPPVRNYRKNIMAQksspeeaageksggggpaaFVKVCMDGAPYLRKVDLKMYESYQ  618
            VVGWPPVR++RKNI+A  S        +      A  VKV MDGAPYLRKVDLKMY SYQ
Sbjct  97   VVGWPPVRSFRKNILATHSDKGSKVEGEKSSNSVA-LVKVSMDGAPYLRKVDLKMYRSYQ  155

Query  619  QLSDALAKMFSSFTMGNYGAQG  684
            +LS AL KMFSSFT GN G+QG
Sbjct  156  ELSMALEKMFSSFTSGNCGSQG  177



>gb|ADL70685.1| indole-3-acetic acid inducible 17 [Arabidopsis thaliana]
 gb|ADL70695.1| indole-3-acetic acid inducible 17 [Arabidopsis thaliana]
Length=149

 Score =   132 bits (332),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 74/136 (54%), Positives = 87/136 (64%), Gaps = 23/136 (17%)
 Frame = +1

Query  289  VTG-KRGFSETVDLKLNLQSAADS----------SLDLKEKMKSPSKEPNKDPIKPPSKA  435
            VTG KRGFSETVDLKLNL +   +          + D KEK   P     KDP KPP+KA
Sbjct  26   VTGNKRGFSETVDLKLNLNNEPANKEGSTTHDVVTFDSKEKSACP-----KDPAKPPAKA  80

Query  436  QVVGWPPVRNYRKNIMAQksspeeaageksggggpaaFVKVCMDGAPYLRKVDLKMYESY  615
            QVVGWPPVR+YRKN+M             +       FVKV MDGAPYLRK+DL+MY+SY
Sbjct  81   QVVGWPPVRSYRKNVMVSCQKSSGGPEAAA-------FVKVSMDGAPYLRKIDLRMYKSY  133

Query  616  QQLSDALAKMFSSFTM  663
             +LS+AL+ MFSSFTM
Sbjct  134  DELSNALSNMFSSFTM  149



>gb|ADL70689.1| indole-3-acetic acid inducible 17 [Arabidopsis thaliana]
Length=138

 Score =   132 bits (331),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 74/136 (54%), Positives = 87/136 (64%), Gaps = 23/136 (17%)
 Frame = +1

Query  289  VTG-KRGFSETVDLKLNLQSAADS----------SLDLKEKMKSPSKEPNKDPIKPPSKA  435
            VTG KRGFSETVDLKLNL +   +          + D KEK   P     KDP KPP+KA
Sbjct  15   VTGNKRGFSETVDLKLNLNNEPANKEGSTTHDVVTFDSKEKSACP-----KDPAKPPAKA  69

Query  436  QVVGWPPVRNYRKNIMAQksspeeaageksggggpaaFVKVCMDGAPYLRKVDLKMYESY  615
            QVVGWPPVR+YRKN+M             +       FVKV MDGAPYLRK+DL+MY+SY
Sbjct  70   QVVGWPPVRSYRKNVMVSCQKSSGGPEAAA-------FVKVSMDGAPYLRKIDLRMYKSY  122

Query  616  QQLSDALAKMFSSFTM  663
             +LS+AL+ MFSSFTM
Sbjct  123  DELSNALSNMFSSFTM  138



>gb|ADL70684.1| indole-3-acetic acid inducible 17 [Arabidopsis thaliana]
 gb|ADL70688.1| indole-3-acetic acid inducible 17 [Arabidopsis thaliana]
 gb|ADL70692.1| indole-3-acetic acid inducible 17 [Arabidopsis thaliana]
Length=144

 Score =   132 bits (331),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 74/136 (54%), Positives = 87/136 (64%), Gaps = 23/136 (17%)
 Frame = +1

Query  289  VTG-KRGFSETVDLKLNLQSAADS----------SLDLKEKMKSPSKEPNKDPIKPPSKA  435
            VTG KRGFSETVDLKLNL +   +          + D KEK   P     KDP KPP+KA
Sbjct  21   VTGNKRGFSETVDLKLNLNNEPANKEGSTTHDVVTFDSKEKSACP-----KDPAKPPAKA  75

Query  436  QVVGWPPVRNYRKNIMAQksspeeaageksggggpaaFVKVCMDGAPYLRKVDLKMYESY  615
            QVVGWPPVR+YRKN+M             +       FVKV MDGAPYLRK+DL+MY+SY
Sbjct  76   QVVGWPPVRSYRKNVMVSCQKSSGGPEAAA-------FVKVSMDGAPYLRKIDLRMYKSY  128

Query  616  QQLSDALAKMFSSFTM  663
             +LS+AL+ MFSSFTM
Sbjct  129  DELSNALSNMFSSFTM  144



>ref|XP_004302055.1| PREDICTED: auxin-responsive protein IAA16-like [Fragaria vesca 
subsp. vesca]
Length=254

 Score =   135 bits (339),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 79/142 (56%), Positives = 98/142 (69%), Gaps = 17/142 (12%)
 Frame = +1

Query  292  TGKRGFSETVDLKLNL--------QSAADSSLDLKEKMKSPSKEPNKDPIKPPSKAQVVG  447
            +GKRGFSETVDLKLN         +S  D  +++K K K  S  P      P +KAQVVG
Sbjct  48   SGKRGFSETVDLKLNFSSENDDVSRSGRDGQVEIK-KEKDASAAP-----APRAKAQVVG  101

Query  448  WPPVRNYRKNIMA---QksspeeaageksggggpaaFVKVCMDGAPYLRKVDLKMYESYQ  618
            WPPVR++RKNI+A   + +  ++AA +       AAFVKV MDGAPYLRKVDLK+Y+SYQ
Sbjct  102  WPPVRSFRKNIVAVQKKSTDQDQAAEKSGSTSTSAAFVKVSMDGAPYLRKVDLKLYQSYQ  161

Query  619  QLSDALAKMFSSFTMGNYGAQG  684
            +LS AL KMFSSFT+GN G+QG
Sbjct  162  ELSTALGKMFSSFTIGNCGSQG  183



>ref|XP_010418365.1| PREDICTED: auxin-responsive protein IAA16 [Camelina sativa]
Length=232

 Score =   134 bits (338),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 94/170 (55%), Positives = 114/170 (67%), Gaps = 23/170 (14%)
 Frame = +1

Query  214  LNLKATElclglpgggggNESESLKVTGKRGFSETVDLKLNLQSAADSSLDLKEKMKSPS  393
            +N +ATEL LGLPGG  G E  S+K  GKRGFSETVDLKLNL S   S  DL E MK   
Sbjct  2    INFEATELRLGLPGGSHGGEM-SVKNNGKRGFSETVDLKLNLSSTV-SEADL-ENMK---  55

Query  394  KEPNKDPIKPPSKAQVVGWPPVRNYRKNIMA-------------Qksspeeaageksggg  534
                +  +KPP+K QVVGWPPVR++RKN+M+              K+S    A   +   
Sbjct  56   ----EKVVKPPAKTQVVGWPPVRSFRKNVMSGQKPITGDAVEGNDKTSGSSGATSSASAC  111

Query  535  gpaaFVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQG  684
              AA+VKV MDGAPYLRK+DLK+Y++YQ LS+AL+KMFSSFT+GNYG QG
Sbjct  112  AAAAYVKVSMDGAPYLRKIDLKLYKTYQDLSNALSKMFSSFTIGNYGPQG  161



>gb|ADB93635.1| indole-3-acetic acid inducible 17 [Arabidopsis thaliana]
 gb|ADB93636.1| indole-3-acetic acid inducible 17 [Arabidopsis thaliana]
 gb|ADB93637.1| indole-3-acetic acid inducible 17 [Arabidopsis thaliana]
 gb|ADB93638.1| indole-3-acetic acid inducible 17 [Arabidopsis thaliana]
 gb|ADB93639.1| indole-3-acetic acid inducible 17 [Arabidopsis thaliana]
 gb|ADL70683.1| indole-3-acetic acid inducible 17 [Arabidopsis thaliana]
 gb|ADL70686.1| indole-3-acetic acid inducible 17 [Arabidopsis thaliana]
 gb|ADL70691.1| indole-3-acetic acid inducible 17 [Arabidopsis thaliana]
 gb|ADL70693.1| indole-3-acetic acid inducible 17 [Arabidopsis thaliana]
 gb|ADL70694.1| indole-3-acetic acid inducible 17 [Arabidopsis thaliana]
Length=150

 Score =   132 bits (331),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 74/136 (54%), Positives = 87/136 (64%), Gaps = 23/136 (17%)
 Frame = +1

Query  289  VTG-KRGFSETVDLKLNLQSAADS----------SLDLKEKMKSPSKEPNKDPIKPPSKA  435
            VTG KRGFSETVDLKLNL +   +          + D KEK   P     KDP KPP+KA
Sbjct  27   VTGNKRGFSETVDLKLNLNNEPANKEGSTTHDVVTFDSKEKSACP-----KDPAKPPAKA  81

Query  436  QVVGWPPVRNYRKNIMAQksspeeaageksggggpaaFVKVCMDGAPYLRKVDLKMYESY  615
            QVVGWPPVR+YRKN+M             +       FVKV MDGAPYLRK+DL+MY+SY
Sbjct  82   QVVGWPPVRSYRKNVMVSCQKSSGGPEAAA-------FVKVSMDGAPYLRKIDLRMYKSY  134

Query  616  QQLSDALAKMFSSFTM  663
             +LS+AL+ MFSSFTM
Sbjct  135  DELSNALSNMFSSFTM  150



>ref|XP_010463960.1| PREDICTED: auxin-responsive protein IAA16-like [Camelina sativa]
Length=232

 Score =   134 bits (338),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 94/170 (55%), Positives = 114/170 (67%), Gaps = 23/170 (14%)
 Frame = +1

Query  214  LNLKATElclglpgggggNESESLKVTGKRGFSETVDLKLNLQSAADSSLDLKEKMKSPS  393
            +N +ATEL LGLPGG  G E  S+K  GKRGFSETVDLKLNL S   S  DL E MK   
Sbjct  2    INFEATELRLGLPGGSHGGEM-SVKNNGKRGFSETVDLKLNLSSTV-SEADL-ENMK---  55

Query  394  KEPNKDPIKPPSKAQVVGWPPVRNYRKNIMA-------------Qksspeeaageksggg  534
                +  +KPP+K QVVGWPPVR++RKN+M+              K+S    A   +   
Sbjct  56   ----EKVVKPPAKTQVVGWPPVRSFRKNVMSGQKPITGDTVEGNDKTSGSSGATSSASAC  111

Query  535  gpaaFVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQG  684
              AA+VKV MDGAPYLRK+DLK+Y++YQ LS+AL+KMFSSFT+GNYG QG
Sbjct  112  AAAAYVKVSMDGAPYLRKIDLKLYKTYQDLSNALSKMFSSFTIGNYGPQG  161



>ref|XP_010485858.1| PREDICTED: auxin-responsive protein IAA16-like [Camelina sativa]
Length=232

 Score =   134 bits (337),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 93/170 (55%), Positives = 113/170 (66%), Gaps = 23/170 (14%)
 Frame = +1

Query  214  LNLKATElclglpgggggNESESLKVTGKRGFSETVDLKLNLQSAADSSLDLKEKMKSPS  393
            +N +ATEL LGLPGG  G E  S+K  GKRGFSETVDLKLNL S   S  DL E MK   
Sbjct  2    INFEATELRLGLPGGSHGGEM-SVKNNGKRGFSETVDLKLNLSSTV-SEADL-ENMK---  55

Query  394  KEPNKDPIKPPSKAQVVGWPPVRNYRKNIMA-------------Qksspeeaageksggg  534
                +  +KPP+K QVVGWPPVR++RKN+M+              K+     A   +   
Sbjct  56   ----EKVVKPPAKTQVVGWPPVRSFRKNVMSGQKPITGDAVEGNDKTPGSSGATSSASAC  111

Query  535  gpaaFVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQG  684
              AA+VKV MDGAPYLRK+DLK+Y++YQ LS+AL+KMFSSFT+GNYG QG
Sbjct  112  AAAAYVKVSMDGAPYLRKIDLKLYKTYQDLSNALSKMFSSFTIGNYGPQG  161



>ref|XP_009418923.1| PREDICTED: auxin-responsive protein IAA30-like [Musa acuminata 
subsp. malaccensis]
Length=243

 Score =   134 bits (338),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 96/167 (57%), Positives = 115/167 (69%), Gaps = 8/167 (5%)
 Frame = +1

Query  208  GGLNLKATElclglpgggggNESESLKVTGKRGFSETVDLKLNLQSAADSSLDLKEKMKS  387
            G L L+ TEL LGLPGGGGG E+E+ K + KRGF+ET+DLKL LQ+  D+   + EK + 
Sbjct  4    GSLGLEETELRLGLPGGGGGGEAEAAKNSCKRGFAETIDLKLKLQTPVDAEEQIIEKARG  63

Query  388  --PSKE-----PNKDPIKPPS-KAQVVGWPPVRNYRKNIMAQksspeeaageksggggpa  543
              PS+         DP KPP+ KAQVVGWPPVR++RKNI++  S      G +  G   A
Sbjct  64   SLPSQRNLGVFCGSDPEKPPAPKAQVVGWPPVRSFRKNILSAHSEKGSKEGGEKPGNPVA  123

Query  544  aFVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQG  684
            AFVKV MDGAPYLRKVDLKMY SYQ+LS  L KMF SFT GN G+QG
Sbjct  124  AFVKVSMDGAPYLRKVDLKMYRSYQELSMGLQKMFGSFTSGNCGSQG  170



>emb|CDY18214.1| BnaC05g02370D [Brassica napus]
Length=224

 Score =   134 bits (336),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 75/133 (56%), Positives = 89/133 (67%), Gaps = 12/133 (9%)
 Frame = +1

Query  298  KRGFSETVDLKLNLQSAADSSLDLK--EKMKSPSKEPNK---DPIKPPSKAQVVGWPPVR  462
            KRGFSETVDLKLNL +  +S    K  + + S SK+ NK   DP KPP+KAQVVGWPPVR
Sbjct  26   KRGFSETVDLKLNLNNEPESKEVSKTHDVVISVSKQKNKCPKDPTKPPAKAQVVGWPPVR  85

Query  463  NYRKNIMAQksspeeaageksggggpaaFVKVCMDGAPYLRKVDLKMYESYQQLSDALAK  642
            +YRKN+M       +             FVKV MDGAPYLRKVDLKMY+SY +LS+AL+ 
Sbjct  86   SYRKNVMGSCQKSNDVTETAV-------FVKVSMDGAPYLRKVDLKMYKSYDELSNALSN  138

Query  643  MFSSFTMGNYGAQ  681
            MF SFTMG  G +
Sbjct  139  MFGSFTMGKNGGE  151



>ref|XP_010923478.1| PREDICTED: auxin-responsive protein IAA30-like isoform X1 [Elaeis 
guineensis]
Length=250

 Score =   134 bits (338),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 80/142 (56%), Positives = 96/142 (68%), Gaps = 10/142 (7%)
 Frame = +1

Query  286  KVTGKRGFSETVDLKLNLQSAADS---SLDLKEKMKSPSKEPN-----KDPIKPPS-KAQ  438
            K +GKRGFSET+DLKL L +  DS    +++ +KMK    + N      DP KP + KAQ
Sbjct  37   KNSGKRGFSETIDLKLKLHTVVDSKEVEMEVWDKMKRLPSQKNLLPCTNDPEKPSAPKAQ  96

Query  439  VVGWPPVRNYRKNIMAQksspeeaageksggggpaaFVKVCMDGAPYLRKVDLKMYESYQ  618
            VVGWPPVR++RKNI+A   S + +  E        A VKV MDGAPYLRKVDLKMY SYQ
Sbjct  97   VVGWPPVRSFRKNILA-THSDKGSKVEGEKSSNSVALVKVSMDGAPYLRKVDLKMYRSYQ  155

Query  619  QLSDALAKMFSSFTMGNYGAQG  684
            +LS AL KMFSSFT GN G+QG
Sbjct  156  ELSMALEKMFSSFTSGNCGSQG  177



>gb|ACL81167.1| auxin-responsive protein IAA1, partial [Mirabilis jalapa]
Length=263

 Score =   134 bits (338),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 80/157 (51%), Positives = 92/157 (59%), Gaps = 28/157 (18%)
 Frame = +1

Query  298  KRGFSET-VDLKLNLQS----------AADSSL-----------------DLKEKMKSPS  393
            KRGFSET VDLKLNL +           A S L                 D+ +  K   
Sbjct  36   KRGFSETLVDLKLNLNNKSSPPSDLDQTATSDLIMMKNDMNKSGGGVIAKDVNDNTKVNG  95

Query  394  KEPNKDPIKPPSKAQVVGWPPVRNYRKNIMAQksspeeaageksggggpaaFVKVCMDGA  573
               N D  KPP+KAQVVGWPPVR+YRKN++A + S      E          VKV MDGA
Sbjct  96   ANNNADLAKPPAKAQVVGWPPVRSYRKNMLAVQKSTGAPESESEKPAANGGLVKVSMDGA  155

Query  574  PYLRKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQG  684
            PYLRKVDLK+Y+SYQ LSDAL KMFSSFT+GNYG+QG
Sbjct  156  PYLRKVDLKLYKSYQDLSDALGKMFSSFTLGNYGSQG  192



>ref|XP_007147174.1| hypothetical protein PHAVU_006G102100g [Phaseolus vulgaris]
 gb|ESW19168.1| hypothetical protein PHAVU_006G102100g [Phaseolus vulgaris]
Length=272

 Score =   134 bits (337),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 81/161 (50%), Positives = 98/161 (61%), Gaps = 24/161 (15%)
 Frame = +1

Query  274  SESLKVTGKRGFSET----VDLKLNLQS-------------AADSSLDLKEKMKSPSKEP  402
            + S   TGKRGFS+T    VDLKLNL S             A D++        +PS  P
Sbjct  41   TSSASFTGKRGFSDTTTASVDLKLNLSSTSNNVSATPSSDMAKDNTASAAANTTTPSSPP  100

Query  403  NKDPIKPPSKAQVVGWPPVRNYRKNIMAQksspeea-------ageksggggpaaFVKVC  561
             KDP KPP+KAQVVGWPPVR++RKNI+                   ++ G   AAFVKV 
Sbjct  101  VKDPAKPPAKAQVVGWPPVRSFRKNIVNNNVQKSNNKEEVQGGTSGRNHGNTGAAFVKVS  160

Query  562  MDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQG  684
            MDGAPYLRKVDLK+Y+SYQ+LSD+LAKMFSSFT+    +QG
Sbjct  161  MDGAPYLRKVDLKVYKSYQELSDSLAKMFSSFTIDKCESQG  201



>ref|XP_006575865.1| PREDICTED: auxin-induced protein AUX28-like [Glycine max]
Length=170

 Score =   131 bits (329),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 78/137 (57%), Positives = 91/137 (66%), Gaps = 15/137 (11%)
 Frame = +1

Query  298  KRGFSET-------VDLKLNL---QSAADSSLDLKEKMKSPSKEPN---KDPIKPPSKAQ  438
            KRGFSET       VDL LNL   ++AA    D +EK K+  KE      DP KPP+KAQ
Sbjct  36   KRGFSETETDETATVDLMLNLSPKEAAAADGADPREKPKTSPKEKTLLLPDPAKPPAKAQ  95

Query  439  VVGWPPVRNYRKNIMAQksspeeaageksggggpaaFVKVCMDGAPYLRKVDLKMYESYQ  618
            VVGWPPVR++RKN+ A  +       E       A+FVKV MDGAPYLRKVDLKMY+SY 
Sbjct  96   VVGWPPVRSFRKNMFA--AQKSSGGEESEKSSPNASFVKVSMDGAPYLRKVDLKMYKSYP  153

Query  619  QLSDALAKMFSSFTMGN  669
            +LSDAL KMFSSFT+GN
Sbjct  154  ELSDALGKMFSSFTIGN  170



>ref|XP_009413916.1| PREDICTED: auxin-responsive protein IAA30-like [Musa acuminata 
subsp. malaccensis]
Length=244

 Score =   133 bits (335),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 81/152 (53%), Positives = 102/152 (67%), Gaps = 19/152 (13%)
 Frame = +1

Query  271  ESESLKVTGKRGFSETVDLKLNLQSAADSSLDLKEKMKSPSKEPNK-------------D  411
            ++E++K +GKRGF+ETVDLKL LQ+     +D+KE +   + E  K             D
Sbjct  25   DAEAVKNSGKRGFAETVDLKLQLQTP----VDVKEAVAEAASEKVKRSVSQKSLVSCGSD  80

Query  412  PIKPPS-KAQVVGWPPVRNYRKNIMAQksspeeaageksggggpaaFVKVCMDGAPYLRK  588
            P KP + KAQVVGWPPVR++RKNI++  +S + +  E       AAFVKV MDGAPYLRK
Sbjct  81   PEKPSAPKAQVVGWPPVRSFRKNILS-VNSEKGSKEEGEKSSISAAFVKVSMDGAPYLRK  139

Query  589  VDLKMYESYQQLSDALAKMFSSFTMGNYGAQG  684
            VDLKMY SYQ+L  AL KMF SFT GNYG+QG
Sbjct  140  VDLKMYRSYQELFMALQKMFISFTGGNYGSQG  171



>gb|EYU30526.1| hypothetical protein MIMGU_mgv1a012831mg [Erythranthe guttata]
Length=239

 Score =   133 bits (334),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 77/135 (57%), Positives = 97/135 (72%), Gaps = 6/135 (4%)
 Frame = +1

Query  298  KRGFSETVDLKLNLQSAADS---SLDLKEKMKSPSKEPNKDPIKPPSKAQVVGWPPVRNY  468
            KR FSE++DLKL L + + S   + ++ E +   + +  ++  KPPSK QVVGWPPVR++
Sbjct  34   KRVFSESIDLKLELNTLSSSGNNNNNIDENIHQKNLKAEENNAKPPSKTQVVGWPPVRSF  93

Query  469  RKNIMA---QksspeeaageksggggpaaFVKVCMDGAPYLRKVDLKMYESYQQLSDALA  639
            RKNI+A     SS      +KS GG  AAFVKV +DGAPYLRKVDLKMY SYQQLSDAL 
Sbjct  94   RKNILAVQKNSSSGATTEADKSSGGAAAAFVKVSLDGAPYLRKVDLKMYTSYQQLSDALG  153

Query  640  KMFSSFTMGNYGAQG  684
            KMFSSFT+GN G++G
Sbjct  154  KMFSSFTIGNCGSEG  168



>ref|NP_001237212.1| uncharacterized protein LOC100499872 [Glycine max]
 gb|ACU13989.1| unknown [Glycine max]
Length=228

 Score =   132 bits (333),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 78/143 (55%), Positives = 93/143 (65%), Gaps = 18/143 (13%)
 Frame = +1

Query  295  GKRGFSET--VDLKLNLQSAADSSLDL-----------KEKMKSPSKEPNKDPIKPPSKA  435
             KRGFSET  VDLKLNL S  + S              + K  +    P  DP KPP+KA
Sbjct  25   AKRGFSETASVDLKLNLSSCINDSASDSPSSVSTEKPKENKTTTAEPPPANDPAKPPAKA  84

Query  436  QVVGWPPVRNYRKNIMAQksspeeaageksggggpaaFVKVCMDGAPYLRKVDLKMYESY  615
            QVVGWPPVR++RKNI+ + S+ EEA            FVKV MDGAPYLRKVD+K+Y+SY
Sbjct  85   QVVGWPPVRSFRKNIVQRNSNEEEAEKSTKNA-----FVKVSMDGAPYLRKVDIKLYKSY  139

Query  616  QQLSDALAKMFSSFTMGNYGAQG  684
            Q+LSDALAKMFSSFT+   G+QG
Sbjct  140  QELSDALAKMFSSFTIEKCGSQG  162



>gb|AAC49055.1| IAA14, partial [Arabidopsis thaliana]
Length=164

 Score =   130 bits (328),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 72/93 (77%), Positives = 77/93 (83%), Gaps = 1/93 (1%)
 Frame = +1

Query  406  KDPIKPPSKAQVVGWPPVRNYRKNIMAQksspeeaageksggggpaaFVKVCMDGAPYLR  585
            KDP KPP+KAQVVGWPPVRNYRKN+MA + S E      SGGG  A FVKV MDGAPYLR
Sbjct  2    KDPSKPPAKAQVVGWPPVRNYRKNVMANQKSGEAEEAMSSGGGTVA-FVKVSMDGAPYLR  60

Query  586  KVDLKMYESYQQLSDALAKMFSSFTMGNYGAQG  684
            KVDLKMY SY+ LSDALAKMFSSFTMG+YGAQG
Sbjct  61   KVDLKMYTSYKDLSDALAKMFSSFTMGSYGAQG  93



>gb|AAC39440.1| IAA17/AXR3-1 protein [Arabidopsis thaliana]
Length=229

 Score =   132 bits (333),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 75/142 (53%), Positives = 90/142 (63%), Gaps = 23/142 (16%)
 Frame = +1

Query  289  VTG-KRGFSETVDLKLNLQSAADS----------SLDLKEKMKSPSKEPNKDPIKPPSKA  435
            VTG KRGFSETVDLKLNL +   +          + D KEK   P     KDP KPP+KA
Sbjct  27   VTGNKRGFSETVDLKLNLNNEPANKEGSTTHDVVTFDSKEKSACP-----KDPAKPPAKA  81

Query  436  QVVGWPPVRNYRKNIMAQksspeeaageksggggpaaFVKVCMDGAPYLRKVDLKMYESY  615
            QVVGWP VR+YRKN+M             +       FVKV MDGAPYLRK+DL+MY+SY
Sbjct  82   QVVGWPLVRSYRKNVMVSCQKSSGGPEAAA-------FVKVSMDGAPYLRKIDLRMYKSY  134

Query  616  QQLSDALAKMFSSFTMGNYGAQ  681
             +LS+AL+ MFSSFTMG +G +
Sbjct  135  DELSNALSNMFSSFTMGKHGGE  156



>gb|KHN18836.1| Auxin-induced protein AUX28 [Glycine soja]
Length=246

 Score =   133 bits (334),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 80/142 (56%), Positives = 94/142 (66%), Gaps = 15/142 (11%)
 Frame = +1

Query  298  KRGFSET-------VDLKLNL---QSAADSSLDLKEKMKSPSKEPN---KDPIKPPSKAQ  438
            KRGFSET       VDL LNL   ++AA    D +EK K+  KE      DP KPP+KAQ
Sbjct  36   KRGFSETETDETATVDLMLNLSPKEAAAADGADPREKPKTSPKEKTLLLPDPAKPPAKAQ  95

Query  439  VVGWPPVRNYRKNIMAQksspeeaageksggggpaaFVKVCMDGAPYLRKVDLKMYESYQ  618
            VVGWPPVR++RKN+ A  +       E       A+FVKV MDGAPYLRKVDLKMY+SY 
Sbjct  96   VVGWPPVRSFRKNMFA--AQKSSGGEESEKSSPNASFVKVSMDGAPYLRKVDLKMYKSYP  153

Query  619  QLSDALAKMFSSFTMGNYGAQG  684
            +LSDAL KMFSSFT+GN  +QG
Sbjct  154  ELSDALGKMFSSFTIGNCESQG  175



>ref|XP_006605305.1| PREDICTED: uncharacterized protein LOC100499872 isoform X1 [Glycine 
max]
 gb|KHN04928.1| Auxin-induced protein AUX28 [Glycine soja]
Length=227

 Score =   132 bits (333),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 78/143 (55%), Positives = 93/143 (65%), Gaps = 18/143 (13%)
 Frame = +1

Query  295  GKRGFSET--VDLKLNLQSAADSSLDL-----------KEKMKSPSKEPNKDPIKPPSKA  435
             KRGFSET  VDLKLNL S  + S              + K  +    P  DP KPP+KA
Sbjct  25   AKRGFSETASVDLKLNLSSCINDSASDSPSSVSTEKPKENKTTTAEPPPANDPAKPPAKA  84

Query  436  QVVGWPPVRNYRKNIMAQksspeeaageksggggpaaFVKVCMDGAPYLRKVDLKMYESY  615
            QVVGWPPVR++RKNI+ + S+ EEA            FVKV MDGAPYLRKVD+K+Y+SY
Sbjct  85   QVVGWPPVRSFRKNIVQRNSNEEEAEKSTKNA-----FVKVSMDGAPYLRKVDIKLYKSY  139

Query  616  QQLSDALAKMFSSFTMGNYGAQG  684
            Q+LSDALAKMFSSFT+   G+QG
Sbjct  140  QELSDALAKMFSSFTIEKCGSQG  162



>gb|ACU18407.1| unknown [Glycine max]
Length=246

 Score =   133 bits (334),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 80/142 (56%), Positives = 94/142 (66%), Gaps = 15/142 (11%)
 Frame = +1

Query  298  KRGFSET-------VDLKLNL---QSAADSSLDLKEKMKSPSKEPN---KDPIKPPSKAQ  438
            KRGFSET       VDL LNL   ++AA    D +EK K+  KE      DP KPP+KAQ
Sbjct  36   KRGFSETETDETATVDLMLNLSPKEAAAADGADPREKPKTSPKEKTLLLPDPAKPPAKAQ  95

Query  439  VVGWPPVRNYRKNIMAQksspeeaageksggggpaaFVKVCMDGAPYLRKVDLKMYESYQ  618
            VVGWPPVR++RKN+ A  +       E       A+FVKV MDGAPYLRKVDLKMY+SY 
Sbjct  96   VVGWPPVRSFRKNMFA--AQKSSGGEESEKSSPNASFVKVSMDGAPYLRKVDLKMYKSYP  153

Query  619  QLSDALAKMFSSFTMGNYGAQG  684
            +LSDAL KMFSSFT+GN  +QG
Sbjct  154  ELSDALGKMFSSFTIGNCESQG  175



>dbj|BAI94494.1| Aux/IAA protein [Dianthus caryophyllus]
Length=238

 Score =   132 bits (333),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 73/128 (57%), Positives = 84/128 (66%), Gaps = 8/128 (6%)
 Frame = +1

Query  301  RGFSETVDLKLNLQSAADSSLDLKEKMKSPSKEPNKDPIKPPSKAQVVGWPPVRNYRKNI  480
            RGFS+TVDL  N     D   D+K+     SK    D +KPP+KAQVVGWPPVR+YRKN+
Sbjct  48   RGFSDTVDLMKN-----DKKADVKD---VCSKVVVTDSVKPPAKAQVVGWPPVRSYRKNV  99

Query  481  MAQksspeeaageksggggpaaFVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFT  660
            M  +       GE          VKV MDGAPYLRKV LKMY+SYQ+LSDAL KMFS FT
Sbjct  100  MTLQKGTAGEEGETVDKSSSGGLVKVSMDGAPYLRKVHLKMYKSYQELSDALGKMFSFFT  159

Query  661  MGNYGAQG  684
            +GNYG QG
Sbjct  160  LGNYGEQG  167



>ref|XP_010550916.1| PREDICTED: LOW QUALITY PROTEIN: auxin-responsive protein IAA16 
[Tarenaya hassleriana]
Length=212

 Score =   132 bits (331),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 80/141 (57%), Positives = 93/141 (66%), Gaps = 20/141 (14%)
 Frame = +1

Query  268  NESESLKVTGKRGFSETVDLKLNLQS-AADS-SLDLKEKMKSPSKEPNKDPIKPPSKAQV  441
            +E ++ K  GKRGFSETVDLKLNL S A DS S+D  EKMK       K  +KPP+K+QV
Sbjct  18   HEEKAAKNNGKRGFSETVDLKLNLSSMATDSGSMDGSEKMKE------KTTVKPPAKSQV  71

Query  442  VGWPPVRNYRKNIMAQksspeeaageksggggpaaFVKVCMDGAPYLRKVDLKMYESYQQ  621
            VGWPPVR              + A + +     AAFVKV MDGAPYLRKVDLK+Y SY +
Sbjct  72   VGWPPVR------------XADEAEKPTSSSAAAAFVKVSMDGAPYLRKVDLKLYNSYHE  119

Query  622  LSDALAKMFSSFTMGNYGAQG  684
            LSDAL KMFSSFT GN+  QG
Sbjct  120  LSDALGKMFSSFTSGNHEQQG  140



>ref|XP_006418150.1| hypothetical protein EUTSA_v10008679mg [Eutrema salsugineum]
 gb|ESQ36503.1| hypothetical protein EUTSA_v10008679mg [Eutrema salsugineum]
Length=229

 Score =   132 bits (332),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 82/146 (56%), Positives = 95/146 (65%), Gaps = 31/146 (21%)
 Frame = +1

Query  289  VTG-KRGFSETVDLKLNLQSA-----ADSSLDL------KEKMKSPSKEPNKDPIKPP--  426
            VTG KRGFSETVDLKLNL +        ++ D+      KEK  SP     KDP KPP  
Sbjct  27   VTGNKRGFSETVDLKLNLNNEPANKEGCTTHDVVTNSVSKEKSSSP-----KDPAKPPAK  81

Query  427  -SKAQVVGWPPVRNYRKNIMAQksspeeaageksggggpaaFVKVCMDGAPYLRKVDLKM  603
             S+AQVVGWPPVR+YRKN++      E AA           FVKV MDGAPYLRKVDLKM
Sbjct  82   ISRAQVVGWPPVRSYRKNVLVSSQKSEAAA-----------FVKVSMDGAPYLRKVDLKM  130

Query  604  YESYQQLSDALAKMFSSFTMGNYGAQ  681
            Y+SY +LS+AL+ MFSSFTMG YG +
Sbjct  131  YKSYDELSNALSNMFSSFTMGKYGGE  156



>ref|XP_008810170.1| PREDICTED: auxin-responsive protein IAA30-like [Phoenix dactylifera]
Length=241

 Score =   132 bits (332),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 80/142 (56%), Positives = 96/142 (68%), Gaps = 12/142 (8%)
 Frame = +1

Query  286  KVTGKRGFSETVDLKLNLQSAADSSLDLK---EKMKSPSKEPN-----KDPIKPPS-KAQ  438
            + T KRGFS+T+DLKL L++    S D K   EKMK  + + N      DP KPP+ KAQ
Sbjct  30   EATKKRGFSKTIDLKLKLRTV--DSKDAKPEAEKMKRSASQKNLLACSSDPEKPPAPKAQ  87

Query  439  VVGWPPVRNYRKNIMAQksspeeaageksggggpaaFVKVCMDGAPYLRKVDLKMYESYQ  618
            VVGWPPVR++RKNIM+   S +    E       A FVKV MDGAPYLRK+DLKMY SYQ
Sbjct  88   VVGWPPVRSFRKNIMS-IQSDKGKKDEGEKSATSATFVKVSMDGAPYLRKIDLKMYSSYQ  146

Query  619  QLSDALAKMFSSFTMGNYGAQG  684
            +LS AL KMFSSFT+GN  +QG
Sbjct  147  ELSVALEKMFSSFTIGNCSSQG  168



>ref|NP_001239753.1| uncharacterized protein LOC100781847 [Glycine max]
 gb|ACU21611.1| unknown [Glycine max]
Length=231

 Score =   132 bits (332),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 86/150 (57%), Positives = 105/150 (70%), Gaps = 22/150 (15%)
 Frame = +1

Query  268  NESESLKVTG-KRGFSET--VDLKLNLQSAADSSLDLK-----EKMKSPSKEP---NKDP  414
            NES ++K +G KRGFSET  VDLKLNL S+ DS+ D       EK  + +  P     DP
Sbjct  22   NESTTVKGSGGKRGFSETASVDLKLNLSSSDDSASDSPSSASTEKTTTAAPPPPSRANDP  81

Query  415  IKPPSKAQVVGWPPVRNYRKNIMAQksspeeaageksggggpaaFVKVCMDGAPYLRKVD  594
             KPP+KAQVVGWPPVR++RKNI+ +  + EEAA           FVKV MDGAPYLRKVD
Sbjct  82   AKPPAKAQVVGWPPVRSFRKNIVQRNKNEEEAA-----------FVKVSMDGAPYLRKVD  130

Query  595  LKMYESYQQLSDALAKMFSSFTMGNYGAQG  684
            +K+Y+SYQ+LSDALAKMFSSFT+   G+QG
Sbjct  131  IKLYKSYQELSDALAKMFSSFTIEKCGSQG  160



>ref|XP_010556884.1| PREDICTED: auxin-responsive protein IAA17 [Tarenaya hassleriana]
Length=238

 Score =   132 bits (331),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 97/181 (54%), Positives = 109/181 (60%), Gaps = 31/181 (17%)
 Frame = +1

Query  193  MLAEHGGLNLKATElclglpgggggNESESLKVTGKRGFSETV-DLKLNLQSAADSSLDL  369
            ML     LNLK TELCLGLPGG    E+ +     KRGFSETV DLKLNL +      DL
Sbjct  1    MLGGGVDLNLKDTELCLGLPGG---GETAAPVSGNKRGFSETVVDLKLNLNNEPRDHKDL  57

Query  370  KEKMKSPSKEPN--------------KDPIKPPSKAQVVGWPPVRNYRKNIMAQksspee  507
                 +  K+P+              KDP KPP+KAQVVGWPPVR+YRKN+ A       
Sbjct  58   GSV--TTEKDPSSLAAVPADNSSSCPKDPSKPPAKAQVVGWPPVRSYRKNMTAMSQKASG  115

Query  508  aageksggggpaaFVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTM--GNYGAQ  681
             +           FVKV MDGAPYLRKVDLKMY SY+ LS+ALAKMFSSFT   GNYGAQ
Sbjct  116  GSAT---------FVKVSMDGAPYLRKVDLKMYNSYEDLSNALAKMFSSFTTEKGNYGAQ  166

Query  682  G  684
            G
Sbjct  167  G  167



>ref|XP_006432922.1| hypothetical protein CICLE_v10002290mg [Citrus clementina]
 ref|XP_006471685.1| PREDICTED: auxin-responsive protein IAA16-like isoform X2 [Citrus 
sinensis]
 gb|ESR46162.1| hypothetical protein CICLE_v10002290mg [Citrus clementina]
Length=221

 Score =   131 bits (329),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 77/126 (61%), Positives = 90/126 (71%), Gaps = 4/126 (3%)
 Frame = +1

Query  298  KRGFSETV-DLKLNLQSAADSSLDL--KEKMKSPSKEPNKDPIKPPSKAQVVGWPPVRNY  468
            KRGF++TV DLKLNL +     +D+  K K KS S     D  KPP+KAQVVGWPPVR++
Sbjct  42   KRGFADTVVDLKLNLSTKESGGIDVIQKTKGKSASATGATDLSKPPAKAQVVGWPPVRSF  101

Query  469  RKNIMA-QksspeeaageksggggpaaFVKVCMDGAPYLRKVDLKMYESYQQLSDALAKM  645
            RKNIMA QK + E      S      AFVKV MDGAPYLRKVDLK+Y+SYQ+LSDAL KM
Sbjct  102  RKNIMAVQKDNEEGDNKASSSSSSNVAFVKVSMDGAPYLRKVDLKLYKSYQELSDALGKM  161

Query  646  FSSFTM  663
            FSSFT+
Sbjct  162  FSSFTI  167



>gb|ABR08763.1| auxin-resistance protein 3 [Arabidopsis thaliana]
Length=134

 Score =   128 bits (321),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 72/134 (54%), Positives = 85/134 (63%), Gaps = 23/134 (17%)
 Frame = +1

Query  289  VTG-KRGFSETVDLKLNLQSAADS----------SLDLKEKMKSPSKEPNKDPIKPPSKA  435
            VTG KRGFSETVDLKLNL +   +          + D KEK   P     KDP KPP+KA
Sbjct  13   VTGNKRGFSETVDLKLNLNNEPANKEGSTTHDVVTFDSKEKSACP-----KDPAKPPTKA  67

Query  436  QVVGWPPVRNYRKNIMAQksspeeaageksggggpaaFVKVCMDGAPYLRKVDLKMYESY  615
            QVVGWPPVR+YRKN+M             +       FVKV MDGAPYLRK+DL+MY+SY
Sbjct  68   QVVGWPPVRSYRKNVMVSCQKSSGGPEAAA-------FVKVSMDGAPYLRKIDLRMYKSY  120

Query  616  QQLSDALAKMFSSF  657
             +LS+AL+ MFSSF
Sbjct  121  DELSNALSNMFSSF  134



>gb|KDO48904.1| hypothetical protein CISIN_1g026005mg [Citrus sinensis]
Length=221

 Score =   130 bits (327),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 76/126 (60%), Positives = 90/126 (71%), Gaps = 4/126 (3%)
 Frame = +1

Query  298  KRGFSETV-DLKLNLQSAADSSLDLKEKMK--SPSKEPNKDPIKPPSKAQVVGWPPVRNY  468
            KRGF++TV DLKLNL +     +D+ EK K  S S     D  KPP+K+QVVGWPPVR++
Sbjct  42   KRGFADTVVDLKLNLSTKESGGIDVIEKTKGKSASATGATDLSKPPAKSQVVGWPPVRSF  101

Query  469  RKNIMA-QksspeeaageksggggpaaFVKVCMDGAPYLRKVDLKMYESYQQLSDALAKM  645
            RKNIMA QK + E      S      AFVKV MDGAPYLRKVDLK+Y+SYQ+LSDAL KM
Sbjct  102  RKNIMAVQKDNEEGDNKASSSSSSNVAFVKVSMDGAPYLRKVDLKLYKSYQELSDALGKM  161

Query  646  FSSFTM  663
            FSSFT+
Sbjct  162  FSSFTI  167



>gb|ABR08758.1| auxin-resistance protein 3 [Arabidopsis thaliana]
 gb|ABR08759.1| auxin-resistance protein 3 [Arabidopsis thaliana]
 gb|ABR08760.1| auxin-resistance protein 3 [Arabidopsis thaliana]
 gb|ABR08761.1| auxin-resistance protein 3 [Arabidopsis thaliana]
 gb|ABR08762.1| auxin-resistance protein 3 [Arabidopsis thaliana]
 gb|ABR08764.1| auxin-resistance protein 3 [Arabidopsis thaliana]
 gb|ABR08765.1| auxin-resistance protein 3 [Arabidopsis thaliana]
 gb|ABR08766.1| auxin-resistance protein 3 [Arabidopsis thaliana]
 gb|ABR08767.1| auxin-resistance protein 3 [Arabidopsis thaliana]
 gb|ABR08768.1| auxin-resistance protein 3 [Arabidopsis thaliana]
 gb|ABR08769.1| auxin-resistance protein 3 [Arabidopsis thaliana]
 gb|ABR08770.1| auxin-resistance protein 3 [Arabidopsis thaliana]
 gb|ABR08771.1| auxin-resistance protein 3 [Arabidopsis thaliana]
 gb|ABR08772.1| auxin-resistance protein 3 [Arabidopsis thaliana]
 gb|ABR08773.1| auxin-resistance protein 3 [Arabidopsis thaliana]
 gb|ABR08774.1| auxin-resistance protein 3 [Arabidopsis thaliana]
 gb|ABR08775.1| auxin-resistance protein 3 [Arabidopsis thaliana]
 gb|ABR08776.1| auxin-resistance protein 3 [Arabidopsis thaliana]
 gb|ABR08777.1| auxin-resistance protein 3 [Arabidopsis thaliana]
 gb|ABR08778.1| auxin-resistance protein 3 [Arabidopsis thaliana]
 gb|ABR08779.1| auxin-resistance protein 3 [Arabidopsis thaliana]
Length=134

 Score =   127 bits (320),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 72/134 (54%), Positives = 85/134 (63%), Gaps = 23/134 (17%)
 Frame = +1

Query  289  VTG-KRGFSETVDLKLNLQSAADS----------SLDLKEKMKSPSKEPNKDPIKPPSKA  435
            VTG KRGFSETVDLKLNL +   +          + D KEK   P     KDP KPP+KA
Sbjct  13   VTGNKRGFSETVDLKLNLNNEPANKEGSTTHDVVTFDSKEKSACP-----KDPAKPPAKA  67

Query  436  QVVGWPPVRNYRKNIMAQksspeeaageksggggpaaFVKVCMDGAPYLRKVDLKMYESY  615
            QVVGWPPVR+YRKN+M             +       FVKV MDGAPYLRK+DL+MY+SY
Sbjct  68   QVVGWPPVRSYRKNVMVSCQKSSGGPEAAA-------FVKVSMDGAPYLRKIDLRMYKSY  120

Query  616  QQLSDALAKMFSSF  657
             +LS+AL+ MFSSF
Sbjct  121  DELSNALSNMFSSF  134



>ref|XP_004156465.1| PREDICTED: LOW QUALITY PROTEIN: auxin-responsive protein IAA16-like 
[Cucumis sativus]
Length=239

 Score =   130 bits (328),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 74/137 (54%), Positives = 94/137 (69%), Gaps = 11/137 (8%)
 Frame = +1

Query  289  VTGKRGFSETVDLKLNLQSAADSS-----LDLKEKMKSPSKEPNKDPIKPPSKAQVVGWP  453
            + GKRGF ETVDLKLNL S   S+      +  +++K+ S++PN D  KPPSKAQVVGWP
Sbjct  37   LAGKRGFMETVDLKLNLASKWASAKGRGPTEFGKRLKTSSQQPN-DXAKPPSKAQVVGWP  95

Query  454  PVRNYRKNIMAQksspeeaageksggggpaaFVKVCMDGAPYLRKVDLKMYESYQQLSDA  633
            PVR+ RKN+         +      GG   +FVKV MDGAPYLRKVDLK+Y SY++LS A
Sbjct  96   PVRSSRKNL-----GVVSSRKGGDEGGAGGSFVKVSMDGAPYLRKVDLKLYASYKELSHA  150

Query  634  LAKMFSSFTMGNYGAQG  684
            LA+MFSSFT+G   ++G
Sbjct  151  LAQMFSSFTIGKCESEG  167



>ref|XP_008788131.1| PREDICTED: auxin-responsive protein IAA30-like [Phoenix dactylifera]
Length=241

 Score =   130 bits (327),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 78/135 (58%), Positives = 93/135 (69%), Gaps = 10/135 (7%)
 Frame = +1

Query  307  FSETVDLKLNLQSAADSS---LDLKEKMK-SPSKE----PNKDPIKPPS-KAQVVGWPPV  459
            FSET+DLKL LQ+ ADS    +++ EKMK SPS +       DP KPP+ KAQVVGWPPV
Sbjct  35   FSETIDLKLKLQTVADSKEVVMEVSEKMKRSPSHKNILPCTNDPEKPPAPKAQVVGWPPV  94

Query  460  RNYRKNIMAQksspeeaageksggggpaaFVKVCMDGAPYLRKVDLKMYESYQQLSDALA  639
            R++RKN+MA  S        +      A  VKV MDGAPYLRKVDLK+Y SY++LS AL 
Sbjct  95   RSFRKNMMATHSDKGSKEAGEKFSNSAA-LVKVSMDGAPYLRKVDLKIYSSYKELSMALE  153

Query  640  KMFSSFTMGNYGAQG  684
            KMFSSFT GN G+QG
Sbjct  154  KMFSSFTSGNCGSQG  168



>ref|XP_011082603.1| PREDICTED: auxin-responsive protein IAA14-like [Sesamum indicum]
Length=215

 Score =   129 bits (325),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 73/129 (57%), Positives = 85/129 (66%), Gaps = 16/129 (12%)
 Frame = +1

Query  298  KRGFSETVDLKLNLQSAADSSLDLKEKMKSPSKEPNKDPIKPPSKAQVVGWPPVRNYRKN  477
            KRGF ET+D KLN  S                 E   D +KPP+KAQVVGWPPVR++RKN
Sbjct  32   KRGFEETLDFKLNFASNG---------------ENINDSVKPPAKAQVVGWPPVRSFRKN  76

Query  478  IMAQksspeeaageksggggpaaFVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSF  657
            IMA      ++   + G GG  AFVKV MDGAPYLRK+DLKMY++YQ+LSDAL KMFSSF
Sbjct  77   IMA-VKKSGDSEDNEKGSGGGGAFVKVSMDGAPYLRKIDLKMYKTYQELSDALGKMFSSF  135

Query  658  TMGNYGAQG  684
            TMG    QG
Sbjct  136  TMGKCDTQG  144



>ref|XP_004289900.1| PREDICTED: auxin-induced protein AUX28-like [Fragaria vesca subsp. 
vesca]
Length=250

 Score =   130 bits (327),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 82/145 (57%), Positives = 103/145 (71%), Gaps = 10/145 (7%)
 Frame = +1

Query  268  NESESLKVTGKRGFSETVDLKLNLQSAADSSLDLKEK--MKSPSKEPN----KDPIKPPS  429
            +E+ES ++T     S  VDLKLNL S   SS   K K  M + +KE N     DP KPP+
Sbjct  39   SETES-QITTDDESSACVDLKLNLSSKDGSSTAEKSKSLMMNKNKEKNVDLPADPAKPPA  97

Query  430  KAQVVGWPPVRNYRKNIMAQksspeeaageksggggpaaFVKVCMDGAPYLRKVDLKMYE  609
            KAQVVGWPPVR++RKN+++   + + +  ++S  GG AA VKV MDGAPYLRKVDL MY+
Sbjct  98   KAQVVGWPPVRSFRKNMLS---AQKSSTTDESKAGGNAALVKVSMDGAPYLRKVDLNMYK  154

Query  610  SYQQLSDALAKMFSSFTMGNYGAQG  684
            +Y QLSDALAKMFSSFT+GN G+QG
Sbjct  155  TYPQLSDALAKMFSSFTIGNCGSQG  179



>ref|NP_001241599.1| uncharacterized protein LOC100803065 [Glycine max]
 gb|ACU20028.1| unknown [Glycine max]
 gb|KHN03840.1| Auxin-induced protein AUX28 [Glycine soja]
Length=248

 Score =   130 bits (326),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 79/145 (54%), Positives = 92/145 (63%), Gaps = 18/145 (12%)
 Frame = +1

Query  298  KRGFSET-------VDLKLNLQ------SAADSSLDLKEKMKSPSKEPNK---DPIKPPS  429
            KRGFSET       VDL LNL       +A     D +E  K+  KE N    DP KPP+
Sbjct  35   KRGFSETETDETTSVDLMLNLSPKEASAAATTDGADPRENPKTSPKEKNLPLLDPAKPPA  94

Query  430  KAQVVGWPPVRNYRKNIMAQksspeeaageksggggpaaFVKVCMDGAPYLRKVDLKMYE  609
            KAQVVGWPPVR++RKN+ A  +       E       A+FVKV MDGAPYLRKVDLKMY+
Sbjct  95   KAQVVGWPPVRSFRKNMFA--AQKSSGGEESEKNSPNASFVKVSMDGAPYLRKVDLKMYK  152

Query  610  SYQQLSDALAKMFSSFTMGNYGAQG  684
            SY +LSDAL KMFSSFT+GN  +QG
Sbjct  153  SYPELSDALGKMFSSFTIGNCESQG  177



>ref|XP_004150437.1| PREDICTED: LOW QUALITY PROTEIN: auxin-responsive protein IAA14-like 
[Cucumis sativus]
Length=264

 Score =   130 bits (327),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 83/152 (55%), Positives = 95/152 (63%), Gaps = 33/152 (22%)
 Frame = +1

Query  280  SLKVTGKRGFSETVDLKLNLQS-------AADSSLDLKEKMKSPSKEPN-------KDPI  417
            SLK +GKRGFSETVDLKLNLQS            +DL E +K+ S   +       KDP 
Sbjct  37   SLKASGKRGFSETVDLKLNLQSKDGGGGVGVGVGVDLNENIKNVSTNVDGEKSLCSKDPA  96

Query  418  KPPSKAQVVGWPPVRNYRKNIMAQkssp---------eeaageksggggpaaFVKVCMDG  570
            KPP+KAQVVGWPPVR+YRKN+MAQK++            ++     GG  AAFVKVCMDG
Sbjct  97   KPPAKAQVVGWPPVRSYRKNVMAQKNTSGGEGTEKGNGGSSAAFGNGGSSAAFVKVCMDG  156

Query  571  APYLRKVDLKMYESYQQLSDALAKMFSSFTMG  666
            APYLRKVDLKMY           KMFSSFTMG
Sbjct  157  APYLRKVDLKMY----------XKMFSSFTMG  178



>gb|KHN22078.1| Auxin-responsive protein IAA16 [Glycine soja]
Length=231

 Score =   129 bits (325),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 85/150 (57%), Positives = 104/150 (69%), Gaps = 22/150 (15%)
 Frame = +1

Query  268  NESESLKVTG-KRGFSET--VDLKLNLQSAADSSLDLK-----EKMKSPSKEP---NKDP  414
            NES ++K +G KRGF ET  VDLKLNL S+ DS+ D       EK  + +  P     DP
Sbjct  22   NESTTVKGSGGKRGFPETASVDLKLNLSSSDDSASDSPSSASTEKTTTAAPLPPSRANDP  81

Query  415  IKPPSKAQVVGWPPVRNYRKNIMAQksspeeaageksggggpaaFVKVCMDGAPYLRKVD  594
             KPP+KAQVVGWPPVR++RKNI+ +  + EEAA           FVKV MDGAPYLRKVD
Sbjct  82   AKPPAKAQVVGWPPVRSFRKNIVQRNKNEEEAA-----------FVKVSMDGAPYLRKVD  130

Query  595  LKMYESYQQLSDALAKMFSSFTMGNYGAQG  684
            +K+Y+SYQ+LSDALAKMFSSFT+   G+QG
Sbjct  131  IKLYKSYQELSDALAKMFSSFTIEKCGSQG  160



>ref|XP_007162490.1| hypothetical protein PHAVU_001G156600g [Phaseolus vulgaris]
 gb|ESW34484.1| hypothetical protein PHAVU_001G156600g [Phaseolus vulgaris]
Length=246

 Score =   129 bits (325),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 77/149 (52%), Positives = 95/149 (64%), Gaps = 14/149 (9%)
 Frame = +1

Query  274  SESLKVTGKRGFSET--------VDLKLNLQSAADSS-LDLKEKMKSPSKEPN---KDPI  417
            S + +V  KRGFSET        VDL LNL S   ++  D   K  +  KE      DP 
Sbjct  27   SATEEVLRKRGFSETETQDDTATVDLMLNLSSKEPTTGADPTHKHNTLPKEKTLLPADPA  86

Query  418  KPPSKAQVVGWPPVRNYRKNIMAQksspeeaageksggggpaaFVKVCMDGAPYLRKVDL  597
            KPP+KAQVVGWPPVR++RKN++A           +      A+FVKV MDGAPYLRKVDL
Sbjct  87   KPPAKAQVVGWPPVRSFRKNMLA--VQKSVGEESEKNSSPNASFVKVSMDGAPYLRKVDL  144

Query  598  KMYESYQQLSDALAKMFSSFTMGNYGAQG  684
            KMY+SY++LSD+L KMFSSFT+GN  +QG
Sbjct  145  KMYQSYRELSDSLGKMFSSFTIGNCESQG  173



>gb|KGN60808.1| hypothetical protein Csa_2G010920 [Cucumis sativus]
Length=237

 Score =   128 bits (322),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 74/132 (56%), Positives = 93/132 (70%), Gaps = 9/132 (7%)
 Frame = +1

Query  298  KRGFSETVDLKLNLQSAADSSLDLK---EKMKSPSKEPNKDPIKPPSKAQVVGWPPVRNY  468
            KRGF ETVDLKLNL S+  S+ +     E++K+ S++PN D  KPPSKAQVVGWPPVR+ 
Sbjct  40   KRGFMETVDLKLNLASSMASTKEEATNLEEIKTSSQQPN-DFAKPPSKAQVVGWPPVRSS  98

Query  469  RKNIMAQksspeeaageksggggpaaFVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMF  648
            RKN+         +      GG   +FVKV MDGAPYLRKVDLK+Y SY++LS ALA+MF
Sbjct  99   RKNL-----GVVSSRKGGDEGGAGGSFVKVSMDGAPYLRKVDLKLYASYKELSHALAQMF  153

Query  649  SSFTMGNYGAQG  684
            SSFT+G   ++G
Sbjct  154  SSFTIGKCESEG  165



>gb|ABM53874.1| IAA6 [Cestrum elegans]
Length=153

 Score =   125 bits (315),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 63/82 (77%), Positives = 72/82 (88%), Gaps = 0/82 (0%)
 Frame = +1

Query  439  VVGWPPVRNYRKNIMAQksspeeaageksggggpaaFVKVCMDGAPYLRKVDLKMYESYQ  618
            VVGWPPVR++RKN+MAQKS+ ++   + S     AAFVKVCMDGAPYLRKVDLKMY+SY+
Sbjct  1    VVGWPPVRSFRKNVMAQKSNTDQENEKNSITTAAAAFVKVCMDGAPYLRKVDLKMYKSYK  60

Query  619  QLSDALAKMFSSFTMGNYGAQG  684
            QLSDALAKMFSSFTMGNYGAQG
Sbjct  61   QLSDALAKMFSSFTMGNYGAQG  82



>ref|XP_004493739.1| PREDICTED: auxin-induced protein AUX28-like [Cicer arietinum]
Length=246

 Score =   128 bits (321),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 78/143 (55%), Positives = 95/143 (66%), Gaps = 14/143 (10%)
 Frame = +1

Query  289  VTGKRGFSET------VDLKLNLQSAAD--SSLDLKEKMKSPSKEPN---KDPIKPPSKA  435
            V  KRGFSET      +DL LNL +  +  S +D  +  K   KE      DP KPP+KA
Sbjct  35   VVRKRGFSETETQDHTMDLMLNLSTNKEPTSEVDPIDNTKILQKENTLLPADPAKPPAKA  94

Query  436  QVVGWPPVRNYRKNIMAQksspeeaageksggggpaaFVKVCMDGAPYLRKVDLKMYESY  615
            QVVGWPPVR+YRKN++A + S  +  GE++       FVKV MDGAPYLRKVDLK+Y SY
Sbjct  95   QVVGWPPVRSYRKNMLAMQKSSNDVVGEENNAIS---FVKVSMDGAPYLRKVDLKIYNSY  151

Query  616  QQLSDALAKMFSSFTMGNYGAQG  684
             QLSD+L KMFSSFT+GN  +QG
Sbjct  152  SQLSDSLGKMFSSFTIGNCESQG  174



>ref|XP_004495802.1| PREDICTED: auxin-responsive protein IAA16-like [Cicer arietinum]
Length=252

 Score =   127 bits (320),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 94/168 (56%), Positives = 110/168 (65%), Gaps = 14/168 (8%)
 Frame = +1

Query  214  LNLKATElclglpgggggNESES-LKVTG-KRGFSET--VDLKLNLQSAADS-----SLD  366
            +N + TEL LGLPGG     SES +K +G KRGFSET  VDLKLNL    DS     ++ 
Sbjct  15   INFEETELRLGLPGGSASEHSESPIKTSGGKRGFSETSNVDLKLNLSPTNDSVSPSSTIP  74

Query  367  LKEKMKSPSKEPNKDPIKPPSKAQVVGWPPVRNYRKNIM---AQksspeeaageksgggg  537
            L    K   K     P  P +KAQVVGWPPVR++RKNI+      +  E        GGG
Sbjct  75   LVPANKVKDKTSTTAP--PRAKAQVVGWPPVRSFRKNIVNVQKSNNEVEAEKKTSGSGGG  132

Query  538  paaFVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQ  681
              AFVKV MDGAPYLRKVDLK+Y+SYQ+LSDALAKMFSSFT+GN G+Q
Sbjct  133  NGAFVKVSMDGAPYLRKVDLKLYKSYQELSDALAKMFSSFTIGNCGSQ  180



>gb|AFK36684.1| unknown [Lotus japonicus]
Length=190

 Score =   125 bits (315),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 80/149 (54%), Positives = 96/149 (64%), Gaps = 16/149 (11%)
 Frame = +1

Query  286  KVTGKRGFSET------VDLKLNLQS------AADSSLDLKEKMKSPSKEPNKDPIKPPS  429
            +V  KRGFSET      VDL LNL S       AD S   K  ++        DP KPP+
Sbjct  38   EVVRKRGFSETESETDTVDLMLNLSSKEPTSAGADPSQKPKTNLQKEKTLLPADPAKPPA  97

Query  430  KAQVVGWPPVRNYRKNIMAQkss----peeaageksggggpaaFVKVCMDGAPYLRKVDL  597
            KA+VVGWPPVR++RKN++A + S             GGGG A+FVKV MDGAPYLRKVDL
Sbjct  98   KARVVGWPPVRSFRKNMLAVQKSVGEESGGEKSNNGGGGGGASFVKVSMDGAPYLRKVDL  157

Query  598  KMYESYQQLSDALAKMFSSFTMGNYGAQG  684
            KMY+SY+ LSD+LAKMFSSFT+G   +QG
Sbjct  158  KMYKSYRDLSDSLAKMFSSFTIGTCESQG  186



>ref|XP_006443920.1| hypothetical protein CICLE_v10022032mg [Citrus clementina]
 gb|ESR57160.1| hypothetical protein CICLE_v10022032mg [Citrus clementina]
Length=226

 Score =   127 bits (318),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 73/125 (58%), Positives = 86/125 (69%), Gaps = 4/125 (3%)
 Frame = +1

Query  298  KRGFSETVDLKLNLQSAADSSLDLK--EKMKSPSKEPNKDPIKPPSKAQVVGWPPVRNYR  471
            KRGFSETVDLKLNL S+ D+S  +K  +K K P       P KPP+K QVVGWPPVR++R
Sbjct  33   KRGFSETVDLKLNL-SSKDTSEKVKSFQKEKHPLPRATDPPAKPPAKTQVVGWPPVRSFR  91

Query  472  KNIMAQksspeeaageksggggpaaFVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFS  651
            KN++               GG  AAFVKV MDGAPYLRKVDL+MY +Y+ L DAL KMFS
Sbjct  92   KNMLG-VVQKSSGEESDMAGGNNAAFVKVSMDGAPYLRKVDLRMYNTYKDLYDALGKMFS  150

Query  652  SFTMG  666
            SFT+G
Sbjct  151  SFTIG  155



>gb|ABD98055.1| auxin-regulated protein [Striga asiatica]
Length=248

 Score =   127 bits (319),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 82/143 (57%), Positives = 98/143 (69%), Gaps = 18/143 (13%)
 Frame = +1

Query  295  GKRGFSETVDLKLNLQSAADSSLD---------LKEK--MKSPSKEPNKDPIKPPSKAQV  441
            GKRGF+ETVDLKL L S     LD          KEK  M SP+     +  +PP+KAQV
Sbjct  40   GKRGFAETVDLKLKLSSKEIGDLDRGGLERKDLCKEKNLMPSPT-----ESARPPAKAQV  94

Query  442  VGWPPVRNYRKNIMA--QksspeeaageksggggpaaFVKVCMDGAPYLRKVDLKMYESY  615
            VGWPPVR++RKN+MA  +KS  E+A    +  GG AAFVKV MDGAPYLRKVDLKMY++Y
Sbjct  95   VGWPPVRSFRKNVMAVQKKSEAEDAEKVAAASGGGAAFVKVSMDGAPYLRKVDLKMYKAY  154

Query  616  QQLSDALAKMFSSFTMGNYGAQG  684
            Q+L DAL KMFSSFTM    ++G
Sbjct  155  QELYDALGKMFSSFTMVKCDSEG  177



>ref|XP_008462707.1| PREDICTED: auxin-induced protein AUX28-like isoform X2 [Cucumis 
melo]
Length=228

 Score =   126 bits (317),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 87/170 (51%), Positives = 110/170 (65%), Gaps = 14/170 (8%)
 Frame = +1

Query  184  MGSMLAEHGGLNLKATElclglpgggggNESESLKVTGKRGFSETVDLKLNLQSAADSSL  363
            MGS+L      + K TEL LGLPG  G N+ +++K   KRGF+ETVDLKL++ + +D   
Sbjct  1    MGSLL------DFKETELRLGLPGWEGRNDGDAVK---KRGFTETVDLKLHIATDSDQGN  51

Query  364  DLKEKMKSPSKEPNKD-PIKPPSKAQVVGWPPVRNYRKNIMA---Qksspeeaageksgg  531
               +K    S   NKD P  PP+K QV+GWPPV++ R+NI+     K    + +      
Sbjct  52   KTIDK-NVVSSFVNKDLPKPPPAKTQVIGWPPVKSLRRNIIGPKKNKLEETKKSAVGDCS  110

Query  532  ggpaaFVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQ  681
             G  AF+KV M+GAPYLRKVDLKMYESYQQL DAL+KMF SFT GN GAQ
Sbjct  111  VGAVAFIKVSMEGAPYLRKVDLKMYESYQQLFDALSKMFGSFTTGNCGAQ  160



>ref|XP_008462706.1| PREDICTED: auxin-responsive protein IAA16-like isoform X1 [Cucumis 
melo]
Length=232

 Score =   126 bits (317),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 87/170 (51%), Positives = 110/170 (65%), Gaps = 14/170 (8%)
 Frame = +1

Query  184  MGSMLAEHGGLNLKATElclglpgggggNESESLKVTGKRGFSETVDLKLNLQSAADSSL  363
            MGS+L      + K TEL LGLPG  G N+ +++K   KRGF+ETVDLKL++ + +D   
Sbjct  1    MGSLL------DFKETELRLGLPGWEGRNDGDAVK---KRGFTETVDLKLHIATDSDQGN  51

Query  364  DLKEKMKSPSKEPNKD-PIKPPSKAQVVGWPPVRNYRKNIMA---Qksspeeaageksgg  531
               +K    S   NKD P  PP+K QV+GWPPV++ R+NI+     K    + +      
Sbjct  52   KTIDK-NVVSSFVNKDLPKPPPAKTQVIGWPPVKSLRRNIIGPKKNKLEETKKSAVGDCS  110

Query  532  ggpaaFVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQ  681
             G  AF+KV M+GAPYLRKVDLKMYESYQQL DAL+KMF SFT GN GAQ
Sbjct  111  VGAVAFIKVSMEGAPYLRKVDLKMYESYQQLFDALSKMFGSFTTGNCGAQ  160



>ref|XP_007144686.1| hypothetical protein PHAVU_007G176600g [Phaseolus vulgaris]
 gb|ESW16680.1| hypothetical protein PHAVU_007G176600g [Phaseolus vulgaris]
Length=245

 Score =   126 bits (317),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 79/150 (53%), Positives = 98/150 (65%), Gaps = 17/150 (11%)
 Frame = +1

Query  268  NESESLKVTGKRGFSET------VDLKLNL---QSAADSSLDLKEKMKSPSKEPN--KDP  414
             ESE ++   KRGFSET      VDL LNL   ++A+  S D +   K+  K+     DP
Sbjct  31   TESEGVR---KRGFSETQTETTTVDLMLNLSPKEAASAPSPDPRNMPKTSPKDNTLIPDP  87

Query  415  IKPPSKAQVVGWPPVRNYRKNIMAQksspeeaageksggggpaaFVKVCMDGAPYLRKVD  594
             KPP+K QVVGWPPVR++RKN+ A   + +    E       A+FVKV MDGAPYLRKVD
Sbjct  88   AKPPAKEQVVGWPPVRSFRKNMFA---AQKSMVEESEKNSPNASFVKVSMDGAPYLRKVD  144

Query  595  LKMYESYQQLSDALAKMFSSFTMGNYGAQG  684
            LKMY+SY +LSDAL KMFSSFT+GN  +QG
Sbjct  145  LKMYKSYPELSDALGKMFSSFTIGNCESQG  174



>gb|KDP21369.1| hypothetical protein JCGZ_21840 [Jatropha curcas]
Length=251

 Score =   127 bits (318),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 76/141 (54%), Positives = 93/141 (66%), Gaps = 14/141 (10%)
 Frame = +1

Query  298  KRGFSETVDLKLNLQSAADSS-LDLKEKMKSPSKEPN---KDPIKPPSKAQVVGWPPVRN  465
            KRGFS+TVDL+LN+ S  +S+  D  +K K+  +E N    DP KPP+KAQVVGWPPVR+
Sbjct  39   KRGFSQTVDLELNISSKEESAAFDPNQKTKNLPREKNLLAADPAKPPAKAQVVGWPPVRS  98

Query  466  YRKNIMA--------QksspeeaageksggggpaaFVKVCMDGAPYLRKVDLKMYESYQQ  621
            YRKN++A          SS E +           +FVKV MDGAPYLRKVDL MY  Y Q
Sbjct  99   YRKNMLAVPKSSNIKNNSSEESSENNSKLSNSNGSFVKVSMDGAPYLRKVDLNMYNGYYQ  158

Query  622  LSDALAKMFSSFTMGNYGAQG  684
            LS ALA+MFS  T+GN G+QG
Sbjct  159  LSHALAQMFS--TIGNCGSQG  177



>ref|XP_010025014.1| PREDICTED: auxin-responsive protein IAA16-like [Eucalyptus grandis]
 gb|KCW61599.1| hypothetical protein EUGRSUZ_H04335 [Eucalyptus grandis]
Length=270

 Score =   127 bits (319),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 76/160 (48%), Positives = 93/160 (58%), Gaps = 30/160 (19%)
 Frame = +1

Query  295  GKRGFSETVDLKLNLQSAADSSLDLKEKMKSPSKE-------------------------  399
            GKR F ETVDLKLN  S  D     K +  +P+++                         
Sbjct  40   GKRVFLETVDLKLNFSSKEDGGSVEKIRASAPAEKKMNSSDGKEKSVAAAAAAAAPPPPS  99

Query  400  PNKDPIKPPSKAQVVGWPPVRNYRKNIMA-----QksspeeaageksggggpaaFVKVCM  564
             + +  KPP+KAQVVGWPPVR++RKNIMA        + +  +         AAFVKV M
Sbjct  100  SSSEVAKPPAKAQVVGWPPVRSFRKNIMAVQKSGSDEAEKGGSSGNGAATSGAAFVKVSM  159

Query  565  DGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQG  684
            DGAPYLRKVDLK+Y+SYQ LSDALAKMFSSFT+GN G+ G
Sbjct  160  DGAPYLRKVDLKLYKSYQDLSDALAKMFSSFTIGNCGSGG  199



>ref|XP_008455992.1| PREDICTED: auxin-responsive protein IAA16 isoform X2 [Cucumis 
melo]
Length=231

 Score =   126 bits (316),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 76/132 (58%), Positives = 90/132 (68%), Gaps = 11/132 (8%)
 Frame = +1

Query  298  KRGFSETVDLKLNLQSAADSSLDLK---EKMKSPSKEPNKDPIKPPSKAQVVGWPPVRNY  468
            KRGF ETVDLKLNL S+  S+ +     E++KS S++PN D  KPPSK QVVGWPPVR+ 
Sbjct  41   KRGFMETVDLKLNLASSMASAKEEGTNLEEIKSCSQQPN-DFAKPPSKTQVVGWPPVRSS  99

Query  469  RKNIMAQksspeeaageksggggpaaFVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMF  648
            RKN+    S      G  S       FVKV MDGAPYLRKVDLK+Y SY+ LS ALAKMF
Sbjct  100  RKNLGVSSSRKGGDEGGGS-------FVKVSMDGAPYLRKVDLKLYGSYKDLSHALAKMF  152

Query  649  SSFTMGNYGAQG  684
            SSFT+G   ++G
Sbjct  153  SSFTIGKCESEG  164



>gb|AAM96891.1| auxin-responsive protein IAA1 [Mirabilis jalapa]
Length=194

 Score =   125 bits (313),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 63/107 (59%), Positives = 74/107 (69%), Gaps = 0/107 (0%)
 Frame = +1

Query  364  DLKEKMKSPSKEPNKDPIKPPSKAQVVGWPPVRNYRKNIMAQksspeeaageksggggpa  543
            D+ +  K      N D  KPP+KAQVVGWPPVR+YRKN++A + S      E        
Sbjct  17   DVNDNTKVNGANNNADLAKPPAKAQVVGWPPVRSYRKNMLAVQKSTGAPESESEKPAANG  76

Query  544  aFVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQG  684
              VKV MDGAPYLRKVDLK+Y+SYQ LSDAL KMFSSFT+GNYG+QG
Sbjct  77   GLVKVSMDGAPYLRKVDLKLYKSYQDLSDALGKMFSSFTLGNYGSQG  123



>gb|AFK36086.1| unknown [Lotus japonicus]
Length=257

 Score =   126 bits (317),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 81/149 (54%), Positives = 96/149 (64%), Gaps = 16/149 (11%)
 Frame = +1

Query  286  KVTGKRGFSET------VDLKLNLQS------AADSSLDLKEKMKSPSKEPNKDPIKPPS  429
            +V  KRGFSET      VDL LNL S       AD S   K  ++        DP KPP+
Sbjct  38   EVVRKRGFSETESETDTVDLMLNLSSKEPTSAGADPSQKPKTNLQKEKTLLPADPAKPPA  97

Query  430  KAQVVGWPPVRNYRKNIMAQkss----peeaageksggggpaaFVKVCMDGAPYLRKVDL  597
            KAQVVGWPPVR++RKN++A + S             GGGG A+FVKV MDGAPYLRKVDL
Sbjct  98   KAQVVGWPPVRSFRKNMLAVQKSVGEESGGEKSNNGGGGGGASFVKVSMDGAPYLRKVDL  157

Query  598  KMYESYQQLSDALAKMFSSFTMGNYGAQG  684
            KMY+SY+ LSD+LAKMFSSFT+G   +QG
Sbjct  158  KMYKSYRDLSDSLAKMFSSFTIGTCESQG  186



>ref|XP_008455985.1| PREDICTED: auxin-responsive protein IAA16 isoform X1 [Cucumis 
melo]
Length=236

 Score =   125 bits (315),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 76/132 (58%), Positives = 93/132 (70%), Gaps = 11/132 (8%)
 Frame = +1

Query  298  KRGFSETVDLKLNLQSAADSSLDLK---EKMKSPSKEPNKDPIKPPSKAQVVGWPPVRNY  468
            KRGF ETVDLKLNL S+  S+ +     E++KS S++PN D  KPPSK QVVGWPPVR+ 
Sbjct  41   KRGFMETVDLKLNLASSMASAKEEGTNLEEIKSCSQQPN-DFAKPPSKTQVVGWPPVRSS  99

Query  469  RKNIMAQksspeeaageksggggpaaFVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMF  648
            RKN+         ++  K G  G  +FVKV MDGAPYLRKVDLK+Y SY+ LS ALAKMF
Sbjct  100  RKNL-------GVSSSRKGGDEGGGSFVKVSMDGAPYLRKVDLKLYGSYKDLSHALAKMF  152

Query  649  SSFTMGNYGAQG  684
            SSFT+G   ++G
Sbjct  153  SSFTIGKCESEG  164



>gb|KFK31703.1| hypothetical protein AALP_AA6G148100 [Arabis alpina]
Length=208

 Score =   125 bits (313),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 69/135 (51%), Positives = 85/135 (63%), Gaps = 16/135 (12%)
 Frame = +1

Query  271  ESESLKVTGKRGFSETVDLKLNLQSAADSSLD--LKEKMKSPSKEPNKDPIKPPSKAQVV  444
            E+ +     KRG+SETVDLKLNL +  +++ +  L  K  + S  P      PP+KAQVV
Sbjct  14   ETTATVAGNKRGYSETVDLKLNLNNEPETNKEGSLVSKENTSSICPKDSTKPPPAKAQVV  73

Query  445  GWPPVRNYRKNIMAQksspeeaageksggggpaaFVKVCMDGAPYLRKVDLKMYESYQQL  624
            GWPPVR+YRKN+M+                  A FVKV MDGAPYLRK+DLKMY+SY  L
Sbjct  74   GWPPVRSYRKNVMS--------------ATAEATFVKVSMDGAPYLRKIDLKMYKSYNDL  119

Query  625  SDALAKMFSSFTMGN  669
            S+AL  MFSSFTM N
Sbjct  120  SNALTTMFSSFTMSN  134



>gb|AFK44192.1| unknown [Medicago truncatula]
Length=253

 Score =   125 bits (315),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 94/168 (56%), Positives = 112/168 (67%), Gaps = 13/168 (8%)
 Frame = +1

Query  214  LNLKATElclglpgggggNESESLKVTGKRGFSET--VDLKLNLQSAADSSLDLKEKMKS  387
            +N + TEL LGLPG G   ES      GKRGFSET  VDLKLNL    DS+      + S
Sbjct  15   INFEETELRLGLPGAGDHGESPVKNSCGKRGFSETANVDLKLNLSPINDSASS-SPTIAS  73

Query  388  PSKEPNKDP-----IKPP--SKAQVVGWPPVRNYRKNIM---AQksspeeaageksgggg  537
             ++   KD      + PP  +KAQVVGWPPVR++RKNI+    + +S  E     SGGGG
Sbjct  74   VAENKGKDTTTSATVSPPPRAKAQVVGWPPVRSFRKNIVNVHQKSNSETEVDKSISGGGG  133

Query  538  paaFVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQ  681
              AFVKV MDGAPYLRKVDLK+Y+SYQ+LSDALAKMFSSFT+ N G+Q
Sbjct  134  NGAFVKVSMDGAPYLRKVDLKLYKSYQELSDALAKMFSSFTIDNCGSQ  181



>emb|CBI35213.3| unnamed protein product [Vitis vinifera]
Length=170

 Score =   123 bits (309),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 67/106 (63%), Positives = 81/106 (76%), Gaps = 7/106 (7%)
 Frame = +1

Query  367  LKEKMKSPSKEPNKDPIKPPSKAQVVGWPPVRNYRKNIMAQksspeeaageksggggpaa  546
            +KEK   P   P+ DP KPP+KAQVVGWPPVR++RKNI+      ++ + E+      AA
Sbjct  1    MKEKSALP---PSNDPAKPPAKAQVVGWPPVRSFRKNILT----VQKNSSEEEKASSSAA  53

Query  547  FVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQG  684
            FVKV MDGAPYLRKVDLKMY+SYQ+LSDAL KMFSSFT+GN G+QG
Sbjct  54   FVKVSMDGAPYLRKVDLKMYKSYQELSDALGKMFSSFTIGNCGSQG  99



>gb|AGV54230.1| auxin-induced protein AUX28 [Phaseolus vulgaris]
Length=245

 Score =   125 bits (314),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 78/150 (52%), Positives = 98/150 (65%), Gaps = 17/150 (11%)
 Frame = +1

Query  268  NESESLKVTGKRGFSET------VDLKLNL---QSAADSSLDLKEKMKSPSKEPN--KDP  414
             ESE ++   KRGFSET      VDL LNL   ++A+  S D +   K+  K+     DP
Sbjct  31   TESEGVR---KRGFSETQTETTTVDLMLNLSPKEAASAPSPDPRNMPKTSPKDNTLIPDP  87

Query  415  IKPPSKAQVVGWPPVRNYRKNIMAQksspeeaageksggggpaaFVKVCMDGAPYLRKVD  594
             KPP+K QVVGWPPVR++RKN+ A   + +    E       A+FVKV MDGAPYLRKVD
Sbjct  88   AKPPAKEQVVGWPPVRSFRKNMFA---AQKSMVEESEKNSPNASFVKVSMDGAPYLRKVD  144

Query  595  LKMYESYQQLSDALAKMFSSFTMGNYGAQG  684
            LKMY++Y +LSDAL KMFSSFT+GN  +QG
Sbjct  145  LKMYKNYPELSDALGKMFSSFTIGNCESQG  174



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1042394327856