BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c61712_g1_i1 len=114 path=[92:0-113]

Length=114
                                                                      Score     E

gb|EXD24685.1|  biofilm PGA synthesis lipopgaB domain protein         81.3    4e-18   
gb|EYS15360.1|  poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylas...  81.6    7e-17   
gb|EXU12217.1|  poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylas...  81.6    7e-17   
gb|KCX83524.1|  poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylas...  81.6    1e-16   
gb|EXE39739.1|  poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylas...  81.6    1e-16   
gb|EXB23211.1|  poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylas...  81.3    1e-16   
gb|ABO11370.2|  putative lipoprotein                                  81.6    1e-16   Acinetobacter baumannii ATCC 17978
ref|WP_032030456.1|  polysaccharide deacetylase                       81.6    1e-16   
ref|WP_032050034.1|  polysaccharide deacetylase                       81.6    1e-16   
ref|WP_005135714.1|  poly-beta-1,6-N-acetyl-D-glucosamine N-deace...  81.6    1e-16   
ref|WP_004738505.1|  poly-beta-1,6-N-acetyl-D-glucosamine N-deace...  81.6    1e-16   
ref|WP_000632818.1|  polysaccharide deacetylase                       81.6    1e-16   
ref|WP_000632821.1|  polysaccharide deacetylase                       81.6    1e-16   
ref|WP_004835659.1|  poly-beta-1,6-N-acetyl-D-glucosamine N-deace...  81.6    1e-16   
ref|WP_032047048.1|  polysaccharide deacetylase                       81.6    1e-16   
ref|WP_032001001.1|  polysaccharide deacetylase                       81.6    1e-16   
ref|WP_032000048.1|  polysaccharide deacetylase                       81.6    1e-16   
ref|WP_005124555.1|  poly-beta-1,6-N-acetyl-D-glucosamine N-deace...  81.6    1e-16   
ref|WP_000632829.1|  polysaccharide deacetylase                       81.6    1e-16   
ref|WP_000632826.1|  polysaccharide deacetylase                       81.6    1e-16   
ref|WP_002061294.1|  poly-beta-1,6-N-acetyl-D-glucosamine N-deace...  81.6    1e-16   
ref|WP_000632828.1|  polysaccharide deacetylase                       81.6    1e-16   
ref|WP_000632827.1|  polysaccharide deacetylase                       81.6    1e-16   
ref|WP_011858614.1|  polysaccharide deacetylase                       81.6    1e-16   
ref|WP_031954780.1|  polysaccharide deacetylase                       81.6    1e-16   
ref|WP_031981419.1|  polysaccharide deacetylase                       81.6    1e-16   
ref|WP_031976165.1|  polysaccharide deacetylase                       81.6    1e-16   
ref|WP_031959834.1|  polysaccharide deacetylase                       81.6    1e-16   
ref|WP_000632832.1|  polysaccharide deacetylase                       81.6    1e-16   
ref|WP_000632830.1|  polysaccharide deacetylase                       81.6    1e-16   
ref|WP_001984313.1|  polysaccharide deacetylase                       81.6    1e-16   
ref|WP_031956970.1|  polysaccharide deacetylase                       81.6    1e-16   
ref|WP_000632824.1|  polysaccharide deacetylase                       81.6    1e-16   
ref|WP_000632831.1|  polysaccharide deacetylase                       81.6    1e-16   
ref|WP_000632816.1|  polysaccharide deacetylase                       81.6    1e-16   
ref|WP_000632815.1|  polysaccharide deacetylase                       81.6    1e-16   
ref|WP_000213116.1|  polysaccharide deacetylase                       81.6    2e-16   
ref|WP_000632817.1|  polysaccharide deacetylase                       81.6    2e-16   
ref|WP_000632820.1|  polysaccharide deacetylase                       81.6    2e-16   
ref|WP_032068379.1|  polysaccharide deacetylase                       81.6    2e-16   
ref|WP_000632825.1|  polysaccharide deacetylase                       81.6    2e-16   
ref|WP_000632823.1|  polysaccharide deacetylase                       81.6    2e-16   
ref|WP_031989941.1|  polysaccharide deacetylase                       81.6    2e-16   
ref|WP_031969701.1|  polysaccharide deacetylase                       81.6    2e-16   
ref|WP_032043513.1|  polysaccharide deacetylase                       81.6    2e-16   
ref|WP_038347472.1|  polysaccharide deacetylase                       81.6    2e-16   
ref|WP_031950277.1|  polysaccharide deacetylase                       81.6    2e-16   
ref|WP_032047699.1|  polysaccharide deacetylase                       81.6    2e-16   
ref|WP_032049371.1|  polysaccharide deacetylase                       81.6    2e-16   
ref|WP_017393332.1|  MULTISPECIES: polysaccharide deacetylase         80.5    4e-16   
ref|WP_034120252.1|  polysaccharide deacetylase                       80.5    4e-16   
ref|WP_032047797.1|  polysaccharide deacetylase                       80.5    4e-16   
ref|WP_016804833.1|  polysaccharide deacetylase                       80.5    4e-16   
ref|WP_004710158.1|  MULTISPECIES: poly-beta-1,6-N-acetyl-D-gluco...  80.1    4e-16   
ref|WP_004703187.1|  MULTISPECIES: poly-beta-1,6-N-acetyl-D-gluco...  80.1    4e-16   
ref|WP_002054296.1|  MULTISPECIES: polysaccharide deacetylase         80.1    4e-16   
ref|WP_039254123.1|  polysaccharide deacetylase                       80.1    4e-16   
ref|WP_004748055.1|  poly-beta-1,6-N-acetyl-D-glucosamine N-deace...  80.1    5e-16   
ref|WP_016144582.1|  poly-beta-1,6-N-acetyl-D-glucosamine N-deace...  77.4    5e-15   
ref|WP_032055106.1|  polysaccharide deacetylase                       77.4    5e-15   
ref|WP_016141945.1|  poly-beta-1,6-N-acetyl-D-glucosamine N-deace...  77.4    5e-15   
ref|WP_031947619.1|  polysaccharide deacetylase                       77.0    5e-15   
ref|WP_014206024.1|  polysaccharide deacetylase                       77.0    6e-15   
ref|WP_017389973.1|  polysaccharide deacetylase                       76.6    9e-15   
dbj|GAM31684.1|  biofilm PGA synthesis lipoprotein PgaB               76.6    9e-15   
ref|WP_005042349.1|  poly-beta-1,6-N-acetyl-D-glucosamine N-deace...  76.6    9e-15   
ref|WP_017391739.1|  polysaccharide deacetylase                       76.6    9e-15   
ref|WP_016138972.1|  poly-beta-1,6-N-acetyl-D-glucosamine N-deace...  76.6    9e-15   
gb|ENV99879.1|  poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylas...  76.3    9e-15   
gb|EEY79045.1|  poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylas...  76.6    9e-15   Acinetobacter calcoaceticus RUH2202
ref|WP_005303254.1|  poly-beta-1,6-N-acetyl-D-glucosamine N-deace...  76.6    9e-15   
ref|WP_009386580.1|  poly-beta-1,6-N-acetyl-D-glucosamine N-deace...  76.6    9e-15   
ref|WP_013198662.1|  polysaccharide deacetylase                       76.6    9e-15   
ref|WP_004794049.1|  poly-beta-1,6-N-acetyl-D-glucosamine N-deace...  76.3    1e-14   
gb|KHN66104.1|  polysaccharide deacetylase                            76.3    1e-14   
ref|WP_017387105.1|  MULTISPECIES: polysaccharide deacetylase         75.1    3e-14   
ref|WP_033848546.1|  polysaccharide deacetylase                       75.1    3e-14   
ref|WP_039757053.1|  polysaccharide deacetylase                       75.1    3e-14   
ref|WP_017399039.1|  polysaccharide deacetylase                       75.1    3e-14   
ref|WP_002117675.1|  MULTISPECIES: poly-beta-1,6-N-acetyl-D-gluco...  75.1    3e-14   
ref|WP_032012754.1|  polysaccharide deacetylase                       75.1    3e-14   
ref|WP_032004181.1|  polysaccharide deacetylase                       75.1    3e-14   
ref|WP_005070744.1|  poly-beta-1,6-N-acetyl-D-glucosamine N-deace...  75.1    3e-14   
ref|WP_005075399.1|  poly-beta-1,6-N-acetyl-D-glucosamine N-deace...  75.1    3e-14   
ref|WP_032052488.1|  polysaccharide deacetylase                       75.1    3e-14   
ref|WP_032042005.1|  polysaccharide deacetylase                       75.1    3e-14   
ref|WP_032056874.1|  polysaccharide deacetylase                       75.1    3e-14   
ref|WP_032005837.1|  polysaccharide deacetylase                       75.1    3e-14   
ref|WP_032063616.1|  polysaccharide deacetylase                       74.7    4e-14   
ref|WP_004641711.1|  poly-beta-1,6-N-acetyl-D-glucosamine N-deace...  74.3    5e-14   
ref|WP_017388708.1|  polysaccharide deacetylase                       74.3    6e-14   
ref|WP_017403160.1|  MULTISPECIES: polysaccharide deacetylase         73.9    8e-14   
ref|WP_032037458.1|  polysaccharide deacetylase                       73.9    8e-14   
ref|WP_017481351.1|  polysaccharide deacetylase                       72.8    2e-13   
ref|WP_005803033.1|  MULTISPECIES: polysaccharide deacetylase         72.8    2e-13   
ref|WP_032032990.1|  polysaccharide deacetylase                       72.8    2e-13   
ref|WP_031946283.1|  polysaccharide deacetylase                       72.4    3e-13   
gb|EPR86097.1|  Biofilm PGA synthesis deacetylase PgaB                70.9    9e-13   
ref|WP_004956114.1|  poly-beta-1,6-N-acetyl-D-glucosamine N-deace...  70.5    1e-12   
ref|WP_004912761.1|  poly-beta-1,6-N-acetyl-D-glucosamine N-deace...  70.5    1e-12   
ref|WP_005402226.1|  polysaccharide deacetylase                       70.5    1e-12   
ref|WP_004963399.1|  poly-beta-1,6-N-acetyl-D-glucosamine N-deace...  70.5    1e-12   
ref|WP_023012992.1|  polysaccharide deacetylase                       68.9    5e-12   
ref|WP_019383907.1|  polysaccharide deacetylase                       68.6    5e-12   
ref|WP_004878336.1|  poly-beta-1,6-N-acetyl-D-glucosamine N-deace...  68.6    5e-12   
ref|WP_007481756.1|  polysaccharide deacetylase                       68.6    5e-12   
ref|WP_004663383.1|  MULTISPECIES: poly-beta-1,6-N-acetyl-D-gluco...  68.2    7e-12   
ref|WP_005158137.1|  poly-beta-1,6-N-acetyl-D-glucosamine N-deace...  68.2    7e-12   
ref|WP_005243539.1|  MULTISPECIES: polysaccharide deacetylase         67.8    1e-11   
ref|WP_005269745.1|  poly-beta-1,6-N-acetyl-D-glucosamine N-deace...  67.8    1e-11   
ref|WP_016651630.1|  poly-beta-1,6-N-acetyl-D-glucosamine N-deace...  67.8    1e-11   
ref|WP_005144821.1|  poly-beta-1,6-N-acetyl-D-glucosamine N-deace...  67.8    1e-11   
ref|WP_005296146.1|  poly-beta-1,6-N-acetyl-D-glucosamine N-deace...  67.8    1e-11   
ref|WP_005208125.1|  poly-beta-1,6-N-acetyl-D-glucosamine N-deace...  67.8    1e-11   
ref|WP_005184277.1|  poly-beta-1,6-N-acetyl-D-glucosamine N-deace...  67.8    1e-11   
ref|WP_018679694.1|  polysaccharide deacetylase                       67.4    1e-11   
gb|KHF78761.1|  Biofilm PGA synthesis deacetylase PgaB                67.4    1e-11   
ref|WP_004770377.1|  MULTISPECIES: poly-beta-1,6-N-acetyl-D-gluco...  67.4    1e-11   
ref|WP_005288343.1|  MULTISPECIES: poly-beta-1,6-N-acetyl-D-gluco...  67.4    1e-11   
ref|WP_005231843.1|  poly-beta-1,6-N-acetyl-D-glucosamine N-deace...  67.4    1e-11   
ref|WP_009511351.1|  poly-beta-1,6-N-acetyl-D-glucosamine N-deace...  67.4    2e-11   
ref|WP_032870317.1|  polysaccharide deacetylase                       67.4    2e-11   
ref|WP_016541202.1|  Biofilm PGA synthesis deacetylase PgaB           67.0    2e-11   
ref|WP_005062935.1|  poly-beta-1,6-N-acetyl-D-glucosamine N-deace...  66.6    2e-11   
ref|WP_005010507.1|  poly-beta-1,6-N-acetyl-D-glucosamine N-deace...  65.9    4e-11   
ref|WP_038341951.1|  polysaccharide deacetylase                       65.9    4e-11   
ref|WP_005055206.1|  poly-beta-1,6-N-acetyl-D-glucosamine N-deace...  65.1    9e-11   
ref|WP_005202062.1|  MULTISPECIES: poly-beta-1,6-N-acetyl-D-gluco...  64.7    1e-10   
ref|WP_004760965.1|  poly-beta-1,6-N-acetyl-D-glucosamine N-deace...  64.7    1e-10   
ref|WP_033134292.1|  polysaccharide deacetylase                       64.7    1e-10   
ref|WP_016162876.1|  poly-beta-1,6-N-acetyl-D-glucosamine N-deace...  64.7    1e-10   
ref|WP_004801495.1|  poly-beta-1,6-N-acetyl-D-glucosamine N-deace...  64.7    1e-10   
ref|WP_025096185.1|  polysaccharide deacetylase                       63.2    5e-10   
ref|WP_004946075.1|  poly-beta-1,6-N-acetyl-D-glucosamine N-deace...  63.2    5e-10   
ref|WP_004652012.1|  poly-beta-1,6-N-acetyl-D-glucosamine N-deace...  62.8    5e-10   
ref|WP_004935973.1|  poly-beta-1,6-N-acetyl-D-glucosamine N-deace...  62.0    1e-09   
ref|WP_004921745.1|  MULTISPECIES: polysaccharide deacetylase         61.6    2e-09   
ref|WP_029574523.1|  polysaccharide deacetylase                       60.1    5e-09   
ref|WP_004900077.1|  poly-beta-1,6-N-acetyl-D-glucosamine N-deace...  60.1    5e-09   
ref|WP_004751145.1|  poly-beta-1,6-N-acetyl-D-glucosamine N-deace...  60.1    6e-09   
ref|WP_004990304.1|  poly-beta-1,6-N-acetyl-D-glucosamine N-deace...  59.7    6e-09   
ref|WP_016166955.1|  poly-beta-1,6-N-acetyl-D-glucosamine N-deace...  59.7    6e-09   
ref|WP_004996516.1|  MULTISPECIES: poly-beta-1,6-N-acetyl-D-gluco...  59.7    6e-09   
dbj|BAP35883.1|  polysaccharide deacetylase                           55.5    2e-07   
gb|EPH37998.1|  Biofilm PGA synthesis deacetylase PgaB                55.5    2e-07   
ref|WP_004722672.1|  poly-beta-1,6-N-acetyl-D-glucosamine N-deace...  55.5    2e-07   
gb|ELW82288.1|  poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylas...  55.5    2e-07   
ref|WP_004819455.1|  MULTISPECIES: poly-beta-1,6-N-acetyl-D-gluco...  55.5    2e-07   
ref|WP_005030820.1|  poly-beta-1,6-N-acetyl-D-glucosamine N-deace...  55.5    2e-07   
ref|WP_004828105.1|  MULTISPECIES: poly-beta-1,6-N-acetyl-D-gluco...  55.5    2e-07   
ref|WP_004857154.1|  poly-beta-1,6-N-acetyl-D-glucosamine N-deace...  54.3    5e-07   
ref|WP_004648176.1|  poly-beta-1,6-N-acetyl-D-glucosamine N-deace...  53.9    7e-07   
ref|WP_023273866.1|  poly-beta-1,6-N-acetyl-D-glucosamine N-deace...  53.1    1e-06   
ref|WP_016657274.1|  poly-beta-1,6-N-acetyl-D-glucosamine N-deace...  52.4    2e-06   
gb|ABS90006.1|  hypothetical protein A1S_3581                         47.0    8e-06   Acinetobacter baumannii ATCC 17978
ref|WP_023273661.1|  poly-beta-1,6-N-acetyl-D-glucosamine N-deace...  49.3    3e-05   
ref|WP_034279990.1|  polysaccharide deacetylase                       48.9    3e-05   
ref|WP_023272184.1|  poly-beta-1,6-N-acetyl-D-glucosamine N-deace...  48.1    8e-05   



>gb|EXD24685.1| biofilm PGA synthesis lipopgaB domain protein [Acinetobacter 
baumannii 34654]
Length=135

 Score = 81.3 bits (199),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 37/37 (100%), Positives = 37/37 (100%), Gaps = 0/37 (0%)
 Frame = -2

Query  113  QQGAMHVAYYPDDPIKDHPDVNVMHKAFAEKSSRLVP  3
            QQGAMHVAYYPDDPIKDHPDVNVMHKAFAEKSSRLVP
Sbjct  99   QQGAMHVAYYPDDPIKDHPDVNVMHKAFAEKSSRLVP  135



>gb|EYS15360.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 25569_7]
Length=419

 Score = 81.6 bits (200),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 37/37 (100%), Positives = 37/37 (100%), Gaps = 0/37 (0%)
 Frame = -2

Query  113  QQGAMHVAYYPDDPIKDHPDVNVMHKAFAEKSSRLVP  3
            QQGAMHVAYYPDDPIKDHPDVNVMHKAFAEKSSRLVP
Sbjct  383  QQGAMHVAYYPDDPIKDHPDVNVMHKAFAEKSSRLVP  419



>gb|EXU12217.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 25253_5]
Length=419

 Score = 81.6 bits (200),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 37/37 (100%), Positives = 37/37 (100%), Gaps = 0/37 (0%)
 Frame = -2

Query  113  QQGAMHVAYYPDDPIKDHPDVNVMHKAFAEKSSRLVP  3
            QQGAMHVAYYPDDPIKDHPDVNVMHKAFAEKSSRLVP
Sbjct  383  QQGAMHVAYYPDDPIKDHPDVNVMHKAFAEKSSRLVP  419



>gb|KCX83524.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB, partial 
[Acinetobacter baumannii 15827]
Length=535

 Score = 81.6 bits (200),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 37/37 (100%), Positives = 37/37 (100%), Gaps = 0/37 (0%)
 Frame = -2

Query  113  QQGAMHVAYYPDDPIKDHPDVNVMHKAFAEKSSRLVP  3
            QQGAMHVAYYPDDPIKDHPDVNVMHKAFAEKSSRLVP
Sbjct  499  QQGAMHVAYYPDDPIKDHPDVNVMHKAFAEKSSRLVP  535



>gb|EXE39739.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 1546444]
Length=541

 Score = 81.6 bits (200),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 37/37 (100%), Positives = 37/37 (100%), Gaps = 0/37 (0%)
 Frame = -2

Query  113  QQGAMHVAYYPDDPIKDHPDVNVMHKAFAEKSSRLVP  3
            QQGAMHVAYYPDDPIKDHPDVNVMHKAFAEKSSRLVP
Sbjct  505  QQGAMHVAYYPDDPIKDHPDVNVMHKAFAEKSSRLVP  541



>gb|EXB23211.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 1406750]
 gb|EXD32670.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 472237-1196]
Length=503

 Score = 81.3 bits (199),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 37/37 (100%), Positives = 37/37 (100%), Gaps = 0/37 (0%)
 Frame = -2

Query  113  QQGAMHVAYYPDDPIKDHPDVNVMHKAFAEKSSRLVP  3
            QQGAMHVAYYPDDPIKDHPDVNVMHKAFAEKSSRLVP
Sbjct  467  QQGAMHVAYYPDDPIKDHPDVNVMHKAFAEKSSRLVP  503



>gb|ABO11370.2| putative lipoprotein [Acinetobacter baumannii ATCC 17978]
Length=664

 Score = 81.6 bits (200),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 37/37 (100%), Positives = 37/37 (100%), Gaps = 0/37 (0%)
 Frame = -2

Query  113  QQGAMHVAYYPDDPIKDHPDVNVMHKAFAEKSSRLVP  3
            QQGAMHVAYYPDDPIKDHPDVNVMHKAFAEKSSRLVP
Sbjct  628  QQGAMHVAYYPDDPIKDHPDVNVMHKAFAEKSSRLVP  664



>ref|WP_032030456.1| polysaccharide deacetylase [Acinetobacter baumannii]
 gb|EXF20042.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 1417041]
Length=664

 Score = 81.6 bits (200),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 37/37 (100%), Positives = 37/37 (100%), Gaps = 0/37 (0%)
 Frame = -2

Query  113  QQGAMHVAYYPDDPIKDHPDVNVMHKAFAEKSSRLVP  3
            QQGAMHVAYYPDDPIKDHPDVNVMHKAFAEKSSRLVP
Sbjct  628  QQGAMHVAYYPDDPIKDHPDVNVMHKAFAEKSSRLVP  664



>ref|WP_032050034.1| polysaccharide deacetylase [Acinetobacter baumannii]
 gb|EXA57707.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 1297549]
 gb|AJB67766.1| polysaccharide deacetylase [Acinetobacter baumannii]
Length=664

 Score = 81.6 bits (200),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 37/37 (100%), Positives = 37/37 (100%), Gaps = 0/37 (0%)
 Frame = -2

Query  113  QQGAMHVAYYPDDPIKDHPDVNVMHKAFAEKSSRLVP  3
            QQGAMHVAYYPDDPIKDHPDVNVMHKAFAEKSSRLVP
Sbjct  628  QQGAMHVAYYPDDPIKDHPDVNVMHKAFAEKSSRLVP  664



>ref|WP_005135714.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii]
 gb|ENW59851.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii NIPH 70]
Length=664

 Score = 81.6 bits (200),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 37/37 (100%), Positives = 37/37 (100%), Gaps = 0/37 (0%)
 Frame = -2

Query  113  QQGAMHVAYYPDDPIKDHPDVNVMHKAFAEKSSRLVP  3
            QQGAMHVAYYPDDPIKDHPDVNVMHKAFAEKSSRLVP
Sbjct  628  QQGAMHVAYYPDDPIKDHPDVNVMHKAFAEKSSRLVP  664



>ref|WP_004738505.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii]
 gb|ENU70139.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii NIPH 615]
Length=664

 Score = 81.6 bits (200),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 37/37 (100%), Positives = 37/37 (100%), Gaps = 0/37 (0%)
 Frame = -2

Query  113  QQGAMHVAYYPDDPIKDHPDVNVMHKAFAEKSSRLVP  3
            QQGAMHVAYYPDDPIKDHPDVNVMHKAFAEKSSRLVP
Sbjct  628  QQGAMHVAYYPDDPIKDHPDVNVMHKAFAEKSSRLVP  664



>ref|WP_000632818.1| polysaccharide deacetylase [Acinetobacter baumannii]
Length=664

 Score = 81.6 bits (200),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 37/37 (100%), Positives = 37/37 (100%), Gaps = 0/37 (0%)
 Frame = -2

Query  113  QQGAMHVAYYPDDPIKDHPDVNVMHKAFAEKSSRLVP  3
            QQGAMHVAYYPDDPIKDHPDVNVMHKAFAEKSSRLVP
Sbjct  628  QQGAMHVAYYPDDPIKDHPDVNVMHKAFAEKSSRLVP  664



>ref|WP_000632821.1| polysaccharide deacetylase [Acinetobacter baumannii]
 gb|ETQ76510.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii UH5107]
 gb|KHV85872.1| polysaccharide deacetylase [Acinetobacter baumannii]
 gb|KHW69187.1| polysaccharide deacetylase [Acinetobacter baumannii]
 gb|KHW75064.1| polysaccharide deacetylase [Acinetobacter baumannii]
 gb|KHW80196.1| polysaccharide deacetylase [Acinetobacter baumannii]
 gb|KHY90426.1| polysaccharide deacetylase [Acinetobacter baumannii]
 gb|KHY97009.1| polysaccharide deacetylase [Acinetobacter baumannii]
 gb|KHY98802.1| polysaccharide deacetylase [Acinetobacter baumannii]
Length=664

 Score = 81.6 bits (200),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 37/37 (100%), Positives = 37/37 (100%), Gaps = 0/37 (0%)
 Frame = -2

Query  113  QQGAMHVAYYPDDPIKDHPDVNVMHKAFAEKSSRLVP  3
            QQGAMHVAYYPDDPIKDHPDVNVMHKAFAEKSSRLVP
Sbjct  628  QQGAMHVAYYPDDPIKDHPDVNVMHKAFAEKSSRLVP  664



>ref|WP_004835659.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii]
 gb|ENV25146.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii NIPH 190]
 gb|EXE20331.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 1106579]
 gb|EXE80838.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 83444]
Length=664

 Score = 81.6 bits (200),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 37/37 (100%), Positives = 37/37 (100%), Gaps = 0/37 (0%)
 Frame = -2

Query  113  QQGAMHVAYYPDDPIKDHPDVNVMHKAFAEKSSRLVP  3
            QQGAMHVAYYPDDPIKDHPDVNVMHKAFAEKSSRLVP
Sbjct  628  QQGAMHVAYYPDDPIKDHPDVNVMHKAFAEKSSRLVP  664



>ref|WP_032047048.1| polysaccharide deacetylase [Acinetobacter baumannii]
 gb|KCY10285.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 1598530]
Length=664

 Score = 81.6 bits (200),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 37/37 (100%), Positives = 37/37 (100%), Gaps = 0/37 (0%)
 Frame = -2

Query  113  QQGAMHVAYYPDDPIKDHPDVNVMHKAFAEKSSRLVP  3
            QQGAMHVAYYPDDPIKDHPDVNVMHKAFAEKSSRLVP
Sbjct  628  QQGAMHVAYYPDDPIKDHPDVNVMHKAFAEKSSRLVP  664



>ref|WP_032001001.1| polysaccharide deacetylase [Acinetobacter baumannii]
 gb|EXD52540.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 781407]
 gb|EXE31933.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 1525283]
Length=664

 Score = 81.6 bits (200),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 37/37 (100%), Positives = 37/37 (100%), Gaps = 0/37 (0%)
 Frame = -2

Query  113  QQGAMHVAYYPDDPIKDHPDVNVMHKAFAEKSSRLVP  3
            QQGAMHVAYYPDDPIKDHPDVNVMHKAFAEKSSRLVP
Sbjct  628  QQGAMHVAYYPDDPIKDHPDVNVMHKAFAEKSSRLVP  664



>ref|WP_032000048.1| polysaccharide deacetylase [Acinetobacter baumannii]
 gb|EXA93547.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 1267820]
 gb|EXR50280.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 1391434]
 gb|EXR84942.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 541915]
 gb|AIL74875.1| polysaccharide deacetylase [Acinetobacter baumannii]
Length=664

 Score = 81.6 bits (200),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 37/37 (100%), Positives = 37/37 (100%), Gaps = 0/37 (0%)
 Frame = -2

Query  113  QQGAMHVAYYPDDPIKDHPDVNVMHKAFAEKSSRLVP  3
            QQGAMHVAYYPDDPIKDHPDVNVMHKAFAEKSSRLVP
Sbjct  628  QQGAMHVAYYPDDPIKDHPDVNVMHKAFAEKSSRLVP  664



>ref|WP_005124555.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii]
 gb|ENW42588.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii NIPH 329]
Length=664

 Score = 81.6 bits (200),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 37/37 (100%), Positives = 37/37 (100%), Gaps = 0/37 (0%)
 Frame = -2

Query  113  QQGAMHVAYYPDDPIKDHPDVNVMHKAFAEKSSRLVP  3
            QQGAMHVAYYPDDPIKDHPDVNVMHKAFAEKSSRLVP
Sbjct  628  QQGAMHVAYYPDDPIKDHPDVNVMHKAFAEKSSRLVP  664



>ref|WP_000632829.1| polysaccharide deacetylase [Acinetobacter baumannii]
 gb|EXC09861.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 625974]
 gb|EXC70453.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 1043794]
 gb|EXD91960.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 972082]
 gb|EXE96665.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 232184]
 gb|EXF10433.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 268680]
 gb|EXG36217.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 121738]
 gb|EXH04122.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 1064293_45]
 gb|EYT18919.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 655378]
Length=664

 Score = 81.6 bits (200),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 37/37 (100%), Positives = 37/37 (100%), Gaps = 0/37 (0%)
 Frame = -2

Query  113  QQGAMHVAYYPDDPIKDHPDVNVMHKAFAEKSSRLVP  3
            QQGAMHVAYYPDDPIKDHPDVNVMHKAFAEKSSRLVP
Sbjct  628  QQGAMHVAYYPDDPIKDHPDVNVMHKAFAEKSSRLVP  664



>ref|WP_000632826.1| polysaccharide deacetylase [Acinetobacter baumannii]
Length=664

 Score = 81.6 bits (200),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 37/37 (100%), Positives = 37/37 (100%), Gaps = 0/37 (0%)
 Frame = -2

Query  113  QQGAMHVAYYPDDPIKDHPDVNVMHKAFAEKSSRLVP  3
            QQGAMHVAYYPDDPIKDHPDVNVMHKAFAEKSSRLVP
Sbjct  628  QQGAMHVAYYPDDPIKDHPDVNVMHKAFAEKSSRLVP  664



>ref|WP_002061294.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii]
 gb|ELX02276.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii OIFC047]
Length=664

 Score = 81.6 bits (200),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 37/37 (100%), Positives = 37/37 (100%), Gaps = 0/37 (0%)
 Frame = -2

Query  113  QQGAMHVAYYPDDPIKDHPDVNVMHKAFAEKSSRLVP  3
            QQGAMHVAYYPDDPIKDHPDVNVMHKAFAEKSSRLVP
Sbjct  628  QQGAMHVAYYPDDPIKDHPDVNVMHKAFAEKSSRLVP  664



>ref|WP_000632828.1| polysaccharide deacetylase [Acinetobacter baumannii]
 ref|YP_008216200.1| putative xylanase/chitin deacetylase [Acinetobacter baumannii 
BJAB0715]
 gb|EKB36666.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii Ab33333]
 gb|EKL44449.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii OIFC098]
 gb|ENW41573.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii NIPH 335]
 gb|AGQ05698.1| putative xylanase/chitin deacetylase [Acinetobacter baumannii 
BJAB0715]
 gb|EXB90229.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 466760]
 gb|EXE23189.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 50595]
 gb|EXG91571.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 1062314]
 gb|EXH96073.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 3390]
 gb|EXQ82459.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 1007214]
 gb|EZF16485.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii LAC-4]
 gb|KCY37406.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 1262761-105]
 gb|AIY37060.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii LAC-4]
 gb|KHV92671.1| polysaccharide deacetylase [Acinetobacter baumannii]
Length=664

 Score = 81.6 bits (200),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 37/37 (100%), Positives = 37/37 (100%), Gaps = 0/37 (0%)
 Frame = -2

Query  113  QQGAMHVAYYPDDPIKDHPDVNVMHKAFAEKSSRLVP  3
            QQGAMHVAYYPDDPIKDHPDVNVMHKAFAEKSSRLVP
Sbjct  628  QQGAMHVAYYPDDPIKDHPDVNVMHKAFAEKSSRLVP  664



>ref|WP_000632827.1| polysaccharide deacetylase [Acinetobacter baumannii]
 gb|EKA72252.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii WC-692]
 gb|EKL60999.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii OIFC110]
 gb|ETR00779.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii UH6507]
Length=664

 Score = 81.6 bits (200),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 37/37 (100%), Positives = 37/37 (100%), Gaps = 0/37 (0%)
 Frame = -2

Query  113  QQGAMHVAYYPDDPIKDHPDVNVMHKAFAEKSSRLVP  3
            QQGAMHVAYYPDDPIKDHPDVNVMHKAFAEKSSRLVP
Sbjct  628  QQGAMHVAYYPDDPIKDHPDVNVMHKAFAEKSSRLVP  664



>ref|WP_011858614.1| polysaccharide deacetylase [Acinetobacter baumannii]
 ref|YP_001083972.1| lipoprotein [Acinetobacter baumannii ATCC 17978]
Length=641

 Score = 81.6 bits (200),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 37/37 (100%), Positives = 37/37 (100%), Gaps = 0/37 (0%)
 Frame = -2

Query  113  QQGAMHVAYYPDDPIKDHPDVNVMHKAFAEKSSRLVP  3
            QQGAMHVAYYPDDPIKDHPDVNVMHKAFAEKSSRLVP
Sbjct  605  QQGAMHVAYYPDDPIKDHPDVNVMHKAFAEKSSRLVP  641



>ref|WP_031954780.1| polysaccharide deacetylase [Acinetobacter baumannii]
 gb|EZI65122.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 25442_5]
Length=664

 Score = 81.6 bits (200),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 37/37 (100%), Positives = 37/37 (100%), Gaps = 0/37 (0%)
 Frame = -2

Query  113  QQGAMHVAYYPDDPIKDHPDVNVMHKAFAEKSSRLVP  3
            QQGAMHVAYYPDDPIKDHPDVNVMHKAFAEKSSRLVP
Sbjct  628  QQGAMHVAYYPDDPIKDHPDVNVMHKAFAEKSSRLVP  664



>ref|WP_031981419.1| polysaccharide deacetylase [Acinetobacter baumannii]
 gb|EXH01942.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 1095464]
Length=664

 Score = 81.6 bits (200),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 37/37 (100%), Positives = 37/37 (100%), Gaps = 0/37 (0%)
 Frame = -2

Query  113  QQGAMHVAYYPDDPIKDHPDVNVMHKAFAEKSSRLVP  3
            QQGAMHVAYYPDDPIKDHPDVNVMHKAFAEKSSRLVP
Sbjct  628  QQGAMHVAYYPDDPIKDHPDVNVMHKAFAEKSSRLVP  664



>ref|WP_031976165.1| polysaccharide deacetylase [Acinetobacter baumannii]
 gb|EXC94758.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 1051830]
Length=664

 Score = 81.6 bits (200),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 37/37 (100%), Positives = 37/37 (100%), Gaps = 0/37 (0%)
 Frame = -2

Query  113  QQGAMHVAYYPDDPIKDHPDVNVMHKAFAEKSSRLVP  3
            QQGAMHVAYYPDDPIKDHPDVNVMHKAFAEKSSRLVP
Sbjct  628  QQGAMHVAYYPDDPIKDHPDVNVMHKAFAEKSSRLVP  664



>ref|WP_031959834.1| polysaccharide deacetylase [Acinetobacter baumannii]
 gb|EXC38161.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 951631]
 gb|EXE68527.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 397971]
 gb|EXG12697.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 722310]
 gb|EXH58804.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 1533268]
 gb|EXI00300.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 607805]
 gb|EXI06498.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 457946]
 gb|EXQ90986.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 1170863]
 gb|EXR13834.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 1413735]
 gb|EXR71796.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 14216]
 gb|EXR87611.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 214216]
 gb|EYT32041.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 1195185_11]
 gb|EYT33944.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 110912]
 gb|KCX59594.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 496487]
 gb|KCX80233.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 754286]
 gb|KCY03320.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 1499986]
 gb|KCY28367.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 1195185_80]
 gb|KEF48910.1| polysaccharide deacetylase [Acinetobacter baumannii]
 gb|KEF49170.1| polysaccharide deacetylase [Acinetobacter baumannii]
 gb|KFG14236.1| lipoprotein HmsF [Acinetobacter baumannii]
Length=664

 Score = 81.6 bits (200),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 37/37 (100%), Positives = 37/37 (100%), Gaps = 0/37 (0%)
 Frame = -2

Query  113  QQGAMHVAYYPDDPIKDHPDVNVMHKAFAEKSSRLVP  3
            QQGAMHVAYYPDDPIKDHPDVNVMHKAFAEKSSRLVP
Sbjct  628  QQGAMHVAYYPDDPIKDHPDVNVMHKAFAEKSSRLVP  664



>ref|WP_000632832.1| polysaccharide deacetylase [Acinetobacter baumannii]
 gb|ETQ19969.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii UH12208]
 gb|ETQ36177.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii UH16208]
 gb|ETQ58004.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii UH19608]
 gb|ETQ64231.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii UH22908]
 gb|ETR05618.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii UH6907]
 gb|ETR08557.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii UH7607]
 gb|ETR19331.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii UH7907]
 gb|AIL77227.1| polysaccharide deacetylase [Acinetobacter baumannii]
 gb|AIS05686.1| polysaccharide deacetylase [Acinetobacter baumannii]
 gb|KHW84090.1| polysaccharide deacetylase [Acinetobacter baumannii]
 gb|KHW88598.1| polysaccharide deacetylase [Acinetobacter baumannii]
Length=664

 Score = 81.6 bits (200),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 37/37 (100%), Positives = 37/37 (100%), Gaps = 0/37 (0%)
 Frame = -2

Query  113  QQGAMHVAYYPDDPIKDHPDVNVMHKAFAEKSSRLVP  3
            QQGAMHVAYYPDDPIKDHPDVNVMHKAFAEKSSRLVP
Sbjct  628  QQGAMHVAYYPDDPIKDHPDVNVMHKAFAEKSSRLVP  664



>ref|WP_000632830.1| polysaccharide deacetylase [Acinetobacter baumannii]
 gb|EGU03865.1| Biofilm PGA synthesis lipoprotein pgaB precursor [Acinetobacter 
baumannii ABNIH4]
 gb|EKP52285.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii Naval-2]
Length=664

 Score = 81.6 bits (200),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 37/37 (100%), Positives = 37/37 (100%), Gaps = 0/37 (0%)
 Frame = -2

Query  113  QQGAMHVAYYPDDPIKDHPDVNVMHKAFAEKSSRLVP  3
            QQGAMHVAYYPDDPIKDHPDVNVMHKAFAEKSSRLVP
Sbjct  628  QQGAMHVAYYPDDPIKDHPDVNVMHKAFAEKSSRLVP  664



>ref|WP_001984313.1| polysaccharide deacetylase [Acinetobacter baumannii]
 ref|YP_001714658.1| lipoprotein HmsF [Acinetobacter baumannii AYE]
 emb|CAM87683.1| putative lipoprotein (Haemin storage system) (HmsF) [Acinetobacter 
baumannii AYE]
 gb|EEX04078.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii ATCC 19606 = CIP 70.34]
 dbj|BAN88480.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii NCGM 237]
Length=671

 Score = 81.6 bits (200),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 37/37 (100%), Positives = 37/37 (100%), Gaps = 0/37 (0%)
 Frame = -2

Query  113  QQGAMHVAYYPDDPIKDHPDVNVMHKAFAEKSSRLVP  3
            QQGAMHVAYYPDDPIKDHPDVNVMHKAFAEKSSRLVP
Sbjct  635  QQGAMHVAYYPDDPIKDHPDVNVMHKAFAEKSSRLVP  671



>ref|WP_031956970.1| polysaccharide deacetylase [Acinetobacter baumannii]
 gb|EZI57576.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 25442_7]
Length=664

 Score = 81.6 bits (200),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 37/37 (100%), Positives = 37/37 (100%), Gaps = 0/37 (0%)
 Frame = -2

Query  113  QQGAMHVAYYPDDPIKDHPDVNVMHKAFAEKSSRLVP  3
            QQGAMHVAYYPDDPIKDHPDVNVMHKAFAEKSSRLVP
Sbjct  628  QQGAMHVAYYPDDPIKDHPDVNVMHKAFAEKSSRLVP  664



>ref|WP_000632824.1| polysaccharide deacetylase [Acinetobacter baumannii]
 gb|EJG22837.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii OIFC143]
 gb|EJP49001.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii Naval-18]
 gb|ENU66009.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii NIPH 146]
 emb|CDG78012.1| xylanase/chitin deacetylase [Acinetobacter baumannii 107m]
 gb|ETR88180.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii CI86]
 gb|ETR90518.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii CI79]
 gb|EXA69492.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 984213]
 gb|EXB20561.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 1429530]
Length=664

 Score = 81.6 bits (200),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 37/37 (100%), Positives = 37/37 (100%), Gaps = 0/37 (0%)
 Frame = -2

Query  113  QQGAMHVAYYPDDPIKDHPDVNVMHKAFAEKSSRLVP  3
            QQGAMHVAYYPDDPIKDHPDVNVMHKAFAEKSSRLVP
Sbjct  628  QQGAMHVAYYPDDPIKDHPDVNVMHKAFAEKSSRLVP  664



>ref|WP_000632831.1| polysaccharide deacetylase [Acinetobacter baumannii]
Length=664

 Score = 81.6 bits (200),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 37/37 (100%), Positives = 37/37 (100%), Gaps = 0/37 (0%)
 Frame = -2

Query  113  QQGAMHVAYYPDDPIKDHPDVNVMHKAFAEKSSRLVP  3
            QQGAMHVAYYPDDPIKDHPDVNVMHKAFAEKSSRLVP
Sbjct  628  QQGAMHVAYYPDDPIKDHPDVNVMHKAFAEKSSRLVP  664



>ref|WP_000632816.1| polysaccharide deacetylase [Acinetobacter baumannii]
 gb|EXA88728.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 118362]
Length=664

 Score = 81.6 bits (200),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 37/37 (100%), Positives = 37/37 (100%), Gaps = 0/37 (0%)
 Frame = -2

Query  113  QQGAMHVAYYPDDPIKDHPDVNVMHKAFAEKSSRLVP  3
            QQGAMHVAYYPDDPIKDHPDVNVMHKAFAEKSSRLVP
Sbjct  628  QQGAMHVAYYPDDPIKDHPDVNVMHKAFAEKSSRLVP  664



>ref|WP_000632815.1| polysaccharide deacetylase [Acinetobacter baumannii]
 gb|EKK09638.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii OIFC0162]
 gb|EKU59124.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii WC-348]
Length=664

 Score = 81.6 bits (200),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 37/37 (100%), Positives = 37/37 (100%), Gaps = 0/37 (0%)
 Frame = -2

Query  113  QQGAMHVAYYPDDPIKDHPDVNVMHKAFAEKSSRLVP  3
            QQGAMHVAYYPDDPIKDHPDVNVMHKAFAEKSSRLVP
Sbjct  628  QQGAMHVAYYPDDPIKDHPDVNVMHKAFAEKSSRLVP  664



>ref|WP_000213116.1| polysaccharide deacetylase [Acinetobacter baumannii]
 gb|EJP41339.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii OIFC032]
 gb|EKP38828.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii OIFC087]
 gb|EKP39820.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii OIFC099]
Length=664

 Score = 81.6 bits (200),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 37/37 (100%), Positives = 37/37 (100%), Gaps = 0/37 (0%)
 Frame = -2

Query  113  QQGAMHVAYYPDDPIKDHPDVNVMHKAFAEKSSRLVP  3
            QQGAMHVAYYPDDPIKDHPDVNVMHKAFAEKSSRLVP
Sbjct  628  QQGAMHVAYYPDDPIKDHPDVNVMHKAFAEKSSRLVP  664



>ref|WP_000632817.1| polysaccharide deacetylase [Acinetobacter baumannii]
 gb|EJG13597.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii OIFC137]
 gb|EJG24950.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii OIFC109]
 gb|EJO41933.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii IS-123]
 gb|EJP59004.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii Naval-81]
 gb|EKL47807.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii Naval-13]
 gb|EKP61994.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii WC-A-694]
 gb|ENU49765.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii NIPH 1669]
 gb|ENU54336.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii NIPH 1362]
Length=664

 Score = 81.6 bits (200),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 37/37 (100%), Positives = 37/37 (100%), Gaps = 0/37 (0%)
 Frame = -2

Query  113  QQGAMHVAYYPDDPIKDHPDVNVMHKAFAEKSSRLVP  3
            QQGAMHVAYYPDDPIKDHPDVNVMHKAFAEKSSRLVP
Sbjct  628  QQGAMHVAYYPDDPIKDHPDVNVMHKAFAEKSSRLVP  664



>ref|WP_000632820.1| polysaccharide deacetylase [Acinetobacter baumannii]
 ref|YP_007595442.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii D1279779]
 gb|EGU01074.1| Biofilm PGA synthesis lipoprotein pgaB precursor [Acinetobacter 
baumannii ABNIH3]
 gb|AGH34781.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii D1279779]
 gb|EXA82367.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 1202252]
 gb|EXC56400.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 1032241]
 gb|EXC65659.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 1040094]
 gb|EXD03245.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 1075025]
 gb|EXD45774.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 562700]
 gb|EXD97432.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 942194]
 gb|EXE55097.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 43926]
 gb|EXE85086.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 42887]
 gb|EXQ88519.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 1058283]
 gb|EYD30770.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 25493_9]
 gb|EYD38909.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 25493_8]
 gb|EYD46489.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 25493_6]
 gb|EYD48411.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 25493_5]
 gb|EYD51829.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 25493_4]
 gb|EYD59456.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 25493_3]
 gb|EYD59742.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 25493_2]
 gb|EYD63583.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 25493_1]
 gb|EYD68318.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 25493_10]
 gb|EYR87427.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 45052_1]
 gb|EYR93158.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 25569_5]
 gb|EYS19630.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 25569_3]
 gb|EYS34212.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 45052_5]
 gb|EYS34682.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 45052_3]
 gb|EYS45584.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 25569_4]
 gb|EYS46498.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 25569_2]
 gb|EYS52334.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 25569_1]
 gb|EYS54430.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 16553_10]
 gb|EYS60818.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 16553_9]
 gb|EYS65186.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 16553_8]
 gb|EYS66732.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 16553_6]
 gb|EYS70559.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 16553_4]
 gb|EYS76627.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 16553_2]
 gb|EYS78488.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 16553_3]
 gb|EYT43275.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 1039621]
 gb|EZI41153.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 45052_4]
 gb|EZI62978.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 25569_9]
 gb|EZI68751.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 25569_8]
 gb|KCW02542.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 45075_1]
 gb|KCW10121.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 45075_2]
 gb|KCW13443.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 45075_3]
 gb|KCW35018.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 45075_5]
 gb|KCW40671.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 45075_6]
 gb|KCX05864.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 45075_8]
 gb|KCX08979.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 45075_9]
 gb|KCX48975.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 25569_10]
 gb|KCX71314.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 45075_10]
 gb|KCY94683.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 929679-598]
 gb|KCZ24515.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 45052_2]
Length=664

 Score = 81.6 bits (200),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 37/37 (100%), Positives = 37/37 (100%), Gaps = 0/37 (0%)
 Frame = -2

Query  113  QQGAMHVAYYPDDPIKDHPDVNVMHKAFAEKSSRLVP  3
            QQGAMHVAYYPDDPIKDHPDVNVMHKAFAEKSSRLVP
Sbjct  628  QQGAMHVAYYPDDPIKDHPDVNVMHKAFAEKSSRLVP  664



>ref|WP_032068379.1| polysaccharide deacetylase [Acinetobacter baumannii]
 gb|EXC51289.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 99063]
Length=664

 Score = 81.6 bits (200),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 37/37 (100%), Positives = 37/37 (100%), Gaps = 0/37 (0%)
 Frame = -2

Query  113  QQGAMHVAYYPDDPIKDHPDVNVMHKAFAEKSSRLVP  3
            QQGAMHVAYYPDDPIKDHPDVNVMHKAFAEKSSRLVP
Sbjct  628  QQGAMHVAYYPDDPIKDHPDVNVMHKAFAEKSSRLVP  664



>ref|WP_000632825.1| polysaccharide deacetylase [Acinetobacter baumannii]
 gb|EKA75622.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii IS-58]
 gb|EKK06570.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii Naval-72]
 gb|EKK09810.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii IS-235]
 gb|EKK19151.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii IS-251]
 gb|EKP42997.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii OIFC111]
 gb|EKP68341.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii OIFC035]
 gb|ELW88860.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii AA-014]
 gb|ELX06976.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii Naval-57]
 gb|ENV29324.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii NIPH 60]
 gb|ENW49974.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii NIPH 601]
 gb|ERH66422.1| polysaccharide deacetylase [Acinetobacter baumannii EGD-HP18]
 gb|ETQ83809.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii UH5207]
 gb|EXA62651.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 1035119]
 gb|EXB06789.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 1295743]
 gb|EXB34203.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 1419130]
 gb|EXB41818.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 1461963]
 gb|EXB82718.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 299505]
 gb|EXC02242.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 342950]
 gb|EXD25410.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 29280]
 gb|EXE07971.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 1096934]
 gb|EXE74061.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 144107]
 gb|EXE86302.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 532279]
 gb|EXF22058.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 831240]
 gb|EXG15620.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 472237-120]
 gb|EXH13818.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 1188188]
 gb|EXH19509.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 1271213]
 gb|EXH27432.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 1237893]
 gb|EXH88074.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 318814]
 gb|EXI07753.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 480175]
 gb|EXR40653.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 1276470-86]
 gb|EXR90338.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 277047]
 gb|EXS38577.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 426863]
 gb|EXS59406.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 1406589]
 gb|EYT39310.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 1121032]
 gb|EZI45822.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 42057_6]
 gb|KCW22061.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 42057_4]
 gb|KCX12819.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 45075_4]
 gb|KCX75758.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 855125]
 gb|KCX85346.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 940793]
 gb|KCY23474.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 233846]
 gb|KCZ20610.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 42057_3]
 gb|KCZ26977.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 42057_5]
 gb|KGF59177.1| polysaccharide deacetylase [Acinetobacter baumannii]
 dbj|BAP67662.1| biofilm PGA synthesis deacetylase PgaB [Acinetobacter baumannii]
 gb|KGP66634.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii AB5075]
 gb|KHV66062.1| polysaccharide deacetylase [Acinetobacter baumannii]
 gb|KIA17968.1| polysaccharide deacetylase [Acinetobacter baumannii]
Length=664

 Score = 81.6 bits (200),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 37/37 (100%), Positives = 37/37 (100%), Gaps = 0/37 (0%)
 Frame = -2

Query  113  QQGAMHVAYYPDDPIKDHPDVNVMHKAFAEKSSRLVP  3
            QQGAMHVAYYPDDPIKDHPDVNVMHKAFAEKSSRLVP
Sbjct  628  QQGAMHVAYYPDDPIKDHPDVNVMHKAFAEKSSRLVP  664



>ref|WP_000632823.1| polysaccharide deacetylase [Acinetobacter baumannii]
 ref|YP_001845559.1| xylanase/chitin deacetylase [Acinetobacter baumannii ACICU]
 ref|YP_002318405.1| polysaccharide deacetylase [Acinetobacter baumannii AB0057]
 ref|YP_002326570.1| Biofilm PGA synthesis lipoprotein pgaB precursor [Acinetobacter 
baumannii AB307-0294]
 ref|YP_005513497.1| xylanase/chitin deacetylase [Acinetobacter baumannii 1656-2]
 ref|YP_005524996.1| xylanase/chitin deacetylase [Acinetobacter baumannii MDR-ZJ06]
 ref|YP_005797925.1| putative lipoprotein (hemin storage system) (HmsF) [Acinetobacter 
baumannii TCDC-AB0715]
 ref|YP_006290758.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii MDR-TJ]
 ref|YP_006847560.1| lipoprotein HmsF [Acinetobacter baumannii TYTH-1]
 ref|YP_008208497.1| putative xylanase/chitin deacetylase [Acinetobacter baumannii 
BJAB07104]
 ref|YP_008212373.1| putative xylanase/chitin deacetylase [Acinetobacter baumannii 
BJAB0868]
 ref|YP_008891461.1| Biofilm PGA synthesis lipoprotein pgaB precursor [Acinetobacter 
baumannii ZW85-1]
 gb|ACC56212.1| predicted xylanase/chitin deacetylase [Acinetobacter baumannii 
ACICU]
 gb|ACJ40806.1| polysaccharide deacetylase [Acinetobacter baumannii AB0057]
 gb|ACJ59081.1| Biofilm PGA synthesis lipoprotein pgaB precursor [Acinetobacter 
baumannii AB307-0294]
 gb|ADX02559.1| xylanase/chitin deacetylase [Acinetobacter baumannii 1656-2]
 gb|ADX91465.1| putative lipoprotein (hemin storage system) (HmsF) [Acinetobacter 
baumannii TCDC-AB0715]
 gb|EGJ59377.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 6013150]
 gb|EGJ63174.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 6013113]
 gb|EGJ69798.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 6014059]
 gb|EGK48264.1| xylanase/chitin deacetylase [Acinetobacter baumannii AB210]
 gb|EGT95820.1| Biofilm PGA synthesis lipoprotein pgaB precursor [Acinetobacter 
baumannii ABNIH1]
 gb|EGT98126.1| Biofilm PGA synthesis lipoprotein pgaB precursor [Acinetobacter 
baumannii ABNIH2]
 gb|AEP05500.1| xylanase/chitin deacetylase [Acinetobacter baumannii MDR-ZJ06]
 gb|AFI96463.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii MDR-TJ]
 gb|EJG17536.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii OIFC189]
 gb|EJG30490.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii Naval-17]
 gb|EJO40766.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii Canada BC-5]
 gb|EKA63167.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii IS-116]
 gb|EKA63865.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii IS-143]
 gb|EKB37033.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii Ab11111]
 gb|EKB42726.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii Ab44444]
 gb|EKE64711.1| xylanase/chitin deacetylase [Acinetobacter baumannii ZWS1122]
 gb|EKE64988.1| xylanase/chitin deacetylase [Acinetobacter baumannii ZWS1219]
 gb|AFU37329.1| lipoprotein HmsF [Acinetobacter baumannii TYTH-1]
 gb|EKL40869.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii OIFC180]
 gb|EKL45730.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii OIFC074]
 gb|EKL54679.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii Naval-83]
 gb|EKP35569.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii OIFC065]
 gb|EKP52465.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii Naval-21]
 gb|EKP57044.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii Canada BC1]
 gb|EKP64740.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii Naval-82]
 gb|EKU64943.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii Naval-113]
 gb|ELW77175.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii WC-A-92]
 gb|ELX02086.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii OIFC338]
 gb|ELX03064.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii Naval-78]
 gb|EME59687.1| lipoprotein HmsF [Acinetobacter baumannii MSP4-16]
 gb|EMT87232.1| lipoprotein HmsF [Acinetobacter baumannii ABNIH26]
 gb|EMT88185.1| lipoprotein HmsF [Acinetobacter baumannii ABNIH25]
 gb|EMT91570.1| lipoprotein HmsF [Acinetobacter baumannii ABNIH5]
 gb|EMT96591.1| lipoprotein HmsF [Acinetobacter baumannii ABNIH6]
 gb|EMT99308.1| lipoprotein HmsF [Acinetobacter baumannii ABNIH7]
 gb|EMU04019.1| lipoprotein HmsF [Acinetobacter baumannii ABNIH11]
 gb|EMU12282.1| lipoprotein HmsF [Acinetobacter baumannii ABNIH13]
 gb|EMU16041.1| lipoprotein HmsF [Acinetobacter baumannii ABNIH14]
 gb|EMU22710.1| lipoprotein HmsF [Acinetobacter baumannii ABNIH15]
 gb|EMU24487.1| lipoprotein HmsF [Acinetobacter baumannii ABNIH16]
 gb|EMU29600.1| lipoprotein HmsF [Acinetobacter baumannii ABNIH19]
 gb|EMU33638.1| lipoprotein HmsF [Acinetobacter baumannii ABNIH18]
 gb|EMU36232.1| lipoprotein HmsF [Acinetobacter baumannii ABNIH17]
 gb|EMU43412.1| lipoprotein HmsF [Acinetobacter baumannii ABNIH22]
 gb|EMU45104.1| lipoprotein HmsF [Acinetobacter baumannii ABNIH20]
 gb|EMU47240.1| lipoprotein HmsF [Acinetobacter baumannii ABNIH23]
 gb|EMU52004.1| lipoprotein HmsF [Acinetobacter baumannii ABNIH24]
 gb|ENU12304.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii NIPH 24]
 gb|ENU74389.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii NIPH 2061]
 gb|ENW34224.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii NIPH 201]
 gb|ENW36089.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii NIPH 527]
 gb|ENW48973.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii NIPH 67]
 gb|ENW57940.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii NIPH 528]
 gb|ENW62430.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii NIPH 290]
 gb|ENW67377.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii NIPH 80]
 gb|ENW70839.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii ANC 4097]
 gb|ENW74487.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii ATCC 19606 = CIP 70.34]
 gb|EPG36393.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii NIPH 410]
 gb|AGQ13402.1| putative xylanase/chitin deacetylase [Acinetobacter baumannii 
BJAB07104]
 gb|AGQ09598.1| putative xylanase/chitin deacetylase [Acinetobacter baumannii 
BJAB0868]
 gb|EPS77537.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 1605]
 gb|AHB92328.1| Biofilm PGA synthesis lipoprotein pgaB precursor [Acinetobacter 
baumannii ZW85-1]
 gb|ETP77788.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii UH0707]
 gb|ETP77954.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii UH0207]
 gb|ETP78271.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii UH0807]
 gb|ETP87105.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii UH1007]
 gb|ETP89044.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii UH10007]
 gb|ETP90898.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii UH10107]
 gb|ETP98005.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii UH11608]
 gb|ETQ00804.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii UH10707]
 gb|ETQ07553.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii UH12408]
 gb|ETQ11727.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii UH12308]
 gb|ETQ16534.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii UH13908]
 gb|ETQ16805.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii UH12808]
 gb|ETQ30441.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii UH16008]
 gb|ETQ30978.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii UH15208]
 gb|ETQ34224.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii UH14508]
 gb|ETQ40496.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii UH16108]
 gb|ETQ41730.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii UH18608]
 gb|ETQ48720.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii UH19908]
 gb|ETQ61037.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii UH20108]
 gb|ETQ61615.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii UH2707]
 gb|ETQ69163.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii UH2307]
 gb|ETQ75486.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii UH2907]
 gb|ETQ85985.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii UH5307]
 gb|ETQ86089.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii UH6107]
 gb|ETQ89638.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii UH5707]
 gb|ETQ97219.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii UH6207]
 gb|ETR10969.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii UH7007]
 gb|ETR12774.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii UH7707]
 gb|ETR13687.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii UH7807]
 gb|ETR28145.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii UH8707]
 gb|ETR28854.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii UH8107]
 gb|ETR30821.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii UH8407]
 gb|ETR40454.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii UH9707]
 gb|ETR40710.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii UH8807]
 gb|ETR47647.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii UH9007]
 gb|ETR48314.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii UH9907]
 gb|ETR53862.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii UH9907]
 gb|ETR56363.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii UH10707]
 gb|ETR59871.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii UH8907]
 gb|ETR90887.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii CI77]
 gb|ETS69181.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii UH3807]
 gb|ETS72306.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii UH2107]
 gb|ETY70257.1| polysaccharide deacetylase [Acinetobacter baumannii MDR_MMC4]
 gb|AHJ92459.1| polysaccharide deacetylase [Acinetobacter baumannii PKAB07]
 gb|EXA82275.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 1159076]
 gb|EXB02115.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 1294217]
 gb|EXB14369.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 1397084]
 gb|EXB50125.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 1440422]
 gb|EXB59721.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 1465485]
 gb|EXB64960.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 1462234]
 gb|EXB98752.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 400834]
 gb|EXC15052.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 647609]
 gb|EXC18161.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 4749]
 gb|EXC23750.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 724909]
 gb|EXC43008.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 17534]
 gb|EXC49323.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 1031433]
 gb|EXC69243.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 1036938]
 gb|EXC75598.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 1042969-1265]
 gb|EXC82700.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 1046051]
 gb|EXC84892.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 1043903]
 gb|EXC91000.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 1051176]
 gb|EXD05250.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 1247182]
 gb|EXD10837.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 1289546]
 gb|EXD20317.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 136706]
 gb|EXD39307.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 34001]
 gb|EXD45401.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 532413]
 gb|EXD49793.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 564012]
 gb|EXD60603.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 653020]
 gb|EXD61673.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 796380-2102]
 gb|EXD67057.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 58452]
 gb|EXD71962.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 662545-1347]
 gb|EXD75858.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 929679-2095]
 gb|EXD79507.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 942133]
 gb|EXD83456.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 947299]
 gb|EXD87238.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 993520]
 gb|EXD99362.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 959073]
 gb|EXE04755.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 1291820]
 gb|EXE12193.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 1277411]
 gb|EXE35497.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 1440750]
 gb|EXE42786.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 1526966]
 gb|EXE48042.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 554515]
 gb|EXE64442.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 1552865]
 gb|EXF08593.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 1575710]
 gb|EXF17231.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 1593273]
 gb|EXF65829.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 1552818]
 gb|EXG00788.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 1552389]
 gb|EXG04216.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 1488685]
 gb|EXG08253.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 1426993]
 gb|EXG22289.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 470922]
 gb|EXG22752.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 458282]
 gb|EXG27810.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 323408]
 gb|EXG39605.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 24860_8]
 gb|EXG46668.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 24860_4]
 gb|EXG49070.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 24860_7]
 gb|EXG50895.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 24860_2]
 gb|EXG59084.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 24812_6]
 gb|EXG62988.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 24860_10]
 gb|EXG63323.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 24812_4]
 gb|EXG69504.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 7893]
 gb|EXG72121.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 24812_10]
 gb|EXG76589.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 1296252]
 gb|EXG96434.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 1022959]
 gb|EXH07249.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 1178044]
 gb|EXH23102.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 1271651]
 gb|EXH40290.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 1207552]
 gb|EXH45951.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 1264936]
 gb|EXH49407.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 1412924]
 gb|EXH61783.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 1471012]
 gb|EXH64716.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 1482820]
 gb|EXH70750.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 1475764]
 gb|EXH81030.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 23671]
 gb|EXH82662.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 273929]
 gb|EXH93222.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 2887]
 gb|EXI20808.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 655555]
 gb|EXI24341.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 737393]
 gb|EXI28155.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 825610]
 gb|EXI32184.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 836190]
 gb|EXI39125.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 846928]
 gb|EXI40122.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 923118]
 gb|EXI44254.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 1045092]
 gb|EXI48712.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 73736]
 gb|EXI52723.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 10519]
 gb|EXI56579.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 1287985]
 gb|EXQ94814.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 11126]
 gb|EXR00883.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 1237202]
 gb|EXR04154.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 1262761-97]
 gb|EXR06559.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 1117819]
 gb|EXR16101.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 1232509]
 gb|EXR27657.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 1266220]
 gb|EXR53684.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 1397513]
 gb|EXR58261.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 1392509]
 gb|EXR62653.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 1406182]
 gb|EXR77316.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 339786]
 gb|EXR85785.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 466215]
 gb|EXR96843.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 145660]
 gb|EXS03834.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 1494580]
 gb|EXS08243.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 303002]
 gb|EXS13232.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 628418]
 gb|EXS19216.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 755829]
 gb|EXS31999.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 730795]
 gb|EXS43100.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 213697]
 gb|EXS51327.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 981176]
 gb|EXS55305.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 98826]
 gb|EXS62274.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 70136]
 gb|EXS66410.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 25307_1]
 gb|EXS75287.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 45002_7]
 gb|EXS79018.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 45002_6]
 gb|EXS84096.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 45002_5]
 gb|EXS87055.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 45002_4]
 gb|EXS91458.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 45002_3]
 gb|EXS95466.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 45002_10]
 gb|EXT05312.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 45002_8]
 gb|EXT09037.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 44895_6]
 gb|EXT17170.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 44895_5]
 gb|EXT20024.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 44895_4]
 gb|EXT28023.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 44895_2]
 gb|EXT31336.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 44895_1]
 gb|EXT34766.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 44895_10]
 gb|EXT69453.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 25307_8]
 gb|EXT73769.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 25307_6]
 gb|EXT81279.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 25307_4]
 gb|EXT83609.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 25307_5]
 gb|EXT86327.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 25307_3]
 gb|EXT94414.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 25307_2]
 gb|EXU02429.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 25253_6]
 gb|EXU08391.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 25253_4]
 gb|EXU14032.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 25253_3]
 gb|EXU19092.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 25253_1]
 gb|EXU21943.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 25253_10]
 gb|EXU28536.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 24845_7]
 gb|EXU29560.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 24845_8]
 gb|EXU34958.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 24845_9]
 gb|EXU38696.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 24845_5]
 gb|EXU43638.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 24845_6]
 gb|EXU45639.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 24845_4]
 gb|EXU50353.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 24845_3]
 gb|EXU54289.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 24845_1]
 gb|EXU57900.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 24845_10]
 gb|EXV11609.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 25561_2]
 gb|EXV15218.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 25561_1]
 gb|EXV17763.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 25561_7]
 gb|EXV22737.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 24975_9]
 gb|EXV24322.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 24975_7]
 gb|EXV29281.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 24975_4]
 gb|EXV35268.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 25935_10]
 gb|EXV39779.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 24975_1]
 gb|EXV44208.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 24975_5]
 gb|EXV47292.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 25935_9]
 gb|EXV50922.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 25935_8]
 gb|EXV54672.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 25935_7]
 gb|EXV57934.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 25935_6]
 gb|EXV64519.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 25935_2]
 gb|EXV67421.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 25935_5]
 gb|EXV71559.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 25935_4]
 gb|EXV74535.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 25935_1]
 gb|EXV78704.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 25691_10]
 gb|EXV84660.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 25691_9]
 gb|EXV85448.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 25691_6]
 gb|EXV92405.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 25691_2]
 gb|EXV95110.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 25691_1]
 gb|EXV98670.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 25766_10]
 gb|EXW03959.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 25766_7]
 gb|EXW08488.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 25766_9]
 gb|EXW10544.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 25766_6]
 gb|EXW16138.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 25766_5]
 gb|EXW19603.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 25766_4]
 gb|EXW24383.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 25766_3]
 gb|EXW27241.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 25766_2]
 gb|EXW31353.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 25561_10]
 gb|EXW37359.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 25766_1]
 gb|EXW42780.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 44327_6]
 gb|EXW45788.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 44857_10]
 gb|EXW48238.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 44857_9]
 gb|EXW55368.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 44467_9]
 gb|EXW57319.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 44467_8]
 gb|EXW59904.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 44467_7]
 gb|EXW65596.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 44467_6]
 gb|EXW69545.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 44467_5]
 gb|EXW71796.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 44467_4]
 gb|EXW79811.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 44467_3]
 gb|EXW80340.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 44467_2]
 gb|EXW85069.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 44467_1]
 gb|EXW96704.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 44327_7]
 gb|EXX06038.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 44327_4]
 gb|EXX09177.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 44327_2]
 gb|EXX14000.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 44327_1]
 gb|EXX17718.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 25750_7]
 gb|EXX21122.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 25750_8]
 gb|EXX27541.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 25750_6]
 gb|EXX28389.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 25681_9]
 gb|EXX32890.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 25681_8]
 gb|EXX38938.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 25681_5]
 gb|EXX42095.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 25681_6]
 gb|EXX44732.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 25681_3]
 gb|EXX49048.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 25681_2]
 gb|EYC56545.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 44437_7]
 gb|EYC61144.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 44437_8]
 gb|EYC67849.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 44437_5]
 gb|EYC72773.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 44437_4]
 gb|EYC72886.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 44437_3]
 gb|EYC84894.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 44362_8]
 gb|EYC87996.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 44362_7]
 gb|EYC93783.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 44362_5]
 gb|EYC98084.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 44362_6]
 gb|EYD00167.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 44362_4]
 gb|EYD10555.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 44362_3]
 gb|EYD12490.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 44362_2]
 gb|EYD18147.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 44362_10]
 gb|EYD21809.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 43557_1]
 gb|EYD23789.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 25878_3]
 gb|EYD31584.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 25878_1]
 gb|EYD39995.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 25878_2]
 gb|EYR97421.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 26016_8]
 gb|EYR99912.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 45057_4]
 gb|EYS03618.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 26016_5]
 gb|EYS07386.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 25569_6]
 gb|EYS12605.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 26016_10]
 gb|EYS24949.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 26016_6]
 gb|EYS28083.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 26016_1]
 gb|EYS40256.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 26016_4]
 gb|EYS81543.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 16553_1]
 gb|EYU48426.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 1457504]
 gb|EYU54266.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 1428368]
 gb|EZF20893.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii R1B]
 gb|EZI49179.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 25442_9]
 gb|EZI53383.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 42057_2]
 gb|EZI72309.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 44298_10]
 gb|EZI76023.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 44298_9]
 gb|EZI81372.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 44298_7]
 gb|EZI84569.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 44298_6]
 gb|EZI87529.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 44298_4]
 gb|EZI92784.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 44298_2]
 gb|EZI95785.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 44298_1]
 gb|EZI99864.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 26016_9]
 gb|EZJ08256.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 24975_10]
 gb|EZJ11079.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 24860_6]
 gb|EZJ17626.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 24860_1]
 gb|AHX28547.1| polysaccharide deacetylase [Acinetobacter baumannii AC12]
 gb|AHX65904.1| polysaccharide deacetylase [Acinetobacter baumannii AC30]
 gb|KCV87687.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 44298_5]
 gb|KCV88241.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 44298_3]
 gb|KCV96115.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 44298_8]
 gb|KCV97485.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 44839_8]
 gb|KCW06516.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 44839_9]
 gb|KCW18325.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 25442_1]
 gb|KCW25237.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 1064293_46]
 gb|KCW29578.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 6935]
 gb|KCW43315.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 1032359]
 gb|KCX20707.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 1539026]
 gb|KCX26149.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 18689]
 gb|KCX32038.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 916567]
 gb|KCX33470.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 96512]
 gb|KCX41342.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 987421]
 gb|KCX44894.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 24812_2]
 gb|KCX55162.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 135867]
 gb|KCX67245.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 1146103]
 gb|KCX91235.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 15827]
 gb|KCY07883.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 23037]
 gb|KCY15228.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 1284800]
 gb|KCY19925.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 21072]
 gb|KCY32724.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 1042969-1197]
 gb|KCY41499.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 1276470-132]
 gb|KCY44469.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 1505311]
 gb|KCY54930.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 24812_8]
 gb|KCY58698.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 24860_3]
 gb|KCY63612.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 24860_5]
 gb|KCY68445.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 24860_9]
 gb|KCY79090.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 756476]
 gb|KCY82137.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 24812_7]
 gb|KCY87382.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 25691_5]
 gb|KCY96305.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 25750_1]
 gb|KCZ00870.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 25691_8]
 gb|KCZ08249.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 26016_2]
 gb|KCZ09803.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 26016_3]
 gb|KCZ15015.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 26016_7]
 gb|KCZ36018.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 45057_1]
 gb|KCZ40330.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 45002_9]
 gb|KCZ44850.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 25691_7]
 gb|KDF11028.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumanii BIDMC 56]
 gb|AIA52395.1| polysaccharide deacetylase [Acinetobacter baumannii]
 gb|KFB64223.1| polysaccharide deacetylase [Acinetobacter baumannii]
 gb|KFC03884.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii ATCC 19606 = CIP 70.34]
 gb|KGB49454.1| Biofilm PGA synthesis deacetylase PgaB [Acinetobacter baumannii 
DU202]
 gb|KHT70575.1| polysaccharide deacetylase [Acinetobacter baumannii]
 gb|KHT76929.1| polysaccharide deacetylase [Acinetobacter baumannii]
 gb|KHT78396.1| polysaccharide deacetylase [Acinetobacter baumannii]
 gb|KHT88060.1| polysaccharide deacetylase [Acinetobacter baumannii]
 gb|KHT88983.1| polysaccharide deacetylase [Acinetobacter baumannii]
 gb|KHT90363.1| polysaccharide deacetylase [Acinetobacter baumannii]
 gb|KHT90813.1| polysaccharide deacetylase [Acinetobacter baumannii]
 gb|KHT94425.1| polysaccharide deacetylase [Acinetobacter baumannii]
 gb|KHV01898.1| polysaccharide deacetylase [Acinetobacter baumannii]
 gb|KHV06211.1| polysaccharide deacetylase [Acinetobacter baumannii]
 gb|KHV14066.1| polysaccharide deacetylase [Acinetobacter baumannii]
 gb|KHV15357.1| polysaccharide deacetylase [Acinetobacter baumannii]
 gb|KHV17374.1| polysaccharide deacetylase [Acinetobacter baumannii]
 gb|KHV19172.1| polysaccharide deacetylase [Acinetobacter baumannii]
 gb|KHV20570.1| polysaccharide deacetylase [Acinetobacter baumannii]
 gb|KHV31813.1| polysaccharide deacetylase [Acinetobacter baumannii]
 gb|KHV36698.1| polysaccharide deacetylase [Acinetobacter baumannii]
 gb|KHV38884.1| polysaccharide deacetylase [Acinetobacter baumannii]
 gb|KHV47454.1| polysaccharide deacetylase [Acinetobacter baumannii]
 gb|KHV48625.1| polysaccharide deacetylase [Acinetobacter baumannii]
 gb|KHV50502.1| polysaccharide deacetylase [Acinetobacter baumannii]
 gb|KHV54459.1| polysaccharide deacetylase [Acinetobacter baumannii]
 gb|KHV59299.1| polysaccharide deacetylase [Acinetobacter baumannii]
 gb|KHV61978.1| polysaccharide deacetylase [Acinetobacter baumannii]
 gb|KHV71025.1| polysaccharide deacetylase [Acinetobacter baumannii]
 gb|KHV72592.1| polysaccharide deacetylase [Acinetobacter baumannii]
 gb|KHV77700.1| polysaccharide deacetylase [Acinetobacter baumannii]
 gb|KHV78093.1| polysaccharide deacetylase [Acinetobacter baumannii]
 gb|KHV85119.1| polysaccharide deacetylase [Acinetobacter baumannii]
 gb|KHV98665.1| polysaccharide deacetylase [Acinetobacter baumannii]
 gb|KHV99733.1| polysaccharide deacetylase [Acinetobacter baumannii]
 gb|KHW01229.1| polysaccharide deacetylase [Acinetobacter baumannii]
 gb|KHW05554.1| polysaccharide deacetylase [Acinetobacter baumannii]
 gb|KHW07594.1| polysaccharide deacetylase [Acinetobacter baumannii]
 gb|KHW19396.1| polysaccharide deacetylase [Acinetobacter baumannii]
 gb|KHW19777.1| polysaccharide deacetylase [Acinetobacter baumannii]
 gb|KHW23644.1| polysaccharide deacetylase [Acinetobacter baumannii]
 gb|KHW28232.1| polysaccharide deacetylase [Acinetobacter baumannii]
 gb|KHW30752.1| polysaccharide deacetylase [Acinetobacter baumannii]
 gb|KHW35023.1| polysaccharide deacetylase [Acinetobacter baumannii]
 gb|KHW38120.1| polysaccharide deacetylase [Acinetobacter baumannii]
 gb|KHW45426.1| polysaccharide deacetylase [Acinetobacter baumannii]
 gb|KHW45503.1| polysaccharide deacetylase [Acinetobacter baumannii]
 gb|KHW51976.1| polysaccharide deacetylase [Acinetobacter baumannii]
 gb|KHW55130.1| polysaccharide deacetylase [Acinetobacter baumannii]
 gb|KHW57212.1| polysaccharide deacetylase [Acinetobacter baumannii]
 gb|KHW62919.1| polysaccharide deacetylase [Acinetobacter baumannii]
 gb|KHW64492.1| polysaccharide deacetylase [Acinetobacter baumannii]
 gb|KHW73107.1| polysaccharide deacetylase [Acinetobacter baumannii]
 gb|KHW90691.1| polysaccharide deacetylase [Acinetobacter baumannii]
 gb|KHW91490.1| polysaccharide deacetylase [Acinetobacter baumannii]
 gb|KHW97993.1| polysaccharide deacetylase [Acinetobacter baumannii]
 gb|KHX02101.1| polysaccharide deacetylase [Acinetobacter baumannii]
 gb|KHX06036.1| polysaccharide deacetylase [Acinetobacter baumannii]
 gb|KHX06581.1| polysaccharide deacetylase [Acinetobacter baumannii]
 gb|KHX16908.1| polysaccharide deacetylase [Acinetobacter baumannii]
 gb|KHX19263.1| polysaccharide deacetylase [Acinetobacter baumannii]
 gb|KHX21372.1| polysaccharide deacetylase [Acinetobacter baumannii]
 gb|KHX26736.1| polysaccharide deacetylase [Acinetobacter baumannii]
 gb|KHX30494.1| polysaccharide deacetylase [Acinetobacter baumannii]
 gb|KHX40210.1| polysaccharide deacetylase [Acinetobacter baumannii]
 gb|KHX40456.1| polysaccharide deacetylase [Acinetobacter baumannii]
 gb|KHX43072.1| polysaccharide deacetylase [Acinetobacter baumannii]
 gb|KHX48702.1| polysaccharide deacetylase [Acinetobacter baumannii]
 gb|KHX52976.1| polysaccharide deacetylase [Acinetobacter baumannii]
 gb|KHX55317.1| polysaccharide deacetylase [Acinetobacter baumannii]
 gb|KHX61162.1| polysaccharide deacetylase [Acinetobacter baumannii]
 gb|KHX64098.1| polysaccharide deacetylase [Acinetobacter baumannii]
 gb|KHX67566.1| polysaccharide deacetylase [Acinetobacter baumannii]
 gb|KHX73347.1| polysaccharide deacetylase [Acinetobacter baumannii]
 gb|KHX74302.1| polysaccharide deacetylase [Acinetobacter baumannii]
 gb|KHX76198.1| polysaccharide deacetylase [Acinetobacter baumannii]
 gb|KHX83071.1| polysaccharide deacetylase [Acinetobacter baumannii]
 gb|KHX86078.1| polysaccharide deacetylase [Acinetobacter baumannii]
 gb|KHX91426.1| polysaccharide deacetylase [Acinetobacter baumannii]
 gb|KHX94884.1| polysaccharide deacetylase [Acinetobacter baumannii]
 gb|KHX97013.1| polysaccharide deacetylase [Acinetobacter baumannii]
 gb|KHY00361.1| polysaccharide deacetylase [Acinetobacter baumannii]
 gb|KHY06916.1| polysaccharide deacetylase [Acinetobacter baumannii]
 gb|KHY07505.1| polysaccharide deacetylase [Acinetobacter baumannii]
 gb|KHY09657.1| polysaccharide deacetylase [Acinetobacter baumannii]
 gb|KHY11532.1| polysaccharide deacetylase [Acinetobacter baumannii]
 gb|KHY19252.1| polysaccharide deacetylase [Acinetobacter baumannii]
 gb|KHY20450.1| polysaccharide deacetylase [Acinetobacter baumannii]
 gb|KHY29373.1| polysaccharide deacetylase [Acinetobacter baumannii]
 gb|KHY31621.1| polysaccharide deacetylase [Acinetobacter baumannii]
 gb|KHY35629.1| polysaccharide deacetylase [Acinetobacter baumannii]
 gb|KHY37350.1| polysaccharide deacetylase [Acinetobacter baumannii]
 gb|KHY40189.1| polysaccharide deacetylase [Acinetobacter baumannii]
 gb|KHY45657.1| polysaccharide deacetylase [Acinetobacter baumannii]
 gb|KHY48133.1| polysaccharide deacetylase [Acinetobacter baumannii]
 gb|KHY55485.1| polysaccharide deacetylase [Acinetobacter baumannii]
 gb|KHY61176.1| polysaccharide deacetylase [Acinetobacter baumannii]
 gb|KHY64272.1| polysaccharide deacetylase [Acinetobacter baumannii]
 gb|KHY64455.1| polysaccharide deacetylase [Acinetobacter baumannii]
 gb|KHY65715.1| polysaccharide deacetylase [Acinetobacter baumannii]
 gb|KHY73724.1| polysaccharide deacetylase [Acinetobacter baumannii]
 gb|KHY78245.1| polysaccharide deacetylase [Acinetobacter baumannii]
 gb|KHY78880.1| polysaccharide deacetylase [Acinetobacter baumannii]
 gb|KHY89809.1| polysaccharide deacetylase [Acinetobacter baumannii]
 gb|KHZ03177.1| polysaccharide deacetylase [Acinetobacter baumannii]
 gb|KHZ07091.1| polysaccharide deacetylase [Acinetobacter baumannii]
 gb|KHZ10979.1| polysaccharide deacetylase [Acinetobacter baumannii]
 gb|KHZ14555.1| polysaccharide deacetylase [Acinetobacter baumannii]
 gb|KHZ19738.1| polysaccharide deacetylase [Acinetobacter baumannii]
 gb|KHZ20172.1| polysaccharide deacetylase [Acinetobacter baumannii]
 gb|KHZ24318.1| polysaccharide deacetylase [Acinetobacter baumannii]
 gb|KHZ28544.1| polysaccharide deacetylase [Acinetobacter baumannii]
 gb|KHZ30131.1| polysaccharide deacetylase [Acinetobacter baumannii]
 gb|KHZ37977.1| polysaccharide deacetylase [Acinetobacter baumannii]
 gb|KHZ40436.1| polysaccharide deacetylase [Acinetobacter baumannii]
 gb|KHZ41830.1| polysaccharide deacetylase [Acinetobacter baumannii]
 gb|KHZ47275.1| polysaccharide deacetylase [Acinetobacter baumannii]
 gb|KHZ51662.1| polysaccharide deacetylase [Acinetobacter baumannii]
 gb|KHZ57678.1| polysaccharide deacetylase [Acinetobacter baumannii]
 gb|KHZ57917.1| polysaccharide deacetylase [Acinetobacter baumannii]
 gb|KHZ60363.1| polysaccharide deacetylase [Acinetobacter baumannii]
 gb|KHZ63360.1| polysaccharide deacetylase [Acinetobacter baumannii]
 gb|KHZ68216.1| polysaccharide deacetylase [Acinetobacter baumannii]
 gb|KHZ69764.1| polysaccharide deacetylase [Acinetobacter baumannii]
 gb|KHZ74660.1| polysaccharide deacetylase [Acinetobacter baumannii]
 gb|KHZ77685.1| polysaccharide deacetylase [Acinetobacter baumannii]
 gb|KHZ78127.1| polysaccharide deacetylase [Acinetobacter baumannii]
 gb|KHZ84540.1| polysaccharide deacetylase [Acinetobacter baumannii]
 gb|KHZ86948.1| polysaccharide deacetylase [Acinetobacter baumannii]
 gb|KHZ89655.1| polysaccharide deacetylase [Acinetobacter baumannii]
 gb|KHZ98810.1| polysaccharide deacetylase [Acinetobacter baumannii]
 gb|KIA07411.1| polysaccharide deacetylase [Acinetobacter baumannii]
 gb|KIA07611.1| polysaccharide deacetylase [Acinetobacter baumannii]
 gb|KIA09650.1| polysaccharide deacetylase [Acinetobacter baumannii]
 gb|KIA10589.1| polysaccharide deacetylase [Acinetobacter baumannii]
 gb|KIA20499.1| polysaccharide deacetylase [Acinetobacter baumannii]
 gb|KIA20865.1| polysaccharide deacetylase [Acinetobacter baumannii]
 gb|KIA29367.1| polysaccharide deacetylase [Acinetobacter baumannii]
 gb|KIA30635.1| polysaccharide deacetylase [Acinetobacter baumannii]
 gb|KIA35095.1| polysaccharide deacetylase [Acinetobacter baumannii]
 gb|KIA37869.1| polysaccharide deacetylase [Acinetobacter baumannii]
 gb|KIA45000.1| polysaccharide deacetylase [Acinetobacter baumannii]
 gb|KIA47747.1| polysaccharide deacetylase [Acinetobacter baumannii]
 gb|KIA53877.1| polysaccharide deacetylase [Acinetobacter baumannii]
 gb|KIA56546.1| polysaccharide deacetylase [Acinetobacter baumannii]
Length=664

 Score = 81.6 bits (200),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 37/37 (100%), Positives = 37/37 (100%), Gaps = 0/37 (0%)
 Frame = -2

Query  113  QQGAMHVAYYPDDPIKDHPDVNVMHKAFAEKSSRLVP  3
            QQGAMHVAYYPDDPIKDHPDVNVMHKAFAEKSSRLVP
Sbjct  628  QQGAMHVAYYPDDPIKDHPDVNVMHKAFAEKSSRLVP  664



>ref|WP_031989941.1| polysaccharide deacetylase [Acinetobacter baumannii]
 gb|EYD07742.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 44362_1]
Length=664

 Score = 81.6 bits (200),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 37/37 (100%), Positives = 37/37 (100%), Gaps = 0/37 (0%)
 Frame = -2

Query  113  QQGAMHVAYYPDDPIKDHPDVNVMHKAFAEKSSRLVP  3
            QQGAMHVAYYPDDPIKDHPDVNVMHKAFAEKSSRLVP
Sbjct  628  QQGAMHVAYYPDDPIKDHPDVNVMHKAFAEKSSRLVP  664



>ref|WP_031969701.1| polysaccharide deacetylase [Acinetobacter baumannii]
 gb|EXT01343.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 44895_9]
 gb|EXT11549.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 44895_8]
 gb|EXT23220.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 44895_3]
 gb|EXW93833.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 44327_8]
 gb|EXX00641.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 44327_5]
 gb|EYC63845.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 44437_9]
 gb|EYC81246.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 44362_9]
 gb|EZJ04761.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 44839_10]
Length=664

 Score = 81.6 bits (200),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 37/37 (100%), Positives = 37/37 (100%), Gaps = 0/37 (0%)
 Frame = -2

Query  113  QQGAMHVAYYPDDPIKDHPDVNVMHKAFAEKSSRLVP  3
            QQGAMHVAYYPDDPIKDHPDVNVMHKAFAEKSSRLVP
Sbjct  628  QQGAMHVAYYPDDPIKDHPDVNVMHKAFAEKSSRLVP  664



>ref|WP_032043513.1| polysaccharide deacetylase [Acinetobacter baumannii]
 gb|EXD17020.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 1297]
Length=664

 Score = 81.6 bits (200),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 37/37 (100%), Positives = 37/37 (100%), Gaps = 0/37 (0%)
 Frame = -2

Query  113  QQGAMHVAYYPDDPIKDHPDVNVMHKAFAEKSSRLVP  3
            QQGAMHVAYYPDDPIKDHPDVNVMHKAFAEKSSRLVP
Sbjct  628  QQGAMHVAYYPDDPIKDHPDVNVMHKAFAEKSSRLVP  664



>ref|WP_038347472.1| polysaccharide deacetylase [Acinetobacter baumannii]
Length=664

 Score = 81.6 bits (200),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 37/37 (100%), Positives = 37/37 (100%), Gaps = 0/37 (0%)
 Frame = -2

Query  113  QQGAMHVAYYPDDPIKDHPDVNVMHKAFAEKSSRLVP  3
            QQGAMHVAYYPDDPIKDHPDVNVMHKAFAEKSSRLVP
Sbjct  628  QQGAMHVAYYPDDPIKDHPDVNVMHKAFAEKSSRLVP  664



>ref|WP_031950277.1| polysaccharide deacetylase [Acinetobacter baumannii]
 gb|EXR46185.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 1294222]
 gb|EXT90039.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 25253_8]
 gb|EXT98680.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 25253_7]
 gb|EXW91195.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 44467_10]
Length=664

 Score = 81.6 bits (200),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 37/37 (100%), Positives = 37/37 (100%), Gaps = 0/37 (0%)
 Frame = -2

Query  113  QQGAMHVAYYPDDPIKDHPDVNVMHKAFAEKSSRLVP  3
            QQGAMHVAYYPDDPIKDHPDVNVMHKAFAEKSSRLVP
Sbjct  628  QQGAMHVAYYPDDPIKDHPDVNVMHKAFAEKSSRLVP  664



>ref|WP_032047699.1| polysaccharide deacetylase [Acinetobacter baumannii]
 gb|EXR22033.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 1295549]
Length=664

 Score = 81.6 bits (200),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 37/37 (100%), Positives = 37/37 (100%), Gaps = 0/37 (0%)
 Frame = -2

Query  113  QQGAMHVAYYPDDPIKDHPDVNVMHKAFAEKSSRLVP  3
            QQGAMHVAYYPDDPIKDHPDVNVMHKAFAEKSSRLVP
Sbjct  628  QQGAMHVAYYPDDPIKDHPDVNVMHKAFAEKSSRLVP  664



>ref|WP_032049371.1| polysaccharide deacetylase [Acinetobacter baumannii]
 gb|EXH43100.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 1293320]
Length=664

 Score = 81.6 bits (200),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 37/37 (100%), Positives = 37/37 (100%), Gaps = 0/37 (0%)
 Frame = -2

Query  113  QQGAMHVAYYPDDPIKDHPDVNVMHKAFAEKSSRLVP  3
            QQGAMHVAYYPDDPIKDHPDVNVMHKAFAEKSSRLVP
Sbjct  628  QQGAMHVAYYPDDPIKDHPDVNVMHKAFAEKSSRLVP  664



>ref|WP_017393332.1| MULTISPECIES: polysaccharide deacetylase [Acinetobacter calcoaceticus/baumannii 
complex]
 gb|EXB70228.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 21871]
 gb|EXR64592.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 1424608]
Length=664

 Score = 80.5 bits (197),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 36/37 (97%), Positives = 37/37 (100%), Gaps = 0/37 (0%)
 Frame = -2

Query  113  QQGAMHVAYYPDDPIKDHPDVNVMHKAFAEKSSRLVP  3
            +QGAMHVAYYPDDPIKDHPDVNVMHKAFAEKSSRLVP
Sbjct  628  EQGAMHVAYYPDDPIKDHPDVNVMHKAFAEKSSRLVP  664



>ref|WP_034120252.1| polysaccharide deacetylase [Acinetobacter nosocomialis]
Length=664

 Score = 80.5 bits (197),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 36/37 (97%), Positives = 37/37 (100%), Gaps = 0/37 (0%)
 Frame = -2

Query  113  QQGAMHVAYYPDDPIKDHPDVNVMHKAFAEKSSRLVP  3
            +QGAMHVAYYPDDPIKDHPDVNVMHKAFAEKSSRLVP
Sbjct  628  EQGAMHVAYYPDDPIKDHPDVNVMHKAFAEKSSRLVP  664



>ref|WP_032047797.1| polysaccharide deacetylase [Acinetobacter baumannii]
 gb|EXE79115.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 1566109]
 gb|AJB49072.1| polysaccharide deacetylase [Acinetobacter baumannii]
Length=664

 Score = 80.5 bits (197),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 36/37 (97%), Positives = 37/37 (100%), Gaps = 0/37 (0%)
 Frame = -2

Query  113  QQGAMHVAYYPDDPIKDHPDVNVMHKAFAEKSSRLVP  3
            +QGAMHVAYYPDDPIKDHPDVNVMHKAFAEKSSRLVP
Sbjct  628  EQGAMHVAYYPDDPIKDHPDVNVMHKAFAEKSSRLVP  664



>ref|WP_016804833.1| polysaccharide deacetylase [Acinetobacter nosocomialis]
Length=664

 Score = 80.5 bits (197),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 36/37 (97%), Positives = 37/37 (100%), Gaps = 0/37 (0%)
 Frame = -2

Query  113  QQGAMHVAYYPDDPIKDHPDVNVMHKAFAEKSSRLVP  3
            +QGAMHVAYYPDDPIKDHPDVNVMHKAFAEKSSRLVP
Sbjct  628  EQGAMHVAYYPDDPIKDHPDVNVMHKAFAEKSSRLVP  664



>ref|WP_004710158.1| MULTISPECIES: poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase 
PgaB [Acinetobacter calcoaceticus/baumannii complex]
 gb|ENU46946.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
nosocomialis NIPH 2119]
 gb|ERL69127.1| polysaccharide deacetylase [Acinetobacter nosocomialis M2]
 gb|KCY48575.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 1571545]
Length=664

 Score = 80.1 bits (196),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 36/37 (97%), Positives = 37/37 (100%), Gaps = 0/37 (0%)
 Frame = -2

Query  113  QQGAMHVAYYPDDPIKDHPDVNVMHKAFAEKSSRLVP  3
            +QGAMHVAYYPDDPIKDHPDVNVMHKAFAEKSSRLVP
Sbjct  628  EQGAMHVAYYPDDPIKDHPDVNVMHKAFAEKSSRLVP  664



>ref|WP_004703187.1| MULTISPECIES: poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase 
PgaB [Acinetobacter]
 gb|ENU42709.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
sp. NIPH 973]
Length=664

 Score = 80.1 bits (196),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 36/37 (97%), Positives = 37/37 (100%), Gaps = 0/37 (0%)
 Frame = -2

Query  113  QQGAMHVAYYPDDPIKDHPDVNVMHKAFAEKSSRLVP  3
            +QGAMHVAYYPDDPIKDHPDVNVMHKAFAEKSSRLVP
Sbjct  628  EQGAMHVAYYPDDPIKDHPDVNVMHKAFAEKSSRLVP  664



>ref|WP_002054296.1| MULTISPECIES: polysaccharide deacetylase [Acinetobacter calcoaceticus/baumannii 
complex]
 gb|EKF48007.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
nosocomialis Ab22222]
 gb|EKU60060.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
sp. WC-487]
 gb|ELW76865.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
sp. OIFC021]
 gb|ENV40470.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
nosocomialis NIPH 386]
 gb|EEW99258.2| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
sp. RUH2624]
 emb|CDG76307.1| xylanase/chitin deacetylase [Acinetobacter nosocomialis 28F]
 gb|EXB11245.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 1396970]
 gb|EXE51394.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 766875]
 gb|EXE99139.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 259052]
 gb|EXH14971.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 1245593]
 gb|EXH75707.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 216872]
 gb|EXI11720.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 694762]
 gb|EXR11003.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 1130196]
 gb|EXR27499.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 1281984]
 gb|EXR33714.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 1179249]
 gb|EXS47993.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 88816]
 gb|EXT37370.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 25977_8]
 gb|EXT41789.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 25977_7]
 gb|EXT41940.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 25977_6]
 gb|EXT48380.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 25977_4]
 gb|EXT52242.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 25977_3]
 gb|EXT54409.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 25977_2]
 gb|EXT59206.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 25977_1]
 gb|EXT67631.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 25977_10]
 gb|EYT20979.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 1592897]
 gb|KCX93746.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 6112]
 gb|KCY73361.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 796380-1375]
 gb|KCZ29822.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 25977_9]
 gb|KDM57632.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumanii BIDMC 57]
Length=664

 Score = 80.1 bits (196),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 36/37 (97%), Positives = 37/37 (100%), Gaps = 0/37 (0%)
 Frame = -2

Query  113  QQGAMHVAYYPDDPIKDHPDVNVMHKAFAEKSSRLVP  3
            +QGAMHVAYYPDDPIKDHPDVNVMHKAFAEKSSRLVP
Sbjct  628  EQGAMHVAYYPDDPIKDHPDVNVMHKAFAEKSSRLVP  664



>ref|WP_039254123.1| polysaccharide deacetylase [Acinetobacter baumannii]
 gb|KHO14727.1| polysaccharide deacetylase [Acinetobacter baumannii]
Length=664

 Score = 80.1 bits (196),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 36/37 (97%), Positives = 37/37 (100%), Gaps = 0/37 (0%)
 Frame = -2

Query  113  QQGAMHVAYYPDDPIKDHPDVNVMHKAFAEKSSRLVP  3
            +QGAMHVAYYPDDPIKDHPDVNVMHKAFAEKSSRLVP
Sbjct  628  EQGAMHVAYYPDDPIKDHPDVNVMHKAFAEKSSRLVP  664



>ref|WP_004748055.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii]
 gb|ENU76202.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii NIPH 1734]
Length=664

 Score = 80.1 bits (196),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 36/37 (97%), Positives = 36/37 (97%), Gaps = 0/37 (0%)
 Frame = -2

Query  113  QQGAMHVAYYPDDPIKDHPDVNVMHKAFAEKSSRLVP  3
            QQGAMHVAYYPDDPIKDHPDVNVMHK FAEKSSRLVP
Sbjct  628  QQGAMHVAYYPDDPIKDHPDVNVMHKVFAEKSSRLVP  664



>ref|WP_016144582.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
pittii]
 gb|EOQ75649.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
pittii ANC 4052]
Length=664

 Score = 77.4 bits (189),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 34/37 (92%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = -2

Query  113  QQGAMHVAYYPDDPIKDHPDVNVMHKAFAEKSSRLVP  3
            QQG MHV YYPDDPIKDHPDVN MHKAFAEKSSRLVP
Sbjct  628  QQGVMHVGYYPDDPIKDHPDVNTMHKAFAEKSSRLVP  664



>ref|WP_032055106.1| polysaccharide deacetylase [Acinetobacter baumannii]
 gb|EXS22264.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 573719]
Length=664

 Score = 77.4 bits (189),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 34/37 (92%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = -2

Query  113  QQGAMHVAYYPDDPIKDHPDVNVMHKAFAEKSSRLVP  3
            QQG MHV YYPDDPIKDHPDVN MHKAFAEKSSRLVP
Sbjct  628  QQGVMHVGYYPDDPIKDHPDVNTMHKAFAEKSSRLVP  664



>ref|WP_016141945.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
pittii]
 gb|EOQ68151.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
pittii ANC 4050]
Length=664

 Score = 77.4 bits (189),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 34/37 (92%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = -2

Query  113  QQGAMHVAYYPDDPIKDHPDVNVMHKAFAEKSSRLVP  3
            QQG MHV YYPDDPIKDHPDVN MHKAFAEKSSRLVP
Sbjct  628  QQGVMHVGYYPDDPIKDHPDVNTMHKAFAEKSSRLVP  664



>ref|WP_031947619.1| polysaccharide deacetylase [Acinetobacter baumannii]
 gb|ETR95677.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii CI78]
Length=664

 Score = 77.0 bits (188),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 34/37 (92%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = -2

Query  113  QQGAMHVAYYPDDPIKDHPDVNVMHKAFAEKSSRLVP  3
            QQG MHV YYPDDPIKDHPDVN MHKAFAEKSSRLVP
Sbjct  628  QQGVMHVGYYPDDPIKDHPDVNTMHKAFAEKSSRLVP  664



>ref|WP_014206024.1| polysaccharide deacetylase [Acinetobacter calcoaceticus]
 ref|YP_004994484.1| biofilm PGA synthesis lipoprotein PgaB [Acinetobacter calcoaceticus 
PHEA-2]
 gb|ADY80802.1| biofilm PGA synthesis lipoprotein PgaB [Acinetobacter calcoaceticus 
PHEA-2]
Length=664

 Score = 77.0 bits (188),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 34/37 (92%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = -2

Query  113  QQGAMHVAYYPDDPIKDHPDVNVMHKAFAEKSSRLVP  3
            QQG MHV YYPDDPIKDHPDVN MHKAFAEKSSRLVP
Sbjct  628  QQGVMHVGYYPDDPIKDHPDVNTMHKAFAEKSSRLVP  664



>ref|WP_017389973.1| polysaccharide deacetylase [Acinetobacter calcoaceticus]
Length=664

 Score = 76.6 bits (187),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 34/37 (92%), Positives = 35/37 (95%), Gaps = 0/37 (0%)
 Frame = -2

Query  113  QQGAMHVAYYPDDPIKDHPDVNVMHKAFAEKSSRLVP  3
            QQG MHV YYPDDPIKDHPDV+VMHKAFAEKSSRLVP
Sbjct  628  QQGVMHVGYYPDDPIKDHPDVDVMHKAFAEKSSRLVP  664



>dbj|GAM31684.1| biofilm PGA synthesis lipoprotein PgaB [Acinetobacter calcoaceticus]
Length=664

 Score = 76.6 bits (187),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 34/37 (92%), Positives = 35/37 (95%), Gaps = 0/37 (0%)
 Frame = -2

Query  113  QQGAMHVAYYPDDPIKDHPDVNVMHKAFAEKSSRLVP  3
            QQG MHV YYPDDPIKDHPDV+VMHKAFAEKSSRLVP
Sbjct  628  QQGVMHVGYYPDDPIKDHPDVDVMHKAFAEKSSRLVP  664



>ref|WP_005042349.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
calcoaceticus]
 gb|ENV94089.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
calcoaceticus ANC 3680]
Length=664

 Score = 76.6 bits (187),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 34/37 (92%), Positives = 35/37 (95%), Gaps = 0/37 (0%)
 Frame = -2

Query  113  QQGAMHVAYYPDDPIKDHPDVNVMHKAFAEKSSRLVP  3
            QQG MHV YYPDDPIKDHPDV+VMHKAFAEKSSRLVP
Sbjct  628  QQGVMHVGYYPDDPIKDHPDVDVMHKAFAEKSSRLVP  664



>ref|WP_017391739.1| polysaccharide deacetylase [Acinetobacter calcoaceticus]
Length=664

 Score = 76.6 bits (187),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 34/37 (92%), Positives = 35/37 (95%), Gaps = 0/37 (0%)
 Frame = -2

Query  113  QQGAMHVAYYPDDPIKDHPDVNVMHKAFAEKSSRLVP  3
            QQG MHV YYPDDPIKDHPDV+VMHKAFAEKSSRLVP
Sbjct  628  QQGVMHVGYYPDDPIKDHPDVDVMHKAFAEKSSRLVP  664



>ref|WP_016138972.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
calcoaceticus]
 gb|EOQ63089.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
calcoaceticus ANC 3811]
Length=664

 Score = 76.6 bits (187),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 34/37 (92%), Positives = 35/37 (95%), Gaps = 0/37 (0%)
 Frame = -2

Query  113  QQGAMHVAYYPDDPIKDHPDVNVMHKAFAEKSSRLVP  3
            QQG MHV YYPDDPIKDHPDV+VMHKAFAEKSSRLVP
Sbjct  628  QQGVMHVGYYPDDPIKDHPDVDVMHKAFAEKSSRLVP  664



>gb|ENV99879.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
calcoaceticus DSM 30006 = CIP 81.8]
Length=595

 Score = 76.3 bits (186),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 34/37 (92%), Positives = 35/37 (95%), Gaps = 0/37 (0%)
 Frame = -2

Query  113  QQGAMHVAYYPDDPIKDHPDVNVMHKAFAEKSSRLVP  3
            QQG MHV YYPDDPIKDHPDV+VMHKAFAEKSSRLVP
Sbjct  559  QQGVMHVGYYPDDPIKDHPDVDVMHKAFAEKSSRLVP  595



>gb|EEY79045.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
calcoaceticus RUH2202]
Length=671

 Score = 76.6 bits (187),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 34/37 (92%), Positives = 35/37 (95%), Gaps = 0/37 (0%)
 Frame = -2

Query  113  QQGAMHVAYYPDDPIKDHPDVNVMHKAFAEKSSRLVP  3
            QQG MHV YYPDDPIKDHPDV+VMHKAFAEKSSRLVP
Sbjct  635  QQGVMHVGYYPDDPIKDHPDVDVMHKAFAEKSSRLVP  671



>ref|WP_005303254.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
sp. NIPH 542]
 gb|ENX45981.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
sp. NIPH 542]
Length=664

 Score = 76.6 bits (187),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 34/37 (92%), Positives = 35/37 (95%), Gaps = 0/37 (0%)
 Frame = -2

Query  113  QQGAMHVAYYPDDPIKDHPDVNVMHKAFAEKSSRLVP  3
            QQG MHV YYPDDPIKDHPDV+VMHKAFAEKSSRLVP
Sbjct  628  QQGVMHVGYYPDDPIKDHPDVDVMHKAFAEKSSRLVP  664



>ref|WP_009386580.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
sp. WC-141]
 gb|EKU40462.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
sp. WC-141]
Length=664

 Score = 76.6 bits (187),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 34/37 (92%), Positives = 35/37 (95%), Gaps = 0/37 (0%)
 Frame = -2

Query  113  QQGAMHVAYYPDDPIKDHPDVNVMHKAFAEKSSRLVP  3
            QQG MHV YYPDDPIKDHPDV+VMHKAFAEKSSRLVP
Sbjct  628  QQGVMHVGYYPDDPIKDHPDVDVMHKAFAEKSSRLVP  664



>ref|WP_013198662.1| polysaccharide deacetylase [Acinetobacter oleivorans]
 ref|YP_003733193.1| Biofilm PGA synthesis lipoprotein pgaB [Acinetobacter oleivorans 
DR1]
 gb|ADI91820.1| Biofilm PGA synthesis lipoprotein pgaB precursor [Acinetobacter 
oleivorans DR1]
 gb|ESK44652.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
oleivorans CIP 110421]
Length=664

 Score = 76.6 bits (187),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 34/37 (92%), Positives = 35/37 (95%), Gaps = 0/37 (0%)
 Frame = -2

Query  113  QQGAMHVAYYPDDPIKDHPDVNVMHKAFAEKSSRLVP  3
            QQG MHV YYPDDPIKDHPDV+VMHKAFAEKSSRLVP
Sbjct  628  QQGVMHVGYYPDDPIKDHPDVDVMHKAFAEKSSRLVP  664



>ref|WP_004794049.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
sp. NIPH 817]
 gb|ENV02281.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
sp. NIPH 817]
Length=664

 Score = 76.3 bits (186),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 34/37 (92%), Positives = 35/37 (95%), Gaps = 0/37 (0%)
 Frame = -2

Query  113  QQGAMHVAYYPDDPIKDHPDVNVMHKAFAEKSSRLVP  3
            QQG MHV YYPDDPIKDHPDV+VMHKAFAEKSSRLVP
Sbjct  628  QQGVMHVGYYPDDPIKDHPDVDVMHKAFAEKSSRLVP  664



>gb|KHN66104.1| polysaccharide deacetylase [Acinetobacter oleivorans]
Length=664

 Score = 76.3 bits (186),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 34/37 (92%), Positives = 35/37 (95%), Gaps = 0/37 (0%)
 Frame = -2

Query  113  QQGAMHVAYYPDDPIKDHPDVNVMHKAFAEKSSRLVP  3
            QQG MHV YYPDDPIKDHPDV+VMHKAFAEKSSRLVP
Sbjct  628  QQGVMHVGYYPDDPIKDHPDVDVMHKAFAEKSSRLVP  664



>ref|WP_017387105.1| MULTISPECIES: polysaccharide deacetylase [Acinetobacter]
Length=664

 Score = 75.1 bits (183),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 33/37 (89%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = -2

Query  113  QQGAMHVAYYPDDPIKDHPDVNVMHKAFAEKSSRLVP  3
            QQG MHV YYPDDPIKDHPDV+ MHKAFAEKSSRLVP
Sbjct  628  QQGVMHVGYYPDDPIKDHPDVDTMHKAFAEKSSRLVP  664



>ref|WP_033848546.1| polysaccharide deacetylase [Acinetobacter baumannii]
 gb|EXS35337.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 826659]
Length=664

 Score = 75.1 bits (183),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 33/37 (89%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = -2

Query  113  QQGAMHVAYYPDDPIKDHPDVNVMHKAFAEKSSRLVP  3
            QQG MHV YYPDDPIKDHPDV+ MHKAFAEKSSRLVP
Sbjct  628  QQGVMHVGYYPDDPIKDHPDVDTMHKAFAEKSSRLVP  664



>ref|WP_039757053.1| polysaccharide deacetylase [Acinetobacter pittii]
 gb|KIE87193.1| polysaccharide deacetylase [Acinetobacter pittii]
Length=664

 Score = 75.1 bits (183),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 33/37 (89%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = -2

Query  113  QQGAMHVAYYPDDPIKDHPDVNVMHKAFAEKSSRLVP  3
            QQG MHV YYPDDPIKDHPDV+ MHKAFAEKSSRLVP
Sbjct  628  QQGVMHVGYYPDDPIKDHPDVDTMHKAFAEKSSRLVP  664



>ref|WP_017399039.1| polysaccharide deacetylase [Acinetobacter pittii]
Length=664

 Score = 75.1 bits (183),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 33/37 (89%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = -2

Query  113  QQGAMHVAYYPDDPIKDHPDVNVMHKAFAEKSSRLVP  3
            QQG MHV YYPDDPIKDHPDV+ MHKAFAEKSSRLVP
Sbjct  628  QQGVMHVGYYPDDPIKDHPDVDTMHKAFAEKSSRLVP  664



>ref|WP_002117675.1| MULTISPECIES: poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase 
PgaB [Acinetobacter calcoaceticus/baumannii complex]
 gb|EKU68397.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
sp. WC-136]
 gb|EXG32348.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 263903-2]
 gb|EYT27700.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 1564232]
Length=664

 Score = 75.1 bits (183),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 33/37 (89%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = -2

Query  113  QQGAMHVAYYPDDPIKDHPDVNVMHKAFAEKSSRLVP  3
            QQG MHV YYPDDPIKDHPDV+ MHKAFAEKSSRLVP
Sbjct  628  QQGVMHVGYYPDDPIKDHPDVDTMHKAFAEKSSRLVP  664



>ref|WP_032012754.1| polysaccharide deacetylase [Acinetobacter baumannii]
 gb|EXH33609.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 1245249]
Length=664

 Score = 75.1 bits (183),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 33/37 (89%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = -2

Query  113  QQGAMHVAYYPDDPIKDHPDVNVMHKAFAEKSSRLVP  3
            QQG MHV YYPDDPIKDHPDV+ MHKAFAEKSSRLVP
Sbjct  628  QQGVMHVGYYPDDPIKDHPDVDTMHKAFAEKSSRLVP  664



>ref|WP_032004181.1| polysaccharide deacetylase [Acinetobacter baumannii]
 gb|EXE62333.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 1542444]
Length=664

 Score = 75.1 bits (183),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 33/37 (89%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = -2

Query  113  QQGAMHVAYYPDDPIKDHPDVNVMHKAFAEKSSRLVP  3
            QQG MHV YYPDDPIKDHPDV+ MHKAFAEKSSRLVP
Sbjct  628  QQGVMHVGYYPDDPIKDHPDVDTMHKAFAEKSSRLVP  664



>ref|WP_005070744.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
pittii]
 gb|ENW12915.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
pittii ANC 3678]
Length=664

 Score = 75.1 bits (183),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 33/37 (89%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = -2

Query  113  QQGAMHVAYYPDDPIKDHPDVNVMHKAFAEKSSRLVP  3
            QQG MHV YYPDDPIKDHPDV+ MHKAFAEKSSRLVP
Sbjct  628  QQGVMHVGYYPDDPIKDHPDVDTMHKAFAEKSSRLVP  664



>ref|WP_005075399.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
pittii]
 gb|ENW09387.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
pittii CIP 70.29]
Length=664

 Score = 75.1 bits (183),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 33/37 (89%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = -2

Query  113  QQGAMHVAYYPDDPIKDHPDVNVMHKAFAEKSSRLVP  3
            QQG MHV YYPDDPIKDHPDV+ MHKAFAEKSSRLVP
Sbjct  628  QQGVMHVGYYPDDPIKDHPDVDTMHKAFAEKSSRLVP  664



>ref|WP_032052488.1| polysaccharide deacetylase [Acinetobacter baumannii]
 gb|EXR42411.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 1294243]
Length=664

 Score = 75.1 bits (183),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 33/37 (89%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = -2

Query  113  QQGAMHVAYYPDDPIKDHPDVNVMHKAFAEKSSRLVP  3
            QQG MHV YYPDDPIKDHPDV+ MHKAFAEKSSRLVP
Sbjct  628  QQGVMHVGYYPDDPIKDHPDVDTMHKAFAEKSSRLVP  664



>ref|WP_032042005.1| polysaccharide deacetylase [Acinetobacter baumannii]
 gb|EXE93924.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 1578804]
Length=664

 Score = 75.1 bits (183),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 33/37 (89%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = -2

Query  113  QQGAMHVAYYPDDPIKDHPDVNVMHKAFAEKSSRLVP  3
            QQG MHV YYPDDPIKDHPDV+ MHKAFAEKSSRLVP
Sbjct  628  QQGVMHVGYYPDDPIKDHPDVDTMHKAFAEKSSRLVP  664



>ref|WP_032056874.1| polysaccharide deacetylase [Acinetobacter baumannii]
 gb|EXE26731.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 907131]
 gb|EXS16516.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 883425]
Length=664

 Score = 75.1 bits (183),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 33/37 (89%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = -2

Query  113  QQGAMHVAYYPDDPIKDHPDVNVMHKAFAEKSSRLVP  3
            QQG MHV YYPDDPIKDHPDV+ MHKAFAEKSSRLVP
Sbjct  628  QQGVMHVGYYPDDPIKDHPDVDTMHKAFAEKSSRLVP  664



>ref|WP_032005837.1| polysaccharide deacetylase [Acinetobacter baumannii]
 gb|KCX17258.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 1264765]
Length=664

 Score = 75.1 bits (183),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 33/37 (89%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = -2

Query  113  QQGAMHVAYYPDDPIKDHPDVNVMHKAFAEKSSRLVP  3
            QQG MHV YYPDDPIKDHPDV+ MHKAFAEKSSRLVP
Sbjct  628  QQGVMHVGYYPDDPIKDHPDVDTMHKAFAEKSSRLVP  664



>ref|WP_032063616.1| polysaccharide deacetylase [Acinetobacter baumannii]
 gb|EXC26547.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 809848]
Length=664

 Score = 74.7 bits (182),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 33/37 (89%), Positives = 33/37 (89%), Gaps = 0/37 (0%)
 Frame = -2

Query  113  QQGAMHVAYYPDDPIKDHPDVNVMHKAFAEKSSRLVP  3
            QQG MHV YYPDDPIKDHPDV  MHKAFAEKSSRLVP
Sbjct  628  QQGVMHVGYYPDDPIKDHPDVETMHKAFAEKSSRLVP  664



>ref|WP_004641711.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
calcoaceticus]
 gb|ENU08318.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
calcoaceticus NIPH 13]
Length=664

 Score = 74.3 bits (181),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 33/37 (89%), Positives = 35/37 (95%), Gaps = 0/37 (0%)
 Frame = -2

Query  113  QQGAMHVAYYPDDPIKDHPDVNVMHKAFAEKSSRLVP  3
            QQG MHV YYPDDPIKDHPDV+VM+KAFAEKSSRLVP
Sbjct  628  QQGVMHVGYYPDDPIKDHPDVDVMNKAFAEKSSRLVP  664



>ref|WP_017388708.1| polysaccharide deacetylase [Acinetobacter calcoaceticus]
Length=664

 Score = 74.3 bits (181),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 33/37 (89%), Positives = 35/37 (95%), Gaps = 0/37 (0%)
 Frame = -2

Query  113  QQGAMHVAYYPDDPIKDHPDVNVMHKAFAEKSSRLVP  3
            QQG MHV YYPDDPIKDHPDV+VM+KAFAEKSSRLVP
Sbjct  628  QQGVMHVGYYPDDPIKDHPDVDVMNKAFAEKSSRLVP  664



>ref|WP_017403160.1| MULTISPECIES: polysaccharide deacetylase [Acinetobacter]
 gb|EXA98553.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 1295259]
Length=664

 Score = 73.9 bits (180),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 33/37 (89%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = -2

Query  113  QQGAMHVAYYPDDPIKDHPDVNVMHKAFAEKSSRLVP  3
            QQG MHV YYPDDPIKDHPDV+VM KAFAEKSSRLVP
Sbjct  628  QQGVMHVGYYPDDPIKDHPDVDVMRKAFAEKSSRLVP  664



>ref|WP_032037458.1| polysaccharide deacetylase [Acinetobacter baumannii]
 gb|EXS26936.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 742879]
Length=664

 Score = 73.9 bits (180),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 33/37 (89%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = -2

Query  113  QQGAMHVAYYPDDPIKDHPDVNVMHKAFAEKSSRLVP  3
            QQG MHV YYPDDPIKDHPDV+VM KAFAEKSSRLVP
Sbjct  628  QQGVMHVGYYPDDPIKDHPDVDVMRKAFAEKSSRLVP  664



>ref|WP_017481351.1| polysaccharide deacetylase [Acinetobacter calcoaceticus]
Length=664

 Score = 72.8 bits (177),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 32/37 (86%), Positives = 33/37 (89%), Gaps = 0/37 (0%)
 Frame = -2

Query  113  QQGAMHVAYYPDDPIKDHPDVNVMHKAFAEKSSRLVP  3
            QQG MHV YYPDDPIKD PDV+ MHKAFAEKSSRLVP
Sbjct  628  QQGVMHVGYYPDDPIKDQPDVDTMHKAFAEKSSRLVP  664



>ref|WP_005803033.1| MULTISPECIES: polysaccharide deacetylase [Acinetobacter calcoaceticus/baumannii 
complex]
 gb|EFF87883.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
sp. SH024]
 emb|CDH39487.1| biofilm PGA synthesis lipoprotein PgaB [Acinetobacter pittii 
42F]
 gb|EXA91045.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 1289694]
 gb|EXB78925.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 1475718]
 gb|EXS00675.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 225588]
 gb|EYT44926.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 478810]
 gb|KCX62825.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 1451147]
 gb|KCX99514.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 72431]
 gb|KCY54290.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 1288284]
Length=664

 Score = 72.8 bits (177),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 32/37 (86%), Positives = 33/37 (89%), Gaps = 0/37 (0%)
 Frame = -2

Query  113  QQGAMHVAYYPDDPIKDHPDVNVMHKAFAEKSSRLVP  3
            QQG MHV YYPDDPIKD PDV+ MHKAFAEKSSRLVP
Sbjct  628  QQGVMHVGYYPDDPIKDQPDVDTMHKAFAEKSSRLVP  664



>ref|WP_032032990.1| polysaccharide deacetylase [Acinetobacter baumannii]
 gb|EXI18302.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 723929]
Length=664

 Score = 72.8 bits (177),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 32/37 (86%), Positives = 33/37 (89%), Gaps = 0/37 (0%)
 Frame = -2

Query  113  QQGAMHVAYYPDDPIKDHPDVNVMHKAFAEKSSRLVP  3
            QQG MHV YYPDDPIKD PDV+ MHKAFAEKSSRLVP
Sbjct  628  QQGVMHVGYYPDDPIKDQPDVDTMHKAFAEKSSRLVP  664



>ref|WP_031946283.1| polysaccharide deacetylase [Acinetobacter calcoaceticus]
Length=664

 Score = 72.4 bits (176),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 32/37 (86%), Positives = 33/37 (89%), Gaps = 0/37 (0%)
 Frame = -2

Query  113  QQGAMHVAYYPDDPIKDHPDVNVMHKAFAEKSSRLVP  3
            QQG MHV YYPDDPIKD PDV+ MHKAFAEKSSRLVP
Sbjct  628  QQGLMHVGYYPDDPIKDQPDVDTMHKAFAEKSSRLVP  664



>gb|EPR86097.1| Biofilm PGA synthesis deacetylase PgaB [Acinetobacter junii MTCC 
11364]
Length=646

 Score = 70.9 bits (172),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 31/37 (84%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = -2

Query  113  QQGAMHVAYYPDDPIKDHPDVNVMHKAFAEKSSRLVP  3
            QQGAMH+AYYPDDPIKDHPDV  MH AFA+KSS+LVP
Sbjct  610  QQGAMHIAYYPDDPIKDHPDVKQMHDAFAQKSSQLVP  646



>ref|WP_004956114.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
junii]
 gb|ENV62687.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
junii NIPH 182]
Length=665

 Score = 70.5 bits (171),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 31/37 (84%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = -2

Query  113  QQGAMHVAYYPDDPIKDHPDVNVMHKAFAEKSSRLVP  3
            QQGAMH+AYYPDDPIKDHPDV  MH AFA+KSS+LVP
Sbjct  629  QQGAMHIAYYPDDPIKDHPDVKQMHDAFAQKSSQLVP  665



>ref|WP_004912761.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
junii]
 gb|ENV50299.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
junii CIP 107470]
Length=665

 Score = 70.5 bits (171),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 31/37 (84%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = -2

Query  113  QQGAMHVAYYPDDPIKDHPDVNVMHKAFAEKSSRLVP  3
            QQGAMH+AYYPDDPIKDHPDV  MH AFA+KSS+LVP
Sbjct  629  QQGAMHIAYYPDDPIKDHPDVKQMHDAFAQKSSQLVP  665



>ref|WP_005402226.1| polysaccharide deacetylase [Acinetobacter junii]
 gb|EEY93096.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
junii SH205]
Length=665

 Score = 70.5 bits (171),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 31/37 (84%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = -2

Query  113  QQGAMHVAYYPDDPIKDHPDVNVMHKAFAEKSSRLVP  3
            QQGAMH+AYYPDDPIKDHPDV  MH AFA+KSS+LVP
Sbjct  629  QQGAMHIAYYPDDPIKDHPDVKQMHDAFAQKSSQLVP  665



>ref|WP_004963399.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
junii]
 gb|ENV66237.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
junii CIP 64.5]
Length=665

 Score = 70.5 bits (171),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 31/37 (84%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = -2

Query  113  QQGAMHVAYYPDDPIKDHPDVNVMHKAFAEKSSRLVP  3
            QQGAMH+AYYPDDPIKDHPDV  MH AFA+KSS+LVP
Sbjct  629  QQGAMHIAYYPDDPIKDHPDVKQMHDAFAQKSSQLVP  665



>ref|WP_023012992.1| polysaccharide deacetylase [Acinetobacter sp. COS3]
 gb|ERS02603.1| polysaccharide deacetylase [Acinetobacter sp. COS3]
Length=665

 Score = 68.9 bits (167),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 31/37 (84%), Positives = 33/37 (89%), Gaps = 0/37 (0%)
 Frame = -2

Query  113  QQGAMHVAYYPDDPIKDHPDVNVMHKAFAEKSSRLVP  3
            QQGAMHVAYYPDDPIK HPDV +MHKAFA KS +LVP
Sbjct  629  QQGAMHVAYYPDDPIKGHPDVEIMHKAFALKSPQLVP  665



>ref|WP_019383907.1| polysaccharide deacetylase [Acinetobacter venetianus]
Length=665

 Score = 68.6 bits (166),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 31/37 (84%), Positives = 33/37 (89%), Gaps = 0/37 (0%)
 Frame = -2

Query  113  QQGAMHVAYYPDDPIKDHPDVNVMHKAFAEKSSRLVP  3
            QQGAMHVAYYPDDPIK HPDV +MHKAFA KS +LVP
Sbjct  629  QQGAMHVAYYPDDPIKGHPDVEIMHKAFALKSPQLVP  665



>ref|WP_004878336.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
venetianus]
 gb|ENV37653.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
venetianus RAG-1 = CIP 110063]
Length=665

 Score = 68.6 bits (166),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 31/37 (84%), Positives = 33/37 (89%), Gaps = 0/37 (0%)
 Frame = -2

Query  113  QQGAMHVAYYPDDPIKDHPDVNVMHKAFAEKSSRLVP  3
            QQGAMHVAYYPDDPIK HPDV +MHKAFA KS +LVP
Sbjct  629  QQGAMHVAYYPDDPIKGHPDVEIMHKAFALKSPQLVP  665



>ref|WP_007481756.1| polysaccharide deacetylase [Acinetobacter sp. NBRC 100985]
 dbj|GAB02012.1| hypothetical protein ACT4_023_01880 [Acinetobacter sp. NBRC 100985]
Length=665

 Score = 68.6 bits (166),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 31/37 (84%), Positives = 33/37 (89%), Gaps = 0/37 (0%)
 Frame = -2

Query  113  QQGAMHVAYYPDDPIKDHPDVNVMHKAFAEKSSRLVP  3
            QQGAMHVAYYPDDPIK HPDV +MHKAFA KS +LVP
Sbjct  629  QQGAMHVAYYPDDPIKGHPDVEIMHKAFALKSPQLVP  665



>ref|WP_004663383.1| MULTISPECIES: poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase 
PgaB [Acinetobacter]
 gb|ENU25839.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
sp. NIPH 236]
 gb|ENW99763.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
sp. ANC 3862]
Length=665

 Score = 68.2 bits (165),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 30/37 (81%), Positives = 33/37 (89%), Gaps = 0/37 (0%)
 Frame = -2

Query  113  QQGAMHVAYYPDDPIKDHPDVNVMHKAFAEKSSRLVP  3
            QQGAMH+AYYPDDPIK+HPDV  M KAFA KSS+LVP
Sbjct  629  QQGAMHIAYYPDDPIKEHPDVETMRKAFALKSSQLVP  665



>ref|WP_005158137.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
sp. NIPH 284]
 gb|ENW84053.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
sp. NIPH 284]
Length=665

 Score = 68.2 bits (165),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 30/37 (81%), Positives = 33/37 (89%), Gaps = 0/37 (0%)
 Frame = -2

Query  113  QQGAMHVAYYPDDPIKDHPDVNVMHKAFAEKSSRLVP  3
            QQGAMH+AYYPDDPIK+HPDV  M KAFA KSS+LVP
Sbjct  629  QQGAMHIAYYPDDPIKEHPDVETMRKAFALKSSQLVP  665



>ref|WP_005243539.1| MULTISPECIES: polysaccharide deacetylase [Acinetobacter]
 gb|ENX12316.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
sp. CIP 64.2]
Length=665

 Score = 67.8 bits (164),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 30/37 (81%), Positives = 33/37 (89%), Gaps = 0/37 (0%)
 Frame = -2

Query  113  QQGAMHVAYYPDDPIKDHPDVNVMHKAFAEKSSRLVP  3
            +QGAMHVAYYPDDPIK HPDV  MHKAF+ KSS+LVP
Sbjct  629  EQGAMHVAYYPDDPIKGHPDVETMHKAFSLKSSQLVP  665



>ref|WP_005269745.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
sp. NIPH 1859]
 gb|ENX36239.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
sp. NIPH 1859]
Length=665

 Score = 67.8 bits (164),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 30/37 (81%), Positives = 33/37 (89%), Gaps = 0/37 (0%)
 Frame = -2

Query  113  QQGAMHVAYYPDDPIKDHPDVNVMHKAFAEKSSRLVP  3
            +QGAMHVAYYPDDPIK HPDV  MHKAF+ KSS+LVP
Sbjct  629  EQGAMHVAYYPDDPIKGHPDVETMHKAFSLKSSQLVP  665



>ref|WP_016651630.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
sp. NIPH 2036]
 gb|EPG40856.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
sp. NIPH 2036]
Length=665

 Score = 67.8 bits (164),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 30/37 (81%), Positives = 33/37 (89%), Gaps = 0/37 (0%)
 Frame = -2

Query  113  QQGAMHVAYYPDDPIKDHPDVNVMHKAFAEKSSRLVP  3
            +QGAMHVAYYPDDPIK HPDV  MHKAF+ KSS+LVP
Sbjct  629  EQGAMHVAYYPDDPIKGHPDVETMHKAFSLKSSQLVP  665



>ref|WP_005144821.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
sp. ANC 3929]
 gb|ENW78608.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
sp. ANC 3929]
Length=665

 Score = 67.8 bits (164),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 30/37 (81%), Positives = 33/37 (89%), Gaps = 0/37 (0%)
 Frame = -2

Query  113  QQGAMHVAYYPDDPIKDHPDVNVMHKAFAEKSSRLVP  3
            +QGAMHVAYYPDDPIK HPDV  MHKAF+ KSS+LVP
Sbjct  629  EQGAMHVAYYPDDPIKGHPDVETMHKAFSLKSSQLVP  665



>ref|WP_005296146.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
sp. NIPH 2100]
 gb|ENX40487.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
sp. NIPH 2100]
Length=665

 Score = 67.8 bits (164),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 30/37 (81%), Positives = 33/37 (89%), Gaps = 0/37 (0%)
 Frame = -2

Query  113  QQGAMHVAYYPDDPIKDHPDVNVMHKAFAEKSSRLVP  3
            +QGAMHVAYYPDDPIK HPDV  MHKAF+ KSS+LVP
Sbjct  629  EQGAMHVAYYPDDPIKGHPDVETMHKAFSLKSSQLVP  665



>ref|WP_005208125.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
sp. NIPH 1867]
 gb|ENX56729.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
sp. NIPH 1867]
Length=665

 Score = 67.8 bits (164),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 30/37 (81%), Positives = 33/37 (89%), Gaps = 0/37 (0%)
 Frame = -2

Query  113  QQGAMHVAYYPDDPIKDHPDVNVMHKAFAEKSSRLVP  3
            +QGAMHVAYYPDDPIK HPDV  MHKAF+ KSS+LVP
Sbjct  629  EQGAMHVAYYPDDPIKGHPDVETMHKAFSLKSSQLVP  665



>ref|WP_005184277.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
sp. ANC 4105]
 gb|ENW95168.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
sp. ANC 4105]
Length=665

 Score = 67.8 bits (164),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 30/37 (81%), Positives = 33/37 (89%), Gaps = 0/37 (0%)
 Frame = -2

Query  113  QQGAMHVAYYPDDPIKDHPDVNVMHKAFAEKSSRLVP  3
            +QGAMHVAYYPDDPIK HPDV  MHKAF+ KSS+LVP
Sbjct  629  EQGAMHVAYYPDDPIKGHPDVETMHKAFSLKSSQLVP  665



>ref|WP_018679694.1| polysaccharide deacetylase [Acinetobacter tjernbergiae]
 gb|ESK54414.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
tjernbergiae DSM 14971 = CIP 107465]
Length=665

 Score = 67.4 bits (163),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 30/37 (81%), Positives = 32/37 (86%), Gaps = 0/37 (0%)
 Frame = -2

Query  113  QQGAMHVAYYPDDPIKDHPDVNVMHKAFAEKSSRLVP  3
            QQGAMH+AYYPDDPIK HPDV  M KAFA KSS+LVP
Sbjct  629  QQGAMHIAYYPDDPIKQHPDVETMRKAFALKSSQLVP  665



>gb|KHF78761.1| Biofilm PGA synthesis deacetylase PgaB [Acinetobacter sp. neg1]
Length=665

 Score = 67.4 bits (163),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 29/37 (78%), Positives = 33/37 (89%), Gaps = 0/37 (0%)
 Frame = -2

Query  113  QQGAMHVAYYPDDPIKDHPDVNVMHKAFAEKSSRLVP  3
            +QGAMH+AYYPDDPIK HPDV  MHKAF+ KSS+LVP
Sbjct  629  EQGAMHIAYYPDDPIKGHPDVETMHKAFSLKSSQLVP  665



>ref|WP_004770377.1| MULTISPECIES: poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase 
PgaB [Acinetobacter]
 gb|ENU94230.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
sp. NIPH 758]
 gb|ENX20759.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
sp. NIPH 2168]
Length=665

 Score = 67.4 bits (163),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 29/37 (78%), Positives = 33/37 (89%), Gaps = 0/37 (0%)
 Frame = -2

Query  113  QQGAMHVAYYPDDPIKDHPDVNVMHKAFAEKSSRLVP  3
            +QGAMH+AYYPDDPIK HPDV  MHKAF+ KSS+LVP
Sbjct  629  EQGAMHIAYYPDDPIKGHPDVETMHKAFSLKSSQLVP  665



>ref|WP_005288343.1| MULTISPECIES: poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase 
PgaB [Acinetobacter]
 gb|ENX36710.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
sp. NIPH 3623]
 gb|EXB25954.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 1437282]
Length=665

 Score = 67.4 bits (163),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 29/37 (78%), Positives = 33/37 (89%), Gaps = 0/37 (0%)
 Frame = -2

Query  113  QQGAMHVAYYPDDPIKDHPDVNVMHKAFAEKSSRLVP  3
            +QGAMH+AYYPDDPIK HPDV  MHKAF+ KSS+LVP
Sbjct  629  EQGAMHIAYYPDDPIKGHPDVETMHKAFSLKSSQLVP  665



>ref|WP_005231843.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
sp. NIPH 1847]
 gb|ENX04739.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
sp. NIPH 1847]
Length=665

 Score = 67.4 bits (163),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 29/37 (78%), Positives = 33/37 (89%), Gaps = 0/37 (0%)
 Frame = -2

Query  113  QQGAMHVAYYPDDPIKDHPDVNVMHKAFAEKSSRLVP  3
            +QGAMH+AYYPDDPIK HPDV  MHKAF+ KSS+LVP
Sbjct  629  EQGAMHIAYYPDDPIKGHPDVETMHKAFSLKSSQLVP  665



>ref|WP_009511351.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
sp. WC-323]
 gb|EKU56824.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
sp. WC-323]
Length=665

 Score = 67.4 bits (163),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 29/37 (78%), Positives = 33/37 (89%), Gaps = 0/37 (0%)
 Frame = -2

Query  113  QQGAMHVAYYPDDPIKDHPDVNVMHKAFAEKSSRLVP  3
            +QGAMH+AYYPDDPIK HPDV  MHKAF+ KSS+LVP
Sbjct  629  EQGAMHIAYYPDDPIKGHPDVETMHKAFSLKSSQLVP  665



>ref|WP_032870317.1| polysaccharide deacetylase [Acinetobacter baumannii]
 gb|EXB46174.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 146457]
 gb|EYT17073.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 1000160]
Length=665

 Score = 67.4 bits (163),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 29/37 (78%), Positives = 33/37 (89%), Gaps = 0/37 (0%)
 Frame = -2

Query  113  QQGAMHVAYYPDDPIKDHPDVNVMHKAFAEKSSRLVP  3
            +QGAMH+AYYPDDPIK HPDV  MHKAF+ KSS+LVP
Sbjct  629  EQGAMHIAYYPDDPIKGHPDVETMHKAFSLKSSQLVP  665



>ref|WP_016541202.1| Biofilm PGA synthesis deacetylase PgaB [Acinetobacter gyllenbergii]
 gb|EPF90622.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
gyllenbergii CIP 110306]
 gb|EPH33931.1| Biofilm PGA synthesis deacetylase PgaB [Acinetobacter gyllenbergii 
MTCC 11365]
 gb|ESK35800.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
gyllenbergii NIPH 230]
Length=665

 Score = 67.0 bits (162),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 29/37 (78%), Positives = 32/37 (86%), Gaps = 0/37 (0%)
 Frame = -2

Query  113  QQGAMHVAYYPDDPIKDHPDVNVMHKAFAEKSSRLVP  3
            +QGAMH+AYYPDDPIK HPDV  MHKAF  KSS+LVP
Sbjct  629  EQGAMHIAYYPDDPIKGHPDVETMHKAFGLKSSQLVP  665



>ref|WP_005062935.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
beijerinckii]
 gb|ENW03222.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
beijerinckii CIP 110307]
Length=665

 Score = 66.6 bits (161),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 30/37 (81%), Positives = 32/37 (86%), Gaps = 0/37 (0%)
 Frame = -2

Query  113  QQGAMHVAYYPDDPIKDHPDVNVMHKAFAEKSSRLVP  3
            QQGAMH+AYYPDDPIK HPDV  M KAFA KSS+LVP
Sbjct  629  QQGAMHIAYYPDDPIKAHPDVETMRKAFALKSSQLVP  665



>ref|WP_005010507.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
bouvetii]
 gb|ENV82487.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
bouvetii DSM 14964 = CIP 107468]
Length=662

 Score = 65.9 bits (159),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 29/37 (78%), Positives = 33/37 (89%), Gaps = 0/37 (0%)
 Frame = -2

Query  113  QQGAMHVAYYPDDPIKDHPDVNVMHKAFAEKSSRLVP  3
            +QGAMHVAYYPDDPIKDHPD +VM KAF  KSS+L+P
Sbjct  626  EQGAMHVAYYPDDPIKDHPDSSVMRKAFDLKSSKLIP  662



>ref|WP_038341951.1| polysaccharide deacetylase [Acinetobacter sp. A47]
Length=665

 Score = 65.9 bits (159),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 29/37 (78%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = -2

Query  113  QQGAMHVAYYPDDPIKDHPDVNVMHKAFAEKSSRLVP  3
            QQGAMH+AYYPDDPIK HPDV  M KAF  KSS+LVP
Sbjct  629  QQGAMHIAYYPDDPIKGHPDVETMRKAFGLKSSQLVP  665



>ref|WP_005055206.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
beijerinckii]
 gb|ENW04397.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
beijerinckii ANC 3835]
Length=665

 Score = 65.1 bits (157),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 29/37 (78%), Positives = 32/37 (86%), Gaps = 0/37 (0%)
 Frame = -2

Query  113  QQGAMHVAYYPDDPIKDHPDVNVMHKAFAEKSSRLVP  3
            +QGAMH+AYYPDDPIK HPDV  M KAFA KSS+LVP
Sbjct  629  KQGAMHIAYYPDDPIKAHPDVETMRKAFALKSSQLVP  665



>ref|WP_005202062.1| MULTISPECIES: poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase 
PgaB [Acinetobacter]
 gb|ENX58730.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
sp. CIP 70.18]
 gb|ENX62534.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
sp. ANC 3880]
Length=665

 Score = 64.7 bits (156),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 29/37 (78%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = -2

Query  113  QQGAMHVAYYPDDPIKDHPDVNVMHKAFAEKSSRLVP  3
            +QGAMHVAYYPDDPIK HPDV  M KAF  KSS+LVP
Sbjct  629  EQGAMHVAYYPDDPIKGHPDVETMRKAFGLKSSQLVP  665



>ref|WP_004760965.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
sp. CIP 102129]
 gb|ENU86486.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
sp. CIP 102129]
Length=665

 Score = 64.7 bits (156),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 27/37 (73%), Positives = 32/37 (86%), Gaps = 0/37 (0%)
 Frame = -2

Query  113  QQGAMHVAYYPDDPIKDHPDVNVMHKAFAEKSSRLVP  3
            +QGAMH+AYYPDDPI+DHP+V  MH AF  KSS+LVP
Sbjct  629  EQGAMHIAYYPDDPIQDHPEVKTMHNAFGLKSSQLVP  665



>ref|WP_033134292.1| polysaccharide deacetylase [Acinetobacter sp. MN12]
Length=665

 Score = 64.7 bits (156),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 29/37 (78%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = -2

Query  113  QQGAMHVAYYPDDPIKDHPDVNVMHKAFAEKSSRLVP  3
            +QGAMHVAYYPDDPIK HPDV  M KAF  KSS+LVP
Sbjct  629  EQGAMHVAYYPDDPIKGHPDVETMRKAFGLKSSQLVP  665



>ref|WP_016162876.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
sp. CIP 110321]
 gb|EOR09172.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
sp. CIP 110321]
Length=665

 Score = 64.7 bits (156),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 29/37 (78%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = -2

Query  113  QQGAMHVAYYPDDPIKDHPDVNVMHKAFAEKSSRLVP  3
            +QGAMHVAYYPDDPIK HPDV  M KAF  KSS+LVP
Sbjct  629  EQGAMHVAYYPDDPIKGHPDVETMRKAFGLKSSQLVP  665



>ref|WP_004801495.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
sp. CIP 56.2]
 gb|ENV11361.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
sp. CIP 56.2]
Length=665

 Score = 64.7 bits (156),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 29/37 (78%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = -2

Query  113  QQGAMHVAYYPDDPIKDHPDVNVMHKAFAEKSSRLVP  3
            +QGAMHVAYYPDDPIK HPDV  M KAF  KSS+LVP
Sbjct  629  EQGAMHVAYYPDDPIKGHPDVETMRKAFGLKSSQLVP  665



>ref|WP_025096185.1| polysaccharide deacetylase [Acinetobacter soli]
Length=691

 Score = 63.2 bits (152),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 27/37 (73%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = -2

Query  113  QQGAMHVAYYPDDPIKDHPDVNVMHKAFAEKSSRLVP  3
            QQGAMHV YYPDDP KDHPD   MH  FA K S+LVP
Sbjct  655  QQGAMHVGYYPDDPFKDHPDTKTMHDVFATKPSKLVP  691



>ref|WP_004946075.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
soli]
 gb|ENV59252.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
soli NIPH 2899]
Length=694

 Score = 63.2 bits (152),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 27/37 (73%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = -2

Query  113  QQGAMHVAYYPDDPIKDHPDVNVMHKAFAEKSSRLVP  3
            QQGAMHV YYPDDP KDHPD   MH  FA K S+LVP
Sbjct  658  QQGAMHVGYYPDDPFKDHPDTKTMHDVFATKPSKLVP  694



>ref|WP_004652012.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
sp. NIPH 809]
 gb|ENU25311.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
sp. NIPH 809]
Length=665

 Score = 62.8 bits (151),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 27/37 (73%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = -2

Query  113  QQGAMHVAYYPDDPIKDHPDVNVMHKAFAEKSSRLVP  3
            +QGAMHVAYYPDDPIK HP+V  M KAF  KSS+L+P
Sbjct  629  EQGAMHVAYYPDDPIKGHPEVETMRKAFGLKSSQLIP  665



>ref|WP_004935973.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
soli]
 gb|ENV56973.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
soli CIP 110264]
Length=694

 Score = 62.0 bits (149),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 26/37 (70%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = -2

Query  113  QQGAMHVAYYPDDPIKDHPDVNVMHKAFAEKSSRLVP  3
            QQGA+HV YYPDDP KDHPD   MH  FA K S+LVP
Sbjct  658  QQGALHVGYYPDDPFKDHPDTKTMHDVFATKPSKLVP  694



>ref|WP_004921745.1| MULTISPECIES: polysaccharide deacetylase [Acinetobacter]
 ref|YP_045741.1| lipoprotein [Acinetobacter sp. ADP1]
 emb|CAG67919.1| putative lipoprotein (Haemin storage system) (HmsF) [Acinetobacter 
sp. ADP1]
 gb|ENV55498.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baylyi DSM 14961 = CIP 107474]
Length=691

 Score = 61.6 bits (148),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 26/37 (70%), Positives = 27/37 (73%), Gaps = 0/37 (0%)
 Frame = -2

Query  113  QQGAMHVAYYPDDPIKDHPDVNVMHKAFAEKSSRLVP  3
            QQGAMHV YYPDDP KDHPD   MH  F  K S+LVP
Sbjct  655  QQGAMHVGYYPDDPFKDHPDTKTMHDVFVTKPSKLVP  691



>ref|WP_029574523.1| polysaccharide deacetylase [Acinetobacter sp. P8-3-8]
Length=677

 Score = 60.1 bits (144),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 25/37 (68%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = -2

Query  113  QQGAMHVAYYPDDPIKDHPDVNVMHKAFAEKSSRLVP  3
            QQG +HV YYPDDPI+DHPD   M K F  KSSRL+P
Sbjct  641  QQGVIHVGYYPDDPIQDHPDATEMRKVFDSKSSRLIP  677



>ref|WP_004900077.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
brisouii]
 gb|ENV47702.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
brisouii ANC 4119]
 gb|ESK51324.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
brisouii CIP 110357]
Length=664

 Score = 60.1 bits (144),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 24/37 (65%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = -2

Query  113  QQGAMHVAYYPDDPIKDHPDVNVMHKAFAEKSSRLVP  3
            +QGA+H+AYYPDDP+K HPDV++M KAF  K  R+VP
Sbjct  628  KQGALHIAYYPDDPVKQHPDVDIMRKAFDSKPDRIVP  664



>ref|WP_004751145.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
sp. ANC 3789]
 gb|ENU81084.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
sp. ANC 3789]
Length=664

 Score = 60.1 bits (144),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 24/37 (65%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = -2

Query  113  QQGAMHVAYYPDDPIKDHPDVNVMHKAFAEKSSRLVP  3
            +QGA+H+AYYPDDP+K HPDV++M KAF  K  R+VP
Sbjct  628  KQGALHIAYYPDDPVKQHPDVDIMRKAFDSKPDRIVP  664



>ref|WP_004990304.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
ursingii]
 gb|ENV75964.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
ursingii DSM 16037 = CIP 107286]
 gb|ENV79734.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
ursingii ANC 3649]
Length=691

 Score = 59.7 bits (143),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 25/36 (69%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = -2

Query  110  QGAMHVAYYPDDPIKDHPDVNVMHKAFAEKSSRLVP  3
            QGAMHV YYPDDP KDHPD  ++H  FA K S+LVP
Sbjct  656  QGAMHVGYYPDDPFKDHPDTQMLHDVFATKPSKLVP  691



>ref|WP_016166955.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
tandoii]
 gb|EOR07012.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
tandoii DSM 14970 = CIP 107469]
Length=664

 Score = 59.7 bits (143),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 26/36 (72%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = -2

Query  110  QGAMHVAYYPDDPIKDHPDVNVMHKAFAEKSSRLVP  3
            QG MHVAYYPDDPI+ HPD  VMH  FA KSS+L+P
Sbjct  629  QGVMHVAYYPDDPIQGHPDPKVMHDVFATKSSQLIP  664



>ref|WP_004996516.1| MULTISPECIES: poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase 
PgaB [Acinetobacter]
 gb|ENX49333.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
ursingii NIPH 706]
 gb|EXD30758.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
baumannii 479375]
Length=691

 Score = 59.7 bits (143),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 25/36 (69%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = -2

Query  110  QGAMHVAYYPDDPIKDHPDVNVMHKAFAEKSSRLVP  3
            QGAMHV YYPDDP KDHPD  ++H  FA K S+LVP
Sbjct  656  QGAMHVGYYPDDPFKDHPDTQMLHDVFATKPSKLVP  691



>dbj|BAP35883.1| polysaccharide deacetylase [Acinetobacter guillouiae]
Length=652

 Score = 55.5 bits (132),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 24/37 (65%), Positives = 26/37 (70%), Gaps = 0/37 (0%)
 Frame = -2

Query  113  QQGAMHVAYYPDDPIKDHPDVNVMHKAFAEKSSRLVP  3
            QQG MHV YYPDDPI+DHP+   M K F  K  RLVP
Sbjct  616  QQGVMHVGYYPDDPIEDHPNTAEMRKVFDSKPQRLVP  652



>gb|EPH37998.1| Biofilm PGA synthesis deacetylase PgaB [Acinetobacter guillouiae 
MSP4-18]
Length=652

 Score = 55.5 bits (132),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 24/37 (65%), Positives = 26/37 (70%), Gaps = 0/37 (0%)
 Frame = -2

Query  113  QQGAMHVAYYPDDPIKDHPDVNVMHKAFAEKSSRLVP  3
            QQG MHV YYPDDPI+DHP+   M K F  K  RLVP
Sbjct  616  QQGVMHVGYYPDDPIEDHPNTAEMRKVFDSKPQRLVP  652



>ref|WP_004722672.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
guillouiae]
 gb|ENU58755.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
guillouiae CIP 63.46]
Length=677

 Score = 55.5 bits (132),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 24/37 (65%), Positives = 26/37 (70%), Gaps = 0/37 (0%)
 Frame = -2

Query  113  QQGAMHVAYYPDDPIKDHPDVNVMHKAFAEKSSRLVP  3
            QQG MHV YYPDDPI+DHP+   M K F  K  RLVP
Sbjct  641  QQGVMHVGYYPDDPIEDHPNTAEMRKVFDSKPQRLVP  677



>gb|ELW82288.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
sp. WC-743]
 emb|CEI53936.1| Biofilm PGA synthesis deacetylase PgaB (EC 3.-) [Acinetobacter 
bereziniae]
Length=652

 Score = 55.5 bits (132),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 24/37 (65%), Positives = 26/37 (70%), Gaps = 0/37 (0%)
 Frame = -2

Query  113  QQGAMHVAYYPDDPIKDHPDVNVMHKAFAEKSSRLVP  3
            QQG MHV YYPDDPI+DHP+   M K F  K  RLVP
Sbjct  616  QQGVMHVGYYPDDPIEDHPNTAEMRKVFDSKPQRLVP  652



>ref|WP_004819455.1| MULTISPECIES: poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase 
PgaB [Acinetobacter]
 gb|ENV17159.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
guillouiae NIPH 991]
 gb|KEC85817.1| polysaccharide deacetylase [Acinetobacter sp. ETR1]
Length=677

 Score = 55.5 bits (132),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 24/37 (65%), Positives = 26/37 (70%), Gaps = 0/37 (0%)
 Frame = -2

Query  113  QQGAMHVAYYPDDPIKDHPDVNVMHKAFAEKSSRLVP  3
            QQG MHV YYPDDPI+DHP+   M K F  K  RLVP
Sbjct  641  QQGVMHVGYYPDDPIEDHPNTAEMRKVFDSKPQRLVP  677



>ref|WP_005030820.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
bereziniae]
 gb|ENV97262.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
bereziniae CIP 70.12]
Length=677

 Score = 55.5 bits (132),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 24/37 (65%), Positives = 26/37 (70%), Gaps = 0/37 (0%)
 Frame = -2

Query  113  QQGAMHVAYYPDDPIKDHPDVNVMHKAFAEKSSRLVP  3
            QQG MHV YYPDDPI+DHP+   M K F  K  RLVP
Sbjct  641  QQGVMHVGYYPDDPIEDHPNTAEMRKVFDSKPQRLVP  677



>ref|WP_004828105.1| MULTISPECIES: poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase 
PgaB [Acinetobacter]
 gb|ENV23416.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
bereziniae NIPH 3]
Length=677

 Score = 55.5 bits (132),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 24/37 (65%), Positives = 26/37 (70%), Gaps = 0/37 (0%)
 Frame = -2

Query  113  QQGAMHVAYYPDDPIKDHPDVNVMHKAFAEKSSRLVP  3
            QQG MHV YYPDDPI+DHP+   M K F  K  RLVP
Sbjct  641  QQGVMHVGYYPDDPIEDHPNTAEMRKVFDSKPQRLVP  677



>ref|WP_004857154.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
gerneri]
 gb|ENV34845.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
gerneri DSM 14967 = CIP 107464]
 gb|EPR81577.1| Biofilm PGA synthesis deacetylase PgaB [Acinetobacter gerneri 
MTCC 9824]
Length=664

 Score = 54.3 bits (129),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 23/37 (62%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = -2

Query  113  QQGAMHVAYYPDDPIKDHPDVNVMHKAFAEKSSRLVP  3
            +QGAMHVAYYPDDP K+HPD  VM + F  + +RL+P
Sbjct  628  KQGAMHVAYYPDDPFKNHPDPKVMRQVFDLQPNRLIP  664



>ref|WP_004648176.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
bohemicus]
 gb|ENU19803.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
bohemicus ANC 3994]
Length=663

 Score = 53.9 bits (128),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 23/37 (62%), Positives = 27/37 (73%), Gaps = 0/37 (0%)
 Frame = -2

Query  113  QQGAMHVAYYPDDPIKDHPDVNVMHKAFAEKSSRLVP  3
            +QG MHVAYYPDDPI+DHPD   + + F  KS  LVP
Sbjct  627  RQGVMHVAYYPDDPIQDHPDTEELRQVFELKSEDLVP  663



>ref|WP_023273866.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
nectaris]
 gb|ESK37820.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
nectaris CIP 110549]
Length=667

 Score = 53.1 bits (126),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 23/37 (62%), Positives = 27/37 (73%), Gaps = 0/37 (0%)
 Frame = -2

Query  113  QQGAMHVAYYPDDPIKDHPDVNVMHKAFAEKSSRLVP  3
            QQG MHVAYYPDDPI  HPD  +M +AF  KS+ + P
Sbjct  631  QQGVMHVAYYPDDPITGHPDPTIMRQAFDSKSNGIEP  667



>ref|WP_016657274.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
rudis]
 gb|EPF70851.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
rudis CIP 110305]
Length=670

 Score = 52.4 bits (124),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 23/37 (62%), Positives = 25/37 (68%), Gaps = 0/37 (0%)
 Frame = -2

Query  113  QQGAMHVAYYPDDPIKDHPDVNVMHKAFAEKSSRLVP  3
            QQG  HVAYYPDDPI+ HP    M K F  KS RL+P
Sbjct  634  QQGVTHVAYYPDDPIQGHPGTAEMRKVFDTKSYRLIP  670



>gb|ABS90006.1| hypothetical protein A1S_3581 [Acinetobacter baumannii ATCC 17978]
 gb|EEX04079.1| hypothetical protein HMPREF0010_01473 [Acinetobacter baumannii 
ATCC 19606 = CIP 70.34]
Length=37

 Score = 47.0 bits (110),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 22/22 (100%), Positives = 22/22 (100%), Gaps = 0/22 (0%)
 Frame = +2

Query  2   MAQDEMIFQQMLYASRSRPDDL  67
           MAQDEMIFQQMLYASRSRPDDL
Sbjct  16  MAQDEMIFQQMLYASRSRPDDL  37



>ref|WP_023273661.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
nectaris]
 gb|ESK38119.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
nectaris CIP 110549]
Length=666

 Score = 49.3 bits (116),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 22/33 (67%), Positives = 24/33 (73%), Gaps = 0/33 (0%)
 Frame = -2

Query  113  QQGAMHVAYYPDDPIKDHPDVNVMHKAFAEKSS  15
            QQG MHVAYYPDDPI  HPD  +M +AF  K S
Sbjct  631  QQGVMHVAYYPDDPITGHPDPTIMRQAFDFKHS  663



>ref|WP_034279990.1| polysaccharide deacetylase [Alkanindiges illinoisensis]
Length=656

 Score = 48.9 bits (115),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 20/36 (56%), Positives = 25/36 (69%), Gaps = 0/36 (0%)
 Frame = -2

Query  110  QGAMHVAYYPDDPIKDHPDVNVMHKAFAEKSSRLVP  3
            QG  HV YYPDDPIKDHPD  ++ + F  K+S  +P
Sbjct  621  QGVRHVGYYPDDPIKDHPDPAILRRVFDSKTSAALP  656



>ref|WP_023272184.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
nectaris]
 gb|ESK40142.1| poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB [Acinetobacter 
nectaris CIP 110549]
Length=667

 Score = 48.1 bits (113),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 20/37 (54%), Positives = 27/37 (73%), Gaps = 0/37 (0%)
 Frame = -2

Query  113  QQGAMHVAYYPDDPIKDHPDVNVMHKAFAEKSSRLVP  3
            QQG MHV YYPDDPIK HPD  ++ +AF  + +++ P
Sbjct  631  QQGVMHVGYYPDDPIKGHPDPAILRQAFDLQPNKVQP  667



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 521190666984