BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c616_g1_i1 len=930 path=[908:0-929]

Length=930
                                                                      Score     E

ref|XP_009600845.1|  PREDICTED: transcription factor MYB34-like       69.7    5e-10   
ref|XP_009769917.1|  PREDICTED: transcription factor MYB86-like       68.2    2e-09   
ref|XP_006358516.1|  PREDICTED: myb-related protein 306-like          63.9    4e-08   
ref|XP_004230371.1|  PREDICTED: protein ODORANT1                      60.5    7e-07   
ref|XP_006423960.1|  hypothetical protein CICLE_v10028398mg           52.0    3e-04   
ref|XP_006480338.1|  PREDICTED: transcription factor MYB86-like       52.0    4e-04   



>ref|XP_009600845.1| PREDICTED: transcription factor MYB34-like [Nicotiana tomentosiformis]
Length=421

 Score = 69.7 bits (169),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 51/111 (46%), Positives = 58/111 (52%), Gaps = 25/111 (23%)
 Frame = +1

Query  412  WGATKESS----DLDETKWSEYLQAPFYLQ----QNHQAPPNHQ-DLFGEGKPDTQFAPQ  564
            WG+T        + +E KWSEYLQ PF L     QNHQ    HQ DL+ E K +TQF  Q
Sbjct  319  WGSTTADGSGKPEREEIKWSEYLQTPFSLGSNTIQNHQISSQHQADLYNETKSETQFVTQ  378

Query  565  GGSPFtpttttataatttWLQNQ--------AMYNNSKNFQRLHAAFGQFS  693
            G            + TTTW+QNQ        A   NS NFQRL AAFGQFS
Sbjct  379  GS--------LNLSTTTTWIQNQPQQSSLQTANLYNSNNFQRLPAAFGQFS  421



>ref|XP_009769917.1| PREDICTED: transcription factor MYB86-like [Nicotiana sylvestris]
Length=422

 Score = 68.2 bits (165),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 89/285 (31%), Positives = 123/285 (43%), Gaps = 72/285 (25%)
 Frame = +1

Query  25   EKLTLSEGSSELNFVEAETCnnnnnsnnQVPSLAVMDSYPTMD--NVV----------CS  168
            +K++ S  + +LNFVEA   N  +    +  S+ +MD YP ++  N+           C 
Sbjct  148  DKVSESSNNDQLNFVEAAHENGFSIEKPKSSSMTIMDHYPLIETNNIAPPTHEFFTTNCK  207

Query  169  NPMSSN----------TPPTHEFFLNKTA--DLSGYLSFLNYTNAAANNIGSSFPMQHPS  312
            +P  SN          TP T+  F NK +  D+     F    +  +N+I ++ P+    
Sbjct  208  SPYFSNYLSFQHLNNYTPNTNILFNNKNSAHDMVSDHQFNCSLSPMSNSILTTSPLARIK  267

Query  313  NSSLFLNPGNPKSNV---------------------VLPMETnssffennasfsWGATKE  429
            + SL   P +   N+                     +      S F  N A+F+WG+T  
Sbjct  268  SPSLTTLPPDNSFNINKSQNWEACTLSSNSNGSSNSIELQSNCSFFDNNAAAFAWGSTTA  327

Query  430  SS----DLDETKWSEYLQAPFYLQ----QNHQAPPNHQDLF-GEGKPDTQFAPQGGSPFt  582
                  + +E KWSEYLQ PF L     QNHQ    HQDL+  E K +TQF  QG     
Sbjct  328  HGSGKPEREEIKWSEYLQTPFSLGSNTIQNHQISSQHQDLYNNETKSETQFMTQGS----  383

Query  583  pttttataatttWLQNQ--------AMYNNSKNFQRLHAAFGQFS  693
                     TTTWLQNQ        A   NS  +QRL AAFGQFS
Sbjct  384  ------LGTTTTWLQNQPQESSLQNANLYNSNTYQRLPAAFGQFS  422



>ref|XP_006358516.1| PREDICTED: myb-related protein 306-like [Solanum tuberosum]
Length=426

 Score = 63.9 bits (154),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 43/102 (42%), Positives = 51/102 (50%), Gaps = 33/102 (32%)
 Frame = +1

Query  436  DLDETKWSEYLQAPFYLQQN-------HQAPPNHQDLFGEGKPDTQFAPQGGSPFtpttt  594
            + +E KWSEYLQ PF L  N       HQ PP+H+   GE K +TQF  QG         
Sbjct  342  EREEIKWSEYLQTPFSLGVNNNTIETHHQIPPHHELYDGETKSETQFMTQGS--------  393

Query  595  tataatttWLQNQA---------MYNNSKNFQRLHAAFGQFS  693
                    WLQNQ          +Y+N+ NFQRL A FGQFS
Sbjct  394  --------WLQNQTPQTSLQTADLYSNN-NFQRLPAVFGQFS  426



>ref|XP_004230371.1| PREDICTED: protein ODORANT1 [Solanum lycopersicum]
Length=426

 Score = 60.5 bits (145),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 42/106 (40%), Positives = 50/106 (47%), Gaps = 36/106 (34%)
 Frame = +1

Query  433  SDLDETKWSEYLQAPFYLQQN---------HQAPPNHQDLFGEGKPDTQFAPQGGSPFtp  585
            S+ +E KWSEYLQ PF L  N         HQ P +H+   GE K  TQF  QG      
Sbjct  338  SEREEIKWSEYLQTPFSLGVNNNTIDTHHQHQIPSHHELYDGETKSKTQFMTQGS-----  392

Query  586  ttttataatttWLQNQA----------MYNNSKNFQRLHAAFGQFS  693
                       WLQNQ           +Y+N+ NFQRL A +GQFS
Sbjct  393  -----------WLQNQTPQTSSLQTAELYSNN-NFQRLPAVYGQFS  426



>ref|XP_006423960.1| hypothetical protein CICLE_v10028398mg [Citrus clementina]
 gb|ESR37200.1| hypothetical protein CICLE_v10028398mg [Citrus clementina]
Length=458

 Score = 52.0 bits (123),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 37/96 (39%), Positives = 49/96 (51%), Gaps = 29/96 (30%)
 Frame = +1

Query  436  DLDETKWSEYLQAPFYLQ---QNHQAPPNHQDLFGEGKPDTQFAPQGGSPFtpttttata  606
            D ++ KWSEYL  PF+L    QNHQ     Q ++ + KP+  F  +G +           
Sbjct  378  DQEDIKWSEYLNTPFFLGSTIQNHQTS---QSMYSDVKPEAHFISEGSN-----------  423

Query  607  atttWLQNQ---------AMYNNSKNFQRLHAAFGQ  687
             TTTW+QNQ         AMY  +K+ QRL  AFGQ
Sbjct  424  -TTTWIQNQHQQASQTTPAMY--TKDLQRLSVAFGQ  456



>ref|XP_006480338.1| PREDICTED: transcription factor MYB86-like [Citrus sinensis]
 gb|KDO56392.1| hypothetical protein CISIN_1g014135mg [Citrus sinensis]
Length=430

 Score = 52.0 bits (123),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 37/96 (39%), Positives = 49/96 (51%), Gaps = 29/96 (30%)
 Frame = +1

Query  436  DLDETKWSEYLQAPFYLQ---QNHQAPPNHQDLFGEGKPDTQFAPQGGSPFtpttttata  606
            D ++ KWSEYL  PF+L    QNHQ     Q ++ + KP+  F  +G +           
Sbjct  350  DQEDIKWSEYLNTPFFLGSTIQNHQTS---QSMYSDVKPEAHFISEGSN-----------  395

Query  607  atttWLQNQ---------AMYNNSKNFQRLHAAFGQ  687
             TTTW+QNQ         AMY  +K+ QRL  AFGQ
Sbjct  396  -TTTWIQNQHQQASQTTPAMY--TKDLQRLSVAFGQ  428



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2019399117948