BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c6152_g2_i1 len=621 path=[1:0-620]

Length=621
                                                                      Score     E

ref|XP_011097322.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    272   5e-87   
ref|XP_009789769.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    271   6e-87   
ref|XP_009586920.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    271   9e-87   
gb|ABR25593.1|  glyceraldehyde-3-phosphate dehydrogenase                267   2e-86   Oryza sativa Indica Group [Indian rice]
ref|XP_006355964.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    268   2e-85   
ref|XP_004239353.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    267   3e-85   
ref|NP_001053139.1|  Os04g0486600                                       266   5e-85   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002452401.1|  hypothetical protein SORBIDRAFT_04g025120          266   1e-84   Sorghum bicolor [broomcorn]
ref|XP_004953003.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    265   2e-84   
ref|NP_001105385.1|  glyceraldehyde-3-phosphate dehydrogenase 3, ...    265   2e-84   Zea mays [maize]
gb|AFW72189.1|  cytosolic glyceroldehyde-3-phosphate dehydrogenas...    265   2e-84   
ref|XP_006652435.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    265   3e-84   
ref|XP_010242342.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    264   4e-84   
gb|EYU34780.1|  hypothetical protein MIMGU_mgv1a009577mg                264   5e-84   
ref|XP_010930058.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    263   9e-84   
gb|ACF87912.1|  unknown                                                 263   1e-83   Zea mays [maize]
gb|ACG36109.1|  glyceraldehyde-3-phosphate dehydrogenase, cytosol...    263   1e-83   Zea mays [maize]
ref|XP_010911739.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    263   1e-83   
gb|ADQ43814.1|  glyceraldehyde-3-phosphate dehydrogenase                263   1e-83   
ref|XP_007037904.1|  Glyceraldehyde-3-phosphate dehydrogenase C s...    263   1e-83   
ref|NP_001105951.1|  LOC100037774                                       263   1e-83   Zea mays [maize]
ref|XP_011024076.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    263   2e-83   
ref|XP_009416004.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    263   2e-83   
ref|XP_011098828.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    263   2e-83   
gb|KCW83197.1|  hypothetical protein EUGRSUZ_B00144                     260   2e-83   
ref|XP_009402724.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    262   2e-83   
gb|ADZ55283.1|  glyceraldehyde-3-phosphate dehydrogenase                262   2e-83   
gb|KCW83196.1|  hypothetical protein EUGRSUZ_B00144                     261   3e-83   
gb|ACJ11728.1|  glyceraldehyde-3-phosphate dehydrogenase                262   4e-83   Gossypium hirsutum [American cotton]
gb|AAW68026.1|  glyceraldehyde-3-phosphate dehydrogenase                256   7e-83   Triticum monococcum [einkorn wheat]
sp|P26519.1|G3PC_PETCR  RecName: Full=Glyceraldehyde-3-phosphate ...    261   8e-83   Petroselinum crispum
ref|XP_004138467.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    261   1e-82   
ref|XP_006438115.1|  hypothetical protein CICLE_v10032014mg             258   2e-82   
ref|XP_010025353.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    260   2e-82   
ref|XP_010026741.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    260   2e-82   
emb|CBW95562.1|  putative glyceraldehyde 3-phosphate dehydrogenase      258   2e-82   
ref|XP_008799964.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    260   2e-82   
ref|XP_004169444.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    260   2e-82   
gb|AET80379.1|  GAPDH3                                                  258   2e-82   
gb|KDO82024.1|  hypothetical protein CISIN_1g019445mg                   257   2e-82   
gb|EPS61158.1|  hypothetical protein M569_13641                         259   3e-82   
gb|AFM93782.1|  glyceraldehyde 3-phosphate dehydrogenase                259   4e-82   
emb|CDP16658.1|  unnamed protein product                                259   4e-82   
gb|KDO82023.1|  hypothetical protein CISIN_1g019445mg                   258   4e-82   
ref|XP_002318114.1|  glyceraldehyde-3-phosphate dehydrogenase fam...    259   4e-82   Populus trichocarpa [western balsam poplar]
ref|XP_008439408.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    259   4e-82   
gb|KDP46338.1|  hypothetical protein JCGZ_10178                         259   4e-82   
sp|P26521.1|G3PC_RANAC  RecName: Full=Glyceraldehyde-3-phosphate ...    259   5e-82   Ranunculus acris [cmmon buttercup]
ref|XP_008441373.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    259   5e-82   
gb|AFV52793.1|  glyceraldehyde 3-phosphate dehydrogenase                259   5e-82   
dbj|BAO57271.1|  glyceraldehyde-3-phosphate dehydrogenase               259   5e-82   
ref|XP_004152516.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    259   6e-82   
gb|AET80378.1|  GAPDH2                                                  257   6e-82   
gb|AET80377.1|  GAPDH1                                                  257   6e-82   
sp|P26518.1|G3PC_MAGLI  RecName: Full=Glyceraldehyde-3-phosphate ...    259   7e-82   Magnolia liliiflora [purple magnolia]
ref|XP_002298594.1|  glyceraldehyde 3-phosphate dehydrogenase fam...    259   7e-82   Populus trichocarpa [western balsam poplar]
gb|ABQ81648.1|  glyceraldehyde-3-phosphate dehydrogenase                258   7e-82   Triticum aestivum [Canadian hard winter wheat]
ref|XP_011045198.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    258   7e-82   
sp|P34783.1|G3P_ATRNU  RecName: Full=Glyceraldehyde-3-phosphate d...    259   7e-82   Atriplex nummularia
ref|XP_008800944.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    259   7e-82   
gb|ABK24012.1|  unknown                                                 258   8e-82   Picea sitchensis
ref|XP_010910405.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    258   8e-82   
gb|ACJ11752.1|  glyceraldehyde-3-phosphate dehydrogenase C subunit      258   9e-82   Gossypium hirsutum [American cotton]
gb|KDO36893.1|  hypothetical protein CISIN_1g024629mg                   253   1e-81   
gb|AEN19694.1|  glyceraldehyde 3-phosphate dehydrogenase                256   1e-81   
ref|XP_009384257.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    258   1e-81   
gb|AAV70659.1|  glyceraldehyde-3-phosphate dehydrogenase                258   1e-81   Musa acuminata [banana]
ref|XP_002265988.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    258   1e-81   Vitis vinifera
gb|AEN19696.1|  glyceraldehyde 3-phosphate dehydrogenase                256   1e-81   
ref|XP_010248875.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    258   1e-81   
gb|KDO36874.1|  hypothetical protein CISIN_1g024565mg                   253   1e-81   
gb|AET80380.1|  GAPDH4                                                  256   1e-81   
gb|AEN19697.1|  glyceraldehyde 3-phosphate dehydrogenase                256   1e-81   
ref|XP_006438114.1|  hypothetical protein CICLE_v10032014mg             258   2e-81   
ref|XP_008439417.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    258   2e-81   
gb|ACX49537.1|  glyceraldehyde-3-phosphate dehydrogenase                253   2e-81   Cucumis sativus [cucumbers]
dbj|BAO45907.1|  glyceraldehyde-3 phosphate dehydrogenase               258   2e-81   
gb|AFJ04516.1|  glyceraldehyde-3-phosphate dehydrogenase                255   2e-81   
ref|XP_009387502.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    257   2e-81   
ref|XP_009383337.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    257   3e-81   
ref|NP_001047348.1|  Os02g0601300                                       257   3e-81   Oryza sativa Japonica Group [Japonica rice]
gb|KDO36888.1|  hypothetical protein CISIN_1g024629mg                   254   3e-81   
gb|KDO36891.1|  hypothetical protein CISIN_1g024629mg                   253   3e-81   
ref|XP_007222473.1|  hypothetical protein PRUPE_ppa008227mg             254   3e-81   
ref|XP_011073006.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    256   4e-81   
ref|XP_007031743.1|  Glyceraldehyde-3-phosphate dehydrogenase C2 ...    256   4e-81   
ref|XP_010248871.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    256   4e-81   
gb|KDO36873.1|  hypothetical protein CISIN_1g024565mg                   254   4e-81   
gb|KDO36892.1|  hypothetical protein CISIN_1g024629mg                   254   4e-81   
ref|XP_004241503.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    256   5e-81   
ref|XP_007031744.1|  Glyceraldehyde-3-phosphate dehydrogenase C2 ...    256   6e-81   
ref|XP_010554090.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    256   7e-81   
gb|ABK96222.1|  unknown                                                 256   7e-81   Populus trichocarpa x Populus deltoides
ref|XP_002263145.2|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    256   7e-81   Vitis vinifera
ref|XP_006347401.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    256   8e-81   
ref|XP_002321679.1|  glyceraldehyde-3-phosphate dehydrogenase fam...    256   8e-81   Populus trichocarpa [western balsam poplar]
gb|AFK93851.1|  glyceraldehyde 3-phosphate dehydrogenase                254   9e-81   
emb|CBX89319.1|  cytosolic glyceraldehyde 3-phosphate dehydrogenase     253   1e-80   
gb|ABC47829.1|  glyceraldehyde-3-phosphate dehydrogenase                255   1e-80   Lilium longiflorum [Easter lily]
dbj|BAJ90709.1|  predicted protein                                      256   1e-80   
ref|XP_006484037.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    256   1e-80   
emb|CBX89318.1|  cytosolic glyceraldehyde 3-phosphate dehydrogenase     253   1e-80   
ref|XP_010458793.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    255   1e-80   
gb|EMS68847.1|  Glyceraldehyde-3-phosphate dehydrogenase, cytosol...    257   1e-80   
ref|XP_002270414.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    255   1e-80   Vitis vinifera
gb|AFK93852.1|  glyceraldehyde 3-phosphate dehydrogenase                254   1e-80   
gb|AEN19695.1|  glyceraldehyde 3-phosphate dehydrogenase                254   1e-80   
gb|KDO36890.1|  hypothetical protein CISIN_1g024629mg                   251   1e-80   
gb|ACV69976.1|  NAD-dependent glyceraldehyde 3-P dehydrogenase          255   2e-80   Solanum chacoense
emb|CDX92059.1|  BnaC03g33610D                                          255   2e-80   
gb|AFK93850.1|  glyceraldehyde 3-phosphate dehydrogenase                253   2e-80   
ref|XP_009787576.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    255   2e-80   
ref|XP_010682871.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    255   2e-80   
emb|CBX89320.1|  cytosolic glyceraldehyde 3-phosphate dehydrogenase     252   2e-80   
ref|XP_009597424.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    255   2e-80   
ref|XP_009792011.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    255   2e-80   
emb|CDP13300.1|  unnamed protein product                                255   2e-80   
emb|CBI27549.3|  unnamed protein product                                256   2e-80   
gb|EEC73541.1|  hypothetical protein OsI_07948                          255   2e-80   Oryza sativa Indica Group [Indian rice]
sp|Q39769.1|G3PC_GINBI  RecName: Full=Glyceraldehyde-3-phosphate ...    255   2e-80   Ginkgo biloba [ginkgo]
ref|XP_006374556.1|  hypothetical protein POPTR_0015s10330g             255   3e-80   
gb|AEO45785.1|  glyceraldehyde-3-phosphate dehydrogenase C              254   3e-80   
ref|XP_010033372.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    254   3e-80   
gb|AID52923.1|  cytosolic glyceraldehyde-3-phosphate dehydrogenase      254   3e-80   
ref|XP_006440049.1|  hypothetical protein CICLE_v10021037mg             254   3e-80   
gb|AFK37023.1|  unknown                                                 250   4e-80   
ref|XP_010524280.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    254   4e-80   
ref|XP_008800947.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    254   4e-80   
ref|XP_006476982.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    254   4e-80   
ref|NP_001267672.1|  glyceraldehyde-3-phosphate dehydrogenase, cy...    254   4e-80   
ref|XP_010476339.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    254   5e-80   
ref|XP_003601828.1|  Glyceraldehyde 3-phosphate dehydrogenase           254   5e-80   
ref|XP_011041572.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    254   5e-80   
ref|XP_011071186.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    254   5e-80   
gb|AFJ42572.1|  glyceraldehyde 3-phosphate dehydrogenase                254   5e-80   
ref|XP_007044990.1|  Glyceraldehyde-3-phosphate dehydrogenase C2 ...    251   5e-80   
ref|XP_008222039.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    254   6e-80   
ref|XP_007222474.1|  hypothetical protein PRUPE_ppa008227mg             254   6e-80   
ref|XP_006378281.1|  hypothetical protein POPTR_0010s06560g             252   6e-80   
gb|ACV86034.1|  glyceraldehyde-3-phosphate dehydrogenase 1              253   7e-80   Festuca arundinacea [tall fescue]
sp|Q42671.1|G3PC_CRAPL  RecName: Full=Glyceraldehyde-3-phosphate ...    253   7e-80   Craterostigma plantagineum
ref|XP_010907761.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    253   7e-80   
gb|AFS33113.1|  glyceraldehyde-3-phosphate dehydrogenase                253   7e-80   
ref|XP_010907760.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    253   8e-80   
gb|KDP30962.1|  hypothetical protein JCGZ_11338                         253   8e-80   
ref|XP_010556366.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    253   8e-80   
ref|XP_002511235.1|  glyceraldehyde 3-phosphate dehydrogenase, pu...    253   9e-80   Ricinus communis
emb|CBX89317.1|  cytosolic glyceraldehyde 3-phosphate dehydrogenase     251   9e-80   
emb|CBI14856.3|  unnamed protein product                                253   9e-80   
ref|NP_001105700.1|  glyceraldehyde-3-phosphate dehydrogenase 2, ...    253   1e-79   Zea mays [maize]
gb|EYU25940.1|  hypothetical protein MIMGU_mgv1a009608mg                253   1e-79   
emb|CAB39974.1|  glyceraldehyde-3-phosphate dehydrogenase               253   1e-79   Nicotiana tabacum [American tobacco]
gb|EYU23146.1|  hypothetical protein MIMGU_mgv1a009579mg                253   1e-79   
gb|AGW24628.1|  glyceraldehyde 3-phosphate dehydrogenase                253   1e-79   
ref|NP_001275277.1|  glyceraldehyde-3-phosphate dehydrogenase, cy...    253   1e-79   
ref|XP_010677936.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    253   1e-79   
gb|AIL56405.1|  glyceraldehyde-3-phosphate dehydrogenase                253   1e-79   
emb|CDX74199.1|  BnaA03g28480D                                          253   2e-79   
gb|AEQ75490.1|  glyeraldehyde 3-phosphate dehydrogenase                 253   2e-79   
ref|XP_008341346.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    252   2e-79   
ref|XP_006297911.1|  hypothetical protein CARUB_v10013953mg             254   2e-79   
ref|XP_009134752.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    251   2e-79   
ref|NP_001289219.1|  glyceraldehyde-3-phosphate dehydrogenase, cy...    252   2e-79   
ref|XP_002315632.1|  glyceraldehyde 3-phosphate dehydrogenase fam...    252   3e-79   Populus trichocarpa [western balsam poplar]
gb|ACR38628.1|  unknown                                                 252   3e-79   Zea mays [maize]
ref|XP_004502328.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    252   3e-79   
ref|XP_003553883.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    252   3e-79   
gb|AAR84410.2|  glyceraldehyde 3-phosphate dehydrogenase                252   3e-79   Daucus carota [carrots]
gb|KFK37847.1|  hypothetical protein AALP_AA3G036600                    252   3e-79   
gb|AFW61324.1|  glyceraldehyde-3-phosphate dehydrogenase1               252   3e-79   
ref|NP_001105413.1|  glyceraldehyde-3-phosphate dehydrogenase 1, ...    252   3e-79   Zea mays [maize]
gb|AGH68507.1|  glyceraldehyde-3-phosphate dehydrogenase                248   3e-79   
gb|AEP31954.1|  glyceraldehyde-3-phosphate dehydrogenase                252   3e-79   
ref|XP_002882331.1|  glyceraldehyde-3-phosphate dehydrogenase C s...    252   3e-79   
sp|P08735.2|G3PC1_MAIZE  RecName: Full=Glyceraldehyde-3-phosphate...    252   3e-79   Zea mays [maize]
gb|AGY14240.1|  glyceraldehyde 3-phosphate dehydrogenase                252   3e-79   
ref|XP_006848723.1|  hypothetical protein AMTR_s00177p00047570          248   3e-79   
sp|P34924.1|G3PC_PINSY  RecName: Full=Glyceraldehyde-3-phosphate ...    252   4e-79   Pinus sylvestris [Scotch pine]
dbj|BAN89461.1|  glyceraldehyde-3-phosphate dehydrogenase C             252   4e-79   
sp|Q41595.1|G3PC_TAXBA  RecName: Full=Glyceraldehyde-3-phosphate ...    252   4e-79   Taxus baccata
ref|XP_008340167.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    252   4e-79   
ref|XP_007163725.1|  hypothetical protein PHAVU_001G259000g             251   4e-79   
gb|EPS63876.1|  hypothetical protein M569_10906                         246   4e-79   
gb|ABA03227.1|  glyceraldehyde-3-phosphate dehydrogenase                251   4e-79   Populus maximowiczii x Populus nigra
ref|XP_004489569.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    251   4e-79   
ref|XP_009134751.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    251   4e-79   
ref|XP_010320554.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    251   4e-79   
ref|XP_010495303.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    251   5e-79   
gb|AGV54709.1|  glyceraldehyde-3-dehydrogenase C subunit                251   5e-79   
ref|NP_001275344.1|  glyceraldehyde-3-phosphate dehydrogenase           251   5e-79   
emb|CDY21098.1|  BnaA08g24270D                                          252   5e-79   
gb|AAM92008.1|AF527779_1  glyceraldehyde 3-phosphate dehydrogenase      251   5e-79   Solanum tuberosum [potatoes]
sp|P26520.1|G3PC_PETHY  RecName: Full=Glyceraldehyde-3-phosphate ...    251   5e-79   Petunia x hybrida [garden petunia]
ref|XP_010318401.1|  PREDICTED: glyceraldehyde 3-phosphate dehydr...    251   5e-79   
ref|XP_009616068.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    251   6e-79   
gb|AGV54256.1|  glyceraldehyde-3-phosphate dehydrogenase                251   6e-79   
ref|XP_006305287.1|  hypothetical protein CARUB_v10009662mg             251   6e-79   
gb|AGX26868.1|  glyceraldehyde-3-phosphate dehydrogenase                249   6e-79   
ref|XP_010518444.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    251   6e-79   
dbj|BAN45710.1|  putative glycelaldehyde-3-phosphate dehydrogenase      251   6e-79   
ref|XP_007044989.1|  Glyceraldehyde-3-phosphate dehydrogenase C2 ...    251   7e-79   
ref|XP_002439163.1|  hypothetical protein SORBIDRAFT_09g001600          251   7e-79   Sorghum bicolor [broomcorn]
gb|KEH31729.1|  glyceraldehyde-3-phosphate dehydrogenase                248   7e-79   
emb|CDY50169.1|  BnaC08g15900D                                          252   7e-79   
gb|AHA84255.1|  glyceraldehyde-3-dehydrogenase C subunit                251   7e-79   
ref|XP_008379147.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    251   7e-79   
ref|XP_004310041.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    251   7e-79   
ref|XP_010528059.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    251   7e-79   
ref|XP_009125005.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    251   8e-79   
ref|XP_010103177.1|  Glyceraldehyde-3-phosphate dehydrogenase           251   8e-79   
ref|NP_187062.1|  glyceraldehyde-3-phosphate dehydrogenase C subu...    251   8e-79   Arabidopsis thaliana [mouse-ear cress]
gb|AFD62802.1|  GAPDH2                                                  251   8e-79   
ref|XP_009124017.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    251   8e-79   
gb|AFW74419.1|  glyceraldehyde-3-phosphate dehydrogenase2               251   9e-79   
gb|AGK63074.1|  glyceraldehyde-3-phosphate dehydrogenase                251   9e-79   
ref|XP_006408221.1|  hypothetical protein EUTSA_v10021083mg             251   9e-79   
dbj|BAH28852.1|  glyceraldehyde-3-phosphate dehydrogenase               251   1e-78   Ipomoea nil [qian niu]
ref|XP_002892749.1|  GAPC-2                                             250   1e-78   
emb|CDY49358.1|  BnaA05g33200D                                          250   1e-78   
emb|CDY21135.1|  BnaA01g33660D                                          250   1e-78   
ref|NP_001240046.1|  uncharacterized protein LOC100782924               250   1e-78   
gb|AGY80450.1|  glyceraldehyde-3-phosphate                              250   1e-78   
sp|P26517.1|G3PC1_HORVU  RecName: Full=Glyceraldehyde-3-phosphate...    250   1e-78   Hordeum vulgare [barley]
ref|XP_011086733.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    250   2e-78   
emb|CAZ76054.1|  glyceraldehyde-3-phosphate dehydrogenase               250   2e-78   Triticum aestivum [Canadian hard winter wheat]
gb|AFW61325.1|  glyceraldehyde-3-phosphate dehydrogenase1 isoform 1     251   2e-78   
gb|ABV02033.1|  glyceraldehyde 3-phosphate dehydrogenase                250   2e-78   Nicotiana langsdorffii x Nicotiana sanderae
ref|XP_009110581.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    250   2e-78   
gb|AFD94086.1|  GAPDH                                                   248   2e-78   
ref|XP_009606469.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    250   2e-78   
emb|CDY29987.1|  BnaC01g40210D                                          251   2e-78   
ref|XP_008677789.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    250   2e-78   
gb|AEO72143.1|  glyceraldehyde-3-phosphate dehydrogenase                249   2e-78   
ref|XP_004515830.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    249   3e-78   
gb|AIC33039.1|  glyceraldehyde-3-phosphate dehydrogenase                248   3e-78   
ref|XP_007044991.1|  Glyceraldehyde-3-phosphate dehydrogenase C2 ...    246   3e-78   
gb|ADC45375.1|  glyceraldehyde-3-phosphate dehydrogenase                248   3e-78   
ref|NP_001060897.1|  Os08g0126300                                       249   3e-78   Oryza sativa Japonica Group [Japonica rice]
sp|P04796.2|G3PC_SINAL  RecName: Full=Glyceraldehyde-3-phosphate ...    249   3e-78   Sinapis alba [bai jie]
emb|CDY26651.1|  BnaA09g46260D                                          249   4e-78   
gb|AHW48354.1|  glyceraldehyde-3-phosphate dehydrogenase C2-like ...    249   4e-78   
gb|ACN59435.1|  glyceraldehyde-3-phosphate dehydrogenase                249   4e-78   Dimocarpus longan [longan]
ref|XP_006659081.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    249   4e-78   
gb|ACJ85080.1|  unknown                                                 249   4e-78   Medicago truncatula
gb|AAA32794.1|  cystolic glyceraldehyde-3-phosphate dehydrogenase       249   4e-78   Arabidopsis thaliana [mouse-ear cress]
dbj|BAH56909.1|  AT1G13440                                              249   4e-78   Arabidopsis thaliana [mouse-ear cress]
ref|NP_172801.1|  glyceraldehyde 3-phosphate dehydrogenase GAPC2        249   4e-78   Arabidopsis thaliana [mouse-ear cress]
dbj|BAJ17660.1|  glyceraldehyde 3-phosphate dehydrogenase               249   4e-78   
ref|XP_009117998.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    249   5e-78   
emb|CDX98100.1|  BnaA06g08510D                                          248   5e-78   
ref|NP_001241184.1|  uncharacterized protein LOC100807342               249   5e-78   
ref|XP_008389804.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    249   5e-78   
dbj|BAJ33926.1|  unnamed protein product                                248   6e-78   
dbj|BAJ10716.1|  glyceraldehyde-3-phosphate dehydrogenase               248   6e-78   
gb|AFK45399.1|  unknown                                                 248   6e-78   
gb|AAM65189.1|  glyceraldehyde-3-phosphate dehydrogenase C subuni...    248   6e-78   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003526975.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    248   7e-78   
ref|NP_001237544.1|  glyceraldehyde-3-dehydrogenase C subunit           248   7e-78   
gb|KCW83195.1|  hypothetical protein EUGRSUZ_B00144                     248   7e-78   
ref|XP_006648814.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    250   8e-78   
gb|AHB86970.1|  glyceraldehyde 3-phosphate dehydrogenase                248   8e-78   
ref|XP_003608875.1|  Glyceraldehyde-3-phosphate dehydrogenase           248   8e-78   
ref|XP_007151566.1|  hypothetical protein PHAVU_004G057600g             248   9e-78   
gb|AFG28406.1|  glyceraldehyde-3-phosphate dehydrogenase C1             248   9e-78   
ref|XP_007151567.1|  hypothetical protein PHAVU_004G057700g             248   9e-78   
gb|AFD94087.1|  GAPDH                                                   246   9e-78   
ref|XP_004972973.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    248   9e-78   
ref|XP_003573324.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    248   9e-78   
gb|AGN95066.1|  putative glyceraldehyde-3-phosphate dehydrogenase...    248   1e-77   
ref|XP_003573317.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    248   1e-77   
dbj|BAP90376.1|  glyceraldehyde-3 phosphate dehydrogenase               248   1e-77   
emb|CAC80375.1|  glyceraldehyde-3-phosphate dehydrogenase               247   1e-77   Capsicum annuum
gb|AIX10772.1|  glyceraldehyde-3-phosphate dehydrogenase                248   1e-77   
gb|ACS68202.1|  glyceraldehyde-3-phosphate dehydrogenase 1              248   1e-77   
emb|CDY42906.1|  BnaC05g47450D                                          248   1e-77   
ref|XP_006578692.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    248   1e-77   
sp|P25861.1|G3PC_ANTMA  RecName: Full=Glyceraldehyde-3-phosphate ...    248   1e-77   Antirrhinum majus [garden snapdragon]
gb|ACV86035.1|  glyceraldehyde-3-phosphate dehydrogenase 2              248   1e-77   Festuca arundinacea [tall fescue]
dbj|BAH20011.1|  AT1G13440                                              248   1e-77   Arabidopsis thaliana [mouse-ear cress]
gb|ACZ51445.1|  glyceraldehyde 3-phosphate dehydrogenase                247   2e-77   
ref|NP_001236129.1|  glyceraldehyde-3-phosphate dehydrogenase           247   2e-77   
ref|XP_006417122.1|  hypothetical protein EUTSA_v10008131mg             247   2e-77   
gb|AAA82047.1|  glyceraldehyde-3-phosphate dehydrogenase                247   3e-77   
pdb|3E6A|O  Chain O, Crystal Structure And Functional Analysis Of...    247   3e-77   
sp|P34921.1|G3PC_DIACA  RecName: Full=Glyceraldehyde-3-phosphate ...    246   4e-77   
emb|CDY30032.1|  BnaC05g09880D                                          248   4e-77   
gb|EYU22565.1|  hypothetical protein MIMGU_mgv1a009585mg                246   5e-77   
gb|ADB98096.1|  glyceraldehyde 3-phosphate dehydrogenase                246   5e-77   
ref|XP_004972972.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    247   6e-77   
sp|P34922.1|G3PC_PEA  RecName: Full=Glyceraldehyde-3-phosphate de...    246   8e-77   
sp|P17878.1|G3PC_MESCR  RecName: Full=Glyceraldehyde-3-phosphate ...    245   1e-76   
emb|CAA42103.1|  glycolytic glyceraldehyde 3-phosphate dehydrogenase    245   1e-76   
ref|XP_010554228.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    245   1e-76   
ref|XP_003524483.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    245   1e-76   
gb|KFK43602.1|  hypothetical protein AALP_AA1G147800                    245   1e-76   
gb|KEH25421.1|  glyceraldehyde-3-phosphate dehydrogenase                244   2e-76   
gb|AIX10973.1|  glyceraldehyde-3-phosphate dehydrogenase                245   2e-76   
ref|XP_003523131.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    244   2e-76   
gb|ACN59434.1|  glyceraldehyde-3-phosphate dehydrogenase                244   2e-76   
gb|ABI96175.1|  glyceraldehyde-3 phosphate dehydrogenase                244   2e-76   
ref|XP_008779385.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    244   2e-76   
gb|KHN31915.1|  Glyceraldehyde-3-phosphate dehydrogenase                244   2e-76   
ref|XP_003573318.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    244   3e-76   
emb|CDY16090.1|  BnaC08g40330D                                          247   3e-76   
ref|XP_011016293.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    243   6e-76   
gb|ACS68203.1|  glyceraldehyde-3-phosphate dehydrogenase 2              243   6e-76   
dbj|BAN45709.1|  putative glycelaldehyde-3-phosphate dehydrogenase      243   7e-76   
gb|AFD62268.1|  glyceraldehyde-3-phosphate dehydrogenase                243   8e-76   
ref|XP_007210523.1|  hypothetical protein PRUPE_ppa008250mg             243   9e-76   
dbj|BAJ10715.1|  glyceraldehyde-3-phosphate dehydrogenase               242   2e-75   
gb|EAY94607.1|  hypothetical protein OsI_16384                          243   2e-75   
gb|KCW61990.1|  hypothetical protein EUGRSUZ_H04673                     245   2e-75   
gb|ADK92819.1|  glyceraldehyde-3-phosphate dehydrogenase                240   2e-75   
gb|AGZ15367.1|  glyceraldehyde-3-dehydrogenase C subunit                246   4e-75   
ref|XP_008239422.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    240   1e-74   
emb|CAC80385.1|  glyceraldehyde-3-phosphate dehydrogenase               240   2e-74   
gb|ABK00054.1|  cytosolic glyceraldehyde-3-phosphate dehydrogenase      239   2e-74   
emb|CAC80376.1|  glyceraldehyde-3-phosphate dehydrogenase               238   3e-74   
gb|KHN30499.1|  Glyceraldehyde-3-phosphate dehydrogenase, cytosolic     239   4e-74   
gb|AAQ55372.1|  glyceraldehyde-3-phosphate dehydrogenase                235   9e-74   
gb|ABP01774.1|  GAP dehydrogenase subunit C                             236   9e-74   
gb|AAQ55376.1|  glyceraldehyde-3-phosphate dehydrogenase                234   1e-73   
ref|XP_002312644.2|  glyceraldehyde 3-phosphate dehydrogenase fam...    237   2e-73   
ref|XP_011041571.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    238   2e-73   
gb|ACX30668.1|  glyceraldehyde-3-phosphate dehydrogenase                236   3e-73   
ref|XP_007217558.1|  hypothetical protein PRUPE_ppa022368mg             236   4e-73   
ref|XP_009336547.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    235   9e-73   
gb|KDP26768.1|  hypothetical protein JCGZ_17926                         234   2e-72   
gb|EYU44806.1|  hypothetical protein MIMGU_mgv1a022565mg                230   8e-72   
sp|P09094.1|G3PC_TOBAC  RecName: Full=Glyceraldehyde-3-phosphate ...    232   1e-71   
gb|EMT25216.1|  Glyceraldehyde-3-phosphate dehydrogenase, cytosol...    231   4e-71   
gb|AAB59010.1|  glyceraldehyde-3-phosphate-dehydrogenase                231   6e-71   
ref|XP_010105174.1|  Glyceraldehyde-3-phosphate dehydrogenase           231   8e-71   
ref|XP_002975979.1|  hypothetical protein SELMODRAFT_175430             230   1e-70   
gb|AAB07758.1|  glyceraldehyde 3-phosphate dehydrogenase                228   1e-70   
ref|XP_010320598.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    228   2e-70   
ref|XP_002968506.1|  hypothetical protein SELMODRAFT_169833             229   3e-70   
ref|XP_004138468.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    227   7e-70   
gb|AGH55663.1|  glyceraldehyde-3-phosphate dehydrogenase                226   1e-69   
gb|KDO36889.1|  hypothetical protein CISIN_1g024629mg                   222   9e-69   
emb|CAC80381.1|  glyceraldehyde-3-phosphate dehydrogenase               224   1e-68   
ref|XP_001783115.1|  predicted protein                                  221   3e-67   
ref|XP_006848720.1|  hypothetical protein AMTR_s00177p00046490          214   4e-67   
gb|AFK35824.1|  unknown                                                 221   4e-67   
ref|XP_001752151.1|  predicted protein                                  219   2e-66   
ref|NP_001077530.1|  glyceraldehyde 3-phosphate dehydrogenase GAPC2     213   1e-64   
ref|XP_004304013.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    214   1e-64   
emb|CAC80383.1|  glyceraldehyde-3-phosphate dehydrogenase               213   2e-64   
gb|ABO14515.1|  glyceraldehyde-3-phosphate dehydrogenase                209   5e-64   
gb|AEO13430.1|  glyceraldehyde-3-phosphate dehydrogenase                206   1e-63   
dbj|BAE98169.1|  glyceraldehyde-3-phosphate dehydrogenase like pr...    208   2e-63   
ref|XP_007137943.1|  hypothetical protein PHAVU_009G1684000g            204   8e-63   
gb|ADZ75465.1|  glyceraldehyde-3-phosphate dehydrogenase                206   1e-61   
emb|CAA06030.1|  glyeraldehyde-3-phosphate dehydrogenase                204   2e-60   
sp|P08477.1|G3PC2_HORVU  RecName: Full=Glyceraldehyde-3-phosphate...    202   4e-60   
gb|ACI69846.1|  Glyceraldehyde-3-phosphate dehydrogenase                199   1e-58   
gb|ACA24137.1|  cytosolic glyceraldehydes-3-phophate dehydrogenase      196   2e-58   
gb|KDP25059.1|  hypothetical protein JCGZ_22594                         201   2e-58   
gb|KHG15503.1|  Glyceraldehyde-3-phosphate dehydrogenase-2C cytos...    196   3e-58   
sp|Q00640.1|G3P_BLUGH  RecName: Full=Glyceraldehyde-3-phosphate d...    197   5e-58   
ref|XP_008776392.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    199   5e-58   
gb|EYU33796.1|  hypothetical protein MIMGU_mgv1a006939mg                199   1e-57   
gb|ABR26570.1|  cytosolic glyceraldehyde-3-phosphate dehydrogenase      194   1e-57   
gb|EYU27576.1|  hypothetical protein MIMGU_mgv1a020814mg                197   1e-57   
gb|AEB31347.1|  glyceraldehyde 3-phosphate dehydrogenase                192   1e-57   
emb|CDQ67160.1|  unnamed protein product                                196   2e-57   
gb|ADM86711.1|  glyceraldehyde-3-phosphate dehydrogenase                190   2e-57   
ref|XP_009414498.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    198   2e-57   
gb|KHG23352.1|  Glyceraldehyde-3-phosphate dehydrogenase-2C cytos...    193   2e-57   
ref|XP_010895169.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    195   3e-57   
gb|ACI66269.1|  Glyceraldehyde-3-phosphate dehydrogenase                195   3e-57   
gb|EPQ64584.1|  Glyceraldehyde-3-phosphate dehydrogenase isozyme 1      195   3e-57   
ref|XP_003452738.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    195   3e-57   
ref|XP_002290129.1|  glyceraldehyde 3-phosphate dehydrogenase           195   3e-57   
ref|XP_010693410.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    197   4e-57   
emb|CAC80382.1|  glyceraldehyde-3-phosphate dehydrogenase               194   4e-57   
ref|XP_004139839.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    197   5e-57   
gb|KHG04963.1|  Glyceraldehyde-3-phosphate dehydrogenase                193   5e-57   
gb|ACL98124.1|  glyceraldehyde-3-phosphate dehydrogenase                192   6e-57   
ref|XP_010914235.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    196   8e-57   
ref|XP_006804270.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    194   1e-56   
ref|XP_010941678.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    196   1e-56   
gb|ABK24753.1|  unknown                                                 196   1e-56   
ref|XP_010095945.1|  Glyceraldehyde-3-phosphate dehydrogenase           196   1e-56   
gb|ACN40575.1|  unknown                                                 195   1e-56   
gb|AEG78378.1|  glyceraldehyde 3-phosphate dehydrogenase isoform 1      189   1e-56   
ref|XP_011095736.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    196   1e-56   
ref|XP_004569788.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    193   1e-56   
ref|XP_005933826.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    193   1e-56   
dbj|BAH36865.1|  glyceraldehyde-3-phosphate dehydrogenase               190   2e-56   
emb|CDQ67159.1|  unnamed protein product                                193   2e-56   
gb|AAO25765.1|  glyceraldehyde-3-phosphate dehydrogenase                187   2e-56   
ref|XP_010240502.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    195   2e-56   
ref|XP_010895225.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    189   2e-56   
gb|AFI57843.1|  glyceraldehyde-3-phosphate dehydrogenase                191   3e-56   
ref|XP_008447086.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    195   3e-56   
ref|XP_010064086.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    195   3e-56   
ref|XP_005745236.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    192   3e-56   
gb|AAT70328.1|  glyceraldehyde 3-phosphate dehydrogenase                192   3e-56   
ref|XP_011086336.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    195   3e-56   
gb|AAZ06767.1|  glyceraldehyde-3-phosphate dehydrogenase                188   5e-56   
ref|XP_009399260.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    194   5e-56   
emb|CDP13563.1|  unnamed protein product                                194   6e-56   
ref|XP_010537807.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    194   6e-56   
ref|XP_010537806.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    194   6e-56   
ref|XP_005804768.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    192   6e-56   
ref|XP_001781685.1|  predicted protein                                  194   7e-56   
gb|ADG29129.1|  glyceraldehyde-3-phosphate dehydrogenase                191   7e-56   
ref|XP_002982970.1|  hypothetical protein SELMODRAFT_234134             192   8e-56   
ref|XP_006307603.1|  hypothetical protein CARUB_v10009227mg             194   8e-56   
ref|XP_004140018.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    193   9e-56   
gb|EAZ37938.1|  hypothetical protein OsJ_22288                          193   9e-56   
ref|XP_004488757.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    192   1e-55   
ref|XP_002315071.2|  hypothetical protein POPTR_0010s17930g             193   1e-55   
ref|XP_010750705.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    191   1e-55   
ref|XP_002890157.1|  GAPCP-2                                            193   1e-55   
ref|XP_001771146.1|  predicted protein                                  191   1e-55   
ref|XP_011013977.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    193   1e-55   
gb|ACJ64842.1|  glyceraldehyde 3-phosphate dehydrogenase                191   1e-55   
ref|WP_034359074.1|  glyceraldehyde-3-phosphate dehydrogenase           186   1e-55   
gb|AIZ74327.1|  NAD+-dependent glyceraldehyde-3-phosphate dehydro...    193   2e-55   
ref|NP_001149357.1|  LOC100282981                                       192   2e-55   
gb|AAD10215.1|  glyceraldehyde-3-phosphate dehydrogenase                193   2e-55   
gb|AFK39182.1|  unknown                                                 191   2e-55   
ref|NP_001058309.1|  Os06g0666600                                       192   2e-55   
ref|XP_006416830.1|  hypothetical protein EUTSA_v10007716mg             192   2e-55   
ref|WP_015359733.1|  MULTISPECIES: glyceraldehyde-3-phosphate deh...    190   2e-55   
gb|KFK42362.1|  hypothetical protein AALP_AA2G245800                    187   2e-55   
ref|NP_001188128.1|  glyceraldehyde-3-phosphate dehydrogenase           190   2e-55   
ref|XP_006646946.1|  PREDICTED: glyceraldehyde 3-phosphate dehydr...    191   2e-55   
ref|XP_004154566.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    192   2e-55   
gb|ADO28001.1|  glyceraldehyde-3-phosphate dehydrogenase                190   2e-55   
gb|ACO13646.1|  Glyceraldehyde-3-phosphate dehydrogenase                190   3e-55   
ref|XP_004488756.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    191   3e-55   
ref|XP_003596038.1|  Glyceraldehyde-3-phosphate dehydrogenase           192   3e-55   
ref|XP_003596040.1|  Glyceraldehyde-3-phosphate dehydrogenase           192   3e-55   
gb|AAO22684.1|  putative glyceraldehyde-3-phosphate dehydrogenase       192   3e-55   
gb|AIX97549.1|  glyceraldehyde-3-phosphate dehydrogenase                192   3e-55   
gb|AAM67077.1|  putative glyceraldehyde-3-phosphate dehydrogenase       192   3e-55   
ref|NP_173080.1|  glyceraldehyde 3-phosphate dehydrogenase              192   3e-55   
emb|CDY35080.1|  BnaA06g10900D                                          192   3e-55   
ref|WP_014254442.1|  glyceraldehyde-3-phosphate dehydrogenase [         190   3e-55   
gb|ADO28487.1|  glyceraldehyde-3-phosphate dehydrogenase                190   3e-55   
ref|XP_006853569.1|  hypothetical protein AMTR_s00032p00242890          193   3e-55   
ref|WP_027622718.1|  glyceraldehyde-3-phosphate dehydrogenase [         190   3e-55   
ref|XP_009149063.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    192   4e-55   
gb|ACH43760.1|  putative glyceraldehyde-3-phosphate dehydrogenase       187   4e-55   
ref|XP_004304011.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    190   4e-55   
ref|XP_002312235.1|  glyceraldehyde 3-phosphate dehydrogenase 1 f...    192   4e-55   
ref|XP_007022674.1|  Glyceraldehyde-3-phosphate dehydrogenase of ...    191   4e-55   
gb|AAD10214.1|  glyceraldehyde-3-phosphate dehydrogenase                192   4e-55   
ref|XP_010276220.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    192   4e-55   
ref|NP_001080768.1|  mg:bb02e05                                         189   4e-55   
gb|KHN22160.1|  Glyceraldehyde-3-phosphate dehydrogenase, cytosolic     192   4e-55   
ref|XP_011016312.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    192   4e-55   
gb|AER42671.1|  glyceraldehyde 3-phosphate dehydrogenase                188   4e-55   
emb|CDY33343.1|  BnaC05g12400D                                          192   4e-55   
ref|XP_001781691.1|  predicted protein                                  192   5e-55   
ref|XP_001632905.1|  predicted protein                                  189   5e-55   
emb|CAA04942.1|  NAD-dependent glyceraldehyde-3-phosphate dehydro...    190   5e-55   
ref|WP_003512173.1|  glyceraldehyde-3-phosphate dehydrogenase           189   5e-55   
ref|XP_007022675.1|  Glyceraldehyde-3-phosphate dehydrogenase of ...    190   5e-55   
gb|ACL54292.1|  unknown                                                 191   5e-55   
emb|CAC80387.1|  glyceraldehyde-3-phosphate dehydrogenase               192   5e-55   
ref|XP_004488755.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    191   6e-55   
ref|XP_010531997.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    190   6e-55   
ref|XP_003547755.1|  PREDICTED: glyceraldehyde 3-phosphate dehydr...    191   6e-55   
ref|XP_009766349.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    191   6e-55   
gb|KFK42359.1|  hypothetical protein AALP_AA2G245800                    187   6e-55   
ref|XP_002508643.1|  glyceraldehyde-3-phosphate dehydrogenase           191   6e-55   
ref|XP_005845921.1|  hypothetical protein CHLNCDRAFT_36383              189   8e-55   
gb|ADH43626.1|  glyceraldehyde 3-phosphate dehydrogenase isoform 1      189   8e-55   
gb|AIN76876.1|  glyceraldehyde-3-phosphate dehydrogenase                189   9e-55   
ref|XP_009593112.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    191   9e-55   
sp|Q05025.2|G3P_COTJA  RecName: Full=Glyceraldehyde-3-phosphate d...    189   9e-55   
gb|EMT03645.1|  Glyceraldehyde-3-phosphate dehydrogenase, cytosolic     191   9e-55   
ref|XP_004306563.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    191   9e-55   
emb|CAC80380.1|  glyceraldehyde-3-phosphate dehydrogenase               188   9e-55   
ref|XP_004951761.1|  PREDICTED: glyceraldehyde 3-phosphate dehydr...    191   9e-55   
gb|EMS57422.1|  Glyceraldehyde-3-phosphate dehydrogenase, cytosolic     191   1e-54   
ref|XP_009408252.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    191   1e-54   
ref|XP_002451619.1|  hypothetical protein SORBIDRAFT_04g004750          191   1e-54   
gb|AGT48254.1|  glyceraldehyde-3-phosphate dehydrogenase                188   1e-54   
ref|XP_006854435.1|  hypothetical protein AMTR_s00039p00217390          191   1e-54   
ref|NP_001130796.1|  glyceraldehyde-3-phosphate dehydrogenase, cy...    190   1e-54   
ref|XP_003173895.1|  glyceraldehyde-3-phosphate dehydrogenase           188   1e-54   
ref|XP_008456299.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    191   1e-54   
ref|XP_004550835.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    188   1e-54   
ref|XP_001485646.1|  glyceraldehyde-3-phosphate dehydrogenase           188   1e-54   
ref|XP_004248314.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    190   1e-54   
ref|XP_010459169.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    191   1e-54   
gb|AAW56452.1|  glyceraldehyde-3-phosphate dehydrogenase                188   1e-54   
gb|EPY51614.1|  glyceraldehyde-3-phosphate dehydrogenase Tdh1           188   1e-54   
dbj|BAJ86344.1|  predicted protein                                      190   1e-54   
ref|NP_001267044.1|  glyceraldehyde-3-phosphate dehydrogenase           188   2e-54   
ref|XP_002965494.1|  hypothetical protein SELMODRAFT_439282             192   2e-54   
emb|CAC80379.1|  glyceraldehyde-3-phosphate dehydrogenase               187   2e-54   
gb|ADJ96634.1|  glyceraldehyde-3-phosphate dehydrogenase                190   2e-54   
gb|AEB31345.1|  glyceraldehyde 3-phosphate dehydrogenase isoform 1      188   2e-54   
ref|XP_009565005.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    188   2e-54   



>ref|XP_011097322.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase, cytosolic 
[Sesamum indicum]
Length=337

 Score =   272 bits (695),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 141/160 (88%), Positives = 151/160 (94%), Gaps = 0/160 (0%)
 Frame = -2

Query  482  MAKVKIGINGFGRIGRLVARVALLSDDIELVAVNDPFITTDYMTYMFKYDTVHGQWTKNE  303
            M K+KIGINGFGRIGRLVARVAL SDDIELVAVNDPFITTDYMTYMFKYD+VHGQW K+E
Sbjct  1    MGKIKIGINGFGRIGRLVARVALQSDDIELVAVNDPFITTDYMTYMFKYDSVHGQWKKHE  60

Query  302  LKVKDAKTLLFGDRHVAVFDKRNPEEIPWGETGAEYVVESTGVFTDQDkaaahlkggakK  123
            LKVKD+KTLLFGDR VAVF  RNPEEIPWGE+GAEYVVESTGVFTD+DKAAAH+KGGAKK
Sbjct  61   LKVKDSKTLLFGDRPVAVFGVRNPEEIPWGESGAEYVVESTGVFTDKDKAAAHIKGGAKK  120

Query  122  VVISAPSKDAPMFVMGVNHLEYKKDVDIVSNASCTTNCLA  3
            VVISAPSKDAPMFV+GVN  EYK D++IVSNASCTTNCLA
Sbjct  121  VVISAPSKDAPMFVVGVNEKEYKADINIVSNASCTTNCLA  160



>ref|XP_009789769.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase, cytosolic 
[Nicotiana sylvestris]
Length=337

 Score =   271 bits (694),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 143/160 (89%), Positives = 148/160 (93%), Gaps = 0/160 (0%)
 Frame = -2

Query  482  MAKVKIGINGFGRIGRLVARVALLSDDIELVAVNDPFITTDYMTYMFKYDTVHGQWTKNE  303
            M KVKIGINGFGRIGRLVARVAL SDDIELVAVNDPFITTDYMTYMFKYDTVHGQW K+E
Sbjct  1    MGKVKIGINGFGRIGRLVARVALQSDDIELVAVNDPFITTDYMTYMFKYDTVHGQWKKHE  60

Query  302  LKVKDAKTLLFGDRHVAVFDKRNPEEIPWGETGAEYVVESTGVFTDQDkaaahlkggakK  123
            LKVKD KTLLFGD+ V VF  RNPEEIPWGE GAEYVVESTGVFTD+DKAAAHLKGGAK+
Sbjct  61   LKVKDEKTLLFGDKPVKVFGARNPEEIPWGEAGAEYVVESTGVFTDKDKAAAHLKGGAKR  120

Query  122  VVISAPSKDAPMFVMGVNHLEYKKDVDIVSNASCTTNCLA  3
            VVISAPSKDAPMFVMGVN  EYK DV+IVSNASCTTNCLA
Sbjct  121  VVISAPSKDAPMFVMGVNEKEYKGDVNIVSNASCTTNCLA  160



>ref|XP_009586920.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase, cytosolic 
[Nicotiana tomentosiformis]
Length=337

 Score =   271 bits (693),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 142/160 (89%), Positives = 148/160 (93%), Gaps = 0/160 (0%)
 Frame = -2

Query  482  MAKVKIGINGFGRIGRLVARVALLSDDIELVAVNDPFITTDYMTYMFKYDTVHGQWTKNE  303
            M KVKIGINGFGRIGRLVARVAL SDDIELVAVNDPFITTDYMTYMFKYDTVHGQW K+E
Sbjct  1    MGKVKIGINGFGRIGRLVARVALQSDDIELVAVNDPFITTDYMTYMFKYDTVHGQWKKHE  60

Query  302  LKVKDAKTLLFGDRHVAVFDKRNPEEIPWGETGAEYVVESTGVFTDQDkaaahlkggakK  123
            LKVKD KTLLFGD+ V VF  RNPEEIPWGE GAEYVVESTGVFTD+DKAAAHLKGGAK+
Sbjct  61   LKVKDEKTLLFGDKPVKVFGARNPEEIPWGEAGAEYVVESTGVFTDKDKAAAHLKGGAKR  120

Query  122  VVISAPSKDAPMFVMGVNHLEYKKDVDIVSNASCTTNCLA  3
            VVISAPSKDAPMFVMGVN  EYK D++IVSNASCTTNCLA
Sbjct  121  VVISAPSKDAPMFVMGVNEKEYKGDINIVSNASCTTNCLA  160



>gb|ABR25593.1| glyceraldehyde-3-phosphate dehydrogenase [Oryza sativa Indica 
Group]
Length=263

 Score =   267 bits (683),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 139/160 (87%), Positives = 150/160 (94%), Gaps = 0/160 (0%)
 Frame = -2

Query  482  MAKVKIGINGFGRIGRLVARVALLSDDIELVAVNDPFITTDYMTYMFKYDTVHGQWTKNE  303
            MAK+KIGINGFGRIGRLVARVAL SDD+ELVAVNDPFITTDYMTYMFKYDTVHGQW  +E
Sbjct  1    MAKIKIGINGFGRIGRLVARVALQSDDVELVAVNDPFITTDYMTYMFKYDTVHGQWKHHE  60

Query  302  LKVKDAKTLLFGDRHVAVFDKRNPEEIPWGETGAEYVVESTGVFTDQDkaaahlkggakK  123
            +KVKD+KTLLFG++ V VF  RNPEEIPWGETGAE+VVESTGVFTD+DKAAAHLKGGAKK
Sbjct  61   VKVKDSKTLLFGEKEVTVFGCRNPEEIPWGETGAEFVVESTGVFTDKDKAAAHLKGGAKK  120

Query  122  VVISAPSKDAPMFVMGVNHLEYKKDVDIVSNASCTTNCLA  3
            VVISAPSKDAPMFV+GVN  EYK D+DIVSNASCTTNCLA
Sbjct  121  VVISAPSKDAPMFVVGVNEKEYKPDIDIVSNASCTTNCLA  160



>ref|XP_006355964.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase, cytosolic-like 
[Solanum tuberosum]
Length=337

 Score =   268 bits (684),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 140/160 (88%), Positives = 148/160 (93%), Gaps = 0/160 (0%)
 Frame = -2

Query  482  MAKVKIGINGFGRIGRLVARVALLSDDIELVAVNDPFITTDYMTYMFKYDTVHGQWTKNE  303
            M KVKIGINGFGRIGRLVARVAL SDDIELVAVNDPFITT+YMTYMFKYDTVHGQW K+E
Sbjct  1    MGKVKIGINGFGRIGRLVARVALQSDDIELVAVNDPFITTEYMTYMFKYDTVHGQWKKHE  60

Query  302  LKVKDAKTLLFGDRHVAVFDKRNPEEIPWGETGAEYVVESTGVFTDQDkaaahlkggakK  123
            LKVKD KTLLFGD+ V VF  RNPEEIPWGE GA+YVVESTGVFTD+DKAAAHLKGGAK+
Sbjct  61   LKVKDEKTLLFGDKPVKVFGARNPEEIPWGEAGADYVVESTGVFTDKDKAAAHLKGGAKR  120

Query  122  VVISAPSKDAPMFVMGVNHLEYKKDVDIVSNASCTTNCLA  3
            VVISAPSKDAPMFVMGVN  EYK D++IVSNASCTTNCLA
Sbjct  121  VVISAPSKDAPMFVMGVNEKEYKADINIVSNASCTTNCLA  160



>ref|XP_004239353.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase, cytosolic 
isoform X1 [Solanum lycopersicum]
Length=337

 Score =   267 bits (683),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 140/160 (88%), Positives = 148/160 (93%), Gaps = 0/160 (0%)
 Frame = -2

Query  482  MAKVKIGINGFGRIGRLVARVALLSDDIELVAVNDPFITTDYMTYMFKYDTVHGQWTKNE  303
            M KVKIGINGFGRIGRLVARVAL SDDIELVAVNDPFITT+YMTYMFKYDTVHGQW K+E
Sbjct  1    MGKVKIGINGFGRIGRLVARVALQSDDIELVAVNDPFITTEYMTYMFKYDTVHGQWKKHE  60

Query  302  LKVKDAKTLLFGDRHVAVFDKRNPEEIPWGETGAEYVVESTGVFTDQDkaaahlkggakK  123
            LKVKD KTLLFGD+ V VF  RNPEEIPWGE GA+YVVESTGVFTD+DKAAAHLKGGAK+
Sbjct  61   LKVKDDKTLLFGDKPVKVFGARNPEEIPWGEAGADYVVESTGVFTDKDKAAAHLKGGAKR  120

Query  122  VVISAPSKDAPMFVMGVNHLEYKKDVDIVSNASCTTNCLA  3
            VVISAPSKDAPMFVMGVN  EYK D++IVSNASCTTNCLA
Sbjct  121  VVISAPSKDAPMFVMGVNEKEYKADINIVSNASCTTNCLA  160



>ref|NP_001053139.1| Os04g0486600 [Oryza sativa Japonica Group]
 sp|Q7FAH2.1|G3PC2_ORYSJ RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase 2, cytosolic 
[Oryza sativa Japonica Group]
 emb|CAE02009.2| OJ000223_09.15 [Oryza sativa Japonica Group]
 emb|CAD79700.2| H0302E05.3 [Oryza sativa Indica Group]
 dbj|BAF15053.1| Os04g0486600 [Oryza sativa Japonica Group]
 gb|ACA50493.1| glyceraldehyde-3-phosphate dehydrogenase [Oryza sativa Japonica 
Group]
 dbj|BAG89296.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|ADM86862.1| glyceraldehyde-3-phosphate dehydrogenase [Oryza sativa Japonica 
Group]
Length=337

 Score =   266 bits (681),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 139/160 (87%), Positives = 150/160 (94%), Gaps = 0/160 (0%)
 Frame = -2

Query  482  MAKVKIGINGFGRIGRLVARVALLSDDIELVAVNDPFITTDYMTYMFKYDTVHGQWTKNE  303
            MAK+KIGINGFGRIGRLVARVAL SDD+ELVAVNDPFITTDYMTYMFKYDTVHGQW  +E
Sbjct  1    MAKIKIGINGFGRIGRLVARVALQSDDVELVAVNDPFITTDYMTYMFKYDTVHGQWKHHE  60

Query  302  LKVKDAKTLLFGDRHVAVFDKRNPEEIPWGETGAEYVVESTGVFTDQDkaaahlkggakK  123
            +KVKD+KTLLFG++ V VF  RNPEEIPWGETGAE+VVESTGVFTD+DKAAAHLKGGAKK
Sbjct  61   VKVKDSKTLLFGEKEVTVFGCRNPEEIPWGETGAEFVVESTGVFTDKDKAAAHLKGGAKK  120

Query  122  VVISAPSKDAPMFVMGVNHLEYKKDVDIVSNASCTTNCLA  3
            VVISAPSKDAPMFV+GVN  EYK D+DIVSNASCTTNCLA
Sbjct  121  VVISAPSKDAPMFVVGVNEKEYKPDIDIVSNASCTTNCLA  160



>ref|XP_002452401.1| hypothetical protein SORBIDRAFT_04g025120 [Sorghum bicolor]
 gb|EES05377.1| hypothetical protein SORBIDRAFT_04g025120 [Sorghum bicolor]
Length=337

 Score =   266 bits (679),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 137/160 (86%), Positives = 149/160 (93%), Gaps = 0/160 (0%)
 Frame = -2

Query  482  MAKVKIGINGFGRIGRLVARVALLSDDIELVAVNDPFITTDYMTYMFKYDTVHGQWTKNE  303
            MAK+KIGINGFGRIGRLVARVAL SDD+ELVAVNDPFITTDYMTYMFKYDTVHGQW  +E
Sbjct  1    MAKIKIGINGFGRIGRLVARVALQSDDVELVAVNDPFITTDYMTYMFKYDTVHGQWKHHE  60

Query  302  LKVKDAKTLLFGDRHVAVFDKRNPEEIPWGETGAEYVVESTGVFTDQDkaaahlkggakK  123
            +KVKD+KTLLFG++ VAVF  RNPEEIPWG  GA+YVVESTGVFTDQ+KAAAHLKGGAKK
Sbjct  61   VKVKDSKTLLFGEKEVAVFGSRNPEEIPWGSVGADYVVESTGVFTDQEKAAAHLKGGAKK  120

Query  122  VVISAPSKDAPMFVMGVNHLEYKKDVDIVSNASCTTNCLA  3
            VVISAPSKDAPMFV+GVN  EYK D++IVSNASCTTNCLA
Sbjct  121  VVISAPSKDAPMFVVGVNEKEYKSDINIVSNASCTTNCLA  160



>ref|XP_004953003.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase 3, cytosolic-like 
[Setaria italica]
Length=337

 Score =   265 bits (677),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 138/160 (86%), Positives = 148/160 (93%), Gaps = 0/160 (0%)
 Frame = -2

Query  482  MAKVKIGINGFGRIGRLVARVALLSDDIELVAVNDPFITTDYMTYMFKYDTVHGQWTKNE  303
            MAK+KIGINGFGRIGRLVARVAL SDD+ELVAVNDPFITTDYMTYMFKYDTVHGQW  +E
Sbjct  1    MAKIKIGINGFGRIGRLVARVALQSDDVELVAVNDPFITTDYMTYMFKYDTVHGQWKHHE  60

Query  302  LKVKDAKTLLFGDRHVAVFDKRNPEEIPWGETGAEYVVESTGVFTDQDkaaahlkggakK  123
            +KVKD+KTLLFG++ VAVF  RNPEEIPWG  GAEYVVESTGVFTDQ+KAAAHLKGGAKK
Sbjct  61   VKVKDSKTLLFGEKEVAVFGCRNPEEIPWGAAGAEYVVESTGVFTDQEKAAAHLKGGAKK  120

Query  122  VVISAPSKDAPMFVMGVNHLEYKKDVDIVSNASCTTNCLA  3
            VVISAPSKDAPMFV GVN  EYK D++IVSNASCTTNCLA
Sbjct  121  VVISAPSKDAPMFVCGVNEKEYKSDINIVSNASCTTNCLA  160



>ref|NP_001105385.1| glyceraldehyde-3-phosphate dehydrogenase 3, cytosolic [Zea mays]
 ref|XP_008677788.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase 3, cytosolic 
isoform X1 [Zea mays]
 sp|Q43247.1|G3PC3_MAIZE RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase 3, cytosolic 
[Zea mays]
 gb|AAA87579.1| cytosolic glyceroldehyde-3-phosphate dehydrogenase GAPC3 [Zea 
mays]
 gb|AFW62860.1| glyceraldehyde-3-phosphate dehydrogenase3 [Zea mays]
Length=337

 Score =   265 bits (677),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 137/160 (86%), Positives = 149/160 (93%), Gaps = 0/160 (0%)
 Frame = -2

Query  482  MAKVKIGINGFGRIGRLVARVALLSDDIELVAVNDPFITTDYMTYMFKYDTVHGQWTKNE  303
            MAK+KIGINGFGRIGRLVARVAL SDD+ELVAVNDPFI+TDYMTYMFKYDTVHGQW  +E
Sbjct  1    MAKIKIGINGFGRIGRLVARVALQSDDVELVAVNDPFISTDYMTYMFKYDTVHGQWKHHE  60

Query  302  LKVKDAKTLLFGDRHVAVFDKRNPEEIPWGETGAEYVVESTGVFTDQDkaaahlkggakK  123
            +KVKD+KTLLFG++ VAVF  RNPEEIPWG  GAEYVVESTGVFTDQ+KAAAHLKGGAKK
Sbjct  61   VKVKDSKTLLFGEKEVAVFGCRNPEEIPWGSVGAEYVVESTGVFTDQEKAAAHLKGGAKK  120

Query  122  VVISAPSKDAPMFVMGVNHLEYKKDVDIVSNASCTTNCLA  3
            VVISAPSKDAPMFV+GVN  EYK D++IVSNASCTTNCLA
Sbjct  121  VVISAPSKDAPMFVVGVNEKEYKSDINIVSNASCTTNCLA  160



>gb|AFW72189.1| cytosolic glyceroldehyde-3-phosphate dehydrogenase GAPC4 isoform 
1 [Zea mays]
 gb|AFW72190.1| cytosolic glyceroldehyde-3-phosphate dehydrogenase GAPC4 isoform 
2 [Zea mays]
Length=337

 Score =   265 bits (677),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 137/160 (86%), Positives = 149/160 (93%), Gaps = 0/160 (0%)
 Frame = -2

Query  482  MAKVKIGINGFGRIGRLVARVALLSDDIELVAVNDPFITTDYMTYMFKYDTVHGQWTKNE  303
            MAK+KIGINGFGRIGRLVARVAL SDD+ELVAVNDPFI+TDYMTYMFKYDTVHGQW  +E
Sbjct  1    MAKIKIGINGFGRIGRLVARVALQSDDVELVAVNDPFISTDYMTYMFKYDTVHGQWKHHE  60

Query  302  LKVKDAKTLLFGDRHVAVFDKRNPEEIPWGETGAEYVVESTGVFTDQDkaaahlkggakK  123
            +KVKD+KTLLFG++ VAVF  RNPEEIPWG  GAEYVVESTGVFTDQ+KAAAHLKGGAKK
Sbjct  61   VKVKDSKTLLFGEKEVAVFGCRNPEEIPWGSVGAEYVVESTGVFTDQEKAAAHLKGGAKK  120

Query  122  VVISAPSKDAPMFVMGVNHLEYKKDVDIVSNASCTTNCLA  3
            VVISAPSKDAPMFV+GVN  EYK D++IVSNASCTTNCLA
Sbjct  121  VVISAPSKDAPMFVVGVNEKEYKSDINIVSNASCTTNCLA  160



>ref|XP_006652435.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase 2, cytosolic-like 
[Oryza brachyantha]
Length=337

 Score =   265 bits (677),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 138/160 (86%), Positives = 150/160 (94%), Gaps = 0/160 (0%)
 Frame = -2

Query  482  MAKVKIGINGFGRIGRLVARVALLSDDIELVAVNDPFITTDYMTYMFKYDTVHGQWTKNE  303
            MAK+KIGINGFGRIGRLVARVAL SDD+ELVAVNDPFITTDYMTYMFKYDTVHGQW  +E
Sbjct  1    MAKIKIGINGFGRIGRLVARVALQSDDVELVAVNDPFITTDYMTYMFKYDTVHGQWKHHE  60

Query  302  LKVKDAKTLLFGDRHVAVFDKRNPEEIPWGETGAEYVVESTGVFTDQDkaaahlkggakK  123
            +KVKD+KTLLFG++ V VF  RNPEEIPWGETGAE+VVESTGVFTD+DKAAAHLKGGAKK
Sbjct  61   VKVKDSKTLLFGEKEVTVFGCRNPEEIPWGETGAEFVVESTGVFTDKDKAAAHLKGGAKK  120

Query  122  VVISAPSKDAPMFVMGVNHLEYKKDVDIVSNASCTTNCLA  3
            VVISAPSKDAPMFV+GVN  EYK D++IVSNASCTTNCLA
Sbjct  121  VVISAPSKDAPMFVVGVNENEYKPDINIVSNASCTTNCLA  160



>ref|XP_010242342.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase 2, cytosolic 
[Nelumbo nucifera]
Length=337

 Score =   264 bits (675),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 138/160 (86%), Positives = 147/160 (92%), Gaps = 0/160 (0%)
 Frame = -2

Query  482  MAKVKIGINGFGRIGRLVARVALLSDDIELVAVNDPFITTDYMTYMFKYDTVHGQWTKNE  303
            M KVKIGINGFGRIGRLVARVAL  DD+ELVAVNDPFITTDYMTYMFKYD+VHGQW  N+
Sbjct  1    MGKVKIGINGFGRIGRLVARVALQRDDVELVAVNDPFITTDYMTYMFKYDSVHGQWKHND  60

Query  302  LKVKDAKTLLFGDRHVAVFDKRNPEEIPWGETGAEYVVESTGVFTDQDkaaahlkggakK  123
            +KVKD+KTLLFGD+ V VF  RNPEEIPWG+TGAEYVVESTGVFTDQDKAAAHLKGGAKK
Sbjct  61   IKVKDSKTLLFGDKPVTVFGVRNPEEIPWGDTGAEYVVESTGVFTDQDKAAAHLKGGAKK  120

Query  122  VVISAPSKDAPMFVMGVNHLEYKKDVDIVSNASCTTNCLA  3
            VVISAPSKDAPMFV+GVN  EYK D+ IVSNASCTTNCLA
Sbjct  121  VVISAPSKDAPMFVVGVNEKEYKSDIAIVSNASCTTNCLA  160



>gb|EYU34780.1| hypothetical protein MIMGU_mgv1a009577mg [Erythranthe guttata]
Length=337

 Score =   264 bits (675),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 137/160 (86%), Positives = 148/160 (93%), Gaps = 0/160 (0%)
 Frame = -2

Query  482  MAKVKIGINGFGRIGRLVARVALLSDDIELVAVNDPFITTDYMTYMFKYDTVHGQWTKNE  303
            MAK+KIGINGFGRIGRLVARVAL SDDIELVAVNDPFITTDYMTYMFKYD+VHGQW  NE
Sbjct  1    MAKIKIGINGFGRIGRLVARVALQSDDIELVAVNDPFITTDYMTYMFKYDSVHGQWKHNE  60

Query  302  LKVKDAKTLLFGDRHVAVFDKRNPEEIPWGETGAEYVVESTGVFTDQDkaaahlkggakK  123
            L VKD+KTLLFG++ VAVF  RNPEEIPWGE GAE+VVESTGVFTD+ KA+AH+KGGAKK
Sbjct  61   LTVKDSKTLLFGEKPVAVFGVRNPEEIPWGEAGAEFVVESTGVFTDKAKASAHIKGGAKK  120

Query  122  VVISAPSKDAPMFVMGVNHLEYKKDVDIVSNASCTTNCLA  3
            VVISAPS DAPMFV+GVN  EYKKD+DIVSNASCTTNCLA
Sbjct  121  VVISAPSADAPMFVVGVNEKEYKKDLDIVSNASCTTNCLA  160



>ref|XP_010930058.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase 2, cytosolic 
[Elaeis guineensis]
Length=337

 Score =   263 bits (673),  Expect = 9e-84, Method: Compositional matrix adjust.
 Identities = 135/160 (84%), Positives = 150/160 (94%), Gaps = 0/160 (0%)
 Frame = -2

Query  482  MAKVKIGINGFGRIGRLVARVALLSDDIELVAVNDPFITTDYMTYMFKYDTVHGQWTKNE  303
            MAK+KIGINGFGRIGRLVARVAL  +D+ELVAVNDPFITTDYMTYMFKYDTVHGQW  ++
Sbjct  1    MAKIKIGINGFGRIGRLVARVALQGNDVELVAVNDPFITTDYMTYMFKYDTVHGQWKHHD  60

Query  302  LKVKDAKTLLFGDRHVAVFDKRNPEEIPWGETGAEYVVESTGVFTDQDkaaahlkggakK  123
            +KVKD+KTLLFG++ VAVF  RNPEEIPWGETGAEYVVESTGVFTD+DKAAAHLKGGAKK
Sbjct  61   VKVKDSKTLLFGEKEVAVFGYRNPEEIPWGETGAEYVVESTGVFTDKDKAAAHLKGGAKK  120

Query  122  VVISAPSKDAPMFVMGVNHLEYKKDVDIVSNASCTTNCLA  3
            V+ISAPSKDAPMFV+GVN  EYK D+++VSNASCTTNCLA
Sbjct  121  VIISAPSKDAPMFVVGVNEKEYKSDINVVSNASCTTNCLA  160



>gb|ACF87912.1| unknown [Zea mays]
Length=337

 Score =   263 bits (672),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 136/159 (86%), Positives = 148/159 (93%), Gaps = 0/159 (0%)
 Frame = -2

Query  482  MAKVKIGINGFGRIGRLVARVALLSDDIELVAVNDPFITTDYMTYMFKYDTVHGQWTKNE  303
            MAK+KIGINGFGRIGRLVARVAL SDD+ELVAVNDPFI+TDYMTYMFKYDTVHGQW  +E
Sbjct  1    MAKIKIGINGFGRIGRLVARVALQSDDVELVAVNDPFISTDYMTYMFKYDTVHGQWKHHE  60

Query  302  LKVKDAKTLLFGDRHVAVFDKRNPEEIPWGETGAEYVVESTGVFTDQDkaaahlkggakK  123
            +KVKD+KTLLFG++ VAVF  RNPEEIPWG  GAEYVVESTGVFTDQ+KAAAHLKGGAKK
Sbjct  61   VKVKDSKTLLFGEKEVAVFGCRNPEEIPWGSVGAEYVVESTGVFTDQEKAAAHLKGGAKK  120

Query  122  VVISAPSKDAPMFVMGVNHLEYKKDVDIVSNASCTTNCL  6
            VVISAPSKDAPMFV+GVN  EYK D++IVSNASCTTNCL
Sbjct  121  VVISAPSKDAPMFVVGVNEKEYKSDINIVSNASCTTNCL  159



>gb|ACG36109.1| glyceraldehyde-3-phosphate dehydrogenase, cytosolic 3 [Zea mays]
Length=337

 Score =   263 bits (672),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 136/160 (85%), Positives = 148/160 (93%), Gaps = 0/160 (0%)
 Frame = -2

Query  482  MAKVKIGINGFGRIGRLVARVALLSDDIELVAVNDPFITTDYMTYMFKYDTVHGQWTKNE  303
            MAK+KIGINGFGRIGRLVARVAL SDD+ELVAVNDPFI+TDYMTYMFKYDTVHGQW  +E
Sbjct  1    MAKIKIGINGFGRIGRLVARVALQSDDVELVAVNDPFISTDYMTYMFKYDTVHGQWKHHE  60

Query  302  LKVKDAKTLLFGDRHVAVFDKRNPEEIPWGETGAEYVVESTGVFTDQDkaaahlkggakK  123
            +KVKD+KTLLFG++ V VF  RNPEEIPWG  GAEYVVESTGVFTDQ+KAAAHLKGGAKK
Sbjct  61   VKVKDSKTLLFGEKEVTVFGCRNPEEIPWGSVGAEYVVESTGVFTDQEKAAAHLKGGAKK  120

Query  122  VVISAPSKDAPMFVMGVNHLEYKKDVDIVSNASCTTNCLA  3
            VVISAPSKDAPMFV+GVN  EYK D++IVSNASCTTNCLA
Sbjct  121  VVISAPSKDAPMFVVGVNEKEYKSDINIVSNASCTTNCLA  160



>ref|XP_010911739.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase 2, cytosolic-like 
[Elaeis guineensis]
Length=337

 Score =   263 bits (672),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 135/160 (84%), Positives = 149/160 (93%), Gaps = 0/160 (0%)
 Frame = -2

Query  482  MAKVKIGINGFGRIGRLVARVALLSDDIELVAVNDPFITTDYMTYMFKYDTVHGQWTKNE  303
            MAK+KIGINGFGRIGRLVARVAL  +D+ELVAVNDPFITTDYMTYMFKYDTVHGQW  +E
Sbjct  1    MAKIKIGINGFGRIGRLVARVALQGNDVELVAVNDPFITTDYMTYMFKYDTVHGQWKHHE  60

Query  302  LKVKDAKTLLFGDRHVAVFDKRNPEEIPWGETGAEYVVESTGVFTDQDkaaahlkggakK  123
            +KVKD+KTLLFG++ V VF  RNPEEIPWGETGAEYVVESTGVFTD++KAAAHLKGGAKK
Sbjct  61   IKVKDSKTLLFGEKEVTVFGIRNPEEIPWGETGAEYVVESTGVFTDKEKAAAHLKGGAKK  120

Query  122  VVISAPSKDAPMFVMGVNHLEYKKDVDIVSNASCTTNCLA  3
            V+ISAPSKDAPMFV+GVN  EYK D+D+VSNASCTTNCLA
Sbjct  121  VIISAPSKDAPMFVVGVNEHEYKPDIDVVSNASCTTNCLA  160



>gb|ADQ43814.1| glyceraldehyde-3-phosphate dehydrogenase [Ananas comosus]
Length=337

 Score =   263 bits (672),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 136/160 (85%), Positives = 148/160 (93%), Gaps = 0/160 (0%)
 Frame = -2

Query  482  MAKVKIGINGFGRIGRLVARVALLSDDIELVAVNDPFITTDYMTYMFKYDTVHGQWTKNE  303
            M K+KIGINGFGRIGRLVARVAL SDD+ELVAVNDPFITTDYMTYMFKYDTVHGQW  ++
Sbjct  1    MGKIKIGINGFGRIGRLVARVALQSDDVELVAVNDPFITTDYMTYMFKYDTVHGQWKHHD  60

Query  302  LKVKDAKTLLFGDRHVAVFDKRNPEEIPWGETGAEYVVESTGVFTDQDkaaahlkggakK  123
            +KVKD+KTLLFG++ V VF  RNPEEIPWGE GAEYVVESTGVFTD+DKAAAHLKGGAKK
Sbjct  61   IKVKDSKTLLFGEKAVTVFGIRNPEEIPWGEAGAEYVVESTGVFTDKDKAAAHLKGGAKK  120

Query  122  VVISAPSKDAPMFVMGVNHLEYKKDVDIVSNASCTTNCLA  3
            V+ISAPSKDAPMFV+GVN  EYK D+DIVSNASCTTNCLA
Sbjct  121  VIISAPSKDAPMFVVGVNEKEYKPDIDIVSNASCTTNCLA  160



>ref|XP_007037904.1| Glyceraldehyde-3-phosphate dehydrogenase C subunit 1 [Theobroma 
cacao]
 gb|EOY22405.1| Glyceraldehyde-3-phosphate dehydrogenase C subunit 1 [Theobroma 
cacao]
Length=337

 Score =   263 bits (672),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 135/160 (84%), Positives = 148/160 (93%), Gaps = 0/160 (0%)
 Frame = -2

Query  482  MAKVKIGINGFGRIGRLVARVALLSDDIELVAVNDPFITTDYMTYMFKYDTVHGQWTKNE  303
            MAKVKIGINGFGRIGRLVARVAL  DD+ELVAVNDPFI+TDYMTYMF+YD+VHGQW  NE
Sbjct  1    MAKVKIGINGFGRIGRLVARVALQRDDVELVAVNDPFISTDYMTYMFRYDSVHGQWKHNE  60

Query  302  LKVKDAKTLLFGDRHVAVFDKRNPEEIPWGETGAEYVVESTGVFTDQDkaaahlkggakK  123
            LKVKD+KTLLFG++ V VF  RNPEEIPWGETGAEY+VESTGVFTD+DKAAAHLKGGAKK
Sbjct  61   LKVKDSKTLLFGEKPVTVFGIRNPEEIPWGETGAEYIVESTGVFTDKDKAAAHLKGGAKK  120

Query  122  VVISAPSKDAPMFVMGVNHLEYKKDVDIVSNASCTTNCLA  3
            V+ISAPSKDAPMFV+GVN  EYK + DI+SNASCTTNCLA
Sbjct  121  VIISAPSKDAPMFVVGVNEKEYKPEYDIISNASCTTNCLA  160



>ref|NP_001105951.1| LOC100037774 [Zea mays]
 gb|AAA87580.1| cytosolic glyceroldehyde-3-phosphate dehydrogenase GAPC4 [Zea 
mays]
Length=337

 Score =   263 bits (672),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 136/160 (85%), Positives = 148/160 (93%), Gaps = 0/160 (0%)
 Frame = -2

Query  482  MAKVKIGINGFGRIGRLVARVALLSDDIELVAVNDPFITTDYMTYMFKYDTVHGQWTKNE  303
            MAK+KIGINGFGRIGRLVARVAL SDD+ELVAVNDPFI+TDYMTYMFKYDTVHGQW  +E
Sbjct  1    MAKIKIGINGFGRIGRLVARVALQSDDVELVAVNDPFISTDYMTYMFKYDTVHGQWKHHE  60

Query  302  LKVKDAKTLLFGDRHVAVFDKRNPEEIPWGETGAEYVVESTGVFTDQDkaaahlkggakK  123
            +KVKD+KTLLFG++ VAVF  RNPEEIPWG  GAEYVVESTGVFTDQ+KAAAHLKGGAKK
Sbjct  61   VKVKDSKTLLFGEKEVAVFGCRNPEEIPWGSVGAEYVVESTGVFTDQEKAAAHLKGGAKK  120

Query  122  VVISAPSKDAPMFVMGVNHLEYKKDVDIVSNASCTTNCLA  3
            VVISAPSKDAPMFV+GVN  EYK D++IVSNA CTTNCLA
Sbjct  121  VVISAPSKDAPMFVVGVNEKEYKSDINIVSNACCTTNCLA  160



>ref|XP_011024076.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase 2, cytosolic 
[Populus euphratica]
Length=338

 Score =   263 bits (671),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 135/160 (84%), Positives = 148/160 (93%), Gaps = 0/160 (0%)
 Frame = -2

Query  482  MAKVKIGINGFGRIGRLVARVALLSDDIELVAVNDPFITTDYMTYMFKYDTVHGQWTKNE  303
            MA++KIGINGFGRIGRLVARVAL  DD+ELVAVNDPFITT+YMTYMFKYDTVHGQW  +E
Sbjct  1    MARIKIGINGFGRIGRLVARVALQRDDVELVAVNDPFITTEYMTYMFKYDTVHGQWKHHE  60

Query  302  LKVKDAKTLLFGDRHVAVFDKRNPEEIPWGETGAEYVVESTGVFTDQDkaaahlkggakK  123
            LKVKD+KTLLFG++ VAVF  RNPEEIPWGETGAEY+VESTGVFTD+DKAAAHLKGGAKK
Sbjct  61   LKVKDSKTLLFGEKSVAVFGSRNPEEIPWGETGAEYIVESTGVFTDKDKAAAHLKGGAKK  120

Query  122  VVISAPSKDAPMFVMGVNHLEYKKDVDIVSNASCTTNCLA  3
            V+ISAPSKDAPMFVMGVN   Y  D++IVSNASCTTNCLA
Sbjct  121  VIISAPSKDAPMFVMGVNEKSYTPDLNIVSNASCTTNCLA  160



>ref|XP_009416004.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase 2, cytosolic-like 
[Musa acuminata subsp. malaccensis]
Length=337

 Score =   263 bits (671),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 136/160 (85%), Positives = 148/160 (93%), Gaps = 0/160 (0%)
 Frame = -2

Query  482  MAKVKIGINGFGRIGRLVARVALLSDDIELVAVNDPFITTDYMTYMFKYDTVHGQWTKNE  303
            M K+KIGINGFGRIGRLVARVAL S D+ELVAVNDPFITTDYMTYMFKYDTVHGQW  ++
Sbjct  1    MGKIKIGINGFGRIGRLVARVALQSSDVELVAVNDPFITTDYMTYMFKYDTVHGQWKHHD  60

Query  302  LKVKDAKTLLFGDRHVAVFDKRNPEEIPWGETGAEYVVESTGVFTDQDkaaahlkggakK  123
            +KVKD+KTLLFG++ V VF  RNPEEIPWGETGAEYVVESTGVFTD+DKAAAHLKGGAKK
Sbjct  61   VKVKDSKTLLFGEKEVTVFGLRNPEEIPWGETGAEYVVESTGVFTDKDKAAAHLKGGAKK  120

Query  122  VVISAPSKDAPMFVMGVNHLEYKKDVDIVSNASCTTNCLA  3
            V+ISAPSKDAPMFV+GVN  EYK D+DIVSNASCTTNCLA
Sbjct  121  VIISAPSKDAPMFVVGVNEHEYKPDIDIVSNASCTTNCLA  160



>ref|XP_011098828.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase, cytosolic-like 
[Sesamum indicum]
Length=337

 Score =   263 bits (671),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 137/160 (86%), Positives = 149/160 (93%), Gaps = 0/160 (0%)
 Frame = -2

Query  482  MAKVKIGINGFGRIGRLVARVALLSDDIELVAVNDPFITTDYMTYMFKYDTVHGQWTKNE  303
            MAK+KIGINGFGRIGRLVARVAL SDD+ELVAVNDPFI+TDYMTYMFKYD+VHGQW K+E
Sbjct  1    MAKIKIGINGFGRIGRLVARVALQSDDVELVAVNDPFISTDYMTYMFKYDSVHGQWKKHE  60

Query  302  LKVKDAKTLLFGDRHVAVFDKRNPEEIPWGETGAEYVVESTGVFTDQDkaaahlkggakK  123
            LKVKD+KTLLFGD+ V VF  RNPEEIPW E GA+YVVESTGVFTD+DKAAAHLKGGAKK
Sbjct  61   LKVKDSKTLLFGDKPVTVFGVRNPEEIPWAEAGADYVVESTGVFTDKDKAAAHLKGGAKK  120

Query  122  VVISAPSKDAPMFVMGVNHLEYKKDVDIVSNASCTTNCLA  3
            VVISAPSKDAPMFV+GVN  EYK D++IVSNASCTTNCLA
Sbjct  121  VVISAPSKDAPMFVVGVNEKEYKPDINIVSNASCTTNCLA  160



>gb|KCW83197.1| hypothetical protein EUGRSUZ_B00144 [Eucalyptus grandis]
Length=272

 Score =   260 bits (665),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 135/160 (84%), Positives = 148/160 (93%), Gaps = 0/160 (0%)
 Frame = -2

Query  482  MAKVKIGINGFGRIGRLVARVALLSDDIELVAVNDPFITTDYMTYMFKYDTVHGQWTKNE  303
            M KVKIGINGFGRIGRLVARVAL  DD+ELVAVNDPFI+TDYMTYMFKYD+VHGQW  +E
Sbjct  1    MGKVKIGINGFGRIGRLVARVALQRDDVELVAVNDPFISTDYMTYMFKYDSVHGQWKHHE  60

Query  302  LKVKDAKTLLFGDRHVAVFDKRNPEEIPWGETGAEYVVESTGVFTDQDkaaahlkggakK  123
            LKVKD+KTLLFG+R VAVF  RNPEEIPW ETGAE++VESTGVFTD++KAAAHLKGGAKK
Sbjct  61   LKVKDSKTLLFGERPVAVFGLRNPEEIPWAETGAEFIVESTGVFTDKEKAAAHLKGGAKK  120

Query  122  VVISAPSKDAPMFVMGVNHLEYKKDVDIVSNASCTTNCLA  3
            V+ISAPSKDAPMFV+GVN  EYK D+DIVSNASCTTNCLA
Sbjct  121  VIISAPSKDAPMFVVGVNEKEYKPDLDIVSNASCTTNCLA  160



>ref|XP_009402724.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase 2, cytosolic 
[Musa acuminata subsp. malaccensis]
Length=337

 Score =   262 bits (670),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 136/160 (85%), Positives = 148/160 (93%), Gaps = 0/160 (0%)
 Frame = -2

Query  482  MAKVKIGINGFGRIGRLVARVALLSDDIELVAVNDPFITTDYMTYMFKYDTVHGQWTKNE  303
            MAK+KIGINGFGRIGRLVARVAL SDD+ELVAVNDPFI+TDYMTYMFKYDTVHG+W  +E
Sbjct  1    MAKIKIGINGFGRIGRLVARVALQSDDVELVAVNDPFISTDYMTYMFKYDTVHGKWKHHE  60

Query  302  LKVKDAKTLLFGDRHVAVFDKRNPEEIPWGETGAEYVVESTGVFTDQDkaaahlkggakK  123
            +KVKD KTLLFG++ V VF  RNPEEIPWGETGAEYVVESTGVFTD+DKAAAHLKGGAKK
Sbjct  61   IKVKDTKTLLFGEKQVTVFGIRNPEEIPWGETGAEYVVESTGVFTDKDKAAAHLKGGAKK  120

Query  122  VVISAPSKDAPMFVMGVNHLEYKKDVDIVSNASCTTNCLA  3
            V+ISAPSKDAPMFV+GVN   YK D+DIVSNASCTTNCLA
Sbjct  121  VIISAPSKDAPMFVVGVNEHTYKPDIDIVSNASCTTNCLA  160



>gb|ADZ55283.1| glyceraldehyde-3-phosphate dehydrogenase [Zea mays]
Length=337

 Score =   262 bits (670),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 136/160 (85%), Positives = 148/160 (93%), Gaps = 0/160 (0%)
 Frame = -2

Query  482  MAKVKIGINGFGRIGRLVARVALLSDDIELVAVNDPFITTDYMTYMFKYDTVHGQWTKNE  303
            MAK+KIGINGFGRIGRLVARVAL SDD+ELVAVNDPFI+TDYMTYMFKYDTVHGQW  +E
Sbjct  1    MAKIKIGINGFGRIGRLVARVALQSDDVELVAVNDPFISTDYMTYMFKYDTVHGQWKHHE  60

Query  302  LKVKDAKTLLFGDRHVAVFDKRNPEEIPWGETGAEYVVESTGVFTDQDkaaahlkggakK  123
            +KVKD+KTLLFG++ VAVF  RNPEEIPWG  GAEYVVESTGVFTDQ+KAAAHLKGGAKK
Sbjct  61   VKVKDSKTLLFGEKEVAVFGCRNPEEIPWGSVGAEYVVESTGVFTDQEKAAAHLKGGAKK  120

Query  122  VVISAPSKDAPMFVMGVNHLEYKKDVDIVSNASCTTNCLA  3
            VVISAPSKDAPMFV+GVN  EYK D++IVSNA CTTNCLA
Sbjct  121  VVISAPSKDAPMFVVGVNEKEYKSDINIVSNACCTTNCLA  160



>gb|KCW83196.1| hypothetical protein EUGRSUZ_B00144 [Eucalyptus grandis]
Length=294

 Score =   261 bits (666),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 135/160 (84%), Positives = 148/160 (93%), Gaps = 0/160 (0%)
 Frame = -2

Query  482  MAKVKIGINGFGRIGRLVARVALLSDDIELVAVNDPFITTDYMTYMFKYDTVHGQWTKNE  303
            M KVKIGINGFGRIGRLVARVAL  DD+ELVAVNDPFI+TDYMTYMFKYD+VHGQW  +E
Sbjct  1    MGKVKIGINGFGRIGRLVARVALQRDDVELVAVNDPFISTDYMTYMFKYDSVHGQWKHHE  60

Query  302  LKVKDAKTLLFGDRHVAVFDKRNPEEIPWGETGAEYVVESTGVFTDQDkaaahlkggakK  123
            LKVKD+KTLLFG+R VAVF  RNPEEIPW ETGAE++VESTGVFTD++KAAAHLKGGAKK
Sbjct  61   LKVKDSKTLLFGERPVAVFGLRNPEEIPWAETGAEFIVESTGVFTDKEKAAAHLKGGAKK  120

Query  122  VVISAPSKDAPMFVMGVNHLEYKKDVDIVSNASCTTNCLA  3
            V+ISAPSKDAPMFV+GVN  EYK D+DIVSNASCTTNCLA
Sbjct  121  VIISAPSKDAPMFVVGVNEKEYKPDLDIVSNASCTTNCLA  160



>gb|ACJ11728.1| glyceraldehyde-3-phosphate dehydrogenase [Gossypium hirsutum]
Length=340

 Score =   262 bits (669),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 136/160 (85%), Positives = 148/160 (93%), Gaps = 0/160 (0%)
 Frame = -2

Query  482  MAKVKIGINGFGRIGRLVARVALLSDDIELVAVNDPFITTDYMTYMFKYDTVHGQWTKNE  303
            MAKVKIGINGFGRIGRLVARVAL  DD+ELVAVNDPFITTDYMTYMFKYD+VHGQW  +E
Sbjct  1    MAKVKIGINGFGRIGRLVARVALKRDDVELVAVNDPFITTDYMTYMFKYDSVHGQWKHHE  60

Query  302  LKVKDAKTLLFGDRHVAVFDKRNPEEIPWGETGAEYVVESTGVFTDQDkaaahlkggakK  123
            LKVKD+KTLLFG++ V VF  RNPEEIPWGETGAEY+VESTGVFTD+DKAAAHLKGGAKK
Sbjct  61   LKVKDSKTLLFGEKPVTVFGIRNPEEIPWGETGAEYIVESTGVFTDKDKAAAHLKGGAKK  120

Query  122  VVISAPSKDAPMFVMGVNHLEYKKDVDIVSNASCTTNCLA  3
            V+ISAPSKDAPMFVMGVN  +YK + DI+SNASCTTNCLA
Sbjct  121  VIISAPSKDAPMFVMGVNEKDYKPEYDIISNASCTTNCLA  160



>gb|AAW68026.1| glyceraldehyde-3-phosphate dehydrogenase [Triticum monococcum]
Length=186

 Score =   256 bits (653),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 133/160 (83%), Positives = 145/160 (91%), Gaps = 0/160 (0%)
 Frame = -2

Query  482  MAKVKIGINGFGRIGRLVARVALLSDDIELVAVNDPFITTDYMTYMFKYDTVHGQWTKNE  303
            MA +KIGINGFGRIGRLVARVAL S D+ELVAVNDPFITTDYMTYMFKYDTVHGQW  +E
Sbjct  1    MAPIKIGINGFGRIGRLVARVALQSPDVELVAVNDPFITTDYMTYMFKYDTVHGQWKHHE  60

Query  302  LKVKDAKTLLFGDRHVAVFDKRNPEEIPWGETGAEYVVESTGVFTDQDkaaahlkggakK  123
            +KVKD+KTLLFG++ VAVF  RNPEEIPW   GAEYVVESTGVFTD++KAAAH+KGGAKK
Sbjct  61   VKVKDSKTLLFGEKEVAVFGCRNPEEIPWAAAGAEYVVESTGVFTDKEKAAAHIKGGAKK  120

Query  122  VVISAPSKDAPMFVMGVNHLEYKKDVDIVSNASCTTNCLA  3
            V+ISAPSKDAPMFV GVN  EYK D+DIVSNASCTTNCLA
Sbjct  121  VIISAPSKDAPMFVCGVNEKEYKSDIDIVSNASCTTNCLA  160



>sp|P26519.1|G3PC_PETCR RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase, cytosolic 
[Petroselinum crispum]
 emb|CAA42902.1| glyceraldehyde 3-phosphate dehydrogenase [Petroselinum crispum]
Length=336

 Score =   261 bits (667),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 136/158 (86%), Positives = 148/158 (94%), Gaps = 0/158 (0%)
 Frame = -2

Query  476  KVKIGINGFGRIGRLVARVALLSDDIELVAVNDPFITTDYMTYMFKYDTVHGQWTKNELK  297
            K+KIGINGFGRIGRLVARVAL+SDDIELVAVNDPFITT+YMTYMFKYD+VHGQW K+ELK
Sbjct  2    KMKIGINGFGRIGRLVARVALMSDDIELVAVNDPFITTEYMTYMFKYDSVHGQWKKDELK  61

Query  296  VKDAKTLLFGDRHVAVFDKRNPEEIPWGETGAEYVVESTGVFTDQDkaaahlkggakKVV  117
            VKD+KTLLFGD+ + VF  RNPEE PWGE GAEYVVESTGVFTD+DKAAAHLKGGAKKVV
Sbjct  62   VKDSKTLLFGDKPLTVFGVRNPEEDPWGEAGAEYVVESTGVFTDKDKAAAHLKGGAKKVV  121

Query  116  ISAPSKDAPMFVMGVNHLEYKKDVDIVSNASCTTNCLA  3
            ISAPS +APMFV+GVN  EYKKD+DIVSNASCTTNCLA
Sbjct  122  ISAPSGNAPMFVVGVNEKEYKKDIDIVSNASCTTNCLA  159



>ref|XP_004138467.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase-like isoform 
1 [Cucumis sativus]
 gb|KGN45728.1| hypothetical protein Csa_6G008590 [Cucumis sativus]
Length=337

 Score =   261 bits (666),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 135/160 (84%), Positives = 148/160 (93%), Gaps = 0/160 (0%)
 Frame = -2

Query  482  MAKVKIGINGFGRIGRLVARVALLSDDIELVAVNDPFITTDYMTYMFKYDTVHGQWTKNE  303
            M KVKIGINGFGRIGRLVARVAL SDDIELVAVNDPFITTDYMTYMFKYD+VHGQW  ++
Sbjct  1    MGKVKIGINGFGRIGRLVARVALQSDDIELVAVNDPFITTDYMTYMFKYDSVHGQWKHHD  60

Query  302  LKVKDAKTLLFGDRHVAVFDKRNPEEIPWGETGAEYVVESTGVFTDQDkaaahlkggakK  123
            +KVKD+KTLLFG++ V VF  RNPEEIPWGE GA+YVVESTGVFTD+DKAAAHLKGGAKK
Sbjct  61   IKVKDSKTLLFGEKSVTVFGTRNPEEIPWGEVGADYVVESTGVFTDKDKAAAHLKGGAKK  120

Query  122  VVISAPSKDAPMFVMGVNHLEYKKDVDIVSNASCTTNCLA  3
            V+ISAPSKDAPMFV+GVN  EYK D++IVSNASCTTNCLA
Sbjct  121  VIISAPSKDAPMFVVGVNEKEYKSDLNIVSNASCTTNCLA  160



>ref|XP_006438115.1| hypothetical protein CICLE_v10032014mg [Citrus clementina]
 gb|ESR51355.1| hypothetical protein CICLE_v10032014mg [Citrus clementina]
Length=268

 Score =   258 bits (658),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 135/158 (85%), Positives = 146/158 (92%), Gaps = 0/158 (0%)
 Frame = -2

Query  476  KVKIGINGFGRIGRLVARVALLSDDIELVAVNDPFITTDYMTYMFKYDTVHGQWTKNELK  297
            K+KIGINGFGRIGRLVARVAL  DD+ELVAVNDPFI+TDYMTYMFKYD+VHGQW  NELK
Sbjct  6    KIKIGINGFGRIGRLVARVALQRDDVELVAVNDPFISTDYMTYMFKYDSVHGQWKHNELK  65

Query  296  VKDAKTLLFGDRHVAVFDKRNPEEIPWGETGAEYVVESTGVFTDQDkaaahlkggakKVV  117
            VKD KTLLFG++ VAVF  RNPEEIPW +TGAEYVVESTGVFTD+DKAAAHLKGGAKKVV
Sbjct  66   VKDEKTLLFGEKPVAVFGFRNPEEIPWAKTGAEYVVESTGVFTDKDKAAAHLKGGAKKVV  125

Query  116  ISAPSKDAPMFVMGVNHLEYKKDVDIVSNASCTTNCLA  3
            ISAPSKDAPMFV+GVN  EYK ++DIVSNASCTTNCLA
Sbjct  126  ISAPSKDAPMFVVGVNEKEYKPELDIVSNASCTTNCLA  163



>ref|XP_010025353.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase, cytosolic 
[Eucalyptus grandis]
Length=337

 Score =   260 bits (665),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 135/160 (84%), Positives = 148/160 (93%), Gaps = 0/160 (0%)
 Frame = -2

Query  482  MAKVKIGINGFGRIGRLVARVALLSDDIELVAVNDPFITTDYMTYMFKYDTVHGQWTKNE  303
            M KVKIGINGFGRIGRLVARVAL  DD+ELVAVNDPFITTDYMTYMFKYD+VHGQW  +E
Sbjct  1    MGKVKIGINGFGRIGRLVARVALQRDDVELVAVNDPFITTDYMTYMFKYDSVHGQWKHHE  60

Query  302  LKVKDAKTLLFGDRHVAVFDKRNPEEIPWGETGAEYVVESTGVFTDQDkaaahlkggakK  123
            LKVKD KTLLFG++ V+VF  RNPEEIPWGETGAE++VESTGVFTD+DKAAAHLKGGAKK
Sbjct  61   LKVKDTKTLLFGEKEVSVFGIRNPEEIPWGETGAEFIVESTGVFTDKDKAAAHLKGGAKK  120

Query  122  VVISAPSKDAPMFVMGVNHLEYKKDVDIVSNASCTTNCLA  3
            VVISAPSKDAPMFV+GVN  EYK +++IVSNASCTTNCLA
Sbjct  121  VVISAPSKDAPMFVVGVNEKEYKPELNIVSNASCTTNCLA  160



>ref|XP_010026741.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase, cytosolic-like 
[Eucalyptus grandis]
 gb|KCW83194.1| hypothetical protein EUGRSUZ_B00144 [Eucalyptus grandis]
Length=337

 Score =   260 bits (664),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 135/160 (84%), Positives = 148/160 (93%), Gaps = 0/160 (0%)
 Frame = -2

Query  482  MAKVKIGINGFGRIGRLVARVALLSDDIELVAVNDPFITTDYMTYMFKYDTVHGQWTKNE  303
            M KVKIGINGFGRIGRLVARVAL  DD+ELVAVNDPFI+TDYMTYMFKYD+VHGQW  +E
Sbjct  1    MGKVKIGINGFGRIGRLVARVALQRDDVELVAVNDPFISTDYMTYMFKYDSVHGQWKHHE  60

Query  302  LKVKDAKTLLFGDRHVAVFDKRNPEEIPWGETGAEYVVESTGVFTDQDkaaahlkggakK  123
            LKVKD+KTLLFG+R VAVF  RNPEEIPW ETGAE++VESTGVFTD++KAAAHLKGGAKK
Sbjct  61   LKVKDSKTLLFGERPVAVFGLRNPEEIPWAETGAEFIVESTGVFTDKEKAAAHLKGGAKK  120

Query  122  VVISAPSKDAPMFVMGVNHLEYKKDVDIVSNASCTTNCLA  3
            V+ISAPSKDAPMFV+GVN  EYK D+DIVSNASCTTNCLA
Sbjct  121  VIISAPSKDAPMFVVGVNEKEYKPDLDIVSNASCTTNCLA  160



>emb|CBW95562.1| putative glyceraldehyde 3-phosphate dehydrogenase [Ophrys sphegodes]
Length=275

 Score =   258 bits (659),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 132/158 (84%), Positives = 148/158 (94%), Gaps = 0/158 (0%)
 Frame = -2

Query  476  KVKIGINGFGRIGRLVARVALLSDDIELVAVNDPFITTDYMTYMFKYDTVHGQWTKNELK  297
            K+KIGINGFGRIGRLVARVALLSDD+ELVAVNDP+ITT+Y+TYMFKYDTVHGQW  +E+K
Sbjct  7    KIKIGINGFGRIGRLVARVALLSDDVELVAVNDPYITTEYVTYMFKYDTVHGQWKHHEIK  66

Query  296  VKDAKTLLFGDRHVAVFDKRNPEEIPWGETGAEYVVESTGVFTDQDkaaahlkggakKVV  117
            VKD+KTLLFG++ VAVF  RNPEEIPWGE GA++VVESTGVFTD+D AAAHLKGGAKKVV
Sbjct  67   VKDSKTLLFGEQSVAVFGVRNPEEIPWGEAGADFVVESTGVFTDKDTAAAHLKGGAKKVV  126

Query  116  ISAPSKDAPMFVMGVNHLEYKKDVDIVSNASCTTNCLA  3
            ISAPSKDAPMFV+GVN  EYK ++DIVSNASCTTNCLA
Sbjct  127  ISAPSKDAPMFVVGVNEHEYKPELDIVSNASCTTNCLA  164



>ref|XP_008799964.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase 3, cytosolic 
[Phoenix dactylifera]
Length=340

 Score =   260 bits (665),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 134/158 (85%), Positives = 148/158 (94%), Gaps = 0/158 (0%)
 Frame = -2

Query  476  KVKIGINGFGRIGRLVARVALLSDDIELVAVNDPFITTDYMTYMFKYDTVHGQWTKNELK  297
            K+KIGINGFGRIGRLVARVAL S D+ELVAVNDPFI+TDYMTYMFKYDTVHG+W  +E+K
Sbjct  6    KIKIGINGFGRIGRLVARVALQSSDVELVAVNDPFISTDYMTYMFKYDTVHGEWKHHEIK  65

Query  296  VKDAKTLLFGDRHVAVFDKRNPEEIPWGETGAEYVVESTGVFTDQDkaaahlkggakKVV  117
            VKD+KTLLFG++ VAVF  RNPEEIPWGETGAEYVVESTGVFTD++KAAAHLKGGAKKVV
Sbjct  66   VKDSKTLLFGEKQVAVFGIRNPEEIPWGETGAEYVVESTGVFTDKEKAAAHLKGGAKKVV  125

Query  116  ISAPSKDAPMFVMGVNHLEYKKDVDIVSNASCTTNCLA  3
            ISAPSKDAPMFV+GVN  EYK D+D+VSNASCTTNCLA
Sbjct  126  ISAPSKDAPMFVVGVNEHEYKPDIDVVSNASCTTNCLA  163



>ref|XP_004169444.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase-like [Cucumis 
sativus]
Length=337

 Score =   260 bits (664),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 135/160 (84%), Positives = 148/160 (93%), Gaps = 0/160 (0%)
 Frame = -2

Query  482  MAKVKIGINGFGRIGRLVARVALLSDDIELVAVNDPFITTDYMTYMFKYDTVHGQWTKNE  303
            M KVKIGINGFGRIGRLVARVAL SDDIELVAVNDPFITTDYMTYMFKYD+VHGQW  ++
Sbjct  1    MGKVKIGINGFGRIGRLVARVALHSDDIELVAVNDPFITTDYMTYMFKYDSVHGQWKHHD  60

Query  302  LKVKDAKTLLFGDRHVAVFDKRNPEEIPWGETGAEYVVESTGVFTDQDkaaahlkggakK  123
            +KVKD+KTLLFG++ V VF  RNPEEIPWGE GA+YVVESTGVFTD+DKAAAHLKGGAKK
Sbjct  61   IKVKDSKTLLFGEKSVTVFGTRNPEEIPWGEVGADYVVESTGVFTDKDKAAAHLKGGAKK  120

Query  122  VVISAPSKDAPMFVMGVNHLEYKKDVDIVSNASCTTNCLA  3
            V+ISAPSKDAPMFV+GVN  EYK D++IVSNASCTTNCLA
Sbjct  121  VIISAPSKDAPMFVVGVNEKEYKSDLNIVSNASCTTNCLA  160



>gb|AET80379.1| GAPDH3 [x Doritaenopsis hybrid cultivar]
Length=291

 Score =   258 bits (660),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 133/156 (85%), Positives = 146/156 (94%), Gaps = 0/156 (0%)
 Frame = -2

Query  470  KIGINGFGRIGRLVARVALLSDDIELVAVNDPFITTDYMTYMFKYDTVHGQWTKNELKVK  291
            KIGINGFGRIGRLVARVALLSDD+ELVA+NDPFITTDYMTYMFKYDTVHGQW  +E+ VK
Sbjct  1    KIGINGFGRIGRLVARVALLSDDVELVAINDPFITTDYMTYMFKYDTVHGQWKHHEITVK  60

Query  290  DAKTLLFGDRHVAVFDKRNPEEIPWGETGAEYVVESTGVFTDQDkaaahlkggakKVVIS  111
            D+KTLLFG++ VA+F  RNPEEIPWGE GA+YVVESTGVFTD+DKAAAHLKGGAKKV+IS
Sbjct  61   DSKTLLFGEKPVAIFGIRNPEEIPWGEAGADYVVESTGVFTDKDKAAAHLKGGAKKVIIS  120

Query  110  APSKDAPMFVMGVNHLEYKKDVDIVSNASCTTNCLA  3
            APSKDAPMFV+GVN  EYK D+DIVSNASCTTNCLA
Sbjct  121  APSKDAPMFVVGVNEHEYKADIDIVSNASCTTNCLA  156



>gb|KDO82024.1| hypothetical protein CISIN_1g019445mg [Citrus sinensis]
Length=250

 Score =   257 bits (656),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 135/158 (85%), Positives = 146/158 (92%), Gaps = 0/158 (0%)
 Frame = -2

Query  476  KVKIGINGFGRIGRLVARVALLSDDIELVAVNDPFITTDYMTYMFKYDTVHGQWTKNELK  297
            K+KIGINGFGRIGRLVARVAL  DD+ELVAVNDPFI+TDYMTYMFKYD+VHGQW  NELK
Sbjct  6    KIKIGINGFGRIGRLVARVALQRDDVELVAVNDPFISTDYMTYMFKYDSVHGQWKHNELK  65

Query  296  VKDAKTLLFGDRHVAVFDKRNPEEIPWGETGAEYVVESTGVFTDQDkaaahlkggakKVV  117
            VKD KTLLFG++ VAVF  RNPEEIPW +TGAEYVVESTGVFTD+DKAAAHLKGGAKKVV
Sbjct  66   VKDEKTLLFGEKPVAVFGFRNPEEIPWAKTGAEYVVESTGVFTDKDKAAAHLKGGAKKVV  125

Query  116  ISAPSKDAPMFVMGVNHLEYKKDVDIVSNASCTTNCLA  3
            ISAPSKDAPMFV+GVN  EYK ++DIVSNASCTTNCLA
Sbjct  126  ISAPSKDAPMFVVGVNEKEYKPELDIVSNASCTTNCLA  163



>gb|EPS61158.1| hypothetical protein M569_13641, partial [Genlisea aurea]
Length=337

 Score =   259 bits (663),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 136/161 (84%), Positives = 146/161 (91%), Gaps = 0/161 (0%)
 Frame = -2

Query  485  IMAKVKIGINGFGRIGRLVARVALLSDDIELVAVNDPFITTDYMTYMFKYDTVHGQWTKN  306
            +MAK+KIGINGFGRIGRLVARVALL DD+ELVAVNDPFITTDYMTYMFKYDTVHGQW  +
Sbjct  1    VMAKIKIGINGFGRIGRLVARVALLRDDVELVAVNDPFITTDYMTYMFKYDTVHGQWKHH  60

Query  305  ELKVKDAKTLLFGDRHVAVFDKRNPEEIPWGETGAEYVVESTGVFTDQDkaaahlkggak  126
            E+ VKD KTLLFG + V VF  RNPEEIPW E GAE+VVESTGVFTD+DKAAAHLKGGAK
Sbjct  61   EITVKDEKTLLFGQKPVKVFGIRNPEEIPWAEAGAEFVVESTGVFTDKDKAAAHLKGGAK  120

Query  125  KVVISAPSKDAPMFVMGVNHLEYKKDVDIVSNASCTTNCLA  3
            KVVISAPSKDAPMFV+GVN  EYK D+DIVSNASCTTNCLA
Sbjct  121  KVVISAPSKDAPMFVVGVNEKEYKPDLDIVSNASCTTNCLA  161



>gb|AFM93782.1| glyceraldehyde 3-phosphate dehydrogenase [Cymbidium goeringii]
Length=340

 Score =   259 bits (663),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 134/159 (84%), Positives = 148/159 (93%), Gaps = 0/159 (0%)
 Frame = -2

Query  479  AKVKIGINGFGRIGRLVARVALLSDDIELVAVNDPFITTDYMTYMFKYDTVHGQWTKNEL  300
             K+KIGINGFGRIGRLVARVALLS+D+ELVAVNDPFITT+YMTYMFKYDTVHGQW  +E+
Sbjct  5    GKIKIGINGFGRIGRLVARVALLSEDVELVAVNDPFITTEYMTYMFKYDTVHGQWKHHEI  64

Query  299  KVKDAKTLLFGDRHVAVFDKRNPEEIPWGETGAEYVVESTGVFTDQDkaaahlkggakKV  120
             VKD+KTLLFG++ VAVF  RNPEEIPWGE GA+YVVESTGVFTD+DKAAAHLKGGAKKV
Sbjct  65   TVKDSKTLLFGEKPVAVFGTRNPEEIPWGEAGADYVVESTGVFTDKDKAAAHLKGGAKKV  124

Query  119  VISAPSKDAPMFVMGVNHLEYKKDVDIVSNASCTTNCLA  3
            +ISAPSKDAPMFV+GVN  EYK D+DIVSNASCTTNCLA
Sbjct  125  IISAPSKDAPMFVVGVNEHEYKDDIDIVSNASCTTNCLA  163



>emb|CDP16658.1| unnamed protein product [Coffea canephora]
Length=337

 Score =   259 bits (662),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 134/160 (84%), Positives = 149/160 (93%), Gaps = 0/160 (0%)
 Frame = -2

Query  482  MAKVKIGINGFGRIGRLVARVALLSDDIELVAVNDPFITTDYMTYMFKYDTVHGQWTKNE  303
            MAK+KIGINGFGRIGRLVARVAL SDD+ELVAVNDPFITTDYM YMFKYDTVHGQ+ K+E
Sbjct  1    MAKIKIGINGFGRIGRLVARVALQSDDVELVAVNDPFITTDYMIYMFKYDTVHGQYKKHE  60

Query  302  LKVKDAKTLLFGDRHVAVFDKRNPEEIPWGETGAEYVVESTGVFTDQDkaaahlkggakK  123
            LKV+D+KT+LFGD+ V VF  RNPEEIPWGE GA++VVESTGVFTD+DKAAAHLKGGAKK
Sbjct  61   LKVQDSKTILFGDKPVTVFGSRNPEEIPWGEAGADFVVESTGVFTDKDKAAAHLKGGAKK  120

Query  122  VVISAPSKDAPMFVMGVNHLEYKKDVDIVSNASCTTNCLA  3
            V+ISAPSKDAPMFV+GVN  +YK D+DIVSNASCTTNCLA
Sbjct  121  VIISAPSKDAPMFVIGVNEKDYKPDIDIVSNASCTTNCLA  160



>gb|KDO82023.1| hypothetical protein CISIN_1g019445mg [Citrus sinensis]
Length=296

 Score =   258 bits (659),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 135/158 (85%), Positives = 146/158 (92%), Gaps = 0/158 (0%)
 Frame = -2

Query  476  KVKIGINGFGRIGRLVARVALLSDDIELVAVNDPFITTDYMTYMFKYDTVHGQWTKNELK  297
            K+KIGINGFGRIGRLVARVAL  DD+ELVAVNDPFI+TDYMTYMFKYD+VHGQW  NELK
Sbjct  6    KIKIGINGFGRIGRLVARVALQRDDVELVAVNDPFISTDYMTYMFKYDSVHGQWKHNELK  65

Query  296  VKDAKTLLFGDRHVAVFDKRNPEEIPWGETGAEYVVESTGVFTDQDkaaahlkggakKVV  117
            VKD KTLLFG++ VAVF  RNPEEIPW +TGAEYVVESTGVFTD+DKAAAHLKGGAKKVV
Sbjct  66   VKDEKTLLFGEKPVAVFGFRNPEEIPWAKTGAEYVVESTGVFTDKDKAAAHLKGGAKKVV  125

Query  116  ISAPSKDAPMFVMGVNHLEYKKDVDIVSNASCTTNCLA  3
            ISAPSKDAPMFV+GVN  EYK ++DIVSNASCTTNCLA
Sbjct  126  ISAPSKDAPMFVVGVNEKEYKPELDIVSNASCTTNCLA  163



>ref|XP_002318114.1| glyceraldehyde-3-phosphate dehydrogenase family protein [Populus 
trichocarpa]
 gb|ABK93203.1| unknown [Populus trichocarpa]
 gb|EEE96334.1| glyceraldehyde-3-phosphate dehydrogenase family protein [Populus 
trichocarpa]
Length=338

 Score =   259 bits (662),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 134/160 (84%), Positives = 146/160 (91%), Gaps = 0/160 (0%)
 Frame = -2

Query  482  MAKVKIGINGFGRIGRLVARVALLSDDIELVAVNDPFITTDYMTYMFKYDTVHGQWTKNE  303
            M K+KIGINGFGRIGRLVARVAL  DD+ELVAVNDPFITTDYMTYMFKYDTVHGQW  +E
Sbjct  1    MGKIKIGINGFGRIGRLVARVALQRDDVELVAVNDPFITTDYMTYMFKYDTVHGQWKHHE  60

Query  302  LKVKDAKTLLFGDRHVAVFDKRNPEEIPWGETGAEYVVESTGVFTDQDkaaahlkggakK  123
            LKVKD+KTLLFG++ V VF  RNPEEIPWGETGA+Y+VESTGVFTD+DKAAAHLKGGAKK
Sbjct  61   LKVKDSKTLLFGEKSVTVFGVRNPEEIPWGETGADYIVESTGVFTDKDKAAAHLKGGAKK  120

Query  122  VVISAPSKDAPMFVMGVNHLEYKKDVDIVSNASCTTNCLA  3
            V+ISAPSKDAPMFVMGVN   Y  D++IVSNASCTTNCLA
Sbjct  121  VIISAPSKDAPMFVMGVNEKSYTPDLNIVSNASCTTNCLA  160



>ref|XP_008439408.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase, cytosolic 
[Cucumis melo]
 gb|ADN33957.1| glyceraldehyde-3-phosphate dehydrogenase [Cucumis melo subsp. 
melo]
Length=337

 Score =   259 bits (662),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 132/160 (83%), Positives = 148/160 (93%), Gaps = 0/160 (0%)
 Frame = -2

Query  482  MAKVKIGINGFGRIGRLVARVALLSDDIELVAVNDPFITTDYMTYMFKYDTVHGQWTKNE  303
            MAK+KIGINGFGRIGRLVARVAL  +D+ELVAVNDPFITTDYMTYMFKYD+VHGQW   +
Sbjct  1    MAKIKIGINGFGRIGRLVARVALQRNDVELVAVNDPFITTDYMTYMFKYDSVHGQWKHQD  60

Query  302  LKVKDAKTLLFGDRHVAVFDKRNPEEIPWGETGAEYVVESTGVFTDQDkaaahlkggakK  123
            +KVKD+KTLLFG++ V VF  RNPEEIPWGETGAEY+VESTGVFTD+DKAAAHLKGGAKK
Sbjct  61   VKVKDSKTLLFGEQAVTVFGIRNPEEIPWGETGAEYIVESTGVFTDKDKAAAHLKGGAKK  120

Query  122  VVISAPSKDAPMFVMGVNHLEYKKDVDIVSNASCTTNCLA  3
            V+ISAPSKDAPMFV+GVN  EYK D+D++SNASCTTNCLA
Sbjct  121  VIISAPSKDAPMFVVGVNEKEYKPDLDVISNASCTTNCLA  160



>gb|KDP46338.1| hypothetical protein JCGZ_10178 [Jatropha curcas]
Length=337

 Score =   259 bits (662),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 135/160 (84%), Positives = 147/160 (92%), Gaps = 0/160 (0%)
 Frame = -2

Query  482  MAKVKIGINGFGRIGRLVARVALLSDDIELVAVNDPFITTDYMTYMFKYDTVHGQWTKNE  303
            MAK+KIGINGFGRIGRLVARVAL  DDIELVAVNDPFITTDYMTYMFKYDTVHGQW  ++
Sbjct  1    MAKIKIGINGFGRIGRLVARVALQRDDIELVAVNDPFITTDYMTYMFKYDTVHGQWKHHD  60

Query  302  LKVKDAKTLLFGDRHVAVFDKRNPEEIPWGETGAEYVVESTGVFTDQDkaaahlkggakK  123
            +KVKD KTLLFGD+ V VF  RNPEEIPWG++GA+YVVESTGVFTDQDKAAAHLKGGAKK
Sbjct  61   IKVKDDKTLLFGDKAVTVFGFRNPEEIPWGQSGADYVVESTGVFTDQDKAAAHLKGGAKK  120

Query  122  VVISAPSKDAPMFVMGVNHLEYKKDVDIVSNASCTTNCLA  3
            V+ISAPSKDAPMFV+GVN  EYK D+ +VSNASCTTNCLA
Sbjct  121  VIISAPSKDAPMFVVGVNEKEYKSDLTVVSNASCTTNCLA  160



>sp|P26521.1|G3PC_RANAC RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase, cytosolic 
[Ranunculus acris]
 emb|CAA42903.1| glyceraldehyde 3-phosphate dehydrogenase [Ranunculus acris]
Length=338

 Score =   259 bits (662),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 134/161 (83%), Positives = 146/161 (91%), Gaps = 0/161 (0%)
 Frame = -2

Query  485  IMAKVKIGINGFGRIGRLVARVALLSDDIELVAVNDPFITTDYMTYMFKYDTVHGQWTKN  306
            +  K+KIGINGFGRIGRLVARVAL  DD+ELVAVNDPFITTDYMTYMFKYDTVHGQW  +
Sbjct  1    MTGKIKIGINGFGRIGRLVARVALARDDVELVAVNDPFITTDYMTYMFKYDTVHGQWKHH  60

Query  305  ELKVKDAKTLLFGDRHVAVFDKRNPEEIPWGETGAEYVVESTGVFTDQDkaaahlkggak  126
            ELKVKD KTLLFG++ V VF  RNPEEIPWGETGAE+VVESTGVFT ++KA+AHLKGGAK
Sbjct  61   ELKVKDEKTLLFGEKPVTVFGCRNPEEIPWGETGAEFVVESTGVFTTKEKASAHLKGGAK  120

Query  125  KVVISAPSKDAPMFVMGVNHLEYKKDVDIVSNASCTTNCLA  3
            KVVISAPS DAPMFV+GVNH EYK D+DIVSNASCTTNCLA
Sbjct  121  KVVISAPSADAPMFVVGVNHTEYKSDIDIVSNASCTTNCLA  161



>ref|XP_008441373.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase [Cucumis 
melo]
Length=337

 Score =   259 bits (661),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 134/160 (84%), Positives = 148/160 (93%), Gaps = 0/160 (0%)
 Frame = -2

Query  482  MAKVKIGINGFGRIGRLVARVALLSDDIELVAVNDPFITTDYMTYMFKYDTVHGQWTKNE  303
            M KVKIGINGFGRIGRLVARVAL S+DIELVAVNDPFITTDYMTYMFKYD+VHGQW  ++
Sbjct  1    MGKVKIGINGFGRIGRLVARVALQSEDIELVAVNDPFITTDYMTYMFKYDSVHGQWKHHD  60

Query  302  LKVKDAKTLLFGDRHVAVFDKRNPEEIPWGETGAEYVVESTGVFTDQDkaaahlkggakK  123
            +KVKD+KTLLFG++ V VF  RNPEEIPWGE GA+YVVESTGVFTD+DKAAAHLKGGAKK
Sbjct  61   IKVKDSKTLLFGEKSVTVFGTRNPEEIPWGEVGADYVVESTGVFTDKDKAAAHLKGGAKK  120

Query  122  VVISAPSKDAPMFVMGVNHLEYKKDVDIVSNASCTTNCLA  3
            V+ISAPSKDAPMFV+GVN  EYK D++IVSNASCTTNCLA
Sbjct  121  VIISAPSKDAPMFVVGVNEKEYKSDLNIVSNASCTTNCLA  160



>gb|AFV52793.1| glyceraldehyde 3-phosphate dehydrogenase [Cymbidium faberi]
Length=340

 Score =   259 bits (661),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 134/159 (84%), Positives = 148/159 (93%), Gaps = 0/159 (0%)
 Frame = -2

Query  479  AKVKIGINGFGRIGRLVARVALLSDDIELVAVNDPFITTDYMTYMFKYDTVHGQWTKNEL  300
             K+KIGINGFGRIGRLVARVALLS+D+ELVAVNDPFITT+YMTYMFKYDTVHGQW  +E+
Sbjct  5    GKIKIGINGFGRIGRLVARVALLSEDVELVAVNDPFITTEYMTYMFKYDTVHGQWKHHEI  64

Query  299  KVKDAKTLLFGDRHVAVFDKRNPEEIPWGETGAEYVVESTGVFTDQDkaaahlkggakKV  120
             VKD+KTLLFG++ VAVF  RNPEEIPWGE GA+YVVESTGVFTD+DKAAAHLKGGAKKV
Sbjct  65   TVKDSKTLLFGEKPVAVFGIRNPEEIPWGEAGADYVVESTGVFTDKDKAAAHLKGGAKKV  124

Query  119  VISAPSKDAPMFVMGVNHLEYKKDVDIVSNASCTTNCLA  3
            +ISAPSKDAPMFV+GVN  EYK D+DIVSNASCTTNCLA
Sbjct  125  IISAPSKDAPMFVVGVNEHEYKDDIDIVSNASCTTNCLA  163



>dbj|BAO57271.1| glyceraldehyde-3-phosphate dehydrogenase [Ipomoea nil]
Length=338

 Score =   259 bits (661),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 135/160 (84%), Positives = 147/160 (92%), Gaps = 0/160 (0%)
 Frame = -2

Query  482  MAKVKIGINGFGRIGRLVARVALLSDDIELVAVNDPFITTDYMTYMFKYDTVHGQWTKNE  303
            MAK+KIGINGFGRIGRLVARVAL  +D+ELVAVNDPFITT+YMTYMFKYDTVHGQW   E
Sbjct  1    MAKIKIGINGFGRIGRLVARVALQREDVELVAVNDPFITTEYMTYMFKYDTVHGQWKHKE  60

Query  302  LKVKDAKTLLFGDRHVAVFDKRNPEEIPWGETGAEYVVESTGVFTDQDkaaahlkggakK  123
            LKVKD KTLLFG++ V VF  RNPEEIPWGETGA+Y+VESTGVFTD+DKAAAHLKGGAKK
Sbjct  61   LKVKDEKTLLFGEQEVRVFGIRNPEEIPWGETGADYIVESTGVFTDKDKAAAHLKGGAKK  120

Query  122  VVISAPSKDAPMFVMGVNHLEYKKDVDIVSNASCTTNCLA  3
            VVISAPSKDAPMFV+GVN  EYK ++DIVSNASCTTNCLA
Sbjct  121  VVISAPSKDAPMFVVGVNEKEYKPELDIVSNASCTTNCLA  160



>ref|XP_004152516.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase, cytosolic-like 
[Cucumis sativus]
 ref|XP_004162130.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase, cytosolic-like 
[Cucumis sativus]
 gb|KGN64386.1| hypothetical protein Csa_1G050250 [Cucumis sativus]
Length=337

 Score =   259 bits (661),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 132/160 (83%), Positives = 148/160 (93%), Gaps = 0/160 (0%)
 Frame = -2

Query  482  MAKVKIGINGFGRIGRLVARVALLSDDIELVAVNDPFITTDYMTYMFKYDTVHGQWTKNE  303
            MAK+KIGINGFGRIGRLVARVAL  +D+ELVAVNDPFITTDYMTYMFKYD+VHGQW   +
Sbjct  1    MAKIKIGINGFGRIGRLVARVALQRNDVELVAVNDPFITTDYMTYMFKYDSVHGQWKHED  60

Query  302  LKVKDAKTLLFGDRHVAVFDKRNPEEIPWGETGAEYVVESTGVFTDQDkaaahlkggakK  123
            +KVKD+KTLLFG++ V VF  RNPEEIPWGETGAEY+VESTGVFTD+DKAAAHLKGGAKK
Sbjct  61   VKVKDSKTLLFGEQAVTVFGIRNPEEIPWGETGAEYIVESTGVFTDKDKAAAHLKGGAKK  120

Query  122  VVISAPSKDAPMFVMGVNHLEYKKDVDIVSNASCTTNCLA  3
            V+ISAPSKDAPMFV+GVN  EYK D+D++SNASCTTNCLA
Sbjct  121  VIISAPSKDAPMFVVGVNEKEYKPDLDVISNASCTTNCLA  160



>gb|AET80378.1| GAPDH2 [x Doritaenopsis hybrid cultivar]
Length=291

 Score =   257 bits (657),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 133/156 (85%), Positives = 145/156 (93%), Gaps = 0/156 (0%)
 Frame = -2

Query  470  KIGINGFGRIGRLVARVALLSDDIELVAVNDPFITTDYMTYMFKYDTVHGQWTKNELKVK  291
            KIGINGFGRIGRLVARVALLSDD+ELVA+NDPFITTDYMTYMFKYDTVHGQW  +E+ VK
Sbjct  1    KIGINGFGRIGRLVARVALLSDDVELVAINDPFITTDYMTYMFKYDTVHGQWKHHEITVK  60

Query  290  DAKTLLFGDRHVAVFDKRNPEEIPWGETGAEYVVESTGVFTDQDkaaahlkggakKVVIS  111
            D+KTLLFG++ V VF  RNPEEIPWGE GA+YVVESTGVFTD+DKAAAHLKGGAKKV+IS
Sbjct  61   DSKTLLFGEKPVTVFGIRNPEEIPWGEAGADYVVESTGVFTDKDKAAAHLKGGAKKVIIS  120

Query  110  APSKDAPMFVMGVNHLEYKKDVDIVSNASCTTNCLA  3
            APSKDAPMFV+GVN  EYK D+DIVSNASCTTNCLA
Sbjct  121  APSKDAPMFVVGVNEHEYKADIDIVSNASCTTNCLA  156



>gb|AET80377.1| GAPDH1, partial [x Doritaenopsis hybrid cultivar]
Length=291

 Score =   257 bits (657),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 133/156 (85%), Positives = 145/156 (93%), Gaps = 0/156 (0%)
 Frame = -2

Query  470  KIGINGFGRIGRLVARVALLSDDIELVAVNDPFITTDYMTYMFKYDTVHGQWTKNELKVK  291
            KIGINGFGRIGRLVARVALLSDD+ELVA+NDPFITTDYMTYMFKYDTVHGQW  +E+ VK
Sbjct  1    KIGINGFGRIGRLVARVALLSDDVELVAINDPFITTDYMTYMFKYDTVHGQWKHHEITVK  60

Query  290  DAKTLLFGDRHVAVFDKRNPEEIPWGETGAEYVVESTGVFTDQDkaaahlkggakKVVIS  111
            D+KTLLFG++ V VF  RNPEEIPWGE GA+YVVESTGVFTD+DKAAAHLKGGAKKV+IS
Sbjct  61   DSKTLLFGEKPVTVFGIRNPEEIPWGEAGADYVVESTGVFTDKDKAAAHLKGGAKKVIIS  120

Query  110  APSKDAPMFVMGVNHLEYKKDVDIVSNASCTTNCLA  3
            APSKDAPMFV+GVN  EYK D+DIVSNASCTTNCLA
Sbjct  121  APSKDAPMFVVGVNEHEYKADIDIVSNASCTTNCLA  156



>sp|P26518.1|G3PC_MAGLI RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase, cytosolic 
[Magnolia liliiflora]
 emb|CAA42905.1| glyceraldehyde 3-phosphate dehydrogenase [Magnolia liliiflora]
Length=341

 Score =   259 bits (661),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 134/158 (85%), Positives = 147/158 (93%), Gaps = 0/158 (0%)
 Frame = -2

Query  476  KVKIGINGFGRIGRLVARVALLSDDIELVAVNDPFITTDYMTYMFKYDTVHGQWTKNELK  297
            K+KIGINGFGRIGRLVARVAL  DD+ELVAVNDPFITTDYMTYMFKYD+VHGQW  +ELK
Sbjct  5    KIKIGINGFGRIGRLVARVALQRDDVELVAVNDPFITTDYMTYMFKYDSVHGQWKHHELK  64

Query  296  VKDAKTLLFGDRHVAVFDKRNPEEIPWGETGAEYVVESTGVFTDQDkaaahlkggakKVV  117
            VKD+KTLLFG++ V VF  RNPEEIPWGETGAE+VVESTGVFTD+DKAAAHLKGGAKKV+
Sbjct  65   VKDSKTLLFGEKPVTVFGVRNPEEIPWGETGAEFVVESTGVFTDKDKAAAHLKGGAKKVI  124

Query  116  ISAPSKDAPMFVMGVNHLEYKKDVDIVSNASCTTNCLA  3
            ISAPSKDAPMFV+GVN  EYK ++DIVSNASCTTNCLA
Sbjct  125  ISAPSKDAPMFVVGVNEHEYKSNIDIVSNASCTTNCLA  162



>ref|XP_002298594.1| glyceraldehyde 3-phosphate dehydrogenase family protein [Populus 
trichocarpa]
 gb|EEE83399.1| glyceraldehyde 3-phosphate dehydrogenase family protein [Populus 
trichocarpa]
Length=337

 Score =   259 bits (661),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 135/160 (84%), Positives = 146/160 (91%), Gaps = 0/160 (0%)
 Frame = -2

Query  482  MAKVKIGINGFGRIGRLVARVALLSDDIELVAVNDPFITTDYMTYMFKYDTVHGQWTKNE  303
            MAK+KIGINGFGRIGRLVARVAL  DD+ELVAVNDPFITTDYMTYMFKYDTVHGQW   +
Sbjct  1    MAKIKIGINGFGRIGRLVARVALQRDDVELVAVNDPFITTDYMTYMFKYDTVHGQWKHGD  60

Query  302  LKVKDAKTLLFGDRHVAVFDKRNPEEIPWGETGAEYVVESTGVFTDQDkaaahlkggakK  123
            +KVKD KTLLFGD+ VAVF  RNPEEIPWG  GA++VVESTGVFTD+DKAAAHLKGGAKK
Sbjct  61   IKVKDEKTLLFGDKPVAVFGVRNPEEIPWGAAGADFVVESTGVFTDKDKAAAHLKGGAKK  120

Query  122  VVISAPSKDAPMFVMGVNHLEYKKDVDIVSNASCTTNCLA  3
            V+ISAPSKDAPMFVMGVN  EYK D++IVSNASCTTNCLA
Sbjct  121  VIISAPSKDAPMFVMGVNEKEYKPDLNIVSNASCTTNCLA  160



>gb|ABQ81648.1| glyceraldehyde-3-phosphate dehydrogenase [Triticum aestivum]
Length=337

 Score =   258 bits (660),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 134/160 (84%), Positives = 145/160 (91%), Gaps = 0/160 (0%)
 Frame = -2

Query  482  MAKVKIGINGFGRIGRLVARVALLSDDIELVAVNDPFITTDYMTYMFKYDTVHGQWTKNE  303
            M K+KIGINGFGRIGRLVARVAL S D+ELVAVNDPFITTDYMTYMFKYDTVHGQW  +E
Sbjct  1    MGKIKIGINGFGRIGRLVARVALQSPDVELVAVNDPFITTDYMTYMFKYDTVHGQWKHHE  60

Query  302  LKVKDAKTLLFGDRHVAVFDKRNPEEIPWGETGAEYVVESTGVFTDQDkaaahlkggakK  123
            +KVKD+KTLLFG++ VAVF  RNPEEIPW   GAEYVVESTGVFTD+DKAAAH+KGGAKK
Sbjct  61   VKVKDSKTLLFGEKEVAVFGCRNPEEIPWAAAGAEYVVESTGVFTDKDKAAAHIKGGAKK  120

Query  122  VVISAPSKDAPMFVMGVNHLEYKKDVDIVSNASCTTNCLA  3
            V+ISAPSKDAPMFV GVN  EYK D+DIVSNASCTTNCLA
Sbjct  121  VIISAPSKDAPMFVCGVNEKEYKSDIDIVSNASCTTNCLA  160



>ref|XP_011045198.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase, cytosolic 
[Populus euphratica]
Length=337

 Score =   258 bits (660),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 135/160 (84%), Positives = 146/160 (91%), Gaps = 0/160 (0%)
 Frame = -2

Query  482  MAKVKIGINGFGRIGRLVARVALLSDDIELVAVNDPFITTDYMTYMFKYDTVHGQWTKNE  303
            MAK+KIGINGFGRIGRLVARVAL  DD+ELVAVNDPFITTDYMTYMFKYDTVHGQW   +
Sbjct  1    MAKIKIGINGFGRIGRLVARVALQRDDVELVAVNDPFITTDYMTYMFKYDTVHGQWKHGD  60

Query  302  LKVKDAKTLLFGDRHVAVFDKRNPEEIPWGETGAEYVVESTGVFTDQDkaaahlkggakK  123
            +KVKD KTLLFGD+ VAVF  RNPEEIPWG  GA++VVESTGVFTD+DKAAAHLKGGAKK
Sbjct  61   IKVKDEKTLLFGDKPVAVFGVRNPEEIPWGAAGADFVVESTGVFTDKDKAAAHLKGGAKK  120

Query  122  VVISAPSKDAPMFVMGVNHLEYKKDVDIVSNASCTTNCLA  3
            V+ISAPSKDAPMFVMGVN  EYK D++IVSNASCTTNCLA
Sbjct  121  VIISAPSKDAPMFVMGVNEKEYKPDLNIVSNASCTTNCLA  160



>sp|P34783.1|G3P_ATRNU RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase; Short=GAPDH 
[Atriplex nummularia]
 gb|AAA03442.1| glyceraldehyde-3-phosphate dehydrogenase [Atriplex nummularia]
 emb|CAA53269.1| glyceraldehyde-3-phosphate dehydrogenase [Atriplex nummularia]
Length=360

 Score =   259 bits (662),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 135/160 (84%), Positives = 147/160 (92%), Gaps = 0/160 (0%)
 Frame = -2

Query  482  MAKVKIGINGFGRIGRLVARVALLSDDIELVAVNDPFITTDYMTYMFKYDTVHGQWTKNE  303
            MAKVKIGINGFGRIGRLVARV L SDD ELVA+NDPFITTDYMTYMFKYD+VHGQW  +E
Sbjct  1    MAKVKIGINGFGRIGRLVARVILQSDDCELVAINDPFITTDYMTYMFKYDSVHGQWKHHE  60

Query  302  LKVKDAKTLLFGDRHVAVFDKRNPEEIPWGETGAEYVVESTGVFTDQDkaaahlkggakK  123
            LKVKD KTLLFG+R V VF  RNPEEIPWG+TGA+YVVESTGVFTD+DKAAAHLKGGAKK
Sbjct  61   LKVKDEKTLLFGERPVTVFGNRNPEEIPWGQTGADYVVESTGVFTDKDKAAAHLKGGAKK  120

Query  122  VVISAPSKDAPMFVMGVNHLEYKKDVDIVSNASCTTNCLA  3
            V+ISAPSKDAPMFV+GVN  EYK +++IVSNASCTTNCLA
Sbjct  121  VIISAPSKDAPMFVVGVNEHEYKSELNIVSNASCTTNCLA  160



>ref|XP_008800944.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase 3, cytosolic-like 
isoform X1 [Phoenix dactylifera]
 ref|XP_008800945.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase 3, cytosolic-like 
isoform X1 [Phoenix dactylifera]
 ref|XP_008800946.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase 3, cytosolic-like 
isoform X2 [Phoenix dactylifera]
Length=340

 Score =   259 bits (661),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 133/158 (84%), Positives = 148/158 (94%), Gaps = 0/158 (0%)
 Frame = -2

Query  476  KVKIGINGFGRIGRLVARVALLSDDIELVAVNDPFITTDYMTYMFKYDTVHGQWTKNELK  297
            K+KIGINGFGRIGRLVARVAL S DIELVAVNDPFI+TDYMTYMFKYDTVHG+W  +++K
Sbjct  6    KIKIGINGFGRIGRLVARVALQSSDIELVAVNDPFISTDYMTYMFKYDTVHGKWKHHDIK  65

Query  296  VKDAKTLLFGDRHVAVFDKRNPEEIPWGETGAEYVVESTGVFTDQDkaaahlkggakKVV  117
            VKD+KTLLFG++ VAVF  RNPEEIPWGETGAEYVVESTGVFTD++KA+AHLKGGAKKVV
Sbjct  66   VKDSKTLLFGEKQVAVFGIRNPEEIPWGETGAEYVVESTGVFTDKEKASAHLKGGAKKVV  125

Query  116  ISAPSKDAPMFVMGVNHLEYKKDVDIVSNASCTTNCLA  3
            ISAPSKDAPMFV+GVN  EYK D++IVSNASCTTNCLA
Sbjct  126  ISAPSKDAPMFVVGVNEHEYKSDINIVSNASCTTNCLA  163



>gb|ABK24012.1| unknown [Picea sitchensis]
Length=340

 Score =   258 bits (660),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 133/159 (84%), Positives = 146/159 (92%), Gaps = 0/159 (0%)
 Frame = -2

Query  479  AKVKIGINGFGRIGRLVARVALLSDDIELVAVNDPFITTDYMTYMFKYDTVHGQWTKNEL  300
             K+KIGINGFGRIGRLVARVAL  DDIELVAVNDPFI+TDYMTYMFKYD+VHGQW  NE+
Sbjct  5    GKIKIGINGFGRIGRLVARVALTRDDIELVAVNDPFISTDYMTYMFKYDSVHGQWKHNEV  64

Query  299  KVKDAKTLLFGDRHVAVFDKRNPEEIPWGETGAEYVVESTGVFTDQDkaaahlkggakKV  120
            KVKD+KTLLFG++ VAVF  RNPEEIPWGE GAEYVVESTGVFTD++KAAAHLK GAKKV
Sbjct  65   KVKDSKTLLFGEKPVAVFGCRNPEEIPWGEVGAEYVVESTGVFTDKEKAAAHLKAGAKKV  124

Query  119  VISAPSKDAPMFVMGVNHLEYKKDVDIVSNASCTTNCLA  3
            VISAPSKDAPMFV+GVN  +YK D++IVSNASCTTNCLA
Sbjct  125  VISAPSKDAPMFVVGVNEHQYKSDLNIVSNASCTTNCLA  163



>ref|XP_010910405.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase, cytosolic 
[Elaeis guineensis]
Length=340

 Score =   258 bits (660),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 133/158 (84%), Positives = 147/158 (93%), Gaps = 0/158 (0%)
 Frame = -2

Query  476  KVKIGINGFGRIGRLVARVALLSDDIELVAVNDPFITTDYMTYMFKYDTVHGQWTKNELK  297
            K+KIGINGFGRIGRLVARVAL S DIELVAVNDPFI+TDYMTYMFKYDTVHG+W  +++K
Sbjct  6    KIKIGINGFGRIGRLVARVALQSSDIELVAVNDPFISTDYMTYMFKYDTVHGKWKHHDIK  65

Query  296  VKDAKTLLFGDRHVAVFDKRNPEEIPWGETGAEYVVESTGVFTDQDkaaahlkggakKVV  117
            VKD+KTLLFG++ V VF  RNPEEIPWGETGAEYVVESTGVFTD++KA+AHLKGGAKKVV
Sbjct  66   VKDSKTLLFGEKQVTVFGIRNPEEIPWGETGAEYVVESTGVFTDKEKASAHLKGGAKKVV  125

Query  116  ISAPSKDAPMFVMGVNHLEYKKDVDIVSNASCTTNCLA  3
            ISAPSKDAPMFV+GVN  EYK D+DIVSNASCTTNCLA
Sbjct  126  ISAPSKDAPMFVVGVNEHEYKSDIDIVSNASCTTNCLA  163



>gb|ACJ11752.1| glyceraldehyde-3-phosphate dehydrogenase C subunit [Gossypium 
hirsutum]
Length=336

 Score =   258 bits (660),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 135/160 (84%), Positives = 147/160 (92%), Gaps = 0/160 (0%)
 Frame = -2

Query  482  MAKVKIGINGFGRIGRLVARVALLSDDIELVAVNDPFITTDYMTYMFKYDTVHGQWTKNE  303
            M K+KIGINGFGRIGRLVARVAL SDDIELVAVNDPFITT+YMTYMFKYD+VHGQW  +E
Sbjct  1    MGKIKIGINGFGRIGRLVARVALQSDDIELVAVNDPFITTEYMTYMFKYDSVHGQWKHHE  60

Query  302  LKVKDAKTLLFGDRHVAVFDKRNPEEIPWGETGAEYVVESTGVFTDQDkaaahlkggakK  123
            LKVKD+KTLLFG++ V VF  RNPEEIPW E GAEYVVESTGVFTD+DKAAAHLKGGAKK
Sbjct  61   LKVKDSKTLLFGEKPVTVFGIRNPEEIPWAEAGAEYVVESTGVFTDKDKAAAHLKGGAKK  120

Query  122  VVISAPSKDAPMFVMGVNHLEYKKDVDIVSNASCTTNCLA  3
            V+ISAPSKDAPMFV+GVN  EYK D++IVSNASCTTNCLA
Sbjct  121  VIISAPSKDAPMFVVGVNEKEYKPDLNIVSNASCTTNCLA  160



>gb|KDO36893.1| hypothetical protein CISIN_1g024629mg [Citrus sinensis]
Length=188

 Score =   253 bits (646),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 134/160 (84%), Positives = 145/160 (91%), Gaps = 0/160 (0%)
 Frame = -2

Query  482  MAKVKIGINGFGRIGRLVARVALLSDDIELVAVNDPFITTDYMTYMFKYDTVHGQWTKNE  303
            M KVKIGINGFGRIGRLVARV L  DD+ELVAVNDPFITTDYMTYMFKYD+VHGQW  +E
Sbjct  1    MGKVKIGINGFGRIGRLVARVILQRDDVELVAVNDPFITTDYMTYMFKYDSVHGQWKHHE  60

Query  302  LKVKDAKTLLFGDRHVAVFDKRNPEEIPWGETGAEYVVESTGVFTDQDkaaahlkggakK  123
            LKVKD KTLLFG++ V VF  RNPEEIPW ETGAEYVVESTGVFTD+DKAAAHLKGGAKK
Sbjct  61   LKVKDDKTLLFGEKPVTVFGVRNPEEIPWAETGAEYVVESTGVFTDKDKAAAHLKGGAKK  120

Query  122  VVISAPSKDAPMFVMGVNHLEYKKDVDIVSNASCTTNCLA  3
            V+ISAPSKDAPMFV+GVN  EYK +++IVSNASCTTNCLA
Sbjct  121  VIISAPSKDAPMFVVGVNENEYKPELNIVSNASCTTNCLA  160



>gb|AEN19694.1| glyceraldehyde 3-phosphate dehydrogenase [Cymbidium faberi]
Length=291

 Score =   256 bits (655),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 133/156 (85%), Positives = 146/156 (94%), Gaps = 0/156 (0%)
 Frame = -2

Query  470  KIGINGFGRIGRLVARVALLSDDIELVAVNDPFITTDYMTYMFKYDTVHGQWTKNELKVK  291
            KIGINGFGRIGRLVARVALLS+D+ELVAVNDPFITT+YMTYMFKYDTVHGQW  +E+ VK
Sbjct  1    KIGINGFGRIGRLVARVALLSEDVELVAVNDPFITTEYMTYMFKYDTVHGQWKHHEITVK  60

Query  290  DAKTLLFGDRHVAVFDKRNPEEIPWGETGAEYVVESTGVFTDQDkaaahlkggakKVVIS  111
            D+KTLLFG++ VAVF  RNPEEIPWGE GA+YVVESTGVFTD+DKAAAHLKGGAKKV+IS
Sbjct  61   DSKTLLFGEKPVAVFGIRNPEEIPWGEAGADYVVESTGVFTDKDKAAAHLKGGAKKVIIS  120

Query  110  APSKDAPMFVMGVNHLEYKKDVDIVSNASCTTNCLA  3
            APSKDAPMFV+GVN  EYK D+DIVSNASCTTNCLA
Sbjct  121  APSKDAPMFVVGVNEHEYKDDIDIVSNASCTTNCLA  156



>ref|XP_009384257.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase 2, cytosolic-like 
[Musa acuminata subsp. malaccensis]
Length=338

 Score =   258 bits (659),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 133/161 (83%), Positives = 147/161 (91%), Gaps = 0/161 (0%)
 Frame = -2

Query  485  IMAKVKIGINGFGRIGRLVARVALLSDDIELVAVNDPFITTDYMTYMFKYDTVHGQWTKN  306
            +  K+KIGINGFGRIGRLVARVAL SDD+ELVAVNDPFITTDYMTYMFKYDTVHG W  +
Sbjct  1    MAGKIKIGINGFGRIGRLVARVALQSDDVELVAVNDPFITTDYMTYMFKYDTVHGSWKHH  60

Query  305  ELKVKDAKTLLFGDRHVAVFDKRNPEEIPWGETGAEYVVESTGVFTDQDkaaahlkggak  126
            E+KVKD+KTLLFG++ V VF  RNPEEIPWGE+GAEYVVESTGVFTD+DKAAAHLKGGAK
Sbjct  61   EIKVKDSKTLLFGEKEVTVFGIRNPEEIPWGESGAEYVVESTGVFTDKDKAAAHLKGGAK  120

Query  125  KVVISAPSKDAPMFVMGVNHLEYKKDVDIVSNASCTTNCLA  3
            KV+ISAPSKDAPMFV+GVN  EY  D++IVSNASCTTNCLA
Sbjct  121  KVIISAPSKDAPMFVIGVNENEYTSDINIVSNASCTTNCLA  161



>gb|AAV70659.1| glyceraldehyde-3-phosphate dehydrogenase [Musa acuminata]
Length=331

 Score =   258 bits (658),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 133/158 (84%), Positives = 146/158 (92%), Gaps = 0/158 (0%)
 Frame = -2

Query  476  KVKIGINGFGRIGRLVARVALLSDDIELVAVNDPFITTDYMTYMFKYDTVHGQWTKNELK  297
            K+KIGINGFGRIGRLVARVAL SDD+ELVAVNDPFITTDYMTYMFKYDTVHG W  +E+K
Sbjct  1    KIKIGINGFGRIGRLVARVALQSDDVELVAVNDPFITTDYMTYMFKYDTVHGSWKHHEIK  60

Query  296  VKDAKTLLFGDRHVAVFDKRNPEEIPWGETGAEYVVESTGVFTDQDkaaahlkggakKVV  117
            VKD+KTLLFG++ V VF  RNPEEIPWGE+GAEYVVESTGVFTD+DKAAAHLKGGAKKV+
Sbjct  61   VKDSKTLLFGEKEVTVFGIRNPEEIPWGESGAEYVVESTGVFTDKDKAAAHLKGGAKKVI  120

Query  116  ISAPSKDAPMFVMGVNHLEYKKDVDIVSNASCTTNCLA  3
            ISAPSKDAPMFV+GVN  EY  D++IVSNASCTTNCLA
Sbjct  121  ISAPSKDAPMFVIGVNENEYTSDINIVSNASCTTNCLA  158



>ref|XP_002265988.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase 2, cytosolic 
[Vitis vinifera]
 emb|CBI40083.3| unnamed protein product [Vitis vinifera]
Length=337

 Score =   258 bits (659),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 131/160 (82%), Positives = 145/160 (91%), Gaps = 0/160 (0%)
 Frame = -2

Query  482  MAKVKIGINGFGRIGRLVARVALLSDDIELVAVNDPFITTDYMTYMFKYDTVHGQWTKNE  303
            MAK+KIGINGFGRIGRLVARVAL  DD+ELVAVNDPFI TDYMTYMFKYD+VHGQW  ++
Sbjct  1    MAKIKIGINGFGRIGRLVARVALQRDDVELVAVNDPFINTDYMTYMFKYDSVHGQWKHHD  60

Query  302  LKVKDAKTLLFGDRHVAVFDKRNPEEIPWGETGAEYVVESTGVFTDQDkaaahlkggakK  123
            +KVKD+KTLLFGD+ V VF  +NPEEIPWGE GAEYVVESTGVFTD+DKAA HLKGGAKK
Sbjct  61   IKVKDSKTLLFGDKAVTVFGAKNPEEIPWGEAGAEYVVESTGVFTDKDKAALHLKGGAKK  120

Query  122  VVISAPSKDAPMFVMGVNHLEYKKDVDIVSNASCTTNCLA  3
            V+ISAPS +APMFVMGVN  EYK ++DIVSNASCTTNCLA
Sbjct  121  VIISAPSSNAPMFVMGVNEKEYKSNIDIVSNASCTTNCLA  160



>gb|AEN19696.1| glyceraldehyde 3-phosphate dehydrogenase [Cymbidium faberi]
 gb|AEN19698.1| glyceraldehyde 3-phosphate dehydrogenase [Cymbidium faberi]
 gb|AFK93853.1| glyceraldehyde 3-phosphate dehydrogenase, partial [Cymbidium 
sinense]
Length=291

 Score =   256 bits (654),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 133/156 (85%), Positives = 146/156 (94%), Gaps = 0/156 (0%)
 Frame = -2

Query  470  KIGINGFGRIGRLVARVALLSDDIELVAVNDPFITTDYMTYMFKYDTVHGQWTKNELKVK  291
            KIGINGFGRIGRLVARVALLS+D+ELVAVNDPFITT+YMTYMFKYDTVHGQW  +E+ VK
Sbjct  1    KIGINGFGRIGRLVARVALLSEDVELVAVNDPFITTEYMTYMFKYDTVHGQWKHHEITVK  60

Query  290  DAKTLLFGDRHVAVFDKRNPEEIPWGETGAEYVVESTGVFTDQDkaaahlkggakKVVIS  111
            D+KTLLFG++ VAVF  RNPEEIPWGE GA+YVVESTGVFTD+DKAAAHLKGGAKKV+IS
Sbjct  61   DSKTLLFGEKPVAVFGIRNPEEIPWGEAGADYVVESTGVFTDKDKAAAHLKGGAKKVIIS  120

Query  110  APSKDAPMFVMGVNHLEYKKDVDIVSNASCTTNCLA  3
            APSKDAPMFV+GVN  EYK D+DIVSNASCTTNCLA
Sbjct  121  APSKDAPMFVVGVNEHEYKDDIDIVSNASCTTNCLA  156



>ref|XP_010248875.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase, cytosolic-like 
[Nelumbo nucifera]
Length=337

 Score =   258 bits (658),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 135/160 (84%), Positives = 146/160 (91%), Gaps = 0/160 (0%)
 Frame = -2

Query  482  MAKVKIGINGFGRIGRLVARVALLSDDIELVAVNDPFITTDYMTYMFKYDTVHGQWTKNE  303
            M KVKIGINGFGRIGRLVARVAL  DD+ELVAVNDPFITTDYMTYMFKYD+VHG W   +
Sbjct  1    MGKVKIGINGFGRIGRLVARVALQRDDVELVAVNDPFITTDYMTYMFKYDSVHGHWKHAD  60

Query  302  LKVKDAKTLLFGDRHVAVFDKRNPEEIPWGETGAEYVVESTGVFTDQDkaaahlkggakK  123
            +KVKD+KTLLFG++ VAVF  RNPEEIPWGETGAE+VVESTGVFTD+DKAAAHLKGGAKK
Sbjct  61   VKVKDSKTLLFGEKPVAVFGVRNPEEIPWGETGAEFVVESTGVFTDKDKAAAHLKGGAKK  120

Query  122  VVISAPSKDAPMFVMGVNHLEYKKDVDIVSNASCTTNCLA  3
            VVISAPSKDAPMFV+GVN  EYK D+ IVSNASCTTNCLA
Sbjct  121  VVISAPSKDAPMFVVGVNEKEYKSDISIVSNASCTTNCLA  160



>gb|KDO36874.1| hypothetical protein CISIN_1g024565mg [Citrus sinensis]
Length=188

 Score =   253 bits (645),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 134/160 (84%), Positives = 145/160 (91%), Gaps = 0/160 (0%)
 Frame = -2

Query  482  MAKVKIGINGFGRIGRLVARVALLSDDIELVAVNDPFITTDYMTYMFKYDTVHGQWTKNE  303
            M KVKIGINGFGRIGRLVARV L  DD+ELVAVNDPFITTDYMTYMFKYD+VHGQW  +E
Sbjct  1    MGKVKIGINGFGRIGRLVARVILQRDDVELVAVNDPFITTDYMTYMFKYDSVHGQWKHHE  60

Query  302  LKVKDAKTLLFGDRHVAVFDKRNPEEIPWGETGAEYVVESTGVFTDQDkaaahlkggakK  123
            LKVKD KTLLFG++ V VF  RNPEEIPW ETGAEYVVESTGVFTD+DKAAAHLKGGAKK
Sbjct  61   LKVKDDKTLLFGEKPVTVFGVRNPEEIPWAETGAEYVVESTGVFTDKDKAAAHLKGGAKK  120

Query  122  VVISAPSKDAPMFVMGVNHLEYKKDVDIVSNASCTTNCLA  3
            V+ISAPSKDAPMFV+GVN  EYK +++IVSNASCTTNCLA
Sbjct  121  VIISAPSKDAPMFVVGVNEHEYKPELNIVSNASCTTNCLA  160



>gb|AET80380.1| GAPDH4 [x Doritaenopsis hybrid cultivar]
Length=291

 Score =   256 bits (654),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 133/156 (85%), Positives = 145/156 (93%), Gaps = 0/156 (0%)
 Frame = -2

Query  470  KIGINGFGRIGRLVARVALLSDDIELVAVNDPFITTDYMTYMFKYDTVHGQWTKNELKVK  291
            KIGINGFGRIGRLVARVALLS+D+ELVAVNDPFITTDYMTYMFKYDTVHGQW  +E+ VK
Sbjct  1    KIGINGFGRIGRLVARVALLSEDVELVAVNDPFITTDYMTYMFKYDTVHGQWKHHEITVK  60

Query  290  DAKTLLFGDRHVAVFDKRNPEEIPWGETGAEYVVESTGVFTDQDkaaahlkggakKVVIS  111
            D+KTLLFG++ V VF  RNPEEIPWGE GA+YVVESTGVFTD+DKAAAHLKGGAKKV+IS
Sbjct  61   DSKTLLFGEKPVTVFGIRNPEEIPWGEAGADYVVESTGVFTDKDKAAAHLKGGAKKVIIS  120

Query  110  APSKDAPMFVMGVNHLEYKKDVDIVSNASCTTNCLA  3
            APSKDAPMFV+GVN  EYK D+DIVSNASCTTNCLA
Sbjct  121  APSKDAPMFVVGVNEHEYKADIDIVSNASCTTNCLA  156



>gb|AEN19697.1| glyceraldehyde 3-phosphate dehydrogenase [Cymbidium faberi]
Length=291

 Score =   256 bits (654),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 133/156 (85%), Positives = 146/156 (94%), Gaps = 0/156 (0%)
 Frame = -2

Query  470  KIGINGFGRIGRLVARVALLSDDIELVAVNDPFITTDYMTYMFKYDTVHGQWTKNELKVK  291
            KIGINGFGRIGRLVARVALLS+D+ELVAVNDPFITT+YMTYMFKYDTVHGQW  +E+ VK
Sbjct  1    KIGINGFGRIGRLVARVALLSEDVELVAVNDPFITTEYMTYMFKYDTVHGQWKHHEITVK  60

Query  290  DAKTLLFGDRHVAVFDKRNPEEIPWGETGAEYVVESTGVFTDQDkaaahlkggakKVVIS  111
            D+KTLLFG++ VAVF  RNPEEIPWGE GA+YVVESTGVFTD+DKAAAHLKGGAKKV+IS
Sbjct  61   DSKTLLFGEKPVAVFGIRNPEEIPWGEAGADYVVESTGVFTDKDKAAAHLKGGAKKVIIS  120

Query  110  APSKDAPMFVMGVNHLEYKKDVDIVSNASCTTNCLA  3
            APSKDAPMFV+GVN  EYK D+DIVSNASCTTNCLA
Sbjct  121  APSKDAPMFVVGVNEHEYKDDIDIVSNASCTTNCLA  156



>ref|XP_006438114.1| hypothetical protein CICLE_v10032014mg [Citrus clementina]
 gb|ESR51354.1| hypothetical protein CICLE_v10032014mg [Citrus clementina]
 gb|KDO82021.1| hypothetical protein CISIN_1g019445mg [Citrus sinensis]
Length=341

 Score =   258 bits (658),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 135/158 (85%), Positives = 146/158 (92%), Gaps = 0/158 (0%)
 Frame = -2

Query  476  KVKIGINGFGRIGRLVARVALLSDDIELVAVNDPFITTDYMTYMFKYDTVHGQWTKNELK  297
            K+KIGINGFGRIGRLVARVAL  DD+ELVAVNDPFI+TDYMTYMFKYD+VHGQW  NELK
Sbjct  6    KIKIGINGFGRIGRLVARVALQRDDVELVAVNDPFISTDYMTYMFKYDSVHGQWKHNELK  65

Query  296  VKDAKTLLFGDRHVAVFDKRNPEEIPWGETGAEYVVESTGVFTDQDkaaahlkggakKVV  117
            VKD KTLLFG++ VAVF  RNPEEIPW +TGAEYVVESTGVFTD+DKAAAHLKGGAKKVV
Sbjct  66   VKDEKTLLFGEKPVAVFGFRNPEEIPWAKTGAEYVVESTGVFTDKDKAAAHLKGGAKKVV  125

Query  116  ISAPSKDAPMFVMGVNHLEYKKDVDIVSNASCTTNCLA  3
            ISAPSKDAPMFV+GVN  EYK ++DIVSNASCTTNCLA
Sbjct  126  ISAPSKDAPMFVVGVNEKEYKPELDIVSNASCTTNCLA  163



>ref|XP_008439417.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase 2, cytosolic-like 
[Cucumis melo]
 gb|ADN33958.1| glyceraldehyde-3-phosphate dehydrogenase [Cucumis melo subsp. 
melo]
Length=337

 Score =   258 bits (658),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 131/160 (82%), Positives = 148/160 (93%), Gaps = 0/160 (0%)
 Frame = -2

Query  482  MAKVKIGINGFGRIGRLVARVALLSDDIELVAVNDPFITTDYMTYMFKYDTVHGQWTKNE  303
            MAK+KIGINGFGRIGRLVARVAL  DD+ELVAVNDPFITTDYMTYMFKYD+VHG W  ++
Sbjct  1    MAKIKIGINGFGRIGRLVARVALQRDDVELVAVNDPFITTDYMTYMFKYDSVHGHWKHSD  60

Query  302  LKVKDAKTLLFGDRHVAVFDKRNPEEIPWGETGAEYVVESTGVFTDQDkaaahlkggakK  123
            +KVKD+KTLLFGD+ V VF  RNPEEIPWGETGAEY+VESTGVFTD+DKAAAHLKGGAKK
Sbjct  61   VKVKDSKTLLFGDKAVTVFGVRNPEEIPWGETGAEYIVESTGVFTDKDKAAAHLKGGAKK  120

Query  122  VVISAPSKDAPMFVMGVNHLEYKKDVDIVSNASCTTNCLA  3
            V+ISAPSKDAPMFV+GVN  EYK +++++SNASCTTNCLA
Sbjct  121  VIISAPSKDAPMFVVGVNEKEYKPELNVISNASCTTNCLA  160



>gb|ACX49537.1| glyceraldehyde-3-phosphate dehydrogenase [Cucumis sativus]
Length=197

 Score =   253 bits (645),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 129/160 (81%), Positives = 148/160 (93%), Gaps = 0/160 (0%)
 Frame = -2

Query  482  MAKVKIGINGFGRIGRLVARVALLSDDIELVAVNDPFITTDYMTYMFKYDTVHGQWTKNE  303
            MAK+KIGINGFGRIGRLVARVAL  DD+ELVAVNDPFITTDYMTYMFKYD+VHG W  ++
Sbjct  1    MAKIKIGINGFGRIGRLVARVALQRDDVELVAVNDPFITTDYMTYMFKYDSVHGHWKHSD  60

Query  302  LKVKDAKTLLFGDRHVAVFDKRNPEEIPWGETGAEYVVESTGVFTDQDkaaahlkggakK  123
            +KVKD+K+LLFG++ V VF  RNP+EIPWGETGAEY+VESTGVFTD+DKAAAHLKGGAKK
Sbjct  61   VKVKDSKSLLFGEKAVTVFGFRNPDEIPWGETGAEYIVESTGVFTDKDKAAAHLKGGAKK  120

Query  122  VVISAPSKDAPMFVMGVNHLEYKKDVDIVSNASCTTNCLA  3
            V+ISAPSKDAPMFV+GVN  EYK ++D++SNASCTTNCLA
Sbjct  121  VIISAPSKDAPMFVVGVNEKEYKPELDVISNASCTTNCLA  160



>dbj|BAO45907.1| glyceraldehyde-3 phosphate dehydrogenase [Acacia mangium]
Length=337

 Score =   258 bits (658),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 133/160 (83%), Positives = 146/160 (91%), Gaps = 0/160 (0%)
 Frame = -2

Query  482  MAKVKIGINGFGRIGRLVARVALLSDDIELVAVNDPFITTDYMTYMFKYDTVHGQWTKNE  303
            M K+KIGINGFGRIGRLVARV+L  DDIELVA+NDPFITTDYMTYMFKYD+VHGQW  +E
Sbjct  1    MGKIKIGINGFGRIGRLVARVSLQRDDIELVAINDPFITTDYMTYMFKYDSVHGQWKHHE  60

Query  302  LKVKDAKTLLFGDRHVAVFDKRNPEEIPWGETGAEYVVESTGVFTDQDkaaahlkggakK  123
            + VKD+KTLLFGD+ V VF  RNPEEIPWGETGAE+VVESTGVFTD++KA AHLKGGAKK
Sbjct  61   VTVKDSKTLLFGDKPVTVFAHRNPEEIPWGETGAEFVVESTGVFTDKEKATAHLKGGAKK  120

Query  122  VVISAPSKDAPMFVMGVNHLEYKKDVDIVSNASCTTNCLA  3
            VVISAPSKDAPMFV+GVN  EYK +VDIVSNASCTTNCLA
Sbjct  121  VVISAPSKDAPMFVVGVNEHEYKPEVDIVSNASCTTNCLA  160



>gb|AFJ04516.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Vernicia fordii]
Length=277

 Score =   255 bits (652),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 134/160 (84%), Positives = 144/160 (90%), Gaps = 0/160 (0%)
 Frame = -2

Query  482  MAKVKIGINGFGRIGRLVARVALLSDDIELVAVNDPFITTDYMTYMFKYDTVHGQWTKNE  303
            M KVKIGINGFGRIGRLVARVAL  DD+ELVAVNDPFI+ +YMTYMFKYDTVHGQW  +E
Sbjct  1    MGKVKIGINGFGRIGRLVARVALQRDDVELVAVNDPFISVEYMTYMFKYDTVHGQWKHHE  60

Query  302  LKVKDAKTLLFGDRHVAVFDKRNPEEIPWGETGAEYVVESTGVFTDQDkaaahlkggakK  123
            LKVKD KTLLFG++ V VF  RNPEEIPW ETGAEYVVESTGVFTD+DKAAAHLKGGAKK
Sbjct  61   LKVKDDKTLLFGEKPVTVFGVRNPEEIPWAETGAEYVVESTGVFTDKDKAAAHLKGGAKK  120

Query  122  VVISAPSKDAPMFVMGVNHLEYKKDVDIVSNASCTTNCLA  3
            V+ISAPSKDAPMFV+GVN  EYK D+ IVSNASCTTNCLA
Sbjct  121  VIISAPSKDAPMFVVGVNEKEYKPDIHIVSNASCTTNCLA  160



>ref|XP_009387502.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase 2, cytosolic-like 
[Musa acuminata subsp. malaccensis]
Length=338

 Score =   257 bits (657),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 134/161 (83%), Positives = 147/161 (91%), Gaps = 0/161 (0%)
 Frame = -2

Query  485  IMAKVKIGINGFGRIGRLVARVALLSDDIELVAVNDPFITTDYMTYMFKYDTVHGQWTKN  306
            +  K+KIGINGFGRIGRLVARVAL S+D+ELVAVNDPFITTDYMTYMFKYDTVHG W  +
Sbjct  1    MAGKIKIGINGFGRIGRLVARVALQSEDVELVAVNDPFITTDYMTYMFKYDTVHGSWKHH  60

Query  305  ELKVKDAKTLLFGDRHVAVFDKRNPEEIPWGETGAEYVVESTGVFTDQDkaaahlkggak  126
            E+KVKD+KTLLFG + VAVF  RNPEEIPWGETGAEYVVESTGVFTD+DKAAAHLKGGAK
Sbjct  61   EIKVKDSKTLLFGTKEVAVFGFRNPEEIPWGETGAEYVVESTGVFTDKDKAAAHLKGGAK  120

Query  125  KVVISAPSKDAPMFVMGVNHLEYKKDVDIVSNASCTTNCLA  3
            KV+ISAPSKDAPMFV+GVN  EYK D++IVSN SCTTNCLA
Sbjct  121  KVIISAPSKDAPMFVVGVNENEYKPDINIVSNVSCTTNCLA  161



>ref|XP_009383337.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase 2, cytosolic-like 
[Musa acuminata subsp. malaccensis]
Length=338

 Score =   257 bits (657),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 132/161 (82%), Positives = 147/161 (91%), Gaps = 0/161 (0%)
 Frame = -2

Query  485  IMAKVKIGINGFGRIGRLVARVALLSDDIELVAVNDPFITTDYMTYMFKYDTVHGQWTKN  306
            +  K+KIGINGFGRIGRLVARVAL SDD+ELVAVNDPFITTDYMTYMFKYDTVHG W  +
Sbjct  1    MAGKIKIGINGFGRIGRLVARVALQSDDVELVAVNDPFITTDYMTYMFKYDTVHGSWKHH  60

Query  305  ELKVKDAKTLLFGDRHVAVFDKRNPEEIPWGETGAEYVVESTGVFTDQDkaaahlkggak  126
            ++KVKD+KTLLFG++ V VF  RNPEEIPWGE GAEY+VESTGVFTD+DKAAAHLKGGAK
Sbjct  61   DIKVKDSKTLLFGEKQVTVFGIRNPEEIPWGEAGAEYIVESTGVFTDKDKAAAHLKGGAK  120

Query  125  KVVISAPSKDAPMFVMGVNHLEYKKDVDIVSNASCTTNCLA  3
            KV+ISAPSKDAPMFV+GVN  EYK D++IVSNASCTTNCLA
Sbjct  121  KVIISAPSKDAPMFVVGVNENEYKPDINIVSNASCTTNCLA  161



>ref|NP_001047348.1| Os02g0601300 [Oryza sativa Japonica Group]
 sp|Q6K5G8.1|G3PC3_ORYSJ RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase 3, cytosolic 
[Oryza sativa Japonica Group]
 dbj|BAD22157.1| putative glyceraldehyde-3-phosphate dehydrogenase (phosphorylating) 
[Oryza sativa Japonica Group]
 dbj|BAF09262.1| Os02g0601300 [Oryza sativa Japonica Group]
 gb|ABL75274.1| glyceralde-3-phosphate dehydrogenase [Oryza sativa]
 dbj|BAG93915.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE57317.1| hypothetical protein OsJ_07411 [Oryza sativa Japonica Group]
 gb|ADM86845.1| glyceraldehyde-3-phosphate dehydrogenase [Oryza sativa Japonica 
Group]
Length=337

 Score =   257 bits (656),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 134/160 (84%), Positives = 146/160 (91%), Gaps = 0/160 (0%)
 Frame = -2

Query  482  MAKVKIGINGFGRIGRLVARVALLSDDIELVAVNDPFITTDYMTYMFKYDTVHGQWTKNE  303
            M K+KIGINGFGRIGRLVARVAL S+D+ELVAVNDPFITT+YMTYMFKYDTVHGQW  +E
Sbjct  1    MGKIKIGINGFGRIGRLVARVALQSEDVELVAVNDPFITTEYMTYMFKYDTVHGQWKHHE  60

Query  302  LKVKDAKTLLFGDRHVAVFDKRNPEEIPWGETGAEYVVESTGVFTDQDkaaahlkggakK  123
            +KVKD+KTL+FG + VAVF  RNPEEIPW   GAEYVVESTGVFTD+DKAAAHLKGGAKK
Sbjct  61   VKVKDSKTLIFGTKEVAVFGCRNPEEIPWAAAGAEYVVESTGVFTDKDKAAAHLKGGAKK  120

Query  122  VVISAPSKDAPMFVMGVNHLEYKKDVDIVSNASCTTNCLA  3
            VVISAPSKDAPMFV+GVN  EYK DV+IVSNASCTTNCLA
Sbjct  121  VVISAPSKDAPMFVVGVNEKEYKSDVNIVSNASCTTNCLA  160



>gb|KDO36888.1| hypothetical protein CISIN_1g024629mg [Citrus sinensis]
Length=265

 Score =   254 bits (650),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 134/160 (84%), Positives = 145/160 (91%), Gaps = 0/160 (0%)
 Frame = -2

Query  482  MAKVKIGINGFGRIGRLVARVALLSDDIELVAVNDPFITTDYMTYMFKYDTVHGQWTKNE  303
            M KVKIGINGFGRIGRLVARV L  DD+ELVAVNDPFITTDYMTYMFKYD+VHGQW  +E
Sbjct  1    MGKVKIGINGFGRIGRLVARVILQRDDVELVAVNDPFITTDYMTYMFKYDSVHGQWKHHE  60

Query  302  LKVKDAKTLLFGDRHVAVFDKRNPEEIPWGETGAEYVVESTGVFTDQDkaaahlkggakK  123
            LKVKD KTLLFG++ V VF  RNPEEIPW ETGAEYVVESTGVFTD+DKAAAHLKGGAKK
Sbjct  61   LKVKDDKTLLFGEKPVTVFGVRNPEEIPWAETGAEYVVESTGVFTDKDKAAAHLKGGAKK  120

Query  122  VVISAPSKDAPMFVMGVNHLEYKKDVDIVSNASCTTNCLA  3
            V+ISAPSKDAPMFV+GVN  EYK +++IVSNASCTTNCLA
Sbjct  121  VIISAPSKDAPMFVVGVNENEYKPELNIVSNASCTTNCLA  160



>gb|KDO36891.1| hypothetical protein CISIN_1g024629mg [Citrus sinensis]
Length=227

 Score =   253 bits (646),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 134/160 (84%), Positives = 145/160 (91%), Gaps = 0/160 (0%)
 Frame = -2

Query  482  MAKVKIGINGFGRIGRLVARVALLSDDIELVAVNDPFITTDYMTYMFKYDTVHGQWTKNE  303
            M KVKIGINGFGRIGRLVARV L  DD+ELVAVNDPFITTDYMTYMFKYD+VHGQW  +E
Sbjct  1    MGKVKIGINGFGRIGRLVARVILQRDDVELVAVNDPFITTDYMTYMFKYDSVHGQWKHHE  60

Query  302  LKVKDAKTLLFGDRHVAVFDKRNPEEIPWGETGAEYVVESTGVFTDQDkaaahlkggakK  123
            LKVKD KTLLFG++ V VF  RNPEEIPW ETGAEYVVESTGVFTD+DKAAAHLKGGAKK
Sbjct  61   LKVKDDKTLLFGEKPVTVFGVRNPEEIPWAETGAEYVVESTGVFTDKDKAAAHLKGGAKK  120

Query  122  VVISAPSKDAPMFVMGVNHLEYKKDVDIVSNASCTTNCLA  3
            V+ISAPSKDAPMFV+GVN  EYK +++IVSNASCTTNCLA
Sbjct  121  VIISAPSKDAPMFVVGVNENEYKPELNIVSNASCTTNCLA  160



>ref|XP_007222473.1| hypothetical protein PRUPE_ppa008227mg [Prunus persica]
 gb|EMJ23672.1| hypothetical protein PRUPE_ppa008227mg [Prunus persica]
Length=268

 Score =   254 bits (650),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 131/158 (83%), Positives = 145/158 (92%), Gaps = 0/158 (0%)
 Frame = -2

Query  476  KVKIGINGFGRIGRLVARVALLSDDIELVAVNDPFITTDYMTYMFKYDTVHGQWTKNELK  297
            K+KIGINGFGRIGRLVARVAL  DD+ELVAVNDPFITTDYMTYMFKYDTVHG W  +ELK
Sbjct  6    KIKIGINGFGRIGRLVARVALQRDDVELVAVNDPFITTDYMTYMFKYDTVHGPWKHHELK  65

Query  296  VKDAKTLLFGDRHVAVFDKRNPEEIPWGETGAEYVVESTGVFTDQDkaaahlkggakKVV  117
            VKD+KTLLFG++ VAVF  RNPEEIPWGE GA+++VESTGVFTD+DKAA HLKGGAKKV+
Sbjct  66   VKDSKTLLFGEKPVAVFGIRNPEEIPWGEAGADFIVESTGVFTDKDKAAFHLKGGAKKVI  125

Query  116  ISAPSKDAPMFVMGVNHLEYKKDVDIVSNASCTTNCLA  3
            ISAPSKDAPMFV+GVN  EYK D+DI+SNASCTTNCLA
Sbjct  126  ISAPSKDAPMFVVGVNEKEYKPDIDILSNASCTTNCLA  163



>ref|XP_011073006.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase, cytosolic-like 
[Sesamum indicum]
Length=337

 Score =   256 bits (655),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 134/160 (84%), Positives = 146/160 (91%), Gaps = 0/160 (0%)
 Frame = -2

Query  482  MAKVKIGINGFGRIGRLVARVALLSDDIELVAVNDPFITTDYMTYMFKYDTVHGQWTKNE  303
            MAK+KIGINGFGRIGRLVARVAL  DD+ELVAVNDPFI+ DYMTYMFKYD+VHGQW  +E
Sbjct  1    MAKIKIGINGFGRIGRLVARVALQRDDVELVAVNDPFISVDYMTYMFKYDSVHGQWKHHE  60

Query  302  LKVKDAKTLLFGDRHVAVFDKRNPEEIPWGETGAEYVVESTGVFTDQDkaaahlkggakK  123
            LKVKD KTLLFG++ VAVF  RNPEEIPWGETGAEY+VESTGVFTD+DKAAAHLKGGAKK
Sbjct  61   LKVKDEKTLLFGEKPVAVFGYRNPEEIPWGETGAEYIVESTGVFTDKDKAAAHLKGGAKK  120

Query  122  VVISAPSKDAPMFVMGVNHLEYKKDVDIVSNASCTTNCLA  3
            VVISAPSKDAPMFV+GVN   Y  D++IVSNASCTTNCLA
Sbjct  121  VVISAPSKDAPMFVVGVNEKTYTPDLNIVSNASCTTNCLA  160



>ref|XP_007031743.1| Glyceraldehyde-3-phosphate dehydrogenase C2 isoform 1 [Theobroma 
cacao]
 gb|EOY02669.1| Glyceraldehyde-3-phosphate dehydrogenase C2 isoform 1 [Theobroma 
cacao]
Length=327

 Score =   256 bits (654),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 134/160 (84%), Positives = 147/160 (92%), Gaps = 0/160 (0%)
 Frame = -2

Query  482  MAKVKIGINGFGRIGRLVARVALLSDDIELVAVNDPFITTDYMTYMFKYDTVHGQWTKNE  303
            MAK+KIGINGFGRIGRLVARVAL SDDIELVAVNDPFI+ +YM YMFKYD+VHGQW  +E
Sbjct  1    MAKIKIGINGFGRIGRLVARVALQSDDIELVAVNDPFISIEYMIYMFKYDSVHGQWKNHE  60

Query  302  LKVKDAKTLLFGDRHVAVFDKRNPEEIPWGETGAEYVVESTGVFTDQDkaaahlkggakK  123
            LKVKD+KTLLFG++ V VF  RNPEEIPWGE+GAEYVVESTGVFTD+DKAAAHLKGGAKK
Sbjct  61   LKVKDSKTLLFGEKPVTVFGIRNPEEIPWGESGAEYVVESTGVFTDKDKAAAHLKGGAKK  120

Query  122  VVISAPSKDAPMFVMGVNHLEYKKDVDIVSNASCTTNCLA  3
            V+ISAPSKDAPMFV+GVN  EYK  +DIVSNASCTTNCLA
Sbjct  121  VIISAPSKDAPMFVVGVNEKEYKPHLDIVSNASCTTNCLA  160



>ref|XP_010248871.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase, cytosolic 
[Nelumbo nucifera]
Length=337

 Score =   256 bits (655),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 134/160 (84%), Positives = 145/160 (91%), Gaps = 0/160 (0%)
 Frame = -2

Query  482  MAKVKIGINGFGRIGRLVARVALLSDDIELVAVNDPFITTDYMTYMFKYDTVHGQWTKNE  303
            M KVKIGINGFGRIGRLVARVAL  DD+ELVAVNDPFITTDYMTYMFKYD+VHG W   +
Sbjct  1    MGKVKIGINGFGRIGRLVARVALQRDDVELVAVNDPFITTDYMTYMFKYDSVHGHWKHTD  60

Query  302  LKVKDAKTLLFGDRHVAVFDKRNPEEIPWGETGAEYVVESTGVFTDQDkaaahlkggakK  123
            +KVKD+KTLLFG++ V VF  RNPEEIPWGETGAE+VVESTGVFTD+DKAAAHLKGGAKK
Sbjct  61   VKVKDSKTLLFGEKPVTVFGVRNPEEIPWGETGAEFVVESTGVFTDKDKAAAHLKGGAKK  120

Query  122  VVISAPSKDAPMFVMGVNHLEYKKDVDIVSNASCTTNCLA  3
            VVISAPSKDAPMFV+GVN  EYK D+ IVSNASCTTNCLA
Sbjct  121  VVISAPSKDAPMFVVGVNEKEYKSDISIVSNASCTTNCLA  160



>gb|KDO36873.1| hypothetical protein CISIN_1g024565mg [Citrus sinensis]
Length=265

 Score =   254 bits (649),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 134/160 (84%), Positives = 145/160 (91%), Gaps = 0/160 (0%)
 Frame = -2

Query  482  MAKVKIGINGFGRIGRLVARVALLSDDIELVAVNDPFITTDYMTYMFKYDTVHGQWTKNE  303
            M KVKIGINGFGRIGRLVARV L  DD+ELVAVNDPFITTDYMTYMFKYD+VHGQW  +E
Sbjct  1    MGKVKIGINGFGRIGRLVARVILQRDDVELVAVNDPFITTDYMTYMFKYDSVHGQWKHHE  60

Query  302  LKVKDAKTLLFGDRHVAVFDKRNPEEIPWGETGAEYVVESTGVFTDQDkaaahlkggakK  123
            LKVKD KTLLFG++ V VF  RNPEEIPW ETGAEYVVESTGVFTD+DKAAAHLKGGAKK
Sbjct  61   LKVKDDKTLLFGEKPVTVFGVRNPEEIPWAETGAEYVVESTGVFTDKDKAAAHLKGGAKK  120

Query  122  VVISAPSKDAPMFVMGVNHLEYKKDVDIVSNASCTTNCLA  3
            V+ISAPSKDAPMFV+GVN  EYK +++IVSNASCTTNCLA
Sbjct  121  VIISAPSKDAPMFVVGVNEHEYKPELNIVSNASCTTNCLA  160



>gb|KDO36892.1| hypothetical protein CISIN_1g024629mg [Citrus sinensis]
Length=252

 Score =   254 bits (648),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 134/160 (84%), Positives = 145/160 (91%), Gaps = 0/160 (0%)
 Frame = -2

Query  482  MAKVKIGINGFGRIGRLVARVALLSDDIELVAVNDPFITTDYMTYMFKYDTVHGQWTKNE  303
            M KVKIGINGFGRIGRLVARV L  DD+ELVAVNDPFITTDYMTYMFKYD+VHGQW  +E
Sbjct  1    MGKVKIGINGFGRIGRLVARVILQRDDVELVAVNDPFITTDYMTYMFKYDSVHGQWKHHE  60

Query  302  LKVKDAKTLLFGDRHVAVFDKRNPEEIPWGETGAEYVVESTGVFTDQDkaaahlkggakK  123
            LKVKD KTLLFG++ V VF  RNPEEIPW ETGAEYVVESTGVFTD+DKAAAHLKGGAKK
Sbjct  61   LKVKDDKTLLFGEKPVTVFGVRNPEEIPWAETGAEYVVESTGVFTDKDKAAAHLKGGAKK  120

Query  122  VVISAPSKDAPMFVMGVNHLEYKKDVDIVSNASCTTNCLA  3
            V+ISAPSKDAPMFV+GVN  EYK +++IVSNASCTTNCLA
Sbjct  121  VIISAPSKDAPMFVVGVNENEYKPELNIVSNASCTTNCLA  160



>ref|XP_004241503.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase, cytosolic 
[Solanum lycopersicum]
Length=337

 Score =   256 bits (655),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 133/160 (83%), Positives = 144/160 (90%), Gaps = 0/160 (0%)
 Frame = -2

Query  482  MAKVKIGINGFGRIGRLVARVALLSDDIELVAVNDPFITTDYMTYMFKYDTVHGQWTKNE  303
            M K+KIGINGFGRIGRLVARVAL  DD+ELVAVNDPFIT +YMTYMFKYD+VHGQW  NE
Sbjct  1    MGKIKIGINGFGRIGRLVARVALQRDDVELVAVNDPFITVEYMTYMFKYDSVHGQWKNNE  60

Query  302  LKVKDAKTLLFGDRHVAVFDKRNPEEIPWGETGAEYVVESTGVFTDQDkaaahlkggakK  123
            LKVKD KTLLFG++ V VF  RNPEEIPW E GAEY+VESTGVFTD+DKAAAHLKGGAKK
Sbjct  61   LKVKDEKTLLFGEKPVTVFGIRNPEEIPWAEAGAEYIVESTGVFTDKDKAAAHLKGGAKK  120

Query  122  VVISAPSKDAPMFVMGVNHLEYKKDVDIVSNASCTTNCLA  3
            VVISAPSKDAPMFV+GVN  EYK D++IVSNASCTTNCLA
Sbjct  121  VVISAPSKDAPMFVVGVNEKEYKPDLNIVSNASCTTNCLA  160



>ref|XP_007031744.1| Glyceraldehyde-3-phosphate dehydrogenase C2 isoform 2 [Theobroma 
cacao]
 gb|EOY02670.1| Glyceraldehyde-3-phosphate dehydrogenase C2 isoform 2 [Theobroma 
cacao]
Length=337

 Score =   256 bits (654),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 134/160 (84%), Positives = 147/160 (92%), Gaps = 0/160 (0%)
 Frame = -2

Query  482  MAKVKIGINGFGRIGRLVARVALLSDDIELVAVNDPFITTDYMTYMFKYDTVHGQWTKNE  303
            MAK+KIGINGFGRIGRLVARVAL SDDIELVAVNDPFI+ +YM YMFKYD+VHGQW  +E
Sbjct  1    MAKIKIGINGFGRIGRLVARVALQSDDIELVAVNDPFISIEYMIYMFKYDSVHGQWKNHE  60

Query  302  LKVKDAKTLLFGDRHVAVFDKRNPEEIPWGETGAEYVVESTGVFTDQDkaaahlkggakK  123
            LKVKD+KTLLFG++ V VF  RNPEEIPWGE+GAEYVVESTGVFTD+DKAAAHLKGGAKK
Sbjct  61   LKVKDSKTLLFGEKPVTVFGIRNPEEIPWGESGAEYVVESTGVFTDKDKAAAHLKGGAKK  120

Query  122  VVISAPSKDAPMFVMGVNHLEYKKDVDIVSNASCTTNCLA  3
            V+ISAPSKDAPMFV+GVN  EYK  +DIVSNASCTTNCLA
Sbjct  121  VIISAPSKDAPMFVVGVNEKEYKPHLDIVSNASCTTNCLA  160



>ref|XP_010554090.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase 1, cytosolic 
[Tarenaya hassleriana]
Length=337

 Score =   256 bits (654),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 131/160 (82%), Positives = 147/160 (92%), Gaps = 0/160 (0%)
 Frame = -2

Query  482  MAKVKIGINGFGRIGRLVARVALLSDDIELVAVNDPFITTDYMTYMFKYDTVHGQWTKNE  303
            MAK+KIGINGFGRIGRLVARVAL SDD+ELVAVNDPFITT+YMTYMFKYD+VHG W  +E
Sbjct  1    MAKIKIGINGFGRIGRLVARVALQSDDVELVAVNDPFITTEYMTYMFKYDSVHGHWKHHE  60

Query  302  LKVKDAKTLLFGDRHVAVFDKRNPEEIPWGETGAEYVVESTGVFTDQDkaaahlkggakK  123
            +KVKD+KTLLFG++ V VF  RNPEEIPWGE GAE+VVESTGVFTD+DKAAAH+KGGAKK
Sbjct  61   VKVKDSKTLLFGEKPVTVFGSRNPEEIPWGEAGAEFVVESTGVFTDKDKAAAHIKGGAKK  120

Query  122  VVISAPSKDAPMFVMGVNHLEYKKDVDIVSNASCTTNCLA  3
            V+ISAPSKDAPMFV+GVN  EY  D++IVSNASCTTNCLA
Sbjct  121  VIISAPSKDAPMFVVGVNEKEYTSDLNIVSNASCTTNCLA  160



>gb|ABK96222.1| unknown [Populus trichocarpa x Populus deltoides]
Length=338

 Score =   256 bits (654),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 133/160 (83%), Positives = 145/160 (91%), Gaps = 0/160 (0%)
 Frame = -2

Query  482  MAKVKIGINGFGRIGRLVARVALLSDDIELVAVNDPFITTDYMTYMFKYDTVHGQWTKNE  303
            M K+KIGINGFGRIGRLVARVAL  DD+ELVAVNDPFITT+YMTYMFKYDTVHG W  +E
Sbjct  1    MGKIKIGINGFGRIGRLVARVALQRDDVELVAVNDPFITTEYMTYMFKYDTVHGPWKHHE  60

Query  302  LKVKDAKTLLFGDRHVAVFDKRNPEEIPWGETGAEYVVESTGVFTDQDkaaahlkggakK  123
            LKVKD+KTLLFG+R V VF  RNPEEIPWGETGAEY+VESTGVFTD++KAAAHLKGGAKK
Sbjct  61   LKVKDSKTLLFGERPVTVFGSRNPEEIPWGETGAEYIVESTGVFTDKEKAAAHLKGGAKK  120

Query  122  VVISAPSKDAPMFVMGVNHLEYKKDVDIVSNASCTTNCLA  3
            V+ISAPSKDAPMFVMGVN   Y  D++IVSNASCTTNCLA
Sbjct  121  VIISAPSKDAPMFVMGVNEKSYTPDLNIVSNASCTTNCLA  160



>ref|XP_002263145.2| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase, cytosolic 
[Vitis vinifera]
Length=337

 Score =   256 bits (654),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 134/160 (84%), Positives = 146/160 (91%), Gaps = 0/160 (0%)
 Frame = -2

Query  482  MAKVKIGINGFGRIGRLVARVALLSDDIELVAVNDPFITTDYMTYMFKYDTVHGQWTKNE  303
            M K+KIGINGFGRIGRLVARVAL  DD+ELVAVNDPFITTDYMTYMFKYD+VHGQW  +E
Sbjct  1    MGKIKIGINGFGRIGRLVARVALQRDDVELVAVNDPFITTDYMTYMFKYDSVHGQWKHHE  60

Query  302  LKVKDAKTLLFGDRHVAVFDKRNPEEIPWGETGAEYVVESTGVFTDQDkaaahlkggakK  123
            LKVKD+ TLLFG++ V VF  RNPEEIPWGETGAE+VVESTGVFTD+DKAAAHLKGGAKK
Sbjct  61   LKVKDSNTLLFGEKPVTVFGIRNPEEIPWGETGAEFVVESTGVFTDKDKAAAHLKGGAKK  120

Query  122  VVISAPSKDAPMFVMGVNHLEYKKDVDIVSNASCTTNCLA  3
            VVISAPSKDAPMFV+GVN  EYK ++ IVSNASCTTNCLA
Sbjct  121  VVISAPSKDAPMFVVGVNEKEYKPELHIVSNASCTTNCLA  160



>ref|XP_006347401.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase, cytosolic-like 
[Solanum tuberosum]
Length=337

 Score =   256 bits (653),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 132/160 (83%), Positives = 144/160 (90%), Gaps = 0/160 (0%)
 Frame = -2

Query  482  MAKVKIGINGFGRIGRLVARVALLSDDIELVAVNDPFITTDYMTYMFKYDTVHGQWTKNE  303
            M K+KIGINGFGRIGRLVARVAL  DD+ELVAVNDPFIT +YMTYMFKYD+VHGQW  NE
Sbjct  1    MGKIKIGINGFGRIGRLVARVALQRDDVELVAVNDPFITVEYMTYMFKYDSVHGQWKNNE  60

Query  302  LKVKDAKTLLFGDRHVAVFDKRNPEEIPWGETGAEYVVESTGVFTDQDkaaahlkggakK  123
            LKVKD KTLLFG++ V VF  RNPEEIPW E GAEY+VESTGVFTD+DKAAAHLKGGAKK
Sbjct  61   LKVKDEKTLLFGEKPVTVFGIRNPEEIPWAEAGAEYIVESTGVFTDKDKAAAHLKGGAKK  120

Query  122  VVISAPSKDAPMFVMGVNHLEYKKDVDIVSNASCTTNCLA  3
            VVISAPSKDAPMFV+GVN  EYK D+++VSNASCTTNCLA
Sbjct  121  VVISAPSKDAPMFVVGVNEKEYKPDLNVVSNASCTTNCLA  160



>ref|XP_002321679.1| glyceraldehyde-3-phosphate dehydrogenase family protein [Populus 
trichocarpa]
 gb|ABK95309.1| unknown [Populus trichocarpa]
 gb|ABK96371.1| unknown [Populus trichocarpa x Populus deltoides]
 gb|EEF05806.1| glyceraldehyde-3-phosphate dehydrogenase family protein [Populus 
trichocarpa]
Length=338

 Score =   256 bits (653),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 132/160 (83%), Positives = 145/160 (91%), Gaps = 0/160 (0%)
 Frame = -2

Query  482  MAKVKIGINGFGRIGRLVARVALLSDDIELVAVNDPFITTDYMTYMFKYDTVHGQWTKNE  303
            M K+KIGINGFGRIGRLVARVAL  DD+ELVAVNDPFITT+YMTYMFKYDTVHG W  +E
Sbjct  1    MGKIKIGINGFGRIGRLVARVALQRDDVELVAVNDPFITTEYMTYMFKYDTVHGPWKHHE  60

Query  302  LKVKDAKTLLFGDRHVAVFDKRNPEEIPWGETGAEYVVESTGVFTDQDkaaahlkggakK  123
            LKVKD+KTLLFG+R V VF  RNPEEIPWGETGAEY+VESTGVFTD++KAAAHLKGGAKK
Sbjct  61   LKVKDSKTLLFGERPVTVFGSRNPEEIPWGETGAEYIVESTGVFTDKEKAAAHLKGGAKK  120

Query  122  VVISAPSKDAPMFVMGVNHLEYKKDVDIVSNASCTTNCLA  3
            V+ISAPSKDAPMFVMGVN   Y  D++I+SNASCTTNCLA
Sbjct  121  VIISAPSKDAPMFVMGVNEKSYTPDLNIISNASCTTNCLA  160



>gb|AFK93851.1| glyceraldehyde 3-phosphate dehydrogenase, partial [Cymbidium 
goeringii]
Length=291

 Score =   254 bits (649),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 132/156 (85%), Positives = 145/156 (93%), Gaps = 0/156 (0%)
 Frame = -2

Query  470  KIGINGFGRIGRLVARVALLSDDIELVAVNDPFITTDYMTYMFKYDTVHGQWTKNELKVK  291
            KIGINGFGRIGRLVARVA LS+D+ELVAVNDPFITT+YMTYMFKYDTVHGQW  +E+ VK
Sbjct  1    KIGINGFGRIGRLVARVAHLSEDVELVAVNDPFITTEYMTYMFKYDTVHGQWKHHEITVK  60

Query  290  DAKTLLFGDRHVAVFDKRNPEEIPWGETGAEYVVESTGVFTDQDkaaahlkggakKVVIS  111
            D+KTLLFG++ VAVF  RNPEEIPWGE GA+YVVESTGVFTD+DKAAAHLKGGAKKV+IS
Sbjct  61   DSKTLLFGEKPVAVFGTRNPEEIPWGEAGADYVVESTGVFTDKDKAAAHLKGGAKKVIIS  120

Query  110  APSKDAPMFVMGVNHLEYKKDVDIVSNASCTTNCLA  3
            APSKDAPMFV+GVN  EYK D+DIVSNASCTTNCLA
Sbjct  121  APSKDAPMFVVGVNEHEYKDDIDIVSNASCTTNCLA  156



>emb|CBX89319.1| cytosolic glyceraldehyde 3-phosphate dehydrogenase [Rosa canina]
Length=263

 Score =   253 bits (646),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 135/159 (85%), Positives = 143/159 (90%), Gaps = 0/159 (0%)
 Frame = -2

Query  479  AKVKIGINGFGRIGRLVARVALLSDDIELVAVNDPFITTDYMTYMFKYDTVHGQWTKNEL  300
            AK+KIGINGFGRIGRLVARVAL  DD+ELVAVNDPFITTDYMTYMFKYDTVHG W  NEL
Sbjct  1    AKIKIGINGFGRIGRLVARVALQRDDVELVAVNDPFITTDYMTYMFKYDTVHGAWKHNEL  60

Query  299  KVKDAKTLLFGDRHVAVFDKRNPEEIPWGETGAEYVVESTGVFTDQDkaaahlkggakKV  120
            KVKD KTLLFG++ VAVF  RNPEEIPWG  GA+ VVESTGVFTD+DKAAAHLKGGAKKV
Sbjct  61   KVKDEKTLLFGEKPVAVFGLRNPEEIPWGSVGADIVVESTGVFTDKDKAAAHLKGGAKKV  120

Query  119  VISAPSKDAPMFVMGVNHLEYKKDVDIVSNASCTTNCLA  3
            VISAPSKDAPMFV+GVN  EYK D+ IVSNASCTTNCLA
Sbjct  121  VISAPSKDAPMFVVGVNEHEYKSDLCIVSNASCTTNCLA  159



>gb|ABC47829.1| glyceraldehyde-3-phosphate dehydrogenase [Lilium longiflorum]
Length=325

 Score =   255 bits (652),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 132/154 (86%), Positives = 143/154 (93%), Gaps = 0/154 (0%)
 Frame = -2

Query  464  GINGFGRIGRLVARVALLSDDIELVAVNDPFITTDYMTYMFKYDTVHGQWTKNELKVKDA  285
            GINGFGRIGRLVARVAL SDDIELVAVNDPFITTDYMTYMFKYDTVHGQW  +E+KVKD+
Sbjct  1    GINGFGRIGRLVARVALQSDDIELVAVNDPFITTDYMTYMFKYDTVHGQWKHHEIKVKDS  60

Query  284  KTLLFGDRHVAVFDKRNPEEIPWGETGAEYVVESTGVFTDQDkaaahlkggakKVVISAP  105
            KTLLFG++ V +F  RNPEEIPWGE GA++VVESTGVFTD+DKAAAHLKGGAKKV+ISAP
Sbjct  61   KTLLFGEKPVTIFGVRNPEEIPWGEAGADFVVESTGVFTDKDKAAAHLKGGAKKVIISAP  120

Query  104  SKDAPMFVMGVNHLEYKKDVDIVSNASCTTNCLA  3
            SKDAPMFVMGVNH EYK D+ IVSNASCTTNCLA
Sbjct  121  SKDAPMFVMGVNHTEYKSDIHIVSNASCTTNCLA  154



>dbj|BAJ90709.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=337

 Score =   256 bits (653),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 133/160 (83%), Positives = 144/160 (90%), Gaps = 0/160 (0%)
 Frame = -2

Query  482  MAKVKIGINGFGRIGRLVARVALLSDDIELVAVNDPFITTDYMTYMFKYDTVHGQWTKNE  303
            MA +KIGINGFGRIGRLVARVAL   D+ELVAVNDPFITTDYMTYMFKYDTVHGQW  +E
Sbjct  1    MAPIKIGINGFGRIGRLVARVALQCPDVELVAVNDPFITTDYMTYMFKYDTVHGQWKHHE  60

Query  302  LKVKDAKTLLFGDRHVAVFDKRNPEEIPWGETGAEYVVESTGVFTDQDkaaahlkggakK  123
            +KVKD+KTLLFG++ VAVF  RNPEEIPW   GAEYVVESTGVFTD+DKAAAH+KGGAKK
Sbjct  61   VKVKDSKTLLFGEKEVAVFGCRNPEEIPWAAAGAEYVVESTGVFTDKDKAAAHIKGGAKK  120

Query  122  VVISAPSKDAPMFVMGVNHLEYKKDVDIVSNASCTTNCLA  3
            V+ISAPSKDAPMFV GVN  EYK D+DIVSNASCTTNCLA
Sbjct  121  VIISAPSKDAPMFVCGVNEKEYKSDIDIVSNASCTTNCLA  160



>ref|XP_006484037.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPC1, cytosolic 
[Citrus sinensis]
Length=341

 Score =   256 bits (653),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 134/158 (85%), Positives = 145/158 (92%), Gaps = 0/158 (0%)
 Frame = -2

Query  476  KVKIGINGFGRIGRLVARVALLSDDIELVAVNDPFITTDYMTYMFKYDTVHGQWTKNELK  297
            K+KIGINGFGRIGRLVARV L  DD+ELVAVNDPFI+TDYMTYMFKYD+VHGQW  NELK
Sbjct  6    KIKIGINGFGRIGRLVARVVLQRDDVELVAVNDPFISTDYMTYMFKYDSVHGQWKHNELK  65

Query  296  VKDAKTLLFGDRHVAVFDKRNPEEIPWGETGAEYVVESTGVFTDQDkaaahlkggakKVV  117
            VKD KTLLFG++ VAVF  RNPEEIPW +TGAEYVVESTGVFTD+DKAAAHLKGGAKKVV
Sbjct  66   VKDEKTLLFGEKPVAVFGFRNPEEIPWAKTGAEYVVESTGVFTDKDKAAAHLKGGAKKVV  125

Query  116  ISAPSKDAPMFVMGVNHLEYKKDVDIVSNASCTTNCLA  3
            ISAPSKDAPMFV+GVN  EYK ++DIVSNASCTTNCLA
Sbjct  126  ISAPSKDAPMFVVGVNEKEYKPELDIVSNASCTTNCLA  163



>emb|CBX89318.1| cytosolic glyceraldehyde 3-phosphate dehydrogenase [Rosa canina]
Length=263

 Score =   253 bits (646),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 135/159 (85%), Positives = 143/159 (90%), Gaps = 0/159 (0%)
 Frame = -2

Query  479  AKVKIGINGFGRIGRLVARVALLSDDIELVAVNDPFITTDYMTYMFKYDTVHGQWTKNEL  300
            AK+KIGINGFGRIGRLVARVAL  DD+ELVAVNDPFITTDYMTYMFKYDTVHG W  NEL
Sbjct  1    AKIKIGINGFGRIGRLVARVALQRDDVELVAVNDPFITTDYMTYMFKYDTVHGAWKHNEL  60

Query  299  KVKDAKTLLFGDRHVAVFDKRNPEEIPWGETGAEYVVESTGVFTDQDkaaahlkggakKV  120
            KVKD KTLLFG++ VAVF  RNPEEIPWG  GA+ VVESTGVFTD+DKAAAHLKGGAKKV
Sbjct  61   KVKDEKTLLFGEKPVAVFGLRNPEEIPWGSVGADIVVESTGVFTDKDKAAAHLKGGAKKV  120

Query  119  VISAPSKDAPMFVMGVNHLEYKKDVDIVSNASCTTNCLA  3
            VISAPSKDAPMFV+GVN  EYK D+ IVSNASCTTNCLA
Sbjct  121  VISAPSKDAPMFVVGVNEHEYKSDLCIVSNASCTTNCLA  159



>ref|XP_010458793.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPC2, cytosolic-like 
[Camelina sativa]
Length=336

 Score =   255 bits (652),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 134/160 (84%), Positives = 146/160 (91%), Gaps = 0/160 (0%)
 Frame = -2

Query  482  MAKVKIGINGFGRIGRLVARVALLSDDIELVAVNDPFITTDYMTYMFKYDTVHGQWTKNE  303
            MAK+KIGINGFGRIGRLVARV L  DD+ELVAVNDPFITT+YMTYMFKYD+VHGQW  +E
Sbjct  1    MAKIKIGINGFGRIGRLVARVVLQRDDVELVAVNDPFITTEYMTYMFKYDSVHGQWKHHE  60

Query  302  LKVKDAKTLLFGDRHVAVFDKRNPEEIPWGETGAEYVVESTGVFTDQDkaaahlkggakK  123
            LKVKD KTLLFG++ V VF  RNPEEIPWGE GA++VVESTGVFTD+DKAAAHLKGGAKK
Sbjct  61   LKVKDDKTLLFGEKPVTVFGIRNPEEIPWGEAGADFVVESTGVFTDKDKAAAHLKGGAKK  120

Query  122  VVISAPSKDAPMFVMGVNHLEYKKDVDIVSNASCTTNCLA  3
            VVISAPSKDAPMFV+GVN  EYK D+DIVSNASCTTNCLA
Sbjct  121  VVISAPSKDAPMFVVGVNEHEYKSDLDIVSNASCTTNCLA  160



>gb|EMS68847.1| Glyceraldehyde-3-phosphate dehydrogenase, cytosolic 3 [Triticum 
urartu]
Length=380

 Score =   257 bits (656),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 134/160 (84%), Positives = 144/160 (90%), Gaps = 0/160 (0%)
 Frame = -2

Query  482  MAKVKIGINGFGRIGRLVARVALLSDDIELVAVNDPFITTDYMTYMFKYDTVHGQWTKNE  303
            MA +KIGINGFGRIGRLVARVAL S D+ELVAVNDPFITTDYMTYMFKYDTVHGQW  +E
Sbjct  1    MAPIKIGINGFGRIGRLVARVALQSPDVELVAVNDPFITTDYMTYMFKYDTVHGQWKHHE  60

Query  302  LKVKDAKTLLFGDRHVAVFDKRNPEEIPWGETGAEYVVESTGVFTDQDkaaahlkggakK  123
            +KVKD+KTLLFG + VAVF  RNPEEIPW   GAEYVVESTGVFTD+DKAAAH+KGGAKK
Sbjct  61   VKVKDSKTLLFGQKEVAVFGCRNPEEIPWAAAGAEYVVESTGVFTDKDKAAAHIKGGAKK  120

Query  122  VVISAPSKDAPMFVMGVNHLEYKKDVDIVSNASCTTNCLA  3
            V+ISAPSKDAPMFV GVN  EYK D+DIVSNASCTTNCLA
Sbjct  121  VIISAPSKDAPMFVCGVNEKEYKSDIDIVSNASCTTNCLA  160



>ref|XP_002270414.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase, cytosolic 
[Vitis vinifera]
Length=339

 Score =   255 bits (652),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 132/158 (84%), Positives = 146/158 (92%), Gaps = 0/158 (0%)
 Frame = -2

Query  476  KVKIGINGFGRIGRLVARVALLSDDIELVAVNDPFITTDYMTYMFKYDTVHGQWTKNELK  297
            K+KIGINGFGRIGRLVARVAL S+D+ELVAVNDPFITTDYMTYMFKYD+VHG W  +++K
Sbjct  6    KIKIGINGFGRIGRLVARVALQSNDVELVAVNDPFITTDYMTYMFKYDSVHGHWKHHDVK  65

Query  296  VKDAKTLLFGDRHVAVFDKRNPEEIPWGETGAEYVVESTGVFTDQDkaaahlkggakKVV  117
            VKD+KTLLFG++ V VF  RNPEEIPW ETGA+YVVESTGVFTD+DKAAAHLKGGAKKV+
Sbjct  66   VKDSKTLLFGEKSVTVFGVRNPEEIPWAETGADYVVESTGVFTDKDKAAAHLKGGAKKVI  125

Query  116  ISAPSKDAPMFVMGVNHLEYKKDVDIVSNASCTTNCLA  3
            ISAPSKDAPMFVMGVN  EYK D+DIVSNASCTTNCLA
Sbjct  126  ISAPSKDAPMFVMGVNEKEYKPDIDIVSNASCTTNCLA  163



>gb|AFK93852.1| glyceraldehyde 3-phosphate dehydrogenase, partial [Cymbidium 
sinense]
Length=291

 Score =   254 bits (648),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 132/156 (85%), Positives = 144/156 (92%), Gaps = 0/156 (0%)
 Frame = -2

Query  470  KIGINGFGRIGRLVARVALLSDDIELVAVNDPFITTDYMTYMFKYDTVHGQWTKNELKVK  291
            K GINGFGRIGRLVARVALLS+D+ELVAVNDPFITT+YMTYMFKYDTVHGQW   E+ VK
Sbjct  1    KSGINGFGRIGRLVARVALLSEDVELVAVNDPFITTEYMTYMFKYDTVHGQWKHQEITVK  60

Query  290  DAKTLLFGDRHVAVFDKRNPEEIPWGETGAEYVVESTGVFTDQDkaaahlkggakKVVIS  111
            D+KTLLFG++ VAVF  RNPEEIPWGE GA+YVVESTGVFTD+DKAAAHLKGGAKKV+IS
Sbjct  61   DSKTLLFGEKPVAVFGIRNPEEIPWGEAGADYVVESTGVFTDKDKAAAHLKGGAKKVIIS  120

Query  110  APSKDAPMFVMGVNHLEYKKDVDIVSNASCTTNCLA  3
            APSKDAPMFV+GVN  EYK D+DIVSNASCTTNCLA
Sbjct  121  APSKDAPMFVVGVNEHEYKDDIDIVSNASCTTNCLA  156



>gb|AEN19695.1| glyceraldehyde 3-phosphate dehydrogenase [Cymbidium faberi]
Length=291

 Score =   254 bits (648),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 132/156 (85%), Positives = 145/156 (93%), Gaps = 0/156 (0%)
 Frame = -2

Query  470  KIGINGFGRIGRLVARVALLSDDIELVAVNDPFITTDYMTYMFKYDTVHGQWTKNELKVK  291
            KIGINGFGRIGRLVARVALLS+D+ELVAVNDPFITT+YMTYMFKYDTVHGQW  +E+ VK
Sbjct  1    KIGINGFGRIGRLVARVALLSEDVELVAVNDPFITTEYMTYMFKYDTVHGQWKHHEITVK  60

Query  290  DAKTLLFGDRHVAVFDKRNPEEIPWGETGAEYVVESTGVFTDQDkaaahlkggakKVVIS  111
            D+KTLLFG++ VAVF  RNPEEIPWG  GA+YVVESTGVFTD+DKAAAHLKGGAKKV+IS
Sbjct  61   DSKTLLFGEKPVAVFGIRNPEEIPWGGAGADYVVESTGVFTDKDKAAAHLKGGAKKVIIS  120

Query  110  APSKDAPMFVMGVNHLEYKKDVDIVSNASCTTNCLA  3
            APSKDAPMFV+GVN  EYK D+DIVSNASCTTNCLA
Sbjct  121  APSKDAPMFVVGVNEHEYKDDIDIVSNASCTTNCLA  156



>gb|KDO36890.1| hypothetical protein CISIN_1g024629mg [Citrus sinensis]
Length=218

 Score =   251 bits (641),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 134/160 (84%), Positives = 145/160 (91%), Gaps = 0/160 (0%)
 Frame = -2

Query  482  MAKVKIGINGFGRIGRLVARVALLSDDIELVAVNDPFITTDYMTYMFKYDTVHGQWTKNE  303
            M KVKIGINGFGRIGRLVARV L  DD+ELVAVNDPFITTDYMTYMFKYD+VHGQW  +E
Sbjct  1    MGKVKIGINGFGRIGRLVARVILQRDDVELVAVNDPFITTDYMTYMFKYDSVHGQWKHHE  60

Query  302  LKVKDAKTLLFGDRHVAVFDKRNPEEIPWGETGAEYVVESTGVFTDQDkaaahlkggakK  123
            LKVKD KTLLFG++ V VF  RNPEEIPW ETGAEYVVESTGVFTD+DKAAAHLKGGAKK
Sbjct  61   LKVKDDKTLLFGEKPVTVFGVRNPEEIPWAETGAEYVVESTGVFTDKDKAAAHLKGGAKK  120

Query  122  VVISAPSKDAPMFVMGVNHLEYKKDVDIVSNASCTTNCLA  3
            V+ISAPSKDAPMFV+GVN  EYK +++IVSNASCTTNCLA
Sbjct  121  VIISAPSKDAPMFVVGVNENEYKPELNIVSNASCTTNCLA  160



>gb|ACV69976.1| NAD-dependent glyceraldehyde 3-P dehydrogenase [Solanum chacoense]
Length=337

 Score =   255 bits (651),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 131/160 (82%), Positives = 144/160 (90%), Gaps = 0/160 (0%)
 Frame = -2

Query  482  MAKVKIGINGFGRIGRLVARVALLSDDIELVAVNDPFITTDYMTYMFKYDTVHGQWTKNE  303
            M K+KIGINGFGRIGRLVARVAL  DD+ELVAVNDPFIT +YMTYMFKYD+VHGQW  NE
Sbjct  1    MGKIKIGINGFGRIGRLVARVALQRDDVELVAVNDPFITVEYMTYMFKYDSVHGQWKNNE  60

Query  302  LKVKDAKTLLFGDRHVAVFDKRNPEEIPWGETGAEYVVESTGVFTDQDkaaahlkggakK  123
            L+VKD KTLLFG++ V VF  RNPEEIPW E GAEY+VESTGVFTD+DKAAAHLKGGAKK
Sbjct  61   LRVKDEKTLLFGEKPVTVFGIRNPEEIPWAEAGAEYIVESTGVFTDKDKAAAHLKGGAKK  120

Query  122  VVISAPSKDAPMFVMGVNHLEYKKDVDIVSNASCTTNCLA  3
            VVISAPSKDAPMFV+GVN  EYK D+++VSNASCTTNCLA
Sbjct  121  VVISAPSKDAPMFVVGVNEKEYKPDLNVVSNASCTTNCLA  160



>emb|CDX92059.1| BnaC03g33610D [Brassica napus]
Length=348

 Score =   255 bits (652),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 133/163 (82%), Positives = 146/163 (90%), Gaps = 0/163 (0%)
 Frame = -2

Query  491  FIIMAKVKIGINGFGRIGRLVARVALLSDDIELVAVNDPFITTDYMTYMFKYDTVHGQWT  312
            F+   K+KIGINGFGRIGRLVARV L  DD+ELVAVNDPFITT+YMTYMFKYD+VHGQW 
Sbjct  10   FVAGGKIKIGINGFGRIGRLVARVVLQRDDVELVAVNDPFITTEYMTYMFKYDSVHGQWK  69

Query  311  KNELKVKDAKTLLFGDRHVAVFDKRNPEEIPWGETGAEYVVESTGVFTDQDkaaahlkgg  132
             NELKVKD KTLLFG++ V VF  RNPE+IPWGE GA++VVESTGVFTD+DKAAAHLKGG
Sbjct  70   HNELKVKDEKTLLFGEKPVTVFGIRNPEDIPWGEAGADFVVESTGVFTDKDKAAAHLKGG  129

Query  131  akKVVISAPSKDAPMFVMGVNHLEYKKDVDIVSNASCTTNCLA  3
            AKKVVISAPSKDAPMFV+GVN  EYK D+DIVSNASCTTNCLA
Sbjct  130  AKKVVISAPSKDAPMFVVGVNEHEYKSDLDIVSNASCTTNCLA  172



>gb|AFK93850.1| glyceraldehyde 3-phosphate dehydrogenase, partial [Cymbidium 
goeringii]
Length=291

 Score =   253 bits (647),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 132/156 (85%), Positives = 144/156 (92%), Gaps = 0/156 (0%)
 Frame = -2

Query  470  KIGINGFGRIGRLVARVALLSDDIELVAVNDPFITTDYMTYMFKYDTVHGQWTKNELKVK  291
            KIGINGFGRIGRL ARVALLS+D+ELVAVNDPFITT+YMTYMFKYDTVHGQW  +E+ VK
Sbjct  1    KIGINGFGRIGRLGARVALLSEDVELVAVNDPFITTEYMTYMFKYDTVHGQWKHHEITVK  60

Query  290  DAKTLLFGDRHVAVFDKRNPEEIPWGETGAEYVVESTGVFTDQDkaaahlkggakKVVIS  111
            D+KTLLFG++ VAVF  RNPEEIPWGE GA+YVVESTGVFTD+DKAAAHLKGGAKKV+IS
Sbjct  61   DSKTLLFGEKPVAVFGVRNPEEIPWGEAGADYVVESTGVFTDKDKAAAHLKGGAKKVIIS  120

Query  110  APSKDAPMFVMGVNHLEYKKDVDIVSNASCTTNCLA  3
            APSKDAPMFV GVN  EYK D+DIVSNASCTTNCLA
Sbjct  121  APSKDAPMFVAGVNEHEYKDDIDIVSNASCTTNCLA  156



>ref|XP_009787576.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase, cytosolic 
[Nicotiana sylvestris]
Length=337

 Score =   255 bits (651),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 132/160 (83%), Positives = 147/160 (92%), Gaps = 0/160 (0%)
 Frame = -2

Query  482  MAKVKIGINGFGRIGRLVARVALLSDDIELVAVNDPFITTDYMTYMFKYDTVHGQWTKNE  303
            MAKVKIGINGFGRIGRLVARVAL  DD+ELVAVNDPFI+ +YMTYMFKYD+VHGQW  +E
Sbjct  1    MAKVKIGINGFGRIGRLVARVALQRDDVELVAVNDPFISVEYMTYMFKYDSVHGQWKHHE  60

Query  302  LKVKDAKTLLFGDRHVAVFDKRNPEEIPWGETGAEYVVESTGVFTDQDkaaahlkggakK  123
            LKVKD KTLLFG++ V VF  RNPEEIPWGETGA+Y+VESTGVFTD+DKAAAHLKGGAKK
Sbjct  61   LKVKDDKTLLFGEKAVTVFGFRNPEEIPWGETGADYIVESTGVFTDKDKAAAHLKGGAKK  120

Query  122  VVISAPSKDAPMFVMGVNHLEYKKDVDIVSNASCTTNCLA  3
            V+ISAPSKDAPMFV+GVN  EYK +++IVSNASCTTNCLA
Sbjct  121  VIISAPSKDAPMFVVGVNEKEYKSELNIVSNASCTTNCLA  160



>ref|XP_010682871.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase, cytosolic 
[Beta vulgaris subsp. vulgaris]
Length=340

 Score =   255 bits (651),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 130/158 (82%), Positives = 146/158 (92%), Gaps = 0/158 (0%)
 Frame = -2

Query  476  KVKIGINGFGRIGRLVARVALLSDDIELVAVNDPFITTDYMTYMFKYDTVHGQWTKNELK  297
            K+KIGINGFGRIGRLVAR+AL  DD+ELVAVNDPFI+TDYMTYMFKYDTVHGQW  +E+K
Sbjct  5    KIKIGINGFGRIGRLVARIALQRDDVELVAVNDPFISTDYMTYMFKYDTVHGQWKHHEVK  64

Query  296  VKDAKTLLFGDRHVAVFDKRNPEEIPWGETGAEYVVESTGVFTDQDkaaahlkggakKVV  117
            VKD+ TLLFG++HV VF  RNPEEIPWGE GA++VVESTGVFTD++KAAAHLKGGAKKVV
Sbjct  65   VKDSNTLLFGEKHVTVFASRNPEEIPWGEAGADFVVESTGVFTDKEKAAAHLKGGAKKVV  124

Query  116  ISAPSKDAPMFVMGVNHLEYKKDVDIVSNASCTTNCLA  3
            ISAPSKDAPMFV+GVN  EYK ++DIVSNASCTTNCLA
Sbjct  125  ISAPSKDAPMFVVGVNEKEYKPEIDIVSNASCTTNCLA  162



>emb|CBX89320.1| cytosolic glyceraldehyde 3-phosphate dehydrogenase [Rosa canina]
Length=263

 Score =   252 bits (644),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 135/159 (85%), Positives = 143/159 (90%), Gaps = 0/159 (0%)
 Frame = -2

Query  479  AKVKIGINGFGRIGRLVARVALLSDDIELVAVNDPFITTDYMTYMFKYDTVHGQWTKNEL  300
            AK+KIGINGFGRIGRLVARVAL  DD+ELVAVNDPFITTDYMTYMFKYDTVHG W  +EL
Sbjct  1    AKIKIGINGFGRIGRLVARVALQRDDVELVAVNDPFITTDYMTYMFKYDTVHGAWKHHEL  60

Query  299  KVKDAKTLLFGDRHVAVFDKRNPEEIPWGETGAEYVVESTGVFTDQDkaaahlkggakKV  120
            KVKD KTLLFG+R VAVF  RNPEEIPWG  GA+ VVESTGVFTD+DKAAAHLKGGAKKV
Sbjct  61   KVKDEKTLLFGERPVAVFGLRNPEEIPWGSVGADIVVESTGVFTDKDKAAAHLKGGAKKV  120

Query  119  VISAPSKDAPMFVMGVNHLEYKKDVDIVSNASCTTNCLA  3
            VISAPSKDAPMFV+GVN  EYK D+ IVSNASCTTNCLA
Sbjct  121  VISAPSKDAPMFVVGVNEHEYKSDLCIVSNASCTTNCLA  159



>ref|XP_009597424.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase, cytosolic 
[Nicotiana tomentosiformis]
Length=337

 Score =   255 bits (651),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 132/160 (83%), Positives = 146/160 (91%), Gaps = 0/160 (0%)
 Frame = -2

Query  482  MAKVKIGINGFGRIGRLVARVALLSDDIELVAVNDPFITTDYMTYMFKYDTVHGQWTKNE  303
            MAKVKIGINGFGRIGRLVARVAL  DD+ELVAVNDPFI+ +YMTYMFKYD+VHGQW  +E
Sbjct  1    MAKVKIGINGFGRIGRLVARVALQRDDVELVAVNDPFISVEYMTYMFKYDSVHGQWKNHE  60

Query  302  LKVKDAKTLLFGDRHVAVFDKRNPEEIPWGETGAEYVVESTGVFTDQDkaaahlkggakK  123
            LKVKD KTLLFG++ VAVF  RNPEEIPW E GAEY+VESTGVFTD+DKAAAHLKGGAKK
Sbjct  61   LKVKDDKTLLFGEKPVAVFGIRNPEEIPWAEAGAEYIVESTGVFTDKDKAAAHLKGGAKK  120

Query  122  VVISAPSKDAPMFVMGVNHLEYKKDVDIVSNASCTTNCLA  3
            V+ISAPSKDAPMFV+GVN  EYK D+++VSNASCTTNCLA
Sbjct  121  VIISAPSKDAPMFVVGVNEKEYKPDLNVVSNASCTTNCLA  160



>ref|XP_009792011.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase, cytosolic-like 
[Nicotiana sylvestris]
Length=337

 Score =   255 bits (651),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 132/160 (83%), Positives = 146/160 (91%), Gaps = 0/160 (0%)
 Frame = -2

Query  482  MAKVKIGINGFGRIGRLVARVALLSDDIELVAVNDPFITTDYMTYMFKYDTVHGQWTKNE  303
            MAKVKIGINGFGRIGRLVARVAL  DD+ELVAVNDPFI+ +YMTYMFKYD+VHGQW  +E
Sbjct  1    MAKVKIGINGFGRIGRLVARVALQRDDVELVAVNDPFISVEYMTYMFKYDSVHGQWKNHE  60

Query  302  LKVKDAKTLLFGDRHVAVFDKRNPEEIPWGETGAEYVVESTGVFTDQDkaaahlkggakK  123
            LKVKD KTLLFG++ VAVF  RNPEEIPW E GAEY+VESTGVFTD+DKAAAHLKGGAKK
Sbjct  61   LKVKDDKTLLFGEKPVAVFGIRNPEEIPWAEAGAEYIVESTGVFTDKDKAAAHLKGGAKK  120

Query  122  VVISAPSKDAPMFVMGVNHLEYKKDVDIVSNASCTTNCLA  3
            V+ISAPSKDAPMFV+GVN  EYK D+++VSNASCTTNCLA
Sbjct  121  VIISAPSKDAPMFVVGVNEKEYKPDLNVVSNASCTTNCLA  160



>emb|CDP13300.1| unnamed protein product [Coffea canephora]
Length=338

 Score =   255 bits (651),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 133/160 (83%), Positives = 146/160 (91%), Gaps = 0/160 (0%)
 Frame = -2

Query  482  MAKVKIGINGFGRIGRLVARVALLSDDIELVAVNDPFITTDYMTYMFKYDTVHGQWTKNE  303
            M KV IGINGFGRIGRLVARVAL  DD+ELVA+NDPFITTDYMTYMFKYDTVHGQW  +E
Sbjct  1    MGKVTIGINGFGRIGRLVARVALQRDDVELVAINDPFITTDYMTYMFKYDTVHGQWKHHE  60

Query  302  LKVKDAKTLLFGDRHVAVFDKRNPEEIPWGETGAEYVVESTGVFTDQDkaaahlkggakK  123
            +KVKD KTLLFG++ V VF  RNPEEIPWGETGA++VVESTGVFTD+DKAAAHLKGGAKK
Sbjct  61   VKVKDDKTLLFGEKPVKVFGLRNPEEIPWGETGADFVVESTGVFTDKDKAAAHLKGGAKK  120

Query  122  VVISAPSKDAPMFVMGVNHLEYKKDVDIVSNASCTTNCLA  3
            VVISAPSKDAPMFV+GVN  EYK D+++VSNASCTTNCLA
Sbjct  121  VVISAPSKDAPMFVVGVNEKEYKPDLNVVSNASCTTNCLA  160



>emb|CBI27549.3| unnamed protein product [Vitis vinifera]
Length=380

 Score =   256 bits (654),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 132/158 (84%), Positives = 146/158 (92%), Gaps = 0/158 (0%)
 Frame = -2

Query  476  KVKIGINGFGRIGRLVARVALLSDDIELVAVNDPFITTDYMTYMFKYDTVHGQWTKNELK  297
            K+KIGINGFGRIGRLVARVAL S+D+ELVAVNDPFITTDYMTYMFKYD+VHG W  +++K
Sbjct  47   KIKIGINGFGRIGRLVARVALQSNDVELVAVNDPFITTDYMTYMFKYDSVHGHWKHHDVK  106

Query  296  VKDAKTLLFGDRHVAVFDKRNPEEIPWGETGAEYVVESTGVFTDQDkaaahlkggakKVV  117
            VKD+KTLLFG++ V VF  RNPEEIPW ETGA+YVVESTGVFTD+DKAAAHLKGGAKKV+
Sbjct  107  VKDSKTLLFGEKSVTVFGVRNPEEIPWAETGADYVVESTGVFTDKDKAAAHLKGGAKKVI  166

Query  116  ISAPSKDAPMFVMGVNHLEYKKDVDIVSNASCTTNCLA  3
            ISAPSKDAPMFVMGVN  EYK D+DIVSNASCTTNCLA
Sbjct  167  ISAPSKDAPMFVMGVNEKEYKPDIDIVSNASCTTNCLA  204



>gb|EEC73541.1| hypothetical protein OsI_07948 [Oryza sativa Indica Group]
Length=356

 Score =   255 bits (652),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 133/159 (84%), Positives = 145/159 (91%), Gaps = 0/159 (0%)
 Frame = -2

Query  479  AKVKIGINGFGRIGRLVARVALLSDDIELVAVNDPFITTDYMTYMFKYDTVHGQWTKNEL  300
             K+KIGINGFGRIGRLVARVAL S+D+ELVAVNDPFITT+YMTYMFKYDTVHGQW  +E+
Sbjct  21   GKIKIGINGFGRIGRLVARVALQSEDVELVAVNDPFITTEYMTYMFKYDTVHGQWKHHEV  80

Query  299  KVKDAKTLLFGDRHVAVFDKRNPEEIPWGETGAEYVVESTGVFTDQDkaaahlkggakKV  120
            KVKD+KTL+FG + VAVF  RNPEEIPW   GAEYVVESTGVFTD+DKAAAHLKGGAKKV
Sbjct  81   KVKDSKTLIFGTKEVAVFGCRNPEEIPWAAAGAEYVVESTGVFTDKDKAAAHLKGGAKKV  140

Query  119  VISAPSKDAPMFVMGVNHLEYKKDVDIVSNASCTTNCLA  3
            VISAPSKDAPMFV+GVN  EYK DV+IVSNASCTTNCLA
Sbjct  141  VISAPSKDAPMFVVGVNEKEYKSDVNIVSNASCTTNCLA  179



>sp|Q39769.1|G3PC_GINBI RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase, cytosolic 
[Ginkgo biloba]
 gb|AAA33352.1| glyceraldehyde-phosphate dehydrogenase [Ginkgo biloba]
Length=340

 Score =   255 bits (651),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 132/159 (83%), Positives = 146/159 (92%), Gaps = 0/159 (0%)
 Frame = -2

Query  479  AKVKIGINGFGRIGRLVARVALLSDDIELVAVNDPFITTDYMTYMFKYDTVHGQWTKNEL  300
             K+KIGINGFGRIGRLVARVALL DDIELVAVNDPFI+TDYMTYMFKYD+VHGQW K+E+
Sbjct  5    GKIKIGINGFGRIGRLVARVALLRDDIELVAVNDPFISTDYMTYMFKYDSVHGQWKKHEV  64

Query  299  KVKDAKTLLFGDRHVAVFDKRNPEEIPWGETGAEYVVESTGVFTDQDkaaahlkggakKV  120
            KVKD+ TLLFG++ V VF  RNPEEIPWGETG EYVVESTGVFTD++KAAAH+KGGAKKV
Sbjct  65   KVKDSNTLLFGEKAVTVFGCRNPEEIPWGETGVEYVVESTGVFTDKEKAAAHIKGGAKKV  124

Query  119  VISAPSKDAPMFVMGVNHLEYKKDVDIVSNASCTTNCLA  3
            VI+APSKDAPMFV+GVN  EYK D+ IVSNASCTTNCLA
Sbjct  125  VITAPSKDAPMFVVGVNEHEYKPDLAIVSNASCTTNCLA  163



>ref|XP_006374556.1| hypothetical protein POPTR_0015s10330g [Populus trichocarpa]
 gb|ERP52353.1| hypothetical protein POPTR_0015s10330g [Populus trichocarpa]
Length=364

 Score =   255 bits (652),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 132/160 (83%), Positives = 145/160 (91%), Gaps = 0/160 (0%)
 Frame = -2

Query  482  MAKVKIGINGFGRIGRLVARVALLSDDIELVAVNDPFITTDYMTYMFKYDTVHGQWTKNE  303
            M K+KIGINGFGRIGRLVARVAL  DD+ELVAVNDPFITT+YMTYMFKYDTVHG W  +E
Sbjct  1    MGKIKIGINGFGRIGRLVARVALQRDDVELVAVNDPFITTEYMTYMFKYDTVHGPWKHHE  60

Query  302  LKVKDAKTLLFGDRHVAVFDKRNPEEIPWGETGAEYVVESTGVFTDQDkaaahlkggakK  123
            LKVKD+KTLLFG+R V VF  RNPEEIPWGETGAEY+VESTGVFTD++KAAAHLKGGAKK
Sbjct  61   LKVKDSKTLLFGERPVTVFGSRNPEEIPWGETGAEYIVESTGVFTDKEKAAAHLKGGAKK  120

Query  122  VVISAPSKDAPMFVMGVNHLEYKKDVDIVSNASCTTNCLA  3
            V+ISAPSKDAPMFVMGVN   Y  D++I+SNASCTTNCLA
Sbjct  121  VIISAPSKDAPMFVMGVNEKSYTPDLNIISNASCTTNCLA  160



>gb|AEO45785.1| glyceraldehyde-3-phosphate dehydrogenase C [Scoparia dulcis]
Length=337

 Score =   254 bits (650),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 132/160 (83%), Positives = 146/160 (91%), Gaps = 0/160 (0%)
 Frame = -2

Query  482  MAKVKIGINGFGRIGRLVARVALLSDDIELVAVNDPFITTDYMTYMFKYDTVHGQWTKNE  303
            MAK+KIGINGFGRIGRLVARVAL  DD+ELVAVNDPFIT D MTYMFKYD+VHGQW  +E
Sbjct  1    MAKIKIGINGFGRIGRLVARVALQRDDVELVAVNDPFITVDCMTYMFKYDSVHGQWKHHE  60

Query  302  LKVKDAKTLLFGDRHVAVFDKRNPEEIPWGETGAEYVVESTGVFTDQDkaaahlkggakK  123
            LKVKD KTLLFG++ VAVF  RNPEEIPWGETGAEY+VESTGVFTD+DKAAAHLKGGAKK
Sbjct  61   LKVKDEKTLLFGEKPVAVFGIRNPEEIPWGETGAEYIVESTGVFTDEDKAAAHLKGGAKK  120

Query  122  VVISAPSKDAPMFVMGVNHLEYKKDVDIVSNASCTTNCLA  3
            V+ISAPSKDAPMFV+GVN  +Y  D++I+SNASCTTNCLA
Sbjct  121  VIISAPSKDAPMFVVGVNEKQYTPDLNIISNASCTTNCLA  160



>ref|XP_010033372.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase, cytosolic-like 
[Eucalyptus grandis]
 gb|KCW52989.1| hypothetical protein EUGRSUZ_J02288 [Eucalyptus grandis]
Length=337

 Score =   254 bits (650),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 133/160 (83%), Positives = 146/160 (91%), Gaps = 0/160 (0%)
 Frame = -2

Query  482  MAKVKIGINGFGRIGRLVARVALLSDDIELVAVNDPFITTDYMTYMFKYDTVHGQWTKNE  303
            M KVKIGINGFGRIGRLVARVAL  DD+ELVAVNDPFITTDYM YMFKYD+VHGQW  +E
Sbjct  1    MGKVKIGINGFGRIGRLVARVALQRDDVELVAVNDPFITTDYMNYMFKYDSVHGQWKHHE  60

Query  302  LKVKDAKTLLFGDRHVAVFDKRNPEEIPWGETGAEYVVESTGVFTDQDkaaahlkggakK  123
            LKV+D+ TLLFG++ VAVF  RNPEEIPWGETGAE++VESTGVFTD++KAAAHLKGGAKK
Sbjct  61   LKVQDSNTLLFGEKPVAVFGFRNPEEIPWGETGAEFIVESTGVFTDKEKAAAHLKGGAKK  120

Query  122  VVISAPSKDAPMFVMGVNHLEYKKDVDIVSNASCTTNCLA  3
            VVISAPSKDAPMFV+GVN  EY  D+DIVSNASCTTNCLA
Sbjct  121  VVISAPSKDAPMFVVGVNEKEYTPDLDIVSNASCTTNCLA  160



>gb|AID52923.1| cytosolic glyceraldehyde-3-phosphate dehydrogenase [Carthamus 
tinctorius]
Length=341

 Score =   254 bits (650),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 134/158 (85%), Positives = 145/158 (92%), Gaps = 0/158 (0%)
 Frame = -2

Query  476  KVKIGINGFGRIGRLVARVALLSDDIELVAVNDPFITTDYMTYMFKYDTVHGQWTKNELK  297
            K+KIGINGFGRIGRLVARVAL  DD+ELVAVNDPFITTDYMTYMFKYDTVHGQW  +ELK
Sbjct  6    KIKIGINGFGRIGRLVARVALQRDDVELVAVNDPFITTDYMTYMFKYDTVHGQWKHHELK  65

Query  296  VKDAKTLLFGDRHVAVFDKRNPEEIPWGETGAEYVVESTGVFTDQDkaaahlkggakKVV  117
            VKD KTLLFG++ V VF  RNPE+IPWGE GA++VVESTGVFTD+DKAAAHLKGGAKKVV
Sbjct  66   VKDEKTLLFGEKPVTVFGIRNPEDIPWGEAGADFVVESTGVFTDKDKAAAHLKGGAKKVV  125

Query  116  ISAPSKDAPMFVMGVNHLEYKKDVDIVSNASCTTNCLA  3
            ISAPSKDAPMFV+GVN  EYK D+DIVSNASCTTNCLA
Sbjct  126  ISAPSKDAPMFVVGVNEHEYKHDLDIVSNASCTTNCLA  163



>ref|XP_006440049.1| hypothetical protein CICLE_v10021037mg [Citrus clementina]
 gb|ESR53289.1| hypothetical protein CICLE_v10021037mg [Citrus clementina]
Length=337

 Score =   254 bits (649),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 134/160 (84%), Positives = 145/160 (91%), Gaps = 0/160 (0%)
 Frame = -2

Query  482  MAKVKIGINGFGRIGRLVARVALLSDDIELVAVNDPFITTDYMTYMFKYDTVHGQWTKNE  303
            M KVKIGINGFGRIGRLVARV L  DD+ELVAVNDPFITTDYMTYMFKYD+VHGQW  +E
Sbjct  1    MGKVKIGINGFGRIGRLVARVILQRDDVELVAVNDPFITTDYMTYMFKYDSVHGQWKHHE  60

Query  302  LKVKDAKTLLFGDRHVAVFDKRNPEEIPWGETGAEYVVESTGVFTDQDkaaahlkggakK  123
            LKVKD KTLLFG++ V VF  RNPEEIPW ETGAEYVVESTGVFTD+DKAAAHLKGGAKK
Sbjct  61   LKVKDDKTLLFGEKPVTVFGVRNPEEIPWAETGAEYVVESTGVFTDKDKAAAHLKGGAKK  120

Query  122  VVISAPSKDAPMFVMGVNHLEYKKDVDIVSNASCTTNCLA  3
            V+ISAPSKDAPMFV+GVN  EYK +++IVSNASCTTNCLA
Sbjct  121  VIISAPSKDAPMFVVGVNEHEYKPELNIVSNASCTTNCLA  160



>gb|AFK37023.1| unknown [Lotus japonicus]
Length=228

 Score =   250 bits (639),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 130/158 (82%), Positives = 145/158 (92%), Gaps = 0/158 (0%)
 Frame = -2

Query  476  KVKIGINGFGRIGRLVARVALLSDDIELVAVNDPFITTDYMTYMFKYDTVHGQWTKNELK  297
            K+KIGINGFGRIGRLVARVAL  +D+ELVA+NDPFITTDYM+YMFKYDTVHGQW   ++K
Sbjct  6    KIKIGINGFGRIGRLVARVALQRNDVELVAINDPFITTDYMSYMFKYDTVHGQWKHFDVK  65

Query  296  VKDAKTLLFGDRHVAVFDKRNPEEIPWGETGAEYVVESTGVFTDQDkaaahlkggakKVV  117
            VKD+KTLLFGD+ V VF  RNPEEIPWGE GA++VVESTGVFTD+DKAAAHLKGGAKKVV
Sbjct  66   VKDSKTLLFGDKAVTVFGTRNPEEIPWGEVGADFVVESTGVFTDKDKAAAHLKGGAKKVV  125

Query  116  ISAPSKDAPMFVMGVNHLEYKKDVDIVSNASCTTNCLA  3
            ISAPSKDAPMFV+GVN  EYK ++DIVSNASCTTNCLA
Sbjct  126  ISAPSKDAPMFVVGVNEKEYKPELDIVSNASCTTNCLA  163



>ref|XP_010524280.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase 2, cytosolic 
[Tarenaya hassleriana]
Length=338

 Score =   254 bits (649),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 132/160 (83%), Positives = 147/160 (92%), Gaps = 0/160 (0%)
 Frame = -2

Query  482  MAKVKIGINGFGRIGRLVARVALLSDDIELVAVNDPFITTDYMTYMFKYDTVHGQWTKNE  303
            MAK+++GINGFGRIGRLVARV L SDD+ELVAVNDPFITT+YMTYMFKYD+VHG W   E
Sbjct  1    MAKIRVGINGFGRIGRLVARVVLQSDDVELVAVNDPFITTEYMTYMFKYDSVHGHWKHYE  60

Query  302  LKVKDAKTLLFGDRHVAVFDKRNPEEIPWGETGAEYVVESTGVFTDQDkaaahlkggakK  123
            +KVKD+KTLLFG++ V VF  RNPEEIPWGETGA++VVESTGVFTD+DKAAAHLKGGAKK
Sbjct  61   VKVKDSKTLLFGEKPVTVFGIRNPEEIPWGETGADFVVESTGVFTDKDKAAAHLKGGAKK  120

Query  122  VVISAPSKDAPMFVMGVNHLEYKKDVDIVSNASCTTNCLA  3
            VVISAPSKDAPMFV+GVN  EYK D+DIVSNASCTTNCLA
Sbjct  121  VVISAPSKDAPMFVVGVNEKEYKPDIDIVSNASCTTNCLA  160



>ref|XP_008800947.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase 3, cytosolic-like 
[Phoenix dactylifera]
Length=340

 Score =   254 bits (649),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 131/158 (83%), Positives = 146/158 (92%), Gaps = 0/158 (0%)
 Frame = -2

Query  476  KVKIGINGFGRIGRLVARVALLSDDIELVAVNDPFITTDYMTYMFKYDTVHGQWTKNELK  297
            K+KIGINGFGRIGRLVARVAL S DIELVAVNDPFI TDYMTYMFKYDTVHG+W  +++K
Sbjct  6    KIKIGINGFGRIGRLVARVALQSSDIELVAVNDPFIGTDYMTYMFKYDTVHGKWKHHDIK  65

Query  296  VKDAKTLLFGDRHVAVFDKRNPEEIPWGETGAEYVVESTGVFTDQDkaaahlkggakKVV  117
            VKD+KTLLFG++ VAVF  RNPEEIPWGETGAEYVVESTGVFTD++KA+AHLKGGAKKVV
Sbjct  66   VKDSKTLLFGEKEVAVFGIRNPEEIPWGETGAEYVVESTGVFTDKEKASAHLKGGAKKVV  125

Query  116  ISAPSKDAPMFVMGVNHLEYKKDVDIVSNASCTTNCLA  3
            IS PSKDAPMFV+GVN  EYK D++IVSNASCTTNC+A
Sbjct  126  ISGPSKDAPMFVVGVNAHEYKSDINIVSNASCTTNCVA  163



>ref|XP_006476982.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase-like isoform 
X1 [Citrus sinensis]
 ref|XP_006476983.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase-like isoform 
X2 [Citrus sinensis]
Length=337

 Score =   254 bits (649),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 134/160 (84%), Positives = 145/160 (91%), Gaps = 0/160 (0%)
 Frame = -2

Query  482  MAKVKIGINGFGRIGRLVARVALLSDDIELVAVNDPFITTDYMTYMFKYDTVHGQWTKNE  303
            M KVKIGINGFGRIGRLVARV L  DD+ELVAVNDPFITTDYMTYMFKYD+VHGQW  +E
Sbjct  1    MGKVKIGINGFGRIGRLVARVILQRDDVELVAVNDPFITTDYMTYMFKYDSVHGQWKHHE  60

Query  302  LKVKDAKTLLFGDRHVAVFDKRNPEEIPWGETGAEYVVESTGVFTDQDkaaahlkggakK  123
            LKVKD KTLLFG++ V VF  RNPEEIPW ETGAEYVVESTGVFTD+DKAAAHLKGGAKK
Sbjct  61   LKVKDDKTLLFGEKPVTVFGVRNPEEIPWAETGAEYVVESTGVFTDKDKAAAHLKGGAKK  120

Query  122  VVISAPSKDAPMFVMGVNHLEYKKDVDIVSNASCTTNCLA  3
            V+ISAPSKDAPMFV+GVN  EYK +++IVSNASCTTNCLA
Sbjct  121  VIISAPSKDAPMFVVGVNENEYKPELNIVSNASCTTNCLA  160



>ref|NP_001267672.1| glyceraldehyde-3-phosphate dehydrogenase, cytosolic-like [Cucumis 
sativus]
 ref|XP_004162129.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase, cytosolic-like 
[Cucumis sativus]
 gb|ADM89006.1| glyceraldehyde-3-phosphate dehydrogenase [Cucumis sativus]
 gb|KGN64385.1| hypothetical protein Csa_1G050240 [Cucumis sativus]
Length=336

 Score =   254 bits (648),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 129/160 (81%), Positives = 148/160 (93%), Gaps = 0/160 (0%)
 Frame = -2

Query  482  MAKVKIGINGFGRIGRLVARVALLSDDIELVAVNDPFITTDYMTYMFKYDTVHGQWTKNE  303
            MAK+KIGINGFGRIGRLVARVAL  DD+ELVAVNDPFITTDYMTYMFKYD+VHG W  ++
Sbjct  1    MAKIKIGINGFGRIGRLVARVALQRDDVELVAVNDPFITTDYMTYMFKYDSVHGHWKHSD  60

Query  302  LKVKDAKTLLFGDRHVAVFDKRNPEEIPWGETGAEYVVESTGVFTDQDkaaahlkggakK  123
            +KVKD+K+LLFG++ V VF  RNP+EIPWGETGAEY+VESTGVFTD+DKAAAHLKGGAKK
Sbjct  61   VKVKDSKSLLFGEKAVTVFGFRNPDEIPWGETGAEYIVESTGVFTDKDKAAAHLKGGAKK  120

Query  122  VVISAPSKDAPMFVMGVNHLEYKKDVDIVSNASCTTNCLA  3
            V+ISAPSKDAPMFV+GVN  EYK ++D++SNASCTTNCLA
Sbjct  121  VIISAPSKDAPMFVVGVNEKEYKPELDVISNASCTTNCLA  160



>ref|XP_010476339.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPC2, cytosolic-like 
[Camelina sativa]
Length=336

 Score =   254 bits (648),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 133/160 (83%), Positives = 146/160 (91%), Gaps = 0/160 (0%)
 Frame = -2

Query  482  MAKVKIGINGFGRIGRLVARVALLSDDIELVAVNDPFITTDYMTYMFKYDTVHGQWTKNE  303
            MAK+KIGINGFGRIGRLVARV L  DD+ELVAVNDPFITT+YMTYMFKYD+VHGQW  +E
Sbjct  1    MAKIKIGINGFGRIGRLVARVVLQRDDVELVAVNDPFITTEYMTYMFKYDSVHGQWKHHE  60

Query  302  LKVKDAKTLLFGDRHVAVFDKRNPEEIPWGETGAEYVVESTGVFTDQDkaaahlkggakK  123
            LKVKD KTLLFG++ V VF  RNPE+IPWGE GA++VVESTGVFTD+DKAAAHLKGGAKK
Sbjct  61   LKVKDDKTLLFGEKPVTVFGIRNPEDIPWGEAGADFVVESTGVFTDKDKAAAHLKGGAKK  120

Query  122  VVISAPSKDAPMFVMGVNHLEYKKDVDIVSNASCTTNCLA  3
            VVISAPSKDAPMFV+GVN  EYK D+DIVSNASCTTNCLA
Sbjct  121  VVISAPSKDAPMFVVGVNEHEYKSDLDIVSNASCTTNCLA  160



>ref|XP_003601828.1| Glyceraldehyde 3-phosphate dehydrogenase [Medicago truncatula]
 gb|AES72079.1| glyceraldehyde-3-phosphate dehydrogenase [Medicago truncatula]
Length=340

 Score =   254 bits (648),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 131/158 (83%), Positives = 145/158 (92%), Gaps = 0/158 (0%)
 Frame = -2

Query  476  KVKIGINGFGRIGRLVARVALLSDDIELVAVNDPFITTDYMTYMFKYDTVHGQWTKNELK  297
            K++IGINGFGRIGRLVARVAL  +D+ELVA+NDPFITTDYMTYMFKYDTVHGQW   ELK
Sbjct  6    KIRIGINGFGRIGRLVARVALQRNDVELVAINDPFITTDYMTYMFKYDTVHGQWKHFELK  65

Query  296  VKDAKTLLFGDRHVAVFDKRNPEEIPWGETGAEYVVESTGVFTDQDkaaahlkggakKVV  117
            VKD KTLLFG++ VAVF  RNPEEIPWGE GA+YV+ESTGVFTD+DKAAAHLKGGAKKVV
Sbjct  66   VKDTKTLLFGEKEVAVFGTRNPEEIPWGEVGADYVIESTGVFTDKDKAAAHLKGGAKKVV  125

Query  116  ISAPSKDAPMFVMGVNHLEYKKDVDIVSNASCTTNCLA  3
            ISAPSKDAPMFV+GVN  EYK +++IVSNASCTTNCLA
Sbjct  126  ISAPSKDAPMFVVGVNEKEYKPELNIVSNASCTTNCLA  163



>ref|XP_011041572.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPC1, cytosolic 
isoform X2 [Populus euphratica]
Length=341

 Score =   254 bits (648),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 133/158 (84%), Positives = 144/158 (91%), Gaps = 0/158 (0%)
 Frame = -2

Query  476  KVKIGINGFGRIGRLVARVALLSDDIELVAVNDPFITTDYMTYMFKYDTVHGQWTKNELK  297
            K+KIGINGFGRIGRLVARVAL  DD+ELVAVNDPFITTDYMTYMFKYDTVHG+W  +ELK
Sbjct  6    KIKIGINGFGRIGRLVARVALQRDDVELVAVNDPFITTDYMTYMFKYDTVHGRWKHSELK  65

Query  296  VKDAKTLLFGDRHVAVFDKRNPEEIPWGETGAEYVVESTGVFTDQDkaaahlkggakKVV  117
            VKD KTLLFG+R VAVF  RNPEEIPW + GAE+VVESTGVFTD+DKAAAHLKGGAKKVV
Sbjct  66   VKDEKTLLFGERAVAVFGIRNPEEIPWAQAGAEFVVESTGVFTDKDKAAAHLKGGAKKVV  125

Query  116  ISAPSKDAPMFVMGVNHLEYKKDVDIVSNASCTTNCLA  3
            ISAPSKDAPMFV+GVN  +Y  D+DIVSNASCTTNCLA
Sbjct  126  ISAPSKDAPMFVVGVNEKQYTPDLDIVSNASCTTNCLA  163



>ref|XP_011071186.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase, cytosolic-like 
[Sesamum indicum]
Length=337

 Score =   254 bits (648),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 133/160 (83%), Positives = 145/160 (91%), Gaps = 0/160 (0%)
 Frame = -2

Query  482  MAKVKIGINGFGRIGRLVARVALLSDDIELVAVNDPFITTDYMTYMFKYDTVHGQWTKNE  303
            M K+KIGINGFGRIGRLVARVAL  DDI+LVAVNDPFI+TDYMTYMFKYD+VHG W  NE
Sbjct  1    MGKIKIGINGFGRIGRLVARVALQRDDIDLVAVNDPFISTDYMTYMFKYDSVHGHWKHNE  60

Query  302  LKVKDAKTLLFGDRHVAVFDKRNPEEIPWGETGAEYVVESTGVFTDQDkaaahlkggakK  123
            +K+KD KTLLFGD+ V VF  RNPEEIPWGE GAE+VVESTGVFTD+DKAAAHLKGGAKK
Sbjct  61   VKMKDEKTLLFGDKPVKVFGFRNPEEIPWGEAGAEFVVESTGVFTDKDKAAAHLKGGAKK  120

Query  122  VVISAPSKDAPMFVMGVNHLEYKKDVDIVSNASCTTNCLA  3
            VVISAPSKDAPMFV+GVN  EYK D++IVSNASCTTNCLA
Sbjct  121  VVISAPSKDAPMFVVGVNEKEYKPDLNIVSNASCTTNCLA  160



>gb|AFJ42572.1| glyceraldehyde 3-phosphate dehydrogenase [Sesamum indicum]
Length=337

 Score =   254 bits (648),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 133/160 (83%), Positives = 145/160 (91%), Gaps = 0/160 (0%)
 Frame = -2

Query  482  MAKVKIGINGFGRIGRLVARVALLSDDIELVAVNDPFITTDYMTYMFKYDTVHGQWTKNE  303
            M K+KIGINGFGRIGRLVARVAL  DDI+LVAVNDPFI+TDYMTYMFKYD+VHG W  NE
Sbjct  1    MGKIKIGINGFGRIGRLVARVALQRDDIDLVAVNDPFISTDYMTYMFKYDSVHGHWKHNE  60

Query  302  LKVKDAKTLLFGDRHVAVFDKRNPEEIPWGETGAEYVVESTGVFTDQDkaaahlkggakK  123
            +K+KD KTLLFGD+ V VF  RNPEEIPWGE GAE+VVESTGVFTD+DKAAAHLKGGAKK
Sbjct  61   VKMKDEKTLLFGDKPVKVFGFRNPEEIPWGEAGAEFVVESTGVFTDKDKAAAHLKGGAKK  120

Query  122  VVISAPSKDAPMFVMGVNHLEYKKDVDIVSNASCTTNCLA  3
            VVISAPSKDAPMFV+GVN  EYK D++IVSNASCTTNCLA
Sbjct  121  VVISAPSKDAPMFVVGVNEKEYKPDLNIVSNASCTTNCLA  160



>ref|XP_007044990.1| Glyceraldehyde-3-phosphate dehydrogenase C2 isoform 2 [Theobroma 
cacao]
 ref|XP_007044992.1| Glyceraldehyde-3-phosphate dehydrogenase C2 isoform 2 [Theobroma 
cacao]
 gb|EOY00822.1| Glyceraldehyde-3-phosphate dehydrogenase C2 isoform 2 [Theobroma 
cacao]
 gb|EOY00824.1| Glyceraldehyde-3-phosphate dehydrogenase C2 isoform 2 [Theobroma 
cacao]
Length=268

 Score =   251 bits (642),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 131/158 (83%), Positives = 145/158 (92%), Gaps = 0/158 (0%)
 Frame = -2

Query  476  KVKIGINGFGRIGRLVARVALLSDDIELVAVNDPFITTDYMTYMFKYDTVHGQWTKNELK  297
            K+KIGINGFGRIGRLVARVAL  +D+ELVAVNDPFITTDYMTYMFKYD+VHGQW  + +K
Sbjct  6    KIKIGINGFGRIGRLVARVALQRNDVELVAVNDPFITTDYMTYMFKYDSVHGQWKHHNVK  65

Query  296  VKDAKTLLFGDRHVAVFDKRNPEEIPWGETGAEYVVESTGVFTDQDkaaahlkggakKVV  117
            VKD+KTLLFG++ V VF  RNPEEIPW ETGAE+VVESTGVFTD+DKAAAHLKGGAKKVV
Sbjct  66   VKDSKTLLFGEKPVTVFGIRNPEEIPWAETGAEFVVESTGVFTDKDKAAAHLKGGAKKVV  125

Query  116  ISAPSKDAPMFVMGVNHLEYKKDVDIVSNASCTTNCLA  3
            ISAPSKDAPMFV+GVN  EYK ++DIVSNASCTTNCLA
Sbjct  126  ISAPSKDAPMFVVGVNEKEYKPELDIVSNASCTTNCLA  163



>ref|XP_008222039.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase, cytosolic 
[Prunus mume]
Length=340

 Score =   254 bits (648),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 131/158 (83%), Positives = 145/158 (92%), Gaps = 0/158 (0%)
 Frame = -2

Query  476  KVKIGINGFGRIGRLVARVALLSDDIELVAVNDPFITTDYMTYMFKYDTVHGQWTKNELK  297
            K+KIGINGFGRIGRLVARVAL  DD+ELVAVNDPFITTDYMTYMFKYDTVHG W  +ELK
Sbjct  6    KIKIGINGFGRIGRLVARVALQRDDVELVAVNDPFITTDYMTYMFKYDTVHGPWKHHELK  65

Query  296  VKDAKTLLFGDRHVAVFDKRNPEEIPWGETGAEYVVESTGVFTDQDkaaahlkggakKVV  117
            VKD+KTLLFG++ VAVF  RNPEEIPWGE GA+++VESTGVFTD+DKAA HLKGGAKKV+
Sbjct  66   VKDSKTLLFGEKPVAVFGIRNPEEIPWGEAGADFIVESTGVFTDKDKAAFHLKGGAKKVI  125

Query  116  ISAPSKDAPMFVMGVNHLEYKKDVDIVSNASCTTNCLA  3
            ISAPSKDAPMFV+GVN  EYK D+DI+SNASCTTNCLA
Sbjct  126  ISAPSKDAPMFVVGVNEKEYKPDIDILSNASCTTNCLA  163



>ref|XP_007222474.1| hypothetical protein PRUPE_ppa008227mg [Prunus persica]
 gb|EMJ23673.1| hypothetical protein PRUPE_ppa008227mg [Prunus persica]
Length=340

 Score =   254 bits (648),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 131/158 (83%), Positives = 145/158 (92%), Gaps = 0/158 (0%)
 Frame = -2

Query  476  KVKIGINGFGRIGRLVARVALLSDDIELVAVNDPFITTDYMTYMFKYDTVHGQWTKNELK  297
            K+KIGINGFGRIGRLVARVAL  DD+ELVAVNDPFITTDYMTYMFKYDTVHG W  +ELK
Sbjct  6    KIKIGINGFGRIGRLVARVALQRDDVELVAVNDPFITTDYMTYMFKYDTVHGPWKHHELK  65

Query  296  VKDAKTLLFGDRHVAVFDKRNPEEIPWGETGAEYVVESTGVFTDQDkaaahlkggakKVV  117
            VKD+KTLLFG++ VAVF  RNPEEIPWGE GA+++VESTGVFTD+DKAA HLKGGAKKV+
Sbjct  66   VKDSKTLLFGEKPVAVFGIRNPEEIPWGEAGADFIVESTGVFTDKDKAAFHLKGGAKKVI  125

Query  116  ISAPSKDAPMFVMGVNHLEYKKDVDIVSNASCTTNCLA  3
            ISAPSKDAPMFV+GVN  EYK D+DI+SNASCTTNCLA
Sbjct  126  ISAPSKDAPMFVVGVNEKEYKPDIDILSNASCTTNCLA  163



>ref|XP_006378281.1| hypothetical protein POPTR_0010s06560g [Populus trichocarpa]
 gb|ERP56078.1| hypothetical protein POPTR_0010s06560g [Populus trichocarpa]
Length=296

 Score =   252 bits (644),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 131/158 (83%), Positives = 144/158 (91%), Gaps = 0/158 (0%)
 Frame = -2

Query  476  KVKIGINGFGRIGRLVARVALLSDDIELVAVNDPFITTDYMTYMFKYDTVHGQWTKNELK  297
            K+KIGINGFGRIGRLVARVAL  DD+ELVA+NDPFITTDYMTYMFKYDTVHG+W  +ELK
Sbjct  6    KIKIGINGFGRIGRLVARVALQRDDVELVAINDPFITTDYMTYMFKYDTVHGRWKHSELK  65

Query  296  VKDAKTLLFGDRHVAVFDKRNPEEIPWGETGAEYVVESTGVFTDQDkaaahlkggakKVV  117
            VKD KTLLFG++ VAVF  RNPEEIPW + GAE+VVESTGVFTD+DKAAAHLKGGAKKVV
Sbjct  66   VKDEKTLLFGEKAVAVFGIRNPEEIPWAQAGAEFVVESTGVFTDKDKAAAHLKGGAKKVV  125

Query  116  ISAPSKDAPMFVMGVNHLEYKKDVDIVSNASCTTNCLA  3
            ISAPSKDAPMFV+GVN  +Y  D+DIVSNASCTTNCLA
Sbjct  126  ISAPSKDAPMFVVGVNEKQYTPDLDIVSNASCTTNCLA  163



>gb|ACV86034.1| glyceraldehyde-3-phosphate dehydrogenase 1 [Festuca arundinacea]
Length=337

 Score =   253 bits (647),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 132/160 (83%), Positives = 143/160 (89%), Gaps = 0/160 (0%)
 Frame = -2

Query  482  MAKVKIGINGFGRIGRLVARVALLSDDIELVAVNDPFITTDYMTYMFKYDTVHGQWTKNE  303
            MA +KIGINGFGRIGRLVARVAL   D+ELVAVNDPFITTDYMTYMFKYDTVHGQW  +E
Sbjct  1    MAPIKIGINGFGRIGRLVARVALQCPDVELVAVNDPFITTDYMTYMFKYDTVHGQWKHHE  60

Query  302  LKVKDAKTLLFGDRHVAVFDKRNPEEIPWGETGAEYVVESTGVFTDQDkaaahlkggakK  123
            +KVKDAKTLLFG++ VAVF  RNPEEIPW   GA+YVVESTGVFTD+DKAAAH+KGGAKK
Sbjct  61   VKVKDAKTLLFGEKEVAVFGCRNPEEIPWASAGADYVVESTGVFTDKDKAAAHIKGGAKK  120

Query  122  VVISAPSKDAPMFVMGVNHLEYKKDVDIVSNASCTTNCLA  3
            V+ISAPSKDAPMFVMGVN  EY  D+ IVSNASCTTNCLA
Sbjct  121  VIISAPSKDAPMFVMGVNEKEYTSDITIVSNASCTTNCLA  160



>sp|Q42671.1|G3PC_CRAPL RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase, cytosolic 
[Craterostigma plantagineum]
 emb|CAA55116.1| glyceraldehyde 3-phosphate dehydrogenase (phosphorylating) [Craterostigma 
plantagineum]
Length=337

 Score =   253 bits (647),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 133/160 (83%), Positives = 145/160 (91%), Gaps = 0/160 (0%)
 Frame = -2

Query  482  MAKVKIGINGFGRIGRLVARVALLSDDIELVAVNDPFITTDYMTYMFKYDTVHGQWTKNE  303
            MAKVKIGINGFGRIGRLVARVAL+ DD+ELVAVNDPFIT DYM YMFKYDTVHGQ+  +E
Sbjct  1    MAKVKIGINGFGRIGRLVARVALVRDDVELVAVNDPFITVDYMAYMFKYDTVHGQYKHHE  60

Query  302  LKVKDAKTLLFGDRHVAVFDKRNPEEIPWGETGAEYVVESTGVFTDQDkaaahlkggakK  123
            LKVKD KTLLFGD+ VAVF  RNPEEIPW ETGAEYVVESTGVFT+++KAAAHLKGGAKK
Sbjct  61   LKVKDEKTLLFGDKPVAVFGLRNPEEIPWAETGAEYVVESTGVFTEKEKAAAHLKGGAKK  120

Query  122  VVISAPSKDAPMFVMGVNHLEYKKDVDIVSNASCTTNCLA  3
            V+ISAPSKDAPMFV+GVN   Y  D+D+VSNASCTTNCLA
Sbjct  121  VIISAPSKDAPMFVVGVNEKTYTPDIDVVSNASCTTNCLA  160



>ref|XP_010907761.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase, cytosolic-like 
isoform X2 [Elaeis guineensis]
Length=340

 Score =   253 bits (647),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 130/158 (82%), Positives = 145/158 (92%), Gaps = 0/158 (0%)
 Frame = -2

Query  476  KVKIGINGFGRIGRLVARVALLSDDIELVAVNDPFITTDYMTYMFKYDTVHGQWTKNELK  297
            K+KIGINGFGRIGRLVARVAL S DIELVAVNDPFI+TDYMTYMFKYDTVHG+W  +++K
Sbjct  6    KIKIGINGFGRIGRLVARVALQSSDIELVAVNDPFISTDYMTYMFKYDTVHGKWKHHDIK  65

Query  296  VKDAKTLLFGDRHVAVFDKRNPEEIPWGETGAEYVVESTGVFTDQDkaaahlkggakKVV  117
            VKD+KTLLFG++ V VF  RNPEEIPWGETGAEYVVESTGVFTD++KA+AHLKGGAKKV+
Sbjct  66   VKDSKTLLFGEKQVTVFGIRNPEEIPWGETGAEYVVESTGVFTDKEKASAHLKGGAKKVI  125

Query  116  ISAPSKDAPMFVMGVNHLEYKKDVDIVSNASCTTNCLA  3
            ISA SKD PMFV+GVN  EYK D+DIVSNASCTTNCLA
Sbjct  126  ISAASKDVPMFVVGVNEHEYKSDIDIVSNASCTTNCLA  163



>gb|AFS33113.1| glyceraldehyde-3-phosphate dehydrogenase [Puccinellia tenuiflora]
Length=337

 Score =   253 bits (647),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 132/160 (83%), Positives = 144/160 (90%), Gaps = 0/160 (0%)
 Frame = -2

Query  482  MAKVKIGINGFGRIGRLVARVALLSDDIELVAVNDPFITTDYMTYMFKYDTVHGQWTKNE  303
            MA +KIGINGFGRIGRLVARVAL   D+ELVAVNDPFITTDYMTYMFKYDTVHGQW  ++
Sbjct  1    MAPIKIGINGFGRIGRLVARVALQCPDVELVAVNDPFITTDYMTYMFKYDTVHGQWKHHD  60

Query  302  LKVKDAKTLLFGDRHVAVFDKRNPEEIPWGETGAEYVVESTGVFTDQDkaaahlkggakK  123
            +KVKDAKTLLFG++ VAVF  RNPEEIPWGE GA+YVVESTGVFTD+DKAAAH+KGGAKK
Sbjct  61   VKVKDAKTLLFGEKEVAVFGCRNPEEIPWGEAGADYVVESTGVFTDKDKAAAHIKGGAKK  120

Query  122  VVISAPSKDAPMFVMGVNHLEYKKDVDIVSNASCTTNCLA  3
            V+ISAPSKDAPMFV GVN  EY  D+ IVSNASCTTNCLA
Sbjct  121  VIISAPSKDAPMFVCGVNEKEYTSDITIVSNASCTTNCLA  160



>ref|XP_010907760.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase, cytosolic-like 
isoform X1 [Elaeis guineensis]
Length=341

 Score =   253 bits (647),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 130/158 (82%), Positives = 145/158 (92%), Gaps = 0/158 (0%)
 Frame = -2

Query  476  KVKIGINGFGRIGRLVARVALLSDDIELVAVNDPFITTDYMTYMFKYDTVHGQWTKNELK  297
            K+KIGINGFGRIGRLVARVAL S DIELVAVNDPFI+TDYMTYMFKYDTVHG+W  +++K
Sbjct  7    KIKIGINGFGRIGRLVARVALQSSDIELVAVNDPFISTDYMTYMFKYDTVHGKWKHHDIK  66

Query  296  VKDAKTLLFGDRHVAVFDKRNPEEIPWGETGAEYVVESTGVFTDQDkaaahlkggakKVV  117
            VKD+KTLLFG++ V VF  RNPEEIPWGETGAEYVVESTGVFTD++KA+AHLKGGAKKV+
Sbjct  67   VKDSKTLLFGEKQVTVFGIRNPEEIPWGETGAEYVVESTGVFTDKEKASAHLKGGAKKVI  126

Query  116  ISAPSKDAPMFVMGVNHLEYKKDVDIVSNASCTTNCLA  3
            ISA SKD PMFV+GVN  EYK D+DIVSNASCTTNCLA
Sbjct  127  ISAASKDVPMFVVGVNEHEYKSDIDIVSNASCTTNCLA  164



>gb|KDP30962.1| hypothetical protein JCGZ_11338 [Jatropha curcas]
Length=337

 Score =   253 bits (647),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 133/160 (83%), Positives = 143/160 (89%), Gaps = 0/160 (0%)
 Frame = -2

Query  482  MAKVKIGINGFGRIGRLVARVALLSDDIELVAVNDPFITTDYMTYMFKYDTVHGQWTKNE  303
            M KVKIGINGFGRIGRLVARVAL  DD+ELVAVNDPFIT DYMTYMFKYDTVHGQW  +E
Sbjct  1    MGKVKIGINGFGRIGRLVARVALQRDDVELVAVNDPFITVDYMTYMFKYDTVHGQWKHHE  60

Query  302  LKVKDAKTLLFGDRHVAVFDKRNPEEIPWGETGAEYVVESTGVFTDQDkaaahlkggakK  123
            LKVKD KTLLFG++ V VF  RNPEEIPW  TGAEY+VESTGVFTD+DKAAAHLKGGAKK
Sbjct  61   LKVKDEKTLLFGEKPVTVFGVRNPEEIPWASTGAEYIVESTGVFTDKDKAAAHLKGGAKK  120

Query  122  VVISAPSKDAPMFVMGVNHLEYKKDVDIVSNASCTTNCLA  3
            V+ISAPSKDAPMFV+GVN  +YK D+ IVSNASCTTNCLA
Sbjct  121  VIISAPSKDAPMFVVGVNEHDYKPDIHIVSNASCTTNCLA  160



>ref|XP_010556366.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPC1, cytosolic-like 
[Tarenaya hassleriana]
Length=338

 Score =   253 bits (647),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 133/159 (84%), Positives = 142/159 (89%), Gaps = 0/159 (0%)
 Frame = -2

Query  479  AKVKIGINGFGRIGRLVARVALLSDDIELVAVNDPFITTDYMTYMFKYDTVHGQWTKNEL  300
             K+KIGINGFGRIGRLVARV L  DD+ELVAVNDPFITTDYMTYMFKYD+VHGQW  NEL
Sbjct  4    GKIKIGINGFGRIGRLVARVILQRDDVELVAVNDPFITTDYMTYMFKYDSVHGQWKHNEL  63

Query  299  KVKDAKTLLFGDRHVAVFDKRNPEEIPWGETGAEYVVESTGVFTDQDkaaahlkggakKV  120
            KVKD KTLLFG + V VF  RNPEEIPW E GAEYVVESTGVFTD+DKAAAHLKGGAKKV
Sbjct  64   KVKDEKTLLFGTKPVTVFGIRNPEEIPWAEAGAEYVVESTGVFTDKDKAAAHLKGGAKKV  123

Query  119  VISAPSKDAPMFVMGVNHLEYKKDVDIVSNASCTTNCLA  3
            +ISAPSKDAPMFV+GVN  EYK ++DIVSNASCTTNCLA
Sbjct  124  IISAPSKDAPMFVVGVNEHEYKPELDIVSNASCTTNCLA  162



>ref|XP_002511235.1| glyceraldehyde 3-phosphate dehydrogenase, putative [Ricinus communis]
 gb|EEF51837.1| glyceraldehyde 3-phosphate dehydrogenase, putative [Ricinus communis]
Length=337

 Score =   253 bits (646),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 131/160 (82%), Positives = 145/160 (91%), Gaps = 0/160 (0%)
 Frame = -2

Query  482  MAKVKIGINGFGRIGRLVARVALLSDDIELVAVNDPFITTDYMTYMFKYDTVHGQWTKNE  303
            MAK+KIGINGFGRIGRLVARVAL  DD+ELVAVNDPFI+T+YMTYMFKYDTVHGQW  +E
Sbjct  1    MAKIKIGINGFGRIGRLVARVALQRDDVELVAVNDPFISTEYMTYMFKYDTVHGQWKHHE  60

Query  302  LKVKDAKTLLFGDRHVAVFDKRNPEEIPWGETGAEYVVESTGVFTDQDkaaahlkggakK  123
            LK+KD KTLLFG++ V VF  RNPEEIPW ETGAEY+VESTGVFTD+DKAAAHLKGGAKK
Sbjct  61   LKIKDDKTLLFGEKPVTVFGVRNPEEIPWAETGAEYIVESTGVFTDKDKAAAHLKGGAKK  120

Query  122  VVISAPSKDAPMFVMGVNHLEYKKDVDIVSNASCTTNCLA  3
            V+ISAPSKDAPMFV+GVN  EY  D+ I+SNASCTTNCLA
Sbjct  121  VIISAPSKDAPMFVVGVNEKEYTPDLHIISNASCTTNCLA  160



>emb|CBX89317.1| cytosolic glyceraldehyde 3-phosphate dehydrogenase [Rosa canina]
Length=263

 Score =   251 bits (640),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 134/159 (84%), Positives = 143/159 (90%), Gaps = 0/159 (0%)
 Frame = -2

Query  479  AKVKIGINGFGRIGRLVARVALLSDDIELVAVNDPFITTDYMTYMFKYDTVHGQWTKNEL  300
            AK+KIGINGFGRIGRLVARVAL  DD+ELVAVNDPFITTDYMTYMFKYDTVHG W  +EL
Sbjct  1    AKIKIGINGFGRIGRLVARVALQRDDVELVAVNDPFITTDYMTYMFKYDTVHGAWKHHEL  60

Query  299  KVKDAKTLLFGDRHVAVFDKRNPEEIPWGETGAEYVVESTGVFTDQDkaaahlkggakKV  120
            KVKD KTLLFG++ VAVF  RNPEEIPWG  GA+ VVESTGVFTD+DKAAAHLKGGAKKV
Sbjct  61   KVKDEKTLLFGEKPVAVFGLRNPEEIPWGSVGADIVVESTGVFTDKDKAAAHLKGGAKKV  120

Query  119  VISAPSKDAPMFVMGVNHLEYKKDVDIVSNASCTTNCLA  3
            VISAPSKDAPMFV+GVN  EYK D+ IVSNASCTTNCLA
Sbjct  121  VISAPSKDAPMFVVGVNEHEYKSDLCIVSNASCTTNCLA  159



>emb|CBI14856.3| unnamed protein product [Vitis vinifera]
Length=343

 Score =   253 bits (647),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 133/158 (84%), Positives = 145/158 (92%), Gaps = 0/158 (0%)
 Frame = -2

Query  476  KVKIGINGFGRIGRLVARVALLSDDIELVAVNDPFITTDYMTYMFKYDTVHGQWTKNELK  297
            K+KIGINGFGRIGRLVARVAL  DD+ELVAVNDPFITTDYMTYMFKYD+VHGQW  +ELK
Sbjct  9    KIKIGINGFGRIGRLVARVALQRDDVELVAVNDPFITTDYMTYMFKYDSVHGQWKHHELK  68

Query  296  VKDAKTLLFGDRHVAVFDKRNPEEIPWGETGAEYVVESTGVFTDQDkaaahlkggakKVV  117
            VKD+ TLLFG++ V VF  RNPEEIPWGETGAE+VVESTGVFTD+DKAAAHLKGGAKKVV
Sbjct  69   VKDSNTLLFGEKPVTVFGIRNPEEIPWGETGAEFVVESTGVFTDKDKAAAHLKGGAKKVV  128

Query  116  ISAPSKDAPMFVMGVNHLEYKKDVDIVSNASCTTNCLA  3
            ISAPSKDAPMFV+GVN  EYK ++ IVSNASCTTNCLA
Sbjct  129  ISAPSKDAPMFVVGVNEKEYKPELHIVSNASCTTNCLA  166



>ref|NP_001105700.1| glyceraldehyde-3-phosphate dehydrogenase 2, cytosolic [Zea mays]
 sp|Q09054.1|G3PC2_MAIZE RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase 2, cytosolic 
[Zea mays]
 emb|CAA51676.1| glyceraldehyde 3-phosphate dehydrogenase (phosphorylating) [Zea 
mays]
 gb|AAA87578.1| cytosolic glyceroldehyde-3-phosphate dehydrogenase GAPC2 [Zea 
mays]
 gb|AAA87880.1| glyceraldehyde-3-phosphate dehydrogenase [Zea mays]
 gb|ACF84980.1| unknown [Zea mays]
 gb|AFW74418.1| glyceraldehyde-3-phosphate dehydrogenase2 [Zea mays]
Length=337

 Score =   253 bits (646),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 132/160 (83%), Positives = 146/160 (91%), Gaps = 0/160 (0%)
 Frame = -2

Query  482  MAKVKIGINGFGRIGRLVARVALLSDDIELVAVNDPFITTDYMTYMFKYDTVHGQWTKNE  303
            M K+KIGINGFGRIGRLVARVAL S+D+ELVAVNDPFITTDYMTYMFKYDTVHGQW  ++
Sbjct  1    MGKIKIGINGFGRIGRLVARVALQSEDVELVAVNDPFITTDYMTYMFKYDTVHGQWKHSD  60

Query  302  LKVKDAKTLLFGDRHVAVFDKRNPEEIPWGETGAEYVVESTGVFTDQDkaaahlkggakK  123
            + +KD+KTLLFG++ V VF  RNPEEIPWGE GAEYVVESTGVFTD+DKAAAHLKGGAKK
Sbjct  61   IALKDSKTLLFGEKPVTVFGIRNPEEIPWGEAGAEYVVESTGVFTDKDKAAAHLKGGAKK  120

Query  122  VVISAPSKDAPMFVMGVNHLEYKKDVDIVSNASCTTNCLA  3
            VVISAPSKDAPMFV+GVN  +Y  DV+IVSNASCTTNCLA
Sbjct  121  VVISAPSKDAPMFVVGVNEDKYTSDVNIVSNASCTTNCLA  160



>gb|EYU25940.1| hypothetical protein MIMGU_mgv1a009608mg [Erythranthe guttata]
Length=337

 Score =   253 bits (646),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 133/160 (83%), Positives = 143/160 (89%), Gaps = 0/160 (0%)
 Frame = -2

Query  482  MAKVKIGINGFGRIGRLVARVALLSDDIELVAVNDPFITTDYMTYMFKYDTVHGQWTKNE  303
            MAK+KIGINGFGRIGRLVARVAL  DD+ELVA+NDPFI TDYMTYMFKYDTVHG W  +E
Sbjct  1    MAKIKIGINGFGRIGRLVARVALQRDDVELVAINDPFIATDYMTYMFKYDTVHGPWKHHE  60

Query  302  LKVKDAKTLLFGDRHVAVFDKRNPEEIPWGETGAEYVVESTGVFTDQDkaaahlkggakK  123
            +KVKD K LLFGD+ V VF  RNPEEIPW E GAE+VVESTGVFTD+DKAAAHLKGGAKK
Sbjct  61   VKVKDEKNLLFGDKPVRVFGFRNPEEIPWAEAGAEFVVESTGVFTDKDKAAAHLKGGAKK  120

Query  122  VVISAPSKDAPMFVMGVNHLEYKKDVDIVSNASCTTNCLA  3
            VVISAPSKDAPMFV+GVN  EYK D+DIVSNASCTTNCLA
Sbjct  121  VVISAPSKDAPMFVVGVNEKEYKSDLDIVSNASCTTNCLA  160



>emb|CAB39974.1| glyceraldehyde-3-phosphate dehydrogenase [Nicotiana tabacum]
Length=337

 Score =   253 bits (646),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 131/160 (82%), Positives = 147/160 (92%), Gaps = 0/160 (0%)
 Frame = -2

Query  482  MAKVKIGINGFGRIGRLVARVALLSDDIELVAVNDPFITTDYMTYMFKYDTVHGQWTKNE  303
            MAKVKIGINGFGRIGRLVARVAL  DD+ELVAVNDPFI+ +YMTYMFKYD+VHGQW  +E
Sbjct  1    MAKVKIGINGFGRIGRLVARVALQRDDVELVAVNDPFISVEYMTYMFKYDSVHGQWKHHE  60

Query  302  LKVKDAKTLLFGDRHVAVFDKRNPEEIPWGETGAEYVVESTGVFTDQDkaaahlkggakK  123
            LKVKD KTLLFG++ V VF  RNPEEIPWG+TGA+Y+VESTGVFTD+DKAAAHLKGGAKK
Sbjct  61   LKVKDDKTLLFGEKAVTVFGFRNPEEIPWGQTGADYIVESTGVFTDKDKAAAHLKGGAKK  120

Query  122  VVISAPSKDAPMFVMGVNHLEYKKDVDIVSNASCTTNCLA  3
            V+ISAPSKDAPMFV+GVN  EYK +++IVSNASCTTNCLA
Sbjct  121  VIISAPSKDAPMFVVGVNEKEYKPELNIVSNASCTTNCLA  160



>gb|EYU23146.1| hypothetical protein MIMGU_mgv1a009579mg [Erythranthe guttata]
Length=337

 Score =   253 bits (646),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 132/160 (83%), Positives = 143/160 (89%), Gaps = 0/160 (0%)
 Frame = -2

Query  482  MAKVKIGINGFGRIGRLVARVALLSDDIELVAVNDPFITTDYMTYMFKYDTVHGQWTKNE  303
            MAK+KIGINGFGRIGRLVARVAL  DD+ELVAVNDPFIT DYMTYMFKYD+VHGQW  +E
Sbjct  1    MAKIKIGINGFGRIGRLVARVALQRDDVELVAVNDPFITVDYMTYMFKYDSVHGQWKHDE  60

Query  302  LKVKDAKTLLFGDRHVAVFDKRNPEEIPWGETGAEYVVESTGVFTDQDkaaahlkggakK  123
            L VKD KTLLFG + V VF  RNPEEIPWGETGAEY+VESTGVFTD+DKAAAHLKGGAKK
Sbjct  61   LTVKDEKTLLFGKKPVTVFGFRNPEEIPWGETGAEYIVESTGVFTDKDKAAAHLKGGAKK  120

Query  122  VVISAPSKDAPMFVMGVNHLEYKKDVDIVSNASCTTNCLA  3
            V+ISAPSKDAPMFV+GVN   Y  D++IVSNASCTTNCLA
Sbjct  121  VIISAPSKDAPMFVVGVNEKSYTSDLNIVSNASCTTNCLA  160



>gb|AGW24628.1| glyceraldehyde 3-phosphate dehydrogenase [Salvia miltiorrhiza]
Length=337

 Score =   253 bits (645),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 132/160 (83%), Positives = 143/160 (89%), Gaps = 0/160 (0%)
 Frame = -2

Query  482  MAKVKIGINGFGRIGRLVARVALLSDDIELVAVNDPFITTDYMTYMFKYDTVHGQWTKNE  303
            MAK+KIGINGFGRIGRLVARVAL  DD+ELVAVNDPFIT DYMTYMFKYD+VHGQW  +E
Sbjct  1    MAKIKIGINGFGRIGRLVARVALQRDDVELVAVNDPFITVDYMTYMFKYDSVHGQWKHHE  60

Query  302  LKVKDAKTLLFGDRHVAVFDKRNPEEIPWGETGAEYVVESTGVFTDQDkaaahlkggakK  123
            LKVKD KTLLFG++ V VF  RNPEEIPW  TGAEY+VESTGVFTDQDKAAAHLKGGAKK
Sbjct  61   LKVKDEKTLLFGEKPVTVFGFRNPEEIPWASTGAEYIVESTGVFTDQDKAAAHLKGGAKK  120

Query  122  VVISAPSKDAPMFVMGVNHLEYKKDVDIVSNASCTTNCLA  3
            V+ISAPSKDAPMFV+GVN   Y  D++IVSNASCTTNCLA
Sbjct  121  VIISAPSKDAPMFVVGVNEKSYTPDLNIVSNASCTTNCLA  160



>ref|NP_001275277.1| glyceraldehyde-3-phosphate dehydrogenase, cytosolic-like [Solanum 
tuberosum]
 gb|AFX67011.1| glyceraldehyde 3-phosphate dehydrogenase [Solanum tuberosum]
Length=337

 Score =   253 bits (645),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 131/160 (82%), Positives = 146/160 (91%), Gaps = 0/160 (0%)
 Frame = -2

Query  482  MAKVKIGINGFGRIGRLVARVALLSDDIELVAVNDPFITTDYMTYMFKYDTVHGQWTKNE  303
            MAKVKIGINGFGRIGRLVARVAL  DD+ELVAVNDPFI+ DYMTYMFKYD+VHGQW  +E
Sbjct  1    MAKVKIGINGFGRIGRLVARVALQRDDVELVAVNDPFISVDYMTYMFKYDSVHGQWKHHE  60

Query  302  LKVKDAKTLLFGDRHVAVFDKRNPEEIPWGETGAEYVVESTGVFTDQDkaaahlkggakK  123
            LKVKD KTLLFG++ V VF  RNPEEIPW +TGA+Y+VESTGVFTD+DKAAAHLKGGAKK
Sbjct  61   LKVKDEKTLLFGEKAVTVFGFRNPEEIPWAQTGADYIVESTGVFTDKDKAAAHLKGGAKK  120

Query  122  VVISAPSKDAPMFVMGVNHLEYKKDVDIVSNASCTTNCLA  3
            V+ISAPSKDAPMFV+GVN  EYK +++IVSNASCTTNCLA
Sbjct  121  VIISAPSKDAPMFVVGVNEKEYKPELNIVSNASCTTNCLA  160



>ref|XP_010677936.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase [Beta vulgaris 
subsp. vulgaris]
 gb|ABN50381.1| glyceraldehyde-3-phosphate dehydogenase [Beta vulgaris]
Length=337

 Score =   253 bits (645),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 133/160 (83%), Positives = 146/160 (91%), Gaps = 0/160 (0%)
 Frame = -2

Query  482  MAKVKIGINGFGRIGRLVARVALLSDDIELVAVNDPFITTDYMTYMFKYDTVHGQWTKNE  303
            MAK+KIGINGFGRIGRLVARV L  DD+ELVAVNDPFITTDYMTYMFKYD+VHGQW  +E
Sbjct  1    MAKIKIGINGFGRIGRLVARVILQRDDVELVAVNDPFITTDYMTYMFKYDSVHGQWKHHE  60

Query  302  LKVKDAKTLLFGDRHVAVFDKRNPEEIPWGETGAEYVVESTGVFTDQDkaaahlkggakK  123
            LKVKD KTLLFG++ V+VF  RNPEEIPW +TGA++VVESTGVFTD+DKAAAHLKGGAKK
Sbjct  61   LKVKDEKTLLFGEKPVSVFGCRNPEEIPWSQTGADFVVESTGVFTDKDKAAAHLKGGAKK  120

Query  122  VVISAPSKDAPMFVMGVNHLEYKKDVDIVSNASCTTNCLA  3
            VVISAPSKDAPMFV+GVN  EYK D+ IVSNASCTTNCLA
Sbjct  121  VVISAPSKDAPMFVVGVNEHEYKSDLHIVSNASCTTNCLA  160



>gb|AIL56405.1| glyceraldehyde-3-phosphate dehydrogenase [Chrysanthemum x morifolium]
Length=341

 Score =   253 bits (646),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 133/158 (84%), Positives = 144/158 (91%), Gaps = 0/158 (0%)
 Frame = -2

Query  476  KVKIGINGFGRIGRLVARVALLSDDIELVAVNDPFITTDYMTYMFKYDTVHGQWTKNELK  297
            K+KIGINGFGRIGRLVARVAL  DDIELVAVNDPFI+TDYMTYMFKYDTVHGQW  +ELK
Sbjct  6    KIKIGINGFGRIGRLVARVALQRDDIELVAVNDPFISTDYMTYMFKYDTVHGQWKHHELK  65

Query  296  VKDAKTLLFGDRHVAVFDKRNPEEIPWGETGAEYVVESTGVFTDQDkaaahlkggakKVV  117
            VKD KTLLFG++ V+VF  RNPEEIPWG  GA++VVESTGVFTD+DKAAAHLKGGAKKVV
Sbjct  66   VKDEKTLLFGEKPVSVFGFRNPEEIPWGAAGADFVVESTGVFTDKDKAAAHLKGGAKKVV  125

Query  116  ISAPSKDAPMFVMGVNHLEYKKDVDIVSNASCTTNCLA  3
            ISAPSKDAPMFVMGVN  EY  D++IVSNASCTTNCLA
Sbjct  126  ISAPSKDAPMFVMGVNEKEYTADLNIVSNASCTTNCLA  163



>emb|CDX74199.1| BnaA03g28480D [Brassica napus]
Length=352

 Score =   253 bits (646),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 132/163 (81%), Positives = 146/163 (90%), Gaps = 0/163 (0%)
 Frame = -2

Query  491  FIIMAKVKIGINGFGRIGRLVARVALLSDDIELVAVNDPFITTDYMTYMFKYDTVHGQWT  312
            F+   K+KIGINGFGRIGRLVARV L  DD+ELVAVNDPFITT+YMTYMFKYD+VHGQW 
Sbjct  14   FVAGGKIKIGINGFGRIGRLVARVVLQRDDVELVAVNDPFITTEYMTYMFKYDSVHGQWK  73

Query  311  KNELKVKDAKTLLFGDRHVAVFDKRNPEEIPWGETGAEYVVESTGVFTDQDkaaahlkgg  132
             NELKVKD KTLLFG++ V VF  RNPE+IPWGE GA++VVESTGVFTD+DKAAAHLKGG
Sbjct  74   HNELKVKDEKTLLFGEKPVTVFGIRNPEDIPWGEAGADFVVESTGVFTDKDKAAAHLKGG  133

Query  131  akKVVISAPSKDAPMFVMGVNHLEYKKDVDIVSNASCTTNCLA  3
            AKKVVISAPSKDAPMFV+GVN  EYK ++DIVSNASCTTNCLA
Sbjct  134  AKKVVISAPSKDAPMFVVGVNEHEYKSNLDIVSNASCTTNCLA  176



>gb|AEQ75490.1| glyeraldehyde 3-phosphate dehydrogenase [Rosa multiflora]
Length=336

 Score =   253 bits (645),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 135/160 (84%), Positives = 144/160 (90%), Gaps = 0/160 (0%)
 Frame = -2

Query  482  MAKVKIGINGFGRIGRLVARVALLSDDIELVAVNDPFITTDYMTYMFKYDTVHGQWTKNE  303
            MAK+KIGINGFGRIGRLVARVAL  DD+ELVAVNDPFITTDYMTYMFKYDTVHG W  +E
Sbjct  1    MAKIKIGINGFGRIGRLVARVALQRDDVELVAVNDPFITTDYMTYMFKYDTVHGAWKHHE  60

Query  302  LKVKDAKTLLFGDRHVAVFDKRNPEEIPWGETGAEYVVESTGVFTDQDkaaahlkggakK  123
            LKVKD KTLLFG++ VAVF  RNPEEIPWG  GA+ VVESTGVFTD+DKAAAHLKGGAKK
Sbjct  61   LKVKDEKTLLFGEKPVAVFGLRNPEEIPWGSVGADIVVESTGVFTDKDKAAAHLKGGAKK  120

Query  122  VVISAPSKDAPMFVMGVNHLEYKKDVDIVSNASCTTNCLA  3
            VVISAPSKDAPMFV+GVN  EYK D+ IVSNASCTTNCLA
Sbjct  121  VVISAPSKDAPMFVVGVNEHEYKSDLCIVSNASCTTNCLA  160



>ref|XP_008341346.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase, cytosolic-like 
[Malus domestica]
Length=337

 Score =   252 bits (644),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 130/160 (81%), Positives = 144/160 (90%), Gaps = 0/160 (0%)
 Frame = -2

Query  482  MAKVKIGINGFGRIGRLVARVALLSDDIELVAVNDPFITTDYMTYMFKYDTVHGQWTKNE  303
            M+K+KIGINGFGRIGRLVARVAL  DDIELVAVNDPFI  +YM+YMFKYDTVHGQW  +E
Sbjct  1    MSKIKIGINGFGRIGRLVARVALQRDDIELVAVNDPFINIEYMSYMFKYDTVHGQWKHHE  60

Query  302  LKVKDAKTLLFGDRHVAVFDKRNPEEIPWGETGAEYVVESTGVFTDQDkaaahlkggakK  123
            LKVKD KTLLFGD+ V VF  R+PE+IPWGE GAEYVVESTGVFTD++KA+ HLKGGAKK
Sbjct  61   LKVKDDKTLLFGDKPVKVFASRDPEQIPWGEAGAEYVVESTGVFTDKEKASLHLKGGAKK  120

Query  122  VVISAPSKDAPMFVMGVNHLEYKKDVDIVSNASCTTNCLA  3
            V+ISAPSKDAPMFV+GVN  EYK D+DIVSNASCTTNCLA
Sbjct  121  VIISAPSKDAPMFVVGVNEKEYKPDLDIVSNASCTTNCLA  160



>ref|XP_006297911.1| hypothetical protein CARUB_v10013953mg [Capsella rubella]
 gb|EOA30809.1| hypothetical protein CARUB_v10013953mg [Capsella rubella]
Length=379

 Score =   254 bits (648),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 135/179 (75%), Positives = 152/179 (85%), Gaps = 6/179 (3%)
 Frame = -2

Query  521  FDSIPFHSREFIIMA------KVKIGINGFGRIGRLVARVALLSDDIELVAVNDPFITTD  360
            F + P HS+++   +      K+KIGINGFGRIGRLVARV L  DD+ELVAVNDPFITT+
Sbjct  25   FHADPNHSKQYKEYSRSAPDKKIKIGINGFGRIGRLVARVVLQRDDVELVAVNDPFITTE  84

Query  359  YMTYMFKYDTVHGQWTKNELKVKDAKTLLFGDRHVAVFDKRNPEEIPWGETGAEYVVEST  180
            YMTYMFKYD+VHGQW  NELK+KD KTLLFG++ V VF  RNPE+IPW E GA+YVVEST
Sbjct  85   YMTYMFKYDSVHGQWKHNELKIKDEKTLLFGEKPVTVFGIRNPEDIPWAEAGADYVVEST  144

Query  179  GVFTDQDkaaahlkggakKVVISAPSKDAPMFVMGVNHLEYKKDVDIVSNASCTTNCLA  3
            GVFTD+DKAAAHLKGGAKKVVISAPSKDAPMFV+GVN  EYK D+DIVSNASCTTNCLA
Sbjct  145  GVFTDKDKAAAHLKGGAKKVVISAPSKDAPMFVVGVNEHEYKSDLDIVSNASCTTNCLA  203



>ref|XP_009134752.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase, cytosolic-like 
isoform X2 [Brassica rapa]
Length=309

 Score =   251 bits (641),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 131/159 (82%), Positives = 144/159 (91%), Gaps = 0/159 (0%)
 Frame = -2

Query  479  AKVKIGINGFGRIGRLVARVALLSDDIELVAVNDPFITTDYMTYMFKYDTVHGQWTKNEL  300
             K+KIGINGFGRIGRLVARV L  DD+ELVAVNDPFITT+YMTYMFKYD+VHGQW  NEL
Sbjct  4    GKIKIGINGFGRIGRLVARVVLQRDDVELVAVNDPFITTEYMTYMFKYDSVHGQWKHNEL  63

Query  299  KVKDAKTLLFGDRHVAVFDKRNPEEIPWGETGAEYVVESTGVFTDQDkaaahlkggakKV  120
            KVKD KTLLFG++ V VF  RNPE+IPWGE GA++VVESTGVFTD+DKAAAHLKGGAKKV
Sbjct  64   KVKDEKTLLFGEKPVTVFGIRNPEDIPWGEAGADFVVESTGVFTDKDKAAAHLKGGAKKV  123

Query  119  VISAPSKDAPMFVMGVNHLEYKKDVDIVSNASCTTNCLA  3
            VISAPSKDAPMFV+GVN  EYK ++DIVSNASCTTNCLA
Sbjct  124  VISAPSKDAPMFVVGVNEHEYKSNLDIVSNASCTTNCLA  162



>ref|NP_001289219.1| glyceraldehyde-3-phosphate dehydrogenase, cytosolic [Pyrus x 
bretschneideri]
 gb|AFG28407.1| glyceraldehyde-3-phosphate dehydrogenase C2 [Pyrus x bretschneideri]
Length=341

 Score =   252 bits (644),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 130/158 (82%), Positives = 146/158 (92%), Gaps = 0/158 (0%)
 Frame = -2

Query  476  KVKIGINGFGRIGRLVARVALLSDDIELVAVNDPFITTDYMTYMFKYDTVHGQWTKNELK  297
            K+KIGINGFGRIGRLVARVAL  DD+ELVAVNDPFITTDYMTYMFKYDTVHG W  +ELK
Sbjct  7    KIKIGINGFGRIGRLVARVALQRDDVELVAVNDPFITTDYMTYMFKYDTVHGAWKHHELK  66

Query  296  VKDAKTLLFGDRHVAVFDKRNPEEIPWGETGAEYVVESTGVFTDQDkaaahlkggakKVV  117
            VKD+KTLLFG++ VAVF  RNPEE+PWGETGA++VVESTGVFTD++KAAAH+KGGAKKV+
Sbjct  67   VKDSKTLLFGEKPVAVFGIRNPEEVPWGETGADFVVESTGVFTDKEKAAAHIKGGAKKVI  126

Query  116  ISAPSKDAPMFVMGVNHLEYKKDVDIVSNASCTTNCLA  3
            ISAPSKDAPMFV+GVN  EYK D+ I+SNASCTTNCLA
Sbjct  127  ISAPSKDAPMFVVGVNEKEYKPDIHILSNASCTTNCLA  164



>ref|XP_002315632.1| glyceraldehyde 3-phosphate dehydrogenase family protein [Populus 
trichocarpa]
 gb|ABK92510.1| unknown [Populus trichocarpa]
 gb|ABK94970.1| unknown [Populus trichocarpa]
 gb|EEF01803.1| glyceraldehyde 3-phosphate dehydrogenase family protein [Populus 
trichocarpa]
Length=341

 Score =   252 bits (644),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 131/158 (83%), Positives = 144/158 (91%), Gaps = 0/158 (0%)
 Frame = -2

Query  476  KVKIGINGFGRIGRLVARVALLSDDIELVAVNDPFITTDYMTYMFKYDTVHGQWTKNELK  297
            K+KIGINGFGRIGRLVARVAL  DD+ELVA+NDPFITTDYMTYMFKYDTVHG+W  +ELK
Sbjct  6    KIKIGINGFGRIGRLVARVALQRDDVELVAINDPFITTDYMTYMFKYDTVHGRWKHSELK  65

Query  296  VKDAKTLLFGDRHVAVFDKRNPEEIPWGETGAEYVVESTGVFTDQDkaaahlkggakKVV  117
            VKD KTLLFG++ VAVF  RNPEEIPW + GAE+VVESTGVFTD+DKAAAHLKGGAKKVV
Sbjct  66   VKDEKTLLFGEKAVAVFGIRNPEEIPWAQAGAEFVVESTGVFTDKDKAAAHLKGGAKKVV  125

Query  116  ISAPSKDAPMFVMGVNHLEYKKDVDIVSNASCTTNCLA  3
            ISAPSKDAPMFV+GVN  +Y  D+DIVSNASCTTNCLA
Sbjct  126  ISAPSKDAPMFVVGVNEKQYTPDLDIVSNASCTTNCLA  163



>gb|ACR38628.1| unknown [Zea mays]
 gb|AFW61328.1| glyceraldehyde-3-phosphate dehydrogenase1 [Zea mays]
Length=337

 Score =   252 bits (643),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 132/160 (83%), Positives = 145/160 (91%), Gaps = 0/160 (0%)
 Frame = -2

Query  482  MAKVKIGINGFGRIGRLVARVALLSDDIELVAVNDPFITTDYMTYMFKYDTVHGQWTKNE  303
            M K+KIGINGFGRIGRLVARVAL S+D+ELVAVNDPFITTDYMTYMFKYDTVHG W  ++
Sbjct  1    MGKIKIGINGFGRIGRLVARVALQSEDVELVAVNDPFITTDYMTYMFKYDTVHGHWKHSD  60

Query  302  LKVKDAKTLLFGDRHVAVFDKRNPEEIPWGETGAEYVVESTGVFTDQDkaaahlkggakK  123
            + +KD+KTLLFGD+ V VF  RNPEEIPWGE GAEYVVESTGVFTD+DKAAAHLKGGAKK
Sbjct  61   ITLKDSKTLLFGDKPVTVFGIRNPEEIPWGEAGAEYVVESTGVFTDKDKAAAHLKGGAKK  120

Query  122  VVISAPSKDAPMFVMGVNHLEYKKDVDIVSNASCTTNCLA  3
            VVISAPSKDAPMFV+GVN  +Y  DV+IVSNASCTTNCLA
Sbjct  121  VVISAPSKDAPMFVVGVNEDKYTSDVNIVSNASCTTNCLA  160



>ref|XP_004502328.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase, cytosolic-like 
[Cicer arietinum]
Length=340

 Score =   252 bits (644),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 131/158 (83%), Positives = 145/158 (92%), Gaps = 0/158 (0%)
 Frame = -2

Query  476  KVKIGINGFGRIGRLVARVALLSDDIELVAVNDPFITTDYMTYMFKYDTVHGQWTKNELK  297
            K++IGINGFGRIGRLVARVAL  DD+ELVA+NDPFITTDYMTYMFKYDTVHGQW   +LK
Sbjct  6    KIRIGINGFGRIGRLVARVALQRDDVELVAINDPFITTDYMTYMFKYDTVHGQWKHFDLK  65

Query  296  VKDAKTLLFGDRHVAVFDKRNPEEIPWGETGAEYVVESTGVFTDQDkaaahlkggakKVV  117
            VKD+KTLLFG++ V VF  RNPEEIPWGE GA+YVVESTGVFTD+DKAAAHLKGGAKKVV
Sbjct  66   VKDSKTLLFGEKTVTVFGTRNPEEIPWGEVGADYVVESTGVFTDKDKAAAHLKGGAKKVV  125

Query  116  ISAPSKDAPMFVMGVNHLEYKKDVDIVSNASCTTNCLA  3
            ISAPSKDAPMFV+GVN  EYK +++IVSNASCTTNCLA
Sbjct  126  ISAPSKDAPMFVVGVNENEYKPELNIVSNASCTTNCLA  163



>ref|XP_003553883.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase, cytosolic-like 
[Glycine max]
Length=337

 Score =   252 bits (643),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 131/158 (83%), Positives = 143/158 (91%), Gaps = 0/158 (0%)
 Frame = -2

Query  476  KVKIGINGFGRIGRLVARVALLSDDIELVAVNDPFITTDYMTYMFKYDTVHGQWTKNELK  297
            K+KIGINGFGRIGRLVARVA+ +DD+ELVAVNDPFITTDYMTYMFKYDTVHGQ+   E+K
Sbjct  4    KIKIGINGFGRIGRLVARVAMQNDDVELVAVNDPFITTDYMTYMFKYDTVHGQFKNCEIK  63

Query  296  VKDAKTLLFGDRHVAVFDKRNPEEIPWGETGAEYVVESTGVFTDQDkaaahlkggakKVV  117
            VKD+KTLLFG   V VF  RNPEEIPWGE GA+YVVESTGVFTDQDKAAAHLKGGAKKV+
Sbjct  64   VKDSKTLLFGSSSVTVFGIRNPEEIPWGEAGADYVVESTGVFTDQDKAAAHLKGGAKKVI  123

Query  116  ISAPSKDAPMFVMGVNHLEYKKDVDIVSNASCTTNCLA  3
            ISAPSKDAPMFV+GVN  EYK D+ +VSNASCTTNCLA
Sbjct  124  ISAPSKDAPMFVVGVNEKEYKSDITVVSNASCTTNCLA  161



>gb|AAR84410.2| glyceraldehyde 3-phosphate dehydrogenase [Daucus carota]
Length=337

 Score =   252 bits (643),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 132/160 (83%), Positives = 144/160 (90%), Gaps = 0/160 (0%)
 Frame = -2

Query  482  MAKVKIGINGFGRIGRLVARVALLSDDIELVAVNDPFITTDYMTYMFKYDTVHGQWTKNE  303
            MA +KIGINGFGRIGRLVARVAL  DD+ELVAVNDPFI+TDYMTYMFKYD+VHG W  +E
Sbjct  1    MAPIKIGINGFGRIGRLVARVALQRDDVELVAVNDPFISTDYMTYMFKYDSVHGAWKHHE  60

Query  302  LKVKDAKTLLFGDRHVAVFDKRNPEEIPWGETGAEYVVESTGVFTDQDkaaahlkggakK  123
            LKVKD KTLLFG++ VAVF  RNPEEIPW  TGAEY+VESTGVFTD+DKAAAHLKGGAKK
Sbjct  61   LKVKDEKTLLFGEKPVAVFGCRNPEEIPWASTGAEYIVESTGVFTDKDKAAAHLKGGAKK  120

Query  122  VVISAPSKDAPMFVMGVNHLEYKKDVDIVSNASCTTNCLA  3
            V+ISAPSKDAPMFV+GVN  EYK D+ IVSNASCTTNCLA
Sbjct  121  VIISAPSKDAPMFVVGVNEKEYKSDLHIVSNASCTTNCLA  160



>gb|KFK37847.1| hypothetical protein AALP_AA3G036600 [Arabis alpina]
Length=338

 Score =   252 bits (643),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 132/159 (83%), Positives = 145/159 (91%), Gaps = 0/159 (0%)
 Frame = -2

Query  479  AKVKIGINGFGRIGRLVARVALLSDDIELVAVNDPFITTDYMTYMFKYDTVHGQWTKNEL  300
            AK+KIGINGFGRIGRLVARV L  DD+ELVAVNDPFITT+YMTYMFKYD+VHGQW  +EL
Sbjct  4    AKIKIGINGFGRIGRLVARVVLQRDDVELVAVNDPFITTEYMTYMFKYDSVHGQWKHHEL  63

Query  299  KVKDAKTLLFGDRHVAVFDKRNPEEIPWGETGAEYVVESTGVFTDQDkaaahlkggakKV  120
            KVKD KTLLFG++ V VF  RNPE+IPWGE GA++VVESTGVFTD+DKAAAHLKGGAKKV
Sbjct  64   KVKDEKTLLFGEKPVTVFGIRNPEDIPWGEAGADFVVESTGVFTDKDKAAAHLKGGAKKV  123

Query  119  VISAPSKDAPMFVMGVNHLEYKKDVDIVSNASCTTNCLA  3
            VISAPSKDAPMFV+GVN  EYK D+DIVSNASCTTNCLA
Sbjct  124  VISAPSKDAPMFVVGVNEHEYKSDLDIVSNASCTTNCLA  162



>gb|AFW61324.1| glyceraldehyde-3-phosphate dehydrogenase1 [Zea mays]
Length=354

 Score =   252 bits (644),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 133/166 (80%), Positives = 147/166 (89%), Gaps = 0/166 (0%)
 Frame = -2

Query  500  SREFIIMAKVKIGINGFGRIGRLVARVALLSDDIELVAVNDPFITTDYMTYMFKYDTVHG  321
            SR  +   K+KIGINGFGRIGRLVARVAL S+D+ELVAVNDPFITTDYMTYMFKYDTVHG
Sbjct  49   SRSSLDAGKIKIGINGFGRIGRLVARVALQSEDVELVAVNDPFITTDYMTYMFKYDTVHG  108

Query  320  QWTKNELKVKDAKTLLFGDRHVAVFDKRNPEEIPWGETGAEYVVESTGVFTDQDkaaahl  141
             W  +++ +KD+KTLLFGD+ V VF  RNPEEIPWGE GAEYVVESTGVFTD+DKAAAHL
Sbjct  109  HWKHSDITLKDSKTLLFGDKPVTVFGIRNPEEIPWGEAGAEYVVESTGVFTDKDKAAAHL  168

Query  140  kggakKVVISAPSKDAPMFVMGVNHLEYKKDVDIVSNASCTTNCLA  3
            KGGAKKVVISAPSKDAPMFV+GVN  +Y  DV+IVSNASCTTNCLA
Sbjct  169  KGGAKKVVISAPSKDAPMFVVGVNEDKYTSDVNIVSNASCTTNCLA  214



>ref|NP_001105413.1| glyceraldehyde-3-phosphate dehydrogenase 1, cytosolic [Zea mays]
 emb|CAA30151.1| unnamed protein product [Zea mays]
Length=337

 Score =   252 bits (643),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 132/160 (83%), Positives = 145/160 (91%), Gaps = 0/160 (0%)
 Frame = -2

Query  482  MAKVKIGINGFGRIGRLVARVALLSDDIELVAVNDPFITTDYMTYMFKYDTVHGQWTKNE  303
            M K+KIGINGFGRIGRLVARVAL S+D+ELVAVNDPFITTDYMTYMFKYDTVHG W  ++
Sbjct  1    MGKIKIGINGFGRIGRLVARVALQSEDVELVAVNDPFITTDYMTYMFKYDTVHGHWKHSD  60

Query  302  LKVKDAKTLLFGDRHVAVFDKRNPEEIPWGETGAEYVVESTGVFTDQDkaaahlkggakK  123
            + +KD+KTLLFGD+ V VF  RNPEEIPWGE GAEYVVESTGVFTD+DKAAAHLKGGAKK
Sbjct  61   ITLKDSKTLLFGDKPVTVFGIRNPEEIPWGEAGAEYVVESTGVFTDKDKAAAHLKGGAKK  120

Query  122  VVISAPSKDAPMFVMGVNHLEYKKDVDIVSNASCTTNCLA  3
            VVISAPSKDAPMFV+GVN  +Y  DV+IVSNASCTTNCLA
Sbjct  121  VVISAPSKDAPMFVVGVNEDKYTSDVNIVSNASCTTNCLA  160



>gb|AGH68507.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Ipomoea batatas]
Length=210

 Score =   248 bits (632),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 128/160 (80%), Positives = 144/160 (90%), Gaps = 0/160 (0%)
 Frame = -2

Query  482  MAKVKIGINGFGRIGRLVARVALLSDDIELVAVNDPFITTDYMTYMFKYDTVHGQWTKNE  303
            M K+KIGINGFGRIGRLVARVAL S+D+ELVAVNDPFI+T+YMTYMFKYDTVHGQW  ++
Sbjct  1    MGKIKIGINGFGRIGRLVARVALHSEDVELVAVNDPFISTEYMTYMFKYDTVHGQWKHHD  60

Query  302  LKVKDAKTLLFGDRHVAVFDKRNPEEIPWGETGAEYVVESTGVFTDQDkaaahlkggakK  123
            +KV+D KTLLFG++ V VF  RNPEEIPW E GAEYVVESTGVFTD+DKAAAHLK GAKK
Sbjct  61   VKVQDEKTLLFGEKSVKVFGCRNPEEIPWAEAGAEYVVESTGVFTDKDKAAAHLKAGAKK  120

Query  122  VVISAPSKDAPMFVMGVNHLEYKKDVDIVSNASCTTNCLA  3
            VVISAPSKDAPMFV+GVN  EY  +++IVSNASCTTNCLA
Sbjct  121  VVISAPSKDAPMFVVGVNEKEYMPELNIVSNASCTTNCLA  160



>gb|AEP31954.1| glyceraldehyde-3-phosphate dehydrogenase [Aeluropus lagopoides]
Length=337

 Score =   252 bits (643),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 132/160 (83%), Positives = 145/160 (91%), Gaps = 0/160 (0%)
 Frame = -2

Query  482  MAKVKIGINGFGRIGRLVARVALLSDDIELVAVNDPFITTDYMTYMFKYDTVHGQWTKNE  303
            M K+KIGINGFGRIGRLVARVAL S+D+ELVAVNDPFITTDYMTYMFKYDTVHGQW  ++
Sbjct  1    MGKIKIGINGFGRIGRLVARVALQSEDVELVAVNDPFITTDYMTYMFKYDTVHGQWKHSD  60

Query  302  LKVKDAKTLLFGDRHVAVFDKRNPEEIPWGETGAEYVVESTGVFTDQDkaaahlkggakK  123
            +KVKDAKTLLFG + V VF  RNPEEIPW E GAEYVVESTGVFTD++KAAAHLKGGAKK
Sbjct  61   IKVKDAKTLLFGQKPVTVFGIRNPEEIPWAEAGAEYVVESTGVFTDKEKAAAHLKGGAKK  120

Query  122  VVISAPSKDAPMFVMGVNHLEYKKDVDIVSNASCTTNCLA  3
            VVISAPSKDAPMFV+GVN  +Y  D++IVSNASCTTNCLA
Sbjct  121  VVISAPSKDAPMFVVGVNEDKYTSDLNIVSNASCTTNCLA  160



>ref|XP_002882331.1| glyceraldehyde-3-phosphate dehydrogenase C subunit [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH58590.1| glyceraldehyde-3-phosphate dehydrogenase C subunit [Arabidopsis 
lyrata subsp. lyrata]
Length=338

 Score =   252 bits (643),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 131/158 (83%), Positives = 143/158 (91%), Gaps = 0/158 (0%)
 Frame = -2

Query  476  KVKIGINGFGRIGRLVARVALLSDDIELVAVNDPFITTDYMTYMFKYDTVHGQWTKNELK  297
            K+KIGINGFGRIGRLVARV L  DD+ELVAVNDPFITT+YMTYMFKYD+VHGQW  NELK
Sbjct  5    KIKIGINGFGRIGRLVARVVLQRDDVELVAVNDPFITTEYMTYMFKYDSVHGQWKHNELK  64

Query  296  VKDAKTLLFGDRHVAVFDKRNPEEIPWGETGAEYVVESTGVFTDQDkaaahlkggakKVV  117
            +KD KTLLFG++ V VF  RNPE+IPW E GA+YVVESTGVFTD+DKAAAHLKGGAKKVV
Sbjct  65   IKDEKTLLFGEKPVTVFGIRNPEDIPWAEAGADYVVESTGVFTDKDKAAAHLKGGAKKVV  124

Query  116  ISAPSKDAPMFVMGVNHLEYKKDVDIVSNASCTTNCLA  3
            ISAPSKDAPMFV+GVN  EYK D+DIVSNASCTTNCLA
Sbjct  125  ISAPSKDAPMFVVGVNEHEYKSDLDIVSNASCTTNCLA  162



>sp|P08735.2|G3PC1_MAIZE RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase 1, cytosolic 
[Zea mays]
 emb|CAA33620.1| GAPDH [Zea mays]
 gb|ACG25181.1| glyceraldehyde-3-phosphate dehydrogenase, cytosolic [Zea mays]
Length=337

 Score =   252 bits (643),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 132/160 (83%), Positives = 145/160 (91%), Gaps = 0/160 (0%)
 Frame = -2

Query  482  MAKVKIGINGFGRIGRLVARVALLSDDIELVAVNDPFITTDYMTYMFKYDTVHGQWTKNE  303
            M K+KIGINGFGRIGRLVARVAL S+D+ELVAVNDPFITTDYMTYMFKYDTVHG W  ++
Sbjct  1    MGKIKIGINGFGRIGRLVARVALQSEDVELVAVNDPFITTDYMTYMFKYDTVHGHWKHSD  60

Query  302  LKVKDAKTLLFGDRHVAVFDKRNPEEIPWGETGAEYVVESTGVFTDQDkaaahlkggakK  123
            + +KD+KTLLFGD+ V VF  RNPEEIPWGE GAEYVVESTGVFTD+DKAAAHLKGGAKK
Sbjct  61   ITLKDSKTLLFGDKPVTVFGIRNPEEIPWGEAGAEYVVESTGVFTDKDKAAAHLKGGAKK  120

Query  122  VVISAPSKDAPMFVMGVNHLEYKKDVDIVSNASCTTNCLA  3
            VVISAPSKDAPMFV+GVN  +Y  DV+IVSNASCTTNCLA
Sbjct  121  VVISAPSKDAPMFVVGVNEDKYTSDVNIVSNASCTTNCLA  160



>gb|AGY14240.1| glyceraldehyde 3-phosphate dehydrogenase [Eschenbachia blinii]
Length=339

 Score =   252 bits (643),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 133/158 (84%), Positives = 143/158 (91%), Gaps = 0/158 (0%)
 Frame = -2

Query  476  KVKIGINGFGRIGRLVARVALLSDDIELVAVNDPFITTDYMTYMFKYDTVHGQWTKNELK  297
            K+KIGINGFGRIGRLVARVAL  DDIELVAVNDPFI+TDYMTYMFKYDTVHGQW  +ELK
Sbjct  6    KIKIGINGFGRIGRLVARVALQRDDIELVAVNDPFISTDYMTYMFKYDTVHGQWKHHELK  65

Query  296  VKDAKTLLFGDRHVAVFDKRNPEEIPWGETGAEYVVESTGVFTDQDkaaahlkggakKVV  117
            VKD KTLLFG++ V+VF  RNPEE PWG  GA++VVESTGVFTD+DKAAAHLKGGAKKVV
Sbjct  66   VKDEKTLLFGEKPVSVFGFRNPEETPWGAAGADFVVESTGVFTDKDKAAAHLKGGAKKVV  125

Query  116  ISAPSKDAPMFVMGVNHLEYKKDVDIVSNASCTTNCLA  3
            ISAPSKDAPMFVMGVN  EY  DV+IVSNASCTTNCLA
Sbjct  126  ISAPSKDAPMFVMGVNEKEYTSDVNIVSNASCTTNCLA  163



>ref|XP_006848723.1| hypothetical protein AMTR_s00177p00047570 [Amborella trichopoda]
 gb|ERN10304.1| hypothetical protein AMTR_s00177p00047570 [Amborella trichopoda]
Length=229

 Score =   248 bits (633),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 131/158 (83%), Positives = 143/158 (91%), Gaps = 0/158 (0%)
 Frame = -2

Query  476  KVKIGINGFGRIGRLVARVALLSDDIELVAVNDPFITTDYMTYMFKYDTVHGQWTKNELK  297
            K+KIGINGFGRIGRLVARVALL DDIELVAVNDPFI+ +YM YMFKYD+VHGQW  ++LK
Sbjct  8    KIKIGINGFGRIGRLVARVALLRDDIELVAVNDPFISPEYMIYMFKYDSVHGQWKHHDLK  67

Query  296  VKDAKTLLFGDRHVAVFDKRNPEEIPWGETGAEYVVESTGVFTDQDkaaahlkggakKVV  117
            +KD+KTLLFG++ V VF  RNPEEI WGE GAEYVVESTGVFTD+DKAAAHLKGGAKKVV
Sbjct  68   LKDSKTLLFGEKPVTVFGNRNPEEIAWGEAGAEYVVESTGVFTDKDKAAAHLKGGAKKVV  127

Query  116  ISAPSKDAPMFVMGVNHLEYKKDVDIVSNASCTTNCLA  3
            ISAPSKDAPMFV+GVN  EYK DV IVSNASCTTNCLA
Sbjct  128  ISAPSKDAPMFVVGVNEHEYKPDVHIVSNASCTTNCLA  165



>sp|P34924.1|G3PC_PINSY RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase, cytosolic 
[Pinus sylvestris]
 gb|AAA33779.1| glyceraldehyde-3-phosphate dehydrogenase [Pinus sylvestris]
Length=340

 Score =   252 bits (643),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 128/159 (81%), Positives = 144/159 (91%), Gaps = 0/159 (0%)
 Frame = -2

Query  479  AKVKIGINGFGRIGRLVARVALLSDDIELVAVNDPFITTDYMTYMFKYDTVHGQWTKNEL  300
             K+KIGINGFGRIGRLVARVAL  DDIELV VNDPFI+TDYM+YMFKYD+VHG+W  +E+
Sbjct  5    GKIKIGINGFGRIGRLVARVALTRDDIELVGVNDPFISTDYMSYMFKYDSVHGKWKHHEV  64

Query  299  KVKDAKTLLFGDRHVAVFDKRNPEEIPWGETGAEYVVESTGVFTDQDkaaahlkggakKV  120
             VKD+KTLLFG++ VAVF  RNPEEIPWGE GAEYVVESTGVFTD++KA+AHLK GAKKV
Sbjct  65   NVKDSKTLLFGEKSVAVFGCRNPEEIPWGEVGAEYVVESTGVFTDKEKASAHLKAGAKKV  124

Query  119  VISAPSKDAPMFVMGVNHLEYKKDVDIVSNASCTTNCLA  3
            VISAPSKDAPMFV+GVN  +YK DV+IVSNASCTTNCLA
Sbjct  125  VISAPSKDAPMFVVGVNEHQYKSDVNIVSNASCTTNCLA  163



>dbj|BAN89461.1| glyceraldehyde-3-phosphate dehydrogenase C [Shorea beccariana]
Length=341

 Score =   252 bits (643),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 132/158 (84%), Positives = 145/158 (92%), Gaps = 0/158 (0%)
 Frame = -2

Query  476  KVKIGINGFGRIGRLVARVALLSDDIELVAVNDPFITTDYMTYMFKYDTVHGQWTKNELK  297
            K+KIGINGFGRIGRLVARVAL  +D+ELVAVNDPFI+TDYMTYMFKYD+VHGQW  +ELK
Sbjct  6    KIKIGINGFGRIGRLVARVALQRNDVELVAVNDPFISTDYMTYMFKYDSVHGQWKHHELK  65

Query  296  VKDAKTLLFGDRHVAVFDKRNPEEIPWGETGAEYVVESTGVFTDQDkaaahlkggakKVV  117
            VKD KTLLFG++ V VF  RNPEEIPW ETGAE+VVESTGVFTD+DKAAAHLKGGAKKVV
Sbjct  66   VKDEKTLLFGEKPVRVFGIRNPEEIPWAETGAEFVVESTGVFTDKDKAAAHLKGGAKKVV  125

Query  116  ISAPSKDAPMFVMGVNHLEYKKDVDIVSNASCTTNCLA  3
            ISAPSKDAPMFV+GVN  EYK ++DIVSNASCTTNCLA
Sbjct  126  ISAPSKDAPMFVVGVNEKEYKPELDIVSNASCTTNCLA  163



>sp|Q41595.1|G3PC_TAXBA RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase, cytosolic 
[Taxus baccata]
 gb|AAA89207.1| glyceraldehyde-phosphate dehydrogenase [Taxus baccata]
Length=340

 Score =   252 bits (643),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 132/159 (83%), Positives = 145/159 (91%), Gaps = 0/159 (0%)
 Frame = -2

Query  479  AKVKIGINGFGRIGRLVARVALLSDDIELVAVNDPFITTDYMTYMFKYDTVHGQWTKNEL  300
             K+KIGINGFGRIGRLVARVAL  DDIELVAVNDPFI+T+ +T +FKYD+VHGQW K+E+
Sbjct  5    GKIKIGINGFGRIGRLVARVALQRDDIELVAVNDPFISTESLTSLFKYDSVHGQWKKHEV  64

Query  299  KVKDAKTLLFGDRHVAVFDKRNPEEIPWGETGAEYVVESTGVFTDQDkaaahlkggakKV  120
            KVKD KTLLFG++HVAVF  RNPEEIPWGE GAEYVVESTGVFTD+DKAAAHLKGGAKKV
Sbjct  65   KVKDEKTLLFGEKHVAVFGCRNPEEIPWGEVGAEYVVESTGVFTDKDKAAAHLKGGAKKV  124

Query  119  VISAPSKDAPMFVMGVNHLEYKKDVDIVSNASCTTNCLA  3
            VISAPSKDAPMFV+GVN  EYK D+ IVSNASCTTNCLA
Sbjct  125  VISAPSKDAPMFVVGVNEHEYKSDLTIVSNASCTTNCLA  163



>ref|XP_008340167.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase, cytosolic 
[Malus domestica]
Length=341

 Score =   252 bits (643),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 130/158 (82%), Positives = 145/158 (92%), Gaps = 0/158 (0%)
 Frame = -2

Query  476  KVKIGINGFGRIGRLVARVALLSDDIELVAVNDPFITTDYMTYMFKYDTVHGQWTKNELK  297
            K+KIGINGFGRIGRLVARVAL  DD+ELVAVNDPFITTDYMTYMFKYDTVHG W  +ELK
Sbjct  7    KIKIGINGFGRIGRLVARVALQRDDVELVAVNDPFITTDYMTYMFKYDTVHGAWKHHELK  66

Query  296  VKDAKTLLFGDRHVAVFDKRNPEEIPWGETGAEYVVESTGVFTDQDkaaahlkggakKVV  117
            VKD+KTLLFG++ VAVF  RNPEEIPWGE GA++VVESTGVFTD++KAAAH+KGGAKKV+
Sbjct  67   VKDSKTLLFGEKPVAVFGIRNPEEIPWGEAGADFVVESTGVFTDKEKAAAHIKGGAKKVI  126

Query  116  ISAPSKDAPMFVMGVNHLEYKKDVDIVSNASCTTNCLA  3
            ISAPSKDAPMFV+GVN  EYK D+ I+SNASCTTNCLA
Sbjct  127  ISAPSKDAPMFVVGVNEKEYKPDIHILSNASCTTNCLA  164



>ref|XP_007163725.1| hypothetical protein PHAVU_001G259000g [Phaseolus vulgaris]
 gb|ESW35719.1| hypothetical protein PHAVU_001G259000g [Phaseolus vulgaris]
Length=340

 Score =   251 bits (642),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 130/158 (82%), Positives = 146/158 (92%), Gaps = 0/158 (0%)
 Frame = -2

Query  476  KVKIGINGFGRIGRLVARVALLSDDIELVAVNDPFITTDYMTYMFKYDTVHGQWTKNELK  297
            K++IGINGFGRIGRLVARVAL  +D+ELVA+NDPFITTDYMTYMFKYDTVHGQW   ++K
Sbjct  6    KIRIGINGFGRIGRLVARVALQRNDVELVAINDPFITTDYMTYMFKYDTVHGQWKHFDVK  65

Query  296  VKDAKTLLFGDRHVAVFDKRNPEEIPWGETGAEYVVESTGVFTDQDkaaahlkggakKVV  117
            VKD+KTLLFG++ VAVF  RNPE+IPWGE GA+YVVESTGVFTD+DKAAAHLKGGAKKVV
Sbjct  66   VKDSKTLLFGEKAVAVFGTRNPEDIPWGEVGADYVVESTGVFTDKDKAAAHLKGGAKKVV  125

Query  116  ISAPSKDAPMFVMGVNHLEYKKDVDIVSNASCTTNCLA  3
            ISAPSKDAPMFV+GVN  EYK ++DIVSNASCTTNCLA
Sbjct  126  ISAPSKDAPMFVVGVNEKEYKPELDIVSNASCTTNCLA  163



>gb|EPS63876.1| hypothetical protein M569_10906, partial [Genlisea aurea]
Length=191

 Score =   246 bits (629),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 128/158 (81%), Positives = 141/158 (89%), Gaps = 0/158 (0%)
 Frame = -2

Query  476  KVKIGINGFGRIGRLVARVALLSDDIELVAVNDPFITTDYMTYMFKYDTVHGQWTKNELK  297
            K+KIGINGFGRIGRLVARVAL  DD+ELVAVNDPFI+ DYMTYMFKYDTVHGQW   ELK
Sbjct  1    KIKIGINGFGRIGRLVARVALQRDDVELVAVNDPFISVDYMTYMFKYDTVHGQWKHYELK  60

Query  296  VKDAKTLLFGDRHVAVFDKRNPEEIPWGETGAEYVVESTGVFTDQDkaaahlkggakKVV  117
            VKD KTLLFG++ V VF  RNPEEIPW ETGAEY+VESTGVFTD+DKAAAHLKGGA+KV+
Sbjct  61   VKDEKTLLFGEKLVTVFGIRNPEEIPWSETGAEYIVESTGVFTDKDKAAAHLKGGARKVI  120

Query  116  ISAPSKDAPMFVMGVNHLEYKKDVDIVSNASCTTNCLA  3
            ISAPSKDAPMFV+GVN   Y  D++I+SNASCTTNCLA
Sbjct  121  ISAPSKDAPMFVVGVNEKSYTPDLNIISNASCTTNCLA  158



>gb|ABA03227.1| glyceraldehyde-3-phosphate dehydrogenase [Populus maximowiczii 
x Populus nigra]
Length=341

 Score =   251 bits (642),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 131/158 (83%), Positives = 143/158 (91%), Gaps = 0/158 (0%)
 Frame = -2

Query  476  KVKIGINGFGRIGRLVARVALLSDDIELVAVNDPFITTDYMTYMFKYDTVHGQWTKNELK  297
            K+KIGINGFGRIGRLVARVAL  DD+ELVA+NDPFITTDYMTYMFKYDTVHG+W   ELK
Sbjct  6    KIKIGINGFGRIGRLVARVALQRDDVELVAINDPFITTDYMTYMFKYDTVHGRWKHGELK  65

Query  296  VKDAKTLLFGDRHVAVFDKRNPEEIPWGETGAEYVVESTGVFTDQDkaaahlkggakKVV  117
            VKD KTLLFG++ VAVF  RNPEEIPW + GAE+VVESTGVFTD+DKAAAHLKGGAKKVV
Sbjct  66   VKDEKTLLFGEKAVAVFGIRNPEEIPWAQAGAEFVVESTGVFTDKDKAAAHLKGGAKKVV  125

Query  116  ISAPSKDAPMFVMGVNHLEYKKDVDIVSNASCTTNCLA  3
            ISAPSKDAPMFV+GVN  +Y  D+DIVSNASCTTNCLA
Sbjct  126  ISAPSKDAPMFVVGVNEKQYTPDLDIVSNASCTTNCLA  163



>ref|XP_004489569.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase 3, cytosolic-like 
[Cicer arietinum]
Length=338

 Score =   251 bits (642),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 131/159 (82%), Positives = 142/159 (89%), Gaps = 0/159 (0%)
 Frame = -2

Query  479  AKVKIGINGFGRIGRLVARVALLSDDIELVAVNDPFITTDYMTYMFKYDTVHGQWTKNEL  300
             K+KIGINGFGRIGRLVARVAL  DD+ELVAVNDPFITTDYMTYMFKYDTVHG W  +E+
Sbjct  3    GKIKIGINGFGRIGRLVARVALERDDVELVAVNDPFITTDYMTYMFKYDTVHGIWKNHEI  62

Query  299  KVKDAKTLLFGDRHVAVFDKRNPEEIPWGETGAEYVVESTGVFTDQDkaaahlkggakKV  120
             VKD+KTLLFG   V+VF  RNPEEIPWGE GAEYVVESTGVFTD+DKAAAHLKGGAKKV
Sbjct  63   TVKDSKTLLFGASQVSVFGARNPEEIPWGEVGAEYVVESTGVFTDKDKAAAHLKGGAKKV  122

Query  119  VISAPSKDAPMFVMGVNHLEYKKDVDIVSNASCTTNCLA  3
            +ISAPSKDAPM+V+GVN  EYK D+ IVSNASCTTNCLA
Sbjct  123  IISAPSKDAPMYVVGVNEKEYKSDIHIVSNASCTTNCLA  161



>ref|XP_009134751.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase, cytosolic-like 
isoform X1 [Brassica rapa]
Length=338

 Score =   251 bits (642),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 131/159 (82%), Positives = 144/159 (91%), Gaps = 0/159 (0%)
 Frame = -2

Query  479  AKVKIGINGFGRIGRLVARVALLSDDIELVAVNDPFITTDYMTYMFKYDTVHGQWTKNEL  300
             K+KIGINGFGRIGRLVARV L  DD+ELVAVNDPFITT+YMTYMFKYD+VHGQW  NEL
Sbjct  4    GKIKIGINGFGRIGRLVARVVLQRDDVELVAVNDPFITTEYMTYMFKYDSVHGQWKHNEL  63

Query  299  KVKDAKTLLFGDRHVAVFDKRNPEEIPWGETGAEYVVESTGVFTDQDkaaahlkggakKV  120
            KVKD KTLLFG++ V VF  RNPE+IPWGE GA++VVESTGVFTD+DKAAAHLKGGAKKV
Sbjct  64   KVKDEKTLLFGEKPVTVFGIRNPEDIPWGEAGADFVVESTGVFTDKDKAAAHLKGGAKKV  123

Query  119  VISAPSKDAPMFVMGVNHLEYKKDVDIVSNASCTTNCLA  3
            VISAPSKDAPMFV+GVN  EYK ++DIVSNASCTTNCLA
Sbjct  124  VISAPSKDAPMFVVGVNEHEYKSNLDIVSNASCTTNCLA  162



>ref|XP_010320554.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase isoform X1 
[Solanum lycopersicum]
Length=338

 Score =   251 bits (642),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 131/159 (82%), Positives = 145/159 (91%), Gaps = 0/159 (0%)
 Frame = -2

Query  479  AKVKIGINGFGRIGRLVARVALLSDDIELVAVNDPFITTDYMTYMFKYDTVHGQWTKNEL  300
             K+KIGINGFGRIGRLVARVAL  DD+ELVAVNDPFI+TDYMTYMFKYD+VHGQW  +EL
Sbjct  4    GKIKIGINGFGRIGRLVARVALQRDDVELVAVNDPFISTDYMTYMFKYDSVHGQWKHHEL  63

Query  299  KVKDAKTLLFGDRHVAVFDKRNPEEIPWGETGAEYVVESTGVFTDQDkaaahlkggakKV  120
            KVKD KTLLFG++ V VF  RNPE+IPWGE GA++VVESTGVFTD+DKAAAHLKGGAKKV
Sbjct  64   KVKDEKTLLFGEKAVTVFGIRNPEDIPWGEAGADFVVESTGVFTDKDKAAAHLKGGAKKV  123

Query  119  VISAPSKDAPMFVMGVNHLEYKKDVDIVSNASCTTNCLA  3
            VISAPSKDAPMFV+GVN  EYK ++DIVSNASCTTNCLA
Sbjct  124  VISAPSKDAPMFVVGVNENEYKPELDIVSNASCTTNCLA  162



>ref|XP_010495303.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPC2, cytosolic 
[Camelina sativa]
Length=338

 Score =   251 bits (642),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 132/158 (84%), Positives = 144/158 (91%), Gaps = 0/158 (0%)
 Frame = -2

Query  476  KVKIGINGFGRIGRLVARVALLSDDIELVAVNDPFITTDYMTYMFKYDTVHGQWTKNELK  297
            K+KIGINGFGRIGRLVARV L  DD+ELVAVNDPFITT+YMTYMFKYD+VHGQW  +ELK
Sbjct  5    KIKIGINGFGRIGRLVARVVLQRDDVELVAVNDPFITTEYMTYMFKYDSVHGQWKHHELK  64

Query  296  VKDAKTLLFGDRHVAVFDKRNPEEIPWGETGAEYVVESTGVFTDQDkaaahlkggakKVV  117
            VKD KTLLFG++ V VF  RNPEEIPWGE GA++VVESTGVFTD+DKAAAHLKGGAKKVV
Sbjct  65   VKDDKTLLFGEKPVTVFGIRNPEEIPWGEAGADFVVESTGVFTDKDKAAAHLKGGAKKVV  124

Query  116  ISAPSKDAPMFVMGVNHLEYKKDVDIVSNASCTTNCLA  3
            ISAPSKDAPMFV+GVN  EYK D+DIVSNASCTTNCLA
Sbjct  125  ISAPSKDAPMFVVGVNEHEYKSDLDIVSNASCTTNCLA  162



>gb|AGV54709.1| glyceraldehyde-3-dehydrogenase C subunit [Phaseolus vulgaris]
Length=338

 Score =   251 bits (642),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 130/160 (81%), Positives = 146/160 (91%), Gaps = 0/160 (0%)
 Frame = -2

Query  482  MAKVKIGINGFGRIGRLVARVALLSDDIELVAVNDPFITTDYMTYMFKYDTVHGQWTKNE  303
            M KVKIGINGFGRIGRLVARVAL  DD+ELVAVNDPFITTDYMTYMFKYD+VHGQW  ++
Sbjct  1    MGKVKIGINGFGRIGRLVARVALQRDDVELVAVNDPFITTDYMTYMFKYDSVHGQWKHHD  60

Query  302  LKVKDAKTLLFGDRHVAVFDKRNPEEIPWGETGAEYVVESTGVFTDQDkaaahlkggakK  123
            + VKD+KTLLFG++ V VF  RNP+EIPWGETGA+ VVESTGVFTD+DKAAAHLKGGAKK
Sbjct  61   VTVKDSKTLLFGEKAVTVFGHRNPDEIPWGETGADIVVESTGVFTDKDKAAAHLKGGAKK  120

Query  122  VVISAPSKDAPMFVMGVNHLEYKKDVDIVSNASCTTNCLA  3
            V+ISAPSKDAPMFV+GVN  EYK ++DI+SNASCTTNCLA
Sbjct  121  VIISAPSKDAPMFVVGVNEHEYKAELDIISNASCTTNCLA  160



>ref|NP_001275344.1| glyceraldehyde-3-phosphate dehydrogenase [Solanum tuberosum]
 gb|ABB72804.1| glyceraldehyde 3-phosphate dehydrogenase-like protein [Solanum 
tuberosum]
 gb|ABB87128.1| glyceraldehyde 3-phosphate dehydrogenase-like [Solanum tuberosum]
Length=338

 Score =   251 bits (642),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 131/159 (82%), Positives = 145/159 (91%), Gaps = 0/159 (0%)
 Frame = -2

Query  479  AKVKIGINGFGRIGRLVARVALLSDDIELVAVNDPFITTDYMTYMFKYDTVHGQWTKNEL  300
             K+KIGINGFGRIGRLVARVAL  DD+ELVAVNDPFI+TDYMTYMFKYD+VHGQW  +EL
Sbjct  4    GKIKIGINGFGRIGRLVARVALQRDDVELVAVNDPFISTDYMTYMFKYDSVHGQWKHHEL  63

Query  299  KVKDAKTLLFGDRHVAVFDKRNPEEIPWGETGAEYVVESTGVFTDQDkaaahlkggakKV  120
            KVKD KTLLFG++ V VF  RNPE+IPWGE GA++VVESTGVFTD+DKAAAHLKGGAKKV
Sbjct  64   KVKDEKTLLFGEKAVTVFGIRNPEDIPWGEAGADFVVESTGVFTDKDKAAAHLKGGAKKV  123

Query  119  VISAPSKDAPMFVMGVNHLEYKKDVDIVSNASCTTNCLA  3
            VISAPSKDAPMFV+GVN  EYK ++DIVSNASCTTNCLA
Sbjct  124  VISAPSKDAPMFVVGVNENEYKPELDIVSNASCTTNCLA  162



>emb|CDY21098.1| BnaA08g24270D [Brassica napus]
Length=373

 Score =   252 bits (644),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 137/180 (76%), Positives = 154/180 (86%), Gaps = 4/180 (2%)
 Frame = -2

Query  533  DSIQFDSIPFHSREFIIMA---KVKIGINGFGRIGRLVARVALLSDDIELVAVNDPFITT  363
            D +   S+ F S + I MA   K+KIGINGFGRIGRLVARV L  +D+ELVAVNDPFITT
Sbjct  19   DYLHARSLAF-SLDLIAMADNKKIKIGINGFGRIGRLVARVILQRNDVELVAVNDPFITT  77

Query  362  DYMTYMFKYDTVHGQWTKNELKVKDAKTLLFGDRHVAVFDKRNPEEIPWGETGAEYVVES  183
            +YMTYMFKYD+VHGQW  NELK+KD KTLLFG++ V VF  RNPEEIPWGE GA++VVES
Sbjct  78   EYMTYMFKYDSVHGQWKHNELKIKDEKTLLFGEKPVTVFGIRNPEEIPWGEAGADFVVES  137

Query  182  TGVFTDQDkaaahlkggakKVVISAPSKDAPMFVMGVNHLEYKKDVDIVSNASCTTNCLA  3
            TGVFTD+DKAAAHLKGGAKKVVISAPSKDAPMFV+GVN  EYK D++IVSNASCTTNCLA
Sbjct  138  TGVFTDKDKAAAHLKGGAKKVVISAPSKDAPMFVVGVNEHEYKSDLNIVSNASCTTNCLA  197



>gb|AAM92008.1|AF527779_1 glyceraldehyde 3-phosphate dehydrogenase [Solanum tuberosum]
 gb|ABB55366.1| glyceraldehyde 3-phosphate dehydrogenase-like [Solanum tuberosum]
Length=338

 Score =   251 bits (641),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 131/159 (82%), Positives = 145/159 (91%), Gaps = 0/159 (0%)
 Frame = -2

Query  479  AKVKIGINGFGRIGRLVARVALLSDDIELVAVNDPFITTDYMTYMFKYDTVHGQWTKNEL  300
             K+KIGINGFGRIGRLVARVAL  DD+ELVAVNDPFI+TDYMTYMFKYD+VHGQW  +EL
Sbjct  4    GKIKIGINGFGRIGRLVARVALQRDDVELVAVNDPFISTDYMTYMFKYDSVHGQWKHHEL  63

Query  299  KVKDAKTLLFGDRHVAVFDKRNPEEIPWGETGAEYVVESTGVFTDQDkaaahlkggakKV  120
            KVKD KTLLFG++ V VF  RNPE+IPWGE GA++VVESTGVFTD+DKAAAHLKGGAKKV
Sbjct  64   KVKDEKTLLFGEKAVTVFGIRNPEDIPWGEAGADFVVESTGVFTDKDKAAAHLKGGAKKV  123

Query  119  VISAPSKDAPMFVMGVNHLEYKKDVDIVSNASCTTNCLA  3
            VISAPSKDAPMFV+GVN  EYK ++DIVSNASCTTNCLA
Sbjct  124  VISAPSKDAPMFVVGVNENEYKPELDIVSNASCTTNCLA  162



>sp|P26520.1|G3PC_PETHY RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase, cytosolic 
[Petunia x hybrida]
 emb|CAA42904.1| glyceraldehyde 3-phosphate dehydrogenase [Petunia x hybrida]
Length=337

 Score =   251 bits (641),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 130/160 (81%), Positives = 144/160 (90%), Gaps = 0/160 (0%)
 Frame = -2

Query  482  MAKVKIGINGFGRIGRLVARVALLSDDIELVAVNDPFITTDYMTYMFKYDTVHGQWTKNE  303
            MAK+KIGINGFGRIGRLVARVAL  DD+ELVAVNDPFI+ +YMTYMFKYD+VHGQW  +E
Sbjct  1    MAKIKIGINGFGRIGRLVARVALQRDDVELVAVNDPFISVEYMTYMFKYDSVHGQWKHHE  60

Query  302  LKVKDAKTLLFGDRHVAVFDKRNPEEIPWGETGAEYVVESTGVFTDQDkaaahlkggakK  123
            LK KD KTLLFG++ V VF  RNPEEIPWGE GA+YVVESTGVFTD+DKAAAHLKGGAKK
Sbjct  61   LKAKDDKTLLFGEKPVTVFGIRNPEEIPWGEAGADYVVESTGVFTDKDKAAAHLKGGAKK  120

Query  122  VVISAPSKDAPMFVMGVNHLEYKKDVDIVSNASCTTNCLA  3
            V+ISAPSKDAPMFV+GVN  EYK D+ +VSNASCTTNCLA
Sbjct  121  VIISAPSKDAPMFVVGVNEKEYKSDLTVVSNASCTTNCLA  160



>ref|XP_010318401.1| PREDICTED: glyceraldehyde 3-phosphate dehydrogenase isoform X1 
[Solanum lycopersicum]
Length=337

 Score =   251 bits (641),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 130/160 (81%), Positives = 146/160 (91%), Gaps = 0/160 (0%)
 Frame = -2

Query  482  MAKVKIGINGFGRIGRLVARVALLSDDIELVAVNDPFITTDYMTYMFKYDTVHGQWTKNE  303
            MAKVKIGINGFGRIGRLVARVAL  +D+ELVAVNDPFI+ DYMTYMFKYD+VHGQW  +E
Sbjct  1    MAKVKIGINGFGRIGRLVARVALQRNDVELVAVNDPFISVDYMTYMFKYDSVHGQWKHHE  60

Query  302  LKVKDAKTLLFGDRHVAVFDKRNPEEIPWGETGAEYVVESTGVFTDQDkaaahlkggakK  123
            LKVKD KTLLFG++ V VF  RNPEEIPW +TGA+Y+VESTGVFTD+DKAAAHLKGGAKK
Sbjct  61   LKVKDEKTLLFGEKAVTVFGFRNPEEIPWAQTGADYIVESTGVFTDKDKAAAHLKGGAKK  120

Query  122  VVISAPSKDAPMFVMGVNHLEYKKDVDIVSNASCTTNCLA  3
            V+ISAPSKDAPMFV+GVN  EYK +++IVSNASCTTNCLA
Sbjct  121  VIISAPSKDAPMFVVGVNEKEYKPELNIVSNASCTTNCLA  160



>ref|XP_009616068.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase, cytosolic-like 
[Nicotiana tomentosiformis]
Length=337

 Score =   251 bits (641),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 130/160 (81%), Positives = 146/160 (91%), Gaps = 0/160 (0%)
 Frame = -2

Query  482  MAKVKIGINGFGRIGRLVARVALLSDDIELVAVNDPFITTDYMTYMFKYDTVHGQWTKNE  303
            MAKVKIGINGFGRIGRLVARVAL  DD+ELVAVNDPFI+ +YMTYMFKYD+VHGQW  +E
Sbjct  1    MAKVKIGINGFGRIGRLVARVALQRDDVELVAVNDPFISVEYMTYMFKYDSVHGQWKHHE  60

Query  302  LKVKDAKTLLFGDRHVAVFDKRNPEEIPWGETGAEYVVESTGVFTDQDkaaahlkggakK  123
            LKVKD KTLLFG++ V VF  RNPEEIPWG+ GA+Y+VESTGVFTD+DKAAAHLKGGAKK
Sbjct  61   LKVKDDKTLLFGEKAVTVFGFRNPEEIPWGQNGADYIVESTGVFTDKDKAAAHLKGGAKK  120

Query  122  VVISAPSKDAPMFVMGVNHLEYKKDVDIVSNASCTTNCLA  3
            V+ISAPSKDAPMFV+GVN  EYK +++IVSNASCTTNCLA
Sbjct  121  VIISAPSKDAPMFVVGVNEKEYKPELNIVSNASCTTNCLA  160



>gb|AGV54256.1| glyceraldehyde-3-phosphate dehydrogenase [Phaseolus vulgaris]
Length=338

 Score =   251 bits (641),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 130/160 (81%), Positives = 146/160 (91%), Gaps = 0/160 (0%)
 Frame = -2

Query  482  MAKVKIGINGFGRIGRLVARVALLSDDIELVAVNDPFITTDYMTYMFKYDTVHGQWTKNE  303
            M KVKIGINGFGRIGRLVARVAL  DD+ELVAVNDPFITTDYMTYMFKYD+VHGQW  ++
Sbjct  1    MGKVKIGINGFGRIGRLVARVALQRDDVELVAVNDPFITTDYMTYMFKYDSVHGQWKHHD  60

Query  302  LKVKDAKTLLFGDRHVAVFDKRNPEEIPWGETGAEYVVESTGVFTDQDkaaahlkggakK  123
            + VKD+KTLLFG++ V VF  RNP+EIPWGETGA+ VVESTGVFTD+DKAAAHLKGGAKK
Sbjct  61   VTVKDSKTLLFGEKAVTVFGHRNPDEIPWGETGADIVVESTGVFTDKDKAAAHLKGGAKK  120

Query  122  VVISAPSKDAPMFVMGVNHLEYKKDVDIVSNASCTTNCLA  3
            V+ISAPSKDAPMFV+GVN  EYK ++DI+SNASCTTNCLA
Sbjct  121  VIISAPSKDAPMFVVGVNEHEYKAELDIISNASCTTNCLA  160



>ref|XP_006305287.1| hypothetical protein CARUB_v10009662mg [Capsella rubella]
 gb|EOA38185.1| hypothetical protein CARUB_v10009662mg [Capsella rubella]
Length=338

 Score =   251 bits (641),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 131/158 (83%), Positives = 144/158 (91%), Gaps = 0/158 (0%)
 Frame = -2

Query  476  KVKIGINGFGRIGRLVARVALLSDDIELVAVNDPFITTDYMTYMFKYDTVHGQWTKNELK  297
            K+KIGINGFGRIGRLVARV L  DD+ELVAVNDPFITT+YMTYMFKYD+VHGQW  +ELK
Sbjct  5    KIKIGINGFGRIGRLVARVVLQRDDVELVAVNDPFITTEYMTYMFKYDSVHGQWKHHELK  64

Query  296  VKDAKTLLFGDRHVAVFDKRNPEEIPWGETGAEYVVESTGVFTDQDkaaahlkggakKVV  117
            +KD KTLLFG++ V VF  RNPEEIPWGE GA++VVESTGVFTD+DKAAAHLKGGAKKVV
Sbjct  65   IKDDKTLLFGEKPVTVFGIRNPEEIPWGEAGADFVVESTGVFTDKDKAAAHLKGGAKKVV  124

Query  116  ISAPSKDAPMFVMGVNHLEYKKDVDIVSNASCTTNCLA  3
            ISAPSKDAPMFV+GVN  EYK D+DIVSNASCTTNCLA
Sbjct  125  ISAPSKDAPMFVVGVNEHEYKSDLDIVSNASCTTNCLA  162



>gb|AGX26868.1| glyceraldehyde-3-phosphate dehydrogenase [Saussurea involucrata]
Length=292

 Score =   249 bits (637),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 130/158 (82%), Positives = 143/158 (91%), Gaps = 0/158 (0%)
 Frame = -2

Query  476  KVKIGINGFGRIGRLVARVALLSDDIELVAVNDPFITTDYMTYMFKYDTVHGQWTKNELK  297
            K+KIGINGFGRIGRLVARVAL  DD+ELVAVNDPFI+TDYMTYMFKYD+VHGQW  NELK
Sbjct  6    KIKIGINGFGRIGRLVARVALQRDDVELVAVNDPFISTDYMTYMFKYDSVHGQWKHNELK  65

Query  296  VKDAKTLLFGDRHVAVFDKRNPEEIPWGETGAEYVVESTGVFTDQDkaaahlkggakKVV  117
            +KD KTLLFG   VAVF  RNPEEIPWG  GA++VVESTGVFTD+DKAAAHLKGGAKKV+
Sbjct  66   IKDEKTLLFGGSPVAVFGFRNPEEIPWGSVGADFVVESTGVFTDKDKAAAHLKGGAKKVI  125

Query  116  ISAPSKDAPMFVMGVNHLEYKKDVDIVSNASCTTNCLA  3
            ISAPSKDAPMFV+GVN  EYK +++IVSNASCTTNCLA
Sbjct  126  ISAPSKDAPMFVVGVNEKEYKPELNIVSNASCTTNCLA  163



>ref|XP_010518444.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPC1, cytosolic 
[Camelina sativa]
 ref|XP_010463885.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPC1, cytosolic 
[Camelina sativa]
 ref|XP_010485781.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPC1, cytosolic 
[Camelina sativa]
Length=338

 Score =   251 bits (641),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 131/158 (83%), Positives = 143/158 (91%), Gaps = 0/158 (0%)
 Frame = -2

Query  476  KVKIGINGFGRIGRLVARVALLSDDIELVAVNDPFITTDYMTYMFKYDTVHGQWTKNELK  297
            K+KIGINGFGRIGRLVARV L  DD+ELVAVNDPFITT+YMTYMFKYD+VHGQW  NELK
Sbjct  5    KIKIGINGFGRIGRLVARVVLQRDDVELVAVNDPFITTEYMTYMFKYDSVHGQWKHNELK  64

Query  296  VKDAKTLLFGDRHVAVFDKRNPEEIPWGETGAEYVVESTGVFTDQDkaaahlkggakKVV  117
            +KD KTLLFG++ V VF  RNPE+IPW E GA+YVVESTGVFTD+DKAAAHLKGGAKKVV
Sbjct  65   IKDDKTLLFGEKPVTVFGIRNPEDIPWAEAGADYVVESTGVFTDKDKAAAHLKGGAKKVV  124

Query  116  ISAPSKDAPMFVMGVNHLEYKKDVDIVSNASCTTNCLA  3
            ISAPSKDAPMFV+GVN  EYK D+DIVSNASCTTNCLA
Sbjct  125  ISAPSKDAPMFVVGVNEHEYKSDLDIVSNASCTTNCLA  162



>dbj|BAN45710.1| putative glycelaldehyde-3-phosphate dehydrogenase, partial [Pyrus 
pyrifolia var. culta]
Length=334

 Score =   251 bits (640),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 130/157 (83%), Positives = 145/157 (92%), Gaps = 0/157 (0%)
 Frame = -2

Query  473  VKIGINGFGRIGRLVARVALLSDDIELVAVNDPFITTDYMTYMFKYDTVHGQWTKNELKV  294
            +KIGINGFGRIGRLVARVAL  DD+ELVAVNDPFITTDYMTYMFKYDTVHG W  +ELKV
Sbjct  1    IKIGINGFGRIGRLVARVALQRDDVELVAVNDPFITTDYMTYMFKYDTVHGAWKHHELKV  60

Query  293  KDAKTLLFGDRHVAVFDKRNPEEIPWGETGAEYVVESTGVFTDQDkaaahlkggakKVVI  114
            KD+KTLLFG++ VAVF  RNPEEIPWGETGA++VVESTGVFTD++KAAAH+KGGAKKV+I
Sbjct  61   KDSKTLLFGEKPVAVFGIRNPEEIPWGETGADFVVESTGVFTDKEKAAAHIKGGAKKVII  120

Query  113  SAPSKDAPMFVMGVNHLEYKKDVDIVSNASCTTNCLA  3
            SAPSKDAPMFV+GVN  EYK D+ I+SNASCTTNCLA
Sbjct  121  SAPSKDAPMFVVGVNEKEYKPDIHILSNASCTTNCLA  157



>ref|XP_007044989.1| Glyceraldehyde-3-phosphate dehydrogenase C2 isoform 1 [Theobroma 
cacao]
 gb|EOY00821.1| Glyceraldehyde-3-phosphate dehydrogenase C2 isoform 1 [Theobroma 
cacao]
Length=342

 Score =   251 bits (641),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 131/158 (83%), Positives = 145/158 (92%), Gaps = 0/158 (0%)
 Frame = -2

Query  476  KVKIGINGFGRIGRLVARVALLSDDIELVAVNDPFITTDYMTYMFKYDTVHGQWTKNELK  297
            K+KIGINGFGRIGRLVARVAL  +D+ELVAVNDPFITTDYMTYMFKYD+VHGQW  + +K
Sbjct  6    KIKIGINGFGRIGRLVARVALQRNDVELVAVNDPFITTDYMTYMFKYDSVHGQWKHHNVK  65

Query  296  VKDAKTLLFGDRHVAVFDKRNPEEIPWGETGAEYVVESTGVFTDQDkaaahlkggakKVV  117
            VKD+KTLLFG++ V VF  RNPEEIPW ETGAE+VVESTGVFTD+DKAAAHLKGGAKKVV
Sbjct  66   VKDSKTLLFGEKPVTVFGIRNPEEIPWAETGAEFVVESTGVFTDKDKAAAHLKGGAKKVV  125

Query  116  ISAPSKDAPMFVMGVNHLEYKKDVDIVSNASCTTNCLA  3
            ISAPSKDAPMFV+GVN  EYK ++DIVSNASCTTNCLA
Sbjct  126  ISAPSKDAPMFVVGVNEKEYKPELDIVSNASCTTNCLA  163



>ref|XP_002439163.1| hypothetical protein SORBIDRAFT_09g001600 [Sorghum bicolor]
 gb|EES17593.1| hypothetical protein SORBIDRAFT_09g001600 [Sorghum bicolor]
Length=352

 Score =   251 bits (642),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 130/160 (81%), Positives = 145/160 (91%), Gaps = 0/160 (0%)
 Frame = -2

Query  482  MAKVKIGINGFGRIGRLVARVALLSDDIELVAVNDPFITTDYMTYMFKYDTVHGQWTKNE  303
            MAK+KIGINGFGRIGRLVARVAL S D+ELVAVNDPFI+T+YMTYMFKYDTVHGQW  ++
Sbjct  1    MAKIKIGINGFGRIGRLVARVALQSSDVELVAVNDPFISTEYMTYMFKYDTVHGQWKHHD  60

Query  302  LKVKDAKTLLFGDRHVAVFDKRNPEEIPWGETGAEYVVESTGVFTDQDkaaahlkggakK  123
            +KVKD+KTL FG+  V VF  RNPEEIPWG  GA+YVVESTGVFT+QDKAAAHLKGGAKK
Sbjct  61   VKVKDSKTLTFGENEVVVFGCRNPEEIPWGSVGADYVVESTGVFTEQDKAAAHLKGGAKK  120

Query  122  VVISAPSKDAPMFVMGVNHLEYKKDVDIVSNASCTTNCLA  3
            V+ISAPSKDAPMFV+GVN  EYK D++IVSNASCTTNCLA
Sbjct  121  VIISAPSKDAPMFVVGVNEKEYKSDINIVSNASCTTNCLA  160



>gb|KEH31729.1| glyceraldehyde-3-phosphate dehydrogenase [Medicago truncatula]
Length=267

 Score =   248 bits (634),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 129/159 (81%), Positives = 143/159 (90%), Gaps = 0/159 (0%)
 Frame = -2

Query  479  AKVKIGINGFGRIGRLVARVALLSDDIELVAVNDPFITTDYMTYMFKYDTVHGQWTKNEL  300
            AK+KIGINGFGRIGRLVARVAL  DD+ELVAVNDPFITTDYMTYMFKYD+VHGQW  +EL
Sbjct  4    AKIKIGINGFGRIGRLVARVALKRDDVELVAVNDPFITTDYMTYMFKYDSVHGQWKNDEL  63

Query  299  KVKDAKTLLFGDRHVAVFDKRNPEEIPWGETGAEYVVESTGVFTDQDkaaahlkggakKV  120
             VKD+KTLLFG++ V VF  RNPEEIPW  TGA+ +VESTGVFTD+DKAAAHLKGGAKKV
Sbjct  64   TVKDSKTLLFGEKPVTVFAHRNPEEIPWASTGADIIVESTGVFTDKDKAAAHLKGGAKKV  123

Query  119  VISAPSKDAPMFVMGVNHLEYKKDVDIVSNASCTTNCLA  3
            +ISAPSKDAPMFV+GVN  EYK + DI+SNASCTTNCLA
Sbjct  124  IISAPSKDAPMFVVGVNEKEYKPEFDIISNASCTTNCLA  162



>emb|CDY50169.1| BnaC08g15900D [Brassica napus]
Length=372

 Score =   252 bits (643),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 137/180 (76%), Positives = 153/180 (85%), Gaps = 4/180 (2%)
 Frame = -2

Query  533  DSIQFDSIPFHSREFIIMA---KVKIGINGFGRIGRLVARVALLSDDIELVAVNDPFITT  363
            D     S+ F S + I MA   K+KIGINGFGRIGRLVARV L  +D+ELVAVNDPFITT
Sbjct  18   DYFHIRSLAF-SLDLIAMADNKKIKIGINGFGRIGRLVARVILQRNDVELVAVNDPFITT  76

Query  362  DYMTYMFKYDTVHGQWTKNELKVKDAKTLLFGDRHVAVFDKRNPEEIPWGETGAEYVVES  183
            +YMTYMFKYD+VHGQW  NELK+KD KTLLFG++ V VF  RNPEEIPWGE GA++VVES
Sbjct  77   EYMTYMFKYDSVHGQWKHNELKIKDEKTLLFGEKPVTVFGIRNPEEIPWGEAGADFVVES  136

Query  182  TGVFTDQDkaaahlkggakKVVISAPSKDAPMFVMGVNHLEYKKDVDIVSNASCTTNCLA  3
            TGVFTD+DKAAAHLKGGAKKVVISAPSKDAPMFV+GVN  EYK D++IVSNASCTTNCLA
Sbjct  137  TGVFTDKDKAAAHLKGGAKKVVISAPSKDAPMFVVGVNEHEYKSDLNIVSNASCTTNCLA  196



>gb|AHA84255.1| glyceraldehyde-3-dehydrogenase C subunit [Phaseolus vulgaris]
Length=339

 Score =   251 bits (641),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 130/160 (81%), Positives = 146/160 (91%), Gaps = 0/160 (0%)
 Frame = -2

Query  482  MAKVKIGINGFGRIGRLVARVALLSDDIELVAVNDPFITTDYMTYMFKYDTVHGQWTKNE  303
            M KVKIGINGFGRIGRLVARVAL  DD+ELVAVNDPFITTDYMTYMFKYD+VHGQW  ++
Sbjct  1    MGKVKIGINGFGRIGRLVARVALQRDDVELVAVNDPFITTDYMTYMFKYDSVHGQWKHHD  60

Query  302  LKVKDAKTLLFGDRHVAVFDKRNPEEIPWGETGAEYVVESTGVFTDQDkaaahlkggakK  123
            + VKD+KTLLFG++ V VF  RNP+EIPWGETGA+ VVESTGVFTD+DKAAAHLKGGAKK
Sbjct  61   VTVKDSKTLLFGEKAVTVFGHRNPDEIPWGETGADIVVESTGVFTDKDKAAAHLKGGAKK  120

Query  122  VVISAPSKDAPMFVMGVNHLEYKKDVDIVSNASCTTNCLA  3
            V+ISAPSKDAPMFV+GVN  EYK ++DI+SNASCTTNCLA
Sbjct  121  VIISAPSKDAPMFVVGVNEHEYKAELDIISNASCTTNCLA  160



>ref|XP_008379147.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase 2, cytosolic-like 
[Malus domestica]
 ref|XP_008365359.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase 2, cytosolic 
[Malus domestica]
Length=337

 Score =   251 bits (640),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 129/160 (81%), Positives = 144/160 (90%), Gaps = 0/160 (0%)
 Frame = -2

Query  482  MAKVKIGINGFGRIGRLVARVALLSDDIELVAVNDPFITTDYMTYMFKYDTVHGQWTKNE  303
            M+K+KIGINGFGRIGRLVARVAL  DDIELVAVNDPFI  +YM+YMFKYDTVHGQW  +E
Sbjct  1    MSKIKIGINGFGRIGRLVARVALQRDDIELVAVNDPFIXVEYMSYMFKYDTVHGQWKHHE  60

Query  302  LKVKDAKTLLFGDRHVAVFDKRNPEEIPWGETGAEYVVESTGVFTDQDkaaahlkggakK  123
            LKVKD KTLLFGD+ V VF  R+PE+IPWGE GAE+VVESTGVFTD++KA+ HLKGGAKK
Sbjct  61   LKVKDDKTLLFGDKPVKVFASRDPEQIPWGEAGAEFVVESTGVFTDKEKASLHLKGGAKK  120

Query  122  VVISAPSKDAPMFVMGVNHLEYKKDVDIVSNASCTTNCLA  3
            V+ISAPSKDAPMFV+GVN  EYK D+DIVSNASCTTNCLA
Sbjct  121  VIISAPSKDAPMFVVGVNEKEYKPDLDIVSNASCTTNCLA  160



>ref|XP_004310041.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase-like [Fragaria 
vesca subsp. vesca]
Length=336

 Score =   251 bits (640),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 135/160 (84%), Positives = 143/160 (89%), Gaps = 0/160 (0%)
 Frame = -2

Query  482  MAKVKIGINGFGRIGRLVARVALLSDDIELVAVNDPFITTDYMTYMFKYDTVHGQWTKNE  303
            MAK+KIGINGFGRIGRLVARVAL  DD+ELVAVNDPFITTDYMTYMFKYDTVHG W  +E
Sbjct  1    MAKIKIGINGFGRIGRLVARVALQRDDVELVAVNDPFITTDYMTYMFKYDTVHGPWKHHE  60

Query  302  LKVKDAKTLLFGDRHVAVFDKRNPEEIPWGETGAEYVVESTGVFTDQDkaaahlkggakK  123
            LKVKD KTLLFG + VAVF  RNPEEIPWG  GA+ VVESTGVFTD+DKAAAHLKGGAKK
Sbjct  61   LKVKDEKTLLFGAKPVAVFGLRNPEEIPWGSVGADIVVESTGVFTDKDKAAAHLKGGAKK  120

Query  122  VVISAPSKDAPMFVMGVNHLEYKKDVDIVSNASCTTNCLA  3
            VVISAPSKDAPMFV+GVN  EYK D+ IVSNASCTTNCLA
Sbjct  121  VVISAPSKDAPMFVVGVNEHEYKSDLCIVSNASCTTNCLA  160



>ref|XP_010528059.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPC1, cytosolic-like 
[Tarenaya hassleriana]
Length=338

 Score =   251 bits (640),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 132/159 (83%), Positives = 143/159 (90%), Gaps = 0/159 (0%)
 Frame = -2

Query  479  AKVKIGINGFGRIGRLVARVALLSDDIELVAVNDPFITTDYMTYMFKYDTVHGQWTKNEL  300
             KVKIGINGFGRIGRLVARV L  DD+ELVAVNDPFITTDYMTYMFKYD+VHGQW  NEL
Sbjct  4    GKVKIGINGFGRIGRLVARVILQRDDVELVAVNDPFITTDYMTYMFKYDSVHGQWKHNEL  63

Query  299  KVKDAKTLLFGDRHVAVFDKRNPEEIPWGETGAEYVVESTGVFTDQDkaaahlkggakKV  120
            KVKD KTLLFG++ V VF  RNPE+IPW + GA+YVVESTGVFTD+DKAAAHLKGGAKKV
Sbjct  64   KVKDEKTLLFGEKPVTVFGIRNPEDIPWAQAGADYVVESTGVFTDKDKAAAHLKGGAKKV  123

Query  119  VISAPSKDAPMFVMGVNHLEYKKDVDIVSNASCTTNCLA  3
            VISAPSKDAPMFV+GVN  EYK ++DIVSNASCTTNCLA
Sbjct  124  VISAPSKDAPMFVVGVNEHEYKPELDIVSNASCTTNCLA  162



>ref|XP_009125005.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase, cytosolic-like 
[Brassica rapa]
Length=338

 Score =   251 bits (640),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 131/159 (82%), Positives = 144/159 (91%), Gaps = 0/159 (0%)
 Frame = -2

Query  479  AKVKIGINGFGRIGRLVARVALLSDDIELVAVNDPFITTDYMTYMFKYDTVHGQWTKNEL  300
             K+KIGINGFGRIGRLVARV L  DD+ELVAVNDPFITT+YMTYMFKYD+VHGQW  +EL
Sbjct  4    GKIKIGINGFGRIGRLVARVVLQRDDVELVAVNDPFITTEYMTYMFKYDSVHGQWKHHEL  63

Query  299  KVKDAKTLLFGDRHVAVFDKRNPEEIPWGETGAEYVVESTGVFTDQDkaaahlkggakKV  120
            KVKD KTLLFG++ V VF  RNPE+IPWGE GA++VVESTGVFTD+DKAAAHLKGGAKKV
Sbjct  64   KVKDEKTLLFGEKPVTVFGIRNPEDIPWGEAGADFVVESTGVFTDKDKAAAHLKGGAKKV  123

Query  119  VISAPSKDAPMFVMGVNHLEYKKDVDIVSNASCTTNCLA  3
            VISAPSKDAPMFV+GVN  EYK D+DIVSNASCTTNCLA
Sbjct  124  VISAPSKDAPMFVVGVNEHEYKSDLDIVSNASCTTNCLA  162



>ref|XP_010103177.1| Glyceraldehyde-3-phosphate dehydrogenase [Morus notabilis]
 gb|EXB94963.1| Glyceraldehyde-3-phosphate dehydrogenase [Morus notabilis]
Length=341

 Score =   251 bits (641),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 129/158 (82%), Positives = 147/158 (93%), Gaps = 0/158 (0%)
 Frame = -2

Query  476  KVKIGINGFGRIGRLVARVALLSDDIELVAVNDPFITTDYMTYMFKYDTVHGQWTKNELK  297
            K+KIGINGFGRIGRLVARVAL  +D+ELVAVNDPFITTDYMTYMFK+D+VHGQW  +++K
Sbjct  6    KIKIGINGFGRIGRLVARVALQRNDVELVAVNDPFITTDYMTYMFKFDSVHGQWKHHDVK  65

Query  296  VKDAKTLLFGDRHVAVFDKRNPEEIPWGETGAEYVVESTGVFTDQDkaaahlkggakKVV  117
            VKD+KTLLFG++ V VF  RNPEEIPWGETGA++VVESTGVFTD+DKAAAHLKGGAKKV+
Sbjct  66   VKDSKTLLFGEKAVTVFGHRNPEEIPWGETGADFVVESTGVFTDKDKAAAHLKGGAKKVI  125

Query  116  ISAPSKDAPMFVMGVNHLEYKKDVDIVSNASCTTNCLA  3
            ISAPSKDAPMFV+GVN  EYK ++DIVSNASCTTNCLA
Sbjct  126  ISAPSKDAPMFVVGVNEHEYKPELDIVSNASCTTNCLA  163



>ref|NP_187062.1| glyceraldehyde-3-phosphate dehydrogenase C subunit 1 [Arabidopsis 
thaliana]
 sp|P25858.2|G3PC1_ARATH RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase GAPC1, 
cytosolic; AltName: Full=NAD-dependent glyceraldehydephosphate 
dehydrogenase C subunit 1 [Arabidopsis thaliana]
 gb|AAF26801.1|AC016829_25 glyceraldehyde-3-phosphate dehydrogenase C subunit (GapC) [Arabidopsis 
thaliana]
 gb|AAK97737.1| AT3g04120/T6K12_26 [Arabidopsis thaliana]
 gb|AAL31134.1| AT3g04120/T6K12_26 [Arabidopsis thaliana]
 gb|AAM98225.1| unknown protein [Arabidopsis thaliana]
 dbj|BAE98901.1| glyceraldehyde-3-phosphate dehydrogenase C subunit [Arabidopsis 
thaliana]
 gb|AEE74039.1| glyceraldehyde-3-phosphate dehydrogenase C subunit 1 [Arabidopsis 
thaliana]
Length=338

 Score =   251 bits (640),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 130/158 (82%), Positives = 143/158 (91%), Gaps = 0/158 (0%)
 Frame = -2

Query  476  KVKIGINGFGRIGRLVARVALLSDDIELVAVNDPFITTDYMTYMFKYDTVHGQWTKNELK  297
            K++IGINGFGRIGRLVARV L  DD+ELVAVNDPFITT+YMTYMFKYD+VHGQW  NELK
Sbjct  5    KIRIGINGFGRIGRLVARVVLQRDDVELVAVNDPFITTEYMTYMFKYDSVHGQWKHNELK  64

Query  296  VKDAKTLLFGDRHVAVFDKRNPEEIPWGETGAEYVVESTGVFTDQDkaaahlkggakKVV  117
            +KD KTLLFG++ V VF  RNPE+IPW E GA+YVVESTGVFTD+DKAAAHLKGGAKKVV
Sbjct  65   IKDEKTLLFGEKPVTVFGIRNPEDIPWAEAGADYVVESTGVFTDKDKAAAHLKGGAKKVV  124

Query  116  ISAPSKDAPMFVMGVNHLEYKKDVDIVSNASCTTNCLA  3
            ISAPSKDAPMFV+GVN  EYK D+DIVSNASCTTNCLA
Sbjct  125  ISAPSKDAPMFVVGVNEHEYKSDLDIVSNASCTTNCLA  162



>gb|AFD62802.1| GAPDH2 [Ipomoea purpurea]
Length=337

 Score =   251 bits (640),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 130/160 (81%), Positives = 145/160 (91%), Gaps = 0/160 (0%)
 Frame = -2

Query  482  MAKVKIGINGFGRIGRLVARVALLSDDIELVAVNDPFITTDYMTYMFKYDTVHGQWTKNE  303
            M K+KIGINGFGRIGRLVARVAL S+DIELVAVNDPFI+T+YMTYMFKYDTVHGQW  ++
Sbjct  1    MGKIKIGINGFGRIGRLVARVALHSEDIELVAVNDPFISTEYMTYMFKYDTVHGQWKHHD  60

Query  302  LKVKDAKTLLFGDRHVAVFDKRNPEEIPWGETGAEYVVESTGVFTDQDkaaahlkggakK  123
            +KV D KTLLFG++ V VF  RNPEEIPWGE GAE+VVESTGVFTD+DKAAAHLK GAKK
Sbjct  61   VKVHDEKTLLFGEKSVKVFGCRNPEEIPWGEAGAEFVVESTGVFTDKDKAAAHLKAGAKK  120

Query  122  VVISAPSKDAPMFVMGVNHLEYKKDVDIVSNASCTTNCLA  3
            VVISAPSKDAPMFV+GVN  EYK +++IVSNASCTTNCLA
Sbjct  121  VVISAPSKDAPMFVVGVNEKEYKPELNIVSNASCTTNCLA  160



>ref|XP_009124017.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase, cytosolic 
[Brassica rapa]
Length=338

 Score =   251 bits (640),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 131/159 (82%), Positives = 144/159 (91%), Gaps = 0/159 (0%)
 Frame = -2

Query  479  AKVKIGINGFGRIGRLVARVALLSDDIELVAVNDPFITTDYMTYMFKYDTVHGQWTKNEL  300
             K+KIGINGFGRIGRLVARV L  DD+ELVAVNDPFITT+YMTYMFKYD+VHGQW  +EL
Sbjct  4    GKIKIGINGFGRIGRLVARVVLQRDDVELVAVNDPFITTEYMTYMFKYDSVHGQWKHHEL  63

Query  299  KVKDAKTLLFGDRHVAVFDKRNPEEIPWGETGAEYVVESTGVFTDQDkaaahlkggakKV  120
            KVKD KTLLFG++ V VF  RNPE+IPWGE GA++VVESTGVFTD+DKAAAHLKGGAKKV
Sbjct  64   KVKDEKTLLFGEKPVTVFGIRNPEDIPWGEAGADFVVESTGVFTDKDKAAAHLKGGAKKV  123

Query  119  VISAPSKDAPMFVMGVNHLEYKKDVDIVSNASCTTNCLA  3
            VISAPSKDAPMFV+GVN  EYK D+DIVSNASCTTNCLA
Sbjct  124  VISAPSKDAPMFVVGVNEHEYKSDLDIVSNASCTTNCLA  162



>gb|AFW74419.1| glyceraldehyde-3-phosphate dehydrogenase2 [Zea mays]
Length=342

 Score =   251 bits (640),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 131/159 (82%), Positives = 145/159 (91%), Gaps = 0/159 (0%)
 Frame = -2

Query  479  AKVKIGINGFGRIGRLVARVALLSDDIELVAVNDPFITTDYMTYMFKYDTVHGQWTKNEL  300
             K+KIGINGFGRIGRLVARVAL S+D+ELVAVNDPFITTDYMTYMFKYDTVHGQW  +++
Sbjct  7    GKIKIGINGFGRIGRLVARVALQSEDVELVAVNDPFITTDYMTYMFKYDTVHGQWKHSDI  66

Query  299  KVKDAKTLLFGDRHVAVFDKRNPEEIPWGETGAEYVVESTGVFTDQDkaaahlkggakKV  120
             +KD+KTLLFG++ V VF  RNPEEIPWGE GAEYVVESTGVFTD+DKAAAHLKGGAKKV
Sbjct  67   ALKDSKTLLFGEKPVTVFGIRNPEEIPWGEAGAEYVVESTGVFTDKDKAAAHLKGGAKKV  126

Query  119  VISAPSKDAPMFVMGVNHLEYKKDVDIVSNASCTTNCLA  3
            VISAPSKDAPMFV+GVN  +Y  DV+IVSNASCTTNCLA
Sbjct  127  VISAPSKDAPMFVVGVNEDKYTSDVNIVSNASCTTNCLA  165



>gb|AGK63074.1| glyceraldehyde-3-phosphate dehydrogenase [Eleutherococcus senticosus]
Length=340

 Score =   251 bits (640),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 132/158 (84%), Positives = 144/158 (91%), Gaps = 0/158 (0%)
 Frame = -2

Query  476  KVKIGINGFGRIGRLVARVALLSDDIELVAVNDPFITTDYMTYMFKYDTVHGQWTKNELK  297
            K+KIGINGFGRIGRLVARVAL  DD+ELVAVNDPFIT DYMTYMFKYD+VHGQW  +ELK
Sbjct  6    KIKIGINGFGRIGRLVARVALQRDDVELVAVNDPFITIDYMTYMFKYDSVHGQWRHHELK  65

Query  296  VKDAKTLLFGDRHVAVFDKRNPEEIPWGETGAEYVVESTGVFTDQDkaaahlkggakKVV  117
            VKD KTLLFG+R V VF  RNPEEIPWGE GA++VVESTGVFTD+DKAAAHLKGGAKKVV
Sbjct  66   VKDDKTLLFGERPVKVFGIRNPEEIPWGEAGADFVVESTGVFTDKDKAAAHLKGGAKKVV  125

Query  116  ISAPSKDAPMFVMGVNHLEYKKDVDIVSNASCTTNCLA  3
            ISAPSKDAPMFV+GVN  EYK +++IVSNASCTTNCLA
Sbjct  126  ISAPSKDAPMFVVGVNEKEYKPELNIVSNASCTTNCLA  163



>ref|XP_006408221.1| hypothetical protein EUTSA_v10021083mg [Eutrema salsugineum]
 gb|ESQ49674.1| hypothetical protein EUTSA_v10021083mg [Eutrema salsugineum]
Length=338

 Score =   251 bits (640),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 131/159 (82%), Positives = 145/159 (91%), Gaps = 0/159 (0%)
 Frame = -2

Query  479  AKVKIGINGFGRIGRLVARVALLSDDIELVAVNDPFITTDYMTYMFKYDTVHGQWTKNEL  300
            AK+KIGINGFGRIGRLVARV L  DD+ELVAVNDPFITT+YMTYMFKYD+VHGQW  +EL
Sbjct  4    AKIKIGINGFGRIGRLVARVVLQRDDVELVAVNDPFITTEYMTYMFKYDSVHGQWKHHEL  63

Query  299  KVKDAKTLLFGDRHVAVFDKRNPEEIPWGETGAEYVVESTGVFTDQDkaaahlkggakKV  120
            KVKD KTLLFG++ V VF  +NPE+IPWGE GA++VVESTGVFTD+DKAAAHLKGGAKKV
Sbjct  64   KVKDEKTLLFGEKPVTVFGIKNPEDIPWGEAGADFVVESTGVFTDKDKAAAHLKGGAKKV  123

Query  119  VISAPSKDAPMFVMGVNHLEYKKDVDIVSNASCTTNCLA  3
            VISAPSKDAPMFV+GVN  EYK D+DIVSNASCTTNCLA
Sbjct  124  VISAPSKDAPMFVVGVNEHEYKSDLDIVSNASCTTNCLA  162



>dbj|BAH28852.1| glyceraldehyde-3-phosphate dehydrogenase [Ipomoea nil]
Length=337

 Score =   251 bits (640),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 130/160 (81%), Positives = 145/160 (91%), Gaps = 0/160 (0%)
 Frame = -2

Query  482  MAKVKIGINGFGRIGRLVARVALLSDDIELVAVNDPFITTDYMTYMFKYDTVHGQWTKNE  303
            M K+KIGINGFGRIGRLVARVAL S+DIELVAVNDPFI+T+YMTYMFKYDTVHGQW  ++
Sbjct  1    MGKIKIGINGFGRIGRLVARVALHSEDIELVAVNDPFISTEYMTYMFKYDTVHGQWKHHD  60

Query  302  LKVKDAKTLLFGDRHVAVFDKRNPEEIPWGETGAEYVVESTGVFTDQDkaaahlkggakK  123
            +KV D KTLLFG++ V VF  RNPEEIPWGE GAE+VVESTGVFTD+DKAAAHLK GAKK
Sbjct  61   VKVHDEKTLLFGEKSVKVFGCRNPEEIPWGEAGAEFVVESTGVFTDKDKAAAHLKAGAKK  120

Query  122  VVISAPSKDAPMFVMGVNHLEYKKDVDIVSNASCTTNCLA  3
            VVISAPSKDAPMFV+GVN  EYK +++IVSNASCTTNCLA
Sbjct  121  VVISAPSKDAPMFVVGVNEKEYKPELNIVSNASCTTNCLA  160



>ref|XP_002892749.1| GAPC-2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH69008.1| GAPC-2 [Arabidopsis lyrata subsp. lyrata]
Length=338

 Score =   250 bits (639),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 131/158 (83%), Positives = 144/158 (91%), Gaps = 0/158 (0%)
 Frame = -2

Query  476  KVKIGINGFGRIGRLVARVALLSDDIELVAVNDPFITTDYMTYMFKYDTVHGQWTKNELK  297
            K++IGINGFGRIGRLVARV L  DD+ELVAVNDPFITT+YMTYMFKYD+VHGQW  +ELK
Sbjct  5    KIRIGINGFGRIGRLVARVVLQRDDVELVAVNDPFITTEYMTYMFKYDSVHGQWKHHELK  64

Query  296  VKDAKTLLFGDRHVAVFDKRNPEEIPWGETGAEYVVESTGVFTDQDkaaahlkggakKVV  117
            VKD KTLLFG++ V VF  RNPEEIPWGE GA++VVESTGVFTD+DKAAAHLKGGAKKVV
Sbjct  65   VKDDKTLLFGEKPVTVFGIRNPEEIPWGEAGADFVVESTGVFTDKDKAAAHLKGGAKKVV  124

Query  116  ISAPSKDAPMFVMGVNHLEYKKDVDIVSNASCTTNCLA  3
            ISAPSKDAPMFV+GVN  EYK D+DIVSNASCTTNCLA
Sbjct  125  ISAPSKDAPMFVVGVNEHEYKSDLDIVSNASCTTNCLA  162



>emb|CDY49358.1| BnaA05g33200D, partial [Brassica napus]
Length=336

 Score =   250 bits (639),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 131/159 (82%), Positives = 144/159 (91%), Gaps = 0/159 (0%)
 Frame = -2

Query  479  AKVKIGINGFGRIGRLVARVALLSDDIELVAVNDPFITTDYMTYMFKYDTVHGQWTKNEL  300
             K+KIGINGFGRIGRLVARV L  DD+ELVAVNDPFITT+YMTYMFKYD+VHGQW  +EL
Sbjct  2    GKIKIGINGFGRIGRLVARVVLQRDDVELVAVNDPFITTEYMTYMFKYDSVHGQWKHHEL  61

Query  299  KVKDAKTLLFGDRHVAVFDKRNPEEIPWGETGAEYVVESTGVFTDQDkaaahlkggakKV  120
            KVKD KTLLFG++ V VF  RNPE+IPWGE GA++VVESTGVFTD+DKAAAHLKGGAKKV
Sbjct  62   KVKDEKTLLFGEKPVTVFGIRNPEDIPWGEAGADFVVESTGVFTDKDKAAAHLKGGAKKV  121

Query  119  VISAPSKDAPMFVMGVNHLEYKKDVDIVSNASCTTNCLA  3
            VISAPSKDAPMFV+GVN  EYK D+DIVSNASCTTNCLA
Sbjct  122  VISAPSKDAPMFVVGVNEHEYKSDLDIVSNASCTTNCLA  160



>emb|CDY21135.1| BnaA01g33660D [Brassica napus]
Length=341

 Score =   250 bits (639),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 135/168 (80%), Positives = 148/168 (88%), Gaps = 2/168 (1%)
 Frame = -2

Query  500  SREFIIMA--KVKIGINGFGRIGRLVARVALLSDDIELVAVNDPFITTDYMTYMFKYDTV  327
            S   I MA  K+KIGINGFGRIGRLVARV L  DD+ELVAVNDPFITT+YMTYMFKYD+V
Sbjct  42   SLSHITMANGKIKIGINGFGRIGRLVARVVLQRDDVELVAVNDPFITTEYMTYMFKYDSV  101

Query  326  HGQWTKNELKVKDAKTLLFGDRHVAVFDKRNPEEIPWGETGAEYVVESTGVFTDQDkaaa  147
            HGQW  +ELKVKD KTLLFG++ V VF  RNPE+IPWGE GA++VVESTGVFTD+DKAAA
Sbjct  102  HGQWKHHELKVKDEKTLLFGEKPVTVFGIRNPEDIPWGEAGADFVVESTGVFTDKDKAAA  161

Query  146  hlkggakKVVISAPSKDAPMFVMGVNHLEYKKDVDIVSNASCTTNCLA  3
            HLKGGAKKVVISAPSKDAPMFV+GVN  EYK D+DIVSNASCTTNCLA
Sbjct  162  HLKGGAKKVVISAPSKDAPMFVVGVNEHEYKSDLDIVSNASCTTNCLA  209



>ref|NP_001240046.1| uncharacterized protein LOC100782924 [Glycine max]
 gb|ACU24328.1| unknown [Glycine max]
 gb|KHN24094.1| Glyceraldehyde-3-phosphate dehydrogenase, cytosolic [Glycine 
soja]
Length=340

 Score =   250 bits (639),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 131/158 (83%), Positives = 145/158 (92%), Gaps = 0/158 (0%)
 Frame = -2

Query  476  KVKIGINGFGRIGRLVARVALLSDDIELVAVNDPFITTDYMTYMFKYDTVHGQWTKNELK  297
            K++IGINGFGRIGRLVARVAL  +D+ELVAVNDPFITTDYMTYMFKYDTVHGQW   ++K
Sbjct  6    KIRIGINGFGRIGRLVARVALQRNDVELVAVNDPFITTDYMTYMFKYDTVHGQWKHFDVK  65

Query  296  VKDAKTLLFGDRHVAVFDKRNPEEIPWGETGAEYVVESTGVFTDQDkaaahlkggakKVV  117
            VKD+KTLLFG++ V VF  RNPEEIPWGE GA+YVVESTGVFTD+DKAAAHLKGGAKKVV
Sbjct  66   VKDSKTLLFGEKPVTVFGIRNPEEIPWGEVGADYVVESTGVFTDKDKAAAHLKGGAKKVV  125

Query  116  ISAPSKDAPMFVMGVNHLEYKKDVDIVSNASCTTNCLA  3
            ISAPSKDAPMFV+GVN  EYK ++DIVSNASCTTNCLA
Sbjct  126  ISAPSKDAPMFVVGVNEKEYKPELDIVSNASCTTNCLA  163



>gb|AGY80450.1| glyceraldehyde-3-phosphate [Dendrocalamus latiflorus]
Length=337

 Score =   250 bits (638),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 130/160 (81%), Positives = 144/160 (90%), Gaps = 0/160 (0%)
 Frame = -2

Query  482  MAKVKIGINGFGRIGRLVARVALLSDDIELVAVNDPFITTDYMTYMFKYDTVHGQWTKNE  303
            M K+KIGINGFGRIGRLVARVAL S+D+ELVAVNDPFITTDYMTYMFKYDTVHGQW  ++
Sbjct  1    MGKIKIGINGFGRIGRLVARVALQSEDVELVAVNDPFITTDYMTYMFKYDTVHGQWKHSD  60

Query  302  LKVKDAKTLLFGDRHVAVFDKRNPEEIPWGETGAEYVVESTGVFTDQDkaaahlkggakK  123
            + +KD+KTLLFG + V VF  RNPEEIPW E GAEYVVESTGVFTD++KAAAHLKGGAKK
Sbjct  61   INIKDSKTLLFGQKPVTVFGIRNPEEIPWAEAGAEYVVESTGVFTDKEKAAAHLKGGAKK  120

Query  122  VVISAPSKDAPMFVMGVNHLEYKKDVDIVSNASCTTNCLA  3
            VVISAPSKDAPMFV+GVN  +Y  DV+IVSNASCTTNCLA
Sbjct  121  VVISAPSKDAPMFVVGVNEEKYTSDVNIVSNASCTTNCLA  160



>sp|P26517.1|G3PC1_HORVU RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase 1, cytosolic 
[Hordeum vulgare]
 emb|CAA42901.1| glyceraldehyde 3-phosphate dehydrogenase [Hordeum vulgare]
 dbj|BAJ86470.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ86589.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=337

 Score =   250 bits (638),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 131/160 (82%), Positives = 145/160 (91%), Gaps = 0/160 (0%)
 Frame = -2

Query  482  MAKVKIGINGFGRIGRLVARVALLSDDIELVAVNDPFITTDYMTYMFKYDTVHGQWTKNE  303
            M K+KIGINGFGRIGRLVARVAL SDD+ELVAVNDPFITT+YMTYMFKYDTVHG W  ++
Sbjct  1    MGKIKIGINGFGRIGRLVARVALQSDDVELVAVNDPFITTEYMTYMFKYDTVHGHWKHSD  60

Query  302  LKVKDAKTLLFGDRHVAVFDKRNPEEIPWGETGAEYVVESTGVFTDQDkaaahlkggakK  123
            +K+KD KTLLFG++ V VF  RNPEEIPWGE GA+YVVESTGVFTD+DKAAAHLKGGAKK
Sbjct  61   IKLKDDKTLLFGEKPVTVFGVRNPEEIPWGEAGADYVVESTGVFTDKDKAAAHLKGGAKK  120

Query  122  VVISAPSKDAPMFVMGVNHLEYKKDVDIVSNASCTTNCLA  3
            VVISAPSKDAPMFV+GVN  +Y  DV+IVSNASCTTNCLA
Sbjct  121  VVISAPSKDAPMFVVGVNEDKYTSDVNIVSNASCTTNCLA  160



>ref|XP_011086733.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase, cytosolic 
[Sesamum indicum]
Length=337

 Score =   250 bits (638),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 131/160 (82%), Positives = 144/160 (90%), Gaps = 0/160 (0%)
 Frame = -2

Query  482  MAKVKIGINGFGRIGRLVARVALLSDDIELVAVNDPFITTDYMTYMFKYDTVHGQWTKNE  303
            M K+KIGINGFGRIGRLVARVAL  DD+ELVAVNDPFI+TDYMTYMFKYD+VHG W  +E
Sbjct  1    MGKIKIGINGFGRIGRLVARVALQRDDVELVAVNDPFISTDYMTYMFKYDSVHGHWKHHE  60

Query  302  LKVKDAKTLLFGDRHVAVFDKRNPEEIPWGETGAEYVVESTGVFTDQDkaaahlkggakK  123
            +KVKD KTLLFG++ V VF  RNPEEIPW E GAE+VVESTGVFTD+DKAAAHLKGGAKK
Sbjct  61   VKVKDEKTLLFGEKPVRVFGFRNPEEIPWAEAGAEFVVESTGVFTDKDKAAAHLKGGAKK  120

Query  122  VVISAPSKDAPMFVMGVNHLEYKKDVDIVSNASCTTNCLA  3
            VVISAPSKDAPMFV+GVN  EYK D++IVSNASCTTNCLA
Sbjct  121  VVISAPSKDAPMFVVGVNEKEYKPDLNIVSNASCTTNCLA  160



>emb|CAZ76054.1| glyceraldehyde-3-phosphate dehydrogenase [Triticum aestivum]
 gb|EMT23312.1| Glyceraldehyde-3-phosphate dehydrogenase, cytosolic [Aegilops 
tauschii]
Length=337

 Score =   250 bits (638),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 131/160 (82%), Positives = 145/160 (91%), Gaps = 0/160 (0%)
 Frame = -2

Query  482  MAKVKIGINGFGRIGRLVARVALLSDDIELVAVNDPFITTDYMTYMFKYDTVHGQWTKNE  303
            M K+KIGINGFGRIGRLVARVAL SDD+ELVAVNDPFITT+YMTYMFKYDTVHG W  ++
Sbjct  1    MGKIKIGINGFGRIGRLVARVALQSDDVELVAVNDPFITTEYMTYMFKYDTVHGHWKHSD  60

Query  302  LKVKDAKTLLFGDRHVAVFDKRNPEEIPWGETGAEYVVESTGVFTDQDkaaahlkggakK  123
            +K+KD KTLLFG++ V VF  RNPEEIPWGE GA+YVVESTGVFTD+DKAAAHLKGGAKK
Sbjct  61   IKLKDDKTLLFGEKPVTVFGVRNPEEIPWGEAGADYVVESTGVFTDKDKAAAHLKGGAKK  120

Query  122  VVISAPSKDAPMFVMGVNHLEYKKDVDIVSNASCTTNCLA  3
            VVISAPSKDAPMFV+GVN  +Y  DV+IVSNASCTTNCLA
Sbjct  121  VVISAPSKDAPMFVVGVNEDKYTSDVNIVSNASCTTNCLA  160



>gb|AFW61325.1| glyceraldehyde-3-phosphate dehydrogenase1 isoform 1 [Zea mays]
 gb|AFW61326.1| glyceraldehyde-3-phosphate dehydrogenase1 isoform 2 [Zea mays]
Length=391

 Score =   251 bits (642),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 133/166 (80%), Positives = 147/166 (89%), Gaps = 0/166 (0%)
 Frame = -2

Query  500  SREFIIMAKVKIGINGFGRIGRLVARVALLSDDIELVAVNDPFITTDYMTYMFKYDTVHG  321
            SR  +   K+KIGINGFGRIGRLVARVAL S+D+ELVAVNDPFITTDYMTYMFKYDTVHG
Sbjct  49   SRSSLDAGKIKIGINGFGRIGRLVARVALQSEDVELVAVNDPFITTDYMTYMFKYDTVHG  108

Query  320  QWTKNELKVKDAKTLLFGDRHVAVFDKRNPEEIPWGETGAEYVVESTGVFTDQDkaaahl  141
             W  +++ +KD+KTLLFGD+ V VF  RNPEEIPWGE GAEYVVESTGVFTD+DKAAAHL
Sbjct  109  HWKHSDITLKDSKTLLFGDKPVTVFGIRNPEEIPWGEAGAEYVVESTGVFTDKDKAAAHL  168

Query  140  kggakKVVISAPSKDAPMFVMGVNHLEYKKDVDIVSNASCTTNCLA  3
            KGGAKKVVISAPSKDAPMFV+GVN  +Y  DV+IVSNASCTTNCLA
Sbjct  169  KGGAKKVVISAPSKDAPMFVVGVNEDKYTSDVNIVSNASCTTNCLA  214



>gb|ABV02033.1| glyceraldehyde 3-phosphate dehydrogenase [Nicotiana langsdorffii 
x Nicotiana sanderae]
Length=340

 Score =   250 bits (638),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 131/158 (83%), Positives = 143/158 (91%), Gaps = 0/158 (0%)
 Frame = -2

Query  476  KVKIGINGFGRIGRLVARVALLSDDIELVAVNDPFITTDYMTYMFKYDTVHGQWTKNELK  297
            K+KIGINGFGRIGRLVARVAL  DD+ELVAVNDPFI+TDYMTYMFKYD+VHGQW  +ELK
Sbjct  6    KIKIGINGFGRIGRLVARVALQRDDVELVAVNDPFISTDYMTYMFKYDSVHGQWKHHELK  65

Query  296  VKDAKTLLFGDRHVAVFDKRNPEEIPWGETGAEYVVESTGVFTDQDkaaahlkggakKVV  117
            VKD KTLLFG++ V VF  RNPEEIPW E GA++VVESTGVFTD+DKAAAHLKGGAKKVV
Sbjct  66   VKDEKTLLFGEKSVRVFGIRNPEEIPWAEAGADFVVESTGVFTDKDKAAAHLKGGAKKVV  125

Query  116  ISAPSKDAPMFVMGVNHLEYKKDVDIVSNASCTTNCLA  3
            ISAPSKDAPMFV+GVN  EYK + DIVSNASCTTNCLA
Sbjct  126  ISAPSKDAPMFVVGVNEKEYKPEYDIVSNASCTTNCLA  163



>ref|XP_009110581.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase, cytosolic 
[Brassica rapa]
Length=339

 Score =   250 bits (638),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 130/158 (82%), Positives = 144/158 (91%), Gaps = 0/158 (0%)
 Frame = -2

Query  476  KVKIGINGFGRIGRLVARVALLSDDIELVAVNDPFITTDYMTYMFKYDTVHGQWTKNELK  297
            K+KIGINGFGRIGRLVARV L  +D+ELVAVNDPFITT+YMTYMFKYD+VHGQW  NELK
Sbjct  6    KIKIGINGFGRIGRLVARVILQRNDVELVAVNDPFITTEYMTYMFKYDSVHGQWKHNELK  65

Query  296  VKDAKTLLFGDRHVAVFDKRNPEEIPWGETGAEYVVESTGVFTDQDkaaahlkggakKVV  117
            +KD KTLLFG++ V VF  RNPEEIPWGE GA++VVESTGVFTD+DKAAAHLKGGAKKVV
Sbjct  66   LKDEKTLLFGEKPVTVFGIRNPEEIPWGEAGADFVVESTGVFTDKDKAAAHLKGGAKKVV  125

Query  116  ISAPSKDAPMFVMGVNHLEYKKDVDIVSNASCTTNCLA  3
            ISAPSKDAPMFV+GVN  EYK D++IVSNASCTTNCLA
Sbjct  126  ISAPSKDAPMFVVGVNEHEYKSDLNIVSNASCTTNCLA  163



>gb|AFD94086.1| GAPDH, partial [Oncidium hybrid cultivar]
Length=291

 Score =   248 bits (633),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 130/156 (83%), Positives = 142/156 (91%), Gaps = 0/156 (0%)
 Frame = -2

Query  470  KIGINGFGRIGRLVARVALLSDDIELVAVNDPFITTDYMTYMFKYDTVHGQWTKNELKVK  291
            KIGINGFGRIGRLVARVALLS+D+ELVAVNDPFITTDYMTYMFKYDTVHGQW  +E+ VK
Sbjct  1    KIGINGFGRIGRLVARVALLSEDVELVAVNDPFITTDYMTYMFKYDTVHGQWKHHEIIVK  60

Query  290  DAKTLLFGDRHVAVFDKRNPEEIPWGETGAEYVVESTGVFTDQDkaaahlkggakKVVIS  111
            D+KTLLFG++ V VF  RNPEEIPWGE GA+YVVESTGVFTD+DKAAAHLKGGAKKV+IS
Sbjct  61   DSKTLLFGEKPVTVFGIRNPEEIPWGEAGADYVVESTGVFTDKDKAAAHLKGGAKKVIIS  120

Query  110  APSKDAPMFVMGVNHLEYKKDVDIVSNASCTTNCLA  3
            APSKDAPMFV+GVN   Y  D+ IVSNASCTTNCLA
Sbjct  121  APSKDAPMFVVGVNEHAYTNDITIVSNASCTTNCLA  156



>ref|XP_009606469.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase, cytosolic 
[Nicotiana tomentosiformis]
 ref|XP_009780356.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase, cytosolic 
[Nicotiana sylvestris]
Length=340

 Score =   250 bits (638),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 131/158 (83%), Positives = 143/158 (91%), Gaps = 0/158 (0%)
 Frame = -2

Query  476  KVKIGINGFGRIGRLVARVALLSDDIELVAVNDPFITTDYMTYMFKYDTVHGQWTKNELK  297
            K+KIGINGFGRIGRLVARVAL  DD+ELVAVNDPFI+TDYMTYMFKYD+VHGQW  +ELK
Sbjct  6    KIKIGINGFGRIGRLVARVALQRDDVELVAVNDPFISTDYMTYMFKYDSVHGQWKHHELK  65

Query  296  VKDAKTLLFGDRHVAVFDKRNPEEIPWGETGAEYVVESTGVFTDQDkaaahlkggakKVV  117
            VKD KTLLFG++ V VF  RNPEEIPW E GA++VVESTGVFTD+DKAAAHLKGGAKKVV
Sbjct  66   VKDEKTLLFGEKSVRVFGIRNPEEIPWAEAGADFVVESTGVFTDKDKAAAHLKGGAKKVV  125

Query  116  ISAPSKDAPMFVMGVNHLEYKKDVDIVSNASCTTNCLA  3
            ISAPSKDAPMFV+GVN  EYK + DIVSNASCTTNCLA
Sbjct  126  ISAPSKDAPMFVVGVNEKEYKPEYDIVSNASCTTNCLA  163



>emb|CDY29987.1| BnaC01g40210D [Brassica napus]
Length=376

 Score =   251 bits (641),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 131/159 (82%), Positives = 144/159 (91%), Gaps = 0/159 (0%)
 Frame = -2

Query  479  AKVKIGINGFGRIGRLVARVALLSDDIELVAVNDPFITTDYMTYMFKYDTVHGQWTKNEL  300
             K+KIGINGFGRIGRLVARV L  DD+ELVAVNDPFITT+YMTYMFKYD+VHGQW  +EL
Sbjct  86   GKIKIGINGFGRIGRLVARVVLQRDDVELVAVNDPFITTEYMTYMFKYDSVHGQWKHHEL  145

Query  299  KVKDAKTLLFGDRHVAVFDKRNPEEIPWGETGAEYVVESTGVFTDQDkaaahlkggakKV  120
            KVKD KTLLFG++ V VF  RNPE+IPWGE GA++VVESTGVFTD+DKAAAHLKGGAKKV
Sbjct  146  KVKDEKTLLFGEKPVTVFGIRNPEDIPWGEAGADFVVESTGVFTDKDKAAAHLKGGAKKV  205

Query  119  VISAPSKDAPMFVMGVNHLEYKKDVDIVSNASCTTNCLA  3
            VISAPSKDAPMFV+GVN  EYK D+DIVSNASCTTNCLA
Sbjct  206  VISAPSKDAPMFVVGVNEHEYKSDLDIVSNASCTTNCLA  244



>ref|XP_008677789.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase 1, cytosolic 
isoform X1 [Zea mays]
 gb|AFW61327.1| glyceraldehyde-3-phosphate dehydrogenase1 [Zea mays]
Length=347

 Score =   250 bits (638),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 131/159 (82%), Positives = 144/159 (91%), Gaps = 0/159 (0%)
 Frame = -2

Query  479  AKVKIGINGFGRIGRLVARVALLSDDIELVAVNDPFITTDYMTYMFKYDTVHGQWTKNEL  300
             K+KIGINGFGRIGRLVARVAL S+D+ELVAVNDPFITTDYMTYMFKYDTVHG W  +++
Sbjct  12   GKIKIGINGFGRIGRLVARVALQSEDVELVAVNDPFITTDYMTYMFKYDTVHGHWKHSDI  71

Query  299  KVKDAKTLLFGDRHVAVFDKRNPEEIPWGETGAEYVVESTGVFTDQDkaaahlkggakKV  120
             +KD+KTLLFGD+ V VF  RNPEEIPWGE GAEYVVESTGVFTD+DKAAAHLKGGAKKV
Sbjct  72   TLKDSKTLLFGDKPVTVFGIRNPEEIPWGEAGAEYVVESTGVFTDKDKAAAHLKGGAKKV  131

Query  119  VISAPSKDAPMFVMGVNHLEYKKDVDIVSNASCTTNCLA  3
            VISAPSKDAPMFV+GVN  +Y  DV+IVSNASCTTNCLA
Sbjct  132  VISAPSKDAPMFVVGVNEDKYTSDVNIVSNASCTTNCLA  170



>gb|AEO72143.1| glyceraldehyde-3-phosphate dehydrogenase [Litchi chinensis]
Length=336

 Score =   249 bits (637),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 132/160 (83%), Positives = 144/160 (90%), Gaps = 0/160 (0%)
 Frame = -2

Query  482  MAKVKIGINGFGRIGRLVARVALLSDDIELVAVNDPFITTDYMTYMFKYDTVHGQWTKNE  303
            M K+K+GINGFGRIGRLVARV L SDD+ELVAVNDPFI T YMTYMFKYD+VHG W  +E
Sbjct  1    MGKIKVGINGFGRIGRLVARVILQSDDVELVAVNDPFIDTTYMTYMFKYDSVHGPWKHHE  60

Query  302  LKVKDAKTLLFGDRHVAVFDKRNPEEIPWGETGAEYVVESTGVFTDQDkaaahlkggakK  123
            LKVKD+KTLLFG+R V VF  RNPEEIPW ETGAEYVVESTGVFTD++KAAAHLKGGAKK
Sbjct  61   LKVKDSKTLLFGERAVTVFGIRNPEEIPWHETGAEYVVESTGVFTDKEKAAAHLKGGAKK  120

Query  122  VVISAPSKDAPMFVMGVNHLEYKKDVDIVSNASCTTNCLA  3
            VVISAPSKDAPMFV+GVN  EYK ++DIVSNASCTTNCLA
Sbjct  121  VVISAPSKDAPMFVVGVNEHEYKPEIDIVSNASCTTNCLA  160



>ref|XP_004515830.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase, cytosolic-like 
[Cicer arietinum]
Length=337

 Score =   249 bits (636),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 131/160 (82%), Positives = 143/160 (89%), Gaps = 0/160 (0%)
 Frame = -2

Query  482  MAKVKIGINGFGRIGRLVARVALLSDDIELVAVNDPFITTDYMTYMFKYDTVHGQWTKNE  303
            MAKVKIGINGFGRIGRLVARVAL  DD+ELVAVNDPFITTDYMTYMFKYD+VHGQW  +E
Sbjct  1    MAKVKIGINGFGRIGRLVARVALKRDDVELVAVNDPFITTDYMTYMFKYDSVHGQWKNDE  60

Query  302  LKVKDAKTLLFGDRHVAVFDKRNPEEIPWGETGAEYVVESTGVFTDQDkaaahlkggakK  123
            L VKD+ TLLFG++ V VF  RNPEEIPW  TGA+ +VESTGVFTD+DKAAAHLKGGAKK
Sbjct  61   LTVKDSNTLLFGEKPVTVFAHRNPEEIPWASTGADIIVESTGVFTDKDKAAAHLKGGAKK  120

Query  122  VVISAPSKDAPMFVMGVNHLEYKKDVDIVSNASCTTNCLA  3
            V+ISAPSKDAPMFV+GVN  EYK + DIVSNASCTTNCLA
Sbjct  121  VIISAPSKDAPMFVVGVNEHEYKPEFDIVSNASCTTNCLA  160



>gb|AIC33039.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Panax ginseng]
Length=298

 Score =   248 bits (633),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 130/160 (81%), Positives = 142/160 (89%), Gaps = 0/160 (0%)
 Frame = -2

Query  482  MAKVKIGINGFGRIGRLVARVALLSDDIELVAVNDPFITTDYMTYMFKYDTVHGQWTKNE  303
            MAK+KIGINGFGRIGRLVARVAL  DD+ELVAVNDPFITTDYMTYMFKYD+VHG W  +E
Sbjct  1    MAKIKIGINGFGRIGRLVARVALQRDDVELVAVNDPFITTDYMTYMFKYDSVHGPWKHHE  60

Query  302  LKVKDAKTLLFGDRHVAVFDKRNPEEIPWGETGAEYVVESTGVFTDQDkaaahlkggakK  123
            LKVKD  TLLFG++ V VF  RNPEEIPW  TGAE+VVESTGVFTD+DKAAAHLKGGAKK
Sbjct  61   LKVKDENTLLFGEKPVTVFGLRNPEEIPWASTGAEFVVESTGVFTDKDKAAAHLKGGAKK  120

Query  122  VVISAPSKDAPMFVMGVNHLEYKKDVDIVSNASCTTNCLA  3
            V+ISAPSKDAPMFV+GVN  EY  D+ I+SNASCTTNCLA
Sbjct  121  VIISAPSKDAPMFVVGVNEKEYTPDLHIISNASCTTNCLA  160



>ref|XP_007044991.1| Glyceraldehyde-3-phosphate dehydrogenase C2 isoform 3 [Theobroma 
cacao]
 gb|EOY00823.1| Glyceraldehyde-3-phosphate dehydrogenase C2 isoform 3 [Theobroma 
cacao]
Length=262

 Score =   246 bits (629),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 125/158 (79%), Positives = 139/158 (88%), Gaps = 6/158 (4%)
 Frame = -2

Query  476  KVKIGINGFGRIGRLVARVALLSDDIELVAVNDPFITTDYMTYMFKYDTVHGQWTKNELK  297
            K+KIGINGFGRIGRLVARVAL  +D+ELVAVNDPFITTDYMTYMFKYD+VHGQW  + +K
Sbjct  6    KIKIGINGFGRIGRLVARVALQRNDVELVAVNDPFITTDYMTYMFKYDSVHGQWKHHNVK  65

Query  296  VKDAKTLLFGDRHVAVFDKRNPEEIPWGETGAEYVVESTGVFTDQDkaaahlkggakKVV  117
            VKD+KTLLFG++ V VF  RNPEEIPW ETGAE+VVESTGVFTD+D      KGGAKKVV
Sbjct  66   VKDSKTLLFGEKPVTVFGIRNPEEIPWAETGAEFVVESTGVFTDKD------KGGAKKVV  119

Query  116  ISAPSKDAPMFVMGVNHLEYKKDVDIVSNASCTTNCLA  3
            ISAPSKDAPMFV+GVN  EYK ++DIVSNASCTTNCLA
Sbjct  120  ISAPSKDAPMFVVGVNEKEYKPELDIVSNASCTTNCLA  157



>gb|ADC45375.1| glyceraldehyde-3-phosphate dehydrogenase [Cleistogenes songorica]
Length=315

 Score =   248 bits (634),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 130/160 (81%), Positives = 144/160 (90%), Gaps = 0/160 (0%)
 Frame = -2

Query  482  MAKVKIGINGFGRIGRLVARVALLSDDIELVAVNDPFITTDYMTYMFKYDTVHGQWTKNE  303
            M K+KIGINGFGRIGRLVARVAL S+D+ELVAVNDPFITTDYMTYMFKYDTVHG W  ++
Sbjct  1    MGKIKIGINGFGRIGRLVARVALQSEDVELVAVNDPFITTDYMTYMFKYDTVHGHWKHSD  60

Query  302  LKVKDAKTLLFGDRHVAVFDKRNPEEIPWGETGAEYVVESTGVFTDQDkaaahlkggakK  123
            +KVKD KTLL G++ V VF  RNPEEIPWGE GAEYVVESTGVFTD++KAAAHLKGGAKK
Sbjct  61   IKVKDTKTLLLGEKPVTVFGVRNPEEIPWGEVGAEYVVESTGVFTDKEKAAAHLKGGAKK  120

Query  122  VVISAPSKDAPMFVMGVNHLEYKKDVDIVSNASCTTNCLA  3
            VVISAPSKDAPMFV+GVN  +Y  D++IVSNASCTTNCLA
Sbjct  121  VVISAPSKDAPMFVVGVNEDKYTSDLNIVSNASCTTNCLA  160



>ref|NP_001060897.1| Os08g0126300 [Oryza sativa Japonica Group]
 sp|Q0J8A4.1|G3PC1_ORYSJ RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase 1, cytosolic; 
AltName: Full=PP38 [Oryza sativa Japonica Group]
 sp|A2YQT7.1|G3PC_ORYSI RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase, cytosolic; 
AltName: Full=PP38 [Oryza sativa Indica Group]
 pdb|3E5R|O Chain O, Crystal Structure And Functional Analysis Of Glyceraldehyde- 
3-Phosphate Dehydrogenase From Oryza Sativa
 pdb|3E5R|A Chain A, Crystal Structure And Functional Analysis Of Glyceraldehyde- 
3-Phosphate Dehydrogenase From Oryza Sativa
 pdb|3E5R|B Chain B, Crystal Structure And Functional Analysis Of Glyceraldehyde- 
3-Phosphate Dehydrogenase From Oryza Sativa
 pdb|3E5R|C Chain C, Crystal Structure And Functional Analysis Of Glyceraldehyde- 
3-Phosphate Dehydrogenase From Oryza Sativa
 pdb|3V1Y|O Chain O, Crystal Structures Of Glyceraldehyde-3-Phosphate Dehydrogenase 
Complexes With Nad
 pdb|3V1Y|A Chain A, Crystal Structures Of Glyceraldehyde-3-Phosphate Dehydrogenase 
Complexes With Nad
 pdb|3V1Y|B Chain B, Crystal Structures Of Glyceraldehyde-3-Phosphate Dehydrogenase 
Complexes With Nad
 pdb|3V1Y|C Chain C, Crystal Structures Of Glyceraldehyde-3-Phosphate Dehydrogenase 
Complexes With Nad
 dbj|BAD08850.1| glyceraldehyde 3-phosphate dehydrogenase, cytosolic [Oryza sativa 
Japonica Group]
 dbj|BAF22811.1| Os08g0126300 [Oryza sativa Japonica Group]
 gb|ABL74559.1| glyceraldehyde-3-phosphate dehydrogenase [Oryza sativa Japonica 
Group]
 gb|EAZ05448.1| hypothetical protein OsI_27662 [Oryza sativa Indica Group]
 gb|EAZ41375.1| hypothetical protein OsJ_25892 [Oryza sativa Japonica Group]
 dbj|BAG92310.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96258.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|ADM86844.1| glyceraldehyde-3-phosphate dehydrogenase [Oryza sativa Japonica 
Group]
 gb|AFI71826.1| glyceraldehyde-3-phosphate dehydrogenase [Oryza sativa]
Length=337

 Score =   249 bits (636),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 129/160 (81%), Positives = 144/160 (90%), Gaps = 0/160 (0%)
 Frame = -2

Query  482  MAKVKIGINGFGRIGRLVARVALLSDDIELVAVNDPFITTDYMTYMFKYDTVHGQWTKNE  303
            M K+KIGINGFGRIGRLVARVAL S+D+ELVAVNDPFITTDYMTYMFKYDTVHGQW  ++
Sbjct  1    MGKIKIGINGFGRIGRLVARVALQSEDVELVAVNDPFITTDYMTYMFKYDTVHGQWKHSD  60

Query  302  LKVKDAKTLLFGDRHVAVFDKRNPEEIPWGETGAEYVVESTGVFTDQDkaaahlkggakK  123
            +K+KD+KTLL G++ V VF  RNP+EIPW E GAEYVVESTGVFTD++KAAAHLKGGAKK
Sbjct  61   IKIKDSKTLLLGEKPVTVFGIRNPDEIPWAEAGAEYVVESTGVFTDKEKAAAHLKGGAKK  120

Query  122  VVISAPSKDAPMFVMGVNHLEYKKDVDIVSNASCTTNCLA  3
            VVISAPSKDAPMFV GVN  +Y  D+DIVSNASCTTNCLA
Sbjct  121  VVISAPSKDAPMFVCGVNEDKYTSDIDIVSNASCTTNCLA  160



>sp|P04796.2|G3PC_SINAL RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase, cytosolic 
[Sinapis alba]
 emb|CAA27844.1| unnamed protein product [Sinapis alba]
Length=338

 Score =   249 bits (636),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 130/158 (82%), Positives = 144/158 (91%), Gaps = 0/158 (0%)
 Frame = -2

Query  476  KVKIGINGFGRIGRLVARVALLSDDIELVAVNDPFITTDYMTYMFKYDTVHGQWTKNELK  297
            K+KIGINGFGRIGRLVARV L  +D+ELVAVNDPFITT+YMTYMFKYD+VHGQW  NELK
Sbjct  5    KIKIGINGFGRIGRLVARVILQRNDVELVAVNDPFITTEYMTYMFKYDSVHGQWKHNELK  64

Query  296  VKDAKTLLFGDRHVAVFDKRNPEEIPWGETGAEYVVESTGVFTDQDkaaahlkggakKVV  117
            VKD KTLLFG++ V VF  RNPE+IPWGE GA++VVESTGVFTD+DKAAAHLKGGAKKVV
Sbjct  65   VKDEKTLLFGEKPVTVFGIRNPEDIPWGEAGADFVVESTGVFTDKDKAAAHLKGGAKKVV  124

Query  116  ISAPSKDAPMFVMGVNHLEYKKDVDIVSNASCTTNCLA  3
            ISAPSKDAPMFV+GVN  EYK D++IVSNASCTTNCLA
Sbjct  125  ISAPSKDAPMFVVGVNEHEYKSDLNIVSNASCTTNCLA  162



>emb|CDY26651.1| BnaA09g46260D [Brassica napus]
Length=333

 Score =   249 bits (635),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 130/158 (82%), Positives = 144/158 (91%), Gaps = 0/158 (0%)
 Frame = -2

Query  476  KVKIGINGFGRIGRLVARVALLSDDIELVAVNDPFITTDYMTYMFKYDTVHGQWTKNELK  297
            K+KIGINGFGRIGRLVARV L  +D+ELVAVNDPFITT+YMTYMFKYD+VHGQW  NELK
Sbjct  44   KIKIGINGFGRIGRLVARVILQRNDVELVAVNDPFITTEYMTYMFKYDSVHGQWKHNELK  103

Query  296  VKDAKTLLFGDRHVAVFDKRNPEEIPWGETGAEYVVESTGVFTDQDkaaahlkggakKVV  117
            +KD KTLLFG++ V VF  RNPE+IPWGE GA++VVESTGVFTD+DKAAAHLKGGAKKVV
Sbjct  104  LKDEKTLLFGEKPVTVFGIRNPEDIPWGEAGADFVVESTGVFTDKDKAAAHLKGGAKKVV  163

Query  116  ISAPSKDAPMFVMGVNHLEYKKDVDIVSNASCTTNCLA  3
            ISAPSKDAPMFV+GVN  EYK D+DIVSNASCTTNCLA
Sbjct  164  ISAPSKDAPMFVVGVNEHEYKSDLDIVSNASCTTNCLA  201



>gb|AHW48354.1| glyceraldehyde-3-phosphate dehydrogenase C2-like protein [Malus 
baccata]
Length=341

 Score =   249 bits (636),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 128/158 (81%), Positives = 143/158 (91%), Gaps = 0/158 (0%)
 Frame = -2

Query  476  KVKIGINGFGRIGRLVARVALLSDDIELVAVNDPFITTDYMTYMFKYDTVHGQWTKNELK  297
            K+KIGINGFGRIGRLVARVAL  DD+ELVAVNDPFITTDYMTYMFKYDTVHG W  +ELK
Sbjct  7    KIKIGINGFGRIGRLVARVALQRDDVELVAVNDPFITTDYMTYMFKYDTVHGPWKHHELK  66

Query  296  VKDAKTLLFGDRHVAVFDKRNPEEIPWGETGAEYVVESTGVFTDQDkaaahlkggakKVV  117
            VKD+KTLLFG++ V VF  RNPEEIPWGE GA++VVESTGVFTD++KAAA +KGGAKKV+
Sbjct  67   VKDSKTLLFGEKPVTVFGIRNPEEIPWGECGADFVVESTGVFTDKEKAAARIKGGAKKVI  126

Query  116  ISAPSKDAPMFVMGVNHLEYKKDVDIVSNASCTTNCLA  3
            ISAPSKDAPMFV+GVN  EYK D+ I+SNASCTTNCLA
Sbjct  127  ISAPSKDAPMFVVGVNEKEYKPDIHILSNASCTTNCLA  164



>gb|ACN59435.1| glyceraldehyde-3-phosphate dehydrogenase [Dimocarpus longan]
Length=336

 Score =   249 bits (636),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 132/160 (83%), Positives = 144/160 (90%), Gaps = 0/160 (0%)
 Frame = -2

Query  482  MAKVKIGINGFGRIGRLVARVALLSDDIELVAVNDPFITTDYMTYMFKYDTVHGQWTKNE  303
            M K+KIGINGFGRIGRLVARV L SDD+ELVAVNDPFI T YMTYMFKYD+VHG W  +E
Sbjct  1    MGKIKIGINGFGRIGRLVARVILQSDDVELVAVNDPFIDTTYMTYMFKYDSVHGPWKHHE  60

Query  302  LKVKDAKTLLFGDRHVAVFDKRNPEEIPWGETGAEYVVESTGVFTDQDkaaahlkggakK  123
            LKVKD+KTLLFG++ V VF  RNPEEIPW ETGAEYVVESTGVFTD++KAAAHLKGGAKK
Sbjct  61   LKVKDSKTLLFGEKAVTVFGIRNPEEIPWQETGAEYVVESTGVFTDKEKAAAHLKGGAKK  120

Query  122  VVISAPSKDAPMFVMGVNHLEYKKDVDIVSNASCTTNCLA  3
            VVISAPSKDAPMFV+GVN  EYK ++DIVSNASCTTNCLA
Sbjct  121  VVISAPSKDAPMFVVGVNEHEYKPEIDIVSNASCTTNCLA  160



>ref|XP_006659081.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase 1, cytosolic-like 
[Oryza brachyantha]
Length=337

 Score =   249 bits (635),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 129/160 (81%), Positives = 145/160 (91%), Gaps = 0/160 (0%)
 Frame = -2

Query  482  MAKVKIGINGFGRIGRLVARVALLSDDIELVAVNDPFITTDYMTYMFKYDTVHGQWTKNE  303
            M K+KIGINGFGRIGRLVARVAL S+D+ELVAVNDPFITTDYMTYMFKYDTVHGQW  ++
Sbjct  1    MGKIKIGINGFGRIGRLVARVALQSEDVELVAVNDPFITTDYMTYMFKYDTVHGQWKHSD  60

Query  302  LKVKDAKTLLFGDRHVAVFDKRNPEEIPWGETGAEYVVESTGVFTDQDkaaahlkggakK  123
            +K+KD+KTLL G++ V VF  RNP+EIPW E GAEYVVESTGVFTD++KAAAHLKGGAKK
Sbjct  61   IKIKDSKTLLLGEKPVTVFGIRNPDEIPWAEAGAEYVVESTGVFTDKEKAAAHLKGGAKK  120

Query  122  VVISAPSKDAPMFVMGVNHLEYKKDVDIVSNASCTTNCLA  3
            VVISAPSKDAPMFV+GVN  +Y  D+DIVSNASCTTNCLA
Sbjct  121  VVISAPSKDAPMFVVGVNEDKYTPDIDIVSNASCTTNCLA  160



>gb|ACJ85080.1| unknown [Medicago truncatula]
 gb|AFK44286.1| unknown [Medicago truncatula]
Length=340

 Score =   249 bits (636),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 130/158 (82%), Positives = 144/158 (91%), Gaps = 0/158 (0%)
 Frame = -2

Query  476  KVKIGINGFGRIGRLVARVALLSDDIELVAVNDPFITTDYMTYMFKYDTVHGQWTKNELK  297
            K++IGINGFGRIGRLVARVAL  +D+ELVA+NDPFITTDYMTYMFKYDTVHGQW   ELK
Sbjct  6    KIRIGINGFGRIGRLVARVALQRNDVELVAINDPFITTDYMTYMFKYDTVHGQWKHFELK  65

Query  296  VKDAKTLLFGDRHVAVFDKRNPEEIPWGETGAEYVVESTGVFTDQDkaaahlkggakKVV  117
            VKD KTLLFG++ VAVF  RNPEEIPWGE GA+YV+ESTGVFTD+DKAAAHLKGGAKKVV
Sbjct  66   VKDTKTLLFGEKEVAVFGTRNPEEIPWGEVGADYVIESTGVFTDKDKAAAHLKGGAKKVV  125

Query  116  ISAPSKDAPMFVMGVNHLEYKKDVDIVSNASCTTNCLA  3
            ISAPSKDAPMFV+GVN  EYK +++IVSNASCTTN LA
Sbjct  126  ISAPSKDAPMFVVGVNEKEYKPELNIVSNASCTTNRLA  163



>gb|AAA32794.1| cystolic glyceraldehyde-3-phosphate dehydrogenase [Arabidopsis 
thaliana]
 gb|AAA32796.1| glyceraldehyde-3-phosphate dehydrogenase [Arabidopsis thaliana]
Length=338

 Score =   249 bits (635),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 129/158 (82%), Positives = 142/158 (90%), Gaps = 0/158 (0%)
 Frame = -2

Query  476  KVKIGINGFGRIGRLVARVALLSDDIELVAVNDPFITTDYMTYMFKYDTVHGQWTKNELK  297
            K++IGINGFGRIGRLVARV L  DD+ELVAVNDPFITT+YMTYMFKYD+VHGQW  NELK
Sbjct  5    KIRIGINGFGRIGRLVARVVLQRDDVELVAVNDPFITTEYMTYMFKYDSVHGQWKHNELK  64

Query  296  VKDAKTLLFGDRHVAVFDKRNPEEIPWGETGAEYVVESTGVFTDQDkaaahlkggakKVV  117
            +KD KTLLFG++ V VF  RNPE+IPW E GA+YVVESTGVFTD+DKAAAHLKGGAKKVV
Sbjct  65   IKDEKTLLFGEKPVTVFGIRNPEDIPWAEAGADYVVESTGVFTDKDKAAAHLKGGAKKVV  124

Query  116  ISAPSKDAPMFVMGVNHLEYKKDVDIVSNASCTTNCLA  3
            IS PSKDAPMFV+GVN  EYK D+DIVSNASCTTNCLA
Sbjct  125  ISEPSKDAPMFVVGVNEHEYKSDLDIVSNASCTTNCLA  162



>dbj|BAH56909.1| AT1G13440 [Arabidopsis thaliana]
Length=343

 Score =   249 bits (636),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 130/158 (82%), Positives = 144/158 (91%), Gaps = 0/158 (0%)
 Frame = -2

Query  476  KVKIGINGFGRIGRLVARVALLSDDIELVAVNDPFITTDYMTYMFKYDTVHGQWTKNELK  297
            K++IGINGFGRIGRLVARV L  DD+ELVAVNDPFITT+YMTYMFKYD+VHGQW  +ELK
Sbjct  5    KIRIGINGFGRIGRLVARVVLQRDDVELVAVNDPFITTEYMTYMFKYDSVHGQWKHHELK  64

Query  296  VKDAKTLLFGDRHVAVFDKRNPEEIPWGETGAEYVVESTGVFTDQDkaaahlkggakKVV  117
            VKD KTLLFG++ V VF  RNPE+IPWGE GA++VVESTGVFTD+DKAAAHLKGGAKKVV
Sbjct  65   VKDDKTLLFGEKPVTVFGIRNPEDIPWGEAGADFVVESTGVFTDKDKAAAHLKGGAKKVV  124

Query  116  ISAPSKDAPMFVMGVNHLEYKKDVDIVSNASCTTNCLA  3
            ISAPSKDAPMFV+GVN  EYK D+DIVSNASCTTNCLA
Sbjct  125  ISAPSKDAPMFVVGVNEHEYKSDLDIVSNASCTTNCLA  162



>ref|NP_172801.1| glyceraldehyde 3-phosphate dehydrogenase GAPC2 [Arabidopsis thaliana]
 sp|Q9FX54.1|G3PC2_ARATH RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase GAPC2, 
cytosolic; AltName: Full=NAD-dependent glyceraldehydephosphate 
dehydrogenase C subunit 2 [Arabidopsis thaliana]
 gb|AAG09543.1|AC011810_2 Putative glyceraldehyde-3-phosphate dehydrogenase [Arabidopsis 
thaliana]
 gb|AAK95257.1|AF410271_1 At1g13440/F13B4_8 [Arabidopsis thaliana]
 gb|AAK83601.1| At1g13440/F13B4_8 [Arabidopsis thaliana]
 gb|AAL90936.1| At1g13440/F13B4_8 [Arabidopsis thaliana]
 gb|AEE29016.1| glyceraldehyde 3-phosphate dehydrogenase [Arabidopsis thaliana]
Length=338

 Score =   249 bits (635),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 130/158 (82%), Positives = 144/158 (91%), Gaps = 0/158 (0%)
 Frame = -2

Query  476  KVKIGINGFGRIGRLVARVALLSDDIELVAVNDPFITTDYMTYMFKYDTVHGQWTKNELK  297
            K++IGINGFGRIGRLVARV L  DD+ELVAVNDPFITT+YMTYMFKYD+VHGQW  +ELK
Sbjct  5    KIRIGINGFGRIGRLVARVVLQRDDVELVAVNDPFITTEYMTYMFKYDSVHGQWKHHELK  64

Query  296  VKDAKTLLFGDRHVAVFDKRNPEEIPWGETGAEYVVESTGVFTDQDkaaahlkggakKVV  117
            VKD KTLLFG++ V VF  RNPE+IPWGE GA++VVESTGVFTD+DKAAAHLKGGAKKVV
Sbjct  65   VKDDKTLLFGEKPVTVFGIRNPEDIPWGEAGADFVVESTGVFTDKDKAAAHLKGGAKKVV  124

Query  116  ISAPSKDAPMFVMGVNHLEYKKDVDIVSNASCTTNCLA  3
            ISAPSKDAPMFV+GVN  EYK D+DIVSNASCTTNCLA
Sbjct  125  ISAPSKDAPMFVVGVNEHEYKSDLDIVSNASCTTNCLA  162



>dbj|BAJ17660.1| glyceraldehyde 3-phosphate dehydrogenase [Gynura bicolor]
Length=340

 Score =   249 bits (635),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 131/158 (83%), Positives = 143/158 (91%), Gaps = 0/158 (0%)
 Frame = -2

Query  476  KVKIGINGFGRIGRLVARVALLSDDIELVAVNDPFITTDYMTYMFKYDTVHGQWTKNELK  297
            K+KIGINGFGRIGRLVARVAL  DDIELVAVNDPFI+TDYMTYMFKYDTVHGQW  +ELK
Sbjct  6    KIKIGINGFGRIGRLVARVALQRDDIELVAVNDPFISTDYMTYMFKYDTVHGQWKHHELK  65

Query  296  VKDAKTLLFGDRHVAVFDKRNPEEIPWGETGAEYVVESTGVFTDQDkaaahlkggakKVV  117
            VKD KTLLFG++ V+VF  RNPEEIPWG  GA++VVESTGVFTD+DKAAAHLKGGAKKVV
Sbjct  66   VKDEKTLLFGEKPVSVFGFRNPEEIPWGAAGADFVVESTGVFTDKDKAAAHLKGGAKKVV  125

Query  116  ISAPSKDAPMFVMGVNHLEYKKDVDIVSNASCTTNCLA  3
            ISAPS +APMFVMGVN  EY  D++IVSNASCTTNCLA
Sbjct  126  ISAPSGNAPMFVMGVNEKEYTSDLNIVSNASCTTNCLA  163



>ref|XP_009117998.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase, cytosolic-like 
[Brassica rapa]
Length=338

 Score =   249 bits (635),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 130/158 (82%), Positives = 144/158 (91%), Gaps = 0/158 (0%)
 Frame = -2

Query  476  KVKIGINGFGRIGRLVARVALLSDDIELVAVNDPFITTDYMTYMFKYDTVHGQWTKNELK  297
            K+KIGINGFGRIGRLVARV L  +D+ELVAVNDPFITT+YMTYMFKYD+VHGQW  NELK
Sbjct  5    KIKIGINGFGRIGRLVARVILQRNDVELVAVNDPFITTEYMTYMFKYDSVHGQWKHNELK  64

Query  296  VKDAKTLLFGDRHVAVFDKRNPEEIPWGETGAEYVVESTGVFTDQDkaaahlkggakKVV  117
            +KD KTLLFG++ V VF  RNPE+IPWGE GA++VVESTGVFTD+DKAAAHLKGGAKKVV
Sbjct  65   LKDEKTLLFGEKPVTVFGIRNPEDIPWGEAGADFVVESTGVFTDKDKAAAHLKGGAKKVV  124

Query  116  ISAPSKDAPMFVMGVNHLEYKKDVDIVSNASCTTNCLA  3
            ISAPSKDAPMFV+GVN  EYK D+DIVSNASCTTNCLA
Sbjct  125  ISAPSKDAPMFVVGVNGHEYKSDLDIVSNASCTTNCLA  162



>emb|CDX98100.1| BnaA06g08510D [Brassica napus]
Length=318

 Score =   248 bits (633),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 130/158 (82%), Positives = 144/158 (91%), Gaps = 0/158 (0%)
 Frame = -2

Query  476  KVKIGINGFGRIGRLVARVALLSDDIELVAVNDPFITTDYMTYMFKYDTVHGQWTKNELK  297
            K+KIGINGFGRIGRLVARV L  +D+ELVAVNDPFITT+YMTYMFKYD+VHGQW  NELK
Sbjct  29   KIKIGINGFGRIGRLVARVILQRNDVELVAVNDPFITTEYMTYMFKYDSVHGQWKHNELK  88

Query  296  VKDAKTLLFGDRHVAVFDKRNPEEIPWGETGAEYVVESTGVFTDQDkaaahlkggakKVV  117
            VKD KTLLFG++ V VF  RNPE+IPWGE GA++VVESTGVFTD+DKAAAHLKGGAKKVV
Sbjct  89   VKDEKTLLFGEKPVTVFGIRNPEDIPWGEAGADFVVESTGVFTDKDKAAAHLKGGAKKVV  148

Query  116  ISAPSKDAPMFVMGVNHLEYKKDVDIVSNASCTTNCLA  3
            ISAPSKDAPMFV+GVN  EYK D++IVSNASCTTNCLA
Sbjct  149  ISAPSKDAPMFVVGVNEHEYKSDLNIVSNASCTTNCLA  186



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 814135294960