BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c6135_g1_i1 len=2945 path=[1:0-2719 2721:2720-2944]

Length=2945
                                                                      Score     E

ref|XP_004244795.1|  PREDICTED: cation/H(+) antiporter 15-like          818   0.0      
ref|XP_009627829.1|  PREDICTED: cation/H(+) antiporter 15-like is...    814   0.0      
ref|XP_009773648.1|  PREDICTED: cation/H(+) antiporter 15-like          811   0.0      
ref|XP_006366098.1|  PREDICTED: cation/H(+) antiporter 15-like          809   0.0      
ref|XP_011096534.1|  PREDICTED: cation/H(+) antiporter 15-like          793   0.0      
gb|EYU33342.1|  hypothetical protein MIMGU_mgv1a001430mg                779   0.0      
ref|XP_011082524.1|  PREDICTED: cation/H(+) antiporter 15-like          773   0.0      
emb|CDO99423.1|  unnamed protein product                                743   0.0      
gb|EPS59090.1|  hypothetical protein M569_15718                         711   0.0      
ref|XP_009627830.1|  PREDICTED: cation/H(+) antiporter 15-like is...    682   0.0      
ref|XP_002516306.1|  Na(+)/H(+) antiporter, putative                    625   0.0      Ricinus communis
ref|XP_007048418.1|  Cation/hydrogen exchanger 15                       624   0.0      
ref|XP_002262677.2|  PREDICTED: cation/H(+) antiporter 15               621   0.0      Vitis vinifera
emb|CAN66285.1|  hypothetical protein VITISV_011183                     621   0.0      Vitis vinifera
ref|XP_006432183.1|  hypothetical protein CICLE_v10000276mg             617   0.0      
emb|CDP09934.1|  unnamed protein product                                617   0.0      
ref|XP_002310518.2|  hypothetical protein POPTR_0007s04230g             616   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_010090834.1|  Cation/H(+) antiporter 15                          616   0.0      
gb|KDO50743.1|  hypothetical protein CISIN_1g043446mg                   614   0.0      
ref|XP_006366744.1|  PREDICTED: cation/H(+) antiporter 15-like          615   0.0      
ref|XP_006409680.1|  hypothetical protein EUTSA_v10023201mg             613   0.0      
ref|XP_011023089.1|  PREDICTED: cation/H(+) antiporter 15               612   0.0      
gb|KDP39397.1|  hypothetical protein JCGZ_03679                         611   0.0      
ref|XP_008461025.1|  PREDICTED: cation/H(+) antiporter 15               611   0.0      
emb|CBI37527.3|  unnamed protein product                                610   0.0      
ref|XP_010273345.1|  PREDICTED: cation/H(+) antiporter 15-like          610   0.0      
ref|XP_009616485.1|  PREDICTED: cation/H(+) antiporter 15-like          610   0.0      
ref|XP_010527098.1|  PREDICTED: cation/H(+) antiporter 15               610   0.0      
ref|XP_009801607.1|  PREDICTED: cation/H(+) antiporter 15-like          609   0.0      
ref|XP_011081225.1|  PREDICTED: cation/H(+) antiporter 15-like          609   0.0      
ref|XP_009776809.1|  PREDICTED: cation/H(+) antiporter 15-like          607   0.0      
ref|XP_009595814.1|  PREDICTED: cation/H(+) antiporter 15-like is...    607   0.0      
ref|XP_004147368.1|  PREDICTED: cation/H(+) antiporter 15-like          607   0.0      
ref|XP_008342861.1|  PREDICTED: cation/H(+) antiporter 15               607   0.0      
gb|EYU30300.1|  hypothetical protein MIMGU_mgv1a026576mg                601   0.0      
ref|XP_010034375.1|  PREDICTED: cation/H(+) antiporter 15               603   0.0      
gb|KFK39941.1|  hypothetical protein AALP_AA3G309700                    600   0.0      
ref|XP_003630280.1|  Cation proton exchanger                            597   0.0      
ref|XP_010277628.1|  PREDICTED: cation/H(+) antiporter 15-like          597   0.0      
emb|CDY37213.1|  BnaA09g08340D                                          594   0.0      
emb|CDX81450.1|  BnaC09g08610D                                          593   0.0      
ref|XP_009112379.1|  PREDICTED: cation/H(+) antiporter 15               593   0.0      
ref|XP_010277629.1|  PREDICTED: cation/H(+) antiporter 15-like          593   0.0      
ref|XP_010680215.1|  PREDICTED: cation/H(+) antiporter 15               588   0.0      
ref|XP_003602627.1|  Cation proton exchanger                            588   0.0      
ref|XP_007213030.1|  hypothetical protein PRUPE_ppa023146mg             585   0.0      
ref|XP_002883804.1|  hypothetical protein ARALYDRAFT_480314             585   0.0      
ref|XP_009124800.1|  PREDICTED: cation/H(+) antiporter 15               583   0.0      
ref|NP_178985.1|  cation/H(+) antiporter 15                             583   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_006837063.1|  hypothetical protein AMTR_s00110p00080970          583   0.0      
ref|XP_010518406.1|  PREDICTED: cation/H(+) antiporter 15-like          582   0.0      
ref|XP_006355520.1|  PREDICTED: cation/H(+) antiporter 15-like          582   0.0      
gb|EYU18565.1|  hypothetical protein MIMGU_mgv1a022165mg                579   0.0      
ref|XP_004246149.1|  PREDICTED: cation/H(+) antiporter 15               581   0.0      
ref|XP_006299510.1|  hypothetical protein CARUB_v10015680mg             580   0.0      
ref|XP_011070107.1|  PREDICTED: cation/H(+) antiporter 15-like          576   0.0      
ref|XP_010468568.1|  PREDICTED: LOW QUALITY PROTEIN: cation/H(+) ...    574   0.0      
ref|XP_004486258.1|  PREDICTED: cation/H(+) antiporter 15-like          572   0.0      
ref|XP_003522484.1|  PREDICTED: cation/H(+) antiporter 15-like          571   0.0      
ref|XP_008804682.1|  PREDICTED: cation/H(+) antiporter 15               573   0.0      
ref|XP_004502946.1|  PREDICTED: cation/H(+) antiporter 15-like          582   0.0      
ref|XP_007137799.1|  hypothetical protein PHAVU_009G156500g             570   0.0      
gb|EYU24742.1|  hypothetical protein MIMGU_mgv1a026419mg                568   0.0      
ref|XP_010923024.1|  PREDICTED: cation/H(+) antiporter 15               568   0.0      
ref|XP_004503932.1|  PREDICTED: cation/H(+) antiporter 15-like          565   0.0      
emb|CDY47435.1|  BnaA08g29740D                                          564   0.0      
ref|XP_008227634.1|  PREDICTED: cation/H(+) antiporter 15               560   0.0      
emb|CDX71162.1|  BnaC07g04410D                                          558   0.0      
ref|XP_003547128.2|  PREDICTED: cation/H(+) antiporter 15-like          553   5e-179   
gb|KHN31156.1|  Cation/H(+) antiporter 15                               553   7e-179   
gb|KEH36491.1|  cation/H+ exchanger 3                                   551   3e-178   
ref|XP_007148262.1|  hypothetical protein PHAVU_006G193500g             552   3e-178   
ref|XP_010490208.1|  PREDICTED: cation/H(+) antiporter 15-like          548   9e-178   
ref|XP_009391148.1|  PREDICTED: cation/H(+) antiporter 15               538   1e-172   
ref|XP_003524307.1|  PREDICTED: cation/H(+) antiporter 15-like          535   1e-171   
ref|XP_010322904.1|  PREDICTED: cation/H(+) antiporter 15-like          527   4e-170   
gb|EAY98474.1|  hypothetical protein OsI_20388                          531   7e-170   Oryza sativa Indica Group [Indian rice]
ref|XP_009595815.1|  PREDICTED: cation/H(+) antiporter 15-like is...    526   1e-169   
ref|NP_001055872.1|  Os05g0485000                                       530   1e-169   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008649801.1|  PREDICTED: cation/H(+) antiporter 15-like          525   1e-167   
ref|XP_003566124.1|  PREDICTED: cation/H(+) antiporter 15-like          525   2e-167   
gb|EAY76275.1|  hypothetical protein OsI_04210                          523   7e-167   Oryza sativa Indica Group [Indian rice]
ref|XP_007159847.1|  hypothetical protein PHAVU_002G272700g             521   1e-166   
dbj|BAB62576.1|  Na+/H+ antiporter-like protein                         523   1e-166   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002441279.1|  hypothetical protein SORBIDRAFT_09g023730          522   3e-166   Sorghum bicolor [broomcorn]
ref|XP_002456534.1|  hypothetical protein SORBIDRAFT_03g038000          518   4e-165   Sorghum bicolor [broomcorn]
ref|XP_010273236.1|  PREDICTED: cation/H(+) antiporter 15-like          513   7e-165   
gb|KGN54815.1|  hypothetical protein Csa_4G507450                       516   5e-164   
gb|EPS59894.1|  hypothetical protein M569_14908                         510   5e-163   
ref|XP_004146404.1|  PREDICTED: cation/H(+) antiporter 15-like          513   9e-163   
emb|CDM84725.1|  unnamed protein product                                512   1e-162   
gb|EMS62572.1|  Cation/H(+) antiporter 15                               510   8e-162   
ref|XP_003564480.1|  PREDICTED: cation/H(+) antiporter 15-like          511   9e-162   
ref|XP_008657132.1|  PREDICTED: cation/H(+) antiporter 15-like          509   3e-161   
ref|XP_002519710.1|  Na(+)/H(+) antiporter, putative                    507   9e-161   Ricinus communis
ref|XP_010655643.1|  PREDICTED: cation/H(+) antiporter 15-like          506   1e-160   
gb|EPS60468.1|  hypothetical protein M569_14334                         501   7e-160   
emb|CBI30847.3|  unnamed protein product                                505   1e-159   
dbj|BAK06977.1|  predicted protein                                      504   2e-159   
ref|XP_011012847.1|  PREDICTED: cation/H(+) antiporter 15-like          499   5e-158   
ref|XP_004156031.1|  PREDICTED: cation/H(+) antiporter 15-like          494   6e-156   
ref|XP_004972230.1|  PREDICTED: cation/H(+) antiporter 15-like          492   8e-155   
dbj|BAK03649.1|  predicted protein                                      487   7e-153   
gb|KHN33638.1|  Cation/H(+) antiporter 15                               482   9e-153   
ref|XP_002305995.2|  hypothetical protein POPTR_0004s13620g             479   3e-151   Populus trichocarpa [western balsam poplar]
ref|XP_007052425.1|  Cation proton exchanger                            479   3e-150   
gb|AFW82335.1|  hypothetical protein ZEAMMB73_343625                    482   3e-150   
gb|KFK42894.1|  hypothetical protein AALP_AA1G052600                    478   2e-149   
emb|CDP06345.1|  unnamed protein product                                473   5e-148   
ref|XP_006418010.1|  hypothetical protein EUTSA_v10006774mg             473   1e-147   
gb|KDO78131.1|  hypothetical protein CISIN_1g040629mg                   469   5e-147   
emb|CDY47266.1|  BnaA10g03800D                                          470   5e-147   
ref|XP_009119138.1|  PREDICTED: cation/H(+) antiporter 23, chloro...    471   8e-147   
emb|CDY10128.1|  BnaC05g03710D                                          469   4e-146   
gb|KDP37950.1|  hypothetical protein JCGZ_04593                         468   4e-146   
gb|EMS52978.1|  Cation/H(+) antiporter 15                               469   5e-146   
ref|XP_002892302.1|  cation/H+ exchanger                                468   8e-146   
ref|XP_010457647.1|  PREDICTED: cation/H(+) antiporter 23, chloro...    467   1e-145   
gb|AAX49549.1|  cation/H+ exchanger                                     466   5e-145   Arabidopsis thaliana [mouse-ear cress]
ref|NP_172049.2|  cation/H(+) antiporter 23                             465   7e-145   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010522268.1|  PREDICTED: cation/H(+) antiporter 23, chloro...    465   8e-145   
ref|XP_010485082.1|  PREDICTED: cation/H(+) antiporter 23, chloro...    465   1e-144   
ref|XP_006303208.1|  hypothetical protein CARUB_v10011346mg             464   1e-144   
ref|XP_010475259.1|  PREDICTED: cation/H(+) antiporter 23, chloro...    464   2e-144   
gb|AAD30610.1|AC007153_2  similar to Na/H antiporter proteins           464   2e-144   Arabidopsis thaliana [mouse-ear cress]
gb|KHN34084.1|  Cation/H(+) antiporter 15                               460   3e-144   
ref|XP_008442278.1|  PREDICTED: cation/H(+) antiporter 15-like          459   4e-143   
ref|XP_007025120.1|  Cation proton exchanger, putative                  460   5e-143   
ref|XP_009402776.1|  PREDICTED: cation/H(+) antiporter 15-like          457   2e-142   
ref|XP_006449661.1|  hypothetical protein CICLE_v10014327mg             456   4e-142   
ref|XP_002517311.1|  monovalent cation:proton antiporter, putative      453   1e-140   Ricinus communis
ref|XP_006447579.1|  hypothetical protein CICLE_v10017901mg             453   3e-140   
ref|XP_010542776.1|  PREDICTED: cation/H(+) antiporter 23, chloro...    452   7e-140   
ref|XP_011023015.1|  PREDICTED: cation/H(+) antiporter 15-like          451   1e-139   
ref|XP_010058865.1|  PREDICTED: cation/H(+) antiporter 15-like          449   3e-139   
ref|XP_009383032.1|  PREDICTED: cation/H(+) antiporter 15-like          450   3e-139   
ref|XP_010931514.1|  PREDICTED: cation/H(+) antiporter 15-like          450   5e-139   
ref|XP_009393134.1|  PREDICTED: cation/H(+) antiporter 19-like          447   1e-138   
ref|XP_008782791.1|  PREDICTED: cation/H(+) antiporter 15-like          450   1e-138   
ref|XP_008784477.1|  PREDICTED: cation/H(+) antiporter 15-like          446   2e-138   
ref|XP_004231538.1|  PREDICTED: cation/H(+) antiporter 15-like is...    445   1e-137   
ref|XP_010522263.1|  PREDICTED: cation/H(+) antiporter 23, chloro...    444   6e-137   
ref|XP_002309885.2|  cation/hydrogen exchanger family protein           444   6e-137   Populus trichocarpa [western balsam poplar]
ref|XP_009611609.1|  PREDICTED: cation/H(+) antiporter 15-like          442   2e-136   
ref|XP_002440851.1|  hypothetical protein SORBIDRAFT_09g008200          441   2e-136   Sorghum bicolor [broomcorn]
ref|XP_008654236.1|  PREDICTED: uncharacterized protein LOC100191...    441   3e-136   
ref|XP_006410325.1|  hypothetical protein EUTSA_v10016242mg             442   3e-136   
ref|XP_006361543.1|  PREDICTED: cation/H(+) antiporter 15-like          438   5e-135   
ref|XP_006295867.1|  hypothetical protein CARUB_v10024997mg             437   9e-135   
ref|XP_009402107.1|  PREDICTED: cation/H(+) antiporter 19-like          437   1e-134   
ref|XP_007052424.1|  Cation proton exchanger                            437   2e-134   
ref|XP_009770550.1|  PREDICTED: cation/H(+) antiporter 15-like          436   3e-134   
ref|XP_010246811.1|  PREDICTED: cation/H(+) antiporter 19               435   5e-134   
ref|XP_010909726.1|  PREDICTED: cation/H(+) antiporter 19               434   2e-133   
gb|KDP20370.1|  hypothetical protein JCGZ_05253                         432   5e-133   
emb|CDY71641.1|  BnaCnng73770D                                          423   2e-132   
emb|CDY62191.1|  BnaCnng39530D                                          431   7e-132   
ref|XP_008800286.1|  PREDICTED: cation/H(+) antiporter 19-like          429   8e-132   
ref|XP_010932717.1|  PREDICTED: cation/H(+) antiporter 15-like          427   7e-131   
ref|XP_007213157.1|  hypothetical protein PRUPE_ppa025261mg             427   8e-131   
ref|XP_010043343.1|  PREDICTED: cation/H(+) antiporter 19               426   1e-130   
gb|KFK31171.1|  hypothetical protein AALP_AA6G078200                    426   4e-130   
emb|CDY19122.1|  BnaA04g18620D                                          422   6e-129   
gb|EMS63173.1|  Cation/H(+) antiporter 15                               420   9e-129   
ref|XP_006654211.1|  PREDICTED: cation/H(+) antiporter 19-like          420   1e-128   
emb|CDY62190.1|  BnaCnng39520D                                          422   2e-128   
ref|XP_009383924.1|  PREDICTED: cation/H(+) antiporter 19-like          420   2e-128   
ref|XP_006418009.1|  hypothetical protein EUTSA_v10006774mg             419   2e-128   
ref|XP_009141442.1|  PREDICTED: cation/H(+) antiporter 21-like          421   4e-128   
ref|XP_009141200.1|  PREDICTED: cation/H(+) antiporter 21-like          420   6e-128   
ref|XP_009413172.1|  PREDICTED: cation/H(+) antiporter 15-like          421   7e-128   
ref|XP_010910508.1|  PREDICTED: cation/H(+) antiporter 18-like          418   2e-127   
ref|NP_001055076.1|  Os05g0276100                                       417   3e-127   Oryza sativa Japonica Group [Japonica rice]
emb|CDY19121.1|  BnaA04g18610D                                          418   3e-127   
ref|XP_007040405.1|  Cation/H+ exchanger 18 isoform 1                   417   3e-127   
ref|NP_180750.2|  cation/H(+) antiporter 21                             417   4e-127   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009402488.1|  PREDICTED: cation/H(+) antiporter 19-like          416   7e-127   
ref|XP_008798688.1|  PREDICTED: cation/H(+) antiporter 18-like          416   9e-127   
ref|XP_010533613.1|  PREDICTED: cation/H(+) antiporter 18-like          416   1e-126   
ref|XP_006476457.1|  PREDICTED: cation/H(+) antiporter 18-like is...    412   1e-125   
ref|XP_004512035.1|  PREDICTED: cation/H(+) antiporter 15-like          413   1e-125   
gb|EYU23396.1|  hypothetical protein MIMGU_mgv1a001514mg                412   1e-125   
ref|XP_006476456.1|  PREDICTED: cation/H(+) antiporter 18-like is...    412   1e-125   
ref|XP_002315160.2|  hypothetical protein POPTR_0010s19640g             413   2e-125   Populus trichocarpa [western balsam poplar]
ref|XP_008804681.1|  PREDICTED: cation/H(+) antiporter 15-like          413   2e-125   
ref|XP_009420052.1|  PREDICTED: cation/H(+) antiporter 15-like          409   4e-125   
ref|XP_010106576.1|  Cation/H(+) antiporter 18                          411   5e-125   
ref|XP_006439427.1|  hypothetical protein CICLE_v10018864mg             410   7e-125   
ref|XP_010089837.1|  Cation/H(+) antiporter 15                          412   1e-124   
gb|KHN45029.1|  Cation/H(+) antiporter 19                               410   2e-124   
ref|XP_006439426.1|  hypothetical protein CICLE_v10018864mg             410   2e-124   
ref|XP_010473909.1|  PREDICTED: cation/H(+) antiporter 21-like          410   2e-124   
ref|XP_002297994.1|  cation/hydrogen exchanger family protein           409   2e-124   Populus trichocarpa [western balsam poplar]
ref|XP_003542393.1|  PREDICTED: cation/H(+) antiporter 19-like          409   3e-124   
ref|XP_007040407.1|  Cation/H+ exchanger 18                             409   3e-124   
gb|KHN35057.1|  Cation/H(+) antiporter 18                               408   4e-124   
ref|XP_003611041.1|  Na+/H+ antiporter-like protein                     408   5e-124   
ref|XP_007158549.1|  hypothetical protein PHAVU_002G161600g             408   5e-124   
gb|KHG06329.1|  hypothetical protein F383_32801                         407   1e-123   
ref|XP_010315616.1|  PREDICTED: cation/H(+) antiporter 15-like is...    404   1e-123   
ref|XP_008369567.1|  PREDICTED: cation/H(+) antiporter 19-like          407   1e-123   
ref|XP_004511538.1|  PREDICTED: LOW QUALITY PROTEIN: cation/H(+) ...    407   1e-123   
gb|KHG26273.1|  Cation/H(+) antiporter 18 -like protein                 407   2e-123   
ref|XP_011026948.1|  PREDICTED: cation/H(+) antiporter 18-like          406   2e-123   
gb|KHG06330.1|  hypothetical protein F383_32801                         407   2e-123   
ref|XP_007028838.1|  Cation/H+ exchanger 19                             406   3e-123   
ref|XP_006285823.1|  hypothetical protein CARUB_v10007299mg             407   3e-123   
ref|XP_006467497.1|  PREDICTED: cation/H(+) antiporter 15-like          402   6e-123   
ref|XP_009402780.1|  PREDICTED: cation/H(+) antiporter 19-like          404   1e-122   
ref|XP_006573800.1|  PREDICTED: cation/H(+) antiporter 18-like is...    405   1e-122   
ref|XP_003538685.1|  PREDICTED: cation/H(+) antiporter 18-like is...    405   1e-122   
ref|XP_004298855.1|  PREDICTED: cation/H(+) antiporter 18-like          404   1e-122   
gb|KHN25663.1|  Cation/H(+) antiporter 18                               405   1e-122   
ref|XP_004146576.1|  PREDICTED: cation/H(+) antiporter 18-like          403   4e-122   
ref|XP_003611042.1|  Cation proton exchanger                            403   5e-122   
ref|XP_006841535.1|  hypothetical protein AMTR_s00003p00159310          402   7e-122   
ref|XP_009353458.1|  PREDICTED: cation/H(+) antiporter 19               403   9e-122   
ref|XP_004309917.1|  PREDICTED: cation/H(+) antiporter 15-like          404   9e-122   
ref|XP_006664748.1|  PREDICTED: cation/H(+) antiporter 19-like          402   9e-122   
ref|XP_002270854.1|  PREDICTED: cation/H(+) antiporter 19               402   1e-121   Vitis vinifera
ref|XP_006841531.1|  hypothetical protein AMTR_s00003p00155190          402   1e-121   
ref|XP_004500568.1|  PREDICTED: cation/H(+) antiporter 15-like          402   1e-121   
ref|XP_008238996.1|  PREDICTED: cation/H(+) antiporter 18-like          401   2e-121   
ref|NP_001030975.1|  cation/H(+) antiporter 23                          400   2e-121   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006646431.1|  PREDICTED: cation/H(+) antiporter 15-like          414   3e-121   
gb|KDP25352.1|  hypothetical protein JCGZ_20508                         401   3e-121   
ref|XP_008390248.1|  PREDICTED: cation/H(+) antiporter 19               401   3e-121   
ref|XP_002868583.1|  ATCHX18                                            401   4e-121   
ref|XP_004164366.1|  PREDICTED: cation/H(+) antiporter 18-like          400   4e-121   
ref|XP_004298244.1|  PREDICTED: cation/H(+) antiporter 19-like          402   4e-121   
ref|XP_004289599.1|  PREDICTED: cation/H(+) antiporter 15-like          401   7e-121   
ref|XP_003543796.1|  PREDICTED: cation/H(+) antiporter 19-like          400   7e-121   
ref|XP_010039253.1|  PREDICTED: cation/H(+) antiporter 15-like          400   8e-121   
ref|XP_008451983.1|  PREDICTED: LOW QUALITY PROTEIN: cation/H(+) ...    400   8e-121   
ref|XP_008341283.1|  PREDICTED: cation/H(+) antiporter 18-like          399   1e-120   
ref|XP_007210361.1|  hypothetical protein PRUPE_ppa001551mg             399   1e-120   
ref|XP_006343906.1|  PREDICTED: cation/H(+) antiporter 18-like          399   1e-120   
ref|XP_004245551.1|  PREDICTED: cation/H(+) antiporter 18-like          399   2e-120   
ref|XP_010676379.1|  PREDICTED: cation/H(+) antiporter 18-like          399   2e-120   
ref|XP_007210366.1|  hypothetical protein PRUPE_ppa001527mg             399   2e-120   
ref|XP_002314344.2|  hypothetical protein POPTR_0010s00740g             398   3e-120   Populus trichocarpa [western balsam poplar]
ref|XP_009354490.1|  PREDICTED: cation/H(+) antiporter 15-like          398   4e-120   
ref|XP_007131515.1|  hypothetical protein PHAVU_011G019400g             398   4e-120   
ref|XP_001770267.1|  predicted protein                                  395   5e-120   
ref|XP_009802616.1|  PREDICTED: cation/H(+) antiporter 18-like          397   7e-120   
ref|XP_011036077.1|  PREDICTED: cation/H(+) antiporter 15-like          397   7e-120   
ref|XP_010096456.1|  Cation/H(+) antiporter 18                          396   1e-119   
ref|XP_007225273.1|  hypothetical protein PRUPE_ppa001482mg             397   2e-119   
ref|XP_006405324.1|  hypothetical protein EUTSA_v10027645mg             396   2e-119   
ref|XP_010921563.1|  PREDICTED: cation/H(+) antiporter 15-like          397   2e-119   
ref|XP_008793392.1|  PREDICTED: cation/H(+) antiporter 15-like          395   2e-119   
ref|XP_010436112.1|  PREDICTED: cation/H(+) antiporter 18-like          396   2e-119   
ref|XP_001773370.1|  predicted protein                                  395   3e-119   
ref|XP_010447730.1|  PREDICTED: cation/H(+) antiporter 18-like          396   3e-119   
ref|XP_006441942.1|  hypothetical protein CICLE_v10018885mg             396   3e-119   
ref|XP_009782586.1|  PREDICTED: cation/H(+) antiporter 18-like          395   4e-119   
ref|XP_006471978.1|  PREDICTED: cation/H(+) antiporter 23, chloro...    396   4e-119   
ref|XP_008227733.1|  PREDICTED: cation/H(+) antiporter 15-like          394   4e-119   
ref|XP_002509894.1|  Na(+)/H(+) antiporter, putative                    395   4e-119   Ricinus communis
ref|XP_011022576.1|  PREDICTED: cation/H(+) antiporter 18-like          395   5e-119   
ref|XP_004252574.1|  PREDICTED: cation/H(+) antiporter 18               395   5e-119   
ref|XP_003532552.1|  PREDICTED: cation/H(+) antiporter 15-like          395   6e-119   
ref|XP_010441325.1|  PREDICTED: cation/H(+) antiporter 18               395   7e-119   
gb|KDP25351.1|  hypothetical protein JCGZ_20507                         395   7e-119   
ref|XP_004233089.1|  PREDICTED: cation/H(+) antiporter 18-like          395   8e-119   
ref|XP_008238994.1|  PREDICTED: cation/H(+) antiporter 18-like          394   1e-118   
ref|XP_006406710.1|  hypothetical protein EUTSA_v10020094mg             394   1e-118   
gb|KHN17780.1|  Cation/H(+) antiporter 19                               394   2e-118   
ref|XP_009334467.1|  PREDICTED: cation/H(+) antiporter 18               394   2e-118   
ref|XP_003550583.1|  PREDICTED: cation/H(+) antiporter 19-like          394   2e-118   
ref|XP_009416716.1|  PREDICTED: cation/H(+) antiporter 15-like          394   3e-118   
ref|XP_010261447.1|  PREDICTED: cation/H(+) antiporter 18 isoform X2    392   5e-118   
gb|KHG13786.1|  Cation/H(+) antiporter 18 -like protein                 392   6e-118   
ref|XP_010261446.1|  PREDICTED: cation/H(+) antiporter 18 isoform X1    392   7e-118   
ref|XP_006360740.1|  PREDICTED: cation/H(+) antiporter 18-like          392   7e-118   
ref|XP_011012790.1|  PREDICTED: cation/H(+) antiporter 19-like          392   9e-118   
ref|XP_006355611.1|  PREDICTED: cation/H(+) antiporter 18-like          392   9e-118   
gb|EPS69500.1|  hypothetical protein M569_05263                         391   1e-117   
ref|XP_002883073.1|  predicted protein                                  391   1e-117   
ref|XP_004244724.1|  PREDICTED: cation/H(+) antiporter 18-like          391   1e-117   
ref|XP_008385052.1|  PREDICTED: cation/H(+) antiporter 18               391   1e-117   
ref|XP_009608562.1|  PREDICTED: cation/H(+) antiporter 18-like          391   2e-117   
gb|AAX49546.1|  cation/H+ exchanger                                     391   2e-117   
ref|XP_009137322.1|  PREDICTED: cation/H(+) antiporter 17               391   2e-117   
ref|XP_008776559.1|  PREDICTED: cation/H(+) antiporter 19-like          391   2e-117   
ref|XP_011080876.1|  PREDICTED: cation/H(+) antiporter 18-like          390   2e-117   
ref|NP_198976.3|  cation/H(+) antiporter 18                             391   2e-117   
ref|XP_010999352.1|  PREDICTED: cation/H(+) antiporter 19-like          391   2e-117   
gb|KEH32403.1|  cation/H+ exchanger 3                                   390   3e-117   
ref|XP_008451982.1|  PREDICTED: cation/H(+) antiporter 18-like          390   3e-117   
ref|XP_009766374.1|  PREDICTED: cation/H(+) antiporter 18-like          390   4e-117   
ref|XP_002276249.1|  PREDICTED: cation/H(+) antiporter 18               389   5e-117   
ref|XP_006297013.1|  hypothetical protein CARUB_v10013004mg             390   5e-117   
gb|KDO46881.1|  hypothetical protein CISIN_1g003517mg                   390   6e-117   
ref|XP_006418008.1|  hypothetical protein EUTSA_v10006774mg             387   6e-117   
ref|XP_006478542.1|  PREDICTED: cation/H(+) antiporter 19-like          390   6e-117   
ref|XP_004245552.1|  PREDICTED: cation/H(+) antiporter 18-like is...    389   8e-117   
ref|XP_004505591.1|  PREDICTED: cation/H(+) antiporter 19-like          389   8e-117   
emb|CBI26043.3|  unnamed protein product                                388   9e-117   
ref|XP_009359907.1|  PREDICTED: cation/H(+) antiporter 19-like          390   9e-117   
emb|CDY69175.1|  BnaCnng62230D                                          388   9e-117   
ref|XP_002272080.1|  PREDICTED: cation/H(+) antiporter 18               389   1e-116   
gb|KDO76404.1|  hypothetical protein CISIN_1g003702mg                   389   1e-116   
ref|XP_009620181.1|  PREDICTED: cation/H(+) antiporter 18-like          389   1e-116   
ref|XP_006476453.1|  PREDICTED: cation/H(+) antiporter 18-like is...    389   1e-116   
ref|XP_007154518.1|  hypothetical protein PHAVU_003G125300g             388   2e-116   
ref|XP_006439425.1|  hypothetical protein CICLE_v10018903mg             388   2e-116   
ref|XP_010931502.1|  PREDICTED: cation/H(+) antiporter 15-like          388   3e-116   
gb|AES89643.2|  cation/H+ exchanger 3                                   388   4e-116   
ref|XP_010101602.1|  Cation/H(+) antiporter 18                          387   4e-116   
emb|CDP12106.1|  unnamed protein product                                387   4e-116   
ref|XP_008451984.1|  PREDICTED: cation/H(+) antiporter 18-like          387   5e-116   
ref|XP_002978431.1|  hypothetical protein SELMODRAFT_50946              386   7e-116   
ref|XP_004298856.1|  PREDICTED: cation/H(+) antiporter 17-like          387   7e-116   
ref|XP_002463597.1|  hypothetical protein SORBIDRAFT_01g002640          387   1e-115   
gb|KDO59509.1|  hypothetical protein CISIN_1g046529mg                   386   1e-115   
ref|NP_188390.2|  cation/H(+) antiporter 19                             386   1e-115   
ref|XP_002879349.1|  predicted protein                                  384   1e-115   
emb|CDY47629.1|  BnaA01g13360D                                          385   1e-115   
ref|XP_009796404.1|  PREDICTED: cation/H(+) antiporter 18-like          385   1e-115   
emb|CDY03530.1|  BnaC01g15520D                                          385   2e-115   
ref|XP_009135538.1|  PREDICTED: cation/H(+) antiporter 19               385   2e-115   
emb|CDX82359.1|  BnaA03g34620D                                          385   2e-115   
ref|XP_006343907.1|  PREDICTED: cation/H(+) antiporter 18-like          385   2e-115   
ref|XP_002304537.2|  hypothetical protein POPTR_0003s13470g             385   2e-115   
ref|XP_004981194.1|  PREDICTED: cation/H(+) antiporter 19-like          385   3e-115   
gb|EYU40046.1|  hypothetical protein MIMGU_mgv1a001527mg                385   3e-115   
emb|CAN81240.1|  hypothetical protein VITISV_031075                     384   3e-115   
ref|XP_006664208.1|  PREDICTED: cation/H(+) antiporter 19-like          383   1e-114   
ref|XP_002970274.1|  hypothetical protein SELMODRAFT_231581             383   1e-114   
ref|XP_008795058.1|  PREDICTED: cation/H(+) antiporter 20               384   1e-114   
ref|XP_009614856.1|  PREDICTED: cation/H(+) antiporter 18-like          383   1e-114   
ref|XP_002509895.1|  Na(+)/H(+) antiporter, putative                    384   1e-114   
ref|XP_010465813.1|  PREDICTED: cation/H(+) antiporter 19 isoform X1    382   2e-114   
ref|XP_009586862.1|  PREDICTED: cation/H(+) antiporter 18-like          382   3e-114   
ref|XP_009586863.1|  PREDICTED: cation/H(+) antiporter 18-like          382   3e-114   
ref|XP_009109299.1|  PREDICTED: cation/H(+) antiporter 17-like          382   4e-114   
ref|XP_004508061.1|  PREDICTED: cation/H(+) antiporter 19-like          382   5e-114   
ref|XP_009140104.1|  PREDICTED: cation/H(+) antiporter 18               381   8e-114   
ref|XP_008792255.1|  PREDICTED: cation/H(+) antiporter 15               381   1e-113   
ref|XP_011073516.1|  PREDICTED: cation/H(+) antiporter 18-like          380   1e-113   
ref|XP_009765985.1|  PREDICTED: cation/H(+) antiporter 18-like          380   2e-113   
emb|CDY24802.1|  BnaA08g15080D                                          380   2e-113   
ref|XP_003595246.1|  Cation proton exchanger                            380   3e-113   
ref|XP_006433290.1|  hypothetical protein CICLE_v10000297mg             380   3e-113   
gb|EYU23392.1|  hypothetical protein MIMGU_mgv1a024127mg                379   4e-113   
ref|XP_010505628.1|  PREDICTED: cation/H(+) antiporter 19-like          379   6e-113   
ref|XP_002276346.1|  PREDICTED: cation/H(+) antiporter 18               378   6e-113   
emb|CDY35447.1|  BnaC03g62130D                                          379   7e-113   
ref|XP_004146578.1|  PREDICTED: cation/H(+) antiporter 18-like          378   1e-112   
ref|XP_003553710.1|  PREDICTED: cation/H(+) antiporter 15-like          378   2e-112   
ref|XP_008662071.1|  PREDICTED: cation/H(+) antiporter 19-like          377   2e-112   
ref|XP_004963208.1|  PREDICTED: cation/H(+) antiporter 19-like          378   2e-112   
ref|XP_002974580.1|  hypothetical protein SELMODRAFT_102077             377   2e-112   
ref|XP_002963280.1|  hypothetical protein SELMODRAFT_80221              377   3e-112   
emb|CDY39729.1|  BnaA04g11240D                                          376   5e-112   
ref|XP_003520797.1|  PREDICTED: cation/H(+) antiporter 15-like          376   7e-112   
ref|XP_010522265.1|  PREDICTED: cation/H(+) antiporter 23, chloro...    374   8e-112   
ref|XP_010541354.1|  PREDICTED: cation/H(+) antiporter 17-like          376   1e-111   
ref|XP_007163349.1|  hypothetical protein PHAVU_001G227300g             375   1e-111   
ref|XP_004146577.1|  PREDICTED: cation/H(+) antiporter 18-like          375   1e-111   
emb|CDY44462.1|  BnaCnng11150D                                          375   1e-111   
ref|XP_002310529.1|  hypothetical protein POPTR_0007s04460g             374   2e-111   
emb|CDP12105.1|  unnamed protein product                                374   3e-111   
ref|XP_010055811.1|  PREDICTED: cation/H(+) antiporter 18               374   3e-111   
gb|AES94002.2|  cation/H+ exchanger 3                                   373   4e-111   
ref|XP_010541366.1|  PREDICTED: cation/H(+) antiporter 17-like          374   4e-111   
ref|XP_002442551.1|  hypothetical protein SORBIDRAFT_08g021730          374   5e-111   
ref|XP_006413527.1|  hypothetical protein EUTSA_v10024412mg             374   8e-111   
ref|XP_008231568.1|  PREDICTED: cation/H(+) antiporter 15-like          374   8e-111   
gb|KEH33439.1|  cation/H+ exchanger 3                                   373   9e-111   
ref|XP_011023088.1|  PREDICTED: cation/H(+) antiporter 15-like          373   1e-110   
ref|XP_003611044.1|  Cation proton exchanger                            373   1e-110   
gb|KEH17740.1|  cation/H+ exchanger 3                                   372   2e-110   
ref|XP_009399874.1|  PREDICTED: cation/H(+) antiporter 20-like          372   4e-110   
ref|XP_010257007.1|  PREDICTED: cation/H(+) antiporter 15-like          372   6e-110   
ref|NP_001067282.2|  Os12g0616500                                       370   8e-110   
ref|XP_004513443.1|  PREDICTED: cation/H(+) antiporter 15-like          371   1e-109   
ref|XP_006429040.1|  hypothetical protein CICLE_v10011060mg             370   2e-109   
gb|EPS69438.1|  hypothetical protein M569_05328                         369   2e-109   
emb|CAN81239.1|  hypothetical protein VITISV_031074                     369   2e-109   
ref|XP_003615414.1|  Cation proton exchanger                            368   7e-109   
ref|XP_006480781.1|  PREDICTED: cation/H(+) antiporter 20-like          369   7e-109   
tpg|DAA47524.1|  TPA: hypothetical protein ZEAMMB73_165935              368   7e-109   
gb|EEC69681.1|  hypothetical protein OsI_39126                          368   7e-109   
gb|KDO76398.1|  hypothetical protein CISIN_1g0036452mg                  364   2e-108   
ref|XP_009137382.1|  PREDICTED: cation/H(+) antiporter 17-like          366   5e-108   
gb|EAY92425.1|  hypothetical protein OsI_14159                          365   5e-108   
ref|XP_008222309.1|  PREDICTED: LOW QUALITY PROTEIN: cation/H(+) ...    365   6e-108   
ref|XP_004497791.1|  PREDICTED: cation/H(+) antiporter 15-like          365   1e-107   
ref|XP_003590053.1|  Cation proton exchanger                            365   1e-107   
dbj|BAK06259.1|  predicted protein                                      366   1e-107   
ref|XP_010650846.1|  PREDICTED: cation/H(+) antiporter 15-like is...    364   1e-107   
ref|XP_006471979.1|  PREDICTED: cation/H(+) antiporter 23, chloro...    363   1e-107   
ref|XP_002277533.2|  PREDICTED: cation/H(+) antiporter 15-like is...    364   1e-107   
ref|XP_006471980.1|  PREDICTED: cation/H(+) antiporter 23, chloro...    363   1e-107   
gb|AAD32281.1|  putative Na+/H+ antiporter                              362   2e-107   
ref|NP_001173696.1|  Os03g0828600                                       363   2e-107   
ref|XP_010260095.1|  PREDICTED: cation/H(+) antiporter 20               365   2e-107   
ref|XP_007219363.1|  hypothetical protein PRUPE_ppa019511mg             364   2e-107   
ref|XP_004978339.1|  PREDICTED: cation/H(+) antiporter 15-like          364   3e-107   
ref|XP_010111945.1|  Cation/H(+) antiporter 15                          362   1e-106   
ref|XP_011007076.1|  PREDICTED: cation/H(+) antiporter 19-like          358   2e-106   
ref|XP_006846157.1|  hypothetical protein AMTR_s00012p00187890          360   2e-106   
ref|XP_010513144.1|  PREDICTED: cation/H(+) antiporter 21-like          359   3e-106   
ref|XP_006283122.1|  hypothetical protein CARUB_v10004144mg             360   5e-106   
emb|CDX94208.1|  BnaC07g38420D                                          360   5e-106   
ref|XP_002269591.1|  PREDICTED: cation/H(+) antiporter 20               360   7e-106   
ref|XP_010424311.1|  PREDICTED: cation/H(+) antiporter 15-like          350   1e-105   
ref|XP_010433872.1|  PREDICTED: cation/H(+) antiporter 17-like          360   1e-105   
ref|XP_010448669.1|  PREDICTED: cation/H(+) antiporter 17-like          358   3e-105   
gb|KHN33866.1|  Cation/H(+) antiporter 19                               357   3e-105   
ref|XP_004162369.1|  PREDICTED: cation/H(+) antiporter 18-like          358   3e-105   
gb|KHN34724.1|  Cation/H(+) antiporter 15                               358   3e-105   
ref|XP_002527747.1|  monovalent cation:proton antiporter, putative      359   4e-105   
gb|ACC91238.1|  putative cation/hydrogen exchanger                      358   4e-105   
ref|XP_007219493.1|  hypothetical protein PRUPE_ppa022252mg             358   5e-105   
ref|XP_004149769.1|  PREDICTED: cation/H(+) antiporter 18-like          357   7e-105   
ref|XP_003537486.1|  PREDICTED: cation/H(+) antiporter 15-like          357   9e-105   
gb|KGN53374.1|  hypothetical protein Csa_4G050780                       356   1e-104   
ref|XP_009406978.1|  PREDICTED: cation/H(+) antiporter 20-like          357   2e-104   
gb|KDP35609.1|  hypothetical protein JCGZ_09047                         356   2e-104   
ref|XP_006654535.1|  PREDICTED: cation/H(+) antiporter 15-like          357   2e-104   
emb|CDY67925.1|  BnaA03g58740D                                          355   2e-104   
ref|XP_007145357.1|  hypothetical protein PHAVU_007G232400g             356   2e-104   
gb|EMT05571.1|  K(+)/H(+) antiporter 1                                  354   2e-104   
ref|XP_010433871.1|  PREDICTED: cation/H(+) antiporter 17               355   6e-104   
gb|KCW49901.1|  hypothetical protein EUGRSUZ_K03367                     352   6e-104   
emb|CBI15866.3|  unnamed protein product                                364   8e-104   
ref|XP_010037850.1|  PREDICTED: cation/H(+) antiporter 20-like          354   1e-103   
gb|ABA91259.1|  Sodium/hydrogen exchanger family protein                354   1e-103   
ref|XP_010251667.1|  PREDICTED: cation/H(+) antiporter 15-like          353   2e-103   
ref|XP_004963207.1|  PREDICTED: cation/H(+) antiporter 19-like is...    353   2e-103   
ref|XP_007208406.1|  hypothetical protein PRUPE_ppa001365mg             354   2e-103   
ref|XP_010257129.1|  PREDICTED: cation/H(+) antiporter 15-like          352   2e-103   
ref|XP_010439142.1|  PREDICTED: cation/H(+) antiporter 17-like          353   2e-103   
ref|NP_001066026.1|  Os12g0121600                                       353   3e-103   
emb|CDX78197.1|  BnaA09g33920D                                          353   3e-103   
ref|XP_003566149.1|  PREDICTED: cation/H(+) antiporter 15-like          353   3e-103   
ref|XP_006602071.1|  PREDICTED: cation/H(+) antiporter 15-like is...    352   3e-103   
ref|XP_009342224.1|  PREDICTED: cation/H(+) antiporter 15-like          352   4e-103   
gb|KDO76396.1|  hypothetical protein CISIN_1g0036452mg                  349   4e-103   
ref|XP_003615945.1|  Cation proton exchanger                            353   4e-103   
gb|KHN19263.1|  Cation/H(+) antiporter 15                               350   5e-103   
ref|XP_006582522.1|  PREDICTED: cation/H(+) antiporter 15-like          350   5e-103   
ref|XP_006602070.1|  PREDICTED: cation/H(+) antiporter 15-like is...    352   5e-103   
ref|NP_194101.1|  cation/H(+) antiporter 17                             352   9e-103   
ref|XP_003590201.1|  Cation proton exchanger                            351   1e-102   
ref|XP_008447651.1|  PREDICTED: cation/H(+) antiporter 20               352   1e-102   
ref|XP_003520628.2|  PREDICTED: cation/H(+) antiporter 20-like          352   2e-102   
ref|XP_008451981.1|  PREDICTED: cation/H(+) antiporter 18-like          350   2e-102   
ref|XP_009338768.1|  PREDICTED: cation/H(+) antiporter 20-like          351   2e-102   
ref|NP_001159300.1|  uncharacterized protein LOC100304392               350   3e-102   
ref|XP_002277552.1|  PREDICTED: cation/H(+) antiporter 14-like          349   4e-102   
ref|XP_002448912.1|  hypothetical protein SORBIDRAFT_05g001490          351   4e-102   
ref|XP_007163537.1|  hypothetical protein PHAVU_001G242600g             350   6e-102   
ref|XP_007145356.1|  hypothetical protein PHAVU_007G232300g             349   7e-102   
emb|CBI30584.3|  unnamed protein product                                350   7e-102   
emb|CAN63422.1|  hypothetical protein VITISV_023524                     350   8e-102   
ref|XP_010046750.1|  PREDICTED: cation/H(+) antiporter 15-like          349   8e-102   
ref|NP_001054455.1|  Os05g0113300                                       349   1e-101   
gb|KGN54233.1|  hypothetical protein Csa_4G294410                       350   1e-101   
ref|XP_004142208.1|  PREDICTED: cation/H(+) antiporter 20-like          349   1e-101   
ref|XP_010504142.1|  PREDICTED: cation/H(+) antiporter 20               348   2e-101   
ref|XP_008776558.1|  PREDICTED: cation/H(+) antiporter 20-like          348   2e-101   
ref|NP_001174464.1|  Os05g0473400                                       348   2e-101   
ref|XP_008241256.1|  PREDICTED: cation/H(+) antiporter 20               348   2e-101   
ref|XP_002277592.2|  PREDICTED: cation/H(+) antiporter 15-like is...    347   3e-101   
gb|KEH33438.1|  cation/H+ exchanger 3                                   347   3e-101   
dbj|BAJ98631.1|  predicted protein                                      346   3e-101   
ref|XP_006306042.1|  hypothetical protein CARUB_v10011344mg             347   4e-101   
ref|XP_008237195.1|  PREDICTED: cation/H(+) antiporter 15-like          345   2e-100   
ref|XP_002308966.2|  hypothetical protein POPTR_0006s05340g             346   2e-100   
ref|XP_002442550.1|  hypothetical protein SORBIDRAFT_08g021720          345   2e-100   
ref|NP_001044623.2|  Os01g0817400                                       338   3e-100   
ref|XP_004963706.1|  PREDICTED: cation/H(+) antiporter 15-like          345   3e-100   
gb|KFK34621.1|  hypothetical protein AALP_AA5G169800                    345   5e-100   
ref|XP_010515872.1|  PREDICTED: cation/H(+) antiporter 20-like          344   8e-100   
ref|XP_008366721.1|  PREDICTED: cation/H(+) antiporter 20-like          344   9e-100   
emb|CDP13955.1|  unnamed protein product                                343   9e-100   
ref|XP_011041839.1|  PREDICTED: cation/H(+) antiporter 15-like          343   1e-99    
ref|XP_002326092.2|  hypothetical protein POPTR_0019s14470g             343   1e-99    
ref|XP_010427030.1|  PREDICTED: cation/H(+) antiporter 20-like          343   1e-99    
ref|XP_006429043.1|  hypothetical protein CICLE_v10011096mg             342   2e-99    
ref|XP_006403661.1|  hypothetical protein EUTSA_v10010121mg             343   2e-99    
gb|EMS54713.1|  Cation/H(+) antiporter 19                               342   3e-99    
ref|XP_008231706.1|  PREDICTED: cation/H(+) antiporter 15-like          342   3e-99    
ref|XP_006480783.1|  PREDICTED: cation/H(+) antiporter 20-like          342   3e-99    
ref|XP_008799868.1|  PREDICTED: cation/H(+) antiporter 15               342   3e-99    
ref|XP_010099439.1|  Cation/H(+) antiporter 15                          342   3e-99    
ref|NP_974866.1|  cation/H(+) antiporter 18                             340   3e-99    
ref|XP_011020326.1|  PREDICTED: cation/H(+) antiporter 20               343   4e-99    
gb|KHN41525.1|  Cation/H(+) antiporter 15                               342   5e-99    
emb|CDP17496.1|  unnamed protein product                                341   5e-99    
ref|XP_003535263.1|  PREDICTED: cation/H(+) antiporter 15-like          342   6e-99    
ref|XP_008349530.1|  PREDICTED: cation/H(+) antiporter 15-like          341   8e-99    
gb|AAX49548.1|  cation/H+ exchanger                                     341   9e-99    
ref|XP_002867692.1|  ATCHX17                                            341   1e-98    
ref|NP_190940.1|  cation/H(+) antiporter 20                             341   1e-98    
emb|CBI34425.3|  unnamed protein product                                339   1e-98    



>ref|XP_004244795.1| PREDICTED: cation/H(+) antiporter 15-like [Solanum lycopersicum]
Length=831

 Score =   818 bits (2112),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 435/788 (55%), Positives = 577/788 (73%), Gaps = 16/788 (2%)
 Frame = -3

Query  2691  PEVDLDRLGQVVMCFSQTIYRSNGVWEGPDPLAPMIPLFILQIMTAILSSRILNFVLKPF  2512
             P VD+ +L + V+C++QTIYR NGVWEGPDPL P+IPLF +Q+  AIL +R ++FVLKP 
Sbjct  6     PLVDVGKLNEKVLCYAQTIYRFNGVWEGPDPLTPIIPLFFIQVSLAILITRFVSFVLKPT  65

Query  2511  NQPPLVAEILSGIILGPSMLGNIEEFRKHNFPNHNFETIETMGHFALVLYAFLTGLQMDV  2332
              QPP VAEI+SGI+LGP+ LG I  FR+  FPN+NF  IETM H ALV Y FL GLQMD+
Sbjct  66    KQPPFVAEIISGILLGPTALGRIMRFRRLLFPNYNFHVIETMAHVALVFYGFLVGLQMDL  125

Query  2331  KAIVHTGTKSRIVAVSGSIFPFLIGAGFYFTLQTDTQSMIGFIFCGSALTVTGFSTLAKI  2152
             K+++  G K+R VA+ G I PF++G   YF+L  D + + GFIF G  LT+TGFS L+KI
Sbjct  126   KSVLRIGVKARNVAIIGIIIPFVLGTILYFSLAHD-EEVRGFIFYGGGLTITGFSVLSKI  184

Query  2151  LDSKRLLNTEIGKIAASSALINVALSWVLLTIGLLFTGSLDNVQWAvlctvgfvvvcvny  1972
             LD +++L T+IGK+A SSA+IN   +W +LT+G + TGS  N+ WA++CT+ + + CV Y
Sbjct  185   LDKQKILQTDIGKMAMSSAVINDIGAWFILTLGYVVTGSTANIHWALICTIAYALFCVFY  244

Query  1971  VRPLLNWLISKTPEGQGFSEFYICSFIAVICAFGCFTDAMGSHPMIGAFIFGLIMPNNEL  1792
             +R  + W+I K PEGQG+SEF+ICS +A +   G  TDA+G+HP+IGAF+FGL +PN +L
Sbjct  245   LRRAIGWIIRKMPEGQGYSEFFICSILAGMAISGVITDALGTHPIIGAFLFGLSIPN-QL  303

Query  1791  LRTAILDRLEDFVMGILMPVFFLVCGLRTNIFTITDGDTSIFTALALILLACSAKIIAAL  1612
             L+  I+D+L+DFV GI MP FF+VCGLRTN   +     SI+  +  +LL  SAKI++++
Sbjct  304   LQAEIIDKLDDFVTGIFMPSFFVVCGLRTNFGEMG----SIYEIVGYVLLFVSAKILSSI  359

Query  1611  VASCYTGMSTNEAIGLGVLTNTKSTMVMIILEVGqvqqvlsvqqysmmvVACLIMTIVAT  1432
              A+ ++ M+  EA+ +GVL+NTKS M +II+E GQ QQVLS Q YS+MV   L+MT++ T
Sbjct  360   AATFFSEMTIKEALAVGVLSNTKSIMALIIIEAGQAQQVLSTQLYSLMVAGILVMTVLVT  419

Query  1431  PLAARYCPKQDLEPYKRRTIQNAKPGEELRILACIHGTNNLPAIISLLETSNSTVTSPIT  1252
             P+   Y P Q++ P+KRRTIQ A+  EELR+LACIHGT ++P++I+LL +S+ST  SPIT
Sbjct  420   PMTMLYRPSQEIAPHKRRTIQKARIDEELRVLACIHGTQDIPSVINLLGSSHSTPASPIT  479

Query  1251  AFGVQLLELVGRAPAMMvvhssgsgrhvggsHEEVQTSQIISTFDNYELRSHGVTAQVLT  1072
              F +Q++ELVGRA +M+ VHSSG        HEE QT QII+ FDNYELRS GV  QVLT
Sbjct  480   VFALQVVELVGRASSMLEVHSSGKRGSRSLGHEETQTRQIITAFDNYELRSDGVMVQVLT  539

Query  1071  ARWSYDTMAEDICKMAKEKRAAFLVLPFHKQQGTDGEMEDTNPAIQTVNEGVLLSAPCSV  892
             AR +  TM ED+C +AK+KR AF++LPFHKQ+G DGEMED NP I+ VNEGVL +APCSV
Sbjct  540   ARSAMSTMDEDMCNIAKDKRVAFIILPFHKQRGIDGEMEDVNPEIRAVNEGVLANAPCSV  599

Query  891   GILVERG--RPNQYAKNIAVLYLGGPDDREALTYARRMSGLPGVHLTVIRFVPAKDVSAD  718
             GIL++RG    + YAKNI VL+ GG DDREAL YA RM   P   LTV++F+P +  S  
Sbjct  600   GILIDRGLSETSDYAKNIVVLFFGGADDREALAYALRMVDRPDTRLTVVKFIPDEGAS--  657

Query  717   GAVEDPDLELELTRETSFVTVSIDPARDKEEDEELLNNFRTETAEDDSKTFMELVLDDEE  538
                   D+E     + S V V ID   +K  D+E LN F+  TA D S T++ELVL+D E
Sbjct  658   ------DVEQTEFADESHVNVQIDKESEKLMDDEFLNRFKISTANDKSVTYIELVLNDVE  711

Query  537   EFTKAVKSLDDRSFDLYVAGRGRGVSSALTSGLADWCECPELGAVGDllvtsefessfsv  358
             E  KA+K +D  ++DLY+ G+GRGV S LT+GL DWC+CPELGA+GDLLVTSEF+S+FSV
Sbjct  712   EAVKAIKLMDQHNYDLYIVGKGRGVVSPLTAGLVDWCDCPELGAIGDLLVTSEFDSTFSV  771

Query  357   lvVQQYVR  334
             LV+QQYV+
Sbjct  772   LVMQQYVK  779



>ref|XP_009627829.1| PREDICTED: cation/H(+) antiporter 15-like isoform X1 [Nicotiana 
tomentosiformis]
Length=830

 Score =   814 bits (2103),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 433/788 (55%), Positives = 572/788 (73%), Gaps = 16/788 (2%)
 Frame = -3

Query  2691  PEVDLDRLGQVVMCFSQTIYRSNGVWEGPDPLAPMIPLFILQIMTAILSSRILNFVLKPF  2512
             P +D ++L + ++C++QTIYR NGVWEGPDPL P+IPLF +QI  AIL +R++ F LK  
Sbjct  6     PPIDTEKLNEKILCYAQTIYRLNGVWEGPDPLTPIIPLFFVQISLAILITRLVMFALKIT  65

Query  2511  NQPPLVAEILSGIILGPSMLGNIEEFRKHNFPNHNFETIETMGHFALVLYAFLTGLQMDV  2332
              QPP VAEI+SGI+LGPS LG I ++R+  FPN+NF  IETM H ALV Y FL GLQMD+
Sbjct  66    RQPPFVAEIISGILLGPSALGQIVKYRRQLFPNYNFHVIETMAHVALVFYGFLVGLQMDI  125

Query  2331  KAIVHTGTKSRIVAVSGSIFPFLIGAGFYFTLQTDTQSMIGFIFCGSALTVTGFSTLAKI  2152
             K+++  G K+R VAV G I PF++G   +F+L  D  +  GFIF G ALTVTGFS LAKI
Sbjct  126   KSVLRIGIKARNVAVIGIIIPFVMGTILFFSLYRDEDAR-GFIFYGGALTVTGFSVLAKI  184

Query  2151  LDSKRLLNTEIGKIAASSALINVALSWVLLTIGLLFTGSLDNVQWAvlctvgfvvvcvny  1972
             LD +++L T+IGK+A SSA+IN   +W +L +G + TGS  N+ WAV+CT+ + + CV Y
Sbjct  185   LDKQKILQTDIGKMAMSSAVINDIGAWFILALGYVVTGSTTNIHWAVICTIAYALFCVFY  244

Query  1971  VRPLLNWLISKTPEGQGFSEFYICSFIAVICAFGCFTDAMGSHPMIGAFIFGLIMPNNEL  1792
             +R  + W+I K PE QG+SEF++CS +A +   G  TDA+G+HP+IGAF+FGL +PN ++
Sbjct  245   LRRAIGWIIRKMPEVQGYSEFFVCSILAGMAISGVITDALGTHPIIGAFLFGLSVPN-QM  303

Query  1791  LRTAILDRLEDFVMGILMPVFFLVCGLRTNIFTITDGDTSIFTALALILLACSAKIIAAL  1612
             L+ AILD+L+DFVMG LMP FF+VCGLRTN   +     SI+  +  I+L  SAKI++  
Sbjct  304   LQAAILDKLDDFVMGFLMPTFFVVCGLRTNFKAMG----SIYEIVGYIILFVSAKILSTF  359

Query  1611  VASCYTGMSTNEAIGLGVLTNTKSTMVMIILEVGqvqqvlsvqqysmmvVACLIMTIVAT  1432
              A+ ++ MS  EA+ +G+L+NTKS M +II+E GQ QQ+L+ Q YS+MV   L+MT++ T
Sbjct  360   AATFFSDMSIKEALAVGILSNTKSLMALIIIEAGQAQQILNTQLYSLMVTGILVMTVIVT  419

Query  1431  PLAARYCPKQDLEPYKRRTIQNAKPGEELRILACIHGTNNLPAIISLLETSNSTVTSPIT  1252
             P+   Y P Q+L P+KRRTIQ AK  EELR+LACIH  +++P++I+LL +SNST  +PIT
Sbjct  420   PITMFYHPSQELAPHKRRTIQKAKVEEELRVLACIHAAHDIPSVINLLGSSNSTPAAPIT  479

Query  1251  AFGVQLLELVGRAPAMMvvhssgsgrhvggsHEEVQTSQIISTFDNYELRSHGVTAQVLT  1072
              F +Q++ELVGRA +M+ VH+SG        HEE QT QII+ FDNYELRS GV  QVLT
Sbjct  480   VFALQVVELVGRASSMLEVHTSGKRGSRSLGHEEAQTRQIIAAFDNYELRSDGVMVQVLT  539

Query  1071  ARWSYDTMAEDICKMAKEKRAAFLVLPFHKQQGTDGEMEDTNPAIQTVNEGVLLSAPCSV  892
             AR +  TM EDIC +AK+KRAAF++LPFHKQ+   GEMED NP I+ VNEGVL +APCSV
Sbjct  540   ARCALSTMDEDICNIAKDKRAAFIILPFHKQRSLAGEMEDVNPEIRAVNEGVLANAPCSV  599

Query  891   GILVERG--RPNQYAKNIAVLYLGGPDDREALTYARRMSGLPGVHLTVIRFVPAKDVSAD  718
             GIL++RG    + YAKNI VLY GGPDDREAL YA RM   P   LTV++F+P +D +  
Sbjct  600   GILIDRGLSETSDYAKNIVVLYFGGPDDREALGYALRMVDRPDTRLTVVKFIPGEDAT--  657

Query  717   GAVEDPDLELELTRETSFVTVSIDPARDKEEDEELLNNFRTETAEDDSKTFMELVLDDEE  538
                   D+E     E S V V ID   +   DEE LN F+  TA D S  ++EL+L+D E
Sbjct  658   ------DIEPMEFAEESHVNVHIDKESENLLDEEFLNRFKISTANDKSVKYIELLLNDVE  711

Query  537   EFTKAVKSLDDRSFDLYVAGRGRGVSSALTSGLADWCECPELGAVGDllvtsefessfsv  358
             E  KA+K +D  S+DLY+ G+GRG+ S LT+GL DWC+CPELGA+GDLLVTSEF+S+FSV
Sbjct  712   EAVKAIKLMDQHSYDLYIVGKGRGIVSPLTAGLVDWCDCPELGAIGDLLVTSEFDSTFSV  771

Query  357   lvVQQYVR  334
             LV+QQYV+
Sbjct  772   LVMQQYVK  779



>ref|XP_009773648.1| PREDICTED: cation/H(+) antiporter 15-like [Nicotiana sylvestris]
Length=830

 Score =   811 bits (2095),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 432/788 (55%), Positives = 571/788 (72%), Gaps = 16/788 (2%)
 Frame = -3

Query  2691  PEVDLDRLGQVVMCFSQTIYRSNGVWEGPDPLAPMIPLFILQIMTAILSSRILNFVLKPF  2512
             P +D ++L   ++C++QTIYR NGVWEGPDPL P+IPLF +QI  AIL +R++ F LK  
Sbjct  6     PPIDTEKLNDKILCYAQTIYRLNGVWEGPDPLTPIIPLFFVQISLAILITRLVMFALKIT  65

Query  2511  NQPPLVAEILSGIILGPSMLGNIEEFRKHNFPNHNFETIETMGHFALVLYAFLTGLQMDV  2332
              QPP VAEI+SGI+LGPS LG I ++R+  FPN+NF  IETM H ALV Y FL GLQMD+
Sbjct  66    RQPPFVAEIISGILLGPSALGQIVKYRRQLFPNYNFHVIETMAHVALVFYGFLVGLQMDI  125

Query  2331  KAIVHTGTKSRIVAVSGSIFPFLIGAGFYFTLQTDTQSMIGFIFCGSALTVTGFSTLAKI  2152
             K+++  G K+R VAV G I PF++GA  +F+L  D  +  GFIF G ALTVTGFS LAKI
Sbjct  126   KSVLRIGIKARNVAVIGIIIPFVMGAILFFSLYRDEDAR-GFIFYGGALTVTGFSVLAKI  184

Query  2151  LDSKRLLNTEIGKIAASSALINVALSWVLLTIGLLFTGSLDNVQWAvlctvgfvvvcvny  1972
             LD +++L T+IGK+A SSA+IN   +W +L +G + TGS  N+ WAV+CT+ + + CV Y
Sbjct  185   LDKQKILQTDIGKMAMSSAVINDIGAWFILALGYVVTGSTTNIHWAVICTIAYALFCVFY  244

Query  1971  VRPLLNWLISKTPEGQGFSEFYICSFIAVICAFGCFTDAMGSHPMIGAFIFGLIMPNNEL  1792
             +R  + W+I K PEGQG+SEF++CS +  +   G  TDA+G+HP+IGAF+FGL +PN ++
Sbjct  245   LRRAIGWIIRKLPEGQGYSEFFVCSILGGMAISGVITDALGTHPIIGAFLFGLSVPN-QM  303

Query  1791  LRTAILDRLEDFVMGILMPVFFLVCGLRTNIFTITDGDTSIFTALALILLACSAKIIAAL  1612
             L+ AILD+L+DFVMG LMP FF+VCGLRTN   +     SI+  +  I+L  SAKI++  
Sbjct  304   LQAAILDKLDDFVMGFLMPTFFVVCGLRTNFRAMG----SIYEIVGYIILFVSAKILSTF  359

Query  1611  VASCYTGMSTNEAIGLGVLTNTKSTMVMIILEVGqvqqvlsvqqysmmvVACLIMTIVAT  1432
              A+ ++ MS  EA+ +G+L+NTKS M +II+E GQ QQ+L+ Q YS+MV   L+MT++ T
Sbjct  360   AATFFSDMSIKEALAVGILSNTKSLMALIIIEAGQAQQILNTQLYSLMVTGILVMTVIVT  419

Query  1431  PLAARYCPKQDLEPYKRRTIQNAKPGEELRILACIHGTNNLPAIISLLETSNSTVTSPIT  1252
             P+   Y P Q+L P+KRRTIQ AK  EELR+LACIH  +++P++I+LL +SNST  +PIT
Sbjct  420   PITMLYHPSQELVPHKRRTIQKAKVEEELRVLACIHAAHDIPSVINLLGSSNSTSAAPIT  479

Query  1251  AFGVQLLELVGRAPAMMvvhssgsgrhvggsHEEVQTSQIISTFDNYELRSHGVTAQVLT  1072
              F +Q++ELVGRA +M+ VH+SG        HEE QT QII+ FDNYELRS GV  QVLT
Sbjct  480   VFALQVVELVGRASSMLEVHTSGKRGSRSLGHEEAQTRQIIAAFDNYELRSDGVMVQVLT  539

Query  1071  ARWSYDTMAEDICKMAKEKRAAFLVLPFHKQQGTDGEMEDTNPAIQTVNEGVLLSAPCSV  892
             AR +  TM EDIC +AK+KRAAF++LPFHKQ+   GEMED NP I+ VNE VL +APCSV
Sbjct  540   ARCALSTMDEDICNIAKDKRAAFIILPFHKQRSLAGEMEDVNPEIRAVNESVLANAPCSV  599

Query  891   GILVERG--RPNQYAKNIAVLYLGGPDDREALTYARRMSGLPGVHLTVIRFVPAKDVSAD  718
             GIL++RG    + YAKNI VLY GGPDDREAL YA RM   P   LTV++F+P      +
Sbjct  600   GILIDRGLSETSDYAKNIVVLYFGGPDDREALAYALRMVDRPDTRLTVVKFIP-----GE  654

Query  717   GAVEDPDLELELTRETSFVTVSIDPARDKEEDEELLNNFRTETAEDDSKTFMELVLDDEE  538
             GA +   +E     E S V V ID   +K  DEE LN F+  TA D S  ++EL+L+D E
Sbjct  655   GATDIDPMEFA---EESHVNVHIDKESEKLLDEEFLNRFKISTANDKSVKYIELLLNDVE  711

Query  537   EFTKAVKSLDDRSFDLYVAGRGRGVSSALTSGLADWCECPELGAVGDllvtsefessfsv  358
             E   A+K +D  ++DLY+ G+GRG+ S LT+GL DWC+CPELGA+GDLLVTSEF+S+FSV
Sbjct  712   EAVNAIKLMDQHNYDLYIVGKGRGIVSPLTAGLVDWCDCPELGAIGDLLVTSEFDSTFSV  771

Query  357   lvVQQYVR  334
             LV+QQYV+
Sbjct  772   LVMQQYVK  779



>ref|XP_006366098.1| PREDICTED: cation/H(+) antiporter 15-like [Solanum tuberosum]
Length=832

 Score =   809 bits (2090),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 430/788 (55%), Positives = 575/788 (73%), Gaps = 16/788 (2%)
 Frame = -3

Query  2691  PEVDLDRLGQVVMCFSQTIYRSNGVWEGPDPLAPMIPLFILQIMTAILSSRILNFVLKPF  2512
             P +D+ +L + V+C++QTIYR NGVWEGPDPL P+IPLF +Q+  AIL +R + FVLKP 
Sbjct  6     PLIDVGKLNEKVLCYAQTIYRFNGVWEGPDPLTPIIPLFFIQVSLAILITRFVTFVLKPT  65

Query  2511  NQPPLVAEILSGIILGPSMLGNIEEFRKHNFPNHNFETIETMGHFALVLYAFLTGLQMDV  2332
              QPP VAEI+SGI+LGP+ LG I  FR+  FPN+NF  IETM H ALV Y FL GLQMD+
Sbjct  66    KQPPFVAEIISGILLGPTALGRIMRFRRLLFPNYNFHVIETMAHVALVFYGFLVGLQMDM  125

Query  2331  KAIVHTGTKSRIVAVSGSIFPFLIGAGFYFTLQTDTQSMIGFIFCGSALTVTGFSTLAKI  2152
             K+++  G K+R VA+ G I PF++G   YF+L  D + + GFIF G ALT+TGFS L+KI
Sbjct  126   KSVLRIGIKARNVAIIGIIIPFVMGTILYFSLTRD-EEVRGFIFYGGALTITGFSVLSKI  184

Query  2151  LDSKRLLNTEIGKIAASSALINVALSWVLLTIGLLFTGSLDNVQWAvlctvgfvvvcvny  1972
             LD +++L T+IGK+A SSA+IN   +W +LT+G + TGS  N+ WA++CT+ + + CV Y
Sbjct  185   LDKQKILQTDIGKMAMSSAVINDIGAWFILTLGYVVTGSTANIHWALICTIAYALFCVFY  244

Query  1971  VRPLLNWLISKTPEGQGFSEFYICSFIAVICAFGCFTDAMGSHPMIGAFIFGLIMPNNEL  1792
             +R  + W I K PEGQG+SEF+ICS +A +   G  TDA+G+HP+IGAF+FGL +PN ++
Sbjct  245   LRRAIGWTIRKMPEGQGYSEFFICSILAGMAISGVITDALGTHPIIGAFLFGLSIPN-QV  303

Query  1791  LRTAILDRLEDFVMGILMPVFFLVCGLRTNIFTITDGDTSIFTALALILLACSAKIIAAL  1612
             L+  I+D+L+DFV GI MP FF+VCGLRTN   +     SI+  +  ILL  SAKI++++
Sbjct  304   LQAEIIDKLDDFVTGIFMPTFFVVCGLRTNFGQMG----SIYEIVGYILLFVSAKILSSI  359

Query  1611  VASCYTGMSTNEAIGLGVLTNTKSTMVMIILEVGqvqqvlsvqqysmmvVACLIMTIVAT  1432
              A+ ++ M+  EA+ +GVL+NTKS M +II+E GQ QQVLS Q YS+MV   L+MT + T
Sbjct  360   AATFFSEMTIKEALAVGVLSNTKSIMALIIIEAGQAQQVLSTQLYSLMVAGILVMTAIVT  419

Query  1431  PLAARYCPKQDLEPYKRRTIQNAKPGEELRILACIHGTNNLPAIISLLETSNSTVTSPIT  1252
             P+   + P Q++ P+KRRTIQ A+  EELR+LACIHGT+++P++I+LL +S+ST  SPIT
Sbjct  420   PMTMLHRPSQEIAPHKRRTIQKARMEEELRVLACIHGTHDIPSVINLLGSSHSTPASPIT  479

Query  1251  AFGVQLLELVGRAPAMMvvhssgsgrhvggsHEEVQTSQIISTFDNYELRSHGVTAQVLT  1072
              F +Q++ELVGR  +M+ VH+SG        HEE QT QII+ FDNYELRS GV  QVLT
Sbjct  480   VFALQVVELVGRGSSMLEVHNSGKRGSRSLGHEETQTRQIITAFDNYELRSDGVMVQVLT  539

Query  1071  ARWSYDTMAEDICKMAKEKRAAFLVLPFHKQQGTDGEMEDTNPAIQTVNEGVLLSAPCSV  892
             AR +  TM ED+C +AK+KR AF++LPFHKQ+G +GEMED NP I+ VNEGVL +APCSV
Sbjct  540   ARSALSTMDEDMCNIAKDKRVAFIILPFHKQRGIEGEMEDVNPEIRAVNEGVLANAPCSV  599

Query  891   GILVERG--RPNQYAKNIAVLYLGGPDDREALTYARRMSGLPGVHLTVIRFVPAKDVSAD  718
             GIL++RG    + YAKNI VL+ GG DDREAL YA RM   P   LTV++F+P +  S  
Sbjct  600   GILIDRGLSETSDYAKNIVVLFFGGADDREALAYALRMVDRPDTRLTVVKFIPDEGAS--  657

Query  717   GAVEDPDLELELTRETSFVTVSIDPARDKEEDEELLNNFRTETAEDDSKTFMELVLDDEE  538
                   D+E     + S V V ID   +K  D+E LN F+  TA D S T++EL+L+D E
Sbjct  658   ------DIEQTEFADESHVNVQIDKESEKLMDDEFLNRFKISTANDKSVTYIELLLNDVE  711

Query  537   EFTKAVKSLDDRSFDLYVAGRGRGVSSALTSGLADWCECPELGAVGDllvtsefessfsv  358
             E  KA+K +D  ++DLY+ G+GRGV S LT+GL DWC+CPELGA+GDLLVTSEF+S+FSV
Sbjct  712   EAVKAIKLMDQHNYDLYIVGKGRGVVSPLTAGLVDWCDCPELGAIGDLLVTSEFDSTFSV  771

Query  357   lvVQQYVR  334
             LV+QQYV+
Sbjct  772   LVMQQYVK  779



>ref|XP_011096534.1| PREDICTED: cation/H(+) antiporter 15-like [Sesamum indicum]
 ref|XP_011096535.1| PREDICTED: cation/H(+) antiporter 15-like [Sesamum indicum]
Length=827

 Score =   793 bits (2049),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 425/801 (53%), Positives = 576/801 (72%), Gaps = 17/801 (2%)
 Frame = -3

Query  2721  MAAPPPPSTGPEVDLDRLGQVVMCFSQTIYRSNGVWEGPDPLAPMIPLFILQIMTAILSS  2542
             MAA P P+     D+DRL + ++C+++TIYR NG+WEGPDPL P+I LF++Q+  +++  
Sbjct  1     MAAQPMPT-----DIDRLNKTILCYAETIYRFNGLWEGPDPLTPLISLFLIQLTFSMVII  55

Query  2541  RILNFVLKPFNQPPLVAEILSGIILGPSMLGNIEEFRKHNFPNHNFETIETMGHFALVLY  2362
              +L + LKPF+QPP VAEIL GI+LGPS  G I+ +R+  FPN++F  +E M H  +  Y
Sbjct  56    HLLVYALKPFHQPPFVAEILGGILLGPSAFGRIKVYRRMMFPNYSFRVLEPMAHLFIGYY  115

Query  2361  AFLTGLQMDVKAIVHTGTKSRIVAVSGSIFPFLIGAGFYFTLQTDTQSMIGFIFCGSALT  2182
             AFL GL+MDV+AI  TG+KS  VA++G+I PFL G+  +F    D     GF+F G+ALT
Sbjct  116   AFLAGLKMDVRAITRTGSKSLKVAIAGTIIPFLFGSAVFFIFTNDKSQKFGFLFWGAALT  175

Query  2181  VTGFSTLAKILDSKRLLNTEIGKIAASSALINVALSWVLLTIGLLFTGSLDNVQWAvlct  2002
             VTGFS L+K+L++ ++L+TEIGK A +SALI+   SWV L +    T S  N  W+++ T
Sbjct  176   VTGFSVLSKVLETHQILHTEIGKTALASALISDMCSWVFLAVAFAVTSSPSNSPWSLIST  235

Query  2001  vgfvvvcvnyVRPLLNWLISKTPEGQGFSEFYICSFIAVICAFGCFTDAMGSHPMIGAFI  1822
             V F+++CV Y+RP+L+W+I KTPEGQG+SEFYICS +  +   G  TD  G+HPMIGAFI
Sbjct  236   VAFLLLCVFYIRPVLSWIIQKTPEGQGYSEFYICSILTGVALCGVITDTCGTHPMIGAFI  295

Query  1821  FGLIMPNNELLRTAILDRLEDFVMGILMPVFFLVCGLRTNIFTITDGDTSIFTALALILL  1642
             FGL++P NE+L   I+++L+DFVMGIL+PV+F+VCGLRTNI  I+D  +S F    +I+L
Sbjct  296   FGLVIP-NEVLEATIVEKLDDFVMGILVPVYFVVCGLRTNIDVISD-TSSWFVVGIVIVL  353

Query  1641  ACSAKIIAALVASCYTGMSTNEAIGLGVLTNTKSTMVMIILEVGqvqqvlsvqqysmmvV  1462
              C+ K +++L+ + ++ +  NEA+ +G+L+N K  +V++ILE GQ+Q  LS + YSMM+V
Sbjct  354   TCTVKALSSLILTMFSDLPVNEAMAVGLLSNAKGILVLVILEAGQIQGALSTETYSMMMV  413

Query  1461  ACLIMTIVATPLAARYCPKQDLEPYKRRTIQNAKPGEELRILACIHGTNNLPAIISLLET  1282
             A L+MT++ TP A  + P Q   PYKRRT+Q AK  EELRILACI+   N+P II+LL T
Sbjct  414   AVLLMTMIVTPAAIWFRPVQSTVPYKRRTLQKAKSDEELRILACIYNIRNVPTIINLLRT  473

Query  1281  SNSTVTSPITAFGVQLLELVGRAPAMMvvhssgsgrhvggsHEEVQTSQIISTFDNYELR  1102
             SN++  SPI+   +QL+ELVGRA  MMVVH S S      SH E Q  QI + FDNYELR
Sbjct  474   SNASTKSPISVVALQLVELVGRASTMMVVHDSHSAGPRNPSHIEAQADQITAAFDNYELR  533

Query  1101  SHGVTAQVLTARWSYDTMAEDICKMAKEKRAAFLVLPFHKQQGTDGEMEDTNPAIQTVNE  922
             S GV  Q +TAR +Y TM EDIC  AK++R A +++PFHKQQ  DGEMED NP+I++VNE
Sbjct  534   SEGVQTQAVTARCAYTTMDEDICTFAKDRRPALIIIPFHKQQTLDGEMEDINPSIRSVNE  593

Query  921   GVLLSAPCSVGILVERG--RPNQYAKNIAVLYLGGPDDREALTYARRMSGLPGVHLTVIR  748
             GVL +APCSVGIL++RG    + +A N+AVL+ GGPDDREAL YA RM+  P V LTV+R
Sbjct  594   GVLANAPCSVGILIDRGLAESHDHASNVAVLFFGGPDDREALAYAWRMADNPDVRLTVVR  653

Query  747   FVPAKDVSADGAVEDPDLELELTRETSFVTVSIDPARDKEEDEELLNNFRTETAEDDSKT  568
             F+P+ D      VE  D +         +++ ID   +K  D++ L NF+T T +D S T
Sbjct  654   FIPSTDAEKLDLVESIDKD--------HLSLPIDHESEKLLDDDYLGNFKTATMKDKSIT  705

Query  567   FMELVLDDEEEFTKAVKSLDDRSFDLYVAGRGRGVSSALTSGLADWCECPELGAVGDllv  388
             + ELVL+DEEE  KA+K +D+   DLY+ GRGRG+ S LTSGLADWC+CPELG +GDLLV
Sbjct  706   YCELVLNDEEEAIKAIKLMDENRHDLYLVGRGRGMVSPLTSGLADWCDCPELGPIGDLLV  765

Query  387   tsefessfsvlvVQQYVRTNK  325
             TSEFESSFSVL+VQQY++T+K
Sbjct  766   TSEFESSFSVLIVQQYIKTDK  786



>gb|EYU33342.1| hypothetical protein MIMGU_mgv1a001430mg [Erythranthe guttata]
Length=821

 Score =   779 bits (2011),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 423/788 (54%), Positives = 573/788 (73%), Gaps = 21/788 (3%)
 Frame = -3

Query  2655  MCFSQTIYRSNGVWEGPDPLAPMIPLFILQIMTAILSSRILNFVLKPFNQPPLVAEILSG  2476
             MC+++TIYR NG+WEGPDPL P+I LF++Q+  ++    +L F LKPFNQPP VAEI+  
Sbjct  1     MCYAETIYRFNGLWEGPDPLTPLISLFLIQLTFSMSVIHLLVFALKPFNQPPFVAEIIVS  60

Query  2475  --------IILGPSMLGNIEEFRKHNFPNHNFETIETMGHFALVLYAFLTGLQMDVKAIV  2320
                     ++LGPS+LG I  +RK  FPN++F+ +E M H ++  YAFL GL+MDVK+I+
Sbjct  61    FLKRTLVVLLLGPSVLGRITSYRKLIFPNYSFKMLEPMAHLSISYYAFLVGLKMDVKSIL  120

Query  2319  HTGTKSRIVAVSGSIFPFLIGAGFYFTLQTDTQSMIGFIFCGSALTVTGFSTLAKILDSK  2140
              TG K+  V+++G+I PF +G+G YF         +GF+F G++LTVTGFS L KILD +
Sbjct  121   RTGPKAMKVSIAGTIIPFSLGSGLYFIFGPKEDEKLGFLFWGASLTVTGFSVLTKILDKQ  180

Query  2139  RLLNTEIGKIAASSALINVALSWVLLTIGLLFTGSLDNVQWAvlctvgfvvvcvnyVRPL  1960
             ++L+TEIGK A ++ALIN   +W  L +    T S  ++QWA++CT+ F +VCV YVRP 
Sbjct  181   QILHTEIGKTAVAAALINDLSAWGFLALAFAVTSSKSDIQWAIICTIAFTLVCVYYVRPA  240

Query  1959  LNWLISKTPEGQGFSEFYICSFIAVICAFGCFTDAMGSHPMIGAFIFGLIMPNNELLRTA  1780
             L+W+I KTPEGQG+SEFYICS +  +   G  TD  G+HPMIGAFIFGL++P NE+L   
Sbjct  241   LSWIIRKTPEGQGYSEFYICSILTGMALGGVVTDLCGTHPMIGAFIFGLVIP-NEVLEAT  299

Query  1779  ILDRLEDFVMGILMPVFFLVCGLRTNIFTITDGDTSIFTALALILLACSAKIIAALVASC  1600
             ++D+LEDFV+GILMPV+F+VCGLRTNI  I++ DTS      +I+LACS K+++AL  + 
Sbjct  300   MVDKLEDFVIGILMPVYFVVCGLRTNIDVISN-DTSWVVVGLVIVLACSVKVLSALAVTL  358

Query  1599  YTGMSTNEAIGLGVLTNTKSTMVMIILEVGqvqqvlsvqqysmmvVACLIMTIVATPLAA  1420
             ++ ++ +EA+ +G+L+N KS MV+IILE GQ+Q+ L+ Q YS+MVVA L+MT++ TP A 
Sbjct  359   FSDLTVSEAVPVGLLSNAKSVMVLIILEAGQLQKALNTQTYSIMVVAVLVMTMIVTPAAI  418

Query  1419  RYCPKQDLEPYKRRTIQNAKPGEELRILACIHGTNNLPAIISLLETSNSTVTSPITAFGV  1240
              + P Q+  PYKRRT+Q AK  EE R+LACI+ T N+P II+LL TSNS+  SPI+ F +
Sbjct  419   WFRPVQNTIPYKRRTVQKAKSDEEFRVLACIYNTRNVPTIINLLRTSNSSQRSPISVFAL  478

Query  1239  QLLELVGRAPAMMvvhssgsgrhvggsHEEVQTSQIISTFDNYELRSHGVTAQVLTARWS  1060
             QL+ELVGRA  MMVVH++        SH E Q  QII+ FDNYELRS GV  Q LTAR +
Sbjct  479   QLVELVGRASTMMVVHNARKAGPRNPSHIEAQADQIITAFDNYELRSEGVYTQALTARCA  538

Query  1059  YDTMAEDICKMAKEKRAAFLVLPFHKQQGTDGEMEDTNPAIQTVNEGVLLSAPCSVGILV  880
             Y TM EDIC +AKEKR+A +++PFHKQQ  DGEMED NP+I++VNEGVL +APCSVGIL+
Sbjct  539   YTTMDEDICTVAKEKRSALIIIPFHKQQTIDGEMEDINPSIRSVNEGVLANAPCSVGILI  598

Query  879   ERG--RPNQYAKNIAVLYLGGPDDREALTYARRMS-GLPGVHLTVIRFVPAKDVSADGAV  709
             +RG    + +A+NIA+L+ GGPDDREAL YA RM+     V LTV+RF+P+ D     AV
Sbjct  599   DRGSAESHDHARNIAMLFFGGPDDREALAYAWRMAEDASDVRLTVMRFIPSSD-----AV  653

Query  708   EDPDLELELTRETSFVTVSIDPARDKEEDEELLNNFRTETAEDDSKTFMELVLDDEEEFT  529
             E  +++     + + V + ID  R+K  D++ L+ F+  T    S ++ ELVL+DEEE  
Sbjct  654   EVNNVD---QNDGNHVCLQIDLEREKLLDDDYLSKFKIATINSKSISYYELVLNDEEEAV  710

Query  528   KAVKSLDDRSFDLYVAGRGRGVSSALTSGLADWCECPELGAVGDllvtsefessfsvlvV  349
             KA+KS+D+ + DLY+ GRGRG+ S LTSGL DWC+CPELG +GDLLVTS+FESSFSVL+V
Sbjct  711   KAIKSMDEHNHDLYMVGRGRGMVSPLTSGLDDWCDCPELGPIGDLLVTSQFESSFSVLIV  770

Query  348   QQYVRTNK  325
             QQY + NK
Sbjct  771   QQYTKANK  778



>ref|XP_011082524.1| PREDICTED: cation/H(+) antiporter 15-like [Sesamum indicum]
Length=830

 Score =   773 bits (1996),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 423/788 (54%), Positives = 567/788 (72%), Gaps = 11/788 (1%)
 Frame = -3

Query  2682  DLDRLGQVVMCFSQTIYRSNGVWEGPDPLAPMIPLFILQIMTAILSSRILNFVLKPFNQP  2503
             D+ +L + ++C++++IYR NG+WEGPDPL P+I LF++Q+  ++    +L + L+ FNQP
Sbjct  9     DIGKLNRTILCYAESIYRFNGLWEGPDPLTPLISLFLIQLTVSMTVVHLLVYALQFFNQP  68

Query  2502  PLVAEILSGIILGPSMLGNIEEFRKHNFPNHNFETIETMGHFALVLYAFLTGLQMDVKAI  2323
             P VAE+L GI+LGPS LG I+ +R+  FPN++F+ +E M H ++  YAFL GL+MDV+A+
Sbjct  69    PFVAEVLGGILLGPSALGRIKAYRRMMFPNYSFKVLEPMAHLSIAYYAFLVGLKMDVRAV  128

Query  2322  VHTGTKSRIVAVSGSIFPFLIGAGFYFTLQTDTQSMIGFIFCGSALTVTGFSTLAKILDS  2143
             + TG K+  VA++G+I PF  G+G YF    D     GFIF G+ALTVTGFS L KILD 
Sbjct  129   MRTGQKTMKVAIAGTIIPFFFGSGVYFIFVNDKSETFGFIFWGAALTVTGFSVLMKILDR  188

Query  2142  KRLLNTEIGKIAASSALINVALSWVLLTIGLLFTGSLDNVQWAvlctvgfvvvcvnyVRP  1963
             +++L+TEIGK A +SAL+N   SW  L +G   T S  N  W+++ T+ FV+VCV +VRP
Sbjct  189   QQILHTEIGKTAVASALVNDLCSWGFLALGFAVTSSPTNSPWSLISTIAFVLVCVYHVRP  248

Query  1962  LLNWLISKTPEGQGFSEFYICSFIAVICAFGCFTDAMGSHPMIGAFIFGLIMPNNELLRT  1783
              LNW+I KT E QG+SEFYICS +  +   G  TD  G+HPMIGAFIFGL++P NE+L  
Sbjct  249   ALNWIIQKT-EVQGYSEFYICSILTGVALSGVITDVCGTHPMIGAFIFGLVIP-NEVLEA  306

Query  1782  AILDRLEDFVMGILMPVFFLVCGLRTNIFTITDGDTSIFTALALILLACSAKIIAALVAS  1603
              I D+LEDFVMGILMPV+F+VCG+RTNI  I+  +TS + A  +I+LACS K+ + L+ +
Sbjct  307   TITDKLEDFVMGILMPVYFVVCGVRTNIDVIS-YNTSWWLAGVVIVLACSVKVFSTLIIA  365

Query  1602  CYTGMSTNEAIGLGVLTNTKSTMVMIILEVGqvqqvlsvqqysmmvVACLIMTIVATPLA  1423
              +  +  ++A  +G+L+N KS MV+IILE GQ+Q VLS Q YS+MVVA L+MT+V TP A
Sbjct  366   PFAELPISDAFAVGLLSNAKSIMVLIILEAGQIQGVLSTQTYSLMVVAVLVMTMVVTPAA  425

Query  1422  ARYCPKQDLEPYKRRTIQNAKPGEELRILACIHGTNNLPAIISLLETSNSTVTSPITAFG  1243
               + P+Q+ EPYKRRT+Q AK  +E R+LACI+ T N+P II+LL TSN++  SPI  F 
Sbjct  426   IWFRPEQNTEPYKRRTVQKAKSDDEFRVLACIYNTRNVPTIINLLRTSNASPRSPINVFA  485

Query  1242  VQLLELVGRAPAMMvvhssgsgrhvggsHEEVQTSQIISTFDNYELRSHGVTAQVLTARW  1063
             +QL+ELVGRA +MMVVH   S      SH E QT QII+ FDNYELRS GV  Q +TAR 
Sbjct  486   LQLVELVGRATSMMVVHEPRSAGPRNPSHIEAQTDQIIAAFDNYELRSEGVQTQAVTARC  545

Query  1062  SYDTMAEDICKMAKEKRAAFLVLPFHKQQGTDGEMEDTNPAIQTVNEGVLLSAPCSVGIL  883
             +Y  MA +IC  A+EKR+AF+++PFHK +  DGEM D NP++Q VNEGVL  A CSVGIL
Sbjct  546   TYTAMANEICIFAREKRSAFIIIPFHKLRTLDGEMIDINPSLQCVNEGVLEDASCSVGIL  605

Query  882   VERG--RPNQYAKNIAVLYLGGPDDREALTYARRMSGLPGVHLTVIRFVPAKDVSADGAV  709
             ++RG    + +A NI VLY GGPDDREAL YA RM+  P V LTV+RF+P+ D     A+
Sbjct  606   IDRGFAESHDHASNIVVLYFGGPDDREALAYAWRMAENPDVRLTVLRFIPSTD-----AL  660

Query  708   EDPDLELELTRETSFVTVSIDPARDKEEDEELLNNFRTETAEDDSKTFMELVLDDEEEFT  529
             E   +E E T + + ++V ID   +   D++ L  F+  T  + S ++ ELVL+DEEE  
Sbjct  661   ELNPVEQEPT-DKNHLSVEIDKDSEILLDDDYLGKFKITTMNNKSISYCELVLNDEEETI  719

Query  528   KAVKSLDDRSFDLYVAGRGRGVSSALTSGLADWCECPELGAVGDllvtsefessfsvlvV  349
             KA+KS+D++ +DLY+ GRGRG++S LTSGLADWC+CPELG +GDLLVTSEFES FSVLVV
Sbjct  720   KAIKSMDEQKYDLYLVGRGRGMTSPLTSGLADWCDCPELGPIGDLLVTSEFESLFSVLVV  779

Query  348   QQYVRTNK  325
             QQY   NK
Sbjct  780   QQYDNINK  787



>emb|CDO99423.1| unnamed protein product [Coffea canephora]
Length=836

 Score =   743 bits (1918),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 405/789 (51%), Positives = 552/789 (70%), Gaps = 17/789 (2%)
 Frame = -3

Query  2685  VDLDRLGQVVMCFSQTIYRSNGVWEGPDPLAPMIPLFILQIMTAILSSRILNFVLKPFNQ  2506
             VD D+L   V C+S TIYR NGVW+GP+PL P++PLF++Q+  A+L++R+L    +PFNQ
Sbjct  8     VDFDKLYHDVQCYSDTIYRFNGVWDGPNPLLPVVPLFLIQLTVAMLATRLLIIAFRPFNQ  67

Query  2505  PPLVAEILSGIILGPSMLGNIEEFRKHNFPNHNFETIETMGHFALVLYAFLTGLQMDVKA  2326
             PP VAEIL+GIILGPS+LG +  F    FP +    +E M H++LV YA LTGLQMD++A
Sbjct  68    PPFVAEILTGIILGPSVLGKLSFFSNFLFPPYYLPVLEPMAHYSLVYYALLTGLQMDIRA  127

Query  2325  IVHTGTKSRIVAVSGSIFPFLIGAGFYFTLQ----TDTQSMIGFIFCGSALTVTGFSTLA  2158
             +  TGT+++ +AV+G   P +IG+  YF ++     ++ + +G  F GSALTVTGFS L+
Sbjct  128   MYRTGTQAKHIAVAGIFIPMIIGSSSYFIIEDHVTAESPTKLGAFFWGSALTVTGFSVLS  187

Query  2157  KILDSKRLLNTEIGKIAASSALINVALSWVLLTIGLLFTG-SLDNVQWAvlctvgfvvvc  1981
             K+LD +++L+TEIGKIA +SAL++   SW  L +GL  TG    N+ W VL T   V++C
Sbjct  188   KVLDRQKILHTEIGKIAVASALLSDLASWFFLALGLAITGDKTTNLIWIVLSTCAVVLLC  247

Query  1980  vnyVRPLLNWLISKTPEGQGFSEFYICSFIAVICAFGCFTDAMGSHPMIGAFIFGLIMPN  1801
               YVRP L+W++  TPEGQG+SEFY+CS I  +   G  TDA G+HP++GA +FGLI+P 
Sbjct  248   AFYVRPALSWIVKNTPEGQGYSEFYLCSVITGVGLLGVITDACGTHPLVGALVFGLIIP-  306

Query  1800  NELLRTAILDRLEDFVMGILMPVFFLVCGLRTNIFTITDGDTSIFTALALILLACSAKII  1621
             +E+L + ++DRL+D V GI MPVFF+ CGLR ++  +   + S      +I+LA SAKI+
Sbjct  307   DEVLESVLVDRLKDVVQGIFMPVFFVACGLRADLNKV---EASWIKVALIIILASSAKIV  363

Query  1620  AALVASCYTGMSTNEAIGLGVLTNTKSTMVMIILEVGqvqqvlsvqqysmmvVACLIMTI  1441
             +AL  S    + T EA+ +GVLTNTKST+ + ILE+G  Q+ L+ + +S+MVVA L+MT+
Sbjct  364   SALTISFLHDLPTKEAVAVGVLTNTKSTLALAILEIGLTQKALTQESFSVMVVAILVMTM  423

Query  1440  VATPLAARYCPKQDLEPYKRRTIQNAKPGEELRILACIHGTNNLPAIISLLETSNSTVTS  1261
             V TP    Y P +++ PYKRRTIQ AK  E LRILACI+   N+P+II+LLE SNST  S
Sbjct  424   VVTPATMLYRPTKNMTPYKRRTIQKAKSDEALRILACIYDVRNVPSIINLLEVSNSTKKS  483

Query  1260  PITAFGVQLLELVGRAPAMMvvhssgsgrhvggsHEEVQTSQIISTFDNYELRSHGVTAQ  1081
             PIT F + L+EL+GRA AM+VVHS+G       S+ E +T QI+S F+NY+L+S GV  Q
Sbjct  484   PITVFALHLVELIGRASAMLVVHSAGGSGPRNPSYLEEKTEQILSAFENYKLQSEGVDTQ  543

Query  1080  VLTARWSYDTMAEDICKMAKEKRAAFLVLPFHKQQGTDGEMEDTNPAIQTVNEGVLLSAP  901
             V+TA  +Y TM EDIC +AK+KRAAF++LPFHKQQ  DG+MED NP  + VNE V+ +AP
Sbjct  544   VMTASSAYATMDEDICSIAKDKRAAFIILPFHKQQTLDGDMEDINPTARNVNESVMENAP  603

Query  900   CSVGILVERGRPN--QYAKNIAVLYLGGPDDREALTYARRMSGLPGVHLTVIRFVPAKDV  727
             CSVGIL++RG  +    A++IA+L+ GG DDREAL YA RM+  P   LTV+RF+  +D 
Sbjct  604   CSVGILIDRGLTDSQNRARSIAMLFFGGSDDREALAYAWRMAEHPETSLTVVRFISGQD-  662

Query  726   SADGAVEDPDLELELTRETSFVTVSIDPARDKEEDEELLNNFRTETAEDDSKTFMELVLD  547
                   E+ + +     +   VT+ ID       D+E LN F+  T  D S +F EL+L+
Sbjct  663   -----TEEEEWDPLAFADRDQVTIEIDSKSHGLLDDEFLNKFKIATVNDSSISFSELMLN  717

Query  546   DEEEFTKAVKSLDDRSFDLYVAGRGRGVSSALTSGLADWCECPELGAVGDllvtsefess  367
             DEEE   A+K +D  + DLY+ G+GRGV+S LT GLADWC+CPELG +GDLLVTSEF+S 
Sbjct  718   DEEETVNAIKDMDGDNHDLYIVGKGRGVTSPLTVGLADWCDCPELGPIGDLLVTSEFKSV  777

Query  366   fsvlvVQQY  340
             FSVLVVQQY
Sbjct  778   FSVLVVQQY  786



>gb|EPS59090.1| hypothetical protein M569_15718, partial [Genlisea aurea]
Length=777

 Score =   711 bits (1835),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 391/784 (50%), Positives = 531/784 (68%), Gaps = 18/784 (2%)
 Frame = -3

Query  2658  VMCFSQTIYRSNGVWEGPDPLAPMIPLFILQIMTAILSSRILNFVLKPFNQPPLVAEILS  2479
             ++C+++TIYR NG+WEGPDPL P+I LF++Q+M ++ ++ +L+  LKPFNQPP V +IL 
Sbjct  2     ILCYAETIYRFNGLWEGPDPLNPLISLFLIQLMVSVSATHVLSVALKPFNQPPFVTQILG  61

Query  2478  GIILGPSMLGNIEEFRKHNFPNHNFETIETMGHFALVLYAFLTGLQMDVKAIVHTGTKSR  2299
             GIILGPS+LG I  +RK  FP  +F+ +E M H ++ LYAFL GL+MD++ I  TG K  
Sbjct  62    GIILGPSVLGRISPYRKFVFPTFSFKLLEAMAHLSISLYAFLIGLKMDIRGIFRTGPKQM  121

Query  2298  IVAVSGSIFPFLIGAGFYFTLQTDTQSMIGFIFCGSALTVTGFSTLAKILDSKRLLNTEI  2119
              +AVSG + PF +G+G YF  QTD     G++F G ALTVTG+STL KIL+ ++LL+TEI
Sbjct  122   KIAVSGIVIPFCVGSGLYFAFQTDESGNTGWLFWGGALTVTGYSTLTKILERQQLLHTEI  181

Query  2118  GKIAASSALINVALSWVLLTIGLLFTGSLDNVQWAvlctvgfvvvcvnyVRPLLNWLISK  1939
             GK AA SAL+    +W  L +    + S  +  WA + ++ FV +CVNYVRP L+W+I +
Sbjct  182   GKTAAGSALMTEFGAWGFLAVAYAVSSSPSSFYWAFISSLAFVFLCVNYVRPGLSWIIKR  241

Query  1938  TPEGQGFSEFYICSFIAVICAFGCFTDAMGSHPMIGAFIFGLIMPNNELLRTAILDRLED  1759
             TPEGQG SEFY+CS +      G  TD  G+HPMIG  +FGL++P +E+L T ++D+LE+
Sbjct  242   TPEGQGHSEFYLCSMLIGSVLSGVVTDLCGTHPMIGTLVFGLVVP-SEVLETTLVDKLEN  300

Query  1758  FVMGILMPVFFLVCGLRTNIFTITDGDTSIFTALALILLACSAKIIAALVASCYTG-MST  1582
             FV G+L+PV+F+VCGLR N+  ++DG  S F A  ++LLAC+ K+ +A V   ++  +S 
Sbjct  301   FVEGLLLPVYFVVCGLRVNVDLVSDGGASWFAAALIVLLACTVKLFSAAVVIMFSDELSV  360

Query  1581  NEAIGLGVLTNTKSTMVMIILEVGqvqqvlsvqqysmmvVACLIMTIVATPLAARYCPKQ  1402
              EA  +G+L + K    + ILE GQ+Q  LS + YS+M+VA LIMT+V  P A  + P Q
Sbjct  361   EEASAVGMLASAKGVAALFILEAGQIQGALSTRSYSIMMVAVLIMTLVVAPAAIWFRPAQ  420

Query  1401  DLEPYKRRTIQNAKPGEELRILACIHGTNNLPAIISLLETSNSTVTSPITAFGVQLLELV  1222
                P+KRRTIQ A+  EELRI+ACIHGT+ +P  I LL  S ST  SP+    +QL+ELV
Sbjct  421   QAAPHKRRTIQKARSEEELRIVACIHGTSQVPPTIDLLRASYSTTRSPLNVCALQLVELV  480

Query  1221  GRAPAMMvvhssgsgrhvggsHE-EVQTSQIISTFDNYELRSHGVTAQVLTARWSYDTMA  1045
             GRA  M++ H+   G         E  T  II+ FD++EL+S GV   V+TAR  Y TM 
Sbjct  481   GRASTMLISHNVRGGAGPRNPSHTEAHTDHIIAAFDDFELQSEGVRTAVMTARSPYATMD  540

Query  1044  EDICKMAKEKRAAFLVLPFHKQQGTDGEMEDTNPAIQTVNEGVLLSAPCSVGILVERGRP  865
             EDIC +A +KRAA +VLPFHKQ G DGE ED   +I+TVNEGVL  APCSV ILV+RG  
Sbjct  541   EDICTVAGDKRAALIVLPFHKQLGPDGEAEDVKGSIRTVNEGVLEKAPCSVAILVDRGMI  600

Query  864   NQYAK--------NIAVLYLGGPDDREALTYARRMSGLPGVHLTVIRFVPAKDVSADGAV  709
                +         NIA+L+LGG DDREAL+YA RM+G     L+V+R + A DV  + A 
Sbjct  601   KSSSAAADQPSGPNIAMLFLGGADDREALSYAWRMAGNRDARLSVVRLIAAIDVGVETAA  660

Query  708   EDPDLELELTRETSFVTVSIDPARDKEEDEELLNNFRTETAEDDSKTFMELVLDDEEEFT  529
              D      +       ++ ID   DK+ DE+ L+ F+  T + ++  + ELVL+DEEE  
Sbjct  661   HDQSRRRHM-------SLQIDGRADKQMDEDFLSKFKLTTMDVENINYTELVLNDEEEAI  713

Query  528   KAVKSLDDRSFDLYVAGRGRGVSSALTSGLADWCECPELGAVGDllvtsefessfsvlvV  349
             KA+KS+D+  ++LY+ GRG G+ S LTSGLADWC+CPELG +GDLLVTSEFESSFSV+VV
Sbjct  714   KAIKSMDENPYNLYLVGRGSGLESPLTSGLADWCDCPELGPIGDLLVTSEFESSFSVVVV  773

Query  348   QQYV  337
             QQYV
Sbjct  774   QQYV  777



>ref|XP_009627830.1| PREDICTED: cation/H(+) antiporter 15-like isoform X2 [Nicotiana 
tomentosiformis]
Length=724

 Score =   682 bits (1761),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 374/687 (54%), Positives = 494/687 (72%), Gaps = 16/687 (2%)
 Frame = -3

Query  2388  MGHFALVLYAFLTGLQMDVKAIVHTGTKSRIVAVSGSIFPFLIGAGFYFTLQTDTQSMIG  2209
             M H ALV Y FL GLQMD+K+++  G K+R VAV G I PF++G   +F+L  D  +  G
Sbjct  1     MAHVALVFYGFLVGLQMDIKSVLRIGIKARNVAVIGIIIPFVMGTILFFSLYRDEDAR-G  59

Query  2208  FIFCGSALTVTGFSTLAKILDSKRLLNTEIGKIAASSALINVALSWVLLTIGLLFTGSLD  2029
             FIF G ALTVTGFS LAKILD +++L T+IGK+A SSA+IN   +W +L +G + TGS  
Sbjct  60    FIFYGGALTVTGFSVLAKILDKQKILQTDIGKMAMSSAVINDIGAWFILALGYVVTGSTT  119

Query  2028  NVQWAvlctvgfvvvcvnyVRPLLNWLISKTPEGQGFSEFYICSFIAVICAFGCFTDAMG  1849
             N+ WAV+CT+ + + CV Y+R  + W+I K PE QG+SEF++CS +A +   G  TDA+G
Sbjct  120   NIHWAVICTIAYALFCVFYLRRAIGWIIRKMPEVQGYSEFFVCSILAGMAISGVITDALG  179

Query  1848  SHPMIGAFIFGLIMPNNELLRTAILDRLEDFVMGILMPVFFLVCGLRTNIFTITDGDTSI  1669
             +HP+IGAF+FGL +PN ++L+ AILD+L+DFVMG LMP FF+VCGLRTN   +     SI
Sbjct  180   THPIIGAFLFGLSVPN-QMLQAAILDKLDDFVMGFLMPTFFVVCGLRTNFKAMG----SI  234

Query  1668  FTALALILLACSAKIIAALVASCYTGMSTNEAIGLGVLTNTKSTMVMIILEVGqvqqvls  1489
             +  +  I+L  SAKI++   A+ ++ MS  EA+ +G+L+NTKS M +II+E GQ QQ+L+
Sbjct  235   YEIVGYIILFVSAKILSTFAATFFSDMSIKEALAVGILSNTKSLMALIIIEAGQAQQILN  294

Query  1488  vqqysmmvVACLIMTIVATPLAARYCPKQDLEPYKRRTIQNAKPGEELRILACIHGTNNL  1309
              Q YS+MV   L+MT++ TP+   Y P Q+L P+KRRTIQ AK  EELR+LACIH  +++
Sbjct  295   TQLYSLMVTGILVMTVIVTPITMFYHPSQELAPHKRRTIQKAKVEEELRVLACIHAAHDI  354

Query  1308  PAIISLLETSNSTVTSPITAFGVQLLELVGRAPAMMvvhssgsgrhvggsHEEVQTSQII  1129
             P++I+LL +SNST  +PIT F +Q++ELVGRA +M+ VH+SG        HEE QT QII
Sbjct  355   PSVINLLGSSNSTPAAPITVFALQVVELVGRASSMLEVHTSGKRGSRSLGHEEAQTRQII  414

Query  1128  STFDNYELRSHGVTAQVLTARWSYDTMAEDICKMAKEKRAAFLVLPFHKQQGTDGEMEDT  949
             + FDNYELRS GV  QVLTAR +  TM EDIC +AK+KRAAF++LPFHKQ+   GEMED 
Sbjct  415   AAFDNYELRSDGVMVQVLTARCALSTMDEDICNIAKDKRAAFIILPFHKQRSLAGEMEDV  474

Query  948   NPAIQTVNEGVLLSAPCSVGILVERG--RPNQYAKNIAVLYLGGPDDREALTYARRMSGL  775
             NP I+ VNEGVL +APCSVGIL++RG    + YAKNI VLY GGPDDREAL YA RM   
Sbjct  475   NPEIRAVNEGVLANAPCSVGILIDRGLSETSDYAKNIVVLYFGGPDDREALGYALRMVDR  534

Query  774   PGVHLTVIRFVPAKDVSADGAVEDPDLELELTRETSFVTVSIDPARDKEEDEELLNNFRT  595
             P   LTV++F+P +D +        D+E     E S V V ID   +   DEE LN F+ 
Sbjct  535   PDTRLTVVKFIPGEDAT--------DIEPMEFAEESHVNVHIDKESENLLDEEFLNRFKI  586

Query  594   ETAEDDSKTFMELVLDDEEEFTKAVKSLDDRSFDLYVAGRGRGVSSALTSGLADWCECPE  415
              TA D S  ++EL+L+D EE  KA+K +D  S+DLY+ G+GRG+ S LT+GL DWC+CPE
Sbjct  587   STANDKSVKYIELLLNDVEEAVKAIKLMDQHSYDLYIVGKGRGIVSPLTAGLVDWCDCPE  646

Query  414   LGAVGDllvtsefessfsvlvVQQYVR  334
             LGA+GDLLVTSEF+S+FSVLV+QQYV+
Sbjct  647   LGAIGDLLVTSEFDSTFSVLVMQQYVK  673



>ref|XP_002516306.1| Na(+)/H(+) antiporter, putative [Ricinus communis]
 gb|EEF46053.1| Na(+)/H(+) antiporter, putative [Ricinus communis]
Length=834

 Score =   625 bits (1611),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 357/791 (45%), Positives = 515/791 (65%), Gaps = 22/791 (3%)
 Frame = -3

Query  2658  VMCFSQTIYRSNGVWEGPDPLAPMIPLFILQIMTAILSSRILNFVLKPFNQPPLVAEILS  2479
             ++C++ T+  +NGVW+G +PL   +PLFILQ+   ++++R+L F+LKPF QP +++EI+ 
Sbjct  17    IVCYAPTMITTNGVWQGDNPLDYSLPLFILQLTLVVVTTRLLVFILKPFRQPRVISEIMG  76

Query  2478  GIILGPSMLGNIEEFRKHNFPNHNFETIETMGHFALVLYAFLTGLQMDVKAIVHTGTKSR  2299
             G+ILGPSMLG  + F    FP  +   +ETM +  L+ + FL G++MD+  I  TG K+ 
Sbjct  77    GVILGPSMLGRSKVFANTIFPLRSVMVLETMANVGLLYFLFLVGVEMDISVIKRTGKKAL  136

Query  2298  IVAVSGSIFPFLIGAGFYFTLQTDTQSM---IGFIFCGSALTVTGFSTLAKILDSKRLLN  2128
              +AV+G I PF  G  F F +  D+ +M      +F G AL+VT F  LA++L   +L+N
Sbjct  137   AIAVAGMILPFFTGLAFSFLIHRDSHNMNEGTFILFLGVALSVTAFPVLARVLAELKLIN  196

Query  2127  TEIGKIAASSALINVALSWVLLTIGLLF----TGSLDNVQWAvlctvgfvvvcvnyVRPL  1960
             TE+G+IA SSALIN   +W+LL   +      + SL ++ W +L +V FV+ CV  VRP 
Sbjct  197   TELGRIAMSSALINDICAWILLCFAIALAENDSASLASL-WVILSSVAFVIFCVFVVRPA  255

Query  1959  LNWLISKTPEGQGFSEFYICSFIAVICAFGCFTDAMGSHPMIGAFIFGLIMPNNELLRTA  1780
             ++W+I +TPEG+ FSEFYIC  +  +   G  TDA+G+H + GAF+FGL++PN  L  T 
Sbjct  256   ISWIIRRTPEGETFSEFYICLILTGVMISGFITDAIGTHSVFGAFVFGLVIPNGPLGVT-  314

Query  1779  ILDRLEDFVMGILMPVFFLVCGLRTNIFTITDGDTSIFTALALILLACSAKIIAALVASC  1600
             ++++LEDFV G+L+P+FF + GL+TN+  I  G T+      +ILL    KI   L+ + 
Sbjct  315   LIEKLEDFVSGLLLPLFFAMSGLKTNVGAI-QGATTWGLLGLVILLGGVGKIAGTLLVTF  373

Query  1599  YTGMSTNEAIGLGVLTNTKSTMVMIILEVGqvqqvlsvqqysmmvVACLIMTIVATPLA-  1423
             +  M   E + LG+L NTK  + MIIL VG+ Q+VL  + +++MV+  +IMT + TP+  
Sbjct  374   FYQMPVREGLTLGLLMNTKGLIEMIILNVGKDQRVLDDESFAIMVIVAVIMTGLITPIVT  433

Query  1422  ARYCPKQDLEPYKRRTIQNAKPGEELRILACIHGTNNLPAIISLLETSNSTVTSPITAFG  1243
             A Y P +   PYKRRTI  +KP  ELRIL C+H   N+P II+LLE S+ T  SP+  F 
Sbjct  434   AIYRPARKFIPYKRRTIHRSKPDAELRILVCVHTPRNVPTIINLLEASHPTKRSPMCVFV  493

Query  1242  VQLLELVGRAPAMMvvhssgsgrhvggsHEEVQTSQIISTFDNYELRSHGVTAQVLTARW  1063
             + L+EL GRA AM++VH++        +  + Q+  II+ F+NYE  +  V+ Q LTA  
Sbjct  494   LHLVELTGRASAMLIVHNTRKSGRPALNRTQAQSDHIINAFENYEQHAVCVSVQPLTAIS  553

Query  1062  SYDTMAEDICKMAKEKRAAFLVLPFHKQQGTDGEMEDTNPAIQTVNEGVLLSAPCSVGIL  883
              Y TM EDIC +A++KR AF+++PFHKQQ  DG ME TNPA +TVN+ VL +APCSVGIL
Sbjct  554   PYSTMHEDICNLAEDKRVAFIIIPFHKQQTVDGGMEATNPAFRTVNQNVLANAPCSVGIL  613

Query  882   VERG-------RPNQYAKNIAVLYLGGPDDREALTYARRMSGLPGVHLTVIRFVPAKDVS  724
             V+RG         NQ + +IAVL+ GGPDDREAL+YA RMS  PG+ LTV+RF+P +D  
Sbjct  614   VDRGLNGSTRLAANQLSHHIAVLFFGGPDDREALSYAWRMSEHPGISLTVMRFLPGED--  671

Query  723   ADGAVEDPDLELELTRETSFVTVSIDPARDKEEDEELLNNFRTETAEDDSKTFMELVLDD  544
             A  +   P        E   +TV     R+K+ DEE +N FR   A D+S  + E+++++
Sbjct  672   AAQSARQPGGSHH--NEPRILTVETHDQREKQLDEEYINEFRIHIANDESVFYTEILVNN  729

Query  543   EEEFTKAVKSLDDRSFDLYVAGRGRGVSSALTSGLADWCECPELGAVGDllvtsefessf  364
              EE   A++ +D  + DL++ GRG+G+ S LT+GL DW ECPELGA+GDLL +S+F ++ 
Sbjct  730   GEETVAAIRGMDINAHDLFIVGRGQGMISPLTAGLTDWSECPELGAIGDLLASSDFAATV  789

Query  363   svlvVQQYVRT  331
             SVLVVQQYV T
Sbjct  790   SVLVVQQYVGT  800



>ref|XP_007048418.1| Cation/hydrogen exchanger 15 [Theobroma cacao]
 gb|EOX92575.1| Cation/hydrogen exchanger 15 [Theobroma cacao]
Length=830

 Score =   624 bits (1609),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 356/790 (45%), Positives = 517/790 (65%), Gaps = 25/790 (3%)
 Frame = -3

Query  2658  VMCFSQTIYRSNGVWEGPDPLAPMIPLFILQIMTAILSSRILNFVLKPFNQPPLVAEILS  2479
             ++C++ T+  +NGVW+G +PL   +PLFILQ+   ++S+RIL F+LKP  QP ++AEIL 
Sbjct  15    IVCYAPTMITTNGVWQGDNPLDYSLPLFILQLTLVVVSTRILVFILKPLRQPRVIAEILG  74

Query  2478  GIILGPSMLGNIEEFRKHNFPNHNFETIETMGHFALVLYAFLTGLQMDVKAIVHTGTKSR  2299
             GI+LGPS+LG  + F    FP  +   +ETM +  L+ + FL G++MD+  I  TG K+ 
Sbjct  75    GILLGPSVLGRSQGFANTLFPLRSVMVLETMANVGLLYFLFLVGVEMDLSVIRRTGKKAL  134

Query  2298  IVAVSGSIFPFLIGAGFYFTLQTDTQSMIG----FIFCGSALTVTGFSTLAKILDSKRLL  2131
              +AVSG I PFLIGA F F L       +G     +F G AL+VT F  LA+IL   +L+
Sbjct  135   AIAVSGMILPFLIGACFTFILHDQNSEALGQGTFILFLGVALSVTAFPVLARILADLKLI  194

Query  2130  NTEIGKIAASSALINVALSWVLLTIGLLF----TGSLDNVQWAvlctvgfvvvcvnyVRP  1963
             N+E+G++A SSALIN   +WVLL I +      + SL +  W +L +V FVV C+  VRP
Sbjct  195   NSELGRMAMSSALINDMCAWVLLAIAIALAENDSSSLASF-WVILSSVAFVVFCIFVVRP  253

Query  1962  LLNWLISKTPEGQGFSEFYICSFIAVICAFGCFTDAMGSHPMIGAFIFGLIMPNNELLRT  1783
              + W+I +TPEG+ FSEFYIC  +  +   G  TDA+G+H + GAF+FGLI+PN  L  T
Sbjct  254   AITWIIRRTPEGESFSEFYICLILTGVMISGFITDAIGTHSVFGAFVFGLIIPNGPLGVT  313

Query  1782  AILDRLEDFVMGILMPVFFLVCGLRTNIFTITDGDTSIFTALALILLACSAKIIAALVAS  1603
              ++++LEDFV G+L+P+FF + GL+T+I  I  G T    AL +I L+C+ KI   L+ +
Sbjct  314   -LIEKLEDFVSGLLLPLFFAISGLKTDIGAIKGGQTWGVLAL-VIFLSCAGKIAGTLLVT  371

Query  1602  CYTGMSTNEAIGLGVLTNTKSTMVMIILEVGqvqqvlsvqqysmmvVACLIMTIVATPLA  1423
              +  M  +E   LG+L NTK  + M++L VG+ ++VL  + +++MVV  ++MT + +P+ 
Sbjct  372   TFYQMPLSEGFTLGLLMNTKGLIEMLVLNVGKDRKVLDDESFAIMVVVAVVMTGIISPIV  431

Query  1422  AR-YCPKQDLEPYKRRTIQNAKPGEELRILACIHGTNNLPAIISLLETSNSTVTSPITAF  1246
             +  Y P +   PYKRRTIQ +K   ELR+L CIH   N+P +I+LLE S+ T  SPI  +
Sbjct  432   STIYRPSRRFVPYKRRTIQTSKLDGELRVLVCIHNPRNVPTMINLLEASHPTKKSPICIY  491

Query  1245  GVQLLELVGRAPAMMvvhssgsgrhvggsHEEVQTSQIISTFDNYELRSHGVTAQVLTAR  1066
              + L+EL GRA AM++VH++        +  + Q+  II+ F+N+E  +  V+ Q LTA 
Sbjct  492   ALHLVELTGRASAMLIVHNTRKSGRPALNRTQAQSDHIINAFENFEQHAGCVSVQPLTAI  551

Query  1065  WSYDTMAEDICKMAKEKRAAFLVLPFHKQQGTDGEMEDTNPAIQTVNEGVLLSAPCSVGI  886
               Y +M EDIC +A++KR A +++PFHKQQ  DG ME TNPA + VN+ +L +APCSVGI
Sbjct  552   SPYSSMHEDICSLAEDKRVALVIIPFHKQQTVDGGMEATNPAFRMVNQNLLANAPCSVGI  611

Query  885   LVERG-------RPNQYAKNIAVLYLGGPDDREALTYARRMSGLPGVHLTVIRFVPAKDV  727
             LV+RG         N+ + ++AVL+LGGPDDREAL YA RM   PG  LTV+RFVP +D 
Sbjct  612   LVDRGLSGSSRLAANEMSHHVAVLFLGGPDDREALVYAWRMCEHPGTRLTVLRFVPGED-  670

Query  726   SADGAVEDPDLELELTRETSFVTVSIDPARDKEEDEELLNNFRTETAEDDSKTFMELVLD  547
                 AVE          +   +TV  D +++K+ D+E +N+FR + A D+S T+ E V++
Sbjct  671   ----AVESTMQPTSDQNDPRILTVETDNSKEKQLDDECINDFRIKIANDESVTYTEKVVN  726

Query  546   DEEEFTKAVKSLDDRSFDLYVAGRGRGVSSALTSGLADWCECPELGAVGDllvtsefess  367
             + EE   A+++LD  S DL++ GRG+G+ S LT+GL DW ECPELGA+GD+L +S+F S+
Sbjct  727   NGEETVAAIRTLDS-SHDLFIVGRGQGMMSPLTTGLTDWSECPELGAIGDILASSDFAST  785

Query  366   fsvlvVQQYV  337
              SVLV+QQYV
Sbjct  786   VSVLVIQQYV  795



>ref|XP_002262677.2| PREDICTED: cation/H(+) antiporter 15 [Vitis vinifera]
Length=837

 Score =   621 bits (1602),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 357/799 (45%), Positives = 522/799 (65%), Gaps = 30/799 (4%)
 Frame = -3

Query  2679  LDRLGQVVMCFSQTIYRSNGVWEGPDPLAPMIPLFILQIMTAILSSRILNFVLKPFNQPP  2500
             ++R   +++C+S T+  +NG+W+G +PL   +PLFILQ+   ++++R+L F+LKP  QP 
Sbjct  8     VNRTDDMIVCYSPTMITTNGIWQGDNPLDYSLPLFILQLTLVVVTTRLLVFILKPLRQPR  67

Query  2499  LVAEILSGIILGPSMLGNIEEFRKHNFPNHNFETIETMGHFALVLYAFLTGLQMDVKAIV  2320
             +++EIL G++LGPS+LG         FP  +   +ETM +  L+ + FL G++MD+  I 
Sbjct  68    VISEILGGVLLGPSVLGQNLHLANLIFPLRSVMVLETMANVGLLYFLFLVGVEMDLTVIR  127

Query  2319  HTGTKSRIVAVSGSIFPFLIGAGFYFTLQTDTQSM---IGFIFCGSALTVTGFSTLAKIL  2149
              TG K+  +A+ G I PF+IG  F   L  + + M      +F G AL+VT F  LA+IL
Sbjct  128   RTGKKAIAIAIIGMILPFIIGCAFSLILHHEDRQMNRSTFVLFLGVALSVTAFPVLARIL  187

Query  2148  DSKRLLNTEIGKIAASSALINVALSWVLLTIGLLF----TGSLDNVQWAvlctvgfvvvc  1981
                +L+NTE+G++A SSALIN   +WVLL + +      + SL ++ W +L +V FVVVC
Sbjct  188   AELKLINTELGRMAMSSALINDMCAWVLLAVAIALAENESSSLASL-WVILSSVFFVVVC  246

Query  1980  vnyVRPLLNWLISKTPEGQGFSEFYICSFIAVICAFGCFTDAMGSHPMIGAFIFGLIMPN  1801
             +  VRP+++W+I +TPEG+ FSEFYIC  +  +   G  TDA+G+H + GAF+FGL++PN
Sbjct  247   IFIVRPVISWMIRRTPEGESFSEFYICLILTGVMISGFVTDAIGTHSVFGAFVFGLVIPN  306

Query  1800  NELLRTAILDRLEDFVMGILMPVFFLVCGLRTNIFTITDGDTSIFTALALILLACSAKII  1621
              +L  T ++++LEDFV G+L+P+FF + GL+T++  I    T  F  L +I+LAC+ KI 
Sbjct  307   GQLGVT-LIEKLEDFVSGLLLPLFFAISGLKTDVTKIHGALTWGFLFL-VIILACAGKIA  364

Query  1620  AALVASCYTGMSTNEAIGLGVLTNTKSTMVMIILEVGqvqqvlsvqqysmmvVACLIMTI  1441
               L+ + +  M   E I LG+L NTK  + MI+L VG+ Q VL  + +++MV   +IMT 
Sbjct  365   GTLIVALFYQMPLREGIVLGLLMNTKGLVEMIVLNVGRDQHVLDDETFAIMVTVAVIMTS  424

Query  1440  VATPLAAR-YCPKQDLEPYKRRTIQNAKPGEELRILACIHGTNNLPAIISLLETSNSTVT  1264
             +  P+    Y P +   PYKRRTIQ +KP  ELRIL CIH   N+P II+LLE S+ +  
Sbjct  425   IIAPIVTHIYKPARKFIPYKRRTIQRSKPDGELRILVCIHTPRNVPTIINLLEASHPSKK  484

Query  1263  SPITAFGVQLLELVGRAPAMMvvhssgsgrhvggsHEEVQTSQIISTFDNYELRSHGVTA  1084
             SPI  + + L+EL GRA AM++VH++        +  + Q+  II+ F+NYE  S  V+ 
Sbjct  485   SPICVYVLHLVELTGRASAMLIVHNTRKSGCPALNRTQAQSDHIINAFENYEQHSSCVSV  544

Query  1083  QVLTARWSYDTMAEDICKMAKEKRAAFLVLPFHKQQGTDGEMEDTNPAIQTVNEGVLLSA  904
             Q LTA   Y TM EDIC +A++KR AF+++PFHKQQ  DG ME TNPA + VN+ VL +A
Sbjct  545   QPLTAISPYSTMHEDICNLAEDKRVAFIIIPFHKQQTVDGGMEATNPAFRAVNQNVLANA  604

Query  903   PCSVGILVERG-------RPNQYAKNIAVLYLGGPDDREALTYARRMSGLPGVHLTVIRF  745
             PCSVGILV+RG         +Q + +IAVL+ GGPDDREAL+YA RMS  PG+ LTV+RF
Sbjct  605   PCSVGILVDRGLNGSTRLAASQVSHHIAVLFFGGPDDREALSYAERMSEHPGISLTVMRF  664

Query  744   VPAKDVSADGAVE---DPDLELELTRETSFVTVSIDPARDKEEDEELLNNFRTETAEDDS  574
             + A D + +  VE   DP+       +   +TV  D  R+K+ DEE +N+FR + + D+S
Sbjct  665   I-AGDETVESTVEPSSDPN-------DPRILTVITDSDREKQLDEEYINDFRMKNSNDES  716

Query  573   KTFMELVLDDEEEFTKAVKSLDDRSFDLYVAGRGRGVSSALTSGLADWCECPELGAVGDl  394
               + E ++++ EE   AV+S+D    DL++ GRG+G+ S LT+GL DW ECPELGA+GD+
Sbjct  717   IVYTEKIVNNGEETVAAVRSIDS-IHDLFIVGRGQGMISPLTAGLTDWSECPELGAIGDM  775

Query  393   lvtsefessfsvlvVQQYV  337
             L +S+F S+ SVLVVQQYV
Sbjct  776   LASSDFASTVSVLVVQQYV  794



>emb|CAN66285.1| hypothetical protein VITISV_011183 [Vitis vinifera]
Length=837

 Score =   621 bits (1602),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 357/799 (45%), Positives = 522/799 (65%), Gaps = 30/799 (4%)
 Frame = -3

Query  2679  LDRLGQVVMCFSQTIYRSNGVWEGPDPLAPMIPLFILQIMTAILSSRILNFVLKPFNQPP  2500
             ++R   +++C+S T+  +NG+W+G +PL   +PLFILQ+   ++++R+L F+LKP  QP 
Sbjct  8     VNRTDDMIVCYSPTMITTNGIWQGDNPLDYSLPLFILQLTLVVVTTRLLVFILKPLRQPR  67

Query  2499  LVAEILSGIILGPSMLGNIEEFRKHNFPNHNFETIETMGHFALVLYAFLTGLQMDVKAIV  2320
             +++EIL G++LGPS+LG         FP  +   +ETM +  L+ + FL G++MD+  I 
Sbjct  68    VISEILGGVLLGPSVLGQNLHLANLIFPLRSVMVLETMANVGLLYFLFLVGVEMDLTVIR  127

Query  2319  HTGTKSRIVAVSGSIFPFLIGAGFYFTLQTDTQSM---IGFIFCGSALTVTGFSTLAKIL  2149
              TG K+  +A+ G I PF+IG  F   L  + + M      +F G AL+VT F  LA+IL
Sbjct  128   RTGKKAIAIAIIGMILPFIIGCAFSLILHHEDRQMNRSTFVLFLGVALSVTAFPVLARIL  187

Query  2148  DSKRLLNTEIGKIAASSALINVALSWVLLTIGLLF----TGSLDNVQWAvlctvgfvvvc  1981
                +L+NTE+G++A SSALIN   +WVLL + +      + SL ++ W +L +V FVVVC
Sbjct  188   AELKLINTELGRMAMSSALINDMCAWVLLAVAIALAENESSSLASL-WVILSSVFFVVVC  246

Query  1980  vnyVRPLLNWLISKTPEGQGFSEFYICSFIAVICAFGCFTDAMGSHPMIGAFIFGLIMPN  1801
             +  VRP+++W+I +TPEG+ FSEFYIC  +  +   G  TDA+G+H + GAF+FGL++PN
Sbjct  247   IFIVRPVISWMIRRTPEGESFSEFYICLILTGVMISGFVTDAIGTHSVFGAFVFGLVIPN  306

Query  1800  NELLRTAILDRLEDFVMGILMPVFFLVCGLRTNIFTITDGDTSIFTALALILLACSAKII  1621
              +L  T ++++LEDFV G+L+P+FF + GL+T++  I    T  F  L +I+LAC+ KI 
Sbjct  307   GQLGVT-LIEKLEDFVSGLLLPLFFAISGLKTDVTKIHGALTWGFLFL-VIILACAGKIA  364

Query  1620  AALVASCYTGMSTNEAIGLGVLTNTKSTMVMIILEVGqvqqvlsvqqysmmvVACLIMTI  1441
               L+ + +  M   E I LG+L NTK  + MI+L VG+ Q VL  + +++MV   +IMT 
Sbjct  365   GTLIVALFYQMPLREGIVLGLLMNTKGLVEMIVLNVGRDQHVLDDETFAIMVTVAVIMTS  424

Query  1440  VATPLAAR-YCPKQDLEPYKRRTIQNAKPGEELRILACIHGTNNLPAIISLLETSNSTVT  1264
             +  P+    Y P +   PYKRRTIQ +KP  ELRIL CIH   N+P II+LLE S+ +  
Sbjct  425   IIAPIVTHIYKPARKFIPYKRRTIQRSKPDGELRILVCIHTPRNVPTIINLLEASHPSKK  484

Query  1263  SPITAFGVQLLELVGRAPAMMvvhssgsgrhvggsHEEVQTSQIISTFDNYELRSHGVTA  1084
             SPI  + + L+EL GRA AM++VH++        +  + Q+  II+ F+NYE  S  V+ 
Sbjct  485   SPICXYVLHLVELTGRASAMLIVHNTRKSGCPALNRTQAQSDHIINAFENYEQHSSCVSV  544

Query  1083  QVLTARWSYDTMAEDICKMAKEKRAAFLVLPFHKQQGTDGEMEDTNPAIQTVNEGVLLSA  904
             Q LTA   Y TM EDIC +A++KR AF+++PFHKQQ  DG ME TNPA + VN+ VL +A
Sbjct  545   QPLTAISPYSTMHEDICNLAEDKRVAFIIIPFHKQQTVDGGMEATNPAFRAVNQNVLANA  604

Query  903   PCSVGILVERG-------RPNQYAKNIAVLYLGGPDDREALTYARRMSGLPGVHLTVIRF  745
             PCSVGILV+RG         +Q + +IAVL+ GGPDDREAL+YA RMS  PG+ LTV+RF
Sbjct  605   PCSVGILVDRGLNGSTRLAASQVSHHIAVLFFGGPDDREALSYAERMSEHPGISLTVMRF  664

Query  744   VPAKDVSADGAVE---DPDLELELTRETSFVTVSIDPARDKEEDEELLNNFRTETAEDDS  574
             + A D + +  VE   DP+       +   +TV  D  R+K+ DEE +N+FR + + D+S
Sbjct  665   I-AGDETVESTVEPSSDPN-------DPRILTVITDSDREKQLDEEYINDFRMKNSNDES  716

Query  573   KTFMELVLDDEEEFTKAVKSLDDRSFDLYVAGRGRGVSSALTSGLADWCECPELGAVGDl  394
               + E ++++ EE   AV+S+D    DL++ GRG+G+ S LT+GL DW ECPELGA+GD+
Sbjct  717   IVYTEKIVNNGEETVAAVRSIDS-IHDLFIVGRGQGMISPLTAGLTDWSECPELGAIGDM  775

Query  393   lvtsefessfsvlvVQQYV  337
             L +S+F S+ SVLVVQQYV
Sbjct  776   LASSDFASTVSVLVVQQYV  794



>ref|XP_006432183.1| hypothetical protein CICLE_v10000276mg [Citrus clementina]
 ref|XP_006465118.1| PREDICTED: cation/H(+) antiporter 15-like [Citrus sinensis]
 gb|ESR45423.1| hypothetical protein CICLE_v10000276mg [Citrus clementina]
Length=832

 Score =   617 bits (1591),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/795 (44%), Positives = 509/795 (64%), Gaps = 28/795 (4%)
 Frame = -3

Query  2676  DRLGQVVMCFSQTIYRSNGVWEGPDPLAPMIPLFILQIMTAILSSRILNFVLKPFNQPPL  2497
             ++  + ++C+S  +  +NGVW+G +PL   +PLFILQ+   ++++R+L  VLKPF QP +
Sbjct  10    NKTDETIVCYSPNMITTNGVWQGDNPLDYSLPLFILQLTLVVVTTRLLVLVLKPFRQPRV  69

Query  2496  VAEILSGIILGPSMLGNIEEFRKHNFPNHNFETIETMGHFALVLYAFLTGLQMDVKAIVH  2317
             ++EI+ G++LGPS+LG    F    FP  +   +ETM +  L+ + FL G++MD+ AI  
Sbjct  70    ISEIIGGVLLGPSVLGRNTAFANTIFPLRSVMVLETMANVGLLYFLFLVGVEMDISAIRR  129

Query  2316  TGTKSRIVAVSGSIFPFLIGAGFYFTLQTDTQSM---IGFIFCGSALTVTGFSTLAKILD  2146
             TG K+  +AV G   PF+IG  F F L    Q M      +F G AL+VT F  LA+IL 
Sbjct  130   TGKKALAIAVGGMTLPFVIGGCFSFILHKKNQGMNQGTFVLFLGVALSVTAFPVLARILA  189

Query  2145  SKRLLNTEIGKIAASSALINVALSWVLLTIGLLF----TGSLDNVQWAvlctvgfvvvcv  1978
               +L+NTE+G+IA SSALIN   +WVLL   +      T +L ++ W +L    FV+ CV
Sbjct  190   ELKLINTELGRIAMSSALINDMCAWVLLAFAIALGENDTSTLASL-WVILSGAAFVIFCV  248

Query  1977  nyVRPLLNWLISKTPEGQGFSEFYICSFIAVICAFGCFTDAMGSHPMIGAFIFGLIMPNN  1798
               VRP + W+I +TPEG+ FSEFY+C  +  +   G  TDA+G+H + GAF+FGL++PN 
Sbjct  249   FVVRPAICWMIRRTPEGESFSEFYVCLILTGVMISGFITDAIGTHSVFGAFVFGLVIPNG  308

Query  1797  ELLRTAILDRLEDFVMGILMPVFFLVCGLRTNIFTITDGDTSIFTALALILLACSAKIIA  1618
              L  T ++++LEDFV G+L+P+FF + GL+T+I +I  G ++    L +I+LAC+ KI  
Sbjct  309   PLGLT-LIEKLEDFVSGLLLPLFFAISGLKTDISSI-HGTSTWMITLLVIVLACAGKIAG  366

Query  1617  ALVASCYTGMSTNEAIGLGVLTNTKSTMVMIILEVGqvqqvlsvqqysmmvVACLIMTIV  1438
              L+ S    M   E + LG+L NTK  + MI+L VG+ Q+VL  + +++MV+  ++MT +
Sbjct  367   TLLVSLMYQMPIREGVTLGLLMNTKGLVEMIVLNVGKDQKVLDDESFAIMVIVAVVMTGI  426

Query  1437  ATPLAAR-YCPKQDLEPYKRRTIQNAKPGEELRILACIHGTNNLPAIISLLETSNSTVTS  1261
              TP+    Y P +   PYKRRTIQ +KP  E R L C+H   N+P II+LLE S+ T  S
Sbjct  427   ITPIVTSIYKPARRFLPYKRRTIQKSKPDSEFRALVCVHTPRNVPTIINLLEASHPTKRS  486

Query  1260  PITAFGVQLLELVGRAPAMMvvhssgsgrhvggsHEEVQTSQIISTFDNYELRSHGVTAQ  1081
             PI  + + L+EL GRA AM++VH++        +  + Q+  II+ F+NYE  +  VT Q
Sbjct  487   PICVYVLHLVELTGRASAMLIVHNTRKSGRPALNRTQAQSDHIINAFENYEQHTGCVTVQ  546

Query  1080  VLTARWSYDTMAEDICKMAKEKRAAFLVLPFHKQQGTDGEMEDTNPAIQTVNEGVLLSAP  901
              LTA   Y +M EDIC +A++KR A +++PFHK Q  DG ME TNPA + VN+ +L +AP
Sbjct  547   PLTAISPYSSMHEDICNLAEDKRVALIIIPFHKHQTVDGGMEATNPAFRMVNQNLLANAP  606

Query  900   CSVGILVERG-------RPNQYAKNIAVLYLGGPDDREALTYARRMSGLPGVHLTVIRFV  742
             CSVGILV+RG         NQ   NIAVL+ GGPDDREAL YA RMS  PG +LTV+RF+
Sbjct  607   CSVGILVDRGLNGSTRLAANQVTHNIAVLFFGGPDDREALAYAWRMSEHPGNNLTVMRFI  666

Query  741   PAKDVSADGAVEDPDLELELTRETSFVTVSIDPARDKEEDEELLNNFRTETAEDDSKTFM  562
              A++V    A + PD         + +TV  +    ++ DEE +N FR + A D+S  + 
Sbjct  667   AAEEVEP-AARQSPD--------QNGLTVETENDNQRQLDEEYINEFRMKIANDESVVYT  717

Query  561   ELVLDDEEEFTKAVKSLDDRSFDLYVAGRGRGVSSALTSGLADWCECPELGAVGDllvts  382
             E + ++ EE   A++S+ D++ DL++ GRG+GV+S LT GL DW ECPELGA+GDLL +S
Sbjct  718   EKLANNGEETLAAIRSM-DQAHDLFIVGRGQGVTSPLTDGLTDWSECPELGAIGDLLASS  776

Query  381   efessfsvlvVQQYV  337
             +F S+ SVLVVQQYV
Sbjct  777   DFASTVSVLVVQQYV  791



>emb|CDP09934.1| unnamed protein product [Coffea canephora]
Length=841

 Score =   617 bits (1591),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/794 (44%), Positives = 511/794 (64%), Gaps = 28/794 (4%)
 Frame = -3

Query  2664  QVVMCFSQTIYRSNGVWEGPDPLAPMIPLFILQIMTAILSSRILNFVLKPFNQPPLVAEI  2485
             + ++C++ T+  +NG+W+G +PL   +PLFILQ+   ++ +RIL ++LKP  QP +++EI
Sbjct  14    ETIVCYAPTMITTNGIWQGDNPLDYSLPLFILQLTLVVVVTRILVYILKPLRQPRVISEI  73

Query  2484  LSGIILGPSMLGNIEEFRKHNFPNHNFETIETMGHFALVLYAFLTGLQMDVKAIVHTGTK  2305
             L GIILGPS+LG   +F    FP  +   +ETM +  L+ + FL G++MD+  I  TG K
Sbjct  74    LGGIILGPSVLGQSAKFANAVFPLRSVMVLETMANIGLLYFLFLVGVEMDLAVIRRTGKK  133

Query  2304  SRIVAVSGSIFPFLIGAGFYFTLQTDTQSM---IGFIFCGSALTVTGFSTLAKILDSKRL  2134
             +  +AV+G I PFLIG  F   L   +Q M      +F G AL+VT F  LA++L   +L
Sbjct  134   AFAIAVAGMIIPFLIGTSFSLMLHQKSQYMKQGTFILFLGVALSVTAFPVLARVLAELKL  193

Query  2133  LNTEIGKIAASSALINVALSWVLLTIGLLF----TGSLDNVQWAvlctvgfvvvcvnyVR  1966
             LNTEIG+IA SSAL+N   +W+LL   +      + SL +V W +L +  FV+ C+  VR
Sbjct  194   LNTEIGRIAMSSALVNDMCAWILLAFAIALAENASVSLASV-WVILSSSAFVLFCIFAVR  252

Query  1965  PLLNWLISKTPEGQGFSEFYICSFIAVICAFGCFTDAMGSHPMIGAFIFGLIMPNNELLR  1786
             PL++W+I +TPEG+  S+FYIC  +  +   G  TDA+G+H + GAF+FGLI+PN  +  
Sbjct  253   PLISWMIRRTPEGETISDFYICLILTGVMICGFITDALGTHSVFGAFVFGLIIPNGPIGL  312

Query  1785  TAILDRLEDFVMGILMPVFFLVCGLRTNIFTITDGDTSIFTALALILLACSAKIIAALVA  1606
             T +++RLEDFV G+L+P+FF + GL+T I TI    T     L +I+L+C+ KI   L+ 
Sbjct  313   T-LIERLEDFVSGLLLPLFFAISGLKTEISTIKGVGTWCILFL-VIVLSCAGKIAGTLLV  370

Query  1605  SCYTGMSTNEAIGLGVLTNTKSTMVMIILEVGqvqqvlsvqqysmmvVACLIMTIVATPL  1426
             + Y  M   E + LG L NTK  + +IIL VG+ Q+VL  Q +++MV+  ++ T +  P+
Sbjct  371   ALYYKMPFYEGLTLGFLMNTKGLVEIIILNVGKDQKVLDDQSFAIMVIISVVKTSIIIPI  430

Query  1425  AAR-YCPKQDLEPYKRRTIQNAKPGEELRILACIHGTNNLPAIISLLETSNSTVTSPITA  1249
                 Y P +   PYK+RT+Q +KP  E R+L C+H   N+P II+LLE S+ T  SPI  
Sbjct  431   VTLIYKPARKFAPYKKRTVQRSKPDSEFRVLVCVHTPRNVPTIINLLEASHPTKKSPICI  490

Query  1248  FGVQLLELVGRAPAMMvvhssgsgrhvggsHEEVQTSQIISTFDNYELRSHGVTAQVLTA  1069
             + + L+EL GRA AM++VH+S        +  + Q+  II+ F+N+E  +  V+ Q LTA
Sbjct  491   YVLHLVELSGRASAMLIVHNSRKSGRPALNRAQAQSDHIINAFENFEQHAGCVSVQPLTA  550

Query  1068  RWSYDTMAEDICKMAKEKRAAFLVLPFHKQQGTDGEMEDTNPAIQTVNEGVLLSAPCSVG  889
                Y TM EDIC +A++KRAAF+++PFHKQQ  DG ME TNPA +T+N+ VL++APCSVG
Sbjct  551   ISPYSTMHEDICNLAEDKRAAFIIIPFHKQQTVDGGMESTNPAFRTINQNVLVNAPCSVG  610

Query  888   ILVERGRPN-------QYAKNIAVLYLGGPDDREALTYARRMSGLPGVHLTVIRFVPAKD  730
             ILV+RG  +       Q + ++A+L+ GGPDDREAL YA RMS  PG++LTV+RF+P + 
Sbjct  611   ILVDRGLSSSTRLAAGQVSHHVAILFFGGPDDREALAYAWRMSEHPGINLTVMRFIPGE-  669

Query  729   VSADGAVEDPDLELELTRETS---FVTVSIDPARDKEEDEELLNNFRTETAEDDSKTFME  559
                  A  +P        E S    +TV  D  R+K+ DE+ +N FR+ T  DDS  + E
Sbjct  670   -----AAAEPSSSSGRRAEASAPGILTVVTDDDREKQLDEDYINQFRSRTMHDDSIVYTE  724

Query  558   LVLDDEEEFTKAVKSLDDRSFDLYVAGRGRGVSSALTSGLADWCECPELGAVGDllvtse  379
              V+ + EE   A++S+D    DL++ GRG+G  S LT+GL DW ECPELGA+GDLL +S+
Sbjct  725   RVVRNGEETVAAIRSIDS-IHDLFIVGRGQGTVSPLTAGLTDWSECPELGAIGDLLASSD  783

Query  378   fessfsvlvVQQYV  337
             F ++ SVLVVQQYV
Sbjct  784   FATTVSVLVVQQYV  797



>ref|XP_002310518.2| hypothetical protein POPTR_0007s04230g [Populus trichocarpa]
 gb|EEE90968.2| hypothetical protein POPTR_0007s04230g [Populus trichocarpa]
Length=826

 Score =   616 bits (1589),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/794 (44%), Positives = 520/794 (65%), Gaps = 32/794 (4%)
 Frame = -3

Query  2664  QVVMCFSQTIYRSNGVWEGPDPLAPMIPLFILQIMTAILSSRILNFVLKPFNQPPLVAEI  2485
             + ++C++ T+  +NG+W+G +PL   +PLFILQ+   ++++R+L ++LKP  QP +++EI
Sbjct  9     ETIVCYAPTMITTNGIWQGDNPLDYSLPLFILQLTLVVVTTRLLVYILKPLRQPRVISEI  68

Query  2484  LSGIILGPSMLGNIEEFRKHNFPNHNFETIETMGHFALVLYAFLTGLQMDVKAIVHTGTK  2305
             L G+ILGPS+LG  + F    FP  +   +ETM +  L+ + FL G++MD+  I  TG K
Sbjct  69    LGGVILGPSVLGRSKAFANTIFPLRSVMVLETMANMGLLYFLFLVGVEMDISVIKRTGKK  128

Query  2304  SRIVAVSGSIFPFLIGAGFYFTLQTDTQSM---IGFIFCGSALTVTGFSTLAKILDSKRL  2134
             +  +A+ G IFPF IG  F F L  D+QS+      +F G AL+VT F  LA++L   +L
Sbjct  129   AIAIAIGGMIFPFFIGLAFSFALHKDSQSLNQGTFVLFLGVALSVTAFPVLARVLAEIKL  188

Query  2133  LNTEIGKIAASSALINVALSWVLLTIGLLF----TGSLDNVQWAvlctvgfvvvcvnyVR  1966
             +NTEIG+IA S+ALIN   +W+LL + +      + SL  + W +L +  FV++C+  +R
Sbjct  189   INTEIGRIAMSAALINDICAWILLALAITLAENKSTSLATL-WVILSSFTFVLICIYVIR  247

Query  1965  PLLNWLISKTPEGQGFSEFYICSFIAVICAFGCFTDAMGSHPMIGAFIFGLIMPNNELLR  1786
             P+++W+IS TPEG+  SEFYIC  +  +   G  TDA+G+H + GAF+FGLI+PN  L  
Sbjct  248   PVISWMISSTPEGETISEFYICLILTGVMISGFITDAIGTHSVFGAFVFGLIIPNGPLGV  307

Query  1785  TAILDRLEDFVMGILMPVFFLVCGLRTNIFTITDGDTSIFTALALILLACSAKIIAALVA  1606
             T ++++LEDFV G+L+P+FF + GL+T+I  I +G  +    + +I++  + K++  ++A
Sbjct  308   T-LIEKLEDFVSGLLLPIFFAMSGLKTDIGAI-NGVATWLILILVIIVGFAGKVVGTVLA  365

Query  1605  SCYTGMSTNEAIGLGVLTNTKSTMVMIILEVGqvqqvlsvqqysmmvVACLIMTIVATP-  1429
             S    M   E I LG L N+K  + MI+L VG+ Q+VL  + ++MMV+  +IMT +  P 
Sbjct  366   SMLYQMPLLEGITLGFLMNSKGLVEMIVLNVGREQKVLDDESFAMMVIVAVIMTAIIIPS  425

Query  1428  LAARYCPKQDLEPYKRRTIQNAKPGEELRILACIHGTNNLPAIISLLETSNSTVTSPITA  1249
             +   Y P++   PY RRTIQ +K   E R LAC+H   N+P II+LLE S+    SP+  
Sbjct  426   VTVIYRPEKRFLPYTRRTIQRSKRDAEFRALACVHTPRNVPTIINLLEASHPNKRSPMCV  485

Query  1248  FGVQLLELVGRAPAMMvvhssgsgrhvggsHEEVQTSQIISTFDNYELRSHGVTAQVLTA  1069
             + V L+EL GRA AM++VH++    H   +  + Q+  II+ FDNYE  +  V+ Q LTA
Sbjct  486   YVVHLVELTGRASAMLIVHNTRKSGHPALNRTQAQSDHIINAFDNYEQNAVCVSVQPLTA  545

Query  1068  RWSYDTMAEDICKMAKEKRAAFLVLPFHKQQGTDGEMEDTNPAIQTVNEGVLLSAPCSVG  889
                Y TM  DIC +A++KR A ++LPFHKQQ  DG ME TNPAI+ VN+ VL SAPCSVG
Sbjct  546   ISPYSTMHVDICNLAEDKRVALIILPFHKQQTVDGGMEATNPAIRMVNQNVLASAPCSVG  605

Query  888   ILVERG-------RPNQYAKNIAVLYLGGPDDREALTYARRMSGLPGVHLTVIRFVPAKD  730
             ILV+RG         NQ A ++AVLY GGPDDREAL+YA RMS  P ++LTV+RFVP +D
Sbjct  606   ILVDRGLSGSTRLASNQAAHHVAVLYFGGPDDREALSYAWRMSEHPTINLTVMRFVPGED  665

Query  729   VSADGAVEDPDLELELTRETSFVTVSIDPARDKEEDEELLNNFRTETAEDDSKTFMELVL  550
                  A+++P +          ++V  +  ++K+ DE+ +N FRT+TA + S  + E+V+
Sbjct  666   AK---ALDNPGM----------LSVETENLKEKQLDEDHVNEFRTQTAHNGSIFYNEIVV  712

Query  549   DDEEEFTKAVKSLDDRSFDLYVAGRGRGVSSALTSGLADWCECPELGAVGDllvtsefes  370
              + EE   A++S+D+   DL++ GRG+G+ S LT+GL DW ECPELGA+GDLL +S+F +
Sbjct  713   SNGEETVAAIRSMDNHH-DLFIVGRGQGMISPLTAGLTDWSECPELGAIGDLLASSDFAA  771

Query  369   sfsvlvVQQYVRTN  328
             + SVLV+QQYV ++
Sbjct  772   TVSVLVLQQYVGSH  785



>ref|XP_010090834.1| Cation/H(+) antiporter 15 [Morus notabilis]
 gb|EXB40959.1| Cation/H(+) antiporter 15 [Morus notabilis]
Length=836

 Score =   616 bits (1588),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/796 (44%), Positives = 516/796 (65%), Gaps = 24/796 (3%)
 Frame = -3

Query  2679  LDRLGQVVMCFSQTIYRSNGVWEGPDPLAPMIPLFILQIMTAILSSRILNFVLKPFNQPP  2500
             +++    ++C++  +  +NGVW+G +PL   +PLFILQ+   ++++R L F+LKPF QP 
Sbjct  9     INKTEDTIVCYAPNMITTNGVWQGDNPLDYSLPLFILQLTMVVVTTRFLVFILKPFRQPR  68

Query  2499  LVAEILSGIILGPSMLGNIEEFRKHNFPNHNFETIETMGHFALVLYAFLTGLQMDVKAIV  2320
             ++AEIL G+ILGPS+LG    F    FP  +   +ETM +  L+ + FL G++MD+  I 
Sbjct  69    VIAEILGGVILGPSVLGRNSRFANTLFPLRSVMVLETMANVGLLYFLFLVGVEMDISVIR  128

Query  2319  HTGTKSRIVAVSGSIFPFLIGAGFYFTLQTDTQSMIG---FIFCGSALTVTGFSTLAKIL  2149
              TG K+  +A++G + PF+IGA F F L    ++M      +F G AL+VT F  LA+IL
Sbjct  129   RTGKKALAIAIAGMVLPFIIGACFSFILHKKDETMTQGTFILFLGVALSVTAFPVLARIL  188

Query  2148  DSKRLLNTEIGKIAASSALINVALSWVLLTIGLL----FTGSLDNVQWAvlctvgfvvvc  1981
                +L+NTEIG+IA SSAL+N   +W+LL + +        SL ++ W +L +  FV  C
Sbjct  189   AELKLINTEIGRIALSSALVNDMSAWILLALAIALAENHATSLASL-WVILSSTAFVAFC  247

Query  1980  vnyVRPLLNWLISKTPEGQGFSEFYICSFIAVICAFGCFTDAMGSHPMIGAFIFGLIMPN  1801
             +  VRP ++W+I +TPEG+ FSEF+IC  +  +   G  TDA+G+H + GAF+FGL++PN
Sbjct  248   ILIVRPAVSWMIRRTPEGESFSEFHICLVLTGVMLSGFITDAIGTHSVFGAFVFGLVIPN  307

Query  1800  NELLRTAILDRLEDFVMGILMPVFFLVCGLRTNIFTITDGDTSIFTALALILLACSAKII  1621
               L  T ++++LEDFV G+L+P+FF + GL+T++ +IT   T  F  L +I+LAC+ K+ 
Sbjct  308   GPLGVT-LIEKLEDFVSGLLLPLFFAISGLKTDVTSITSVGTWGFLML-IIVLACAGKVA  365

Query  1620  AALVASCYTGMSTNEAIGLGVLTNTKSTMVMIILEVGqvqqvlsvqqysmmvVACLIMTI  1441
               L+   Y  M  +E I LG+L NTK  + MIIL VG+ Q+VL  + +++MV+  ++MT 
Sbjct  366   GTLLVCIYYQMPVHEGITLGLLMNTKGLVEMIILNVGRDQKVLDDESFAIMVIVAVVMTA  425

Query  1440  VATPLAAR-YCPKQDLEPYKRRTIQNAKPGEELRILACIHGTNNLPAIISLLETSNSTVT  1264
             + TP+    Y P +   PYKRRTIQ  KP  ELR+L CIH   N+P II+LLE S+ +  
Sbjct  426   IITPIVTSIYKPARKFIPYKRRTIQRLKPDAELRMLVCIHTPRNVPTIINLLEASHPSKR  485

Query  1263  SPITAFGVQLLELVGRAPAMMvvhssgsgrhvggsHEEVQTSQIISTFDNYELRSHGVTA  1084
             SP+  + + L+EL GRA AM++VH++        +  + Q+  II+ F+NYE  +  V+ 
Sbjct  486   SPLCVYVLHLVELTGRASAMLIVHNTRKSGRPPLNRTQAQSDHIINAFENYEQHAGCVSV  545

Query  1083  QVLTARWSYDTMAEDICKMAKEKRAAFLVLPFHKQQGTDGEMEDTNPAIQTVNEGVLLSA  904
             Q LTA   Y TM EDIC +A++KR AF+++PFHKQQ  DG ME TNPA + +N+ VL +A
Sbjct  546   QPLTAISPYSTMHEDICNLAEDKRVAFIIIPFHKQQTVDGGMEATNPAFRMINQNVLANA  605

Query  903   PCSVGILVERG-------RPNQYAKNIAVLYLGGPDDREALTYARRMSGLPGVHLTVIRF  745
             PCSVGI+V+RG         NQ   +IAV++ GGPDDREALTYA RMS  PG  LTV+RF
Sbjct  606   PCSVGIIVDRGLNGSTRLAANQVTHHIAVIFFGGPDDREALTYALRMSDHPGTSLTVLRF  665

Query  744   VPAKDVSADGAVEDPDLELELTRETSFVTVSIDPARDKEEDEELLNNFRTETAEDDSKTF  565
                  +S D A +  +       +   +TV  D   +++ D++L+N+FR +T  D+S  +
Sbjct  666   -----ISGDDAADTTEQSRGNPNDPRMLTVETDDTMERQLDDDLVNDFRMKTMNDESIVY  720

Query  564   MELVLDDEEEFTKAVKSLDDRSFDLYVAGRGRGVSSALTSGLADWCECPELGAVGDllvt  385
              E V+ + EE   A++S+D+   DL++ GRG+G+ S LT+GL DW ECPELGA+GDLL +
Sbjct  721   NEKVVHNGEETVAAIRSMDN-VHDLFIVGRGQGMISPLTAGLTDWSECPELGAIGDLLAS  779

Query  384   sefessfsvlvVQQYV  337
             S+F ++ SVLVVQQYV
Sbjct  780   SDFAATVSVLVVQQYV  795



>gb|KDO50743.1| hypothetical protein CISIN_1g043446mg, partial [Citrus sinensis]
Length=784

 Score =   614 bits (1583),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 338/775 (44%), Positives = 491/775 (63%), Gaps = 28/775 (4%)
 Frame = -3

Query  2676  DRLGQVVMCFSQTIYRSNGVWEGPDPLAPMIPLFILQIMTAILSSRILNFVLKPFNQPPL  2497
             ++  + ++C+S  +  +NGVW+G +PL   +PLFILQ+   ++++R+L  VLKPF QP +
Sbjct  6     NKTDETIVCYSPNMITTNGVWQGDNPLDYSLPLFILQLTLVVVTTRLLVLVLKPFRQPRV  65

Query  2496  VAEILSGIILGPSMLGNIEEFRKHNFPNHNFETIETMGHFALVLYAFLTGLQMDVKAIVH  2317
             ++EI+ G++LGPS+LG    F    FP  +   +ETM +  L+ + FL G++MD+ AI  
Sbjct  66    ISEIIGGVLLGPSVLGRNTAFANTIFPLRSVMVLETMANVGLLYFLFLVGVEMDISAIRR  125

Query  2316  TGTKSRIVAVSGSIFPFLIGAGFYFTLQTDTQSM---IGFIFCGSALTVTGFSTLAKILD  2146
             TG K+  +AV G   PF+IG  F F L    Q M      +F G AL+VT F  LA+IL 
Sbjct  126   TGKKALAIAVGGMTLPFVIGGCFSFILHKKNQGMNQGTFVLFLGVALSVTAFPVLARILA  185

Query  2145  SKRLLNTEIGKIAASSALINVALSWVLLTIGLLF----TGSLDNVQWAvlctvgfvvvcv  1978
               +L+NTE+G+IA SSALIN   +WVLL   +      T +L ++ W +L    FV+ CV
Sbjct  186   ELKLINTELGRIAMSSALINDMCAWVLLAFAIALGENDTSTLASL-WVILSGAAFVIFCV  244

Query  1977  nyVRPLLNWLISKTPEGQGFSEFYICSFIAVICAFGCFTDAMGSHPMIGAFIFGLIMPNN  1798
               VRP + W+I +TPEG+ FSEFY+C  +  +   G  TDA+G+H + GAF+FGL++PN 
Sbjct  245   FVVRPAICWMIRRTPEGESFSEFYVCLILTGVMISGFITDAIGTHSVFGAFVFGLVIPNG  304

Query  1797  ELLRTAILDRLEDFVMGILMPVFFLVCGLRTNIFTITDGDTSIFTALALILLACSAKIIA  1618
              L  T ++++LEDFV G+L+P+FF + GL+T+I +I  G ++    L +I+LAC+ KI  
Sbjct  305   PLGLT-LIEKLEDFVSGLLLPLFFAISGLKTDISSI-HGTSTWMITLLVIILACAGKIAG  362

Query  1617  ALVASCYTGMSTNEAIGLGVLTNTKSTMVMIILEVGqvqqvlsvqqysmmvVACLIMTIV  1438
              L+ S    M   E + LG+L NTK  + MI+L VG+ Q+VL  + +++MV+  ++MT +
Sbjct  363   TLLVSLMYQMPIREGVTLGLLMNTKGLVEMIVLNVGKDQKVLDDESFAIMVIVAVVMTGI  422

Query  1437  ATPLAAR-YCPKQDLEPYKRRTIQNAKPGEELRILACIHGTNNLPAIISLLETSNSTVTS  1261
              TP+    Y P +   PYKRRTIQ +KP  E R+L C+H   N+P II+LLE S+ T  S
Sbjct  423   ITPIVTSIYKPARRFLPYKRRTIQKSKPDSEFRVLVCVHTPRNVPTIINLLEASHPTKRS  482

Query  1260  PITAFGVQLLELVGRAPAMMvvhssgsgrhvggsHEEVQTSQIISTFDNYELRSHGVTAQ  1081
             PI  + + L+EL GRA AM++VH++        +  + Q+  II+ F+NYE  +  VT Q
Sbjct  483   PICVYVLHLVELTGRASAMLIVHNTRKSGRPALNRTQAQSDHIINAFENYEQHTGCVTVQ  542

Query  1080  VLTARWSYDTMAEDICKMAKEKRAAFLVLPFHKQQGTDGEMEDTNPAIQTVNEGVLLSAP  901
              LTA   Y +M EDIC +A++KR A +++PFHK Q  DG ME TNPA + VN+ +L +AP
Sbjct  543   PLTAISPYSSMHEDICNLAEDKRVALIIIPFHKHQTVDGGMEATNPAFRMVNQNLLANAP  602

Query  900   CSVGILVERG-------RPNQYAKNIAVLYLGGPDDREALTYARRMSGLPGVHLTVIRFV  742
             CSVGILV+RG         NQ   NIAVL+ GGPDDREAL YA RMS  PG +LTV+RF+
Sbjct  603   CSVGILVDRGLNGSTRLAANQVTHNIAVLFFGGPDDREALAYAWRMSEHPGNNLTVMRFI  662

Query  741   PAKDVSADGAVEDPDLELELTRETSFVTVSIDPARDKEEDEELLNNFRTETAEDDSKTFM  562
              A++V      + PD         + +TV  +    ++ DEE +N FR + A D+S  + 
Sbjct  663   AAEEVEP-AERQSPD--------QNGLTVETENDNQRQLDEEYINEFRMKIANDESVVYT  713

Query  561   ELVLDDEEEFTKAVKSLDDRSFDLYVAGRGRGVSSALTSGLADWCECPELGAVGD  397
             E + ++ EE   A++S+ D S DL++ GRG+GV+S LT GL DW ECPELGA+GD
Sbjct  714   EKLANNGEETLAAIRSM-DHSHDLFIVGRGQGVTSPLTDGLTDWSECPELGAIGD  767



>ref|XP_006366744.1| PREDICTED: cation/H(+) antiporter 15-like [Solanum tuberosum]
Length=841

 Score =   615 bits (1585),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/796 (44%), Positives = 509/796 (64%), Gaps = 36/796 (5%)
 Frame = -3

Query  2658  VMCFSQTIYRSNGVWEGPDPLAPMIPLFILQIMTAILSSRILNFVLKPFNQPPLVAEILS  2479
             ++C+S ++  +NGVW+G +PL   +PLFILQ+   ++ +RIL F+LKPF QP ++AEIL 
Sbjct  16    IVCYSPSMITTNGVWQGENPLDYALPLFILQLTLVVIFTRILVFILKPFRQPRVIAEILG  75

Query  2478  GIILGPSMLGNIEEFRKHNFPNHNFETIETMGHFALVLYAFLTGLQMDVKAIVHTGTKSR  2299
             G+ILGPS+LG  + F    FP  +   +ETM +  L+ + FL G++MD+  I  TG K+ 
Sbjct  76    GVILGPSVLGRSKRFTDTVFPLRSVMVLETMANIGLLYFIFLVGVEMDIAVIRRTGKKAI  135

Query  2298  IVAVSGSIFPFLIGAGFYFTLQTDTQSMIG---FIFCGSALTVTGFSTLAKILDSKRLLN  2128
              +A++G + PFLIG  F F L   TQ        +F G AL+VT F  LA+IL   +L+N
Sbjct  136   PIALAGMVVPFLIGVSFSFMLHKSTQETKHGTFVLFLGVALSVTAFPVLARILAELKLIN  195

Query  2127  TEIGKIAASSALINVALSWVLLTIGLLF----TGSLDNVQWAvlctvgfvvvcvnyVRPL  1960
             +EIG+IA S+ALIN   +W+LL   + F    T +L +V W +L T  FVV CV  +RPL
Sbjct  196   SEIGRIAMSAALINDIFAWILLAFAIAFSENKTMALTSV-WVLLSTAAFVVFCVIIIRPL  254

Query  1959  LNWLISKTPEGQGFSEFYICSFIAVICAFGCFTDAMGSHPMIGAFIFGLIMPNNELLRTA  1780
             + W+I +TPEG+  SEF IC  ++ +   G  TDA+G H + GAF+FGL++PN  L  T 
Sbjct  255   IGWMIKRTPEGESISEFSICIILSGVMICGFITDAIGMHSIFGAFMFGLVIPNGPLGLT-  313

Query  1779  ILDRLEDFVMGILMPVFFLVCGLRTNIFTITDGDTSIFTALALILLACSAKIIAALVASC  1600
             + ++LEDFV G+L+P+FF++ GL+T I  I    +    ALA I+LAC  KI   ++ + 
Sbjct  314   LNEKLEDFVSGLLLPLFFVISGLKTEINAIDGVGSWAILALA-IVLACVGKIAGTVLITL  372

Query  1599  YTGMSTNEAIGLGVLTNTKSTMVMIILEVGqvqqvlsvqqysmmvVACLIMTIVATPLAA  1420
             Y  +  +E I LG+L N K  + MI++ VG+ Q+VL  + +++MVVA ++MT +  P   
Sbjct  373   YYRIPIHEGITLGLLMNAKGLIEMIVINVGKDQKVLDDKSFAIMVVATVLMTAIIIPFVT  432

Query  1419  R-YCPKQDLEPYKRRTIQNAKPGEELRILACIHGTNNLPAIISLLETSNSTVTSPITAFG  1243
               Y P +   PYKRRT+Q+ KP  E R+LACIH   N+P II+LLE S  T  SPI  + 
Sbjct  433   LIYKPARKFAPYKRRTVQSTKPDSEFRVLACIHTPRNVPTIINLLEASCPTKKSPICVYV  492

Query  1242  VQLLELVGRAPAMMvvhssgsgrhvggsHEEVQTSQIISTFDNYELRSHGVTAQVLTARW  1063
             + L+EL GR+ AM++VH++        +  + Q+  II+ F+N+E     V+ Q LTA  
Sbjct  493   LHLVELTGRSSAMLIVHNTRKSGRPALNRTQAQSDHIINAFENFEQHVGSVSVQPLTAIS  552

Query  1062  SYDTMAEDICKMAKEKRAAFLVLPFHKQQGTDGEMEDTNPAIQTVNEGVLLSAPCSVGIL  883
              Y TM EDIC +A++KR AFL++PFHKQQ  DG ME TNP  +T+N+ VL +APCSVGIL
Sbjct  553   PYSTMHEDICTVAEDKRVAFLIIPFHKQQTVDGGMEITNPNFRTINQNVLANAPCSVGIL  612

Query  882   VERG-------RPNQYAKNIAVLYLGGPDDREALTYARRMSGLPGVHLTVIRFVP-----  739
             V+RG         NQ + ++AVL+ GGPDDREAL+Y  RM   PG++LTV+RF+P     
Sbjct  613   VDRGLSGSTRLAANQVSHHVAVLFFGGPDDREALSYGLRMREHPGINLTVMRFLPGVSAL  672

Query  738   --AKDVSADGAVEDPDLELELTRETSFVTVSIDPARDKEEDEELLNNFRTETAEDDSKTF  565
               A+  S    + DP++          +T+  D  ++K+ DE+ ++ FR  TA DDS  +
Sbjct  673   EEARSGSRRSNMNDPNV----------LTIVTDDDKEKQLDEDYVSAFRLRTANDDSVVY  722

Query  564   MELVLDDEEEFTKAVKSLDDRSFDLYVAGRGRGVSSALTSGLADWCECPELGAVGDllvt  385
             +E V++  EE   A++++ D+S DL++ GRG+G  S LT+GL DW ECPELGA+GDLL +
Sbjct  723   IERVVNHGEETVAAIRTI-DQSHDLFIVGRGQGTISPLTAGLTDWSECPELGAIGDLLAS  781

Query  384   sefessfsvlvVQQYV  337
             S+  +  SVLVVQQYV
Sbjct  782   SDNAAIVSVLVVQQYV  797



>ref|XP_006409680.1| hypothetical protein EUTSA_v10023201mg [Eutrema salsugineum]
 gb|ESQ51133.1| hypothetical protein EUTSA_v10023201mg [Eutrema salsugineum]
Length=810

 Score =   613 bits (1581),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 339/789 (43%), Positives = 506/789 (64%), Gaps = 37/789 (5%)
 Frame = -3

Query  2658  VMCFSQTIYRSNGVWEGPDPLAPMIPLFILQIMTAILSSRILNFVLKPFNQPPLVAEILS  2479
             ++C++ ++  +NGVW+G +PL   +PLF+LQ+   ++ +R   F+LKPF QP +++EIL 
Sbjct  12    IICYAPSMITTNGVWQGDNPLDFSLPLFVLQLTLVVVITRFFVFILKPFRQPRVISEILG  71

Query  2478  GIILGPSMLGNIEEFRKHNFPNHNFETIETMGHFALVLYAFLTGLQMDVKAIVHTGTKSR  2299
             GI+LGPS+LG   +F    FP  +   +ETM +  L+ + FL G++MD+  +  TG ++ 
Sbjct  72    GIVLGPSLLGRYTKFANTIFPQRSVMVLETMANVGLLYFLFLVGVEMDIMVVRKTGKRAL  131

Query  2298  IVAVSGSIFPFLIGAGFYFTLQTDTQSM---IGFIFCGSALTVTGFSTLAKILDSKRLLN  2128
              +A+ G + PFLIGA F F++      +      +F G AL+VT F  LA+IL   +L+N
Sbjct  132   TIAIGGMVLPFLIGAAFSFSMHRSDDHLGQGTYILFLGVALSVTAFPVLARILAELKLIN  191

Query  2127  TEIGKIAASSALINVALSWVLLTIGLLFTGSLDNVQ----WAvlctvgfvvvcvnyVRPL  1960
             TEIG+I+ S+AL+N   +W+LL + +    S D       W ++ +  F+ +CV  VRP 
Sbjct  192   TEIGRISMSAALVNDMFAWILLALAIALAES-DKTSFASLWVMISSAAFIAICVFVVRPG  250

Query  1959  LNWLISKTPEGQGFSEFYICSFIAVICAFGCFTDAMGSHPMIGAFIFGLIMPNNELLRTA  1780
             ++W+I KTPEG+ FSEFYIC  +  +   G  TDA+G+H + GAF+FGL++PN  L  T 
Sbjct  251   ISWIIRKTPEGENFSEFYICLILTGVMISGFITDAIGTHSVFGAFVFGLVIPNGPLGLT-  309

Query  1779  ILDRLEDFVMGILMPVFFLVCGLRTNIFTITDGDTSIFTALALILLACSAKIIAALVASC  1600
             ++++LEDFV G+L+P+FF + GL+TNI +I  G  +  T + +I LAC+ K+I  ++ + 
Sbjct  310   LIEKLEDFVSGLLLPLFFAISGLKTNIASI-QGPATWLTLMLVIFLACAGKVIGTVIVAF  368

Query  1599  YTGMSTNEAIGLGVLTNTKSTMVMIILEVGqvqqvlsvqqysmmvVACLIMTIVATPLAA  1420
             + GM   E I LG+L NTK  + MI+L VG+ Q+VL  + ++ MV+  L+MT V TP+  
Sbjct  369   FHGMPVREGITLGLLLNTKGLVEMIVLNVGKDQKVLDDETFATMVLVALVMTGVITPIVT  428

Query  1419  -RYCPKQDLEPYKRRTIQNAKPGEELRILACIHGTNNLPAIISLLETSNSTVTSPITAFG  1243
               Y P +    YKRRTIQ  KP  ELR+L C+H   N+P II+LLE S+ T  SPI  + 
Sbjct  429   ILYRPVKRSVSYKRRTIQQTKPDSELRVLVCVHTPRNVPTIINLLEASHPTKRSPICIYI  488

Query  1242  VQLLELVGRAPAMMvvhssgsgrhvggsHEEVQTSQIISTFDNYELRSHGVTAQVLTARW  1063
             + L+EL GRA AM++VH++        +  + Q+  II+ F+NYE  +  V  Q LTA  
Sbjct  489   LHLVELTGRASAMLIVHNTRKSGRPALNRTQAQSDHIINAFENYEQHAAFVAVQPLTAIS  548

Query  1062  SYDTMAEDICKMAKEKRAAFLVLPFHKQQGTDGEMEDTNPAIQTVNEGVLLSAPCSVGIL  883
              Y TM ED+C +A++KR +F+++PFHKQQ  DG ME TNPA + VN+ +L ++PCSVGIL
Sbjct  549   PYSTMHEDVCSLAEDKRVSFIIIPFHKQQTVDGGMEATNPAYRLVNQNLLENSPCSVGIL  608

Query  882   VERG-------RPNQYAKNIAVLYLGGPDDREALTYARRMSGLPGVHLTVIRFVPAKDVS  724
             V+RG         N  +  +AVLY GGPDDREAL YA RM+  PG+ LTV+RF+P +DV+
Sbjct  609   VDRGLNGATRLTSNTISLQVAVLYFGGPDDREALAYAWRMAEHPGITLTVLRFIPDEDVT  668

Query  723   ADGAVEDPDLELELTRETSFVTVSIDPARDKEEDEELLNNFRTETAEDDSKTFMELVLDD  544
             +D                    + +D  + ++ D+E +N FR E A+ +S  ++E ++ +
Sbjct  669   SD------------------TNLKVDLKKQRQLDDEYINAFRVENADQESIVYIEKIVSN  710

Query  543   EEEFTKAVKSLDDRSFDLYVAGRGRGVSSALTSGLADWCECPELGAVGDllvtsefessf  364
              EE   AV+S+D  S DL++ GRG G+SS LT+GL DW ECPELGA+GDLL +S+F ++ 
Sbjct  711   GEETVAAVRSMDS-SHDLFIVGRGEGMSSPLTAGLTDWSECPELGAIGDLLASSDFAATV  769

Query  363   svlvVQQYV  337
             SVLVVQQY+
Sbjct  770   SVLVVQQYL  778



>ref|XP_011023089.1| PREDICTED: cation/H(+) antiporter 15 [Populus euphratica]
Length=826

 Score =   612 bits (1577),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/791 (44%), Positives = 520/791 (66%), Gaps = 32/791 (4%)
 Frame = -3

Query  2664  QVVMCFSQTIYRSNGVWEGPDPLAPMIPLFILQIMTAILSSRILNFVLKPFNQPPLVAEI  2485
             + ++C++ T+  +NG+W+G +PL   +PLFILQ+   ++++R+L ++LKP  QP +++EI
Sbjct  14    ETIVCYAPTMITTNGIWQGDNPLDYSLPLFILQLTLVVVTTRLLVYILKPLRQPRVISEI  73

Query  2484  LSGIILGPSMLGNIEEFRKHNFPNHNFETIETMGHFALVLYAFLTGLQMDVKAIVHTGTK  2305
             L G+ILGPS+LG  + F    FP  +   +ETM +  L+ + FL G++MD+  I  TG K
Sbjct  74    LGGVILGPSVLGRSKAFANTIFPLRSVMVLETMANMGLLYFLFLVGVEMDISVIKRTGKK  133

Query  2304  SRIVAVSGSIFPFLIGAGFYFTLQTDTQSM---IGFIFCGSALTVTGFSTLAKILDSKRL  2134
             +  +A+ G IFPF IG  F F L  D+QS+      +F G AL+VT F  LA++L   +L
Sbjct  134   AIAIAIGGMIFPFFIGLAFSFALHKDSQSLNQGTFVLFLGVALSVTAFPVLARVLAEIKL  193

Query  2133  LNTEIGKIAASSALINVALSWVLLTIGLLF----TGSLDNVQWAvlctvgfvvvcvnyVR  1966
             +NTEIG+IA S+ALIN   +W+LL + +      + SL  + W +L ++ FV++C+  +R
Sbjct  194   INTEIGRIAMSAALINDICAWILLALAITLAENKSTSLATL-WVILSSLTFVLICIYVIR  252

Query  1965  PLLNWLISKTPEGQGFSEFYICSFIAVICAFGCFTDAMGSHPMIGAFIFGLIMPNNELLR  1786
             P+++W+IS TPEG+  SEFYIC  +  +   G  TDA+G+H + GAF+FGLI+PN  L  
Sbjct  253   PVISWMISSTPEGETISEFYICLILTGVMISGFITDAIGTHSVFGAFVFGLIIPNGPLGV  312

Query  1785  TAILDRLEDFVMGILMPVFFLVCGLRTNIFTITDGDTSIFTALALILLACSAKIIAALVA  1606
             T ++++LEDFV G+L+P+FF + GL+T+I  I +G  +    + +I++  + K++  ++A
Sbjct  313   T-LIEKLEDFVSGLLLPIFFAMSGLKTDIGAI-NGVATWLILILVIIIGFAGKVVGTVLA  370

Query  1605  SCYTGMSTNEAIGLGVLTNTKSTMVMIILEVGqvqqvlsvqqysmmvVACLIMTIVATP-  1429
             S    M   E I LG L N+K  + MI+L VG+ Q+VL  + ++MMV+  +IMT +  P 
Sbjct  371   SMLYQMPLLEGITLGFLMNSKGLVEMIVLNVGREQKVLDDESFAMMVIVAVIMTAIIIPS  430

Query  1428  LAARYCPKQDLEPYKRRTIQNAKPGEELRILACIHGTNNLPAIISLLETSNSTVTSPITA  1249
             + A Y P++   PY RRTIQ +K   E R LAC+H   N+P II++LE S+    SP+  
Sbjct  431   VTAIYRPEKRFLPYTRRTIQRSKRDAEFRALACVHTPRNVPTIINILEASHPNKRSPMCV  490

Query  1248  FGVQLLELVGRAPAMMvvhssgsgrhvggsHEEVQTSQIISTFDNYELRSHGVTAQVLTA  1069
             + V L+EL GRA AM++VH++    H   +  + Q+  II+ FDNYE  +  V+ Q LTA
Sbjct  491   YVVHLVELTGRASAMLIVHNTRKSGHPALNRTQAQSDHIINAFDNYEQNAVCVSVQPLTA  550

Query  1068  RWSYDTMAEDICKMAKEKRAAFLVLPFHKQQGTDGEMEDTNPAIQTVNEGVLLSAPCSVG  889
                Y TM  DIC +A++KR A ++LPFHKQQ  DG ME TNPAI+ VN+ VL +APCSVG
Sbjct  551   ISPYSTMHVDICNLAEDKRVALIILPFHKQQTVDGGMEATNPAIRMVNQNVLANAPCSVG  610

Query  888   ILVERG-------RPNQYAKNIAVLYLGGPDDREALTYARRMSGLPGVHLTVIRFVPAKD  730
             ILV+RG         NQ A ++AVLY GGPDDREAL+YA RMS  P ++LTV+RFVP +D
Sbjct  611   ILVDRGLSGSTRLASNQAAHHVAVLYFGGPDDREALSYAWRMSEHPAINLTVMRFVPGED  670

Query  729   VSADGAVEDPDLELELTRETSFVTVSIDPARDKEEDEELLNNFRTETAEDDSKTFMELVL  550
                  A+++P +          ++V  +  ++K+ DEE +N FRT+TA + S  + E+V+
Sbjct  671   AK---ALDNPGM----------LSVETENLKEKQLDEEHVNEFRTQTAHNGSIFYNEIVV  717

Query  549   DDEEEFTKAVKSLDDRSFDLYVAGRGRGVSSALTSGLADWCECPELGAVGDllvtsefes  370
              + EE   A++S+D+   DL++ GRG+G+ S LT+GL DW ECPELGA+GDLL +S+F +
Sbjct  718   SNGEETVAAIRSMDNHH-DLFIVGRGQGMISPLTAGLTDWSECPELGAIGDLLASSDFAA  776

Query  369   sfsvlvVQQYV  337
             + SVLV+QQYV
Sbjct  777   TVSVLVLQQYV  787



>gb|KDP39397.1| hypothetical protein JCGZ_03679 [Jatropha curcas]
Length=831

 Score =   611 bits (1576),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 343/791 (43%), Positives = 516/791 (65%), Gaps = 27/791 (3%)
 Frame = -3

Query  2658  VMCFSQTIYRSNGVWEGPDPLAPMIPLFILQIMTAILSSRILNFVLKPFNQPPLVAEILS  2479
             ++C++ T+  +NGVW+G +PL   +PLFILQ+   ++++R+L F+LKPF QP +++EI+ 
Sbjct  15    IVCYAPTMITTNGVWQGDNPLDYSLPLFILQLTLVVVTTRVLVFLLKPFRQPRVISEIMG  74

Query  2478  GIILGPSMLGNIEEFRKHNFPNHNFETIETMGHFALVLYAFLTGLQMDVKAIVHTGTKSR  2299
             G+ILGPS+LG  + F    FP  +   +ETM +  L+ + FL G++MD+  I  TG K+ 
Sbjct  75    GVILGPSVLGRNKAFASTLFPLRSVMVLETMANVGLLYFLFLVGVEMDISVIRRTGKKAF  134

Query  2298  IVAVSGSIFPFLIGAGFYFTLQTDTQSM---IGFIFCGSALTVTGFSTLAKILDSKRLLN  2128
              +A++G I PF  G  F + +  +   M      +F G AL+VT F  LA++L   +L+N
Sbjct  135   AIAIAGMILPFFTGLAFSYLMHREAHDMNKGTFILFLGVALSVTAFPVLARVLAELKLIN  194

Query  2127  TEIGKIAASSALINVALSWVLLTIGLLF----TGSLDNVQWAvlctvgfvvvcvnyVRPL  1960
             TE+G++A SSALIN   +W+LL   +      + SL +  + +L +  FVV+CV  VRP 
Sbjct  195   TELGRVAMSSALINDICAWILLCFAIALAENDSASLASF-YVILSSGAFVVLCVYAVRPA  253

Query  1959  LNWLISKTPEGQGFSEFYICSFIAVICAFGCFTDAMGSHPMIGAFIFGLIMPNNELLRTA  1780
             ++W+I +TPEG+ FS+FYIC  +  +   G  TDA+G+H + GAF+FGLI+PN  L  T 
Sbjct  254   ISWIIRRTPEGETFSDFYICLILTGVMISGFITDAIGTHSVFGAFVFGLIIPNGPLGVT-  312

Query  1779  ILDRLEDFVMGILMPVFFLVCGLRTNIFTITDGDTSIFTALALILLACSAKIIAALVASC  1600
             ++++LEDFV G+L+P+FF + GL+TN+  I    T    AL +I L  + K+   L+ + 
Sbjct  313   LIEKLEDFVSGLLLPLFFAMSGLKTNVGAIEGAATWGLLAL-VIFLGSAGKVAGTLIVTT  371

Query  1599  YTGMSTNEAIGLGVLTNTKSTMVMIILEVGqvqqvlsvqqysmmvVACLIMTIVATPLA-  1423
             +  M   E + LG+L NTK  + MIIL VG+ Q+VL  + +++MV+  ++MT + TP+  
Sbjct  372   FYQMPIREGLTLGLLMNTKGLIEMIILNVGKDQRVLDDESFAIMVIVAVVMTGLVTPIVT  431

Query  1422  ARYCPKQDLEPYKRRTIQNAKPGEELRILACIHGTNNLPAIISLLETSNSTVTSPITAFG  1243
             A Y P +   PYKRRTIQ +KP  ELRIL C+H   N+P II+LLE SN T  SP+  + 
Sbjct  432   AIYRPTRKFVPYKRRTIQRSKPDAELRILVCVHTPRNVPTIINLLEASNPTKRSPMCVYV  491

Query  1242  VQLLELVGRAPAMMvvhssgsgrhvggsHEEVQTSQIISTFDNYELRSHGVTAQVLTARW  1063
             + L+EL GRA AM++VH++        +  + Q+  II+ F+NYE  +  V  Q LTA  
Sbjct  492   LHLVELTGRASAMLIVHNTRKSGRPALNRTQAQSDHIINAFENYEQHAVCVNVQPLTAIS  551

Query  1062  SYDTMAEDICKMAKEKRAAFLVLPFHKQQGTDGEMEDTNPAIQTVNEGVLLSAPCSVGIL  883
              Y TM ED+C +A++KR AF+V+PFHKQQ  DG ME TNPA + VN+ +L +APCSVGIL
Sbjct  552   PYSTMHEDVCNLAEDKRVAFIVIPFHKQQTVDGGMEATNPAFRMVNQNLLANAPCSVGIL  611

Query  882   VERG-------RPNQYAKNIAVLYLGGPDDREALTYARRMSGLPGVHLTVIRFVPAKDVS  724
             V+RG         NQ   +IAV++ GGPDDREAL+YA RMS  PG++LT++RF+P +D +
Sbjct  612   VDRGLSGSTRLATNQLCHHIAVIFFGGPDDREALSYAWRMSDHPGINLTILRFIPGEDAA  671

Query  723   --ADGAVEDPDLELELTRETSFVTVSIDPARDKEEDEELLNNFRTETAEDDSKTFMELVL  550
               A  +  DP+       +   +TV  +  R+K+ DEE +N FR  TA D+S  + E+++
Sbjct  672   QPARQSPGDPN-------DPRILTVETEDQREKQLDEEFINEFRMHTANDESVFYTEIIV  724

Query  549   DDEEEFTKAVKSLDDRSFDLYVAGRGRGVSSALTSGLADWCECPELGAVGDllvtsefes  370
             ++ EE   +++++D  + DL++ GRG+G+ S LT+GL DW ECPELGA+GDLL +++F +
Sbjct  725   NNGEETVASIRAMDINAHDLFIVGRGQGMISPLTAGLTDWSECPELGAIGDLLASADFAA  784

Query  369   sfsvlvVQQYV  337
             + SVLV+QQYV
Sbjct  785   TVSVLVIQQYV  795



>ref|XP_008461025.1| PREDICTED: cation/H(+) antiporter 15 [Cucumis melo]
Length=837

 Score =   611 bits (1576),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 355/789 (45%), Positives = 512/789 (65%), Gaps = 29/789 (4%)
 Frame = -3

Query  2658  VMCFSQTIYRSNGVWEGPDPLAPMIPLFILQIMTAILSSRILNFVLKPFNQPPLVAEILS  2479
             ++C++ T+  +NGVW+G +PL   +PLFILQ+   ++ +RIL F+LKPF QP +++EIL 
Sbjct  15    IVCYAPTMITTNGVWQGDNPLDYSLPLFILQLTMVVVMTRILVFLLKPFRQPRVISEILG  74

Query  2478  GIILGPSMLGNIEEFRKHNFPNHNFETIETMGHFALVLYAFLTGLQMDVKAIVHTGTKSR  2299
             G+ILGPS+LG    F    FP  +   +ETM +  L+ + FL G++MD+  I  TG K+ 
Sbjct  75    GVILGPSVLGRSSRFANTVFPLRSVMVLETMANVGLLYFLFLVGVEMDLSVIRRTGKKAM  134

Query  2298  IVAVSGSIFPFLIGAGFYFTLQTDTQSM---IGFIFCGSALTVTGFSTLAKILDSKRLLN  2128
              +AV+G I PF IGA F F L  + Q +      +F G AL+VT F  LA+IL   +L+N
Sbjct  135   AIAVAGMILPFGIGAAFSFQLHKEGQKLNYNTYIMFLGIALSVTAFPVLARILAELKLIN  194

Query  2127  TEIGKIAASSALINVALSWVLLTIGLLF----TGSLDNVQWAvlctvgfvvvcvnyVRPL  1960
             +E+G++A +SAL N   +WVLL + +      + SL ++ W VL + GFV+ C+  VRP+
Sbjct  195   SELGRMAMASALFNDMCAWVLLALAIALSENDSSSLASL-WVVLSSAGFVLFCIFIVRPM  253

Query  1959  LNWLISKTPEGQGFSEFYICSFIAVICAFGCFTDAMGSHPMIGAFIFGLIMPNNELLRTA  1780
             ++W+I KTPEG+  SEFYIC  +  +   G  TDA+G+H + GAF+FGL++PN   L  A
Sbjct  254   ISWMIRKTPEGESVSEFYICLILTGVMISGFVTDAIGTHSVFGAFVFGLVIPNGS-LGVA  312

Query  1779  ILDRLEDFVMGILMPVFFLVCGLRTNIFTITDGDTSIFTALALILLACSAKIIAALVASC  1600
             ++++LEDFV G+L+P+FF + GL+TN+ ++ DG  +  + L + LLA   K+I  L+AS 
Sbjct  313   LIEKLEDFVSGLLLPLFFAISGLKTNVSSV-DGLFAWISILCITLLAFVGKVIGTLLASI  371

Query  1599  YTGMSTNEAIGLGVLTNTKSTMVMIILEVGqvqqvlsvqqysmmvVACLIMTIVATPLAA  1420
                MS  E + LG+L NTK  + MIIL VG+ Q+VL  Q +++MV+  LIMT + TP+  
Sbjct  372   CYQMSYREGVTLGLLMNTKGLIEMIILNVGKDQKVLDDQTFTVMVIVALIMTGIITPVVT  431

Query  1419  -RYCPKQDLEPYKRRTIQNAKPGEELRILACIHGTNNLPAIISLLETSNSTVTSPITAFG  1243
               Y P +   PYK+RTIQ +KP  E R+L C+H   N+P IISLL+ S+ T  SPI  + 
Sbjct  432   IIYRPTRRFLPYKKRTIQASKPDSEFRVLVCVHTPRNVPTIISLLDASHPTKRSPICIYV  491

Query  1242  VQLLELVGRAPAMMvvhssgsgrhvggsHEEVQTSQIISTFDNYELRSHGVTAQVLTARW  1063
             + L+EL GRA AM++VH++        +  + Q+  II+ F+NYE     V+ Q LTA  
Sbjct  492   LHLVELTGRASAMLIVHNTRKSGRPALNRTQAQSDHIINAFENYEQHVDCVSVQPLTAIS  551

Query  1062  SYDTMAEDICKMAKEKRAAFLVLPFHKQQGTDGEMEDTNPAIQTVNEGVLLSAPCSVGIL  883
              Y TM EDIC +A++KR AF+++PFHKQQ  DG ME TNPA + VN+ VL +APCSVGIL
Sbjct  552   PYSTMHEDICNLAEDKRVAFIIIPFHKQQTVDGGMEATNPAFRLVNQNVLANAPCSVGIL  611

Query  882   VERGR--PNQYAK------NIAVLYLGGPDDREALTYARRMSGLPGVHLTVIRFVPAKDV  727
             V+RG    N+ A       NI VL+ GG DDREAL+YA RMS  PGV+LTV+RF+ A+++
Sbjct  612   VDRGLNGANRVASNKATHYNIIVLFFGGQDDREALSYAWRMSEHPGVNLTVMRFIAAQEI  671

Query  726   SADGAVEDPDLELELTRETSFVTVSIDPARDKEEDEELLNNFRTETAEDDSKTFMELVLD  547
                    +P  E    R +   T+  +  RD++ DE+ +N FR      +S T+ E VL+
Sbjct  672   M------EPKPEESTPRIS---TMETEIKRDRKLDEDYINEFRARNPNSESITYTEKVLN  722

Query  546   DEEEFTKAVKSLDDRSFDLYVAGRGRGVSSALTSGLADWCECPELGAVGDllvtsefess  367
             + EE   A++S+DD + DL++ GRG    S LT+GL DW ECPELGA+GDLL +S+F ++
Sbjct  723   NGEETVAAIRSMDD-AHDLFIVGRGESHISPLTAGLTDWSECPELGAIGDLLASSDFAAT  781

Query  366   fsvlvVQQY  340
              SVLVVQQ+
Sbjct  782   TSVLVVQQF  790



>emb|CBI37527.3| unnamed protein product [Vitis vinifera]
Length=820

 Score =   610 bits (1573),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 351/796 (44%), Positives = 516/796 (65%), Gaps = 41/796 (5%)
 Frame = -3

Query  2679  LDRLGQVVMCFSQTIYRSNGVWEGPDPLAPMIPLFILQIMTAILSSRILNFVLKPFNQPP  2500
             ++R   +++C+S T+  +NG+W+G +PL   +PLFILQ+   ++++R+L F+LKP  QP 
Sbjct  8     VNRTDDMIVCYSPTMITTNGIWQGDNPLDYSLPLFILQLTLVVVTTRLLVFILKPLRQPR  67

Query  2499  LVAEILSGIILGPSMLGNIEEFRKHNFPNHNFETIETMGHFALVLYAFLTGLQMDVKAIV  2320
             +++EIL G++LGPS+LG         FP  +   +ETM +  L+ + FL G++MD+  I 
Sbjct  68    VISEILGGVLLGPSVLGQNLHLANLIFPLRSVMVLETMANVGLLYFLFLVGVEMDLTVIR  127

Query  2319  HTGTKSRIVAVSGSIFPFLIGAGFYFTLQTDTQSM---IGFIFCGSALTVTGFSTLAKIL  2149
              TG K+  +A+ G I PF+IG  F   L  + + M      +F G AL+VT F  LA+IL
Sbjct  128   RTGKKAIAIAIIGMILPFIIGCAFSLILHHEDRQMNRSTFVLFLGVALSVTAFPVLARIL  187

Query  2148  DSKRLLNTEIGKIAASSALINVALSWVLLTIGLLF----TGSLDNVQWAvlctvgfvvvc  1981
                +L+NTE+G++A SSALIN   +WVLL + +      + SL ++ W +L +V FVVVC
Sbjct  188   AELKLINTELGRMAMSSALINDMCAWVLLAVAIALAENESSSLASL-WVILSSVFFVVVC  246

Query  1980  vnyVRPLLNWLISKTPEGQGFSEFYICSFIAVICAFGCFTDAMGSHPMIGAFIFGLIMPN  1801
             +  VRP+++W+I +TPEG+ FSEFYIC  +  +   G  TDA+G+H + GAF+FGL++PN
Sbjct  247   IFIVRPVISWMIRRTPEGESFSEFYICLILTGVMISGFVTDAIGTHSVFGAFVFGLVIPN  306

Query  1800  NELLRTAILDRLEDFVMGILMPVFFLVCGLRTNIFTITDGDTSIFTALALILLACSAKII  1621
              +L  T ++++LEDFV G+L+P+FF + GL+T++  I    T  F  L +I+LAC+ KI 
Sbjct  307   GQLGVT-LIEKLEDFVSGLLLPLFFAISGLKTDVTKIHGALTWGFLFL-VIILACAGKIA  364

Query  1620  AALVASCYTGMSTNEAIGLGVLTNTKSTMVMIILEVGqvqqvlsvqqysmmvVACLIMTI  1441
               L+ + +  M   E I LG+L NTK  + MI+L VG+ Q VL  + +++MV   +IMT 
Sbjct  365   GTLIVALFYQMPLREGIVLGLLMNTKGLVEMIVLNVGRDQHVLDDETFAIMVTVAVIMTS  424

Query  1440  VATPLAAR-YCPKQDLEPYKRRTIQNAKPGEELRILACIHGTNNLPAIISLLETSNSTVT  1264
             +  P+    Y P +   PYKRRTIQ +KP  ELRIL CIH   N+P II+LLE S+ +  
Sbjct  425   IIAPIVTHIYKPARKFIPYKRRTIQRSKPDGELRILVCIHTPRNVPTIINLLEASHPSKK  484

Query  1263  SPITAFGVQLLELVGRAPAMMvvhssgsgrhvggsHEEVQTSQIISTFDNYELRSHGVTA  1084
             SPI  + + L+EL GRA AM++VH++        +  + Q+  II+ F+NYE  S  V+ 
Sbjct  485   SPICVYVLHLVELTGRASAMLIVHNTRKSGCPALNRTQAQSDHIINAFENYEQHSSCVSV  544

Query  1083  QVLTARWSYDTMAEDICKMAKEKRAAFLVLPFHKQQGTDGEMEDTNPAIQTVNEGVLLSA  904
             Q LTA   Y TM EDIC +A++KR AF+++PFHKQQ  DG ME TNPA + VN+ VL +A
Sbjct  545   QPLTAISPYSTMHEDICNLAEDKRVAFIIIPFHKQQTVDGGMEATNPAFRAVNQNVLANA  604

Query  903   PCSVGILVERG-------RPNQYAKNIAVLYLGGPDDREALTYARRMSGLPGVHLTVIRF  745
             PCSVGILV+RG         +Q + +IAVL+ GGPDDREAL+YA RMS  PG+ LTV+RF
Sbjct  605   PCSVGILVDRGLNGSTRLAASQVSHHIAVLFFGGPDDREALSYAERMSEHPGISLTVMRF  664

Query  744   VPAKDVSADGAVEDPDLELELTRETSFVTVSIDPARDKEEDEELLNNFRTETAEDDSKTF  565
                  ++ D  VE                 +++P++ K+ DEE +N+FR + + D+S  +
Sbjct  665   -----IAGDETVES----------------TVEPSK-KQLDEEYINDFRMKNSNDESIVY  702

Query  564   MELVLDDEEEFTKAVKSLDDRSFDLYVAGRGRGVSSALTSGLADWCECPELGAVGDllvt  385
              E ++++ EE   AV+S+D    DL++ GRG+G+ S LT+GL DW ECPELGA+GD+L +
Sbjct  703   TEKIVNNGEETVAAVRSIDS-IHDLFIVGRGQGMISPLTAGLTDWSECPELGAIGDMLAS  761

Query  384   sefessfsvlvVQQYV  337
             S+F S+ SVLVVQQYV
Sbjct  762   SDFASTVSVLVVQQYV  777



>ref|XP_010273345.1| PREDICTED: cation/H(+) antiporter 15-like [Nelumbo nucifera]
Length=837

 Score =   610 bits (1574),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/805 (42%), Positives = 518/805 (64%), Gaps = 31/805 (4%)
 Frame = -3

Query  2700  STGPEVDLDRLGQVVMCFSQTIYRSNGVWEGPDPLAPMIPLFILQIMTAILSSRILNFVL  2521
             + GP   +++   +++C+S T+  ++G+W+G +PL   +PLFILQ+   ++++R+L F+L
Sbjct  11    AVGP---MNKTEDLIVCYSPTMITTSGIWQGDNPLDYSLPLFILQLTLVVITTRVLVFIL  67

Query  2520  KPFNQPPLVAEILSGIILGPSMLGNIEEFRKHNFPNHNFETIETMGHFALVLYAFLTGLQ  2341
             +PF QP +++EIL G++LGPS+LG   +F    FP  +   +ETM +  L+ + FL G++
Sbjct  68    RPFRQPRVISEILGGVLLGPSVLGRSSKFANAVFPLRSVMVLETMANVGLLYFLFLVGVE  127

Query  2340  MDVKAIVHTGTKSRIVAVSGSIFPFLIGAGFYFTL-----QTDTQSMIGFIFCGSALTVT  2176
             MD+  I  TG K+  +A++G I PF+IGA F F L     QT    +   +F G AL+VT
Sbjct  128   MDLTVIRRTGKKALFIALAGMILPFIIGAAFSFFLLEIKEQTTVNHVTYLLFLGVALSVT  187

Query  2175  GFSTLAKILDSKRLLNTEIGKIAASSALINVALSWVLLTIGLLF----TGSLDNVQWAvl  2008
              F  LA++L   +LLNTEIG+IA S+A+IN   +W+LL + +        SL ++ W ++
Sbjct  188   AFPVLARVLAELKLLNTEIGRIAMSAAIINDISAWILLAVAIAVAETDAASLASL-WVIV  246

Query  2007  ctvgfvvvcvnyVRPLLNWLISKTPEGQGFSEFYICSFIAVICAFGCFTDAMGSHPMIGA  1828
              T  +V+VC+  VRP ++W+I +TPEG+ F++ YIC  +  +   G  TDA+G+H + GA
Sbjct  247   STAMYVLVCIFLVRPAISWIIRRTPEGENFNDVYICLILTGVMICGFITDAIGTHSIFGA  306

Query  1827  FIFGLIMPNNELLRTAILDRLEDFVMGILMPVFFLVCGLRTNIFTITDGDTSIFTALALI  1648
             F+FGL++PN   L  A++++LEDFV G+L+P+FF + GLRT+I +I  G ++    + +I
Sbjct  307   FVFGLVIPNGP-LGAALIEKLEDFVSGLLLPLFFAISGLRTDIASI-HGSSTWAVLMVII  364

Query  1647  LLACSAKIIAALVASCYTGMSTNEAIGLGVLTNTKSTMVMIILEVGqvqqvlsvqqysmm  1468
              L C+ K+    + + +  M   + I LG+L N K  + MI+L VG+ Q+V+  Q +++M
Sbjct  365   ALGCAGKVFGTALVAFFYDMPIRDGIALGLLMNAKGLVEMIVLNVGKDQKVIDDQSFALM  424

Query  1467  vVACLIMTIVATPLAAR-YCPKQDLEPYKRRTIQNAKPGEELRILACIHGTNNLPAIISL  1291
             VV  ++MT V TP+    Y P +   PYKRRTIQ +K   E RIL+CIH   N+P +I+L
Sbjct  425   VVVAVLMTSVITPVVTMIYKPARRFVPYKRRTIQRSKLDGEFRILSCIHTPRNVPTMINL  484

Query  1290  LETSNSTVTSPITAFGVQLLELVGRAPAMMvvhssgsgrhvggsHEEVQTSQIISTFDNY  1111
             LE S+ +  SPI  + + L+EL GRA AM++VH++    H   +  + Q+  II+ F+NY
Sbjct  485   LEASHPSKRSPICVYALHLVELTGRASAMLIVHNTRKTGHPALNRTQAQSDHIINAFENY  544

Query  1110  ELRSHGVTAQVLTARWSYDTMAEDICKMAKEKRAAFLVLPFHKQQGTDGEMEDTNPAIQT  931
             E  S  V+ Q LTA   Y TM EDIC +A++KR AF++LPFHKQQ  DG ME  NPA + 
Sbjct  545   EQHSGSVSVQPLTAISPYSTMHEDICNLAEDKRVAFIILPFHKQQTVDGGMEAINPACRN  604

Query  930   VNEGVLLSAPCSVGILVERG-------RPNQYAKNIAVLYLGGPDDREALTYARRMSGLP  772
             VN+ VL +APC+VGILV+RG          Q + +IA+L+ GGPDDREAL YA RMS  P
Sbjct  605   VNQNVLANAPCTVGILVDRGLGGASRAAAGQTSHHIAILFFGGPDDREALAYAWRMSEHP  664

Query  771   GVHLTVIRFVPAKDVSADGAVEDPDLE-LELTRETSFVTVSIDPARDKEEDEELLNNFRT  595
             G+ LTVIRF+P ++        DP +E    T +   +TV  D  +++  D+E +N FR 
Sbjct  665   GIILTVIRFIPGENAV------DPLVEPASDTHDIKILTVITDSEKERHLDDEYVNEFRM  718

Query  594   ETAEDDSKTFMELVLDDEEEFTKAVKSLDDRSFDLYVAGRGRGVSSALTSGLADWCECPE  415
             +   ++S T+ E + ++ EE    ++S+D+   DLY+ GRG+G+ S LT+GL DW ECPE
Sbjct  719   KNMHNESITYTEKICNNGEETVAVIRSMDNMH-DLYIVGRGQGMVSPLTAGLTDWSECPE  777

Query  414   LGAVGDllvtsefessfsvlvVQQY  340
             LGA+GDLL +S+F  + SVLV+QQY
Sbjct  778   LGAIGDLLASSDFALTVSVLVMQQY  802



>ref|XP_009616485.1| PREDICTED: cation/H(+) antiporter 15-like [Nicotiana tomentosiformis]
Length=841

 Score =   610 bits (1573),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/790 (44%), Positives = 506/790 (64%), Gaps = 24/790 (3%)
 Frame = -3

Query  2658  VMCFSQTIYRSNGVWEGPDPLAPMIPLFILQIMTAILSSRILNFVLKPFNQPPLVAEILS  2479
             ++C++ T+  +NG+W+G +PL   +PLFILQ+   ++ +RIL F+LKPF QP ++AEIL 
Sbjct  16    IVCYAPTMITTNGIWQGENPLDYSLPLFILQLTLVVVMTRILVFILKPFRQPRVIAEILG  75

Query  2478  GIILGPSMLGNIEEFRKHNFPNHNFETIETMGHFALVLYAFLTGLQMDVKAIVHTGTKSR  2299
             G+ILGPS+LG  ++F    FP  +   +ETM +  L+ + FL G++MD+  I  TG K+ 
Sbjct  76    GVILGPSVLGRSKKFADTIFPLRSVMVLETMANIGLLYFLFLVGVEMDIAVIRRTGKKAI  135

Query  2298  IVAVSGSIFPFLIGAGFYFTLQT---DTQSMIGFIFCGSALTVTGFSTLAKILDSKRLLN  2128
              +A++G + PFLIG  F F L     DT+     +F G AL+VT F  LA+IL   +L+N
Sbjct  136   PIALAGMVVPFLIGVSFSFMLHKSSQDTKQGTFILFLGVALSVTAFPVLARILAELKLIN  195

Query  2127  TEIGKIAASSALINVALSWVLLTIGLLFTGSLDNVQ---WAvlctvgfvvvcvnyVRPLL  1957
             TEIG+IA S+ALIN   +WVLL   + F+ + +      W +L +  FVV CV  VRPL+
Sbjct  196   TEIGRIAMSAALINDIFAWVLLAFAIAFSENHNMALASIWVILSSAAFVVFCVIIVRPLV  255

Query  1956  NWLISKTPEGQGFSEFYICSFIAVICAFGCFTDAMGSHPMIGAFIFGLIMPNNELLRTAI  1777
              W+I +TPEG+  SEF IC  +  +   G  TDA+G+H + GAFIFGL++PN  L  T +
Sbjct  256   GWMIRRTPEGESISEFSICLILTGVMICGFITDAIGTHSIFGAFIFGLVIPNGPLGVT-L  314

Query  1776  LDRLEDFVMGILMPVFFLVCGLRTNIFTITDGDTSIFTALALILLACSAKIIAALVASCY  1597
             ++RLEDFV G+L+P+FF + GL+T I  I    T    AL +I+LAC+ KI   ++ + Y
Sbjct  315   IERLEDFVSGLLLPLFFAISGLKTEISAIDGVGTWAILAL-VIVLACAGKIAGTVLVTLY  373

Query  1596  TGMSTNEAIGLGVLTNTKSTMVMIILEVGqvqqvlsvqqysmmvVACLIMTIVATPLAA-  1420
               M   E + LG+L N K  + MI++ VG+ Q+VL  + +++MV+  ++MT    P+   
Sbjct  374   YRMPFYEGVTLGLLMNAKGLIEMIVINVGKDQKVLDDKSFAIMVMVAVLMTACIIPIVTI  433

Query  1419  RYCPKQDLEPYKRRTIQNAKPGEELRILACIHGTNNLPAIISLLETSNSTVTSPITAFGV  1240
              Y P +   PYKRRT+Q+ KP  E R+L CIH   N+P II++LE S  T  SPI  + +
Sbjct  434   IYKPARKFVPYKRRTVQSTKPDSEFRVLVCIHTPRNVPTIINILEASYPTKKSPIGIYVL  493

Query  1239  QLLELVGRAPAMMvvhssgsgrhvggsHEEVQTSQIISTFDNYELRSHGVTAQVLTARWS  1060
              L+EL GR+ AM++VH++        +  + Q+  II+ F+N+E     V+ Q LTA   
Sbjct  494   HLVELTGRSSAMLIVHNTRKSGRPALNRTQAQSDHIINAFENFEQHVGCVSVQPLTAISP  553

Query  1059  YDTMAEDICKMAKEKRAAFLVLPFHKQQGTDGEMEDTNPAIQTVNEGVLLSAPCSVGILV  880
             Y TM EDIC +A++KR A L++PFHKQQ  DG ME TNPA +T+N+ VL +APCSVGILV
Sbjct  554   YSTMHEDICTVAEDKRVALLIVPFHKQQTVDGGMEVTNPAFRTINQNVLANAPCSVGILV  613

Query  879   ERG-------RPNQYAKNIAVLYLGGPDDREALTYARRMSGLPGVHLTVIRFVPAKDVSA  721
             +RG         NQ + ++AVL+ GGPDDREAL+Y  RM   PG++LTV+RF+P      
Sbjct  614   DRGLSGSTRLAANQVSHHVAVLFFGGPDDREALSYGLRMREHPGINLTVMRFLP-----G  668

Query  720   DGAVE--DPDLELELTRETSFVTVSIDPARDKEEDEELLNNFRTETAEDDSKTFMELVLD  547
             + A+E    D       +   +TV  D  R+K+ DE+ ++ FR  T+ DDS  ++E V++
Sbjct  669   EAAIEATRSDSRKSSMNDPGVLTVVTDDDREKQLDEDYVSEFRARTSNDDSVVYIERVVN  728

Query  546   DEEEFTKAVKSLDDRSFDLYVAGRGRGVSSALTSGLADWCECPELGAVGDllvtsefess  367
               EE   A++++D+ S DL++ GRG+G  S LT+GL DW ECPELGA+GDLL +S+  S+
Sbjct  729   HGEETVAAIRTIDN-SHDLFIVGRGQGTISPLTAGLTDWSECPELGAIGDLLASSDSASA  787

Query  366   fsvlvVQQYV  337
              SVLVVQQYV
Sbjct  788   VSVLVVQQYV  797



>ref|XP_010527098.1| PREDICTED: cation/H(+) antiporter 15 [Tarenaya hassleriana]
Length=834

 Score =   610 bits (1572),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 338/786 (43%), Positives = 509/786 (65%), Gaps = 22/786 (3%)
 Frame = -3

Query  2658  VMCFSQTIYRSNGVWEGPDPLAPMIPLFILQIMTAILSSRILNFVLKPFNQPPLVAEILS  2479
             ++C++ ++  +NGVW+G +PL   +PLFILQ+   +L++RI  ++L+PF QP ++AEIL 
Sbjct  17    IICYAPSMITTNGVWQGDNPLDFSLPLFILQLTLVVLTTRIFVYILRPFRQPRVIAEILG  76

Query  2478  GIILGPSMLGNIEEFRKHNFPNHNFETIETMGHFALVLYAFLTGLQMDVKAIVHTGTKSR  2299
             GI+LGPS+LG  ++F    FP  +   +ETM +  L+ + FL G++MD+  +  TG ++ 
Sbjct  77    GIVLGPSVLGRNKKFANMIFPQRSVIVLETMANVGLLYFLFLVGVEMDITVVRRTGKRAL  136

Query  2298  IVAVSGSIFPFLIGAGFYFTLQTDTQSM---IGFIFCGSALTVTGFSTLAKILDSKRLLN  2128
              +AV G + PFL+G GF F ++ +   +      +F G AL+VT F  LA+IL   +L+N
Sbjct  137   TIAVGGMVIPFLLGCGFSFIIRKENDHLSQGTYILFLGVALSVTAFPVLARILAELKLIN  196

Query  2127  TEIGKIAASSALINVALSWVLLTIGLLFTGSLDNVQ--WAvlctvgfvvvcvnyVRPLLN  1954
             T++G++A SSALIN   +WVLL + +  + + DN+   W +L +  F+ +C   VRP ++
Sbjct  197   TDLGRLAMSSALINDMFAWVLLALAIALSEN-DNLASLWVLLSSAAFIAICFFVVRPGIS  255

Query  1953  WLISKTPEGQGFSEFYICSFIAVICAFGCFTDAMGSHPMIGAFIFGLIMPNNELLRTAIL  1774
             W+I KTPEG+ FS+F+IC  +  +   G  TDA+G+H + GAF+FGL++PN  L  T ++
Sbjct  256   WIIRKTPEGENFSDFHICLILTGVMISGFITDAIGTHSVFGAFLFGLVIPNGPLGLT-LI  314

Query  1773  DRLEDFVMGILMPVFFLVCGLRTNIFTITDGDTSIFTALALILLACSAKIIAALVASCYT  1594
             ++LEDFV G+L+P+FF + GL+T+I  I  G  +    L +ILLAC  K+   +VA+ + 
Sbjct  315   EKLEDFVSGLLLPLFFAISGLKTDISAI-KGPVTWGALLLMILLACVGKVAGTVVAAFFH  373

Query  1593  GMSTNEAIGLGVLTNTKSTMVMIILEVGqvqqvlsvqqysmmvVACLIMTIVATPLAA-R  1417
              M   E + LG+L NTK  + MI+L VG+ Q+VL  + ++ MV+  +IMT + TP+A   
Sbjct  374   DMPIREGVTLGLLLNTKGLIEMIVLNVGKDQKVLDDEIFATMVMVAVIMTGIITPIATIV  433

Query  1416  YCPKQDLEPYKRRTIQNAKPGEELRILACIHGTNNLPAIISLLETSNSTVTSPITAFGVQ  1237
             Y P +   PYKRRTIQ  KP  E R+L CIH   N+P II+L E S+ T  SPI  + + 
Sbjct  434   YRPTKRFVPYKRRTIQKMKPDSEFRVLVCIHTPRNVPTIINLFEASHPTRRSPICIYVLH  493

Query  1236  LLELVGRAPAMMvvhssgsgrhvggsHEEVQTSQIISTFDNYELRSHGVTAQVLTARWSY  1057
             L+EL GRA AM++VH++        +  + Q+  II+ F+NYE  +  V  Q LTA   Y
Sbjct  494   LVELTGRASAMLIVHNTRKSGRPALNRTQAQSDHIINAFENYEQHAAYVAVQPLTAISPY  553

Query  1056  DTMAEDICKMAKEKRAAFLVLPFHKQQGTDGEMEDTNPAIQTVNEGVLLSAPCSVGILVE  877
             +TM EDI  +A++KR +F+++PFHKQQ  DG ME TNPA + VN+ +L +APCSVGILV+
Sbjct  554   NTMHEDIANLAEDKRVSFIIIPFHKQQTVDGGMEATNPAYRLVNQNLLENAPCSVGILVD  613

Query  876   RG-------RPNQYAKNIAVLYLGGPDDREALTYARRMSGLPGVHLTVIRFVPAKDVSAD  718
             RG         +  +  +AVL+L GPDDREAL YA RMS  PG+ LTV+RF+P +DV+  
Sbjct  614   RGLNGGTRLASSTISLQVAVLFLAGPDDREALAYAWRMSEHPGITLTVMRFIPGEDVALP  673

Query  717   GAVEDPDLELELTRETSFVTVSIDPARDKEEDEELLNNFRTETAEDDSKTFMELVLDDEE  538
              +            ++  + + +D  ++ E D+E LN FRT  A+ +  T++E V+++ E
Sbjct  674   SSARATH-----HSDSKMLRIDMDFGKEMELDDEYLNVFRTANADYEGITYIEKVVNNGE  728

Query  537   EFTKAVKSLDDRSFDLYVAGRGRGVSSALTSGLADWCECPELGAVGDllvtsefessfsv  358
             E   A++S+D  S DL++ GR RG+   LT+GL DW ECPELGA+GDLL +S+F ++ SV
Sbjct  729   ETVAAIRSMDS-SHDLFIVGRRRGIPCPLTAGLTDWSECPELGAIGDLLASSDFAATVSV  787

Query  357   lvVQQY  340
             LVVQQY
Sbjct  788   LVVQQY  793



>ref|XP_009801607.1| PREDICTED: cation/H(+) antiporter 15-like [Nicotiana sylvestris]
Length=841

 Score =   609 bits (1571),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/790 (44%), Positives = 506/790 (64%), Gaps = 24/790 (3%)
 Frame = -3

Query  2658  VMCFSQTIYRSNGVWEGPDPLAPMIPLFILQIMTAILSSRILNFVLKPFNQPPLVAEILS  2479
             ++C++ T+  +NG+W+G +PL   +PLFILQ+   ++ +RIL F+LKPF QP ++AEIL 
Sbjct  16    IVCYAPTMITTNGIWQGENPLDYSLPLFILQLTLVVVMTRILVFILKPFRQPRVIAEILG  75

Query  2478  GIILGPSMLGNIEEFRKHNFPNHNFETIETMGHFALVLYAFLTGLQMDVKAIVHTGTKSR  2299
             G+ILGPS+LG  ++F    FP  +   +ETM +  L+ + FL G++MD+  I  TG K+ 
Sbjct  76    GVILGPSVLGRSKKFADTIFPLRSVMVLETMANIGLLYFLFLVGVEMDIAVIRRTGKKAI  135

Query  2298  IVAVSGSIFPFLIGAGFYFTLQT---DTQSMIGFIFCGSALTVTGFSTLAKILDSKRLLN  2128
              +A++G + PFLIG  F F L     DT+     +F G AL+VT F  LA+IL   +L+N
Sbjct  136   PIALAGMVVPFLIGVSFSFMLHKNSQDTKQGTFILFLGVALSVTAFPVLARILAELKLIN  195

Query  2127  TEIGKIAASSALINVALSWVLLTIGLLFTGSLDNVQ---WAvlctvgfvvvcvnyVRPLL  1957
             TEIG+IA S+ALIN   +WVLL   + F+ + +      W +L +  FVV CV  VRPL+
Sbjct  196   TEIGRIAMSAALINDIFAWVLLAFAIAFSENHNMALASIWVILSSAAFVVFCVIIVRPLV  255

Query  1956  NWLISKTPEGQGFSEFYICSFIAVICAFGCFTDAMGSHPMIGAFIFGLIMPNNELLRTAI  1777
              W+I +TPEG+  SEF IC  +  +   G  TDA+G+H + GAFIFGL++PN  L  T +
Sbjct  256   GWMIRRTPEGESISEFSICLILTGVMICGFITDAIGTHSIFGAFIFGLVIPNGPLGVT-L  314

Query  1776  LDRLEDFVMGILMPVFFLVCGLRTNIFTITDGDTSIFTALALILLACSAKIIAALVASCY  1597
             ++RLEDFV G+L+P+FF + GL+T I  I    T    AL +I+LAC+ KI   ++ + Y
Sbjct  315   IERLEDFVSGLLLPLFFAISGLKTEINAIDGVGTWAILAL-VIVLACAGKIAGTVLVTLY  373

Query  1596  TGMSTNEAIGLGVLTNTKSTMVMIILEVGqvqqvlsvqqysmmvVACLIMTIVATPLAA-  1420
               M   E + LG+L N K  + MI++ VG+ Q+VL  + +++MV+  ++MT    P+   
Sbjct  374   YRMPFYEGVTLGLLMNAKGLIEMIVINVGKDQKVLDDKSFAIMVMVAVLMTACIIPIVTI  433

Query  1419  RYCPKQDLEPYKRRTIQNAKPGEELRILACIHGTNNLPAIISLLETSNSTVTSPITAFGV  1240
              Y P +   PYKRRT+Q+ KP  E R+L CIH   N+P II+LLE +  T  SP+  + +
Sbjct  434   IYKPARKFVPYKRRTVQSTKPDSEFRVLVCIHTPRNVPTIINLLEATYPTKKSPLGIYVL  493

Query  1239  QLLELVGRAPAMMvvhssgsgrhvggsHEEVQTSQIISTFDNYELRSHGVTAQVLTARWS  1060
              L+EL GR+ AM++VH++        +  + Q+  II+ F+N+E     V+ Q LTA   
Sbjct  494   HLVELTGRSSAMLIVHNTRKSGRPALNRTQAQSDHIINAFENFEQHVGCVSVQPLTAISP  553

Query  1059  YDTMAEDICKMAKEKRAAFLVLPFHKQQGTDGEMEDTNPAIQTVNEGVLLSAPCSVGILV  880
             Y TM EDIC +A++KR A L++PFHKQQ  DG ME TNPA +T+N+ VL +APCSVGILV
Sbjct  554   YSTMHEDICTVAEDKRVALLIVPFHKQQTVDGGMEVTNPAFRTINQNVLANAPCSVGILV  613

Query  879   ERG-------RPNQYAKNIAVLYLGGPDDREALTYARRMSGLPGVHLTVIRFVPAKDVSA  721
             +RG         NQ + ++AVL+ GGPDDREAL+Y  RM   PG++LTV+RF+P      
Sbjct  614   DRGLSGSTRLAANQVSHHVAVLFFGGPDDREALSYGLRMREHPGINLTVMRFLP-----G  668

Query  720   DGAVE--DPDLELELTRETSFVTVSIDPARDKEEDEELLNNFRTETAEDDSKTFMELVLD  547
             + A+E    D       +   +TV  D  R+K+ DE+ ++ FR  TA DDS  ++E V++
Sbjct  669   EAAIEATRSDSRKSSMNDPGVLTVVTDDDREKQLDEDYVSEFRARTANDDSAVYIERVVN  728

Query  546   DEEEFTKAVKSLDDRSFDLYVAGRGRGVSSALTSGLADWCECPELGAVGDllvtsefess  367
               EE   A++++D+ S DL++ GRG+G  S LT+GL DW ECPELGA+GDLL +S+  S+
Sbjct  729   HGEETVAAIRTIDN-SHDLFIVGRGQGTISPLTAGLTDWSECPELGAIGDLLASSDSASA  787

Query  366   fsvlvVQQYV  337
              SVLVVQQYV
Sbjct  788   VSVLVVQQYV  797



>ref|XP_011081225.1| PREDICTED: cation/H(+) antiporter 15-like [Sesamum indicum]
Length=839

 Score =   609 bits (1570),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 357/794 (45%), Positives = 509/794 (64%), Gaps = 30/794 (4%)
 Frame = -3

Query  2664  QVVMCFSQTIYRSNGVWEGPDPLAPMIPLFILQIMTAILSSRILNFVLKPFNQPPLVAEI  2485
             Q ++C++ T+  +NG+W+G +PL   +PLFILQ+   ++++RIL F LKP  QP +++EI
Sbjct  14    QTIVCYAPTMITTNGIWQGDNPLDYSLPLFILQLTLVVVTTRILVFALKPLRQPRVISEI  73

Query  2484  LSGIILGPSMLGNIEEFRKHNFPNHNFETIETMGHFALVLYAFLTGLQMDVKAIVHTGTK  2305
             L GIILGPS+LG   +F +  FP  +   +ETM +  L+ + FL G++MD+  I  TG +
Sbjct  74    LGGIILGPSVLGRSSKFAETVFPLRSVMVLETMANVGLLYFLFLVGVEMDIGVIKRTGKQ  133

Query  2304  SRIVAVSGSIFPFLIGAGFYFTLQTDTQ--SMIGFI-FCGSALTVTGFSTLAKILDSKRL  2134
             +  +A+SG I PF+IG GF F L   T+   +  FI F G AL+VT F  LA+IL   +L
Sbjct  134   ALAIAISGMILPFVIGVGFAFLLHQSTEFVKLSTFILFLGVALSVTAFPVLARILAELKL  193

Query  2133  LNTEIGKIAASSALINVALSWVLLTIGLLFTG----SLDNVQWAvlctvgfvvvcvnyVR  1966
             LNTEIGKIA SSALIN   +WVLL   +        SL +V W +L +  FVV CV  VR
Sbjct  194   LNTEIGKIAMSSALINDMCAWVLLAFAIALAENEAMSLASV-WVILSSGAFVVFCVYVVR  252

Query  1965  PLLNWLISKTPEGQGFSEFYICSFIAVICAFGCFTDAMGSHPMIGAFIFGLIMPNNELLR  1786
             PL++W+I +TPEG+  SEF IC  +  +   G  TDA+G+H + GAF+FGL++PN  L  
Sbjct  253   PLISWIIRRTPEGESISEFSICLILTGVMISGFITDAIGTHSVFGAFVFGLVIPNGPLGV  312

Query  1785  TAILDRLEDFVMGILMPVFFLVCGLRTNIFTITDGDTSIFTALALILLACSAKIIAALVA  1606
             T +++RLEDFV G+L+P+FF + GL+T+I  I DG T+      +I+LAC+ KI   L+ 
Sbjct  313   T-LIERLEDFVSGLLLPLFFAISGLKTDIGAI-DGATTWVLLFVVIILACAGKIAGTLLV  370

Query  1605  SCYTGMSTNEAIGLGVLTNTKSTMVMIILEVGqvqqvlsvqqysmmvVACLIMTIVATPL  1426
             + Y  M   E + LG+L NTK  + MI+L VG+ Q+VL  + +++MV+  ++MT +  PL
Sbjct  371   TVYYKMPFYEGLTLGLLMNTKGLVEMIVLNVGKDQKVLDDKSFAIMVIVAIVMTSIIGPL  430

Query  1425  AAR-YCPKQDLEPYKRRTIQNAKPGEELRILACIHGTNNLPAIISLLETSNSTVTSPITA  1249
                 + P +    YKRRTIQ  KP  E R++ C+H   N+P II+LLE S  T  SPI  
Sbjct  431   VTSVHKPGRKSVSYKRRTIQRTKPEGEFRVMVCVHTPRNVPTIINLLEASYPTKKSPICT  490

Query  1248  FGVQLLELVGRAPAMMvvhssgsgrhvggsHEEVQTSQIISTFDNYELRSHGVTAQVLTA  1069
             + + L+EL GRA AM++VH++        +  + Q+  II+ F+N+E  +  V+   LTA
Sbjct  491   YVLHLVELTGRASAMLIVHNTRKTGRPALNRTQAQSDHIINAFENFEQHAGFVSVNPLTA  550

Query  1068  RWSYDTMAEDICKMAKEKRAAFLVLPFHKQQGTDGEMEDTNPAIQTVNEGVLLSAPCSVG  889
                Y TM EDIC +A +KR AF+++PFHKQQ  DG ME TNPA +T+N+ VL +APCSVG
Sbjct  551   ISPYSTMHEDICNVALDKRVAFIIVPFHKQQTVDGGMEATNPAFRTINQNVLANAPCSVG  610

Query  888   ILVERG------RPNQYAKNIAVLYLGGPDDREALTYARRMSGLPGVHLTVIRFVPAKDV  727
             ILV+RG        NQ   ++ VL+ GG DDREAL YA RMS  PG++LTV+RF+P +  
Sbjct  611   ILVDRGLNGSRLAGNQVTHHVTVLFFGGVDDREALAYAWRMSEHPGINLTVMRFLPGEHA  670

Query  726   --SADGAVEDPDLELELTRETSFVTVSIDPARDKEE--DEELLNNFRTETAEDDSKTFME  559
               +   A  +P    E+        +S++   DKE+  DEE +N F++ T  D S  + E
Sbjct  671   FETTGSARRNPSGRREI--------LSVETNDDKEQQLDEEYVNEFKSRTMNDSSVIYTE  722

Query  558   LVLDDEEEFTKAVKSLDDRSFDLYVAGRGRGVSSALTSGLADWCECPELGAVGDllvtse  379
              V++  EE   A++S+D    DL++ GRG+G+ S LT+GL DW ECPELGA+GDLL +S+
Sbjct  723   RVVNHGEETVAAIRSIDP-IHDLFIVGRGQGIMSPLTAGLTDWSECPELGAIGDLLASSD  781

Query  378   fessfsvlvVQQYV  337
             F +S+SVLVVQQYV
Sbjct  782   FGASYSVLVVQQYV  795



>ref|XP_009776809.1| PREDICTED: cation/H(+) antiporter 15-like [Nicotiana sylvestris]
Length=838

 Score =   607 bits (1566),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 339/786 (43%), Positives = 499/786 (63%), Gaps = 20/786 (3%)
 Frame = -3

Query  2658  VMCFSQTIYRSNGVWEGPDPLAPMIPLFILQIMTAILSSRILNFVLKPFNQPPLVAEILS  2479
             ++C++  +  +NG+W+G +PL   +PLFILQ+   ++ +R+L ++LKP  QP ++AEIL 
Sbjct  18    IVCYAPMMITTNGIWQGDNPLDYSLPLFILQLTLVVVITRLLVYILKPLRQPRVIAEILG  77

Query  2478  GIILGPSMLGNIEEFRKHNFPNHNFETIETMGHFALVLYAFLTGLQMDVKAIVHTGTKSR  2299
             G+ILGPS+LG   +F    FP  +   +ETM +  L+ + FL G++MD+  I   G KS 
Sbjct  78    GVILGPSVLGRSSKFANTIFPQRSVMVLETMANIGLLYFLFLVGVEMDIDVISRNGKKSL  137

Query  2298  IVAVSGSIFPFLIGAGFYFTLQTDTQSM---IGFIFCGSALTVTGFSTLAKILDSKRLLN  2128
             I+A++G + PF++G+ F F L   +Q        +F G +L+VT F  LA+IL   +L+N
Sbjct  138   IIAIAGMVLPFILGSSFSFMLHETSQHTKQGTFILFLGLSLSVTAFPVLARILAELKLIN  197

Query  2127  TEIGKIAASSALINVALSWVLLTIGLLFTGSLDNV---QWAvlctvgfvvvcvnyVRPLL  1957
             TEIG+IA S++LIN  L+WV+L   + F+ + +      W +L +  F+  C   VRPL+
Sbjct  198   TEIGRIAMSASLINDMLAWVVLAFAIAFSENKNMTLASLWVILSSTAFICFCFFVVRPLI  257

Query  1956  NWLISKTPEGQGFSEFYICSFIAVICAFGCFTDAMGSHPMIGAFIFGLIMPNNELLRTAI  1777
                I +TPEG+  SEF IC  +  +   G  TDA+G+H + GAF+FGLI+PN   L   +
Sbjct  258   GRRIRQTPEGESISEFNICLILTGVMVAGFITDAIGTHSVFGAFVFGLIIPNGP-LGLVL  316

Query  1776  LDRLEDFVMGILMPVFFLVCGLRTNIFTITDGDTSIFTALALILLACSAKIIAALVASCY  1597
             ++RLEDFV G+L+P+FF + GL+T I T  DG  +      +I+LAC+ K++   +A+ Y
Sbjct  317   VERLEDFVSGLLLPLFFAISGLKTEI-TAIDGVGTWAILFVVIILACAGKVLGVFLATLY  375

Query  1596  TGMSTNEAIGLGVLTNTKSTMVMIILEVGqvqqvlsvqqysmmvVACLIMTIVATPLAAR  1417
               M  +E + LG+L N K  + MI+L VG+ Q+V   + +++MV+  + MT + TP+   
Sbjct  376   YKMPYHEGLSLGLLMNAKGLIEMIVLNVGKDQKVFDDKSFAIMVMVAIGMTAIITPIVTV  435

Query  1416  -YCPKQDLEPYKRRTIQNAKPGEELRILACIHGTNNLPAIISLLETSNSTVTSPITAFGV  1240
              Y P ++  PYKRRT+Q  K   E R+L CIH T N+P II+LLE S  T  SPI  + +
Sbjct  436   IYKPARNFVPYKRRTVQRTKLDREFRVLVCIHTTRNVPTIINLLEASYPTKKSPICIYVL  495

Query  1239  QLLELVGRAPAMMvvhssgsgrhvggsHEEVQTSQIISTFDNYELRSHGVTAQVLTARWS  1060
              L+EL GRA AM++VH+         +  + Q+  II+ F+N+E     V  Q LTA   
Sbjct  496   HLVELTGRASAMLIVHNMRKTGRPAINRTQAQSDHIINAFENFEKNVGCVYVQPLTAISP  555

Query  1059  YDTMAEDICKMAKEKRAAFLVLPFHKQQGTDGEMEDTNPAIQTVNEGVLLSAPCSVGILV  880
             Y TM EDIC +A++KR A +++PFHKQQ  DG ME TNPA + +N+ VL ++PCS+GILV
Sbjct  556   YSTMHEDICLLAEDKRVALIIIPFHKQQTVDGGMEATNPAFRAINQNVLANSPCSIGILV  615

Query  879   ERG----RPNQYAKNIAVLYLGGPDDREALTYARRMSGLPGVHLTVIRFVPAKDVSADGA  712
             +RG    R NQ + +IAVL+ GGPDDREAL YA RMS  P  +LTV+RF+P      + A
Sbjct  616   DRGLSASRMNQVSHHIAVLFFGGPDDREALAYAWRMSEHPNTNLTVLRFLP-----GEAA  670

Query  711   VEDPDLELELTR-ETSFVTVSIDPARDKEEDEELLNNFRTETAEDDSKTFMELVLDDEEE  535
             +E    +   +R + S +TV+ D  ++K+ DEE +  FRT T  D+S  + E V++  EE
Sbjct  671   IEATRSDSTKSRNDHSILTVATDSDKEKQLDEEYIKEFRTRTTNDESVIYTERVVNHGEE  730

Query  534   FTKAVKSLDDRSFDLYVAGRGRGVSSALTSGLADWCECPELGAVGDllvtsefessfsvl  355
                A++S+D+ S DL++ GRG+G  S LT+GL DW ECPELGA+GDLL +S+F    SVL
Sbjct  731   TVAAIRSIDN-SHDLFIVGRGQGNISPLTAGLTDWSECPELGAIGDLLASSDFAMKVSVL  789

Query  354   vVQQYV  337
             VVQQYV
Sbjct  790   VVQQYV  795



>ref|XP_009595814.1| PREDICTED: cation/H(+) antiporter 15-like isoform X1 [Nicotiana 
tomentosiformis]
Length=838

 Score =   607 bits (1566),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/786 (43%), Positives = 501/786 (64%), Gaps = 20/786 (3%)
 Frame = -3

Query  2658  VMCFSQTIYRSNGVWEGPDPLAPMIPLFILQIMTAILSSRILNFVLKPFNQPPLVAEILS  2479
             ++C++ T+  +NG+W+G +PL   +PLFILQ+   ++ +R+L +VLKP  QP ++AEIL 
Sbjct  18    IVCYAPTMITTNGIWQGDNPLDYSLPLFILQLTLVVVITRLLVYVLKPIRQPRVIAEILG  77

Query  2478  GIILGPSMLGNIEEFRKHNFPNHNFETIETMGHFALVLYAFLTGLQMDVKAIVHTGTKSR  2299
             G+ILGPS+LG   +F    FP  +   +ETM +  L+ + FL G++MD+  I   G KS 
Sbjct  78    GVILGPSVLGRSSKFANTIFPQRSVMVLETMANIGLLYFLFLVGVEMDIDVIRRNGKKSL  137

Query  2298  IVAVSGSIFPFLIGAGFYFTLQTDTQSM---IGFIFCGSALTVTGFSTLAKILDSKRLLN  2128
             I+A++G + PF++G+ F F L   +Q        +F G +L+VT F  LA+IL   +L+N
Sbjct  138   IIAIAGMVLPFIVGSSFSFMLHETSQHTKEGTFILFLGLSLSVTAFPVLARILAELKLIN  197

Query  2127  TEIGKIAASSALINVALSWVLLTIGLLFTGSLDNV---QWAvlctvgfvvvcvnyVRPLL  1957
             TEIG+IA S++LIN  L+WV+L   + F+ + +      W +L +  F+  C   VRPL+
Sbjct  198   TEIGRIAMSASLINDILAWVVLAFAIAFSENKNMTLASLWVILSSTAFICFCFFVVRPLI  257

Query  1956  NWLISKTPEGQGFSEFYICSFIAVICAFGCFTDAMGSHPMIGAFIFGLIMPNNELLRTAI  1777
                I +TPEG+  SEF IC  +  +   G  TDA+G+H + GAF+FGLI+PN   L   +
Sbjct  258   ERRIRQTPEGESISEFNICLILTGVMVAGFITDAIGTHSVFGAFVFGLIIPNGP-LGLVL  316

Query  1776  LDRLEDFVMGILMPVFFLVCGLRTNIFTITDGDTSIFTALALILLACSAKIIAALVASCY  1597
             ++RLEDFV G+L+P+FF + GL+T I T  DG  +  +   +I+LAC+ K++   + + Y
Sbjct  317   VERLEDFVSGLLLPLFFAISGLKTEI-TAIDGVGTWASLFVVIVLACAGKVLGVFLVTLY  375

Query  1596  TGMSTNEAIGLGVLTNTKSTMVMIILEVGqvqqvlsvqqysmmvVACLIMTIVATPLAAR  1417
               M  +E + LG+L N K  + MI+L VG+ Q+VL  + +++MV+  + MT + TP+   
Sbjct  376   YKMPYHEGLSLGLLMNAKGLIEMIVLNVGKDQKVLDDKSFAIMVMVAVGMTAIITPIVTV  435

Query  1416  -YCPKQDLEPYKRRTIQNAKPGEELRILACIHGTNNLPAIISLLETSNSTVTSPITAFGV  1240
              Y P ++  PYKRRT+Q  K   E R+L CIH   N+P II+LLE S  T  SPI  + +
Sbjct  436   IYKPARNFVPYKRRTVQRTKLDREFRVLVCIHTPRNVPTIINLLEASYPTKKSPICIYVL  495

Query  1239  QLLELVGRAPAMMvvhssgsgrhvggsHEEVQTSQIISTFDNYELRSHGVTAQVLTARWS  1060
              L+EL GRA AM++VH+         +  + Q+  II+ F+N+E     V  Q LTA   
Sbjct  496   HLVELTGRASAMLIVHNMRKTGRPAINRTQAQSDHIINAFENFEKNVGCVYVQSLTAISP  555

Query  1059  YDTMAEDICKMAKEKRAAFLVLPFHKQQGTDGEMEDTNPAIQTVNEGVLLSAPCSVGILV  880
             Y TM EDIC +A++KR A +++PFHKQQ  DG ME TNPA Q +N+ VL ++PCSVGILV
Sbjct  556   YSTMHEDICLLAEDKRVALIIIPFHKQQTVDGGMEATNPAFQAINQNVLANSPCSVGILV  615

Query  879   ERG----RPNQYAKNIAVLYLGGPDDREALTYARRMSGLPGVHLTVIRFVPAKDVSADGA  712
             +RG    R NQ + +IAVL+ GGPDDREAL YA RMS  P ++LTV+RF+P      + +
Sbjct  616   DRGLSASRMNQVSHHIAVLFFGGPDDREALAYAWRMSEHPNINLTVLRFLP-----GEAS  670

Query  711   VEDPDLELELTR-ETSFVTVSIDPARDKEEDEELLNNFRTETAEDDSKTFMELVLDDEEE  535
             +E    +   +R + S +TV+ D  ++K+ DEE +  FRT T  D+S  + E V++  EE
Sbjct  671   IEATRSDSTNSRNDHSILTVATDSDKEKQLDEEYVKEFRTRTTNDESVIYTERVVNHGEE  730

Query  534   FTKAVKSLDDRSFDLYVAGRGRGVSSALTSGLADWCECPELGAVGDllvtsefessfsvl  355
                A++S+D+ S DL++ GRG+G  S LT+GL DW ECPELGA+GDLL +S+F    SVL
Sbjct  731   TVAAIRSIDN-SHDLFIVGRGQGNISPLTAGLTDWSECPELGAIGDLLASSDFAMEVSVL  789

Query  354   vVQQYV  337
             +VQQYV
Sbjct  790   IVQQYV  795



>ref|XP_004147368.1| PREDICTED: cation/H(+) antiporter 15-like [Cucumis sativus]
 ref|XP_004164295.1| PREDICTED: cation/H(+) antiporter 15-like [Cucumis sativus]
 gb|KGN62161.1| hypothetical protein Csa_2G302270 [Cucumis sativus]
Length=837

 Score =   607 bits (1564),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 351/790 (44%), Positives = 511/790 (65%), Gaps = 31/790 (4%)
 Frame = -3

Query  2658  VMCFSQTIYRSNGVWEGPDPLAPMIPLFILQIMTAILSSRILNFVLKPFNQPPLVAEILS  2479
             ++C++ T+  +NGVW+G +PL   +PLFILQ+   ++ +RIL F+LKPF QP +++EIL 
Sbjct  15    IVCYAPTMITTNGVWQGDNPLDYSLPLFILQLTMVVVMTRILVFLLKPFRQPRVISEILG  74

Query  2478  GIILGPSMLGNIEEFRKHNFPNHNFETIETMGHFALVLYAFLTGLQMDVKAIVHTGTKSR  2299
             G+ILGPS+LG   +F    FP  +   +ETM +  L+ + FL G++MD+  I  TG K+ 
Sbjct  75    GVILGPSVLGRSSKFANTVFPLRSVMVLETMANVGLLYFLFLVGVEMDLSVIRRTGKKAM  134

Query  2298  IVAVSGSIFPFLIGAGFYFTLQTDTQSM---IGFIFCGSALTVTGFSTLAKILDSKRLLN  2128
              +AV+G I PF IGA F F L  ++Q +      +F G AL+VT F  LA+IL   +L+N
Sbjct  135   AIAVAGMILPFGIGAAFSFQLHKESQKLNYNTYIMFLGIALSVTAFPVLARILAELKLIN  194

Query  2127  TEIGKIAASSALINVALSWVLLTIGLLFT---GSLDNVQWAvlctvgfvvvcvnyVRPLL  1957
             +E+G++A +SAL N   +WVLL + +  +    S     W VL +  FV+ C+  VRP++
Sbjct  195   SELGRMAMASALFNDMCAWVLLALAIALSENDSSSFASLWVVLSSAAFVLFCIFIVRPMI  254

Query  1956  NWLISKTPEGQGFSEFYICSFIAVICAFGCFTDAMGSHPMIGAFIFGLIMPNNELLRTAI  1777
             +W+I KTPEG+  SEFYIC  +  +   G  TDA+G+H + GAF+FGL++PN   L  A+
Sbjct  255   SWMIRKTPEGESVSEFYICLILTGVMISGFVTDAIGTHSVFGAFVFGLVIPNGS-LGVAL  313

Query  1776  LDRLEDFVMGILMPVFFLVCGLRTNIFTITDGDTSIFTALALILLACSAKIIAALVASCY  1597
             +++LEDFV G+L+P+FF + GL+TNI +I +G  +  + L + LLA   K+I  L+AS  
Sbjct  314   IEKLEDFVSGLLLPLFFAISGLKTNISSI-EGIFAWISILCITLLAFLGKVIGTLLASIC  372

Query  1596  TGMSTNEAIGLGVLTNTKSTMVMIILEVGqvqqvlsvqqysmmvVACLIMTIVATPLAA-  1420
               MS  E + LG+L NTK  + MIIL VG+ Q+VL  Q +++MV+  LIMT + TP+   
Sbjct  373   YQMSYREGVTLGLLMNTKGLIEMIILNVGKDQKVLDDQTFTVMVIVALIMTGIITPVVTI  432

Query  1419  RYCPKQDLEPYKRRTIQNAKPGEELRILACIHGTNNLPAIISLLETSNSTVTSPITAFGV  1240
              Y P +   PYK+RTIQ +KP  E R+L CIH   N+P II+LL+ S+ T  SPI  + +
Sbjct  433   IYRPTRRFLPYKKRTIQASKPDSEFRVLVCIHTPRNVPTIINLLDASHPTKRSPICIYVL  492

Query  1239  QLLELVGRAPAMMvvhssgsgrhvggsHEEVQTSQIISTFDNYELRSHGVTAQVLTARWS  1060
              L+EL GRA AM++VH++        +  + Q+  II+ F+NYE     V+ Q LTA   
Sbjct  493   HLVELTGRASAMLIVHNTRKSGRPALNRTQAQSDHIINAFENYEQHVDCVSVQPLTAISP  552

Query  1059  YDTMAEDICKMAKEKRAAFLVLPFHKQQGTDGEMEDTNPAIQTVNEGVLLSAPCSVGILV  880
             Y TM EDIC +A++KR AF+++PFHKQQ  DG ME +NPA + VN+ VL +APCSVGILV
Sbjct  553   YSTMHEDICNLAEDKRVAFIIIPFHKQQTVDGGMEASNPAFRLVNQNVLANAPCSVGILV  612

Query  879   ERG----------RPNQYAKNIAVLYLGGPDDREALTYARRMSGLPGVHLTVIRFVPAKD  730
             +RG          +   Y  NI VL+ GG DDREAL+YA RMS  PGV+LTV+RF+ A++
Sbjct  613   DRGLNGANRATSNKGTHY--NIIVLFFGGQDDREALSYAWRMSEHPGVNLTVMRFIAAQE  670

Query  729   VSADGAVEDPDLELELTRETSFVTVSIDPARDKEEDEELLNNFRTETAEDDSKTFMELVL  550
             +       +P LE   +R +   T+  +  RD++ DE+ ++ FR      +S T+ E VL
Sbjct  671   IM------EPKLEENTSRIS---TMETEMNRDRKLDEDHISEFRARNPNSESITYTEKVL  721

Query  549   DDEEEFTKAVKSLDDRSFDLYVAGRGRGVSSALTSGLADWCECPELGAVGDllvtsefes  370
             ++ EE   A++S++D + DL++ GRG    S LT+GL DW ECPELGA+GDLL +S+F +
Sbjct  722   NNGEETVAAIRSMND-AHDLFIVGRGESHISPLTAGLTDWSECPELGAIGDLLASSDFAA  780

Query  369   sfsvlvVQQY  340
             + SVLVVQQ+
Sbjct  781   TTSVLVVQQF  790



>ref|XP_008342861.1| PREDICTED: cation/H(+) antiporter 15 [Malus domestica]
Length=857

 Score =   607 bits (1565),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 343/793 (43%), Positives = 510/793 (64%), Gaps = 23/793 (3%)
 Frame = -3

Query  2658  VMCFSQTIYRSNGVWEGPDPLAPMIPLFILQIMTAILSSRILNFVLKPFNQPPLVAEILS  2479
             ++C++ T+  +NG+W+G +PL   +PLFILQ+   ++++RIL  +LKPF QP +++EIL 
Sbjct  20    IVCYAPTMITTNGIWQGDNPLDYSLPLFILQLTMVVVTTRILVLILKPFRQPRVISEILG  79

Query  2478  GIILGPSMLGNIEEFRKHNFPNHNFETIETMGHFALVLYAFLTGLQMDVKAIVHTGTKSR  2299
             G++LGPS+LG  ++F    FP  +   +ETM +  L+ + FL GL+MD+  I   G ++ 
Sbjct  80    GVLLGPSVLGKSDKFANTIFPLRSVMVLETMANVGLLYFLFLVGLEMDISVIRRMGKRAV  139

Query  2298  IVAVSGSIFPFLIGAGFYFTLQTDTQSM---IGFIFCGSALTVTGFSTLAKILDSKRLLN  2128
             ++A+SG I PFLIGA F F L    QSM      +F G AL+VT F  LA++L   +L+N
Sbjct  140   VIAISGMILPFLIGAAFSFLLHKREQSMNQGTFILFLGVALSVTAFPVLARVLAELKLIN  199

Query  2127  TEIGKIAASSALINVALSWVLLTIGLLFTGSLDNVQWAvlctvgfvvvcvny----VRPL  1960
             TE+G+IA SSAL+N  +    L    +     D+   A L  V      V      VRP 
Sbjct  200   TELGRIALSSALVN-DMCAWALLAIAIALAENDSTSLASLYVVLSSGAFVLVCIFIVRPA  258

Query  1959  LNWLISKTPEGQGFSEFYICSFIAVICAFGCFTDAMGSHPMIGAFIFGLIMPNNELLRTA  1780
             + WLI +TPEG+ FSEFYIC  +  +   G  TDA+G+H + GAF+FGL++PN  L  T 
Sbjct  259   ICWLIRRTPEGETFSEFYICLILTGVMISGFVTDAIGTHSVFGAFVFGLVIPNGPLGAT-  317

Query  1779  ILDRLEDFVMGILMPVFFLVCGLRTNIFTITDGDTSIFTALALILLACSAKIIAALVASC  1600
             ++++LEDFV G+L+P+FF + GLRTNI +IT G  +    L +I LAC  KI   ++   
Sbjct  318   LIEKLEDFVSGLLLPLFFAISGLRTNITSIT-GPGTWGILLLVIFLACIGKIAGTVIVCL  376

Query  1599  YTGMSTNEAIGLGVLTNTKSTMVMIILEVGqvqqvlsvqqysmmvVACLIMTIVATPLAA  1420
             +  M  +E   LG+L N K  + +I+L VG+ Q+VL  + +++MV+  ++MT + TP+  
Sbjct  377   FYQMPFDEGFTLGLLMNCKGLVELIVLNVGKDQKVLDDEAFAIMVIVAVVMTGIITPIVT  436

Query  1419  R-YCPKQDLEPYKRRTIQNAKPGEELRILACIHGTNNLPAIISLLETSNSTVTSPITAFG  1243
               Y P +   PYKRR+IQ +KP  ELRIL C+H   N+P +I+LLE S+ T  SP+  + 
Sbjct  437   TVYKPARRFIPYKRRSIQRSKPDAELRILVCVHTPRNVPTMINLLEASHPTKRSPLCVYI  496

Query  1242  VQLLELVGRAPAMMvvhssgsgrhvggsHEEVQTSQIISTFDNYELRSHG--VTAQVLTA  1069
             + L+EL GRA AM++VH++        +  + Q+  II+ F+NYE  + G  V+ Q LTA
Sbjct  497   LHLVELSGRASAMLIVHNTRKSGRPALNRTQAQSDHIINAFENYEQHAPGNCVSVQPLTA  556

Query  1068  RWSYDTMAEDICKMAKEKRAAFLVLPFHKQQGTDGEMEDTNPAIQTVNEGVLLSAPCSVG  889
                Y TM EDIC +A++KR AFL++PFHKQQ  DG ME  NPA +T+N+ VL +APCSVG
Sbjct  557   ISPYSTMHEDICNLAEDKRVAFLIIPFHKQQTVDGGMEAMNPAFRTMNQNVLTNAPCSVG  616

Query  888   ILVERG--------RPNQYAKNIAVLYLGGPDDREALTYARRMSGLPGVHLTVIRFVPAK  733
             ILV+RG          NQ + ++ +L+ GGPDDREAL+YA RMS  PG++LTV+RFVP +
Sbjct  617   ILVDRGLNGSSRLAAANQISHHVVILFFGGPDDREALSYAWRMSEHPGINLTVMRFVPGE  676

Query  732   DVSADGAVEDPDLELE-LTRETSFVTVSIDPARDKEEDEELLNNFRTETAEDDSKTFMEL  556
             +   + A       ++ +   +  ++V +D   +K+ DEEL+N+FR + A ++S  + E 
Sbjct  677   EAGLERAASTSTSNVDGIGNNSRILSVEMDIGWEKQLDEELINDFRMKNANEESVVYTEK  736

Query  555   VLDDEEEFTKAVKSLDDRSFDLYVAGRGRGVSSALTSGLADWCECPELGAVGDllvtsef  376
             V+++ EE   A++S+D+   DL++ GRG+G+ S LT+GL DW ECPELGA+GDLL +S+F
Sbjct  737   VVNNGEETVAAIRSMDN-VHDLFIVGRGQGMVSPLTAGLTDWSECPELGAIGDLLASSDF  795

Query  375   essfsvlvVQQYV  337
              ++ SVLV+QQYV
Sbjct  796   AATASVLVMQQYV  808



>gb|EYU30300.1| hypothetical protein MIMGU_mgv1a026576mg, partial [Erythranthe 
guttata]
Length=772

 Score =   601 bits (1550),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/778 (45%), Positives = 505/778 (65%), Gaps = 24/778 (3%)
 Frame = -3

Query  2628  SNGVWEGPDPLAPMIPLFILQIMTAILSSRILNFVLKPFNQPPLVAEILSGIILGPSMLG  2449
             +NG+W+G +PL   +PLFILQ+   + ++R+L FVLKP  QP +++EIL GIILGPS+LG
Sbjct  4     TNGIWQGDNPLDYSLPLFILQLTLVVTTTRLLVFVLKPLRQPRVISEILGGIILGPSVLG  63

Query  2448  NIEEFRKHNFPNHNFETIETMGHFALVLYAFLTGLQMDVKAIVHTGTKSRIVAVSGSIFP  2269
                +F    FP  +   +ETM +  L+ + FL G++MD+  I  TG ++  +A++G I P
Sbjct  64    RSTKFADTIFPLRSVMVLETMANVGLLYFLFLVGVEMDIGVIKRTGKRALAIAIAGMILP  123

Query  2268  FLIGAGFYFTLQTDTQ--SMIGFI-FCGSALTVTGFSTLAKILDSKRLLNTEIGKIAASS  2098
             FLIG  F F L   T+  ++  FI F G AL+VT F  LA+IL   +LLNT+IG+IA SS
Sbjct  124   FLIGVSFAFMLHQTTELIALGTFILFLGVALSVTAFPVLARILAELKLLNTDIGRIAMSS  183

Query  2097  ALINVALSWVLLTIGLLF----TGSLDNVQWAvlctvgfvvvcvnyVRPLLNWLISKTPE  1930
             ALIN   +W+LL   +      + SL ++ W +L +V FV+ CV  VRP+++W++ +TPE
Sbjct  184   ALINDMCAWILLAFAIALAENESMSLASI-WVILSSVVFVLFCVYIVRPIVSWMVRRTPE  242

Query  1929  GQGFSEFYICSFIAVICAFGCFTDAMGSHPMIGAFIFGLIMPNNELLRTAILDRLEDFVM  1750
             G+  SEFYIC  +  +   G  TDA+G+H + GAF+FGL++PN  L  T +++RLEDFV 
Sbjct  243   GESISEFYICLILTGVMISGFITDAIGTHSVFGAFVFGLVIPNGPLGVT-LIERLEDFVS  301

Query  1749  GILMPVFFLVCGLRTNIFTITDGDTSIFTALALILLACSAKIIAALVASCYTGMSTNEAI  1570
             G+L+P+FF + GL+T+I T   G T+      +I+LAC+ KI   L+ S Y  +  NE +
Sbjct  302   GLLLPLFFAISGLKTDI-TAIHGFTTWAILGVVIILACAGKIAGTLLVSLYYKIPFNEGL  360

Query  1569  GLGVLTNTKSTMVMIILEVGqvqqvlsvqqysmmvVACLIMTIVATPLAAR-YCPKQDLE  1393
              LG+L NTK  + MI+L VG+ Q+VL  + +++MV+  ++MT + +P+    Y P +   
Sbjct  361   TLGLLMNTKGLVEMIVLNVGKDQKVLDDKSFAIMVIVAVVMTAIISPIVTTIYRPARKFT  420

Query  1392  PYKRRTIQNAKPGEELRILACIHGTNNLPAIISLLETSNSTVTSPITAFGVQLLELVGRA  1213
             PYKRRTIQ  KP  E R+L CIH   N+P II+LL+ S+ T  SPI  + + L+EL GRA
Sbjct  421   PYKRRTIQRTKPEGEFRVLVCIHTPRNVPTIINLLDASHPTKKSPICTYVLHLVELTGRA  480

Query  1212  PAMMvvhssgsgrhvggsHEEVQTSQIISTFDNYELRSHGVTAQVLTARWSYDTMAEDIC  1033
              AM++VH++        +  + Q+  II+ F+N+E  S  V+   LTA   Y TM EDIC
Sbjct  481   SAMLIVHNTRKSGRPALNRTQAQSDHIINAFENFEQHSGFVSVNPLTAVSPYSTMHEDIC  540

Query  1032  KMAKEKRAAFLVLPFHKQQGTDGEMEDTNPAIQTVNEGVLLSAPCSVGILVERG------  871
              +A++KR AF+++PFHKQQ  DG ME TNPA +T+N+ VL +APCSVGILV+RG      
Sbjct  541   NVAEDKRVAFIIVPFHKQQTVDGGMEATNPAFRTINQNVLANAPCSVGILVDRGLSGSTR  600

Query  870   -RPNQYAKNIAVLYLGGPDDREALTYARRMSGLPGVHLTVIRFVPAKDVSADGAVEDPDL  694
                NQ A ++AVL+ GGPDDREAL Y  RM    GV+LTV+RF+  ++     AVE    
Sbjct  601   LAANQIAHHVAVLFFGGPDDREALAYGWRMCEHSGVNLTVLRFIVGEN-----AVEPVAE  655

Query  693   ELELTRETSFVTVSIDPARDKEEDEELLNNFRTETAEDDSKTFMELVLDDEEEFTKAVKS  514
                   +   +TV+ +  R+++ DE+ +N FR  T +D S  + E V++  EE   A++S
Sbjct  656   ARRNPSQREMLTVATETDRERQLDEDYINAFRARTMDDSSVVYDEKVVNHGEETVAAIRS  715

Query  513   LDDRSFDLYVAGRGRGVSSALTSGLADWCECPELGAVGDllvtsefessfsvlvVQQY  340
             +D    DL++ GRG+G+ S +T+GL DW ECPELGA+GDLL +S+F +++SVLVVQQY
Sbjct  716   VDP-VHDLFIVGRGQGLISPVTAGLTDWSECPELGAIGDLLASSDFAATYSVLVVQQY  772



>ref|XP_010034375.1| PREDICTED: cation/H(+) antiporter 15 [Eucalyptus grandis]
 gb|KCW51840.1| hypothetical protein EUGRSUZ_J01292 [Eucalyptus grandis]
Length=829

 Score =   603 bits (1554),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 355/788 (45%), Positives = 515/788 (65%), Gaps = 24/788 (3%)
 Frame = -3

Query  2658  VMCFSQTIYRSNGVWEGPDPLAPMIPLFILQIMTAILSSRILNFVLKPFNQPPLVAEILS  2479
             ++C++ T+  +NG+W+G +PL   +PLFILQ+   ++ +R++ +VLKPF QP +++EIL 
Sbjct  11    IICYAPTMITTNGIWQGDNPLDYSLPLFILQLTFVVVVTRVMVYVLKPFRQPRVISEILG  70

Query  2478  GIILGPSMLGNIEEFRKHNFPNHNFETIETMGHFALVLYAFLTGLQMDVKAIVHTGTKSR  2299
             GI+LGPS+LG  E F    FP  +   +ETM +  L+ + FL G++MD+  I  TG KS 
Sbjct  71    GILLGPSVLGRSETFANTIFPLRSVMVLETMANVGLLYFLFLVGVEMDISVIKRTGRKSL  130

Query  2298  IVAVSGSIFPFLIGAGFYFTLQTDTQSM---IGFIFCGSALTVTGFSTLAKILDSKRLLN  2128
              +A++G I PFL G GF F L T   SM      +F G AL+VT F  LA++L   +L+N
Sbjct  131   AIAIAGMILPFLFGLGFSFLLNTKNGSMSQGTYILFLGVALSVTAFPVLARVLAELKLIN  190

Query  2127  TEIGKIAASSALINVALSWVLLTIGLLF----TGSLDNVQWAvlctvgfvvvcvnyVRPL  1960
             TE+G+IA SSALIN   +WVLL + +        SL ++ W VL +V FV+VC+  VRP 
Sbjct  191   TELGRIAMSSALINDMCAWVLLALAIALAENEKASLASL-WVVLSSVAFVLVCIFVVRPA  249

Query  1959  LNWLISKTPEGQGFSEFYICSFIAVICAFGCFTDAMGSHPMIGAFIFGLIMPNNELLRTA  1780
             + W+I +TPEG+ +SEFYIC  +  +   G  TDA+G+H + GAF+FGLI+PN  L  T 
Sbjct  250   IAWMIRRTPEGETYSEFYICLILTGVMISGFITDAIGTHSVFGAFVFGLIIPNGPLGVT-  308

Query  1779  ILDRLEDFVMGILMPVFFLVCGLRTNIFTITDGDTSIFTALALILLACSAKIIAALVASC  1600
             ++++LEDFV G+L+P++F + GLRT+I  I    +     L +I+L+   KI   L+ S 
Sbjct  309   LIEKLEDFVSGLLLPLYFAISGLRTDIRKIAGARSWGILGL-IIILSSLGKIFGTLMVSV  367

Query  1599  YTGMSTNEAIGLGVLTNTKSTMVMIILEVGqvqqvlsvqqysmmvVACLIMTIVATPLAA  1420
             +  M+  E I LG+L NTK  + MIIL VG+ Q+VL  + ++ MV+  + +T + TP+  
Sbjct  368   FYQMTVREGITLGLLMNTKGLVEMIILNVGKDQKVLDDKSFAAMVIVAVFITAIITPIVT  427

Query  1419  R-YCPKQDLEPYKRRTIQNAKPGEELRILACIHGTNNLPAIISLLETSNSTVTSPITAFG  1243
               Y P +   PYKRRTIQ +KP  E R+L C+H   N+P II+LLE SN+T  SPI  + 
Sbjct  428   VIYRPARRFMPYKRRTIQRSKPDVEFRVLVCVHTPRNVPTIINLLEASNATKKSPICVYV  487

Query  1242  VQLLELVGRAPAMMvvhssgsgrhvggsHEEVQTSQIISTFDNYELRSHGVTAQVLTARW  1063
             + L+EL GRA AM++VH++        +  + Q+  II+ F+NYE  +  VT Q LTA  
Sbjct  488   LHLVELTGRASAMLIVHNTRKSGRPALNRTQAQSDHIINAFENYEQHTGCVTVQPLTAIS  547

Query  1062  SYDTMAEDICKMAKEKRAAFLVLPFHKQQGTDGEMEDTNPAIQTVNEGVLLSAPCSVGIL  883
              Y TM EDIC +A++KR+AF+++PFHKQQ  DG ME TNPA + +N+ VL ++PCSVGIL
Sbjct  548   PYSTMHEDICNLAEDKRSAFIIIPFHKQQTVDGGMEATNPAFRMINQNVLANSPCSVGIL  607

Query  882   VERG-------RPNQYAKNIAVLYLGGPDDREALTYARRMSGLPGVHLTVIRFVPAKDVS  724
             V+RG         NQ A ++AVL+ GGPDDREAL Y  RM   PG++LTV+RF+P ++ +
Sbjct  608   VDRGLNGSTRLAANQVAHHVAVLFFGGPDDREALAYGWRMCEHPGINLTVMRFMPGEE-A  666

Query  723   ADGAVEDPDLELELTRETSFVTVSIDPARDKEEDEELLNNFRTETAEDDSKTFMELVLDD  544
              D AV   + E   +R  S VT   D  +D++ DEE +  FR   A ++S  ++E ++++
Sbjct  667   IDTAVASTN-EFGDSRILSVVT---DRDKDRQLDEEYVKEFRMRNANNESIVYIEKIVNN  722

Query  543   EEEFTKAVKSLDDRSFDLYVAGRGRGVSSALTSGLADWCECPELGAVGDllvtsefessf  364
              EE   A++S+D  S DL++ GRG+G+ S LT+GL DW ECPELGA+GDLL +S+F ++ 
Sbjct  723   GEETVTAIQSIDS-SHDLFIVGRGQGMISPLTAGLTDWSECPELGAIGDLLASSDFAATV  781

Query  363   svlvVQQY  340
             SVLVVQQY
Sbjct  782   SVLVVQQY  789



>gb|KFK39941.1| hypothetical protein AALP_AA3G309700 [Arabis alpina]
Length=808

 Score =   600 bits (1546),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/790 (44%), Positives = 516/790 (65%), Gaps = 25/790 (3%)
 Frame = -3

Query  2658  VMCFSQTIYRSNGVWEGPDPLAPMIPLFILQIMTAILSSRILNFVLKPFNQPPLVAEILS  2479
             ++C++ ++  +NGVW+G +PL   +PLF+LQ+   ++ +R+  FVLKPF QP +++EIL 
Sbjct  12    IICYAPSMITTNGVWQGDNPLDFSLPLFVLQLTLVVVVTRLFVFVLKPFRQPRVISEILG  71

Query  2478  GIILGPSMLGNIEEFRKHNFPNHNFETIETMGHFALVLYAFLTGLQMDVKAIVHTGTKSR  2299
             GI+LGPS+LG  ++F    FP  +   +ETM +  L+ + FL G++MD+  +  TG ++ 
Sbjct  72    GIVLGPSVLGRFDKFANTVFPQRSVMVLETMANVGLLYFLFLVGVEMDIMVVRKTGKRAL  131

Query  2298  IVAVSGSIFPFLIGAGFYFTLQTDTQSMIG----FIFCGSALTVTGFSTLAKILDSKRLL  2131
              +A+ G + PFLIGA F F++   ++  +G     +F G AL+VT F  LA+IL   +L+
Sbjct  132   TIAIGGMVLPFLIGAAFSFSMHR-SEDHLGQGTYILFLGVALSVTAFPVLARILAELKLI  190

Query  2130  NTEIGKIAASSALINVALSWVLLTIGLLFTGSLDNVQ----WAvlctvgfvvvcvnyVRP  1963
             NTEIG+I+ S+AL+N   +W+LL + +    S D       W ++ +  F+ +CV  VRP
Sbjct  191   NTEIGRISMSAALVNDMFAWILLALAIALAES-DKTSFASLWVMISSAAFIAICVFVVRP  249

Query  1962  LLNWLISKTPEGQGFSEFYICSFIAVICAFGCFTDAMGSHPMIGAFIFGLIMPNNELLRT  1783
              ++W+I KTPEG+ FSEFYIC  +  +   G  TDA+G+H + GAF+FGL++PN  L  T
Sbjct  250   GISWIIRKTPEGENFSEFYICLILTGVMISGFITDAIGTHSVFGAFVFGLVIPNGPLGLT  309

Query  1782  AILDRLEDFVMGILMPVFFLVCGLRTNIFTITDGDTSIFTALALILLACSAKIIAALVAS  1603
              ++++LEDFV G+L+P+FF + GL+TNI  I  G  +  T + +I LAC+ K+I  +V +
Sbjct  310   -LIEKLEDFVSGLLLPLFFAISGLKTNISAI-QGPATWLTLMLVIFLACAGKVIGTVVVA  367

Query  1602  CYTGMSTNEAIGLGVLTNTKSTMVMIILEVGqvqqvlsvqqysmmvVACLIMTIVATPLA  1423
              + GM   E I LG+L NTK  + MI+L VG+ Q+VL  + ++ MV+  LIMT V TP+ 
Sbjct  368   FFHGMPVREGITLGLLLNTKGLVEMIVLNVGKDQKVLDDETFATMVLVALIMTGVITPIV  427

Query  1422  -ARYCPKQDLEPYKRRTIQNAKPGEELRILACIHGTNNLPAIISLLETSNSTVTSPITAF  1246
                Y P +    YKRRTIQ  KP  ELR+L C+H   N+P II+LLE S+ T  SPI  +
Sbjct  428   TVLYRPVKRSVSYKRRTIQQTKPDSELRVLVCVHTPRNVPTIINLLEASHPTKRSPICIY  487

Query  1245  GVQLLELVGRAPAMMvvhssgsgrhvggsHEEVQTSQIISTFDNYELRSHGVTAQVLTAR  1066
              + L+EL GRA AM++VH++        +  + Q+  II+ F+NYE  +  V  Q LTA 
Sbjct  488   VLHLVELTGRASAMLIVHNTRKSGRPALNRTQAQSDHIINAFENYEQHAAFVAVQPLTAI  547

Query  1065  WSYDTMAEDICKMAKEKRAAFLVLPFHKQQGTDGEMEDTNPAIQTVNEGVLLSAPCSVGI  886
               Y TM ED+C +A++KR +F+++PFHKQQ  DG ME TNPA + VN+ +L ++PCSVGI
Sbjct  548   SPYSTMHEDVCSLAEDKRVSFIIIPFHKQQTVDGGMEATNPAYRLVNQNLLGNSPCSVGI  607

Query  885   LVERG-------RPNQYAKNIAVLYLGGPDDREALTYARRMSGLPGVHLTVIRFVPAKDV  727
             LV+RG         N  +  +AVL+ GGPDDREAL+YA RM+  PG+ LTV+RF+P  DV
Sbjct  608   LVDRGLNGATRLTSNNISLQVAVLFFGGPDDREALSYAWRMAEHPGITLTVLRFIPEDDV  667

Query  726   SADGAVEDPDLELELTRETSFVTVSIDPARDKEEDEELLNNFRTETAEDDSKTFMELVLD  547
             +   +    +   E  ++T+ + +++D  + ++ D+E +N FR   A+ +S  F+E V+ 
Sbjct  668   TEAASTRATN---ESDQKTTNM-LNVDMKKQRQLDDEYVNAFRAANADYESIVFIEKVVS  723

Query  546   DEEEFTKAVKSLDDRSFDLYVAGRGRGVSSALTSGLADWCECPELGAVGDllvtsefess  367
             + EE   AV+S+D  S DL++ GRG G++S LT+GL DW ECPELGA+GDLL +S+F ++
Sbjct  724   NGEETVAAVRSMDS-SHDLFIVGRGEGMASPLTAGLTDWSECPELGAIGDLLASSDFAAT  782

Query  366   fsvlvVQQYV  337
              SVLVVQQYV
Sbjct  783   VSVLVVQQYV  792



>ref|XP_003630280.1| Cation proton exchanger [Medicago truncatula]
 gb|AET04756.1| cation/H+ exchanger 3 [Medicago truncatula]
Length=831

 Score =   597 bits (1540),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/797 (43%), Positives = 504/797 (63%), Gaps = 22/797 (3%)
 Frame = -3

Query  2682  DLDRLGQVVMCFSQTIYRSNGVWEGPDPLAPMIPLFILQIMTAILSSRILNFVLKPFNQP  2503
             D++     ++C+S T+  +NG+W+G +PL   +PLFILQ++  ++++RI  F+LKP  QP
Sbjct  3     DMNATADEMVCYSPTMITTNGIWQGDNPLDYSLPLFILQVILVVIATRIFVFILKPIRQP  62

Query  2502  PLVAEILSGIILGPSMLGNIEEFRKHNFPNHNFETIETMGHFALVLYAFLTGLQMDVKAI  2323
              ++AEIL GI+LGPS+LG  + F    FP  +   IETM +  L+ + FL G+ MD  A+
Sbjct  63    RVIAEILGGIVLGPSVLGRNKTFADAVFPLRSVMVIETMANVGLLYFLFLVGVGMDASAL  122

Query  2322  VHTGTKSRIVAVSGSIFPFLIGAGF-YFTLQTDTQSMIG--FIFCGSALTVTGFSTLAKI  2152
                G KS  +AV+G I PF  GA F  F L+   ++ +G   +  G  L+VT F  LA+I
Sbjct  123   RRIGRKSITIAVAGMILPFGTGALFSIFLLKNTEKAYVGAFVLMLGVVLSVTAFPVLARI  182

Query  2151  LDSKRLLNTEIGKIAASSALINVALSWVLLTIGLLFTGSLDNVQWAvlctvgfvvvcvn-  1975
             L   +L+NTE+G++A SSALIN  LSWVLL I +    + + V  A +  V      V  
Sbjct  183   LAELKLINTELGRVALSSALINDVLSWVLLAIAIAMAEN-ERVTLASIMVVLSSAAFVAF  241

Query  1974  ---yVRPLLNWLISKTPEGQGFSEFYICSFIAVICAFGCFTDAMGSHPMIGAFIFGLIMP  1804
                 VRP++ W+I KTPEG+ FS+FYIC  +A +   G  TDA+G+H + GAF+FGLI+P
Sbjct  242   NVFVVRPIIMWIIRKTPEGETFSDFYICLILAGVMISGFITDAIGTHSVFGAFVFGLIIP  301

Query  1803  NNELLRTAILDRLEDFVMGILMPVFFLVCGLRTNIFTITDGDTSIFTALALILLACSAKI  1624
                 L  A++++LEDFV G+L+P+FF + GL+T++  I DG ++    + L++LAC  K+
Sbjct  302   TGP-LGFALIEKLEDFVSGLLLPLFFAISGLKTDVGLI-DGPSTWAVIILLVILACVGKV  359

Query  1623  IAALVASCYTGMSTNEAIGLGVLTNTKSTMVMIILEVGqvqqvlsvqqysmmvVACLIMT  1444
             +  L+ +    MS ++   LG+L NTK  + +++L +G+ Q+VL    ++ MVV  ++MT
Sbjct  360   VGTLIVALSYQMSVSDGAALGMLMNTKGLVEILVLNIGRDQKVLDEGAFATMVVITIMMT  419

Query  1443  IVATP-LAARYCPKQDLEPYKRRTIQNAKPGEELRILACIHGTNNLPAIISLLETSNSTV  1267
              +  P ++  Y P + +  YKRRTIQ +K   E R+L CIH   N+P +I+LLE SN T 
Sbjct  420   GLIVPGISIIYRPSRGMISYKRRTIQMSKKDAEFRVLVCIHTPRNVPTMINLLEASNPTK  479

Query  1266  TSPITAFGVQLLELVGRAPAMMvvhssgsgrhvggsHEEVQTSQIISTFDNYELRSHGVT  1087
              SPI  + V L+EL GR  A+++VH+S    H   +  E Q+  II+ F+NYE  +  V+
Sbjct  480   KSPICIYVVHLVELTGRTSALLIVHTSRKSDHPALNRTEAQSDHIINAFENYEQHAEHVS  539

Query  1086  AQVLTARWSYDTMAEDICKMAKEKRAAFLVLPFHKQQGTDGEMEDTNPAIQTVNEGVLLS  907
              Q LTA   Y TM EDIC +A+EKR AF+++PFHKQQ  DG ME TN A +TVN+ VL +
Sbjct  540   VQPLTAISPYSTMHEDICTLAEEKRVAFIIIPFHKQQTVDGGMESTNMAFRTVNQNVLAN  599

Query  906   APCSVGILVERGR-------PNQYAKNIAVLYLGGPDDREALTYARRMSGLPGVHLTVIR  748
             +PCSVGILV+RG         +Q + +IAVL+ GGPDDREAL+Y  RMS   G+ LTV+R
Sbjct  600   SPCSVGILVDRGLNSSNRLIADQMSHHIAVLFFGGPDDREALSYGWRMSEHSGISLTVMR  659

Query  747   FVPAKDVSADGAVEDPDLELELTRETSFVTVSIDPARDKEEDEELLNNFRTETAEDDSKT  568
             FVP  +++ +  +   D  +   R    + V  +   +K+ DE+ L+ F      DDS  
Sbjct  660   FVPGDEITMNENISTRDNNVNRQR---VLDVETEEDSEKQMDEKFLHWFTMSHVNDDSIA  716

Query  567   FMELVLDDEEEFTKAVKSLDDRSFDLYVAGRGRGVSSALTSGLADWCECPELGAVGDllv  388
             ++E V+++ EE   A++S+ D  F L++ GRG+GV S LT+GL DW ECPELGA+GDLL 
Sbjct  717   YIEKVVNNGEETVAAIRSMGD-VFGLFIVGRGQGVISPLTAGLTDWSECPELGAIGDLLA  775

Query  387   tsefessfsvlvVQQYV  337
             +S+F +  SVLVVQQYV
Sbjct  776   SSDFATIASVLVVQQYV  792



>ref|XP_010277628.1| PREDICTED: cation/H(+) antiporter 15-like [Nelumbo nucifera]
Length=832

 Score =   597 bits (1538),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 333/809 (41%), Positives = 523/809 (65%), Gaps = 24/809 (3%)
 Frame = -3

Query  2721  MAAPPPPSTGPEVDLDRLGQVVMCFSQTIYRSNGVWEGPDPLAPMIPLFILQIMTAILSS  2542
             MAAP   +TG   +++     ++C+S T+  +NG+W+G +PL   +PLFILQ+   ++ +
Sbjct  1     MAAPE--NTGNNFNMNLTENTIICYSPTMITTNGIWQGDNPLDYSLPLFILQLTLVVVIT  58

Query  2541  RILNFVLKPFNQPPLVAEILSGIILGPSMLGNIEEFRKHNFPNHNFETIETMGHFALVLY  2362
             RIL  +LKP  QP +++EIL GIILGPS+LG    F    FP  +   +ETM +  L+ +
Sbjct  59    RILFVLLKPLRQPKVISEILGGIILGPSVLGRYPNFADSVFPLRSVMMLETMANVGLLYF  118

Query  2361  AFLTGLQMDVKAIVHTGTKSRIVAVSGSIFPFLIGAGF--YFTLQTDTQSMIGF-IFCGS  2191
              FL G++MD+  I  TG K+  ++++G + PF+IGA F  +F  + D+     F +F G 
Sbjct  119   LFLVGVEMDLSVIKRTGKKAMTISLAGMVLPFIIGAVFSIFFYKEKDSMEQGTFMLFLGV  178

Query  2190  ALTVTGFSTLAKILDSKRLLNTEIGKIAASSALINVALSWVLLTIGLLFTGSLDNV---Q  2020
             AL+ T F  LA+IL   +LLNTE+GK+A S+++IN   +W+LL +G+  + +        
Sbjct  179   ALSATAFPVLARILAEIKLLNTELGKLAMSASIINDITAWILLALGIALSENDSTTLISL  238

Query  2019  WAvlctvgfvvvcvnyVRPLLNWLISKTPEGQGFSEFYICSFIAVICAFGCFTDAMGSHP  1840
             W +L T  F+  C+  +RP++ W+I K PEG+   + +IC  +  +   G  TDA+G H 
Sbjct  239   WVILSTSAFIAFCIFVIRPIIEWMIRKNPEGESVKDSHICIILTGVMLCGFITDAIGVHS  298

Query  1839  MIGAFIFGLIMPNNELLRTAILDRLEDFVMGILMPVFFLVCGLRTNIFTITDGDTSIFTA  1660
             + GAF+FGL++PN   L  A++++LEDFV G+L+P+FF + GLRT+ ++I +G  +    
Sbjct  299   LFGAFVFGLVIPNGP-LGAALIEKLEDFVSGLLLPLFFAISGLRTDFWSI-NGFGTWGPL  356

Query  1659  LALILLACSAKIIAALVASCYTGMSTNEAIGLGVLTNTKSTMVMIILEVGqvqqvlsvqq  1480
               LI+L+C  K++   +   +  M   E I LG+L NTK  + +I+L VG+ Q+VLS   
Sbjct  357   GILIILSCIGKVVGTTLVGLFFQMPIREGISLGMLMNTKGLVELIVLNVGRDQKVLSDDV  416

Query  1479  ysmmvVACLIMTIVATPLAAR-YCPKQDLEPYKRRTIQNAKPGEELRILACIHGTNNLPA  1303
             +++MV+  +I+T + +P+    Y P + +  YKRRT+Q +KP  E R+L C+H   ++P 
Sbjct  417   FAVMVIMAVIITSIISPVVTSIYKPAKRIISYKRRTVQKSKPDGEFRMLTCVHNPRSIPT  476

Query  1302  IISLLETSNSTVTSPITAFGVQLLELVGRAPAMMvvhssgsgrhvggsHEEVQTSQIIST  1123
             +I+LLE ++ T  SP+  + + L+EL GRA AM++VH++    H   +  + QT  II+ 
Sbjct  477   MINLLEVTHPTRRSPVCVYALHLVELTGRASAMLIVHNTRQSGHPALNRTQAQTDHIITA  536

Query  1122  FDNYELRSHGVTAQVLTARWSYDTMAEDICKMAKEKRAAFLVLPFHKQQGTDGEMEDTNP  943
             F+N+E ++ GV+ Q LT    Y +M EDIC++A++KR A +++PFHKQQ  DG ME +NP
Sbjct  537   FENFEQKNSGVSVQPLTVISPYSSMHEDICEIAEDKRVALIIVPFHKQQTVDGGMEASNP  596

Query  942   AIQTVNEGVLLSAPCSVGILVERG-------RPNQYAKNIAVLYLGGPDDREALTYARRM  784
             A +T+N+ VL +APCSVGILV+RG          Q A NIAVL+ GGPDDREAL YARRM
Sbjct  597   AFRTINQNVLANAPCSVGILVDRGFSGSTKSASGQTAHNIAVLFFGGPDDREALAYARRM  656

Query  783   SGLPGVHLTVIRFVPAKDVSADGAVEDPDLELELTRETSFVTVSIDPARDKEEDEELLNN  604
             +  P V+LTV+RFVP ++ + D  V+    +    + +S +TV  +  ++K+ D+E ++ 
Sbjct  657   AEHPAVNLTVVRFVPGEE-ATDAVVQSYTDD----QGSSILTVFTENDKEKKLDDEYIHE  711

Query  603   FRTETAEDDSKTFMELVLDDEEEFTKAVKSLDDRSFDLYVAGRGRGVSSALTSGLADWCE  424
             F+T+   D+S T++E ++++ EE    ++S+ + ++DLY+ GRG+G+ S LT+GL DW E
Sbjct  712   FKTKVTGDESITYIEKIVNNGEETVALIRSMGN-AYDLYIVGRGQGIVSPLTAGLTDWSE  770

Query  423   CPELGAVGDllvtsefessfsvlvVQQYV  337
             CPELGA+GDLL +S+F  + SVLVVQQYV
Sbjct  771   CPELGAIGDLLASSDFGVTVSVLVVQQYV  799



>emb|CDY37213.1| BnaA09g08340D [Brassica napus]
Length=822

 Score =   594 bits (1532),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 337/794 (42%), Positives = 509/794 (64%), Gaps = 37/794 (5%)
 Frame = -3

Query  2658  VMCFSQTIYRSNGVWEGPDPLAPMIPLFILQIMTAILSSRILNFVLKPFNQPPLVAEILS  2479
             ++C++ ++  +NGVW+G +PL   +PLF+LQ+   +L +R   FVLKPF QP +++EIL 
Sbjct  12    IICYAPSMITTNGVWQGDNPLDFSLPLFVLQLTLVVLVTRFFVFVLKPFRQPRVISEILG  71

Query  2478  GIILGPSMLGNIEEFRKHNFPNHNFETIETMGHFALVLYAFLTGLQMDVKAIVHTGTKSR  2299
             GI+LGPS+LG  ++F    FP  +   +ETM +  L+ + FL G++MD+  +  TG ++ 
Sbjct  72    GIVLGPSVLGRYDKFANTVFPQRSVMVLETMANVGLLYFLFLVGVEMDIMVVRKTGRRAL  131

Query  2298  IVAVSGSIFPFLIGAGFYFTLQTDTQSM---IGFIFCGSALTVTGFSTLAKILDSKRLLN  2128
              +A+ G + PFLIGA F F++      +      +F G AL+VT F  LA+IL   +L+N
Sbjct  132   TIAIGGMVLPFLIGAAFSFSMHRSDDHLGQGTYILFLGVALSVTAFPVLARILAELKLIN  191

Query  2127  TEIGKIAASSALINVALSWVLLTIGLLFTGSLDN---VQWAvlctvgfvvvcvnyVRPLL  1957
             TEIG+I+ S+AL+N   +W+LL + +    S        W ++ +  F+  CV  VRP +
Sbjct  192   TEIGRISMSAALVNDMFAWILLALAIALAESEKTSFASLWVMISSAAFIAACVFVVRPGI  251

Query  1956  NWLISKTPEGQGFSEFYICSFIAVICAFGCFTDAMGSHPMIGAFIFGLIMPNNELLRTAI  1777
             +W+I KTPEG+ FSEFYIC  +  +   G  TD++G+H + GAF+FGL++PN  L  T +
Sbjct  252   SWIIRKTPEGENFSEFYICLILTGVMISGFITDSIGTHSVFGAFVFGLVIPNGPLGLT-L  310

Query  1776  LDRLEDFVMGILMPVFFLVCGLRTNIFTITDGDTSIFTALALILLACSAKIIAALVASCY  1597
             +++LEDFV G+L+P+FF + GL+TNI +I +G  +  T + +I+LAC+ K+I  ++ + +
Sbjct  311   IEKLEDFVSGLLLPLFFAISGLKTNIASI-EGPATWITLMLVIVLACAGKVIGTVIVAFF  369

Query  1596  TGMSTNEAIGLGVLTNTKSTMVMIILEVGqvqqvlsvqqysmmvVACLIMTIVATPLAA-  1420
              GM   E I +G+L NTK  + MI+L VG+ Q+VL  + ++ MV+  L+MT V TP+   
Sbjct  370   HGMPVREGITIGLLLNTKGLVEMIVLNVGKDQKVLDDETFATMVLIALVMTGVITPIVTI  429

Query  1419  RYCPKQDLEPYKRRTIQNAKPGEELRILACIHGTNNLPAIISLLETSNSTVTSPITAFGV  1240
              Y P +    YKRRTIQ  KP  ELR+L C+H   N+P II+LLE S++T  SPI  + +
Sbjct  430   LYKPVRRSVSYKRRTIQQTKPDSELRVLVCVHTPRNVPTIINLLEASHATKRSPICIYVL  489

Query  1239  QLLELVGRAPAMMvvhssgsgrhvggsHEEVQTSQIISTFDNYELRSHGVTAQVLTARWS  1060
              L+EL GRA AM++VHS+        +  + Q+  II+ F+NYE  +  V  Q LTA   
Sbjct  490   HLVELTGRASAMLIVHSTRKSGRPALNRTQAQSDHIINAFENYEQHAAFVAVQPLTAISP  549

Query  1059  YDTMAEDICKMAKEKRAAFLVLPFHKQQGTDGEMEDTNPAIQTVNEGVLLSAPCSVGILV  880
             Y TM ED+C +A++KR +F+++PFHKQQ  DG ME TNPA + VN+ +L ++PCSVGILV
Sbjct  550   YSTMHEDVCSLAEDKRVSFIIIPFHKQQTVDGGMEATNPAYRLVNQNLLGNSPCSVGILV  609

Query  879   ERG-------RPNQYAKNIAVLYLGGPDDREALTYARRMSGLPGVHLTVIRFVPAKDVSA  721
             +RG         N  +  +AVL+ GGPDDREAL YA RM+  PG+ L+V+RF+P +DV+ 
Sbjct  610   DRGLNGATRLTSNNISLQVAVLFFGGPDDREALAYAWRMAEHPGISLSVLRFIPDEDVA-  668

Query  720   DGAVEDPDLELELTRETSFVTVSIDPARDKEEDEELLNNFRTETAEDDSKTFMELVLDDE  541
                  +P         +S   +++D  + ++ D+E +N FR   AE ++  +++ V+ + 
Sbjct  669   -----EP--------ASSTRNMNVDMKKQRQLDDEYINTFRAANAEHETILYVDKVVSNG  715

Query  540   EEFTKAVKSLD-------DRSFDLYVAGRGRGVSSALTSGLADWCECPELGAVGDllvts  382
             EE   AV+S+D       D S DL++ GRG G+ S LT+GL DW ECPELGA+GDLL +S
Sbjct  716   EETVAAVRSMDSSHDLSMDSSHDLFIVGRGEGMLSPLTAGLTDWSECPELGAIGDLLASS  775

Query  381   efessfsvlvVQQY  340
             +F ++ SVLVVQQY
Sbjct  776   DFAATVSVLVVQQY  789



>emb|CDX81450.1| BnaC09g08610D [Brassica napus]
Length=814

 Score =   593 bits (1530),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 337/787 (43%), Positives = 509/787 (65%), Gaps = 31/787 (4%)
 Frame = -3

Query  2658  VMCFSQTIYRSNGVWEGPDPLAPMIPLFILQIMTAILSSRILNFVLKPFNQPPLVAEILS  2479
             ++C++ ++  +NGVW+G +PL   +PLF+LQ+   +L +R   FVLKPF QP +++EIL 
Sbjct  12    IICYAPSMITTNGVWQGDNPLDFSLPLFVLQLTLVVLVTRFFVFVLKPFRQPRVISEILG  71

Query  2478  GIILGPSMLGNIEEFRKHNFPNHNFETIETMGHFALVLYAFLTGLQMDVKAIVHTGTKSR  2299
             GI+LGPS+LG  ++F    FP  +   +ETM +  L+ + FL G++MD+  +  TG ++ 
Sbjct  72    GIVLGPSVLGRYDKFANTVFPQRSVMVLETMANVGLLYFLFLVGVEMDIMVVRKTGRRAL  131

Query  2298  IVAVSGSIFPFLIGAGFYFTLQTDTQSM---IGFIFCGSALTVTGFSTLAKILDSKRLLN  2128
              +A+ G + PFLIGA F F++      +      +F G AL+VT F  LA+IL   +L+N
Sbjct  132   TIAIGGMVLPFLIGAAFSFSMHRSDDHLGQGTYILFLGVALSVTAFPVLARILAELKLIN  191

Query  2127  TEIGKIAASSALINVALSWVLLTIGLLFTGSLDN---VQWAvlctvgfvvvcvnyVRPLL  1957
             TEIG+I+ S+AL+N   +W+LL + +    S  +     W ++ +  F+ VCV  VRP +
Sbjct  192   TEIGRISMSAALVNDMFAWILLALAIALAESEKSSFASLWVMISSAAFIAVCVFVVRPGI  251

Query  1956  NWLISKTPEGQGFSEFYICSFIAVICAFGCFTDAMGSHPMIGAFIFGLIMPNNELLRTAI  1777
             +W+I KTPEG+ FSEFYIC  +  +   G  TD++G+H + GAF+FGL++PN  L  T +
Sbjct  252   SWIIRKTPEGENFSEFYICLILTGVMISGFITDSIGTHSVFGAFVFGLVIPNGPLGLT-L  310

Query  1776  LDRLEDFVMGILMPVFFLVCGLRTNIFTITDGDTSIFTALALILLACSAKIIAALVASCY  1597
             +++LEDFV G+L+P+FF + GL+TNI +I +G  +  T + +I+LAC+ K+I  ++ + +
Sbjct  311   IEKLEDFVSGLLLPLFFAISGLKTNIASI-EGPATWLTLMLVIVLACAGKVIGTVIVAFF  369

Query  1596  TGMSTNEAIGLGVLTNTKSTMVMIILEVGqvqqvlsvqqysmmvVACLIMTIVATPLA-A  1420
              GM   E I +G+L NTK  + MI+L VG+ Q+VL  + ++ MV+  L+MT V TP+   
Sbjct  370   HGMPVREGITIGLLLNTKGLVEMIVLNVGKDQKVLDDETFATMVLIALVMTGVITPIVTV  429

Query  1419  RYCPKQDLEPYKRRTIQNAKPGEELRILACIHGTNNLPAIISLLETSNSTVTSPITAFGV  1240
              Y P +    YKRRTIQ  KP  ELR+L C+H   N+P II+LLE S+ T  SPI  + +
Sbjct  430   LYKPVRRSVSYKRRTIQQTKPDSELRVLVCVHTPRNVPTIINLLEASHPTKRSPICIYVL  489

Query  1239  QLLELVGRAPAMMvvhssgsgrhvggsHEEVQTSQIISTFDNYELRSHGVTAQVLTARWS  1060
              L+EL GRA AM++VHS+        +  + Q+  II+ F+NYE  +  V  Q LTA   
Sbjct  490   HLVELTGRASAMLIVHSTRKSGRPALNRTQAQSDHIINAFENYEQHAAFVAVQPLTAISP  549

Query  1059  YDTMAEDICKMAKEKRAAFLVLPFHKQQGTDGEMEDTNPAIQTVNEGVLLSAPCSVGILV  880
             Y TM ED+C +A++KR +F+++PFHKQQ  DG ME TNPA + VN+ +L ++PCSVGILV
Sbjct  550   YSTMHEDVCSLAEDKRVSFIIIPFHKQQTVDGGMEATNPAYRLVNQNLLGNSPCSVGILV  609

Query  879   ERG-------RPNQYAKNIAVLYLGGPDDREALTYARRMSGLPGVHLTVIRFVPAKDVSA  721
             +RG         N  +  +AVL+ GGPDDREAL YA RM+  PG+ L+V+RF+P +DV+ 
Sbjct  610   DRGLNGATRLTSNTISLQVAVLFFGGPDDREALAYAWRMAEHPGISLSVLRFIPDEDVA-  668

Query  720   DGAVEDPDLELELTRETSFVTVSIDPARDKEEDEELLNNFRTETAEDDSKTFMELVLDDE  541
                  +P         +S   +++D  + ++ D+E +N FR   AE ++  +++ V+ + 
Sbjct  669   -----EP--------ASSTRNMNVDMKKQRQLDDEYINTFRAANAEHETILYVDKVVSNG  715

Query  540   EEFTKAVKSLDDRSFDLYVAGRGRGVSSALTSGLADWCECPELGAVGDllvtsefessfs  361
             EE   AV+S+D  S DL++ GRG G+ S LT+GL DW ECPELGA+GDLL +S+F ++ S
Sbjct  716   EETVAAVRSMDS-SHDLFIVGRGEGMLSPLTAGLTDWSECPELGAIGDLLASSDFAATVS  774

Query  360   vlvVQQY  340
             VLVVQQY
Sbjct  775   VLVVQQY  781



>ref|XP_009112379.1| PREDICTED: cation/H(+) antiporter 15 [Brassica rapa]
Length=814

 Score =   593 bits (1530),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 337/788 (43%), Positives = 508/788 (64%), Gaps = 31/788 (4%)
 Frame = -3

Query  2658  VMCFSQTIYRSNGVWEGPDPLAPMIPLFILQIMTAILSSRILNFVLKPFNQPPLVAEILS  2479
             ++C++ ++  +NGVW+G +PL   +PLF+LQ+   +L +R   FVLKPF QP +++EIL 
Sbjct  12    IICYAPSMITTNGVWQGDNPLDFSLPLFVLQLTLVVLVTRFFVFVLKPFRQPRVISEILG  71

Query  2478  GIILGPSMLGNIEEFRKHNFPNHNFETIETMGHFALVLYAFLTGLQMDVKAIVHTGTKSR  2299
             GI+LGPS+LG  ++F    FP  +   +ETM +  L+ + FL G++MD+  +  TG ++ 
Sbjct  72    GIVLGPSVLGRYDKFANTVFPQRSVMVLETMANVGLLYFLFLVGVEMDIMVVRKTGRRAL  131

Query  2298  IVAVSGSIFPFLIGAGFYFTLQTDTQSM---IGFIFCGSALTVTGFSTLAKILDSKRLLN  2128
              +A+ G + PFLIGA F F++      +      +F G AL+VT F  LA+IL   +L+N
Sbjct  132   TIAIGGMVLPFLIGAAFSFSMHRSDDHLGQGTYILFLGVALSVTAFPVLARILAELKLIN  191

Query  2127  TEIGKIAASSALINVALSWVLLTIGLLFTGSLDN---VQWAvlctvgfvvvcvnyVRPLL  1957
             TEIG+I+ S+AL+N   +W+LL + +    S        W ++ +  F+  CV  VRP +
Sbjct  192   TEIGRISMSAALVNDMFAWILLALAIALAESEKTSFASLWVMISSAAFIAACVFVVRPGI  251

Query  1956  NWLISKTPEGQGFSEFYICSFIAVICAFGCFTDAMGSHPMIGAFIFGLIMPNNELLRTAI  1777
             +W+I KTPEG+ FSEFYIC  +  +   G  TD++G+H + GAF+FGL++PN  L  T +
Sbjct  252   SWIIRKTPEGENFSEFYICLILTGVMISGFITDSIGTHSVFGAFVFGLVIPNGPLGLT-L  310

Query  1776  LDRLEDFVMGILMPVFFLVCGLRTNIFTITDGDTSIFTALALILLACSAKIIAALVASCY  1597
             +++LEDFV G+L+P+FF + GL+TNI +I +G  +  T + +I+LAC+ K+I  ++ + +
Sbjct  311   IEKLEDFVSGLLLPLFFAISGLKTNIASI-EGPATWITLMLVIVLACAGKVIGTVIVAFF  369

Query  1596  TGMSTNEAIGLGVLTNTKSTMVMIILEVGqvqqvlsvqqysmmvVACLIMTIVATPLAA-  1420
              GM   E I +G+L NTK  + MI+L VG+ Q+VL  + ++ MV+  L+MT V TP+   
Sbjct  370   HGMPVREGITIGLLLNTKGLVEMIVLNVGKDQKVLDDETFATMVLIALVMTGVITPIVTI  429

Query  1419  RYCPKQDLEPYKRRTIQNAKPGEELRILACIHGTNNLPAIISLLETSNSTVTSPITAFGV  1240
              Y P +    YKRRTIQ  KP  ELR+L C+H   N+P II+LLE S++T  SPI  + +
Sbjct  430   LYKPVRRSVSYKRRTIQQTKPDSELRVLVCVHTPRNVPTIINLLEASHATKRSPICIYVL  489

Query  1239  QLLELVGRAPAMMvvhssgsgrhvggsHEEVQTSQIISTFDNYELRSHGVTAQVLTARWS  1060
              L+EL GRA AM++VHS+        +  + Q+  II+ F+NYE  +  V  Q LTA   
Sbjct  490   HLVELTGRASAMLIVHSTRKSGRPALNRTQAQSDHIINAFENYEQHAAFVAVQPLTAISP  549

Query  1059  YDTMAEDICKMAKEKRAAFLVLPFHKQQGTDGEMEDTNPAIQTVNEGVLLSAPCSVGILV  880
             Y TM ED+C +A++KR +F+++PFHKQQ  DG ME TNPA + VN+ +L ++PCSVGILV
Sbjct  550   YSTMHEDVCSLAEDKRVSFIIIPFHKQQTVDGGMEATNPAYRLVNQNLLGNSPCSVGILV  609

Query  879   ERG-------RPNQYAKNIAVLYLGGPDDREALTYARRMSGLPGVHLTVIRFVPAKDVSA  721
             +RG         N  +  +AVL+ GGPDDREAL YA RM+  PG+ L+V+RF+P +DV+ 
Sbjct  610   DRGLNGATRLTSNTISLQVAVLFFGGPDDREALAYAWRMAEHPGISLSVLRFIPDEDVA-  668

Query  720   DGAVEDPDLELELTRETSFVTVSIDPARDKEEDEELLNNFRTETAEDDSKTFMELVLDDE  541
                  +P         +S   +++D  + +  D+E +N FR   AE ++  +++ V+ + 
Sbjct  669   -----EP--------ASSTRNMNVDMKKQRLLDDEYINTFRAANAEHETILYVDKVVSNG  715

Query  540   EEFTKAVKSLDDRSFDLYVAGRGRGVSSALTSGLADWCECPELGAVGDllvtsefessfs  361
             EE   AV+S+D  S DL++ GRG G+ S LT+GL DW ECPELGA+GDLL +S+F ++ S
Sbjct  716   EETVAAVRSMDS-SHDLFIVGRGEGMLSPLTAGLTDWSECPELGAIGDLLASSDFAATVS  774

Query  360   vlvVQQYV  337
             VLVVQQYV
Sbjct  775   VLVVQQYV  782



>ref|XP_010277629.1| PREDICTED: cation/H(+) antiporter 15-like [Nelumbo nucifera]
Length=857

 Score =   593 bits (1528),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 334/769 (43%), Positives = 491/769 (64%), Gaps = 22/769 (3%)
 Frame = -3

Query  2661  VVMCFSQTIYRSNGVWEGPDPLAPMIPLFILQIMTAILSSRILNFVLKPFNQPPLVAEIL  2482
             +++C+S  +  ++G+W G  P    +P+F+LQI   I+++R L F+LKP  QP +++EIL
Sbjct  24    MIVCYSPKMITTSGIWVGSMPWDYSLPVFLLQITLIIITTRFLVFILKPLRQPKVISEIL  83

Query  2481  SGIILGPSMLGNIEEFRKHNFPNHNFETIETMGHFALVLYAFLTGLQMDVKAIVHTGTKS  2302
              G++LGPS++G I +F    FP  +   +ETM +  L+ + FL G++MD+  I   G K+
Sbjct  84    GGVLLGPSVMGRIPKFADIVFPLRSVLILETMANIGLLYFLFLVGIEMDLYVIKRIGKKA  143

Query  2301  RIVAVSGSIFPFLIGAGFYFTLQTDTQSMIG--FIFCGSALTVTGFSTLAKILDSKRLLN  2128
               +A+ G I PFLIG    F LQT      G   +F G  L+VT F  LA+IL   +LLN
Sbjct  144   LTIAIIGMIPPFLIGISLSFFLQTSEDVGPGTFLLFLGVTLSVTAFPVLARILAELKLLN  203

Query  2127  TEIGKIAASSALINVALSWVL--LTIGLLFTGSLD-NVQWAvlctvgfvvvcvnyVRPLL  1957
             TE+GK+A S+A+IN   +W+L  L + L  TG+        V+  V FV+ C+  +RP +
Sbjct  204   TELGKLALSAAIINDLCAWILISLAVSLAKTGATRFASLLVVVSAVVFVMCCIFVIRPAI  263

Query  1956  NWLISKTPEGQGFSEFYICSFIAVICAFGCFTDAMGSHPMIGAFIFGLIMPNNELLRTAI  1777
              W+I +TPE   ++EFYIC  ++ +   G  TD +G+HP+ GAF+FGL++PN  L  T I
Sbjct  264   AWIIRRTPESSNYNEFYICLIVSGVMICGLITDTLGTHPIFGAFVFGLVIPNGPLGAT-I  322

Query  1776  LDRLEDFVMGILMPVFFLVCGLRTNIFTITDGDTSIFTALALILLACSAKIIAALVASCY  1597
             +D+L+DFV   L+P+FF + GLRTNI+ I  G +++   +  I L+C+ K +A ++ S  
Sbjct  323   IDKLQDFVSVFLLPLFFAISGLRTNIWAI-HGSSTLGLLILAIFLSCTGKAVATIIVSVV  381

Query  1596  TGMSTNEAIGLGVLTNTKSTMVMIILEVGqvqqvlsvqqysmmvVACLIMTIVATP-LAA  1420
               M   E++ LG+L NTK  + +IIL  G+ Q+VL  Q ++++V+  +IMT + TP + A
Sbjct  382   NHMPMQESVALGLLMNTKGPIEIIILSAGRDQKVLDDQSFAILVIVAVIMTSIITPVITA  441

Query  1419  RYCPKQDLEPYKRRTIQNAKPGEELRILACIHGTNNLPAIISLLETSNSTVTSPITAFGV  1240
              Y P +   PYKRRT+Q  K   ELRILAC+H   N+P II+L++ S+ T  SPI  F +
Sbjct  442   IYKPARPFIPYKRRTVQWPKRDAELRILACVHTPRNVPTIINLIDASHPTKKSPICVFAL  501

Query  1239  QLLELVGRAPAMMvvhssgsgrhvggsHE-EVQTSQIISTFDNYELRSHGVTAQVLTARW  1063
              L+EL GR+ AM++VH+S         +  + Q+  IIS F+NYE  S GV+ Q LTA  
Sbjct  502   HLVELTGRSSAMLIVHNSHKSGGHPALNRTQAQSDHIISAFENYEQHSGGVSVQPLTAIS  561

Query  1062  SYDTMAEDICKMAKEKRAAFLVLPFHKQQGTDGEMEDTNPAIQTVNEGVLLSAPCSVGIL  883
              Y TM EDIC +A++KRA+ ++LPFHKQQ  DG ME TNPA + +N+ VL +APCSVGIL
Sbjct  562   RYSTMHEDICNLAEDKRASLILLPFHKQQTLDGSMEATNPAFRGINQNVLATAPCSVGIL  621

Query  882   VERG-------RPNQYAKNIAVLYLGGPDDREALTYARRMSGLPGVHLTVIRFVPAKDVS  724
             V+RG          +   ++AVL+ GGPDDREAL Y  RM+  PGV LTV+RF+P +D +
Sbjct  622   VDRGLDGSTRVAATETTHHVAVLFFGGPDDREALAYGWRMAEHPGVCLTVLRFLPGED-A  680

Query  723   ADGAVEDPDLELELTRETSFVTVSIDPARDKEEDEELLNNFRTETAEDDSKTFMELVLDD  544
             AD  VE P  +   TR+   +TV  D  R+K+ D+E +N FR +   D+S ++ E ++++
Sbjct  681   ADPVVE-PSSD---TRDLRILTVITDNEREKKLDDEYINEFRIKNTNDESISYSEKIVNN  736

Query  543   EEEFTKAVKSLDDRSFDLYVAGRGRGVSSALTSGLADWCECPELGAVGD  397
              EE    V+SLD+ + DLY+ GRG+G+ S LT+GL DW ECPELGA+GD
Sbjct  737   GEETAAVVRSLDN-THDLYIVGRGQGMISPLTAGLTDWSECPELGAIGD  784



>ref|XP_010680215.1| PREDICTED: cation/H(+) antiporter 15 [Beta vulgaris subsp. vulgaris]
Length=844

 Score =   588 bits (1516),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 356/791 (45%), Positives = 510/791 (64%), Gaps = 25/791 (3%)
 Frame = -3

Query  2658  VMCFSQTIYRSNGVWEGPDPLAPMIPLFILQIMTAILSSRILNFVLKPFNQPPLVAEILS  2479
             ++C++ T+  +NGVW+G +PL   +PLFILQ+   ++ +R+L F+LKP  QP ++AEIL 
Sbjct  16    IVCYAPTMITTNGVWQGDNPLDYSLPLFILQLTLVVVVTRVLVFLLKPLRQPRVIAEILG  75

Query  2478  GIILGPSMLGNIEEFRKHNFPNHNFETIETMGHFALVLYAFLTGLQMDVKAIVHTGTKSR  2299
             G+ILGPS+LG  ++F    FP  +   +ETM +  L+ + FL G++MD+  +  TG K+ 
Sbjct  76    GVILGPSVLGRNKQFANTIFPLRSVMVLETMANIGLLYFLFLVGVEMDIAVLKRTGRKAI  135

Query  2298  IVAVSGSIFPFLIGAGFYFTLQ--TDTQSMIGFI-FCGSALTVTGFSTLAKILDSKRLLN  2128
              +A+ G I PF++G  F   +Q   D      F+ F G AL VT F  LA++L   +L+N
Sbjct  136   SIAIGGMIIPFVVGCTFSLLMQQKNDNAHHGTFVLFLGVALAVTAFPVLARVLAELKLIN  195

Query  2127  TEIGKIAASSALINVALSWVLLTIGLLF----TGSLDNVQWAvlctvgfvvvcvnyVRPL  1960
             TEIG+IA SSAL+N   +WVLL + +      + SL ++ W +L +  FVVVC+  VRP 
Sbjct  196   TEIGRIAMSSALVNDICAWVLLALAIALAETNSSSLTSL-WVILSSTAFVVVCIFLVRPC  254

Query  1959  LNWLISKTPEGQGFSEFYICSFIAVICAFGCFTDAMGSHPMIGAFIFGLIMPNNELLRTA  1780
             + W+I +TPEG+ FS+FYIC  +  +   G  TDA+G+H + GAF+FGLI+PN  L  T 
Sbjct  255   IMWMIRRTPEGEPFSDFYICLILTGVMISGFITDAIGTHSVFGAFVFGLIIPNGPLGVT-  313

Query  1779  ILDRLEDFVMGILMPVFFLVCGLRTNIFTITDGDTSIFTALALILLACSAKIIAALVASC  1600
             ++++LEDFV G+L+P+FF + GL+T+I  I  G    F  +A+I+LAC+ K++     S 
Sbjct  314   LIEKLEDFVSGLLLPLFFAISGLKTDIRQI-GGLKVWFNLMAVIILACAGKVLGTAGVSL  372

Query  1599  YTGMSTNEAIGLGVLTNTKSTMVMIILEVGqvqqvlsvqqysmmvVACLIMTIVATPLAA  1420
                M   E + LG+L NTK  + MI+L VG+ Q+VL    +S+MV++ LIMT V  PL  
Sbjct  373   LYKMPFREGVTLGLLMNTKGLVEMIVLNVGKDQKVLDDASFSIMVISALIMTGVIGPLVT  432

Query  1419  -RYCPKQDLEPYKRRTIQNAKPGEELRILACIHGTNNLPAIISLLETSNSTVTSPITAFG  1243
               Y P +    YKRRTIQ +KP  ELRIL CIH   N+P II+LLE S+ T  S I  + 
Sbjct  433   IIYRPARRSVAYKRRTIQKSKPDAELRILTCIHTPRNVPTIINLLEASHPTRRSSICVYV  492

Query  1242  VQLLELVGRAPAMMvvhssgsgrhvggsHEEVQTSQIISTFDNYELRSH--GVTAQVLTA  1069
             + L+EL GRA AM++VH++        +  + Q+  II+ F+NYE  +    V+ Q LTA
Sbjct  493   LHLVELTGRASAMLIVHNTRKSGGGAATRTQAQSDHIINAFENYEQHTQTGSVSIQPLTA  552

Query  1068  RWSYDTMAEDICKMAKEKRAAFLVLPFHKQQGTDGEMEDTNPAIQTVNEGVLLSAPCSVG  889
                Y +M EDIC +A+EKR AF+++PFHKQQ  DG ME TNPA + +N+ +L +APCSVG
Sbjct  553   ISPYSSMHEDICHLAEEKRVAFIIIPFHKQQTVDGGMESTNPAFRIINQNLLANAPCSVG  612

Query  888   ILVERG-------RPNQYAKNIAVLYLGGPDDREALTYARRMSGLPGVHLTVIRFVPAKD  730
             ILV+RG         NQ + NI VL+ GGPDDREAL YA RMS  P + LTV+RF+P  D
Sbjct  613   ILVDRGLSGSTRLAANQVSHNIGVLFFGGPDDREALAYALRMSEHPTITLTVMRFLPGDD  672

Query  729   VSADGAVEDPDLELELTRETSFVTVSIDPARDKEEDEELLNNFRTETAEDDSKTFMELVL  550
              S   +VE P  E     +   +TV  D  ++K+ DEE +N+F+ + A  DS T+ E ++
Sbjct  673   ASRTASVE-PSRE---PGDPRVLTVITDAEQEKQLDEEFINDFKMKIANSDSITYSERIV  728

Query  549   DDEEEFTKAVKSLDDRSFDLYVAGRGRGVSSALTSGLADWCECPELGAVGDllvtsefes  370
             ++ EE   ++++++    DLYV GRG+GV S LT+GL DW ECPELGA+GD+L +S+F S
Sbjct  729   NNGEETVASIRAIES-VHDLYVVGRGQGVISPLTAGLTDWSECPELGAIGDMLASSDFAS  787

Query  369   sfsvlvVQQYV  337
             + SVLVVQQYV
Sbjct  788   TSSVLVVQQYV  798



>ref|XP_003602627.1| Cation proton exchanger [Medicago truncatula]
 gb|AES72878.1| cation/H+ exchanger 3 [Medicago truncatula]
Length=838

 Score =   588 bits (1515),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 343/796 (43%), Positives = 498/796 (63%), Gaps = 26/796 (3%)
 Frame = -3

Query  2676  DRLGQVVMCFSQTIYRSNGVWEGPDPLAPMIPLFILQIMTAILSSRILNFVLKPFNQPPL  2497
             ++ G  ++C++  +  +NG+W+G  PL   +PLFILQ+   + ++RI  FVLKPF QP +
Sbjct  6     NKTGDYIVCYAPAMITTNGIWQGDSPLEFSLPLFILQLTLVVAATRIFVFVLKPFRQPRV  65

Query  2496  VAEILSGIILGPSMLGNIEEFRKHNFPNHNFETIETMGHFALVLYAFLTGLQMDVKAIVH  2317
             +AEIL G+ILGPS+LG  E F    FP  +   IETM +  L+ + FL G++MD+  +  
Sbjct  66    IAEILGGVILGPSVLGKNEIFANAVFPLRSVMVIETMANVGLLYFLFLVGVEMDITVLRS  125

Query  2316  TGTKSRIVAVSGSIFPFLIGAGFYFTLQT----DTQSMIGFIFCGSALTVTGFSTLAKIL  2149
              G K+   A++G + PF++G  F F L+     DT      +F G AL+VT F  LA+IL
Sbjct  126   VGRKAVAAAIAGMVLPFILGGAFIFFLKRESHCDTNRGTYVLFLGVALSVTAFPVLARIL  185

Query  2148  DSKRLLNTEIGKIAASSALINVALSWVLLTIGLLFTGSLDN---VQWAvlctvgfvvvcv  1978
                +L+NT+IGK+A S+ALI+   +W+LL + +    +        W +L    FV +C+
Sbjct  186   AELKLINTDIGKLALSAALISDVCAWILLALAIAMAENQATSFASLWVLLSAAAFVAICI  245

Query  1977  nyVRPLLNWLISKTPEGQGFSEFYICSFIAVICAFGCFTDAMGSHPMIGAFIFGLIMPNN  1798
               VRP  +W++ KTPEG+ FSEFYI   +A +   G  TDA+G+H + GAF+FGL +PN 
Sbjct  246   YAVRPAASWIVQKTPEGESFSEFYISLILAGVMVSGFITDAIGTHSVFGAFVFGLAIPNG  305

Query  1797  ELLRTAILDRLEDFVMGILMPVFFLVCGLRTNIFTITDGDTSIFTALALILLACSAKIIA  1618
               L  +++++LEDFV G+L+P+FF + GL+TNI  I    T +   L +I LAC  KI+ 
Sbjct  306   P-LGVSLVEKLEDFVSGLLLPLFFAISGLKTNIGLIKGSFTWVILIL-VIFLACIGKIVG  363

Query  1617  ALVASCYTGMSTNEAIGLGVLTNTKSTMVMIILEVGqvqqvlsvqqysmmvVACLIMTIV  1438
              L  + Y  M   E   LG+L NTK  + MI+L VG+ Q+V   + +++MV+  +IMT +
Sbjct  364   TLAVAIYYRMPIREGATLGLLMNTKGLVEMIVLNVGKDQKVFDEESFAVMVIITVIMTGI  423

Query  1437  ATP-LAARYCPKQDLEPYKRRTIQNAKPGEELRILACIHGTNNLPAIISLLETSNSTVTS  1261
               P ++  Y P +    YKRRTIQ +KP  E ++L C+H   N+P +ISLL  SN T  S
Sbjct  424   IVPAVSIIYRPSRRNIYYKRRTIQKSKPDAEFKVLVCVHSPRNVPTMISLLGASNPTKRS  483

Query  1260  PITAFGVQLLELVGRAPAMMvvhssgsgrhvggsHEEVQTSQIISTFDNYELRSHGVTAQ  1081
             PI A+ + L+EL GR  AM++VH++    H   +  E Q+  IIS F NYE  S  VT Q
Sbjct  484   PICAYVLHLVELCGRTSAMLIVHNTNKPEHQALNRTEAQSDHIISAFKNYEKHSSFVTVQ  543

Query  1080  VLTARWSYDTMAEDICKMAKEKRAAFLVLPFHKQQGTDGEMEDTNPAIQTVNEGVLLSAP  901
              L+A   Y TM EDIC +A++KR + +++PFHKQQ  DG ME TN A +T+N+ VL +AP
Sbjct  544   PLSAVSPYSTMHEDICNLAEDKRVSLIIVPFHKQQTVDGAMEATNMAFRTINQNVLANAP  603

Query  900   CSVGILVERG-------RPNQYAKNIAVLYLGGPDDREALTYARRMSGLPGVHLTVIRFV  742
             CSVGILV+RG         +Q + ++AV++ GGPDDREAL Y  RM    G  LT++RFV
Sbjct  604   CSVGILVDRGLSGSNRLASDQVSHHVAVMFFGGPDDREALCYGWRMLEHSGTSLTIMRFV  663

Query  741   PAKDVSADGAVEDPDLELEL-TRETSFVTVSIDPARDKEEDEELLNNFRTETAEDDSKTF  565
             P + VS     E    +  L + E S +TV  D   +K+ D++L++ FRT+   DDS  +
Sbjct  664   PGERVS-----EPVRQQHRLNSDEPSVLTVETDI--EKQLDDKLIHEFRTKYGNDDSVDY  716

Query  564   MELVLDDEEEFTKAVKSLDDRSFDLYVAGRGRGVSSALTSGLADWCECPELGAVGDllvt  385
              E V+++ EE   A++++DD   DL++ GRGRG+ S LT+GL DW ECPE+GA+GDLL  
Sbjct  717   FEKVVNNGEETVAAIRAMDD-IHDLFIVGRGRGMISPLTAGLTDWSECPEMGAIGDLLAA  775

Query  384   sefessfsvlvVQQYV  337
             S+F +S SVLVVQQ+V
Sbjct  776   SDFAASASVLVVQQHV  791



>ref|XP_007213030.1| hypothetical protein PRUPE_ppa023146mg [Prunus persica]
 gb|EMJ14229.1| hypothetical protein PRUPE_ppa023146mg [Prunus persica]
Length=816

 Score =   585 bits (1508),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 343/787 (44%), Positives = 506/787 (64%), Gaps = 29/787 (4%)
 Frame = -3

Query  2628  SNGVWEGPDPLAPMIPLFILQIMTAILSSRILNFVLKPFNQPPLVAEILSGIILGPSMLG  2449
             +NG+W+G +PL   +PLFILQ+   ++++RIL  +LKPF QP +++EIL G++LGPS+LG
Sbjct  4     TNGIWQGDNPLDYSLPLFILQLTMVVVTTRILVIILKPFRQPRVISEILGGVLLGPSVLG  63

Query  2448  NIEEFRKHNFPNHNFETIETMGHFALVLYAFLTGLQMDVKAIVHTGTKSRIVAVSGSIFP  2269
               ++F    FP  +   +ETM +  L+ + FL GL+MD+  I   G ++ ++A++G I P
Sbjct  64    KSDKFATTIFPLRSVMVLETMANVGLLYFLFLVGLEMDISVIRRMGKRAIVIAIAGMILP  123

Query  2268  FLIGAGFYFTLQTDTQSM---IGFIFCGSALTVTGFSTLAKILDSKRLLNTEIGKIAASS  2098
             FLIGA F F L    Q M      +F G AL+VT F  LA+IL   +L+NTE+G+IA SS
Sbjct  124   FLIGAAFSFLLHKREQPMNQGTFILFLGVALSVTAFPVLARILAELKLVNTELGRIALSS  183

Query  2097  ALINVALSWVLLTIGLLF----TGSLDNVQWAvlctvgfvvvcvnyVRPLLNWLISKTPE  1930
             AL+N   +W LL + +      T SL ++ + VL +  FV++C+  VRP + W+I +TPE
Sbjct  184   ALVNDMCAWALLALAIALAENDTTSLASL-YVVLSSAAFVLICIFIVRPAVCWIIRRTPE  242

Query  1929  GQGFSEFYICSFIAVICAFGCFTDAMGSHPMIGAFIFGLIMPNNELLRTAILDRLEDFVM  1750
             G+ FS+FYIC  +  +   G  TDA+G+H + GAF+FGL++PN  L  T ++++LEDFV 
Sbjct  243   GESFSDFYICLILTGVMISGFITDAIGTHSVFGAFVFGLVIPNGPLGAT-LIEKLEDFVS  301

Query  1749  GILMPVFFLVCGLRTNIFTITDGDTSIFTALALILLACSAKIIAALVASCYTGMSTNEAI  1570
             G+L+P+FF + GLRTN+ +I  G  +    L +I LAC  KI   ++   +  M  +E  
Sbjct  302   GLLLPLFFAISGLRTNVGSI-QGPGTWGILLLVIFLACVGKIAGTVIVCLFYQMPFDEGF  360

Query  1569  GLGVLTNTKSTMVMIILEVGqvqqvlsvqqysmmvVACLIMTIVATPLAAR-YCPKQDLE  1393
              LG+L NTK  + +I+L VG+ Q+VL  + +++MV+  ++MT + TP+    Y P +   
Sbjct  361   TLGLLMNTKGLVELIVLNVGRDQKVLDDEAFAIMVIVAVVMTGIITPIVTTVYKPARRFI  420

Query  1392  PYKRRTIQNAKPGEELRILACIHGTNNLPAIISLLETSNSTVTSPITAFGVQLLELVGRA  1213
             PYKRR+IQ +KP  ELR+L CIH   N+P +I+LLE S+ T  SP+  + + L+EL GRA
Sbjct  421   PYKRRSIQRSKPDAELRVLVCIHTPRNVPTMINLLEASHPTKRSPLCIYVLHLVELSGRA  480

Query  1212  PAMMvvhssgsgrhvggsHEEVQTSQIISTFDNYELRSHGVTAQVLTARWSYDTMAEDIC  1033
              AM++VH++        +  + Q+  II+ F+NYE  +  V+ Q LTA   Y TM EDIC
Sbjct  481   SAMLIVHNTRKSGRPALNRTQAQSDHIINAFENYEQHAGCVSVQPLTAISPYSTMHEDIC  540

Query  1032  KMAKEKRAAFLVLPFHKQQGTDGEMEDTNPAIQTVNEGVLLSAPCSVGILVERG------  871
              +A++KR AFL++PFHKQQ  DG ME  NPA +T+N+ VL +APCSVGILV+RG      
Sbjct  541   NLAEDKRVAFLIIPFHKQQTVDGGMEAMNPAFRTMNQNVLANAPCSVGILVDRGLNGSNR  600

Query  870   -RPNQYAKNIAVLYLGGPDDREALTYARRMSGLPGVHLTVIRFVPAKDVSADGAVEDPDL  694
                NQ + ++ VL+ GGPDDREAL+YA RMS  PG+ LTV+RFVP     A+GA      
Sbjct  601   LAANQVSHHVVVLFFGGPDDREALSYAWRMSEHPGISLTVMRFVPGD--GAEGAKSASAS  658

Query  693   ELELT--------RETSFVTVSIDPARDKEEDEELLNNFRTETAEDDSKTFMELVLDDEE  538
                            +  ++V  D   +K+ DEEL+N+FR + A D+S  + E  +++ E
Sbjct  659   AAASATTATDAEGNNSRILSVETDLGWEKQLDEELINDFRMKNANDESILYTEKFVNNGE  718

Query  537   EFTKAVKSLDDRSFDLYVAGRGRGVSSALTSGLADWCECPELGAVGDllvtsefessfsv  358
             E   A++S+D+   DL++ GRG+G+ S LT+GL DW ECPELGA+GDLL +S+F ++ SV
Sbjct  719   ETVAAIRSMDN-VHDLFIVGRGQGMISPLTAGLTDWSECPELGAIGDLLASSDFAATASV  777

Query  357   lvVQQYV  337
             LV+ QYV
Sbjct  778   LVMHQYV  784



>ref|XP_002883804.1| hypothetical protein ARALYDRAFT_480314 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH60063.1| hypothetical protein ARALYDRAFT_480314 [Arabidopsis lyrata subsp. 
lyrata]
Length=823

 Score =   585 bits (1508),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/793 (43%), Positives = 509/793 (64%), Gaps = 32/793 (4%)
 Frame = -3

Query  2658  VMCFSQTIYRSNGVWEGPDPLAPMIPLFILQIMTAILSSRILNFVLKPFNQPPLVAEILS  2479
             ++C++ ++  +NGVW+G +PL   +PLF+LQ+   ++ +R   F+LKPF QP +++EIL 
Sbjct  13    IICYAPSMITTNGVWQGDNPLDFSLPLFVLQLTLVVVVTRFFVFILKPFRQPRVISEILG  72

Query  2478  GIILGPSMLGNIEEFRKHNFPNHNFETIETMGHFALVLYAFLTGLQMDVKAIVHTGTKSR  2299
             GI+LGPS+LG   +F    FP  +   +ETM +  L+ + FL G++MD+  +  TG ++ 
Sbjct  73    GIVLGPSVLGRYAKFAHTIFPQRSVMVLETMANVGLLYFLFLVGVEMDIMVVRKTGKRAL  132

Query  2298  IVAVSGSIFPFLIGAGFYFTLQTDTQSMIG----FIFCGSALTVTGFSTLAKILDSKRLL  2131
              +A+ G + PFLIGA F F++   ++  +G     +F G AL+VT F  LA+IL   +L+
Sbjct  133   TIAIGGMVLPFLIGAAFSFSMHR-SEDHLGQGTYILFLGVALSVTAFPVLARILAELKLI  191

Query  2130  NTEIGKIAASSALINVALSWVLLTIGLLFTGSLDNVQ----WAvlctvgfvvvcvnyVRP  1963
             NTEIG+I+ S+AL+N   +W+LL + +    S D       W ++ +  F+ +CV  VRP
Sbjct  192   NTEIGRISMSAALVNDMFAWILLALAIALAES-DKTSFASLWVMISSAVFIAICVFVVRP  250

Query  1962  LLNWLISKTPEGQGFSEFYICSFIAVICAFGCFTDAMGSHPMIGAFIFGLIMPNNELLRT  1783
              + W+I KTPEG+ FSEFYIC  +  +   G  TDA+G+H + GAF+FGL++PN  L  T
Sbjct  251   GIAWIIRKTPEGENFSEFYICLILTGVMISGFITDAIGTHSVFGAFVFGLVIPNGPLGLT  310

Query  1782  AILDRLEDFVMGILMPVFFLVCGLRTNIFTITDGDTSIFTALALILLACSAKIIAALVAS  1603
              ++++LEDFV G+L+P+FF + GL+TN+  I  G  +  T   +I LAC+ K+I  ++ +
Sbjct  311   -LIEKLEDFVSGLLLPLFFAISGLKTNVAAI-QGPATWLTLFLVIFLACAGKVIGTVIVA  368

Query  1602  CYTGMSTNEAIGLGVLTNTKSTMVMIILEVGqvqqvlsvqqysmmvVACLIMTIVATPLA  1423
              + GM   E I LG+L NTK  + MI+L VG+ Q+VL  + ++ MV+  L+MT V TP+ 
Sbjct  369   FFHGMPVREGITLGLLLNTKGLVEMIVLNVGKDQKVLDDETFATMVLVALVMTGVITPIV  428

Query  1422  -ARYCPKQDLEPYKRRTIQNAKPGEELRILACIHGTNNLPAIISLLETSNSTVTSPITAF  1246
                Y P +    YKRRTIQ  KP  ELR+L C+H   N+P II+LLE S  T  SPI  +
Sbjct  429   TVLYKPVKKSVSYKRRTIQQTKPDSELRVLVCVHTPRNVPTIINLLEASYPTKRSPICIY  488

Query  1245  GVQLLELVGRAPAMMvvhssgsgrhvggsHEEVQTSQIISTFDNYELRSHGVTAQVLTAR  1066
              + L+EL GRA AM++VH++        +  + Q+  II+ F+NYE  +  V  Q LTA 
Sbjct  489   VLHLVELTGRASAMLIVHNTRKSGRPALNRTQAQSDHIINAFENYEQHAAFVAVQPLTAI  548

Query  1065  WSYDTMAEDICKMAKEKRAAFLVLPFHKQQGTDGEMEDTNPAIQTVNEGVLLSAPCSVGI  886
               Y TM ED+C +A++KR +F+++PFHKQQ  DG ME TNPA + VN+ +L ++PCSVGI
Sbjct  549   SPYSTMHEDVCSLAEDKRVSFIIIPFHKQQTVDGGMESTNPAYRLVNQNLLENSPCSVGI  608

Query  885   LVERG-------RPNQYAKNIAVLYLGGPDDREALTYARRMSGLPGVHLTVIRFVPAK--  733
             LV+RG         N  +  +AVL+ GGPDDREAL YA RM+  PG+ LTV+RF+  +  
Sbjct  609   LVDRGLNGATRLNSNTVSLQVAVLFFGGPDDREALAYAWRMAQHPGITLTVLRFIHDEDE  668

Query  732   -DVSADGAVEDPDLELELTRETSFVTVSIDPARDKEEDEELLNNFRTETAEDDSKTFMEL  556
              D ++  A  D DL++          +++D  + ++ D++ +N FR E AE +S  ++E 
Sbjct  669   ADTASTRATNDSDLKIP--------KMNMDHKKQRQLDDDYINLFRAENAELESIVYIEK  720

Query  555   VLDDEEEFTKAVKSLDDRSFDLYVAGRGRGVSSALTSGLADWCECPELGAVGDllvtsef  376
             ++ + EE   AV+S+D  S DL++ GRG G+SS LT+GL DW ECPELGA+GDLL +S+F
Sbjct  721   LVSNGEETVAAVRSMDS-SHDLFIVGRGEGMSSPLTAGLTDWSECPELGAIGDLLASSDF  779

Query  375   essfsvlvVQQYV  337
              ++ SVLVVQQYV
Sbjct  780   AATVSVLVVQQYV  792



>ref|XP_009124800.1| PREDICTED: cation/H(+) antiporter 15 [Brassica rapa]
Length=819

 Score =   583 bits (1504),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 343/789 (43%), Positives = 511/789 (65%), Gaps = 27/789 (3%)
 Frame = -3

Query  2658  VMCFSQTIYRSNGVWEGPDPLAPMIPLFILQIMTAILSSRILNFVLKPFNQPPLVAEILS  2479
             ++C++ ++  +NGVW+G +PL   +PLF+LQ+   ++ +R   FVLKPF QP +++EIL 
Sbjct  11    IICYAPSMITTNGVWQGDNPLDFSLPLFVLQLTLVVVVTRFFVFVLKPFRQPRVISEILG  70

Query  2478  GIILGPSMLGNIEEFRKHNFPNHNFETIETMGHFALVLYAFLTGLQMDVKAIVHTGTKSR  2299
             GI+LGPS+LG  ++F    FP  +   +ETM +  L+ + FL G++MD+  +  TG ++ 
Sbjct  71    GIVLGPSVLGRYDKFANTIFPQRSVMVLETMANVGLLYFLFLVGVEMDIMVVRKTGKRAL  130

Query  2298  IVAVSGSIFPFLIGAGFYFTLQTDTQSMIG----FIFCGSALTVTGFSTLAKILDSKRLL  2131
              +A+ G + PF+IGA F F++Q  T+  +G     +F G AL+VT F  LA+IL   +L+
Sbjct  131   TIALGGMVLPFVIGAAFSFSMQR-TEDHLGQGTYILFLGVALSVTAFPVLARILAELKLI  189

Query  2130  NTEIGKIAASSALINVALSWVLLTIGLLFTGSLDN---VQWAvlctvgfvvvcvnyVRPL  1960
             NTEIG+I+ S+AL+N   +W+LL + +    S  +     W ++ +  F+ +CV  VRP 
Sbjct  190   NTEIGRISMSAALVNDMFAWILLALAIALAESEKSSFASLWVMISSAAFIAICVFVVRPG  249

Query  1959  LNWLISKTPEGQGFSEFYICSFIAVICAFGCFTDAMGSHPMIGAFIFGLIMPNNELLRTA  1780
             ++W+I KTPEG+ FSEFYIC  +  +   G  TD++G+H + GAF+FGL++PN  L  T 
Sbjct  250   ISWIIRKTPEGENFSEFYICLILTGVMICGFITDSIGTHSVFGAFVFGLVIPNGPLGLT-  308

Query  1779  ILDRLEDFVMGILMPVFFLVCGLRTNIFTITDGDTSIFTALALILLACSAKIIAALVASC  1600
             ++++LEDFV G+L+P+FF + GL+TN+  I  G  +  T   +I LAC+ K+I  +V + 
Sbjct  309   LIEKLEDFVSGLLLPLFFAISGLKTNVAAI-QGPATWVTLFLVIFLACTGKVIGTVVVAF  367

Query  1599  YTGMSTNEAIGLGVLTNTKSTMVMIILEVGqvqqvlsvqqysmmvVACLIMTIVATPLAA  1420
             + GM   E I LG+L NTK  + MI+L VG+ Q+VL  + ++ MV+  L+MT V TP+  
Sbjct  368   FHGMPVREGITLGLLLNTKGLVEMIVLNVGKDQKVLDDETFATMVLIALVMTGVITPIVT  427

Query  1419  -RYCPKQDLEPYKRRTIQNAKPGEELRILACIHGTNNLPAIISLLETSNSTVTSPITAFG  1243
               Y P +    YKRRTIQ  KP  ELR+L CIH   N+P II+LLE S+ T  SPI  + 
Sbjct  428   ILYKPVKRSVSYKRRTIQQTKPDSELRVLVCIHTPRNVPTIINLLEASHPTKRSPICIYV  487

Query  1242  VQLLELVGRAPAMMvvhssgsgrhvggsHEEVQTSQIISTFDNYELRSHGVTAQVLTARW  1063
             + L+EL GRA AM++VH++        +  + Q+  II+ F+NYE  +  V  Q LTA  
Sbjct  488   LHLVELTGRASAMLIVHNTRKSGKPALNRTQAQSDHIINAFENYEQHAAFVAVQPLTAIS  547

Query  1062  SYDTMAEDICKMAKEKRAAFLVLPFHKQQGTDGEMEDTNPAIQTVNEGVLLSAPCSVGIL  883
              Y TM ED+C +A++KR +F+++PFHKQQ  DG ME TNPA + VN+ +L ++PCSVGIL
Sbjct  548   PYSTMHEDVCSLAEDKRVSFIIIPFHKQQTVDGGMEATNPAYRLVNQNLLGNSPCSVGIL  607

Query  882   VERG-------RPNQYAKNIAVLYLGGPDDREALTYARRMSGLPGVHLTVIRFVPAKDVS  724
             V+RG         N  +  +AVL+ GGPDDREAL YA RM+  PG+ LTV+RF+P +DV+
Sbjct  608   VDRGLNGATRLTSNTISLQVAVLFFGGPDDREALAYAWRMAEHPGISLTVLRFIPDEDVT  667

Query  723   ADGAVEDPDLELELTRETSFVTVSIDPARDKEEDEELLNNFRTETAEDDSKTFMELVLDD  544
              D A          T ET    +++D  + ++ D+E +N FR   AE ++  +++ V+ +
Sbjct  668   -DAA------STRATNETD-RNMNVDMKKQRQLDDEYVNTFRAANAEYETIVYIDKVVSN  719

Query  543   EEEFTKAVKSLDDRSFDLYVAGRGRGVSSALTSGLADWCECPELGAVGDllvtsefessf  364
              EE   AV+S+D  S DL++ GRG  +SS LT+GL DW ECPELGA+GDLL +S+F ++ 
Sbjct  720   GEETVAAVRSMDS-SHDLFIVGRGEEMSSPLTAGLTDWSECPELGAIGDLLASSDFAATV  778

Query  363   svlvVQQYV  337
             SVLVVQQYV
Sbjct  779   SVLVVQQYV  787



>ref|NP_178985.1| cation/H(+) antiporter 15 [Arabidopsis thaliana]
 sp|Q9SIT5.1|CHX15_ARATH RecName: Full=Cation/H(+) antiporter 15; AltName: Full=Protein 
CATION/H+ EXCHANGER 15; Short=AtCHX15 [Arabidopsis thaliana]
 gb|AAD22684.1| putative Na/H antiporter [Arabidopsis thaliana]
 gb|AAX49544.1| cation/H+ exchanger [Arabidopsis thaliana]
 gb|AEC06246.1| cation/H(+) antiporter 15 [Arabidopsis thaliana]
Length=821

 Score =   583 bits (1504),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/793 (43%), Positives = 508/793 (64%), Gaps = 34/793 (4%)
 Frame = -3

Query  2658  VMCFSQTIYRSNGVWEGPDPLAPMIPLFILQIMTAILSSRILNFVLKPFNQPPLVAEILS  2479
             ++C++ ++  +NGVW+G +PL   +PLF+LQ+   ++ +R   F+LKPF QP +++EIL 
Sbjct  13    IICYAPSMITTNGVWQGDNPLDFSLPLFVLQLTLVVVVTRFFVFILKPFRQPRVISEILG  72

Query  2478  GIILGPSMLGNIEEFRKHNFPNHNFETIETMGHFALVLYAFLTGLQMDVKAIVHTGTKSR  2299
             GI+LGPS+LG   +F    FP  +   +ETM +  L+ + FL G++MD+  +  TG ++ 
Sbjct  73    GIVLGPSVLGRSTKFAHTIFPQRSVMVLETMANVGLLYFLFLVGVEMDIMVVRKTGKRAL  132

Query  2298  IVAVSGSIFPFLIGAGFYFTLQTDTQSMIG----FIFCGSALTVTGFSTLAKILDSKRLL  2131
              +A+ G + PFLIGA F F++   ++  +G     +F G AL+VT F  LA+IL   +L+
Sbjct  133   TIAIGGMVLPFLIGAAFSFSMHR-SEDHLGQGTYILFLGVALSVTAFPVLARILAELKLI  191

Query  2130  NTEIGKIAASSALINVALSWVLLTIGLLFTGSLDNVQ----WAvlctvgfvvvcvnyVRP  1963
             NTEIG+I+ S+AL+N   +W+LL + +    S D       W ++ +  F+ VCV  VRP
Sbjct  192   NTEIGRISMSAALVNDMFAWILLALAIALAES-DKTSFASLWVMISSAVFIAVCVFVVRP  250

Query  1962  LLNWLISKTPEGQGFSEFYICSFIAVICAFGCFTDAMGSHPMIGAFIFGLIMPNNELLRT  1783
              + W+I KTPEG+ FSEF+IC  +  +   G  TDA+G+H + GAF+FGL++PN  L  T
Sbjct  251   GIAWIIRKTPEGENFSEFHICLILTGVMISGFITDAIGTHSVFGAFVFGLVIPNGPLGLT  310

Query  1782  AILDRLEDFVMGILMPVFFLVCGLRTNIFTITDGDTSIFTALALILLACSAKIIAALVAS  1603
              ++++LEDFV G+L+P+FF + GL+TNI  I  G  +  T   +I LAC+ K+I  ++ +
Sbjct  311   -LIEKLEDFVSGLLLPLFFAISGLKTNIAAI-QGPATWLTLFLVIFLACAGKVIGTVIVA  368

Query  1602  CYTGMSTNEAIGLGVLTNTKSTMVMIILEVGqvqqvlsvqqysmmvVACLIMTIVATPLA  1423
              + GM   E I LG+L NTK  + MI+L VG+ Q+VL  + ++ MV+  L+MT V TP+ 
Sbjct  369   FFHGMPVREGITLGLLLNTKGLVEMIVLNVGKDQKVLDDETFATMVLVALVMTGVITPIV  428

Query  1422  A-RYCPKQDLEPYKRRTIQNAKPGEELRILACIHGTNNLPAIISLLETSNSTVTSPITAF  1246
                Y P +    YKRRTIQ  KP  ELR+L C+H   N+P II+LLE S+ T  SPI  +
Sbjct  429   TILYKPVKKSVSYKRRTIQQTKPDSELRVLVCVHTPRNVPTIINLLEASHPTKRSPICIY  488

Query  1245  GVQLLELVGRAPAMMvvhssgsgrhvggsHEEVQTSQIISTFDNYELRSHGVTAQVLTAR  1066
              + L+EL GRA AM++VH++        +  + Q+  II+ F+NYE  +  V  Q LTA 
Sbjct  489   VLHLVELTGRASAMLIVHNTRKSGRPALNRTQAQSDHIINAFENYEQHAAFVAVQPLTAI  548

Query  1065  WSYDTMAEDICKMAKEKRAAFLVLPFHKQQGTDGEMEDTNPAIQTVNEGVLLSAPCSVGI  886
               Y TM ED+C +A++KR +F+++PFHKQQ  DG ME TNPA + VN+ +L ++PCSVGI
Sbjct  549   SPYSTMHEDVCSLAEDKRVSFIIIPFHKQQTVDGGMESTNPAYRLVNQNLLENSPCSVGI  608

Query  885   LVERG-------RPNQYAKNIAVLYLGGPDDREALTYARRMSGLPGVHLTVIRFVPAK--  733
             LV+RG         N  +  +AVL+ GGPDDREAL YA RM+  PG+ LTV+RF+  +  
Sbjct  609   LVDRGLNGATRLNSNTVSLQVAVLFFGGPDDREALAYAWRMAQHPGITLTVLRFIHDEDE  668

Query  732   -DVSADGAVEDPDLELELTRETSFVTVSIDPARDKEEDEELLNNFRTETAEDDSKTFMEL  556
              D ++  A  D DL++            +D  + ++ D++ +N FR E AE +S  ++E 
Sbjct  669   ADTASTRATNDSDLKIP----------KMDHRKQRQLDDDYINLFRAENAEYESIVYIEK  718

Query  555   VLDDEEEFTKAVKSLDDRSFDLYVAGRGRGVSSALTSGLADWCECPELGAVGDllvtsef  376
             ++ + EE   AV+S+D  S DL++ GRG G+SS LT+GL DW ECPELGA+GDLL +S+F
Sbjct  719   LVSNGEETVAAVRSMDS-SHDLFIVGRGEGMSSPLTAGLTDWSECPELGAIGDLLASSDF  777

Query  375   essfsvlvVQQYV  337
              ++ SVLVVQQYV
Sbjct  778   AATVSVLVVQQYV  790



>ref|XP_006837063.1| hypothetical protein AMTR_s00110p00080970 [Amborella trichopoda]
 gb|ERM99916.1| hypothetical protein AMTR_s00110p00080970 [Amborella trichopoda]
Length=858

 Score =   583 bits (1504),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 334/792 (42%), Positives = 503/792 (64%), Gaps = 27/792 (3%)
 Frame = -3

Query  2658  VMCFSQTIYRSNGVWEGPDPLAPMIPLFILQIMTAILSSRILNFVLKPFNQPPLVAEILS  2479
             ++C+S T   +NG+W+G +PL    PLF +Q+   ++++R+L F+L+P  QP ++AEI+ 
Sbjct  17    LVCYSPTWITTNGIWQGDNPLHYSFPLFTIQLTLVVVATRVLTFLLRPLRQPRVIAEIIG  76

Query  2478  GIILGPSMLGNIEEFRKHNFPNHNFETIETMGHFALVLYAFLTGLQMDVKAIVHTGTKSR  2299
             GIILGPS+LG  + F    FP H+   +ET+ +  LV + F+ GL+MD+  I  T  K+ 
Sbjct  77    GIILGPSVLGRNKNFASSIFPLHSVTVLETIANIGLVYFLFIVGLEMDINVIRRTRAKAL  136

Query  2298  IVAVSGSIFPFLIGAGFYFTLQ---TDTQSMIGF-IFCGSALTVTGFSTLAKILDSKRLL  2131
             ++A +G + PF+IG    F L+   ++  S + F +F    L++T F  LA+IL   +LL
Sbjct  137   LIAGAGMVIPFVIGISSSFLLKESVSENVSQVTFLLFLSVGLSITAFPVLARILAELKLL  196

Query  2130  NTEIGKIAASSALINVALSWVLLTIGLLFTGSLDNV---QWAvlctvgfvvvcvnyVRPL  1960
             NTE+G++A S+A+IN   +WVLL + +       N     W VL  V FV+  +  +RP 
Sbjct  197   NTELGRLAMSAAIINDVCAWVLLALAIAVNDRDKNALASVWVVLSGVVFVLFSLLVLRPA  256

Query  1959  LNWLISKTPEGQGFSEFYICSFI--AVICAFGCFTDAMGSHPMIGAFIFGLIMPNNELLR  1786
             + W+  KT EG+  SE YIC+ +   ++CAF   TD +G HP+ GAF+FGL++PN   L 
Sbjct  257   VTWVTRKTTEGEAVSEIYICAIMLGVMVCAFT--TDIIGIHPVFGAFMFGLVIPNGS-LG  313

Query  1785  TAILDRLEDFVMGILMPVFFLVCGLRTNIFTITDGDTSIFTALALILLACSAKIIAALVA  1606
              A++++LEDF  G+L+P+FF + GLRTN+ TIT+ DT     L +I+LAC+ K++  LV 
Sbjct  314   GALIEKLEDFTSGLLLPLFFAISGLRTNVMTITNEDTWAILML-VIVLACAGKVVGTLVV  372

Query  1605  SCYTGMSTNEAIGLGVLTNTKSTMVMIILEVGqvqqvlsvqqysmmvVACLIMTIVATPL  1426
             + +  M+  E I LG+L NTK  + MI+L +G  ++VL    +++MV+A +IMT + TP+
Sbjct  373   ALFMKMTPREGIALGLLMNTKGLIEMIVLNIGMDKKVLDESSFAIMVIAAVIMTGMITPV  432

Query  1425  AAR-YCPKQDLEPYKRRTIQNAKPGEELRILACIHGTNNLPAIISLLETSNSTVTSPITA  1249
                 Y P +   PYKRRT++  KP   LR+L C+H + N+P II+LLE S++T  SPI+ 
Sbjct  433   VTTIYKPARRFLPYKRRTVEKGKPESLLRMLVCVHTSRNVPTIINLLEASHATKKSPISV  492

Query  1248  FGVQLLELVGRAPAMMvvhssgsgrhvggsHEEVQTSQIISTFDNYELRSHGVTAQVLTA  1069
               + L+EL GR+ AM++VHSS          E  ++  I++ F+NY +   GV  Q++TA
Sbjct  493   HALHLVELTGRSSAMIIVHSSRKSGRHMNRTEA-ESEHIVNAFENY-VGVSGVAVQLVTA  550

Query  1068  RWSYDTMAEDICKMAKEKRAAFLVLPFHKQQGTDGEMEDTNPAIQTVNEGVLLSAPCSVG  889
                + TM EDIC +A+EKRAA ++LPFHK Q  DG +E TNPA +T+N+ VL++APCSVG
Sbjct  551   MSPFATMHEDICNLAEEKRAALIILPFHKHQTVDGGLETTNPAFRTINQNVLVNAPCSVG  610

Query  888   ILVERG-------RPNQYAKNIAVLYLGGPDDREALTYARRMSGLPGVHLTVIRFVPAKD  730
             IL++RG         +    ++AVL+ GGPDDREAL YA RM+  PGV LTV+RF+P  +
Sbjct  611   ILIDRGLGGTTGISASHVCHHLAVLFFGGPDDREALAYASRMAEHPGVSLTVVRFLPGDE  670

Query  729   -VSADGAVEDPDLELELTRETSFVTVSIDPARDKEEDEELLNNFRTETAEDDSKTFMELV  553
              V  +  V D  L  + ++    +TV  D  R+   D+  +  FR  T  D+S  + E V
Sbjct  671   AVEPEFPVAD-TLYQDDSKNLRILTVLTDNDREHHLDDGYIAEFRLRTVGDESIMYTEKV  729

Query  552   LDDEEEFTKAVKSLDDRSFDLYVAGRGRGVSSALTSGLADWCECPELGAVGDllvtsefe  373
             +++ EE   A++S+D    DL+V GR + VSS LT+GL DW ECPELG +GDLL +S+F 
Sbjct  730   VNNVEESIAAIRSMDS-IHDLFVVGRAQRVSS-LTTGLTDWSECPELGPIGDLLASSDFA  787

Query  372   ssfsvlvVQQYV  337
             ++ SVL++QQYV
Sbjct  788   ATVSVLIMQQYV  799



>ref|XP_010518406.1| PREDICTED: cation/H(+) antiporter 15-like [Camelina sativa]
Length=823

 Score =   582 bits (1499),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 339/791 (43%), Positives = 508/791 (64%), Gaps = 30/791 (4%)
 Frame = -3

Query  2658  VMCFSQTIYRSNGVWEGPDPLAPMIPLFILQIMTAILSSRILNFVLKPFNQPPLVAEILS  2479
             ++C++ ++  +NGVW+G +PL   +PLF+LQ+   ++ +R   F+LKPF QP +++EIL 
Sbjct  13    IICYAPSMITTNGVWQGDNPLDFSLPLFVLQLTLVVVVTRFFVFILKPFRQPRVISEILG  72

Query  2478  GIILGPSMLGNIEEFRKHNFPNHNFETIETMGHFALVLYAFLTGLQMDVKAIVHTGTKSR  2299
             GI+LGPS+LG  E+F    FP  +   +ETM +  L+ + FL G++MD+  +  TG ++ 
Sbjct  73    GIVLGPSVLGRSEKFAHTIFPQRSVMVLETMANVGLLYFLFLVGVEMDIMVVRKTGKRAL  132

Query  2298  IVAVSGSIFPFLIGAGFYFTLQTDTQSMIG----FIFCGSALTVTGFSTLAKILDSKRLL  2131
              +A+ G + PFLIGA F F++   ++  +G     +F G AL+VT F  LA+IL   +L+
Sbjct  133   TIAIGGMVLPFLIGAAFSFSMHR-SEDHLGQGTYILFLGVALSVTAFPVLARILAELKLI  191

Query  2130  NTEIGKIAASSALINVALSWVLLTIGLLFTGSLDN---VQWAvlctvgfvvvcvnyVRPL  1960
             NTEIG+I+ S+AL+N   +W+LL + +    S  N     W ++ +  F+ VCV  VRP 
Sbjct  192   NTEIGRISMSAALVNDMFAWILLALAIALAESDKNSFASLWVMISSAVFIAVCVFIVRPG  251

Query  1959  LNWLISKTPEGQGFSEFYICSFIAVICAFGCFTDAMGSHPMIGAFIFGLIMPNNELLRTA  1780
             + W+I KTPEG+ +SEFYIC  +  +   G  TDA+G+H + GAF+FGL++PN  L  T 
Sbjct  252   ITWIIRKTPEGENYSEFYICLILTGVMISGFITDAIGTHSVFGAFVFGLVIPNGPLGLT-  310

Query  1779  ILDRLEDFVMGILMPVFFLVCGLRTNIFTITDGDTSIFTALALILLACSAKIIAALVASC  1600
             ++++LEDFV G+L+P+FF + GL+TN+  I  G  +  T   +I LAC+ K+I  ++ + 
Sbjct  311   LIEKLEDFVSGLLLPLFFAISGLKTNVAAI-QGPATWATLFFVIFLACAGKVIGTVIVAF  369

Query  1599  YTGMSTNEAIGLGVLTNTKSTMVMIILEVGqvqqvlsvqqysmmvVACLIMTIVATPLA-  1423
             + GM   E I LG+L NTK  + MI+L VG+ Q+VL  + ++ MV+  L+MT V TP+  
Sbjct  370   FHGMPVREGITLGLLLNTKGLVEMIVLNVGKDQKVLDDETFATMVLVALVMTGVITPIVT  429

Query  1422  ARYCPKQDLEPYKRRTIQNAKPGEELRILACIHGTNNLPAIISLLETSNSTVTSPITAFG  1243
               Y P +    YKRRTIQ  KP  ELR+L C+H   N+P II+LLE S+ T  SPI  + 
Sbjct  430   VLYRPVKKSVSYKRRTIQQTKPDSELRVLVCVHTPRNVPTIINLLEASHPTKRSPICIYV  489

Query  1242  VQLLELVGRAPAMMvvhssgsgrhvggsHEEVQTSQIISTFDNYELRSHGVTAQVLTARW  1063
             + L+EL GRA AM++VH++        +  + Q+  II+ F+NYE  +  V  Q LTA  
Sbjct  490   LHLVELTGRASAMLIVHNTRKSGRPALNRTQAQSDHIINAFENYEQHAAFVAVQPLTAIS  549

Query  1062  SYDTMAEDICKMAKEKRAAFLVLPFHKQQGTDGEMEDTNPAIQTVNEGVLLSAPCSVGIL  883
              Y TM ED+C +A++KR +F+++PFHKQQ  DG ME TNPA + VN+ +L ++PCSVGIL
Sbjct  550   PYSTMHEDVCSLAEDKRVSFIIIPFHKQQTVDGGMEATNPAYRLVNQNLLENSPCSVGIL  609

Query  882   VERG-------RPNQYAKNIAVLYLGGPDDREALTYARRMSGLPGVHLTVIRFVPAK---  733
             V+RG         N  +  +AVL+ GG DDREAL YA RM+  PG+ LTV+RF+      
Sbjct  610   VDRGLNGATRLNSNTVSLQVAVLFFGGQDDREALAYAWRMAQHPGISLTVLRFIHDGDEI  669

Query  732   DVSADGAVEDPDLELELTRETSFVTVSIDPARDKEEDEELLNNFRTETAEDDSKTFMELV  553
             D ++  A  + DL++          +++D  + K+ D+E +N FRT  A+ +S  ++E +
Sbjct  670   DTASTRATNETDLKVP--------KMNMDHKKQKQLDDEYINAFRTSNADFESVVYIEKL  721

Query  552   LDDEEEFTKAVKSLDDRSFDLYVAGRGRGVSSALTSGLADWCECPELGAVGDllvtsefe  373
             + + EE   AV+S+D  S DL++ GRG G+SS LT+GL DW ECPELGA+GDLL +S+F 
Sbjct  722   VSNGEETVAAVRSMDS-SHDLFIVGRGEGMSSPLTAGLTDWSECPELGAIGDLLASSDFA  780

Query  372   ssfsvlvVQQY  340
             ++ SVLVVQQY
Sbjct  781   ATVSVLVVQQY  791



>ref|XP_006355520.1| PREDICTED: cation/H(+) antiporter 15-like [Solanum tuberosum]
Length=830

 Score =   582 bits (1499),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 331/791 (42%), Positives = 497/791 (63%), Gaps = 21/791 (3%)
 Frame = -3

Query  2676  DRLGQVVMCFSQTIYRSNGVWEGPDPLAPMIPLFILQIMTAILSSRILNFVLKPFNQPPL  2497
             D++   ++C++ T+  ++G+W+G +PL   +PLFI+Q+   ++ +R+L F+LKP  QP +
Sbjct  12    DKIYDSIVCYAPTMITTSGIWQGDNPLDYSLPLFIVQLTLVVVITRLLVFILKPIRQPRV  71

Query  2496  VAEILSGIILGPSMLGNIEEFRKHNFPNHNFETIETMGHFALVLYAFLTGLQMDVKAIVH  2317
             +AEIL G+ILGPS+LG    F    FP  +   +ETM +  L+ + FL G++MD+  +  
Sbjct  72    IAEILGGVILGPSVLGRSSTFANTIFPQRSVMVLETMANIGLLYFLFLIGVEMDIAVLRR  131

Query  2316  TGTKSRIVAVSGSIFPFLIGAGFYFTLQTDTQSM---IGFIFCGSALTVTGFSTLAKILD  2146
                KS ++A++G I P +IG+ F   L   +Q+       +F G AL+VT F  LA+IL 
Sbjct  132   NSKKSLLIAMAGMILPCIIGSSFSVLLHDKSQNTKEGTFILFLGLALSVTSFPVLARILA  191

Query  2145  SKRLLNTEIGKIAASSALINVALSWVLLTIGLLFTGSLD---NVQWAvlctvgfvvvcvn  1975
               +L+N+EIG+IA S++LIN  L+W++L   + FT + D      W +L ++ F+ VC  
Sbjct  192   ELKLINSEIGRIAMSASLINDMLAWIVLAFAIAFTENKDMSLATLWVILSSIAFICVCFF  251

Query  1974  yVRPLLNWLISKTPEGQGFSEFYICSFIAVICAFGCFTDAMGSHPMIGAFIFGLIMPNNE  1795
              +RPL+   IS+TPEG+  SEF IC  +  +   G  TD +G+H + GAF+FGLI+P+  
Sbjct  252   VIRPLIERRISQTPEGESISEFNICLILTGVMISGFITDVIGTHSVFGAFVFGLIIPSGP  311

Query  1794  LLRTAILDRLEDFVMGILMPVFFLVCGLRTNIFTITDGDTSIFTALALILLACSAKIIAA  1615
             L  T +++RLEDFV G+L+P+FF + GL+T I  I D   +      +I+LAC+ K+I  
Sbjct  312   LGLT-LIERLEDFVSGLLLPLFFAISGLKTEISAI-DSAATWGVLCVVIILACAGKVIGV  369

Query  1614  LVASCYTGMSTNEAIGLGVLTNTKSTMVMIILEVGqvqqvlsvqqysmmvVACLIMTIVA  1435
             ++ + Y  M  +E + LG+L N K  + +I+L VG+ Q+VL  + +++MV+  + MT V 
Sbjct  370   VIVTLYYKMPFHEGLSLGLLMNAKGLVEIIVLNVGKDQKVLDEKSFAIMVIVAIGMTAVI  429

Query  1434  TPLAA-RYCPKQDLEPYKRRTIQNAKPGEELRILACIHGTNNLPAIISLLETSNSTVTSP  1258
             TP+    Y P ++  PYKRRT+Q  K   E R+L  IH    +P IISLLE S  T  SP
Sbjct  430   TPIVTIVYKPSRNFTPYKRRTVQKTKLDREFRVLVSIHTPKAVPTIISLLEASCPTKKSP  489

Query  1257  ITAFGVQLLELVGRAPAMMvvhssgsgrhvggsHEEVQTSQIISTFDNYELRSHGVTAQV  1078
             I  + + L+EL GRA  M++VH+         +  + Q+  II+ F+N+E  +  V  Q 
Sbjct  490   ICIYVLHLVELTGRASGMLIVHNMRKTGRPAMNRTQAQSDHIINAFENFEKSAGCVYVQP  549

Query  1077  LTARWSYDTMAEDICKMAKEKRAAFLVLPFHKQQGTDGEMEDTNPAIQTVNEGVLLSAPC  898
             LTA   Y TM EDIC +A+EKR A +++PFHKQQ  DG +E TN + +T+N+ VL +APC
Sbjct  550   LTAISPYSTMHEDICVLAEEKRVALIIIPFHKQQTVDGGLETTNSSFRTINQNVLANAPC  609

Query  897   SVGILVERGRP----NQYAKNIAVLYLGGPDDREALTYARRMSGLPGVHLTVIRFVPAKD  730
             SVGILV+RG      NQ + ++AVL+ GGPDDREAL YA RMS    ++LTV+RF+P  D
Sbjct  610   SVGILVDRGLTRSTMNQISHHVAVLFFGGPDDREALAYAWRMSEHANINLTVMRFLPG-D  668

Query  729   VSADGAVEDPDLELELTRETSFVTVSIDPARDKEEDEELLNNFRTETAEDDSKTFMELVL  550
              + +G   +         + S +TV  +  R+K+ DEE +  FRT+T  D S  ++E ++
Sbjct  669   TTIEGRKSNSG------NDYSVLTVETERDREKQLDEEYVTEFRTKTGSDGSIVYIERIV  722

Query  549   DDEEEFTKAVKSLDDRSFDLYVAGRGRGVSSALTSGLADWCECPELGAVGDllvtsefes  370
             +  EE   A++S+D+ S DL++ GRG+G SS LT+GL DW ECPELGA+GDLL +S+F  
Sbjct  723   NHGEETVGAIRSIDN-SHDLFIVGRGQGTSSPLTAGLTDWSECPELGAIGDLLASSDFAM  781

Query  369   sfsvlvVQQYV  337
               S LVVQQYV
Sbjct  782   KASALVVQQYV  792



>gb|EYU18565.1| hypothetical protein MIMGU_mgv1a022165mg [Erythranthe guttata]
Length=788

 Score =   579 bits (1493),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 337/774 (44%), Positives = 491/774 (63%), Gaps = 27/774 (3%)
 Frame = -3

Query  2655  MCFSQTIYRSNGVWEGPDPLAPMIPLFILQIMTAILSSRILNFVLKPFNQPPLVAEILSG  2476
             +C++ T+  +NG+W+G +PL   +PLFILQ++  I++ R L F+LKPF QP +++EIL G
Sbjct  3     ICYAPTMITTNGIWQGDNPLDYSLPLFILQVLLIIVTIRFLVFILKPFRQPRVISEILGG  62

Query  2475  IILGPSMLGNIEEFRKHNFPNHNFETIETMGHFALVLYAFLTGLQMDVKAIVHTGTKSRI  2296
             +ILGPS+LG  ++F  + FP  +   +ETMG+  L+ + FL G++MD+  I  TG ++ +
Sbjct  63    VILGPSLLGQSKQFANNIFPPRSVMILETMGNVGLLFFLFLVGVEMDIAVIRSTGRRTFV  122

Query  2295  VAVSGSIFPFLIGAGFYFTLQTDTQSM-IG--FIFCGSALTVTGFSTLAKILDSKRLLNT  2125
             +A++G I PFLIG  F FTL   TQ + +G   +F G AL+VT F  LA+IL   +LLNT
Sbjct  123   IAIAGMILPFLIGVSFAFTLHESTQWVKLGTFILFLGVALSVTAFPVLARILAELKLLNT  182

Query  2124  EIGKIAASSALINVALSWVLLTIGLLF----TGSLDNVQWAvlctvgfvvvcvnyVRPLL  1957
             EIG+IA +SAL N   +W+LL I +      + SL ++ W VL T  FV+ C   +RPL+
Sbjct  183   EIGRIAMASALFNDICAWILLAIAIAIAENESLSLSSL-WVVLSTGAFVLFCYYVMRPLV  241

Query  1956  NWLISKTPEGQGFSEFYICSFIAVICAFGCFTDAMGSHPMIGAFIFGLIMPNNELLRTAI  1777
              W++ +TPEGQ  SE YIC  +  +   G  TDA+G+H + GAFIFGL++P+  +  T +
Sbjct  242   CWIVRRTPEGQLISEVYICLILTGVMISGFITDAIGTHSVFGAFIFGLVIPSGPIGVT-L  300

Query  1776  LDRLEDFVMGILMPVFFLVCGLRTNIFTITDGDTSIFTALALILLACSAKIIAALVASCY  1597
             ++RLEDFV G+L+P+FF + GL+T++  I    T     L +I+LAC+ K+   L+ S Y
Sbjct  301   IERLEDFVTGLLLPLFFAISGLKTDLTLINGVGTWAILGL-VIVLACAGKVTGTLLVSLY  359

Query  1596  TGMSTNEAIGLGVLTNTKSTMVMIILEVGqvqqvlsvqqysmmvVACLIMTIVATPLAAR  1417
               +   E + LG+L N K  + MI+L VG+ Q VL  + +++M+V  ++MT V  P+   
Sbjct  360   YRIPFYEGLTLGLLMNAKGLVEMIVLNVGKDQHVLDDKSFAIMIVVEIVMTAVIQPIVTN  419

Query  1416  -YCPKQDLEPYKRRTIQNAKPGEELRILACIHGTNNLPAIISLLETSNSTVTSPITAFGV  1240
              Y P + L  YKRRTIQ  K   E R+L C+H   N+P II LLE SN T  SPI+++ +
Sbjct  420   IYRPGRKLVAYKRRTIQRTKLKGEFRLLVCVHVPRNVPTIIHLLEASNPTKKSPISSYVL  479

Query  1239  QLLELVGRAPAMMvvhssgsgrhvggsHEEVQTSQIISTFDNYELRSHGVTAQVLTARWS  1060
              L+EL GRA A+++VH++        +  + Q+  I + F+N+E +   VT   LTA   
Sbjct  480   HLVELTGRASAVLIVHNTRKSGRSALNLAQAQSEHIFNAFENFERQGGFVTVNPLTAISP  539

Query  1059  YDTMAEDICKMAKEKRAAFLVLPFHKQQGTDGEMEDTNPAIQTVNEGVLLSAPCSVGILV  880
             Y TM EDI  +A++KR AF+++PFHKQQ  DG ME TNPA + +N+ VL +APCSVGILV
Sbjct  540   YSTMHEDIFTVAEDKRVAFIIIPFHKQQTVDGGMEATNPAFRIINQSVLANAPCSVGILV  599

Query  879   ERG-------RPNQYA-KNIAVLYLGGPDDREALTYARRMSGLPGVHLTVIRFV---PAK  733
             +RG         NQ +  +IA+L+ GGPDDREA+  A RMS  P   LTV+RFV    A 
Sbjct  600   DRGLNGSSRASANQMSHHHIALLFFGGPDDREAMALAWRMSEHPRNSLTVMRFVLGETAP  659

Query  732   DVSADGAVED--PDLELELTRETSFVTVSIDPARDKEEDEELLNNFRTETAEDDSKTFME  559
             D +  G + D   +  +E   ET  +TV  D  R+KE D+  +N FR  T  D S  ++E
Sbjct  660   DTTKGGDMADAVANSSIETGHET--LTVLTDDDREKEMDQAYINEFRAATMNDSSVHYVE  717

Query  558   LVLDDEEEFTKAVKSLDDRSFDLYVAGRGRGVSSALTSGLADWCECPELGAVGD  397
              V++  EE   A++S+D R  D++V GRG G+ S +T+GL+DW ECPELGA+GD
Sbjct  718   KVVNHGEETVAAIRSIDTRH-DMFVVGRGHGMISPVTAGLSDWSECPELGAIGD  770



>ref|XP_004246149.1| PREDICTED: cation/H(+) antiporter 15 [Solanum lycopersicum]
Length=835

 Score =   581 bits (1498),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/791 (41%), Positives = 497/791 (63%), Gaps = 18/791 (2%)
 Frame = -3

Query  2676  DRLGQVVMCFSQTIYRSNGVWEGPDPLAPMIPLFILQIMTAILSSRILNFVLKPFNQPPL  2497
             +++   ++C++ T+  ++G+W+G +PL   +PLFI+Q+   ++ +R+L F+LKP  QP +
Sbjct  12    NKIDDAIVCYAPTMITTSGIWQGDNPLDYSLPLFIVQLTLVVVITRLLVFILKPIRQPRV  71

Query  2496  VAEILSGIILGPSMLGNIEEFRKHNFPNHNFETIETMGHFALVLYAFLTGLQMDVKAIVH  2317
             +AEIL G+ILGPS+LG    F    FP  +   +ETM +  L+ + FL G++MD+  +  
Sbjct  72    IAEILGGVILGPSVLGRSSTFANTIFPQRSVMVLETMANIGLLYFLFLIGVEMDIAVLRR  131

Query  2316  TGTKSRIVAVSGSIFPFLIGAGFYFTLQTDTQSM---IGFIFCGSALTVTGFSTLAKILD  2146
                KS ++A++G + PF+IG+ F   L   +Q+       +F G AL+VT F  LA+IL 
Sbjct  132   NSKKSLLIAIAGMVLPFIIGSSFSVLLHDKSQNTKEETFVLFLGLALSVTSFPVLARILA  191

Query  2145  SKRLLNTEIGKIAASSALINVALSWVLLTIGLLFTGSLD---NVQWAvlctvgfvvvcvn  1975
               +L+N+EIG+IA S++LIN  L+W++L   + F+ + D      W +L ++ F+ VC  
Sbjct  192   ELKLINSEIGRIAMSASLINDMLAWIVLAFAIAFSENKDMSIATLWVILSSIAFICVCFF  251

Query  1974  yVRPLLNWLISKTPEGQGFSEFYICSFIAVICAFGCFTDAMGSHPMIGAFIFGLIMPNNE  1795
              +RPL+   IS+TPEG+  SEF IC  +  +   G  TD +G+H + GAF+FGLI+P+  
Sbjct  252   VIRPLIGRRISQTPEGESISEFNICLILTGVMISGFITDVIGTHSVFGAFVFGLIIPSGP  311

Query  1794  LLRTAILDRLEDFVMGILMPVFFLVCGLRTNIFTITDGDTSIFTALALILLACSAKIIAA  1615
             L  T +++RLEDFV G+L+P+FF + GL+T I  I D   +      +I LAC+ K+I  
Sbjct  312   LGLT-LVERLEDFVSGLLLPLFFAISGLKTEISAI-DSVATWGVLCVVIFLACAGKVIGV  369

Query  1614  LVASCYTGMSTNEAIGLGVLTNTKSTMVMIILEVGqvqqvlsvqqysmmvVACLIMTIVA  1435
             ++ + Y  M   E + LG+L N K  + MI+L VG+ Q+VL  + +++MV+  + MT + 
Sbjct  370   VIVTLYYKMPFYEGLSLGLLMNAKGLVEMIVLNVGKDQKVLDEKSFAIMVIVAIGMTAII  429

Query  1434  TPLAA-RYCPKQDLEPYKRRTIQNAKPGEELRILACIHGTNNLPAIISLLETSNSTVTSP  1258
             TP+    Y P ++  PYKRRT+Q  K   E R+L  IH    +P IISLLE S  T  SP
Sbjct  430   TPIVTIVYKPSRNFTPYKRRTVQITKLDREFRVLVSIHTPKAVPTIISLLEASCPTKKSP  489

Query  1257  ITAFGVQLLELVGRAPAMMvvhssgsgrhvggsHEEVQTSQIISTFDNYELRSHGVTAQV  1078
             +  + + L+EL GRA  M++VH+         +  + Q+  II+ F+N+E  +  V  Q 
Sbjct  490   LCIYVLHLVELTGRASGMLIVHNMRKIGRPAMNRTQAQSDHIINAFENFEKSAGCVYVQP  549

Query  1077  LTARWSYDTMAEDICKMAKEKRAAFLVLPFHKQQGTDGEMEDTNPAIQTVNEGVLLSAPC  898
             LTA   Y TM EDIC +A+EKR A +++PFHKQQ  DG +E TN + +T+N+ VL +APC
Sbjct  550   LTAISPYSTMHEDICVLAEEKRVALIIIPFHKQQTVDGGLETTNTSFRTINQNVLANAPC  609

Query  897   SVGILVERG----RPNQYAKNIAVLYLGGPDDREALTYARRMSGLPGVHLTVIRFVPAKD  730
             SVGILV+RG      NQ + ++AVL+ GGPDDREAL YA RMS  P ++LTV+RF+P  +
Sbjct  610   SVGILVDRGLTRSTANQISHHVAVLFFGGPDDREALAYAWRMSEHPNLNLTVMRFLPG-E  668

Query  729   VSADGAVEDPDLELELTRETSFVTVSIDPARDKEEDEELLNNFRTETAEDDSKTFMELVL  550
              + + +  D         + S +TV  +  R+K+ DEE +  FRT+T  D S  ++E ++
Sbjct  669   TTTEASRSDSTSN---KNDYSVLTVETERDREKQLDEEYVTEFRTKTGNDGSIVYIERIV  725

Query  549   DDEEEFTKAVKSLDDRSFDLYVAGRGRGVSSALTSGLADWCECPELGAVGDllvtsefes  370
             +  EE   A++S+D+ S DL++ GRG+G SS LT+G+ DW ECPELGA+GDLL +S+F  
Sbjct  726   NHGEETVAAIRSIDN-SHDLFIVGRGQGTSSPLTAGITDWSECPELGAIGDLLASSDFAM  784

Query  369   sfsvlvVQQYV  337
               S LVVQQYV
Sbjct  785   KASALVVQQYV  795



>ref|XP_006299510.1| hypothetical protein CARUB_v10015680mg [Capsella rubella]
 gb|EOA32408.1| hypothetical protein CARUB_v10015680mg [Capsella rubella]
Length=823

 Score =   580 bits (1495),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 338/793 (43%), Positives = 510/793 (64%), Gaps = 32/793 (4%)
 Frame = -3

Query  2658  VMCFSQTIYRSNGVWEGPDPLAPMIPLFILQIMTAILSSRILNFVLKPFNQPPLVAEILS  2479
             ++C++ ++  +NGVW+G +PL   +PLF+LQ+   ++ +R   F+LKPF QP +++EIL 
Sbjct  13    IICYAPSMITTNGVWQGDNPLDFSLPLFVLQLTLVVVVTRFFVFILKPFRQPRVISEILG  72

Query  2478  GIILGPSMLGNIEEFRKHNFPNHNFETIETMGHFALVLYAFLTGLQMDVKAIVHTGTKSR  2299
             GI+LGPS+ G  ++F    FP  +   +ETM +  L+ + FL G++MD+  +  TG ++ 
Sbjct  73    GIVLGPSVFGRSQKFAHTIFPQRSVMVLETMANVGLLYFLFLVGVEMDIMVVRKTGKRAL  132

Query  2298  IVAVSGSIFPFLIGAGFYFTLQTDTQSMIG----FIFCGSALTVTGFSTLAKILDSKRLL  2131
              +A+ G + PFLIGA F F++   ++  +G     +F G AL+VT F  LA+IL   +L+
Sbjct  133   TIAIGGMVLPFLIGAAFSFSMHR-SEDHLGQGTYILFLGVALSVTAFPVLARILAELKLI  191

Query  2130  NTEIGKIAASSALINVALSWVLLTIGLLFTGSLDNVQ----WAvlctvgfvvvcvnyVRP  1963
             NTEIG+I+ S+AL+N   +W+LL + +    S D       W ++ + GF+ +CV  VRP
Sbjct  192   NTEIGRISMSAALVNDMFAWILLALAIALAES-DKTSFASLWVMISSAGFIAICVFVVRP  250

Query  1962  LLNWLISKTPEGQGFSEFYICSFIAVICAFGCFTDAMGSHPMIGAFIFGLIMPNNELLRT  1783
              + W+I KTPEG+ FSEFYIC  +  +   G  TDA+G+H + GAF+FGL++PN  L  T
Sbjct  251   GITWIIRKTPEGENFSEFYICLILTGVMISGFITDAIGTHSVFGAFVFGLVIPNGPLGLT  310

Query  1782  AILDRLEDFVMGILMPVFFLVCGLRTNIFTITDGDTSIFTALALILLACSAKIIAALVAS  1603
              ++++LEDFV G+L+P+FF + GL+TNI +I  G  +  T   +I LAC+ K+I  ++ +
Sbjct  311   -LIEKLEDFVSGLLLPLFFAISGLKTNIASI-QGPATWATLFFVIFLACAGKVIGTVIVA  368

Query  1602  CYTGMSTNEAIGLGVLTNTKSTMVMIILEVGqvqqvlsvqqysmmvVACLIMTIVATPLA  1423
              + GM   E I LG+L NTK  + MI+L VG+ Q+VL  + ++ MV+  L+MT V TP+ 
Sbjct  369   FFHGMPVREGITLGLLLNTKGLVEMIVLNVGKDQKVLDDETFATMVLVALVMTGVITPIV  428

Query  1422  -ARYCPKQDLEPYKRRTIQNAKPGEELRILACIHGTNNLPAIISLLETSNSTVTSPITAF  1246
                Y P +    YKRRT+Q  KP  E R+L C+H   N+P II+LLE S+ T  SPI  +
Sbjct  429   TVLYRPVKKSVSYKRRTVQQTKPDSEFRVLVCVHTPRNVPTIINLLEASHPTKRSPICIY  488

Query  1245  GVQLLELVGRAPAMMvvhssgsgrhvggsHEEVQTSQIISTFDNYELRSHGVTAQVLTAR  1066
              + L+EL GRA AM++VH++        +  + Q+  II+ F+NYE  +  V  Q LTA 
Sbjct  489   VLHLVELTGRASAMLIVHNTRKSGRPALNRTQAQSDHIINAFENYEQHAAFVAVQPLTAI  548

Query  1065  WSYDTMAEDICKMAKEKRAAFLVLPFHKQQGTDGEMEDTNPAIQTVNEGVLLSAPCSVGI  886
               Y TM ED+C +A++KR +F+++PFHKQQ  DG ME TNPA + VN+ +L ++PCSVGI
Sbjct  549   SPYSTMHEDVCSLAEDKRVSFIIIPFHKQQTVDGGMEATNPAYRLVNQNLLENSPCSVGI  608

Query  885   LVERG-------RPNQYAKNIAVLYLGGPDDREALTYARRMSGLPGVHLTVIRFVPAKD-  730
             LV+RG         N  +  +AVL+ GGPDDREAL YA RM+  PG+ LTV+RF+  +D 
Sbjct  609   LVDRGLNGATRLNTNTVSLQVAVLFFGGPDDREALAYAWRMAQHPGISLTVLRFIHDQDE  668

Query  729   --VSADGAVEDPDLELELTRETSFVTVSIDPARDKEEDEELLNNFRTETAEDDSKTFMEL  556
                ++  A  D DL++          +++D  + ++ D+E +N FRT  A+ +S  ++E 
Sbjct  669   LETASMRATNDTDLKIP--------KMNMDHKKQRQFDDEYINAFRTSNADFESVVYIEK  720

Query  555   VLDDEEEFTKAVKSLDDRSFDLYVAGRGRGVSSALTSGLADWCECPELGAVGDllvtsef  376
             ++ + EE   AV+S+D  S DL++ GRG G+SS L +GL DW ECPELGA+GDLL +S+F
Sbjct  721   LVANGEETVAAVRSMDS-SHDLFIVGRGEGMSSPLLAGLTDWSECPELGAIGDLLASSDF  779

Query  375   essfsvlvVQQYV  337
              ++ SVLVVQQYV
Sbjct  780   AATVSVLVVQQYV  792



>ref|XP_011070107.1| PREDICTED: cation/H(+) antiporter 15-like [Sesamum indicum]
Length=831

 Score =   576 bits (1485),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 338/796 (42%), Positives = 492/796 (62%), Gaps = 40/796 (5%)
 Frame = -3

Query  2658  VMCFSQTIYRSNGVWEGPDPLAPMIPLFILQIMTAILSSRILNFVLKPFNQPPLVAEILS  2479
             ++C+S T+  +NG+W+G DPL   +PLF+LQ+   I ++RIL F+LKPF QP ++AEIL 
Sbjct  16    IVCYSPTMITTNGIWQGEDPLDFALPLFVLQVTLIICTTRILVFILKPFRQPRVIAEILG  75

Query  2478  GIILGPSMLGNIEEFRKHNFPNHNFETIETMGHFALVLYAFLTGLQMD-VKAIVHTGTKS  2302
             G+ILGPS+LG   EF    FP  +   +ETM +  L+ + FL G++MD V+ I  +G K+
Sbjct  76    GVILGPSVLGRSTEFSITLFPLRSVMVLETMANVGLLYFLFLVGVEMDIVQVIKSSGRKA  135

Query  2301  RIVAVSGSIFPFLIGAGFYFTLQTDTQSM---IGFIFCGSALTVTGFSTLAKILDSKRLL  2131
              I+AV+G I PFLIG  F F L    Q +   I  IF G AL+VT F  LA+IL   +L+
Sbjct  136   VIIAVTGMILPFLIGVSFSFILHQSAQYVKLGIFIIFLGVALSVTAFPVLARILAELKLV  195

Query  2130  NTEIGKIAASSALINVALSWVLLTIGLLFTGSLDNVQWAvlctvgfvvvcv------nyV  1969
             NTEIGKIA +SAL+N   +WVLL    +     +N  W++   +               V
Sbjct  196   NTEIGKIAMASALLNDMCAWVLLA---VALAVAENEYWSLNSLMVIAGTAAFVVFCIYVV  252

Query  1968  RPLLNWLISKTPEGQGFSEFYICSFIAVICAFGCFTDAMGSHPMIGAFIFGLIMPNNELL  1789
             RPL+ W+I KTPEG+  SEFYIC  ++ +   G  TDA+G+H + GAF++GL++PN  + 
Sbjct  253   RPLILWIIQKTPEGESVSEFYICLILSGVMISGFITDAIGTHSVFGAFVYGLVIPNGPIG  312

Query  1788  RTAILDRLEDFVMGILMPVFFLVCGLRTNIFTITDGDTSIFTALALILLACSAKIIAALV  1609
              T +++RLEDFV+G+L+P+FF + GL+T++ +I    T    AL +I+LA + KI   L+
Sbjct  313   VT-LIERLEDFVLGLLLPLFFAISGLKTDVTSIKGAGTWATLAL-VIVLASAGKITGTLL  370

Query  1608  ASCYTGMSTNEAIGLGVLTNTKSTMVMIILEVGqvqqvlsvqqysmmvVACLIMTIVATP  1429
              S Y  +   E + LG+L NTK  + +I+L VG+ Q VL  + +++MV+  ++MT +  P
Sbjct  371   VSLYYDIPFYEGLTLGLLMNTKGLVEIIVLNVGKDQNVLDDKTFAIMVIVAVVMTSIVQP  430

Query  1428  -LAARYCPKQDLEPYKRRTIQNAKPGEELRILACIHGTNNLPAIISLLETSNSTVTSPIT  1252
              +   Y P +    YKRRTIQ  KP  E R++ C+H   N+P II LLE S+ T  SPI+
Sbjct  431   GVTTLYRPARKRVAYKRRTIQRTKPDGEFRVVVCVHTPRNVPTIIQLLEASHPTKKSPIS  490

Query  1251  AFGVQLLELVGRAPAMMvvhssgsgrhvggsHEEVQTSQIISTFDNYELRSHGVTAQVLT  1072
              + + L+EL GRA A+ +V  +        +  + Q+  I + F N+E     V+    T
Sbjct  491   TYVLHLVELSGRASAVHIVQYTRKSGRPAINRMQAQSDHIFNAFQNFEQHGGFVSVTPFT  550

Query  1071  ARWSYDTMAEDICKMAKEKRAAFLVLPFHKQQGTDGEMEDTNPAIQTVNEGVLLSAPCSV  892
             A   Y T+ EDIC +A++KRAA +++PFHK Q  DG MEDTN + + +N+ VL  APCSV
Sbjct  551   AISQYSTIHEDICNLAEDKRAALIIIPFHKHQTVDGRMEDTNSSFRMLNQNVLAHAPCSV  610

Query  891   GILVERG-------RPNQYAKNIAVLYLGGPDDREALTYARRMSGLPGVHLTVIRFVPAK  733
             GILV+RG         NQ   +IAVL+ GGPDDREAL YA R+S  PG ++TV+RFV   
Sbjct  611   GILVDRGLNGQKRLSQNQILHHIAVLFFGGPDDREALAYAWRLSQHPGNNITVMRFVLG-  669

Query  732   DVSADGAVEDPDLELELTRETS----FVTVSIDPARDKEEDEELLNNFRTETAEDDSKTF  565
                        D  LE T E++     +TV  D  R+K+ DE+ ++ FR  T    +  +
Sbjct  670   -----------DNGLETTTESNSGQETLTVETDDDREKKLDEKCIHEFREITMHSSAVMY  718

Query  564   MELVLDDEEEFTKAVKSLDDRSFDLYVAGRGRGVSSALTSGLADWCECPELGAVGDllvt  385
             ME V++  EE   A++++D  + DL++ G+GR V S  T+GL+DW ECPELGA+GDLL +
Sbjct  719   MEKVVNHGEETVAAIRTIDG-NHDLFIVGKGRAVISPFTAGLSDWSECPELGAIGDLLAS  777

Query  384   sefessfsvlvVQQYV  337
             S+F +++SVLV+QQYV
Sbjct  778   SDFLATYSVLVLQQYV  793



>ref|XP_010468568.1| PREDICTED: LOW QUALITY PROTEIN: cation/H(+) antiporter 15-like 
[Camelina sativa]
Length=823

 Score =   574 bits (1479),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 336/792 (42%), Positives = 507/792 (64%), Gaps = 32/792 (4%)
 Frame = -3

Query  2658  VMCFSQTIYRSNGVWEGPDPLAPMIPLFILQIMTAILSSRILNFVLKPFNQPPLVAEILS  2479
             ++ ++ ++  +NGVW+G +PL   +PLF+LQ+   ++ +R   F+LKPF QP +++EIL 
Sbjct  13    IIXYAPSMITTNGVWQGDNPLDFSLPLFVLQLTLVVVVTRFFVFILKPFRQPRVISEILG  72

Query  2478  GIILGPSMLGNIEEFRKHNFPNHNFETIETMGHFALVLYAFLTGLQMDVKAIVHTGTKSR  2299
             GI+LGPS+LG  E+F    FP  +   +ETM +  L+ + FL G++MD+  +  TG ++ 
Sbjct  73    GIVLGPSVLGRSEKFAHTIFPQRSVMVLETMANVGLLYFLFLVGVEMDIMVVRKTGKRAL  132

Query  2298  IVAVSGSIFPFLIGAGFYFTLQTDTQSMIG----FIFCGSALTVTGFSTLAKILDSKRLL  2131
              +A+ G + PFLIGA F F++   ++  +G     +F G AL+VT F  LA+IL   +L+
Sbjct  133   TIAIGGMVLPFLIGAAFSFSMHR-SEDHLGQGTYILFLGVALSVTAFPVLARILAELKLI  191

Query  2130  NTEIGKIAASSALINVALSWVLLTIGLLFTGSLDNVQ----WAvlctvgfvvvcvnyVRP  1963
             NTEIG+I+ S+AL+N   +W+LL + +    S D       W ++ +  F+ VCV  VRP
Sbjct  192   NTEIGRISMSAALVNDMFAWILLALAIALAES-DKTSFASLWVMISSAVFIAVCVFIVRP  250

Query  1962  LLNWLISKTPEGQGFSEFYICSFIAVICAFGCFTDAMGSHPMIGAFIFGLIMPNNELLRT  1783
              + W+I KTPEG+ +SEFYIC  +  +   G  TDA+G+H + GAF+FGL++PN  L  T
Sbjct  251   GITWIIRKTPEGENYSEFYICLILTGVMISGFITDAIGTHSVFGAFVFGLVIPNGPLGLT  310

Query  1782  AILDRLEDFVMGILMPVFFLVCGLRTNIFTITDGDTSIFTALALILLACSAKIIAALVAS  1603
              ++++LEDFV G+L+P+FF + GL+TN+  I  G  +  T   +I LAC+ K+I  ++ +
Sbjct  311   -LIEKLEDFVSGLLLPLFFAISGLKTNVAAI-QGPATWATLFFVIFLACAGKVIGTVIVA  368

Query  1602  CYTGMSTNEAIGLGVLTNTKSTMVMIILEVGqvqqvlsvqqysmmvVACLIMTIVATPLA  1423
              + GM   E I LG+L NTK  + MI+L VG+ Q+VL  + ++ MV+  L+MT V TP+ 
Sbjct  369   FFHGMPVREGITLGLLLNTKGLVEMIVLNVGKDQKVLDDETFATMVLVALVMTGVITPIV  428

Query  1422  -ARYCPKQDLEPYKRRTIQNAKPGEELRILACIHGTNNLPAIISLLETSNSTVTSPITAF  1246
                Y P +    YKRRTIQ  KP  ELR+L C+H   N+P II+LLE S+ T  SPI  +
Sbjct  429   TVLYRPVKKSVSYKRRTIQQTKPDSELRVLVCVHTPRNVPTIINLLEASHPTKRSPICIY  488

Query  1245  GVQLLELVGRAPAMMvvhssgsgrhvggsHEEVQTSQIISTFDNYELRSHGVTAQVLTAR  1066
              + L+EL GRA AM++VH++        +  + Q+  II+ F+NYE  +  V  Q LTA 
Sbjct  489   VLHLVELTGRASAMLIVHNTRKSGRPALNRTQAQSDHIINAFENYEQHAAFVAVQPLTAI  548

Query  1065  WSYDTMAEDICKMAKEKRAAFLVLPFHKQQGTDGEMEDTNPAIQTVNEGVLLSAPCSVGI  886
               Y TM ED+C +A++KR +F+++PFHKQQ  DG ME TNPA + VN+ +L ++PCSVGI
Sbjct  549   SPYSTMHEDVCSLAEDKRVSFIIIPFHKQQTVDGGMEATNPAYRLVNQNLLENSPCSVGI  608

Query  885   LVERG-------RPNQYAKNIAVLYLGGPDDREALTYARRMSGLPGVHLTVIRFVPAK--  733
             LV+RG         N  +  +AVL+ GGPDDREAL YA RM+  PG+ LTV+RF+  +  
Sbjct  609   LVDRGLNGATRLNSNTVSLQVAVLFFGGPDDREALAYAWRMAQHPGISLTVLRFIHDEDE  668

Query  732   -DVSADGAVEDPDLELELTRETSFVTVSIDPARDKEEDEELLNNFRTETAEDDSKTFMEL  556
              D ++  A  + DL+           +++D  + ++ D+E +N FRT  A+ +S  ++E 
Sbjct  669   IDTASTRATNETDLKAP--------KMNMDHKKQRQLDDEYINAFRTSNADFESIVYIEK  720

Query  555   VLDDEEEFTKAVKSLDDRSFDLYVAGRGRGVSSALTSGLADWCECPELGAVGDllvtsef  376
             ++ + E+   AV+S+D  S DL++ GRG G+ S LT+GL DW ECPELGA+GDLL +S+F
Sbjct  721   LVSNGEDTVAAVRSMDS-SHDLFIVGRGEGMLSPLTAGLTDWSECPELGAIGDLLASSDF  779

Query  375   essfsvlvVQQY  340
              ++ SVLVVQQY
Sbjct  780   AATVSVLVVQQY  791



>ref|XP_004486258.1| PREDICTED: cation/H(+) antiporter 15-like [Cicer arietinum]
Length=831

 Score =   572 bits (1475),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 334/789 (42%), Positives = 496/789 (63%), Gaps = 31/789 (4%)
 Frame = -3

Query  2658  VMCFSQTIYRSNGVWEGPDPLAPMIPLFILQIMTAILSSRILNFVLKPFNQPPLVAEILS  2479
             ++C++ T+  ++GVW+G  PL   IPLFILQ    +L++R   F+LKPF+QP ++AEI+ 
Sbjct  17    IICYTPTMTTTSGVWQGDSPLDYSIPLFILQSTLVVLATRFFVFILKPFHQPRVIAEIMG  76

Query  2478  GIILGPSMLGNIEEFRKHNFPNHNFETIETMGHFALVLYAFLTGLQMDVKAIVHTGTKSR  2299
             G++LGPS+LG  E F    FP  +   IETM +  L+ + FL GL+MD+  +  TG K+ 
Sbjct  77    GLLLGPSVLGRDERFANMVFPLKSAMVIETMANIGLIYFLFLVGLEMDMSIVKRTGRKAV  136

Query  2298  IVAVSGSIFPFLIGAGF--YFTLQTDTQSMIGFI-FCGSALTVTGFSTLAKILDSKRLLN  2128
              +AV+G I PF+I  G   +   +    + + ++ + G  L+VT F  LA++L   +L+N
Sbjct  137   SIAVAGMILPFVIAIGISHFMDYKDKGANDVSYVLYLGIVLSVTAFPVLARMLAELKLIN  196

Query  2127  TEIGKIAASSALINVALSWVLLTIGLLF----TGSLDNVQWAvlctvgfvvvcvnyVRPL  1960
             TE+GK+A SS+LIN   +WVLL + +      + +L +V W VL  + FV  C   VRP 
Sbjct  197   TELGKLALSSSLINDVCAWVLLALAIALSEQNSSTLASV-WVVLSNIFFVSFCFLVVRPA  255

Query  1959  LNWLISKTPEGQGFSEFYICSFIAVICAFGCFTDAMGSHPMIGAFIFGLIMPNNELLRTA  1780
             + WLI KTPEG+ FSEF IC  +  +      TD +G+H + GAF++GL++PN   L  A
Sbjct  256   VTWLIKKTPEGKPFSEFQICIVLVGVLVSAFITDVIGTHSIFGAFVYGLVIPNGP-LGAA  314

Query  1779  ILDRLEDFVMGILMPVFFLVCGLRTNIFTITDGDTSIFTALALILLACSAKIIAALVASC  1600
             I+++LEDFV G+L+P+F+ + GL+TNI  +  G  S      ++ L C  KI+  L+ S 
Sbjct  315   IIEKLEDFVSGLLLPLFYAISGLKTNI-NLIHGTRSWSFIFTIVPLTCFGKILGTLITSI  373

Query  1599  YTGMSTNEAIGLGVLTNTKSTMVMIILEVGqvqqvlsvqqysmmvVACLIMTIVATPLAA  1420
                + T + I LG+L NTK  + MI+L +G+ Q+VL  + +S+MV+  +IMT + +P+  
Sbjct  374   LFDIPTRDGIVLGLLMNTKGLIEMIVLNIGREQKVLGDEIFSIMVIVTVIMTAIISPIVT  433

Query  1419  R-YCPKQDLEPYKRRTIQNAKPGEELRILACIHGTNNLPAIISLLETSNSTVTSPITAFG  1243
               Y P++ L PYK+RT+Q+++   ELR+L CIH   N+P II+LLE ++ +  SPI A+ 
Sbjct  434   LIYKPRKRLVPYKKRTVQSSRVDAELRVLVCIHAPRNVPTIINLLEATHPSKRSPICAYV  493

Query  1242  VQLLELVGRAPAMMvvhssgsgrhvggsHEEVQTSQIISTFDNYELRSHGVTAQVLTARW  1063
             + L+EL GRA AM+VVH+S        +  + QT  II+ F N+E     V  Q LTA  
Sbjct  494   LHLVELTGRASAMLVVHASRQSGGPALNKTQAQTEHIITAFQNFEEHVGYVAVQPLTAVS  553

Query  1062  SYDTMAEDICKMAKEKRAAFLVLPFHKQQGTDGEMEDTNPAIQTVNEGVLLSAPCSVGIL  883
              Y TM EDIC +A+EKR A +++PFHKQQ  DG+M++TNPA++ VN  +L S+PCSVGIL
Sbjct  554   PYSTMHEDICNLAEEKRVATIIIPFHKQQTVDGDMKETNPALRMVNHNLLQSSPCSVGIL  613

Query  882   VERG-------RPNQYAKNIAVLYLGGPDDREALTYARRMSGLPGVHLTVIRFVPAKDVS  724
             V+RG         NQ +  +AV++ GG DDREAL+Y  RMS  P VHLTV+ F+P KDV+
Sbjct  614   VDRGLNGSNRLTANQASHQVAVIFFGGADDREALSYGWRMSRHPRVHLTVMHFIPGKDVT  673

Query  723   ADGAVEDPDLELELTRETSFVTVSIDPARDKEEDEELLNNFRTETAEDDSKTFMELVLDD  544
                 ++  D   +L  + + +T  I        DEE +N  +   A DD   ++E V+ +
Sbjct  674   ---QLKTNDFN-QLDDQRNIITNRI--------DEECINELKMIAANDDKINYIEKVVSN  721

Query  543   EEEFTKAVKSLDDRSFDLYVAGRGRGVSSALTSGLADWCECPELGAVGDllvtsefessf  364
              EE   A++  ++ + DL++ GRG+G SS LT GL DW ECPELG +GDLL +S+FE++ 
Sbjct  722   GEETVAAIRGTNNAN-DLFIVGRGQGNSSTLTEGLTDWSECPELGPIGDLLASSDFETTA  780

Query  363   svlvVQQYV  337
             SVLV+ QYV
Sbjct  781   SVLVMHQYV  789



>ref|XP_003522484.1| PREDICTED: cation/H(+) antiporter 15-like [Glycine max]
Length=827

 Score =   571 bits (1472),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 329/803 (41%), Positives = 502/803 (63%), Gaps = 28/803 (3%)
 Frame = -3

Query  2688  EVDLDRLGQVVMCFSQTIYRSNGVWEGPDPLAPMIPLFILQIMTAILSSRILNFVLKPFN  2509
             +V  ++    ++C++ ++  +NGVW+G +PL   +PLFILQ+   ++++RI  F+LKPF 
Sbjct  3     DVATNKTDDYIVCYAPSMITTNGVWQGDNPLEYSLPLFILQLTLVVVATRIFVFILKPFR  62

Query  2508  QPPLVAEILSGIILGPSMLGNIEEFRKHNFPNHNFETIETMGHFALVLYAFLTGLQMDVK  2329
             QP ++AEIL G++LGPS+LG  E F    FP  +   IETM +  L+ + FL G++MD+ 
Sbjct  63    QPRVIAEILGGVMLGPSVLGQNEAFANAVFPLRSVMVIETMANIGLLYFLFLVGVEMDLT  122

Query  2328  AIVHTGTKSRIVAVSGSIFPFLIGAGFYFTLQTDTQSMIG----FIFCGSALTVTGFSTL  2161
              +   G K+   A++G I PF++G  F + L   T S I      +F G AL+VT F  L
Sbjct  123   VMRSVGRKAVASAIAGMILPFIVGIAFSYLLAKKTDSDINQGTYILFLGVALSVTAFPVL  182

Query  2160  AKILDSKRLLNTEIGKIAASSALINVALSWVLLTIGLLFT----GSLDNVQWAvlctvgf  1993
             A+IL   +L+NTE+G++A S+ALIN   +WV+L + +        +L ++ W ++ +V F
Sbjct  183   ARILAELKLVNTELGRLALSAALINDVCAWVMLALAIALAETEITTLASL-WVLISSVVF  241

Query  1992  vvvcvnyVRPLLNWLISKTPEGQGFSEFYICSFIAVICAFGCFTDAMGSHPMIGAFIFGL  1813
             V +C   VRP    L+ KTPEG+ FSEFYI   +A +   G  TDA+G+H + GAF+FGL
Sbjct  242   VAICAYGVRPAAKCLVKKTPEGESFSEFYISLILAGVMVSGFITDAIGTHAVFGAFVFGL  301

Query  1812  IMPNNELLRTAILDRLEDFVMGILMPVFFLVCGLRTNIFTITDGDTSIFTALALILLACS  1633
              +PN  L  T ++++LEDFV G+L+P+FF + GL+TN+  I  G  +    + +I LAC 
Sbjct  302   SIPNGPLSFT-LVEKLEDFVSGLLLPLFFAISGLKTNLGLI-HGSYTWVILIIVIFLACL  359

Query  1632  AKIIAALVASCYTGMSTNEAIGLGVLTNTKSTMVMIILEVGqvqqvlsvqqysmmvVACL  1453
              K++  ++ + +  M  +E   LG+L NTK  + M++L VG+ Q+V   + +++MVV  +
Sbjct  360   GKVVGTILVALFYEMPIHEGAALGLLMNTKGLVEMVVLNVGKDQKVFDEESFAIMVVITV  419

Query  1452  IMTIVATP-LAARYCPKQDLEPYKRRTIQNAKPGEELRILACIHGTNNLPAIISLLETSN  1276
             IMT +  P ++  Y P ++   YKRRTI+ +K   E R+L C+H   N+P +I+LLE SN
Sbjct  420   IMTGIIVPAISVIYKPSRNSICYKRRTIEISKLDAEFRVLFCVHTPRNVPTMINLLEASN  479

Query  1275  STVTSPITAFGVQLLELVGRAPAMMvvhssgsgrhvggsHEEVQTSQIISTFDNYELRSH  1096
              T  SPI  + + L+EL GR  AM++VH++        +  E Q+  II  F+NYE  + 
Sbjct  480   PTKNSPICVYVLHLVELSGRTSAMLIVHNTAKQDAPALNRTEAQSDHIIKAFENYEQHAS  539

Query  1095  GVTAQVLTARWSYDTMAEDICKMAKEKRAAFLVLPFHKQQGTDGEMEDTNPAIQTVNEGV  916
              V+ Q LTA   Y TM EDIC +A +KR + +++PFHKQQ  DG ME TN A +++N+ V
Sbjct  540   FVSVQPLTAISPYSTMHEDICNLALDKRVSLIIVPFHKQQTVDGGMEATNMAYRSINQNV  599

Query  915   LLSAPCSVGILVERGRP-------NQYAKNIAVLYLGGPDDREALTYARRMSGLPGVHLT  757
             L +APCSVGILV++G         NQ + ++AVL+ GGPDDREAL Y  RM    G+ LT
Sbjct  600   LANAPCSVGILVDKGLSGSNRLAGNQVSHHVAVLFFGGPDDREALCYGWRMVEHHGISLT  659

Query  756   VIRFVPAKDVSADGAVEDP---DLELELTRETSFVTVSIDPARDKEEDEELLNNFRTETA  586
             V+RFV +  V  +   +     DL+     E   +TV  D    K+ DE+L++ FR    
Sbjct  660   VMRFVQSDQVQVEPLRQQHGGIDLD-----EPRVLTVQTDRDIQKQHDEKLIHEFRMRCG  714

Query  585   EDDSKTFMELVLDDEEEFTKAVKSLDDRSFDLYVAGRGRGVSSALTSGLADWCECPELGA  406
             +DD+  ++E V+ + E+   A++++DD   DL++ GRG+GV S LT+GL DW ECPE+GA
Sbjct  715   DDDAVDYVEKVVSNGEDTVAAIRTMDDIH-DLFIVGRGQGVISPLTAGLTDWSECPEIGA  773

Query  405   VGDllvtsefessfsvlvVQQYV  337
             +GD+L +S+F ++ SVLV+QQYV
Sbjct  774   IGDMLASSDFAATASVLVLQQYV  796



>ref|XP_008804682.1| PREDICTED: cation/H(+) antiporter 15 [Phoenix dactylifera]
Length=903

 Score =   573 bits (1478),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 328/808 (41%), Positives = 504/808 (62%), Gaps = 43/808 (5%)
 Frame = -3

Query  2658  VMCFSQTIYRSNGVWEGPDPLAPMIPLFILQIMTAILSSRILNFVLKPFNQPPLVAEILS  2479
             V+C+S T+  +NG+W+G +PL   +PLFI+Q++  ++++R+L  +LKP +QP +VAEI+ 
Sbjct  18    VVCYSPTLITTNGIWQGNNPLEYSLPLFIIQVILVVVTTRVLVLLLKPLHQPRVVAEIIG  77

Query  2478  GIILGPSMLGNIEEFRKHNFPNHNFETIETMGHFALVLYAFLTGLQMDVKAIVHTGTKSR  2299
             GI+LGPS LG ++   +  FP  +  T+ET+ H  L+ + FL G++MDV  I  TG ++ 
Sbjct  78    GILLGPSCLGKVKIIGESVFPTRSLLTLETVAHVGLLYFLFLVGVEMDVMVIKRTGRRAL  137

Query  2298  IVAVSGSIFPFLIGAGFYFTLQTDTQSMIG----FIFCGSALTVTGFSTLAKILDSKRLL  2131
             ++AV+G + PF IG    + LQ      I      +F G AL VT F  LA+IL   +LL
Sbjct  138   VIAVAGMVLPFGIGVAASYGLQRHVSQNIHQASFLLFIGVALAVTAFPVLARILAESKLL  197

Query  2130  NTEIGKIAASSALINVALSWVL--LTIGLLFTGSLDNVQ------------WAvlctvgf  1993
             NTEIG+IA SSA++N   +W+L  L+I L  +GS D+              W +L  V F
Sbjct  198   NTEIGRIAMSSAIVNDMCAWILLALSIALAESGSGDSAGKGNSSGNALASLWVLLSGVAF  257

Query  1992  vvvcvnyVRPLLNWLISKTPEGQGFSEFYICSFIAVICAFGCFTDAMGSHPMIGAFIFGL  1813
             V+ C   VRP + W++ +TPEG+G S+FY+C  +  +   G  TDA+G H + GAF+FGL
Sbjct  258   VLFCFYAVRPAMRWVMKRTPEGEGVSDFYVCLILTGVMLAGLTTDAIGIHSVFGAFVFGL  317

Query  1812  IMPNNELLRTAILDRLEDFVMGILMPVFFLVCGLRTNIFTITDGDTSIFTALALILLACS  1633
             ++PN   L  A++++LEDFV G+L+P+FF++ GLRTN+ T+ D    +  A+  + LA  
Sbjct  318   VIPNGS-LGVALIEKLEDFVTGLLLPLFFVISGLRTNLATVRDMKAVVPLAVVFV-LASV  375

Query  1632  AKIIAALVASCYTGMSTNEAIGLGVLTNTKSTMVMIILEVGqvqqvlsvqqysmmvVACL  1453
              KI+  ++ + +  MS  + + LG L NT+  + MI+L +G+ ++VL  + +++MV+A +
Sbjct  376   GKILGTVLIAIFFTMSFRDGVALGFLMNTRGLVEMIVLNIGRDKEVLDDESFAVMVLASV  435

Query  1452  IMTIVATPLA-ARYCPKQDLEPYKRRTIQNAKPGEELRILACIHGTNNLPAIISLLETSN  1276
             +MT + TP+  A + P + L  YKRR +Q +KP  ELR+LAC+H T N+PA+ISLL+ S+
Sbjct  436   VMTAMVTPVVMAVHRPTRRLIGYKRRNLQRSKPDVELRMLACVHNTRNVPALISLLDLSH  495

Query  1275  STVTSPITAFGVQLLELVGRAPAMMvvhssgsgr-------hvggsHEEVQTSQIISTFD  1117
              T  SPI  + + L+EL  RA +M++ HS+ +             +    Q   I + F+
Sbjct  496   PTKRSPIFVYALHLVELTNRASSMLIAHSAAATSKPHSSGHSASTTGTHAQADHIFAAFE  555

Query  1116  NYELRSHGVTAQVLTARWSYDTMAEDICKMAKEKRAAFLVLPFHKQQGTDGEMEDTNPAI  937
             +YE  + GV+ Q +T   +Y +M EDIC +A+EK    +VLPFHKQQ  DG ME  N AI
Sbjct  556   SYEQHAGGVSVQAITTVSTYGSMHEDICALAEEKHVTLIVLPFHKQQTVDGAMEPINSAI  615

Query  936   QTVNEGVLLSAPCSVGILVERGR--------PNQYAKNIAVLYLGGPDDREALTYARRMS  781
             +T+NEGVL +APCSV +LV+RG          +    ++A+L+ GGPDDREAL YA RM 
Sbjct  616   RTLNEGVLATAPCSVAVLVDRGLSAASRAAPAHPPTHHVALLFFGGPDDREALAYASRMV  675

Query  780   GLPGVHLTVIRFVPAKDVSADGAVEDPDLELELTRETSFVTVSIDPARDKEEDEELLNNF  601
               PGV L VIRF+P  D++       P       R++  +T+  D +R ++ D+E +N F
Sbjct  676   EHPGVTLLVIRFLPGDDLAV------PTSPSAAARDSRVITIVTDSSRQRQLDDECMNEF  729

Query  600   RTETAEDDSKTFMELVLDDEEEFTKAVKSLDDRSFDLYVAGRGRGVSSALTSGLADWCEC  421
             R     ++S  + E V++  EE   A+++++    DLY+ GRG+G ++ +T+ LA+W EC
Sbjct  730   RLRNVSNESVAYTERVVNSSEETVAALRAMES-IHDLYIVGRGQGEATPMTAALAEWMEC  788

Query  420   PELGAVGDllvtsefessfsvlvVQQYV  337
             PELG +GDLL +S+F ++ SVLVVQQYV
Sbjct  789   PELGPIGDLLASSDFSATVSVLVVQQYV  816



>ref|XP_004502946.1| PREDICTED: cation/H(+) antiporter 15-like [Cicer arietinum]
Length=1173

 Score =   582 bits (1499),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 338/789 (43%), Positives = 495/789 (63%), Gaps = 19/789 (2%)
 Frame = -3

Query  2658  VMCFSQTIYRSNGVWEGPDPLAPMIPLFILQIMTAILSSRILNFVLKPFNQPPLVAEILS  2479
             ++C++ T+  +NG+W+G +PL   +PLFILQ+   + ++RI  F+LKPF QP ++AEIL 
Sbjct  342   IVCYAPTMITTNGIWQGDNPLDYSLPLFILQLTLVVAATRIFVFLLKPFRQPRVIAEILG  401

Query  2478  GIILGPSMLGNIEEFRKHNFPNHNFETIETMGHFALVLYAFLTGLQMDVKAIVHTGTKSR  2299
             G++LGPS+LG  + F    FP  +   IETM +  L+ + FL G++MDV  +   G KS 
Sbjct  402   GVMLGPSLLGQNQTFANTVFPLRSVIVIETMANVGLLYFLFLVGVEMDVTVLRGVGRKSV  461

Query  2298  IVAVSGSIFPFLIGAGFYFTLQTDTQSMIG----FIFCGSALTVTGFSTLAKILDSKRLL  2131
               AV+G + PF IG  F F L+ +  S +      +F G AL+VT F  LA+IL   +L+
Sbjct  462   AAAVAGMVLPFFIGGAFSFLLKREHNSSMNQVTYVLFLGVALSVTAFPVLARILAELKLI  521

Query  2130  NTEIGKIAASSALINVALSWVLLTIGLLFTGSLDNV---QWAvlctvgfvvvcvnyVRPL  1960
             NT++G++A SSALIN   +W+LL   +             W VL  V FV  CV  VRP 
Sbjct  522   NTDLGRLALSSALINDVCAWILLAFAIALADHKATTFASIWVVLSGVAFVAFCVYAVRPA  581

Query  1959  LNWLISKTPEGQGFSEFYICSFIAVICAFGCFTDAMGSHPMIGAFIFGLIMPNNELLRTA  1780
              +W++ KTPEG+ FSEFYI   +A +   G  TDA+G+H + GAF+FGL +P+  L  T 
Sbjct  582   ASWIVKKTPEGESFSEFYISLILAGVMVSGFITDAIGTHSVFGAFVFGLAIPSGPLGVT-  640

Query  1779  ILDRLEDFVMGILMPVFFLVCGLRTNIFTITDGDTSIFTALALILLACSAKIIAALVASC  1600
             ++++LEDFV G+L+P+FF + GL+TNI  IT  +T     L +I LAC  KI+  L  + 
Sbjct  641   LVEKLEDFVSGLLLPLFFAISGLKTNIRLITGANTWAILIL-VIFLACIGKIVGTLAVAI  699

Query  1599  YTGMSTNEAIGLGVLTNTKSTMVMIILEVGqvqqvlsvqqysmmvVACLIMTIVATP-LA  1423
             +  M   E I LG+L NTK  + MI+L VG+ Q++   + +++MV+  +IMT +  P ++
Sbjct  700   FYQMPLQEGITLGLLMNTKGLVEMIVLNVGKDQKIFDEESFAVMVIITIIMTGIIVPSVS  759

Query  1422  ARYCPKQDLEPYKRRTIQNAKPGEELRILACIHGTNNLPAIISLLETSNSTVTSPITAFG  1243
               Y P +    YKRRTIQ +KP  E R+L C+H   N+P +I+LLE SN T  SPI  + 
Sbjct  760   IIYKPSRRNVCYKRRTIQISKPDAEFRVLVCVHSPRNVPTMINLLEASNPTKRSPICIYV  819

Query  1242  VQLLELVGRAPAMMvvhssgsgrhvggsHEEVQTSQIISTFDNYELRSHGVTAQVLTARW  1063
             + L+EL GR  AM++VH++    H   +  E Q+  II  F NYE  +  V  Q LTA  
Sbjct  820   LHLVELSGRTSAMLIVHNTAKPEHTALNRTEAQSDHIIKAFKNYEQHASFVAVQPLTAIS  879

Query  1062  SYDTMAEDICKMAKEKRAAFLVLPFHKQQGTDGEMEDTNPAIQTVNEGVLLSAPCSVGIL  883
              Y TM EDIC +A++KR + +++PFHKQQ  DG ME TN A +T+N+ VL +APCSVGIL
Sbjct  880   PYSTMHEDICHLAEDKRVSLIIIPFHKQQTVDGAMEPTNMAFRTINQNVLANAPCSVGIL  939

Query  882   VERG-------RPNQYAKNIAVLYLGGPDDREALTYARRMSGLPGVHLTVIRFVPAKDVS  724
             V+RG         NQ + ++AV++ GGPDDREAL Y  RM    G++LT++RFVP +   
Sbjct  940   VDRGLTGSNRLSSNQLSHHVAVMFFGGPDDREALCYGWRMLEHSGINLTIMRFVPGEQAC  999

Query  723   ADGAVEDPDLELELTRETSFVTVSIDPARDKEEDEELLNNFRTETAEDDSKTFMELVLDD  544
              + A +  +  L  + E S +TV  D    K+ D++L++ F+     D+S  + E V+++
Sbjct  1000  NEPAKQQHN-GLSNSDEPSVLTVETDNDIQKQLDDKLIHEFKMNHMNDESVDYFEKVVNN  1058

Query  543   EEEFTKAVKSLDDRSFDLYVAGRGRGVSSALTSGLADWCECPELGAVGDllvtsefessf  364
              EE   A++++DD   DL++ GRG+G+ S LT+GL DW ECPE+GA+GDLL +S+F ++ 
Sbjct  1059  GEETVAAIRTIDDIH-DLFIVGRGQGMISPLTAGLTDWSECPEMGAIGDLLASSDFAATA  1117

Query  363   svlvVQQYV  337
             SVLVVQQY+
Sbjct  1118  SVLVVQQYI  1126



>ref|XP_007137799.1| hypothetical protein PHAVU_009G156500g [Phaseolus vulgaris]
 gb|ESW09793.1| hypothetical protein PHAVU_009G156500g [Phaseolus vulgaris]
Length=828

 Score =   570 bits (1469),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 336/790 (43%), Positives = 499/790 (63%), Gaps = 24/790 (3%)
 Frame = -3

Query  2658  VMCFSQTIYRSNGVWEGPDPLAPMIPLFILQIMTAILSSRILNFVLKPFNQPPLVAEILS  2479
             ++C++ T+  +NGVW+G +PL   +PLFILQ+   ++++RI  F+LKPF QP ++AE+L 
Sbjct  12    IVCYAPTMITTNGVWQGDNPLDYSLPLFILQLTLVVIATRIFVFILKPFRQPRVIAEVLG  71

Query  2478  GIILGPSMLGNIEEFRKHNFPNHNFETIETMGHFALVLYAFLTGLQMDVKAIVHTGTKSR  2299
             G++LGPS+LG  + F    FP  +   IETM +  L+ + FL G++MD+  +     K+ 
Sbjct  72    GVMLGPSVLGQNKTFANAVFPLRSVMVIETMANIGLLYFLFLVGVEMDITVMRSVRRKAV  131

Query  2298  IVAVSGSIFPFLIGAGFYFTLQTDTQSMIG----FIFCGSALTVTGFSTLAKILDSKRLL  2131
               A++G + PFL+G  F + L   T S I      +F G AL+VT F  LA+IL   +L+
Sbjct  132   ASAMAGMVLPFLVGVAFSYLLAKKTDSHINQATYILFLGVALSVTAFPVLARILAELKLI  191

Query  2130  NTEIGKIAASSALINVALSWVLLTIGLLF----TGSLDNVQWAvlctvgfvvvcvnyVRP  1963
             NTE+G++A S+ALIN   +W+LL + +        SL ++ W +L   GFV  CV  VRP
Sbjct  192   NTELGRLALSAALINDVCAWILLALAIALAENNATSLASL-WVLLSGAGFVAFCVFAVRP  250

Query  1962  LLNWLISKTPEGQGFSEFYICSFIAVICAFGCFTDAMGSHPMIGAFIFGLIMPNNELLRT  1783
              + WL+ KTPEG+ FSEFYI   +A +   G  TDA+G+H + GAF+FGL +PN  L  T
Sbjct  251   AVAWLVKKTPEGESFSEFYISLILAGVMVSGFITDAIGTHSVFGAFVFGLAIPNGPLSFT  310

Query  1782  AILDRLEDFVMGILMPVFFLVCGLRTNIFTITDGDTSIFTALALILLACSAKIIAALVAS  1603
              ++++LEDFV G+L+P+FF + GL+TN+  + +G  +    + +I LAC  K++  L+ +
Sbjct  311   -LVEKLEDFVSGLLLPLFFAISGLKTNL-ALINGSYTWAILILVIFLACIGKVLGTLMIA  368

Query  1602  CYTGMSTNEAIGLGVLTNTKSTMVMIILEVGqvqqvlsvqqysmmvVACLIMTIVATP-L  1426
              +  M   E   LG+L NTK  + M++L VG+ Q+V   + +++MVV  +IMT +  P +
Sbjct  369   LFYKMPIREGAALGLLMNTKGLVEMVVLNVGKDQKVFDEESFAVMVVITVIMTAIIVPAV  428

Query  1425  AARYCPKQDLEPYKRRTIQNAKPGEELRILACIHGTNNLPAIISLLETSNSTVTSPITAF  1246
             +  Y P +    YKRRTI+ +K   ELR+L CIH   N+P +I+LLE +N T  SPI  +
Sbjct  429   SIIYRPSRSSIYYKRRTIEISKTDTELRLLVCIHTPRNVPTMINLLEATNPTKNSPICVY  488

Query  1245  GVQLLELVGRAPAMMvvhssgsgrhvggsHEEVQTSQIISTFDNYELRSHGVTAQVLTAR  1066
              + L+EL GR  AM++VH++G       +  E Q+  II  F+NYE     ++ Q LTA 
Sbjct  489   VLHLVELSGRTSAMLIVHNTGKPDLPALNRTEAQSDHIIKAFENYEQHVSYISVQPLTAI  548

Query  1065  WSYDTMAEDICKMAKEKRAAFLVLPFHKQQGTDGEMEDTNPAIQTVNEGVLLSAPCSVGI  886
               Y TM EDIC +A +KR + +++PFHKQQ  DG ME TN + + +N+ VL  APCSVGI
Sbjct  549   SPYSTMHEDICNLAADKRVSLIIVPFHKQQTVDGGMEATNMSYRAINQNVLAHAPCSVGI  608

Query  885   LVERGRP-------NQYAKNIAVLYLGGPDDREALTYARRMSGLPGVHLTVIRFVPAKDV  727
             LV+RG         +Q + +IAVL+ GGPDDREAL YA RM     + LT++RFVP + V
Sbjct  609   LVDRGLSGSNRLAGSQVSHHIAVLFFGGPDDREALCYAWRMVEHQAITLTIMRFVPGEQV  668

Query  726   SADGAVEDPDLELELTRETSFVTVSIDPARDKEEDEELLNNFRTETAEDDSKTFMELVLD  547
                   ++ +  ++  RE   +TV  D    K+ DE+LLN FR    ED+S  F+E V++
Sbjct  669   EPSFQQQE-NKHMDGPRE---LTVQTDRDIQKQLDEKLLNEFRMRCGEDNSVGFIEKVVN  724

Query  546   DEEEFTKAVKSLDDRSFDLYVAGRGRGVSSALTSGLADWCECPELGAVGDllvtsefess  367
             + E+   A++++DD   DL+V GRG+G+ S LT+GL DW ECPE+GA+GDLL +S+F ++
Sbjct  725   NGEDTVAAIRTMDD-VHDLFVVGRGQGMISPLTAGLTDWSECPEIGAIGDLLASSDFAAT  783

Query  366   fsvlvVQQYV  337
              SVLVVQQYV
Sbjct  784   ASVLVVQQYV  793



>gb|EYU24742.1| hypothetical protein MIMGU_mgv1a026419mg [Erythranthe guttata]
Length=822

 Score =   568 bits (1465),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/771 (43%), Positives = 484/771 (63%), Gaps = 33/771 (4%)
 Frame = -3

Query  2655  MCFSQTIYRSNGVWEGPDPLAPMIPLFILQIMTAILSSRILNFVLKPFNQPPLVAEILSG  2476
             +C++ T+  +NG+W+G +PL   +PLFILQ++  I++ R L F+LKPF QP +++EIL G
Sbjct  3     LCYAPTMITTNGIWQGDNPLDYSLPLFILQVLLIIVTIRFLVFILKPFRQPRVISEILGG  62

Query  2475  IILGPSMLGNIEEFRKHNFPNHNFETIETMGHFALVLYAFLTGLQMDVKAIVHTGTKSRI  2296
             +ILGPS+LG  ++F  + FP  +   +ETMG+  L+ + FL G+++D+  I  TG ++ +
Sbjct  63    VILGPSLLGQSKQFANNIFPPRSVMILETMGNVGLLFFLFLVGVELDIAVIRSTGRRTFV  122

Query  2295  VAVSGSIFPFLIGAGFYFTLQTDTQSMIGFIFCGSALTVTGFSTLAKILDSKRLLNTEIG  2116
             +A++G I PFLIG  F FTL   TQ          + +VT F  LA+IL   +LLNTEIG
Sbjct  123   IAIAGMILPFLIGVSFAFTLHESTQ---------RSASVTAFPVLARILAELKLLNTEIG  173

Query  2115  KIAASSALINVALSWVLLTIGLLF----TGSLDNVQWAvlctvgfvvvcvnyVRPLLNWL  1948
             +IA +SAL N   +W+LL I +      + SL ++ W VL T  FV+ C   +RPL+ W+
Sbjct  174   RIAMASALFNDICAWILLAIAIAIAENESLSLSSL-WVVLSTGAFVLFCYYVMRPLVCWI  232

Query  1947  ISKTPEGQGFSEFYICSFIAVICAFGCFTDAMGSHPMIGAFIFGLIMPNNELLRTAILDR  1768
             + +TPEGQ  SE YIC  +  +   G  TDA+G+H + GAFIFGL++P+  +  T +++R
Sbjct  233   VRRTPEGQLISEVYICLILTGVMISGFITDAIGTHSVFGAFIFGLVIPSGPIGVT-LIER  291

Query  1767  LEDFVMGILMPVFFLVCGLRTNIFTITDGDTSIFTALALILLACSAKIIAALVASCYTGM  1588
             LEDFV G+L+P+FF + GL+T++  I    T     L +I+LAC+ K+   L+ S Y  +
Sbjct  292   LEDFVTGLLLPLFFAISGLKTDLTLINGVGTWAILGL-VIVLACAGKVTGTLLVSLYYRI  350

Query  1587  STNEAIGLGVLTNTKSTMVMIILEVGqvqqvlsvqqysmmvVACLIMTIVATPLAAR-YC  1411
                E + LG+L N K  + MI+L VG+ Q VL  + +++M+V  ++MT V  P+    Y 
Sbjct  351   PFYEGLTLGLLMNAKGLVEMIVLNVGKDQHVLDDKSFAIMIVVEIVMTAVIQPIVTNIYR  410

Query  1410  PKQDLEPYKRRTIQNAKPGEELRILACIHGTNNLPAIISLLETSNSTVTSPITAFGVQLL  1231
             P + L  YKRRTIQ  K   E R+L C+H   N+P II LLE SN T  SPI+++ + L+
Sbjct  411   PGRKLVAYKRRTIQRTKLKGEFRLLVCVHVPRNVPTIIHLLEASNPTKKSPISSYVLHLV  470

Query  1230  ELVGRAPAMMvvhssgsgrhvggsHEEVQTSQIISTFDNYELRSHGVTAQVLTARWSYDT  1051
             EL GRA A+++VH++        +  + Q+  I + F+N+E +   VT   LTA   Y T
Sbjct  471   ELTGRASAVLIVHNTRKSGRSALNLAQAQSEHIFNAFENFERQGGFVTVNPLTAISPYST  530

Query  1050  MAEDICKMAKEKRAAFLVLPFHKQQGTDGEMEDTNPAIQTVNEGVLLSAPCSVGILVERG  871
             M EDI  +A++KR AF+++PFHKQQ  DG ME TNPA + +N+ VL +APCSVGILV+RG
Sbjct  531   MHEDIFTVAEDKRVAFIIIPFHKQQTVDGGMEATNPAFRIINQSVLANAPCSVGILVDRG  590

Query  870   -------RPNQYA-KNIAVLYLGGPDDREALTYARRMSGLPGVHLTVIRFV---PAKDVS  724
                      NQ +  +IA+L+ GGPDDREA+  A RMS  P   LTV+RFV    A D +
Sbjct  591   LNGSSRASANQMSHHHIALLFFGGPDDREAMALAWRMSEHPRNSLTVMRFVLGETALDTT  650

Query  723   ADGAVED--PDLELELTRETSFVTVSIDPARDKEEDEELLNNFRTETAEDDSKTFMELVL  550
               G + +   +  +E   ET  +TV  D  R+KE D+  +N FR  T  D S  ++E V+
Sbjct  651   KGGDMAEAVANSSIETGHET--LTVLTDDDREKEMDQAYINEFRVATMNDSSVHYVEKVV  708

Query  549   DDEEEFTKAVKSLDDRSFDLYVAGRGRGVSSALTSGLADWCECPELGAVGD  397
             +  EE   A++S+D R  DL++ GRG G+ S +T+GL+DW ECPELGA+GD
Sbjct  709   NHGEETVAAIRSIDTRH-DLFIVGRGHGMISPVTAGLSDWSECPELGAIGD  758



>ref|XP_010923024.1| PREDICTED: cation/H(+) antiporter 15 [Elaeis guineensis]
Length=866

 Score =   568 bits (1463),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/801 (40%), Positives = 500/801 (62%), Gaps = 31/801 (4%)
 Frame = -3

Query  2670  LGQVVMCFSQTIYRSNGVWEGPDPLAPMIPLFILQIMTAILSSRILNFVLKPFNQPPLVA  2491
             +G  V+C+S T+  +NG+W+G +PL   +PLFI+Q++  ++++R+L  +LKP +QP +VA
Sbjct  18    VGGGVVCYSPTLITTNGIWKGSNPLEYSLPLFIIQVILVVVTTRVLVILLKPLHQPRVVA  77

Query  2490  EILSGIILGPSMLGNIEEFRKHNFPNHNFETIETMGHFALVLYAFLTGLQMDVKAIVHTG  2311
             EI+ GI+LGPS LG+++   +  FP  +  T+ET+ H  L+ + FL G++MDV  I  TG
Sbjct  78    EIIGGILLGPSCLGSVKIMGESLFPIRSLLTLETVAHIGLLFFLFLVGVEMDVMVIKRTG  137

Query  2310  TKSRIVAVSGSIFPFLIGAGFYFTLQTDTQSMIG----FIFCGSALTVTGFSTLAKILDS  2143
              ++ ++AV+G + PF IG    + LQ      I      +F G AL VT F  LA+IL  
Sbjct  138   RRALVIAVAGMVVPFGIGIVASYGLQRHVSRNIHQGSFLLFIGVALAVTAFPVLARILAE  197

Query  2142  KRLLNTEIGKIAASSALINVALSWVLLTIGLLFT----------GSLDNVQWAvlctvgf  1993
              +LLNTEIG+IA SSA++N   +W+LL + +  +          G+     W +L  V F
Sbjct  198   SKLLNTEIGRIAMSSAIVNDMCAWILLALSIALSDNGRGGGKPNGNALASLWVLLSGVVF  257

Query  1992  vvvcvnyVRPLLNWLISKTPEGQGFSEFYICSFIAVICAFGCFTDAMGSHPMIGAFIFGL  1813
             V+ C   VRP + W++ +TPEG+G S+F++C  ++ +   G  TDA+G H + GAF+FGL
Sbjct  258   VLFCFYAVRPAMRWIMKRTPEGEGVSDFHVCLILSGVMLAGLTTDAIGIHSVFGAFVFGL  317

Query  1812  IMPNNELLRTAILDRLEDFVMGILMPVFFLVCGLRTNIFTITDGDTSIFTALALILLACS  1633
             ++PN   L  A++++LEDFV G+L+P+FF++ GLRTN+ T+ D  T +   + + +LA  
Sbjct  318   VVPNGP-LGVALIEKLEDFVTGLLLPLFFVISGLRTNLATVRDPKT-VIALVVVFVLASV  375

Query  1632  AKIIAALVASCYTGMSTNEAIGLGVLTNTKSTMVMIILEVGqvqqvlsvqqysmmvVACL  1453
              KI+  ++ + +  MS  + + LG L NT+  + MI+L +G+ +QVL  + +++MVVA +
Sbjct  376   GKILGTVLIAVFFTMSFRDGLALGFLMNTRGLVEMIVLNIGRDKQVLDDESFAVMVVASV  435

Query  1452  IMTIVATPLA-ARYCPKQDLEPYKRRTIQNAKPGEELRILACIHGTNNLPAIISLLETSN  1276
              MT + TP+  A + P + L  YKRR +Q +KP  ELR++ C+H T N+P++ISLL+ S+
Sbjct  436   AMTALVTPVVMAVHRPTRRLIGYKRRNLQRSKPDVELRMMVCVHNTRNVPSLISLLDLSH  495

Query  1275  STVTSPITAFGVQLLELVGRAPAMMvvhssgsgrhvggsHEEVQTSQIISTFDNYELRSH  1096
              T  SPI  + + L+EL  RA AM+      +            +  I + F++YE  + 
Sbjct  496   PTKRSPIFVYALHLVELTARATAML--IVHSAHSSSSAGGGRAHSDHIFAGFESYEQHAG  553

Query  1095  GVTAQVLTARWSYDTMAEDICKMAKEKRAAFLVLPFHKQQGTDGEMEDTNPAIQTVNEGV  916
             GV+ Q +T   +Y +M ED+C +A++K    +VLPFHKQQ  DG M+  NPAI+T+NEGV
Sbjct  554   GVSVQTITTVSTYGSMHEDVCALAEDKHVTLIVLPFHKQQTVDGAMQPINPAIRTLNEGV  613

Query  915   LLSAPCSVGILVERGR--------PNQYAKNIAVLYLGGPDDREALTYARRMSGLPGVHL  760
             L +APCSV +LV+RG          +    ++A+L+ GGPDDREAL YA RM   PGV L
Sbjct  614   LATAPCSVAVLVDRGLSAASRAAPAHTPTHHVALLFFGGPDDREALAYASRMVEHPGVKL  673

Query  759   TVIRFVPAKDVSADGAVEDPDLELELTRETSFVTVSIDPARDKEEDEELLNNFRTETAED  580
              VIRF+P  D +A      P      TR++  +T+  D +R  + D+E +N FR     +
Sbjct  674   LVIRFLPGDDPAAS---TSPSATAAATRDSRVITIVTDGSRQWQLDDECMNEFRLRNVSN  730

Query  579   DSKTFMELVLDDEEEFTKAVKSLDDRSFDLYVAGRGRGVSSALTSGLADWCECPELGAVG  400
             +S  + E V++  E+   A+++++    DLY+ GRG+G ++ +T+ LA+W ECPELG +G
Sbjct  731   ESVAYTERVVNSSEDTVAALRAMES-IHDLYIVGRGQGEATPMTAALAEWMECPELGPIG  789

Query  399   DllvtsefessfsvlvVQQYV  337
             DLL +S+F ++ SVLVVQQYV
Sbjct  790   DLLASSDFSATVSVLVVQQYV  810



>ref|XP_004503932.1| PREDICTED: cation/H(+) antiporter 15-like [Cicer arietinum]
Length=830

 Score =   565 bits (1457),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/794 (42%), Positives = 500/794 (63%), Gaps = 27/794 (3%)
 Frame = -3

Query  2658  VMCFSQTIYRSNGVWEGPDPLAPMIPLFILQIMTAILSSRILNFVLKPFNQPPLVAEILS  2479
             ++C+S  +  +NG+++G +PL   +P+FILQ++  ++++R+  F+LKP  QP ++AEIL 
Sbjct  12    MVCYSPNMITTNGIFQGDNPLDYALPVFILQVILVVIATRLFVFILKPIRQPRVIAEILG  71

Query  2478  GIILGPSMLGNIEEFRKHNFPNHNFETIETMGHFALVLYAFLTGLQMDVKAIVHTGTKSR  2299
             GI+LGPS+LG  + F    FP  +   IETM +  L+ + FL G+ MD  A+  TG KS 
Sbjct  72    GIVLGPSVLGRNKTFADAVFPLRSVMIIETMANVGLLYFLFLVGVGMDASALRRTGRKSV  131

Query  2298  IVAVSGSIFPFLIGA--GFYFTLQTDTQSMIG--FIFCGSALTVTGFSTLAKILDSKRLL  2131
              +AV+G I PF  GA    +    ++ ++  G   +  G  L+VT F  LA+IL   +L+
Sbjct  132   AIAVAGMILPFGTGALCSIWLVKNSEKETNGGSFVLLLGVVLSVTAFPVLARILAELKLV  191

Query  2130  NTEIGKIAASSALINVALSWVLLTIGLLFTGSLDNVQWAvlctvgfvvvcvn----yVRP  1963
             NTE+G++A S+ALIN A+SW+LL + +    + D +  A    V      V      V+P
Sbjct  192   NTEMGRVALSAALINDAMSWILLALAIALAEN-DKISLASFMVVLSSAAYVAFNAFVVKP  250

Query  1962  LLNWLISKTPEGQGFSEFYICSFIAVICAFGCFTDAMGSHPMIGAFIFGLIMPNNELLRT  1783
             ++ W+I KTPEG+ FS+FYIC  +A +   G  TDA+G+H + GAF+FGLI+P    L  
Sbjct  251   VIMWIIRKTPEGESFSDFYICLILAGVMISGFITDAIGTHSVFGAFLFGLIIPPGP-LGC  309

Query  1782  AILDRLEDFVMGILMPVFFLVCGLRTNIFTITDGDTSIFTALALILLACSAKIIAALVAS  1603
             A++++LEDFV G+L+P+FF   GL+TN+  I +  T     + L++LAC  K+I  L+ +
Sbjct  310   ALIEKLEDFVSGLLLPLFFATSGLKTNLCLINNFATWALL-IVLVILACIGKVIGTLIVA  368

Query  1602  CYTGMSTNEAIGLGVLTNTKSTMVMIILEVGqvqqvlsvqqysmmvVACLIMTIVATP-L  1426
                 MS +E   LG+L NTK  + +++L +G+ Q+VL    ++ MV+  ++MT +  P +
Sbjct  369   LSYQMSFSEGAALGMLMNTKGLVEILVLNIGRDQKVLDEGAFATMVIITILMTGMIVPGI  428

Query  1425  AARYCPKQDLEPYKRRTIQNAKPGEELRILACIHGTNNLPAIISLLETSNSTVTSPITAF  1246
             +  Y P + +  YKRRT+Q +K   E R+L CIH   N+P +I+LLE SN T  SPI  +
Sbjct  429   SIIYRPSRGMISYKRRTLQMSKKDAEFRVLVCIHTPRNVPTMINLLEASNPTKKSPICIY  488

Query  1245  GVQLLELVGRAPAMMvvhssgsgrhvggsHEEVQTSQIISTFDNYELRSHGVTAQVLTAR  1066
              + ++EL GR  A+++VH+S    +   +  E Q+  II+ F+N+E  ++ V+ Q LTA 
Sbjct  489   VLHMVELTGRTSALLIVHTSRKSNNPAVNRTEAQSDHIINAFENFEQHANHVSVQPLTAI  548

Query  1065  WSYDTMAEDICKMAKEKRAAFLVLPFHKQQGTDGEMEDTNPAIQTVNEGVLLSAPCSVGI  886
               Y TM EDIC +A+EKR AF++LPFHKQQ  DG ME TN A +TVN+ VL ++PCSVGI
Sbjct  549   SPYSTMHEDICSLAEEKRVAFIILPFHKQQTVDGGMEATNIAFRTVNQNVLANSPCSVGI  608

Query  885   LVERGR-------PNQYAKNIAVLYLGGPDDREALTYARRMSGLPGVHLTVIRFVPAKDV  727
             LV+RG         +Q + N+AVL+ GGPDDREAL+Y  RMS  PG+ LTV+RFVP ++V
Sbjct  609   LVDRGLNSSNRLIADQMSHNVAVLFFGGPDDREALSYGWRMSDHPGITLTVMRFVPGEEV  668

Query  726   SADGAVEDPDLELELTRETSFVTVSIDPARDKEEDEELLNNFRTETAEDDSKTFMELVLD  547
               +    + D +  LT ET       +   DK+ DE+ L+ F      DDS  ++E V+ 
Sbjct  669   LMNDNNHNADKQRVLTVET-------EEDNDKQLDEKFLHWFMISHVNDDSIAYIEKVVS  721

Query  546   DEEEFTKAVKSLDDRSFDLYVAGRGRGVSSALTSGLADWCECPELGAVGDllvtsefess  367
             + EE   A++S+ D  F L++ GRG+GV S LT+GL DW ECPELGA+GDL+ +S+F ++
Sbjct  722   NGEETVAAIRSMGD-VFGLFIVGRGQGVISPLTAGLTDWSECPELGAIGDLMASSDFATT  780

Query  366   fsvlvVQQYVRTNK  325
              SVLVVQQYV  N 
Sbjct  781   ASVLVVQQYVDVNS  794



>emb|CDY47435.1| BnaA08g29740D [Brassica napus]
Length=800

 Score =   564 bits (1453),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 337/788 (43%), Positives = 496/788 (63%), Gaps = 44/788 (6%)
 Frame = -3

Query  2658  VMCFSQTIYRSNGVWEGPDPLAPMIPLFILQIMTAILSSRILNFVLKPFNQPPLVAEILS  2479
             ++C++ ++  +NGVW+G +PL   +PLF+LQ+   ++ +R   FVLKPF QP +++EIL 
Sbjct  11    IICYAPSMITTNGVWQGDNPLDFSLPLFVLQLTLVVVVTRFFVFVLKPFRQPRVISEILG  70

Query  2478  GIILGPSMLGNIEEFRKHNFPNHNFETIETMGHFALVLYAFLTGLQMDVKAIVHTGTKSR  2299
             GI+LGPS+LG  ++F    FP  +   +ETM +  L+ + FL G++MD+  +  TG ++ 
Sbjct  71    GIVLGPSVLGRYDKFANTIFPQRSVMVLETMANVGLLYFLFLVGVEMDIMVVRKTGKRAL  130

Query  2298  IVAVSGSIFPFLIGAGFYFTLQTDTQSMIG----FIFCGSALTVTGFSTLAKILDSKRLL  2131
              +A+ G + PF+IGA F F++Q  T+  +G     +F G AL+VT F  LA+IL   +L+
Sbjct  131   TIALGGMVLPFVIGAAFSFSMQR-TEDHLGQGTYILFLGVALSVTAFPVLARILAELKLI  189

Query  2130  NTEIG-KIA-ASSALINVALSWVLLTIGLLFTGSLDNVQWAvlctvgfvvvcvnyVRPLL  1957
             NTEI   IA A S   + A  WV+++                        +CV  VRP +
Sbjct  190   NTEIALAIALAESEKSSFASLWVMISSAAFIA------------------ICVFVVRPGI  231

Query  1956  NWLISKTPEGQGFSEFYICSFIAVICAFGCFTDAMGSHPMIGAFIFGLIMPNNELLRTAI  1777
             +W+I KTPEG+ FSEFYIC  +  +   G  TD++G+H + GAF+FGL++PN  L  T +
Sbjct  232   SWIIRKTPEGENFSEFYICLILTGVMICGFITDSIGTHSVFGAFVFGLVIPNGPLGLT-L  290

Query  1776  LDRLEDFVMGILMPVFFLVCGLRTNIFTITDGDTSIFTALALILLACSAKIIAALVASCY  1597
             +++LEDFV G+L+P+FF + GL+TN+  I  G  +  T   +I LAC+ K+I  +V + +
Sbjct  291   IEKLEDFVSGLLLPLFFAISGLKTNVAAI-QGPATWVTLFLVIFLACTGKVIGTVVVAFF  349

Query  1596  TGMSTNEAIGLGVLTNTKSTMVMIILEVGqvqqvlsvqqysmmvVACLIMTIVATPLA-A  1420
              GM   E I LG+L NTK  + MI+L VG+ Q+VL  + ++ MV+  L+MT V TP+   
Sbjct  350   HGMPVREGITLGLLLNTKGLVEMIVLNVGKDQKVLDDETFATMVLIALVMTGVITPIVTV  409

Query  1419  RYCPKQDLEPYKRRTIQNAKPGEELRILACIHGTNNLPAIISLLETSNSTVTSPITAFGV  1240
              Y P +    YKRRTIQ  KP  ELR+L CIH   N+P II+LLE S+ T  SPI  + +
Sbjct  410   LYKPVKRSVSYKRRTIQQTKPDSELRVLVCIHTPRNVPTIINLLEASHPTKRSPICIYVL  469

Query  1239  QLLELVGRAPAMMvvhssgsgrhvggsHEEVQTSQIISTFDNYELRSHGVTAQVLTARWS  1060
              L+EL GRA AM++VH++        +  + Q+  II+ F+NYE  +  V  Q LTA   
Sbjct  470   HLVELTGRASAMLIVHNTRKSGKPALNRTQAQSDHIINAFENYEQHAAFVAVQPLTAISP  529

Query  1059  YDTMAEDICKMAKEKRAAFLVLPFHKQQGTDGEMEDTNPAIQTVNEGVLLSAPCSVGILV  880
             Y TM ED+C +A++KR +F+++PFHKQQ  DG ME TNPA + VN+ +L ++PCSVGILV
Sbjct  530   YSTMHEDVCSLAEDKRVSFIIIPFHKQQTVDGGMEATNPAYRLVNQNLLGNSPCSVGILV  589

Query  879   ERG-------RPNQYAKNIAVLYLGGPDDREALTYARRMSGLPGVHLTVIRFVPAKDVSA  721
             +RG         N  +  +AVL+ GGPDDREAL YA RM+  PG+ LTV+RF+P +DV+ 
Sbjct  590   DRGLNGATRLTSNTISLQVAVLFFGGPDDREALAYAWRMAEHPGISLTVLRFIPDEDVT-  648

Query  720   DGAVEDPDLELELTRETSFVTVSIDPARDKEEDEELLNNFRTETAEDDSKTFMELVLDDE  541
             D A          T ET    +++D  + ++ D+E +N FR    E ++  +++ V+ + 
Sbjct  649   DAA------STRATNETDR-NMNVDMKKQRQLDDEYVNTFRAANTEYETIVYIDKVVSNG  701

Query  540   EEFTKAVKSLDDRSFDLYVAGRGRGVSSALTSGLADWCECPELGAVGDllvtsefessfs  361
             EE   AV+S+D  S DL++ GRG  +SS LT+GL DW ECPELGA+GDLL +S+F ++ S
Sbjct  702   EETVAAVRSMDS-SHDLFIVGRGEEMSSPLTAGLTDWSECPELGAIGDLLASSDFAATVS  760

Query  360   vlvVQQYV  337
             VLVVQQYV
Sbjct  761   VLVVQQYV  768



>ref|XP_008227634.1| PREDICTED: cation/H(+) antiporter 15 [Prunus mume]
Length=840

 Score =   560 bits (1443),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 337/800 (42%), Positives = 504/800 (63%), Gaps = 53/800 (7%)
 Frame = -3

Query  2658  VMCFSQTIYRSNGVWEGPDPLAPMIPLFILQIMTAILSSRILNFVLKPFNQPPLVAEILS  2479
             ++C++ T+  +NG+W+G +PL   +PLFILQ+   ++++RIL  +LKPF QP +++EI+ 
Sbjct  20    IVCYAPTMITTNGIWQGDNPLDYSLPLFILQLTMVVVTTRILVIILKPFRQPRVISEIV-  78

Query  2478  GIILGPSMLGNIEEFRKHNFPNHNFETIETMGHFALVLYAFLTGLQMDVKAIVHTGTKSR  2299
             GI                 FP  +   +ETM +  L+ + FL GL+MD+  I   G ++ 
Sbjct  79    GI-----------------FPLRSVMVLETMANVGLLYFLFLVGLEMDISVIRRMGKRAI  121

Query  2298  IVAVSGSIFPFLIGAGFYFTLQTDTQSM---IGFIFCGSALTVTGFSTLAKILDSKRLLN  2128
             ++A++G I PFLIGA F F L    Q M      +F G AL+VT F  LA++L   +L+N
Sbjct  122   VIAIAGMILPFLIGAAFSFLLHKREQPMNQGTFILFLGVALSVTAFPVLARVLAELKLVN  181

Query  2127  TEIGKIAASSALINVALSWVLLTIGLLF----TGSLDNVQWAvlctvgfvvvcvnyVRPL  1960
             TE+G+IA SSAL+N   +W LL + +      T SL ++ + VL +  FV++C+  VRP 
Sbjct  182   TELGRIALSSALVNDMCAWALLALAIALAENDTTSLASL-YVVLSSAAFVLICIFIVRPA  240

Query  1959  LNWLISKTPEGQGFSEFYICSFIAVICAFGCFTDAMGSHPMIGAFIFGLIMPNNELLRTA  1780
             + W+I +TPEG+ FS+FYIC  +  +   G  TDA+G+H + GAF+FGL++PN  L  T 
Sbjct  241   VCWIIRRTPEGESFSDFYICLILTGVMISGFITDAIGTHSVFGAFVFGLVIPNGPLGAT-  299

Query  1779  ILDRLEDFVMGILMPVFFLVCGLRTNIFTITDGDTSIFTALALILLACSAKIIAALVASC  1600
             ++++LEDFV G+L+P+FF + GLRTN+ +I  G  +    L +I LAC  KI   ++   
Sbjct  300   LIEKLEDFVSGLLLPLFFAISGLRTNVSSI-QGPGTWGILLLVIFLACVGKIAGTVIVCL  358

Query  1599  YTGMSTNEAIGLGVLTNTKSTMVMIILEVGqvqqvlsvqqysmmvVACLIMTIVATPLAA  1420
             +  M  +E   LG+L NTK  + +I+L VG+ Q+VL  + +++MV+  ++MT + TP+  
Sbjct  359   FYQMPFDEGFTLGLLMNTKGLVELIVLNVGRDQKVLDDEAFAIMVIVAVVMTGIITPIVT  418

Query  1419  R-YCPKQDLEPYKRRTIQNAKPGEELRILACIHGTNNLPAIISLLETSNSTVTSPITAFG  1243
               Y P +   PYKRR+IQ + P  ELR+L C+H   N+P +I+LLE S+ T  SP+  + 
Sbjct  419   TVYKPARRFIPYKRRSIQRSMPDAELRVLVCVHTPRNVPTMINLLEASHPTKRSPLCIYV  478

Query  1242  VQLLELVGRAPAMMvvhssgsgrhvggsHEEVQTSQIISTFDNYELRSHGVTAQVLTARW  1063
             + L+EL GRA AM++VH++        +  + Q+  II+ F+NYE  +  V+ Q LTA  
Sbjct  479   LHLVELSGRASAMLIVHNTRKSGRPALNRTQAQSDHIINAFENYEQHAGCVSVQPLTAIS  538

Query  1062  SYDTMAEDICKMAKEKRAAFLVLPFHKQQGTDGEMEDTNPAIQTVNEGVLLSAPCSVGIL  883
              Y TM EDIC +A++KR AFL++PFHKQQ  DG ME  NPA +T+N+ VL +APCSVGIL
Sbjct  539   PYSTMHEDICNLAEDKRVAFLIIPFHKQQTVDGGMEAMNPAFRTMNQNVLANAPCSVGIL  598

Query  882   VERG-------RPNQYAKNIAVLYLGGPDDREALTYARRMSGLPGVHLTVIRFVPAKDVS  724
             V+RG         NQ + ++ VL+ GGPDDREAL+YA RMS  PG+ L V+RFVP     
Sbjct  599   VDRGLNGSNRLAANQVSHHVVVLFFGGPDDREALSYAWRMSEHPGISLAVMRFVPGD--G  656

Query  723   ADGA-----------VEDPDLELELTRETSFVTVSIDPARDKEEDEELLNNFRTETAEDD  577
             A GA               D E   +R    ++V  D   +K+ D+EL+N+FR + A D+
Sbjct  657   AGGAERTSASTAASATTATDAEGNNSR---ILSVETDLGWEKQLDDELINDFRMKNANDE  713

Query  576   SKTFMELVLDDEEEFTKAVKSLDDRSFDLYVAGRGRGVSSALTSGLADWCECPELGAVGD  397
             S  + E ++++ EE   A++S+D+   DL++ GRG+G+ S LT+GL DW ECPELGA+GD
Sbjct  714   SILYTEKLVNNGEETVAAIRSMDN-VHDLFIVGRGQGMISPLTAGLTDWSECPELGAIGD  772

Query  396   llvtsefessfsvlvVQQYV  337
             LL +S+F ++ SVLV+QQYV
Sbjct  773   LLASSDFAATASVLVMQQYV  792



>emb|CDX71162.1| BnaC07g04410D [Brassica napus]
Length=800

 Score =   558 bits (1439),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 334/788 (42%), Positives = 495/788 (63%), Gaps = 44/788 (6%)
 Frame = -3

Query  2658  VMCFSQTIYRSNGVWEGPDPLAPMIPLFILQIMTAILSSRILNFVLKPFNQPPLVAEILS  2479
             ++C++ ++  +NGVW+G +PL   +PLF+LQ+   ++ +R   FVLKPF QP +++EIL 
Sbjct  11    IICYAPSMITTNGVWQGDNPLDFSLPLFVLQLTLVVVVTRFFVFVLKPFRQPRVISEILG  70

Query  2478  GIILGPSMLGNIEEFRKHNFPNHNFETIETMGHFALVLYAFLTGLQMDVKAIVHTGTKSR  2299
             GI+LGPS+LG  ++F    FP  +   +ETM +  L+ + FL G++MD+  +  TG ++ 
Sbjct  71    GIVLGPSVLGRYDKFANTIFPRRSVMVLETMANVGLLYFLFLVGVEMDIMVVRKTGKRAL  130

Query  2298  IVAVSGSIFPFLIGAGFYFTLQTDTQSMIG----FIFCGSALTVTGFSTLAKILDSKRLL  2131
              +A+ G + PF+IGA F F++Q  ++  +G     +F G AL+VT F  LA+IL   +L+
Sbjct  131   TIALGGMVLPFVIGAAFSFSMQR-SEDHLGQGTYILFLGVALSVTAFPVLARILAELKLI  189

Query  2130  NTEIG-KIA-ASSALINVALSWVLLTIGLLFTGSLDNVQWAvlctvgfvvvcvnyVRPLL  1957
             NTEI   IA A S   + A  WV+++                        +CV  VRP +
Sbjct  190   NTEIALAIALAESEKSSFASLWVMISSAAFIA------------------ICVFVVRPGI  231

Query  1956  NWLISKTPEGQGFSEFYICSFIAVICAFGCFTDAMGSHPMIGAFIFGLIMPNNELLRTAI  1777
             +W+I KTPEG+ FSEFYIC  +  +   G  TD++G+H + GAF+FGL++PN  L  T +
Sbjct  232   SWIIRKTPEGENFSEFYICLILTGVMICGFITDSIGTHSVFGAFVFGLVIPNGPLGLT-L  290

Query  1776  LDRLEDFVMGILMPVFFLVCGLRTNIFTITDGDTSIFTALALILLACSAKIIAALVASCY  1597
             +++LEDFV G+L+P+FF + GL+TN+  I  G  +  T   +I LAC+ K+I  +V + +
Sbjct  291   IEKLEDFVSGLLLPLFFAISGLKTNVAAI-QGPATWVTLFLVIFLACTGKVIGTVVVAFF  349

Query  1596  TGMSTNEAIGLGVLTNTKSTMVMIILEVGqvqqvlsvqqysmmvVACLIMTIVATPLA-A  1420
              GM   E I LG+L NTK  + MI+L VG+ Q+VL  + ++ MV+  L+MT V TP+   
Sbjct  350   HGMPVREGITLGLLLNTKGLVEMIVLNVGKDQKVLDDETFATMVLIALVMTGVITPIVTV  409

Query  1419  RYCPKQDLEPYKRRTIQNAKPGEELRILACIHGTNNLPAIISLLETSNSTVTSPITAFGV  1240
              Y P +    YKRRTIQ  KP  ELR+L C+H   N+P II+LLE S+ T  SPI  + +
Sbjct  410   LYKPVKRSVSYKRRTIQQTKPDSELRVLVCVHTPRNVPTIINLLEASHPTKRSPICIYVL  469

Query  1239  QLLELVGRAPAMMvvhssgsgrhvggsHEEVQTSQIISTFDNYELRSHGVTAQVLTARWS  1060
              L+EL GRA AM++VH++        +  + Q+  II+ F+NYE  +  V  Q LTA   
Sbjct  470   HLVELTGRASAMLIVHNTRKSGKPALNRTQAQSDHIINAFENYEQHAAFVAVQALTAISP  529

Query  1059  YDTMAEDICKMAKEKRAAFLVLPFHKQQGTDGEMEDTNPAIQTVNEGVLLSAPCSVGILV  880
             Y TM ED+C +A+ KR +F+++PFHKQQ  DG ME TNPA + VN+ +L ++PCSVGILV
Sbjct  530   YSTMHEDVCSLAENKRVSFIIIPFHKQQTVDGGMEATNPAYRLVNQNLLGNSPCSVGILV  589

Query  879   ERG-------RPNQYAKNIAVLYLGGPDDREALTYARRMSGLPGVHLTVIRFVPAKDVSA  721
             +RG         N  +  +AVL+ GGPDDREAL YA RM+  P + LTV+RF+P +DV+ 
Sbjct  590   DRGLNGATRLTSNTISLQVAVLFFGGPDDREALAYAWRMAEHPWISLTVLRFIPDEDVT-  648

Query  720   DGAVEDPDLELELTRETSFVTVSIDPARDKEEDEELLNNFRTETAEDDSKTFMELVLDDE  541
             D A          T ET+   +++D  + ++ D+E +N FR   AE ++  +++ V+ + 
Sbjct  649   DAA------STRATNETN-RNMNVDMKKQRQLDDEYVNTFRAANAEYETIVYIDKVVSNG  701

Query  540   EEFTKAVKSLDDRSFDLYVAGRGRGVSSALTSGLADWCECPELGAVGDllvtsefessfs  361
             EE   AV+S+D  S DL++ GR  G+ S LT+GL DW ECPELGA+GDLL +S+F ++ S
Sbjct  702   EETVAAVRSMDS-SHDLFIVGRREGMLSPLTAGLTDWSECPELGAIGDLLASSDFAATVS  760

Query  360   vlvVQQYV  337
             VLVVQQYV
Sbjct  761   VLVVQQYV  768



>ref|XP_003547128.2| PREDICTED: cation/H(+) antiporter 15-like [Glycine max]
Length=834

 Score =   553 bits (1426),  Expect = 5e-179, Method: Compositional matrix adjust.
 Identities = 321/790 (41%), Positives = 485/790 (61%), Gaps = 27/790 (3%)
 Frame = -3

Query  2658  VMCFSQTIYRSNGVWEGPDPLAPMIPLFILQIMTAILSSRILNFVLKPFNQPPLVAEILS  2479
             ++C++  +  +NG+W+G +PL   +PLFILQ+   + ++R   F+LKP +QP ++AEIL 
Sbjct  11    LICYTPLMTTTNGLWQGDNPLDYSLPLFILQLTMVVCATRFFVFILKPLHQPRVIAEILG  70

Query  2478  GIILGPSMLGNIEEFRKHNFPNHNFETIETMGHFALVLYAFLTGLQMDVKAIVHTGTKSR  2299
             G++LGPS+ G   +F    FP  +   +ETM +  L+ + FL GL+MD+  I  TG K+ 
Sbjct  71    GLLLGPSIFGRNLKFANAVFPLKSVMVLETMANMGLIYFVFLVGLEMDISIIKRTGKKTV  130

Query  2298  IVAVSGSIFPFLIGAGFYFTLQTDTQSMIG---FIFCGSALTVTGFSTLAKILDSKRLLN  2128
              +A +G I PFLI       ++    SM      ++ G  L+VT F  LA++L   +L++
Sbjct  131   SIAFAGMILPFLIAVCVSHLIEDKDNSMNQASYVLYIGIVLSVTAFPVLARMLADLKLIS  190

Query  2127  TEIGKIAASSALINVALSWVLLTIGLLFTGSLDNVQWAvlctvgfvvvcvn----yVRPL  1960
             T++GK+A S +LIN   +W+LL + +  + + +   WA +  V   +V V+     VRP 
Sbjct  191   TDLGKLALSISLINDVFAWILLALAIALSEA-NTGTWASVLVVISNLVFVSFCFVIVRPA  249

Query  1959  LNWLISKTPEGQGFSEFYICSFIAVICAFGCFTDAMGSHPMIGAFIFGLIMPNNELLRTA  1780
             ++WLI +TPEG+ FSEF +C  +  +      TD +G+H   GAF++GL++PN   L  A
Sbjct  250   VSWLIERTPEGKPFSEFQLCIVLTGVMISAFITDVLGTHCAFGAFVYGLVIPNGP-LGAA  308

Query  1779  ILDRLEDFVMGILMPVFFLVCGLRTNIFTITDGDTSIFTALALILLACSAKIIAALVASC  1600
             IL++LEDFV G+L+P+F+ +CGL+T+I  I+   T  F  L +I L C  KI+     S 
Sbjct  309   ILEKLEDFVSGLLLPLFYAICGLKTDIKLISGASTWTF-VLTVIPLTCLGKILGTFFISL  367

Query  1599  YTGMSTNEAIGLGVLTNTKSTMVMIILEVGqvqqvlsvqqysmmvVACLIMTIVATPLAA  1420
                +   + + LG+L N+K  + MI+L VG+ Q+VL  + +S+MV+  L+MT V +P+  
Sbjct  368   IFQIPNRDGVVLGLLMNSKGLIEMIVLNVGREQKVLGDKIFSVMVIVTLVMTAVVSPIVT  427

Query  1419  R-YCPKQDLEPYKRRTIQNAKPGEELRILACIHGTNNLPAIISLLETSNSTVTSPITAFG  1243
               Y P++ L PYKRRTIQN++   ELR+L CIH   N+P +++LLE ++    SPI A+ 
Sbjct  428   LIYKPRKRLIPYKRRTIQNSRLDAELRVLVCIHTPRNVPTLVNLLEATHPHKRSPICAYV  487

Query  1242  VQLLELVGRAPAMMvvhssgsgrhvggsHEEVQTSQIISTFDNYELRSHGVTAQVLTARW  1063
             + L+EL GRA AM+VVH++        +  + QT  II+ F N+E        Q LTA  
Sbjct  488   LHLVELTGRASAMLVVHANRQSGGPALNKTQAQTDHIITAFQNFEEHVGHTQVQPLTAIS  547

Query  1062  SYDTMAEDICKMAKEKRAAFLVLPFHKQQGTDGEMEDTNPAIQTVNEGVLLSAPCSVGIL  883
              Y TM EDIC +A++KR + +++PFHKQQ  DGEM DT PA + +N  +L ++PCSVGIL
Sbjct  548   PYSTMHEDICNLAEDKRVSLIIIPFHKQQTVDGEMHDTIPAFRMINHNLLQNSPCSVGIL  607

Query  882   VERGRP-------NQYAKNIAVLYLGGPDDREALTYARRMSGLPGVHLTVIRFVPAKDVS  724
             V+RG         N  +  +AVLY GGPDDREAL Y  RMS  P VHLTV+ F P+K   
Sbjct  608   VDRGLNGSNRLIGNLASHKVAVLYFGGPDDREALAYGWRMSRHPRVHLTVMHFTPSKH--  665

Query  723   ADGAVEDPDLE-LELTRETSFVTVSIDPARDKEEDEELLNNFRTETAEDDSKTFMELVLD  547
                  + P+ + L    + SF    I   R+   DEE ++ F+     DDS  +++ V++
Sbjct  666   ---PTQTPETDHLWANIDRSFTI--IKNGREHTLDEEYISEFKKMITNDDSVVYIDKVVN  720

Query  546   DEEEFTKAVKSLDDRSFDLYVAGRGRGVSSALTSGLADWCECPELGAVGDllvtsefess  367
             + EE   A++S+++ + DL++ GRG+G  S LT GL DW ECPELGA+GDLL +S+FE++
Sbjct  721   NGEETVAAIRSINNVN-DLFIVGRGQGTMSPLTDGLTDWSECPELGAIGDLLASSDFETT  779

Query  366   fsvlvVQQYV  337
              SVLV+ QYV
Sbjct  780   ASVLVMHQYV  789



>gb|KHN31156.1| Cation/H(+) antiporter 15 [Glycine soja]
Length=817

 Score =   553 bits (1424),  Expect = 7e-179, Method: Compositional matrix adjust.
 Identities = 323/803 (40%), Positives = 495/803 (62%), Gaps = 38/803 (5%)
 Frame = -3

Query  2688  EVDLDRLGQVVMCFSQTIYRSNGVWEGPDPLAPMIPLFILQIMTAILSSRILNFVLKPFN  2509
             +V  ++    ++C++ ++  +NGVW+G +PL   +PLFILQ+   ++++RI  F+LKPF 
Sbjct  3     DVATNKTDDYIVCYAPSMITTNGVWQGDNPLEYSLPLFILQLTLVVVATRIFVFILKPFR  62

Query  2508  QPPLVAEILSGIILGPSMLGNIEEFRKHNFPNHNFETIETMGHFALVLYAFLTGLQMDVK  2329
             QP ++AEIL G++LGPS+LG  E F    FP  +   IETM +  L+ + FL G++MD+ 
Sbjct  63    QPRVIAEILGGVMLGPSVLGQNEAFANAVFPLRSVMVIETMANIGLLYFLFLVGVEMDLT  122

Query  2328  AIVHTGTKSRIVAVSGSIFPFLIGAGFYFTLQTDTQSMIG----FIFCGSALTVTGFSTL  2161
              +   G K+   A++G I PF++G  F + L   T S I      +F G AL+VT F  L
Sbjct  123   VMRSVGRKAVASAIAGMILPFIVGIAFSYLLAKKTDSDINQGTYILFLGVALSVTAFPVL  182

Query  2160  AKILDSKRLLNTEIGKIAASSALINVALSWVLLTIGLLFT----GSLDNVQWAvlctvgf  1993
             A+IL   +L+NTE+G++A S+ALIN   +WV+L + +        +L ++ W ++ +V F
Sbjct  183   ARILAELKLVNTELGRLALSAALINDVCAWVMLALAIALAETEITTLASL-WVLISSVVF  241

Query  1992  vvvcvnyVRPLLNWLISKTPEGQGFSEFYICSFIAVICAFGCFTDAMGSHPMIGAFIFGL  1813
             V +C   VRP    L+ KTPEG+ FSEFYI   +A +   G  TDA+G+H + GAF+FGL
Sbjct  242   VAICAYGVRPAAKCLVKKTPEGESFSEFYISLILAGVMVSGFITDAIGTHAVFGAFVFGL  301

Query  1812  IMPNNELLRTAILDRLEDFVMGILMPVFFLVCGLRTNIFTITDGDTSIFTALALILLACS  1633
              +PN  L  T ++++LEDFV G+L+P+FF + GL+TN+  I  G  +    + +I LAC 
Sbjct  302   SIPNGPLSFT-LVEKLEDFVSGLLLPLFFAISGLKTNLGLI-HGSYTWVILIIVIFLACL  359

Query  1632  AKIIAALVASCYTGMSTNEAIGLGVLTNTKSTMVMIILEVGqvqqvlsvqqysmmvVACL  1453
              K++  ++ + +  M  +E   LG+L NTK  + M++L VG+ Q+V   + +++MVV  +
Sbjct  360   GKVVGTILVALFYEMPIHEGAALGLLMNTKGLVEMVVLNVGKDQKVFDEESFAIMVVITV  419

Query  1452  IMTIVATP-LAARYCPKQDLEPYKRRTIQNAKPGEELRILACIHGTNNLPAIISLLETSN  1276
             IMT +  P ++  Y P ++   YKRRTI+ +K   E R+L C+H   N+P +I+LLE SN
Sbjct  420   IMTGIIVPAISVIYKPSRNSICYKRRTIEISKLDAEFRVLFCVHTPRNVPTMINLLEASN  479

Query  1275  STVTSPITAFGVQLLELVGRAPAMMvvhssgsgrhvggsHEEVQTSQIISTFDNYELRSH  1096
              T  SPI  + + L+EL GR  AM++VH++        +  E Q+  II  F+NYE  + 
Sbjct  480   PTKNSPICVYVLHLVELSGRTSAMLIVHNTAKQDAPALNRTEAQSDHIIKAFENYEQHAS  539

Query  1095  GVTAQVLTARWSYDTMAEDICKMAKEKRAAFLVLPFHKQQGTDGEMEDTNPAIQTVNEGV  916
              V+ Q LTA   Y TM EDIC +A +KR + +++PFHKQQ  DG          ++N+ V
Sbjct  540   FVSVQPLTAISPYSTMHEDICNLALDKRVSLIIVPFHKQQTVDG----------SINQYV  589

Query  915   LLSAPCSVGILVERGRP-------NQYAKNIAVLYLGGPDDREALTYARRMSGLPGVHLT  757
             L +APCSV ILV++G         NQ + ++AVL+ GGPDDREAL Y  RM    G+ LT
Sbjct  590   LANAPCSVEILVDKGLSGSNHLAGNQVSHHVAVLFFGGPDDREALCYGWRMVEHHGISLT  649

Query  756   VIRFVPAKDVSADGAVEDP---DLELELTRETSFVTVSIDPARDKEEDEELLNNFRTETA  586
             ++RFV +  V  +   +     DLE     E   +TV  D    K+ DE+L++ FR    
Sbjct  650   IMRFVQSDQVQVEPLRQQHGGIDLE-----EPRVLTVQTDRDIQKQHDEKLIHEFRMRCG  704

Query  585   EDDSKTFMELVLDDEEEFTKAVKSLDDRSFDLYVAGRGRGVSSALTSGLADWCECPELGA  406
             +DD+  ++E V+ + E+   A++++DD   DL++ GRG+GV S LT+GL DW ECPE+GA
Sbjct  705   DDDAVDYVEKVVSNGEDTVAAIRTMDDIH-DLFIVGRGQGVISPLTAGLTDWSECPEIGA  763

Query  405   VGDllvtsefessfsvlvVQQYV  337
             +GD+L +S+F ++ SVLV+QQYV
Sbjct  764   IGDMLASSDFAATASVLVLQQYV  786



>gb|KEH36491.1| cation/H+ exchanger 3 [Medicago truncatula]
Length=813

 Score =   551 bits (1420),  Expect = 3e-178, Method: Compositional matrix adjust.
 Identities = 327/779 (42%), Positives = 490/779 (63%), Gaps = 32/779 (4%)
 Frame = -3

Query  2628  SNGVWEGPDPLAPMIPLFILQIMTAILSSRILNFVLKPFNQPPLVAEILSGIILGPSMLG  2449
             +NGVW G +PL   IPLFILQI   + ++R   F+LKPF+QP ++AEI+ G+ LGPS+LG
Sbjct  4     TNGVWAGENPLNYSIPLFILQITLVVFTTRFFVFILKPFHQPRVIAEIMGGLFLGPSVLG  63

Query  2448  NIEEFRKHNFPNHNFETIETMGHFALVLYAFLTGLQMDVKAIVHTGTKSRIVAVSGSIFP  2269
               E F    FP  +   +ETM +  L+ + FL GL+MD+  +  TG K+  +AV+G I P
Sbjct  64    RHENFANIVFPLKSAMVLETMANIGLIYFLFLIGLEMDISIVKRTGAKAVSIAVAGMILP  123

Query  2268  FLIGAGFYFTLQTDTQSMIGF---IFCGSALTVTGFSTLAKILDSKRLLNTEIGKIAASS  2098
             F++G G  F      +S+  F   ++ G  L+VT F  LA++L   +L+NTE+GK++ S+
Sbjct  124   FIVGLGVSFAFTGRDESVNDFSFVLYLGIVLSVTSFPVLARMLAELKLINTELGKLSLST  183

Query  2097  ALINVALSWVLLTIGLLFTGSLDNVQWAvlctvgfvvvcv----nyVRPLLNWLISKTPE  1930
             +LIN   +W+LL + +  + + ++  WA +  V   +  V      VRP + WLI KTPE
Sbjct  184   SLINDVCAWLLLALAIALSEN-NSTTWASVYVVISNLFFVGFCFLVVRPAITWLIKKTPE  242

Query  1929  GQGFSEFYICSFIAVICAFGCFTDAMGSHPMIGAFIFGLIMPNNELLRTAILDRLEDFVM  1750
             G+ FS+F IC+ +  +      TD +G+H + GAF++GL++PN   L  AI+++LEDFV 
Sbjct  243   GKPFSDFQICAVLVGVMISALITDVIGTHSIFGAFVYGLVIPNGP-LGAAIIEKLEDFVS  301

Query  1749  GILMPVFFLVCGLRTNIFTITDGDTSIFTALALILLACSAKIIAALVASCYTGMSTNEAI  1570
             G+L+P+F+ + GL+TNI     G +  F  L ++ L C  KII  ++ S    +   + I
Sbjct  302   GLLLPLFYAISGLKTNINLFNKGGSWAF-VLTIVPLTCLGKIIGTVIVSILFDLPARDGI  360

Query  1569  GLGVLTNTKSTMVMIILEVGqvqqvlsvqqysmmvVACLIMTIVATPLAAR-YCPKQDLE  1393
              LG+L NTK  + MI+L +G+ Q+VL  + +S+MV+  LIMT + +P+ A  Y P++ L 
Sbjct  361   VLGLLMNTKGLIEMIVLNIGREQKVLGDEIFSIMVIVTLIMTAIISPIVALIYRPRKRLI  420

Query  1392  PYKRRTIQNAKPGEELRILACIHGTNNLPAIISLLETSNSTVTSPITAFGVQLLELVGRA  1213
             PY++RT+Q+++   ELR+L CIH   N+P I++LLE ++    SPI A+ + L+EL GRA
Sbjct  421   PYRKRTVQSSRVDAELRVLVCIHAPRNVPTIVNLLEATHPNKRSPICAYVLHLVELTGRA  480

Query  1212  PAMMvvhssgsgrhvggsHEEVQTSQIISTFDNYELRSHGVTAQVLTARWSYDTMAEDIC  1033
              AM+VVH+SG       +  + QT  II+ F N E     V+ Q LTA   Y TM EDIC
Sbjct  481   SAMLVVHASGQSGGPALNKTQAQTEHIITAFQNLEDHVGYVSTQPLTAVSPYSTMHEDIC  540

Query  1032  KMAKEKRAAFLVLPFHKQQGTDGEMEDTNPAIQTVNEGVLLSAPCSVGILVERG------  871
              +A+EKR + +++PFHKQQ  DGEM++TNPA++ VN  +L S+PCSVGILV+RG      
Sbjct  541   NLAEEKRVSTIIIPFHKQQTVDGEMQETNPALRMVNHNLLQSSPCSVGILVDRGLNGSSR  600

Query  870   -RPNQYAKNIAVLYLGGPDDREALTYARRMSGLPGVHLTVIRFVPAKDVSADGAVEDPDL  694
                +Q +  +AVL+ GGPDDREAL+Y  RMS  P VHLTV+ F+  KDV+ +  ++D  L
Sbjct  601   LTASQASHQVAVLFFGGPDDREALSYGWRMSRHPRVHLTVMHFISGKDVT-ESLIDDELL  659

Query  693   ELELTRETSFVTVSIDPARDKEEDEELLNNFRTETAEDDSKTFMELVLDDEEEFTKAVKS  514
             +     + S ++  I        DEE +N  +     D S  ++E ++ + E+   A++ 
Sbjct  660   D----NQRSTISNKI--------DEECINEIKMLATCDVSIKYIEKIVSNGEQTVSAIRE  707

Query  513   LDDRSFDLYVAGRGRGVSSALTSGLADWCECPELGAVGDllvtsefessfsvlvVQQYV  337
              ++ + DL++ GRG+G SS LT GL DW ECPELGA+GDLL +S+FE+S SVLV+ QYV
Sbjct  708   TNNAN-DLFIVGRGQGDSSPLTEGLTDWSECPELGAIGDLLASSDFETSASVLVMHQYV  765



>ref|XP_007148262.1| hypothetical protein PHAVU_006G193500g [Phaseolus vulgaris]
 gb|ESW20256.1| hypothetical protein PHAVU_006G193500g [Phaseolus vulgaris]
Length=838

 Score =   552 bits (1422),  Expect = 3e-178, Method: Compositional matrix adjust.
 Identities = 319/790 (40%), Positives = 491/790 (62%), Gaps = 24/790 (3%)
 Frame = -3

Query  2664  QVVMCFSQTIYRSNGVWEGPDPLAPMIPLFILQIMTAILSSRILNFVLKPFNQPPLVAEI  2485
             Q ++C++     +NG+W+G +PL   +PLF LQ+   + ++R    +LKPFNQP ++AEI
Sbjct  14    QSIICYTPMKTTTNGLWKGDNPLDYSLPLFTLQLTLVVCATRFFALILKPFNQPRVIAEI  73

Query  2484  LSGIILGPSMLGNIEEFRKHNFPNHNFETIETMGHFALVLYAFLTGLQMDVKAIVHTGTK  2305
             L G++LGPS++G  E+F    FP  +   +ETM +  L+ + FL GL+MD+  I  TG K
Sbjct  74    LGGLLLGPSVMGRNEKFANVVFPLKSVMVVETMANMGLIYFVFLVGLEMDISIIKRTGKK  133

Query  2304  SRIVAVSGSIFPFLIGAGFYFTLQTDTQSMIG---FIFCGSALTVTGFSTLAKILDSKRL  2134
             + ++A++G + PF+I      +L  DT  +      ++ G  L+ T F  LA++L   +L
Sbjct  134   TILMALAGMVLPFMIAICLS-SLIADTNEIDQTNCVLYLGIVLSATAFPVLARMLVELKL  192

Query  2133  LNTEIGKIAASSALINVALSWVLLTIGLLFTGSLDNVQ---WAvlctvgfvvvcvnyVRP  1963
             +NTE+GK+A S++LIN   +W+LL   +  +    N+    W  +  + F+      VRP
Sbjct  193   INTELGKLALSTSLINDVCAWMLLASAIALSDERVNIWASLWVGVSNIFFLSFSFVIVRP  252

Query  1962  LLNWLISKTPEGQGFSEFYICSFIAVICAFGCFTDAMGSHPMIGAFIFGLIMPNNELLRT  1783
             +++WLI KTPEG+ FSEF +C  +  +      TD +G+H + GAF++GL++PN   L  
Sbjct  253   IMSWLIEKTPEGKAFSEFQLCIVLTGVMISAFITDVLGTHSIFGAFVYGLVIPNGP-LGA  311

Query  1782  AILDRLEDFVMGILMPVFFLVCGLRTNIFTITDGDTSIFTALALILLACSAKIIAALVAS  1603
             AI+++LEDFV G+L+P+F+ + GL+TNI  I+  +T  F  L++I L+   KI   L+ S
Sbjct  312   AIIEKLEDFVSGLLLPLFYAISGLKTNINLISGTNTWTF-VLSVIPLSYLGKIAGTLLVS  370

Query  1602  CYTGMSTNEAIGLGVLTNTKSTMVMIILEVGqvqqvlsvqqysmmvVACLIMTIVATPLA  1423
                 +   + + LG+L N+K  + +I+L VG+ Q+VL+ + +S+M+V  LIMT + +P+ 
Sbjct  371   NMFQIPNRDGVVLGLLMNSKGLIEIIVLNVGREQKVLNDKIFSVMIVVILIMTTMISPIV  430

Query  1422  AR-YCPKQDLEPYKRRTIQNAKPGEELRILACIHGTNNLPAIISLLETSNSTVTSPITAF  1246
                Y P++ L PYKRRTIQN++   ELR+L  IH   N+P +I+LLE +     SP+ A+
Sbjct  431   TLIYKPRRRLIPYKRRTIQNSRLEGELRVLVGIHTPRNVPTLINLLEATYPNKRSPLCAY  490

Query  1245  GVQLLELVGRAPAMMvvhssgsgrhvggsHEEVQTSQIISTFDNYELRSHGVTAQVLTAR  1066
              + L+EL GRA AM+ VH++        +  + QT+ II+ F N+E   +    Q LT  
Sbjct  491   VLHLVELTGRASAMLTVHANRESGGPALNKTQAQTNHIITAFQNFEEHDNYAQVQPLTTI  550

Query  1065  WSYDTMAEDICKMAKEKRAAFLVLPFHKQQGTDGEMEDTNPAIQTVNEGVLLSAPCSVGI  886
               Y TM EDIC +A+EKR + +++PFHKQQ  DGEMEDT PA + VN  +L ++PCSVGI
Sbjct  551   SPYSTMHEDICSLAEEKRVSIIIIPFHKQQTVDGEMEDTIPAFRMVNHNLLQNSPCSVGI  610

Query  885   LVERGRP-------NQYAKNIAVLYLGGPDDREALTYARRMSGLPGVHLTVIRFVPAKDV  727
             LV+RG         N  +  + VLY GGPDDREAL Y  RMS  P V LTV+ F+P+  +
Sbjct  611   LVDRGLNGSNRLIGNLASHQVVVLYFGGPDDREALAYGWRMSRHPRVRLTVMHFIPS--L  668

Query  726   SADGAVEDPDLELELTRETSFVTVSIDPARDKEEDEELLNNFRTETAEDDSKTFMELVLD  547
              ++   +   L  ++ R  SF T  I    + + DEE ++ F+   A DDS  +M+ V++
Sbjct  669   YSNQTSKSDHLWAKIDR--SFTT--IKNGNENKLDEEYISEFKMMVAHDDSVIYMDKVVN  724

Query  546   DEEEFTKAVKSLDDRSFDLYVAGRGRGVSSALTSGLADWCECPELGAVGDllvtsefess  367
             + EE   A++S+++ + DL++ GRG+G  S LT GL DW ECPELGA+GDLL +S+FE++
Sbjct  725   NGEETVAAIRSINNVN-DLFIVGRGQGTMSPLTDGLTDWSECPELGAIGDLLASSDFETT  783

Query  366   fsvlvVQQYV  337
              SVLV+ QYV
Sbjct  784   ASVLVLHQYV  793



>ref|XP_010490208.1| PREDICTED: cation/H(+) antiporter 15-like [Camelina sativa]
Length=764

 Score =   548 bits (1412),  Expect = 9e-178, Method: Compositional matrix adjust.
 Identities = 317/736 (43%), Positives = 470/736 (64%), Gaps = 30/736 (4%)
 Frame = -3

Query  2493  AEILSGIILGPSMLGNIEEFRKHNFPNHNFETIETMGHFALVLYAFLTGLQMDVKAIVHT  2314
             AE + GI+LGPS+LG  E+F    FP  +   +ETM +  L+ + FL G++MD+  +  T
Sbjct  9     AEPMGGIVLGPSVLGRSEKFAHTIFPQRSVMVLETMANVGLLYFLFLVGVEMDIMVVRKT  68

Query  2313  GTKSRIVAVSGSIFPFLIGAGFYFTLQTDTQSMIG----FIFCGSALTVTGFSTLAKILD  2146
             G ++  +A+ G + PFLIGA F F++   ++  +G     +F G AL+VT F  LA+IL 
Sbjct  69    GKRALTIAIGGMVLPFLIGAAFSFSMHR-SEDHLGQGTYILFLGVALSVTAFPVLARILA  127

Query  2145  SKRLLNTEIGKIAASSALINVALSWVLLTIGLLFTGSLDNV---QWAvlctvgfvvvcvn  1975
               +L+NTEIG+I+ S+AL+N   +W+LL + +    S  N     W ++ +  F+ VCV 
Sbjct  128   ELKLINTEIGRISMSAALVNDMFAWILLALAIALAESDKNSFASLWVMISSAVFIAVCVF  187

Query  1974  yVRPLLNWLISKTPEGQGFSEFYICSFIAVICAFGCFTDAMGSHPMIGAFIFGLIMPNNE  1795
              VRP + W+I KTPEG+ +SEFYIC  +  +   G  TDA+G+H + GAF+FGL++PN  
Sbjct  188   IVRPGITWIIRKTPEGENYSEFYICLILTGVMISGFITDAIGTHSVFGAFVFGLVIPNGP  247

Query  1794  LLRTAILDRLEDFVMGILMPVFFLVCGLRTNIFTITDGDTSIFTALALILLACSAKIIAA  1615
             L  T ++++LEDFV G+L+P+FF + GL+TN+  I  G  +  T   +I LAC+ K+I  
Sbjct  248   LGLT-LIEKLEDFVSGLLLPLFFAISGLKTNVAAI-QGPATWATLFFVIFLACAGKVIGT  305

Query  1614  LVASCYTGMSTNEAIGLGVLTNTKSTMVMIILEVGqvqqvlsvqqysmmvVACLIMTIVA  1435
             ++ + + GM   E I LG+L NTK  + MI+L VG+ Q+VL  + ++ MV+  L+MT V 
Sbjct  306   VIVAFFHGMPVREGITLGLLLNTKGLVEMIVLNVGKDQKVLDDETFATMVLVALVMTGVI  365

Query  1434  TPLA-ARYCPKQDLEPYKRRTIQNAKPGEELRILACIHGTNNLPAIISLLETSNSTVTSP  1258
             TP+    Y P +    YKRRTIQ  KP  ELR+L C+H   N+P II+LLE S+ T  SP
Sbjct  366   TPIVTVLYRPVKKSVSYKRRTIQQTKPDSELRVLVCVHTPRNVPTIINLLEASHPTKRSP  425

Query  1257  ITAFGVQLLELVGRAPAMMvvhssgsgrhvggsHEEVQTSQIISTFDNYELRSHGVTAQV  1078
             I  + + L+EL GRA AM++VH++        +  + Q+  II+ F+NYE  +  V  Q 
Sbjct  426   ICIYVLHLVELTGRASAMLIVHNTRKSGRPALNRTQAQSDHIINAFENYEQHAAFVAVQP  485

Query  1077  LTARWSYDTMAEDICKMAKEKRAAFLVLPFHKQQGTDGEMEDTNPAIQTVNEGVLLSAPC  898
             LTA   Y TM ED+C +A++KR +F+++PFHKQQ  DG ME TNPA + VN+ +L ++PC
Sbjct  486   LTAISPYSTMHEDVCSLAEDKRVSFIIIPFHKQQTVDGGMEATNPAYRLVNQNLLENSPC  545

Query  897   SVGILVERG-------RPNQYAKNIAVLYLGGPDDREALTYARRMSGLPGVHLTVIRFVP  739
             SVGILV+RG         N  +  +AVL+ GGPDDREAL YA RM+  PG+ LTV+RF+ 
Sbjct  546   SVGILVDRGLNGATRLNSNTVSLQVAVLFFGGPDDREALAYAWRMAQHPGISLTVLRFIH  605

Query  738   AK---DVSADGAVEDPDLELELTRETSFVTVSIDPARDKEEDEELLNNFRTETAEDDSKT  568
              +   D ++  A  + DL++          +++D  + ++ D+E +N FRT  A+ +S  
Sbjct  606   DEDEIDTASTRATNETDLKVP--------KMNMDHKKQRQLDDEYINAFRTSNADFESIV  657

Query  567   FMELVLDDEEEFTKAVKSLDDRSFDLYVAGRGRGVSSALTSGLADWCECPELGAVGDllv  388
             ++E ++ + EE   AV+S+D  S DL++ GRG G+SS LT+GL DW ECPELGA+GDLL 
Sbjct  658   YIEKLVSNGEETVAAVRSMDS-SHDLFIVGRGEGMSSPLTAGLTDWSECPELGAIGDLLA  716

Query  387   tsefessfsvlvVQQY  340
             +S+F ++ SVLVVQQY
Sbjct  717   SSDFAATVSVLVVQQY  732



>ref|XP_009391148.1| PREDICTED: cation/H(+) antiporter 15 [Musa acuminata subsp. malaccensis]
Length=859

 Score =   538 bits (1385),  Expect = 1e-172, Method: Compositional matrix adjust.
 Identities = 327/812 (40%), Positives = 483/812 (59%), Gaps = 33/812 (4%)
 Frame = -3

Query  2697  TGPEVDLDRLGQVVMCFSQTIYRSNGVWEGPDPLAPMIPLFILQIMTAILSSRILNFVLK  2518
             T P    D  G VV CF  T+  +NG+W+G +PL+  +PL ILQ +  +L +R++  +LK
Sbjct  3     TAPTNITDDTGTVV-CFVSTMTCTNGIWQGLNPLSFSLPLLILQNIVIVLVTRVVALLLK  61

Query  2517  PFNQPPLVAEILSGIILGPSMLGNIEEFRKHNFPNHNFETIETMGHFALVLYAFLTGLQM  2338
             PF+QP L+AEI+ GI+LGPS+ G +  FR   FP  +  T++  GH  L+ + FL G++M
Sbjct  62    PFHQPRLLAEIIGGIVLGPSVAGQMAVFRDVVFPPRSILTLQGFGHLGLLYFLFLVGVEM  121

Query  2337  DVKAIVHTGTKSRIVAVSGSIFPFLIGAGFYFTLQTDTQSMIG----FIFCGSALTVTGF  2170
             D+  I  TG K+ +VA +  + PF IG    F L+      I      +F G AL+VT F
Sbjct  122   DIAVIGRTGHKALVVAAASMVIPFSIGTASSFLLRNFISKNIHEGAFVLFLGVALSVTAF  181

Query  2169  STLAKILDSKRLLNTEIGKIAASSALINVALSWVLLTIGLLFTGSLDNV---QWAvlctv  1999
               LA+IL   +LLN+EIG+I+ S+A+IN   +W+LL I +  TG         W +L  V
Sbjct  182   PLLARILAETKLLNSEIGRISMSAAIINDLCAWILLAISVALTGPSGTALTPLWVLLSGV  241

Query  1998  gfvvvcvnyVRPLLNWLISKTPEGQGFSEFYICSFIAVICAFGCFTDAMGSHPMIGAFIF  1819
             GFV++C+  +RP + W + K PEGQ  S+F++C  +  +      +D +G H   GAF+F
Sbjct  242   GFVLLCLFCIRPTMWWFMQKLPEGQAVSDFHVCLLLGTMMLAAVMSDVIGFHSAFGAFVF  301

Query  1818  GLIMPNNELLRTAILDRLEDFVMGILMPVFFLVCGLRTNIFTITDGDTSIFTALALILLA  1639
             GL++PN   +  A++ RLED V G+L+P++F+  GL T++  + DG T     L  +L +
Sbjct  302   GLVLPNGP-VGVALIARLEDIVSGLLLPLYFVSNGLSTDLSKVRDGRTVALLVLVFVLAS  360

Query  1638  CSAKIIAALVASCYTGMSTNEAIGLGVLTNTKSTMVMIILEVGqvqqvlsvqqysmmvVA  1459
                KI   +V S +  M   E + LG L NT+  + +I+L +G+  +VL  + +++MV+ 
Sbjct  361   I-GKIAGTVVISLFYTMPLREGLSLGFLMNTRGLVEIIVLNIGRDMEVLDDESFAVMVMT  419

Query  1458  CLIMTIVATPLAAR-YCPKQDLEPYKRRTIQNAKPGEELRILACIHGTNNLPAIISLLET  1282
              L+MT++ TPL    + P + L  YKRR +Q +KP  ELR+LAC+H T N+P+I+S+L  
Sbjct  420   SLVMTLMVTPLVTYLHRPLRRLVGYKRRNLQRSKPDTELRVLACVHNTRNVPSIVSVLNI  479

Query  1281  SNSTVTSPITAFGVQLLELVGRAPAMMvvhssgsgr-------hvggsHEEVQTSQIIST  1123
             SN +  SPI  + + L+EL GRA AM++VH + + +              +VQ+  I   
Sbjct  480   SNPSKRSPIFVYALHLVELTGRASAMLIVHHTKTSKVNNNRKPVASLIGRQVQSEHIFHA  539

Query  1122  FDNYELRSHGVTAQVLTARWSYDTMAEDICKMAKEKRAAFLVLPFHKQQGTDGEMEDTNP  943
             FDNYE R  GV+ Q LT    Y TM EDIC +A++K    ++LPFHKQQ  DG ME  N 
Sbjct  540   FDNYEQRVGGVSVQTLTVVSPYTTMHEDICSLAEDKHVTLIILPFHKQQTVDGGMEPINS  599

Query  942   AIQTVNEGVLLSAPCSVGILVERG--------RPNQYAKNIAVLYLGGPDDREALTYARR  787
             +I+ +N  VL ++PCSVGIL++RG           QY+  IA+L+ GGPDDREAL YA R
Sbjct  600   SIKVLNANVLNASPCSVGILIDRGLSSKARMAHGQQYSHRIALLFFGGPDDREALAYAWR  659

Query  786   MSGLPGVHLTVIRFVPA--KDVSADGAVEDPDLELELTRETSFVTVSIDPARDKEEDEEL  613
             M+  P ++LTV+RF+     DV    A   P    + +R  S VT   D  ++K+ DEE 
Sbjct  660   MAENPSINLTVVRFIAGDQADVPQSPATTPPPPTAQDSRTISIVT---DSTQEKQLDEEY  716

Query  612   LNNFRTETAEDDSKTFMELVLDDEEEFTKAVKSLDDRSFDLYVAGRG-RGVSSALTSGLA  436
             LN F      ++S  + E V++  EE   A++S++    DLYV GR  R  +  LT+GL 
Sbjct  717   LNEFLLGNIGNESLLYTEKVVNSTEETVAAIQSMES-VHDLYVVGRSQRDAALTLTAGLT  775

Query  435   DWCECPELGAVGDllvtsefessfsvlvVQQY  340
             +W ECPELG +GDLL +S+F ++ SVLVV QY
Sbjct  776   EWAECPELGPIGDLLASSDFATTISVLVVHQY  807



>ref|XP_003524307.1| PREDICTED: cation/H(+) antiporter 15-like [Glycine max]
Length=835

 Score =   535 bits (1377),  Expect = 1e-171, Method: Compositional matrix adjust.
 Identities = 320/799 (40%), Positives = 487/799 (61%), Gaps = 36/799 (5%)
 Frame = -3

Query  2658  VMCFSQTIYRSNGVWEGPDPLAPMIPLFILQIMTAILSSRILNFVLKPFNQPPLVAEILS  2479
             ++C+S T+  + G+W   DPL   +PLFILQ+M  ++ +R+  F+LKP  QP +++E+L 
Sbjct  11    IICYSATMITTEGIWNNDDPLKYSLPLFILQLMLIVIVTRLFVFILKPLRQPRVISEMLG  70

Query  2478  GIILGPSMLGNIEEFRKHNFPNHNFETIETMGHFALVLYAFLTGLQMDVKAIVHTGTKSR  2299
             GI+LGP+ LG    F    FP+ +   IETM +  ++ + FL G+ MD  A+ + G K+ 
Sbjct  71    GILLGPTFLGKNTVFFDAVFPSRSRMLIETMSNVGILYFMFLVGVGMDASALRNIGRKAV  130

Query  2298  IVAVSGSIFPFLIGAGFYFTL----QTDTQSMIGFIFCGSALTVTGFSTLAKILDSKRLL  2131
              +A+ G I PF +GA F   L    + D++S    IF G+ L+V  F  LA+IL   + +
Sbjct  131   AIAILGMILPFSLGALFASFLIRLSEEDSRSGAYIIFLGAILSVASFPVLARILAELKFI  190

Query  2130  NTEIGKIAASSALINVALSWVLLTIGLLFTGSLD---NVQWAvlctvgfvvvcvnyVRPL  1960
             NTE+G++A SSAL+N  +SW+LL   +    +     ++         F+   +  VRPL
Sbjct  191   NTELGRVALSSALVNDIISWMLLIASITMVENEKPSLSILMVFGSCAAFIAFNIFAVRPL  250

Query  1959  LNWLISKTPEGQGFSEFYICSFIAVICAFGCFTDAMGSHPMIGAFIFGLIMPNNELLRTA  1780
             +  +I KTPEG+ FS+FYIC  ++ +   G  TDA+G+H + GA+IFGL +PN  L  T 
Sbjct  251   ILLIIRKTPEGEAFSDFYICLILSGVMISGLITDAIGTHAIFGAYIFGLTIPNGPLGLT-  309

Query  1779  ILDRLEDFVMGILMPVFFLVCGLRTNIFTITDGDTSIFTALALILLACSAKIIAALVASC  1600
             +++RLEDF+  +L+P+FF   GLRT++  +  G  S    ++LI L+C AKI+  +VA+ 
Sbjct  310   LVERLEDFISLLLLPLFFATTGLRTDL-GLLRGFYSWAILISLIALSCIAKIVGTMVAAV  368

Query  1599  YTGMSTNEAIGLGVLTNTKSTMVMIILEVGqvqqvlsvqqysmmvVACLIMTIVATP-LA  1423
             Y  MS  E   LG+L NTK  + +I+L +G+ Q+VL+ + ++ MV+  L+MT +  P ++
Sbjct  369   YYQMSIREGAVLGLLMNTKGVIEVIVLNIGKDQKVLTDESFASMVIITLLMTGIIVPGIS  428

Query  1422  ARYCPKQDLEPYKRRTIQNAKPGEELRILACIHGTNNLPAIISLLETSNSTVTSPITAFG  1243
             A Y   + + PYKRR IQ ++   E R+L CIH   N+P +I+LL+ SN T  SPI  + 
Sbjct  429   AIYKTSKGIIPYKRRNIQMSQTDTEFRVLVCIHSPRNVPTMINLLDASNPTKNSPICIYV  488

Query  1242  VQLLELVGRAPAMMvvhssgsgrhvgg-----sHEEVQTSQIISTFDNYELRSHGVTAQV  1078
             + L EL G A A++VVH+    +         +  + Q+  II+ F+NY  ++  ++ Q 
Sbjct  489   LHLTELAGHASALLVVHNQYGKKSDQIGNGGYNRTQAQSDHIINAFENYVQQASHISVQP  548

Query  1077  LTARWSYDTMAEDICKMAKEKRAAFLVLPFHKQQGTDGEMEDTNPAIQTVNEGVLLSAPC  898
             ++    Y TM EDIC +A++KR AF+V+PFHKQQ  DG M+D N + +TVN  VL  APC
Sbjct  549   MSVVSPYSTMHEDICNVAQDKRVAFIVVPFHKQQMVDGGMQDMNTSFRTVNRNVLTKAPC  608

Query  897   SVGILVERG-------RPNQYAKNIAVLYLGGPDDREALTYARRMSGLPGVHLTVIRFVP  739
             SVGILV+RG        P+Q A ++AVL+ GGPDDRE+L+Y  RMS    ++LTV+RFV 
Sbjct  609   SVGILVDRGFNFCNHLAPDQKAHHVAVLFFGGPDDRESLSYGWRMSEHQSINLTVMRFVH  668

Query  738   AKDV----SADGAVEDPDLELELTRETSFVTVSIDPARDKEEDEELLNNFRTETAED-DS  574
              ++V    S  G   D         E S +TV  D    K+ DE+ ++ F T  A+D  S
Sbjct  669   EEEVMHCHSHSGGDRDD--------EPSVLTVKTDKDTQKQIDEKFIHWFMTSHADDGGS  720

Query  573   KTFMELVLDDEEEFTKAVKSLDDRSFDLYVAGRGRGVSSALTSGLADWCECPELGAVGDl  394
               ++E  +++ E+   A++S+DD    L++ GR  G+SS LT+G  DW E PELGA+GDL
Sbjct  721   VVYVEKRVNNGEQTVAAIRSMDD-VHGLFIVGRSYGISSPLTAGFTDWSEYPELGAIGDL  779

Query  393   lvtsefessfsvlvVQQYV  337
             L +S+F ++ SVL+VQQYV
Sbjct  780   LASSDFAATASVLIVQQYV  798



>ref|XP_010322904.1| PREDICTED: cation/H(+) antiporter 15-like [Solanum lycopersicum]
Length=741

 Score =   527 bits (1358),  Expect = 4e-170, Method: Compositional matrix adjust.
 Identities = 305/708 (43%), Positives = 445/708 (63%), Gaps = 34/708 (5%)
 Frame = -3

Query  2397  IETMGHFALVLYAFLTGLQMDVKAIVHTGTKSRIVAVSGSIFPFLIGAGFYFTLQT---D  2227
             +ETM +  L+ + FL G++MD+  I  TG ++  +A++G + PFLIG  F F L     D
Sbjct  3     LETMANIGLLYFVFLVGVEMDIAVIRRTGKRAIPIALAGMVVPFLIGISFSFMLHRSAHD  62

Query  2226  TQSMIGFIFCGSALTVTGFSTLAKILDSKRLLNTEIGKIAASSALINVALSWVLLTIGLL  2047
             T+     +F G AL+VT F  LA+IL   +L+N+EIG+IA S+ALIN   +WVLL   + 
Sbjct  63    TKQGTFVLFLGVALSVTAFPVLARILAELKLINSEIGRIAMSAALINDIFAWVLLAFAIA  122

Query  2046  FTGSLD---NVQWAvlctvgfvvvcvnyVRPLLNWLISKTPEGQGFSEFYICSFIAVICA  1876
             F+ + +      W +L +  FVV C+  +RPL+ W+I +TPEG+  SEF+IC  ++ +  
Sbjct  123   FSENKNMALTSVWVLLSSAAFVVFCIIIIRPLIGWMIKRTPEGESISEFFICIILSGVMI  182

Query  1875  FGCFTDAMGSHPMIGAFIFGLIMPNNELLRTAILDRLEDFVMGILMPVFFLVCGLRTNIF  1696
              G  TDA+G H + GAFIFGL++PN  L  T + ++LEDF+ GIL+P+FF + GL+T I 
Sbjct  183   SGFITDAIGMHSIFGAFIFGLVIPNGPLGLT-LNEKLEDFISGILLPLFFAISGLKTEIN  241

Query  1695  TITDGDTSIFTALALILLACSAKIIAALVASCYTGMSTNEAIGLGVLTNTKSTMVMIILE  1516
              I DG  S      +I+LAC  KI   ++ + Y     +E I LG+L N K  + MI++ 
Sbjct  242   AI-DGVGSWAILALVIVLACVGKIAGTVIVTLYYRTPIHEGITLGLLMNAKGLIEMIVIN  300

Query  1515  VGqvqqvlsvqqysmmvVACLIMTIVATPLAAR-YCPKQDLEPYKRRTIQNAKPGEELRI  1339
             +G+ Q+V+  + +++MVVA ++MT +  P     Y P +   PYKRRT+Q+ KP  E R+
Sbjct  301   IGKDQKVIDQKSFAIMVVAVVLMTAIIIPFVTLIYKPARKFAPYKRRTVQSTKPDSEFRV  360

Query  1338  LACIHGTNNLPAIISLLETSNSTVTSPITAFGVQLLELVGRAPAMMvvhssgsgrhvggs  1159
             L CIH   N+P II+LLE S  T  SPI  + + L+EL GR+ AM++VH++        +
Sbjct  361   LTCIHTPRNVPTIINLLEASCPTKKSPICIYVLHLVELTGRSSAMLIVHNTRKSGRPALN  420

Query  1158  HEEVQTSQIISTFDNYELRSHGVTAQVLTARWSYDTMAEDICKMAKEKRAAFLVLPFHKQ  979
               + Q+  II+ F+N+E     V+ Q LTA   Y TM EDIC +A++KR AFL++PFHKQ
Sbjct  421   RTQAQSDHIINAFENFEQHVGSVSVQPLTAISPYSTMHEDICTVAEDKRVAFLIIPFHKQ  480

Query  978   QGTDGEMEDTNPAIQTVNEGVLLSAPCSVGILVERG-------RPNQYAKNIAVLYLGGP  820
                DG ME TNP  +T+N+ VL +APCSVGILV+RG         NQ + ++AVL+ GGP
Sbjct  481   LTVDGGMEITNPNFRTINQNVLANAPCSVGILVDRGLSGSTRLAANQVSHHVAVLFFGGP  540

Query  819   DDREALTYARRMSGLPGVHLTVIRFVP-------AKDVSADGAVEDPDLELELTRETSFV  661
             DDREAL+Y  RM   PG++LTV+RF+P       A+  S    + DP++          +
Sbjct  541   DDREALSYGLRMREHPGINLTVMRFLPGVPAHEEARSGSRRSNMNDPNV----------L  590

Query  660   TVSIDPARDKEEDEELLNNFRTETAEDDSKTFMELVLDDEEEFTKAVKSLDDRSFDLYVA  481
             T+  D  ++K+ DE+ +N FR  TA DDS  ++E V++  EE   A++++ D+S DL++ 
Sbjct  591   TIVTDDDKEKQLDEDYVNAFRLRTANDDSVVYIEKVVNHGEETVAAIRTI-DQSHDLFIV  649

Query  480   GRGRGVSSALTSGLADWCECPELGAVGDllvtsefessfsvlvVQQYV  337
             GRG+G  S LT+GL DW ECPELGA+GDLL +S+  +  SVLVVQQYV
Sbjct  650   GRGQGTISPLTAGLTDWSECPELGAIGDLLASSDNAAIVSVLVVQQYV  697



>gb|EAY98474.1| hypothetical protein OsI_20388 [Oryza sativa Indica Group]
Length=874

 Score =   531 bits (1368),  Expect = 7e-170, Method: Compositional matrix adjust.
 Identities = 315/791 (40%), Positives = 473/791 (60%), Gaps = 27/791 (3%)
 Frame = -3

Query  2658  VMCFSQTIYRSNGVWEGPDPLAPMIPLFILQIMTAILSSRILNFVLKPFNQPPLVAEILS  2479
             V+C+S  +  + G+W+G  PL   +PLF+LQ+   + ++R+L  +LKPF QP ++AEIL+
Sbjct  43    VVCYSPMMVTAYGIWQGASPLDFSLPLFLLQVAIIVATTRLLVILLKPFRQPRVIAEILA  102

Query  2478  GIILGPSMLGNIEEFRKHNFPNHNFETIETMGHFALVLYAFLTGLQMDVKAIVHTGTKSR  2299
             G+ILGPS++G +  +    FP  +  T+ET+ H  L+ + FL GL+MDV  I  +G K+ 
Sbjct  103   GVILGPSVMGQVSTWAVKVFPERSLLTLETVAHLGLLYFLFLVGLEMDVNTIRRSGKKAL  162

Query  2298  IVAVSGSIFPFLIGAGFYFTLQTDTQSMIG----FIFCGSALTVTGFSTLAKILDSKRLL  2131
             I+AV+G   PF IG    F  +      +      +F G AL+VT F  LA+IL   +LL
Sbjct  163   IIAVAGMALPFCIGTATSFIFRHQVSKNVHQASFLLFLGVALSVTAFPVLARILAEVKLL  222

Query  2130  NTEIGKIAASSALINVALSWVLLTIGLLFT---GSLDNVQWAvlctvgfvvvcvnyVRPL  1960
             N+++G+IA S+A++N   +W+LL + +  +    S  +  W ++  V FV+ C   VRPL
Sbjct  223   NSDLGRIAMSAAIVNDMCAWILLALAIAISEVNSSAFSSLWVLIAGVAFVLACFYVVRPL  282

Query  1959  LNWLISKTPEGQGFSEFYICSFIAVICAFGCFTDAMGSHPMIGAFIFGLIMPNNELLRTA  1780
             + W++ + PEG+   + +I   +  +   G  TDA+G H + GAF++GL+MP+   L   
Sbjct  283   MWWIVRRVPEGEAIGDVHITLILTGVMVAGVCTDAIGIHSVFGAFVYGLVMPSGP-LGVV  341

Query  1779  ILDRLEDFVMGILMPVFFLVCGLRTNIFTITDGDTSIFTALALILLACSAKIIAA-LVAS  1603
             ++++LEDFV G+L+P+FF + GLRTN+  + D  T     L  + +A  AKI+   L+A 
Sbjct  342   LIEKLEDFVTGLLLPLFFAISGLRTNVTKVRDPITVGLLVLVFV-MASFAKIMGTILIAV  400

Query  1602  CYTGMSTNEAIGLGVLTNTKSTMVMIILEVGqvqqvlsvqqysmmvVACLIMTIVATPLA  1423
              YT M+  + + LG L NT+  + MI+L +G+ ++VL  + +++MV+  + MT + TP+ 
Sbjct  401   SYT-MTFRDGVALGFLMNTRGLVEMIVLNIGRDKEVLDDESFAVMVLVSVAMTALVTPVV  459

Query  1422  AR-YCPKQDLEPYKRRTIQNAKPGEELRILACIHGTNNLPAIISLLETSNSTVTSPITAF  1246
                Y P + L  YKRR +Q +K   ELR+LAC+H T N+P+IISLLE SN T  SPI  +
Sbjct  460   TTVYRPARRLVGYKRRNLQRSKHDAELRMLACVHTTRNVPSIISLLELSNPTKRSPIFIY  519

Query  1245  GVQLLELVGRAPAMMvvhssgsgrhvggsHEEVQTSQIISTFDNYELRSHGVTAQVLTAR  1066
              + L+EL GRA  M+  H S S            +  I + F++YE    GV+ Q LTA 
Sbjct  520   ALHLVELTGRASNMLAAHHSASNPGGA-------SDHIFNAFESYEEMVGGVSVQALTAA  572

Query  1065  WSYDTMAEDICKMAKEKRAAFLVLPFHKQQGTDGEMEDTNPAIQTVNEGVLLSAPCSVGI  886
               Y TM ED+C +A++K  + +VLPFHKQQ  DG ME  N +++  NE +L SAPCSVGI
Sbjct  573   SPYQTMHEDVCVLAEDKHVSLIVLPFHKQQTVDGGMEPINASLRGFNESILASAPCSVGI  632

Query  885   LVERG-----RPNQYAKNIAVLYLGGPDDREALTYARRMSGLPGVHLTVIRFVPAKDVSA  721
             LV+RG            ++A+L+ GGPDDRE L YA RM   PGV LT++R +P    + 
Sbjct  633   LVDRGLSAAAARMAAVHHVALLFFGGPDDREGLAYAWRMVENPGVCLTIVRLIPPGYTAP  692

Query  720   DGAVEDPDLELELTRETSFVTVSIDPARDKEEDEELLNNFRTETAEDDSKTFMELVLDDE  541
               A+  P   +      +   V      +++ DEE LN FR+    +D+  ++E V+ + 
Sbjct  693   --AISPPQPPMPAAHSRAINVVPEVAKSERQMDEEYLNEFRSRNLGNDAILYVEQVVANS  750

Query  540   EEFTKAVKSLDDRSFDLYVAGRGRG-VSSALTSGLADWCECPELGAVGDllvtsefessf  364
             EE   A++S  D + +LY+ GR  G  SS LTS LA+W E PELG +GDLLV+SEF    
Sbjct  751   EETVAAIRSQLDNAHELYIVGRHPGEASSPLTSALAEWMESPELGPIGDLLVSSEFSKMA  810

Query  363   svlvVQQYVRT  331
             SVLV+QQYV T
Sbjct  811   SVLVMQQYVIT  821



>ref|XP_009595815.1| PREDICTED: cation/H(+) antiporter 15-like isoform X2 [Nicotiana 
tomentosiformis]
Length=736

 Score =   526 bits (1355),  Expect = 1e-169, Method: Compositional matrix adjust.
 Identities = 303/699 (43%), Positives = 442/699 (63%), Gaps = 20/699 (3%)
 Frame = -3

Query  2397  IETMGHFALVLYAFLTGLQMDVKAIVHTGTKSRIVAVSGSIFPFLIGAGFYFTLQTDTQS  2218
             +ETM +  L+ + FL G++MD+  I   G KS I+A++G + PF++G+ F F L   +Q 
Sbjct  3     LETMANIGLLYFLFLVGVEMDIDVIRRNGKKSLIIAIAGMVLPFIVGSSFSFMLHETSQH  62

Query  2217  M---IGFIFCGSALTVTGFSTLAKILDSKRLLNTEIGKIAASSALINVALSWVLLTIGLL  2047
                    +F G +L+VT F  LA+IL   +L+NTEIG+IA S++LIN  L+WV+L   + 
Sbjct  63    TKEGTFILFLGLSLSVTAFPVLARILAELKLINTEIGRIAMSASLINDILAWVVLAFAIA  122

Query  2046  FTGSLDNVQ---WAvlctvgfvvvcvnyVRPLLNWLISKTPEGQGFSEFYICSFIAVICA  1876
             F+ + +      W +L +  F+  C   VRPL+   I +TPEG+  SEF IC  +  +  
Sbjct  123   FSENKNMTLASLWVILSSTAFICFCFFVVRPLIERRIRQTPEGESISEFNICLILTGVMV  182

Query  1875  FGCFTDAMGSHPMIGAFIFGLIMPNNELLRTAILDRLEDFVMGILMPVFFLVCGLRTNIF  1696
              G  TDA+G+H + GAF+FGLI+PN  L    +++RLEDFV G+L+P+FF + GL+T I 
Sbjct  183   AGFITDAIGTHSVFGAFVFGLIIPNGPL-GLVLVERLEDFVSGLLLPLFFAISGLKTEI-  240

Query  1695  TITDGDTSIFTALALILLACSAKIIAALVASCYTGMSTNEAIGLGVLTNTKSTMVMIILE  1516
             T  DG  +  +   +I+LAC+ K++   + + Y  M  +E + LG+L N K  + MI+L 
Sbjct  241   TAIDGVGTWASLFVVIVLACAGKVLGVFLVTLYYKMPYHEGLSLGLLMNAKGLIEMIVLN  300

Query  1515  VGqvqqvlsvqqysmmvVACLIMTIVATPLAAR-YCPKQDLEPYKRRTIQNAKPGEELRI  1339
             VG+ Q+VL  + +++MV+  + MT + TP+    Y P ++  PYKRRT+Q  K   E R+
Sbjct  301   VGKDQKVLDDKSFAIMVMVAVGMTAIITPIVTVIYKPARNFVPYKRRTVQRTKLDREFRV  360

Query  1338  LACIHGTNNLPAIISLLETSNSTVTSPITAFGVQLLELVGRAPAMMvvhssgsgrhvggs  1159
             L CIH   N+P II+LLE S  T  SPI  + + L+EL GRA AM++VH+         +
Sbjct  361   LVCIHTPRNVPTIINLLEASYPTKKSPICIYVLHLVELTGRASAMLIVHNMRKTGRPAIN  420

Query  1158  HEEVQTSQIISTFDNYELRSHGVTAQVLTARWSYDTMAEDICKMAKEKRAAFLVLPFHKQ  979
               + Q+  II+ F+N+E     V  Q LTA   Y TM EDIC +A++KR A +++PFHKQ
Sbjct  421   RTQAQSDHIINAFENFEKNVGCVYVQSLTAISPYSTMHEDICLLAEDKRVALIIIPFHKQ  480

Query  978   QGTDGEMEDTNPAIQTVNEGVLLSAPCSVGILVERG----RPNQYAKNIAVLYLGGPDDR  811
             Q  DG ME TNPA Q +N+ VL ++PCSVGILV+RG    R NQ + +IAVL+ GGPDDR
Sbjct  481   QTVDGGMEATNPAFQAINQNVLANSPCSVGILVDRGLSASRMNQVSHHIAVLFFGGPDDR  540

Query  810   EALTYARRMSGLPGVHLTVIRFVPAKDVSADGAVEDPDLELELTR-ETSFVTVSIDPARD  634
             EAL YA RMS  P ++LTV+RF+P      + ++E    +   +R + S +TV+ D  ++
Sbjct  541   EALAYAWRMSEHPNINLTVLRFLP-----GEASIEATRSDSTNSRNDHSILTVATDSDKE  595

Query  633   KEEDEELLNNFRTETAEDDSKTFMELVLDDEEEFTKAVKSLDDRSFDLYVAGRGRGVSSA  454
             K+ DEE +  FRT T  D+S  + E V++  EE   A++S+D+ S DL++ GRG+G  S 
Sbjct  596   KQLDEEYVKEFRTRTTNDESVIYTERVVNHGEETVAAIRSIDN-SHDLFIVGRGQGNISP  654

Query  453   LTSGLADWCECPELGAVGDllvtsefessfsvlvVQQYV  337
             LT+GL DW ECPELGA+GDLL +S+F    SVL+VQQYV
Sbjct  655   LTAGLTDWSECPELGAIGDLLASSDFAMEVSVLIVQQYV  693



>ref|NP_001055872.1| Os05g0485000 [Oryza sativa Japonica Group]
 gb|AAT01398.1| putative cation/hydrogen exchanger (CHX6a) [Oryza sativa Japonica 
Group]
 dbj|BAF17786.1| Os05g0485000 [Oryza sativa Japonica Group]
 gb|EEE64151.1| hypothetical protein OsJ_18983 [Oryza sativa Japonica Group]
Length=874

 Score =   530 bits (1366),  Expect = 1e-169, Method: Compositional matrix adjust.
 Identities = 315/791 (40%), Positives = 473/791 (60%), Gaps = 27/791 (3%)
 Frame = -3

Query  2658  VMCFSQTIYRSNGVWEGPDPLAPMIPLFILQIMTAILSSRILNFVLKPFNQPPLVAEILS  2479
             V+C+S  +  + G+W+G  PL   +PLF+LQ+   + ++R+L  +LKPF QP ++AEIL+
Sbjct  43    VVCYSPMMVTAYGIWQGASPLDFSLPLFLLQVAIIVATTRLLVILLKPFRQPRVIAEILA  102

Query  2478  GIILGPSMLGNIEEFRKHNFPNHNFETIETMGHFALVLYAFLTGLQMDVKAIVHTGTKSR  2299
             G+ILGPS++G +  +    FP  +  T+ET+ H  L+ + FL GL+MDV  I  +G K+ 
Sbjct  103   GVILGPSVMGQVSTWAVKVFPERSLLTLETVAHLGLLYFLFLVGLEMDVNTIRRSGKKAL  162

Query  2298  IVAVSGSIFPFLIGAGFYFTLQTDTQSMIG----FIFCGSALTVTGFSTLAKILDSKRLL  2131
             I+AV+G   PF IG    F  +      +      +F G AL+VT F  LA+IL   +LL
Sbjct  163   IIAVAGMALPFCIGTATSFIFRHQVSKNVHQASFLLFLGVALSVTAFPVLARILAEVKLL  222

Query  2130  NTEIGKIAASSALINVALSWVLLTIGLLFT---GSLDNVQWAvlctvgfvvvcvnyVRPL  1960
             N+++G+IA S+A++N   +W+LL + +  +    S  +  W ++  V FV+ C   VRPL
Sbjct  223   NSDLGRIAMSAAIVNDMCAWILLALAIAISEVNSSAFSSLWVLIAGVAFVLACFYVVRPL  282

Query  1959  LNWLISKTPEGQGFSEFYICSFIAVICAFGCFTDAMGSHPMIGAFIFGLIMPNNELLRTA  1780
             + W++ + PEG+   + +I   +  +   G  TDA+G H + GAF++GL+MP+   L   
Sbjct  283   MWWIVRRVPEGEAIGDVHITLILTGVMVAGVCTDAIGIHSVFGAFVYGLVMPSGP-LGVV  341

Query  1779  ILDRLEDFVMGILMPVFFLVCGLRTNIFTITDGDTSIFTALALILLACSAKIIAA-LVAS  1603
             ++++LEDFV G+L+P+FF + GLRTN+  + D  T     L  + +A  AKI+   L+A 
Sbjct  342   LIEKLEDFVTGLLLPLFFAISGLRTNVTKVRDPITVGLLVLVFV-MASFAKIMGTILIAV  400

Query  1602  CYTGMSTNEAIGLGVLTNTKSTMVMIILEVGqvqqvlsvqqysmmvVACLIMTIVATPLA  1423
              YT M+  + + LG L NT+  + MI+L +G+ ++VL  + +++MV+  + MT + TP+ 
Sbjct  401   SYT-MTFRDGVALGFLMNTRGLVEMIVLNIGRDKEVLDDESFAVMVLVSVAMTALVTPVV  459

Query  1422  AR-YCPKQDLEPYKRRTIQNAKPGEELRILACIHGTNNLPAIISLLETSNSTVTSPITAF  1246
                Y P + L  YKRR +Q +K   ELR+LAC+H T N+P+IISLLE SN T  SPI  +
Sbjct  460   TTVYRPARRLVGYKRRNLQRSKHDAELRMLACVHTTRNVPSIISLLELSNPTKRSPIFIY  519

Query  1245  GVQLLELVGRAPAMMvvhssgsgrhvggsHEEVQTSQIISTFDNYELRSHGVTAQVLTAR  1066
              + L+EL GRA  M+  H S S            +  I + F++YE    GV+ Q LTA 
Sbjct  520   ALHLVELTGRASNMLAAHHSASNPGGA-------SDHIFNAFESYEEMVGGVSVQALTAV  572

Query  1065  WSYDTMAEDICKMAKEKRAAFLVLPFHKQQGTDGEMEDTNPAIQTVNEGVLLSAPCSVGI  886
               Y TM ED+C +A++K  + +VLPFHKQQ  DG ME  N +++  NE +L SAPCSVGI
Sbjct  573   SPYQTMHEDVCVLAEDKHVSLIVLPFHKQQTVDGGMEPINASLRGFNESILASAPCSVGI  632

Query  885   LVERG-----RPNQYAKNIAVLYLGGPDDREALTYARRMSGLPGVHLTVIRFVPAKDVSA  721
             LV+RG            ++A+L+ GGPDDRE L YA RM   PGV LT++R +P    + 
Sbjct  633   LVDRGLSAAAARMAAVHHVALLFFGGPDDREGLAYAWRMVENPGVCLTIVRLIPPGYTAP  692

Query  720   DGAVEDPDLELELTRETSFVTVSIDPARDKEEDEELLNNFRTETAEDDSKTFMELVLDDE  541
               A+  P   +      +   V      +++ DEE LN FR+    +D+  ++E V+ + 
Sbjct  693   --AISPPQPPMPAAHSRAINVVPEVAKSERQMDEEYLNEFRSRNLGNDAILYVEQVVANS  750

Query  540   EEFTKAVKSLDDRSFDLYVAGRGRG-VSSALTSGLADWCECPELGAVGDllvtsefessf  364
             EE   A++S  D + +LY+ GR  G  SS LTS LA+W E PELG +GDLLV+SEF    
Sbjct  751   EETVAAIRSQLDNAHELYIVGRHPGEASSPLTSALAEWMESPELGPIGDLLVSSEFSKMA  810

Query  363   svlvVQQYVRT  331
             SVLV+QQYV T
Sbjct  811   SVLVMQQYVIT  821



>ref|XP_008649801.1| PREDICTED: cation/H(+) antiporter 15-like [Zea mays]
 gb|AFW78427.1| hypothetical protein ZEAMMB73_492061 [Zea mays]
Length=865

 Score =   525 bits (1352),  Expect = 1e-167, Method: Compositional matrix adjust.
 Identities = 312/794 (39%), Positives = 474/794 (60%), Gaps = 26/794 (3%)
 Frame = -3

Query  2658  VMCFSQTIYRSNGVWEGPDPLAPMIPLFILQIMTAILSSRILNFVLKPFNQPPLVAEILS  2479
             V+C+S  +  ++G+W+G +PL   +PLFILQ    + ++R+L  +LKP  QP ++AEIL+
Sbjct  35    VVCYSPMMVTAHGIWQGANPLEFSLPLFILQTAIIVATTRLLVLLLKPIRQPRVIAEILA  94

Query  2478  GIILGPSMLGNIEEFRKHNFPNHNFETIETMGHFALVLYAFLTGLQMDVKAIVHTGTKSR  2299
             G+ILGPS++G ++ +    FP  +  T+ET+ H  L+ + FL GL+MDV  I  +G K+ 
Sbjct  95    GVILGPSVMGQVDVWASTVFPVRSLLTLETVAHLGLLYFLFLVGLEMDVNVIRRSGKKAL  154

Query  2298  IVAVSGSIFPFLIGAGFYFTLQTDTQSMIG----FIFCGSALTVTGFSTLAKILDSKRLL  2131
             I+AV+G   PF IG    F  +      +      +F G AL+VT F  LA+IL   +LL
Sbjct  155   IIAVAGMALPFCIGTATSFIFRHQVSKNVHQASFLLFLGVALSVTAFPVLARILAEIKLL  214

Query  2130  NTEIGKIAASSALINVALSWVLLTIGLLFT---GSLDNVQWAvlctvgfvvvcvnyVRPL  1960
             N+++G+IA S+A++N   +W+LL + +  +    S  +  W +L  V FV+ C   VRPL
Sbjct  215   NSDLGRIAMSAAIVNDMCAWILLALAIAISEVNSSAFSSLWVLLSGVLFVLACFYVVRPL  274

Query  1959  LNWLISKTPEGQGFSEFYICSFIAVICAFGCFTDAMGSHPMIGAFIFGLIMPNNELLRTA  1780
             + W++ + PEG+  S+ ++   +  +   G  TDA+G H + GAF++GL++P+ + L   
Sbjct  275   MRWIVRRVPEGEAISDVHVMLVLTGVMIAGVCTDAIGIHSVFGAFVYGLVIPSGQ-LGVV  333

Query  1779  ILDRLEDFVMGILMPVFFLVCGLRTNIFTITDGDTSIFTALALILLACSAKIIAALVASC  1600
             ++++LEDFV G+L+P+FF + GLRTNI  + D  T     L   + + +  +   L+A  
Sbjct  334   LIEKLEDFVTGLLLPLFFAISGLRTNITRVHDPVTVGLLVLVFTMASFAKVMGTILIAVS  393

Query  1599  YTGMSTNEAIGLGVLTNTKSTMVMIILEVGqvqqvlsvqqysmmvVACLIMTIVATPLAA  1420
             YT M+  + + LG L NT+  + MI+L +G+ ++VL  + +++MV+  + MT + TP+  
Sbjct  394   YT-MTFRDGVALGFLMNTRGLVEMIVLNIGRDKEVLDDESFAVMVLVSVAMTALVTPVVT  452

Query  1419  R-YCPKQDLEPYKRRTIQNAKPGEELRILACIHGTNNLPAIISLLETSNSTVTSPITAFG  1243
               Y P + L  YKRR +Q +K   ELR+LAC+H T N+P+IISLLE SN T  SPI  + 
Sbjct  453   TVYRPARRLVGYKRRNLQRSKHDSELRMLACVHTTRNVPSIISLLELSNPTKRSPIFIYA  512

Query  1242  VQLLELVGRAPAMMvvhssgsgrhvggsHEEVQTSQIISTFDNYELRSHGVTAQVLTARW  1063
             + L+EL GRA  M+      +  H   +     +  I + F++YE    GV+ Q LTA  
Sbjct  513   LHLVELTGRASNML------AAHHSATNQSRSSSDHIFNAFESYEESVGGVSVQALTAVS  566

Query  1062  SYDTMAEDICKMAKEKRAAFLVLPFHKQQGTDGEMEDTNPAIQTVNEGVLLSAPCSVGIL  883
              Y TM ED+  +A++K  + +VLPFHKQQ  DG ME  N +++  NE +L SAPCSVGIL
Sbjct  567   PYQTMHEDVSILAEDKHVSLIVLPFHKQQTVDGGMEPINASLRGFNESILSSAPCSVGIL  626

Query  882   VERGRPNQYAK-----NIAVLYLGGPDDREALTYARRMSGLPGVHLTVIRFVPA--KDVS  724
             V+RG     A+     ++A+L+ GGPDDRE L YA RM   PGV LT++RF+P   K  +
Sbjct  627   VDRGLSAAAARMASVHHVALLFFGGPDDREGLAYAWRMVEHPGVCLTIVRFIPPGYKAPA  686

Query  723   ADGAVEDPDLELELTRETSFVTVSID-PARDKEEDEELLNNFRTETAEDDSKTFMELVLD  547
                    P            +T+  D P  +++ DEE LN FR     +D+  +ME V+ 
Sbjct  687   LAPPQPMPPRGPAANVHARAITIVPDVPKSERQMDEEYLNEFRVRNIGNDAILYMEQVVA  746

Query  546   DEEEFTKAVKSLDDRSFDLYVAGRGRG-VSSALTSGLADWCECPELGAVGDllvtsefes  370
             + E+   A++ LD  + +LY+ GR  G   S LTS LA+W E PELG +GDLLV+SEF  
Sbjct  747   NSEDTLAAIRGLDS-AHELYIVGRHPGEAGSPLTSALAEWMESPELGPIGDLLVSSEFSK  805

Query  369   sfsvlvVQQYVRTN  328
               SVLV+QQYV T 
Sbjct  806   MVSVLVMQQYVITT  819



>ref|XP_003566124.1| PREDICTED: cation/H(+) antiporter 15-like [Brachypodium distachyon]
Length=870

 Score =   525 bits (1351),  Expect = 2e-167, Method: Compositional matrix adjust.
 Identities = 313/803 (39%), Positives = 481/803 (60%), Gaps = 48/803 (6%)
 Frame = -3

Query  2667  GQVVMCFSQTIYRSNGVWEGPDPLAPMIPLFILQIMTAILSSRILNFVLKPFNQPPLVAE  2488
             G  V+C+S  +  + G+W+G  PL   +PLFILQ+   + ++RIL  +LKP  QP ++AE
Sbjct  36    GAAVVCYSPMMVTTYGIWQGVSPLEFSLPLFILQVTIIVGTTRILVLLLKPLRQPRVIAE  95

Query  2487  ILSGIILGPSMLGNIEEFRKHNFPNHNFETIETMGHFALVLYAFLTGLQMDVKAIVHTGT  2308
             IL+G+ILGPS++G +  +    FP  +  T+ET+ H  L+ + FL GL+MDV  I  +G 
Sbjct  96    ILAGVILGPSLMGQLGTWAGTVFPERSLLTLETVAHLGLLYFLFLVGLEMDVNVIKRSGK  155

Query  2307  KSRIVAVSGSIFPFLIGAGFYFTLQTDTQSMIG----FIFCGSALTVTGFSTLAKILDSK  2140
             K+ I+AV+G   PF IG    F  +      +      +F G AL+VT F  LA+IL   
Sbjct  156   KALIIAVAGMALPFCIGTATSFIFRHQVSKNVHQASFLLFLGVALSVTAFPVLARILAEI  215

Query  2139  RLLNTEIGKIAASSALINVALSWVLLTIGLLFT---GSLDNVQWAvlctvgfvvvcvnyV  1969
             +LLN+++GKIA S+A++N   +W+LL + +  +    +  +  W +L  V FV+ C   V
Sbjct  216   KLLNSDLGKIAMSAAIVNDMCAWILLALAIAISEVNSTPFSSLWVLLSGVAFVLACFYVV  275

Query  1968  RPLLNWLISKTPEGQGFSEFYICSFIAVICAFGCFTDAMGSHPMIGAFIFGLIMPNNELL  1789
             RP++ W++ + PEG+  S+ ++   +  +   G  TDA+G H + GAF++GL++P+   L
Sbjct  276   RPVMWWIVRRVPEGESISDVHVTLILTGVMISGVCTDAIGIHSVFGAFVYGLVIPSAP-L  334

Query  1788  RTAILDRLEDFVMGILMPVFFLVCGLRTNIFTITDGDTSIFTALALILLACSAKIIAA-L  1612
                ++++LEDFV G+L+P+FF + GLRTN+  + D   +++  + + ++A  AKI+   L
Sbjct  335   GVVLIEKLEDFVTGLLLPLFFAISGLRTNVTQVRD-PVTVWLLVLVFVMASFAKIMGTIL  393

Query  1611  VASCYTGMSTNEAIGLGVLTNTKSTMVMIILEVGqvqqvlsvqqysmmvVACLIMTIVAT  1432
             +A  YT MS  + + LG L NT+  + MI+L +G+ ++VL  + +++MV+  + MT + T
Sbjct  394   IAVAYT-MSFRDGVALGFLMNTRGLVEMIVLNIGRDKEVLDDESFAVMVLVSVAMTALVT  452

Query  1431  PLAAR-YCPKQDLEPYKRRTIQNAKPGEELRILACIHGTNNLPAIISLLETSNSTVTSPI  1255
             P+    Y P + L  YKRR +Q +K   ELR+LAC+H   N+P+IISLLE SN T  SPI
Sbjct  453   PVVTTVYRPARRLVGYKRRNLQRSKHDSELRMLACVHINRNVPSIISLLELSNPTKRSPI  512

Query  1254  TAFGVQLLELVGRAPAMMvvhssgsgrhvggsHEEVQTSQIISTFDNYELRSHGVTAQVL  1075
               + + L+EL GRA  M+    +              +  I + F++YE    GV+ Q L
Sbjct  513   FIYALHLVELTGRASNMLAASHTAGS----------SSDHIFNAFESYEESVGGVSVQAL  562

Query  1074  TARWSYDTMAEDICKMAKEKRAAFLVLPFHKQQGTDGEMEDTNPAIQTVNEGVLLSAPCS  895
             TA   Y TM ED+C +A++K  + +VLPFHKQQ  DG ME  NP+I+  NE +L SAPCS
Sbjct  563   TAVSPYQTMHEDVCVLAEDKHVSLIVLPFHKQQTVDGGMEPINPSIRGFNESILASAPCS  622

Query  894   VGILVERGRPNQYAK-----NIAVLYLGGPDDREALTYARRMSGLPGVHLTVIRFVP---  739
             +GILV+RG     A+     ++A+L+ GGPDDREAL YA RM   PGV LT++RF+P   
Sbjct  623   IGILVDRGLSAATARMASVHHVALLFFGGPDDREALAYAWRMVEHPGVCLTIVRFIPPGY  682

Query  738   --------AKDVSADGAVEDPDLELELTRETSFVTVSIDPARDKEEDEELLNNFRTETAE  583
                        +S+ G V         +R T+   V      +++ DEE LN FR+    
Sbjct  683   TPAPPTSMVSPMSSVGGVG--------SRATAITIVPEAGKSERQMDEEYLNEFRSRNMG  734

Query  582   DDSKTFMELVLDDEEEFTKAVKSLDDRSFDLYVAGRGRG-VSSALTSGLADWCECPELGA  406
             +++  ++E V+ + EE    +++L++ + +L + GR  G  SS LTS LADW E PELG 
Sbjct  735   NEAILYVEQVVGNSEETLAVIRNLNN-AHELCIVGRQPGEESSPLTSALADWMESPELGP  793

Query  405   VGDllvtsefessfsvlvVQQYV  337
             +GDLLV+SEF    SVLV+QQY+
Sbjct  794   IGDLLVSSEFSKMVSVLVMQQYI  816



>gb|EAY76275.1| hypothetical protein OsI_04210 [Oryza sativa Indica Group]
Length=875

 Score =   523 bits (1348),  Expect = 7e-167, Method: Compositional matrix adjust.
 Identities = 311/802 (39%), Positives = 474/802 (59%), Gaps = 42/802 (5%)
 Frame = -3

Query  2658  VMCFSQTIYRSNGVWEGPDPLAPMIPLFILQIMTAILSSRILNFVLKPFNQPPLVAEILS  2479
             V+C+S  +  +NG+W+G +PL   +PLFILQ+   ++++R+L  +LKPF QP ++AEIL+
Sbjct  33    VVCYSPMMITTNGIWQGVNPLEFSLPLFILQVAVIVVTTRLLVVLLKPFRQPRVIAEILA  92

Query  2478  GIILGPSMLGNIEEFRKHNFPNHNFETIETMGHFALVLYAFLTGLQMDVKAIVHTGTKSR  2299
             G++LGPS++G +E +    FP  +  T+ET+ H  L+ + FL GL+MD+  I  +G K+ 
Sbjct  93    GVVLGPSVMGQVEVWATMVFPQRSLLTLETVAHLGLLYFLFLVGLEMDLDVIRRSGKKAL  152

Query  2298  IVAVSGSIFPFLIGAGFYFTLQTDTQSMIG----FIFCGSALTVTGFSTLAKILDSKRLL  2131
              VAV+G   PF IG    F  +      +      +F G AL+VT F  LA+IL   +LL
Sbjct  153   FVAVAGMALPFCIGIATSFIFRHQVSRNVHQTSFLLFLGVALSVTAFPVLARILAEIKLL  212

Query  2130  NTEIGKIAASSALINVALSWVLLTIGLLFT---GSLDNVQWAvlctvgfvvvcvnyVRPL  1960
             NTE+G+IA S+A++N   +W+LL + +  +    +  +  W +L  V FV+ C   VRP 
Sbjct  213   NTELGRIAMSAAIVNDMCAWILLALAIAISEVNSTALSSLWVLLAGVLFVLFCFYVVRPG  272

Query  1959  LNWLISKTPEGQGFSEFYICSFIAVICAFGCFTDAMGSHPMIGAFIFGLIMPNNELLRTA  1780
             + WLI + PEG+  S+  +   +  +   G  TDA+G H + GAF++GL++P  + L  A
Sbjct  273   MWWLIRRIPEGEVVSDMQVSLILTGVMLAGVCTDAIGIHSVFGAFVYGLVIPGGQ-LGVA  331

Query  1779  ILDRLEDFVMGILMPVFFLVCGLRTNIFTITDGDTSIFTALALILLACSAKIIAALVASC  1600
             ++++LEDFV G+L+P+FF + GLRTNI  I D  T     L    +A  AKI+  ++ + 
Sbjct  332   LIEKLEDFVTGLLLPLFFAISGLRTNISKIRDPITVGLLVLVFT-MASFAKIMGTIIIAA  390

Query  1599  YTGMSTNEAIGLGVLTNTKSTMVMIILEVGqvqqvlsvqqysmmvVACLIMTIVATPLA-  1423
                M   E I LG L NT+  + MI+L +G+ ++VL  + +++MV+  + MT + TP+  
Sbjct  391   LYTMPFREGIALGFLMNTRGLVEMIVLNIGRDKEVLDDESFAVMVLVSVAMTTLVTPVVT  450

Query  1422  ARYCPKQDLEPYKRRTIQNAKPGEELRILACIHGTNNLPAIISLLETSNSTVTSPITAFG  1243
               Y P + L  YKRR +Q  +   ELR+L C+H T N+P+++SLLE SN T  SPI  + 
Sbjct  451   GVYRPSRRLVGYKRRNLQRIRHDSELRMLICVHTTRNVPSVLSLLELSNPTKRSPIFIYA  510

Query  1242  VQLLELVGRAPAMMvvhssgsgrhvggsHEEV---QTSQIISTFDNYELRSHGVTAQVLT  1072
             + L+EL GRA  M+   ++ + +    S        T  I + F+NYE  + G++ Q L 
Sbjct  511   LHLVELTGRASNMLAAAAASASKQNRSSSSSTLPPVTEHIFNAFENYERHTGGISIQTLA  570

Query  1071  ARWSYDTMAEDICKMAKEKRAAFLVLPFHKQQGTDGEMEDTNPAIQTVNEGVLLSAPCSV  892
             A   Y TM +D+  +A++K  + +V+PFHKQQ  DG ME  NP+I+  NE +L ++PCSV
Sbjct  571   AVSPYQTMHDDVSVLAEDKHVSLIVVPFHKQQTVDGAMEPINPSIRGFNESLLSTSPCSV  630

Query  891   GILVERGRPNQYA-----KNIAVLYLGGPDDREALTYARRMSGLPGVHLTVIRFVPAKDV  727
              ILV+RG     A       +A+ + GGPDDREAL YA RM   PGV LTV+RFVP    
Sbjct  631   AILVDRGLSAAAARMAALHRVALFFFGGPDDREALAYAWRMVEHPGVALTVVRFVP----  686

Query  726   SADGAVEDPDLELELTRETSFVTVSIDP-----------ARDKEEDEELLNNFRTETAED  580
                     PD  +     T++ +V+ D              + + DEE L +FRT    +
Sbjct  687   --------PDYRVRSYSNTNYRSVASDADPRSIGMDTEGKTELQMDEEYLGDFRTRNIGN  738

Query  579   DSKTFMELVLDDEEEFTKAVKSLDDRSFDLYVAGRGRG-VSSALTSGLADWCECPELGAV  403
             D+ ++ + V+ + EE   A++++DD   +LY+ GR  G   S +T+ L DW ECPELG +
Sbjct  739   DAISYSDKVVANSEETVSAIRNMDDSLHELYIVGRRPGEAGSPMTASLEDWMECPELGPI  798

Query  402   GDllvtsefessfsvlvVQQYV  337
             GD+LV+S+F  S SVLVVQQYV
Sbjct  799   GDMLVSSDFSMSVSVLVVQQYV  820



>ref|XP_007159847.1| hypothetical protein PHAVU_002G272700g [Phaseolus vulgaris]
 gb|ESW31841.1| hypothetical protein PHAVU_002G272700g [Phaseolus vulgaris]
Length=813

 Score =   521 bits (1342),  Expect = 1e-166, Method: Compositional matrix adjust.
 Identities = 315/791 (40%), Positives = 488/791 (62%), Gaps = 27/791 (3%)
 Frame = -3

Query  2658  VMCFSQTIYRSNGVWEGPDPLAPMIPLFILQIMTAILSSRILNFVLKPFNQPPLVAEILS  2479
             ++C++ T+  S G W+  +PL   +PLF+LQ+M  ++ +R+  F+LKP  QP +++E++ 
Sbjct  16    IVCYAATMITSEGFWQKENPLNYALPLFLLQLMLILVVTRLFIFILKPIRQPRVISELMG  75

Query  2478  GIILGPSMLGNIEEFRKHNFPNHNFETIETMGHFALVLYAFLTGLQMDVKAIVHTGTKSR  2299
             GIILGPS+LG  + F    FP      IETM +  +V + FL G+ MD  ++   G+K+ 
Sbjct  76    GIILGPSVLGKSKAFADVIFPPRGKILIETMANVGIVYFMFLVGVGMDATSLRRIGSKAV  135

Query  2298  IVAVSGSIFPFLIGAGF-YFTLQTDTQS---MIGFIFCGSALTVTGFSTLAKILDSKRLL  2131
              +AV G I PF IGA F  + ++ D QS       +F GS L+V  F  LA+IL   +L+
Sbjct  136   AIAVVGMILPFTIGALFSVYLIKFDEQSERSAASILFIGSILSVAAFPVLARILAELKLI  195

Query  2130  NTEIGKIAASSALINVALSWVLLTIGLLFTGSLDNVQWAvlctvgfv----vvcvnyVRP  1963
             N+++GKIA SSAL+N  +S VLL + +           ++L T        V  +  VRP
Sbjct  196   NSDLGKIALSSALVNDLISCVLLVLSINLVEHNSEASLSLLSTFLASGGFVVFNIFVVRP  255

Query  1962  LLNWLISKTPEGQGFSEFYICSFIAVICAFGCFTDAMGSHPMIGAFIFGLIMPNNELLRT  1783
              + W+I KTPEG+ FS+ ++C  ++ +   G  TD +G+H + GAF+FGL +PN  +   
Sbjct  256   GILWMIRKTPEGEAFSDLFMCIILSGVMISGFITDFIGTHAVFGAFVFGLTIPNGPI-GL  314

Query  1782  AILDRLEDFVMGILMPVFFLVCGLRTNIFTITDGDTSIFTALALILLACSAKIIAALVAS  1603
             +I++RLEDF+  +L+P+FF   GL+T++  +  G  +    + L++LAC  KII  + A+
Sbjct  315   SIVERLEDFITLLLLPLFFASNGLKTDL-GLLKGLYTWSILIILVILACIGKIIGTIAAA  373

Query  1602  CYTGMSTNEAIGLGVLTNTKSTMVMIILEVGqvqqvlsvqqysmmvVACLIMTIVATP-L  1426
              Y  +S  +   LG+L NTK  + +I++ VG+ Q+VL+ + ++ +++  ++MT V  P +
Sbjct  374   FYYQISVRDGAALGLLMNTKGVIEVIVISVGKDQKVLTSESFASLMLLTVLMTAVIVPGM  433

Query  1425  AARYCPKQDLEPYKRRTIQNAKPGEELRILACIHGTNNLPAIISLLETSNSTVTSPITAF  1246
             +  Y P + + PYKRRTIQ +    E R+L CIH   N+P +I LL+ ++ +  SPI  +
Sbjct  434   SFIYKPSRGIIPYKRRTIQMSYRETEFRVLVCIHTPRNVPTMIGLLDATSPSKNSPICIY  493

Query  1245  GVQLLELVGRAPAMMvvhssgsgrhvggsHEEV-QTSQIISTFDNYELRSHGVTAQVLTA  1069
              + L EL G A A++++H+          ++ + QT  I++ F NYE  +  V+ Q  T 
Sbjct  494   LLHLTELSGHASALLILHNHTKKPDQPACNKTLAQTEHIVNAFQNYEQEASYVSVQPSTV  553

Query  1068  RWSYDTMAEDICKMAKEKRAAFLVLPFHKQQGTDGEMEDTNPAIQTVNEGVLLSAPCSVG  889
                Y TM ED+C +A+EKR AF++LPFHK Q  DGEME TN + +TVN  VL  APCSVG
Sbjct  554   ISPYSTMHEDVCNLAQEKRVAFIILPFHKHQTVDGEMESTNISFRTVNLNVLCKAPCSVG  613

Query  888   ILVERG-------RPNQYAKNIAVLYLGGPDDREALTYARRMSGLPGVHLTVIRFVPAKD  730
             ILV+RG        P+Q + N+AVL+ GGP DREAL+YA RM   PG++LTV+RFV A++
Sbjct  614   ILVDRGLSVFTHLAPDQKSHNVAVLFFGGPHDREALSYAWRMLERPGINLTVMRFVHAEE  673

Query  729   VSADGAVEDPDLELELTRETSFVTVSIDPARDKEEDEELLNNFRTETAEDDSKTFMELVL  550
             V    +  +P        E+  +TV  D   +K+ DE  +N FRTE  ++DS  ++E ++
Sbjct  674   VMHHHSDPNP-------HESKLLTVETDMETEKKLDERFINWFRTEHEDNDSVVYVEKMV  726

Query  549   DDEEEFTKAVKSLDDRSFDLYVAGRGRGVSSALTSGLADWCECPELGAVGDllvtsefes  370
             ++ E+   A++S+DD   DL++ GRG+G  S LT+GL DW EC ELGA+GDLL +S+F +
Sbjct  727   NNGEQTVSAIRSMDDIH-DLFIIGRGQGNKSPLTAGLTDWSECHELGAIGDLLASSDFAA  785

Query  369   sfsvlvVQQYV  337
             + SVL+VQQY+
Sbjct  786   TASVLIVQQYL  796



>dbj|BAB62576.1| Na+/H+ antiporter-like protein [Oryza sativa Japonica Group]
 dbj|BAD82290.1| Na+/H+ antiporter-like protein [Oryza sativa Japonica Group]
 gb|EAZ13944.1| hypothetical protein OsJ_03870 [Oryza sativa Japonica Group]
Length=875

 Score =   523 bits (1346),  Expect = 1e-166, Method: Compositional matrix adjust.
 Identities = 311/802 (39%), Positives = 474/802 (59%), Gaps = 42/802 (5%)
 Frame = -3

Query  2658  VMCFSQTIYRSNGVWEGPDPLAPMIPLFILQIMTAILSSRILNFVLKPFNQPPLVAEILS  2479
             V+C+S  +  +NG+W+G +PL   +PLFILQ+   ++++R+L  +LKPF QP ++AEIL+
Sbjct  33    VVCYSPMMITTNGIWQGVNPLEFSLPLFILQVAVIVVTTRLLVVLLKPFRQPRVIAEILA  92

Query  2478  GIILGPSMLGNIEEFRKHNFPNHNFETIETMGHFALVLYAFLTGLQMDVKAIVHTGTKSR  2299
             G++LGPS++G +E +    FP  +  T+ET+ H  L+ + FL GL+MD+  I  +G K+ 
Sbjct  93    GVVLGPSVMGQVEVWATMVFPQRSLLTLETVAHLGLLYFLFLVGLEMDLDVIRRSGKKAL  152

Query  2298  IVAVSGSIFPFLIGAGFYFTLQTDTQSMIG----FIFCGSALTVTGFSTLAKILDSKRLL  2131
              VAV+G   PF IG    F  +      +      +F G AL+VT F  LA+IL   +LL
Sbjct  153   FVAVAGMALPFCIGIATSFIFRHQVSRNVHQTSFLLFLGVALSVTAFPVLARILAEIKLL  212

Query  2130  NTEIGKIAASSALINVALSWVLLTIGLLFT---GSLDNVQWAvlctvgfvvvcvnyVRPL  1960
             NTE+G+IA S+A++N   +W+LL + +  +    +  +  W +L  V FV+ C   VRP 
Sbjct  213   NTELGRIAMSAAIVNDMCAWILLALAIAISEVNSTALSSLWVLLAGVLFVLFCFYVVRPG  272

Query  1959  LNWLISKTPEGQGFSEFYICSFIAVICAFGCFTDAMGSHPMIGAFIFGLIMPNNELLRTA  1780
             + WLI + PEG+  S+  +   +  +   G  TDA+G H + GAF++GL++P  + L  A
Sbjct  273   MWWLIRRIPEGEVVSDMQVSLILTGVMLAGVCTDAIGIHSVFGAFVYGLVIPGGQ-LGVA  331

Query  1779  ILDRLEDFVMGILMPVFFLVCGLRTNIFTITDGDTSIFTALALILLACSAKIIAALVASC  1600
             ++++LEDFV G+L+P+FF + GLRTNI  I D  T     L    +A  AKI+  ++ + 
Sbjct  332   LIEKLEDFVTGLLLPLFFAISGLRTNISKIRDPITVGLLVLVFT-MASFAKIMGTIIIAA  390

Query  1599  YTGMSTNEAIGLGVLTNTKSTMVMIILEVGqvqqvlsvqqysmmvVACLIMTIVATPLA-  1423
                M   E I LG L NT+  + MI+L +G+ ++VL  + +++MV+  + MT + TP+  
Sbjct  391   LYTMPFREGIALGFLMNTRGLVEMIVLNIGRDKEVLDDESFAVMVLVSVAMTTLVTPVVT  450

Query  1422  ARYCPKQDLEPYKRRTIQNAKPGEELRILACIHGTNNLPAIISLLETSNSTVTSPITAFG  1243
               Y P + L  YKRR +Q  +   ELR+L C+H T N+P+++SLLE SN T  SPI  + 
Sbjct  451   GVYRPSRRLVGYKRRNLQRIRHDSELRMLICVHTTRNVPSVLSLLELSNPTKRSPIFIYA  510

Query  1242  VQLLELVGRAPAMMvvhssgsgrhvggsHEEV---QTSQIISTFDNYELRSHGVTAQVLT  1072
             + L+EL GRA  M+   ++ + +    S        T  I + F+NYE  + G++ Q L 
Sbjct  511   LHLVELTGRASNMLAAAAASASKQNRSSSSSTLPPVTEHIFNAFENYERHTGGISIQTLA  570

Query  1071  ARWSYDTMAEDICKMAKEKRAAFLVLPFHKQQGTDGEMEDTNPAIQTVNEGVLLSAPCSV  892
             A   Y TM +D+  +A++K  + +V+PFHKQQ  DG ME  NP+I+  NE +L ++PCSV
Sbjct  571   AVSPYQTMHDDVSVLAEDKHVSLIVVPFHKQQTVDGAMEPINPSIRGFNESLLSTSPCSV  630

Query  891   GILVERGRPNQYA-----KNIAVLYLGGPDDREALTYARRMSGLPGVHLTVIRFVPAKDV  727
              ILV+RG     A       +A+ + GGPDDREAL YA RM   PGV LTV+RFVP    
Sbjct  631   AILVDRGLSAAAARMAALHRVALFFFGGPDDREALAYAWRMVEHPGVALTVVRFVP----  686

Query  726   SADGAVEDPDLELELTRETSFVTVSIDP-----------ARDKEEDEELLNNFRTETAED  580
                     PD  +     T++ +V+ D              + + DEE L +FRT    +
Sbjct  687   --------PDYRVRSYSNTNYRSVASDADPRSIGIDTEGKTELQMDEEYLGDFRTRNIGN  738

Query  579   DSKTFMELVLDDEEEFTKAVKSLDDRSFDLYVAGRGRG-VSSALTSGLADWCECPELGAV  403
             D+ ++ + V+ + EE   A++++DD   +LY+ GR  G   S +T+ L DW ECPELG +
Sbjct  739   DAISYSDKVVANSEETVSAIRNMDDSLHELYIVGRRPGEAGSPMTASLEDWMECPELGPI  798

Query  402   GDllvtsefessfsvlvVQQYV  337
             GD+LV+S+F  S SVLVVQQYV
Sbjct  799   GDMLVSSDFSMSVSVLVVQQYV  820



>ref|XP_002441279.1| hypothetical protein SORBIDRAFT_09g023730 [Sorghum bicolor]
 gb|EES19709.1| hypothetical protein SORBIDRAFT_09g023730 [Sorghum bicolor]
Length=886

 Score =   522 bits (1345),  Expect = 3e-166, Method: Compositional matrix adjust.
 Identities = 318/805 (40%), Positives = 475/805 (59%), Gaps = 33/805 (4%)
 Frame = -3

Query  2658  VMCFSQTIYRSNGVWEGPDPLAPMIPLFILQIMTAILSSRILNFVLKPFNQPPLVAEILS  2479
             V+C+S  +  + G+W+G +PL   +PLFILQ    + ++R+L  +LKPF QP ++AEIL+
Sbjct  35    VVCYSPMMVTAYGIWQGVNPLEFSLPLFILQTAIIVATTRLLVLLLKPFRQPRVIAEILA  94

Query  2478  GIILGPSMLGNIEEFRKHNFPNHNFETIETMGHFALVLYAFLTGLQMDVKAIVHTGTKSR  2299
             G+ILGPS++G +E +    FP  +  T+ET+ H  L+ + FL GL+MDV  I  +G K+ 
Sbjct  95    GVILGPSVMGQVEVWGNTVFPVRSLLTLETVAHLGLLYFLFLVGLEMDVNVIKRSGKKAL  154

Query  2298  IVAVSGSIFPFLIGAGFYFTLQTDTQSMIG----FIFCGSALTVTGFSTLAKILDSKRLL  2131
             I+AV+G   PF IG    F  +      +      +F G AL+VT F  LA+IL   +LL
Sbjct  155   IIAVAGMALPFCIGTATSFIFRHQVSKNVHQASFLLFLGVALSVTAFPVLARILAEIKLL  214

Query  2130  NTEIGKIAASSALINVALSWVLLTIGLLFT---GSLDNVQWAvlctvgfvvvcvnyVRPL  1960
             N+++G+IA S+A++N   +W+LL + +  +    +  +  W +L  V FV+ C   VRPL
Sbjct  215   NSDLGRIAMSAAIVNDMCAWILLALAIAISEVNSTALSSLWVLLSGVFFVLACFYIVRPL  274

Query  1959  LNWLISKTPEGQGFSEFYICSFIAVICAFGCFTDAMGSHPMIGAFIFGLIMPNNELLRTA  1780
             + W+  + PEG+  S+ ++   +  +   G  TDA+G H + GAF++GL++P+ + L   
Sbjct  275   MWWIARRVPEGEAISDMHVTLVLTGVMIAGVCTDAIGIHSVFGAFVYGLVIPSGQ-LGVV  333

Query  1779  ILDRLEDFVMGILMPVFFLVCGLRTNIFTITDGDTSIFTALALILLACSAKIIAALVASC  1600
             ++++LEDFV G+L+P+FF + GLRTNI  + D  T     L   + + +  +   L+A  
Sbjct  334   LIEKLEDFVTGLLLPLFFAISGLRTNITRVHDPVTVGLLVLVFTMASFAKVMGTILIAVS  393

Query  1599  YTGMSTNEAIGLGVLTNTKSTMVMIILEVGqvqqvlsvqqysmmvVACLIMTIVATPLAA  1420
             YT M+  + + LG L NT+  + MI+L +G+ ++VL  + +++MV+  + MT + TP+  
Sbjct  394   YT-MTFRDGVALGFLMNTRGLVEMIVLNIGRDKEVLDDESFAVMVLVSVAMTALVTPVVT  452

Query  1419  R-YCPKQDLEPYKRRTIQNAKPGEELRILACIHGTNNLPAIISLLETSNSTVTSPITAFG  1243
               Y P + L  YKRR +Q +K   ELR+LAC+H T N+P+IISLLE SN T  SPI  + 
Sbjct  453   TVYRPARRLVGYKRRNLQRSKHDAELRMLACVHTTRNVPSIISLLELSNPTKRSPIFIYA  512

Query  1242  VQLLELVGRAPAMMvvhssgsgrhvggsHEEVQTS-QIISTFDNYELRSHGVTAQVLTAR  1066
             + L+EL GRA  M+  H S +      S     +   I + F++YE    GV+ Q LTA 
Sbjct  513   LHLVELTGRASNMLAAHHSATSNQNRSSSSAPGSGDHIFNAFESYEESVGGVSIQALTAV  572

Query  1065  WSYDTMAEDICKMAKEKRAAFLVLPFHKQQGTDGEMEDTNPAIQTVNEGVLLSAPCSVGI  886
               Y TM ED+  +A++K  + +VLPFHKQQ  DG ME  N +++  NE +L SAPCSV I
Sbjct  573   SPYQTMHEDVSVLAEDKHVSLIVLPFHKQQTVDGGMEPINASLRGFNENILSSAPCSVAI  632

Query  885   LVERGRPNQYAK-----NIAVLYLGGPDDREALTYARRMSGLPGVHLTVIRFVPAKDVSA  721
             LV+RG     A+     ++A+L+ GGPDDRE L YA RM   PGV LTV+RF+P  D  A
Sbjct  633   LVDRGLSAAAARMASVHHVALLFFGGPDDREGLAYAWRMVEHPGVCLTVVRFIP-PDYKA  691

Query  720   DGAVEDPDLELEL--------------TRETSFVTVSIDPARDKEEDEELLNNFRTETAE  583
                   P  +  +               R T+   V      +++ DEE LN FRT    
Sbjct  692   PALTLTPPQQHMMPPAPRVPASSNVVQARATAITIVPDAGKSERQMDEEYLNEFRTRNIG  751

Query  582   DDSKTFMELVLDDEEEFTKAVKSLDDRSFDLYVAGRGRG-VSSALTSGLADWCECPELGA  406
             +D+  +ME V+ + EE   A++ LD  + +LY+ GR  G   S LTS LA+W E PELG 
Sbjct  752   NDAILYMEQVVANSEETLAAIRGLDS-AHELYIVGRHPGEAGSPLTSALAEWMESPELGP  810

Query  405   VGDllvtsefessfsvlvVQQYVRT  331
             +GDLLV+SEF    SVLV+QQYV T
Sbjct  811   IGDLLVSSEFSKMVSVLVMQQYVIT  835



>ref|XP_002456534.1| hypothetical protein SORBIDRAFT_03g038000 [Sorghum bicolor]
 gb|EES01654.1| hypothetical protein SORBIDRAFT_03g038000 [Sorghum bicolor]
Length=869

 Score =   518 bits (1335),  Expect = 4e-165, Method: Compositional matrix adjust.
 Identities = 306/809 (38%), Positives = 481/809 (59%), Gaps = 26/809 (3%)
 Frame = -3

Query  2703  PSTGPEVDLDRLGQVVMCFSQTIYRSNGVWEGPDPLAPMIPLFILQIMTAILSSRILNFV  2524
             P+   E  L +    V+C+S  +  +NG+W+G +PL   +PLFILQ    ++++R+L  V
Sbjct  11    PTNATEQMLPKASSTVVCYSPMMITTNGIWQGFNPLEFSLPLFILQTAIIVVTTRLLVLV  70

Query  2523  LKPFNQPPLVAEILSGIILGPSMLGNIEEFRKHNFPNHNFETIETMGHFALVLYAFLTGL  2344
             L+PF QP ++AEIL+G++LGPS++G IE +    FP  +  T+ET+ H  L+ + FL GL
Sbjct  71    LRPFRQPRVIAEILAGVLLGPSVMGQIETWETMVFPMRSLLTLETVAHLGLLYFLFLVGL  130

Query  2343  QMDVKAIVHTGTKSRIVAVSGSIFPFLIGAGFYFTLQTDTQSMIG----FIFCGSALTVT  2176
             +MD+  I  +G K+  +A++G   PF +G    F  +      +      +F G AL+VT
Sbjct  131   EMDIDVIRRSGKKALFIAIAGMALPFCMGIATSFIFRHQVSRNVHQTSFILFLGVALSVT  190

Query  2175  GFSTLAKILDSKRLLNTEIGKIAASSALINVALSWVLLTIGLLF----TGSLDNVQWAvl  2008
              F  LA+IL   +LL T++G+IA S+A++N   +W+LL I +      + +L ++ W +L
Sbjct  191   AFPVLARILAEIKLLGTDLGRIAMSAAIVNDMCAWILLAIAIAISEADSAALSSL-WVLL  249

Query  2007  ctvgfvvvcvnyVRPLLNWLISKTPEGQGFSEFYICSFIAVICAFGCFTDAMGSHPMIGA  1828
               V FV+ C   VRP + WLI +TPEG+G S+  I   +  +   G  TDA+G H + GA
Sbjct  250   SGVLFVLFCFYVVRPGMWWLIRRTPEGEGVSDMQISLILTGVMLAGVCTDAIGIHSVFGA  309

Query  1827  FIFGLIMPNNELLRTAILDRLEDFVMGILMPVFFLVCGLRTNIFTITDGDTSIFTALALI  1648
             F++GL++P    L   +++++EDFV G+L+P+FF + GLRTN+  I D  T     L  +
Sbjct  310   FVYGLVIPTGP-LGVLLIEKIEDFVTGLLLPLFFAISGLRTNVQKIDDPITVGLLVLVFV  368

Query  1647  LLACSAKIIAALVASCYTGMSTNEAIGLGVLTNTKSTMVMIILEVGqvqqvlsvqqysmm  1468
              +A  AKI+  ++ +    M   E I LG L NT+  + MI+L +G+ ++VL  + +++M
Sbjct  369   -MASFAKIMGTIIIAALYTMPFREGIALGFLMNTRGLVEMIVLNIGRDKEVLDDESFAVM  427

Query  1467  vVACLIMTIVATPLA-ARYCPKQDLEPYKRRTIQNAKPGEELRILACIHGTNNLPAIISL  1291
             V+  + MT + TP+    Y P + L  YKRR +Q  +   ELR+L C+H T N+P+++SL
Sbjct  428   VLVSVAMTTLVTPVVTGVYRPSRRLVGYKRRNLQRIRHDSELRMLTCVHTTRNVPSVLSL  487

Query  1290  LETSNSTVTSPITAFGVQLLELVGRAPAMMvvhssgsgrhvggsHEEVQ----TSQIIST  1123
             LE SN +  SPI  + + L+EL GRA  M+   ++ S      S         T  I + 
Sbjct  488   LELSNPSKRSPIFIYALHLVELTGRASNMLAAAAASSASKQNRSGSGSSLPPVTEHIFNA  547

Query  1122  FDNYELRSHGVTAQVLTARWSYDTMAEDICKMAKEKRAAFLVLPFHKQQGTDGEMEDTNP  943
             F+NYE  + GV+ Q L A   Y +M ED+  +A++K  + +V+PFHKQQ  DG ME  NP
Sbjct  548   FENYERHTGGVSIQTLAAVSPYQSMHEDVSVLAEDKHVSLIVVPFHKQQTVDGGMEPINP  607

Query  942   AIQTVNEGVLLSAPCSVGILVERGRPNQYAK-----NIAVLYLGGPDDREALTYARRMSG  778
              ++  NE +L ++PCSV ILV+RG     A+     ++A+ + GGPDDREAL YA RM  
Sbjct  608   HVRGFNESLLSTSPCSVAILVDRGLSAAAARMATEHHVALFFFGGPDDREALAYAWRMVE  667

Query  777   LPGVHLTVIRFVPA--KDVSADGAVEDPDLELELTRETSFVTVSIDPARDKEEDEELLNN  604
              PGV LT++RF+P   +  +  G+   P   ++   ++  +T+S +   + E+DEE LN 
Sbjct  668   HPGVTLTIVRFLPPDYRSRTVSGSAYRPPSSVD--SDSRAITISTEGKSELEQDEEYLNE  725

Query  603   FRTETAEDDSKTFMELVLDDEEEFTKAVKSLDDRSFDLYVAGRGRG-VSSALTSGLADWC  427
             FR     +D+ ++   ++ + EE   A++ +D+   +LY+ GR  G V S +T+ L +W 
Sbjct  726   FRARNHGNDAISYAMRMVANSEETVAAMRGMDNSLHELYIVGRRPGEVGSPMTAALEEWM  785

Query  426   ECPELGAVGDllvtsefessfsvlvVQQY  340
             E PELG +GD+LV+S+F  S SVLVVQQY
Sbjct  786   ENPELGPIGDMLVSSDFSMSVSVLVVQQY  814



>ref|XP_010273236.1| PREDICTED: cation/H(+) antiporter 15-like [Nelumbo nucifera]
Length=733

 Score =   513 bits (1322),  Expect = 7e-165, Method: Compositional matrix adjust.
 Identities = 297/700 (42%), Positives = 431/700 (62%), Gaps = 22/700 (3%)
 Frame = -3

Query  2388  MGHFALVLYAFLTGLQMDVKAIVHTGTKSRIVAVSGSIFPFLIGAGFY-FTLQTD--TQS  2218
             M +  L+ Y FL G++MD+  I  T  K+  +A++G   PF IG  F  FT Q    + S
Sbjct  1     MANVGLLYYLFLVGVEMDLTMIKRTKKKAFSIAIAGMFLPFAIGIIFMSFTSQNTGVSHS  60

Query  2217  MIGFIFCGSALTVTGFSTLAKILDSKRLLNTEIGKIAASSALINVALSWVLLTIGLLFTG  2038
                  +   AL+VT F  +A+IL   +LLNTE+GKIA S+AL+N   +W+LL + +  +G
Sbjct  61    TSSIFYLAVALSVTAFPVVARILAELKLLNTELGKIAMSAALVNDMCAWILLAVAVALSG  120

Query  2037  SLDNVQWAvlctvgfvvvc---vnyVRPLLNWLISKTPEGQGFSEFYICSFIAVICAFGC  1867
             +  N    +      +      +  VRP + W++ +TPEG+ FS+F+IC  +  +  FG 
Sbjct  121   NDSNNMAPLGMVFTTIGYVGFCIFVVRPAIEWIVERTPEGENFSDFHICLILTGVMVFGF  180

Query  1866  FTDAMGSHPMIGAFIFGLIMPNNELLRTAILDRLEDFVMGILMPVFFLVCGLRTNIFTIT  1687
               DA+G+H + GAF FGL++PN  L    ++++LEDFV G+L+P+FF V GLRT++  I 
Sbjct  181   INDAVGTHSIFGAFFFGLVIPNGHL-GVVLIEKLEDFVSGLLLPLFFAVNGLRTDVGAI-  238

Query  1686  DGDTSIFTALALILLACSAKIIAALVASCYTGMSTNEAIGLGVLTNTKSTMVMIILEVGq  1507
              G  S  T + L +LAC  K+   L  S    M   E + LG+L NTK  + +IIL +G+
Sbjct  239   QGFGSWSTLILLAVLACLGKVFGTLFVSFLYKMPMREGVSLGLLMNTKGLIEIIILNIGR  298

Query  1506  vqqvlsvqqysmmvVACLIMTIVATPLAAR-YCPKQDLEPYKRRTIQNAKPGEELRILAC  1330
                VL  Q +S+MV+A ++MT + TP+    Y P +   PYKRRTIQ +KP  ELRIL+C
Sbjct  299   EHGVLDEQSFSVMVIAAIVMTSLITPIVTTIYKPTRRFLPYKRRTIQMSKPESELRILSC  358

Query  1329  IHGTNNLPAIISLLETSNSTVTSPITAFGVQLLELVGRAPAMMvvhssgsgrhvggsHEE  1150
             IH   N+P IISL++ ++ +  SPI  + + L+EL GRA AM++VH++    H   +  +
Sbjct  359   IHSPRNVPTIISLIDAAHPSKKSPICVYALHLVELTGRASAMLIVHNTRKFGHPALNRTQ  418

Query  1149  VQTSQIISTFDNYELRSHGVTAQVLTARWSYDTMAEDICKMAKEKRAAFLVLPFHKQQGT  970
              Q+  I++ F+NY   + G+  Q LTA   Y TM EDIC +A++KR  F++LPFHKQQ  
Sbjct  419   AQSDHIVNAFENYRQHTSGIAIQPLTAISPYSTMHEDICNLAEDKRVTFIILPFHKQQTV  478

Query  969   DGEMEDTNPAIQTVNEGVLLSAPCSVGILVERG-------RPNQYAKNIAVLYLGGPDDR  811
             DG ME TNPA ++VN+ VL +APCSVGILV+RG         N    ++A+L+ GGPDDR
Sbjct  479   DGGMEATNPAFRSVNQNVLANAPCSVGILVDRGFTRSARVGSNHDTHHVAMLFFGGPDDR  538

Query  810   EALTYARRMSGLPGVHLTVIRFVPAKDVSADGAVEDPDLELELTRETSFVTVSIDPARDK  631
             EAL YA RM+  P V L+++RF+P  D S        +     T ++S +TV  D  ++K
Sbjct  539   EALAYAWRMTTHPNVKLSLLRFLPGNDTSEIIVAAGNE-----TEDSSILTVVTDNDKEK  593

Query  630   EEDEELLNNFRTETAEDDSKTFMELVLDDEEEFTKAVKSLDDRSFDLYVAGRGRGVSSAL  451
             + DEE +N FR  T  ++S T+ E ++ + EE   A++S+D+   DLY+ GR  GV S L
Sbjct  594   QLDEEYINEFRLRTVHNESVTYREKIVKNGEETVAAIRSIDNIH-DLYIVGRSHGVVSPL  652

Query  450   TSGLADWCECPELGAVGDllvtsefessfsvlvVQQYVRT  331
             T+GL DW ECPELGA+GDLL +S+F ++ SVLVVQQY  T
Sbjct  653   TAGLTDWSECPELGAIGDLLASSDFAATVSVLVVQQYAGT  692



>gb|KGN54815.1| hypothetical protein Csa_4G507450 [Cucumis sativus]
Length=876

 Score =   516 bits (1329),  Expect = 5e-164, Method: Compositional matrix adjust.
 Identities = 296/774 (38%), Positives = 455/774 (59%), Gaps = 35/774 (5%)
 Frame = -3

Query  2658  VMCFSQTIYRSNGVWEGPDPLAPMIPLFILQIMTAILSSRILNFVLKPFNQPPLVAEILS  2479
             V+C++  +     +W   +P+A  +P+F LQ+   I  SR+L FV KP  QPP+VAEIL+
Sbjct  20    VVCYNTNVTHEGSLWRAENPVASTLPVFALQLCLIIFFSRVLIFVFKPLRQPPIVAEILA  79

Query  2478  GIILGPSMLGNIEEFRKHNFPNHNFETIETMGHFALVLYAFLTGLQMDVKAIVHTGTKSR  2299
             G+++GPS+LG  + F K+ F   +   +ET+ + +LV Y FL GL++D+  IV  G KS 
Sbjct  80    GVLMGPSLLGLTDTFAKYIFAWKSLLALETVANLSLVYYIFLVGLELDMAPIVRAGGKSI  139

Query  2298  IVAVSGSIFPFLIGAGFYFTLQTDTQ-------SMIGFIFCGSALTVTGFSTLAKILDSK  2140
              +A+ G + P  +G G +  + +          ++ G +F G +L  T F  L++IL   
Sbjct  140   SIALLGILLPIPVGIGLHHLINSGRNKAKMPQATVHGPLFWGISLATTNFPDLSRILSDV  199

Query  2139  RLLNTEIGKIAASSALINVALSWVLLTIGLLFTGSLDNV--QWAvlctvgfvvvcvnyVR  1966
             +LL++EIG+ A S+A+I    SWVLL I    T S+ NV   +AV  T  FV +C+   R
Sbjct  200   KLLHSEIGRTALSAAVITDLCSWVLLVI----TMSISNVGKYYAVTSTFIFVCMCLFLFR  255

Query  1965  PLLNWLISKTPEGQGFSEFYICSFIAVICAFGCFTDAMGSHPMIGAFIFGLIMPNNELLR  1786
             P L WL+  + +   ++EF+IC  +  + A G  TDA G+H ++GAF++G+IMP  E L+
Sbjct  256   PALKWLVRVSSKDGNYNEFHICFVMTGVVACGLITDACGTHSIVGAFMWGVIMPKGE-LK  314

Query  1785  TAILDRLEDFVMGILMPVFFLVCGLRTNIFTITDGDTSIFTALALILLACSAKIIAALVA  1606
               I+ ++ED V  ILMP FF+V GLR N   I   ++     L +I LA SAKI++  + 
Sbjct  315   DMIMGKVEDLVKSILMPTFFVVTGLRVNC-NIISKESDWVLVLLIIFLATSAKIVSTFLV  373

Query  1605  SCYTGMSTNEAIGLGVLTNTKSTMVMIILEVGqvqqvlsvqqysmmvVACLIMTIVATP-  1429
             + +  M   E + LG L NTK  + +II+  G+  Q L +  +++M+++  +MT +  P 
Sbjct  374   AIFCNMPPREGLTLGSLMNTKGLLALIIISAGRDMQALGLLTFTVMIMSFWVMTALIGPT  433

Query  1428  LAARYCPKQDLEPYKRRTIQNAKPGEELRILACIHGTNNLPAIISLLETSNSTVTSPITA  1249
             LA  Y   +     + RTIQ+ KP  E R++AC+H T N+  II LL  SN T  SP+  
Sbjct  434   LAFTYKSIKTSRKTRYRTIQSIKPEAEFRVVACVHSTRNVYGIIHLLGASNPTKQSPLLV  493

Query  1248  FGVQLLELVGRAPAMMvvhssgsgrhvggsHEEVQTSQIISTFDNYELRSHGVTAQVLTA  1069
             F + L+EL GRA AMM+VH             +VQT  II+ FD +E +++ VT   LTA
Sbjct  494   FAIHLVELTGRATAMMIVHGQCKASSAKA---KVQTDHIINAFDKFENQNNSVTVHSLTA  550

Query  1068  RWSYDTMAEDICKMAKEKRAAFLVLPFHKQQGTDGEMEDTNPAIQTVNEGVLLSAPCSVG  889
                Y TM +DIC +A EKR   +++PFHKQ   DG +ED NP++  VN  V+ +APCSV 
Sbjct  551   VSPYATMHDDICGIAAEKRVHLIIVPFHKQPTLDGGLEDGNPSLGLVNNSVMTNAPCSVA  610

Query  888   ILVERG----------RPNQYAKNIAVLYLGGPDDREALTYARRMSGLPGVHLTVIRFVP  739
             +LV+RG          R N+  +  A+ ++GGPDDREAL YA+RMS  PG+ +TV+RF+P
Sbjct  611   VLVDRGLSATNLTDSNRSNRTQQRFALFFIGGPDDREALAYAKRMSEHPGILITVVRFIP  670

Query  738   AKDVSADGAVEDPDLELELTRETSFVTVSIDPARDKEEDEELLNNFRTETAEDDSKTFME  559
              ++V     ++ P  E         +T      ++K  D + +++FR +   + S  + E
Sbjct  671   GEEVKEMSIMDFPGEE-----NVEILTALAREKKEKVIDNDYIDDFRLQILSNQSIGYAE  725

Query  558   LVLDDEEEFTKAVKSLDDRSFDLYVAGRGRGVSSALTSGLADWCECPELGAVGD  397
             +V+++ +E  KA+ +L++  F LY+ GRGRG+ S L SGL++W + PELG +GD
Sbjct  726   VVVNNGDETLKAISTLENE-FSLYIVGRGRGMVSPLVSGLSEWSDSPELGVLGD  778



>gb|EPS59894.1| hypothetical protein M569_14908, partial [Genlisea aurea]
Length=771

 Score =   510 bits (1313),  Expect = 5e-163, Method: Compositional matrix adjust.
 Identities = 323/807 (40%), Positives = 490/807 (61%), Gaps = 70/807 (9%)
 Frame = -3

Query  2658  VMCFSQTIYRSNGVWEGPDPLAPMIPLFILQIMTAILSSRILNFVLKPFNQPPLVAEILS  2479
             V+C++ T+  +NG+W G +PL   +PLFILQ++  +L++R   F+ KP  QP +++EIL 
Sbjct  1     VICYAPTMIATNGIWVGENPLDYSLPLFILQLILVVLTTRFFVFLFKPLKQPRVISEILG  60

Query  2478  GIILGPSMLGNIEEFRKHNFPNHNFETIETMGHFALVLYAFLTGLQMDVKAIVHTGTKSR  2299
             GIILGPS+LG  ++F    FP  +   +ETM +  L+ + FL G++MD+  I  TG ++ 
Sbjct  61    GIILGPSVLGRSKKFADTIFPLRSLMILETMANVGLLYFLFLVGVEMDIGVIRRTGKRAF  120

Query  2298  IVAVSGSIFPFLIGAGFYFTLQTDTQSM-IG--FIFCGSALTVTGFSTLAKILDSKRLLN  2128
              +A+SG I PF+IG+ F F + +D++ + +G   +F G AL+VT F  LA+IL   +LLN
Sbjct  121   TIALSGMILPFVIGSSFAFLIHSDSEIVPLGTFILFLGVALSVTAFPVLARILAELKLLN  180

Query  2127  TEIGKIAASSALINVALSWVLLTIGLLF----TGSLDNVQWAvlctvgfvvvcvnyVRPL  1960
             TEIG+IA SSALIN   +W+LL + +      + SL +V W +L +  FVV+C+  ++PL
Sbjct  181   TEIGRIAMSSALINDMCAWILLAVAIALAENESMSLASV-WVILSSAAFVVLCIYVIKPL  239

Query  1959  LNWLISKTPEGQG-----FSEFYICSFIAVICAFGCFTDAMGSHPMIGAFIFGLIMPNNE  1795
             + W+++ T    G      ++ +IC  +  +   G  TDA+G+H + GAFIFGLI+P+  
Sbjct  240   IAWMVTTTTHDGGESSSSITDLHICIILTGVMISGFITDAIGTHSVFGAFIFGLIIPDGS  299

Query  1794  LLRTAILDRLEDFVMGILMPVFFLVCGLRTNIFTITDGDTSIFTALALIL---LACSAKI  1624
              L  A++++LEDFV GIL+P+FF + GL+T+I  I      ++T LAL+L   L+C+ KI
Sbjct  300   -LGVALIEKLEDFVSGILLPLFFAISGLKTDISAI----GGVWTWLALVLLMILSCAGKI  354

Query  1623  IAALVASCYTGMSTNEAIGLGVLTNTKSTMVMIILEVGqvqqvlsvqqysmmvVACLIMT  1444
             +  L+ S Y  M   E + LG+L NTK  + MI+L VG+ Q+VL  + +++MVV  ++MT
Sbjct  355   VGTLLISTYYKMLLPEGLALGLLMNTKGLVEMIVLNVGRDQRVLDDKAFAIMVVVAVVMT  414

Query  1443  IVATPLAAR-YCP--KQDLEPYKRRTIQNAK-PGEELRILACIHGTNNLPAIISLLETSN  1276
              V +P+    Y P  K+ L  YKRRTI  A+   EELR+L CIH   N+P IISLLE SN
Sbjct  415   SVISPVVMTIYNPAKKKSLSTYKRRTILQAETEEEELRVLVCIHHPRNVPTIISLLEASN  474

Query  1275  STVTSPITAFGVQLLELVGRAPAMMvvhssgsgrhvggsHE---EVQTSQIISTFDNYEL  1105
              T  SPI+ + + ++EL GR  A+++VHS          +    + Q+  IIS F+++  
Sbjct  475   PTNRSPISVYALHMVELTGRDSAVIIVHSRHHNAAFNNRNRMQVQAQSDTIISAFESFAN  534

Query  1104  RSHGVTAQVLTARWSYDTMAEDICKMAKEKRAAFLVLPFHKQQGTDGEMEDTNPAIQTVN  925
             R   V+ Q LTA   Y T+ ED+  +A+E+RAAF+++PFHKQQ  DG ME+ NPA + +N
Sbjct  535   RVPFVSVQPLTAVSPYSTVHEDVSNVAEEQRAAFVIIPFHKQQTVDGGMEELNPAYRLIN  594

Query  924   EGVLLSAPCSVGILVERGR------------PNQYAKNIAVLYLGGPDDREALTYARRMS  781
               VL +APCSVGILV+RG             P + +  + VL+ GG DDREAL+YA RMS
Sbjct  595   RNVLDTAPCSVGILVDRGLNLNLSLSRSGGIPARNSYRVMVLFFGGADDREALSYAWRMS  654

Query  780   GLPGVHLTVIRFVPAKDVSADGAVEDPDLELELTRETSFVTVSIDPARDKEEDEELLNNF  601
                   +TV RF+  +     G +                          + D+E + +F
Sbjct  655   ESENTRVTVARFLAGQ----GGQI------------------------SSQADDEYI-DF  685

Query  600   RTETAEDDSKTFMELVLDDEEEFTKAVKSLDDRSFDLYVAGRGRGVSSALTSGLADWCEC  421
                 + +++ ++ E  L+  EE   A++ +   + DL++ GRG G+ S L +G+ DW EC
Sbjct  686   YMSKSHNNNTSYCEKFLNHGEETVAAIREMVALT-DLFIVGRGYGMESPLLAGITDWSEC  744

Query  420   PELGAVGDllvtsefessfsvlvVQQY  340
             PELG +GDLL +S+F ++ SVLVVQQY
Sbjct  745   PELGPIGDLLASSDFAATSSVLVVQQY  771



>ref|XP_004146404.1| PREDICTED: cation/H(+) antiporter 15-like [Cucumis sativus]
Length=889

 Score =   513 bits (1321),  Expect = 9e-163, Method: Compositional matrix adjust.
 Identities = 295/778 (38%), Positives = 456/778 (59%), Gaps = 35/778 (4%)
 Frame = -3

Query  2670  LGQVVMCFSQTIYRSNGVWEGPDPLAPMIPLFILQIMTAILSSRILNFVLKPFNQPPLVA  2491
             +G++ +    +    + +W   +P+A  +P+F LQ+   I  SR+L FV KP  QPP+VA
Sbjct  29    VGKIFLVVDMSYVEESSLWRAENPVASTLPVFALQLCLIIFFSRVLIFVFKPLRQPPIVA  88

Query  2490  EILSGIILGPSMLGNIEEFRKHNFPNHNFETIETMGHFALVLYAFLTGLQMDVKAIVHTG  2311
             EIL+G+++GPS+LG  + F K+ F   +   +ET+ + +LV Y FL GL++D+  IV  G
Sbjct  89    EILAGVLMGPSLLGLTDTFAKYIFAWKSLLALETVANLSLVYYIFLVGLELDMAPIVRAG  148

Query  2310  TKSRIVAVSGSIFPFLIGAGFYFTLQTDTQ-------SMIGFIFCGSALTVTGFSTLAKI  2152
              KS  +A+ G + P  +G G +  + +          ++ G +F G +L  T F  L++I
Sbjct  149   GKSISIALLGILLPIPVGIGLHHLINSGRNKAKMPQATVHGPLFWGISLATTNFPDLSRI  208

Query  2151  LDSKRLLNTEIGKIAASSALINVALSWVLLTIGLLFTGSLDNV--QWAvlctvgfvvvcv  1978
             L   +LL++EIG+ A S+A+I    SWVLL I    T S+ NV   +AV  T  FV +C+
Sbjct  209   LSDVKLLHSEIGRTALSAAVITDLCSWVLLVI----TMSISNVGKYYAVTSTFIFVCMCL  264

Query  1977  nyVRPLLNWLISKTPEGQGFSEFYICSFIAVICAFGCFTDAMGSHPMIGAFIFGLIMPNN  1798
                RP L WL+  + +   ++EF+IC  +  + A G  TDA G+H ++GAF++G+IMP  
Sbjct  265   FLFRPALKWLVRVSSKDGNYNEFHICFVMTGVVACGLITDACGTHSIVGAFMWGVIMPKG  324

Query  1797  ELLRTAILDRLEDFVMGILMPVFFLVCGLRTNIFTITDGDTSIFTALALILLACSAKIIA  1618
             E L+  I+ ++ED V  ILMP FF+V GLR N   I   ++     L +I LA SAKI++
Sbjct  325   E-LKDMIMGKVEDLVKSILMPTFFVVTGLRVNC-NIISKESDWVLVLLIIFLATSAKIVS  382

Query  1617  ALVASCYTGMSTNEAIGLGVLTNTKSTMVMIILEVGqvqqvlsvqqysmmvVACLIMTIV  1438
               + + +  M   E + LG L NTK  + +II+  G+  Q L +  +++M+++  +MT +
Sbjct  383   TFLVAIFCNMPPREGLTLGSLMNTKGLLALIIISAGRDMQALGLLTFTVMIMSFWVMTAL  442

Query  1437  ATP-LAARYCPKQDLEPYKRRTIQNAKPGEELRILACIHGTNNLPAIISLLETSNSTVTS  1261
               P LA  Y   +     + RTIQ+ KP  E R++AC+H T N+  II LL  SN T  S
Sbjct  443   IGPTLAFTYKSIKTSRKTRYRTIQSIKPEAEFRVVACVHSTRNVYGIIHLLGASNPTKQS  502

Query  1260  PITAFGVQLLELVGRAPAMMvvhssgsgrhvggsHEEVQTSQIISTFDNYELRSHGVTAQ  1081
             P+  F + L+EL GRA AMM+VH             +VQT  II+ FD +E +++ VT  
Sbjct  503   PLLVFAIHLVELTGRATAMMIVHGQCKASSAKA---KVQTDHIINAFDKFENQNNSVTVH  559

Query  1080  VLTARWSYDTMAEDICKMAKEKRAAFLVLPFHKQQGTDGEMEDTNPAIQTVNEGVLLSAP  901
              LTA   Y TM +DIC +A EKR   +++PFHKQ   DG +ED NP++  VN  V+ +AP
Sbjct  560   SLTAVSPYATMHDDICGIAAEKRVHLIIVPFHKQPTLDGGLEDGNPSLGLVNNSVMTNAP  619

Query  900   CSVGILVERG----------RPNQYAKNIAVLYLGGPDDREALTYARRMSGLPGVHLTVI  751
             CSV +LV+RG          R N+  +  A+ ++GGPDDREAL YA+RMS  PG+ +TV+
Sbjct  620   CSVAVLVDRGLSATNLTDSNRSNRTQQRFALFFIGGPDDREALAYAKRMSEHPGILITVV  679

Query  750   RFVPAKDVSADGAVEDPDLELELTRETSFVTVSIDPARDKEEDEELLNNFRTETAEDDSK  571
             RF+P ++V     ++ P  E         +T      ++K  D + +++FR +   + S 
Sbjct  680   RFIPGEEVKEMSIMDFPGEE-----NVEILTALAREKKEKVIDNDYIDDFRLQILSNQSI  734

Query  570   TFMELVLDDEEEFTKAVKSLDDRSFDLYVAGRGRGVSSALTSGLADWCECPELGAVGD  397
              + E+V+++ +E  KA+ +L++  F LY+ GRGRG+ S L SGL++W + PELG +GD
Sbjct  735   GYAEVVVNNGDETLKAISTLENE-FSLYIVGRGRGMVSPLVSGLSEWSDSPELGVLGD  791



>emb|CDM84725.1| unnamed protein product [Triticum aestivum]
Length=874

 Score =   512 bits (1319),  Expect = 1e-162, Method: Compositional matrix adjust.
 Identities = 301/797 (38%), Positives = 475/797 (60%), Gaps = 22/797 (3%)
 Frame = -3

Query  2676  DRLGQVVMCFSQTIYRSNGVWEGPDPLAPMIPLFILQIMTAILSSRILNFVLKPFNQPPL  2497
              ++  +V+C+S  +  +NG+W+G +PL   +PLFILQ+   ++++R+L  +LKPF QP +
Sbjct  28    SKITNMVVCYSPMMITTNGIWQGVNPLEFSLPLFILQVAVIVITTRVLVLLLKPFRQPRV  87

Query  2496  VAEILSGIILGPSMLGNIEEFRKHNFPNHNFETIETMGHFALVLYAFLTGLQMDVKAIVH  2317
             +AEIL+G++LGPS++G ++ +    FP  +  T+ET+ H  L+ + FL GL+MD+  I  
Sbjct  88    IAEILAGVVLGPSLMGQMDGWGNLVFPQRSLLTLETVAHLGLLYFLFLVGLEMDIDVIKR  147

Query  2316  TGTKSRIVAVSGSIFPFLIGAGFYFTLQTDTQSMIG----FIFCGSALTVTGFSTLAKIL  2149
             +G K+  VA++G   PF IG    F L+      +      +F G AL+VT F  LA+IL
Sbjct  148   SGKKALFVALAGMALPFCIGTATSFILRHQVSRNVHQTSFLLFLGVALSVTAFPVLARIL  207

Query  2148  DSKRLLNTEIGKIAASSALINVALSWVLLTIGLLFTGSLDNVQ----WAvlctvgfvvvc  1981
                +LLNTE+G+IA S+A++N   +W+LL + +  T  +D+      W +L  V FV++C
Sbjct  208   AEIKLLNTELGRIAMSAAIVNDMCAWILLALAIAIT-EVDSTALSSLWVLLSGVAFVLIC  266

Query  1980  vnyVRPLLNWLISKTPEGQGFSEFYICSFIAVICAFGCFTDAMGSHPMIGAFIFGLIMPN  1801
                VRP + WLI + PEG+  S+  +   +A +   G  T+A+G H + GAFI+GL++P+
Sbjct  267   FYVVRPAMWWLIHRIPEGESISDMDVSLILAGVLLAGVCTEAIGIHSVFGAFIYGLVIPS  326

Query  1800  NELLRTAILDRLEDFVMGILMPVFFLVCGLRTNIFTITDGDTSIFTALALILLACSAKII  1621
               L  T ++++LEDFV G+L+P+FF + GLRTNI    D  T     L  + +A  AKI+
Sbjct  327   GPLGVT-LIEKLEDFVTGLLLPLFFAISGLRTNITKARDPVTVGLLVLVFV-MASFAKIM  384

Query  1620  AALVASCYTGMSTNEAIGLGVLTNTKSTMVMIILEVGqvqqvlsvqqysmmvVACLIMTI  1441
               ++ +    M   E I LG L NT+  + MI+L +G+ +QVL  + +++MV+  + MT 
Sbjct  385   GTIIIAALYTMPFREGIALGFLMNTRGLVEMIVLNIGRDRQVLDDESFAVMVMVSVGMTA  444

Query  1440  VATPLA-ARYCPKQDLEPYKRRTIQNAKPGEELRILACIHGTNNLPAIISLLETSNSTVT  1264
             + TP+  + + P + L  YKRR +Q  +   ELR+LAC+H T N+P+++SLL+ SN +  
Sbjct  445   LVTPIVTSLHKPARRLVGYKRRNLQRIRHDSELRMLACVHTTRNVPSVLSLLDLSNPSKR  504

Query  1263  SPITAFGVQLLELVGRAPAMMvvhssgsgrhvggsHEEV--QTSQIISTFDNYELRSHGV  1090
             SPI  + + L+EL GRA  M+   ++ +  +       +   T  I + F+NYE+ + GV
Sbjct  505   SPIFIYALHLVELTGRASNMLAAAAASASTNSQSGSSALPATTEHIFNAFENYEMHTGGV  564

Query  1089  TAQVLTARWSYDTMAEDICKMAKEKRAAFLVLPFHKQQGTDGEMEDTNPAIQTVNEGVLL  910
             + Q L A   Y TM ED+  +A++K  + +V+PFHKQQ  DG ME  NP+I+  NE +L 
Sbjct  565   SIQTLAAVSPYQTMHEDVSVLAEDKHVSLIVVPFHKQQTVDGGMEPINPSIRGFNESLLS  624

Query  909   SAPCSVGILVERGRPNQYAK-----NIAVLYLGGPDDREALTYARRMSGLPGVHLTVIRF  745
             ++PCSV ILV+RG     A+      + + + GGPDDREAL YA RM   P V L ++RF
Sbjct  625   TSPCSVAILVDRGLSAAAARMADEHRLVLFFFGGPDDREALAYAWRMVENPAVSLAIVRF  684

Query  744   VPAKDVSADGAVEDPDLELELTRETSFVTVSIDPARDKEEDEELLNNFRTETAEDDSKTF  565
             +P      + +   P      T ++  + +  +   + E DEE L  FR     + + T+
Sbjct  685   LPPD--YRERSFSSPTYRSAATADSRAINIGAEGKTELEMDEEYLGEFRARNHGNGAITY  742

Query  564   MELVLDDEEEFTKAVKSLDDRSFDLYVAGRGRG-VSSALTSGLADWCECPELGAVGDllv  388
              +  + + EE   A++S+D  + ++Y+ GR  G   S +TS L DW E PELG +GD+LV
Sbjct  743   ADKTVTNSEETVAAIRSMDSSTHEMYIVGRRPGEAGSPMTSALEDWMESPELGPIGDMLV  802

Query  387   tsefessfsvlvVQQYV  337
             +S+F    SVLVVQQYV
Sbjct  803   SSDFSMGVSVLVVQQYV  819



>gb|EMS62572.1| Cation/H(+) antiporter 15 [Triticum urartu]
Length=876

 Score =   510 bits (1314),  Expect = 8e-162, Method: Compositional matrix adjust.
 Identities = 298/798 (37%), Positives = 469/798 (59%), Gaps = 24/798 (3%)
 Frame = -3

Query  2676  DRLGQVVMCFSQTIYRSNGVWEGPDPLAPMIPLFILQIMTAILSSRILNFVLKPFNQPPL  2497
              ++  +V+C+S  +  +NG+W+G +PL   +PLFILQ+   ++++R+L  +LKPF QP +
Sbjct  28    SKITNMVVCYSPMMITTNGIWQGVNPLEFSLPLFILQVAVIVITTRVLVLLLKPFRQPRV  87

Query  2496  VAEILSGIILGPSMLGNIEEFRKHNFPNHNFETIETMGHFALVLYAFLTGLQMDVKAIVH  2317
             +AEIL+G++LGPS++G ++ +    FP  +  T+ET+ H  L+ + FL GL+MD+  I  
Sbjct  88    IAEILAGVVLGPSLMGQMDGWGNMVFPQRSLLTLETVAHLGLLYFLFLVGLEMDLDVIKR  147

Query  2316  TGTKSRIVAVSGSIFPFLIGAGFYFTLQTDTQSMIG----FIFCGSALTVTGFSTLAKIL  2149
             +G K+  VA++G   PF IG    F  +      +      +F G AL+VT F  LA+IL
Sbjct  148   SGKKALFVALAGMALPFCIGTATSFIFRHQVSRNVHQTSFLLFLGVALSVTAFPVLARIL  207

Query  2148  DSKRLLNTEIGKIAASSALINVALSWVLLTIGLLFTGSLDNVQ----WAvlctvgfvvvc  1981
                +LLNTE+G+IA S+A++N   +W+LL + +  T  +D+      W +L  V FV++C
Sbjct  208   GETKLLNTELGRIAMSAAIVNDMCAWILLALAIAIT-EVDSTALSSLWVLLSGVVFVLIC  266

Query  1980  vnyVRPLLNWLISKTPEGQGFSEFYICSFIAVICAFGCFTDAMGSHPMIGAFIFGLIMPN  1801
                VRP + WLI + PEG+  S+  +   +A +   G  T+A+G H + GAFI+GL++P+
Sbjct  267   FYVVRPAMWWLIHRIPEGESISDMDVSLILAGVLLAGVCTEAIGIHSVFGAFIYGLVIPS  326

Query  1800  NELLRTAILDRLEDFVMGILMPVFFLVCGLRTNIFTITDGDTSIFTALALILLACSAKII  1621
               L  T ++++LEDFV G+L+P+FF + GLRTNI    D  T     L  + +A  AKI+
Sbjct  327   GPLGVT-LIEKLEDFVTGLLLPLFFAISGLRTNITKARDPVTVGLLVLVFV-MASFAKIM  384

Query  1620  AALVASCYTGMSTNEAIGLGVLTNTKSTMVMIILEVGqvqqvlsvqqysmmvVACLIMTI  1441
               ++ +    M   E I LG L NT+  + MI+L +G+ +QVL  + +++MV+  + MT 
Sbjct  385   GTIIIAALYTMPFREGIALGFLMNTRGLVEMIVLNIGRDKQVLDDESFAVMVMVSVGMTA  444

Query  1440  VATPLAAR-YCPKQDLEPYKRRTIQNAKPGEELRILACIHGTNNLPAIISLLETSNSTVT  1264
             + TP+    + P + L  YKRR +Q  +   ELR+LAC+H T N+P+++SLLE SN +  
Sbjct  445   LVTPIVTSLHKPPRRLVGYKRRNLQRIRHDSELRMLACVHTTRNVPSVLSLLELSNPSKR  504

Query  1263  SPITAFGVQLLELVGRAPAMMvvhssgsgrhvggsHEE----VQTSQIISTFDNYELRSH  1096
             SPI  + + L+EL GRA  M+   ++ +                T  I + F+NYE+ + 
Sbjct  505   SPIFIYALHLVELTGRASNMLAAAAASASASTNSRSGSSALPATTEHIFNAFENYEMHTG  564

Query  1095  GVTAQVLTARWSYDTMAEDICKMAKEKRAAFLVLPFHKQQGTDGEMEDTNPAIQTVNEGV  916
             GV+ Q L A   Y TM +D+  +A++K  + +V+PFHKQQ  DG ME  N +I+  NE +
Sbjct  565   GVSIQTLAAVSPYQTMHDDVSVLAEDKHVSLIVVPFHKQQTVDGGMEPINTSIRGFNESL  624

Query  915   LLSAPCSVGILVERGRPNQYAK-----NIAVLYLGGPDDREALTYARRMSGLPGVHLTVI  751
             L ++PCSV ILV+RG     A+      + + + GGPDDREAL YA RM   P V L ++
Sbjct  625   LSASPCSVAILVDRGLSAAAARMADEHRLVLFFFGGPDDREALAYAWRMVENPSVSLAIV  684

Query  750   RFVPAKDVSADGAVEDPDLELELTRETSFVTVSIDPARDKEEDEELLNNFRTETAEDDSK  571
             RF+P      + +   P      T ++  + +  +   + E DEE L  FR     + + 
Sbjct  685   RFLPPD--YRERSFSSPTYRSAATADSRAINIGTEGKSELEMDEEYLGEFRDRNHGNGAI  742

Query  570   TFMELVLDDEEEFTKAVKSLDDRSFDLYVAGRGRG-VSSALTSGLADWCECPELGAVGDl  394
             T+ +  + + EE   A++S+D  + ++Y+ GR  G   S +TS L DW E PELG +GD+
Sbjct  743   TYADKTVANSEETVAAIRSMDSSTHEMYIVGRRPGEAGSPMTSALEDWMESPELGPIGDM  802

Query  393   lvtsefessfsvlvVQQY  340
             LV+S+F    SVLVVQQY
Sbjct  803   LVSSDFSMGVSVLVVQQY  820



>ref|XP_003564480.1| PREDICTED: cation/H(+) antiporter 15-like [Brachypodium distachyon]
Length=893

 Score =   511 bits (1315),  Expect = 9e-162, Method: Compositional matrix adjust.
 Identities = 294/784 (38%), Positives = 456/784 (58%), Gaps = 31/784 (4%)
 Frame = -3

Query  2661  VVMCFSQTIYRSNGVWEGPDPLAPMIPLFILQIMTAILSSRILNFVLKPFNQPPLVAEIL  2482
             +V+C+S  +  +NG+W+G +PL   +PLFILQ+   ++++R L  +LKPF QP ++AEIL
Sbjct  33    LVVCYSPMMITTNGIWQGVNPLEFSLPLFILQVAVIVVTTRFLVLLLKPFRQPRVIAEIL  92

Query  2481  SGIILGPSMLGNIEEFRKHNFPNHNFETIETMGHFALVLYAFLTGLQMDVKAIVHTGTKS  2302
             +G++LGPS++G +E +    FP  +  T+ET+ H  L+ + FL GL+MD+  I  +G K+
Sbjct  93    AGVLLGPSVMGQMEVWANMVFPQRSLLTLETVAHLGLLYFLFLVGLEMDLDVIRRSGKKA  152

Query  2301  RIVAVSGSIFPFLIGAGFYFTLQTDTQSMIG----FIFCGSALTVTGFSTLAKILDSKRL  2134
               VA++G   PF IG    F  +      +      +F G AL+VT F  LA+IL   +L
Sbjct  153   LFVALAGMALPFCIGIATSFIFRHQVSRNVHQSSFLLFLGVALSVTAFPVLARILAEIKL  212

Query  2133  LNTEIGKIAASSALINVALSWVLLTIGLLFT---GSLDNVQWAvlctvgfvvvcvnyVRP  1963
             LNTE+G+IA S+A++N   +W+LL + +  +    +  +  W +L  V FV+ C   VRP
Sbjct  213   LNTELGRIAMSAAIVNDMCAWILLALAIAISEVNSTALSSLWVLLAGVSFVLFCFYAVRP  272

Query  1962  LLNWLISKTPEGQGFSEFYICSFIAVICAFGCFTDAMGSHPMIGAFIFGLIMPNNELLRT  1783
              + WLI + PEG+  SE  +   +  +   G  TDA+G H + GAF++GL++P+   L  
Sbjct  273   GMWWLIRRIPEGEAVSEMQVSLILTGVMLAGVCTDAIGIHSVFGAFVYGLVIPSGT-LGV  331

Query  1782  AILDRLEDFVMGILMPVFFLVCGLRTNIFTITDGDTSIFTALALILLACSAKIIAALVAS  1603
             A++++LEDFV G+L+P+FF + GLRTNI  + D  T     L  + +A  AKI+  ++ +
Sbjct  332   ALIEKLEDFVTGLLLPLFFAISGLRTNIANVRDPITVGLLVLVFV-MASFAKIMGTIIIA  390

Query  1602  CYTGMSTNEAIGLGVLTNTKSTMVMIILEVGqvqqvlsvqqysmmvVACLIMTIVATPLA  1423
                 M   E I LG L NT+  + MI+L +G+ ++VL  + +++MV+  + MT + TP+ 
Sbjct  391   ALYTMPFREGIALGFLMNTRGLVEMIVLNIGRDKEVLDDESFAVMVLVSVAMTALVTPVV  450

Query  1422  -ARYCPKQDLEPYKRRTIQNAKPGEELRILACIHGTNNLPAIISLLETSNSTVTSPITAF  1246
                Y P + L  YKRR +Q  +   ELR+LAC+H T N+P+++SLLE SN +  SPI  +
Sbjct  451   LGVYRPSRRLVGYKRRNLQRIRHDSELRMLACVHTTRNVPSVLSLLELSNPSKRSPIFIY  510

Query  1245  GVQLLELVGRAPAMMvvhssgsgrhvggsHEE---VQTSQIISTFDNYELRSHGVTAQVL  1075
              + L+EL GRA  M+   ++ + +             T  I + F+NYE  + GV+ Q L
Sbjct  511   ALHLVELTGRASNMLAAAAASASKQNRSGSSSALPAATEHIFNAFENYERLTGGVSIQTL  570

Query  1074  TARWSYDTMAEDICKMAKEKRAAFLVLPFHKQQGTDGEMEDTNPAIQTVNEGVLLSAPCS  895
              A   Y TM +D+  +A++K  + +V+PFHKQQ  DG ME  NP+I+  NE +L ++PCS
Sbjct  571   AAVSPYQTMHDDVSVLAEDKHVSLIVIPFHKQQTVDGGMEPINPSIRGFNESLLSTSPCS  630

Query  894   VGILVERGRPNQYAK-----NIAVLYLGGPDDREALTYARRMSGLPGVHLTVIRFVP---  739
             V ILV+RG     A+      + + + GGPDDREAL YA RM   PGV LT++RF+P   
Sbjct  631   VAILVDRGLSAAAARMATEHRVVLFFFGGPDDREALAYAWRMVENPGVWLTILRFLPPDY  690

Query  738   -AKDVSADGAVEDPDLELELTRETSFVTV-----SIDPARDKEE---DEELLNNFRTETA  586
              A+  S +                S+  V     +I+    K E   DEE L  FR    
Sbjct  691   RARSFSTNSNSSSGSGSGSYRSAASYENVDSRAIAINADGSKTELQMDEEYLGEFRARNH  750

Query  585   EDDSKTFMELVLDDEEEFTKAVKSLDDRSFDLYVAGRGRG-VSSALTSGLADWCECPELG  409
              +D+ T+++ ++ + EE    ++S+D+   +LY+ GR  G   S +TS L DW ECPELG
Sbjct  751   GNDAITYVDKMVANSEETVATIRSMDNSMHELYIVGRRPGEAGSPMTSALDDWMECPELG  810

Query  408   AVGD  397
              +GD
Sbjct  811   PIGD  814



>ref|XP_008657132.1| PREDICTED: cation/H(+) antiporter 15-like [Zea mays]
 gb|AFW84768.1| hypothetical protein ZEAMMB73_931231 [Zea mays]
Length=875

 Score =   509 bits (1310),  Expect = 3e-161, Method: Compositional matrix adjust.
 Identities = 303/801 (38%), Positives = 472/801 (59%), Gaps = 29/801 (4%)
 Frame = -3

Query  2679  LDRLGQVVMCFSQTIYRSNGVWEGPDPLAPMIPLFILQIMTAILSSRILNFVLKPFNQPP  2500
             L +    V+C+S  +  +NG+W+G +PL   +PLFILQ    ++++R+L  VL+PF QP 
Sbjct  24    LPKASSTVVCYSPMMITTNGIWQGFNPLEFSLPLFILQTAVIVVTTRLLVLVLRPFRQPR  83

Query  2499  LVAEILSGIILGPSMLGNIEEFRKHNFPNHNFETIETMGHFALVLYAFLTGLQMDVKAIV  2320
             ++AEILSG++LGPS+LG IE +    FP  +  T+ET+ H  L+ + FL GL+MD+  I 
Sbjct  84    VIAEILSGVLLGPSVLGQIETWATMVFPMRSLLTLETVAHLGLLYFLFLVGLEMDIDVIR  143

Query  2319  HTGTKSRIVAVSGSIFPFLIGAGFYFTLQTDTQSMIG----FIFCGSALTVTGFSTLAKI  2152
              +G K+  VA++G   PF +G    F  +      +      +F G AL+VT F  LA+I
Sbjct  144   RSGKKALFVALAGMALPFCMGIATSFIFRHQVSRNVHQASFLLFLGVALSVTAFPVLARI  203

Query  2151  LDSKRLLNTEIGKIAASSALINVALSWVLLTIGLLF---TGSLDNVQWAvlctvgfvvvc  1981
             L   +LL T++G+IA S+A++N   +W+LL I +     + +  +  W +L    FV+ C
Sbjct  204   LAEIKLLGTDLGQIAMSAAIVNDMCAWILLAIAIAISEVSSAALSSTWVLLSGALFVLFC  263

Query  1980  vnyVRPLLNWLISKTPEGQGFSEFYICSFIAVICAFGCFTDAMGSHPMIGAFIFGLIMPN  1801
                VRP + WLI +TPEG+G S+  +   +  +   G  TDA+G H + GAF++GL++P 
Sbjct  264   FYVVRPGMWWLIRRTPEGEGISDMQVSLILTGVMLAGVCTDAIGIHSVFGAFVYGLVIPT  323

Query  1800  NELLRTAILDRLEDFVMGILMPVFFLVCGLRTNIFTITDGDTSIFTALALILLACSAKII  1621
                L   +++++EDFV G+L+P+FF + GLRTN+  I D  T     L  + +A  AKI+
Sbjct  324   GP-LGVVLIEKIEDFVTGLLLPLFFAISGLRTNVRKIRDPVTVGLLVLVFV-MASFAKIM  381

Query  1620  AALVASCYTGMSTNEAIGLGVLTNTKSTMVMIILEVGqvqqvlsvqqysmmvVACLIMTI  1441
               ++ +    M   E I LG L NT+  + MI+L +G+ ++VL  + +++MV+  + MT 
Sbjct  382   GTIIIAALYTMPFREGIALGFLMNTRGLVEMIVLNIGRDKEVLDDESFAVMVLVSVAMTT  441

Query  1440  VATPLAAR-YCPKQDLEPYKRRTIQNAKPGEELRILACIHGTNNLPAIISLLETSNSTVT  1264
             + TP+    Y P + L  YKRR +Q  +   ELR+LAC+H T N+P+++SLLE SN    
Sbjct  442   LVTPVVTSVYRPSRRLVGYKRRNLQRIRHDSELRMLACVHTTRNVPSVLSLLELSNPNKR  501

Query  1263  SPITAFGVQLLELVGRAPAMMvvhssgsgrhvggsHEEV---QTSQIISTFDNYELRSHG  1093
             SPI  + + L+EL GRA  M+   ++ + +   G         T  I + F+NYE  + G
Sbjct  502   SPIFIYALHLVELTGRASNMLAAAAASASKQSRGGSGSSLPPVTEHIFNAFENYERLTGG  561

Query  1092  VTAQVLTARWSYDTMAEDICKMAKEKRAAFLVLPFHKQQGTDGEMEDTNPAIQTVNEGVL  913
             V+ Q L A   Y +M ED+  +A++K  + +V+PFHKQQ  DG ME  NP ++  NE +L
Sbjct  562   VSIQTLAAVSPYQSMHEDVSVLAEDKHVSLIVVPFHKQQTVDGGMEPINPHVRGFNESLL  621

Query  912   LSAPCSVGILVERGRPNQYAK-----NIAVLYLGGPDDREALTYARRMSGLPGVHLTVIR  748
              ++PCSV ILV+RG     A+     ++A+ + GGPDDREAL YA RM   PGV L+++R
Sbjct  622   STSPCSVAILVDRGLSAAAARMATEHHVALFFFGGPDDREALAYAWRMVEHPGVTLSIVR  681

Query  747   FVP----AKDVSADGAVEDPDLELELTRETSFVTVSIDPARDKEEDEELLNNFRTETAED  580
             FVP    A+ VS        D       ++  +T++ +   + E DE+ L+ FR     +
Sbjct  682   FVPPDYRARTVSCSAYRPPAD------SDSRAITINTEGKSELEMDEDYLSEFRARNHGN  735

Query  579   DSKTFMELVLDDEEEFTKAVKSLDDRSFDLYVAGRGRG-VSSALTSGLADWCECPELGAV  403
              + T+    + + EE   A++++D+   +LY+ GR  G V S +T+ L +W E PELG +
Sbjct  736   IAITYATRTVANSEETVAAIRAMDNNLQELYIVGRRPGEVRSPMTAALEEWMENPELGPI  795

Query  402   GDllvtsefessfsvlvVQQY  340
             GD+LV+S+F  S SVLVVQQY
Sbjct  796   GDMLVSSDFSMSVSVLVVQQY  816



>ref|XP_002519710.1| Na(+)/H(+) antiporter, putative [Ricinus communis]
 gb|EEF42683.1| Na(+)/H(+) antiporter, putative [Ricinus communis]
Length=862

 Score =   507 bits (1305),  Expect = 9e-161, Method: Compositional matrix adjust.
 Identities = 294/764 (38%), Positives = 457/764 (60%), Gaps = 31/764 (4%)
 Frame = -3

Query  2652  CFSQTIYRSNGVWEGPDPLAPMIPLFILQIMTAILSSRILNFVLKPFNQPPLVAEILSGI  2473
             C+   I   +G W+  +PL   +PL   Q+   I+ +RIL ++LKP   P +V +IL+GI
Sbjct  20    CYIVNITAEHGFWQSENPLTQALPLLAWQLAVVIMMNRILFYLLKPLAVPRIVTDILAGI  79

Query  2472  ILGPSMLGNIEEFRKHNFPNHNFETIETMGHFALVLYAFLTGLQMDVKAIVHTGTKSRIV  2293
             +LGPS L     F    FP  +  T+ET+ ++AL L+ F+ GL+MD+ +    G KS   
Sbjct  80    LLGPSALSKTHFFSVM-FPLRSIYTVETVAYWALTLHLFMAGLEMDLYSFFRIGKKSIRF  138

Query  2292  AVSGSIFPFLIGAGFYFTLQTD----TQSMIGFIFCGSALTVTGFSTLAKILDSKRLLNT  2125
             A++  + PF++G   YF + +     +    G IF G+ALTVT +  +A+IL  ++LL++
Sbjct  139   AIATILLPFILGICLYFIVTSSRAPSSFRKSGCIFWGAALTVTSYPVVARILADEKLLHS  198

Query  2124  EIGKIAASSALINVALSWVLLTIGLLFTGSLDNVQWAvlctvgfvvvcvnyVRPLLNWLI  1945
             +IG++A S + IN   +WVLL++ +       N   +++ T  F   C   VRP L  LI
Sbjct  199   DIGRLATSISFINELFTWVLLSVLIPSRIGGLNALLSLVATAAFTAFCFIVVRPALTVLI  258

Query  1944  SKTPEGQGFSEFYICSFIAVICAFGCFTDAMGSHPMIGAFIFGLIMPNNELLRTAILDRL  1765
              KT     +SE+Y+C  +  +  F   +D +G+  +IGAF+FGLIMPN  +L + +L++ 
Sbjct  259   RKTSSENKYSEYYLCFILVSVSFFSLVSDMLGTTSIIGAFVFGLIMPN-RILASVLLEKF  317

Query  1764  EDFVMGILMPVFFLVCGLRTNIFTITDGDTSIFTALALILLACSAKIIAALVASCYTGMS  1585
             EDFV   L+P+FF   GLR NI++IT+   S+F    +++L C  KI+++++AS Y  +S
Sbjct  318   EDFVTAYLLPLFFASMGLRLNIWSITNWGLSLF----VLVLCCGVKIVSSMLASYYFKLS  373

Query  1584  TNEAIGLGVLTNTKSTMVMIILEVGqvqqvlsvqqysmmvVACLIMTIVATPL-AARYCP  1408
               +   LG+L NTKS + M+IL +G  +  L V+ Y  M +A L+MT   +P+ ++ Y P
Sbjct  374   RQDGFALGILLNTKSILAMLILHMGFDKSYLQVEDYVTMALAILLMTGAVSPIISSIYHP  433

Query  1407  KQDLEPYKRRTIQNAKPGEELRILACIHGTNNLPAIISLLETSNSTVTSPITAFGVQLLE  1228
              + L  YK+RTIQN +P  E RIL C+  T N+  II+LL++SN+T  SP+  F + L+E
Sbjct  434   NKRLLQYKQRTIQNTRPDSEFRILTCLQSTGNVSGIINLLDSSNATTESPLCVFALHLVE  493

Query  1227  LVGRAPAMMvvhssgsgrhvggsHEEVQTSQIISTFDNYELRSHGVTAQVLTARWSYDTM  1048
             L GRA AM+           G       + +I+S+F+ Y   +  V  Q LTA   + TM
Sbjct  494   LTGRASAML------IVHSPGKKSRSSYSEKIVSSFETYSNLNELVAIQPLTALSPFSTM  547

Query  1047  AEDICKMAKEKRAAFLVLPFHKQQGTDGEMEDT-NPAIQTVNEGVLLSAPCSVGILVER-  874
              EDIC +A+EK   FL+LPFHK    DG++ED  + + + VN  VL  APC+VGI V+R 
Sbjct  548   HEDICSLAEEKEVGFLILPFHKLPTPDGKLEDEGSTSFRGVNLNVLAHAPCTVGIFVDRG  607

Query  873   ----GRPNQYAKNIAVLYLGGPDDREALTYARRMSGLPGVHLTVIRFVPAKDVSADGAVE  706
                 G  N   + +A+L++GGPDDREAL+YA RMS   GV LTV+RF+P      +G  +
Sbjct  608   FGIHGESNLTMRQLAMLFIGGPDDREALSYAWRMSLSHGVSLTVVRFLP-----GEGGQQ  662

Query  705   DPDLELELTRETSFVTVSID-PARDKEEDEELLNNFRTETAEDDSKTFMELVLDDEEEFT  529
             +   E E   +     VSI+  +R ++ D+E +N FR ++A +    + E +++++E+  
Sbjct  663   NIQ-EQEQVGDARKGAVSIEFLSRQRKLDDEFVNEFRLKSAGEQFMGYEEKIVNNDEDLI  721

Query  528   KAVKSLDDRSFDLYVAGRGRGVSSALTSGLADWCECPELGAVGD  397
             +++K +  + +DLY+ GRG G++S LT+GL DWCE PELGA+GD
Sbjct  722   ESLKEM-HQIYDLYLVGRGEGMNSPLTAGLMDWCEYPELGALGD  764



>ref|XP_010655643.1| PREDICTED: cation/H(+) antiporter 15-like [Vitis vinifera]
Length=846

 Score =   506 bits (1303),  Expect = 1e-160, Method: Compositional matrix adjust.
 Identities = 306/784 (39%), Positives = 477/784 (61%), Gaps = 20/784 (3%)
 Frame = -3

Query  2655  MCFSQTIYRSNGVWEGPDPLAPMIPLFILQIMTAILSSRILNFVLKPFNQPPLVAEILSG  2476
             +C    I   + +W+  +PL   +P+F+ Q+   +L +R+L F+LKP  QP ++AEIL+G
Sbjct  16    ICLVLDIANGDSLWKAENPLVKSVPVFVRQMALTLLVTRLLVFILKPLKQPRIMAEILAG  75

Query  2475  IILGPSMLGNI-EEFRKHNFPNHNFETIETMGHFALVLYAFLTGLQMDVKAIVHTGTKSR  2299
             +   P +LG I        FP  ++  +ET+ +  LV + FL GL++D+ +++ TG ++ 
Sbjct  76    MFFNPGILGRIYNNMALKLFPYDSWAVLETLANVGLVFHVFLVGLEIDLTSVMTTGQRAF  135

Query  2298  IVAVSGSIFPFLIGAGFYFTL---QTDTQSMIGFIFCGSALTVTGFSTLAKILDSKRLLN  2128
              +A+SG + P  +G+G +  L   Q    +  G +  G ++TVTG   L ++L + +LLN
Sbjct  136   SIAISGIVVPLAVGSGSFLMLKDYQEGNFTFAGSVLWGLSVTVTGVHMLTRVLANLKLLN  195

Query  2127  TEIGKIAASSALINVALSWVLLTIGLLFTGSLDNVQWAvlctvgfvvvcvnyVRPLLNWL  1948
             T++GK+A SSA+IN    WV+L + +     +    WA+L T  FV+  +  VRP + W+
Sbjct  196   TDLGKLAMSSAVINELFLWVILAVAIPIVNDVGTSCWAILATAAFVLFFIFLVRPAIVWM  255

Query  1947  ISKTPEGQGFSEFYICSFIAVICAFGCFTDAMGSHPMIGAFIFGLIMPNNELLRTAILDR  1768
             +S+ PEG   SE  +   +  +      TDA GS+ +IGAF+FGL+ P   +  T I+++
Sbjct  256   LSRYPEGDSLSECQVGLILFGVVLSAVATDACGSYSIIGAFVFGLVFPTG-VQATEIMEK  314

Query  1767  LEDFVMGILMPVFFLVCGLRTNIFTITDGDTSIFTALALILLACSAKIIAALVASCYTGM  1588
             LED V GIL+P++F+ CG+R N+ ++ D D      L + LL CSAK+I+ L+      M
Sbjct  315   LEDLVSGILVPLYFVTCGIRINLESLWDSDAMAKVMLVVALL-CSAKVISTLLVYILYKM  373

Query  1587  STNEAIGLGVLTNTKSTMVMIILEVGqvqqvlsvqqysmmvVACLIMTIVATPLAA-RYC  1411
                E IGLG++ NTK  +  IIL +G+ +Q    + +++MVVA L+MT + TPL    Y 
Sbjct  374   PIQEGIGLGLVLNTKDILAFIILHIGRDRQAFDNKMFTVMVVAMLVMTGMVTPLINFVYQ  433

Query  1410  PKQDLEPYKRRTIQNAKPGEELRILACIHGTNNLPAIISLLETSNSTVTSPITAFGVQLL  1231
             P+     YK R+I+ ++   ELRIL C+H T N+P IISLLE SN    SP+  F + L+
Sbjct  434   PRTRFMRYKNRSIEKSQADGELRILTCLHQTRNVPGIISLLEASNPIPRSPLRVFALHLV  493

Query  1230  ELVGRAPAMMvvhssg----sgrhvggsHEEVQTSQIISTFDNYELRSHGVTAQVLTARW  1063
             EL  RA AM+++H++     S         + Q+ QIIS F++ E R+  V+ Q LT   
Sbjct  494   ELTDRASAMLIIHNTQNSGPSTTLANHRSTQAQSEQIISAFEDLEQRNLAVSVQSLTVMS  553

Query  1062  SYDTMAEDICKMAKEKRAAFLVLPFHKQQGTDGEMEDTNPAIQTVNEGVLLSAPCSVGIL  883
              Y TM EDIC +A++KR A  ++PFHKQQ  DG+ME+ + A++ VN+ VL +  CSV I 
Sbjct  554   PYATMDEDICSIAEDKRVALTIIPFHKQQTADGQMEEGDAAVRRVNQNVLANTSCSVAIF  613

Query  882   VER--GRPNQYAKNIAVLYLGGPDDREALTYARRMSGLPGVHLTVIRFVPAKDVSADGAV  709
             V+R  G  +   + I +L+  GPDDREAL+Y+ RM G P   L VIRF+P+++     A 
Sbjct  614   VDRGFGALDYQDRRICMLFFCGPDDREALSYSWRMVGHPTAMLAVIRFIPSEN-----AA  668

Query  708   EDPDLELELTRETSFVTVSI-DPARDKEEDEELLNNFRTETAEDDSKTFMELVLDDEEEF  532
             +   LE  +  +++ +  +I +  + K  D+E + NFR  T+ D++  + E+VL++ EE 
Sbjct  669   DLETLEEYVPGDSNGILSAISEYEKQKSLDDEFVENFRIRTSGDENILYREVVLNNGEEA  728

Query  531   TKAVKSLDDRSFDLYVAGRGRGVSSALTSGLADWCECPELGAVGDllvtsefessfsvlv  352
               A++ + D ++DLYV GRG+ V S LT+GL +W +CPELGA+GD+LVTSEF SS SVLV
Sbjct  729   VTAIREM-DHNYDLYVVGRGQKVLSPLTAGLNEWSDCPELGAIGDILVTSEFASSASVLV  787

Query  351   VQQY  340
             +QQ+
Sbjct  788   IQQF  791



>gb|EPS60468.1| hypothetical protein M569_14334 [Genlisea aurea]
Length=764

 Score =   501 bits (1291),  Expect = 7e-160, Method: Compositional matrix adjust.
 Identities = 308/734 (42%), Positives = 458/734 (62%), Gaps = 29/734 (4%)
 Frame = -3

Query  2478  GIILGPSMLGNIEEFRKHNFPNHNFETIETMGHFALVLYAFLTGLQMDVKAIVHTGTKSR  2299
             GIILGPS+LG   +F    FP  +   +ETM +  L+ Y FL GL+MDV  +  TG K+ 
Sbjct  10    GIILGPSVLGRSAKFADTIFPLRSVVVLETMANLGLLYYLFLIGLEMDVAVVKRTGRKAV  69

Query  2298  IVAVSGSIFPFLIGAGFYFTLQTDTQSM-IG--FIFCGSALTVTGFSTLAKILDSKRLLN  2128
             ++A+SG   PFLIG  F F L + T+ + +G   +F G  L VT F  LA++L   +L+N
Sbjct  70    LIAISGMFLPFLIGVSFAFMLHSSTEYVKLGTFILFLGMVLAVTAFPVLARVLADLKLIN  129

Query  2127  TEIGKIAASSALINVALSWVLLTIGLLFTGSLDNVQ---WAvlctvgfvvvcvnyVRPLL  1957
             TEIG+IA SSAL+N   +WVLL  G+    + D      W +L +V FVV C   V+PL+
Sbjct  130   TEIGRIALSSALVNDVCAWVLLGFGIALAENDDTSLASLWVILASVAFVVFCFCVVKPLI  189

Query  1956  NWLISKTPEGQGFSEFYICSFIAVICAFGCFTDAMGSHPMIGAFIFGLIMPNNELLRTAI  1777
             +W++  TPEG+  +E Y+C  ++ +   G  TDA+G + ++G+F+ GLI+P+  L  T +
Sbjct  190   SWVVRTTPEGESVNELYVCLILSAVMLAGFITDAIGMNSVLGSFVLGLIIPHGTLGIT-L  248

Query  1776  LDRLEDFVMGILMPVFFLVCGLRTNIFTITDGDTSIFTALALILLACSAKIIAALVASCY  1597
             ++RLEDFV G++MP+FF + GL+T+IF I +G  +    L +I+LA   KI   L+ S Y
Sbjct  249   IERLEDFVSGLMMPLFFTMSGLKTDIFAI-NGAWTWVCLLTVIVLASIGKIAGTLLVSLY  307

Query  1596  TGMSTNEAIGLGVLTNTKSTMVMIILEVGqvqqvlsvqqysmmvVACLIMTIVATPLAAR  1417
               M   E + LG+L NTK  + MI+L VG+ Q+VL  + +S+MVVA L+MT + +P+   
Sbjct  308   YKMPFYEGLTLGLLMNTKGLVEMIVLNVGRDQKVLDTESFSIMVVAALVMTSIISPIVMT  367

Query  1416  -YCPKQDLEPYKRRTIQNAKPGEELRILACIHGTNNLPAIISLLETSNSTVTSPITAFGV  1240
              Y P +   PYKRRT+Q  K   E RIL C+H   N+P +I+LLE S     SPI    +
Sbjct  368   IYKPSRRYAPYKRRTMQRTKQEGEFRILVCVHTPRNVPTMINLLEASYPNRRSPILVCVL  427

Query  1239  QLLELVGRAPAMMvvhssgsgrhv---ggsHEEVQTSQIISTFDNYELRSHGVTAQVLTA  1069
              L+EL GR  +M++VH++G    +    GS  + Q+  I++ F+N++  +  V+   LTA
Sbjct  428   HLVELTGRNSSMLIVHNTGKNDGIGGGNGSRSQAQSDHIVNAFENFQQHAGFVSVDPLTA  487

Query  1068  RWSYDTMAEDICKMAKEKRAAFLVLPFHKQQGTDGEMEDTNPAIQTVNEGVLLSAPCSVG  889
                Y T+ EDIC +A++KR AF+++PFHKQQ  DG ME TNPA + +N+ V+ +APCSVG
Sbjct  488   VSPYSTIHEDICSVAEDKRVAFIIVPFHKQQTVDGGMESTNPAYRAINQNVMAAAPCSVG  547

Query  888   ILVERG----------RPNQYAKNIAVLYLGGPDDREALTYARRMSGLPGVHLTVIRFVP  739
             ILV+RG           P  +  ++AVL+ GG DDREAL Y  RMS  PG++LTV+RF+ 
Sbjct  548   ILVDRGLGGAGRMAAVTPGTH--HVAVLFFGGADDREALAYGWRMSEHPGINLTVMRFLC  605

Query  738   AKDVSADGAVEDPDLELELTRETSFVTVSIDPARDKEEDEELLNNFRTETAEDDSKTFME  559
              +  +      + +++  L      ++   +  R+++ DE+ +N FR  T  D S ++ E
Sbjct  606   GRSTTEATVAGERNIQSGL----GMLSRPTETDRERDLDEDYINQFRARTMMDSSISYSE  661

Query  558   LVLDDEEEFTKAVKSLDDRSFDLYVAGRGRGVSSALTSGLADWCECPELGAVGDllvtse  379
              V++  EE   A++S+ D   DL++ GRG+G+ S LT+GL DW ECPELG +GDLL +S+
Sbjct  662   SVVNHGEETVAAIRSI-DAIHDLFIVGRGQGLESPLTAGLTDWSECPELGPIGDLLASSD  720

Query  378   fessfsvlvVQQYV  337
             F S++SVLVVQQY+
Sbjct  721   FASTYSVLVVQQYI  734



>emb|CBI30847.3| unnamed protein product [Vitis vinifera]
Length=899

 Score =   505 bits (1300),  Expect = 1e-159, Method: Compositional matrix adjust.
 Identities = 305/783 (39%), Positives = 474/783 (61%), Gaps = 32/783 (4%)
 Frame = -3

Query  2655  MCFSQTIYRSNGVWEGPDPLAPMIPLFILQIMTAILSSRILNFVLKPFNQPPLVAEILSG  2476
             +C    I   + +W+  +PL   +P+F+ Q+   +L +R+L F+LKP  QP ++AEIL+G
Sbjct  16    ICLVLDIANGDSLWKAENPLVKSVPVFVRQMALTLLVTRLLVFILKPLKQPRIMAEILAG  75

Query  2475  IILGPSMLGNI-EEFRKHNFPNHNFETIETMGHFALVLYAFLTGLQMDVKAIVHTGTKSR  2299
             +   P +LG I        FP  ++  +ET+ +  LV + FL GL++D+ +++ TG ++ 
Sbjct  76    MFFNPGILGRIYNNMALKLFPYDSWAVLETLANVGLVFHVFLVGLEIDLTSVMTTGQRAF  135

Query  2298  IVAVSGSIFPFLIGAGFYFTL---QTDTQSMIGFIFCGSALTVTGFSTLAKILDSKRLLN  2128
              +A+SG + P  +G+G +  L   Q    +  G +  G ++TVTG   L ++L + +LLN
Sbjct  136   SIAISGIVVPLAVGSGSFLMLKDYQEGNFTFAGSVLWGLSVTVTGVHMLTRVLANLKLLN  195

Query  2127  TEIGKIAASSALINVALSWVLLTIGLLFTGSLDNVQWAvlctvgfvvvcvnyVRPLLNWL  1948
             T++GK+A SSA+IN    WV+L + +     +    WA+L T  FV+  +  VRP + W+
Sbjct  196   TDLGKLAMSSAVINELFLWVILAVAIPIVNDVGTSCWAILATAAFVLFFIFLVRPAIVWM  255

Query  1947  ISKTPEGQGFSEFYICSFIAVICAFGCFTDAMGSHPMIGAFIFGLIMPNNELLRTAILDR  1768
             +S+ PEG   SE  +   +  +      TDA GS+ +IGAF+FGL+ P   +  T I+++
Sbjct  256   LSRYPEGDSLSECQVGLILFGVVLSAVATDACGSYSIIGAFVFGLVFPTG-VQATEIMEK  314

Query  1767  LEDFVMGILMPVFFLVCGLRTNIFTITDGDTSIFTALALILLACSAKIIAALVASCYTGM  1588
             LED V GIL+P++F+ CG+R N+ ++ D D ++   + ++ L CSAK+I+ L+      M
Sbjct  315   LEDLVSGILVPLYFVTCGIRINLESLWDSD-AMAKVMLVVALLCSAKVISTLLVYILYKM  373

Query  1587  STNEAIGLGVLTNTKSTMVMIILEVGqvqqvlsvqqysmmvVACLIMTIVATPLAA-RYC  1411
                E IGLG++ NTK  +  IIL +G+ +Q    + +++MVVA L+MT + TPL    Y 
Sbjct  374   PIQEGIGLGLVLNTKDILAFIILHIGRDRQAFDNKMFTVMVVAMLVMTGMVTPLINFVYQ  433

Query  1410  PKQDLEPYKRRTIQNAKPGEELRILACIHGTNNLPAIISLLETSNSTVTSPITAFGVQLL  1231
             P+     YK R+I+ ++   ELRIL C+H T N+P IISLLE SN    SP+  F + L+
Sbjct  434   PRTRFMRYKNRSIEKSQADGELRILTCLHQTRNVPGIISLLEASNPIPRSPLRVFALHLV  493

Query  1230  ELVGRAPAMMvvhssg----sgrhvggsHEEVQTSQIISTFDNYELRSHGVTAQVLTARW  1063
             EL  RA AM+++H++     S         + Q+ QIIS F++ E R+  V+ Q LT   
Sbjct  494   ELTDRASAMLIIHNTQNSGPSTTLANHRSTQAQSEQIISAFEDLEQRNLAVSVQSLTVMS  553

Query  1062  SYDTMAEDICKMAKEKRAAFLVLPFHKQQGTDGEMEDTNPAIQTVNEGVLLSAPCSVGIL  883
              Y TM EDIC +A++KR A  ++PFHKQQ  DG+ME+ + A++ VN+ VL +  CSV I 
Sbjct  554   PYATMDEDICSIAEDKRVALTIIPFHKQQTADGQMEEGDAAVRRVNQNVLANTSCSVAIF  613

Query  882   VER--GRPNQYAKNIAVLYLGGPDDREALTYARRMSGLPGVHLTVIRFVPAKDVSADGAV  709
             V+R  G  +   + I +L+  GPDDREAL+Y+ RM G P   L VIRF+P+++ +     
Sbjct  614   VDRGFGALDYQDRRICMLFFCGPDDREALSYSWRMVGHPTAMLAVIRFIPSENAA-----  668

Query  708   EDPDLELELTRETSFVTVSIDPARDKEEDEELLNNFRTETAEDDSKTFMELVLDDEEEFT  529
                DLE   T E  +        + K  D+E + NFR  T+ D++  + E+VL++ EE  
Sbjct  669   ---DLE---TLEEYY-------EKQKSLDDEFVENFRIRTSGDENILYREVVLNNGEEAV  715

Query  528   KAVKSLDDRSFDLYVAGRGRGVSSALTSGLADWCECPELGAVGDllvtsefessfsvlvV  349
              A++ + D ++DLYV GRG+ V S LT+GL +W +CPELGA+GD+LVTSEF SS SVLV+
Sbjct  716   TAIREM-DHNYDLYVVGRGQKVLSPLTAGLNEWSDCPELGAIGDILVTSEFASSASVLVI  774

Query  348   QQY  340
             QQ+
Sbjct  775   QQF  777



>dbj|BAK06977.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=875

 Score =   504 bits (1297),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 297/798 (37%), Positives = 472/798 (59%), Gaps = 23/798 (3%)
 Frame = -3

Query  2676  DRLGQVVMCFSQTIYRSNGVWEGPDPLAPMIPLFILQIMTAILSSRILNFVLKPFNQPPL  2497
              ++  +V+C+S  +  +NG+W+G +PL   +PLFILQ+   ++++R +  +L+PF QP +
Sbjct  28    SKVTNMVVCYSPMMITTNGIWQGVNPLEFSLPLFILQVAVIVITTRFIVLLLRPFRQPRV  87

Query  2496  VAEILSGIILGPSMLGNIEEFRKHNFPNHNFETIETMGHFALVLYAFLTGLQMDVKAIVH  2317
             +AEIL+G++LGPS++G ++ +    FP  +  T+ET+ H  L+ + FL GL+MD+  I  
Sbjct  88    IAEILAGVVLGPSLMGQMDVWGNMVFPQRSLLTLETVAHLGLLYFLFLVGLEMDLDVIRR  147

Query  2316  TGTKSRIVAVSGSIFPFLIGAGFYFTLQTDTQSMIG----FIFCGSALTVTGFSTLAKIL  2149
             +G K+  VA++G   PF IG    F  +      +      +F G AL+VT F  LA+IL
Sbjct  148   SGRKALFVALAGMALPFCIGTATSFIFRHQVSRNVHQTSFLLFLGVALSVTAFPVLARIL  207

Query  2148  DSKRLLNTEIGKIAASSALINVALSWVLLTIGLLFTGSLDNVQ----WAvlctvgfvvvc  1981
                +LLNT++G+IA S+A++N   +W+LL + +  T  +D+      W +L  V FV++C
Sbjct  208   AEIKLLNTDLGRIAMSAAIVNDMCAWILLAMAIAIT-EVDSTALSSLWVLLSGVVFVLIC  266

Query  1980  vnyVRPLLNWLISKTPEGQGFSEFYICSFIAVICAFGCFTDAMGSHPMIGAFIFGLIMPN  1801
                VRP + WLI + PEG+  S+  +   +A +   G  T+A+G H + GAFI+GL++P+
Sbjct  267   FYVVRPAMWWLIHRIPEGESISDMEVSLILAGVMLAGVCTEAIGIHSVFGAFIYGLVIPS  326

Query  1800  NELLRTAILDRLEDFVMGILMPVFFLVCGLRTNIFTITDGDTSIFTALALILLACSAKII  1621
               L  T ++++LEDFV G+L+P+FF + GLRTNI    D  T     L  + +A  AK++
Sbjct  327   VPLGVT-LIEKLEDFVTGLLLPLFFAISGLRTNITKARDPVTVGLLVLVFV-MASFAKVM  384

Query  1620  AALVASCYTGMSTNEAIGLGVLTNTKSTMVMIILEVGqvqqvlsvqqysmmvVACLIMTI  1441
               ++ +    M   E I LG L NT+  + MI+L +G+ +QVL  + +++MV+  + MT 
Sbjct  385   GTIIIAALYTMPFREGIALGFLMNTRGLVEMIVLNIGRDKQVLDDESFAVMVMVSVGMTA  444

Query  1440  VATPLA-ARYCPKQDLEPYKRRTIQNAKPGEELRILACIHGTNNLPAIISLLETSNSTVT  1264
             + TP+    + P + L  YKRR +Q  +   ELR+LAC+H T N+P+++SLLE SN +  
Sbjct  445   LVTPIVTGLHKPARRLVGYKRRNLQRIRHDSELRMLACVHTTRNVPSVLSLLELSNPSKR  504

Query  1263  SPITAFGVQLLELVGRAPAMMvvhssgsgrhvggsHEE---VQTSQIISTFDNYELRSHG  1093
             SPI  + + L+EL GRA  M+   ++ +  +   S        T  I + F+NYE+ + G
Sbjct  505   SPIFIYALHLVELTGRASNMLAAAAASASTNNNRSGSSALPATTEHIFNAFENYEMHTGG  564

Query  1092  VTAQVLTARWSYDTMAEDICKMAKEKRAAFLVLPFHKQQGTDGEMEDTNPAIQTVNEGVL  913
             V+ Q L A   Y TM +D+  +A++K  + +V+PFHKQQ  DG ME  NP+I+  NE +L
Sbjct  565   VSIQTLAAVSPYQTMHDDVSVLAEDKHVSLIVVPFHKQQTVDGGMEPINPSIRAFNESLL  624

Query  912   LSAPCSVGILVERGRPNQYAK-----NIAVLYLGGPDDREALTYARRMSGLPGVHLTVIR  748
              ++PCSV ILV+RG     A+      + + + GGPDDREAL YA RM   P V L ++R
Sbjct  625   SASPCSVAILVDRGLGAAAARMADEHRLVLFFFGGPDDREALAYAWRMVENPSVSLAIVR  684

Query  747   FVPAKDVSADGAVEDPDLELELTRETSFVTVSIDPARDKEEDEELLNNFRTETAEDDSKT  568
             F+P      + +   P      T ++  + +  +   + E DEE L  FR     + +  
Sbjct  685   FLPPD--YRERSFSSPTYRSADTADSRAINIGTEGKTELEMDEEYLGEFRARNQGNGAIM  742

Query  567   FMELVLDDEEEFTKAVKSLDDRSFDLYVAGRGRG-VSSALTSGLADWCECPELGAVGDll  391
             + +  + + EE   A++S+D  + ++Y+ GR  G   S +TS L DW ECPELG +GD+L
Sbjct  743   YADKTVTNSEETVAAIRSMDSSTHEMYIVGRRPGEAGSPMTSALEDWMECPELGPIGDML  802

Query  390   vtsefessfsvlvVQQYV  337
             V+S+F    SVLVVQQYV
Sbjct  803   VSSDFSMGVSVLVVQQYV  820



>ref|XP_011012847.1| PREDICTED: cation/H(+) antiporter 15-like [Populus euphratica]
Length=854

 Score =   499 bits (1286),  Expect = 5e-158, Method: Compositional matrix adjust.
 Identities = 290/770 (38%), Positives = 463/770 (60%), Gaps = 25/770 (3%)
 Frame = -3

Query  2652  CFSQTIYRSNGVWEGPDPLAPMIPLFILQIMTAILSSRILNFVLKPFNQPPLVAEILSGI  2473
             CF   I   +G+W+  +PL   +PL  +Q+   I  +R + ++L+P   P +V + L G+
Sbjct  20    CFVVNITAEHGIWQSENPLTQSLPLLAMQLAATIFVTRAVYYLLRPLAVPRIVTDFLGGV  79

Query  2472  ILGPSMLGNIEEFRKHNFPNHNFETIETMGHFALVLYAFLTGLQMDVKAI---VHTGTKS  2302
             ++GPS L  + +FR   FP  +  T+ET+ ++AL  + FL GL+ D+  I     T  K+
Sbjct  80    LMGPSALSLLPKFRDM-FPLRSIVTVETVAYWALCCHLFLIGLEFDMSVIENLTRTSKKA  138

Query  2301  RIVAVSGSIFPFLIGAGFYFTLQT---DTQSMIGFIFCGSALTVTGFSTLAKILDSKRLL  2131
               +A++G + PF++G G +F +        +  G ++ G +L VTG+  +A++L+  +LL
Sbjct  139   IHIAIAGVLIPFIMGIGLFFFMNRVPGGEYNPTGCVYIGLSLAVTGYPIVARVLNDVKLL  198

Query  2130  NTEIGKIAASSALINVALSWVLLTIGLLFTGSLDN-VQWAvlctvgfvvvcvnyVRPLLN  1954
             +++IG++A S++L+   +SW+L+ IG+ F+         AVL TVGF + C+  VRP L 
Sbjct  199   HSDIGRMAMSASLVTDLISWILVLIGIPFSNQTSGGASVAVLSTVGFALFCIFVVRPALA  258

Query  1953  WLISKTPEGQGFSEFYICSFIAVICAFGCFTDAMGSHPMIGAFIFGLIMPNNELLRTAIL  1774
              +ISKT +   +SE Y+C  +  I AF   TD +G++ ++GAFIFG IMPN  +L  A L
Sbjct  259   MIISKTSKENDYSENYLCFVLVAISAFAVVTDILGTNSIVGAFIFGFIMPN-RILAAAFL  317

Query  1773  DRLEDFVMGILMPVFFLVCGLRTNIFTITDGDTSIFTALALILLACSAKIIAALVASCYT  1594
             D+ EDFV G L+P+FF +CG+R +I+++ D    +     +++L+CSAKI++ L+ S Y 
Sbjct  318   DKFEDFVTGYLLPLFFTICGIRIDIWSLFDKKAHLAIGPVVVVLSCSAKILSTLLVSFYE  377

Query  1593  GMSTNEAIGLGVLTNTKSTMVMIILEVGqvqqvlsvqqysmmvVACLIMTIVATPLAAR-  1417
              + T +   LG++ NTK  + ++IL++G   + L+ + Y++M +A L+MT V  P+ A  
Sbjct  378   NVPTRDGFSLGIVLNTKGILAILILQLGHSGEFLNKRDYTVMAIAILLMTGVVAPVTAFI  437

Query  1416  YCPKQDLEPYKRRTIQNAKPGEELRILACIHGTNNLPAIISLLETSNSTVTSPITAFGVQ  1237
             Y P + L  YKRRTIQ  +   ELRILAC     N+  +ISL+++SN+T  SP+T F + 
Sbjct  438   YRPAKHLSHYKRRTIQKGRQDGELRILACFQNFRNVSGMISLIDSSNATRESPLTVFALH  497

Query  1236  LLELVGRAPAMMvvhss--gsgrhvggsHEEVQTSQIISTFDNYELRSHGVTAQVLTARW  1063
             +LEL GRA AM++VHS+   SG +     +   + +I++  + Y+  +  V    LT+  
Sbjct  498   VLELTGRASAMLIVHSTGGKSGGYSRHGRKNSPSEKIVTALETYQTLNDNVNIHALTSMS  557

Query  1062  SYDTMAEDICKMAKEKRAAFLVLPFHKQQGTDGEME-DTNPAIQTVNEGVLLSAPCSVGI  886
              + +M EDIC +A+EK  A LV+PFHK    DG++E + N + + VN  VL +APCSVGI
Sbjct  558   PHASMHEDICSLAEEKHTALLVIPFHKLPSKDGKLEAEDNTSFRGVNLNVLANAPCSVGI  617

Query  885   LVER-------GRPNQYAKNIAVLYLGGPDDREALTYARRMSGLPGVHLTVIRFVPAKDV  727
              V+R       G  +   + I +L++GGPDDREAL YA RM G  G+ LTV+RF+P   V
Sbjct  618   FVDRGFGVSENGESSLTMRQILMLFVGGPDDREALAYAWRMGGTEGIGLTVVRFLPGDQV  677

Query  726   SADGAVEDPDLELELTRETSFVTVSIDPARDKEEDEELLNNFRTETAEDDSKTFMELVLD  547
                  ++  DL L +      +T       +++ D+E +N FR + A +   ++ E V++
Sbjct  678   E---EIQPKDL-LPVGEAHKMLTSITYVDSNRKLDDEYVNEFRLKIAGEQFVSYQEKVVN  733

Query  546   DEEEFTKAVKSLDDRSFDLYVAGRGRGVSSALTSGLADWCECPELGAVGD  397
             ++EE   A++ +    +DLYV GRG G+ S LT  LADWCE PELG +GD
Sbjct  734   NDEEIVLALQEM-HHIYDLYVVGRGEGIVSPLTESLADWCEYPELGPIGD  782



>ref|XP_004156031.1| PREDICTED: cation/H(+) antiporter 15-like [Cucumis sativus]
Length=839

 Score =   494 bits (1271),  Expect = 6e-156, Method: Compositional matrix adjust.
 Identities = 279/772 (36%), Positives = 434/772 (56%), Gaps = 68/772 (9%)
 Frame = -3

Query  2658  VMCFSQTIYRSNGVWEGPDPLAPMIPLFILQIMTAILSSRILNFVLKPFNQPPLVAEILS  2479
             V+C++  +     +W   +P+A  +P+F LQ+   I  SR+L FV KP  QPP+VAEIL+
Sbjct  20    VVCYNTNVTHEGSLWRAENPVASTLPVFALQLCLIIFFSRVLIFVFKPLRQPPIVAEILA  79

Query  2478  GIILGPSMLGNIEEFRKHNFPNHNFETIETMGHFALVLYAFLTGLQMDVKAIVHTGTKSR  2299
             G+++GPS+LG  + F K+ F   +   +ET+ + +LV Y FL GL++D+  IV  G KS 
Sbjct  80    GVLMGPSLLGLTDTFAKYIFAWKSLLALETVANLSLVYYIFLVGLELDMAPIVRAGGKSI  139

Query  2298  IVAVSGSIFPFLIGAGFYFTLQTDTQ-------SMIGFIFCGSALTVTGFSTLAKILDSK  2140
              +A+ G + P  +G G +  + +          ++ G +F G +L  T F  L++IL   
Sbjct  140   SIALLGILLPIPVGIGLHHLINSGRNKAKMPQATVHGPLFWGISLATTNFPDLSRILSDV  199

Query  2139  RLLNTEIGKIAASSALINVALSWVLLTIGLLFTGSLDNVQWAvlctvgfvvvcvnyVRPL  1960
             +LL++EIG+ A S+A+I    SW                                     
Sbjct  200   KLLHSEIGRTALSAAVITDLCSW-------------------------------------  222

Query  1959  LNWLISKTPEGQGFSEFYICSFIAVICAFGCFTDAMGSHPMIGAFIFGLIMPNNELLRTA  1780
               WL+  + +   ++EF+IC  +  + A G  TDA G+H ++GAF++G+IMP  EL +  
Sbjct  223   --WLVRVSSKDGNYNEFHICFVMTGVVACGLITDACGTHSIVGAFMWGVIMPKGEL-KDM  279

Query  1779  ILDRLEDFVMGILMPVFFLVCGLRTNIFTITDGDTSIFTALALILLACSAKIIAALVASC  1600
             I+ ++ED V  ILMP FF+V GLR N   I   ++     L +I LA SAKI++  + + 
Sbjct  280   IMGKVEDLVKSILMPTFFVVTGLRVNC-NIISKESDWVLVLLIIFLATSAKIVSTFLVAI  338

Query  1599  YTGMSTNEAIGLGVLTNTKSTMVMIILEVGqvqqvlsvqqysmmvVACLIMTIVATP-LA  1423
             +  M   E + LG L NTK  + +II+  G+  Q L +  +++M+++  +MT +  P LA
Sbjct  339   FCNMPPREGLTLGSLMNTKGLLALIIISAGRDMQALGLLTFTVMIMSFWVMTALIGPTLA  398

Query  1422  ARYCPKQDLEPYKRRTIQNAKPGEELRILACIHGTNNLPAIISLLETSNSTVTSPITAFG  1243
               Y   +     + RTIQ+ KP  E R++AC+H T N+  II LL  SN T  SP+  F 
Sbjct  399   FTYKSIKTSRKTRYRTIQSIKPEAEFRVVACVHSTRNVYGIIHLLGASNPTKQSPLLVFA  458

Query  1242  VQLLELVGRAPAMMvvhssgsgrhvggsHEEVQTSQIISTFDNYELRSHGVTAQVLTARW  1063
             + L+EL GRA AMM+VH             +VQT  II+ FD +E +++ VT   LTA  
Sbjct  459   IHLVELTGRATAMMIVHGQCKASSAKA---KVQTDHIINAFDKFENQNNSVTVHSLTAVS  515

Query  1062  SYDTMAEDICKMAKEKRAAFLVLPFHKQQGTDGEMEDTNPAIQTVNEGVLLSAPCSVGIL  883
              Y TM +DIC +A EKR   +++PFHKQ   DG +ED NP++  VN  V+ +APCSV +L
Sbjct  516   PYATMHDDICGIAAEKRVHLIIVPFHKQPTLDGGLEDGNPSLGLVNNSVMTNAPCSVAVL  575

Query  882   VERG----------RPNQYAKNIAVLYLGGPDDREALTYARRMSGLPGVHLTVIRFVPAK  733
             V+RG          R N+  +  A+ ++GGPDDREAL YA+RMS  PG+ +TV+RF+P +
Sbjct  576   VDRGLSATNLTDSNRSNRTQQRFALFFIGGPDDREALAYAKRMSEHPGILITVVRFIPGE  635

Query  732   DVSADGAVEDPDLELELTRETSFVTVSIDPARDKEEDEELLNNFRTETAEDDSKTFMELV  553
             +V     ++ P  E         +T      ++K  D + +++FR +   + S  + E+V
Sbjct  636   EVKEMSIMDFPGEE-----NVEILTALAREKKEKVIDNDYIDDFRLQILSNQSIGYAEVV  690

Query  552   LDDEEEFTKAVKSLDDRSFDLYVAGRGRGVSSALTSGLADWCECPELGAVGD  397
             +++ +E  KA+ +L++  F LY+ GRGRG+ S L SGL++W + PELG +GD
Sbjct  691   VNNGDETLKAISTLENE-FSLYIVGRGRGMVSPLVSGLSEWSDSPELGVLGD  741



>ref|XP_004972230.1| PREDICTED: cation/H(+) antiporter 15-like [Setaria italica]
Length=875

 Score =   492 bits (1266),  Expect = 8e-155, Method: Compositional matrix adjust.
 Identities = 301/793 (38%), Positives = 473/793 (60%), Gaps = 26/793 (3%)
 Frame = -3

Query  2658  VMCFSQTIYRSNGVWEGPDPLAPMIPLFILQIMTAILSSRILNFVLKPFNQPPLVAEILS  2479
             V+C+S  +  +NG+W+G +PL   +PLFILQ    ++++R+L  VL+PF QP ++AEIL+
Sbjct  30    VVCYSPMMITTNGIWQGFNPLEFSLPLFILQTAIIVVTTRVLVLVLRPFRQPRVIAEILA  89

Query  2478  GIILGPSMLGNIEEFRKHNFPNHNFETIETMGHFALVLYAFLTGLQMDVKAIVHTGTKSR  2299
             G++LGPS++G IE +    FP  +  T+ET+ H  L+ + FL GL+MD+  I  +G K+ 
Sbjct  90    GVLLGPSVMGQIETWATMVFPQRSLLTLETVAHLGLLYFLFLVGLEMDIDVIRRSGKKAL  149

Query  2298  IVAVSGSIFPFLIGAGFYFTLQTDTQSMIG----FIFCGSALTVTGFSTLAKILDSKRLL  2131
              VA++G   PF +G    F  +      +      +F G AL+VT F  LA+IL   +LL
Sbjct  150   FVAIAGMALPFCMGIATSFIFRHQVSRNVHQTSFLLFLGVALSVTAFPVLARILAEIKLL  209

Query  2130  NTEIGKIAASSALINVALSWVLLTIGLLF----TGSLDNVQWAvlctvgfvvvcvnyVRP  1963
              TE+G+IA S+A++N   +W+LL + +      + +L ++ W +LC V FV+ C   VRP
Sbjct  210   GTELGRIAMSAAIVNDMCAWILLALAIAISEVNSAALSSL-WVLLCGVLFVLFCFYAVRP  268

Query  1962  LLNWLISKTPEGQGFSEFYICSFIAVICAFGCFTDAMGSHPMIGAFIFGLIMPNNELLRT  1783
              + WLI +TPEG+  S+  +   +  +   G  TDA+G H + GAF++GL++P    L  
Sbjct  269   GMWWLIRRTPEGEAVSDMQVSLILTGVMLAGVCTDAIGIHSVFGAFVYGLVIPTGP-LGV  327

Query  1782  AILDRLEDFVMGILMPVFFLVCGLRTNIFTITDGDTSIFTALALILLACSAKIIAALVAS  1603
              +++++EDFV G+L+P+FF + GLRTN+  I D  T     L  + +A  AKI+  ++ +
Sbjct  328   VLIEKIEDFVTGLLLPLFFAISGLRTNVRKIGDPITVGLLVLVFV-MASFAKIMGTIIIA  386

Query  1602  CYTGMSTNEAIGLGVLTNTKSTMVMIILEVGqvqqvlsvqqysmmvVACLIMTIVATPLA  1423
                 M   E I LG L NT+  + MI+L +G+ ++VL  + +++MV+  + MT + TP+ 
Sbjct  387   ALYTMPFREGIALGFLMNTRGLVEMIVLNIGRDKEVLDDESFAVMVLVSVAMTTLVTPVV  446

Query  1422  -ARYCPKQDLEPYKRRTIQNAKPGEELRILACIHGTNNLPAIISLLETSNSTVTSPITAF  1246
                Y P + L  YKRR +Q  +   ELR+LAC+H T N+P+++SLLE SN    SPI  +
Sbjct  447   TGVYRPSRRLVGYKRRNLQRIRHDSELRMLACVHTTRNVPSVLSLLELSNPNKRSPIFIY  506

Query  1245  GVQLLELVGRAPAMMvvhssgsgrhvggsHEEV---QTSQIISTFDNYELRSHGVTAQVL  1075
              + L+EL GRA  M+   ++ + +             T  I + F+NYE  + GV+ Q L
Sbjct  507   ALHLVELTGRASNMLAAAAASASKQSRSGTGSSLPPVTEHIFNAFENYERHTGGVSIQTL  566

Query  1074  TARWSYDTMAEDICKMAKEKRAAFLVLPFHKQQGTDGEMEDTNPAIQTVNEGVLLSAPCS  895
              A   Y TM ED+  +A++K  + +V+PFHKQQ  DG ME  N  ++  NE +L ++PCS
Sbjct  567   AAVSPYQTMHEDVAVLAEDKHVSLIVVPFHKQQTVDGGMEPINAHVRGFNESLLSTSPCS  626

Query  894   VGILVERGRPNQYAK-----NIAVLYLGGPDDREALTYARRMSGLPGVHLTVIRFVPA--  736
             V ILV+RG     A+     ++A+ + GGPDDREAL YA RM   PGV LT++RF+P   
Sbjct  627   VAILVDRGLSAAAARMATEHHVALFFFGGPDDREALAYAWRMVEHPGVTLTIVRFLPPDY  686

Query  735   KDVSADGAVEDPDLELELTRETSFVTVSIDPARDKEEDEELLNNFRTETAEDDSKTFMEL  556
             +  S  G+   P        ++  +T+S +   + E DE+ LN FRT    +++ ++   
Sbjct  687   RTPSVSGSSYRPS---PADADSRHITISTEGKSELEMDEDYLNEFRTRNHGNEAISYSTK  743

Query  555   VLDDEEEFTKAVKSLDDRSFDLYVAGRGRG-VSSALTSGLADWCECPELGAVGDllvtse  379
             ++ + EE   A++S+D+   +LY+ GR  G   S +T+ L DW E PELG +GD+LV+S+
Sbjct  744   MVANSEETVAAIRSMDNNLHELYIVGRRPGQAGSPMTAALEDWMENPELGPIGDMLVSSD  803

Query  378   fessfsvlvVQQY  340
             F  + S+LVVQQY
Sbjct  804   FSMAVSLLVVQQY  816



>dbj|BAK03649.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=876

 Score =   487 bits (1253),  Expect = 7e-153, Method: Compositional matrix adjust.
 Identities = 288/780 (37%), Positives = 449/780 (58%), Gaps = 33/780 (4%)
 Frame = -3

Query  2658  VMCFSQTIYRSNGVW--EGPDPLAPMIPLFILQIMTAILSSRILNFVLKPFNQPPLVAEI  2485
             V+C+S  +  +NG+W  EG +PL   +PLFI+Q+   ++++R+L  +L+PF QP ++AEI
Sbjct  34    VVCYSPMMMTTNGMWQGEGVNPLEFSLPLFIVQLAVIVVTTRLLVILLRPFRQPRVIAEI  93

Query  2484  LSGIILGPSMLGNIEEFRKHNFPNHNFETIETMGHFALVLYAFLTGLQMDVKAIVHTGTK  2305
             L+G++LGPSM+G  E +    FP  +  T+ET+ H  L+ + FL GL+MDV  I  +G K
Sbjct  94    LAGVVLGPSMIGQSEVWASLVFPVRSLLTLETVAHLGLLYFLFLVGLEMDVDVIRRSGDK  153

Query  2304  SRIVAVSGSIFPFLIGAGFYFTLQTDTQSMIG----FIFCGSALTVTGFSTLAKILDSKR  2137
             +  VA++G   PF +G    F  +      +      +F G AL+VT F  LA+IL   +
Sbjct  154   AVFVAMAGMALPFCMGIATSFIFRHQVSRNVHQTSFLLFLGVALSVTAFPVLARILAEIK  213

Query  2136  LLNTEIGKIAASSALINVALSWVLLTIGLLFTGSLDNVQ-------WAvlctvgfvvvcv  1978
             LLNTE+G+ A S+A++N   +W+LL + +    S+  V        W +L  V FV+ C 
Sbjct  214   LLNTELGRTAMSAAIVNDMCAWILLAVAI----SISEVHSTAFSSLWVLLAGVTFVLFCF  269

Query  1977  nyVRPLLNWLISKTPEGQGFSEFYICSFIAVICAFGCFTDAMGSHPMIGAFIFGLIMPNN  1798
               VRPL+  LI   PEG   S   I   +  +   G  TDA+G H + GAF++GL++P+ 
Sbjct  270   YAVRPLMWRLIRNIPEGDDVSNLQITLILTGVMIAGALTDAIGIHSVFGAFVYGLVIPSA  329

Query  1797  ELLRTAILDRLEDFVMGILMPVFFLVCGLRTNIFTITDGDTSIFTALALILLACSAKIIA  1618
               L  A++++LEDFV G+L+P+FF + GLRTN+  I D  T     L  + +A  AK++ 
Sbjct  330   P-LGVALIEKLEDFVTGLLLPLFFAMSGLRTNVRMIRDPVTVGLLVLVFV-MASFAKVMG  387

Query  1617  ALVASCYTGMSTNEAIGLGVLTNTKSTMVMIILEVGqvqqvlsvqqysmmvVACLIMTIV  1438
              ++ +    M   E I LG L NT+  + MI+L +G+ +QVL  + +++MV+  + MT +
Sbjct  388   TIIIAALYAMPFREGIALGFLMNTRGLVEMIVLNIGRDKQVLDDESFAVMVLVSVAMTSL  447

Query  1437  ATPLA-ARYCPKQDLEPYKRRTIQNAKPGEELRILACIHGTNNLPAIISLLETSNSTVTS  1261
              TP+    Y P + L  YKRR +Q  +   ELR+LAC+H T N+P+++SLLE SN +  S
Sbjct  448   VTPVVTGVYRPSRRLVGYKRRNLQRIRHDSELRMLACVHTTRNVPSVLSLLELSNPSKRS  507

Query  1260  PITAFGVQLLELVGRAPAMMvvhssgsgrhvggsHEEVQTSQIISTFDNYELRSHGVTAQ  1081
             PI  + + ++EL GRA  M+   ++ S      +     T  I + F+NYE  + GV+ Q
Sbjct  508   PIFIYALHIIELTGRASNMLAAAAASSSTRSSSTL-PAATEHIFNAFENYERLTGGVSIQ  566

Query  1080  VLTARWSYDTMAEDICKMAKEKRAAFLVLPFHKQQGTDGEMEDTNPAIQTVNEGVLLSAP  901
              L A   Y TM +D+  +A++K  + +V+PFHKQQ  DG ME  NP+I+  NE +L ++P
Sbjct  567   TLAAVSPYQTMHDDVSVLAEDKHVSLIVIPFHKQQTVDGGMEPINPSIKGFNESLLSTSP  626

Query  900   CSVGILVERGRPNQYAK-----NIAVLYLGGPDDREALTYARRMSGLPGVHLTVIRFVP-  739
             CSV ILV+RG     A+      +A+ + GGPDDREAL YA RM   PGV LT++RF+P 
Sbjct  627   CSVAILVDRGLSAATARMATEHRVALFFFGGPDDREALAYAWRMVEHPGVSLTIVRFLPP  686

Query  738   -----AKDVSADGAVEDPDLELELTRETSFVTVSIDPARDKEEDEELLNNFRTETAEDDS  574
                  A+  S           ++       ++ S +   + + DEE L  FR     + +
Sbjct  687   DYRAAARSFSEASYRSAASGGMDPRGGGGAMSGSTEGKSELQMDEEYLGEFRARNHGNPA  746

Query  573   KTFMELVLDDEEEFTKAVKSLDDRSFDLYVAGRGRG-VSSALTSGLADWCECPELGAVGD  397
              T+++  + + EE   A++ +D+ + ++Y+ GR  G   S +T+ L DW E PELG +GD
Sbjct  747   ITYVDKSVTNSEETVAAIRGMDNSAHEMYIVGRRPGEAGSPMTAALEDWMESPELGPIGD  806



>gb|KHN33638.1| Cation/H(+) antiporter 15 [Glycine soja]
Length=739

 Score =   482 bits (1241),  Expect = 9e-153, Method: Compositional matrix adjust.
 Identities = 288/703 (41%), Positives = 429/703 (61%), Gaps = 27/703 (4%)
 Frame = -3

Query  2397  IETMGHFALVLYAFLTGLQMDVKAIVHTGTKSRIVAVSGSIFPFLIGAGFYFTLQTDTQS  2218
             +ETM +  L+ + FL GL+MD+  I  TG K+  +A +G I PFLI       ++    S
Sbjct  3     LETMANMGLIYFVFLVGLEMDISIIKRTGKKTVSIAFAGMILPFLIAVCVSHLIEDKDNS  62

Query  2217  MIG---FIFCGSALTVTGFSTLAKILDSKRLLNTEIGKIAASSALINVALSWVLLTIGLL  2047
             M      ++ G  L+VT F  LA++L   +L++T++GK+A S +LIN   +W+LL + + 
Sbjct  63    MNQASYVLYIGIVLSVTAFPVLARMLADLKLISTDLGKLALSISLINDVFAWILLALAIA  122

Query  2046  FTGSLDNVQWAvlctvgfvvvcvn----yVRPLLNWLISKTPEGQGFSEFYICSFIAVIC  1879
              + + +   WA +  V   +V V+     VRP ++WLI +TPEG+ FSEF +C  +  + 
Sbjct  123   LSEA-NTGTWASVLVVISNLVFVSFCFVIVRPAVSWLIERTPEGKPFSEFQLCIVLTGVM  181

Query  1878  AFGCFTDAMGSHPMIGAFIFGLIMPNNELLRTAILDRLEDFVMGILMPVFFLVCGLRTNI  1699
                  TD +G+H   GAF++GL++PN  L   AIL++LEDFV G+L+P+F+ +CGL+T+I
Sbjct  182   ISAFITDVLGTHCAFGAFVYGLVIPNGPL-GAAILEKLEDFVSGLLLPLFYAICGLKTDI  240

Query  1698  FTITDGDTSIFTALALILLACSAKIIAALVASCYTGMSTNEAIGLGVLTNTKSTMVMIIL  1519
               I+   T  F  L +I L C  KI+     S    +   + + LG+L N+K  + MI+L
Sbjct  241   KLISGASTWTF-VLTVIPLTCFGKILGTFFISLIFQIPNRDGVVLGLLMNSKGLIEMIVL  299

Query  1518  EVGqvqqvlsvqqysmmvVACLIMTIVATPLAAR-YCPKQDLEPYKRRTIQNAKPGEELR  1342
              VG+ Q+VL  + +S+MV+  L+MT V +P+    Y P++ L PYKRRTIQN++   ELR
Sbjct  300   NVGREQKVLGDKIFSVMVIVTLVMTAVVSPIVTLIYKPRKRLIPYKRRTIQNSRLDAELR  359

Query  1341  ILACIHGTNNLPAIISLLETSNSTVTSPITAFGVQLLELVGRAPAMMvvhssgsgrhvgg  1162
             +L CIH   N+P +++LLE ++    SPI A+ + L+EL GRA AM+VVH++        
Sbjct  360   VLVCIHTPRNVPTLVNLLEATHPHKRSPICAYVLHLVELTGRASAMLVVHANRQSGGPAL  419

Query  1161  sHEEVQTSQIISTFDNYELRSHGVTAQVLTARWSYDTMAEDICKMAKEKRAAFLVLPFHK  982
             +  + QT  II+ F N+E        Q LTA   Y TM EDIC +A++KR + +++PFHK
Sbjct  420   NKTQAQTDHIITAFQNFEEHVGHTQVQPLTAISPYSTMHEDICNLAEDKRVSLIIIPFHK  479

Query  981   QQGTDGEMEDTNPAIQTVNEGVLLSAPCSVGILVERGRP-------NQYAKNIAVLYLGG  823
             QQ  DGEM DT PA + +N  +L ++PCSVGILV+RG         N  +  +AVLY GG
Sbjct  480   QQTVDGEMHDTIPAFRMINHNLLQNSPCSVGILVDRGLNGSNRLIGNLASHKVAVLYFGG  539

Query  822   PDDREALTYARRMSGLPGVHLTVIRFVPAKDVSADGAVEDPDLE-LELTRETSFVTVSID  646
             PDDREAL Y  RMS  P VHLTV+ F P+K        + P+ + L    + SF    I 
Sbjct  540   PDDREALAYGWRMSRHPRVHLTVMHFTPSKH-----PTQTPETDHLWANIDRSFTI--IK  592

Query  645   PARDKEEDEELLNNFRTETAEDDSKTFMELVLDDEEEFTKAVKSLDDRSFDLYVAGRGRG  466
               R+   DEE ++ F+     DDS  +++ V+++ EE   A++S+++ + DL++ GRG+G
Sbjct  593   NGREHTLDEEYISEFKKMITNDDSVVYIDKVVNNGEETVAAIRSINNVN-DLFIVGRGQG  651

Query  465   VSSALTSGLADWCECPELGAVGDllvtsefessfsvlvVQQYV  337
               S LT GL DW ECPELGA+GDLL +S+FE++ SVLV+ QYV
Sbjct  652   TMSPLTDGLTDWSECPELGAIGDLLASSDFETTASVLVMHQYV  694



>ref|XP_002305995.2| hypothetical protein POPTR_0004s13620g [Populus trichocarpa]
 gb|EEE86506.2| hypothetical protein POPTR_0004s13620g [Populus trichocarpa]
Length=769

 Score =   479 bits (1233),  Expect = 3e-151, Method: Compositional matrix adjust.
 Identities = 279/743 (38%), Positives = 447/743 (60%), Gaps = 25/743 (3%)
 Frame = -3

Query  2571  LQIMTAILSSRILNFVLKPFNQPPLVAEILSGIILGPSMLGNIEEFRKHNFPNHNFETIE  2392
             +Q+   I  +R + ++L+P   P +V + L G+++GPS L    +FR   FP  +  T+E
Sbjct  1     MQLAATIFVTRAVYYLLRPLAVPRIVTDFLGGVLMGPSALSLFPKFRDM-FPLRSIVTVE  59

Query  2391  TMGHFALVLYAFLTGLQMDVKAI---VHTGTKSRIVAVSGSIFPFLIGAGFYFTLQT---  2230
             T+ ++AL  + FL GL+ D+  I     T  K+  +A++G + PF++G G +F +     
Sbjct  60    TVAYWALCCHLFLIGLEFDMSVIENLTRTSKKAIHIAIAGVLIPFIMGIGLFFLMNQVPG  119

Query  2229  DTQSMIGFIFCGSALTVTGFSTLAKILDSKRLLNTEIGKIAASSALINVALSWVLLTIGL  2050
                +  G ++ G +L VTG+  +A++L+  +LL+++IG++A S++L+   +SW+L+ IG+
Sbjct  120   GGYNPTGCVYVGLSLAVTGYPIVARVLNDVKLLHSDIGRMAMSASLVTDLISWILVIIGI  179

Query  2049  LFTGSLDN-VQWAvlctvgfvvvcvnyVRPLLNWLISKTPEGQGFSEFYICSFIAVICAF  1873
              F+         AVL TVGF + C+  VRP L  +ISKT +   +SE Y+C  +  I AF
Sbjct  180   AFSNQTSGGASVAVLSTVGFALFCIFVVRPALAIIISKTSKENDYSENYLCFVLVSISAF  239

Query  1872  GCFTDAMGSHPMIGAFIFGLIMPNNELLRTAILDRLEDFVMGILMPVFFLVCGLRTNIFT  1693
                TD +G++ ++GAFIFG IMPN  +L  A LD+ E+FV G L+P+FF +CG+R +I++
Sbjct  240   AVVTDVLGTNSIVGAFIFGFIMPN-RILAAAFLDKFEEFVTGYLLPLFFTICGIRIDIWS  298

Query  1692  ITDGDTSIFTALALILLACSAKIIAALVASCYTGMSTNEAIGLGVLTNTKSTMVMIILEV  1513
             + D    +     +++L+CSAKI++ L+ S Y  +   +   LG++ NTK  + ++IL++
Sbjct  299   LFDKKAHLAMGSVVVVLSCSAKILSTLLVSFYENVPARDGFSLGIVLNTKGILAILILQL  358

Query  1512  GqvqqvlsvqqysmmvVACLIMTIVATPLAAR-YCPKQDLEPYKRRTIQNAKPGEELRIL  1336
             G   + L+ + Y++M +A L+MT V  P+ A  Y P + L  YKRRTIQ  +   ELRIL
Sbjct  359   GNSGEFLNKRDYTVMAIAILLMTGVVAPVTASIYRPAKHLSNYKRRTIQKGRQDGELRIL  418

Query  1335  ACIHGTNNLPAIISLLETSNSTVTSPITAFGVQLLELVGRAPAMMvvhss--gsgrhvgg  1162
             AC     N+  +ISL+++SN+T  SP+T F + +LEL GRA AM++VHS+   S  +   
Sbjct  419   ACFQNFRNVSGMISLIDSSNATRESPLTVFALHVLELTGRASAMLIVHSTGGKSSGYSRH  478

Query  1161  sHEEVQTSQIISTFDNYELRSHGVTAQVLTARWSYDTMAEDICKMAKEKRAAFLVLPFHK  982
               +   + +I++  + Y+  +  V    LTA   + +M EDIC +A+EK  + LV+PFHK
Sbjct  479   GRKNSHSEKIVTALETYQTLNDNVNIHALTAMSPHASMHEDICSLAEEKHTSLLVIPFHK  538

Query  981   QQGTDGEME-DTNPAIQTVNEGVLLSAPCSVGILVER-------GRPNQYAKNIAVLYLG  826
                 DG++E + N + + VN  VL +APCSVGI V+R       G  +   + I +L++G
Sbjct  539   LPSKDGKLEAEDNTSFRGVNLNVLANAPCSVGIFVDRGFGVSENGESSLTMRQILMLFVG  598

Query  825   GPDDREALTYARRMSGLPGVHLTVIRFVPAKDVSADGAVEDPDLELELTRETSFVTVSID  646
             GPDDREAL YA RM G  G+ LTV+RF+P   V     ++  DL L +      +T    
Sbjct  599   GPDDREALAYAWRMGGTEGIGLTVVRFLPGDQVE---EIQPKDL-LPVGEAHKMLTSITY  654

Query  645   PARDKEEDEELLNNFRTETAEDDSKTFMELVLDDEEEFTKAVKSLDDRSFDLYVAGRGRG  466
                +++ D+E +N FR +TA +   ++ E V++++EE   A++ +    +DLYV GRG G
Sbjct  655   VDSNRKLDDEYVNEFRLKTAGEQFVSYQEKVVNNDEEIVLALQEM-HHIYDLYVVGRGEG  713

Query  465   VSSALTSGLADWCECPELGAVGD  397
             + S LT  LADWCE PELG +GD
Sbjct  714   IVSPLTESLADWCEYPELGPIGD  736



>ref|XP_007052425.1| Cation proton exchanger [Theobroma cacao]
 gb|EOX96582.1| Cation proton exchanger [Theobroma cacao]
Length=847

 Score =   479 bits (1233),  Expect = 3e-150, Method: Compositional matrix adjust.
 Identities = 290/776 (37%), Positives = 446/776 (57%), Gaps = 36/776 (5%)
 Frame = -3

Query  2655  MCFSQTIYRSNGVWEGPDPLAPMIPLFILQIMTAILSSRILNFVLKPFNQPPLVAEILSG  2476
             +C++ T   ++  W+  +P+   +P F+LQ    IL SR+L   L+P  QP  VAEIL+G
Sbjct  25    ICYNDTRPLTDNYWQSVNPVVKFVPTFMLQFTIIILFSRVLMLFLRPLRQPRFVAEILAG  84

Query  2475  IILGPSMLGNIEEFRKHNFPNHNFETIETMGHFALVLYAFLTGLQMDVKAIVHTGTKSRI  2296
             I+LGPS LG+      +  P      +ETM +  +  Y FL GL+MD+  I   G  +  
Sbjct  85    IVLGPSALGDTNWVSNNITPFEAVLCMETMANLGVTFYMFLVGLEMDLTPIRRIGKTALS  144

Query  2295  VAVSGSIFPFLIGAGFYFTL---QTDTQSMIGFIFCGSALTVTGFSTLAKILDSKRLLNT  2125
             +A++G I P   GAG Y+ +   Q      IG  F   AL+VT F  LA++L   +L+ T
Sbjct  145   IAIAGIILPMSAGAGLYYLVWEKQKQRAPFIGAFFWAIALSVTSFPDLARMLSDLKLMYT  204

Query  2124  EIGKIAASSALINVALSWVLLTIGLLFTGSLDNVQWAvlctvgfvvvcvnyVRPLLNWLI  1945
             ++GK A ++A ++   SW LL   +    + + +  A +  +  +      +RPL+ WL+
Sbjct  205   DLGKTALTAAAVSDVSSWFLLVGTISLINAHEKLHVA-IPVILSMTAFWFMMRPLIAWLM  263

Query  1944  -----SKTPEGQG-FSEFYICSFIAVICAFGCFTDAMGSHPMIGAFIFGLIMPNNELLRT  1783
                  SK    +G +S+ ++   ++ +   G FT+  G+H + GAF+FGL++P+ E L T
Sbjct  264   KQAAASKETSTEGKYSDKHVYLILSGVVFCGYFTELCGAHSIFGAFMFGLMIPSGE-LGT  322

Query  1782  AILDRLEDFVMGILMPVFFLVCGLRTNIFTITDGDTSIFTALALILLACSAKIIAALVAS  1603
              I+D++E+FV+GIL+P  FLV G+RTN+  +   D  +  AL +ILLACSAKI++ L+  
Sbjct  323   TIMDKIEEFVVGILLPPTFLVTGMRTNLLYMF-ADFPLGLALLVILLACSAKIVSTLLVC  381

Query  1602  CYTGMSTNEAIGLGVLTNTKSTMVMIILEVGqvqqvlsvqqysmmvVACLIMTIVATPLA  1423
              Y      +++ LGVL NTK  +V+I+L  G+  +    Q +S +V A LIMTI+  P+ 
Sbjct  382   LYFKCPKRDSLALGVLMNTKGVLVLIVLNEGRNMKGFDQQTFSWIVSALLIMTIIICPIV  441

Query  1422  A-RYCPKQDLEPYKRRTIQNAKPGEELRILACIHGTNNLPAIISLLETSNSTVTSPITAF  1246
             +  +   + L+ Y  R +Q +K    LRILAC++ T NL  +I+LL+ SN+T  SPIT F
Sbjct  442   SFTHKSARHLKQYYHRNLQKSKDA-PLRILACVYSTRNLSGLINLLQISNATRRSPITVF  500

Query  1245  GVQLLELVGRAPAMMvvhssgsgrh--vggsHEEVQTSQIISTFDNYELRSHGVTAQVLT  1072
              V L+EL GRA AM++ H            + E+ +  QI+S F+++E  +H  T Q LT
Sbjct  501   AVHLVELTGRATAMLIFHDKHKEADVGKNATREKAEAEQIVSAFESFENDNHAATVQPLT  560

Query  1071  ARWSYDTMAEDICKMAKEKRAAFLVLPFHKQQGTDGEMEDTNPAIQTVNEGVLLSAPCSV  892
             A   YDTM ED+   A +K A  +++PFHKQ   DG   D N   + VN+ +L SAPC++
Sbjct  561   AVSPYDTMHEDVSNFALDKHANIILIPFHKQPSADGGWTDENLQHKQVNQNLLASAPCTI  620

Query  891   GILVERG---------RPNQYAKNIAVLYLGGPDDREALTYARRMSGLPGVHLTVIRFVP  739
             G+LV+RG         +  +    IA+L++ GPDDREAL YA RM G PG++LTV+RF+P
Sbjct  621   GLLVDRGLTSSVCSESQNGRLECRIAMLFVEGPDDREALAYAWRMVGTPGLNLTVVRFLP  680

Query  738   AKDVS--ADGAVEDPDLELELTRETSFVTVSIDPARDKEEDEELLNNFRTETAEDDSKTF  565
              KDV   ++ A ED         E+   T   +  ++K+ D++ +N FR  T  D S  +
Sbjct  681   GKDVYDMSENAAED--------DESGIFTAMFEREKEKQFDDDYVNEFRFRTMHDKSVAY  732

Query  564   MELVLDDEEEFTKAVKSLDDRSFDLYVAGRGRGVSSALTSGLADWCECPELGAVGD  397
             +E  ++  ++    V S D  +FDLY+ GRG G  S LTSGL++W + PELG +G+
Sbjct  733   IEKQVNSGDQIVSIVTS-DYNNFDLYIVGRGHGTISPLTSGLSNWSDFPELGPLGE  787



>gb|AFW82335.1| hypothetical protein ZEAMMB73_343625 [Zea mays]
Length=957

 Score =   482 bits (1241),  Expect = 3e-150, Method: Compositional matrix adjust.
 Identities = 303/790 (38%), Positives = 459/790 (58%), Gaps = 52/790 (7%)
 Frame = -3

Query  2658  VMCFSQTIYRSNGVWEGPDPLAPMIPLFILQIMTAILSSRILNFVLKPFNQPPLVAEILS  2479
             V+C+S  +  + G+W+G +PL   +PLFILQ    + ++R+L  +LKP  QP ++AEIL+
Sbjct  36    VVCYSPMMVTAYGIWQGVNPLEFSLPLFILQTAIIVATTRLLVLLLKPIRQPRVIAEILA  95

Query  2478  GIILGPSMLGNIEEFRKHNFPNHNFETIETMGHFALVLYAFLTGLQMDVKAIVHTGTKSR  2299
             G+ILGPS++G +E +    FP  +  T+ET+ H  L+ + FL GL+MDV  I  +G K+ 
Sbjct  96    GVILGPSVMGQVEVWGTTVFPVRSLLTLETVAHLGLLYFLFLVGLEMDVNVIRRSGKKAL  155

Query  2298  IVAVSGSIFPFLIGAGFYFTLQTDTQSMIG----FIFCGSALTVTGFSTLAKILDSKRLL  2131
             I+AV+G   PF IG    F  +      +      +F G AL+VT F  LA+IL   +LL
Sbjct  156   IIAVAGMALPFCIGTATSFVFRHQVSKNVHQASFLLFLGVALSVTAFPVLARILAEIKLL  215

Query  2130  NTEIGKIAASSALINVALSWVLLTIGLLFT---GSLDNVQWAvlctvgfvvvcvnyVRPL  1960
             N+++G+IA S+A++N   +W+LL + +  +    S  +  W +L  V FV+ C   VRPL
Sbjct  216   NSDLGRIAMSAAIVNDMCAWILLALAIAISEVNSSAFSSLWVLLSGVFFVLACFYGVRPL  275

Query  1959  LNWLISKTPEGQGFSEFYICSFIAVICAFGCFTDAMGSHPMIGAFIFGLIMPNNELLRTA  1780
             + W+  + PEG+  S+ ++   +  +   G  TDA+G H + GAF++GL++P+ +L    
Sbjct  276   MWWIARRVPEGEAISDVHVTLVLTGVMVAGVCTDAIGIHSVFGAFVYGLVIPSGQL-GVV  334

Query  1779  ILDRLEDFVMGILMPVFFLVCGLRTNIFTITDGDTSIFTALALILLACSAKIIAALVASC  1600
             ++++LEDFV G+L+P+FF + GLR+                                 S 
Sbjct  335   LIEKLEDFVTGLLLPLFFAISGLRSPHQHFPGAR------------------------SR  370

Query  1599  YTGMSTNEAIGLGVLTNTKSTMVMIILEVGqvqqvlsvqqysmmvVACLIMTIVATPLAA  1420
             + G +    +  G L   +  + MI+L +G+ ++VL  + +++MV+  + MT + TP+  
Sbjct  371   HRG-APRPRVHHGQLR--QGLVEMIVLNIGRDKEVLDDESFAVMVLVSVAMTALVTPVVT  427

Query  1419  R-YCPKQDLEPYKRRTIQNAKPGEELRILACIHGTNNLPAIISLLETSNSTVTSPITAFG  1243
               Y P + L  YKRR +Q +K   ELR+LAC+H T N+P+IISLLE SN T  SPI  + 
Sbjct  428   SVYRPARRLVGYKRRNLQRSKHDAELRMLACVHTTRNVPSIISLLELSNPTKRSPIFIYA  487

Query  1242  VQLLELVGRAPAMMvvhssgsgrhvggsHEEVQTSQIISTFDNYELRSHGVTAQVLTARW  1063
             + L+EL GRA  M+  H S + ++ G       +  I + F+ YE    GV+ Q LTA  
Sbjct  488   LHLVELTGRASNMLAAHHSAANQNRGS-----SSDHIFNAFERYEESVGGVSIQALTAVS  542

Query  1062  SYDTMAEDICKMAKEKRAAFLVLPFHKQQGTDGEMEDTNPAIQTVNEGVLLSAPCSVGIL  883
              Y TM ED+  +A++K  + +VLPFHKQQ  DG ME  N +++  NE +L +APCSVGIL
Sbjct  543   PYQTMHEDVSVLAEDKHVSIIVLPFHKQQTVDGGMEPINASLRGFNESILSAAPCSVGIL  602

Query  882   VERGRPNQYAK-----NIAVLYLGGPDDREALTYARRMSGLPGVHLTVIRFVPAKDVSAD  718
             V+RG     A+     ++A+L+ GGPDDRE L YA RM   PGV LTV+RF+P  D  A 
Sbjct  603   VDRGLSAAAARMASVHHVALLFFGGPDDREGLAYAWRMVEHPGVCLTVVRFIP-PDYRAP  661

Query  717   GAVEDPDLELELTRETSFVTVSIDPARDKEEDEELLNNFRTETAEDDSKTFMELVLDDEE  538
                    +        +   ++I P  +++ DEE LN FRT    +++  +ME V+ + E
Sbjct  662   ALAPPQHMPASSVHARA---ITIVPKSERQMDEEYLNEFRTRNVGNNAILYMEQVVANSE  718

Query  537   EFTKAVKSLDDRSFDLYVAGRGRG-VSSALTSGLADWCECPELGAVGDllvtsefessfs  361
             +   A++ LD  + +LY+ GR  G   SALTS LA+W E PELG +GDLLV+SEF    S
Sbjct  719   DTLAAIRDLDS-AHELYIVGRHPGEAGSALTSALAEWMESPELGPIGDLLVSSEFSKMVS  777

Query  360   vlvVQQYVRT  331
             VLV+QQYV T
Sbjct  778   VLVMQQYVIT  787



>gb|KFK42894.1| hypothetical protein AALP_AA1G052600 [Arabis alpina]
Length=866

 Score =   478 bits (1229),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 301/813 (37%), Positives = 454/813 (56%), Gaps = 48/813 (6%)
 Frame = -3

Query  2700  STGP--EVDLDRLGQVVMCFSQTIY---RSNGVWEGPDPLAPMIPLFILQIMTAILSSRI  2536
             ST P  +++  R G+VV C+ Q++    R    WE    LA  +P FI Q+  A LS RI
Sbjct  9     STDPIYQIEESRYGKVV-CYDQSLLFEKREQKGWESGSTLASSLPFFITQLFVANLSYRI  67

Query  2535  LNFVLKPFNQPPLVAEILSGIILGPSMLGNIEEFRKHNFPNHNFETIETMGHFALVLYAF  2356
             L ++ +P   PP VA+IL G++  PS+LGN +   +H FP      +ET  + ALV   F
Sbjct  68    LYYLTRPLYLPPFVAQILCGLLFSPSVLGNTDFIIQHVFPYRFTMVLETFANLALVYNIF  127

Query  2355  LTGLQMDVKAIVHTGTKSRIVAVSGSIFPFLIGAGFYFTLQTDT--QSMIGFIFCGSALT  2182
             L GL MD++ +  T  K  I+AV+G +    IG   YF        + M G +F   AL 
Sbjct  128   LLGLGMDLRMVRLTERKPVIIAVAGLLVALPIGGFLYFLPGNGHPDKIMSGCLFWSVALA  187

Query  2181  VTGFSTLAKILDSKRLLNTEIGKIAASSALINVALSWVLLTIGLLF---TGSLDNVQ-WA  2014
              T F  LA+IL   +LL +++G+ A  +A+I    +WVLL  G      TGS +N+  W 
Sbjct  188   CTNFPDLARILADLKLLRSDMGRTAMCAAIITDLCTWVLLVFGFASFDKTGSWNNMMPWV  247

Query  2013  vlctvgfvvvcvnyVRPLLNWLISKTPEGQGFSEFYICSFIAVICAFGCFTDAMGSHPMI  1834
             +L T  FV++C+  +RP + W+  KT +     + ++   +  +   G  TDA G H + 
Sbjct  248   MLSTAVFVLLCIYVIRPGVAWIFEKTGQAGQVGDTHVWFVLGGVILCGLITDACGVHSIT  307

Query  1833  GAFIFGLIMPNNELLRTAILDRLEDFVMGILMPVFFLVCGLRTNI-FTITDGDTSIFTAL  1657
             GAF+FGL +P++ ++R  I ++L DF+ GILMP+F+++CGLR +I F +T  D   F   
Sbjct  308   GAFLFGLSIPHDHIIRNMIEEKLHDFLSGILMPLFYIICGLRADIGFMLTYTDK--FVMF  365

Query  1656  ALILLACSAKIIAALVASCYTGMSTNEAIGLGVLTNTKSTMVMIILEVGqvqqvlsvqqy  1477
              +I  +   KI+  +VAS +  M T +   +G L NTK T+ +++L  G+  + L    Y
Sbjct  366   IVICSSFLVKIVTTVVASLFMQMHTRDGFAIGALMNTKGTLSLVVLNAGRDTKALDSPMY  425

Query  1476  smmvVACLIMTIVATP-LAARYCPKQDLEPYKRRTIQNAKPGEELRILACIHGTNNLPAI  1300
             + M +A L+M +V  P LA  Y PK+ L  YK R IQ  K   E R+LAC+H   N+  I
Sbjct  426   THMTIALLVMALVIEPLLAVAYKPKKKLVHYKHRMIQKIKGETEFRVLACVHVLPNVSGI  485

Query  1299  ISLLETSNSTVTSPITAFGVQLLELVGRAPA-MMvvhssgsgrhvggsHEEVQTSQIIST  1123
              SLL+ SN T  SP+  F + L+EL GR  A +++++     +         ++ QI  T
Sbjct  486   TSLLQVSNPTKQSPLNVFAIHLVELTGRTTASLLIMNDENKPKTTFSDRVRAESDQIAET  545

Query  1122  FDNYELRSHGVTAQVLTARWSYDTMAEDICKMAKEKRAAFLVLPFHKQQGTDGEMEDTNP  943
             F++ E+ +  +T Q +TA  +Y TM EDIC +A++KR  F+VLP+HK    DG M + N 
Sbjct  546   FESMEVNNDAMTVQTITAVSTYATMHEDICALAEDKRVCFIVLPYHKHLTPDGRMGEGNS  605

Query  942   AIQTVNEGVLLSAPCSVGILVERG---------RPNQYAKNIAVLYLGGPDDREALTYAR  790
             +   +N+ VL  APCSVGILV+RG         R     + +A+L++G PDDREAL+YA 
Sbjct  606   SHAEINQNVLNHAPCSVGILVDRGMAMVRSESSRGEAMKREVAMLFVGSPDDREALSYAW  665

Query  789   RMSGLPGVHLTVIRFVPAKD--VSADGAVEDPDLELELTRETSFVTVSIDPARDKEEDEE  616
             RM G   + LTV+RFVP ++  VSA  A                    ++  R+K+  +E
Sbjct  666   RMVGQHLIKLTVVRFVPGREALVSAGKA-------------------GVEYEREKQVCDE  706

Query  615   LLNNFRTETAEDDSKTFMELVLDDEEEFTKAVKSLDDR-SFDLYVAGRGRGVSSALTSGL  439
              +  F  +T  D S T++E V++D ++    ++ ++++ SFDLY+ GRG    S +T+GL
Sbjct  707   SIYEFNFKTMNDSSVTYIEKVVNDGQDTISTIREMEEKNSFDLYIVGRGYNSDSPVTAGL  766

Query  438   ADWCECPELGAVGDllvtsefessfsvlvVQQY  340
              DW   PELG +GD L +S F    SVLV+QQY
Sbjct  767   NDWSSSPELGTIGDTLASSNFTMHASVLVIQQY  799



>emb|CDP06345.1| unnamed protein product [Coffea canephora]
Length=830

 Score =   473 bits (1216),  Expect = 5e-148, Method: Compositional matrix adjust.
 Identities = 299/797 (38%), Positives = 455/797 (57%), Gaps = 24/797 (3%)
 Frame = -3

Query  2667  GQVVMCFSQTIYRSNGVWEGPDPLAPMIPLFILQIMTAILSSRILNFVLKPFNQPPLVAE  2488
             GQ   C+        GVW   +PL   +P+F++Q++     +R+L  + KP  QPP VAE
Sbjct  24    GQSQSCYLTKATIDRGVWTDINPLNQKLPMFVMQLVIVTSVTRLLLVIAKPLRQPPFVAE  83

Query  2487  ILSGIILGPSMLGNIEEFRKHN----FPNHNFETIETMGHFALVLYAFLTGLQMDVKAIV  2320
              L+G+++GPS+  +I   +K      F       +ET+    L  + F  GL+MD+ A+ 
Sbjct  84    FLAGLLIGPSVTSHISGLQKFISDTIFATPRLMMMETVASLGLNYHVFFLGLEMDITAVT  143

Query  2319  HTGTKSRIVAVSGSIFPFLIGAGFY-FTLQTDTQSM-IGFIFCGSALTVTGFSTLAKILD  2146
               G K+  + +SGS+F F++GA FY F +    Q+  +GF++ G  L+VTG   +  +L 
Sbjct  144   RVGRKALSIGISGSLFSFIVGAAFYIFGVPQYLQNYKMGFLYWGVVLSVTGIQPVGDLLV  203

Query  2145  SKRLLNTEIGKIAASSALINVALSWVLLTIGLLFTGSLDNVQWAvlctvgfvvvcvnyVR  1966
               +LL +E G++A SSAL+N  +SW+LL I    T S      ++L  V   V     VR
Sbjct  204   RHKLLQSEFGRVAMSSALVNGVISWLLLLISSAITCSKQLFFVSLLMAVLLAVFFCFVVR  263

Query  1965  PLLNWLISKTPEGQGFSEFYICSFIAVICAFGCFTDAMGSHPMIGAFIFGLIMPNNELLR  1786
             P + W+I +T EG+ FSE  +C  +  +   G  TD  G     GAF+FGLI+P  ++L 
Sbjct  264   PAILWVIKETQEGEEFSESTVCVILTTVLFCGLLTDVCGLSSFYGAFMFGLIIPK-DVLG  322

Query  1785  TAILDRLEDFVMGILMPVFFLVCGLRTNIFTITDGDTSIFT-ALALILLACSAKIIAALV  1609
                L  L+ FV  +L+P+F+   G+RT++ + T  D + +T  L +  L+   K+I  L 
Sbjct  323   DRFLTVLQGFVSDLLLPLFYCSVGMRTHVDSSTIHDKNDWTLMLQVTFLSFLPKLITTLA  382

Query  1608  ASCYTGMSTNEAIGLGVLTNTKSTMVMIILEVGqvqqvlsvqqysmmvVACLIMTIVATP  1429
              S +  +   E I LGVL N K  +  + L  G     L+ Q Y+MM++   +MT+VA+P
Sbjct  383   VSYFYKIPFREGIALGVLMNAKGILAPMALNWGYDHLALNRQGYTMMILPIALMTVVASP  442

Query  1428  -LAARYCPKQDLEPYKRRTIQNAKPGEELRILACIHGTNNLPAIISLLETSNSTVTSPIT  1252
              L   Y P +   P K RT+Q  +P  ELR+LACIH    +P II+LLE SN+T  SPI 
Sbjct  443   ILGYLYKPTKHFLPSKHRTLQKLRPDAELRLLACIHELQTVPGIITLLEVSNATKRSPIF  502

Query  1251  AFGVQLLELVGRAPAMMvvhssgsgrhvggsHEEVQTSQIISTFDNYELRSHGVTAQVLT  1072
              F VQL+ L     A+++ H  G          + QT Q+I+ F+  E  ++  + Q LT
Sbjct  503   LFAVQLIRLAKHTTALLIEHGPGGFGSQSSRSFDGQTDQVIAAFEKLEEANNMFSVQPLT  562

Query  1071  ARWSYDTMAEDICKMAKEKRAAFLVLPFHKQQGTDGEMEDTNPAIQTVNEGVLLSAPCSV  892
             A   Y +M ED+C +A++KR   ++LPFHK+Q    +MED NPA + +N+ +L +APCSV
Sbjct  563   AMSDYGSMHEDVCSIAEDKRVTLILLPFHKRQTIHNQMEDVNPAYKDMNDNILANAPCSV  622

Query  891   GILVERGRPNQYAK---------NIAVLYLGGPDDREALTYARRMSGLPGVHLTVIRFVP  739
             GILV+RG    + K          + ++Y+GG DDREALTYA RM+G P   LTVI+F  
Sbjct  623   GILVDRGIGISFRKEDDNDDGTIRVCMIYIGGDDDREALTYAWRMAGHPRATLTVIQFSA  682

Query  738   AKDVSADGAVEDPDLELELTRETSFVTVSIDPARDKEEDEELLNNFRTETAEDDSKTFME  559
             ++  SA   +E  D   +  +  S    ++D A +K+ D + +++FR ++ E +  T++E
Sbjct  683   SE--SAASNIEPHDFAQDGGKVAS---ATVDIATEKQLDADFISDFRQKSVEKEKVTYLE  737

Query  558   LVLDDEEEFTKAVKSLDDRSFDLYVAGRGRGVSSALTSGLADWCECPELGAVGDllvtse  379
                ++  E    +KSL + S+DL+V GRG G+SS L SGL DW + PELG++GDLL++S+
Sbjct  738   KESNNGAETVSIIKSLAE-SYDLFVVGRGLGMSSPLKSGLDDWSDFPELGSIGDLLISSD  796

Query  378   fessfsvlvVQQYVRTN  328
             F S+ SVLVVQQ+V  N
Sbjct  797   FPSTTSVLVVQQHVEKN  813



>ref|XP_006418010.1| hypothetical protein EUTSA_v10006774mg [Eutrema salsugineum]
 gb|ESQ36363.1| hypothetical protein EUTSA_v10006774mg [Eutrema salsugineum]
Length=863

 Score =   473 bits (1216),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 293/826 (35%), Positives = 454/826 (55%), Gaps = 50/826 (6%)
 Frame = -3

Query  2721  MAAPPPPSTGP--EVDLDRLGQVVMCFSQTIY---RSNGVWEGPDPLAPMIPLFILQIMT  2557
             MA  P  +T P  ++D  R G++V C+ Q++    R    WE    LA  +P FI Q+  
Sbjct  1     MAGLPDNTTNPVYQIDESRYGKIV-CYDQSLLYEKREQKGWESGSTLASSLPFFITQLFV  59

Query  2556  AILSSRILNFVLKPFNQPPLVAEILSGIILGPSMLGNIEEFRKHNFPNHNFETIETMGHF  2377
             A LS R++ ++ +P   PP VA+IL G++  PS+LGN E   +H FP      +ET  + 
Sbjct  60    ANLSYRVIYYLTRPLYLPPFVAQILCGLLFSPSVLGNTEFIIQHVFPYRFTMVLETFANL  119

Query  2376  ALVLYAFLTGLQMDVKAIVHTGTKSRIVAVSGSIFPFLIGAGFYFTLQTDTQSMI--GFI  2203
             ALV   FL GL MD++ +  T  K  I+A +G +     G   Y+         I  G +
Sbjct  120   ALVYNIFLLGLGMDLRMVRITELKPVIIASAGLLVALPAGVFLYYLPGNGHPDKIISGCV  179

Query  2202  FCGSALTVTGFSTLAKILDSKRLLNTEIGKIAASSALINVALSWVLLTIGLLF---TGSL  2032
             F   AL  T F  LA+IL   +LL +++G+ A  +A++    +WVLL  G       G+ 
Sbjct  180   FWSIALACTNFPDLARILADLKLLRSDMGRTAMCAAIVTDLCTWVLLIFGFASFSKAGTW  239

Query  2031  DNVQ-WAvlctvgfvvvcvnyVRPLLNWLISKTPEGQGFSEFYICSFIAVICAFGCFTDA  1855
             + +  W +L T  FV++C+  +RP + W+ +KT +     + ++   +  +   G  TDA
Sbjct  240   NKMMPWVILTTFMFVLLCIYVIRPGITWIFAKTVKAGQVGDTHVWFILGGVVLCGLITDA  299

Query  1854  MGSHPMIGAFIFGLIMPNNELLRTAILDRLEDFVMGILMPVFFLVCGLRTNIFTITDGDT  1675
              G H + GAF+FGL +P++ ++R  I ++L DF+ GILMP+F+++CGLR +I     G  
Sbjct  300   CGVHSITGAFLFGLSIPHDHIIRNMIEEKLHDFLSGILMPLFYIICGLRADI-----GYM  354

Query  1674  SIFT-ALALILLACSA---KIIAALVASCYTGMSTNEAIGLGVLTNTKSTMVMIILEVGq  1507
               FT    + L+ CS+   KI+  ++ S +  M T +A+ +G L NTK T+ +++L  G+
Sbjct  355   LKFTDKFMMTLVICSSFLVKIVTTVIVSLFMKMPTRDALAIGALMNTKGTLSLVVLNAGR  414

Query  1506  vqqvlsvqqysmmvVACLIMTIVATPL-AARYCPKQDLEPYKRRTIQNAKPGEELRILAC  1330
               + L    Y+ M +A L+M++V  PL A  Y PK+ L  YK RT+Q  K   E R+LAC
Sbjct  415   DTKALDSPMYTHMTIALLVMSLVVEPLLAVAYKPKKKLVHYKHRTVQKIKGETEFRVLAC  474

Query  1329  IHGTNNLPAIISLLETSNSTVTSPITAFGVQLLELVGRAPA-MMvvhssgsgrhvggsHE  1153
             +H   N+  I +LL+ SN T  SP+  F + L+EL GR  A +++++     +       
Sbjct  475   VHILPNVSGITNLLQVSNPTKQSPLNVFAIHLVELTGRTTASLLIMNDECKPKANFSDRV  534

Query  1152  EVQTSQIISTFDNYELRSHGVTAQVLTARWSYDTMAEDICKMAKEKRAAFLVLPFHKQQG  973
               ++ QI  TF+  E+ +  +T Q +TA   Y TM EDIC +A++KR  F++LP+HK   
Sbjct  535   RAESDQIAETFEAMEVNNDAMTVQTITAVSPYTTMHEDICALAEDKRVCFIILPYHKHLT  594

Query  972   TDGEMEDTNPAIQTVNEGVLLSAPCSVGILVERG---------RPNQYAKNIAVLYLGGP  820
              DG M + N +   +N+ VL  APCSVGILV+RG         R     + +A+L++GGP
Sbjct  595   PDGRMGEGNSSHADINQNVLSHAPCSVGILVDRGMAMVRSESFRGEPMKREVAMLFVGGP  654

Query  819   DDREALTYARRMSGLPGVHLTVIRFVPAKDVSADGAVEDPDLELELTRETSFVTVSIDPA  640
             DDREAL+YA RM G   + LTV+RFVP ++                        V+ +  
Sbjct  655   DDREALSYAWRMVGQHVIKLTVVRFVPGREALISAG-----------------KVAAEYE  697

Query  639   RDKEEDEELLNNFRTETAEDDSKTFMELVLDDEEEFTKAVKSL-DDRSFDLYVAGRGRGV  463
             R+K+ D+E +  F  +T  D S  ++E V++D ++    ++ + D+ S+DLYV GRG   
Sbjct  698   REKQVDDECIYEFNFKTMNDSSVRYIEKVVNDGQDTISTIREMEDNNSYDLYVVGRGYNS  757

Query  462   SSALTSGLADWCECPELGAVGDllvtsefessfsvlvVQQYVRTNK  325
              S +T+GL DW   PELG +GD L +S F    SVLV+QQY   N+
Sbjct  758   DSPVTAGLNDWSSSPELGTIGDTLASSNFTMHASVLVIQQYSAVNR  803



>gb|KDO78131.1| hypothetical protein CISIN_1g040629mg, partial [Citrus sinensis]
Length=786

 Score =   469 bits (1206),  Expect = 5e-147, Method: Compositional matrix adjust.
 Identities = 291/767 (38%), Positives = 452/767 (59%), Gaps = 43/767 (6%)
 Frame = -3

Query  2652  CFSQTIYRSNGVWEGPDPLAPMIPLFILQIMTAILSSRILNFVLKPFNQPPLVAEILSGI  2473
             C    +  +NG+W   +PL   IPL I+Q+   I  +R L F+L+P  QP LV +IL G+
Sbjct  6     CIILNVTTTNGIWPSKNPLFEPIPLLIVQLAFIITITRSLYFILRPLRQPRLVTDILGGL  65

Query  2472  ILGPSMLGNIEEFRKHNFPNHNFETIETMGHFALVLYAFLTGLQMDVKAIVHTGTKSRIV  2293
             +LGPS  G    F K  FP  +  T+ET+ + AL LY FL GL+MDV +I  +  +   +
Sbjct  66    LLGPSFFGRKAYFSKL-FPVRSVTTLETVAYMALDLYIFLIGLEMDVNSIKSSSKRELNI  124

Query  2292  AVSGSIFPFLIGAGFYF------TLQTDTQSMIGFIFCGSALTVTGFSTLAKILDSKRLL  2131
             A +G++ P  +GAG +F       L TD     G +F G  LTVTGF  +  IL   +LL
Sbjct  125   AAAGALIPMGVGAGLFFLTARLLHLPTDPS---GCLFWGLTLTVTGFPAVTWILGELKLL  181

Query  2130  NTEIGKIAASSALINVALSWVLLTIGLLFTGSLDNVQWAvlctvgfvvvcvnyVRPLLNW  1951
              T+IG++A S A+I+   SW+L+ + L    S +N   A++ T+ F + C+  VRP L W
Sbjct  182   QTDIGRLATSIAMISDVCSWILVAVVLPIRSSPENAPAAIISTIAFSLTCIYAVRPGLEW  241

Query  1950  LISKTPEGQ--GFSEFYICSFI--AVICAFGCFTDAMGSHPMIGAFIFGLIMPNNELLRT  1783
             LI +T +G    +S+ Y+C F+   VIC+F   T+  G+  ++GAF+FG+IMP+ +L   
Sbjct  242   LIRRTSKGNNNAYSDSYLCFFLIGVVICSF--VTEVTGTFSIVGAFVFGIIMPDRDL-GA  298

Query  1782  AILDRLEDFVMGILMPVFFLVCGLRTNIFTITDGDTSIFTALALILLACSAKIIAALVAS  1603
              + +R  DFV GI++P+FF +CG+RTN+  + +     F A  +I+L C  KI+  L+ S
Sbjct  299   LLFERFADFVSGIMLPLFFAMCGIRTNVHKVHNW----FLAGFVIILTCFCKILGTLLVS  354

Query  1602  CYTGMSTNEAIGLGVLTNTKSTMVMIILEVGqvqqvlsvqqysmmvVACLIMTIVATPL-  1426
                 M   + + LGVL NTK  + +++L +G  ++VL  Q+Y++MV+A +IMT    P+ 
Sbjct  355   HSYHMPLQDRLALGVLMNTKGILAVVVLNLGWDKKVLHDQEYAVMVIAIVIMTGGVAPII  414

Query  1425  AARYCPKQDLEPYKRRTIQNAKPGEELRILACIHGTNNLPAIISLLETSNSTVTSPITAF  1246
             +  Y     +  YK R+IQ AK G ELRILAC+HG  N+   I+LLE SN+T  SP+  F
Sbjct  415   STMYRSSTRIIKYKGRSIQRAKQGAELRILACVHGVGNVLGTINLLELSNATKESPLCIF  474

Query  1245  GVQLLELVGRAPAMMvvhssgsgrhvggsHEEVQTSQIISTFDNYELRSHGVTAQVLTAR  1066
              + L+EL G A A+++VH+S              + +I++ F+ +E RS G++   LTA 
Sbjct  475   ALHLVELRGSASAVLIVHTSSKNSAYKRVGSS-PSDRIVNIFEAFENRSTGISVHPLTAM  533

Query  1065  WSYDTMAEDICKMAKEKRAAFLVLPFHKQQG-TDGEMEDTNPAIQTVNEGVLLSAPCSVG  889
               + TM ED+C +A++K  AF++LPFH Q G ++G+   ++P  + VN+ +L +APCSVG
Sbjct  534   SPFITMHEDVCNLAEDKHIAFMILPFHNQAGNSNGDTTGSSP-FREVNKNILANAPCSVG  592

Query  888   ILVERGR---PNQYAKNIAVLYLGGPDDREALTYARRMSGLPGVHLTVIRFVPAKDVSAD  718
             I V++G+    N   +++ ++++GGPDDREAL  A RMS  P V LTV+R         +
Sbjct  593   IFVDKGQGKSDNGRMQHVVMVFIGGPDDREALALAWRMSANPSVQLTVLRL----HSRYN  648

Query  717   GAVEDPDLELELTRETSFVTVSIDPARDKEEDEELLNNFRTETAEDDSKTFMELVLDDEE  538
               V++ D+           +  ID  R  + D E +N FR +TA + +  + E V+++ E
Sbjct  649   NNVKEEDIRY---------SKCID-GRQSQVDAEFVNEFRLQTAGEHNVNYYEKVVNNRE  698

Query  537   EFTKAVKSLDDRSFDLYVAGRGRGVSSALTSGLADWCECPELGAVGD  397
             E T A++ ++ +   LY+ GR   ++SA T+ L  W ECPE+GA+GD
Sbjct  699   ETTGALREMELQKVGLYIVGR-EVMASAATADLLGWSECPEIGAIGD  744



>emb|CDY47266.1| BnaA10g03800D [Brassica napus]
Length=840

 Score =   470 bits (1210),  Expect = 5e-147, Method: Compositional matrix adjust.
 Identities = 288/819 (35%), Positives = 454/819 (55%), Gaps = 52/819 (6%)
 Frame = -3

Query  2700  STGPEVDLDRLGQVVMCFSQTIY---RSNGVWEGPDPLAPMIPLFILQIMTAILSSRILN  2530
             +T  E+D+ R G++V C+ Q++    R    WE    LA  +P FI Q+  A LS R++ 
Sbjct  11    NTAYEIDVSRFGKIV-CYDQSLLFEKREQKGWESGSTLASSLPFFITQLFVANLSYRVIY  69

Query  2529  FVLKPFNQPPLVAEILSGIILGPSMLGNIEEFRKHNFPNHNFETIETMGHFALVLYAFLT  2350
             ++ +P   PP VA+IL G++  PS+LGN E   +H FP      +ET  + ALV   FL 
Sbjct  70    YLTRPLYLPPFVAQILCGLLFSPSVLGNSEFIVQHVFPYRFTMVLETFANLALVYNIFLL  129

Query  2349  GLQMDVKAIVHTGTKSRIVAVSGSIFPFLIGAGFYFTLQTDTQSMI--GFIFCGSALTVT  2176
             GL MD++ +  T  K  I+A +G +    +G   Y+         I  G +F   AL  T
Sbjct  130   GLGMDLRMVRITEAKPVIIAFAGLLIALPVGVFLYYLPGNGDPEKITSGCVFWSLALACT  189

Query  2175  GFSTLAKILDSKRLLNTEIGKIAASSALINVALSWVLLTIGLLF---TGSLDNVQ-WAvl  2008
              F  LA++L   +LL +++G+ A  +A+I    +WVLL          G+ + +  W +L
Sbjct  190   NFPDLARVLADLKLLRSDMGRTAMCAAIITDLCTWVLLVFAFASFNKAGTWNQMMPWVIL  249

Query  2007  ctvgfvvvcvnyVRPLLNWLISKTPEGQGFSEFYICSFIAVICAFGCFTDAMGSHPMIGA  1828
              T  FV++C+  +RP + W+ +KT +     + ++   +  +   G  TDA G H + GA
Sbjct  250   TTFIFVLLCIYVIRPGITWIFAKTVKAGQVGDTHVWFILGGVVLCGLITDACGVHSITGA  309

Query  1827  FIFGLIMPNNELLRTAILDRLEDFVMGILMPVFFLVCGLRTNIFTITDGDTSIFT-ALAL  1651
             F+FGL +P++ ++R  I ++L DF+ GILMP+F+++CGLR +I     G    FT    L
Sbjct  310   FLFGLSIPHDHIIRNMIEEKLHDFLSGILMPLFYIICGLRADI-----GYMLRFTDKFIL  364

Query  1650  ILLACSA---KIIAALVASCYTGMSTNEAIGLGVLTNTKSTMVMIILEVGqvqqvlsvqq  1480
             +L+ CS+   KI+  +V S +  M T +A+ +G L NTK T+ +++L  G+  + L    
Sbjct  365   VLVICSSFLVKIVTTVVVSLFMQMPTRDALAIGALMNTKGTLSLVVLNAGRDTKALDSPM  424

Query  1479  ysmmvVACLIMTIVATP-LAARYCPKQDLEPYKRRTIQNAKPGEELRILACIHGTNNLPA  1303
             Y+ M +A L+M++V  P LA  Y PK+ L  YK RT+Q  K   E R+LAC+H   N+  
Sbjct  425   YTHMTIALLVMSLVVEPLLAVAYKPKKRLVHYKHRTVQKIKGETEFRVLACVHILPNVSG  484

Query  1302  IISLLETSNSTVTSPITAFGVQLLELVGRAPA-MMvvhssgsgrhvggsHEEVQTSQIIS  1126
             + +LL+ SN T  SP+  F + L+EL GR  A +++++     +         ++ QI  
Sbjct  485   VTNLLQVSNPTKQSPLNVFAIHLVELTGRTTASLLIMNDENKPKANFSDRVRAESDQIAE  544

Query  1125  TFDNYELRSHGVTAQVLTARWSYDTMAEDICKMAKEKRAAFLVLPFHKQQGTDGEMEDTN  946
             +F+  E+ +  +  Q +TA   Y TM EDIC +A++KR  F++LP+HK    DG M + N
Sbjct  545   SFEAMEVNNDAMMVQTITAVSPYATMHEDICALAEDKRVCFIILPYHKHLTPDGRMGEGN  604

Query  945   PAIQTVNEGVLLSAPCSVGILVER-----------GRPNQYAKNIAVLYLGGPDDREALT  799
              +   +N+ VL  APCSVGILV+R           G PN+  + +A+L++GGPDDREAL+
Sbjct  605   SSHADINQNVLNHAPCSVGILVDRGMAMVRSESFHGEPNK--RGVAMLFVGGPDDREALS  662

Query  798   YARRMSGLPGVHLTVIRFVPAKDVSADGAVEDPDLELELTRETSFVTVSIDPARDKEEDE  619
             YA RM G   ++LTV+RFVP ++                        V+ +  R+K+ D+
Sbjct  663   YAWRMVGQHQINLTVVRFVPGREALVSAG-----------------KVAAEYEREKQVDD  705

Query  618   ELLNNFRTETAEDDSKTFMELVLDDEEEFTKAVKSL-DDRSFDLYVAGRGRGVSSALTSG  442
             E +  F  +T  D S  ++E V++D ++    ++ + D+ S+DLYV GRG    S +T+G
Sbjct  706   ECIYEFNFKTMNDSSVKYIEKVVNDGQDTISTIREMEDNNSYDLYVVGRGYNSDSPVTAG  765

Query  441   LADWCECPELGAVGDllvtsefessfsvlvVQQYVRTNK  325
             L DW   PELG +GD L +S F    SVLV+QQ+   N+
Sbjct  766   LNDWSSSPELGTIGDTLASSNFTMHASVLVIQQFSAVNR  804



>ref|XP_009119138.1| PREDICTED: cation/H(+) antiporter 23, chloroplastic [Brassica 
rapa]
Length=865

 Score =   471 bits (1211),  Expect = 8e-147, Method: Compositional matrix adjust.
 Identities = 288/819 (35%), Positives = 454/819 (55%), Gaps = 52/819 (6%)
 Frame = -3

Query  2700  STGPEVDLDRLGQVVMCFSQTIY---RSNGVWEGPDPLAPMIPLFILQIMTAILSSRILN  2530
             +T  E+D+ R G++V C+ Q++    R    WE    LA  +P FI Q+  A LS R++ 
Sbjct  11    NTAYEIDVSRFGKIV-CYDQSLLFEKREQKGWESGSTLASSLPFFITQLFVANLSYRVIY  69

Query  2529  FVLKPFNQPPLVAEILSGIILGPSMLGNIEEFRKHNFPNHNFETIETMGHFALVLYAFLT  2350
             ++ +P   PP VA+IL G++  PS+LGN E   +H FP      +ET  + ALV   FL 
Sbjct  70    YLTRPLYLPPFVAQILCGLLFSPSVLGNSEFIVQHVFPYRFTMVLETFANLALVYNIFLL  129

Query  2349  GLQMDVKAIVHTGTKSRIVAVSGSIFPFLIGAGFYFTLQTDTQSMI--GFIFCGSALTVT  2176
             GL MD++ +  T  K  I+A +G +    +G   Y+         I  G +F   AL  T
Sbjct  130   GLGMDLRMVRITEAKPVIIAFAGLLIALPVGVFLYYLPGNGDPEKITSGCVFWSLALACT  189

Query  2175  GFSTLAKILDSKRLLNTEIGKIAASSALINVALSWVLLTIGLLF---TGSLDNVQ-WAvl  2008
              F  LA++L   +LL +++G+ A  +A+I    +WVLL          G+ + +  W +L
Sbjct  190   NFPDLARVLADLKLLRSDMGRTAMCAAIITDLCTWVLLVFAFASFNKAGTWNQMMPWVIL  249

Query  2007  ctvgfvvvcvnyVRPLLNWLISKTPEGQGFSEFYICSFIAVICAFGCFTDAMGSHPMIGA  1828
              T  FV++C+  +RP + W+ +KT +     + ++   +  +   G  TDA G H + GA
Sbjct  250   TTFIFVLLCIYVIRPGITWIFAKTVKAGQVGDTHVWFILGGVVLCGLITDACGVHSITGA  309

Query  1827  FIFGLIMPNNELLRTAILDRLEDFVMGILMPVFFLVCGLRTNIFTITDGDTSIFT-ALAL  1651
             F+FGL +P++ ++R  I ++L DF+ GILMP+F+++CGLR +I     G    FT    L
Sbjct  310   FLFGLSIPHDHIIRNMIEEKLHDFLSGILMPLFYIICGLRADI-----GYMLRFTDKFIL  364

Query  1650  ILLACSA---KIIAALVASCYTGMSTNEAIGLGVLTNTKSTMVMIILEVGqvqqvlsvqq  1480
             +L+ CS+   KI+  +V S +  M T +A+ +G L NTK T+ +++L  G+  + L    
Sbjct  365   VLVICSSFLVKIVTTVVVSLFMQMPTRDALAIGALMNTKGTLSLVVLNAGRDTKALDSPM  424

Query  1479  ysmmvVACLIMTIVATP-LAARYCPKQDLEPYKRRTIQNAKPGEELRILACIHGTNNLPA  1303
             Y+ M +A L+M++V  P LA  Y PK+ L  YK RT+Q  K   E R+LAC+H   N+  
Sbjct  425   YTHMTIALLVMSLVVEPLLAVAYKPKKRLVHYKHRTVQKIKGETEFRVLACVHILPNVSG  484

Query  1302  IISLLETSNSTVTSPITAFGVQLLELVGRAPA-MMvvhssgsgrhvggsHEEVQTSQIIS  1126
             + +LL+ SN T  SP+  F + L+EL GR  A +++++     +         ++ QI  
Sbjct  485   VTNLLQVSNPTKQSPLNVFAIHLVELTGRTTASLLIMNDENKPKANFSDRVRAESDQIAE  544

Query  1125  TFDNYELRSHGVTAQVLTARWSYDTMAEDICKMAKEKRAAFLVLPFHKQQGTDGEMEDTN  946
             +F+  E+ +  +  Q +TA   Y TM EDIC +A++KR  F++LP+HK    DG M + N
Sbjct  545   SFEAMEVNNDAMMVQTITAVSPYATMHEDICALAEDKRVCFIILPYHKHLTPDGRMGEGN  604

Query  945   PAIQTVNEGVLLSAPCSVGILVER-----------GRPNQYAKNIAVLYLGGPDDREALT  799
              +   +N+ VL  APCSVGILV+R           G PN+  + +A+L++GGPDDREAL+
Sbjct  605   SSHADINQNVLNHAPCSVGILVDRGMAMVRSESFHGEPNK--RGVAMLFVGGPDDREALS  662

Query  798   YARRMSGLPGVHLTVIRFVPAKDVSADGAVEDPDLELELTRETSFVTVSIDPARDKEEDE  619
             YA RM G   ++LTV+RFVP ++                        V+ +  R+K+ D+
Sbjct  663   YAWRMVGQHQINLTVVRFVPGREALVSAG-----------------KVAAEYEREKQVDD  705

Query  618   ELLNNFRTETAEDDSKTFMELVLDDEEEFTKAVKSL-DDRSFDLYVAGRGRGVSSALTSG  442
             E +  F  +T  D S  ++E V++D ++    ++ + D+ S+DLYV GRG    S +T+G
Sbjct  706   ECIYEFNFKTMNDSSVKYIEKVVNDGQDTISTIREMEDNNSYDLYVVGRGYNSDSPVTAG  765

Query  441   LADWCECPELGAVGDllvtsefessfsvlvVQQYVRTNK  325
             L DW   PELG +GD L +S F    SVLV+QQ+   N+
Sbjct  766   LNDWSSSPELGTIGDTLASSNFTMHASVLVIQQFSAVNR  804



>emb|CDY10128.1| BnaC05g03710D [Brassica napus]
Length=866

 Score =   469 bits (1206),  Expect = 4e-146, Method: Compositional matrix adjust.
 Identities = 286/817 (35%), Positives = 453/817 (55%), Gaps = 48/817 (6%)
 Frame = -3

Query  2700  STGPEVDLDRLGQVVMCFSQTIY---RSNGVWEGPDPLAPMIPLFILQIMTAILSSRILN  2530
             +T  E+D+ R G++V C+ Q++    R    WE    LA  +P FI Q+  A LS R++ 
Sbjct  11    NTAYEIDVSRFGKIV-CYDQSLLFEKREQKGWESGSTLASSLPFFITQLFVANLSYRVIY  69

Query  2529  FVLKPFNQPPLVAEILSGIILGPSMLGNIEEFRKHNFPNHNFETIETMGHFALVLYAFLT  2350
             ++ +P   PP VA+IL G++  PS+LGN E   +H FP      +ET  + ALV   FL 
Sbjct  70    YLTRPLYLPPFVAQILCGLLFSPSVLGNSEFIVQHVFPYRFTMVLETFANLALVYNIFLL  129

Query  2349  GLQMDVKAIVHTGTKSRIVAVSGSIFPFLIGAGFYFTLQTDTQSMI--GFIFCGSALTVT  2176
             GL MD++ +  T  K  I+A +G +    +G   Y+         I  G +F   AL  T
Sbjct  130   GLGMDLRMVRITEAKPVIIAFAGLLIALPVGVFLYYLPGNGDPEKIKSGCVFWSLALACT  189

Query  2175  GFSTLAKILDSKRLLNTEIGKIAASSALINVALSWVLLTIGLLF---TGSLDNVQ-WAvl  2008
              F  LA++L   +LL +++G+ A  +A+I    +WVLL          G+ + +  W +L
Sbjct  190   NFPDLARVLADLKLLRSDMGRTAMCAAIITDLCTWVLLVFAFASFNKAGTWNQMMPWVIL  249

Query  2007  ctvgfvvvcvnyVRPLLNWLISKTPEGQGFSEFYICSFIAVICAFGCFTDAMGSHPMIGA  1828
              T  FV++C+  +RP + W+ +KT +     + ++   +  +   G  TDA G H + GA
Sbjct  250   TTFIFVLLCIYVIRPGITWIFAKTVKAGQVGDTHVWFILGGVVLCGLITDACGVHSITGA  309

Query  1827  FIFGLIMPNNELLRTAILDRLEDFVMGILMPVFFLVCGLRTNIFTITDGDTSIFT-ALAL  1651
             F+FGL +P++ ++R  I ++L DF+ GILMP+F+++CGLR +I     G    FT    +
Sbjct  310   FLFGLSIPHDHIIRNMIEEKLHDFLSGILMPLFYIICGLRADI-----GYMLKFTDKFIM  364

Query  1650  ILLACSA---KIIAALVASCYTGMSTNEAIGLGVLTNTKSTMVMIILEVGqvqqvlsvqq  1480
             +L+ CS+   KI+  +V S +  M T +A+ +G L NTK T+ +++L  G+  + L    
Sbjct  365   VLVICSSFLVKIVTTVVVSLFMQMPTRDALAIGALMNTKGTLSLVVLNAGRDTKALDSPM  424

Query  1479  ysmmvVACLIMTIVATP-LAARYCPKQDLEPYKRRTIQNAKPGEELRILACIHGTNNLPA  1303
             Y+ M +A L+M++V  P LA  Y PK+ L  YK RT+Q  K   E R+LAC+H   N+  
Sbjct  425   YTHMTIALLVMSLVVEPLLAVAYKPKKRLVHYKHRTVQKIKGETEFRVLACVHILPNVSG  484

Query  1302  IISLLETSNSTVTSPITAFGVQLLELVGRAPA-MMvvhssgsgrhvggsHEEVQTSQIIS  1126
             + +LL+ SN T  SP+  F + L+EL GR  A +++++     +         ++ QI  
Sbjct  485   VTNLLQVSNPTKQSPLNVFAIHLVELTGRTTASLLIMNDENKPKANFSDRVRAESDQIAE  544

Query  1125  TFDNYELRSHGVTAQVLTARWSYDTMAEDICKMAKEKRAAFLVLPFHKQQGTDGEMEDTN  946
             +F+  E+ +  +  Q +TA   Y TM EDIC +A++KR  F++LP+HK    DG M + N
Sbjct  545   SFEAMEVNNDAMMVQTITAVSPYTTMHEDICALAEDKRVCFIILPYHKHLTPDGRMGEGN  604

Query  945   PAIQTVNEGVLLSAPCSVGILVERG----RPNQY-----AKNIAVLYLGGPDDREALTYA  793
              +   +N+ VL  APCSVGILV+RG    R   +      + +A+L++GGPDDREAL+YA
Sbjct  605   SSHADINQNVLNHAPCSVGILVDRGMAMVRSESFHGEPTKRGVAMLFVGGPDDREALSYA  664

Query  792   RRMSGLPGVHLTVIRFVPAKDVSADGAVEDPDLELELTRETSFVTVSIDPARDKEEDEEL  613
              RM G   ++LTV+RFVP ++                        V+ +  R+K+ D+E 
Sbjct  665   WRMVGQHQINLTVVRFVPGREALVSAG-----------------KVAAEYEREKQVDDEC  707

Query  612   LNNFRTETAEDDSKTFMELVLDDEEEFTKAVKSL-DDRSFDLYVAGRGRGVSSALTSGLA  436
             +  F  +T  D S  ++E V++D ++    ++ + D+ S+DLYV GRG    S +T+GL 
Sbjct  708   IYEFNFKTMNDSSVKYIEKVVNDGQDTISTIREMEDNNSYDLYVVGRGYNSDSPVTAGLN  767

Query  435   DWCECPELGAVGDllvtsefessfsvlvVQQYVRTNK  325
             DW   PELG +GD L +S F    SVLV+QQ+   N+
Sbjct  768   DWSSSPELGTIGDTLASSNFTMHASVLVIQQFSAVNR  804



>gb|KDP37950.1| hypothetical protein JCGZ_04593 [Jatropha curcas]
Length=846

 Score =   468 bits (1204),  Expect = 4e-146, Method: Compositional matrix adjust.
 Identities = 273/770 (35%), Positives = 456/770 (59%), Gaps = 34/770 (4%)
 Frame = -3

Query  2652  CFSQTIYRSNGVWEGPDPLAPMIPLFILQIMTAILSSRILNFVLKPFNQPPLVAEILSGI  2473
             C+   +   +G W+  +PL+  +PL   Q+   I+ +R+L ++ KP   P +V +IL+GI
Sbjct  20    CYIVNVTAEHGYWQSENPLSQALPLLAWQLSIVIMINRVLFYLFKPLGTPRIVTDILAGI  79

Query  2472  ILGPSMLGNIEEFRKHNFPNHNFETIETMGHFALVLYAFLTGLQMDVKAIVHTGTKSRIV  2293
             ++GPS+L     F    FP  +   +ET+  +AL  + FLTGL++D+ +I+  G KS  +
Sbjct  80    LIGPSLLSK-SRFFAGLFPLRSIFIVETVSFWALTCHLFLTGLEIDMTSILRAGNKSIGL  138

Query  2292  AVSGSIFPFLIGAGFYF---TLQTDTQSMIGFIFCGSALTVTGFSTLAKILDSKRLLNTE  2122
             A+ G++ PF++G   Y    + +       G +F G+AL++T +  +A++L  ++LL+ +
Sbjct  139   AIVGTVLPFIMGICLYLIEASFRGGPYRSSGCVFWGAALSITSYPVVARVLADQKLLHID  198

Query  2121  IGKIAASSALINVALSWVLLTIGLLFTGSLDNVQWAvlctvgfvvvcvnyVRPLLNWLIS  1942
             IG++A S ++I+   +W+++++ +  +    N   +++ T GFV  C   +RP L ++I 
Sbjct  199   IGRLAMSISIISEVFAWLMVSVLIPASVGPMNAILSLIATTGFVAFCFTAIRPFLVFIIK  258

Query  1941  KTPEGQGFSEFYICSFIAVICAFGCFTDAMGSHPMIGAFIFGLIMPNNELLRTAILDRLE  1762
             K+  G  +SE+ +C  +  +  F   +D +G+  ++GAF+FG+IMPN  +L +A+L++ E
Sbjct  259   KSTNGNKYSEYCLCFILVSVSFFSLASDLLGTTSIVGAFVFGIIMPN-RVLASALLEKFE  317

Query  1761  DFVMGILMPVFFLVCGLRTNIFTITDGDTSIFTALALILLACSAKIIAALVASCYTGMST  1582
             DF+   L+P+FF   G+R +I++I++        L +I+L CS KII+  +AS Y  ++ 
Sbjct  318   DFITAYLLPLFFASMGIRLDIWSISNW----ILDLVMIILFCSVKIISIFLASHYYQLTR  373

Query  1581  NEAIGLGVLTNTKSTMVMIILEVGqvqqvlsvqqysmmvVACLIMTIVATPL-AARYCPK  1405
              +   LGVL NTK  + +IIL +G  + +L  + Y +M++A L+MT +  P+ ++ Y P 
Sbjct  374   EDGFALGVLMNTKGILTLIILNMGFDKSILLQEDYVVMMLAILVMTGIVPPIISSIYNPN  433

Query  1404  QDLEPYKRRTIQNAKPGEELRILACIHGTNNLPAIISLLETSNSTVTSPITAFGVQLLEL  1225
             + L  YK+RTI +A+P  E R+LAC   + N+  +I L++ SN+T  SP+T F + L+EL
Sbjct  434   KRLSHYKQRTIVHARPDTEFRMLACFQSSRNVVGMIHLIDCSNATKESPLTIFALHLVEL  493

Query  1224  VGRAPAMMvvhssgsgrhvggsHEEVQTSQIISTFDNYELRSHGVTAQVLTARWSYDTMA  1045
              GRA AM+      +G   GG+     + QIIS+ + Y   +  V    LTA   + TM 
Sbjct  494   TGRASAML---IVHNGNKSGGTSRNAYSEQIISSLETYANLNELVAMHPLTALSPFATMH  550

Query  1044  EDICKMAKEKRAAFLVLPFHKQQGTDGEM-EDTNPAIQTVNEGVLLSAPCSVGILVER--  874
             EDIC +A++K   FL+LPFHK    DG++ ED + + + VN  VL  APC+VGI V+R  
Sbjct  551   EDICCLAEDKEVGFLILPFHKLPTPDGKLEEDGSTSFRGVNLNVLADAPCTVGIFVDRGF  610

Query  873   ---GRPNQYAKNIAVLYLGGPDDREALTYARRMSGLPGVHLTVIRFVPAKDVS-----AD  718
                G  N   + IA+ ++GGPDDREAL++A RM    GV LTV+RF+P + V        
Sbjct  611   GAVGESNLTLRQIAMFFIGGPDDREALSFAWRMGLTHGVSLTVVRFIPGEGVEDALRQQQ  670

Query  717   GAVEDP---DLELELTRETSFVTVSIDPARDKEEDEELLNNFRTETAEDDSKTFMELVLD  547
                + P   D+ +     TSFV       R K+ D+E +N FR ++A  +  ++ E +++
Sbjct  671   QQQKHPNSVDIAVRTLSNTSFVD------RQKKLDDEFVNEFRLKSAGVEFMSYEEKIVN  724

Query  546   DEEEFTKAVKSLDDRSFDLYVAGRGRGVSSALTSGLADWCECPELGAVGD  397
             ++E+  + +K +    +DLYV GR   + S+LT+GL DWCE PELGA+GD
Sbjct  725   NDEDIIQELKGM-HHIYDLYVVGRSEVMQSSLTAGLMDWCEFPELGAMGD  773



>gb|EMS52978.1| Cation/H(+) antiporter 15 [Triticum urartu]
Length=878

 Score =   469 bits (1206),  Expect = 5e-146, Method: Compositional matrix adjust.
 Identities = 288/776 (37%), Positives = 454/776 (59%), Gaps = 25/776 (3%)
 Frame = -3

Query  2658  VMCFSQTIYRSNGVWEGP--DPLAPMIPLFILQIMTAILSSRILNFVLKPFNQPPLVAEI  2485
             V+C+S  +  +NG+W+G   +PL   +PLFI+Q+   ++++R+L  +L+PF QP ++AEI
Sbjct  34    VVCYSPMMMTTNGMWQGDGVNPLEFSLPLFIVQVAVIVVTTRLLVVLLRPFRQPRVIAEI  93

Query  2484  LSGIILGPSMLGNIEEFRKHNFPNHNFETIETMGHFALVLYAFLTGLQMDVKAIVHTGTK  2305
             L+G++LGPSM+G  E +    FP  +  T+ET+ H  L+ + FL GL+MDV  I  +G K
Sbjct  94    LAGVVLGPSMIGRSEVWASLVFPVRSLLTLETVAHLGLLFFLFLVGLEMDVDVIRRSGDK  153

Query  2304  SRIVAVSGSIFPFLIGAGFYFTLQTDTQSMIG----FIFCGSALTVTGFSTLAKILDSKR  2137
             + +VA++G   PF +G    F  +      +      +F G AL+VT F  LA+IL   +
Sbjct  154   AVLVAMAGMALPFCMGIATSFIFRHQVSRNVHQTSFLLFLGVALSVTAFPVLARILAEIK  213

Query  2136  LLNTEIGKIAASSALINVALSWVLLTIGL----LFTGSLDNVQWAvlctvgfvvvcvnyV  1969
             LLN+E+G+ A S+A++N   +W+LL + +    + + +L ++ W +L  V FV+ C   V
Sbjct  214   LLNSELGRTAMSAAIVNDMCAWILLALAISISEVHSTALSSL-WVLLAGVTFVLFCFYAV  272

Query  1968  RPLLNWLISKTPEGQGFSEFYICSFIAVICAFGCFTDAMGSHPMIGAFIFGLIMPNNELL  1789
             RPL+  LI   PEG G S   +   +  +   G  TDA+G H + GAF++GL++P+  L 
Sbjct  273   RPLMWRLIRSIPEGDGISNTQVTLILTGVMIAGACTDAIGIHSVFGAFVYGLVIPSAPLG  332

Query  1788  RTAILDRLEDFVMGILMPVFFLVCGLRTNIFTITDGDTSIFTALALILLACSAKIIAALV  1609
              T ++++LEDFV G+L+P+FF + GLRTN+  I D  T     L  + +A  AKI+  ++
Sbjct  333   VT-LIEKLEDFVTGLLLPLFFAMSGLRTNVRMIRDPITVGLLVLVFV-MASFAKIMGTII  390

Query  1608  ASCYTGMSTNEAIGLGVLTNTKSTMVMIILEVGqvqqvlsvqqysmmvVACLIMTIVATP  1429
              +    M   E I LG L NT+  + MI+L +G+ +QVL  + +++MV+  + MT + TP
Sbjct  391   IAALYAMPFREGIALGFLMNTRGLVEMIVLNIGRDKQVLDDESFAVMVLVSVAMTSLVTP  450

Query  1428  LA-ARYCPKQDLEPYKRRTIQNAKPGEELRILACIHGTNNLPAIISLLETSNSTVTSPIT  1252
             +    Y P + L  YKRR +Q  +   ELR+LAC+H T N+P+++SLLE SN +  SPI 
Sbjct  451   VVTGVYRPSRRLVGYKRRNLQLIRHDSELRMLACVHTTRNVPSVLSLLELSNPSKRSPIF  510

Query  1251  AFGVQLLELVGRAPAMMvvhssgsgrhvggsHE-EVQTSQIISTFDNYELRSHGVTAQVL  1075
              + + ++EL GRA  M+   ++ S      S      T  I + F+NYE  + GV+ Q L
Sbjct  511   IYALHIIELTGRASNMLAAAAASSSSRTSSSSALPAATEHIFNAFENYERLTGGVSIQTL  570

Query  1074  TARWSYDTMAEDICKMAKEKRAAFLVLPFHKQQGTDGEMEDTNPAIQTVNEGVLLSAPCS  895
              A   Y TM +D+  +A++K  + +V+PFHKQQ  DG ME  NP+I+  NE +L ++PCS
Sbjct  571   AAVSPYQTMHDDVSVLAEDKHVSLIVIPFHKQQTVDGGMEPINPSIKLFNESLLATSPCS  630

Query  894   VGILVERGRPNQYAK-----NIAVLYLGGPDDREALTYARRMSGLPGVHLTVIRFVPAKD  730
             V ILV+RG     A+      +A+ + GGPDDREAL YA RM   PGV LT++RF+P   
Sbjct  631   VAILVDRGLSAAAARMATEHRVALFFFGGPDDREALAYAWRMVENPGVALTILRFLPPDY  690

Query  729   VSADGAVEDPDLELE----LTRETSFVTVSIDPARDKEEDEELLNNFRTETAEDDSKTFM  562
              +A  +  +          +    + ++ S +   + + DEE L  FR     + S T+ 
Sbjct  691   RAAARSFSEASYRSAASGGMDPRGAAMSASTEGKSELQMDEEYLGEFRARNHGNPSITYA  750

Query  561   ELVLDDEEEFTKAVKSLDDRSFDLYVAGRGRG-VSSALTSGLADWCECPELGAVGD  397
             +  + + EE   A++ +D+ + +LY+ GR  G   S +T+ L DW E PELG +GD
Sbjct  751   DRPVTNSEETVAAIRGMDNSAHELYIVGRRPGEAGSPMTAALEDWMESPELGPIGD  806



>ref|XP_002892302.1| cation/H+ exchanger [Arabidopsis lyrata subsp. lyrata]
 gb|EFH68561.1| cation/H+ exchanger [Arabidopsis lyrata subsp. lyrata]
Length=866

 Score =   468 bits (1204),  Expect = 8e-146, Method: Compositional matrix adjust.
 Identities = 290/821 (35%), Positives = 451/821 (55%), Gaps = 42/821 (5%)
 Frame = -3

Query  2718  AAPPPPSTGPEVDLD--RLGQVVMCFSQTIY---RSNGVWEGPDPLAPMIPLFILQIMTA  2554
             +  P   T P  D++  R G++V C+ Q++    R    WE    LA  +P FI Q+  A
Sbjct  3     SGAPLNVTNPSYDIEISRFGKIV-CYDQSLLFEKREQKGWESGSTLASSLPFFITQLFVA  61

Query  2553  ILSSRILNFVLKPFNQPPLVAEILSGIILGPSMLGNIEEFRKHNFPNHNFETIETMGHFA  2374
              LS R+L ++ +PF  PP VA+IL G++  PS+LGN      H FP      +ET  + A
Sbjct  62    NLSYRVLYYITRPFYLPPFVAQILCGLLFSPSVLGNTPFIVTHVFPYRFTMVLETFANLA  121

Query  2373  LVLYAFLTGLQMDVKAIVHTGTKSRIVAVSGSIFPFLIGAGFYFTLQTDTQSMI--GFIF  2200
             LV   FL GL MD++ +  T  K  I+A +G +    +GA  Y+         I  G +F
Sbjct  122   LVYNIFLLGLGMDLRMVRITELKPVIIAFAGLLVALPVGAFLYYLPGNGHPDKIISGCVF  181

Query  2199  CGSALTVTGFSTLAKILDSKRLLNTEIGKIAASSALINVALSWVLLTIGLLF---TGSLD  2029
                AL  T F  LA+IL   +LL +++G+ A  +A+I    +WVLL  G       G+ +
Sbjct  182   WSVALACTNFPDLARILADLKLLRSDMGRTAMCAAIITDLCTWVLLVFGFASFSKAGTWN  241

Query  2028  N-VQWAvlctvgfvvvcvnyVRPLLNWLISKTPEGQGFSEFYICSFIAVICAFGCFTDAM  1852
               + + ++ T  FV++C+  +RP + W+ SKT +     + ++   +  +   G  TDA 
Sbjct  242   KFMPFVIVVTAIFVLLCIFVIRPGIAWIFSKTVKAGHVGDTHVWFILGGVVLCGLITDAC  301

Query  1851  GSHPMIGAFIFGLIMPNNELLRTAILDRLEDFVMGILMPVFFLVCGLRTNIFTITDGDTS  1672
             G H + GAF+FGL +P++ ++R  I ++L DF+ GILMP+F+++CGLR +I  + D  T 
Sbjct  302   GVHSITGAFLFGLSIPHDHIIRNMIEEKLHDFLSGILMPLFYIICGLRADIGFMLD-YTD  360

Query  1671  IFTALALILLACSAKIIAALVASCYTGMSTNEAIGLGVLTNTKSTMVMIILEVGqvqqvl  1492
              F  + +I  +   KI+  +V S +  M   +A  +G L NTK T+ +++L  G+  + L
Sbjct  361   KFMMVVVICSSFLVKIVTTVVTSLFMHMPMRDAFAIGALMNTKGTLSLVVLNAGRDTKAL  420

Query  1491  svqqysmmvVACLIMTIVATP-LAARYCPKQDLEPYKRRTIQNAKPGEELRILACIHGTN  1315
                 Y+ M +A L+M++V  P LA  Y PK+ L  YK RT+Q  K   E R+LAC+H   
Sbjct  421   DSPMYTHMTIALLVMSLVVEPLLAVAYKPKKKLVHYKYRTVQKIKGETEFRVLACVHILP  480

Query  1314  NLPAIISLLETSNSTVTSPITAFGVQLLELVGRAPA-MMvvhssgsgrhvggsHEEVQTS  1138
             N+  I +LL+ SN T  SP++ F + L+EL GR  A +++++     +         ++ 
Sbjct  481   NVSGITNLLQVSNPTKQSPLSVFAIHLVELTGRTTASLLIMNDECKPKANFSDRVRAESD  540

Query  1137  QIISTFDNYELRSHGVTAQVLTARWSYDTMAEDICKMAKEKRAAFLVLPFHKQQGTDGEM  958
             QI  TF+  E+ +  +T Q +TA   Y TM EDIC +A++KR  F++LP+HK    DG M
Sbjct  541   QIAETFEAMEVNNDAMTVQTITAVSPYATMHEDICALAEDKRVCFIILPYHKHLTPDGRM  600

Query  957   EDTNPAIQTVNEGVLLSAPCSVGILVERG---------RPNQYAKNIAVLYLGGPDDREA  805
              + N +   +N+ VL  APCSVGILV+RG         R     + +A+L++GGPDDREA
Sbjct  601   GEGNSSHAEINQNVLSHAPCSVGILVDRGMAMVRSESFRGEAMKREVAMLFVGGPDDREA  660

Query  804   LTYARRMSGLPGVHLTVIRFVPAKDVSADGAVEDPDLELELTRETSFVTVSIDPARDKEE  625
             L+YA RM G   + LTV+RFVP ++                        V+ +  R+K+ 
Sbjct  661   LSYAWRMVGQHVIKLTVVRFVPGREALISSG-----------------KVAAEYEREKQV  703

Query  624   DEELLNNFRTETAEDDSKTFMELVLDDEEEFTKAVKSL-DDRSFDLYVAGRGRGVSSALT  448
             D+E +  F  +T  D S  ++E V++D ++    ++ + D+ S+DLYV GRG    + +T
Sbjct  704   DDECIYEFNFKTMNDSSVKYIEKVVNDGQDTISTIREMEDNNSYDLYVVGRGYNSETPVT  763

Query  447   SGLADWCECPELGAVGDllvtsefessfsvlvVQQYVRTNK  325
             +GL DW   PELG +GD L +S F    SVLV+QQY  T +
Sbjct  764   AGLNDWSSSPELGTIGDTLASSNFTMHASVLVIQQYSATKR  804



>ref|XP_010457647.1| PREDICTED: cation/H(+) antiporter 23, chloroplastic-like [Camelina 
sativa]
Length=859

 Score =   467 bits (1202),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 291/823 (35%), Positives = 451/823 (55%), Gaps = 44/823 (5%)
 Frame = -3

Query  2721  MAAPPPPSTGP--EVDLDRLGQVVMCFSQTIY---RSNGVWEGPDPLAPMIPLFILQIMT  2557
             M++ P  +T P  E++  R G++V C+ Q +    R    WE    LA  +P FI Q+  
Sbjct  1     MSSDPFNTTEPKYEIEESRFGKIV-CYDQQLLFEKREQKGWESGSTLASSLPFFITQLFV  59

Query  2556  AILSSRILNFVLKPFNQPPLVAEILSGIILGPSMLGNIEEFRKHNFPNHNFETIETMGHF  2377
             A LS R+L ++ +PF  PP VA+IL G++  PS+LGN++   +H FP      +ET  + 
Sbjct  60    ANLSYRVLYYITRPFYLPPFVAQILCGLLFSPSVLGNVDIVIQHIFPYRFTMVLETFANL  119

Query  2376  ALVLYAFLTGLQMDVKAIVHTGTKSRIVAVSGSIFPFLIGAGFYFTLQTDTQSMI--GFI  2203
             ALV   FL GL MD++ +  T  K  I+A +G      +GA  Y+         I  G +
Sbjct  120   ALVYNIFLLGLGMDLRMVRITEFKPVIIAFAGLFVALPVGAALYYLPGNGHPEKILAGCV  179

Query  2202  FCGSALTVTGFSTLAKILDSKRLLNTEIGKIAASSALINVALSWVLLTIGLL-FT--GSL  2032
             F   +L  T F  LA+IL   +LL +++G+ A  +A+I    +WVLL  G   FT  GS 
Sbjct  180   FWSVSLACTNFPDLARILADLKLLRSDMGRTAMCAAIITDLCTWVLLVFGFASFTKSGSW  239

Query  2031  D-NVQWAvlctvgfvvvcvnyVRPLLNWLISKTPEGQGFSEFYICSFIAVICAFGCFTDA  1855
             +  + + +  T  FVV C+  +RP + W+ +KT +     + ++   +  +   G  TDA
Sbjct  240   NIRMPYVLFATAIFVVFCIFVLRPGIKWIFAKTVKAGHVGDTHVWFVLGGVVLCGLITDA  299

Query  1854  MGSHPMIGAFIFGLIMPNNELLRTAILDRLEDFVMGILMPVFFLVCGLRTNI-FTITDGD  1678
              G H + GAF+FGL +P++ ++R  I ++L DF+ GILMP+F+++CGLR +I F +   D
Sbjct  300   CGVHSITGAFLFGLSIPHDHIIRNMIEEKLHDFLAGILMPLFYIICGLRADIGFMLQYTD  359

Query  1677  TSIFTALALILLACSAKIIAALVASCYTGMSTNEAIGLGVLTNTKSTMVMIILEVGqvqq  1498
                F    +I  +   KI+  ++ S +  M   +A+ +G L NTK T+ +++L  G+  +
Sbjct  360   K--FMMAFVICSSFLVKIVTTVIVSLFMRMPMRDALAMGALMNTKGTLSLVVLNAGRDTK  417

Query  1497  vlsvqqysmmvVACLIMTIVATP-LAARYCPKQDLEPYKRRTIQNAKPGEELRILACIHG  1321
              L    Y+ M +A L+M++V  P LA  Y PK+ L  YK RT+Q  K   E R+LAC+H 
Sbjct  418   ALDSPMYTHMTIALLVMSLVVEPLLAVSYKPKKKLAHYKHRTVQKIKGETEFRVLACVHI  477

Query  1320  TNNLPAIISLLETSNSTVTSPITAFGVQLLELVGRAPA-MMvvhssgsgrhvggsHEEVQ  1144
               N+  I +LL+ SN T  SP+  F + L+EL GR  A +++++     +          
Sbjct  478   LPNVSGIANLLQVSNPTKQSPLNVFAIHLVELTGRTTASLLIMNDECKPKANFSDRVRAD  537

Query  1143  TSQIISTFDNYELRSHGVTAQVLTARWSYDTMAEDICKMAKEKRAAFLVLPFHKQQGTDG  964
             + QI   F+  E+ +  +  Q +TA   Y TM EDIC +A++KR  F++LP+HK    DG
Sbjct  538   SDQIAENFEAMEVNNDAMMVQTITAVSPYTTMHEDICALAEDKRVCFIILPYHKHLTPDG  597

Query  963   EMEDTNPAIQTVNEGVLLSAPCSVGILVERG---------RPNQYAKNIAVLYLGGPDDR  811
              M + N +   +N+ VL  APCSVGILV+RG         R     + +A+L++GGPDDR
Sbjct  598   RMGEGNSSHADINQNVLNHAPCSVGILVDRGMAMVRSESFRGEAMKREVAMLFVGGPDDR  657

Query  810   EALTYARRMSGLPGVHLTVIRFVPAKDVSADGAVEDPDLELELTRETSFVTVSIDPARDK  631
             EAL+YA RM G   + LTV+RFVP ++                        V+ +  R+K
Sbjct  658   EALSYAWRMVGQHVIKLTVVRFVPGREALLSSG-----------------KVAAEYEREK  700

Query  630   EEDEELLNNFRTETAEDDSKTFMELVLDDEEEFTKAVKSLDD-RSFDLYVAGRGRGVSSA  454
             + D+E +  F  +T  D S  ++E V++D ++    ++ ++D  S+DLYV GRG    S 
Sbjct  701   QVDDECIYEFNFKTMNDSSVKYIEKVVNDGQDTISTIREMEDNNSYDLYVVGRGYNSDSP  760

Query  453   LTSGLADWCECPELGAVGDllvtsefessfsvlvVQQYVRTNK  325
             +T+GL DW   PELG +GD L +S F    SVLV+QQY   N+
Sbjct  761   VTAGLNDWSSSPELGTIGDTLASSNFTMHASVLVIQQYSAVNR  803



>gb|AAX49549.1| cation/H+ exchanger [Arabidopsis thaliana]
Length=859

 Score =   466 bits (1198),  Expect = 5e-145, Method: Compositional matrix adjust.
 Identities = 287/825 (35%), Positives = 455/825 (55%), Gaps = 50/825 (6%)
 Frame = -3

Query  2718  AAPPPPSTGPEVDLD--RLGQVVMCFSQTIY---RSNGVWEGPDPLAPMIPLFILQIMTA  2554
             +  P   T P  D++  R G++V C+ Q++    R    WE    LA  +P FI Q+  A
Sbjct  3     SGAPLNVTNPNYDIEESRFGKIV-CYDQSLLFEKREQKGWESGSTLASSLPFFITQLFVA  61

Query  2553  ILSSRILNFVLKPFNQPPLVAEILSGIILGPSMLGNIEEFRKHNFPNHNFETIETMGHFA  2374
              LS R+L ++ +P   PP VA+IL G++  PS+LGN      H FP      +ET  + A
Sbjct  62    NLSYRVLYYLTRPLYLPPFVAQILCGLLFSPSVLGNTRFIIAHVFPYRFTMVLETFANLA  121

Query  2373  LVLYAFLTGLQMDVKAIVHTGTKSRIVAVSGSIFPFLIGAGFYFTLQTDTQSMI--GFIF  2200
             LV   FL GL MD++ +  T  K  I+A +G +    +GA  Y+         I  G +F
Sbjct  122   LVYNIFLLGLGMDLRMVRITELKPVIIAFTGLLVALPVGAFLYYLPGNGHPDKIISGCVF  181

Query  2199  CGSALTVTGFSTLAKILDSKRLLNTEIGKIAASSALINVALSWVLLTIGLLF---TGSLD  2029
                AL  T F  LA+IL   +LL +++G+ A  +A++    +WVLL  G      +G+ +
Sbjct  182   WSVALACTNFPDLARILADLKLLRSDMGRTAMCAAIVTDLCTWVLLVFGFASFSKSGTWN  241

Query  2028  NVQ-WAvlctvgfvvvcvnyVRPLLNWLISKTPEGQGFSEFYICSFIAVICAFGCFTDAM  1852
              +  + ++ T  FV++C+  +RP + W+ +KT +     + ++   +  +   G  TDA 
Sbjct  242   KMMPFVIITTAIFVLLCIFVIRPGIAWIFAKTVKAGHVGDTHVWFILGGVVLCGLITDAC  301

Query  1851  GSHPMIGAFIFGLIMPNNELLRTAILDRLEDFVMGILMPVFFLVCGLRTNI-FTITDGDT  1675
             G H + GAF+FGL +P++ ++R  I ++L DF+ GILMP+F+++CGLR +I F +   D 
Sbjct  302   GVHSITGAFLFGLSIPHDHIIRNMIEEKLHDFLSGILMPLFYIICGLRADIGFMLQFTD-  360

Query  1674  SIFTALALILLACSA---KIIAALVASCYTGMSTNEAIGLGVLTNTKSTMVMIILEVGqv  1504
                    ++++ CS+   KI+  ++ S +  +   +A  +G L NTK T+ +++L  G+ 
Sbjct  361   ----KFMMVVVICSSFLVKIVTTVITSLFMHIPMRDAFAIGALMNTKGTLSLVVLNAGRD  416

Query  1503  qqvlsvqqysmmvVACLIMTIVATPLAA-RYCPKQDLEPYKRRTIQNAKPGEELRILACI  1327
              + L    Y+ M +A L+M++V  PL A  Y PK+ L  YK RT+Q  K   ELR+LAC+
Sbjct  417   TKALDSPMYTHMTIALLVMSLVVEPLLAFAYKPKKKLAHYKHRTVQKIKGETELRVLACV  476

Query  1326  HGTNNLPAIISLLETSNSTVTSPITAFGVQLLELVGRAPA-MMvvhssgsgrhvggsHEE  1150
             H   N+  I +LL+ SN+T  SP++ F + L+EL GR  A +++++     +        
Sbjct  477   HVLPNVSGITNLLQVSNATKQSPLSVFAIHLVELTGRTTASLLIMNDECKPKANFSDRVR  536

Query  1149  VQTSQIISTFDNYELRSHGVTAQVLTARWSYDTMAEDICKMAKEKRAAFLVLPFHKQQGT  970
              ++ QI  TF+  E+ +  +T Q +TA   Y TM EDIC +A++KR  F++LP+HK    
Sbjct  537   AESDQIAETFEAMEVNNDAMTVQTITAVSPYATMHEDICVLAEDKRVCFIILPYHKHLTP  596

Query  969   DGEMEDTNPAIQTVNEGVLLSAPCSVGILVERG---------RPNQYAKNIAVLYLGGPD  817
             DG M + N +   +N+ VL  APCSVGILV+RG         R     + +A+L++GGPD
Sbjct  597   DGRMGEGNSSHAEINQNVLSHAPCSVGILVDRGMAMVRSESFRGESMKREVAMLFVGGPD  656

Query  816   DREALTYARRMSGLPGVHLTVIRFVPAKDVSADGAVEDPDLELELTRETSFVTVSIDPAR  637
             DREAL+YA RM G   + LTV+RFVP ++                        V+ +  R
Sbjct  657   DREALSYAWRMVGQHVIKLTVVRFVPGREALISSG-----------------KVAAEYER  699

Query  636   DKEEDEELLNNFRTETAEDDSKTFMELVLDDEEEFTKAVKSL-DDRSFDLYVAGRGRGVS  460
             +K+ D+E +  F  +T  D S  ++E V++D ++    ++ + D+ S+DLYV GRG    
Sbjct  700   EKQVDDECIYEFNFKTMNDSSVKYIEKVVNDGQDTIATIREMEDNNSYDLYVVGRGYNSD  759

Query  459   SALTSGLADWCECPELGAVGDllvtsefessfsvlvVQQYVRTNK  325
             S +T+GL DW   PELG +GD L +S F    SVLV+QQY  T +
Sbjct  760   SPVTAGLNDWSSSPELGTIGDTLASSNFTMHASVLVIQQYSATKR  804



>ref|NP_172049.2| cation/H(+) antiporter 23 [Arabidopsis thaliana]
 sp|Q8VYD4.1|CHX23_ARATH RecName: Full=Cation/H(+) antiporter 23, chloroplastic; AltName: 
Full=Protein CATION/H+ EXCHANGER 23; Short=AtCHX23 [Arabidopsis 
thaliana]
 gb|AAL59981.1| unknown protein [Arabidopsis thaliana]
 gb|AAM20055.1| unknown protein [Arabidopsis thaliana]
 gb|AEE27859.1| cation/H(+) antiporter 23 [Arabidopsis thaliana]
Length=867

 Score =   465 bits (1197),  Expect = 7e-145, Method: Compositional matrix adjust.
 Identities = 287/825 (35%), Positives = 455/825 (55%), Gaps = 50/825 (6%)
 Frame = -3

Query  2718  AAPPPPSTGPEVDLD--RLGQVVMCFSQTIY---RSNGVWEGPDPLAPMIPLFILQIMTA  2554
             +  P   T P  D++  R G++V C+ Q++    R    WE    LA  +P FI Q+  A
Sbjct  3     SGAPLNVTNPNYDIEESRFGKIV-CYDQSLLFEKREQKGWESGSTLASSLPFFITQLFVA  61

Query  2553  ILSSRILNFVLKPFNQPPLVAEILSGIILGPSMLGNIEEFRKHNFPNHNFETIETMGHFA  2374
              LS R+L ++ +P   PP VA+IL G++  PS+LGN      H FP      +ET  + A
Sbjct  62    NLSYRVLYYLTRPLYLPPFVAQILCGLLFSPSVLGNTRFIIAHVFPYRFTMVLETFANLA  121

Query  2373  LVLYAFLTGLQMDVKAIVHTGTKSRIVAVSGSIFPFLIGAGFYFTLQTDTQSMI--GFIF  2200
             LV   FL GL MD++ +  T  K  I+A +G +    +GA  Y+         I  G +F
Sbjct  122   LVYNIFLLGLGMDLRMVRITELKPVIIAFTGLLVALPVGAFLYYLPGNGHPDKIISGCVF  181

Query  2199  CGSALTVTGFSTLAKILDSKRLLNTEIGKIAASSALINVALSWVLLTIGLLF---TGSLD  2029
                AL  T F  LA+IL   +LL +++G+ A  +A++    +WVLL  G      +G+ +
Sbjct  182   WSVALACTNFPDLARILADLKLLRSDMGRTAMCAAIVTDLCTWVLLVFGFASFSKSGTWN  241

Query  2028  NVQ-WAvlctvgfvvvcvnyVRPLLNWLISKTPEGQGFSEFYICSFIAVICAFGCFTDAM  1852
              +  + ++ T  FV++C+  +RP + W+ +KT +     + ++   +  +   G  TDA 
Sbjct  242   KMMPFVIITTAIFVLLCIFVIRPGIAWIFAKTVKAGHVGDTHVWFILGGVVLCGLITDAC  301

Query  1851  GSHPMIGAFIFGLIMPNNELLRTAILDRLEDFVMGILMPVFFLVCGLRTNI-FTITDGDT  1675
             G H + GAF+FGL +P++ ++R  I ++L DF+ GILMP+F+++CGLR +I F +   D 
Sbjct  302   GVHSITGAFLFGLSIPHDHIIRNMIEEKLHDFLSGILMPLFYIICGLRADIGFMLQFTD-  360

Query  1674  SIFTALALILLACSA---KIIAALVASCYTGMSTNEAIGLGVLTNTKSTMVMIILEVGqv  1504
                    ++++ CS+   KI+  ++ S +  +   +A  +G L NTK T+ +++L  G+ 
Sbjct  361   ----KFMMVVVICSSFLVKIVTTVITSLFMHIPMRDAFAIGALMNTKGTLSLVVLNAGRD  416

Query  1503  qqvlsvqqysmmvVACLIMTIVATPLAA-RYCPKQDLEPYKRRTIQNAKPGEELRILACI  1327
              + L    Y+ M +A L+M++V  PL A  Y PK+ L  YK RT+Q  K   ELR+LAC+
Sbjct  417   TKALDSPMYTHMTIALLVMSLVVEPLLAFAYKPKKKLAHYKHRTVQKIKGETELRVLACV  476

Query  1326  HGTNNLPAIISLLETSNSTVTSPITAFGVQLLELVGRAPA-MMvvhssgsgrhvggsHEE  1150
             H   N+  I +LL+ SN+T  SP++ F + L+EL GR  A +++++     +        
Sbjct  477   HVLPNVSGITNLLQVSNATKQSPLSVFAIHLVELTGRTTASLLIMNDECKPKANFSDRVR  536

Query  1149  VQTSQIISTFDNYELRSHGVTAQVLTARWSYDTMAEDICKMAKEKRAAFLVLPFHKQQGT  970
              ++ QI  TF+  E+ +  +T Q +TA   Y TM EDIC +A++KR  F++LP+HK    
Sbjct  537   AESDQIAETFEAMEVNNDAMTVQTITAVSPYATMHEDICVLAEDKRVCFIILPYHKHLTP  596

Query  969   DGEMEDTNPAIQTVNEGVLLSAPCSVGILVERG---------RPNQYAKNIAVLYLGGPD  817
             DG M + N +   +N+ VL  APCSVGILV+RG         R     + +A+L++GGPD
Sbjct  597   DGRMGEGNSSHAEINQNVLSHAPCSVGILVDRGMAMVRSESFRGESMKREVAMLFVGGPD  656

Query  816   DREALTYARRMSGLPGVHLTVIRFVPAKDVSADGAVEDPDLELELTRETSFVTVSIDPAR  637
             DREAL+YA RM G   + LTV+RFVP ++                        V+ +  R
Sbjct  657   DREALSYAWRMVGQHVIKLTVVRFVPGREALISSG-----------------KVAAEYER  699

Query  636   DKEEDEELLNNFRTETAEDDSKTFMELVLDDEEEFTKAVKSLDD-RSFDLYVAGRGRGVS  460
             +K+ D+E +  F  +T  D S  ++E V++D ++    ++ ++D  S+DLYV GRG    
Sbjct  700   EKQVDDECIYEFNFKTMNDSSVKYIEKVVNDGQDTIATIREMEDNNSYDLYVVGRGYNSD  759

Query  459   SALTSGLADWCECPELGAVGDllvtsefessfsvlvVQQYVRTNK  325
             S +T+GL DW   PELG +GD L +S F    SVLV+QQY  T +
Sbjct  760   SPVTAGLNDWSSSPELGTIGDTLASSNFTMHASVLVIQQYSATKR  804



>ref|XP_010522268.1| PREDICTED: cation/H(+) antiporter 23, chloroplastic-like [Tarenaya 
hassleriana]
Length=855

 Score =   465 bits (1196),  Expect = 8e-145, Method: Compositional matrix adjust.
 Identities = 288/808 (36%), Positives = 455/808 (56%), Gaps = 40/808 (5%)
 Frame = -3

Query  2685  VDLDRLGQVVMCFSQTIY---RSNGVWEGPDPLAPMIPLFILQIMTAILSSRILNFVLKP  2515
             VD  R G++V C+ Q      R    WE    +A  +P  + Q++ + LS R++ ++ +P
Sbjct  14    VDESRYGKIV-CYPQEFLFEKREQKAWESGSTMASALPFLVTQLLVSNLSYRVIYYLTRP  72

Query  2514  FNQPPLVAEILSGIILGPSMLGNIEEFRKHNFPNHNFETIETMGHFALVLYAFLTGLQMD  2335
                PP VA+IL G++  PS+LGN     ++ FP      +ET  + ALV   FL GL MD
Sbjct  73    LYLPPFVAQILCGLLYSPSVLGNKGFIIQYVFPYRFTMILETFANLALVYNIFLLGLGMD  132

Query  2334  VKAIVHTGTKSRIVAVSGSIFPFLIGAGFYFTLQTDTQSMI--GFIFCGSALTVTGFSTL  2161
             ++ +  T  K  ++A +G +    +G   YF      +  I  G +F   AL+ T F  L
Sbjct  133   LRMVRLTELKPLVIAAAGLLVSLPVGIILYFLPGNGAEDKILAGSVFWAVALSCTNFPDL  192

Query  2160  AKILDSKRLLNTEIGKIAASSALINVALSWVLLTIGL-LFT--GSLDNVQ-WAvlctvgf  1993
             A+IL   +LL T++GKIA SSA++    +WVLL +G  +F+  G+L+ +  + +L T GF
Sbjct  193   ARILADLKLLRTDMGKIAMSSAIVTDVCTWVLLVLGFSVFSKAGTLNKMMPFVLLSTGGF  252

Query  1992  vvvcvnyVRPLLNWLISKTPEGQGFSEFYICSFIAVICAFGCFTDAMGSHPMIGAFIFGL  1813
              + C+  +RP + W  S+T +    ++ +I   ++ +   G  TDA G+H + GAF+FGL
Sbjct  253   ALFCIFVIRPTIAWFFSRTAKTGHTADSHIWFILSGVVFCGLVTDACGTHSITGAFLFGL  312

Query  1812  IMPNNELLRTAILDRLEDFVMGILMPVFFLVCGLRTNIFTITDGDTSIFTALALILLACS  1633
              +P++ L+R  I ++L DF+ GILMP+F+++CGLR ++  +      +  A+ +I  + S
Sbjct  313   SIPHDHLIRNMIEEKLHDFLSGILMPLFYIICGLRADLQYMLAFTDPVIMAV-VITSSFS  371

Query  1632  AKIIAALVASCYTGMSTNEAIGLGVLTNTKSTMVMIILEVGqvqqvlsvqqysmmvVACL  1453
              KI+  ++ S +  M   +A+ LG L NTK  + +++L  G+  + L    Y+ M V  L
Sbjct  372   LKILTTVIVSLFMRMPARDALALGCLMNTKGILALVVLNAGRDTKALDSPMYTHMTVVFL  431

Query  1452  IMTIVATPLAA-RYCPKQDLEPYKRRTIQNAKPGEELRILACIHGTNNLPAIISLLETSN  1276
             +M+++  PL A  Y PK+ L  YK RTIQ  K   E R++AC+H   N+  I +LL+TS+
Sbjct  432   VMSLIVEPLLAFAYKPKKPLVHYKHRTIQRVKGETEFRVMACVHALPNVFGITNLLQTSH  491

Query  1275  STVTSPITAFGVQLLELVGRAPA-MMvvhssgsgrhvggsHEEVQTSQIISTFDNYELRS  1099
                 SP+  F + L+EL GR  A M++++     +         Q+ QI  +F+  EL  
Sbjct  492   RRKQSPLNVFAIHLVELTGRTTASMLIMNDECKPKANFSDRVRAQSDQIAESFETLELHD  551

Query  1098  HGVTAQVLTARWSYDTMAEDICKMAKEKRAAFLVLPFHKQQGTDGEMEDTNPAIQTVNEG  919
              GV  Q +TA   Y TM EDIC +A++KR  F++LP+HKQ  +DG M + N +   +N+ 
Sbjct  552   DGVMVQTITAVSPYTTMHEDICALAEDKRVCFIILPYHKQMTSDGRMGEGNASHADINQN  611

Query  918   VLLSAPCSVGILVERG----RPNQY-----AKNIAVLYLGGPDDREALTYARRMSGLPGV  766
             VL  APCSVGILV+RG    R   +        +A+L++GG DDREAL+YA RM G   V
Sbjct  612   VLNHAPCSVGILVDRGMGMVRTESFPALPPKTQVAMLFVGGADDREALSYAWRMVGQDTV  671

Query  765   HLTVIRFVPAKDVSADGAVEDPDLELELTRETSFVTVSIDPARDKEEDEELLNNFRTETA  586
              LT++RFVP +D                         ++   ++K+ D+E +  F  +T 
Sbjct  672   KLTLLRFVPGRDALVLAG-----------------KAAVAYEKEKQVDDECIYEFNFKTT  714

Query  585   EDDSKTFMELVLDDEEEFTKAVKSLDDR-SFDLYVAGRGRGVSSALTSGLADWCECPELG  409
             +D S T++E V++D +     ++ ++DR S+DLY+ GRG   +S +T GL DW   PELG
Sbjct  715   DDSSVTYIEKVVNDGQGTIATIREMEDRHSYDLYIVGRGCNDNSPVTDGLTDWSSSPELG  774

Query  408   AVGDllvtsefessfsvlvVQQYVRTNK  325
             ++GD L +S+F    SVLV+QQY  TN+
Sbjct  775   SIGDTLASSKFTMHASVLVIQQYSATNR  802



>ref|XP_010485082.1| PREDICTED: cation/H(+) antiporter 23, chloroplastic [Camelina 
sativa]
Length=859

 Score =   465 bits (1196),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 290/823 (35%), Positives = 450/823 (55%), Gaps = 44/823 (5%)
 Frame = -3

Query  2721  MAAPPPPSTGP--EVDLDRLGQVVMCFSQTIY---RSNGVWEGPDPLAPMIPLFILQIMT  2557
             M++ P  +T P  E++  R G++V C+ Q +    R    WE    LA  +P FI Q+  
Sbjct  1     MSSDPFNTTEPKYEIEESRFGKIV-CYDQQLLFEKREQKGWESGSTLASSLPFFITQLFV  59

Query  2556  AILSSRILNFVLKPFNQPPLVAEILSGIILGPSMLGNIEEFRKHNFPNHNFETIETMGHF  2377
             A LS R++ ++ +P   PP VA+IL G++  PS+LGN++   +H FP      +ET  + 
Sbjct  60    ANLSYRVIYYITRPLYLPPFVAQILCGLLFSPSVLGNVDIVIQHIFPYRFTMVLETFANL  119

Query  2376  ALVLYAFLTGLQMDVKAIVHTGTKSRIVAVSGSIFPFLIGAGFYFTLQTDTQSMI--GFI  2203
             ALV   FL GL MD++ +  T  K  I+A +G      +GA  Y+         I  G +
Sbjct  120   ALVYNIFLLGLGMDLRMVRITEFKPVIIAFAGLFVALPVGAALYYLPGNGHPEKILAGCV  179

Query  2202  FCGSALTVTGFSTLAKILDSKRLLNTEIGKIAASSALINVALSWVLLTIGLL-FT--GSL  2032
             F   +L  T F  LA+IL   +LL +++G+ A  +A+I    +WVLL  G   FT  GS 
Sbjct  180   FWSVSLACTNFPDLARILADLKLLRSDMGRTAMCAAIITDLCTWVLLVFGFASFTKSGSW  239

Query  2031  D-NVQWAvlctvgfvvvcvnyVRPLLNWLISKTPEGQGFSEFYICSFIAVICAFGCFTDA  1855
             +  + + +  T  FVV C+  +RP + W+ SKT +     + ++   +  +   G  TDA
Sbjct  240   NIRMPYVLFATAIFVVFCIFVLRPGIKWIFSKTVKAGHVGDTHVWFVLGGVVLCGLITDA  299

Query  1854  MGSHPMIGAFIFGLIMPNNELLRTAILDRLEDFVMGILMPVFFLVCGLRTNI-FTITDGD  1678
              G H + GAF+FGL +P++ ++R  I ++L DF+ GILMP+F+++CGLR +I F +   D
Sbjct  300   CGVHSITGAFLFGLSIPHDHIIRNMIEEKLHDFLAGILMPLFYIICGLRADIGFMLQYTD  359

Query  1677  TSIFTALALILLACSAKIIAALVASCYTGMSTNEAIGLGVLTNTKSTMVMIILEVGqvqq  1498
                F    +I  +   KI+  ++ S +  M   +A+ +G L NTK T+ +++L  G+  +
Sbjct  360   K--FMMAFVICSSFLVKIVTTVIVSLFMRMPMRDALAMGALMNTKGTLSLVVLNAGRDTK  417

Query  1497  vlsvqqysmmvVACLIMTIVATP-LAARYCPKQDLEPYKRRTIQNAKPGEELRILACIHG  1321
              L    Y+ M +A L+M++V  P LA  Y PK+ L  YK RT+Q  K   E R+LAC+H 
Sbjct  418   ALDSPMYTHMTIALLVMSLVVEPLLAVAYKPKKKLAHYKHRTVQKIKGETEFRVLACVHI  477

Query  1320  TNNLPAIISLLETSNSTVTSPITAFGVQLLELVGRAPA-MMvvhssgsgrhvggsHEEVQ  1144
               N+  I +LL+ SN T  SP+  F + L+EL GR  A +++++     +          
Sbjct  478   LPNVSGIANLLQVSNPTKQSPLNVFAIHLVELTGRTTASLLIMNDECKPKANFSDRVRAD  537

Query  1143  TSQIISTFDNYELRSHGVTAQVLTARWSYDTMAEDICKMAKEKRAAFLVLPFHKQQGTDG  964
             + QI   F+  E+ +  +  Q +TA   Y TM EDIC +A++KR  F++LP+HK    DG
Sbjct  538   SDQIAENFEAMEVNNDAMMVQTITAVSPYTTMHEDICALAEDKRVCFIILPYHKHLTPDG  597

Query  963   EMEDTNPAIQTVNEGVLLSAPCSVGILVERG---------RPNQYAKNIAVLYLGGPDDR  811
              M + N +   +N+ VL  APCSVGILV+RG         R     + +A+L++GGPDDR
Sbjct  598   RMGEGNSSHADINQNVLNHAPCSVGILVDRGMAMVRSESFRGEAMKREVAMLFVGGPDDR  657

Query  810   EALTYARRMSGLPGVHLTVIRFVPAKDVSADGAVEDPDLELELTRETSFVTVSIDPARDK  631
             EAL+YA RM G   + LTV+RFVP ++                        V+ +  R+K
Sbjct  658   EALSYAWRMVGQHVIKLTVVRFVPGREALLSSG-----------------KVAAEYEREK  700

Query  630   EEDEELLNNFRTETAEDDSKTFMELVLDDEEEFTKAVKSLDD-RSFDLYVAGRGRGVSSA  454
             + D+E +  F  +T  D S  ++E V++D ++    ++ ++D  S+DLYV GRG    S 
Sbjct  701   QVDDECIYEFNFKTMNDSSVKYIEKVVNDGQDTISTIREMEDNNSYDLYVVGRGYNSDSP  760

Query  453   LTSGLADWCECPELGAVGDllvtsefessfsvlvVQQYVRTNK  325
             +T+GL DW   PELG +GD L +S F    SVLV+QQY   N+
Sbjct  761   VTAGLNDWSSSPELGTIGDTLASSNFTMHASVLVIQQYSAVNR  803



>ref|XP_006303208.1| hypothetical protein CARUB_v10011346mg [Capsella rubella]
 gb|EOA36106.1| hypothetical protein CARUB_v10011346mg [Capsella rubella]
Length=863

 Score =   464 bits (1195),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 293/824 (36%), Positives = 451/824 (55%), Gaps = 48/824 (6%)
 Frame = -3

Query  2718  AAPPPPSTGP--EVDLDRLGQVVMCFSQTIY---RSNGVWEGPDPLAPMIPLFILQIMTA  2554
             A  P  +T P  E++  R G++V C+ Q +    R    WE    LA  +P FI Q+  A
Sbjct  3     AGTPFNTTEPKYEIEESRFGKIV-CYDQQLLFEKREQKGWESGSTLASSLPFFITQLFVA  61

Query  2553  ILSSRILNFVLKPFNQPPLVAEILSGIILGPSMLGNIEEFRKHNFPNHNFETIETMGHFA  2374
              LS R+L ++ +PF  PP VA+IL G++  PS+LGN+    +H FP      +ET  + A
Sbjct  62    NLSYRVLYYLTRPFYLPPFVAQILCGLLFSPSVLGNMTIVVEHIFPYRFTMVLETFANLA  121

Query  2373  LVLYAFLTGLQMDVKAIVHTGTKSRIVAVSGSIFPFLIGAGFYFTLQTDTQSMI--GFIF  2200
             LV   FL GL MD++ +  T  +  I+A +G I    +GA  Y+         I  G IF
Sbjct  122   LVYNIFLLGLGMDLRMVRITELRPVIIAFAGLIVALPVGAALYYLPGNGHPDKIVAGCIF  181

Query  2199  CGSALTVTGFSTLAKILDSKRLLNTEIGKIAASSALINVALSWVLLTIGLLF---TGSLD  2029
                +L  T F  LA+IL   +LL +++G+ A  +A+I    +WVLL  G       GS +
Sbjct  182   WSISLACTNFPDLARILADLKLLRSDMGRTAMCAAIITDLSTWVLLVFGFASFSKAGSWN  241

Query  2028  NVQ-WAvlctvgfvvvcvnyVRPLLNWLISKTPEGQGFSEFYICSFIAVICAFGCFTDAM  1852
              +  + ++ T  FVV+C+  +RP + W+ SKT +     + ++   +  +   G  TDA 
Sbjct  242   KMMPYVIIATAMFVVLCIFVIRPGIKWIFSKTVKAGHVGDTHVWFVLGGVVLCGLITDAC  301

Query  1851  GSHPMIGAFIFGLIMPNNELLRTAILDRLEDFVMGILMPVFFLVCGLRTNI---FTITDG  1681
             G H + GAF+FGL +P++ ++R  I ++L DF+ GILMP+F+++CGLR +I      TD 
Sbjct  302   GVHSITGAFLFGLSIPHDHIIRNMIEEKLHDFLSGILMPLFYIICGLRADINFMLKYTDK  361

Query  1680  DTSIFTALALILLACSAKIIAALVASCYTGMSTNEAIGLGVLTNTKSTMVMIILEVGqvq  1501
                +F   +  L+    KI+  +V S +  M   +A+ +G L NTK T+ +++L  G+  
Sbjct  362   LIMVFVIGSSFLV----KILTTVVVSLFMRMPMRDALAMGALMNTKGTLSLVVLNAGRDT  417

Query  1500  qvlsvqqysmmvVACLIMTIVATP-LAARYCPKQDLEPYKRRTIQNAKPGEELRILACIH  1324
             + L    Y+ M +A L+M++V  P LA  Y PK+ L  YK RT+Q  K   E R+LAC+H
Sbjct  418   KALDSPMYTHMTLALLVMSLVIEPLLAVAYKPKKKLAHYKHRTVQKIKGETEFRVLACVH  477

Query  1323  GTNNLPAIISLLETSNSTVTSPITAFGVQLLELVGRAPA-MMvvhssgsgrhvggsHEEV  1147
                N+  I +LL+ SN T  SP+  F + L+EL GR  A +++++     +         
Sbjct  478   ILPNVSGITNLLQVSNPTKQSPLNVFAIHLVELTGRTTASLLIMNDECKPKANFSDRVRA  537

Query  1146  QTSQIISTFDNYELRSHGVTAQVLTARWSYDTMAEDICKMAKEKRAAFLVLPFHKQQGTD  967
              + QI   F+  E+ +  +T Q +TA   Y TM EDIC +A++KR  F+VLP+HK    D
Sbjct  538   DSDQIAENFEAMEVNNDAMTVQTITAVSPYTTMHEDICALAEDKRVCFIVLPYHKHLTPD  597

Query  966   GEMEDTNPAIQTVNEGVLLSAPCSVGILVERG----RPNQY-----AKNIAVLYLGGPDD  814
             G M + N +   +N+ VL  APCSVGILV+RG    R   +      + +A+L++GGPDD
Sbjct  598   GRMGEGNSSHADINQNVLNHAPCSVGILVDRGMAMVRSESFHGEAMKREVAMLFVGGPDD  657

Query  813   REALTYARRMSGLPGVHLTVIRFVPAKDVSADGAVEDPDLELELTRETSFVTVSIDPARD  634
             REAL+YA RM G   + LTV+RFVP ++                        V+ +  R+
Sbjct  658   REALSYAWRMVGQHVIKLTVVRFVPGREALLSSG-----------------KVAAEYERE  700

Query  633   KEEDEELLNNFRTETAEDDSKTFMELVLDDEEEFTKAVKSL-DDRSFDLYVAGRGRGVSS  457
             K+ D+E +  F  +T  D S  ++E V++D ++    ++ + D+ S+DLYV GRG    S
Sbjct  701   KQVDDECIYEFNFKTMNDSSVKYIEKVVNDGQDTISTIREMEDNNSYDLYVVGRGYNSDS  760

Query  456   ALTSGLADWCECPELGAVGDllvtsefessfsvlvVQQYVRTNK  325
              +T+GL DW   PELG +GD L +S F    SVLV+QQ+   N+
Sbjct  761   PVTAGLNDWSSSPELGTIGDTLASSNFTMHASVLVIQQFSAVNR  804



>ref|XP_010475259.1| PREDICTED: cation/H(+) antiporter 23, chloroplastic-like [Camelina 
sativa]
Length=859

 Score =   464 bits (1194),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 291/826 (35%), Positives = 450/826 (54%), Gaps = 50/826 (6%)
 Frame = -3

Query  2721  MAAPPPPSTGP--EVDLDRLGQVVMCFSQTIY---RSNGVWEGPDPLAPMIPLFILQIMT  2557
             M++ P  +T P  E++  R G++V C+ Q +    R    WE    LA  +P FI Q+  
Sbjct  1     MSSDPFNTTEPKYEIEESRFGKIV-CYDQQLLFEKREQKGWESGSTLASSLPFFITQLFV  59

Query  2556  AILSSRILNFVLKPFNQPPLVAEILSGIILGPSMLGNIEEFRKHNFPNHNFETIETMGHF  2377
             A LS RI+ ++ +P   PP VA+IL G++  PS+LGN++   +H FP      +ET  + 
Sbjct  60    ANLSYRIIYYITRPLYLPPFVAQILCGLLFSPSVLGNVDIVIQHIFPYRFTMVLETFANL  119

Query  2376  ALVLYAFLTGLQMDVKAIVHTGTKSRIVAVSGSIFPFLIGAGFYFTLQTDTQSMI--GFI  2203
             ALV   FL GL MD++ +  T  K  I+A +G      +GA  Y+         I  G +
Sbjct  120   ALVYNIFLLGLGMDLRMVKITEFKPVIIAFAGLFVALPVGAALYYLRGNGHPDKIIAGCV  179

Query  2202  FCGSALTVTGFSTLAKILDSKRLLNTEIGKIAASSALINVALSWVLLTIGLL-FT--GSL  2032
             F   +L  T F  LA+IL   +LL +++G+ A  +A+I    +WVLL  G   FT  GS 
Sbjct  180   FWSVSLACTNFPDLARILADLKLLRSDMGRTAMCAAIITDLCTWVLLVFGFASFTKAGSW  239

Query  2031  D-NVQWAvlctvgfvvvcvnyVRPLLNWLISKTPEGQGFSEFYICSFIAVICAFGCFTDA  1855
             +  + + +  T  FVV C+  +RP + W+ SKT +     + ++   +  +   G  TDA
Sbjct  240   NIRMPYVMFATGIFVVFCIFVLRPGIKWIFSKTVKAGHVGDTHVWFVLGGVVLCGLITDA  299

Query  1854  MGSHPMIGAFIFGLIMPNNELLRTAILDRLEDFVMGILMPVFFLVCGLRTNI-FTITDGD  1678
              G H + GAF+FGL +P++ ++R  I ++L DF+ GILMP+F+++CGLR +I F +   D
Sbjct  300   CGVHSITGAFLFGLSIPHDHIIRNMIEEKLHDFLAGILMPLFYIICGLRADISFMLQYTD  359

Query  1677  TSIFTALALILLACSA---KIIAALVASCYTGMSTNEAIGLGVLTNTKSTMVMIILEVGq  1507
               I     +  + CS+   KI+  ++ S +  M   +A  +G L NTK T+ +++L  G+
Sbjct  360   KFI-----MAFVICSSFLVKIVTTVIVSLFMRMPMRDAFAMGALMNTKGTLSLVVLNAGR  414

Query  1506  vqqvlsvqqysmmvVACLIMTIVATP-LAARYCPKQDLEPYKRRTIQNAKPGEELRILAC  1330
               + L    Y+ M +A L+M++V  P LA  Y PK+ L  YK RT+Q  K   E R+LAC
Sbjct  415   DTKALDSPMYTHMTIALLVMSLVVEPLLAVTYKPKRKLAHYKHRTVQKIKGETEFRVLAC  474

Query  1329  IHGTNNLPAIISLLETSNSTVTSPITAFGVQLLELVGRAPA-MMvvhssgsgrhvggsHE  1153
             +H   N+  I +LL+ SN T  SP+  F + L+EL GR  A +++++     +       
Sbjct  475   VHILPNVSGIANLLQVSNPTKQSPLNVFAIHLVELTGRTTASLLIMNDECKPKANFSDRV  534

Query  1152  EVQTSQIISTFDNYELRSHGVTAQVLTARWSYDTMAEDICKMAKEKRAAFLVLPFHKQQG  973
                + QI   F+  E+ +  +  Q +TA   Y TM EDIC +A++KR  F++LP+HK   
Sbjct  535   RADSDQIAENFEAMEVNNDAMMVQTITAVSPYTTMHEDICALAEDKRVCFIILPYHKHLT  594

Query  972   TDGEMEDTNPAIQTVNEGVLLSAPCSVGILVERG---------RPNQYAKNIAVLYLGGP  820
              DG M + N +   +N+ VL  APCSVGILV+RG         R     + +A+L++GGP
Sbjct  595   PDGRMGEGNSSHADINQNVLNHAPCSVGILVDRGMAMVRSESFRGEAVKREVAMLFVGGP  654

Query  819   DDREALTYARRMSGLPGVHLTVIRFVPAKDVSADGAVEDPDLELELTRETSFVTVSIDPA  640
             DDREAL+YA RM G   + L V+RFVP ++                        V+ +  
Sbjct  655   DDREALSYAWRMVGQHVIKLIVVRFVPGREALLSSG-----------------KVAAEYE  697

Query  639   RDKEEDEELLNNFRTETAEDDSKTFMELVLDDEEEFTKAVKSL-DDRSFDLYVAGRGRGV  463
             R+K+ D+E +  F  +T  D S  ++E V++D ++    ++ + D+ S+DLYV GRG   
Sbjct  698   REKQVDDECIYEFNFKTMNDSSVKYIEKVVNDGQDTISTIRDMEDNNSYDLYVVGRGYNS  757

Query  462   SSALTSGLADWCECPELGAVGDllvtsefessfsvlvVQQYVRTNK  325
              S +T+GL DW   PELG +GD L +S F    SVLV+QQY   N+
Sbjct  758   DSPVTAGLNDWSSSPELGTIGDTLASSNFTMHASVLVIQQYSAVNR  803



>gb|AAD30610.1|AC007153_2 similar to Na/H antiporter proteins [Arabidopsis thaliana]
Length=855

 Score =   464 bits (1193),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 290/825 (35%), Positives = 454/825 (55%), Gaps = 62/825 (8%)
 Frame = -3

Query  2718  AAPPPPSTGPEVDLD--RLGQVVMCFSQTIY---RSNGVWEGPDPLAPMIPLFILQIMTA  2554
             +  P   T P  D++  R G++V C+ Q++    R    WE    LA  +P FI Q+  A
Sbjct  3     SGAPLNVTNPNYDIEESRFGKIV-CYDQSLLFEKREQKGWESGSTLASSLPFFITQLFVA  61

Query  2553  ILSSRILNFVLKPFNQPPLVAEILSGIILGPSMLGNIEEFRKHNFPNHNFETIETMGHFA  2374
              LS R+L ++ +P   PP VA+IL G++  PS+LGN      H FP      +ET  + A
Sbjct  62    NLSYRVLYYLTRPLYLPPFVAQILCGLLFSPSVLGNTRFIIAHVFPYRFTMVLETFANLA  121

Query  2373  LVLYAFLTGLQMDVKAIVHTGTKSRIVAVSGSIFPFLIGAGFYFTLQTDTQSMI--GFIF  2200
             LV   FL GL MD++ +  T  K  I+A +G +    +GA  Y+         I  G +F
Sbjct  122   LVYNIFLLGLGMDLRMVRITELKPVIIAFTGLLVALPVGAFLYYLPGNGHPDKIISGCVF  181

Query  2199  CGSALTVTGFSTLAKILDSKRLLNTEIGKIAASSALINVALSWVLLTIGLLF---TGSLD  2029
                AL  T F  LA+IL   +LL +++G+ A  +A++    +WVLL  G      +G+ +
Sbjct  182   WSVALACTNFPDLARILADLKLLRSDMGRTAMCAAIVTDLCTWVLLVFGFASFSKSGTWN  241

Query  2028  NVQ-WAvlctvgfvvvcvnyVRPLLNWLISKTPEGQGFSEFYICSFIAVICAFGCFTDAM  1852
              +  + ++ T  FV++C+  +RP + W+ +KT +  G           V+C  G  TDA 
Sbjct  242   KMMPFVIITTAIFVLLCIFVIRPGIAWIFAKTVKAGG----------VVLC--GLITDAC  289

Query  1851  GSHPMIGAFIFGLIMPNNELLRTAILDRLEDFVMGILMPVFFLVCGLRTNI-FTITDGDT  1675
             G H + GAF+FGL +P++ ++R  I ++L DF+ GILMP+F+++CGLR +I F +   D 
Sbjct  290   GVHSITGAFLFGLSIPHDHIIRNMIEEKLHDFLSGILMPLFYIICGLRADIGFMLQFTD-  348

Query  1674  SIFTALALILLACSA---KIIAALVASCYTGMSTNEAIGLGVLTNTKSTMVMIILEVGqv  1504
                    ++++ CS+   KI+  ++ S +  +   +A  +G L NTK T+ +++L  G+ 
Sbjct  349   ----KFMMVVVICSSFLVKIVTTVITSLFMHIPMRDAFAIGALMNTKGTLSLVVLNAGRD  404

Query  1503  qqvlsvqqysmmvVACLIMTIVATPLAA-RYCPKQDLEPYKRRTIQNAKPGEELRILACI  1327
              + L    Y+ M +A L+M++V  PL A  Y PK+ L  YK RT+Q  K   ELR+LAC+
Sbjct  405   TKALDSPMYTHMTIALLVMSLVVEPLLAFAYKPKKKLAHYKHRTVQKIKGETELRVLACV  464

Query  1326  HGTNNLPAIISLLETSNSTVTSPITAFGVQLLELVGRAPA-MMvvhssgsgrhvggsHEE  1150
             H   N+  I +LL+ SN+T  SP++ F + L+EL GR  A +++++     +        
Sbjct  465   HVLPNVSGITNLLQVSNATKQSPLSVFAIHLVELTGRTTASLLIMNDECKPKANFSDRVR  524

Query  1149  VQTSQIISTFDNYELRSHGVTAQVLTARWSYDTMAEDICKMAKEKRAAFLVLPFHKQQGT  970
              ++ QI  TF+  E+ +  +T Q +TA   Y TM EDIC +A++KR  F++LP+HK    
Sbjct  525   AESDQIAETFEAMEVNNDAMTVQTITAVSPYATMHEDICVLAEDKRVCFIILPYHKHLTP  584

Query  969   DGEMEDTNPAIQTVNEGVLLSAPCSVGILVERG---------RPNQYAKNIAVLYLGGPD  817
             DG M + N +   +N+ VL  APCSVGILV+RG         R     + +A+L++GGPD
Sbjct  585   DGRMGEGNSSHAEINQNVLSHAPCSVGILVDRGMAMVRSESFRGESMKREVAMLFVGGPD  644

Query  816   DREALTYARRMSGLPGVHLTVIRFVPAKDVSADGAVEDPDLELELTRETSFVTVSIDPAR  637
             DREAL+YA RM G   + LTV+RFVP ++                        V+ +  R
Sbjct  645   DREALSYAWRMVGQHVIKLTVVRFVPGREALISSG-----------------KVAAEYER  687

Query  636   DKEEDEELLNNFRTETAEDDSKTFMELVLDDEEEFTKAVKSL-DDRSFDLYVAGRGRGVS  460
             +K+ D+E +  F  +T  D S  ++E V++D ++    ++ + D+ S+DLYV GRG    
Sbjct  688   EKQVDDECIYEFNFKTMNDSSVKYIEKVVNDGQDTIATIREMEDNNSYDLYVVGRGYNSD  747

Query  459   SALTSGLADWCECPELGAVGDllvtsefessfsvlvVQQYVRTNK  325
             S +T+GL DW   PELG +GD L +S F    SVLV+QQY  T +
Sbjct  748   SPVTAGLNDWSSSPELGTIGDTLASSNFTMHASVLVIQQYSATKR  792



>gb|KHN34084.1| Cation/H(+) antiporter 15 [Glycine soja]
Length=740

 Score =   460 bits (1183),  Expect = 3e-144, Method: Compositional matrix adjust.
 Identities = 286/712 (40%), Positives = 432/712 (61%), Gaps = 36/712 (5%)
 Frame = -3

Query  2397  IETMGHFALVLYAFLTGLQMDVKAIVHTGTKSRIVAVSGSIFPFLIGAGFYFTL----QT  2230
             IETM +  ++ + FL G+ MD  A+ + G K+  +A+ G I PF +GA F   L    + 
Sbjct  3     IETMSNVGILYFMFLVGVGMDASALRNIGRKAVAIAILGMILPFSLGALFASFLIRLSEE  62

Query  2229  DTQSMIGFIFCGSALTVTGFSTLAKILDSKRLLNTEIGKIAASSALINVALSWVLLTIGL  2050
             D++S    IF G+ L+V  F  LA+IL   + +NTE+G++A SSAL+N  +SW+LL   +
Sbjct  63    DSRSGAYIIFLGAILSVASFPVLARILAELKFINTELGRVALSSALVNDIISWMLLIASI  122

Query  2049  LFTGSLD---NVQWAvlctvgfvvvcvnyVRPLLNWLISKTPEGQGFSEFYICSFIAVIC  1879
                 +     ++         F+   +  VRPL+  +I KTPEG+ FS+FYIC  ++ + 
Sbjct  123   TMVENEKPSLSILMVFGSCAAFIAFNIFAVRPLILLIIRKTPEGEAFSDFYICLILSGVM  182

Query  1878  AFGCFTDAMGSHPMIGAFIFGLIMPNNELLRTAILDRLEDFVMGILMPVFFLVCGLRTNI  1699
               G  TDA+G+H + GA+IFGL +PN  L  T +++RLEDF+  +L+P+FF   GLRT++
Sbjct  183   ISGLITDAIGTHAIFGAYIFGLTIPNGPLGLT-LVERLEDFISLLLLPLFFATTGLRTDL  241

Query  1698  FTITDGDTSIFTALALILLACSAKIIAALVASCYTGMSTNEAIGLGVLTNTKSTMVMIIL  1519
               +  G  S    ++LI L+C AKI+  +VA+ Y  MS  E   LG+L NTK  + +I+L
Sbjct  242   -GLLRGFYSWAILISLIALSCIAKIVGTMVAAVYYQMSIREGAVLGLLMNTKGVIEVIVL  300

Query  1518  EVGqvqqvlsvqqysmmvVACLIMTIVATP-LAARYCPKQDLEPYKRRTIQNAKPGEELR  1342
              +G+ Q+VL+ + ++ MV+  L+MT +  P ++A Y   + + PYKRR IQ ++   E R
Sbjct  301   NIGKDQKVLTDESFASMVIITLLMTGIIVPGISAIYKTSKGIIPYKRRNIQMSQTDTEFR  360

Query  1341  ILACIHGTNNLPAIISLLETSNSTVTSPITAFGVQLLELVGRAPAMMvvhssgsgrhvgg  1162
             +L CIH   N+P +I+LL+ SN T  SPI  + + L EL G A A++VVH+    +    
Sbjct  361   VLVCIHSPRNVPTMINLLDASNPTKNSPICIYVLHLTELAGHASALLVVHNQYGKKSDQI  420

Query  1161  -----sHEEVQTSQIISTFDNYELRSHGVTAQVLTARWSYDTMAEDICKMAKEKRAAFLV  997
                  +  + Q+  II+ F+NY  ++  ++ Q ++    Y TM EDIC +A++KR AF+V
Sbjct  421   GNGGYNRTQAQSDHIINAFENYVQQASHISVQPMSVVSPYSTMHEDICNVAQDKRVAFIV  480

Query  996   LPFHKQQGTDGEMEDTNPAIQTVNEGVLLSAPCSVGILVERG-------RPNQYAKNIAV  838
             +PFHKQQ  DG M+D N + +TVN  VL  APCSVGILV+RG        P+Q A ++AV
Sbjct  481   VPFHKQQMVDGGMQDMNTSFRTVNRNVLTKAPCSVGILVDRGFNFCNHLAPDQKAHHVAV  540

Query  837   LYLGGPDDREALTYARRMSGLPGVHLTVIRFVPAKDV----SADGAVEDPDLELELTRET  670
             L+ GGPDDRE+L+Y  RMS    ++LTV+RFV  ++V    S  G   D         E 
Sbjct  541   LFFGGPDDRESLSYGWRMSEHQSINLTVMRFVHEEEVMHCHSHSGGDRDD--------EP  592

Query  669   SFVTVSIDPARDKEEDEELLNNFRTETAED-DSKTFMELVLDDEEEFTKAVKSLDDRSFD  493
             S +TV  D    K+ DE+ ++ F T  A+D  S  ++E  +++ E+   A++S+DD    
Sbjct  593   SVLTVKTDKDTQKQIDEKFIHWFMTSHADDGGSVVYVEKRVNNGEQTVAAIRSMDD-VHG  651

Query  492   LYVAGRGRGVSSALTSGLADWCECPELGAVGDllvtsefessfsvlvVQQYV  337
             L++ GR  G+SS LT+G  DW E PELGA+GDLL +S+F ++ SVL+VQQYV
Sbjct  652   LFIVGRSYGISSPLTAGFTDWSEYPELGAIGDLLASSDFAATASVLIVQQYV  703



>ref|XP_008442278.1| PREDICTED: cation/H(+) antiporter 15-like [Cucumis melo]
Length=795

 Score =   459 bits (1180),  Expect = 4e-143, Method: Compositional matrix adjust.
 Identities = 272/711 (38%), Positives = 412/711 (58%), Gaps = 35/711 (5%)
 Frame = -3

Query  2469  LGPSMLGNIEEFRKHNFPNHNFETIETMGHFALVLYAFLTGLQMDVKAIVHTGTKSRIVA  2290
             +GPS+LG  + F K+ F   +   +ET+ + +LV Y FL GL++D+  IV  G KS  +A
Sbjct  1     MGPSLLGWTDLFSKYIFAWKSLLALETVANLSLVYYIFLVGLELDMAPIVRAGGKSISIA  60

Query  2289  VSGSIFPFLIGAGFYFTLQTDTQ-------SMIGFIFCGSALTVTGFSTLAKILDSKRLL  2131
             + G + P  +G G +  +            +  G +F G +L  T F  L++IL   +LL
Sbjct  61    LLGILLPIPVGIGLHHLINNSRNKAKMPQATAHGPLFWGISLATTNFPDLSRILSDVKLL  120

Query  2130  NTEIGKIAASSALINVALSWVLLTIGLLFTGSLDNV--QWAvlctvgfvvvcvnyVRPLL  1957
             ++EIG+ A S+A+I    SWVLL I    T S+ NV   +AV  T  FV +C+   RP L
Sbjct  121   HSEIGRTALSAAVITDLCSWVLLVI----TMSISNVGKYYAVTSTFVFVCMCLFLFRPAL  176

Query  1956  NWLISKTPEGQGFSEFYICSFIAVICAFGCFTDAMGSHPMIGAFIFGLIMPNNELLRTAI  1777
              WLI  + +   ++EF+IC  +  + A G  TDA G+H ++GAF++G+IMP  EL +  I
Sbjct  177   KWLIRVSSKDGNYNEFHICFVMTGVVACGLITDACGTHSIVGAFMWGVIMPKGEL-KDMI  235

Query  1776  LDRLEDFVMGILMPVFFLVCGLRTNIFTITDGDTSIFTALALILLACSAKIIAALVASCY  1597
             + ++ED V  ILMP FF+V GLR N   I   ++     L +I LA SAKI++  + + +
Sbjct  236   MGKVEDLVKSILMPTFFVVTGLRVNC-NIISKESDWVLVLLIIFLATSAKIVSTFLVAIF  294

Query  1596  TGMSTNEAIGLGVLTNTKSTMVMIILEVGqvqqvlsvqqysmmvVACLIMTIVATP-LAA  1420
               M   E + LG L NTK  + +II+  G+  Q L    +++M+++  +MT +  P LA 
Sbjct  295   CNMPPREGLTLGSLMNTKGLLALIIISAGRDMQALGRLTFTVMIMSFWVMTALIGPTLAF  354

Query  1419  RYCPKQDLEPYKRRTIQNAKPGEELRILACIHGTNNLPAIISLLETSNSTVTSPITAFGV  1240
              Y   +     + RTIQ+ KP  E R++AC+H T N+  II LL  SN T  SP+  F +
Sbjct  355   TYKSIKTSRKSRYRTIQSIKPEAEFRVVACVHSTRNVYGIIHLLGASNPTKQSPLLVFAI  414

Query  1239  QLLELVGRAPAMMvvhssgsgrhvggsHEEVQTSQIISTFDNYELRSHGVTAQVLTARWS  1060
              L+EL GRA AM++VH             +VQT  II+ FD +E +++GVT   LTA   
Sbjct  415   HLVELTGRATAMLIVHGQCKASSAKA---KVQTDHIINAFDKFENQNNGVTVHSLTAVSP  471

Query  1059  YDTMAEDICKMAKEKRAAFLVLPFHKQQGTDGEMEDTNPAIQTVNEGVLLSAPCSVGILV  880
             Y TM +DIC +A EKR   +++PFHKQ   DG +ED NP++  VN  V+ +APCSV +LV
Sbjct  472   YATMHDDICGIAAEKRVHLIIVPFHKQPTLDGGLEDGNPSLGLVNNSVMANAPCSVAVLV  531

Query  879   ERG----------RPNQYAKNIAVLYLGGPDDREALTYARRMSGLPGVHLTVIRFVPAKD  730
             +RG          R N+  +  A+ ++GGPDDREAL YA RMS  PG+ +TV+RF+P ++
Sbjct  532   DRGLSATSLTDSNRSNRIQQRFALFFIGGPDDREALAYALRMSEHPGILITVVRFIPGEE  591

Query  729   VSADGAVEDPDLELELTRETSFVTVSIDPARDKEEDEELLNNFRTETAEDDSKTFMELVL  550
             V     ++ P  E         +T      ++K  D + ++NFR + + + S  + E+V+
Sbjct  592   VQEMSIMDFPGEE-----NVEILTALARAKKEKVIDNDYIDNFRLQISSNQSIGYAEVVV  646

Query  549   DDEEEFTKAVKSLDDRSFDLYVAGRGRGVSSALTSGLADWCECPELGAVGD  397
             ++ +E  KA+ +L++  F LY+ GRGRG+ S L SGL++W + PELG +GD
Sbjct  647   NNGDETLKAISTLENE-FSLYIVGRGRGMVSPLVSGLSEWSDSPELGVLGD  696



>ref|XP_007025120.1| Cation proton exchanger, putative [Theobroma cacao]
 gb|EOY27742.1| Cation proton exchanger, putative [Theobroma cacao]
Length=838

 Score =   460 bits (1183),  Expect = 5e-143, Method: Compositional matrix adjust.
 Identities = 278/778 (36%), Positives = 442/778 (57%), Gaps = 44/778 (6%)
 Frame = -3

Query  2658  VMCFSQTIYRSNGVWEGPDPLAPMIPLFILQIMTAILSSRILNFVLKPFNQPPLVAEILS  2479
             + CF   I + NG+W+G +P    +PL + Q+   ++ +R L  +LKP  QP ++++IL 
Sbjct  18    IQCFILNITKHNGIWQGDNPFTESLPLLVTQLAAILILTRSLYHLLKPLRQPRIISDILG  77

Query  2478  GIILGPSMLGNIEEFRKHNFPNHNFETIETMGHFALVLYAFLTGLQMDVKAIVHTGTKSR  2299
             GI+LGPS LG    F    FP  N  T+ET+ + ALV + FL GL++D+  I     K+ 
Sbjct  78    GILLGPSALGTTIYFADL-FPTINVITVETLAYMALVFHMFLVGLEIDLNVIGRISKKAI  136

Query  2298  IVAVSGSIFPFLIGAGFYFTLQTDTQ---------SMIGFIFCGSALTVTGFSTLAKILD  2146
                V+G +FPF +G GF++ L    +         ++ G     +AL VT F  ++ IL 
Sbjct  137   SFTVTGLLFPFTVGIGFFYLLHAYWEHDQSQGFEVNVQGSFLWAAALAVTSFPVVSGILS  196

Query  2145  SKRLLNTEIGKIAASSALINVALSWVLLTIGLLFTGSLDNVQWAvlctvgfvvvcvnyVR  1966
               +LLN++IG++A   AL++   SWVL+ I + F  +  N  + +  T+ +V+ CV   R
Sbjct  197   DLKLLNSDIGRLAMPIALVSDMGSWVLIVIVIPFCANPTNAPYIITTTIAYVLACVYTFR  256

Query  1965  PLLNWLISKTPEG--QGFSEFYICSFIAVICAFGCFTDAMGSHPMIGAFIFGLIMPNNEL  1792
             P L W+I +T +G  Q +S+FY+C  +  +      TD  G+H ++GAF+FGLI+P    
Sbjct  257   PFLAWIIRRTSKGKDQNYSKFYLCFVLVGVVLSAFVTDVTGTHSIVGAFVFGLILPTE--  314

Query  1791  LRTAILDRLEDFVMGILMPVFFLVCGLRTNIFTITDGDTSIFTALALILLACSAKIIAAL  1612
             L   +++R E FV G+LMPVFF V G+R +IF I++        L +++  C+ KII+ L
Sbjct  315   LALVLIERFEYFVSGLLMPVFFAVSGVRVDIFKISEWRL----VLLIVVWLCAVKIISFL  370

Query  1611  VASCYTGMSTNEAIGLGVLTNTKSTMVMIILEVGqvqqvlsvqqysmmvVACLIMTIVAT  1432
               S  + +   ++  LG+L NTK    ++I+  G  + VL    Y++M++  L+MT +  
Sbjct  371   PISLVSDIKPKDSFALGLLMNTKGVWAILIIHTGLDRGVLQDDDYAVMMITILLMTSIVA  430

Query  1431  PLAARYCPKQDLEP-YKRRTIQNAKPGEELRILACIHGTNNLPAIISLLETSNSTVTSPI  1255
             P+ A    + +L   Y+RRTIQ+A    ELRILACIH   ++P I+ LL+ S +T    I
Sbjct  431   PIIAAIYKRTNLSTRYERRTIQHASTEAELRILACIHSFCSVPGILKLLDVSQTTQNGHI  490

Query  1254  TAFGVQLLELVGRAPAMMvvhssgsgrhvggsHE-----EVQTSQIISTFDNYELRSHGV  1090
             T F + L+EL G A AM++VH S + R      +       +T +I++ F  YE ++  +
Sbjct  491   TVFTLHLVELSGCASAMLIVHDSQNRRFEDPVFDPDYGDSSETEKIVNAFREYENKNGNI  550

Query  1089  TAQVLTARWSYDTMAEDICKMAKEKRAAFLVLPFHKQQGTDGEMEDTNPAIQTVNEGVLL  910
             + Q LTA   +  M  DIC +A++K+A FL+LPFHKQ   +G + + N A + +N+ VLL
Sbjct  551   SIQSLTAVSPFVAMHGDICSLAEDKQATFLILPFHKQATKEGTLPEINAAFRDINKNVLL  610

Query  909   SAPCSVGILVERG-------RPNQYAKNIAVLYLGGPDDREALTYARRMSGLPGVHLTVI  751
             +APCSVGI ++RG       + N     IA+++LGGPDD EAL YA RM+  PGV LTVI
Sbjct  611   NAPCSVGIYIDRGLQETAGAKSNNKIHQIAMVFLGGPDDCEALAYAWRMAKNPGVRLTVI  670

Query  750   RFVPAKDVSADGAVEDPDLELELTRETSFVTVSIDPARDKEEDEELLNNFRTETAEDDSK  571
             R +          ++ P+ +  +    S++       R +E  +E +N FR  T  ++  
Sbjct  671   RLLEMD------TMDFPNGKASMLYSRSYLD------RQREIADEYINEFRLRTVGEELI  718

Query  570   TFMELVLDDEEEFTKAVKSLDDRSFDLYVAGRGRGVSSALTSGLADWCECPELGAVGD  397
              + E +L + EE    +K ++++ F+L++ GR  G+ S LT+ L    +CPELG +GD
Sbjct  719   HYEEKILLNGEELAVTLKEIENK-FELFIVGRREGLESPLTTLLVTRVDCPELGVIGD  775



>ref|XP_009402776.1| PREDICTED: cation/H(+) antiporter 15-like [Musa acuminata subsp. 
malaccensis]
Length=825

 Score =   457 bits (1177),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 274/775 (35%), Positives = 449/775 (58%), Gaps = 31/775 (4%)
 Frame = -3

Query  2658  VMCFSQTIYRSNGVWEGPDPLAPMIPLFILQIMTAILSSRILNFVLKPFNQPPLVAEILS  2479
             V+C+  +   + G+W+G +PL   IPLFILQ++  +++SR++  +L PF QP  V+EIL 
Sbjct  22    VLCYPTSSTTNFGIWKGENPLDYTIPLFILQLLIIVMTSRVVAILLHPFGQPRYVSEILG  81

Query  2478  GIILGPSMLGNIEEFRKHNFPNHNFETIETMGHFALVLYAFLTGLQMDVKAIVHTGTKSR  2299
             G +LGP++LG I  F +  FP  +   +E + H  ++ + F+ GL++D  ++  TG K  
Sbjct  82    GFVLGPTVLGRIPGFLRTLFPYRSLPILEVIAHVGIIYFVFIIGLEIDPTSLQRTG-KYA  140

Query  2298  IVAVSGSIFPFLIGA------GFYFTLQTDTQSMIGFIFCGSALTVTGFSTLAKILDSKR  2137
             I A +  +FPF +GA        Y  ++T+  S + F+  G   ++T FS LA+ L   +
Sbjct  141   IFAAACVVFPFAVGAISGKLVHTYLAIETNKSSFLTFL--GVTFSITSFSVLARTLTEHK  198

Query  2136  LLNTEIGKIAASSALINVALSWVLLTIGL-LFTGSLDNVQWAvlctvgfvvvcvnyVRPL  1960
             L+NT +G    S+A+   + +W+LL++   L +G+L  + W +   + F++  V  V+P 
Sbjct  199   LINTNLGLTTLSTAMFIDSWAWILLSMAFSLSSGNLPAIMWTMASGMVFILWSVKVVKPA  258

Query  1959  LNWLISKTPEGQGFSEFYICSFIAVICAFGCFTDAMGSHPMIGAFIFGLIMPNNELLRTA  1780
             + W+  + P+G+   E      +  +  +    DA+G + + GAF++GL++P    L  A
Sbjct  259   VLWVSRRKPKGEVVGELSASVILVGVMVWALMADAIGINAVSGAFVYGLMIPYGP-LGVA  317

Query  1779  ILDRLEDFVMGILMPVFFLVCGLRTNIFTITDGDTSIFTALALILLACSAKIIAALVASC  1600
             +++R++DFV G+L+P+FF +CGLR+N++++++   +      + LL+ +AK+ A L    
Sbjct  318   LIERVDDFVEGLLLPLFFAICGLRSNLYSVSN-VWAAVALAMVALLSAAAKVAACLSVGY  376

Query  1599  YTGMSTNEAIGLGVLTNTKSTMVMIILEVGqvqqvlsvqqysmmvVACLIMTIVATP-LA  1423
                M  N+   +G+L +TK  + M+IL++G+  +VLS Q YS++VV  +++TI   P L 
Sbjct  377   LYDMPLNDRFAMGLLMSTKGVIEMVILKIGRDMEVLSEQAYSILVVMSVVITIAVGPLLK  436

Query  1422  ARYCPKQDLEPYKRRTIQNAKPGEELRILACIHGTNNLPAIISLLETSNSTVTSPITAFG  1243
                   +    Y+RRTI    P  ELR+  C+H T N+P+++ LLE    T  SP+  F 
Sbjct  437   LATTSNRGQASYQRRTIMWPDPNSELRMQVCVHNTRNIPSMLGLLEACCPTKRSPVFVFA  496

Query  1242  VQLLELVGRAPAMMvvhssgsgrhvg--gsHEEV---QTSQIISTFDNYELRSHGVTAQV  1078
             + L+EL GRA AM+VVH +             +V   ++  +I   ++Y  R+ GVT Q 
Sbjct  497   LHLVELTGRASAMLVVHDTTGSASSSDPQHLHKVPLGRSRHMIQALESYAQRAAGVTIQP  556

Query  1077  LTARWSYDTMAEDICKMAKEKRAAFLVLPFHKQQGTDGEMEDTNPAIQTVNEGVLLSAPC  898
             LTA  SY TM  D+C +A++   A +VLPFHKQ   DG+M+  NPAI ++N+ VL +APC
Sbjct  557   LTAVSSYSTMHVDVCGVAEDNCVALIVLPFHKQPTVDGDMQVINPAIHSLNQSVLANAPC  616

Query  897   SVGILVERGR--PNQYA------KNIAVLYLGGPDDREALTYARRMSGLPGVHLTVIRFV  742
             SV ILV+ G   P++ A       ++AVL+ GGPDDREAL  A RM+  P V LTV RF+
Sbjct  617   SVAILVDHGLSGPSRMAVAQHSVHHVAVLFFGGPDDREALALASRMAEHPAVSLTVFRFI  676

Query  741   PAKDVSADGAVEDPDLELELTRETSFVTVSIDPARDKEEDEELLNNFRTETAEDDSKTFM  562
             P  D++   ++               +T+  D  ++++ DE  +  FR +   D++  ++
Sbjct  677   PGDDLATRPSMR----RYGSNNSDEVLTLEEDEEKEEQFDEAYITEFRLKHVSDETVVYI  732

Query  561   ELVLDDEEEFTKAVKSLDDRSFDLYVAGRGRGVSSALTSGLADWCECPELGAVGD  397
             E V ++ EE    ++S++    DLYV G+G G SS LT GL +WCECPELG +GD
Sbjct  733   EKVSNNAEETVAVIRSMEG-IHDLYVVGKGGGSSSPLTEGLTEWCECPELGPIGD  786



>ref|XP_006449661.1| hypothetical protein CICLE_v10014327mg [Citrus clementina]
 gb|ESR62901.1| hypothetical protein CICLE_v10014327mg [Citrus clementina]
Length=792

 Score =   456 bits (1172),  Expect = 4e-142, Method: Compositional matrix adjust.
 Identities = 285/766 (37%), Positives = 441/766 (58%), Gaps = 45/766 (6%)
 Frame = -3

Query  2652  CFSQTIYRSNGVWEGPDPLAPMIPLFILQIMTAILSSRILNFVLKPFNQPPLVAEILSGI  2473
             C    +  +NG+W   +PL   IPL I+Q+   I  +R L F+L+P  QP LV +IL   
Sbjct  16    CIILNVTTTNGIWPSKNPLFEPIPLLIVQLAFIITITRSLYFILRPLRQPRLVTDIL---  72

Query  2472  ILGPSMLGNIEEFRKHNFPNHNFETIETMGHFALVLYAFLTGLQMDVKAIVHTGTKSRIV  2293
              + PS  G    F K  FP  +  T+ET+ + AL LY FL GL+MDV +I  +  +   +
Sbjct  73    -VSPSFFGRKAYFSKL-FPVRSVTTLETVAYMALDLYIFLIGLEMDVNSIKSSSKRELNI  130

Query  2292  AVSGSIFPFLIGAGFYF------TLQTDTQSMIGFIFCGSALTVTGFSTLAKILDSKRLL  2131
             A +G++ P  +GAG +F       L TD     G +F G  LTVTGF  + +IL   +LL
Sbjct  131   AAAGALIPMGVGAGLFFLTARLLHLPTDPS---GCLFWGLTLTVTGFPAVTRILGELKLL  187

Query  2130  NTEIGKIAASSALINVALSWVLLTIGLLFTGSLDNVQWAvlctvgfvvvcvnyVRPLLNW  1951
              T+IG++A S A+I+   SW+L+ + L    S  N   A++ T+ F + C+  VRP L W
Sbjct  188   QTDIGRLATSIAMISDVCSWILVAVVLPIRSSPKNAPAAIISTIAFSLTCIYAVRPGLEW  247

Query  1950  LISKTPEGQ--GFSEFYICSFI--AVICAFGCFTDAMGSHPMIGAFIFGLIMPNNELLRT  1783
             LI +T +G    +S+ Y+C F+   VIC+F   T+  G++ ++GAF+FG+IMP+ +L   
Sbjct  248   LIRRTSKGNNNAYSDSYLCFFLIGVVICSF--VTEVTGTYSIVGAFVFGIIMPDRDL-GA  304

Query  1782  AILDRLEDFVMGILMPVFFLVCGLRTNIFTITDGDTSIFTALALILLACSAKIIAALVAS  1603
              + +R  DFV GI++P+FF +CG+RTN+  + +     F A  +I+L C  KI+  L+ S
Sbjct  305   LLFERFADFVSGIMLPLFFAMCGIRTNVHKVHNW----FLAGFVIILTCFCKILGTLLVS  360

Query  1602  CYTGMSTNEAIGLGVLTNTKSTMVMIILEVGqvqqvlsvqqysmmvVACLIMTIVATPL-  1426
                 M   + + LGVL NTK  + +++L +G  ++VL  Q+Y++MV+A +IMT    P+ 
Sbjct  361   HSYHMPLQDRLALGVLMNTKGILAVVVLNLGWDKKVLHDQEYAVMVIAIVIMTGGVAPII  420

Query  1425  AARYCPKQDLEPYKRRTIQNAKPGEELRILACIHGTNNLPAIISLLETSNSTVTSPITAF  1246
             +  Y     +  YK R+IQ AK G ELRILAC+HG  N+   I+LLE SN+T  SP+  F
Sbjct  421   STMYRSSTRIIKYKGRSIQRAKQGAELRILACVHGVGNVLGTINLLELSNATKESPLCIF  480

Query  1245  GVQLLELVGRAPAMMvvhssgsgrhvggsHEEVQTSQIISTFDNYELRSHGVTAQVLTAR  1066
              + L+EL G A A+++VH+S              + +I++ F+ +E RS G++   LTA 
Sbjct  481   ALHLVELRGSASAVLIVHTSSKNSAYKRVGSS-PSDRIVNIFEAFENRSTGISVHPLTAM  539

Query  1065  WSYDTMAEDICKMAKEKRAAFLVLPFHKQQGTDGEMEDTNPAIQTVNEGVLLSAPCSVGI  886
               + TM ED+C +A++K  AF++LPFH Q G        +   + VN+ +L +APCSVGI
Sbjct  540   SPFITMHEDVCNLAEDKHIAFMILPFHNQAGNSNADTTGSSPFREVNKNILANAPCSVGI  599

Query  885   LVERGR---PNQYAKNIAVLYLGGPDDREALTYARRMSGLPGVHLTVIRFVPAKDVSADG  715
              V++G+    N   +++ ++++GGPDDREAL  A RMS  P V LTV+R         + 
Sbjct  600   FVDKGQGKSDNGRMQHVVMVFIGGPDDREALALAWRMSANPSVQLTVLRL----HSRYNN  655

Query  714   AVEDPDLELELTRETSFVTVSIDPARDKEEDEELLNNFRTETAEDDSKTFMELVLDDEEE  535
              V++ D+           +  ID  R  + D E +N FR +TA + +  + E  +++ EE
Sbjct  656   NVKEEDIRY---------SKCID-GRQSQVDAEFVNEFRLQTAGEHNVNYYEKAVNNREE  705

Query  534   FTKAVKSLDDRSFDLYVAGRGRGVSSALTSGLADWCECPELGAVGD  397
              T A++ ++ +   LY+ GR    +SA T+ L  W ECPE+GA+GD
Sbjct  706   TTGALREMELQKVGLYIVGR-EVTASAATADLLGWSECPEIGAIGD  750



>ref|XP_002517311.1| monovalent cation:proton antiporter, putative [Ricinus communis]
 gb|EEF45104.1| monovalent cation:proton antiporter, putative [Ricinus communis]
Length=833

 Score =   453 bits (1166),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 296/796 (37%), Positives = 449/796 (56%), Gaps = 42/796 (5%)
 Frame = -3

Query  2661  VVMCFSQTIYRSNGVWEGPDPLAPMIPLFILQIMTAILSSRILNFVLKPFNQPPLVAEIL  2482
             + MC+ + I      W+  + L   +P FI+Q+   +L  R++  +LKP  QP  +AE+L
Sbjct  34    ITMCYFENITNDQAFWKSENSLLTSLPYFIIQLTLMMLCIRLVFGILKPLRQPRFLAELL  93

Query  2481  SGIILGPSMLGNIEEFRKHNFPNHNFETIETMGHFALVLYAFLTGLQMDVKAIVHTGTKS  2302
             S +++ PS   NI  F+K+  P  +  T++TMG   LV Y FL GL+MD+  + H   K+
Sbjct  94    SAVLIVPSSTANIAFFQKYISPAKSTRTLDTMGQLGLVYYMFLVGLEMDLTLLKHIEKKA  153

Query  2301  RIVAVSGSIFPFLIGAGFYFTLQTDTQSMI---GFIFCGSALTVTGFSTLAKILDSKRLL  2131
                AV   +FP  +G G +F L       +   G       LTVT F  LA++L   +LL
Sbjct  154   LYNAVVTILFPLGMGIGLFFLLDHYRDEKVVGMGGAIWALTLTVTSFPDLARVLSDMKLL  213

Query  2130  NTEIGKIAASSALINVALSWVLLTIGLLFTGSLDNVQWAvlctvgfvvvcv---nyVRPL  1960
             +T+IG++A SSA++   ++W LL + +    ++ N  +  L     V   +     VRP 
Sbjct  214   HTDIGRLALSSAVVCDLVAWALLVLAI----TMVNQHFYFLNVFVMVGFVLFCWFVVRPA  269

Query  1959  LNWLI--SKTPEGQGFSEFYICSFIAVICAFGCFTDAMGSHPMIGAFIFGLIMPNNELLR  1786
             L+W+I  + +  G    E  I   +  +  FG  TDA GS  M+GAF+FGLI+P  E L 
Sbjct  270   LSWIIRLNNSSNGGMDHELLIYFILGGVVIFGFVTDACGSRSMVGAFMFGLIIPKGE-LG  328

Query  1785  TAILDRLEDFVMGILMPVFFLVCGLRTNIFTITDGDTSIFTALALILLACSAKIIAALVA  1606
               ++++LED V GIL+P F+   GL+ +  T+ D   +I     +I+LAC+ KII+A + 
Sbjct  329   IRLIEKLEDLVTGILLPAFYWTNGLKIHFHTLND-RVNIIVVPIIIVLACTTKIISAFIF  387

Query  1605  SCYTGMSTNEAIGLGVLTNTKSTMVMIILEVGqvqqvlsvqqysmmvVACLIMTIVATPL  1426
             S   GMS  E I LGVL NTK  + +II+ VG+  +    Q Y+MM ++ ++MT++  P+
Sbjct  388   SIVQGMSAREGITLGVLMNTKGVLALIIMNVGRDLKGFDEQMYAMMTMSLILMTLMVKPI  447

Query  1425  A-ARYCPKQDLEPYKRRTIQNAKPGEELRILACIHGTNNLPAIISLLETSNSTVTSPITA  1249
             A A     + ++ YKRRTI+ +K   ELRILAC +  NN+  II+LLE SN T  SPI  
Sbjct  448   AMATTKSTKQVKQYKRRTIEMSKHNAELRILACTYSVNNISGIINLLEASNPTKQSPICV  507

Query  1248  FGVQLLELVGRAPAMMvvhssgsgrhvggsHE----EVQTSQ-IISTFDNYELRSHGVTA  1084
             F V L++L  R  + M++      R      E    EV+ S+ +I+ F  YE RS  V+ 
Sbjct  508   FAVHLVQLTARRVSAMLIVHDAYHRTPNIGQENQSHEVEESEHVINAFQEYESRSTEVSV  567

Query  1083  QVLTARWSYDTMAEDICKMAKEKRAAFLVLPFHKQQGTDGEMEDTNPA-IQTVNEGVLLS  907
             Q LT    Y +M ED+C++A++KR   +++PFHKQ    G+M+D   A ++ VN+ +L +
Sbjct  568   QALTVVSPYTSMQEDVCRLAEDKRVNLILVPFHKQPDVYGKMQDEEDAPLRAVNQNLLST  627

Query  906   APCSVGILVERGR-PNQYAKNIAVLYLGGPDDREALTYARRMSGLPGVHLTVIRFVPAKD  730
             +PCS+GIL++RG   +Q   N  +L++GG D REAL YA RM+G   V+LTV+RFV    
Sbjct  628   SPCSIGILIDRGLGESQGQNNFIMLFVGGADSREALAYAWRMAGSASVNLTVVRFVLTTT  687

Query  729   VSADGAVEDPDLELELTRETSFVTVSIDPARDKEEDEELLNNFRTETAEDDSKTFMELVL  550
              + D  V               VT   +  +++  D+E +N FR +T  D+S TF E++ 
Sbjct  688   TNDDARV---------------VT---EQEKERRLDDECINQFRFKTMYDESITFEEILF  729

Query  549   DDEEEFTKAVKSLDDRSFDLYVAGRGRGVSSALTSGLADWCECPELGAVGDllvtsefes  370
                 E   A++ + D  +DLY+ GRG G  S LT GL +  +C ELGA+ D L++S+F  
Sbjct  730   SYGNEIITAMRRMQD-GYDLYIVGRGEGAMSQLTPGLLELSDCEELGALWDTLLSSDFAG  788

Query  369   sfsvlvVQQ-YVRTNK  325
             S S+LV+QQ YVR  K
Sbjct  789   SSSILVIQQHYVRGAK  804



>ref|XP_006447579.1| hypothetical protein CICLE_v10017901mg [Citrus clementina]
 gb|ESR60819.1| hypothetical protein CICLE_v10017901mg [Citrus clementina]
 gb|KDO54688.1| hypothetical protein CISIN_1g043953mg [Citrus sinensis]
Length=868

 Score =   453 bits (1166),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 288/797 (36%), Positives = 434/797 (54%), Gaps = 50/797 (6%)
 Frame = -3

Query  2664  QVVMCFSQTIYRSNGVWEGPDPLAPMIPLFILQIMTAILSSRILNFVLKPFNQPPLVAEI  2485
             ++ +C+ +   + +  W+  +P+   +PL   ++  AI++ R+   +LKP +QP  + E+
Sbjct  21    EIQVCYPEEFNKYDSPWQRQNPMMRAVPLLATELGFAIVAIRLFIILLKPLHQPRFIPEL  80

Query  2484  LSGIILGPSMLGNIEEFRKHN--------FPNHNFETIETMGHFALVLYAFLTGLQMDVK  2329
             L+ I++GPS  G  E              FP  N   +ET     L  Y FL GL+MDV 
Sbjct  81    LTSILIGPSTFGTFESLSPDTIVKQMMKLFPYENTVLLETFSSLGLTFYMFLVGLEMDVS  140

Query  2328  AIVHTGTKSRIVAVSGSIFPFLIGAGFYFTLQ----TDTQSMIGFIFCGSALTVTGFSTL  2161
             A+     KS  +A +G + PF IGA  +F       T     +G +F   +LT+T F  L
Sbjct  141   AVKRMEKKSLSIAFAGIVIPFCIGAALHFVPIHEGITRESPNLGALFWAISLTITSFPDL  200

Query  2160  AKILDSKRLLNTEIGKIAASSALINVALSWVLLTIGLLFTG------------SLDNVQW  2017
             A+IL   +LL+T+IGK A SSA++N   SW LL + ++                L     
Sbjct  201   ARILSDVKLLHTDIGKTALSSAIVNDLSSWFLLVLVIVAFNHYSKHRHGPALTELGAFLM  260

Query  2016  AvlctvgfvvvcvnyVRPLLNWLISKTPEGQG-FSEFYICSFIAVICAFGCFTDAMGSHP  1840
             A+L  + F+++    +RP + W+I +T +  G FS+ +I   +  +   G   D  G H 
Sbjct  261   AMLPIICFILIFWFVLRPCIAWMIKETKKKAGKFSDTHISVILLGVVVCGFIADGCGMHS  320

Query  1839  MIGAFIFGLIMPNNELLRTAILDRLEDFVMGILMPVFFLVCGLRTNIFTITDGDTSIFTA  1660
             M G FIFGLI+PN EL    I++R E+F+ G+ +P F +V GLRTN   +    T +F  
Sbjct  321   MAGGFIFGLIIPNGEL-AINIMERTEEFISGVWLPSFIVVSGLRTNFLELFS-KTKLFYL  378

Query  1659  LALILLACSAKIIA-ALVASCYTGMSTNEAIGLGVLTNTKSTMVMIILEVGqvqqvlsvq  1483
             L   ++A SAKI++  LVA CY GM   + + LG L NTK  M +I+L  G+  + +   
Sbjct  379   LLTTIVATSAKILSTVLVALCY-GMPVRDGVALGGLMNTKGVMALIVLNEGRSLKAIDNI  437

Query  1482  qysmmvVACLIMTIVATPLAARYCPK-QDLEPYKRRTIQNAKPGEELRILACIHGTNNLP  1306
               + MV   L+MT +  P+      K +    YK+RTIQ   P  ELRIL CIH   NL 
Sbjct  438   LMAAMVFMLLLMTGLVGPIFFLANKKAKRTRKYKQRTIQRRNPDTELRILTCIHSVGNLS  497

Query  1305  AIISLLETSNSTVTSPITAFGVQLLELVGRAPAMMvvhss--gsgrhvggsHEEVQTSQI  1132
              II+LLE SN+T  SP+  F V L+EL  RA AM++VH +            E   +  I
Sbjct  498   GIINLLELSNATKKSPLCVFAVHLVELTRRASAMLIVHDAFRTKTSDQNSIRELADSDLI  557

Query  1131  ISTFDNYELRSHGVTAQVLTARWSYDTMAEDICKMAKEKRAAFLVLPFHKQQGTDGEMED  952
             I+ F +Y+ R+  +T Q LTA  S+ ++ EDI ++A++K  A +++PFHKQ   DGE++ 
Sbjct  558   INAFRHYQDRNDDITVQPLTAVSSFTSIHEDIFEIAEDKVVALILIPFHKQPTADGELQG  617

Query  951   TNPAIQTVNEGVLLSAPCSVGILVERG------------RPNQYAKNIAVLYLGGPDDRE  808
              N  I+ VN  +L  APCS+GILV+RG               +    + +L++GGPDDRE
Sbjct  618   ENHQIREVNNNLLAKAPCSIGILVDRGIGSAVITSAQSSLHGRQGLKLCMLFIGGPDDRE  677

Query  807   ALTYARRMSGLPGVHLTVIRFVPAKDVSADGAVEDPDLELELTRETSFVTVSIDPARDKE  628
             AL YA RM+G PGV+LTV+R+V  KD  +   VED    L  T +   V  + D  ++KE
Sbjct  678   ALFYAWRMAGKPGVNLTVVRYVYNKDGESGILVED----LNNTEDEDLVDTARD-VKEKE  732

Query  627   EDEELLNNFRTETAEDDSKTFMELVLDDEEEFTKAVKSLDDRSFDLYVAGRGRGVSSALT  448
              D+E +N FR +T  D S T+ + ++ + EE  +++ ++    ++LY+ GRG  V S LT
Sbjct  733   LDDEFINEFRFKTMYDSSITYNDKMVSNVEELVESITTMYGE-YELYIIGRGDNVKSPLT  791

Query  447   SGLADWCECPELGAVGD  397
              GL+ W + PELG VG+
Sbjct  792   MGLSGWVDNPELGPVGE  808



>ref|XP_010542776.1| PREDICTED: cation/H(+) antiporter 23, chloroplastic-like [Tarenaya 
hassleriana]
Length=854

 Score =   452 bits (1162),  Expect = 7e-140, Method: Compositional matrix adjust.
 Identities = 291/810 (36%), Positives = 446/810 (55%), Gaps = 46/810 (6%)
 Frame = -3

Query  2682  DLDRLGQVVMCFSQTIYRSNGV--WEGPDPLAPMIPLFILQIMTAILSSRILNFVLKPFN  2509
             D  R G++V    + +Y  N     E    LA  +P FI QI  A L+ RIL ++ +P  
Sbjct  15    DESRYGKIVCYPQEYLYEKNDQKNLESGGTLASALPFFITQIFVANLTYRILYYLTRPLY  74

Query  2508  QPPLVAEILSGIILGPSMLGNIEEFRKHNFPNHNFETIETMGHFALVLYAFLTGLQMDVK  2329
              PP VA+IL G++  PS+LGN E   ++ FP      +ET  + ALV   FL GL MD++
Sbjct  75    LPPFVAQILCGLLFSPSLLGNTEFVIENIFPYRFTMILETFANLALVYNVFLLGLGMDIR  134

Query  2328  AIVHTGTKSRIVAVSGSIFPFLIGAGFYFTLQTDTQSMI--GFIFCGSALTVTGFSTLAK  2155
              +  T  KS +++  G +     GA  Y+         I  G +F   AL+ T F  LA+
Sbjct  135   MVRLTEFKSLVISAVGLLVSLPAGAALYYLPGNGDSDKILAGCVFWCIALSCTNFPDLAR  194

Query  2154  ILDSKRLLNTEIGKIAASSALINVALSWVLLTIG---LLFTGSLDNVQ-WAvlctvgfvv  1987
             +L   +LL ++IG+ A S+A++    +WVLL  G   L  +G+ +++  + +L T GF++
Sbjct  195   VLADLKLLRSDIGRTAMSAAIVTDLCTWVLLVFGFAALSKSGTWNHMMPFVLLATGGFIL  254

Query  1986  vcvnyVRPLLNWLISKTPEGQGFSEFYICSFIAVICAFGCFTDAMGSHPMIGAFIFGLIM  1807
             +C+  +RP ++W  SKT +G    + ++   +  +   G  TDA G H + GAF+FGL +
Sbjct  255   LCILVIRPGISWAFSKTVKGGHVDDTHVWFILCGVVLCGLITDACGVHSITGAFVFGLSI  314

Query  1806  PNNELLRTAILDRLEDFVMGILMPVFFLVCGLRTNI-FTITDGDTSIFTALALILLACSA  1630
             P+++++R  I ++L DF+ GILMP+F+++CGLR +  F     D +I       L+ C++
Sbjct  315   PHDQIIRNMIEEKLHDFLSGILMPLFYIICGLRADFEFMFRYVDPAIMG-----LVVCTS  369

Query  1629  ---KIIAALVASCYTGMSTNEAIGLGVLTNTKSTMVMIILEVGqvqqvlsvqqysmmvVA  1459
                KI+   +A  +   S  +A+ LG L NTK T+ ++IL  G+  + L    Y+ M + 
Sbjct  370   FLLKIVPTFIALLFMRTSFRDALALGTLMNTKGTLALVILNAGRDTKALDSPMYTHMTIV  429

Query  1458  CLIMTIVATP-LAARYCPKQDLEPYKRRTIQNAKPGEELRILACIHGTNNLPAIISLLET  1282
              L+M++V  P LA  Y  K+ +  YK RTIQ  K   E  +LAC+H   N+  I +LL  
Sbjct  430   FLVMSLVVEPFLALTYRAKKKVIHYKLRTIQKIKGDTEFHVLACVHILPNVLGITNLLRD  489

Query  1281  SNSTVTSPITAFGVQLLELVGRAPAMMvvhssgsgrhvggsHE-EVQTSQIISTFDNYEL  1105
             SN T  SP+  F V L+EL GR  A +++ +         S +   ++ QI   F+  E+
Sbjct  490   SNPTKQSPLYVFAVHLVELTGRTTASLLIMNDECKPKGNFSDKFRAESDQIAEAFEAIEV  549

Query  1104  RSHGVTAQVLTARWSYDTMAEDICKMAKEKRAAFLVLPFHKQQGTDGEMEDTNPAIQTVN  925
              +  V  Q +TA   Y TM EDIC +A++KR  F++LP+HK   +DG M + N +   +N
Sbjct  550   HNDSVVVQTITAVSPYTTMHEDICALAEDKRVCFIILPYHKHLTSDGRMGEGNASHADIN  609

Query  924   EGVLLSAPCSVGILVERG----RPNQY-----AKNIAVLYLGGPDDREALTYARRMSGLP  772
             + VL  APCSVGILV+RG    R          + +A+L++GG DDREAL YARRM G  
Sbjct  610   QNVLNHAPCSVGILVDRGIGMVRSESLHGLPAKRKVAMLFVGGADDREALAYARRMVGQH  669

Query  771   GVHLTVIRFVPAKDVSADGAVEDPDLELELTRETSFVTVSIDPARDKEEDEELLNNFRTE  592
              + LTV+RFVP  D            E                 R+K+ D+EL+  F  +
Sbjct  670   MIELTVVRFVPGHDALVSAGKTAAAYE-----------------REKQVDDELIYEFNFK  712

Query  591   TAEDDSKTFMELVLDDEEEFTKAVKSLDDR-SFDLYVAGRGRGVSSALTSGLADWCECPE  415
             T  D S T++E V++D +E    ++ ++D+ S+DLY+ GRG  V S +TSGLADW   P+
Sbjct  713   TMNDPSVTYIEKVVNDGQETISTIREMEDKHSYDLYIVGRGYNVDSPVTSGLADWSSSPD  772

Query  414   LGAVGDllvtsefessfsvlvVQQYVRTNK  325
             LG +GD L ++ F    SVLV+QQY  +N+
Sbjct  773   LGTIGDTLASANFTMQASVLVIQQYSASNR  802



>ref|XP_011023015.1| PREDICTED: cation/H(+) antiporter 15-like [Populus euphratica]
Length=858

 Score =   451 bits (1161),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 288/786 (37%), Positives = 452/786 (58%), Gaps = 36/786 (5%)
 Frame = -3

Query  2616  WEGPDPLAPMIPLFILQIMTAILSSRILNFVLKPFNQPPLVAEILSGIILGPSMLGNIEE  2437
             ++    L   +PLF+LQ+   + ++R+L  +L+P  QP +VA I++G++LGPS LG    
Sbjct  29    FQSTGALTTSLPLFVLQLSVVLFTTRLLLLILRPLRQPSIVAFIIAGVLLGPSALGTTPL  88

Query  2436  FRKHNFPNHNFETIETMGHFALVLYAFLTGLQMDVKAIVHTGTKSRIVAVSGSIFPFLIG  2257
             F  H  P    + +ET  + ALV Y FL GL+MD+K I+++G+++  +A+SG++ P   G
Sbjct  89    FLDHVLPFKAVKVLETFANLALVYYMFLFGLEMDLKPIMNSGSEAIRIAISGTLIPLGFG  148

Query  2256  AGFYFTLQ------TDTQSMIGFIFCGSALTVTGFSTLAKILDSKRLLNTEIGKIAASSA  2095
              G ++ LQ       +  S  G IF    LT T F  + ++L   +LL T+IG++A SSA
Sbjct  149   FGLFYLLQLLDSNAKEISSFKGSIFWAITLTATNFPDVTQVLTDLKLLRTDIGRLAMSSA  208

Query  2094  LINVALSWVLLTIGLLFTGSLDNVQ--WAvlctvgfvvvcvnyVRPLLNWLISKTPEGQG  1921
             + +   +W+LL + +    SL N +  + +   + FV++C   +RP+++ + +   +G+ 
Sbjct  209   ISSDFFTWILLVVAM----SLLNARPYYVLPSILAFVLLCGFVIRPVISKIANHAVKGED  264

Query  1920  FSEFYICSFIAVICAFGCFTDAMGSHPMIGAFIFGLIMPNNELLRTAILDRLEDFVMGIL  1741
             F+E +I   +  I  FG  TDA G H M+G+F+ G+IMP  +++R  +++RL+DFV GI+
Sbjct  265   FTEQHIWFILGWIVFFGFITDAFGLHSMVGSFMLGVIMPRRDVIRMKLMERLDDFVSGIM  324

Query  1740  MPVFFLVCGLRTNI-FTITDGDTSIFTALALILLACSAKIIAALVASCYTGMSTNEAIGL  1564
             MP+FFL  G RT+  F +   +T  +    +I L+  AKI++ L+       S  +   L
Sbjct  325   MPLFFLTSGTRTDAGFMLK--ETPWYAIFIIIFLSFGAKILSTLLVFLLHNKSMEDGFAL  382

Query  1563  GVLTNTKSTMVMIILEVGqvqqvlsvqqysmmvVACLIMTIVATPL-AARYCPKQDLEPY  1387
             GV+ NTK  M +II+  G+  + L+ Q +++MV + L MT +  P+ AA Y P++ L  Y
Sbjct  383   GVIMNTKGVMSIIIINAGRNIKALNNQTFTLMVFSALAMTCLVEPIVAATYKPRKKLLRY  442

Query  1386  KRRTIQNA-KPGEELRILACIHGTNNLPAIISLLETSNSTVTSPITAFGVQLLELVGRAP  1210
             K RTI++    G E +ILAC+    + P +ISLLE SN+    PI    V L+EL GR  
Sbjct  443   KHRTIESVLTNGVEFKILACVLSNRDAPCMISLLEASNAGPDFPICVIAVHLVELTGRNT  502

Query  1209  AMMvvhssgsgrhvggsHEEVQTSQIISTFDNYELRSHGVTAQVLTARWSYDTMAEDICK  1030
             AM++VH             + ++ QII  F +YE R+  V+ Q +TA   Y+ M EDIC 
Sbjct  503   AMLIVHDHSMTSMSNPIRAKSESDQIIFAFKSYEKRNGAVSVQTITAISPYENMHEDICS  562

Query  1029  MAKEKRAAFLVLPFHKQQGTDGEMEDTNPAIQTVNEGVLLSAPCSVGILVERG-------  871
             +A +KR + +++PF      DG +ED       +N+ VL +A CSVG+LV+RG       
Sbjct  563   LALDKRVSLIIIPFQTVLTADGRVEDAKSTFPAMNQYVLENATCSVGLLVDRGLGSIMQT  622

Query  870   -----RPNQYAKNIAVLYLGGPDDREALTYARRMSGLPGVHLTVIRFVPAKDVSADGAVE  706
                    N     IA++++GG DDREAL YA RM+G PG+ LTV+RF+P +  +      
Sbjct  623   GPARNSSNSKRHRIAMIFIGGHDDREALAYAWRMAGHPGISLTVLRFLPGRIAAQSTPEH  682

Query  705   DPDLELELTRETSFVTVSIDPARDKEEDEELLNNFRTETAEDDSKTFMELVLDDEEEFTK  526
               +   EL     F +++I+  R+K  D++    F  +T +D+S T+ E V+++ +E   
Sbjct  683   SSNNHDEL-----FSSMTIEE-REKRLDDDYTYEFMFKTLDDESITYTEKVVNNGDETLA  736

Query  525   AVKSLDDRSFDLYVAGRGRGVSSALTSGLADWCECPELGAVGDllvtsefessfsvlvVQ  346
              ++  +D  FDLY+ GRG    S LTSGL+DW  C ELG +GD L +S F S  SVLVVQ
Sbjct  737   EIRR-NDADFDLYIVGRGEKTRSVLTSGLSDWNSCQELGTMGDTLASSNFASHASVLVVQ  795

Query  345   QYVRTN  328
             QYV  N
Sbjct  796   QYVPKN  801



>ref|XP_010058865.1| PREDICTED: cation/H(+) antiporter 15-like [Eucalyptus grandis]
 gb|KCW73790.1| hypothetical protein EUGRSUZ_E02390 [Eucalyptus grandis]
Length=807

 Score =   449 bits (1155),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 278/797 (35%), Positives = 458/797 (57%), Gaps = 33/797 (4%)
 Frame = -3

Query  2676  DRLGQVVMCFSQTIYRSNGVWEGPDPLAPMIPLFILQIMTAILSSRILNFVLKPFNQPPL  2497
             ++L +   C+ + +  S+ +W  P      + +F+ Q+   I  S  L F L+P  QP +
Sbjct  5     EQLNKTGTCYVEHVLHSHDIWREPGAPRLSVSVFLKQLGITIFLSHALIFALRPLRQPRI  64

Query  2496  VAEILSGIILGPSMLGNIEEFRKHNFPNHNFETIETMGHFALVLYAFLTGLQMDVKAIVH  2317
             VAEIL G+++GP+  GN + F  + FP  +F  IET+G+  L+ + FL GL+ D+ A+  
Sbjct  65    VAEILCGLLIGPTAFGNSKYF-GYVFPERSFVKIETVGYLGLMYHLFLVGLRFDLSALAL  123

Query  2316  TGTKSRIVAVSGSIFPFLIGAGFYFTLQTDTQSM----IGFIFCGSALTVTGFSTLAKIL  2149
              G K+  +A++    P ++G   +F + +   +     +G +F   ALT TG   L++IL
Sbjct  124   IGKKATSIALAAFFLPGIVGISTFFMVTSSPGARNADGLGGVFWVIALTFTGSPVLSEIL  183

Query  2148  DSKRLLNTEIGKIAASSALINVALSWVLLTIGLLFTGSLDNVQWAvlctvgfvvvcvnyV  1969
              S +LL+++IG+ A ++A+I+   +WVL+ + +  + +     ++    +GF++VC+   
Sbjct  184   ASIKLLHSDIGRTATAAAVISDVCAWVLIIVVMPISLAGKEFSYSFTAIIGFILVCLFGF  243

Query  1968  RPLLNWLISKTPEGQGFSEFYICSFIAVICAFGCFTDAMGSHPMIGAFIFGLIMPNNELL  1789
             RP L W+I KT + + +S+ Y+   +  +  FG  TD +G+H ++GAF+FGLIMPN +L 
Sbjct  244   RPALAWIIRKTSKERDYSDHYVVIILIGVSIFGLITDIIGTHALVGAFMFGLIMPNRDLG  303

Query  1788  RTAILDRLEDFVMGILMPVFFLVCGLRTNIFTIT---DGDTSIFTALALILLACSAKIIA  1618
                +L ++E++V GIL+P F++VCG+R N++ I    D   ++F    +I L   AK+++
Sbjct  304   SKLVL-KIEEYVAGILLPFFYVVCGIRANLWEIKRLEDWAVTVF----VICLGWLAKVLS  358

Query  1617  ALVASCYTGMSTNEAIGLGVLTNTKSTMVMIILEVGqvqqvlsvqqysmmvVACLIMTIV  1438
              +  S +  +   E + LG+L N KS + + +L+V   +  LS Q YS+MV+A LIMT  
Sbjct  359   TMGISMFFNIQPREGVVLGLLMNCKSLLGLALLDVAWDKGALSTQHYSIMVLAFLIMTGS  418

Query  1437  ATPLA-ARYCPKQDLEPYKRRTIQNAKPGEELRILACIHGTNNLPAIISLLETSNSTVTS  1261
               PL    Y P +    Y  R+IQ A    E R+L+CI+ T ++  I++LLE S   + S
Sbjct  419   VAPLIDVIYGPTKRFMHYTLRSIQAAGSNTEFRVLSCIYSTRHVSPIVNLLEVSTGNMRS  478

Query  1260  PITAFGVQLLELVGRAPAMMvvhssgsgrhvggsHEEVQTSQIISTFDNYELRSHGVTAQ  1081
             P T FG+ L+E+ G A A ++VH            +  Q+  I+ + +++E ++   +AQ
Sbjct  479   PFTVFGLHLVEVTGCASATLIVHDPNKPSKSHLH-DSAQSEHIMKSLEDFEYQNRSASAQ  537

Query  1080  VLTARWSYDTMAEDICKMAKEKRAAFLVLPFHKQQGTDGEMEDTNPAIQTVNEGVLLSAP  901
             +LT    Y++M ED+C +A++KR + ++LPFH++    G MED     + +N  VL  AP
Sbjct  538   LLTILSPYESMCEDVCGLAEDKRVSLIILPFHRRATMAGAMEDAELTFRPINRSVLADAP  597

Query  900   CSVGILVERG--------RPNQYAKNIAVLYLGGPDDREALTYARRMSGLPGVHLTVIRF  745
             CSV + ++RG          +   +  A+L++GG DDREAL YA RM+G P + LTV+RF
Sbjct  598   CSVALFIDRGLAAMRRTESNHIMTRRAAMLFIGGHDDREALAYAWRMAGHPSISLTVVRF  657

Query  744   VPAKDVSADGAVEDPDLEL-ELTRETSFVTVSIDPARDKEEDEELLNNFRTETAEDDSKT  568
             +   DV         D+EL EL      +T+  D  R K  D+  +  FR   + ++S T
Sbjct  658   LQGNDVV--------DIELMELQERHGILTIISDMERQKRLDDVYIAEFRRNNSGNESIT  709

Query  567   FMELVLDDEEEFTKAVKSLDDRSFDLYVAGRGRGVSSALTSGLADWCECPELGAVGDllv  388
             + E+ +++  E   A++ + +R F+LY+ GR     S LT GLA+W E PELGA+GD+LV
Sbjct  710   YREVTVNNGNETVTAIREM-EREFELYIVGRSERSISPLTFGLAEWSEYPELGAIGDILV  768

Query  387   tsefessfsvlvVQQYV  337
             +S F    SVLVVQQYV
Sbjct  769   SSSFNMQASVLVVQQYV  785



>ref|XP_009383032.1| PREDICTED: cation/H(+) antiporter 15-like [Musa acuminata subsp. 
malaccensis]
Length=864

 Score =   450 bits (1158),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 285/817 (35%), Positives = 465/817 (57%), Gaps = 49/817 (6%)
 Frame = -3

Query  2661  VVMCFSQTIYRSNGVWEGPDPLAPM-IPLFILQIMTAILSSRILNFVLKPFNQPPLVAEI  2485
             ++ C+      S GVW    PL    IP+ + Q++ A++ SR L F+LKP  QP +VAEI
Sbjct  11    ILYCYKLDSISSGGVWN-ERPLHKFAIPVLLWQMVLAVIVSRGLAFLLKPLRQPRVVAEI  69

Query  2484  LSGIILGPSMLGNIE--------EFRKHNFPNHNFETIETMGHFALVLYAFLTGLQMDVK  2329
             L+GI+LGPS+LG I            +  +P  +   +ETMG   L+ Y F+ G++ D++
Sbjct  70    LTGIVLGPSVLGKIVIHEAGIPVSLGEVVYPAASHRLLETMGLIGLLYYLFMVGMEFDLQ  129

Query  2328  AIVHTGTKSRIVAVSGSIFPFLIG--AGFYFTLQT--DTQSMIGFIFCGSALTVTGFSTL  2161
                    K   +A +    PF++   A     LQ       +   +F GSA TVT F+ L
Sbjct  130   IFESWREKVIAIAAANMALPFIVTLLAANVMNLQPPGHVNYLSQVVFIGSATTVTSFTVL  189

Query  2160  AKILDSKRLLNTEIGKIAASSALINVALSWVLLTIGLLFTGSLDNVQ----------WAv  2011
              ++L   ++LN+E+G++   SA+++  ++WVLL   ++   S  + +          W  
Sbjct  190   VRVLAELKILNSELGQLVMPSAILSDLMTWVLLAATVVLPASAGSNRDIAPTKFAFLWIS  249

Query  2010  lctvgfvvvcvnyVRPLLNWLISKTPEGQGFSEFYICSFIAVICAFGCFTDAMGSHPMIG  1831
             +  + F   C   +RP + W++ +TPEG+   + YI      + A G  TD +G H + G
Sbjct  250   VSGIAFTAACWLVIRPTMCWILRRTPEGEPVDDVYISVIATGVLAVGIITDMIGFHAVYG  309

Query  1830  AFIFGLIMPNNELLRTAILDRLEDFVMGILMPVFFLVCGLRTNIFTIT----DGDTSIFT  1663
             AF++GL++P   L    + +RLE+FV+G+LMP+F   CG + ++  +      G   I T
Sbjct  310   AFVYGLVVPRGPL-TIGLRNRLEEFVIGLLMPIFLATCGFKADLSLLNTEDKKGAAVIST  368

Query  1662  ALALILLACSAKIIAALVASCYTGMSTNEAIGLGVLTNTKSTMVMIILEVGqvqqvlsvq  1483
                +I+L+   K+ +++  + Y  M+  E++ LG+L NTK  + MIIL +G+ +Q+  V+
Sbjct  369   LSMIIVLSFLVKLGSSMAIAQYNSMTAPESLSLGLLMNTKGPIDMIILNIGKHKQIFDVR  428

Query  1482  qysmmvVACLIMTIVATPLAARYCPKQDLE-PYKRRTIQNAKPGEELRILACIHGTNNLP  1306
              Y+++++  +      TP  A       +   +KRR +Q  +P  ELR++AC++   N+P
Sbjct  429   MYTVLILGSIFTMAAVTPSVAILNKTSRIRVAHKRRNLQRCRPDMELRMVACVYNARNVP  488

Query  1305  AIISLLETSNSTVTSPITAFGVQLLELVGRAPAMMvvhssgsgrhvggsHEE-----VQT  1141
             ++ISLL+ SN T  SPI  + + LLE  GRA AM++VH  G  +             +Q+
Sbjct  489   SVISLLQMSNPTKRSPIFVYALHLLEPTGRASAMLIVHEIGKSKGQRQVVSNPSGGAMQS  548

Query  1140  SQIISTFDNYELRSHGVTAQVLTARWSYDTMAEDICKMAKEKRAAFLVLPFHKQQGTDGE  961
              QII+TF++YE  + GV+ Q +TA   Y TM ED+  +A+E+ +  ++LPFHKQ    G+
Sbjct  549   EQIIATFESYEQHAGGVSVQPVTAISPYSTMHEDVFNIAEERHSTLIILPFHKQLSVAGD  608

Query  960   MEDTNPAIQTVNEGVLLSAPCSVGILVERG-------RPNQYAK-NIAVLYLGGPDDREA  805
              ED NP+I++VN  VL +APCSVGILV+RG         +Q+ + ++AVL+ GGPDDREA
Sbjct  609   FEDINPSIRSVNRSVLANAPCSVGILVDRGLSGGGRFSVSQFVEHHVAVLFFGGPDDREA  668

Query  804   LTYARRMSGLPGVHLTVIRFVPAKDVSADGAVEDPDLELELTRETSFVTVSIDPARDKEE  625
             L Y+ RM+  P V+LTV+RF+P ++         P L    + E + +TV  D +  ++ 
Sbjct  669   LAYSWRMAEHPSVNLTVVRFLPGEEAPVP---PSPSLSCA-SGEHAAMTVVEDDSMQRQL  724

Query  624   DEELLNNFRTETAEDDSKTFMELVLDDEEEFTKAVKSLDDRSFDLYVAGRGRGV-SSALT  448
             D+E +N FR     D+S  + E V+++  E   A+++++     +YV GRG+G  SS L 
Sbjct  725   DDECVNEFRLRYVSDESVMYTEKVVNNASEAVAAIRAMNS-IHSMYVVGRGQGRESSPLL  783

Query  447   SGLADWCECPELGAVGDllvtsefessfsvlvVQQYV  337
             +GL +W E PELGA+GD+LV+++F +  SVLV+QQ++
Sbjct  784   AGLTEWSEYPELGAIGDMLVSADFGAQVSVLVIQQHL  820



>ref|XP_010931514.1| PREDICTED: cation/H(+) antiporter 15-like [Elaeis guineensis]
Length=857

 Score =   450 bits (1157),  Expect = 5e-139, Method: Compositional matrix adjust.
 Identities = 271/785 (35%), Positives = 438/785 (56%), Gaps = 41/785 (5%)
 Frame = -3

Query  2658  VMCFSQTIYRSNGVWEGPDPLAPMIPLFILQIMTAILSSRILNFVLKPFNQPPLVAEILS  2479
             V+C++  +    GVW     L    PLF+ Q +  I ++R ++F+L+P  QP  ++EI+ 
Sbjct  30    VVCYAPIMSTKTGVWLEDSFLTFPFPLFLFQCLLIIATTRAIDFLLRPLRQPRYISEIVG  89

Query  2478  GIILGPSMLGNIEEFRKHNFPNHNFETIETMGHFALVLYAFLTGLQMDVKAIVHTGTKSR  2299
             G +L  S++G I  F ++ FP  +  T++ + H  L+ Y F+ G+QMDV ++     +  
Sbjct  90    GFVLSSSVMGQIPGFSQNVFPLSSLLTLDGVAHLGLIYYIFVAGIQMDVDSLRAREIRPL  149

Query  2298  IVAVSGSIFPFLI----GAGFYFTLQTDTQSMIGFIFCGSALTVTGFSTLAKILDSKRLL  2131
               A +  + P  I    GA  +      TQ      F G A+ VT FS LA+IL   +L+
Sbjct  150   GFAAACMLPPLAITWKLGAKVHHLFGESTQKGAFLAFLGVAVIVTAFSVLARILAEMKLI  209

Query  2130  NTEIGKIAASSALINVALSWVLLTIGLLFT----GSLDNVQWAvlctvgfvvvcvnyVRP  1963
              +++G+I+ SSA +  +++W++L   +         ++   +A++  V F V C   VRP
Sbjct  210   GSDVGRISLSSASLTNSVTWMVLATAMALAREGGKEMEKSIYAMVSGVAFYVACRCLVRP  269

Query  1962  LLNWLISKTPEGQGFSEFYICSFIAVICAFGCFTDAMGSHPMIGAFIFGLIMPNNELLRT  1783
             ++ WL  +TPEG+   E ++C  +  + A     DA+G H + GAF+ GL++PN +    
Sbjct  270   VVVWLARQTPEGEEVDELHMCGILVGVMAAAFTADAIGMHAIYGAFLLGLMVPNGQF-GE  328

Query  1782  AILDRLEDFVMGILMPVFFLVCGLRTNIFTITDGDTSIFTALALILLACSAKIIAALVAS  1603
             AI D++ED VMG++MP+F ++ G+RT++  I          L ++  + ++K+ A+++ +
Sbjct  329   AIADKVEDLVMGLMMPLFLVLSGIRTDLSRIQSWQGVALLVL-MVFASVASKVAASVLVA  387

Query  1602  CYTGMSTNEAIGLGVLTNTKSTMVMIILEVGqvqqvlsvqqysmmvVACLIMTIVATPLA  1423
              +  M  ++ + +G+L N K    +++L++ +   ++  Q Y+++V+  +++T+  +PL 
Sbjct  388   AFYKMPLHDGVTVGLLANCKGVTELVLLDIAKDSHIIEDQTYTILVLMSVLVTVAVSPLM  447

Query  1422  ARYC-PKQDLEPYKRRTIQNAKPGEELRILACIHGTNNLPAIISLLETSNSTVTSPITAF  1246
              +   P + L  YKRRTI  + P  ELRILAC+H    +PA+ISLL+ S+ T +SPI   
Sbjct  448   TKVVKPVRRLVSYKRRTIWWSNPDSELRILACVHTPRQVPALISLLDISHPTKSSPIFVC  507

Query  1245  GVQLLELVGRAPAMMvvhssgsgrhvggsHEE----------VQTSQIISTFDNYELRSH  1096
              + L+EL GR  A++VV+S+         H +           Q+  I   F +YE R+ 
Sbjct  508   ALHLVELTGRTAALLVVNSAAPTAAAKDHHHQQHIPSLGRIQAQSDAITHAFVSYEQRAG  567

Query  1095  GVTAQVLTARWSYDTMAEDICKMAKEKRAAFLVLPFHKQQGTDGEMEDTNPAIQTVNEGV  916
             GVTAQ LTA   Y TM ED+  + +++ AAF+VLPFH  Q  DG ME  + AI+ VNE +
Sbjct  568   GVTAQCLTAFSPYATMHEDVFAVGEDRHAAFIVLPFHMHQTVDGGMEVDHRAIRGVNEAI  627

Query  915   LLSAPCSVGILVERG------RPNQYAKNIAVLYLGGPDDREALTYARRMSGLPGVHLTV  754
             L  APCS+GILV+RG      R ++Y   +AVL+ GGPDDREAL +A RM G P ++LTV
Sbjct  628   LTGAPCSIGILVDRGLGASGHRESRY--RVAVLFFGGPDDREALAFAARMVGHPRINLTV  685

Query  753   IRFVPAKDVSADGAVEDPDLELELT------RETSFVTVSIDPARDKEEDEELLNNFRTE  592
             +RF     V  DG+        E        R    +T+  +  R+++ DEE L  FR  
Sbjct  686   VRF-----VYGDGSSRQQQNHHERAAGRRSPRAEKVLTIMSEEDRERQLDEERLREFRAR  740

Query  591   TAEDDSKTFMELVLDDEEEFTKAVKSLDDRSFDLYVAGRGRGVSSALTSGLADWCECPEL  412
                 D   + E+V  + EE   A+K +D+R  DL+V G G G+ S LT G+ +W E PEL
Sbjct  741   WG-GDMVEYEEVVATNAEETMAAMKRVDERGRDLFVVGMGHGLESPLTEGMNEWSEFPEL  799

Query  411   GAVGD  397
             G +GD
Sbjct  800   GPIGD  804



>ref|XP_009393134.1| PREDICTED: cation/H(+) antiporter 19-like [Musa acuminata subsp. 
malaccensis]
Length=798

 Score =   447 bits (1150),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 274/789 (35%), Positives = 442/789 (56%), Gaps = 55/789 (7%)
 Frame = -3

Query  2652  CFSQTIYRSNGVWEGPDPLAPMIPLFILQIMTAILSSRILNFVLKPFNQPPLVAEILSGI  2473
             C + +   SNG W+G +PL   +PL ILQI   ++ +R L FVL+P  QP ++AEI+ GI
Sbjct  7     CPTPSTVTSNGSWDGDNPLHHALPLIILQICLVVVVTRALAFVLRPLRQPRVIAEIIGGI  66

Query  2472  ILGPSMLGNIEEFRKHNFPNHNFETIETMGHFALVLYAFLTGLQMDVKAIVHTGTKSRIV  2293
             +LGPS LG    F ++ FP H+   ++T+ +  L+ + FL GL++D++AI  TG  +  +
Sbjct  67    LLGPSALGRSTRFTENVFPKHSMTVLDTVANIGLIFFLFLVGLELDIRAIRRTGKGALAI  126

Query  2292  AVSGSIFPFLIGAGFYFTLQT----DTQSMIGFIFCGSALTVTGFSTLAKILDSKRLLNT  2125
             A++G   PF++G G    L++     T+     +F G AL++T F  LA+IL   +LL T
Sbjct  127   ALAGISLPFVLGVGTSVVLRSTIVKGTRQGPFLVFMGVALSITAFPVLARILAELKLLTT  186

Query  2124  EIGKIAASSALINVALSWVLLTIGLLFTGSLDNVQ--WAvlctvgfvvvcvnyVRPLLNW  1951
             ++G++A S+A +N   +W+LL + +  +G+   +   W +L  + FV     ++RP+L W
Sbjct  187   DLGRMAMSAAAVNDVAAWILLALAIALSGNGSPIVSLWVLLTGIAFVTCVAVFLRPVLAW  246

Query  1950  LISKTPEGQGFSEFYICSFIAVICAFGCFTDAMGSHPMIGAFIFGLIMPNNELLRTAILD  1771
             +  ++PEG+   E YIC+ + ++ A G  TDA+G H + GAF+ G+ +P +      +++
Sbjct  247   MARRSPEGEPVKESYICATLTLVLAAGFTTDAIGIHALFGAFVVGIAVPKDGPFAGVLIE  306

Query  1770  RLEDFVMGILMPVFFLVCGLRTNIFTITDGDTSIFTALALILLACSAKIIAALVASCYTG  1591
             ++ED V G+ +P++F+  GL+TN+ TI  G +     L +I  AC  KI+  ++AS    
Sbjct  307   KVEDLVSGLFLPLYFVSSGLKTNVATIKGGRSWGLLVL-VITNACLGKIVGTIIASVVVK  365

Query  1590  MSTNEAIGLGVLTNTKSTMVMIILEVGqvqqvlsvqqysmmvVACLIMTIVATPLA-ARY  1414
             +   EA+ LG L NTK  + +I+L +G+ ++VL+ + +++MV+  L  T + TP+    Y
Sbjct  366   VPIREAVTLGFLMNTKGLVELIVLNIGKDRKVLNDETFAIMVLMALFTTFITTPIVMGIY  425

Query  1413  CPKQDLEPYKRRTIQNAKPGEELRILACIHGTNNLPAIISLLETSNSTVTSPITAFGVQL  1234
              P +   PYK RT++ +    ELR+LAC HG+ N+P +++++E+S  T    +T + + L
Sbjct  426   KPARRAAPYKHRTVERSDMDSELRVLACFHGSRNIPTMVNVIESSRGTRRRRLTVYAMHL  485

Query  1233  LELVGRAPAMMvvhssgsgrhvggsHEEVQTSQIISTFDNYELRSHGVTAQVLTARWSYD  1054
             +EL  R+ A + +        +   ++     Q++  F+ Y   S  VT + +TA    D
Sbjct  486   MELSERSSA-ISMVHKARRNGLPFWNKGGNADQMVVAFEAYRQLS-AVTVRPMTAISDLD  543

Query  1053  TMAEDICKMAKEKRAAFLVLPFHKQQGTDGEMEDTNPAIQTVNEGVLLSAPCSVGILVER  874
             T+ EDI   A++KRAA ++LPFHK Q  DG  E    A   VN+ VL  APCSV ILV+R
Sbjct  544   TIHEDIVTSAQQKRAALILLPFHKLQQIDGTFESIGHAYHLVNQRVLRHAPCSVAILVDR  603

Query  873   G-------RPNQYAKNIAVLYLGGPDDREALTYARRMSGLPGVHLTVIRFVPAKDVSADG  715
             G         N+ +  +AVL+ GGPDDRE L Y  RM+  PGV L V+RF+PA  V  D 
Sbjct  604   GLGGTTKITSNEVSYTVAVLFFGGPDDREVLAYGTRMAEHPGVSLMVLRFLPAATVDQD-  662

Query  714   AVEDPDLELELTRETSFVTVSIDPARDKEEDEELLNNFR----TETAEDDSKTFMELVLD  547
                      EL +                 DE  ++NFR    + +A D S  + E    
Sbjct  663   ---------ELAK-----------------DEACISNFRANLPSSSAPDGSVKYEETSSS  696

Query  546   DEEEFTKAVKSLDDRSFDLYVAGRGRGVSSALTSGLADWCECPELGAVGDllvtsefess  367
             D+     A+K+L     ++++ GR     S     L +  +CPELG VG  L  SEF ++
Sbjct  697   DKAGIIAAIKNLG--RCNIFIVGR-----SPPAVALVEKSDCPELGPVGSYLAASEFSTT  749

Query  366   fsvlvVQQY  340
              SV+V+Q+Y
Sbjct  750   ASVVVIQRY  758



>ref|XP_008782791.1| PREDICTED: cation/H(+) antiporter 15-like [Phoenix dactylifera]
Length=902

 Score =   450 bits (1157),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 294/818 (36%), Positives = 463/818 (57%), Gaps = 56/818 (7%)
 Frame = -3

Query  2652  CFSQTIYRSNGVWEGPDPLAPMIPLFILQIMTAILSSRILNFVLKPFNQPPLVAEILSGI  2473
             C+S     + G+W G +    M+P+FI Q++  I  +R+++F+LKP  QP ++AE ++G+
Sbjct  9     CYSPESIGTPGIW-GVNVFDYMLPVFIGQLLLVIFITRVVSFLLKPLRQPKVIAETIAGM  67

Query  2472  ILGPSMLGNIEEFRKHNFPNHNFETIETMGHFALVLYAFLTGLQMDVKAIVHTGTKSRIV  2293
             +LGPS LGN         P+ N+  ++T  +FAL  Y F+  +++DV+ I   G K  I+
Sbjct  68    LLGPSFLGNFFNEAYDLMPDQNYVLLDTAANFALTYYMFMVAVELDVRTIRGMGRKVLII  127

Query  2292  AVSGSIFPFLIG--AGFYFTLQTD-TQSMIGF-----------------IFCGSALTVTG  2173
             AV G +  F++   + +   L+ D    M GF                 +F   A++VTG
Sbjct  128   AVVGMVLAFVVSFTSAYALGLRPDIVIKMPGFPDPPANSRADEKVTPFLLFFSLAISVTG  187

Query  2172  FSTLAKILDSKRLLNTEIGKIAASSALINVALSWVLLTIGLLFTGSLDNVQ-------WA  2014
                L +I+   +LLN+ +G ++ +SA++N   +W+LL + L  TG  D          W 
Sbjct  188   LPVLTRIITELKLLNSPLGPLSMASAILNDMFAWILLAVTLAATGGKDGKSVSLLVPLWV  247

Query  2013  vlctvgfvvvcvnyVRPLLNWLISKTPEGQGFSEFYICSFIAVICAFGCFTDAMGSHPMI  1834
              L    FV+VC   VRP +  +  +TPEG+  S+F++   +A + A G  +D +G H + 
Sbjct  248   TLAGAAFVLVCFYVVRPGIARMARRTPEGERMSDFHLGIILAGVPATGFLSDLIGIHSIF  307

Query  1833  GAFIFGLIMPNNELLRTAILDRLEDFVMGILMPVFFLVCGLRTNIFTITDGDTSIFTALA  1654
             G+FI+GL +PN   L   +++R+E F+  +L+P+FF   G RTNIFTI     +I +  A
Sbjct  308   GSFIYGLAVPNGP-LTAHLIERMEPFLENMLLPLFFANSGFRTNIFTILP-LWAISSFAA  365

Query  1653  LILLACSAKIIAALVASCYTGMSTNEAIGLGVLTNTKSTMVMIILEVGqvqqvlsvqqys  1474
             +++L+  AK++  ++ + +  +S  +++ LG L + K  + MIIL V   ++VL    ++
Sbjct  366   VVVLSTLAKVVGTIIVAMFYSISFRDSLALGFLMSVKGPVEMIILNVAIDKKVLRGDMFA  425

Query  1473  mmvVACLIMTIVATPLA--ARYCPKQDLEPYKRRTIQNAKPGEELRILACIHGTNNLPAI  1300
             +++V  LI T +A P+   A   P + L  Y+RR IQ A+P  ELR+LACIH T ++  +
Sbjct  426   VILVTSLITTALAAPVVTLAYIKPSKPLAVYRRRNIQGARPDAELRMLACIHNTRHVHCL  485

Query  1299  ISLLETSNSTVTSPITAFGVQLLELVGRAPAMMvvhssgsgrhvggsHE------EVQTS  1138
               LL+ SN +  SPI  + + L+E+ GR  +M+++H S      G  H       + Q+ 
Sbjct  486   TRLLDVSNPSKRSPIVVYALHLVEVAGRVSSMLIMHPSAGYSDHGRRHRPALPYGQAQSE  545

Query  1137  QIISTFDNYELRSHGVTAQVLTARWSYDTMAEDICKMAKEKRAAFLVLPFHKQQGTDGEM  958
              I++  + YE  S GV+ Q LTA     TM ED+C +A+E+ A+ +VLPFHKQ   DG M
Sbjct  546   SILAAIEGYEQHSPGVSFQPLTAFSQPATMHEDVCSVAEERHASLIVLPFHKQMTVDGAM  605

Query  957   EDT-NPAIQTVNEGVLLSAPCSVGILVERGR----------PNQYAKNIAVLYLGGPDDR  811
             E+  + A++ VN  VL +APCSV ILV+RG            ++ + ++ ++++GGPDDR
Sbjct  606   EEVGSTAVRPVNLNVLANAPCSVAILVDRGLGTGVTSLFPGAHRASHHVVLVFIGGPDDR  665

Query  810   EALTYARRMSGLPGVHLTVIRFVPAKDVSADGAVEDPDLELELTRETSFVTVSIDPARDK  631
             EAL YA RM+  P + LTVIRF+ A   S   ++        +T   +   +  D   +K
Sbjct  666   EALAYAGRMAEHPAIVLTVIRFIEAAAPSRSQSISS------VTDVENAAALLADAELEK  719

Query  630   EEDEELLNNFRTETAEDDSKTFMELVLDDEEEFTKAVKSLDDRSFDLYVAGRGRGVSSAL  451
             E DEE +N FR     D+S  F E V  +  E   A++ +   S+DLYV GRG G  SAL
Sbjct  720   ERDEEAVNEFRLRFVSDESVVFTEKVASNGGETVAALREMRS-SYDLYVVGRGHGRKSAL  778

Query  450   TSGLADWCECPELGAVGDllvtsefessfsvlvVQQYV  337
             T+GL +W E PELG +GDLL +S+F +  SVLVVQQYV
Sbjct  779   TAGLEEWSEIPELGPIGDLLASSDFGAKVSVLVVQQYV  816



>ref|XP_008784477.1| PREDICTED: cation/H(+) antiporter 15-like [Phoenix dactylifera]
Length=782

 Score =   446 bits (1147),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 287/782 (37%), Positives = 451/782 (58%), Gaps = 49/782 (6%)
 Frame = -3

Query  2589  MIPLFILQIMTAILSSRILNFVLKPFNQPPLVAEILSGIILGPSMLG----NIEEFRKHN  2422
             M+P F+ Q++  +++ + L F+LKP  QP +VAEILSG++LGPS+LG    NI E     
Sbjct  1     MLPAFLAQLVVVVVTIQTLEFLLKPLRQPRIVAEILSGVLLGPSVLGFFFPNIYELP---  57

Query  2421  FPNHNFETIETMGHFALVLYAFLTGLQMDVKAIVHTGTKSRIVAVSGSIFPFLIG-AGFY  2245
              P+ N+  + T   FAL+ + F+ GL++DVKAI   G K   +AV G   PF +  AG Y
Sbjct  58    -PDQNYVIVGTAASFALLYFVFMVGLELDVKAIRALGKKVLTLAVVGMAVPFAVSSAGIY  116

Query  2244  FT-LQTD-----TQSMIGFIFCGSALTVTGFSTLAKILDSKRLLNTEIGKIAASSALINV  2083
                LQ+       + ++  IF G  ++++GF  LA+++   +LLNT +G +A +S++IN 
Sbjct  117   LLGLQSSLSRKMVKPLVFHIFVGVTVSISGFPVLARMITELKLLNTGVGPVAMASSIINS  176

Query  2082  ALSWVLLTIGLLF------TGSLDNVQWAvlctvgfvvvcvnyVRPLLNWLISKTPE-GQ  1924
              LS+ LL + +          S+    + +L    FV  C   VRP + W++ + PE G+
Sbjct  177   MLSFTLLGVAMASGVRYGEEASMAAAVYVMLSGAAFVAGCFFVVRPAVKWMVRRKPEVGE  236

Query  1923  GFSEFYICSFIAVICAFGCFTDAMGSHPMIGAFIFGLIMPNNELLRTAILDRLEDFVMGI  1744
               S+  I   +    A G  +D +G + + GAF++GL +PN  L  TA++ R+E F++ +
Sbjct  237   RVSDVEISIILGGAAAAGFISDVIGMNWVFGAFVYGLAIPNGPL-ATALIQRMELFMVHM  295

Query  1743  LMPVFFLVCGLRTNIFTITDGDTSIFTALALILLACSAKIIAALVASCYTGMSTNEAIGL  1564
             ++P+FF   GLR ++ T+     S   A  + +L  +AK+   ++A+    +  NE++ L
Sbjct  296   MLPLFFFYGGLRADLHTLVSPTASAQLA-GVFILTVAAKVAGTMLAAHRYSIPLNESLTL  354

Query  1563  GVLTNTKSTMVMIILEVGqvqqvlsvqqysmmvVACLIMTIVATPLAA-RYCPKQDLEPY  1387
             G L   K  + MIIL+VG  ++V++   +++M +A  + T V  P+    Y P + L  +
Sbjct  355   GFLATAKGPLEMIILKVGMDEKVVTSDFFTVMTIASALSTAVVAPVVTLTYKPSRPLIGH  414

Query  1386  KRRTIQNAKPGEELRILACIHGTNNLPAIISLLETSNSTVTSPITAFGVQLLELVGRAPA  1207
             +RR ++ ++P  ELR+LAC+H T N+ +I  LL+ SN T  SPI    + L+EL GRA A
Sbjct  415   RRRQLERSRPDAELRMLACVHNTRNVHSITRLLDFSNPTKRSPIFVCALHLVELTGRASA  474

Query  1206  MMvvhssgsgrhvggsHE---------EVQTSQIISTFDNYELRSHGVTAQVLTARWSYD  1054
             M+++H++                    + Q+  II+ F++YE  + GV+ Q LTA  S +
Sbjct  475   MLIMHNTSGDSSNNSGQNRGNKNLPYGQAQSESIIAAFESYEQHAAGVSIQPLTAFSSPN  534

Query  1053  TMAEDICKMAKEKRAAFLVLPFHKQQGTDGEMEDTNPAIQTVNEGVLLSAPCSVGILVER  874
             TM ED+C +A+E+ ++ +VLPFH+ Q  DGE+ + N  I+TVN  VL++ PCSV + V+R
Sbjct  535   TMHEDVCTLAEERHSSLIVLPFHRHQTADGELAEGNTNIRTVNLNVLVNPPCSVAVFVDR  594

Query  873   ----GRPNQYAKNIAVLYLGGPDDREALTYARRMSGLPGVHLTVIRFVPAKDVSADGAVE  706
                 G+  +   ++ VL+ GGPDDREAL YA RM+    V LTV+RFV       + A  
Sbjct  595   LPGGGKRFRAHHSVVVLFFGGPDDREALAYAARMAEHRAVSLTVVRFV-------EVARS  647

Query  705   DPDLELELTRETSFVTVSIDPARDKEEDEELLNNFRTETAEDDSKTFMELVLDDEEEFTK  526
              PD  L  + E      S D    +  DEE+LN FR     D++  + E V  + EE   
Sbjct  648   VPDTPLHGSSEAQ---ESADRDLHRMRDEEVLNEFRLRFVSDETVLYTEKVASNSEETVA  704

Query  525   AVKSLDDRSFDLYVAGRGRGVSSALTSGLADWCECPELGAVGDllvtsefessfsvlvVQ  346
             A++S+++  +DLYV GRG   +S LT+GL +W ECPELG +GDLLV+ +F +  SVLVVQ
Sbjct  705   ALRSMEN-VYDLYVVGRGHREASRLTAGLEEWAECPELGPIGDLLVSPDFGTRVSVLVVQ  763

Query  345   QY  340
             QY
Sbjct  764   QY  765



>ref|XP_004231538.1| PREDICTED: cation/H(+) antiporter 15-like isoform X1 [Solanum 
lycopersicum]
Length=806

 Score =   445 bits (1144),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 295/824 (36%), Positives = 462/824 (56%), Gaps = 40/824 (5%)
 Frame = -3

Query  2739  LLQPEKMAAPPPPSTGPEVDLDRLGQVVMCFSQTIYRSNGVWEGPDPLAPMIPLFILQIM  2560
             ++ P  + AP   S     +   LG   +C+       NG+WE  +PL   +P F+ Q+ 
Sbjct  1     MVNPNILKAPELASYNVRGNQPALGVGKLCYLTDTISDNGMWEEINPLESKLPTFMFQLA  60

Query  2559  TAILSSRILNFVLKPFNQPPLVAEILSGIILGPSMLGNIEEFRKHNFP-------NHNFE  2401
               +  +R+   +LKP  QP   AE+L+GI++G + + +  EF + +FP            
Sbjct  61    IVLFVTRLCLLLLKPLRQPHFAAELLAGILVGSTAIAS--EFARKHFPVLGSVFSASRIM  118

Query  2400  TIETMGHFALVLYAFLTGLQMDVKAIVHTGTKSRIVAVSGSIFPFLIGAGFY-FTLQTDT  2224
              +ET+G+  L+ + FL GL+MD++A+   G K+  + +SG++FPF  GA  Y F  +   
Sbjct  119   MMETVGNLGLIYHVFLIGLEMDLRALTSVGPKALGIGISGALFPFFFGASLYTFIAEYPE  178

Query  2223  QSMIGFIFCGSALTVTGFSTLAKILDSKRLLNTEIGKIAASSALINVALSWVLLTIGLLF  2044
                 G ++ G AL+VTG   +A+I    +LL++EIG+IA SSAL+N   SWVLL   L  
Sbjct  179   NFRWGCLYWGVALSVTGLPVIAEIFAKLKLLHSEIGRIAMSSALVNDISSWVLLVFSLAV  238

Query  2043  TGSLDNVQWAvlctvgfvvvcvnyVRPLLNWLISK-TPEGQGFSEFYICSFIAVICAFGC  1867
             T S      ++   + FV+  V  +RP + W++ K T EG+ +SE  IC+ + ++ A G 
Sbjct  239   TSSSSTTYLSLFSVLFFVIFSVFVIRPAILWMLRKITREGEDYSEATICAILTMVLACGL  298

Query  1866  FTDAMGSHPMIGAFIFGLIMPNNELLRTAILDRLEDFVMGILMPVFFLVCGLRTNIFTIT  1687
              TD  G   + GAF+FGLI+P++ L    +L  ++ FV  +L+P+++   G+RT++  I+
Sbjct  299   ITDMCGVSSVFGAFVFGLIIPSHVLGHRFVL-MVQGFVSDLLLPLYYASLGMRTHLGGIS  357

Query  1686  DGDTSIFTALALILLACSAKIIAALVASCYTGMSTNEAIGLGVLTNTKSTMVMIILEVGq  1507
               D  +   ++L  L+   KI+  L  S +  +S +E   LG+L NTK  + ++ + +G+
Sbjct  358   REDMLMMVLISL--LSFIPKIVCTLAMSYFYRISLHEGFTLGILMNTKGLVAVMAMSLGR  415

Query  1506  vqqvlsvqqysmmvVACLIMTIVATPLAA-RYCPKQDLEPYKRRTIQNAKPGEELRILAC  1330
                V++   +++M+     MTIV +P+    Y   +   P + R +QN KP  ELRIL C
Sbjct  416   DHTVMNDDGFAIMLFTIFFMTIVTSPIVNFLYRRTKKFLPSQHRVLQNLKPDSELRILTC  475

Query  1329  IHGTNNLPAIISLLETSNSTVTSPITAFGVQLLELVGRAPAMMvvhssgsgrhvggsHEE  1150
             IH       I +LLE S+++  SPI  F +QL++L     A+++VH +G       S  +
Sbjct  476   IHEVQTAAGITALLEISHASRRSPICIFALQLMQLKKHTTALLIVHGAGGTSSESYSRAD  535

Query  1149  VQTSQIISTFDNYELRSHGVTAQVLTARWSYDTMAEDICKMAKEKRAAFLVLPFHKQQGT  970
              Q  Q+I+TF+N E +S  ++ Q+LTA   Y TM EDIC +A+EK+   ++LPFHK+Q  
Sbjct  536   GQIDQLITTFNNLEHQSPMISVQLLTAISPYGTMHEDICSLAEEKQVTLIILPFHKRQTI  595

Query  969   DGEMEDTNPAIQTVNEGVLLSAPCSVGILVERG----------RPNQYAKNIAVLYLGGP  820
                ME+ NPA + VN   L SAPC+VGILV+RG            N  +  IA++++GG 
Sbjct  596   HNNMEEMNPAYKDVNNSTLESAPCAVGILVDRGFGTLLTSKIDDGNARSCRIAMIFIGGR  655

Query  819   DDREALTYARRMSGLPGVHLTVIRFVPAKDVSADGAVEDPDLELELTRETSFVTVSIDPA  640
             DDREALTYA RM+  P V L V+RF+  K  + +   +D DL L +  E           
Sbjct  656   DDREALTYASRMARHPKVALIVLRFILDKTSAQN---DDADLFLTMEGED----------  702

Query  639   RDKEEDEELLNNFRTETAEDDSKTFMELVLDDEEEFTKAVKSLDDRSFDLYVAGRGRGVS  460
              +K+ D+  +N FR +   DDS  + E +  +  E  K ++SL  + FDLYV GRG    
Sbjct  703   -EKKVDDHFVNEFRLKVQNDDSVVYTEQMSSNGAETVKTIRSL-GQDFDLYVLGRGLSFF  760

Query  459   SALTSGLADWCECPELGAVGDllvtsefessfsvlvVQQYVRTN  328
             S L  GL +W +CPELG++GDLL+TS+F S+ S+LVVQ +   N
Sbjct  761   SPLKGGLDEWSDCPELGSIGDLLLTSDFSSTASILVVQHHAELN  804



>ref|XP_010522263.1| PREDICTED: cation/H(+) antiporter 23, chloroplastic-like isoform 
X1 [Tarenaya hassleriana]
 ref|XP_010522264.1| PREDICTED: cation/H(+) antiporter 23, chloroplastic-like isoform 
X1 [Tarenaya hassleriana]
Length=855

 Score =   444 bits (1142),  Expect = 6e-137, Method: Compositional matrix adjust.
 Identities = 274/807 (34%), Positives = 446/807 (55%), Gaps = 38/807 (5%)
 Frame = -3

Query  2685  VDLDRLGQVVMCFSQTIYRSNGV--WEGPDPLAPMIPLFILQIMTAILSSRILNFVLKPF  2512
             VD+ R G+VV    + ++++  +  W+    ++  +P FI Q++ A  + R+L ++ +P 
Sbjct  16    VDVSRYGKVVCYEEKYLFQNRDLKGWQSGSTMSSALPFFITQLLIANFTYRVLYYLTRPL  75

Query  2511  NQPPLVAEILSGIILGPSMLGNIEEFRKHNFPNHNFETIETMGHFALVLYAFLTGLQMDV  2332
               PP VA+IL G++  PS+ G+ E   K+ FP      +ET  + ALV   FL GL M++
Sbjct  76    YLPPFVAQILCGLLFSPSVFGDTEFIVKYVFPYRYTLVLETFANLALVYNIFLLGLGMEL  135

Query  2331  KAIVHTGTKSRIVAVSGSIFPFLIGAGFYFTLQTDTQSMI--GFIFCGSALTVTGFSTLA  2158
             + +  T  K  ++A+ G +    +G   YF         +  G +F   A++ T F  LA
Sbjct  136   RMVRFTELKPLVIAIVGLVASLPLGIVLYFLPGNGVSDKVLAGCVFWSVAMSCTNFPDLA  195

Query  2157  KILDSKRLLNTEIGKIAASSALINVALSWVLLTIGLLF---TGSLDNVQ-WAvlctvgfv  1990
             +IL   +LL +++G+ A S+++I    +WVLL +G      TG  + +  + +L T GFV
Sbjct  196   RILADLKLLRSDVGRTAMSASIITDMSTWVLLVLGFAAFSKTGEFNKMMPFVILSTGGFV  255

Query  1989  vvcvnyVRPLLNWLISKTPEGQGFSEFYICSFIAVICAFGCFTDAMGSHPMIGAFIFGLI  1810
             ++ +  ++PLL W  SKT +G    + ++   +  +   G  TDA G+H + GAF+FGL 
Sbjct  256   LLSIFVIQPLLAWAFSKTMKGGHIGDTHVWFILGGVVLCGLITDACGAHSITGAFLFGLS  315

Query  1809  MPNNELLRTAILDRLEDFVMGILMPVFFLVCGLRTNIFTITDGDTSIFTALALILLACSA  1630
             +P++ ++R  I ++L DF+ GILMP+F++ CGLR+++  +    T+  T + +++ +   
Sbjct  316   IPHDHVVRNTIEEKLHDFLSGILMPLFYVTCGLRSDLRYMFQF-TNQLTMVVVMVSSFMV  374

Query  1629  KIIAALVASCYTGMSTNEAIGLGVLTNTKSTMVMIILEVGqvqqvlsvqqysmmvVACLI  1450
             KI+     S +  M   +++ LG L NTK T+ +++L  G+  + L    Y+ M V  L+
Sbjct  375   KIVTTFAVSFFMPMPVRDSLALGALMNTKGTLSLVVLNAGRDTKALDSPMYTHMTVVLLV  434

Query  1449  MTIVATPLAA-RYCPKQDLEPYKRRTIQNAKPGEELRILACIHGTNNLPAIISLLETSNS  1273
             M+++  PL A  Y PK+    YK RT++  K   E R+L C+H   N+  I +LL  SN 
Sbjct  435   MSLIVEPLLALTYRPKKKAAHYKHRTVEKIKGESEFRVLTCVHVLPNVFGITNLLRASNP  494

Query  1272  TVTSPITAFGVQLLELVGRAPA-MMvvhssgsgrhvggsHEEVQTSQIISTFDNYELRSH  1096
             T  SP+T F + L+EL GR  A M++++     +         ++ QI  +F+  E+ + 
Sbjct  495   TKQSPLTVFAIHLVELTGRTTASMLIMNDECKPKANFSDRVRAESEQIAESFEALEVHND  554

Query  1095  GVTAQVLTARWSYDTMAEDICKMAKEKRAAFLVLPFHKQQGTDGEMEDTNPAIQTVNEGV  916
              +  Q +TA   Y TM EDIC +A++KR  F++LP+H+    DG M + N +   +N+ V
Sbjct  555   AMMVQTITAVSPYATMHEDICALAEDKRVCFIILPYHRHLTADGRMGEGNASHADINQNV  614

Query  915   LLSAPCSVGILVERG----RPNQY-----AKNIAVLYLGGPDDREALTYARRMSGLPGVH  763
             L +APCSVGILV+RG    R +        ++IA+L++GG DDREAL+YA RM G   + 
Sbjct  615   LNNAPCSVGILVDRGMGMVRSDSVHGEPTTRHIAMLFVGGADDREALSYAWRMVGQHMIR  674

Query  762   LTVIRFVPAKDVSADGAVEDPDLELELTRETSFVTVSIDPARDKEEDEELLNNFRTETAE  583
             LTV+RFVP  D  A                          +++K+ D+E +  F  +T  
Sbjct  675   LTVVRFVPGNDALASAGKSAGSY-----------------SKEKQVDDECIYEFNFKTMN  717

Query  582   DDSKTFMELVLDDEEEFTKAVKSLDD-RSFDLYVAGRGRGVSSALTSGLADWCECPELGA  406
             D S TF+E V++D ++    ++ ++D +S DLYV GRG  V S +T GL DW   PELG 
Sbjct  718   DPSVTFIEKVVNDGQDTVSMIREMEDNQSCDLYVVGRGYNVDSPVTVGLTDWSSSPELGT  777

Query  405   VGDllvtsefessfsvlvVQQYVRTNK  325
             +GD L  S F    SVLV+QQY   N+
Sbjct  778   IGDTLAASNFTMHASVLVIQQYSSVNR  804



>ref|XP_002309885.2| cation/hydrogen exchanger family protein [Populus trichocarpa]
 gb|EEE90335.2| cation/hydrogen exchanger family protein [Populus trichocarpa]
Length=860

 Score =   444 bits (1143),  Expect = 6e-137, Method: Compositional matrix adjust.
 Identities = 288/785 (37%), Positives = 451/785 (57%), Gaps = 34/785 (4%)
 Frame = -3

Query  2616  WEGPDPLAPMIPLFILQIMTAILSSRILNFVLKPFNQPPLVAEILSGIILGPSMLGNIEE  2437
             ++    L   +PLF+LQ+   + ++R+L  +L+P  QP +VA I +G++LGPS LG    
Sbjct  29    FQSTSALTTSLPLFVLQLSVVLFTTRLLLLILRPLRQPSIVALITAGVLLGPSALGTTPL  88

Query  2436  FRKHNFPNHNFETIETMGHFALVLYAFLTGLQMDVKAIVHTGTKSRIVAVSGSIFPFLIG  2257
             F  H  P    + +ET  + ALV Y FL GL+MD+K I+++G+++  +A+SG + P   G
Sbjct  89    FFDHVLPFKAVKVLETFANLALVYYMFLFGLEMDLKPIMNSGSEAIRIAISGILIPLGFG  148

Query  2256  AGFYFTLQ------TDTQSMIGFIFCGSALTVTGFSTLAKILDSKRLLNTEIGKIAASSA  2095
              G ++ LQ       +  S  G IF    LT T F  + ++L   +LL T++G++A SSA
Sbjct  149   FGLFYLLQLLDSDAKEISSFKGSIFWAITLTATNFPDVTQVLTDLKLLRTDMGRLAMSSA  208

Query  2094  LINVALSWVLLTIGLLFTGSLDNVQ--WAvlctvgfvvvcvnyVRPLLNWLISKTPEGQG  1921
             + +   +W+LL + +    SL N    + +   + FV++C   +RP+++ + +   +G  
Sbjct  209   VSSDFFTWILLVVAM----SLLNAHPYYVLPFILAFVLLCCFVIRPVISKIANHAVKGDD  264

Query  1920  FSEFYICSFIAVICAFGCFTDAMGSHPMIGAFIFGLIMPNNELLRTAILDRLEDFVMGIL  1741
             F+E +I   +  I  FG  TDA G H M+G+F+ G+IMP  +++R  +++RL+DFV GI+
Sbjct  265   FTEQHIWFVLGWIVFFGFITDAFGLHSMVGSFMLGVIMPRRDVIRMKLMERLDDFVSGIM  324

Query  1740  MPVFFLVCGLRTNIFTITDGDTSIFTALALILLACSAKIIAALVASCYTGMSTNEAIGLG  1561
             MP+FFL  G RT+   +   +T  +    +I L+  AKI++ L+          +   LG
Sbjct  325   MPLFFLTSGTRTDAGFLLK-ETPWYAIFIIIFLSFGAKILSTLLVFLLHNKPLEDGFALG  383

Query  1560  VLTNTKSTMVMIILEVGqvqqvlsvqqysmmvVACLIMTIVATPL-AARYCPKQDLEPYK  1384
             V+ NTK  M +II+  G+  +VL+ Q +++MV + L MT +  P+ AA Y P++ L  YK
Sbjct  384   VIMNTKGVMSIIIINAGRNIKVLNNQTFTIMVFSALAMTCLVEPIVAATYKPRKKLLRYK  443

Query  1383  RRTIQNA-KPGEELRILACIHGTNNLPAIISLLETSNSTVTSPITAFGVQLLELVGRAPA  1207
              RTI++    G E +ILAC+    + P +ISLLE SN+    PI    V L+EL GR  A
Sbjct  444   HRTIESVLVNGVEFKILACVLSNRDAPCMISLLEASNAGPDFPICVIAVHLVELTGRNTA  503

Query  1206  MMvvhssgsgrhvggsHEEVQTSQIISTFDNYELRSHGVTAQVLTARWSYDTMAEDICKM  1027
             M++VH             + ++ QII  F +YE R+  V+ Q +TA   Y+ M EDIC +
Sbjct  504   MLIVHDHSMTSMSNPIRAKSESDQIIFAFKSYEKRNGAVSVQTITAISPYENMHEDICSL  563

Query  1026  AKEKRAAFLVLPFHKQQGTDGEMEDTNPAIQTVNEGVLLSAPCSVGILVERG--------  871
             A +KR + +++PF      DG +ED       +N+ VL +A CSVG+LV+RG        
Sbjct  564   ALDKRVSLIIIPFQTVLTADGRVEDAKSTFPAMNQYVLENATCSVGLLVDRGLGSIMQTG  623

Query  870   --RPNQYAK--NIAVLYLGGPDDREALTYARRMSGLPGVHLTVIRFVPAKDVSADGAVED  703
               R +  +K   IA++++GGPDDREAL YA RM+G PG+ LTV+RF+P +  +       
Sbjct  624   PARNSSSSKGHRIAMIFIGGPDDREALAYAWRMAGHPGISLTVLRFLPGRIAAQSTPEHG  683

Query  702   PDLELELTRETSFVTVSIDPARDKEEDEELLNNFRTETAEDDSKTFMELVLDDEEEFTKA  523
              +   EL     F +++I+  R+K  D++    F  +T +D+S T+ E V+++ +E    
Sbjct  684   SNSHDEL-----FSSMTIEE-REKRLDDDYTYEFMFKTLDDESITYTEKVVNNGDETLAE  737

Query  522   VKSLDDRSFDLYVAGRGRGVSSALTSGLADWCECPELGAVGDllvtsefessfsvlvVQQ  343
             ++  +D  FDLY+ GRG    S LTSGL+DW  C ELG +GD L +S F S  SVLVVQQ
Sbjct  738   IRR-NDADFDLYIVGRGEKTRSVLTSGLSDWNSCQELGTMGDTLASSNFASHASVLVVQQ  796

Query  342   YVRTN  328
             YV  N
Sbjct  797   YVPKN  801



>ref|XP_009611609.1| PREDICTED: cation/H(+) antiporter 15-like [Nicotiana tomentosiformis]
Length=819

 Score =   442 bits (1136),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 288/828 (35%), Positives = 465/828 (56%), Gaps = 44/828 (5%)
 Frame = -3

Query  2739  LLQPEKMAAPPPPSTG----PEVDLDRLGQVVMCFSQTIYRSNGVWEGPDPLAPMIPLFI  2572
             ++ P  +  P  PS      P   +D+L     C+       NG+WE  +PL   +P+FI
Sbjct  1     MVNPNFLKTPDIPSYNVRGKPVAGVDKL-----CYMTDTVTDNGIWEEINPLDSKLPIFI  55

Query  2571  LQIMTAILSSRILNFVLKPFNQPPLVAEILSGIILGPSMLGNIEEFRKHNFPN-------  2413
              Q+   +  +R+   +LKP  QP   AE+L+GI++G + + +  EF + + P        
Sbjct  56    FQLAIVLFVTRLCLLLLKPLRQPHFAAELLAGILVGSTAIAS--EFAREHIPALGAIFAA  113

Query  2412  HNFETIETMGHFALVLYAFLTGLQMDVKAIVHTGTKSRIVAVSGSIFPFLIGAGFYFTLQ  2233
                  +ET+G+  L+ + FL GL+MD++A+   G K+  + ++G+IFPF+IGA  Y  + 
Sbjct  114   SRIMMMETVGNLGLIYHVFLLGLEMDLRALTSVGPKALGIGIAGAIFPFVIGASLYIFIA  173

Query  2232  TDTQSM-IGFIFCGSALTVTGFSTLAKILDSKRLLNTEIGKIAASSALINVALSWVLLTI  2056
                +S   GF++ G AL+VTG   +A+I    +LL++EIG+IA SSAL+N   SW LL +
Sbjct  174   DYPESFRWGFLYWGVALSVTGLPVIAEIFAKLKLLHSEIGRIAMSSALVNDLSSWFLLVV  233

Query  2055  GLLFTGSLDNVQWAvlctvgfvvvcvnyVRPLLNWLISK-TPEGQGFSEFYICSFIAVIC  1879
              L  T S  +   ++   + F++  +  +RP L W+I + T EG+ FSE  +C+ +A++ 
Sbjct  234   SLSITSSYSSTFLSLFSAIVFIIFSIFVIRPALLWVIRRRTREGEEFSEAVVCAILAMVL  293

Query  1878  AFGCFTDAMGSHPMIGAFIFGLIMPNNELLRTAILDRLEDFVMGILMPVFFLVCGLRTNI  1699
               G  TD  G   M+GAF+FGLI+P + L    +L  L+ F   +L+P+++   G+RT++
Sbjct  294   VCGLVTDICGVSSMLGAFVFGLIIPPDFLGHRFVL-MLQGFASDLLLPLYYASLGMRTHL  352

Query  1698  FTITDGDTSIFTALALILLACSAKIIAALVASCYTGMSTNEAIGLGVLTNTKSTMVMIIL  1519
               +   D  +   ++    +   KI+  +  S    MS  E   LGVL NTK  + ++ +
Sbjct  353   GGLNKEDVLMMVLVSF--FSFIPKIVCTIAVSYLYKMSLREGFTLGVLMNTKGLVAVMAM  410

Query  1518  EVGqvqqvlsvqqysmmvVACLIMTIVATPLAA-RYCPKQDLEPYKRRTIQNAKPGEELR  1342
              +G+   V++   +++M+     M+I  +P+    Y   +   P + R +Q+ KP  ELR
Sbjct  411   SLGRDHTVMNEDGFAIMLFTIFFMSIATSPIVNFLYRRTKRFLPSQHRVLQDLKPDAELR  470

Query  1341  ILACIHGTNNLPAIISLLETSNSTVTSPITAFGVQLLELVGRAPAMMvvhssgsgrhvgg  1162
             IL CIH    +  I +LLE S+++  SPI  F +QL++L     A+++VH S        
Sbjct  471   ILTCIHEVQTVAGITALLEISHASRRSPICVFALQLMQLKKHTTALLIVHDSSRASSKSV  530

Query  1161  sHEEVQTSQIISTFDNYELRSHGVTAQVLTARWSYDTMAEDICKMAKEKRAAFLVLPFHK  982
             S    Q  Q+I+ F+N E +S  ++ Q+LTA   Y TM ED+C +A+EK+   ++LPFHK
Sbjct  531   SKVGGQIDQLIAAFNNLEHQSANISVQLLTAISPYGTMHEDVCSIAEEKQVTLIILPFHK  590

Query  981   QQGTDGEMEDTNPAIQTVNEGVLLSAPCSVGILVERG----RPNQYAK------NIAVLY  832
             +Q     ME+ NPA + VN  +L +AP +VGILV+RG     P +  +       IA+++
Sbjct  591   RQTIHNNMEEMNPAYKDVNNNILANAPSTVGILVDRGFGTLLPTKKDEGISRSCRIAMIF  650

Query  831   LGGPDDREALTYARRMSGLPGVHLTVIRFVPAKDVSADGAVEDPDLELELTRETSFVTVS  652
             +GGPDDREALTYA RM+  P V LTV+RF+  +  +  G+ ++ D +          +V 
Sbjct  651   IGGPDDREALTYALRMARHPKVSLTVLRFILDESRAIAGSTQNDDEDF---------SVI  701

Query  651   IDPARDKEEDEELLNNFRTETAEDDSKTFMELVLDDEEEFTKAVKSLDDRSFDLYVAGRG  472
             +    +K+ D+ L+N FR +   D S  ++E +  +  E  K + +L D+ FDLYV GRG
Sbjct  702   MGAEAEKQADDLLVNEFRHKVQNDGSVVYIEEMSSNGAETVKIIATL-DQDFDLYVVGRG  760

Query  471   RGVSSALTSGLADWCECPELGAVGDllvtsefessfsvlvVQQYVRTN  328
              G  S L  GL +W +CPELG++GDLL+TS+F S+ S+ VVQQ+   N
Sbjct  761   LGFFSPLKGGLDEWSDCPELGSIGDLLLTSDFSSTASIFVVQQHAWLN  808



>ref|XP_002440851.1| hypothetical protein SORBIDRAFT_09g008200 [Sorghum bicolor]
 gb|EES19281.1| hypothetical protein SORBIDRAFT_09g008200 [Sorghum bicolor]
Length=796

 Score =   441 bits (1134),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 276/787 (35%), Positives = 440/787 (56%), Gaps = 57/787 (7%)
 Frame = -3

Query  2628  SNGVWEGPDPLAPMIPLFILQIMTAILSSRILNFVLKPFNQPPLVAEILSGIILGPSMLG  2449
             S+GV++G +PL   +PL ILQI   ++ +R+L F+L+P  QP +VAEI+ GI+LGPS +G
Sbjct  16    SDGVFQGENPLHSALPLAILQICIVVVLTRVLAFILRPLRQPRVVAEIIGGILLGPSAVG  75

Query  2448  NIEEFRKHNFPNHNFETIETMGHFALVLYAFLTGLQMDVKAIVHTGTKSRIVAVSGSIFP  2269
                 F    FP  +   ++T+ +  L+ + FL GL++D++AI  TG+ + ++AV+G   P
Sbjct  76    RSTAFLNTVFPKQSLTVLDTLANIGLLYFLFLVGLELDLRAIRRTGSTALVIAVAGISLP  135

Query  2268  FLIGAGFYFTLQTDTQSMIG----FIFCGSALTVTGFSTLAKILDSKRLLNTEIGKIAAS  2101
             F++G G  F LQ      +      +F G AL++T F  LA+IL   +LL T+IG++A S
Sbjct  136   FIMGIGTSFVLQHTVARGVPTGPFLVFMGVALSITAFPVLARILAELKLLTTDIGRMAMS  195

Query  2100  SALINVALSWVLLTIGLLFTGSLDNVQ--WAvlctvgfvvvcvnyVRPLLNWLISKTPEG  1927
             +A +N  ++W+LL + +  +GS   +   W +L   GFV+     +RP+L W+  ++PEG
Sbjct  196   AAAVNDVVAWILLALAIALSGSGSPLVSLWVLLAGAGFVLAAFLLIRPVLTWMARRSPEG  255

Query  1926  QGFSEFYICSFIAVICAFGCFTDAMGSHPMIGAFIFGLIMPNNELLRTAILDRLEDFVMG  1747
             +   E YIC+ +A++ A G  TD +G H + GAFI G+++P +      +L+++ED + G
Sbjct  256   EPVKELYICATLAIVLAAGFATDTIGIHALFGAFIVGIVVPKDGPFAGVLLEKVEDLISG  315

Query  1746  ILMPVFFLVCGLRTNIFTITDGDTSIFTALALILLACSAKIIAALVASCYTGMSTNEAIG  1567
             + +P++F+  GL+TN+ TI  GD+     L ++  AC  KI   ++AS    +   EA+ 
Sbjct  316   LFLPLYFVSSGLKTNVMTIKGGDSWALLVL-VVATACIGKIGGTVIASLIVRVPFREALT  374

Query  1566  LGVLTNTKSTMVMIILEVGqvqqvlsvqqysmmvVACLIMTIVATPLA-ARYCPKQDLEP  1390
             LG L NTK  + +I+L +G+ + VL+ + ++++V+  LI T + TP+  A Y P +   P
Sbjct  375   LGFLMNTKGLVELIVLNIGKDRHVLNDETFAILVLMALITTFITTPVVMAIYKPARRGPP  434

Query  1389  YKRRTIQNAKPGEELRILACIHGTNNLPAIISLLETSNSTVTSPITAFGVQLLELVGRAP  1210
             YK R ++ A P +E R++AC H T N+P II+L+E+S  T    IT + + L+EL  R+ 
Sbjct  435   YKNRAVERANPHDEFRMMACFHSTRNIPTIINLMESSRGTRKRGITVYAMHLVELSERSS  494

Query  1209  AMMvvhssgsgrhvggsHE---EVQTSQIISTFDNYELRSHGVTAQVLTARWSYDTMAED  1039
             A+ +VH +        +     +    Q++  F+ Y+  S  V+ + +TA     T+ ED
Sbjct  495   AISMVHKARRNGMPFWNKRRNGDGDGDQLVVAFETYQQLSR-VSIRAMTAISDLHTIHED  553

Query  1038  ICKMAKEKRAAFLVLPFHKQQGTDGEMEDTNPAIQTVNEGVLLSAPCSVGILVERG----  871
             +   A +KRAA +VLPFHK    DG ME      Q +N+ VL  APCSVGILV+RG    
Sbjct  554   VVTSAHQKRAALIVLPFHKLHQMDGHMESLGDQYQHINQRVLHHAPCSVGILVDRGLGGA  613

Query  870   ---RPNQYAKNIAVLYLGGPDDREALTYARRMSGLPGVHLTVIRFVPAKDVSADGAVEDP  700
                  +  +  I V++ GG DDREAL YA RM   PG+ L V+RF   +  S D      
Sbjct  614   AQVAASDVSYTIVVIFFGGRDDREALAYAMRMVEHPGIGLHVLRFCLVQSSSTD------  667

Query  699   DLELELTRETSFVTVSIDPARDKEEDEELLNNFRTETAE-DDSKTFMELVLDDEEEFTKA  523
                                     +D+  L +FRT+ A  +DS  + +     +EE  +A
Sbjct  668   -----------------------VDDDAFLEDFRTKVANGNDSVRYEDKPAGGKEEVVEA  704

Query  522   VKSLDDRSFDLYVAGRGRGVSSALTSGLADWC-ECPELGAVGDllvtsefessfsvlvVQ  346
             +K++     +L++ G+G          L DW  +CPELG +G  L   EF +  SVLV++
Sbjct  705   IKAIG--PCNLFLVGQGTPCMP-----LIDWSTDCPELGPLGTYLALPEFSTVASVLVMK  757

Query  345   QYVRTNK  325
             QY  T K
Sbjct  758   QYDPTAK  764



>ref|XP_008654236.1| PREDICTED: uncharacterized protein LOC100191437 isoform X1 [Zea 
mays]
 gb|AFW81495.1| hypothetical protein ZEAMMB73_283365 [Zea mays]
Length=796

 Score =   441 bits (1133),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 270/762 (35%), Positives = 426/762 (56%), Gaps = 57/762 (7%)
 Frame = -3

Query  2628  SNGVWEGPDPLAPMIPLFILQIMTAILSSRILNFVLKPFNQPPLVAEILSGIILGPSMLG  2449
             S+GV++G +PL   +PL ILQI   ++ +R+L F+L+P  QP ++AEI+ GI+LGPS +G
Sbjct  16    SDGVFQGENPLHSALPLAILQICIVVVLTRVLAFILRPLRQPRVIAEIIGGILLGPSAVG  75

Query  2448  NIEEFRKHNFPNHNFETIETMGHFALVLYAFLTGLQMDVKAIVHTGTKSRIVAVSGSIFP  2269
                 F    FP  +   ++T+ +  L+ + FL GL++D++AI HTG+ + ++AV+G   P
Sbjct  76    RSTAFLNTVFPKQSLTVLDTIANIGLLYFLFLVGLELDLRAIRHTGSTALVIAVAGISLP  135

Query  2268  FLIGAGFYFTLQTDTQSMIG----FIFCGSALTVTGFSTLAKILDSKRLLNTEIGKIAAS  2101
             F++G G  F LQ      +      +F G AL++T F  LA+IL   +LL T++G++A S
Sbjct  136   FIMGIGTSFVLQHTVARGVPTAPFLVFMGVALSITAFPVLARILAELKLLTTDLGRMAMS  195

Query  2100  SALINVALSWVL--LTIGLLFTGSLDNVQWAvlctvgfvvvcvnyVRPLLNWLISKTPEG  1927
             +A +N  ++W+L  L I L  TGS     W +L   GFV+     +RP L W+  ++PEG
Sbjct  196   AAAVNDVVAWILLALAIALSGTGSPLVSLWVLLAGTGFVLAAFLLLRPGLTWMARRSPEG  255

Query  1926  QGFSEFYICSFIAVICAFGCFTDAMGSHPMIGAFIFGLIMPNNELLRTAILDRLEDFVMG  1747
             +   E YIC+ +A++ A G  TDA+G H + GAFI G+I+P +      +L+++ED + G
Sbjct  256   EPVKELYICATLAIVLAAGFATDAIGIHALFGAFIVGIIVPKDGPFAGVLLEKVEDLISG  315

Query  1746  ILMPVFFLVCGLRTNIFTITDGDTSIFTALALILLACSAKIIAALVASCYTGMSTNEAIG  1567
             + +P++F+  GL+TN+ TI  GD+     L ++  AC  KI   ++AS    +   EA+ 
Sbjct  316   LFLPLYFVSSGLKTNVMTIKGGDSWALLVL-VVATACIGKIGGTVIASLIVRVPFREALT  374

Query  1566  LGVLTNTKSTMVMIILEVGqvqqvlsvqqysmmvVACLIMTIVATPLAAR-YCPKQDLEP  1390
             LG L NTK  + +I+L +G+ + VL+ + ++++V+  LI T + TP+    Y P +   P
Sbjct  375   LGFLMNTKGLVELIVLNIGKDRHVLNDETFAILVLMALITTFITTPVVMTIYKPARRGAP  434

Query  1389  YKRRTIQNAKPGEELRILACIHGTNNLPAIISLLETSNSTVTSPITAFGVQLLELVGRAP  1210
             YK RT+Q A P +E R++AC H T N+P II+L+E+S  T    IT + + L+EL  R+ 
Sbjct  435   YKNRTVQRANPHDEFRMMACFHSTRNIPTIINLMESSRGTRKRGITVYAMHLVELSERSS  494

Query  1209  AMMvvhssgsgrhvggsHE---EVQTSQIISTFDNYELRSHGVTAQVLTARWSYDTMAED  1039
             A+ +VH +        +     +    Q++  F+ Y+  S  V+ + +TA    +T+ ED
Sbjct  495   AICMVHKARRNGMPFWNRRRNGDGGGDQLVVAFETYQQLSR-VSIRAMTAISDLETIHED  553

Query  1038  ICKMAKEKRAAFLVLPFHKQQGTDGEMEDTNPAIQTVNEGVLLSAPCSVGILVERG----  871
             +   A +KRAA +VLPFHK    DG ME      Q +N+ VL  APCSVGILV+RG    
Sbjct  554   VVTSAHQKRAALIVLPFHKLHQIDGHMESLGDQYQHINQRVLHHAPCSVGILVDRGLGGV  613

Query  870   ---RPNQYAKNIAVLYLGGPDDREALTYARRMSGLPGVHLTVIRFVPAKDVSADGAVEDP  700
                  +  +  I V++ GG DDREAL Y  RM   PG+ L V+RF+    + + GA  D 
Sbjct  614   AQVAASDVSYTIVVIFFGGRDDREALAYGMRMVEHPGIGLHVLRFL----LQSGGAASD-  668

Query  699   DLELELTRETSFVTVSIDPARDKEEDEELLNNFRTETAE-DDSKTFMELVLDDEEEFTKA  523
                                     +D   L  FRT+ A  +DS  + +  +  +EE  +A
Sbjct  669   ------------------------DDASFLEEFRTKVANGNDSVRYEDRTVGGKEEVVEA  704

Query  522   VKSLDDRSFDLYVAGRGRGVSSALTSGLADWC-ECPELGAVG  400
             +K+      +L++ G+G          L DW  + PELG VG
Sbjct  705   IKATG--RCNLFLVGQGTPCMP-----LVDWSTDSPELGPVG  739



>ref|XP_006410325.1| hypothetical protein EUTSA_v10016242mg [Eutrema salsugineum]
 gb|ESQ51778.1| hypothetical protein EUTSA_v10016242mg [Eutrema salsugineum]
Length=846

 Score =   442 bits (1137),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 289/825 (35%), Positives = 448/825 (54%), Gaps = 61/825 (7%)
 Frame = -3

Query  2709  PPPSTGPEVDLD--RLGQVVMCFSQT----IYRSNGVWEGPDPLAPMIPLFILQIMTAIL  2548
             PP     + D+   R G V+ C++QT    I   NG WE    LA ++P F+ Q+  A  
Sbjct  8     PPEQEELQYDVSDSRYGSVI-CYNQTVAAVIGDHNG-WESGSSLAAVLPFFVTQLFVANF  65

Query  2547  SSRILNFVLKPFNQPPLVAEILSGIILGPSMLGNIEEFRKHNFPNHNFETIETMGHFALV  2368
             S R++ ++++P   PP VA+IL G++  P++LG  E    H FP      +ET  + ALV
Sbjct  66    SYRVIYYLIRPLRLPPFVAQILCGLLFSPTVLGRHELVLTHLFPFRFTMVLETFANLALV  125

Query  2367  LYAFLTGLQMDVKAIVHTGTKSRIVAVSGSIFPFLIGAGFYFTLQTDTQSMI--GFIFCG  2194
                FL GL MD++ I     K  ++A+ G +     GAG Y+         I  G +F  
Sbjct  126   YNIFLLGLGMDLRMIKLKEVKPLVIAIVGLLVALAAGAGLYYIPGNGDSDKILAGCLFWS  185

Query  2193  SALTVTGFSTLAKILDSKRLLNTEIGKIAASSALINVALSWVLLTIGL-LFT--GSLDNV  2023
              A   T F  LAKIL   +LL +++G+ A  +A+I    +WVLL IG+  FT  G  + +
Sbjct  186   VAFGCTNFPDLAKILADLKLLRSDMGRTAMCAAIITDLCTWVLLVIGIATFTKQGIYNQM  245

Query  2022  Q-WAvlctvgfvvvcvnyVRPLLNWLISKTPEGQGFSEFYICSFIAVICAFGCFTDAMGS  1846
               +A++ T+ FV  C+  +RP + W  + T +G    + ++   +A +      TD  G 
Sbjct  246   MPYAIVSTIAFVFFCIYVMRPGIAWAFANTVKGGNVGDTHVWFTLAGVLLCSLITDTFGV  305

Query  1845  HPMIGAFIFGLIMPNNELLRTAILDRLEDFVMGILMPVFFLVCGLRTNIFTITDGDTSIF  1666
             H + GAF+FGL +P++ ++R  I ++L DF+ GILMP+F+++CGLR ++  +       +
Sbjct  306   HSITGAFLFGLSIPHDHIIRNMIEEKLHDFLSGILMPLFYIICGLRIDLNYMFK-----Y  360

Query  1665  TALALILLACSA----KIIAALVASCYTGMSTNEAIGLGVLTNTKSTMVMIILEVGqvqq  1498
             T++ +++   S+    KI++ +V S +  +   +A+ +G L NTK TM ++ L  G+  +
Sbjct  361   TSVGMMVFVISSSFMVKILSTVVCSFFLRIPLRDALAIGALMNTKGTMALVTLNAGRDTR  420

Query  1497  vlsvqqysmmvVACLIMTIVATP-LAARYCPKQDLEPYKRRTIQNAKPGEELRILACIHG  1321
              L V  Y+ M +  L M+IV  P L   Y PK+    YK RT+Q  K   ELR+L C+H 
Sbjct  421   ALDVIMYTHMTLMFLAMSIVVQPLLTVAYKPKKKAVFYKYRTVQKLKGEVELRVLTCVHV  480

Query  1320  TNNLPAIISLLETSNSTVTSPITAFGVQLLELVGRAPA-MMvvhssgsgrhvggsHEEVQ  1144
               N+  I SLL+ SN T  SP+  F + L+EL GR  A M++++     +         +
Sbjct  481   LPNVSGITSLLQLSNPTKQSPLNVFAIHLVELTGRTTASMLIMNDEAKPKANFSDRVRAE  540

Query  1143  TSQIISTFDNYELRSHGVTAQVLTARWSYDTMAEDICKMAKEKRAAFLVLPFHKQQGTDG  964
             + QI   F+  E+ ++ +  Q +TA   Y TM EDIC +A++KR + ++LP+HK   +DG
Sbjct  541   SEQIAEMFEGMEVNNNAMMVQTITAVSPYATMHEDICTLAEDKRVSLVLLPYHKNLTSDG  600

Query  963   EMEDTNPAIQTVNEGVLLSAPCSVGILVERG-----------RPNQYAKNIAVLYLGGPD  817
              + + N A   +N  VL  APCSVGILV+RG           +     K +A+L++GG D
Sbjct  601   RLGEGNDAHAEINRNVLSHAPCSVGILVDRGMTIVRSESSSFQGETSKKEVAMLFVGGRD  660

Query  816   DREALTYARRMSGLPGVHLTVIRFVPAKDVSADGAVEDPDLELELTRETSFVTVSIDPAR  637
             DREAL YA RM G   + LTV+RFV A   +A  A E                      +
Sbjct  661   DREALAYAWRMVGQEMIKLTVVRFVAAGKSTA--AYE----------------------K  696

Query  636   DKEEDEELLNNFRTETAEDDSKTFMELVLDDEEEFTKAVKSLDD-RSFDLYVAGRGRGVS  460
             +K+ DEE +  F  +T +D S T++E V++D +E   A++ L+D  S+DLY+ GRG  V 
Sbjct  697   EKQVDEECIYEFNFKTMDDSSVTYIEKVVNDGQETIAAIRELEDNHSYDLYIVGRGYKVE  756

Query  459   SALTSGLADWCECPELGAVGDllvtsefessfsvlvVQQYVRTNK  325
             S +T+GL DW   P+LG +GD L +S F    SVLV+QQY   N+
Sbjct  757   SPVTAGLTDWSSSPDLGTIGDTLASSNFTMQASVLVIQQYSAANR  801



>ref|XP_006361543.1| PREDICTED: cation/H(+) antiporter 15-like [Solanum tuberosum]
Length=813

 Score =   438 bits (1126),  Expect = 5e-135, Method: Compositional matrix adjust.
 Identities = 288/823 (35%), Positives = 461/823 (56%), Gaps = 34/823 (4%)
 Frame = -3

Query  2739  LLQPEKMAAPPPPSTGPEVDLDRLGQVVMCFSQTIYRSNGVWEGPDPLAPMIPLFILQIM  2560
             ++ P  + AP   S     +   LG   +C+    +  NG+WE  +PL   +P FI Q+ 
Sbjct  1     MVNPNFLKAPELASYNVRGNQPALGVDKLCYLTDTFSDNGIWEEINPLESKLPTFIFQLA  60

Query  2559  TAILSSRILNFVLKPFNQPPLVAEILSGIILGPSMLGNIEEFRKH------NFPNHNFET  2398
               +  +R+   +LKP  QP   AE+L+GI++G   + + E  RKH       F       
Sbjct  61    IVLFVTRLSLLLLKPLRQPHFAAELLAGILVGSIAIAS-EFARKHIPTLGSVFAASRIMM  119

Query  2397  IETMGHFALVLYAFLTGLQMDVKAIVHTGTKSRIVAVSGSIFPFLIGAGFY-FTLQTDTQ  2221
             +ET+G+  L+ + FL GL++D++A+   G K+  + ++G++FPF  GA  Y F  +    
Sbjct  120   METVGNLGLIYHVFLIGLEIDLRALTSVGPKALGIGIAGALFPFFFGASLYTFIAEYPEN  179

Query  2220  SMIGFIFCGSALTVTGFSTLAKILDSKRLLNTEIGKIAASSALINVALSWVLLTIGLLFT  2041
                G ++ G AL+VTG   +A+I    +LL++EIG+IA SSAL+N   SW+LL   L  T
Sbjct  180   FRWGCLYWGVALSVTGLPVIAEIFAKLKLLHSEIGRIAMSSALVNDFSSWILLVFSLAIT  239

Query  2040  GSLDNVQWAvlctvgfvvvcvnyVRPLLNWLISK-TPEGQGFSEFYICSFIAVICAFGCF  1864
              S  +   ++   + F++  +  +RP L W++ K T EG+ +SE  IC+ + ++ A G  
Sbjct  240   SSSSSTYLSLFSVLFFIIFSIFVIRPALLWMLRKSTREGEDYSEATICAILTMVLACGLI  299

Query  1863  TDAMGSHPMIGAFIFGLIMPNNELLRTAILDRLEDFVMGILMPVFFLVCGLRTNIFTITD  1684
             TD  G   ++GAF+FGLI+P++ L    +L  ++ FV  +L+P+++   G+RT++  I  
Sbjct  300   TDICGVSSVLGAFVFGLIIPSDLLGHRFVLT-VQGFVSDLLLPLYYASLGMRTHLGGINR  358

Query  1683  GDTSIFTALALILLACSAKIIAALVASCYTGMSTNEAIGLGVLTNTKSTMVMIILEVGqv  1504
              D  +   ++L  L+   KI+  L  S +  MS +E   LG+L NTK  + ++ + +G+ 
Sbjct  359   EDMLMMVLISL--LSFIPKIVCTLAMSYFYRMSLHEGFTLGILMNTKGLLAVMAMSLGRD  416

Query  1503  qqvlsvqqysmmvVACLIMTIVATPLAA-RYCPKQDLEPYKRRTIQNAKPGEELRILACI  1327
               V++   +++M+     MTIV +P+    Y   +   P + R +QN KP  ELRIL  I
Sbjct  417   HTVMNEDGFAIMLFTIFFMTIVTSPIVNFLYRRTKKFLPSQHRVLQNLKPDSELRILTSI  476

Query  1326  HGTNNLPAIISLLETSNSTVTSPITAFGVQLLELVGRAPAMMvvhssgsgrhvggsHEEV  1147
             H       I +LLE S+++  SPI  F +QL++L     A+++VH +        S  + 
Sbjct  477   HEVQTAAGITALLEISHASRRSPICVFALQLMQLKKHTTALLIVHGASGTSSESYSRADG  536

Query  1146  QTSQIISTFDNYELRSHGVTAQVLTARWSYDTMAEDICKMAKEKRAAFLVLPFHKQQGTD  967
             Q  Q+++TF+N E ++  ++ Q+LTA   Y TM EDIC +A+EK+   ++LPFHK+Q   
Sbjct  537   QIDQLVTTFNNLEHQNPMISVQLLTAISPYSTMHEDICCLAEEKQVTLIILPFHKRQTIH  596

Query  966   GEMEDTNPAIQTVNEGVLLSAPCSVGILVERG----------RPNQYAKNIAVLYLGGPD  817
               ME+ NPA + VN   L +APC+VGILV+RG               +  IA++++GG D
Sbjct  597   NNMEEMNPAYKEVNNNTLENAPCAVGILVDRGFGTLLTSKIDDDKTRSCRIAMIFIGGRD  656

Query  816   DREALTYARRMSGLPGVHLTVIRFVPAKDVSADGAVEDPDLELELTRETSFVTVSIDPAR  637
             DREAL+YA RM+  P V L V+RF+  +  + +G   D DL L +  E        +   
Sbjct  657   DREALSYALRMARHPKVSLIVLRFILDETSAQNG---DADLSLTMEGEH-------EGEA  706

Query  636   DKEEDEELLNNFRTETAEDDSKTFMELVLDDEEEFTKAVKSLDDRSFDLYVAGRGRGVSS  457
             +K+ D+  +N FR +   DDS  + E +  +  E  K ++SL  + FDLYV GRG G  S
Sbjct  707   EKKADDIFVNEFRQKVQNDDSVVYTEEMSSNGAETVKTIRSL-GQDFDLYVVGRGLGFFS  765

Query  456   ALTSGLADWCECPELGAVGDllvtsefessfsvlvVQQYVRTN  328
              L  GL +W +CPELG++GDLL+TS+F S+ S+LVVQ +   N
Sbjct  766   PLKGGLDEWNDCPELGSIGDLLLTSDFSSTASILVVQHHAELN  808



>ref|XP_006295867.1| hypothetical protein CARUB_v10024997mg [Capsella rubella]
 gb|EOA28765.1| hypothetical protein CARUB_v10024997mg [Capsella rubella]
Length=829

 Score =   437 bits (1125),  Expect = 9e-135, Method: Compositional matrix adjust.
 Identities = 282/808 (35%), Positives = 439/808 (54%), Gaps = 45/808 (6%)
 Frame = -3

Query  2679  LDRLGQVVMCFSQTIYRSNG---VWEGPDPLAPMIPLFILQIMTAILSSRILNFVLKPFN  2509
             + R G VV C++QT+    G   + +    L   +P+F++Q+  + L+ R+L +  +P  
Sbjct  3     ISRYGNVV-CYNQTLMNMAGDHSLEDSGSSLTAALPVFVMQLFVSNLTYRLLYYFTRPLY  61

Query  2508  QPPLVAEILSGIILGPSMLGNIEEFRKHNFPNHNFETIETMGHFALVLYAFLTGLQMDVK  2329
              PP VA+IL G++  PS+LGN      H FP      +ET  + ALV   FL GL MD++
Sbjct  62    FPPFVAQILCGLLFSPSVLGNKGWVLDHVFPYRFTMVLETFANLALVYNIFLLGLGMDLR  121

Query  2328  AIVHTGTKSRIVAVSGSIFPFLIGAGFYFTLQTDTQSMI--GFIFCGSALTVTGFSTLAK  2155
              I     K  I+A+ G I   L G G Y+         I  G ++   A   T F  LA+
Sbjct  122   MIKMKDPKPVIIAIVGLIAALLAGVGLYYLPGNGDPDKILAGGLYWSVAFGCTNFPDLAR  181

Query  2154  ILDSKRLLNTEIGKIAASSALINVALSWVLLTIGL--LFTGSLDN--VQWAvlctvgfvv  1987
             IL   +LL +++G+ A S+A+I    +W+L   G+       + N  + ++++ T  FV+
Sbjct  182   ILADLKLLRSDMGRTAMSAAIITDLCTWILFVFGMGCFSKAGIRNAMMAYSLVSTAVFVL  241

Query  1986  vcvnyVRPLLNWLISKTPEGQGFSEFYICSFIAVICAFGCFTDAMGSHPMIGAFIFGLIM  1807
              C   +RP + W+ + T +G    E ++   +A +     FT+  G   + GAF+FGL +
Sbjct  242   FCYFAIRPAVAWIFNNTVKGGNVDETHVWFILAGVILCSLFTEVCGVQSITGAFLFGLSI  301

Query  1806  PNNELLRTAILDRLEDFVMGILMPVFFLVCGLRTNIFTITDGDTSIFTALALILLACSAK  1627
             P++ ++R  I ++L D++ GILMP+F+++CGLR ++  +  G  SI T   +I  +   K
Sbjct  302   PHDHIIRNMIEEKLHDYISGILMPLFYIICGLRADLAYMF-GFVSIGTMALVISASFMVK  360

Query  1626  IIAALVASCYTGMSTNEAIGLGVLTNTKSTMVMIILEVGqvqqvlsvqqysmmvVACLIM  1447
             I++ +V S +  +   +   +G L NTK TM ++IL  G+    L V  Y+ M +A L+M
Sbjct  361   ILSTIVCSIFLRIPLLDGFAIGSLMNTKGTMALVILNAGRDTYSLDVSMYTHMTLAFLVM  420

Query  1446  TIVATPL-AARYCPKQDLEPYKRRTIQNAKPGEELRILACIHGTNNLPAIISLLETSNST  1270
             +IV  PL A  Y PK+ L  YK RTIQ  K   EL +L C+H   N+  I +LL+ SN T
Sbjct  421   SIVVQPLLAIAYKPKKKLAFYKNRTIQKHKGESELGVLTCVHVFPNVSGITNLLQLSNPT  480

Query  1269  VTSPITAFGVQLLELVGRAPA-MMvvhssgsgrhvggsHEEVQTSQIISTFDNYELRSHG  1093
               SP+  F + L+EL GR  A +++++     +         ++ QI   F   E+ + G
Sbjct  481   KKSPLNVFAIHLVELTGRTTASLLIMNDEAKPKANFSERVRAESDQIAEKFAALEVDNDG  540

Query  1092  VTAQVLTARWSYDTMAEDICKMAKEKRAAFLVLPFHKQQGTDGEMEDTNPAIQTVNEGVL  913
             +  Q +TA   Y TM EDIC +A++K+ +F++LP+HK   +DG + + N A   +N+ VL
Sbjct  541   ILVQTITAVSPYTTMHEDICSLAEDKQVSFILLPYHKNMTSDGRLTEGNHAHADINKNVL  600

Query  912   LSAPCSVGILVERG-----------RPNQYAKNIAVLYLGGPDDREALTYARRMSGLPGV  766
               APCSVGILV+RG           +     K IA+L++GG DDREAL +A RM G   V
Sbjct  601   SYAPCSVGILVDRGMTIIRSESLTFQGENTKKEIAMLFIGGRDDREALAFAWRMVGQEMV  660

Query  765   HLTVIRFVPAKDVSADGAVEDPDLELELTRETSFVTVSIDPARDKEEDEELLNNFRTETA  586
              LTV+RFVP ++                    + +TV I+  ++K  DEE +  F  +T 
Sbjct  661   KLTVVRFVPGRE--------------------ALLTVGIEYEKEKNIDEEYIYEFNFKTR  700

Query  585   EDDSKTFMELVLDDEEEFTKAVKSL-DDRSFDLYVAGRGRGVSSALTSGLADWCECPELG  409
             +D S T++E V++D +E   A+  L ++ S DLY+ GRG  V + +T+GL DW   P LG
Sbjct  701   DDPSVTYIEKVVNDGQETITAIIELEENNSHDLYIVGRGYQVETPVTAGLTDWNSAPVLG  760

Query  408   AVGDllvtsefessfsvlvVQQYVRTNK  325
              +GD L +S F    SVLVVQQY   N+
Sbjct  761   VIGDTLASSNFTMHASVLVVQQYSSANR  788



>ref|XP_009402107.1| PREDICTED: cation/H(+) antiporter 19-like [Musa acuminata subsp. 
malaccensis]
Length=808

 Score =   437 bits (1123),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 264/761 (35%), Positives = 428/761 (56%), Gaps = 36/761 (5%)
 Frame = -3

Query  2628  SNGVWEGPDPLAPMIPLFILQIMTAILSSRILNFVLKPFNQPPLVAEILSGIILGPSMLG  2449
             SNG W+G +PL   +PL ILQI   I  +R L FVL P  QP +VAEI+ G++LGPS +G
Sbjct  16    SNGSWQGDNPLDSALPLAILQICLVIALTRFLAFVLHPLRQPRVVAEIIGGVLLGPSAIG  75

Query  2448  NIEEFRKHNFPNHNFETIETMGHFALVLYAFLTGLQMDVKAIVHTGTKSRIVAVSGSIFP  2269
               E F K  FP  +   ++T+    L+ + FL G+++D++AI  TG ++  +A++G   P
Sbjct  76    RSERFLKMVFPKQSLTVLDTLASVGLIFFLFLVGMELDLRAIRRTGQRALAIAIAGISLP  135

Query  2268  FLIGAGFYFTLQTDTQSMIG----FIFCGSALTVTGFSTLAKILDSKRLLNTEIGKIAAS  2101
             F++G G    L+      +      +F G AL++T F  LA+IL   +LL T++G++A S
Sbjct  136   FVMGIGTSVVLRHTVAKGVPEAPFLVFMGVALSITAFPVLARILAELKLLTTDLGRMAMS  195

Query  2100  SALINVALSWVLLTIGLLFTGSLDNVQ--WAvlctvgfvvvcvnyVRPLLNWLISKTPEG  1927
             +A +N   +W+LL + +  +GS   +   W +L  VGFV     +VRP+L+W+  ++PEG
Sbjct  196   AAAVNDIAAWILLALAIALSGSGSPLVSLWVLLSGVGFVAFVAIFVRPVLDWMARRSPEG  255

Query  1926  QGFSEFYICSFIAVICAFGCFTDAMGSHPMIGAFIFGLIMPNNELLRTAILDRLEDFVMG  1747
             +  +E +IC+ +A + A G  TD +G H + GAFI G+++P +      +++++ED + G
Sbjct  256   EPVNEMFICATLATVLAAGFVTDTIGIHALFGAFIVGVVVPKDGPFAGVLIEKIEDLISG  315

Query  1746  ILMPVFFLVCGLRTNIFTITDGDTSIFTALALILLACSAKIIAALVASCYTGMSTNEAIG  1567
             + +P++F+  GL+TN+ TI+ G++    AL +I  AC  KI   ++ S    +   EAI 
Sbjct  316   LFLPLYFVSSGLKTNVATISGGESWALLAL-VICTACLGKICGTVIVSLLVKVPAREAIA  374

Query  1566  LGVLTNTKSTMVMIILEVGqvqqvlsvqqysmmvVACLIMTIVATPLA-ARYCPKQDLEP  1390
             LG L NTK  + +I+L +G+ ++VL+ + ++++V+  L+ T + TP+  A Y P +   P
Sbjct  375   LGFLMNTKGLVELIVLNIGKDRKVLNDETFAILVLMALVTTFLTTPIVMAIYKPARRSAP  434

Query  1389  YKRRTIQNAKPGEELRILACIHGTNNLPAIISLLETSNSTVTSPITAFGVQLLELVGRAP  1210
             YK RTIQ      ELR+LAC HG+ N+P +I+L+E+S       IT + + L+EL  R+ 
Sbjct  435   YKHRTIQRNDTDSELRVLACFHGSRNIPTMINLIESSRGIRRRGITVYAMHLMELSERSS  494

Query  1209  AMMvvhssgsgrh---vggsHEEVQTSQIISTFDNYELRSHGVTAQVLTARWSYDTMAED  1039
             A+ +VH +              +     ++  F  Y+  S+ V+ + + A    +TM ED
Sbjct  495   AIFMVHKARLNGLPFWNRKGDSDNGADHLVIAFQAYQQLSN-VSVRPMIAISDLETMHED  553

Query  1038  ICKMAKEKRAAFLVLPFHKQQGTDGEMEDTNPAIQTVNEGVLLSAPCSVGILVERGR---  868
             I   A +KRAAF++LPFHK Q  DG ME T  A   +N  VL  APCSVG+LV+RG    
Sbjct  554   IITSADQKRAAFILLPFHKLQQIDGSMESTGHAYHLINRRVLRRAPCSVGVLVDRGLGGT  613

Query  867   ----PNQYAKNIAVLYLGGPDDREALTYARRMSGLPGVHLTVIRFVPAKDVSADGAVEDP  700
                  ++ +  +A L+ GG DDREAL Y+ RM+  PG+ L V+RF+P          +  
Sbjct  614   AQVVASEVSYTVATLFFGGRDDREALAYSARMAEHPGIQLIVVRFIPP---------QTG  664

Query  699   DLELELTRETSFVTVSIDPARDKEEDEELLNNFRTET-AEDDSKTFMELVLDDEEEFTKA  523
             +  LE +R        I  A +   D+  +  FR +  A ++S  + + V+    E   A
Sbjct  665   NWFLERSRGGGGSVSIIVDANEISADDACITEFRDKVLASNESIRYDDKVMGSRVEIIAA  724

Query  522   VKSLDDRSFDLYVAGRGRGVSSALTSGLADWCECPELGAVG  400
             +KS+     +L++ G+   +       L++  + PELG VG
Sbjct  725   IKSIG--RCNLFLVGQAPPIMV-----LSEKADSPELGPVG  758



>ref|XP_007052424.1| Cation proton exchanger [Theobroma cacao]
 gb|EOX96581.1| Cation proton exchanger [Theobroma cacao]
Length=854

 Score =   437 bits (1125),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 279/784 (36%), Positives = 438/784 (56%), Gaps = 41/784 (5%)
 Frame = -3

Query  2655  MCFSQTIYRSNGVWEGPDPLAPMIPLFILQIMTAILSSRILNFVLKPFNQPPLVAEILSG  2476
             +C+++    +N  W+  +PL   +P+F+LQ+   IL +R    VL P  QP  V+EIL+G
Sbjct  21    VCYNEDRSFANTDWQVTNPLLKSLPIFMLQLSVVILFTRTFIIVLTPIRQPRFVSEILAG  80

Query  2475  IILGPSMLGNIEEFRKHNFPNHNFETIETMGHFALVLYAFLTGLQMDVKAIVHTGTKSRI  2296
             I+LGPS LG I     +  P      +ETMG+  +  Y FL GL+MD+  I   G  +  
Sbjct  81    IVLGPSALGIIGWVSSNINPFEGALLLETMGNLGVTFYMFLVGLEMDLTPIRKMGKTACS  140

Query  2295  VAVSGSIFPFLIGAG-FYFTLQTDTQS-MIGFIFCGSALTVTGFSTLAKILDSKRLLNTE  2122
             VA++G + P   GAG +Y  LQ D +    G +F   ALTVT F  LA++L S +L+ T+
Sbjct  141   VAIAGIVLPACGGAGLYYLVLQKDGRRPSEGGLFWAIALTVTSFPDLARMLSSLKLMYTD  200

Query  2121  IGKIAASSALINVALSWVLLTIGLLFTGSLDNVQWAvlctvgfvvvcvnyVRPLLNWLIS  1942
             +GK A +SA++    SW+LL + ++   +     + V+ T+ F+V+    +RP + W + 
Sbjct  201   LGKTALTSAVLTDLSSWILL-VAVVSVVNGRGKLYTVIPTMLFLVISWFLMRPFILWAVK  259

Query  1941  K------TPEGQGFSEFYICSFIAVICAFGCFTDAMGSHPMIGAFIFGLIMPNNELLRTA  1780
             +      +     ++E  +C  ++ +   G FT+  G H M GAF+FGL++P+ E L T 
Sbjct  260   RIALRNESSMESRYNEKQVCYILSGVLLCGFFTEMCGVHSMFGAFMFGLMIPSGE-LGTM  318

Query  1779  ILDRLEDFVMGILMPVFFLVCGLRTNIFTITDGDTSIFTALALILLACSAKIIAALVASC  1600
             I+D++E++V+GIL+P  FL+ GLRTN   +    TS    + +IL+A S KI++ L+   
Sbjct  319   IMDKIEEYVVGILLPPVFLITGLRTNFAYMAVEHTS-HLVIIVILVASSVKIVSTLLVCL  377

Query  1599  YTGMSTNEAIGLGVLTNTKSTMVMIILEVGqvqqvlsvqqysmmvVACLIMTIVATPL--  1426
             Y      +++ LGVL NTK  + +I+L  G+  +    Q +S MV++ LIMT +  P+  
Sbjct  378   YLKCPIRDSLALGVLMNTKGVLAIIVLNEGRNVKGFDQQTFSWMVLSILIMTGLVGPIVN  437

Query  1425  ----AARYCPKQDLEPYKRRTIQNAKPGEELRILACIHGTNNLPAIISLLETSNSTVTSP  1258
                 + RY  K     Y RR ++ +K   ELR+LAC+H + N+  +I+LL  SN+T   P
Sbjct  438   FTHKSTRYTKK-----YYRRNLERSKVEAELRVLACVHSSKNVSGLINLLHISNATRKFP  492

Query  1257  ITAFGVQLLELVGRAPAMMvvhssgsgrhvg------gsHEEVQTSQIISTFDNYELRSH  1096
             IT F V L+EL GRA AM++ H      +V        S  + +  QI+S F+++   +H
Sbjct  493   ITVFAVHLVELTGRASAMLIFHDKTRTTNVIGNEINPISRGKAEAEQIVSAFESFHNDNH  552

Query  1095  GVTAQVLTARWSYDTMAEDICKMAKEKRAAFLVLPFHKQQGTDGEMEDTNPAIQTVNEGV  916
              V  Q LTA  SY +M ED+   A +K    ++LPFHKQ    G   D N   + V + +
Sbjct  553   AVYVQPLTAVSSYASMHEDVSNFALDKGVTVILLPFHKQANAHGGWTDENLQHKQVTDNL  612

Query  915   LLSAPCSVGILVER---------GRPNQYAKN--IAVLYLGGPDDREALTYARRMSGLPG  769
             L +APCS+GILV+R         G P+   +   IA+L+L GPD REAL YA RM+G  G
Sbjct  613   LANAPCSIGILVDRGLTPPYLPLGSPHDRKRKCRIAMLFLQGPDYREALAYAWRMAGTSG  672

Query  768   VHLTVIRFVPAKDVSADGAVEDPDLELELTRETSFVTVSIDPARDKEEDEELLNNFRTET  589
             V LTV+RF+P K+V      +  +   +   +  F   + +  ++   D++ +N FR  T
Sbjct  673   VMLTVVRFIPGKEVVKFAETDAGNGGGDDDDDEIF-AATFEKEKEMLLDDDYINEFRFRT  731

Query  588   AEDDSKTFMELVLDDEEEFTKAVKSLDDRSFDLYVAGRGRGVSSALTSGLADWCECPELG  409
               + S +++E  ++  ++    ++S  +  FDLY+ GRG G+ S LT GL+DW  CPELG
Sbjct  732   MHNQSISYIEKQVNSGDQIVSIIRSTYN-DFDLYIVGRGHGMQSPLTVGLSDWSNCPELG  790

Query  408   AVGD  397
              +G+
Sbjct  791   LIGE  794



>ref|XP_009770550.1| PREDICTED: cation/H(+) antiporter 15-like [Nicotiana sylvestris]
Length=819

 Score =   436 bits (1121),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 288/828 (35%), Positives = 468/828 (57%), Gaps = 44/828 (5%)
 Frame = -3

Query  2739  LLQPEKMAAPPPPS---TGPEV-DLDRLGQVVMCFSQTIYRSNGVWEGPDPLAPMIPLFI  2572
             ++ P  +  P  PS    G +V  +D+L     C+       NG+WE  +PL   +P+FI
Sbjct  1     MVNPNFLKTPEIPSYNVRGKQVAGVDKL-----CYMTDTVTDNGIWEEINPLDSKLPIFI  55

Query  2571  LQIMTAILSSRILNFVLKPFNQPPLVAEILSGIILGPSMLGNIEEFRKHNFPN-------  2413
              Q+   +  +R+   +LKP  QP   AE+L+GI++G + + +  EF + + P        
Sbjct  56    FQLAIVLFVTRLCLLLLKPLRQPHFAAELLAGILVGSTAIAS--EFAREHIPAFGAIFAA  113

Query  2412  HNFETIETMGHFALVLYAFLTGLQMDVKAIVHTGTKSRIVAVSGSIFPFLIGAGFYFTLQ  2233
                  +ET+G+  L+ + FL GL+MD++A+   G K+  + ++G+IFPF+IGA  Y  + 
Sbjct  114   SRIMMMETVGNLGLIYHVFLLGLEMDLRALTSVGPKALGIGIAGAIFPFVIGASLYTFIA  173

Query  2232  TDTQSM-IGFIFCGSALTVTGFSTLAKILDSKRLLNTEIGKIAASSALINVALSWVLLTI  2056
                +S   GF++ G AL+VTG   +A+I    +LL++EIG+IA SSAL+N   SW LL +
Sbjct  174   DYPESFRWGFLYWGVALSVTGLPVIAEIFAKLKLLHSEIGRIAMSSALVNDLSSWFLLVV  233

Query  2055  GLLFTGSLDNVQWAvlctvgfvvvcvnyVRPLLNWLISK-TPEGQGFSEFYICSFIAVIC  1879
              L  T S  +   ++   + F++  +  +RP L W+I + T +G+ FSE  +C+ +A++ 
Sbjct  234   SLSITSSYSSTYLSLFSAIVFIIFSIFAIRPALLWVIRRRTRDGEEFSEAIVCAILAMVL  293

Query  1878  AFGCFTDAMGSHPMIGAFIFGLIMPNNELLRTAILDRLEDFVMGILMPVFFLVCGLRTNI  1699
             A G  TD  G   M+GAF+FGLI+P + L    +L  L+ F   +L+P+++   G+RT++
Sbjct  294   ACGLVTDICGVSSMLGAFVFGLIIPPDFLGHRFVL-MLQGFASDLLLPLYYASLGMRTHL  352

Query  1698  FTITDGDTSIFTALALILLACSAKIIAALVASCYTGMSTNEAIGLGVLTNTKSTMVMIIL  1519
               +   D  +   ++    +   KI++ +  S    MS  E   LGVL NTK  + ++ +
Sbjct  353   GGLNKEDVLMMVLVSF--FSFIPKIVSTIAVSYLYRMSLREGFTLGVLMNTKGLVAVMAM  410

Query  1518  EVGqvqqvlsvqqysmmvVACLIMTIVATPLAA-RYCPKQDLEPYKRRTIQNAKPGEELR  1342
              +G+   V++   +++M+     M+I  +P+    Y   +   P + R +Q+ KP  ELR
Sbjct  411   SLGRDHTVMNEDGFAIMLFTIFFMSIATSPIVNFLYRRTKRFLPSQHRVLQDLKPDAELR  470

Query  1341  ILACIHGTNNLPAIISLLETSNSTVTSPITAFGVQLLELVGRAPAMMvvhssgsgrhvgg  1162
             IL CIH    +  I +LL+ S+++  SPI  F +QL++L     A+++VH S        
Sbjct  471   ILTCIHEVQTVAGITALLDISHASRRSPICVFALQLMQLKKHTTALLIVHGSSRTSSESV  530

Query  1161  sHEEVQTSQIISTFDNYELRSHGVTAQVLTARWSYDTMAEDICKMAKEKRAAFLVLPFHK  982
             S    Q  Q+I+ F+N E ++  V+ Q+LTA   Y TM ED+C +A+EK+   ++LPFHK
Sbjct  531   SKVGGQIDQLIAAFNNLEHQNPMVSVQLLTAISPYGTMHEDVCSLAEEKQVTLIILPFHK  590

Query  981   QQGTDGEMEDTNPAIQTVNEGVLLSAPCSVGILVERG----RPNQYAK------NIAVLY  832
             +Q     ME+ NPA + VN  +L +APC+VGILV+RG     P +  +       IA+++
Sbjct  591   RQTIHNNMEEMNPAYKDVNNNILATAPCTVGILVDRGFGTLLPTKKDEGISRSCRIAMIF  650

Query  831   LGGPDDREALTYARRMSGLPGVHLTVIRFVPAKDVSADGAVEDPDLELELTRETSFVTVS  652
             +GGPDDREAL YA RM+  P V LTV+RF+  +  +  G+ ++ D +          +V 
Sbjct  651   IGGPDDREALAYALRMARHPKVSLTVLRFILDESRAIAGSTQNDDADF---------SVI  701

Query  651   IDPARDKEEDEELLNNFRTETAEDDSKTFMELVLDDEEEFTKAVKSLDDRSFDLYVAGRG  472
             +    +K+ D+ L+N FR +   D S  ++E +  +  E  K + +L  + FDLYV GRG
Sbjct  702   MGAEAEKQADDLLVNEFRHKVQNDGSIVYIEEMSSNGAETVKIIATL-GQDFDLYVVGRG  760

Query  471   RGVSSALTSGLADWCECPELGAVGDllvtsefessfsvlvVQQYVRTN  328
              G  S L  GL +W +CPELG++GDLL+TS+F SS S+ VVQQ+   N
Sbjct  761   LGFFSPLKGGLDEWSDCPELGSIGDLLLTSDFSSSASIFVVQQHAWLN  808



>ref|XP_010246811.1| PREDICTED: cation/H(+) antiporter 19 [Nelumbo nucifera]
Length=806

 Score =   435 bits (1118),  Expect = 5e-134, Method: Compositional matrix adjust.
 Identities = 261/758 (34%), Positives = 426/758 (56%), Gaps = 32/758 (4%)
 Frame = -3

Query  2628  SNGVWEGPDPLAPMIPLFILQIMTAILSSRILNFVLKPFNQPPLVAEILSGIILGPSMLG  2449
             SNG ++G DPL   +PL ILQI   ++ +R++  +LKP  QP ++AEI+ GI+LGPS  G
Sbjct  17    SNGSFQGEDPLDYALPLLILQICLVVVFTRVIGLILKPLRQPRVIAEIIGGILLGPSAFG  76

Query  2448  NIEEFRKHNFPNHNFETIETMGHFALVLYAFLTGLQMDVKAIVHTGTKSRIVAVSGSIFP  2269
               E+F    FP      ++T+ +  L+ + FL GL++D++AI  TG K+  +A+ G  FP
Sbjct  77    RSEKFLHKVFPARGMTVLDTLANIGLLYFLFLVGLELDLRAIRRTGKKALAIALVGISFP  136

Query  2268  FLIGAG----FYFTLQTDTQSMIGFIFCGSALTVTGFSTLAKILDSKRLLNTEIGKIAAS  2101
             F++G G       T+    +     +F G +L++T F  LA+IL   +LL T++G++A S
Sbjct  137   FILGVGTSVVLRATISKGAKHGPFLVFMGVSLSITAFPVLARILAELKLLTTDLGRMAMS  196

Query  2100  SALINVALSWVLLTIGLLFTGSLDN---VQWAvlctvgfvvvcvnyVRPLLNWLISKTPE  1930
             +A +N   +W+LL + +  +GS  +     W +L    FV   +  +RP L  +  ++PE
Sbjct  197   AAAVNDVAAWILLALAIALSGSDTSPVISLWVLLSGAAFVTFAILVLRPALALMARRSPE  256

Query  1929  GQGFSEFYICSFIAVICAFGCFTDAMGSHPMIGAFIFGLIMPNNELLRTAILDRLEDFVM  1750
             G+   E YIC+ ++++ A G  TD +G H + GAF+ G+I+P +      +++++ED V 
Sbjct  257   GEPVKELYICATLSLVLAAGFVTDTIGIHALFGAFVVGVIVPKDGPFAGVLIEKIEDLVS  316

Query  1749  GILMPVFFLVCGLRTNIFTITDGDTSIFTALALILLACSAKIIAALVASCYTGMSTNEAI  1570
             G+ +P++F+  GL+TN+ TI  G +     L +I  AC  KI+  +V S    +   EA+
Sbjct  317   GLFLPLYFVSSGLKTNVATIRGGQSWGLLCL-VIFNACFGKIVGTVVISIICKVPKREAV  375

Query  1569  GLGVLTNTKSTMVMIILEVGqvqqvlsvqqysmmvVACLIMTIVATPLA-ARYCPKQDLE  1393
              LG L NTK  + +I+L +G+ ++VL+ Q ++++V+  L  T V TP+  A Y P +   
Sbjct  376   ALGFLMNTKGLVELIVLNIGKDRKVLNDQTFAILVLMALFTTFVTTPIVMAVYKPARKAA  435

Query  1392  PYKRRTIQNAKPGEELRILACIHGTNNLPAIISLLETSNSTVTSPITAFGVQLLELVGRA  1213
             PYK RTI+      ELRILAC + T N+P +I+++E+S  T +  +  + + L+E   R+
Sbjct  436   PYKHRTIKRHDRDTELRILACFNSTRNIPTMINVIESSRGTRSRGVCVYAMHLMEFSERS  495

Query  1212  PAMMvvhssgsgrhvggsHEEVQTSQIISTFDNYELRSHGVTAQVLTARWSYDTMAEDIC  1033
              A+ +VH +        + +     Q++  F+ Y+  S+ VT + +TA  +  T+ EDIC
Sbjct  496   SAISMVHKARKNGLPFWNKKHGDRDQMVIAFEAYQQLSN-VTIRPMTAISALQTIHEDIC  554

Query  1032  KMAKEKRAAFLVLPFHKQQGTDGEMEDTNPAIQTVNEGVLLSAPCSVGILVERG------  871
               A+ KRA+ ++LPFHK Q  DG ME    +   +N+ VL  +PCSVGILV+RG      
Sbjct  555   ASAQRKRASIILLPFHKHQRLDGTMESLGHSFHLINQQVLRHSPCSVGILVDRGLGGTTQ  614

Query  870   -RPNQYAKNIAVLYLGGPDDREALTYARRMSGLPGVHLTVIRFVPAKDVSADGAVEDPDL  694
                ++ + +I V + GG DDREAL YA RM+  PG+ LTV++F      S  G     + 
Sbjct  615   VSASEVSYSIVVPFFGGRDDREALAYAFRMAEHPGIVLTVVKFEAQPGTSLTGDSNSGN-  673

Query  693   ELELTRETSFVTVSIDPARDKEEDEELLNNFRTETAEDDSKTFMELVLDDEEEFTKAVKS  514
                  R ++ +TV  +   +K+ D E L   R    E  S TF E V+  +E+    +K+
Sbjct  674   -----RGSTSITVGTEEEDEKKADMEYLEELRENVPE--STTFEERVVGGKEDIRAVLKT  726

Query  513   LDDRSFDLYVAGRGRGVSSALTSGLADWCECPELGAVG  400
             ++    +L++ GR   +       L D  +CPELG VG
Sbjct  727   MNK--CNLFLVGRKPPIVQ-----LMDRTDCPELGPVG  757



>ref|XP_010909726.1| PREDICTED: cation/H(+) antiporter 19 [Elaeis guineensis]
Length=807

 Score =   434 bits (1115),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 267/761 (35%), Positives = 424/761 (56%), Gaps = 39/761 (5%)
 Frame = -3

Query  2628  SNGVWEGPDPLAPMIPLFILQIMTAILSSRILNFVLKPFNQPPLVAEILSGIILGPSMLG  2449
             SNG W+G +PL   +PL I+QI   I  +R L F+L+P  QP ++AEI+ GI+LGPS LG
Sbjct  18    SNGSWQGENPLEASLPLAIVQICLVIAVTRSLAFLLRPLRQPRVIAEIIGGILLGPSALG  77

Query  2448  NIEEFRKHNFPNHNFETIETMGHFALVLYAFLTGLQMDVKAIVHTGTKSRIVAVSGSIFP  2269
               E F +  FP ++   ++T+ +  L+ + FL GL++D++AI  TG ++ I+A++G   P
Sbjct  78    RSETFLETFFPKNSLTVLDTLANIGLLYFLFLVGLELDLRAIRRTGKRALIIAIAGISLP  137

Query  2268  FLIGAGFYFTLQTDTQSMIG----FIFCGSALTVTGFSTLAKILDSKRLLNTEIGKIAAS  2101
             F++G G  F L+T     +      +F G AL++T F  LA+IL   +LL T+IG++A S
Sbjct  138   FIMGIGTSFALRTTINKGVAEGPFLVFMGVALSITAFPVLARILAELKLLTTDIGRMAMS  197

Query  2100  SALINVALSWVLLTIGLLFT--GSLDNVQWAvlctvgfvvvcvnyVRPLLNWLISKTPEG  1927
             +A +N   +W+LL + +  +  GS+    W +L    FVV    ++RP L W+  ++PEG
Sbjct  198   AAAVNDVAAWILLALAIALSGAGSMLVSLWVLLSGAAFVVAAALFLRPALAWMARRSPEG  257

Query  1926  QGFSEFYICSFIAVICAFGCFTDAMGSHPMIGAFIFGLIMPNNELLRTAILDRLEDFVMG  1747
             +   E YIC+ +  + A G  TD +G H + GAF+ G+I+P        +++++ED + G
Sbjct  258   EPVKELYICATLVSVLACGFITDTIGIHALFGAFVVGIIVPKEGPFAGVLIEKVEDLISG  317

Query  1746  ILMPVFFLVCGLRTNIFTITDGDTSIFTALALILLACSAKIIAALVASCYTGMSTNEAIG  1567
             + +P++F+  GL+TN+ TI  G +     L +I  AC  KI   ++ S    +   EA+ 
Sbjct  318   LFLPLYFVSSGLKTNVATIKGGQSWGLLVL-VITTACLGKIGGTVITSLLVNVPVREALT  376

Query  1566  LGVLTNTKSTMVMIILEVGqvqqvlsvqqysmmvVACLIMTIVATPLAAR-YCP-KQDLE  1393
             LG L NTK  + +I+L +G+ ++VL+ + ++++V+  L  T + TPL    + P ++   
Sbjct  377   LGFLMNTKGLVELIVLNIGKDRKVLNDETFAILVLMALFTTFITTPLVMTIFKPARRAAT  436

Query  1392  PYKRRTIQNAKPGEELRILACIHGTNNLPAIISLLETSNSTVTSPITAFGVQLLELVGRA  1213
             PYK RTIQ   P  E R+LAC HG+ N+P +I+L+E+S  T    +T + + L+EL  R+
Sbjct  437   PYKHRTIQRNDPDSEFRVLACFHGSRNIPTMINLVESSRGTRKRRLTVYAMHLMELSERS  496

Query  1212  PAMMvvhssgsgrhvggsHEEVQTSQIISTFDNYELRSHGVTAQVLTARWSYDTMAEDIC  1033
              A+ +VH +        + +     Q+   F  ++  S+ VT + +TA     +M EDI 
Sbjct  497   SAISMVHKARLNGLPFWNRKH-NGDQLEVAFQAFQQLSN-VTIRPMTAISDLYSMHEDIV  554

Query  1032  KMAKEKRAAFLVLPFHKQQGTDGEMEDTNPAIQTVNEGVLLSAPCSVGILVERGR-----  868
               A++KRAA  VLPFHK +  DG M+      Q VN+ VL  APCSVGILV+RG      
Sbjct  555   TSAEQKRAALAVLPFHKIRQFDGSMDSVGHGYQLVNQRVLRYAPCSVGILVDRGLGGSAQ  614

Query  867   --PNQYAKNIAVLYLGGPDDREALTYARRMSGLPGVHLTVIRFVPAKDVSADGAVEDPDL  694
                ++ +  +AVLY GG DDREAL Y  RM+  PG+ LTV++FVP           +P  
Sbjct  615   VCASEVSYTVAVLYFGGRDDREALAYGARMAEHPGIELTVMQFVP----QPGQHFVNPSS  670

Query  693   ELELTRETSFVTVSIDPARDKEEDEELLNNFRTET--AEDDSKTFMELVLDDEEEFTKAV  520
             E  + R T         A ++  DE  +  F+ +   A    K   ++V   + E   A+
Sbjct  671   EGSMGRATD--------ASERLADETCITEFQAKVMGANQSVKYLEKVVGGGKAEIVAAI  722

Query  519   KSLDDRSFDLYVAGRGRGVSSALTSGLADWCECPELGAVGD  397
             +++    F+L++ G    V       L D  +CPELG VG 
Sbjct  723   RAMGK--FNLFLVGHAPRVMP-----LTDKTDCPELGPVGS  756



>gb|KDP20370.1| hypothetical protein JCGZ_05253 [Jatropha curcas]
Length=814

 Score =   432 bits (1112),  Expect = 5e-133, Method: Compositional matrix adjust.
 Identities = 261/772 (34%), Positives = 430/772 (56%), Gaps = 41/772 (5%)
 Frame = -3

Query  2661  VVMCFSQTIYRSNGVWEGPDPLAPMIPLFILQIMTAILSSRILNFVLKPFNQPPLVAEIL  2482
             +  C+ + +      W+    L   +P F++Q+   +L  R+L  VLKP  QP  +AE+L
Sbjct  24    ITACYYEKVTNDKAFWKSEYSLINSLPYFVIQLSLMMLCIRLLFIVLKPLRQPRFLAELL  83

Query  2481  SGIILGPSMLGNIEEFRKHNFPNHNFETIETMGHFALVLYAFLTGLQMDVKAIVHTGTKS  2302
             SG++LG +         ++  P  +  T++TMG   LV Y FL GL++D+  +     K+
Sbjct  84    SGVLLGQTFTAVSPFSNRYIHPAKSTTTLDTMGQLGLVYYMFLVGLEIDITTLRCIERKA  143

Query  2301  RIVAVSGSIFPFLIGAG-FYFTLQTDTQSMIGF--IFCGSALTVTGFSTLAKILDSKRLL  2131
                A    +FP   G G +YF +      ++G         LTVT FS LA++L   +LL
Sbjct  144   MCNAAITILFPLFSGIGLYYFIMHFKDAKLMGMGGAVWAITLTVTSFSDLARVLSDMKLL  203

Query  2130  NTEIGKIAASSALINVALSWVLLTIGLLFTGSLDNVQWAvlctvgfvvvcvn---yVRPL  1960
             +T+IG++A SSA++   ++W LL      T ++ N  +  L     +   V     VRP 
Sbjct  204   HTDIGRLALSSAILCDLVAWSLLVA----TITMANQHFYYLNVFTMIAFAVLCWFVVRPG  259

Query  1959  LNWLISKTPEGQGFSEFYICSFIAV--ICAFGCFTDAMGSHPMIGAFIFGLIMPNNELLR  1786
             ++W+I       G  ++ + ++  +  +  FG  TDA GS  MIGAF+FGL++P  + L 
Sbjct  260   ISWIIRLNNSSNGGIDYELLTYFILGGVVVFGFITDACGSQSMIGAFLFGLVIPKGD-LT  318

Query  1785  TAILDRLEDFVMGILMPVFFLVCGLRTNIFTITDGDTSIFTALALILLACSAKIIAALVA  1606
             T ++++LEDFV GI++P FF   GL+T++F +T G  +    + +++LAC  KI+ A + 
Sbjct  319   TKLIEKLEDFVTGIMLPAFFWTNGLKTDLFDMT-GSVNPLIVITVVILACLTKIVGAFIF  377

Query  1605  SCYTGMSTNEAIGLGVLTNTKSTMVMIILEVGqvqqvlsvqqysmmvVACLIMTIVATPL  1426
             S   GMST E I LGVL NTK  + +I++  G+  +    Q +++M ++ +++T++  P+
Sbjct  378   SMTQGMSTREGILLGVLMNTKGVLALIVMNSGRDLRGFDQQLFAIMTMSLILITLMVKPI  437

Query  1425  A-ARYCPKQDLEPYKRRTIQNAKPGEELRILACIHGTNNLPAIISLLETSNSTVTSPITA  1249
             A A     + + P+KRRTI+ +K   ELRIL+CIH T+NL  +I+LL+ SN T  SPI  
Sbjct  438   AMAAIKSTKHVRPFKRRTIERSKNDSELRILSCIHSTSNLSGMINLLQYSNPTKQSPICI  497

Query  1248  FGVQLLELVGRAPAMMvvhssgsgrhvggs-----HEEVQTSQ-IISTFDNYELRSHGVT  1087
             F + LL+L  R    M++           +     ++EVQ S+ II+ F  +E +   ++
Sbjct  498   FALHLLQLTERRVTAMLIVHDAYNHVTAATGQGSKNQEVQESEHIINAFHTFESKFTAIS  557

Query  1086  AQVLTARWSYDTMAEDICKMAKEKRAAFLVLPFHKQQGTDGEMED-TNPAIQTVNEGVLL  910
              Q LT    Y +M ED+ ++A++KR   +++PFHKQ    G+++D  + +++ VN  +L 
Sbjct  558   IQALTVVSPYSSMHEDVSRLAEDKRVNLILVPFHKQPDIYGKLQDEEDVSLRAVNRNLLA  617

Query  909   SAPCSVGILVERGRPN-QYAKNIAVLYLGGPDDREALTYARRMSGLPGVHLTVIRFVPAK  733
             +APCS+GIL++RG    Q   +  + +LGG D REAL +A RM+G  GV LTV RFVP  
Sbjct  618   TAPCSIGILIDRGLGEFQTQTHFIMAFLGGADSREALAFAWRMAGTMGVMLTVARFVPTT  677

Query  732   DVSADGAVEDPDLELELTRETSFVTVSIDPARDKEEDEELLNNFRTETAEDDSKTFMELV  553
              V  +      +L++E                 K+ D++ +N+FR +T  DDS  + E+ 
Sbjct  678   AVVNEEKEALTELDIE-----------------KKLDDDYVNDFRYKTMYDDSIIYTEVP  720

Query  552   LDDEEEFTKAVKSLDDRSFDLYVAGRGRGVSSALTSGLADWCECPELGAVGD  397
             +   +E    ++ + +   +LY+ GRG+G ++ LT GL +W +C ELGA+GD
Sbjct  721   VSSADEIITTMRRMHN-GCELYIVGRGQGAATQLTMGLLEWSDCEELGALGD  771



>emb|CDY71641.1| BnaCnng73770D, partial [Brassica napus]
Length=570

 Score =   423 bits (1088),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 244/552 (44%), Positives = 349/552 (63%), Gaps = 31/552 (6%)
 Frame = -3

Query  1968  RPLLNWLISKTPEGQGFSEFYICSFIAVICAFGCFTDAMGSHPMIGAFIFGLIMPNNELL  1789
             RP ++ +I KTPEG+ FSEFYIC  +  +   G  TD++G+H + GAF+FGL++PN  L 
Sbjct  10    RPGISRIIRKTPEGENFSEFYICLILTGVMICGFITDSIGTHSVFGAFVFGLVIPNGPLG  69

Query  1788  RTAILDRLEDFVMGILMPVFFLVCGLRTNIFTITDGDTSIFTALALILLACSAKIIAALV  1609
              T ++++LEDFV G+L+P+FF + GL+TN+  I  G  +  T   +I LAC+ K+I  +V
Sbjct  70    LT-LIEKLEDFVSGLLLPLFFAISGLKTNVAAI-QGPATWVTLFLVIFLACTGKVIGTVV  127

Query  1608  ASCYTGMSTNEAIGLGVLTNTKSTMVMIILEVGqvqqvlsvqqysmmvVACLIMTIVATP  1429
              + + GM   E I LG+L NTK  + MI+L VG+ Q+VL  + ++ MV+  L+MT V TP
Sbjct  128   VAFFHGMPVREGITLGLLLNTKGLVEMIVLNVGKDQKVLDDETFATMVLIALVMTGVITP  187

Query  1428  LA-ARYCPKQDLEPYKRRTIQNAKPGEELRILACIHGTNNLPAIISLLETSNSTVTSPIT  1252
             +    Y P +    YKRRTIQ  KP  ELR+L C+H   N+P II+LLE S+ T  SPI 
Sbjct  188   IVTVLYKPVKRSVSYKRRTIQQTKPDSELRVLVCVHTPRNVPTIINLLEASHPTKRSPIC  247

Query  1251  AFGVQLLELVGRAPAMMvvhssgsgrhvggsHEEVQTSQIISTFDNYELRSHGVTAQVLT  1072
              + + L+EL GRA AM++VH++        +  + Q+  II+ F+NYE  +  V  Q LT
Sbjct  248   IYVLHLVELTGRASAMLIVHNTRKSGKPALNRTQAQSDHIINAFENYEQHAAFVAVQALT  307

Query  1071  ARWSYDTMAEDICKMAKEKRAAFLVLPFHKQQGTDGEMEDTNPAIQTVNEGVLLSAPCSV  892
             A   Y TM ED+C +A+ KR +F+++PFHKQQ  DG ME TNPA + VN+ +L ++PCSV
Sbjct  308   AISPYSTMHEDVCSLAENKRVSFIIIPFHKQQTVDGGMEATNPAYRLVNQNLLGNSPCSV  367

Query  891   GILVERG-------RPNQYAKNIAVLYLGGPDDREALTYARRMSGLPGVHLTVIRFVPAK  733
             GILV+RG         N  +  +AVL+ GGPDDREAL YA RM+  P + LTV+RF+P +
Sbjct  368   GILVDRGLNGATRLTSNTISLQVAVLFFGGPDDREALAYAWRMAEHPWISLTVLRFIPDE  427

Query  732   DVSADGAVEDPDLELELTRETSFVTVSIDPARDKEEDEELLNNFRTETAEDDSKTFMELV  553
             DV+   +          TR T+          +   +   +N FR   AE ++  +++ V
Sbjct  428   DVTDAAS----------TRATN----------ETNRNMNYVNTFRAANAEYETIVYIDKV  467

Query  552   LDDEEEFTKAVKSLDDRSFDLYVAGRGRGVSSALTSGLADWCECPELGAVGDllvtsefe  373
             + + EE   AV+S+D  S DL++ GR  G+ S LT+GL DW ECPELGA+GDLL +S+F 
Sbjct  468   VSNGEETVAAVRSMDS-SHDLFIVGRREGMLSPLTAGLTDWSECPELGAIGDLLASSDFA  526

Query  372   ssfsvlvVQQYV  337
             ++ SVLVVQQYV
Sbjct  527   ATVSVLVVQQYV  538



>emb|CDY62191.1| BnaCnng39530D [Brassica napus]
Length=846

 Score =   431 bits (1107),  Expect = 7e-132, Method: Compositional matrix adjust.
 Identities = 279/802 (35%), Positives = 436/802 (54%), Gaps = 44/802 (5%)
 Frame = -3

Query  2673  RLGQVVMCFSQTIY----RSNGVWEGPDPLAPMIPLFILQIMTAILSSRILNFVLKPFNQ  2506
             R G+V +C+S T        NG WE   P+    P FI Q++ A    R++ ++ +P + 
Sbjct  16    RYGKV-LCYSHTDLIAEEHHNG-WESAKPIHAAFPFFIKQLLVANFVYRVIYYMTRPLHL  73

Query  2505  PPLVAEILSGIILGPSMLGNIEEFRKHNFPNHNFETIETMGHFALVLYAFLTGLQMDVKA  2326
             PP VA+IL G++  P++LG  +   K  FP      +ET  + ALV   FL GL MD+K 
Sbjct  74    PPFVAQILCGLLFSPTLLGENDTVLKDIFPYRYTMVLETFANLALVYNIFLLGLGMDLKM  133

Query  2325  IVHTGTKSRIVAVSGSIFPFLIGAGFYFTLQTDTQSMI--GFIFCGSALTVTGFSTLAKI  2152
             I     K  ++A+ G +   L G+G Y+         I  G ++   AL+ T F  LA+I
Sbjct  134   IKIKQRKPIVIAIVGLVVALLTGSGLYYLPGNGDADKIFSGCLYWSVALSCTNFPDLARI  193

Query  2151  LDSKRLLNTEIGKIAASSALINVALSWVLLTIGLLFTG----SLDNVQWAvlctvgfvvv  1984
             L   +LL +++G+ A S+++I    +WVLL +GL+       S D + +A++ T+GFV  
Sbjct  194   LADLKLLRSDMGRTAMSASIITDLCTWVLLLLGLVMFNKQGVSNDMMLFALVSTIGFVFF  253

Query  1983  cvnyVRPLLNWLISKTPEGQGFSEFYICSFIAVICAFGCFTDAMGSHPMIGAFIFGLIMP  1804
             C+  +RP + W  + T +G    E ++   +  +      T+A G   + GAF+FGL +P
Sbjct  254   CIYVIRPGVAWAFANTVKGGHVGENHVWFTLVGVIFCSLITEAFGVTSIPGAFLFGLSVP  313

Query  1803  NNELLRTAILDRLEDFVMGILMPVFFLVCGLRTNIFTITDGDTSIFTALALILLACSAKI  1624
             ++ ++R  I ++L D++ GILMP+F+++CGLR N+  ++  +TS  T + +I      KI
Sbjct  314   HDHIIRDMIEEKLHDYLSGILMPLFYIICGLRLNLGYLST-NTSAGTLVFVISSCFMVKI  372

Query  1623  IAALVASCYTGMSTNEAIGLGVLTNTKSTMVMIILEVGqvqqvlsvqqysmmvVACLIMT  1444
             ++ ++ S +  M   +   +G L NTK TM ++IL  G+  + L V  Y+ M VA L+M+
Sbjct  373   LSTVICSLFLRMPLRDGFAVGALMNTKGTMALVILNAGRDSKALDVIMYTHMTVAFLVMS  432

Query  1443  IVATPLAA-RYCPKQDLEPYKRRTIQNAKPGEELRILACIHGTNNLPAIISLLETSNSTV  1267
             I+  PL    Y PK+    YK RT+Q  +   E R+L C H   N+  + SLL+ SN T 
Sbjct  433   ILVQPLLTLTYTPKKKYSFYKYRTVQKLQGEVEFRVLTCAHVLANVSGLTSLLQVSNPTK  492

Query  1266  TSPITAFGVQLLELVGRAPA-MMvvhssgsgrhvggsHEEVQTSQIISTFDNYELRSHGV  1090
              SPI  F + L+EL GR  A +++++     +         ++ QI   F++ E+ +  +
Sbjct  493   RSPINVFAIHLVELTGRTTASLLIMNDETKPKANFSDRVRAESEQIAEMFEDIEVNNDAM  552

Query  1089  TAQVLTARWSYDTMAEDICKMAKEKRAAFLVLPFHKQQGTDGEMEDTNPAIQTVNEGVLL  910
               Q LTA   Y TM EDIC +A++KRA+ ++LP+HK   +DG + + N A + +N  VL 
Sbjct  553   LVQTLTAVSPYATMHEDICSLAEDKRASLILLPYHKNLTSDGRLGEGNDAHENINHNVLS  612

Query  909   SAPCSVGILVERG-----------RPNQYAKNIAVLYLGGPDDREALTYARRMSGLPGVH  763
              APCSVGILV+RG                 K IA+L++GG DDREAL YA RM G   + 
Sbjct  613   DAPCSVGILVDRGMTIIRSESSSFHGEATDKEIAMLFIGGRDDREALAYAWRMVGQEMIK  672

Query  762   LTVIRFVPAKDVSADGAVEDPDLELELTRETSFVTVSIDPARDKEEDEELLNNFRTETAE  583
             LTV+RFVP+++       E                 + +  ++ + DEE +  F  +T  
Sbjct  673   LTVVRFVPSREALFAAGEE-----------------AAEYVKEAQVDEEYIYQFNFKTMN  715

Query  582   DDSKTFMELVLDDEEEFTKAVKSLDD-RSFDLYVAGRGRGVSSALTSGLADWCECPELGA  406
             D S T+ E V+ D  E   A++ ++D  SFDLY+ GRG  V + +T GL DW   P+LG 
Sbjct  716   DSSVTYTEKVVIDGPETIAAIREMEDNHSFDLYIVGRGYKVETPVTVGLTDWNTSPDLGV  775

Query  405   VGDllvtsefessfsvlvVQQY  340
             +GD L +S F    SVLV+QQ+
Sbjct  776   IGDTLASSNFTMQGSVLVIQQF  797



>ref|XP_008800286.1| PREDICTED: cation/H(+) antiporter 19-like [Phoenix dactylifera]
Length=816

 Score =   429 bits (1104),  Expect = 8e-132, Method: Compositional matrix adjust.
 Identities = 267/761 (35%), Positives = 425/761 (56%), Gaps = 39/761 (5%)
 Frame = -3

Query  2628  SNGVWEGPDPLAPMIPLFILQIMTAILSSRILNFVLKPFNQPPLVAEILSGIILGPSMLG  2449
             SNG W+G +PL   +PL I+QI   I+ +R L F+L+P  QP ++AEI+ GI+LGPS LG
Sbjct  18    SNGSWQGENPLEASLPLAIVQICLVIVVTRSLAFLLRPLRQPRVIAEIIGGILLGPSALG  77

Query  2448  NIEEFRKHNFPNHNFETIETMGHFALVLYAFLTGLQMDVKAIVHTGTKSRIVAVSGSIFP  2269
               E+F +  FP  +   ++T+ +  L+ + FL GL++D++AI  TG ++ I+A++G   P
Sbjct  78    RSEKFLETFFPKQSLTVLDTLANIGLLYFLFLVGLELDLRAIRRTGKRALIIAIAGISLP  137

Query  2268  FLIGAGFYFTLQTDTQSMIG----FIFCGSALTVTGFSTLAKILDSKRLLNTEIGKIAAS  2101
             F++G G  F L+T     +      +F G AL++T F  LA+IL   +LL T++G++A S
Sbjct  138   FIMGIGTSFALRTTIAKGVAEAPFLVFMGVALSITAFPVLARILAELKLLTTDLGRMAMS  197

Query  2100  SALINVALSWVLLTIGLLFT--GSLDNVQWAvlctvgfvvvcvnyVRPLLNWLISKTPEG  1927
             +A +N   +W+LL + +  +  GS+    W +L    FVV     +RP L W+  ++PEG
Sbjct  198   AAAVNDVAAWILLALAIALSGAGSMLVSLWVLLSGAVFVVAAALLLRPALEWMARRSPEG  257

Query  1926  QGFSEFYICSFIAVICAFGCFTDAMGSHPMIGAFIFGLIMPNNELLRTAILDRLEDFVMG  1747
             +   E YIC+ +  + A G  TD +G H + GAF+ G+++P        ++++LED + G
Sbjct  258   EPVKELYICATLVSVLACGFITDTIGIHALFGAFVVGIVVPKEGPFAGVLIEKLEDLISG  317

Query  1746  ILMPVFFLVCGLRTNIFTITDGDTSIFTALALILLACSAKIIAALVASCYTGMSTNEAIG  1567
             + +P++F+  GL+TN+ TI  G +     L +I  AC  KI   ++ S    +   EA+ 
Sbjct  318   LFLPLYFVSSGLKTNVATIKGGQSWGLLVL-VITTACLGKIGGTVITSLLVKVPVREALT  376

Query  1566  LGVLTNTKSTMVMIILEVGqvqqvlsvqqysmmvVACLIMTIVATPLA-ARYCP-KQDLE  1393
             LG L NTK  + +I+L +G+ ++VL+ + ++++V+  L+ T + TP+  A + P ++   
Sbjct  377   LGFLMNTKGLVELIVLNIGKDRKVLNDETFAILVLMALVTTFITTPVVMAIFKPARRAAT  436

Query  1392  PYKRRTIQNAKPGEELRILACIHGTNNLPAIISLLETSNSTVTSPITAFGVQLLELVGRA  1213
             PYK RTIQ   P  E R+LAC HG+ N+P +I+L+E+S  T    +T + + L+EL  R+
Sbjct  437   PYKHRTIQRNDPDSEFRVLACFHGSRNVPTMINLVESSRGTRKHRLTVYAMHLMELSERS  496

Query  1212  PAMMvvhssgsgrhvggsHEEVQTSQIISTFDNYELRSHGVTAQVLTARWSYDTMAEDIC  1033
              A+ +VH +        + +      +   F  Y+  S+ VT + +TA     +M EDI 
Sbjct  497   SAISMVHKARLNGLPFWNRKH-NGDHLEVAFQAYQQLSN-VTIRPMTAISDLYSMHEDII  554

Query  1032  KMAKEKRAAFLVLPFHKQQGTDGEMEDTNPAIQTVNEGVLLSAPCSVGILVERGR-----  868
               A++KRAA +VLPFHK Q  DG M+      Q VN+ VL  APCSVG+LV+RG      
Sbjct  555   SSAEQKRAALVVLPFHKIQQFDGSMDSVGHGYQLVNQRVLRHAPCSVGVLVDRGLGGSTQ  614

Query  867   --PNQYAKNIAVLYLGGPDDREALTYARRMSGLPGVHLTVIRFVPAKDVSADGAVEDPDL  694
                ++ +  +AVLY GG DDREAL Y  RM+  PG+ LTV++FVP            P  
Sbjct  615   VCASEVSYTVAVLYFGGGDDREALAYGARMAEHPGIELTVMQFVP----QPGQHFVKPSS  670

Query  693   ELELTRETSFVTVSIDPARDKEEDEELLNNFRTET--AEDDSKTFMELVLDDEEEFTKAV  520
             E  + R T         A ++  DE  +  F+ +   A    K   ++V   + E   A+
Sbjct  671   EGSMGRATD--------ASERLADETCITEFQAKVMGANKSVKYEEKVVGGGKMEIVAAI  722

Query  519   KSLDDRSFDLYVAGRGRGVSSALTSGLADWCECPELGAVGD  397
             K++    F+L++ G    V       L D  +CPELG VG 
Sbjct  723   KAMGK--FNLFLVGHAPRVMP-----LTDRTDCPELGPVGS  756



>ref|XP_010932717.1| PREDICTED: cation/H(+) antiporter 15-like [Elaeis guineensis]
Length=809

 Score =   427 bits (1097),  Expect = 7e-131, Method: Compositional matrix adjust.
 Identities = 263/754 (35%), Positives = 437/754 (58%), Gaps = 37/754 (5%)
 Frame = -3

Query  2589  MIPLFILQIMTAILSSRILNFVLKPFNQPPLVAEILSGIILGPSMLGNIEEFRKHNFPNH  2410
             M+P +++Q++  I++ + + F+LKP +QP +VAEILSG++LGPS+LG          P  
Sbjct  30    MLPAYLVQLVVVIVTIQTVEFLLKPLHQPRIVAEILSGVLLGPSVLGYFFPNVHRLPPEQ  89

Query  2409  NFETIETMGHFALVLYAFLTGLQMDVKAIVHTGTKSRIVAVSGSIFPFLIGAGFYFTL--  2236
             N+  + T+G+FAL+ Y F+ GL++DV A+     K+  +AV+G   PF++ +   + L  
Sbjct  90    NYFILSTVGNFALLFYVFMVGLELDVNALRELRKKALTLAVAGMALPFVVSSAATYLLDL  149

Query  2235  -----QTDTQSMIGFIFCGSALTVTGFSTLAKILDSKRLLNTEIGKIAASSALINVALSW  2071
                  +   + ++ +IF G  ++++GF  LA+++   +LLN+ +G +A +S++I+  LS+
Sbjct  150   HSLLSRKTVKPVVFYIFFGITVSISGFPVLARMITELKLLNSSVGPVAMASSIISSMLSF  209

Query  2070  VLLTIGLLF------TGSLDNVQWAvlctvgfvvvcvnyVRPLLNWLISKTPEG-QGFSE  1912
             +LL I L F        SL+   WA+L + GF++ C   VRP + W++ +  EG +  SE
Sbjct  210   MLLAICLAFGVRLDQEASLEAAVWAILSSAGFLIGCFFVVRPAVRWMLGRRAEGDERGSE  269

Query  1911  FYICSFIAVICAFGCFTDAMGSHPMIGAFIFGLIMPNNELLRTAILDRLEDFVMGILMPV  1732
               +   +A   A G   D +G + + GAF +GL +PN  L  TA++ RLE F++ ++MP+
Sbjct  270   MEMGVLLAGAAAAGFIADVIGMNWVFGAFAYGLAIPNGPL-ATALIQRLELFMVHLMMPL  328

Query  1731  FFLVCGLRTNIFTITDGDTSIFTALALILLACSAKIIAALVASCYTGMSTNEAIGLGVLT  1552
             FF   GL  N+ TI     +I   +A+  +    K++  ++A+    +  +E++ LG L 
Sbjct  329   FFFCSGLVANLQTILSPPGAI-RLVAVFAVTVLVKVLGTVLAAYRYSIPLHESLTLGFLA  387

Query  1551  NTKSTMVMIILEVGqvqqvlsvqqysmmvVACLIMTIVATPLAA-RYCPKQDLEPYKRRT  1375
               K  + +IIL+VG+  +++    +++M VA  + T V  PL    Y P + L  ++RR 
Sbjct  388   IAKGPLHLIILKVGKDAKIVLNDFFTVMTVASALATAVVAPLVTWTYKPTRPLIGHRRRQ  447

Query  1374  IQNAKPGEELRILACIHGTNNLPAIISLLETSNSTVTSPITAFGVQLLELVGRAPAMMvv  1195
             ++ ++P  ELR++AC+H T ++ +I  LL+ SN T  SPI    + L+EL GRA AM+++
Sbjct  448   LERSRPDAELRMVACVHSTRHVHSITRLLDFSNPTKRSPIFVCALHLVELTGRASAMLIM  507

Query  1194  hssgsgrh----vggsHEEVQTSQIISTFDNYELRSHGVTAQVLTARWSYDTMAEDICKM  1027
             H               H + Q+  II+ F +YE  + GV+ Q LTA  S +TM ED+C +
Sbjct  508   HHGAGADQNRGDKAHPHGQAQSESIIAAFHSYEQHAAGVSIQTLTAFSSPNTMHEDVCSL  567

Query  1026  AKEKRAAFLVLPFHKQQGTDGEMEDTNPAIQTVNEGVLLSAPCSVGILVER--GRPNQYA  853
             A+E+RA+ +VLPFHK    DG++ + +P ++TVN+ +L   PCSV + V+R  G   ++ 
Sbjct  568   AEERRASLIVLPFHKHPTADGQLVEGSPNVRTVNQNILSDPPCSVALFVDRSPGGARRFC  627

Query  852   --KNIAVLYLGGPDDREALTYARRMSGLPGVHLTVIRFVPAKDVSADGAVEDPDLELELT  679
                ++A  +  GPDDREAL YA RM+  P V+LTV+RFV      +   + D   E  L 
Sbjct  628   AHHSVAAFFFSGPDDREALAYAARMAEHPAVNLTVVRFVEGATSLSTTPLHDSSEEETLE  687

Query  678   RETSFVTVSIDPARDKEEDEELLNNFRTETAEDDSKTFMELVLDDEEEFTKAVKSLDDRS  499
             R+             +  D+E+LN FR     +++  + E V+ + E+    V+S++   
Sbjct  688   RDA-----------QRMRDDEMLNEFRLRFVSNETVLYTEKVVSNSEDTVAVVRSMEA-V  735

Query  498   FDLYVAGRGRGVSSALTSGLADWCECPELGAVGD  397
             +DLYV GRGR V+S LT+GL +W ECPELG +GD
Sbjct  736   YDLYVVGRGRRVASPLTAGLEEWTECPELGPIGD  769



>ref|XP_007213157.1| hypothetical protein PRUPE_ppa025261mg [Prunus persica]
 gb|EMJ14356.1| hypothetical protein PRUPE_ppa025261mg [Prunus persica]
Length=831

 Score =   427 bits (1098),  Expect = 8e-131, Method: Compositional matrix adjust.
 Identities = 272/788 (35%), Positives = 439/788 (56%), Gaps = 43/788 (5%)
 Frame = -3

Query  2655  MCFSQTIYRSNGVWEGPDPLAPMIPLFILQIMTAILSSRILNFVLKPFNQPPLVAEILSG  2476
             +C+++TI    G+W+  +PL   +PLF  Q+   +     L  +L P +QP +VA  + G
Sbjct  19    VCYNKTITHVTGMWKAENPLLSTLPLFFTQLGLIMFICHFLKLLLAPLHQPRIVAYTIGG  78

Query  2475  IILGPSMLGNIEEFRKHNFPNHNFETIETMGHFALVLYAFLTGLQMDVKAIVHTGTKSRI  2296
             IILGPS +   +  RK+ FP  +  TIETM +  L+ Y FL GL++D K I+    K   
Sbjct  79    IILGPSFILKTQFSRKYLFPVKSTLTIETMANLGLIYYMFLQGLEVDFKPILQARKKVWS  138

Query  2295  VAVSGSIFPFLIGAGFYFTLQTDTQSM----IGFIFCGSALTVTGFSTLAKILDSKRLLN  2128
             +A +G + P  +G   + TL  ++  +     G  F G+ L  T FS LA +L   +LL 
Sbjct  139   IATAGILVPLPLGYLLHKTLTPNSHPLKATTYGPFFWGTTLATTNFSELALVLADAKLLY  198

Query  2127  TEIGKIAASSALINVALSWVLLTIGLLFTGSLDNVQWAvlctvgfvvvcvnyVRPLLNWL  1948
             +++G+ A S ++IN  +SWVLL I +      D   + +L T   ++ CV  +RP+L W+
Sbjct  199   SDVGRTALSVSVINDLVSWVLLLITVAIVS--DGKLYTLLSTFTLIIFCVYGLRPVLPWM  256

Query  1947  ISKTPEGQGFSEFY-----ICSFIAVICAFGCFTDAMGSHPMIGAFIFGLIMPNNELLRT  1783
             +  T     F+E Y     IC  +A +  FG  +DA GSH ++GAF+ G I+P  E L+T
Sbjct  257   VCNT---SFFNEKYDMDNQICFIMAGVLLFGFISDAFGSHSILGAFMLGAILPKGE-LKT  312

Query  1782  AILDRLEDFVMGILMPVFFLVCGLRTNIFTITDGDTSIFTALALILLACSAKIIAALVAS  1603
              I +++EDFV  +L+P+FFL+ G+RT++  +     S+   +++I+LA  AK + + VA+
Sbjct  313   VITEKVEDFVSKVLLPLFFLIVGMRTHV-DVVFRSASLLIVMSIIVLAFLAKFVVSSVAA  371

Query  1602  CYTGMSTNEAIGLGVLTNTKSTMVMIILEVGqvqqvlsvqqysmmvVACLIMTIVATP-L  1426
                 M   +++  G++ N K  +  IIL  G+   VL    +S+M++A +IMT    P L
Sbjct  372   IVNKMPVRDSLAFGLVMNAKGLLATIILNSGRDLHVLDHNTFSVMILAIVIMTAAVGPIL  431

Query  1425  AARYCPKQDLEPYKRRTIQNAKPGEELRILACIHGTNNLPAIISLLETSNSTVTSPITAF  1246
             A  Y      + +  R+I++ +P  E RIL CI+ T+N+ ++I+LLE SN T  SP+  F
Sbjct  432   ALIYKSNGPSKQHTHRSIRSIQPNSEFRILICIYSTSNVSSVINLLEISNPTKQSPMFVF  491

Query  1245  GVQLLELVGRAPAMMvvhss------gsgrhvggsHEEVQTSQIISTFDNYELRSH--GV  1090
              V L+EL G A AM++VH +       +            ++QI++ F+  E  S    +
Sbjct  492   AVHLVELSGHASAMLIVHDTCSNIRNTAEITAKNQKHSSPSNQIVAAFEKLETESEEGSL  551

Query  1089  TAQVLTARWSYDTMAEDICKMAKEKRAAFLVLPFHKQQGTDGEMEDTNPAIQTVNEGVLL  910
             + + LTA  SY +M EDIC +A +K A  +++PFHKQ   DG M++ N + + VN+ +L 
Sbjct  552   SVEALTAVSSYTSMHEDICNLADDKSADLIIIPFHKQSTIDGGMDNGNCSFRGVNKNLLE  611

Query  909   SAPCSVGILVERG--RPNQYAKN-------IAVLYLGGPDDREALTYARRM----SGLPG  769
             +A CSV I V+RG   P+    +        A+L++GGPDDREAL YA RM    S  P 
Sbjct  612   NASCSVAIFVDRGLTDPSNIKNDDGHGCCRCAMLFIGGPDDREALAYAWRMASNPSPNPN  671

Query  768   VHLTVIRFVPAKDVSADGAVEDPD----LELELTRETSFVTVSIDPARDKEEDEELLNNF  601
             + LTV+RF+  KD S D  +   +     +     + + + V  +  ++K+ D++ + +F
Sbjct  672   ISLTVVRFIIGKDASVDSDLRPNNPNNDHDDHEDEDKNILEVIEENEKEKQLDDQYIESF  731

Query  600   RTETAEDDSKTFMELVLDDEEEFTKAVKSLDDRSFDLYVAGRGRGVSSALTSGLADWCEC  421
                T    S   +  V+++ EE  K + ++ +  +DLY+ GRG+  SS LT GL++W +C
Sbjct  732   VFNTRNQPSIRLINEVVNNVEETLKLISAMGN-DYDLYIVGRGQTGSSPLTFGLSEWGDC  790

Query  420   PELGAVGD  397
             PELG +GD
Sbjct  791   PELGPLGD  798



>ref|XP_010043343.1| PREDICTED: cation/H(+) antiporter 19 [Eucalyptus grandis]
Length=799

 Score =   426 bits (1095),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 278/794 (35%), Positives = 441/794 (56%), Gaps = 51/794 (6%)
 Frame = -3

Query  2667  GQVVMCFSQTIYRSNGVWEGPDPLAPMIPLFILQIMTAILSSRILNFVLKPFNQPPLVAE  2488
             G   +C       SNG ++G  PL   +PL ILQI   +  +R+L  +L+P  QP ++AE
Sbjct  3     GNATVCPKPMKATSNGSFQGDSPLDYALPLVILQICLVVAFTRLLALILRPLRQPRVIAE  62

Query  2487  ILSGIILGPSMLGNIEEFRKHNFPNHNFETIETMGHFALVLYAFLTGLQMDVKAIVHTGT  2308
             I+ GI+LGPS LG  E+F    FP  +   ++T+ +  L+ + FL GL++D+ +I  TG 
Sbjct  63    IIGGILLGPSALGRSEKFLHAVFPTQSLTVLDTLANIGLLYFLFLVGLELDISSIKRTGK  122

Query  2307  KSRIVAVSGSIFPFLIGAGFYFTLQTDTQSMIG----FIFCGSALTVTGFSTLAKILDSK  2140
             K+  +A++G   PF++G G    L++     +      +F G AL++T F  LA+IL   
Sbjct  123   KALAIALAGISLPFILGIGTSVVLRSTISKGVSQGPFLVFMGVALSITAFPVLARILAEL  182

Query  2139  RLLNTEIGKIAASSALINVALSWVLLTIGLLFTGSLDN---VQWAvlctvgfvvvcvnyV  1969
             +LL T++G+IA S+A +N   +W+LL + +  +GS  +     W +LC V FV++ +  +
Sbjct  183   KLLTTDVGRIAMSAAAVNDVAAWILLALAIALSGSNTSPLVSLWVLLCGVAFVLLAIFAL  242

Query  1968  RPLLNWLISKTPEGQGFSEFYICSFIAVICAFGCFTDAMGSHPMIGAFIFGLIMPNNELL  1789
              P L W+  ++PEG+   E YIC  ++++ A G  TD +G H + GAF+ G++MP +   
Sbjct  243   NPALAWMARRSPEGEPVKELYICITLSLVLAAGFVTDTIGIHALFGAFVVGIVMPKDGPF  302

Query  1788  RTAILDRLEDFVMGILMPVFFLVCGLRTNIFTITDGDTSIFTALALILLACSAKIIAALV  1609
                +++++ED V G+L+P++F+  GL+TN+ TI  G  S    + +I  AC  KI+  L 
Sbjct  303   AGVLIEKIEDLVSGLLLPLYFVSSGLKTNVATI-QGAQSWGLLVLVIFTACFGKIVGTLS  361

Query  1608  ASCYTGMSTNEAIGLGVLTNTKSTMVMIILEVGqvqqvlsvqqysmmvVACLIMTIVATP  1429
              S    +   EA+ LG L NTK  + +I+L +G+ ++VL+ Q ++++V+  L  T + TP
Sbjct  362   VSMLCKVPFKEALTLGFLMNTKGLVELIVLNIGKDRKVLNDQTFAVLVLMALFTTFITTP  421

Query  1428  LA-ARYCPKQDLEPYKRRTIQNAKPGEELRILACIHGTNNLPAIISLLETSNSTVT-SPI  1255
             +  A Y P +   PYK RTI+      ELR+L C H T N+P +I+L+E+S  T     +
Sbjct  422   VVTAVYKPARRGVPYKHRTIRRKDLDTELRLLVCFHSTRNIPTMINLIESSRGTRKRGRL  481

Query  1254  TAFGVQLLELVGRAPAMMvvhssgsgrhvggsHEEVQTSQIISTFDNYELRSHGVTAQVL  1075
             + + + L+EL  R+ A+ +VH +        +       Q++  F+ Y+  S  VT + +
Sbjct  482   SVYAMHLMELSERSSAISMVHKARRNGLPFWNKVREDQDQMVIAFEAYQQLS-SVTVRPM  540

Query  1074  TARWSYDTMAEDICKMAKEKRAAFLVLPFHKQQGTDGEMEDTNPAIQTVNEGVLLSAPCS  895
             TA     T+ EDIC  A +KR+A ++LPFHK Q  DG ME    + Q VN+ VL  APCS
Sbjct  541   TAISPLSTIHEDICTSAHQKRSAMILLPFHKHQRLDGVMESLGHSFQVVNQRVLRYAPCS  600

Query  894   VGILVERG-------RPNQYAKNIAVLYLGGPDDREALTYARRMSGLPGVHLTVIRFV--  742
             VGILV+RG         +  +  IAV + GGPDD EALT+  RM+  PG+ L+V++FV  
Sbjct  601   VGILVDRGLGGTTQVSASDVSYTIAVPFFGGPDDHEALTFGVRMAEHPGIVLSVVKFVFP  660

Query  741   PAKDVSADGAVEDPDLELELTRETSFVTVSIDPARDKEEDEELLNNFRTETAEDDSKTFM  562
             P   V+A  + ED D                          +LL+     T +++S T+ 
Sbjct  661   PGTAVAAQESSEDDD-----------------------SPNDLLD---VTTGKNESITYE  694

Query  561   ELVLDDEEEFTKAVKSLDDRSFDLYVAGRGRGVSSALTSGLADWCECPELGAVGDllvts  382
             E  +  +E+   A+KS+     +L++ GR    +  L    +D   CPELG VG  L +S
Sbjct  695   ERTVGTKEDIVAALKSMS--RCNLFIVGRTPSTAPVLVDRTSD---CPELGHVGGYLASS  749

Query  381   efessfsvlvVQQY  340
              F ++ SVLVVQQY
Sbjct  750   GFSTTASVLVVQQY  763



>gb|KFK31171.1| hypothetical protein AALP_AA6G078200 [Arabis alpina]
Length=841

 Score =   426 bits (1094),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 278/829 (34%), Positives = 450/829 (54%), Gaps = 58/829 (7%)
 Frame = -3

Query  2718  AAPPPPSTGPEVDLDRLGQVVMCFSQTIYRSNG---VWEGPDPLAPMIPLFILQIMTAIL  2548
              AP P     E+ L R G+++ C++QT    +G    WE    LA  +P+FI QI+ A L
Sbjct  3     GAPEPEFY--EISLSRYGKII-CYNQTALLVSGDHKGWENASSLADALPIFIGQILVANL  59

Query  2547  SSRILNFVLKPFNQPPLVAEILSGIILGPSMLGNIEEFRKHNFPNHNFETIETMGHFALV  2368
             + R+  ++ +P   PP VA++LSG++  P+ LG  +    +  P      +ET  + AL+
Sbjct  60    TYRVFYYMTRPLYLPPFVAQLLSGLLFSPTFLGRTKFILNYVLPFRFNLVLETFANLALI  119

Query  2367  LYAFLTGLQMDVKAIVHTGTKSRIVAVSGSIFPFLIGAGFYFTLQT--DTQSMIGFIFCG  2194
                FL GL +D + I     K  I+A +G +   L G G ++        +++ G  +  
Sbjct  120   YNIFLLGLGIDFRMIRIKELKPVIIASAGLVVAILAGIGLFYIPGNGQSKKNLSGGFYWA  179

Query  2193  SALTVTGFSTLAKILDSKRLLNTEIGKIAASSALINVALSWVLLTIGLLF---TGSLDNV  2023
               L  T F  LA+IL   +LL T++G+ A  ++LI    +W LL  G       G+L +V
Sbjct  180   VTLGCTNFPDLARILADLKLLRTDMGRTAMCASLITDLCTWCLLLFGFATFSRAGALSDV  239

Query  2022  Q-WAvlctvgfvvvcvnyVRPLLNWLISKTPEGQGFSEFYICSFIAVICAFGCFTDAMGS  1846
               +    T+ F+++C   +RP + W  + T +G    E ++   +A +   G  TDA G 
Sbjct  240   MPYVFSSTLVFLLLCFYVIRPGIAWAFAHTVKGGQVGETHVWFTLAGVVLSGLITDACGI  299

Query  1845  HPMIGAFIFGLIMPNNELLRTAILDRLEDFVMGILMPVFFLVCGLRTNIFTITDGDTSIF  1666
               + GAF+FGL +P++ ++R+ I ++L DF+ GILMP+F+++CG+R ++  + +     +
Sbjct  300   SSIPGAFLFGLSIPHDHIIRSMIEEKLHDFLSGILMPLFYIICGVRVDLRFMLE-----Y  354

Query  1665  TALALILLACSA----KIIAALVASCYTGMSTNEAIGLGVLTNTKSTMVMIILEVGqvqq  1498
             T+  ++    S+    KII+ +V S +  +   + + +G L NTK T+ +++L  G  ++
Sbjct  355   TSYGMLAFVISSSFMVKIISTVVCSYFLRIPMRDGLAIGALMNTKGTLALVVLNTGLDKR  414

Query  1497  vlsvqqysmmvVACLIMTIVATPLAA-RYCPKQDLEPYKRRTIQNAKPGEELRILACIHG  1321
              L V  YS M +  L M+IV  PL A  Y PK+ L  YK RT+Q  K   ELR+L C+H 
Sbjct  415   ALDVPMYSHMTLVLLAMSIVGQPLLAFAYKPKKKLVFYKNRTVQKLKGEVELRVLTCVHV  474

Query  1320  TNNLPAIISLLETSNSTVTSPITAFGVQLLELVGRAP-AMMvvhssgsgrhvggsHEEVQ  1144
               N+  I SLL+ SN T  S +  F + L+EL GR   ++++++     +         +
Sbjct  475   LPNVSGITSLLQISNPTKKSALRVFAIHLVELTGRTTTSLLIMNDEAKSKSSFSDRIRAE  534

Query  1143  TSQIISTFDNYELRSHGVTAQVLTARWSYDTMAEDICKMAKEKRAAFLVLPFHKQQGTDG  964
             + QI   F+  E+ + GV  + +TA   Y T+ EDIC++A++KR +F++LP+HK   +DG
Sbjct  535   SEQIAERFEAMEVNNEGVMVETITAVSPYATIHEDICQLAEDKRVSFILLPYHKSLTSDG  594

Query  963   EMEDTNPAIQTVNEGVLLSAPCSVGILVERG------------RPNQYAKNIAVLYLGGP  820
              +++ N +   +N  VL  APCSVGILV+RG                  + +A+L++GG 
Sbjct  595   RLDEGNASYADINHEVLGHAPCSVGILVDRGMTLVPSETNSSFHGEHTKREVAMLFVGGR  654

Query  819   DDREALTYARRMSGLPGVHLTVIRFVPAKD--VSADGAVEDPDLELELTRETSFVTVSID  646
             DDREAL YA RMS    ++LTV+RF+P ++  ++A   V D + E ++            
Sbjct  655   DDREALAYAWRMSVQQNMNLTVVRFIPGREALIAARKTVADYEKETQV------------  702

Query  645   PARDKEEDEELLNNFRTETAEDDSKTFMELVLDDEEEFTKAVKSLDD-RSFDLYVAGRGR  469
                    DEE +  F   T ++ S T++E V++D +E   A++ +DD +SFDLY+ GRG 
Sbjct  703   -------DEESIYEFNFNTMDNSSVTYIENVVNDGQETIAAIREMDDNKSFDLYIVGRGY  755

Query  468   GVSSALTSGLADWCE-CPELGAVGDllvtsefessfsvlvVQQYVRTNK  325
              V S  T+GL DW    PELG +GD L +S F    SVLV+QQY   N+
Sbjct  756   KVESPATAGLTDWTSTTPELGTIGDTLASSNFTMQASVLVIQQYSAANR  804



>emb|CDY19122.1| BnaA04g18620D [Brassica napus]
Length=846

 Score =   422 bits (1086),  Expect = 6e-129, Method: Compositional matrix adjust.
 Identities = 275/812 (34%), Positives = 441/812 (54%), Gaps = 46/812 (6%)
 Frame = -3

Query  2700  STGPEVDLDRLGQVVMCFSQTIY----RSNGVWEGPDPLAPMIPLFILQIMTAILSSRIL  2533
             S+  ++   R G+VV C+S T        NG W+   P+    P FI Q++ A    R++
Sbjct  7     SSYYDLSTSRYGKVV-CYSHTDLIAEEHHNG-WDSAKPIHAAFPFFIKQLLVANFVYRVI  64

Query  2532  NFVLKPFNQPPLVAEILSGIILGPSMLGNIEEFRKHNFPNHNFETIETMGHFALVLYAFL  2353
              ++ +P + PP VA++L G++  P++LG      ++ FP      +ET  + ALV   FL
Sbjct  65    YYMSRPLHLPPFVAQLLCGLLFSPTLLGGEIFVLEYIFPYKYTMVLETFANLALVYNIFL  124

Query  2352  TGLQMDVKAIVHTGTKSRIVAVSGSIFPFLIGAGFYFTLQT--DTQSMIGFIFCGSALTV  2179
              GL MD+K I     K  ++A+ G +   L G   Y+      D + + G ++   AL+ 
Sbjct  125   LGLGMDLKMIKIKQRKPIVIAIVGLVVALLAGYALYYLHGNGDDDKIISGCLYWSVALSC  184

Query  2178  TGFSTLAKILDSKRLLNTEIGKIAASSALINVALSWVLLTIGLLFTG----SLDNVQWAv  2011
             T F  LA+IL   +LL +++G+ A S+++I    +WVLL +GL+       S D + +A+
Sbjct  185   TNFPDLARILADLKLLRSDMGRTAMSASIITDLCTWVLLLLGLVMFNKQGVSNDMMLFAL  244

Query  2010  lctvgfvvvcvnyVRPLLNWLISKTPEGQGFSEFYICSFIAVICAFGCFTDAMGSHPMIG  1831
             + T+GFV   +  +RP + W  + T +G    E ++   +  +      T+A+G   + G
Sbjct  245   VSTIGFVFFSIYVIRPGVAWAFANTVKGGHVGENHVWFTLVGVVFCSLITEAIGVTSIPG  304

Query  1830  AFIFGLIMPNNELLRTAILDRLEDFVMGILMPVFFLVCGLRTNIFTITDGDTSIFTALAL  1651
             AF+FGL +P++ ++R  I ++L D++ GILMP+F+++CGLR N+  +    T     L  
Sbjct  305   AFLFGLSIPHDHVIRDMIEEKLHDYLSGILMPLFYIICGLRLNLDYLLQNTT--VGVLVF  362

Query  1650  ILLAC-SAKIIAALVASCYTGMSTNEAIGLGVLTNTKSTMVMIILEVGqvqqvlsvqqys  1474
             ++ +C   KI++ ++ S +  M   +   +G L NTK TM ++IL  G+  + L V  Y+
Sbjct  363   VISSCFMVKILSTVICSLFLRMPLRDGFAVGALMNTKGTMALVILNAGRDSKALDVIMYT  422

Query  1473  mmvVACLIMTIVATPLAA-RYCPKQDLEPYKRRTIQNAKPGEELRILACIHGTNNLPAII  1297
              M V  L+M+I+  PL    Y PK+ +  YK RT+Q  +   E R+L C H   N+  + 
Sbjct  423   HMTVVFLVMSILVQPLLTLTYTPKKKMSFYKYRTVQKLQGEVEFRVLTCAHVLANVSGLT  482

Query  1296  SLLETSNSTVTSPITAFGVQLLELVGRAPA-MMvvhssgsgrhvggsHEEVQTSQIISTF  1120
             SLL+ SN T  SPI  F + L+EL GR  A +++++     +         ++ QI   F
Sbjct  483   SLLQVSNPTKRSPINVFAIHLVELTGRTTASLLIMNDETKPKANFSDRVRAESEQIAEMF  542

Query  1119  DNYELRSHGVTAQVLTARWSYDTMAEDICKMAKEKRAAFLVLPFHKQQGTDGEMEDTNPA  940
             ++ ++ +  +  Q LTA   Y TM EDIC +A++KRA+ ++LP+HK   +DG + + N A
Sbjct  543   EDMDVNNDAMLVQTLTAVSPYATMHEDICSLAEDKRASLILLPYHKNLTSDGRLGEGNDA  602

Query  939   IQTVNEGVLLSAPCSVGILVERG-----------RPNQYAKNIAVLYLGGPDDREALTYA  793
              + +N  VL  APCSVGILV+RG                 K IA+L++GG DDREAL YA
Sbjct  603   HEDINHNVLSYAPCSVGILVDRGMTVIRSESSSFHGETTDKEIAMLFIGGRDDREALAYA  662

Query  792   RRMSGLPGVHLTVIRFVPAKDVSADGAVEDPDLELELTRETSFVTVSIDPARDKEEDEEL  613
              RM G   + LTV+RFVP+++ +   A ED                + +  ++ + DEE 
Sbjct  663   WRMVGQEMIKLTVVRFVPSRE-ALFAAGED----------------AAEYVKEAQVDEEY  705

Query  612   LNNFRTETAEDDSKTFMELVLDDEEEFTKAVKSLDD-RSFDLYVAGRGRGVSSALTSGLA  436
             +  F  +T  D S T+ E V+ D  E   A++ ++D  SFDLY+ GRG  V + +T GL 
Sbjct  706   IYQFNFKTMNDSSVTYTEKVVVDGPETIAAIREMEDNHSFDLYIVGRGYKVETPVTVGLT  765

Query  435   DWCECPELGAVGDllvtsefessfsvlvVQQY  340
             DW   P+LG +GD L +S F    SVLV+QQ+
Sbjct  766   DWNTSPDLGVIGDTLASSNFTMQGSVLVIQQF  797



>gb|EMS63173.1| Cation/H(+) antiporter 15 [Triticum urartu]
Length=763

 Score =   420 bits (1079),  Expect = 9e-129, Method: Compositional matrix adjust.
 Identities = 241/605 (40%), Positives = 374/605 (62%), Gaps = 14/605 (2%)
 Frame = -3

Query  2658  VMCFSQTIYRSNGVWEGPDPLAPMIPLFILQIMTAILSSRILNFVLKPFNQPPLVAEILS  2479
             V+C+S     + G+WEG +PL   +P+FILQ    + ++R+L  +LKPF QP ++AEIL+
Sbjct  11    VVCYSPMKVTTYGIWEGVNPLEFSLPIFILQTAVIVGTTRLLVLLLKPFRQPRVIAEILA  70

Query  2478  GIILGPSMLGNIEEFRKHNFPNHNFETIETMGHFALVLYAFLTGLQMDVKAIVHTGTKSR  2299
             G+ILGPS++G +  +    FP  +  T+ET+ H  L+ + FL GL+MDV  I  +G K+ 
Sbjct  71    GVILGPSVMGQVGTWAATVFPGRSLLTLETVAHLGLLYFLFLVGLEMDVNVIKRSGKKAV  130

Query  2298  IVAVSGSIFPFLIGAGFYFTLQTDTQSMIG----FIFCGSALTVTGFSTLAKILDSKRLL  2131
             I+AV+G   PF IG    F  +      +      +F G AL+VT F  LA+IL   +LL
Sbjct  131   IIAVAGMALPFCIGTATSFIFRHQVSKNVHQASFLLFLGVALSVTAFPVLARILAEIKLL  190

Query  2130  NTEIGKIAASSALINVALSWVLLTIGLLFT---GSLDNVQWAvlctvgfvvvcvnyVRPL  1960
             N+++GKIA S+A++N   +W+LL + +  +    +  +  + +L  V FV+ C   VRP+
Sbjct  191   NSDLGKIAMSAAIVNDMCAWILLALAIAISDVNSTPFSSLYVLLSGVAFVLACFYVVRPV  250

Query  1959  LNWLISKTPEGQGFSEFYICSFIAVICAFGCFTDAMGSHPMIGAFIFGLIMPNNELLRTA  1780
             + W++ + PEG+  S+  +   +  +   G  TDA+G H + GAF++GL++P+ E L   
Sbjct  251   MWWIVRRIPEGETISDVQVTLILTGVMISGVCTDAIGIHSVFGAFVYGLVIPSGE-LGVV  309

Query  1779  ILDRLEDFVMGILMPVFFLVCGLRTNIFTITDGDTSIFTALALILLACSAKIIAA-LVAS  1603
             ++++LEDFVMG+L+P+FF + GLRTN+  + D  T+    L  + +A  AKI+   L+A 
Sbjct  310   LIEKLEDFVMGLLLPLFFAISGLRTNVTRVRDPVTAGLLVLVFV-MASFAKIMGTILIAI  368

Query  1602  CYTGMSTNEAIGLGVLTNTKSTMVMIILEVGqvqqvlsvqqysmmvVACLIMTIVATPLA  1423
              YT M+  + + LG L NT+  + MI+L +G+ +QVL  + +++MV+  + MT + TP+ 
Sbjct  369   SYT-MTFRDGVALGFLMNTRGLVEMIVLNIGRDKQVLDDESFAVMVLVSVAMTALVTPVV  427

Query  1422  AR-YCPKQDLEPYKRRTIQNAKPGEELRILACIHGTNNLPAIISLLETSNSTVTSPITAF  1246
                Y P + L  YKRR +Q +K   ELR+LAC+H T N+P+IISLLE SN +  SP+  +
Sbjct  428   TTVYRPARRLVGYKRRNLQRSKHDAELRMLACVHTTRNVPSIISLLELSNPSKRSPLFIY  487

Query  1245  GVQLLELVGRAPAMMvvhssgsgrhvggsHEEVQTSQIISTFDNYELRSHGVTAQVLTAR  1066
              + L+EL GRA  M+  H + + ++   S     +  I + F+NYE    GV+ Q LTA 
Sbjct  488   ALHLVELTGRASNMLAAHHTAANQNRSASTS--ASEHIFNAFENYEESVAGVSVQALTAV  545

Query  1065  WSYDTMAEDICKMAKEKRAAFLVLPFHKQQGTDGEMEDTNPAIQTVNEGVLLSAPCSVGI  886
               Y TM ED+  +A++K  + +VLPFHKQQ  DG ME  +PA++  NE +L SAPCSVGI
Sbjct  546   SPYQTMHEDVSVLAEDKHVSLIVLPFHKQQTVDGGMEPIHPALKGFNESILNSAPCSVGI  605

Query  885   LVERG  871
             LV+RG
Sbjct  606   LVDRG  610


 Score = 72.4 bits (176),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 46/100 (46%), Positives = 68/100 (68%), Gaps = 2/100 (2%)
 Frame = -3

Query  636  DKEEDEELLNNFRTETAEDDSKTFMELVLDDEEEFTKAVKSLDDRSFDLYVAGRGRGV-S  460
            +++ DEE LN FR+    +++  ++E V+ + EE   A+++L + + +LY+ GR  G  S
Sbjct  622  ERQMDEEYLNEFRSRNVGNEAIVYVEQVVANSEETMAAIRNLGN-AHELYIVGRHPGEES  680

Query  459  SALTSGLADWCECPELGAVGDllvtsefessfsvlvVQQY  340
            S LTS L+DW E PELG +GDLLV+SEF    SVLV+QQY
Sbjct  681  SPLTSALSDWMESPELGPIGDLLVSSEFSKMVSVLVMQQY  720



>ref|XP_006654211.1| PREDICTED: cation/H(+) antiporter 19-like [Oryza brachyantha]
Length=786

 Score =   420 bits (1080),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 285/780 (37%), Positives = 437/780 (56%), Gaps = 48/780 (6%)
 Frame = -3

Query  2628  SNGVWEGPDPLAPMIPLFILQIMTAILSSRILNFVLKPFNQPPLVAEILSGIILGPSMLG  2449
             S+GV++G +PL   +PL ILQI   ++ +R+L F+L+P  QP ++AEI+ GI+LGPS +G
Sbjct  5     SDGVFQGENPLHSALPLAILQICIVVVLTRVLAFLLRPLRQPRVIAEIIGGILLGPSAIG  64

Query  2448  NIEEFRKHNFPNHNFETIETMGHFALVLYAFLTGLQMDVKAIVHTGTKSRIVAVSGSIFP  2269
                 F    FP  +   ++T+ +  L+ + FL GL++D++++  TG  +  +AV+G   P
Sbjct  65    RSSAFIDTVFPKQSLTVLDTLANIGLLFFLFLVGLELDLRSLRRTGAGALAIAVAGISLP  124

Query  2268  FLIGAGFYFTLQTDTQSMIG----FIFCGSALTVTGFSTLAKILDSKRLLNTEIGKIAAS  2101
             F++G    F LQ      +      +F G AL++T F  LA+IL   +LL T++G++A S
Sbjct  125   FVLGIATSFVLQNTVARGVPTGPFLVFMGVALSITAFPVLARILAELKLLTTDLGRMAMS  184

Query  2100  SALINVALSWVL--LTIGLLFTGSLDNVQWAvlctvgfvvvcvnyVRPLLNWLISKTPEG  1927
             +A +N   +W+L  L I L  TGS     W +L  VGFVV    ++RPLL W+  ++PEG
Sbjct  185   AAAVNDVAAWILLALAIALSGTGSPLVSLWVLLTGVGFVVSSFLFLRPLLAWMARRSPEG  244

Query  1926  QGFSEFYICSFIAVICAFGCFTDAMGSHPMIGAFIFGLIMPNNELLRTAILDRLEDFVMG  1747
             +   E YIC+ ++++ A G  TD +G H + GAFI G+I+P +      +L+++ED + G
Sbjct  245   EPVKEIYICATLSIVLAAGFVTDTIGIHALFGAFIVGIIVPKDGPFAGVLLEKVEDLISG  304

Query  1746  ILMPVFFLVCGLRTNIFTITDGDTSIFTALALILLACSAKIIAALVASCYTGMSTNEAIG  1567
             +L+P++F+  GL+TN+ TI  G++     L ++  AC  KI   ++AS    +   EA+ 
Sbjct  305   LLLPLYFVSSGLKTNVLTIKGGESWGLLVL-VVATACIGKIGGTVLASLIASVPLREAVT  363

Query  1566  LGVLTNTKSTMVMIILEVGqvqqvlsvqqysmmvVACLIMTIVATPLA-ARYCPKQDLEP  1390
             LGVL NTK  + +I+L +G+ + VL+ + ++++V+  LI T + TPL  A Y P +   P
Sbjct  364   LGVLMNTKGLVELIVLNIGKDRHVLNDETFAILVLMALINTFITTPLVMAIYKPARQGLP  423

Query  1389  YKRRTIQNAKPGEELRILACIHGTNNLPAIISLLETSNSTVTSPITAFGVQLLELVGRAP  1210
             YK R +Q A P +ELR++AC H T N+P +I+L+E+S  T    IT + + L+EL  R+ 
Sbjct  424   YKNRAVQRANPEDELRMMACFHSTRNIPTMINLMESSRGTRRRGITVYAMHLVELSERSS  483

Query  1209  AM-MvvhssgsgrhvggsHEEVQTSQIISTFDNYELRSHGVTAQVLTARWSYDTMAEDIC  1033
             A+ MV  +  +G             Q++  F  Y+  S  V+ + +TA     TM ED+ 
Sbjct  484   AIYMVHKARRNGMPFWNRRFNGDGDQLVVAFQTYQQLSR-VSIRAMTAISDLHTMHEDVV  542

Query  1032  KMAKEKRAAFLVLPFHKQQGTDGEMEDTNPAIQTVNEGVLLSAPCSVGILVERG------  871
               A +KRAA +VLPFHK    DG ME      Q +N+ V+  APCSV ILV+RG      
Sbjct  543   TSAHQKRAALIVLPFHKLHQMDGHMESMGDEYQHINQRVVRHAPCSVAILVDRGLGGAAQ  602

Query  870   -RPNQYAKNIAVLYLGGPDDREALTYARRMSGLPGVHLTVIRFVPAKDVSADGAVEDPDL  694
                +  + NIAVL+ GG DDREAL YA RM   PG+ L V+RFVP     A GA    D 
Sbjct  603   VAASDVSYNIAVLFFGGRDDREALAYATRMVEHPGIALHVLRFVPKP--GAAGADSGND-  659

Query  693   ELELTRETSFVTVSIDPARDKEEDEELLNNFRTETAE-DDSKTFMELVLDDEEEFTKAVK  517
                                    DE  L +FR   A+ +DS  + E     + +  +A+K
Sbjct  660   -------------------SAAADEASLADFRGNVADGNDSVRYEERAAGGKTDVVEAIK  700

Query  516   SLDDRSFDLYVAGRGRGVSSALTSGLADWC-ECPELGAVGDllvtsefessfsvlvVQQY  340
             ++     +L++ G+G          LAD   +CPELG VG  L   EF +  SVLV++QY
Sbjct  701   AMG--PCNLFLVGQGTPCVP-----LADRSTDCPELGPVGSYLALPEFSTVASVLVMKQY  753



>emb|CDY62190.1| BnaCnng39520D [Brassica napus]
Length=847

 Score =   422 bits (1084),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 277/829 (33%), Positives = 442/829 (53%), Gaps = 56/829 (7%)
 Frame = -3

Query  2715  APPPPSTGPEV----DLDRLGQVVMCFSQT---IYRSNGVWEGPDPLAPMIPLFILQIMT  2557
             A PP S  P +       R G +V C++QT   +      W+    +   +P F++Q++ 
Sbjct  2     AEPPTSDEPNITYSLSTSRYGNIV-CYNQTNETLVGDYSGWQSAKSIETALPFFVMQLLI  60

Query  2556  AILSSRILNFVLKPFNQPPLVAEILSGIILGPSMLGNIEEFRKHNFPNHNFETIETMGHF  2377
             + L+  ++  + +P + PP VA+IL G++  P++LG      +  FP      +ET  + 
Sbjct  61    SNLTYGLMYSLTRPLHLPPFVAQILCGLLFSPTVLGRNSIVLEKLFPYRYTMFMETFANL  120

Query  2376  ALVLYAFLTGLQMDVKAIVHTGTKSRIVAVSGSIFPFLIGAG-FYFTLQTDTQSMI-GFI  2203
             ALV   FL GL MD++ I     K  ++A+ G +   L G+G +YF    D  +++ G +
Sbjct  121   ALVYNMFLLGLGMDLRMIRIKQVKPMVIAIVGVVVALLAGSGLYYFPGNGDPDTILAGCL  180

Query  2202  FCGSALTVTGFSTLAKILDSKRLLNTEIGKIAASSALINVALSWVLLTIGLLFTGSLDNV  2023
             +   AL+ T F  LA+IL   +LL +++G  A S+++I    +WVLL  G     +  N 
Sbjct  181   YWSVALSCTNFPDLARILADLKLLRSDMGHTAMSASIITDLCTWVLLVFG----NACFNK  236

Query  2022  Q--W------AvlctvgfvvvcvnyVRPLLNWLISKTPEGQGFSEFYICSFIAVICAFGC  1867
             Q  W      A++ T+ F   C+  + P + W  + T +G    E ++   +  +     
Sbjct  237   QGVWNDLMPCALVSTIAFAFFCIYVIHPGIVWAFANTVKGGHVGENHVWFTLVGVVFCAL  296

Query  1866  FTDAMGSHPMIGAFIFGLIMPNNELLRTAILDRLEDFVMGILMPVFFLVCGLRTNIFTIT  1687
              TDA G + + GAF+FGL +P++ ++R  I ++L DF+ G LMP+F+++CG R ++  + 
Sbjct  297   ITDAFGVNSITGAFLFGLSIPHDHIIRNMIEEKLHDFLSGFLMPLFYVICGFRVDLDYLL  356

Query  1686  DGDTSIFTALALILLAC-SAKIIAALVASCYTGMSTNEAIGLGVLTNTKSTMVMIILEVG  1510
                T     L  ++ +C   KI + ++ S + GM   +   +G L NTK TM ++IL  G
Sbjct  357   QNTT--VGVLVFVISSCFMVKIFSTVICSLFLGMPLRDGFAVGALMNTKGTMALVILNAG  414

Query  1509  qvqqvlsvqqysmmvVACLIMTIVATPLAA-RYCPKQDLEPYKRRTIQNAKPGEELRILA  1333
             +  +VL V  Y+ M  A L+M+IV  PL    Y P + L  YK RT+Q  K  EE R+L 
Sbjct  415   RDSKVLDVILYTHMTFAFLVMSIVVQPLLTFTYTPNKKLTFYKYRTVQKLKGEEEFRVLT  474

Query  1332  CIHGTNNLPAIISLLETSNSTVTSPITAFGVQLLELVGRAPA-MMvvhssgsgrhvggsH  1156
             C+H   N+P I +LL  SN T  SP+  + + L+EL GR  A ++++H     +      
Sbjct  475   CVHVLGNVPGITNLLHISNPTKKSPLNIYAIHLVELTGRTEASLLIMHDESKPKVNFSDR  534

Query  1155  EEVQTSQIISTFDNYELRSHGVTAQVLTARWSYDTMAEDICKMAKEKRAAFLVLPFHKQQ  976
                ++ QI   F+  E+ S  V+ Q LTA   Y TM EDIC +A++K+ + ++LP+HK  
Sbjct  535   VRAESEQIAELFEGMEVNSDAVSVQTLTAVSPYATMHEDICTLAQDKQVSLILLPYHKNM  594

Query  975   GTDGEMEDTNPAIQTVNEGVLLSAPCSVGILVERGRPNQYA-----------KNIAVLYL  829
               DG + + N   + VN+ VL +APCSVG+LV+RG     +           K IA+L++
Sbjct  595   TPDGRLGEGNYGHEGVNQNVLRNAPCSVGVLVDRGMTTVRSEASSFNAEITKKEIAMLFI  654

Query  828   GGPDDREALTYARRMSGLPGVHLTVIRFVPAKDVSADGAVEDPDLELELTRETSFVTVSI  649
             GG DDREAL YA RM G   V LTV+RFVP +D                        +S+
Sbjct  655   GGRDDREALAYAWRMVGQEMVKLTVVRFVPGRDALVSAG-----------------KLSV  697

Query  648   DPARDKEEDEELLNNFRTETAEDDSKTFMELVLDDEEEFTKAVKSL-DDRSFDLYVAGRG  472
             + A++ + DEE +  F  +T  D S T +E V++D +E  +A++ + D+ S+DLY+ GRG
Sbjct  698   EYAKEAQVDEECIYEFNFKTMNDSSVTCIEKVVNDGQEVIEAIREMEDNHSYDLYIVGRG  757

Query  471   RGVSSALTSGLADWCECPELGAVGDllvtsefessfsvlvVQQYVRTNK  325
               V + +T+GL DW    +LG +GD L +  F    SVLV+QQY   N+
Sbjct  758   YKVETPVTAGLTDWSSNSDLGTIGDTLASLNFTLHASVLVIQQYSAANR  806



>ref|XP_009383924.1| PREDICTED: cation/H(+) antiporter 19-like [Musa acuminata subsp. 
malaccensis]
Length=793

 Score =   420 bits (1079),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 274/764 (36%), Positives = 428/764 (56%), Gaps = 46/764 (6%)
 Frame = -3

Query  2628  SNGVWEGPDPLAPMIPLFILQIMTAILSSRILNFVLKPFNQPPLVAEILSGIILGPSMLG  2449
             SNG W+G +PL   +PL I+QI   I  +R L FVL+P  QP ++AEI+ GI+LGPS LG
Sbjct  5     SNGSWQGDNPLDYALPLAIVQICLVITVTRFLAFVLRPLRQPRVIAEIIGGILLGPSALG  64

Query  2448  NIEEFRKHNFPNHNFETIETMGHFALVLYAFLTGLQMDVKAIVHTGTKSRIVAVSGSIFP  2269
               E F    FP  +   ++T+ +  L+ + FL GL++D++AI  TG ++  +AV+G   P
Sbjct  65    RSEAFLNTVFPKQSLTVLDTLANIGLLFFLFLVGLELDIRAIRRTGKRALGIAVAGISLP  124

Query  2268  FLIGAGFYFTLQTDTQSMIG----FIFCGSALTVTGFSTLAKILDSKRLLNTEIGKIAAS  2101
             F++G G    L+      +      +F G AL++T F  LA+IL   +LL T++G++A S
Sbjct  125   FIMGIGTSVVLRHTVSKGVRAGPFLVFMGVALSITAFPVLARILAELKLLTTDLGRMAMS  184

Query  2100  SALINVALSWVLLTIGLLFTGSLDNV--QWAvlctvgfvvvcvnyVRPLLNWLISKTPEG  1927
             +A +N   +W+LL + +  TGS   +   W +L  VGFVV     VRP+L+W+  ++P G
Sbjct  185   AAAVNDVAAWILLALAIALTGSGSPLISLWVLLTGVGFVVFVALLVRPVLDWMARRSPVG  244

Query  1926  QGFSEFYICSFIAVICAFGCFTDAMGSHPMIGAFIFGLIMPNNELLRTAILDRLEDFVMG  1747
             +   E YIC+ +A + A G  TD +G H + GAFI G+++P +      +++++ED + G
Sbjct  245   EPVKEIYICATLATVLAAGFVTDTIGIHALFGAFIIGIVVPKDGPFAGVLIEKIEDLIAG  304

Query  1746  ILMPVFFLVCGLRTNIFTITDGDTSIFTALALILLACSA---KIIAALVASCYTGMSTNE  1576
             + +P++F+  GL+TN+ TI  G +       L+L+ C+A   KI   LV S    +   E
Sbjct  305   LFLPLYFVSSGLKTNVATIRGGQSWAL----LVLVICTASFGKIGGTLVVSLLVKVPMRE  360

Query  1575  AIGLGVLTNTKSTMVMIILEVGqvqqvlsvqqysmmvVACLIMTIVATPLA-ARYCPKQD  1399
             A+ LG+L NTK  + +I+L +G+ ++VL+ + ++++V+  L  T + TP+  A Y P + 
Sbjct  361   ALTLGILMNTKGLVELIVLNIGKDRKVLNDETFAILVLMALFTTFITTPIVMAVYKPARR  420

Query  1398  LEPYKRRTIQNAKPGEELRILACIHGTNNLPAIISLLETSNSTVTSPITAFGVQLLELVG  1219
               PYK R+I       E RILAC HG+ N+P +I+L+E+S  T    IT + V L+EL  
Sbjct  421   SPPYKHRSILRDDAESEFRILACFHGSRNIPTMINLIESSRGTRRRGITVYAVHLMELSE  480

Query  1218  RAPAMMvvhssgsgrhvggsHEEVQT---SQIISTFDNYELRSHGVTAQVLTARWSYDTM  1048
             R+ A+ +VH +        + ++       Q++  F  Y+  S+ VT + +TA     T+
Sbjct  481   RSSAISMVHKARRNGLPFWNKKQCYEDGGDQLVVAFQAYQQLSN-VTVRSMTAISDLQTI  539

Query  1047  AEDICKMAKEKRAAFLVLPFHKQQGTDGEMEDTNPAIQTVNEGVLLSAPCSVGILVERGR  868
              EDI   A++KR +F++LPFHK Q  DG ME    A   VN+ VL  APCSVGILV+RG 
Sbjct  540   HEDIITSAEQKRTSFILLPFHKLQQIDGSMESIGHAYHLVNQRVLRCAPCSVGILVDRGL  599

Query  867   -------PNQYAKNIAVLYLGGPDDREALTYARRMSGLPGVHLTVIRFVPAKDVSADGAV  709
                     ++    +AVL+ GG DDREAL    RM+  PG+ LTV RF+P  D       
Sbjct  600   GGAAQVVASEVFYTVAVLFFGGRDDREALALGMRMAEHPGIQLTVTRFIPQAD-------  652

Query  708   EDPDLELELTRETSFVTVSIDPARDKEEDEELLNNFRTET-AEDDSKTFMELVLDDEEEF  532
                  +L        VT+ +D A +   DE+ +  FR +    ++S T+ + V   + E 
Sbjct  653   -----QLRGRDGGGSVTIRMD-ANEIAADEDYITVFRDKVLPSNESITYDDKVAGGKAEI  706

Query  531   TKAVKSLDDRSFDLYVAGRGRGVSSALTSGLADWCECPELGAVG  400
               A+K  D    +L++ G+     +  T  L D  +CPELG VG
Sbjct  707   VAAIK--DMGRCNLFLVGQ-----APATVALTDKNDCPELGPVG  743



>ref|XP_006418009.1| hypothetical protein EUTSA_v10006774mg [Eutrema salsugineum]
 gb|ESQ36362.1| hypothetical protein EUTSA_v10006774mg [Eutrema salsugineum]
Length=786

 Score =   419 bits (1078),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 262/740 (35%), Positives = 407/740 (55%), Gaps = 44/740 (6%)
 Frame = -3

Query  2478  GIILGPSMLGNIEEFRKHNFPNHNFETIETMGHFALVLYAFLTGLQMDVKAIVHTGTKSR  2299
             G++  PS+LGN E   +H FP      +ET  + ALV   FL GL MD++ +  T  K  
Sbjct  9     GLLFSPSVLGNTEFIIQHVFPYRFTMVLETFANLALVYNIFLLGLGMDLRMVRITELKPV  68

Query  2298  IVAVSGSIFPFLIGAGFYFTLQTDTQSMI--GFIFCGSALTVTGFSTLAKILDSKRLLNT  2125
             I+A +G +     G   Y+         I  G +F   AL  T F  LA+IL   +LL +
Sbjct  69    IIASAGLLVALPAGVFLYYLPGNGHPDKIISGCVFWSIALACTNFPDLARILADLKLLRS  128

Query  2124  EIGKIAASSALINVALSWVLLTIGLLF---TGSLDNVQ-WAvlctvgfvvvcvnyVRPLL  1957
             ++G+ A  +A++    +WVLL  G       G+ + +  W +L T  FV++C+  +RP +
Sbjct  129   DMGRTAMCAAIVTDLCTWVLLIFGFASFSKAGTWNKMMPWVILTTFMFVLLCIYVIRPGI  188

Query  1956  NWLISKTPEGQGFSEFYICSFIAVICAFGCFTDAMGSHPMIGAFIFGLIMPNNELLRTAI  1777
              W+ +KT +     + ++   +  +   G  TDA G H + GAF+FGL +P++ ++R  I
Sbjct  189   TWIFAKTVKAGQVGDTHVWFILGGVVLCGLITDACGVHSITGAFLFGLSIPHDHIIRNMI  248

Query  1776  LDRLEDFVMGILMPVFFLVCGLRTNIFTITDGDTSIFT-ALALILLACSA---KIIAALV  1609
              ++L DF+ GILMP+F+++CGLR +I     G    FT    + L+ CS+   KI+  ++
Sbjct  249   EEKLHDFLSGILMPLFYIICGLRADI-----GYMLKFTDKFMMTLVICSSFLVKIVTTVI  303

Query  1608  ASCYTGMSTNEAIGLGVLTNTKSTMVMIILEVGqvqqvlsvqqysmmvVACLIMTIVATP  1429
              S +  M T +A+ +G L NTK T+ +++L  G+  + L    Y+ M +A L+M++V  P
Sbjct  304   VSLFMKMPTRDALAIGALMNTKGTLSLVVLNAGRDTKALDSPMYTHMTIALLVMSLVVEP  363

Query  1428  L-AARYCPKQDLEPYKRRTIQNAKPGEELRILACIHGTNNLPAIISLLETSNSTVTSPIT  1252
             L A  Y PK+ L  YK RT+Q  K   E R+LAC+H   N+  I +LL+ SN T  SP+ 
Sbjct  364   LLAVAYKPKKKLVHYKHRTVQKIKGETEFRVLACVHILPNVSGITNLLQVSNPTKQSPLN  423

Query  1251  AFGVQLLELVGRAPA-MMvvhssgsgrhvggsHEEVQTSQIISTFDNYELRSHGVTAQVL  1075
              F + L+EL GR  A +++++     +         ++ QI  TF+  E+ +  +T Q +
Sbjct  424   VFAIHLVELTGRTTASLLIMNDECKPKANFSDRVRAESDQIAETFEAMEVNNDAMTVQTI  483

Query  1074  TARWSYDTMAEDICKMAKEKRAAFLVLPFHKQQGTDGEMEDTNPAIQTVNEGVLLSAPCS  895
             TA   Y TM EDIC +A++KR  F++LP+HK    DG M + N +   +N+ VL  APCS
Sbjct  484   TAVSPYTTMHEDICALAEDKRVCFIILPYHKHLTPDGRMGEGNSSHADINQNVLSHAPCS  543

Query  894   VGILVERG---------RPNQYAKNIAVLYLGGPDDREALTYARRMSGLPGVHLTVIRFV  742
             VGILV+RG         R     + +A+L++GGPDDREAL+YA RM G   + LTV+RFV
Sbjct  544   VGILVDRGMAMVRSESFRGEPMKREVAMLFVGGPDDREALSYAWRMVGQHVIKLTVVRFV  603

Query  741   PAKDVSADGAVEDPDLELELTRETSFVTVSIDPARDKEEDEELLNNFRTETAEDDSKTFM  562
             P ++                        V+ +  R+K+ D+E +  F  +T  D S  ++
Sbjct  604   PGREALISAG-----------------KVAAEYEREKQVDDECIYEFNFKTMNDSSVRYI  646

Query  561   ELVLDDEEEFTKAVKSL-DDRSFDLYVAGRGRGVSSALTSGLADWCECPELGAVGDllvt  385
             E V++D ++    ++ + D+ S+DLYV GRG    S +T+GL DW   PELG +GD L +
Sbjct  647   EKVVNDGQDTISTIREMEDNNSYDLYVVGRGYNSDSPVTAGLNDWSSSPELGTIGDTLAS  706

Query  384   sefessfsvlvVQQYVRTNK  325
             S F    SVLV+QQY   N+
Sbjct  707   SNFTMHASVLVIQQYSAVNR  726



>ref|XP_009141442.1| PREDICTED: cation/H(+) antiporter 21-like [Brassica rapa]
Length=846

 Score =   421 bits (1081),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 274/812 (34%), Positives = 440/812 (54%), Gaps = 46/812 (6%)
 Frame = -3

Query  2700  STGPEVDLDRLGQVVMCFSQTIY----RSNGVWEGPDPLAPMIPLFILQIMTAILSSRIL  2533
             S+  ++   R G+VV C+S T        NG W+   P+    P FI Q++ A    R++
Sbjct  7     SSYYDLSTSRYGKVV-CYSHTDLIAEEHHNG-WDSAKPIHAAFPFFIKQLLVANFVYRVI  64

Query  2532  NFVLKPFNQPPLVAEILSGIILGPSMLGNIEEFRKHNFPNHNFETIETMGHFALVLYAFL  2353
              ++ +P + PP VA++L G++  P++LG      ++ FP      +ET  + ALV   FL
Sbjct  65    YYMSRPLHLPPFVAQLLCGLLFSPTLLGGEIFVLEYIFPYKYTMVLETFANLALVYNIFL  124

Query  2352  TGLQMDVKAIVHTGTKSRIVAVSGSIFPFLIGAGFYFTLQT--DTQSMIGFIFCGSALTV  2179
              GL MD+K I     K  ++A+ G +   L G   Y+      D + + G ++   AL+ 
Sbjct  125   LGLGMDLKMIKIKQRKPIVIAIVGLVVALLAGYALYYLHGNGDDDKIISGCLYWSVALSC  184

Query  2178  TGFSTLAKILDSKRLLNTEIGKIAASSALINVALSWVLLTIGLLFTG----SLDNVQWAv  2011
             T F  LA+IL   +L  +++G+ A S+++I    +WVLL +GL+       S D + +A+
Sbjct  185   TNFPDLARILADLKLWRSDMGRTAMSASIITDLCTWVLLLLGLVMFNKQGVSNDMMLFAL  244

Query  2010  lctvgfvvvcvnyVRPLLNWLISKTPEGQGFSEFYICSFIAVICAFGCFTDAMGSHPMIG  1831
             + T+GFV   +  +RP + W  + T +G    E ++   +  +      T+A+G   + G
Sbjct  245   VSTIGFVFFSIYVIRPGVAWAFANTVKGGHVGENHVWFTLVGVVFCSLITEAIGVTSIPG  304

Query  1830  AFIFGLIMPNNELLRTAILDRLEDFVMGILMPVFFLVCGLRTNIFTITDGDTSIFTALAL  1651
             AF+FGL +P++ ++R  I ++L D++ GILMP+F+++CGLR N+  +    T     L  
Sbjct  305   AFLFGLSIPHDHVIRDMIEEKLHDYLSGILMPLFYIICGLRLNLDYLLQNTT--VGVLVF  362

Query  1650  ILLAC-SAKIIAALVASCYTGMSTNEAIGLGVLTNTKSTMVMIILEVGqvqqvlsvqqys  1474
             ++ +C   KI++ ++ S +  M   +   +G L NTK TM ++IL  G+  + L V  Y+
Sbjct  363   VISSCFMVKILSTVICSLFLRMPLRDGFAVGALMNTKGTMALVILNAGRDSKALDVIMYT  422

Query  1473  mmvVACLIMTIVATPLAA-RYCPKQDLEPYKRRTIQNAKPGEELRILACIHGTNNLPAII  1297
              M V  L+M+I+  PL    Y PK+ +  YK RT+Q  +   E R+L C H   N+  + 
Sbjct  423   HMTVVFLVMSILVQPLLTLTYTPKKKMSFYKYRTVQKLQGEVEFRVLTCAHVLANVSGLT  482

Query  1296  SLLETSNSTVTSPITAFGVQLLELVGRAPA-MMvvhssgsgrhvggsHEEVQTSQIISTF  1120
             SLL+ SN T  SPI  F + L+EL GR  A +++++     +         ++ QI   F
Sbjct  483   SLLQVSNPTKRSPINVFAIHLVELTGRTTASLLIMNDETKPKANFSDRVRAESEQIAEMF  542

Query  1119  DNYELRSHGVTAQVLTARWSYDTMAEDICKMAKEKRAAFLVLPFHKQQGTDGEMEDTNPA  940
             ++ ++ +  +  Q LTA   Y TM EDIC +A++KRA+ ++LP+HK   +DG + + N A
Sbjct  543   EDMDVNNDAMLVQTLTAVSPYATMHEDICSLAEDKRASLILLPYHKNLTSDGRLGEGNDA  602

Query  939   IQTVNEGVLLSAPCSVGILVERG-----------RPNQYAKNIAVLYLGGPDDREALTYA  793
              + +N  VL  APCSVGILV+RG                 K IA+L++GG DDREAL YA
Sbjct  603   HEDINHNVLSYAPCSVGILVDRGMTVIRSESSSFHGETTDKEIAMLFIGGRDDREALAYA  662

Query  792   RRMSGLPGVHLTVIRFVPAKDVSADGAVEDPDLELELTRETSFVTVSIDPARDKEEDEEL  613
              RM G   + LTV+RFVP+++ +   A ED                + +  ++ + DEE 
Sbjct  663   WRMVGQEMIKLTVVRFVPSRE-ALFAAGED----------------AAEYVKEAQVDEEY  705

Query  612   LNNFRTETAEDDSKTFMELVLDDEEEFTKAVKSLDD-RSFDLYVAGRGRGVSSALTSGLA  436
             +  F  +T  D S T+ E V+ D  E   A++ ++D  SFDLY+ GRG  V + +T GL 
Sbjct  706   IYQFNFKTMNDSSVTYTEKVVVDGPETIAAIREMEDNHSFDLYIVGRGYKVETPVTVGLT  765

Query  435   DWCECPELGAVGDllvtsefessfsvlvVQQY  340
             DW   P+LG +GD L +S F    SVLV+QQ+
Sbjct  766   DWNTSPDLGVIGDTLASSNFTMQGSVLVIQQF  797



>ref|XP_009141200.1| PREDICTED: cation/H(+) antiporter 21-like [Brassica rapa]
Length=847

 Score =   420 bits (1080),  Expect = 6e-128, Method: Compositional matrix adjust.
 Identities = 276/829 (33%), Positives = 443/829 (53%), Gaps = 56/829 (7%)
 Frame = -3

Query  2715  APPPPSTGPEV----DLDRLGQVVMCFSQT---IYRSNGVWEGPDPLAPMIPLFILQIMT  2557
             A PP S  P +       R G +V C++QT   +      W+    +   +P F++Q++ 
Sbjct  2     AEPPTSDEPNITYSLSTSRYGNIV-CYNQTNEALVGDYSGWQSAKSIETALPFFVMQLLI  60

Query  2556  AILSSRILNFVLKPFNQPPLVAEILSGIILGPSMLGNIEEFRKHNFPNHNFETIETMGHF  2377
             + LS  ++  + +P + PP VA+IL G++  P++LG      +  FP      +ET  + 
Sbjct  61    SNLSYGLMYSLTRPLHLPPFVAQILCGLLFSPTVLGRNSIVLEKLFPYRYTMFMETFANL  120

Query  2376  ALVLYAFLTGLQMDVKAIVHTGTKSRIVAVSGSIFPFLIGAG-FYFTLQTDTQSMI-GFI  2203
             ALV   FL G+ MD++ I     K  ++A+ G +   L G+G +YF    D  +++ G +
Sbjct  121   ALVYNMFLLGVGMDLRMIRIKQVKPMVIAIVGVVVALLAGSGLYYFPGNGDPDTILAGCL  180

Query  2202  FCGSALTVTGFSTLAKILDSKRLLNTEIGKIAASSALINVALSWVLLTIGLLFTGSLDNV  2023
             +   AL+ T F  LA+IL   +LL +++G  A S+++I    +WVLL +G     +  N 
Sbjct  181   YWSVALSCTNFPDLARILADLKLLRSDMGHTAMSASMITDLCTWVLLVLG----NACFNK  236

Query  2022  Q--W------AvlctvgfvvvcvnyVRPLLNWLISKTPEGQGFSEFYICSFIAVICAFGC  1867
             Q  W      A++ T+ FV  C+  + P + W  + T +G    E ++   +  +     
Sbjct  237   QGVWNDLMPCALVSTIAFVFFCIYVIHPGIVWAFANTVKGGHVGENHVWFTLVGVVFCAL  296

Query  1866  FTDAMGSHPMIGAFIFGLIMPNNELLRTAILDRLEDFVMGILMPVFFLVCGLRTNIFTIT  1687
              TDA G + + GAF+FGL +P++ ++R  I ++L DF+ G LMP+F+++CG R ++  + 
Sbjct  297   ITDAFGVNSITGAFLFGLSIPHDHIIRNMIEEKLHDFLSGFLMPLFYVICGFRVDLDYLL  356

Query  1686  DGDTSIFTALALILLAC-SAKIIAALVASCYTGMSTNEAIGLGVLTNTKSTMVMIILEVG  1510
                T     L  ++ +C   KI++ ++ S +  M   +   +G L NTK TM +++L  G
Sbjct  357   QNTT--VGVLVFVISSCFMVKILSTVICSLFLRMPLRDGFAVGALMNTKGTMALVVLNAG  414

Query  1509  qvqqvlsvqqysmmvVACLIMTIVATPLAA-RYCPKQDLEPYKRRTIQNAKPGEELRILA  1333
             +  + L V  Y+ M  A L+M+IV  PL    Y P + L  YK RT+Q  K  EE R+L 
Sbjct  415   RDSKALDVILYTHMTFAFLVMSIVVQPLLTFTYTPNKKLTFYKYRTVQKLKGEEEFRVLT  474

Query  1332  CIHGTNNLPAIISLLETSNSTVTSPITAFGVQLLELVGRAPA-MMvvhssgsgrhvggsH  1156
             C+H   N+P I +LL  SN T  SP+  + + L+EL GR  A ++++H     +      
Sbjct  475   CVHVLGNVPGITNLLHISNPTKKSPLNIYAIHLVELTGRTEASLLIMHDESKPKVNFSDR  534

Query  1155  EEVQTSQIISTFDNYELRSHGVTAQVLTARWSYDTMAEDICKMAKEKRAAFLVLPFHKQQ  976
                ++ QI   F+  E+ S  V+ Q LTA   Y TM EDIC +A++K+ + ++LP+HK  
Sbjct  535   VRAESEQIAELFEGMEVNSDAVSVQTLTAVSPYATMHEDICTLAQDKQVSLILLPYHKNL  594

Query  975   GTDGEMEDTNPAIQTVNEGVLLSAPCSVGILVERG-----------RPNQYAKNIAVLYL  829
               DG + + N   + VN+ VL +APCSVG+LV+RG                 K IA+L++
Sbjct  595   TPDGRLGEGNYGHEGVNQNVLRNAPCSVGVLVDRGMTTVRSEASSFNAETTKKEIAMLFI  654

Query  828   GGPDDREALTYARRMSGLPGVHLTVIRFVPAKDVSADGAVEDPDLELELTRETSFVTVSI  649
             GG DDREAL YA RM G   V LTV+RFVP +D                        +S+
Sbjct  655   GGRDDREALAYAWRMVGQEMVKLTVVRFVPGRDALVSAG-----------------KLSV  697

Query  648   DPARDKEEDEELLNNFRTETAEDDSKTFMELVLDDEEEFTKAVKSL-DDRSFDLYVAGRG  472
             + A++ + DEE +  F  +T  D S T +E V++D +E  +A++ + D+ S+DLY+ GRG
Sbjct  698   EYAKEAQVDEECIYEFNFKTMNDSSVTCIEKVVNDGQEVIEAIREMEDNHSYDLYIVGRG  757

Query  471   RGVSSALTSGLADWCECPELGAVGDllvtsefessfsvlvVQQYVRTNK  325
               V + +T+GL DW    +LG +GD L +  F    SVLV+QQY  TN+
Sbjct  758   YKVETPVTAGLTDWSSNSDLGTIGDTLASLNFTLHASVLVIQQYSATNR  806



>ref|XP_009413172.1| PREDICTED: cation/H(+) antiporter 15-like [Musa acuminata subsp. 
malaccensis]
Length=870

 Score =   421 bits (1081),  Expect = 7e-128, Method: Compositional matrix adjust.
 Identities = 281/821 (34%), Positives = 448/821 (55%), Gaps = 52/821 (6%)
 Frame = -3

Query  2661  VVMCFSQTIYRSNGVWEGPDPLAPMIPLFILQIMTAILSSRILNFVLKPFNQPPLVAEIL  2482
             +  C+        GVW+     +  +P+ + Q++  +  SR L F+LKP  QP ++AEIL
Sbjct  10    ITFCYRPDNIVGGGVWQSKPFYSYSLPVLLWQMVLVVAISRGLAFLLKPLRQPRVIAEIL  69

Query  2481  SGIILGPSMLGNIEEFRKHN----------FPNHNFETIETMGHFALVLYAFLTGLQMDV  2332
             +G++LGP+ L NI                 FP  ++  +E M    +  Y FL G + D+
Sbjct  70    AGVLLGPTGLRNITFSGGEGGKPLPLGDILFPPASYRQLEAMSTLGITYYLFLIGAEFDI  129

Query  2331  KAIVHTGTKSRIVAVSGSIFPFLIGAGFYFTLQTDTQSMIGFI----FCGSALTVTGFST  2164
             + +     K   +A      P +I       +       + ++    F G+A+ VT F  
Sbjct  130   QMVAAMKKKVVAIATVNMAVPIVITVLVAHAMNLQPPEYVSYLAHVAFIGAAMGVTAFPV  189

Query  2163  LAKILDSKRLLNTEIGKIAASSALINVALSWVLLTIGLLFTGSLDNVQ------------  2020
             L ++L   +LLN E+G++    A+++   +WV L   +L     D+ +            
Sbjct  190   LVRLLAELKLLNDELGQLVVPPAVLSELTAWVFLAGSVLLPSYGDSPEVVDLYRSSAFAP  249

Query  2019  -WAvlctvgfvvvcvnyVRPLLNWLISKTPEGQGFSEFYICSFIAVICAFGCFTDAMGSH  1843
              W +L  +G  ++C   V P++NW + +TPEG+  S+ +I      + A G   D +G  
Sbjct  250   LWIMLSGIGLGLICWLVVLPIMNWTVQRTPEGEAVSDAHITIVATGVLAAGLIADVIGFP  309

Query  1842  PMIGAFIFGLIMPNNELLRTAILDRLEDFVMGILMPVFFLVCGLRTNIFTITDGD---TS  1672
              + GAF+FGL+MP   L  T + ++LEDFV+G+L+P++F   G + N+  IT  D    +
Sbjct  310   SVFGAFVFGLLMPQGAL-TTELRNKLEDFVVGLLLPIYFGGSGFKANVSVITMDDEQGAA  368

Query  1671  IFTALALILLAC-SAKIIAALVASCYTGMSTNEAIGLGVLTNTKSTMVMIILEVGqvqqv  1495
                AL +I++ C  AK+ + L+ + Y  M  +  + LG+L NTK ++ MIIL +G+ + +
Sbjct  369   FVAALTVIMVLCFVAKLGSNLLIAQYYSMPASRGLSLGLLMNTKGSIDMIILNIGKQKGI  428

Query  1494  lsvqqysmmvVACLIMTIVATP-LAARYCPKQDLEPYKRRTIQNAKPGEELRILACIHGT  1318
             L  + Y+MMV+  ++ T V  P L   +   +    YKRR +Q  +P  ELR++AC++  
Sbjct  429   LDERTYTMMVLGYILTTAVIGPALEIFHKTSRSRAAYKRRNLQQCRPDSELRMVACVYTA  488

Query  1317  NNLPAIISLLETSNSTVTSPITAFGVQLLELVGRAPAMMvvhssgsgrhvggsHEE----  1150
              N+P+IIS L+ SN T  SP+  + V LLEL GR  AMM+VH + S         +    
Sbjct  489   RNVPSIISFLQMSNPTKRSPVFVYVVHLLELTGRGAAMMIVHQASSKHAQEKVGSKSSGC  548

Query  1149  -VQTSQIISTFDNYELRSHGVTAQVLTARWSYDTMAEDICKMAKEKRAAFLVLPFHKQQG  973
              +Q   II+ F +YE ++ GV+ Q +TA   Y TM EDI  +A+++    +VLPFH+ Q 
Sbjct  549   ALQADHIIAPFQSYEQQAGGVSVQWVTAVSPYSTMHEDIFNIAEDRHTTIIVLPFHRLQS  608

Query  972   TDGEMEDTNPAIQTVNEGVLLSAPCSVGILVERG-------RPNQYAK-NIAVLYLGGPD  817
               G+ E+ +PAI++VN  VL  +PC+V ILV+RG          Q A+ ++AVL+ GGPD
Sbjct  609   VAGDFEEADPAIRSVNMNVLAHSPCTVCILVDRGISGVGRSSTGQLAQHHVAVLFFGGPD  668

Query  816   DREALTYARRMSGLPGVHLTVIRFVPAKDVSADGAVEDPDLELELTRETSFVTVSIDPAR  637
             DREALTY+ RM+  PGV LTVIRF+P +    +  V         + E + +T   +   
Sbjct  669   DREALTYSSRMAEHPGVILTVIRFLPGE----EAMVPPSPAPSCASGERAAMTAVAEANM  724

Query  636   DKEEDEELLNNFRTETAEDDSKTFMELVLDDEEEFTKAVKSLDDRSFDLYVAGRGRGV-S  460
              ++ D+E  N FR     +DS T+ E+V+++ EE   AV++++     +YV GRG+G+ S
Sbjct  725   QRQLDDECTNLFRLRHVTNDSVTYTEMVINNIEETVTAVRAMNG-VHSMYVVGRGKGMES  783

Query  459   SALTSGLADWCECPELGAVGDllvtsefessfsvlvVQQYV  337
             S L +GL  W E PELG +GD+LV+++F +  SVLVVQQYV
Sbjct  784   SPLLAGLTLWSEYPELGPIGDMLVSADFGTQASVLVVQQYV  824



>ref|XP_010910508.1| PREDICTED: cation/H(+) antiporter 18-like [Elaeis guineensis]
Length=821

 Score =   418 bits (1075),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 287/781 (37%), Positives = 443/781 (57%), Gaps = 36/781 (5%)
 Frame = -3

Query  2628  SNGVWEGPDPLAPMIPLFILQIMTAILSSRILNFVLKPFNQPPLVAEILSGIILGPSMLG  2449
             SNGV++G +PL   +PL ILQI   ++ +R L F+LKP  QP ++AEI+ GI+LGPS LG
Sbjct  30    SNGVFQGDNPLHSALPLAILQICLVVVITRSLAFLLKPLRQPRVIAEIIGGILLGPSALG  89

Query  2448  NIEEFRKHNFPNHNFETIETMGHFALVLYAFLTGLQMDVKAIVHTGTKSRIVAVSGSIFP  2269
               + F    FP  +   ++T+ +  L+ + FL GL++D K++  TG ++  +AV+G   P
Sbjct  90    RSKAFLHAVFPPSSLTVLDTLANLGLLFFLFLVGLELDPKSLRRTGKRAFGIAVAGISLP  149

Query  2268  FLIGAG----FYFTLQTDTQSMIGFIFCGSALTVTGFSTLAKILDSKRLLNTEIGKIAAS  2101
             F +G G       T+    Q     +F G AL++T F  LA+IL   +LL T++G++A S
Sbjct  150   FFLGIGTSVVLRHTISKGVQGAPFLVFVGVALSITAFPVLARILAELKLLTTDVGRMAMS  209

Query  2100  SALINVALSWVLLTIGLLFTGSLDN---VQWAvlctvgfvvvcvnyVRPLLNWLISKTPE  1930
             +A +N   +W+LL + +  + S  +     W +LC V FV+ C   V+P+L W+  +TPE
Sbjct  210   AAAVNDVAAWILLALAIALSDSSQSPLVSLWVLLCGVAFVLFCTFLVQPILGWIARRTPE  269

Query  1929  GQGFSEFYICSFIAVICAFGCFTDAMGSHPMIGAFIFGLIMPNNELLRTAILDRLEDFVM  1750
             G+   E Y+C+ +A + A G  TD +G H + G FI G+++P +     A+++++ED V 
Sbjct  270   GEPVGEIYVCATLAAVLAAGFVTDTIGIHALFGGFIIGVLVPKDGPFAGALVEKVEDLVS  329

Query  1749  GILMPVFFLVCGLRTNIFTITDGDTSIFTALALILLACSAKIIAALVASCYTGMSTNEAI  1570
             G+ +P++F+  GL+TN+ TI  G  S    + +IL AC  KI   +  S    M + EA+
Sbjct  330   GLFLPLYFVSSGLKTNVATI-QGAQSWGLLVLVILTACLGKIAGTVGVSIACRMPSREAL  388

Query  1569  GLGVLTNTKSTMVMIILEVGqvqqvlsvqqysmmvVACLIMTIVATPLA-ARYCP-KQDL  1396
              LG L NTK  + +I+L +G+ ++VL+ Q +++ V+  L  T + TPL  A Y P ++  
Sbjct  389   ALGFLMNTKGLVELIVLNIGKDRKVLNDQTFAVFVLMALFTTFITTPLVTAFYKPARKSC  448

Query  1395  EPYKRRTIQNAKPGEELRILACIHGTNNLPAIISLLETSNST-VTSPITAFGVQLLELVG  1219
               YK RTI+    G +LR LAC H T N+P II+L+E S  T     +  + + L+EL  
Sbjct  449   TIYKHRTIERKDSGTQLRFLACFHSTRNIPTIINLIEASRGTNRREGLCVYAMHLMELSE  508

Query  1218  RAPA-MMvvhssgsgrhvggsHEEVQTSQIISTFDNYELRSHGVTAQVLTARWSYDTMAE  1042
             R  A +MV  +  +G             Q++  F+ +E R   V+ + +TA  +   + E
Sbjct  509   RPSAILMVHKARKNGLPFWNKTLRSGYDQVVVAFEAFE-RLSNVSIRPMTAISALSDIHE  567

Query  1041  DICKMAKEKRAAFLVLPFHKQQGTDGEMEDTNPAIQTVNEGVLLSAPCSVGILVERG---  871
             DIC  A+ K AA ++LPFHK Q  DG +E T    ++VN  VL  APCSVGILV+RG   
Sbjct  568   DICASAERKEAAIIILPFHKHQRLDGALEMTRHEFRSVNRKVLEHAPCSVGILVDRGLGG  627

Query  870   ----RPNQYAKNIAVLYLGGPDDREALTYARRMSGLPGVHLTVIRFVPAKDVSADGAVED  703
                   +  + +I VL+ GG DDREALTYA R++  PG+ LTV+RF+ +++ S DG    
Sbjct  628   TTHVSASDVSSSITVLFFGGQDDREALTYATRIAEHPGIQLTVLRFIESRNGS-DGESVA  686

Query  702   PDLELELTRETSFVTVSIDPARDKEEDEELLNNFRTETAEDDSKTFMELVLDDEEEFTKA  523
              D+    T E                DE++LN FR +T  D +  + E  +   +E   A
Sbjct  687   IDMNGSSTAEGMLA------------DEKVLNEFRNKTQNDPAIKYEEREVASSDETVAA  734

Query  522   VKSLDDRSFDLYVAGRGRGVSSALTSGLADWCECPELGAVGDllvtsefessfsvlvVQQ  343
             ++++  RS DL + GR R   +A  + + +  ECPELG VGDLL +    ++ SVLVVQQ
Sbjct  735   IQTV-SRS-DLILVGR-RPEGAAAAALMTERNECPELGPVGDLLTSPSSLTTASVLVVQQ  791

Query  342   Y  340
             Y
Sbjct  792   Y  792



>ref|NP_001055076.1| Os05g0276100 [Oryza sativa Japonica Group]
 gb|AAT85133.1| putative sodium/hydrogen exchanger [Oryza sativa Japonica Group]
 dbj|BAF16990.1| Os05g0276100 [Oryza sativa Japonica Group]
 dbj|BAG91247.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE63074.1| hypothetical protein OsJ_17882 [Oryza sativa Japonica Group]
Length=790

 Score =   417 bits (1071),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 277/779 (36%), Positives = 432/779 (55%), Gaps = 49/779 (6%)
 Frame = -3

Query  2628  SNGVWEGPDPLAPMIPLFILQIMTAILSSRILNFVLKPFNQPPLVAEILSGIILGPSMLG  2449
             S+GV++G DPL   +PL I+QI   ++ +R+L F L+P  QP ++AEI+ GI+LGPS +G
Sbjct  17    SDGVFQGEDPLEAALPLAIVQICIVVVLTRVLAFFLRPLRQPRVIAEIIGGIMLGPSAIG  76

Query  2448  NIEEFRKHNFPNHNFETIETMGHFALVLYAFLTGLQMDVKAIVHTGTKSRIVAVSGSIFP  2269
                 F    FP  +   ++T+ +  L+ + FL GL++D++AI  TG  +  +AV+G   P
Sbjct  77    RNSAFINTVFPKQSLTVLDTLANIGLLFFLFLVGLELDLRAIRRTGAGALAIAVAGISLP  136

Query  2268  FLIGAGFYFTLQTDTQSMIG----FIFCGSALTVTGFSTLAKILDSKRLLNTEIGKIAAS  2101
             F++G G    LQ      +      +F G AL++T F  LA+IL   +LL T++G++A S
Sbjct  137   FVLGIGTSVVLQNTVNRGVPTGPFLVFMGVALSITAFPVLARILAELKLLTTDLGRMAMS  196

Query  2100  SALINVALSWVLLTIGLLFTGSLDNVQ--WAvlctvgfvvvcvnyVRPLLNWLISKTPEG  1927
             +A +N   +W+LL + +  +GS       W +L  VGFV+    ++RPLL+W+  ++PEG
Sbjct  197   AAAVNDVAAWILLALAIALSGSGSPFVSLWVLLSGVGFVLSSFFFIRPLLSWMARRSPEG  256

Query  1926  QGFSEFYICSFIAVICAFGCFTDAMGSHPMIGAFIFGLIMPNNELLRTAILDRLEDFVMG  1747
             +   E YIC+ + ++ A G  TD +G H + GAFI G+I+P        +L+++ED + G
Sbjct  257   EPVKELYICTTLTIVLAAGFITDTIGIHALFGAFIVGIIVPKEGPFAGVLLEKVEDLISG  316

Query  1746  ILMPVFFLVCGLRTNIFTITDGDTSIFTALALILLACSAKIIAALVASCYTGMSTNEAIG  1567
             + +P++F+  GL+TN+ TI  GD+     L ++  AC  KI   ++AS    +   EA+ 
Sbjct  317   LFLPLYFVSSGLKTNVLTIKGGDSWGLLVL-VVATACIGKIGGTVLASLIVRVPLREAVT  375

Query  1566  LGVLTNTKSTMVMIILEVGqvqqvlsvqqysmmvVACLIMTIVATPLA-ARYCPKQDLEP  1390
             LGVL NTK  + +I+L +G+ + VL+ + ++++V+  LI T + TPL  A Y P +   P
Sbjct  376   LGVLMNTKGLVELIVLNIGKDRHVLNDETFAILVLMALINTFITTPLVMAIYKPARRAPP  435

Query  1389  YKRRTIQNAKPGEELRILACIHGTNNLPAIISLLETSNSTVTSPITAFGVQLLELVGRAP  1210
             YK R +Q   P +ELR++ C H T N+P +I+L+E+S  T    IT + + L+EL  R+ 
Sbjct  436   YKNRAVQRPNPDDELRMMVCFHSTRNIPTMINLMESSRGTRRRGITVYAMHLVELSERSS  495

Query  1209  AM-MvvhssgsgrhvggsHEEVQTSQIISTFDNYELRSHGVTAQVLTARWSYDTMAEDIC  1033
             A+ MV  +  +G             Q++  F+ Y+  SH V+ + +TA     T+ ED+ 
Sbjct  496   AINMVHKARRNGMPFWNRRRNGDGDQLVVAFETYQQLSH-VSIRAMTAISDLHTIHEDVV  554

Query  1032  KMAKEKRAAFLVLPFHKQQGTDGEMEDTNPAIQTVNEGVLLSAPCSVGILVERG------  871
               A +KRAA +VLPFHK    DG ME      Q +N+ VL  APCSVGILV+RG      
Sbjct  555   TSAHQKRAALIVLPFHKLHQMDGHMESLGDEYQHINQRVLHHAPCSVGILVDRGLGGAAQ  614

Query  870   -RPNQYAKNIAVLYLGGPDDREALTYARRMSGLPGVHLTVIRFVPAKDVSADGAVEDPDL  694
                +  + NI VL+ GG DDREAL+YA RM   PG+ L VIRFVP  +    GA +    
Sbjct  615   VAASDVSYNIVVLFFGGRDDREALSYATRMVEHPGIALHVIRFVP--ESGGGGANDKAAA  672

Query  693   ELELTRETSFVTVSIDPARDKEEDEELLNNFRTETA-EDDSKTFMELVLDDEEEFTKAVK  517
             +     E                       FR + A  +DS  + E     + +  +A+K
Sbjct  673   DDAFLAE-----------------------FRGKVAGGNDSIRYEERTSRGKADVVEAIK  709

Query  516   SLDDRSFDLYVAGRGRGVSSALTSGLADWCECPELGAVGDllvtsefessfsvlvVQQY  340
             ++     +L++ G+G    S     +    ECPELG VG  L   +F +  SVLV++QY
Sbjct  710   AMGPT--NLFLVGQG----SPCAPLMEPSAECPELGPVGSYLAMPDFSTVASVLVMKQY  762



>emb|CDY19121.1| BnaA04g18610D [Brassica napus]
Length=847

 Score =   418 bits (1075),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 275/829 (33%), Positives = 443/829 (53%), Gaps = 56/829 (7%)
 Frame = -3

Query  2715  APPPPSTGPEV----DLDRLGQVVMCFSQT---IYRSNGVWEGPDPLAPMIPLFILQIMT  2557
             A PP S  P +       R G +V C++QT   +      W+    +   +P F++Q++ 
Sbjct  2     AEPPTSDEPNITYSLSTSRYGNIV-CYNQTNEALVGDYSGWQSAKSIETALPFFVMQLLI  60

Query  2556  AILSSRILNFVLKPFNQPPLVAEILSGIILGPSMLGNIEEFRKHNFPNHNFETIETMGHF  2377
             + LS  ++  + +P + PP VA+IL G++  P++LG      +  FP      +ET  + 
Sbjct  61    SNLSYGLMYSLTRPLHLPPFVAQILCGLLFSPTVLGRNSIVLEKLFPYRYTMFMETFANL  120

Query  2376  ALVLYAFLTGLQMDVKAIVHTGTKSRIVAVSGSIFPFLIGAG-FYFTLQTDTQSMI-GFI  2203
             ALV   FL G+ MD++ I     K  ++A+ G +   L G+G +YF    D  +++ G +
Sbjct  121   ALVYNMFLLGVGMDLRMIRIKQVKPMVIAIVGVVVALLAGSGLYYFPGNGDPDTILAGCL  180

Query  2202  FCGSALTVTGFSTLAKILDSKRLLNTEIGKIAASSALINVALSWVLLTIGLLFTGSLDNV  2023
             +   AL+ T F  LA+IL   +LL +++G  A S+++I    +WVLL +G     +  N 
Sbjct  181   YWSVALSCTNFPDLARILADLKLLRSDMGHTAMSASMITDLCTWVLLVLG----NACFNK  236

Query  2022  Q--W------AvlctvgfvvvcvnyVRPLLNWLISKTPEGQGFSEFYICSFIAVICAFGC  1867
             Q  W      A++ T+ FV  C+  + P + W  + T +G    E ++   +  +     
Sbjct  237   QGVWNDLMPCALVSTIAFVFFCIYVIHPGIVWAFANTVKGGHVGENHVWFTLVGVVFCAL  296

Query  1866  FTDAMGSHPMIGAFIFGLIMPNNELLRTAILDRLEDFVMGILMPVFFLVCGLRTNIFTIT  1687
              TDA G + + GAF+FGL +P++ ++R  I ++L DF+ G LMP+F+++CG R ++  + 
Sbjct  297   ITDAFGVNSITGAFLFGLSIPHDHIIRNMIEEKLHDFLSGFLMPLFYVICGFRVDLDYLL  356

Query  1686  DGDTSIFTALALILLAC-SAKIIAALVASCYTGMSTNEAIGLGVLTNTKSTMVMIILEVG  1510
                T     L  ++ +C   KI++ ++ S +  M   +   +G L NTK TM +++L  G
Sbjct  357   QNTT--VGVLVFVISSCFMVKILSTVICSLFLRMPLRDGFAVGALMNTKGTMALVVLNAG  414

Query  1509  qvqqvlsvqqysmmvVACLIMTIVATPLAA-RYCPKQDLEPYKRRTIQNAKPGEELRILA  1333
             +  + L V  Y+ M  A L+M+IV  PL    Y P + L  YK RT+Q  K  EE R+L 
Sbjct  415   RDSKALDVILYTHMTFAFLVMSIVVQPLLTFTYTPNKKLTFYKYRTVQKLKGEEEFRVLT  474

Query  1332  CIHGTNNLPAIISLLETSNSTVTSPITAFGVQLLELVGRAPA-MMvvhssgsgrhvggsH  1156
             C+H   N+P I +LL  SN T  SP+  + + L+EL GR  A ++++H     +      
Sbjct  475   CVHVLGNVPGITNLLHISNPTKKSPLNIYAIHLVELTGRTEASLLIMHDESKPKVNFSDR  534

Query  1155  EEVQTSQIISTFDNYELRSHGVTAQVLTARWSYDTMAEDICKMAKEKRAAFLVLPFHKQQ  976
                ++ QI   F+  E+ S  V+ Q LTA   Y TM EDIC +A++K+ + ++LP+HK  
Sbjct  535   VRAESEQIAELFEGMEVNSDAVSVQTLTAVSPYATMHEDICTLAQDKQVSLILLPYHKNL  594

Query  975   GTDGEMEDTNPAIQTVNEGVLLSAPCSVGILVERG-----------RPNQYAKNIAVLYL  829
               DG + + N   + VN+ VL +APCSVG+LV+RG                 K IA+L++
Sbjct  595   TPDGRLGEGNYGHEGVNQNVLRNAPCSVGVLVDRGMTTVRSEASSFNAETTKKEIAMLFI  654

Query  828   GGPDDREALTYARRMSGLPGVHLTVIRFVPAKDVSADGAVEDPDLELELTRETSFVTVSI  649
             GG DDREAL YA RM G   V LTV+RFVP +D                        +S+
Sbjct  655   GGRDDREALAYAWRMVGQEMVKLTVVRFVPGRDALVSAG-----------------KLSV  697

Query  648   DPARDKEEDEELLNNFRTETAEDDSKTFMELVLDDEEEFTKAVKSL-DDRSFDLYVAGRG  472
             + A++ + DEE +  F  +T  D S T +E V++D +E  +A++ + ++ S+DLY+ GRG
Sbjct  698   EYAKEAQVDEECIYEFNFKTMNDSSVTCIEKVVNDGQEVIEAIREMEENHSYDLYIVGRG  757

Query  471   RGVSSALTSGLADWCECPELGAVGDllvtsefessfsvlvVQQYVRTNK  325
               V + +T+GL DW    +LG +GD L +  F    SVLV+QQY  TN+
Sbjct  758   YKVETPVTAGLTDWSSNSDLGTIGDTLASLNFTLHASVLVIQQYSATNR  806



>ref|XP_007040405.1| Cation/H+ exchanger 18 isoform 1 [Theobroma cacao]
 ref|XP_007040406.1| Cation/H+ exchanger 18 isoform 1 [Theobroma cacao]
 gb|EOY24906.1| Cation/H+ exchanger 18 isoform 1 [Theobroma cacao]
 gb|EOY24907.1| Cation/H+ exchanger 18 isoform 1 [Theobroma cacao]
Length=803

 Score =   417 bits (1071),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 277/789 (35%), Positives = 433/789 (55%), Gaps = 38/789 (5%)
 Frame = -3

Query  2652  CFSQTIYRSNGVWEGPDPLAPMIPLFILQIMTAILSSRILNFVLKPFNQPPLVAEILSGI  2473
             C S     SNG+++G +PL   +PL ILQI   ++ +R L F+L+P  QP ++AEI+ GI
Sbjct  11    CPSPMKATSNGLFQGDNPLDYALPLAILQICLVVVLTRGLAFLLRPIRQPRVIAEIIGGI  70

Query  2472  ILGPSMLGNIEEFRKHNFPNHNFETIETMGHFALVLYAFLTGLQMDVKAIVHTGTKSRIV  2293
             +LGPS+LG  + + +  FP  +   ++T+ +  L+ + FL GL++D+KA+  TG  +  +
Sbjct  71    LLGPSVLGRSKSYLQAIFPPKSLTVLDTLANIGLIFFLFLAGLEIDLKALRRTGKTALGI  130

Query  2292  AVSGSIFPFLIGAGFYFTLQTDTQSMIG----FIFCGSALTVTGFSTLAKILDSKRLLNT  2125
             AV+G   PF +G G  F L+      +      +F G AL++T F  LA+IL   +LL T
Sbjct  131   AVAGIGLPFALGIGSSFLLKATISKGVNASAFLVFMGVALSITAFPVLARILAELKLLTT  190

Query  2124  EIGKIAASSALINVALSWVLLTIGLLFTGSLDNVQ---WAvlctvgfvvvcvnyVRPLLN  1954
             ++G+IA S+A +N   +W+LL + +  +GS  +     W  L    FV+     V P+  
Sbjct  191   DVGRIAMSAAAVNDVAAWILLALAVALSGSNSSPAASLWVFLSGCVFVICLSFIVPPIFK  250

Query  1953  WLISKTPEGQGFSEFYICSFIAVICAFGCFTDAMGSHPMIGAFIFGLIMPNNELLRTAIL  1774
             W+  +  EG+   E YIC+ +A + A G  TDA+G H M GAF+ G++ P       A++
Sbjct  251   WMAYRCHEGEPVEEMYICATLAAVLAAGFVTDAIGIHAMFGAFVVGVVFPKEGPFAGALV  310

Query  1773  DRLEDFVMGILMPVFFLVCGLRTNIFTITDGDTSIFTALALILLACSAKIIAALVASCYT  1594
             +++ED V G+ +P++F+  GL+TNI TI    +    AL +I  AC  KI+  +V S   
Sbjct  311   EKVEDLVSGLFLPLYFVSSGLKTNIATIQGLQSWGLLAL-VIFTACFGKIVGTVVVSLSC  369

Query  1593  GMSTNEAIGLGVLTNTKSTMVMIILEVGqvqqvlsvqqysmmvVACLIMTIVATPLA-AR  1417
              +   EA  LG L NTK  + +I+L +G+ ++VL+ Q +++MV+  L  T + TP+  A 
Sbjct  370   KVPAREAFALGFLMNTKGLVELIVLNIGRDRKVLNDQTFAIMVLMALFTTFITTPVVMAV  429

Query  1416  YCPKQDLE-PYKRRTIQNAKPGEELRILACIHGTNNLPAIISLLETSNST-VTSPITAFG  1243
             Y P +  +  YK RTI+   P  +LRIL C H + N+P++I+LLE S         + + 
Sbjct  430   YKPARSRKVDYKHRTIERKNPDTQLRILTCFHSSRNIPSMINLLEASRGVGKREGFSVYA  489

Query  1242  VQLLELVGRAPA-MMvvhssgsgrhvggsHEEVQTSQIISTFDNYELRSHGVTAQVLTAR  1066
             + L+EL  R+ A +MV  +  +G           +  I+  F+ ++  S  VT + +T+ 
Sbjct  490   LHLMELSERSSAILMVHKARKNGLPFWNKGRHSDSDHIVVAFEAFQQLSQ-VTVRSMTSI  548

Query  1065  WSYDTMAEDICKMAKEKRAAFLVLPFHKQQGTDGEMEDTNPAIQTVNEGVLLSAPCSVGI  886
              S   M EDIC  A+ KRAA ++LPFHK Q  DG  E T    + VN+ VL  APCS+GI
Sbjct  549   SSMADMHEDICTTAERKRAAIIILPFHKHQRMDGSFETTRTDFRWVNQRVLEHAPCSIGI  608

Query  885   LVERG-------RPNQYAKNIAVLYLGGPDDREALTYARRMSGLPGVHLTVIRFVPAKDV  727
             LV+RG         +  + ++ VL+ GG DDREAL Y  RM+  PG+ L VIRFV   + 
Sbjct  609   LVDRGLGGTTHVSASNVSLSMTVLFFGGCDDREALAYGARMAEHPGISLNVIRFVVEPET  668

Query  726   SADGAVEDPDLELELTRETSFVTVSIDPARDKEEDEELLNNFRTETAEDDSKTFMELVLD  547
               + A       +++   +   ++S+        DEE L+ F+ + + DDS  + E  + 
Sbjct  669   IGEIA------RIDMQENSGLKSMSL--------DEEFLSKFKQKISNDDSVRYEEKAVR  714

Query  546   DEEEFTKAVKSLDDRSFDLYVAGRGRGVSSALTSGLADWCECPELGAVGDllvtsefess  367
             +  E   A++     +  L     GR     L   L    ECPELG VG LL++ +F ++
Sbjct  715   NATETFAAIREASRCNLVLV----GRMPDGELALALMRRSECPELGPVGCLLISPDFSAT  770

Query  366   fsvlvVQQY  340
              SVLVVQQY
Sbjct  771   ASVLVVQQY  779



>ref|NP_180750.2| cation/H(+) antiporter 21 [Arabidopsis thaliana]
 sp|Q9SKA9.2|CHX21_ARATH RecName: Full=Cation/H(+) antiporter 21; AltName: Full=Protein 
CATION/H+ EXCHANGER 21; Short=AtCHX21 [Arabidopsis thaliana]
 gb|AEC08602.1| cation/H(+) antiporter 21 [Arabidopsis thaliana]
Length=832

 Score =   417 bits (1073),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 285/820 (35%), Positives = 450/820 (55%), Gaps = 57/820 (7%)
 Frame = -3

Query  2706  PPSTGPEVDLDRLGQVVMCFSQTIYRSNGVWEGPDPLAPMIPLFILQIMTAILSSRILNF  2527
             P +   +    R G+VV C++QT         G + ++   P F+ Q+  A L+ RIL +
Sbjct  4     PAAESIDASSSRFGRVV-CYNQT------AMHGSNTISAAAPFFMTQLSVANLTYRILYY  56

Query  2526  VLKPFNQPPLVAEILSGIILGPSMLGNIEEFRKHNFPNHNFETIETMGHFALVLYAFLTG  2347
              LKP   PP VA+IL G++  P++LGN E   K  FP      +ET  + ALV   FL G
Sbjct  57    FLKPLCLPPFVAQILCGLLFSPTVLGNNEVVLKLIFPYKYTMLLETFANLALVYNVFLLG  116

Query  2346  LQMDVKAIVHTGTKSRIVAVSGSIFPFLIGAGFYFTLQTDTQSMI--GFIFCGSALTVTG  2173
             L +D++ I     K  I+A+ G +   L GAG Y+         I  G ++   A   T 
Sbjct  117   LGLDLRMIKIKDIKPVIIAIVGLLAALLAGAGLYYLPSNGEADKILAGCMYWSIAFGCTN  176

Query  2172  FSTLAKILDSKRLLNTEIGKIAASSALINVALSWVLLTIGL-LFTGS---LDNVQWAvlc  2005
             F  LA+IL   +LL T++G  A  +A++    +W+L   G+ +F+ S    + + +++  
Sbjct  177   FPDLARILADLKLLRTDMGHTAMCAAVVTDLCTWILFIFGMAIFSKSGVRNEMLPYSLAS  236

Query  2004  tvgfvvvcvnyVRPLLNWLISKTPEGQGFSEFYICSFIAVICAFGCFTDAMGSHPMIGAF  1825
             T+ FV++C   ++P + W+ + T EG    + ++   +A +      T+  G H + GAF
Sbjct  237   TIAFVLLCYFVIQPGVAWIFNNTVEGGQVGDTHVWYTLAGVIICSLITEVCGVHSITGAF  296

Query  1824  IFGLIMPNNELLRTAILDRLEDFVMGILMPVFFLVCGLRTNI----FTITDGDTSIFTAL  1657
             +FGL +P++ ++R  I ++L DF+ G+LMP+F+++CGLR +I     T++ G  ++ T+ 
Sbjct  297   LFGLSIPHDHIIRKMIEEKLHDFLSGMLMPLFYIICGLRADIGYMNRTVSVGMMAVVTSA  356

Query  1656  ALILLACSAKIIAALVASCYTGMSTNEAIGLGVLTNTKSTMVMIILEVGqvqqvlsvqqy  1477
             ++++     KI++ +  S +  +   + + +G L NTK TM ++IL  G+  + L V  Y
Sbjct  357   SVMV-----KILSTMFCSIFLRIPLRDGLAIGALMNTKGTMALVILNAGRDTKALDVIMY  411

Query  1476  smmvVACLIMTIVATPL-AARYCPKQDLEPYKRRTIQNAKPGEELRILACIHGTNNLPAI  1300
             + + +A L+M++V  PL A  Y PK+ L  YK RTIQ  K   EL +L C+H   N+  I
Sbjct  412   THLTLAFLVMSMVVQPLLAIAYKPKKKLIFYKNRTIQKHKGESELCVLTCVHVLPNVSGI  471

Query  1299  ISLLETSNSTVTSPITAFGVQLLELVGRAPA-MMvvhssgsgrhvggsHEEVQTSQIIST  1123
              +LL+ SN T  SP+  F + L+EL GR  A +++++     +         ++ QI   
Sbjct  472   TNLLQLSNPTKKSPLNVFAIHLVELTGRTTASLLIMNDEAKPKANFADRVRAESDQIAEM  531

Query  1122  FDNYELRSHGVTAQVLTARWSYDTMAEDICKMAKEKRAAFLVLPFHKQQGTDGEMEDTNP  943
             F   E+ + GV  Q +TA   Y TM EDIC +A++K+A F++LP+HK   +DG + + N 
Sbjct  532   FTALEVNNDGVMVQTITAVSPYATMDEDICLLAEDKQACFILLPYHKNMTSDGRLNEGNA  591

Query  942   AIQTVNEGVLLSAPCSVGILVERG-----------RPNQYAKNIAVLYLGGPDDREALTY  796
                 +N+ V+  APCSVGILV+RG           +     K IA+L+LGG DDREAL Y
Sbjct  592   VHAEINQNVMSHAPCSVGILVDRGMTTVRFESFMFQGETTKKEIAMLFLGGRDDREALAY  651

Query  795   ARRMSGLPGVHLTVIRFVPAKD--VSADGAVEDPDLELELTRETSFVTVSIDPARDKEED  622
             A RM G   V LTV+RFVP+++  VSA  A ++ +                   +DK  D
Sbjct  652   AWRMVGQEMVQLTVVRFVPSQEALVSAGEAADEYE-------------------KDKHVD  692

Query  621   EELLNNFRTETAEDDSKTFMELVLDDEEEFTKAVKSLDD-RSFDLYVAGRGRGVSSALTS  445
             EE +  F  +T  D S T++E V+ + +E   A+  L+D  S+DLY+ GRG  V + +TS
Sbjct  693   EESIYEFNFKTMNDPSVTYVEKVVKNGQETITAILELEDNNSYDLYIVGRGYQVETPVTS  752

Query  444   GLADWCECPELGAVGDllvtsefessfsvlvVQQYVRTNK  325
             GL DW   P+LG +GD L++S F    SVLVVQQY   N+
Sbjct  753   GLTDWNSTPDLGIIGDTLISSNFTMQASVLVVQQYSSANR  792



>ref|XP_009402488.1| PREDICTED: cation/H(+) antiporter 19-like [Musa acuminata subsp. 
malaccensis]
Length=792

 Score =   416 bits (1068),  Expect = 7e-127, Method: Compositional matrix adjust.
 Identities = 273/787 (35%), Positives = 440/787 (56%), Gaps = 52/787 (7%)
 Frame = -3

Query  2655  MCFSQTIYRSNGVWEGPDPLAPMIPLFILQIMTAILSSRILNFVLKPFNQPPLVAEILSG  2476
             +C +     SNG W+G +PL   +PL ILQI   ++ +R L F+L+P  QP +VAEI+ G
Sbjct  6     VCPAPMTATSNGSWDGDNPLHHSLPLIILQICLVLVVTRSLAFLLRPLRQPRVVAEIIGG  65

Query  2475  IILGPSMLGNIEEFRKHNFPNHNFETIETMGHFALVLYAFLTGLQMDVKAIVHTGTKSRI  2296
             I+LGPS LG  + F  + FP      ++T+ +  L+ + FL GL++D+++I  TG  +  
Sbjct  66    ILLGPSALGRSKRFTDNVFPKQGMTVLDTLANIGLLFFLFLVGLELDLRSIRRTGKGALA  125

Query  2295  VAVSGSIFPFLIGAG----FYFTLQTDTQSMIGFIFCGSALTVTGFSTLAKILDSKRLLN  2128
             +A++G   PF++G G       T+    +     +F G AL++T F  LA+IL   RLL 
Sbjct  126   IAIAGITLPFVLGIGTSVVLRHTIVEGARQGPFLVFMGVALSITAFPVLARILAELRLLT  185

Query  2127  TEIGKIAASSALINVALSWVLLTIGLLFTGSLDNV--QWAvlctvgfvvvcvnyVRPLLN  1954
             T++G++A S+A +N  ++W+LL + +  +GS   +   W +L  +GFV     ++RP+L 
Sbjct  186   TDLGRMAMSAAAVNDVVAWILLALAIALSGSGSPLISLWVLLTGIGFVACVAIFLRPVLA  245

Query  1953  WLISKTPEGQGFSEFYICSFIAVICAFGCFTDAMGSHPMIGAFIFGLIMPNNELLRTAIL  1774
             W+  ++ EG+   E Y+C+ +A++ A G  TDA+G H + GAF+ G+++P +      I+
Sbjct  246   WMARRSLEGEPVKESYVCATLAIVLAAGFVTDAIGIHALFGAFMVGVVVPKDGPFAAVII  305

Query  1773  DRLEDFVMGILMPVFFLVCGLRTNIFTITDGDTSIFTALALILLACSAKIIAALVASCYT  1594
             +++ED V G+ +P++F+  GL+TN+ TI  G  S    + +I  AC  KI   +VAS   
Sbjct  306   EKVEDLVSGLFLPLYFVSSGLKTNVATI-RGARSWGLLVLVITNACLGKIAGTVVASLIV  364

Query  1593  GMSTNEAIGLGVLTNTKSTMVMIILEVGqvqqvlsvqqysmmvVACLIMTIVATPLA-AR  1417
              +   EA  LG L NTK  + +I+L +G+ ++VL+ + +++MV+  L  T + TP+    
Sbjct  365   KIPIREAFTLGFLMNTKGLVELIVLNIGKDRKVLNDETFAIMVLMALFTTFITTPIVMGI  424

Query  1416  YCPKQDLEPYKRRTIQNAKPGEELRILACIHGTNNLPAIISLLETSNSTVTSPITAFGVQ  1237
             Y P +   PYK RT++ +    ELR+LAC HG  N+P II+L+E S      P+  + + 
Sbjct  425   YKPARRAAPYKHRTVERSHVDSELRVLACFHGVRNIPTIINLVEISRGIRHRPLAVYALH  484

Query  1236  LLELVGRAPAMMvvhssgsgrhvggsHEEVQTSQIISTFDNYELRSHGVTAQVLTARWSY  1057
             L+EL  R+ A+ +VH +        +  +     ++  F+ Y+  S  V  + +TA +  
Sbjct  485   LMELSERSSAISMVHKARRNGLPFWNRRD-NAGHMVVAFEAYQQLS-AVNIRPMTAIYDL  542

Query  1056  DTMAEDICKMAKEKRAAFLVLPFHKQQGTDGEMEDTNPAIQTVNEGVLLSAPCSVGILVE  877
             DT+ EDI   A +KRAA ++LPFHK Q  DG +E        +N+ VL  APCSV I+V+
Sbjct  543   DTIHEDIVASALQKRAALILLPFHKMQQLDGTLESVGHPYHLINQRVLRHAPCSVAIVVD  602

Query  876   RG-------RPNQYAKNIAVLYLGGPDDREALTYARRMSGLPGVHLTVIRFVPAKDVSAD  718
             RG         ++ +  + VL+ GGPDDREAL+Y   M+  PG+ LTV+RF+PA      
Sbjct  603   RGLGGTAQVSSSEVSYTVVVLFFGGPDDREALSYGGLMAEHPGIALTVLRFLPAP-----  657

Query  717   GAVEDPDLELELTRETSFVTVSIDPARDKEEDEELLNNFRTET-AEDDSKTFMELVLDDE  541
               VE+ D                       EDE  ++ FR+ + + D S T+ E    D 
Sbjct  658   --VENVD--------------------RSAEDEACISKFRSNSQSSDGSLTYEESAAADM  695

Query  540   EEFTKAVKSLDDRSFDLYVAGRGRGVSSALTSGLADWCECPELGAVGDllvtsefessfs  361
                  A+K+L  R  +L++ GR     S     L +  +CPELG VG  LV++EF ++ S
Sbjct  696   AGIIAAIKNLGRR--NLFLVGR-----SPPAVALVEKSDCPELGPVGSYLVSAEFSTTAS  748

Query  360   vlvVQQY  340
             VL++Q+Y
Sbjct  749   VLIIQRY  755



>ref|XP_008798688.1| PREDICTED: cation/H(+) antiporter 18-like [Phoenix dactylifera]
Length=808

 Score =   416 bits (1069),  Expect = 9e-127, Method: Compositional matrix adjust.
 Identities = 289/782 (37%), Positives = 449/782 (57%), Gaps = 38/782 (5%)
 Frame = -3

Query  2628  SNGVWEGPDPLAPMIPLFILQIMTAILSSRILNFVLKPFNQPPLVAEILSGIILGPSMLG  2449
             SNGV++G +PL   +PL ILQI   I+ +R L F+L+P  QP ++AEI+ GI+LGPS LG
Sbjct  17    SNGVFQGDNPLHSALPLAILQICLVIVITRCLAFLLRPLRQPRVIAEIIGGILLGPSALG  76

Query  2448  NIEEFRKHNFPNHNFETIETMGHFALVLYAFLTGLQMDVKAIVHTGTKSRIVAVSGSIFP  2269
               + FR   FP  +   ++T+ +  L+ + FL GL+++ K++  TG ++  +A++G   P
Sbjct  77    RSKAFRHVVFPPSSLTVLDTLANLGLLFFLFLVGLELEPKSLRRTGKRAVGIAIAGISLP  136

Query  2268  FLIGAG----FYFTLQTDTQSMIGFIFCGSALTVTGFSTLAKILDSKRLLNTEIGKIAAS  2101
             F++G G       T+    Q     +F G AL++T F  LA+IL   +LL T+IG++A S
Sbjct  137   FVLGIGTSVVLRHTISKGVQGAPFQVFIGVALSITAFPVLARILAELKLLTTDIGRMAMS  196

Query  2100  SALINVALSWVLLTIGLLFTGSLDN---VQWAvlctvgfvvvcvnyVRPLLNWLISKTPE  1930
             +A +N   +W+LL + +  +GS  +     W +LC VGFV+ C+  VRP+L W+  +TPE
Sbjct  197   AAAVNDVAAWILLALAIALSGSSHSPLISLWVLLCGVGFVLFCIILVRPILAWIARRTPE  256

Query  1929  GQGFSEFYICSFIAVICAFGCFTDAMGSHPMIGAFIFGLIMPNNELLRTAILDRLEDFVM  1750
             G+   E Y+C+ +A + +    TDA+G H + GAFI G+++P +     A+++++ED V 
Sbjct  257   GEPIGEIYVCATLAAVLSASFVTDAIGIHALFGAFIIGVLVPKDGPFAGAMVEKVEDLVS  316

Query  1749  GILMPVFFLVCGLRTNIFTITDGDTSIFTALALILLACSAKIIAALVASCYTGMSTNEAI  1570
             G+ +P++F+  GL+TN+ TI  G  S    + +IL +C  KI   +  S    M   EA+
Sbjct  317   GLFLPLYFVSSGLKTNVATI-QGAQSWGLLVLVILTSCLGKIAGTVGVSIACRMPFREAL  375

Query  1569  GLGVLTNTKSTMVMIILEVGqvqqvlsvqqysmmvVACLIMTIVATPLA-ARYCP-KQDL  1396
              LG L NTK  + +I+L +G+ ++VL+ Q +++ V+  L+ T + TPL  A Y P ++  
Sbjct  376   ALGFLMNTKGLVELIVLNIGKDRKVLNDQTFAIFVLMALVTTFITTPLVTAVYKPARKSS  435

Query  1395  EPYKRRTIQNAKPGEELRILACIHGTNNLPAIISLLETSNST-VTSPITAFGVQLLELVG  1219
               YK R I+  +   +LRILAC H T N+P II+L+E    T     +  + + L+EL  
Sbjct  436   TVYKHRRIERIESSTQLRILACFHSTRNIPTIINLIEACRGTNRREGLCVYAMHLMELSE  495

Query  1218  RAPA-MMvvhssgsgrhvggsHEEVQTSQIISTFDNYELRSHGVTAQVLTARWSYDTMAE  1042
             R  A +MV  +  +G        +    Q++  F+ +E R   V+ + +TA  +   + E
Sbjct  496   RPSAILMVHKARKNGLPFWNKTPQSGHDQVVVAFEAFE-RLSNVSIRPMTAISALTDIHE  554

Query  1041  DICKMAKEKRAAFLVLPFHKQQGTDGEMEDTNPAIQTVNEGVLLSAPCSVGILVERG---  871
             DIC  A+ K+AA ++LPFHK Q  DG +E T    + VN  VL  APCSVGILV+RG   
Sbjct  555   DICASAERKKAAVIILPFHKHQRLDGTLEMTRHDFRLVNRKVLEHAPCSVGILVDRGLGG  614

Query  870   ----RPNQYAKNIAVLYLGGPDDREALTYARRMSGLPGVHLTVIRFVPAKDVSADGAVED  703
                   +  + +I  L+ GGPDDREALTYA RM+  PG+ LTV+ F      S  G    
Sbjct  615   TTHVSASDVSSSITALFFGGPDDREALTYATRMAEHPGIQLTVLHF----SESGHG----  666

Query  702   PDLELELTRETSFVTVSIDPARDKE-EDEELLNNFRTETAEDDSKTFMELVLDDEEEFTK  526
                      E+  V V+ D + ++   DEE+LN FR +T +D    + E V+   +E   
Sbjct  667   ------FQGESIAVDVNADSSSERRLADEEVLNEFRNKTRKDSVIRYEERVVASRDEIVA  720

Query  525   AVKSLDDRSFDLYVAGRGRGVSSALTSGLADWCECPELGAVGDllvtsefessfsvlvVQ  346
             A++++  RS DL + GR R   +A  + + +  ECPELG VG LL +  F ++ SVLVVQ
Sbjct  721   AIQTV-SRS-DLILVGR-RPEGAAAAALVTERSECPELGPVGGLLTSPSFSTTASVLVVQ  777

Query  345   QY  340
             QY
Sbjct  778   QY  779



>ref|XP_010533613.1| PREDICTED: cation/H(+) antiporter 18-like [Tarenaya hassleriana]
Length=808

 Score =   416 bits (1068),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 280/787 (36%), Positives = 443/787 (56%), Gaps = 44/787 (6%)
 Frame = -3

Query  2628  SNGVWEGPDPLAPMIPLFILQIMTAILSSRILNFVLKPFNQPPLVAEILSGIILGPSMLG  2449
             SNGV++G +P+   +PL ILQI   +  +R L ++L+P  QP ++AE++ GI+LGPS+LG
Sbjct  20    SNGVFQGDNPIDFALPLAILQICIVVALTRGLAYLLRPLRQPRVIAEVIGGIMLGPSLLG  79

Query  2448  NIEEFRKHNFPNHNFETIETMGHFALVLYAFLTGLQMDVKAIVHTGTKSRIVAVSGSIFP  2269
               + +    FP+ +   +ET+ +  ++ + FL GL++D  ++  TG K+  +A +G   P
Sbjct  80    RSKGYLNTIFPSKSLTVLETLANLGILFFLFLAGLEIDTGSLRRTGKKALAIAAAGISLP  139

Query  2268  FLIGAGFYFTLQ-TDTQSMIG---FIFCGSALTVTGFSTLAKILDSKRLLNTEIGKIAAS  2101
             F++G G  F L+ T ++ + G    IF G AL++T F  LA+IL   +LL T+IG++A S
Sbjct  140   FVMGIGSSFVLKATISKGVDGTAFLIFMGVALSITAFPVLARILAELKLLTTDIGRLAMS  199

Query  2100  SALINVALSWVLLTIGLLFTGSLDN---VQWAvlctvgfvvvcvnyVRPLLNWLISKTPE  1930
             +A +N   +W+LL + +  +GS  +     W  L   GFV + +  + P+  W+ S+  E
Sbjct  200   AAAVNDVAAWILLALAIALSGSNTSPLVSLWVFLGGCGFVTLAILIIPPVFRWIGSRCHE  259

Query  1929  GQGFSEFYICSFIAVICAFGCFTDAMGSHPMIGAFIFGLIMPNNELLRTAILDRLEDFVM  1750
             G+  +E YIC+ + ++ A G  TDA+G H M GAF+ G+++P       A+++++ED V 
Sbjct  260   GEPINETYICAALTIVLACGFVTDAVGIHAMFGAFVVGVLIPKEGPFAGALVEKVEDLVS  319

Query  1749  GILMPVFFLVCGLRTNIFTITDGDTSIFTALALILLACSAKIIAALVASCYTGMSTNEAI  1570
             G+ +P++F+  GL+TN+ TI  G  S    + +I  AC  KI+  L  S    + T EA+
Sbjct  320   GLFLPLYFVASGLKTNVATI-QGLQSWGLLVLVIFTACFGKIVGTLAVSLALKVPTREAV  378

Query  1569  GLGVLTNTKSTMVMIILEVGqvqqvlsvqqysmmvVACLIMTIVATPL-AARYCP-KQDL  1396
              LG L NTK  + +I+L +G+ ++VL+ Q +++MV+  L  T + TP+  A Y P ++  
Sbjct  379   ALGFLMNTKGLVELIVLNIGKDRKVLNDQTFAIMVLMALFTTFITTPIVVAVYKPARRSK  438

Query  1395  EP--YKRRTIQNAKPGEELRILACIHGTNNLPAIISLLETSNSTVTSP-ITAFGVQLLEL  1225
             +P  YK RTI+   P  +LRIL+C HGT N+P++I+LLE S        +  + + L E 
Sbjct  439   KPDDYKHRTIERESPSSQLRILSCFHGTRNIPSMINLLEASRGIEKGEDLCVYALHLREF  498

Query  1224  VGRAPAMMvvhssgsgrhvggsHEEVQTS---QIISTFDNYELRSHGVTAQVLTARWSYD  1054
               R+ A+++V+          + + V  S   Q++  F  ++  S  VT + +TA  S  
Sbjct  499   SERSSAILMVNKVRKNGLPFWNRKSVGGSNADQVVVAFQAFQQLSR-VTVRPMTAISSLS  557

Query  1053  TMAEDICKMAKEKRAAFLVLPFHKQQGTDGEMEDTNPAIQTVNEGVLLSAPCSVGILVER  874
              + EDIC  A +KRAA ++LPFHK Q  DG +E T      VN  VL +APCSVGI V+R
Sbjct  558   DIHEDICTTAAKKRAAIIILPFHKHQRLDGSLETTRSDYGWVNRKVLQNAPCSVGIFVDR  617

Query  873   G-------RPNQYAKNIAVLYLGGPDDREALTYARRMSGLPGVHLTVIRFVPAKDVSADG  715
             G            A ++ VL+ GG DD EAL Y  RM+  PG+ LTVIRF+ + + S  G
Sbjct  618   GLGGSTHVSAKDVAYSVVVLFFGGRDDHEALAYGLRMAEHPGIALTVIRFIVSPEKS--G  675

Query  714   AVEDPDLELELTRETSFVTVSIDP-ARDKEEDEELLNNFRTETAEDDSKTFME-LVLDDE  541
              +   D++ +            DP AR+   DEE+L+  R   + ++S  F E  V    
Sbjct  676   EIVRVDVKND------------DPAARNFRSDEEVLSEIRKRASVEESIKFEEKRVGKAA  723

Query  540   EEFTKAVKSLDDRSFDLYVAGRGRGVSSALTSGLADWCECPELGAVGDllvtsefessfs  361
              +   AV+ +   S  L     GR     +   L +  ECPELG +G LL++ E  ++ S
Sbjct  724   TDVASAVEEVRRSSLFLV----GRMPEGEIAVALREKIECPELGPIGSLLISPESPTAAS  779

Query  360   vlvVQQY  340
             VLVVQQY
Sbjct  780   VLVVQQY  786



>ref|XP_006476457.1| PREDICTED: cation/H(+) antiporter 18-like isoform X2 [Citrus 
sinensis]
Length=797

 Score =   412 bits (1060),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 272/765 (36%), Positives = 413/765 (54%), Gaps = 47/765 (6%)
 Frame = -3

Query  2628  SNGVWEGPDPLAPMIPLFILQIMTAILSSRILNFVLKPFNQPPLVAEILSGIILGPSMLG  2449
             SNGV++G  PL   +PL ILQI   IL +R L F+L+P  QP ++AEI  GI+LGPS LG
Sbjct  16    SNGVFQGDSPLDFALPLAILQICLVILLTRGLAFILRPLRQPRVIAEITGGILLGPSALG  75

Query  2448  NIEEFRKHNFPNHNFETIETMGHFALVLYAFLTGLQMDVKAIVHTGTKSRIVAVSGSIFP  2269
               E F +  FP  +   ++T+ +  L+ + FL GL++D K++  TG K+  +A++G   P
Sbjct  76    RSERFLQAVFPPKSQTVLDTLANLGLIFFMFLVGLELDPKSLRQTGKKALGIAIAGISLP  135

Query  2268  FLIGAGFYFTLQ------TDTQSMIGFIFCGSALTVTGFSTLAKILDSKRLLNTEIGKIA  2107
             F +G G  F L+       D++S +  +F G AL++T F  LA+IL   +LL  ++G++A
Sbjct  136   FALGIGSSFLLRETISKGVDSRSFL--VFMGVALSITAFPVLARILAELKLLTADVGRMA  193

Query  2106  ASSALINVALSWVLLTIGLLFTGSLDNV---QWAvlctvgfvvvcvnyVRPLLNWLISKT  1936
              S+A +N   +W+LL + +  +GS  +     W  L    FV+     V P   W+  + 
Sbjct  194   MSAAAVNDVAAWILLALAVALSGSGQSSLVPVWVFLSGCVFVICLTLLVPPTFKWMARQC  253

Query  1935  PEGQGFSEFYICSFIAVICAFGCFTDAMGSHPMIGAFIFGLIMPNNELLRTAILDRLEDF  1756
              EG+   E Y+C+ +A + A G  TDA+G H M GAF+ G+++P      +A+++++ED 
Sbjct  254   HEGEPVEETYVCATLAAVLAAGFITDAIGIHAMFGAFVVGVLVPKEGPFASALVEKVEDL  313

Query  1755  VMGILMPVFFLVCGLRTNIFTITDGDTSIFTALALILLACSAKIIAALVASCYTGMSTNE  1576
             V GI +P++F+  GL+TNI TI    +    AL +IL AC  KI+   V S    +   E
Sbjct  314   VSGIFLPLYFVSSGLKTNIATIQGLQSWGLLAL-VILTACLGKIVGTFVVSLSFKVPLRE  372

Query  1575  AIGLGVLTNTKSTMVMIILEVGqvqqvlsvqqysmmvVACLIMTIVATPLA-ARYCP--K  1405
             A+ LG+L NTK  + +I+L +G+ ++VL+ Q +++MV+  ++ T + TPL  A Y P  +
Sbjct  373   ALALGILMNTKGLVELIVLNIGKDRKVLNDQVFAIMVLMAVVTTFMTTPLVMAVYKPARR  432

Query  1404  QDLEPYKRRTIQNAKPGEELRILACIHGTNNLPAIISLLETSNSTVTSP-ITAFGVQLLE  1228
               +  YK RT++      + RILAC H   N+P+ I+LLE       S  +  + + L+E
Sbjct  433   ARVADYKHRTVERKNSKAQFRILACFHSARNIPSTINLLEALRGIQKSEGLCVYALHLME  492

Query  1227  LVGRAPA-MMvvhssgsgrhvggsHEEVQTSQIISTFDNYELRSHGVTAQVLTARWSYDT  1051
             L  R+ A +MV  +  +G        +   + I+  F+ ++  S  V+ + +TA  S   
Sbjct  493   LSERSSAILMVHKARRNGLPFWNRGRQSNPNHIVVAFEAFQQLSR-VSVRPMTAISSMSD  551

Query  1050  MAEDICKMAKEKRAAFLVLPFHKQQGTDGEMEDTNPAIQTVNEGVLLSAPCSVGILVERG  871
             M EDIC  A+ KRAA ++LPFHK Q  DG +E T    + VN+ VL  APCSVGIL++RG
Sbjct  552   MHEDICTTAESKRAAIIILPFHKHQRLDGSLETTRSDFRWVNQRVLKHAPCSVGILIDRG  611

Query  870   -------RPNQYAKNIAVLYLGGPDDREALTYARRMSGLPGVHLTVIRFVPAKDVSADGA  712
                      +  +  I VL+ GG DDREAL    RM+  PG+   VIRF+ A D   +  
Sbjct  612   LGGTTQVSASNVSYTITVLFFGGRDDREALACGARMAEHPGISFIVIRFLLAADTIGN--  669

Query  711   VEDPDLELELTRETSFVTVSIDPARDKEEDEELLNNFRTETAEDDSKTFMELVLDDEEEF  532
                              TVS+D A +   DEE+L+ F+ +T+  D     E  L      
Sbjct  670   -----------------TVSVDMAGNASMDEEVLSEFKLKTSHRDGSVRYEERLVRNTTE  712

Query  531   TKAVKSLDDRSFDLYVAGRGRGVSSALTSGLADWCECPELGAVGD  397
             T AV     R   L V   GR     L   L+   +CPELG VG 
Sbjct  713   TIAVIREVSRCNLLLV---GRMPDGELALALSTRSDCPELGPVGS  754



>ref|XP_004512035.1| PREDICTED: cation/H(+) antiporter 15-like [Cicer arietinum]
Length=813

 Score =   413 bits (1061),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 270/792 (34%), Positives = 436/792 (55%), Gaps = 34/792 (4%)
 Frame = -3

Query  2652  CFSQTIYRSNGVWEGPDPLAPMIPLFILQIMTAILSSRILNFVLKPFNQPPLVAEILSGI  2473
             C+  ++   + +W+  + L   +P+   QI+  +L SR+  F+ KP +QP ++++I +G 
Sbjct  10    CYQMSVVNPSRIWQTDNVLKKELPILAFQIVFVVLLSRLFFFIYKPLHQPRIISQISAGF  69

Query  2472  ILGPSMLGNIEEFRKHNFPNHNFETIETMGHFALVLYAFLTGLQMDVKAIVHTGTKSRIV  2293
             +L P  LG      +  FP +    IE + H  ++ YAFL+GL+M++  I+H   K+  +
Sbjct  70    LLTPPFLGRYTSIFQFIFPVNGVFNIEVLAHIGIIYYAFLSGLEMNLNTILHVKKKAASI  129

Query  2292  AVSGSIFPFLIGAGFYFTLQTDT-----------QSMIGFIFCGSALTVTGFSTLAKILD  2146
             AV+G IFP ++G   Y TL   T            +M  ++     LTVTGF  +A  L 
Sbjct  130   AVAGIIFPMIMGPALY-TLHRKTYGKGDGSEIEESTMNAYLLWTLVLTVTGFPVIAHTLS  188

Query  2145  SKRLLNTEIGKIAASSALINVALSWVLLTIGLLFTGSLDNVQWAvlctvgfvvvcvnyVR  1966
               +LL T +GK A ++A+I+   +W+L T+ + F+ +     ++V+ T+ FV +C++ VR
Sbjct  189   ELKLLYTGLGKAALTAAMISDTYAWILFTLFVPFSINGTKAIYSVVSTIIFVFICISVVR  248

Query  1965  PLLNWLISKTPEGQGFSEFYICSFIAVICAFGCFTDAMGSHPMIGAFIFGLIMPNNEL--  1792
             P++  +I +  E   + +      +  +  F   TD +G+H ++GAF++GLI+P+     
Sbjct  249   PIIVKIIDRKTERDEWDDGQFLYVVMGLLVFSHITDVLGTHAIVGAFVYGLILPHGRFAD  308

Query  1791  LRTAILDRLEDFVMGILMPVFFLVCGLRTNIFTITDGDTSIFTALALILLACSAKIIAAL  1612
             +  +I D   DF  G L P+FF   G++  + TI   D  + T + + +L C  KI++ L
Sbjct  309   MVASISD---DFGGGFLAPLFFSGNGMKLMVTTIFYQDNWLATIIII-ILLCVPKILSTL  364

Query  1611  VASCYTGMSTNEAIGLGVLTNTKSTMVMIILEVGqvqqvlsvqqysmmvVACLIMTIVAT  1432
              A+ + GM T +   LG++ NTK  + +I+L +   + ++SV  Y ++  A L+MTIV +
Sbjct  365   FATFFFGMRTRDGFSLGLILNTKGAIALIMLNIAWDRSIVSVPTYVVLTSAVLLMTIVVS  424

Query  1431  P-LAARYCPKQDLEPYKRRTIQNAKPGEELRILACIHGTNNLPAIISLLETSNSTVTSPI  1255
             P + A Y P++  E  K +TIQ  +   ELRILAC+H +     IISL+E+ N+T  SPI
Sbjct  425   PVINAIYKPRKRFEQNKLKTIQKLRVDAELRILACVHNSRQAVGIISLIESFNATRLSPI  484

Query  1254  TAFGVQLLELVGRAPAMMvvhssgsg---rhvggsHEEVQTSQIISTFDNYELRSHGVTA  1084
               F + L+EL GRA A++  H             +  +V+   I  TFD++      V  
Sbjct  485   HVFALYLVELTGRAAALVAAHMEKPSGQPGMQNLTKSQVELENINDTFDSFGEAYDAVRV  544

Query  1083  QVLTARWSYDTMAEDICKMAKEKRAAFLVLPFHKQQGTDGEMEDTNPAIQTVNEGVLLSA  904
             Q L    +Y T+ EDI   A EKR + ++LPFHKQ  ++G +E TN   + +N  V+ SA
Sbjct  545   QTLNVVSAYATIHEDIYNSANEKRTSLVLLPFHKQLSSEGALETTNVVYRDINLNVMNSA  604

Query  903   PCSVGILVER--GRPNQYAKNIAVLYLGGPDDREALTYARRMSGLPGVHLTVIRFVPAKD  730
             PCSVG+ V+R  G   +    I ++++GGPDDREAL  A RMSG PG+ L+V+R      
Sbjct  605   PCSVGVFVDRDLGSLPKLNFRIRMIFVGGPDDREALAVAWRMSGHPGIRLSVVRI-----  659

Query  729   VSADGAVE-DPDLELELTRETSFVTVSIDPARDKEEDEELLNNFR-TETAEDDSKTFMEL  556
             +  D A E D     E       ++  +D  + KE D+E +N+FR T    DDS ++ E+
Sbjct  660   LLFDEATEIDTSFHAE---AQGILSAVMDSEKQKELDDEYVNSFRLTAVNNDDSISYSEV  716

Query  555   VLDDEEEFTKAVKSLDDRSFDLYVAGRGRGVSSALTSGLADWCECPELGAVGDllvtsef  376
              +   E+    +  LD    DLY+ G+G   +  + S L +WC+C ELG +GD+L ++ F
Sbjct  717   DVHSGEDIPTVLNELDKFGCDLYIVGQGNCRNLRVFSNLLEWCDCSELGVIGDILASNNF  776

Query  375   essfsvlvVQQY  340
              S  SVLVVQQY
Sbjct  777   GSRSSVLVVQQY  788



>gb|EYU23396.1| hypothetical protein MIMGU_mgv1a001514mg [Erythranthe guttata]
Length=804

 Score =   412 bits (1060),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 277/780 (36%), Positives = 434/780 (56%), Gaps = 35/780 (4%)
 Frame = -3

Query  2628  SNGVWEGPDPLAPMIPLFILQIMTAILSSRILNFVLKPFNQPPLVAEILSGIILGPSMLG  2449
             SNGV++G +PL   +PL I+QI   +  +R L ++L+P  QP ++AEI+ GI+LGPS LG
Sbjct  18    SNGVFQGDNPLHFSLPLLIIQICLVVALTRALAYLLRPLRQPRVIAEIIGGILLGPSALG  77

Query  2448  NIEEFRKHNFPNHNFETIETMGHFALVLYAFLTGLQMDVKAIVHTGTKSRIVAVSGSIFP  2269
               +++    FP  +   ++T+ +  L+ + FL GL++D KA+  TG K+  +A++G   P
Sbjct  78    RNQKYLHAVFPARSLTVLDTIANLGLLFFLFLVGLELDPKALRRTGKKALSIALAGITLP  137

Query  2268  FLIGAGFYFTLQTDTQSMIG----FIFCGSALTVTGFSTLAKILDSKRLLNTEIGKIAAS  2101
             F +G G  F L++     +      +F G A+++T F  LA+IL   +LL T++G++A S
Sbjct  138   FALGIGTSFVLRSTISKDVAQGPFLVFMGVAVSITAFPVLARILAELKLLTTDVGRMAMS  197

Query  2100  SALINVALSWVL--LTIGLLFTGSLDNVQWAvlctvgfvvvcvnyVRPLLNWLISKTPEG  1927
             +A +N   +W+L  L I L  TGS     W  L   GF+ +C+     L  W++ + PEG
Sbjct  198   AAAVNDVAAWILLALAIALSGTGSPLVSLWVFLSGSGFITLCIFVAPLLFKWMVKRCPEG  257

Query  1926  QGFSEFYICSFIAVICAFGCFTDAMGSHPMIGAFIFGLIMPNNELLRTAILDRLEDFVMG  1747
             +   E Y+C+ +A + A G  TD +G H + GAF+ G+++P       A+++++ED V G
Sbjct  258   EPVDEIYVCATLAAVLAAGLVTDTIGIHALFGAFVLGVLVPKEGPFAGALVEKVEDLVSG  317

Query  1746  ILMPVFFLVCGLRTNIFTITDGDTSIFTALALILLACSAKIIAALVASCYTGMSTNEAIG  1567
             + +P++F+  GL+TN+ TI  G +     L +I  AC  KI+  +V S    +   EA+ 
Sbjct  318   LFLPLYFVSSGLKTNVATIQGGQSWGLLVL-VIFTACFGKIVGTVVVSLLCKIPFREALV  376

Query  1566  LGVLTNTKSTMVMIILEVGqvqqvlsvqqysmmvVACLIMTIVATPL-AARYCP-KQDLE  1393
             LG L NTK  + +I+L +G+ + VL+ Q +++MV+  L  T + TP+  A Y P +    
Sbjct  377   LGFLMNTKGLVELIVLNIGKDRGVLNDQTFAIMVLMALFTTFITTPIVVALYKPARMAAS  436

Query  1392  PYKRRTIQNAKPGEELRILACIHGTNNLPAIISLLETSNST-VTSPITAFGVQLLELVGR  1216
              YK RTIQ   P  +LR+L C H T ++P +I+L+ETS  T     +  F + L+EL  R
Sbjct  437   DYKHRTIQRKDPNTQLRLLTCFHSTRSIPTLINLMETSRGTGKRGGLRVFAMHLMELSER  496

Query  1215  APA-MMvvhssgsgrhvggsHEEVQTSQIISTFDNYELRSHGVTAQVLTARWSYDTMAED  1039
             + A +MV  +  +G       E   T+Q++  F+ +E  S  V+ +  TA  +  +M ED
Sbjct  497   SSAILMVHKARKNGAPFWNKAESTDTNQVVVAFEAFEQLSQ-VSIRPTTAISAMSSMHED  555

Query  1038  ICKMAKEKRAAFLVLPFHKQQGTDGEMEDTNPAIQTVNEGVLLSAPCSVGILVERG----  871
             IC  A+ K+AA ++LPFHK Q  DG +E T   ++ VN  VL  APCSVGILV+RG    
Sbjct  556   ICSSAQGKKAAVIILPFHKHQRIDGHLETTRSDLRHVNRRVLEHAPCSVGILVDRGLGGA  615

Query  870   ---RPNQYAKNIAVLYLGGPDDREALTYARRMSGLPGVHLTVIRFVPAKDVSADGAVEDP  700
                  +     I VL+ GGPDDREAL+Y   M+  PG++L V+RFV       D  V   
Sbjct  616   AHIAASNVNYTITVLFFGGPDDREALSYGAIMAEHPGINLNVVRFV------VDSKVAGE  669

Query  699   DLELELTRETSFVTVSIDPARDKEEDEELLNNFRTETAEDDSKTFMELVLDDEEEFTKAV  520
              + L++           +   D+ +DEE ++ FR   ++  S  F E V+    E    +
Sbjct  670   SVRLDIDGNDG------NRPEDRSDDEEFISEFRERVSKAGSIKFEECVVGGAAEAMAVI  723

Query  519   KSLDDRSFDLYVAGRGRGVSSALTSGLADWCECPELGAVGDllvtsefessfsvlvVQQY  340
             +S +  +  L     GR     L + L    ECPELG +G LLV+ E  ++ SVLV+QQY
Sbjct  724   RSHNVSNLFLV----GRIPEGQLVAALDKKGECPELGPIGKLLVSPEMSTAASVLVMQQY  779



>ref|XP_006476456.1| PREDICTED: cation/H(+) antiporter 18-like isoform X1 [Citrus 
sinensis]
Length=809

 Score =   412 bits (1060),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 272/765 (36%), Positives = 413/765 (54%), Gaps = 47/765 (6%)
 Frame = -3

Query  2628  SNGVWEGPDPLAPMIPLFILQIMTAILSSRILNFVLKPFNQPPLVAEILSGIILGPSMLG  2449
             SNGV++G  PL   +PL ILQI   IL +R L F+L+P  QP ++AEI  GI+LGPS LG
Sbjct  28    SNGVFQGDSPLDFALPLAILQICLVILLTRGLAFILRPLRQPRVIAEITGGILLGPSALG  87

Query  2448  NIEEFRKHNFPNHNFETIETMGHFALVLYAFLTGLQMDVKAIVHTGTKSRIVAVSGSIFP  2269
               E F +  FP  +   ++T+ +  L+ + FL GL++D K++  TG K+  +A++G   P
Sbjct  88    RSERFLQAVFPPKSQTVLDTLANLGLIFFMFLVGLELDPKSLRQTGKKALGIAIAGISLP  147

Query  2268  FLIGAGFYFTLQ------TDTQSMIGFIFCGSALTVTGFSTLAKILDSKRLLNTEIGKIA  2107
             F +G G  F L+       D++S +  +F G AL++T F  LA+IL   +LL  ++G++A
Sbjct  148   FALGIGSSFLLRETISKGVDSRSFL--VFMGVALSITAFPVLARILAELKLLTADVGRMA  205

Query  2106  ASSALINVALSWVLLTIGLLFTGSLDNV---QWAvlctvgfvvvcvnyVRPLLNWLISKT  1936
              S+A +N   +W+LL + +  +GS  +     W  L    FV+     V P   W+  + 
Sbjct  206   MSAAAVNDVAAWILLALAVALSGSGQSSLVPVWVFLSGCVFVICLTLLVPPTFKWMARQC  265

Query  1935  PEGQGFSEFYICSFIAVICAFGCFTDAMGSHPMIGAFIFGLIMPNNELLRTAILDRLEDF  1756
              EG+   E Y+C+ +A + A G  TDA+G H M GAF+ G+++P      +A+++++ED 
Sbjct  266   HEGEPVEETYVCATLAAVLAAGFITDAIGIHAMFGAFVVGVLVPKEGPFASALVEKVEDL  325

Query  1755  VMGILMPVFFLVCGLRTNIFTITDGDTSIFTALALILLACSAKIIAALVASCYTGMSTNE  1576
             V GI +P++F+  GL+TNI TI    +    AL +IL AC  KI+   V S    +   E
Sbjct  326   VSGIFLPLYFVSSGLKTNIATIQGLQSWGLLAL-VILTACLGKIVGTFVVSLSFKVPLRE  384

Query  1575  AIGLGVLTNTKSTMVMIILEVGqvqqvlsvqqysmmvVACLIMTIVATPLA-ARYCP--K  1405
             A+ LG+L NTK  + +I+L +G+ ++VL+ Q +++MV+  ++ T + TPL  A Y P  +
Sbjct  385   ALALGILMNTKGLVELIVLNIGKDRKVLNDQVFAIMVLMAVVTTFMTTPLVMAVYKPARR  444

Query  1404  QDLEPYKRRTIQNAKPGEELRILACIHGTNNLPAIISLLETSNSTVTSP-ITAFGVQLLE  1228
               +  YK RT++      + RILAC H   N+P+ I+LLE       S  +  + + L+E
Sbjct  445   ARVADYKHRTVERKNSKAQFRILACFHSARNIPSTINLLEALRGIQKSEGLCVYALHLME  504

Query  1227  LVGRAPA-MMvvhssgsgrhvggsHEEVQTSQIISTFDNYELRSHGVTAQVLTARWSYDT  1051
             L  R+ A +MV  +  +G        +   + I+  F+ ++  S  V+ + +TA  S   
Sbjct  505   LSERSSAILMVHKARRNGLPFWNRGRQSNPNHIVVAFEAFQQLSR-VSVRPMTAISSMSD  563

Query  1050  MAEDICKMAKEKRAAFLVLPFHKQQGTDGEMEDTNPAIQTVNEGVLLSAPCSVGILVERG  871
             M EDIC  A+ KRAA ++LPFHK Q  DG +E T    + VN+ VL  APCSVGIL++RG
Sbjct  564   MHEDICTTAESKRAAIIILPFHKHQRLDGSLETTRSDFRWVNQRVLKHAPCSVGILIDRG  623

Query  870   -------RPNQYAKNIAVLYLGGPDDREALTYARRMSGLPGVHLTVIRFVPAKDVSADGA  712
                      +  +  I VL+ GG DDREAL    RM+  PG+   VIRF+ A D   +  
Sbjct  624   LGGTTQVSASNVSYTITVLFFGGRDDREALACGARMAEHPGISFIVIRFLLAADTIGN--  681

Query  711   VEDPDLELELTRETSFVTVSIDPARDKEEDEELLNNFRTETAEDDSKTFMELVLDDEEEF  532
                              TVS+D A +   DEE+L+ F+ +T+  D     E  L      
Sbjct  682   -----------------TVSVDMAGNASMDEEVLSEFKLKTSHRDGSVRYEERLVRNTTE  724

Query  531   TKAVKSLDDRSFDLYVAGRGRGVSSALTSGLADWCECPELGAVGD  397
             T AV     R   L V   GR     L   L+   +CPELG VG 
Sbjct  725   TIAVIREVSRCNLLLV---GRMPDGELALALSTRSDCPELGPVGS  766



>ref|XP_002315160.2| hypothetical protein POPTR_0010s19640g, partial [Populus trichocarpa]
 gb|EEF01331.2| hypothetical protein POPTR_0010s19640g, partial [Populus trichocarpa]
Length=830

 Score =   413 bits (1062),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 277/738 (38%), Positives = 412/738 (56%), Gaps = 38/738 (5%)
 Frame = -3

Query  2505  PPLVAEILSGIILGPSMLGNIEEFRKHNFPNHNFETIETMGHFALVLYAFLTGLQMDVKA  2326
             P   +E+++G+++GP +LG    F ++  P       ET+ +  ++ Y FL GLQMD+  
Sbjct  81    PRFFSELITGLLMGPMVLGANALFSEYTHPVRQTGATETLTNLGVIYYMFLVGLQMDLTT  140

Query  2325  IVHTGTKSRIVAVSGSIFPFLIGAGFYFTL--QTDTQSMIGFIFCGSALTVTGFSTLAKI  2152
             I      +   A+ G + P  +GAG +  L  +T  ++ +G  F   ALTVT F  LA+I
Sbjct  141   IRRISKGAWGNALFGILLPLGMGAGLFHLLPGKTHFENPLGAWFWSVALTVTSFPDLAQI  200

Query  2151  LDSKRLLNTEIGKIAASSALINVALSWVLLTIGLLFTGSLDNVQWAvlctvgfvvvcvny  1972
             L   +LL TE+G++A SSA ++   SW  L + +  T S    +  +L TV F++ C   
Sbjct  201   LSDLKLLRTEVGQMAISSAFVSDIASWSFLVVTI--TVSNGKTRAFILPTVAFILFCWFV  258

Query  1971  VRPLLNWLISK-TPEGQGFSEFYICSFIAVICAFGCFTDAMGSHPMIGAFIFGLIMPNNE  1795
             +RP+L+ +I K + +G  +S+  I S +  +   G  TDA GSH MIGAF+FGLI+P+ E
Sbjct  259   LRPVLSQIIDKDSSKGGNYSDLCIYSILTGVVVCGFITDACGSHSMIGAFMFGLIIPDGE  318

Query  1794  LLRTAILDRLEDFVMGILMPVFFLVCGLRTNIFTITDGDTSIFTALALILLACSAKIIAA  1615
             L    I+++LEDFV GI++P FF++ G R NI  +   + + F  L +++LAC AKII+ 
Sbjct  319   L-GMMIMEKLEDFVPGIMLPAFFVLTGTRCNILAMFY-NINPFAVLGILVLACLAKIISG  376

Query  1614  LVASCYTGMSTNEAIGLGVLTNTKSTMVMIILEVGqvqqvlsvqqysmmvVACLIMTIVA  1435
              + + Y GM   E + LGVL N K  + +IIL VG+  + +  Q +++MV+  L+MTI+ 
Sbjct  377   FLVAMYYGMPVREGVALGVLMNAKGVLALIILNVGRDIKAVDNQPFTIMVMTILLMTILV  436

Query  1434  TPLAARYCPK-QDLEPYKRRTIQNAKPGEELRILACIHGTNNLPAIISLLETSNSTVTSP  1258
              P+    C   +    YK RT+Q +KP  ELRILACIH T NL  I++LLE SNST  SP
Sbjct  437   KPIPLWACKTTKHFRKYKLRTLQESKPNSELRILACIHTTRNLSGILNLLELSNSTEKSP  496

Query  1257  ITAFGVQLLELVGRAPAMMvvhssgsgrhvgg---sHEEVQTSQIISTFDNYELRSHGVT  1087
             I  F   L+ L GR  AM++VH             +       QIIST +NYE R+  ++
Sbjct  497   ICVFAACLVGLSGRTNAMLIVHDENRNSSGQNYPPARGRSDADQIISTLENYERRNQSMS  556

Query  1086  AQVLTARWSYDTMAEDICKMAKEKRAAFLVLPFHKQQGTDGEMEDTNPAIQTVNEGVLLS  907
                LT    Y +M EDI  +A++KR  F+++PFHKQ G +G M+  N +I+ V + +L  
Sbjct  557   FLPLTVVSPYTSMHEDIHNLAEDKRVTFILIPFHKQSGAEG-MQQENSSIRLVTQNLLTK  615

Query  906   APCSVGILVER---------GRPNQYAKNIAVLYLGGPDDREALTYARRMSGLPGVHLTV  754
             APCSVGI ++R         G   +   N A+ Y GG DDREALTYA RM+G   V L V
Sbjct  616   APCSVGIFIDRGLSLKIYNEGSHRREKLNFAMFYTGGHDDREALTYACRMAGSLNVSLKV  675

Query  753   IRFVPAKDVSADGAVEDPDLELELTRETSFVTVSIDPARDKEEDEELLNNFRTETAEDDS  574
             +RF+P K+                      +   ++    +  D+  LN  R  T  + S
Sbjct  676   VRFLPGKEAIE----------------MMDMEEEVEGENQRFVDDMYLNELRFMTMCNPS  719

Query  573   KTFMELVLDDEEEFTKAVKSLDDRSFDLYVAGRGRGVSSALTSGLADWCECPELGAVGDl  394
              T+++  ++  +E   A K L D  +DLY+ GRG+G+      GL++W  C ELG +GD 
Sbjct  720   ATWVDKSVNSGDEIIIAAKDLADE-YDLYIVGRGQGMIKPFALGLSEWSNCEELGPLGDA  778

Query  393   lvtsefessfsvlvVQQY  340
             L TS+F    S+LVVQQ+
Sbjct  779   LSTSDFAQHASILVVQQH  796



>ref|XP_008804681.1| PREDICTED: cation/H(+) antiporter 15-like [Phoenix dactylifera]
Length=857

 Score =   413 bits (1062),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 261/788 (33%), Positives = 426/788 (54%), Gaps = 44/788 (6%)
 Frame = -3

Query  2658  VMCFSQTIYRSNGVWEGPDPLAPMIPLFILQIMTAILSSRILNFVLKPFNQPPLVAEILS  2479
             ++C++ T    N +W   +PLA   PLF+LQ +  I ++R +NF+L+P  QP  ++EIL 
Sbjct  27    LVCYAGTTTMHNSIWHDENPLAYSFPLFLLQCILIIATTRTINFLLRPLRQPRYISEILG  86

Query  2478  GIILGPSMLGNIEEFRKHNFPNHNFETIETMGHFALVLYAFLTGLQ-MDVKAIVHTGTKS  2302
             G +LGPS++G I  F    FP  +  T+  + H  L+   FL GL+ ++++++   G +S
Sbjct  87    GFVLGPSVMGRIPGFGLTTFPLWSLVTLNAIAHIGLIYSTFLVGLEVVELESLSSGGPRS  146

Query  2301  RIVAVSGSIFPFLIGAGF----YFTLQTDTQSMIGFIFCGSALTVTGFSTLAKILDSKRL  2134
                  +  + P  I +      +  L   T       F G A+TVT FS L +IL   +L
Sbjct  147   LGFTAACVLPPLAISSKMAPIVHDLLHESTHREAFLAFIGVAVTVTAFSVLTRILAEMKL  206

Query  2133  LNTEIGKIAASSALINVALSWVLLTIGLLFTGSLDNVQ---WAvlctvgfvvvcvnyVRP  1963
             + +++G+IA S A +N  +SW+LL   +    +   V+   ++VL  + F V+C   VRP
Sbjct  207   IGSDVGRIALSCAGLNDIVSWMLLATAVALAQTDSEVEKSIFSVLSAIAFYVMCRILVRP  266

Query  1962  LLNWLISKTPEGQGFSEFYICSFIAVICAFGCFTDAMGSHPMIGAFIFGLIMPNNELLRT  1783
             ++ W+  + P G+  +E ++   +  + A    TD++G H + GAF  G+++PN      
Sbjct  267   VVLWVARQAPVGEEANELHLSGMLVGVLAAAFITDSIGMHGIYGAFTLGIMVPNGP-FGE  325

Query  1782  AILDRLEDFVMGILMPVFFLVCGLRTNIFTITDGDTSIFTALALILLACSAKIIAALVAS  1603
             AI ++  D V G+LMP+F ++ GLRT++ TI + D   +  L ++L   +AK++A+++ +
Sbjct  326   AIAEKAGDLVDGLLMPLFLVISGLRTDLSTIKNWDGVAWLVL-MVLFTAAAKVLASMLMA  384

Query  1602  CYTGMSTNEAIGLGVLTNTKSTMVMIILEVGqvqqvlsvqqysmmvVACLIMTIVATPLA  1423
                 M  ++ + +G+L N+K  + +++L + + + V+  Q ++++V+  +++T   +PL 
Sbjct  385   ALCKMPLHDGLSVGLLMNSKGVIELVLLNIARDKHVIEGQTFTILVLMSMLLTATVSPLL  444

Query  1422  ARYC-PKQDLEPYKRRTIQNAKPGEELRILACIHGTNNLPAIISLLETSNSTVTSPITAF  1246
                  P + L  YKRRTI    P  ELRIL C+H     P+ +SLL+ S+ T  SPI   
Sbjct  445   TVVVKPVRRLVSYKRRTIWWTNPDSELRILVCVHTPREAPSFVSLLDISHPTKRSPIYVD  504

Query  1245  GVQLLELVGRAPAMMvvhssgsgrhvggsHE----------EVQTSQIISTFDNYELRSH  1096
              + L+EL GRA AM+ V+S+         H           + Q+  I   F++YE  + 
Sbjct  505   ALHLVELTGRAAAMLAVNSAAPPAAAKDPHHQQHLPALGRIQAQSDAINHVFESYEQHAG  564

Query  1095  GVTAQVLTARWSYDTMAEDICKMAKEKRAAFLVLPFHKQQGTDGEMEDTNPAIQTVNEGV  916
             GVTAQ  TA   Y TM EDI   A ++ AA ++LPFHK Q  DG ME  + AI+++N+ V
Sbjct  565   GVTAQCHTAVSPYATMHEDIIAAAVDRHAALILLPFHKHQTVDGGMEVVHQAIRSLNQAV  624

Query  915   LLSAPCSVGILVER----GRPNQYAKNIAVLYLGGPDDREALTYARRMSGLPGVHLTVIR  748
             L +APCSVGI ++R    G        +A+L+ GG DDREAL +A RM+G P ++L VIR
Sbjct  625   LAAAPCSVGIFIDRGLGAGDRRTSGHRVALLFFGGADDREALAFAGRMAGHPKINLKVIR  684

Query  747   FVPAKDVS-----------ADGAVEDPDLELELTRETSFVTVSIDPARDKEEDEELLNNF  601
             F+     S           A      P  E         +TV  +  R++  DE+ L  F
Sbjct  685   FMYGGGKSRQQQHHHRLGAAAATAGSPKAE-------RVLTVMTEGEREQRLDEDSLGEF  737

Query  600   RTETAEDDSKTFMELVLDDEEEFTKAVKSLDDRSFDLYVAGRGRGVSSALTSGLADWCEC  421
             +        + + E+V  + EE   A++ +++   DL+V GRG+ + S L  GL DW E 
Sbjct  738   QARWGRGMVE-YEEVVATNAEETVAAIQRVEESGHDLFVVGRGQNMESRLIEGLNDWSEF  796

Query  420   PELGAVGD  397
             PELG +GD
Sbjct  797   PELGPIGD  804



>ref|XP_009420052.1| PREDICTED: cation/H(+) antiporter 15-like [Musa acuminata subsp. 
malaccensis]
Length=745

 Score =   409 bits (1052),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 252/705 (36%), Positives = 397/705 (56%), Gaps = 33/705 (5%)
 Frame = -3

Query  2454  LGNIEEFRKHNFPNHNFETIETMGHFALVLYAFLTGLQMDVKAIVHTGTKSRIVAVSGSI  2275
             +G I +F    FP  +   ++TM H  LV + F  G++++   I   G K+   A    +
Sbjct  1     MGRIPDFNVMIFPLRSLIILDTMSHLGLVYFIFTVGVEVEKNVIKRKGAKALAFAAGCMV  60

Query  2274  FPFLIGA--GFYF--TLQTDTQSMIGFIFCGSALTVTGFSTLAKILDSKRLLNTEIGKIA  2107
               F IG+  G +    LQ  T       F G  L++  FS LA++L  ++L+ +EIG++A
Sbjct  61    PSFAIGSLSGIFIHRRLQEATNEAAFITFLGFTLSINSFSVLARVLAEQKLVGSEIGRLA  120

Query  2106  ASSALINVALSWVLL--TIGLLFT-GSLDNVQWAvlctvgfvvvcvnyVRPLLNWLISKT  1936
              SSA+++   +W+LL  +IGL  + G L +  W VL  +  ++     ++P + W+  +T
Sbjct  121   LSSAMLSDICAWILLAFSIGLAQSDGDLLSSLWTVLSGITLLLFSYAVLKPGVLWVQRRT  180

Query  1935  PEGQGFSEFYICSFIAVICAFGCFTDAMGSHPMIGAFIFGLIMPNNELLRTAILDRLEDF  1756
             PEG+   E Y C  +  +  +    DA+G+H + GAF+FGL +PN  L   A+++++EDF
Sbjct  181   PEGEDLDEIYACVLLVGVMVWAFIADALGTHAIFGAFVFGLSVPNGPL-GEALIEKVEDF  239

Query  1755  VMGILMPVFFLVCGLRTNIFTITDGDTSIFTALALILLACSAKIIA--ALVASCYTGMST  1582
             V GILMP+FF++ GLRT++++I D  +++   L +++LA +A  +A  A +A+ Y  M  
Sbjct  240   VAGILMPLFFVISGLRTDVYSIKDPGSTVL--LIIVVLAGAASKVASGAFLAATYR-MPL  296

Query  1581  NEAIGLGVLTNTKSTMVMIILEVGqvqqvlsvqqysmmvVACLIMTIVATPL-AARYCPK  1405
             +E + LG+L NTK  + +IIL +G+ + +L  Q ++++VV  +++T + +PL  A   P 
Sbjct  297   HEGMSLGILMNTKGLVDVIILNIGRSKMILGNQSFTILVVMSVVVTTLVSPLLKAVVRPS  356

Query  1404  QDLEPYKRRTIQNAKPGEELRILACIHGTNNLPAIISLLETSNSTVTSPITAFGVQLLEL  1225
             + L  YKRRTI    P  ELR+L C+H    +P +I+LL+ S+ T  SPI  + + L+EL
Sbjct  357   KRLVFYKRRTIWWPNPDSELRLLTCVHVPRQVPGLIALLDISHPTKRSPIFVYALHLIEL  416

Query  1224  VGRAPAMMvvhssgsgrhvggsHE--------EVQTSQIISTFDNYELRSHGVTAQVLTA  1069
              GR  A+++  +       G  H         + Q+  I   F++Y+  + GV+ Q LTA
Sbjct  417   TGRTSAILLNATPADASPSGNQHAHGHGHGRIQAQSDHIFHAFESYDQYAGGVSIQFLTA  476

Query  1068  RWSYDTMAEDICKMAKEKRAAFLVLPFHKQQGTDGEMEDTNPAIQTVNEGVLLSAPCSVG  889
                Y TM ED+   A+++ AA ++LPFHK    DG M   +PA + +N+ VL +APCSVG
Sbjct  477   ISPYATMHEDVISAAEDRHAALILLPFHKHHTVDGGMRPNHPACRAINQSVLSAAPCSVG  536

Query  888   ILVERGRPNQYA-KNIAVLYLGGPDDREALTYARRMSGLPGVHLTVIRFVPAKDVSADGA  712
             IL++RG  +  A + I + + GGPDDREAL  A RM+G P +++TV+RFV A    +   
Sbjct  537   ILIDRGLGSHRATRRITLFFFGGPDDREALALASRMAGHPAINVTVLRFVHAARAHSQSG  596

Query  711   VEDPDLELELTRETSFVTVSIDPARDKEEDEELLNNFRTETAEDDSKTFMELVLDDEEEF  532
                P  E  +T          D  RD   DEE +  FR E        + E V+ + EE 
Sbjct  597   --SPKTERVVT------VAGEDEERDWRIDEECVGEFR-ERWGGGIAEYEERVVSNAEET  647

Query  531   TKAVKSLDDRSFDLYVAGRGRGVSSALTSGLADWCECPELGAVGD  397
                ++ +D    D+YV GRG G  S LT+GL DW ECPELG +GD
Sbjct  648   VAVIRGVDGIQ-DMYVVGRGHGKESPLTAGLTDWSECPELGPIGD  691



>ref|XP_010106576.1| Cation/H(+) antiporter 18 [Morus notabilis]
 gb|EXC10830.1| Cation/H(+) antiporter 18 [Morus notabilis]
Length=798

 Score =   411 bits (1056),  Expect = 5e-125, Method: Compositional matrix adjust.
 Identities = 284/791 (36%), Positives = 444/791 (56%), Gaps = 41/791 (5%)
 Frame = -3

Query  2652  CFSQTIYRSNGVWEGPDPLAPMIPLFILQIMTAILSSRILNFVLKPFNQPPLVAEILSGI  2473
             C S     SNGV++G DPL   +PL ILQI   ++ +R+L F+++P  QP ++AEI+ GI
Sbjct  8     CPSPMKATSNGVFQGDDPLHFALPLVILQICLVLVVTRVLAFLMRPLRQPRVIAEIIGGI  67

Query  2472  ILGPSMLGNIEEFRKHNFPNHNFETIETMGHFALVLYAFLTGLQMDVKAIVHTGTKSRIV  2293
             +LGPS LG  + +    FP  +   ++T+ +  L+ + FL GL++D K+I  TG K+  +
Sbjct  68    LLGPSALGRNQNYLHAIFPARSLTVLDTLANLGLLFFLFLVGLELDPKSIRRTGKKALGI  127

Query  2292  AVSGSIFPFLIGAGFYF----TLQTDTQSMIGFIFCGSALTVTGFSTLAKILDSKRLLNT  2125
             A+ G   PF +G G  F    T+     S    +F G AL++T F  LA+IL   +LL T
Sbjct  128   AIVGISLPFALGIGSSFILRATISKGVSSAAFLVFMGVALSITAFPVLARILAELKLLTT  187

Query  2124  EIGKIAASSALINVALSWVLLTIGLLFTGSLDN---VQWAvlctvgfvvvcvnyVRPLLN  1954
             ++G++A S+A +N   +WVLL + +  +GS  +     W +L    FV+ C+  V P+  
Sbjct  188   DVGRMAMSAAAVNDVAAWVLLALAIALSGSNQSPLVSLWVLLSGCIFVISCIILVPPIFK  247

Query  1953  WLISKTPEGQGFSEFYICSFIAVICAFGCFTDAMGSHPMIGAFIFGLIMPNNELLRTAIL  1774
             W+  +  EG+   E YIC+ +A + A G  TD +G H M GAF+ G+++P +  L  A++
Sbjct  248   WMSQRCHEGEPVDEMYICATLAAVLAAGFITDTIGIHAMFGAFVIGVLVPKDGPLAGALV  307

Query  1773  DRLEDFVMGILMPVFFLVCGLRTNIFTITDGDTSIFTALALILLACSAKIIAALVASCYT  1594
             +++ED V G+ +P++F+  GL+TN+ TI  G  S    + +I  AC  KI   ++ S Y 
Sbjct  308   EKVEDLVSGLFLPLYFVSSGLKTNVATI-QGLQSWGLLVLVIFTACFGKIFGTVMVSLYC  366

Query  1593  GMSTNEAIGLGVLTNTKSTMVMIILEVGqvqqvlsvqqysmmvVACLIMTIVATPL-AAR  1417
              +   EA+ LG L NTK  + +I+L +G+ ++VL+ Q +++M++  +  T + TPL  A 
Sbjct  367   KVPIREALALGFLMNTKGLVELIVLNIGKDRKVLNDQTFAIMILMAVFTTFITTPLVVAV  426

Query  1416  YCP--KQDLEPYKRRTIQNAKPGEELRILACIHGTNNLPAIISLLETSNSTVT-SPITAF  1246
             Y P  +  +  YK RTI+   P  +LRILAC H   N+P++++LLE+S  T     +  +
Sbjct  427   YKPAKRARMAEYKYRTIERKNPNSQLRILACFHSQRNVPSLLNLLESSRGTEKHQELCVY  486

Query  1245  GVQLLELVGRAPA-MMvvhssgsgrhvggsHEEVQTSQIISTFDNYELRSHG-VTAQVLT  1072
              + L+EL  R+ A +MV  +  +G           +  I+  F+ Y  R  G V+ + +T
Sbjct  487   ALHLMELSERSSAILMVHKARRNGLPFWNKGHRSDSGNIVVAFEAY--RQLGRVSVRPMT  544

Query  1071  ARWSYDTMAEDICKMAKEKRAAFLVLPFHKQQGTDGEMEDTNPAIQTVNEGVLLSAPCSV  892
             +  S   M EDIC  A+ KRAA ++LPFHK Q  DG +E T    + VN  VL  APCSV
Sbjct  545   SISSMSDMHEDICTTAEGKRAAIIILPFHKHQRLDGSLETTRSDFRWVNRRVLERAPCSV  604

Query  891   GILVERG-------RPNQYAKNIAVLYLGGPDDREALTYARRMSGLPGVHLTVIRFVPAK  733
             GI V+RG         +  + +I VL+ GG DDREAL Y  RM+  PG+ LTVIRF+  +
Sbjct  605   GIFVDRGLGGSSHVAASNVSYSITVLFFGGRDDREALAYGSRMAEHPGIRLTVIRFLVER  664

Query  732   DVSADGAVEDPDLELELTRETSFVTVSIDPARDKEEDEELLNNFRTETAEDDSKTFMELV  553
             +  A G +   ++E     ++S +  S+        DE LLN F+   A+++S  + E  
Sbjct  665   E--AAGEITRVNME----EDSSTILDSV--------DEVLLNEFKKTKADNNSVKYEEKA  710

Query  552   LDDEEEFTKAVKSLDDRSFDLYVAGRGRGVSSALTSGLADWCECPELGAVGDllvtsefe  373
             +   E+    ++  +    +LY+ GR      AL   L    ECPELG VG LL + +F 
Sbjct  711   VTSPEQAIAIIR--ETGRCNLYLVGRMPAGEVAL--ALTRRSECPELGPVGTLLTSPDFS  766

Query  372   ssfsvlvVQQY  340
             ++ SVLV+QQY
Sbjct  767   TTASVLVLQQY  777



>ref|XP_006439427.1| hypothetical protein CICLE_v10018864mg [Citrus clementina]
 gb|ESR52667.1| hypothetical protein CICLE_v10018864mg [Citrus clementina]
Length=796

 Score =   410 bits (1055),  Expect = 7e-125, Method: Compositional matrix adjust.
 Identities = 265/765 (35%), Positives = 415/765 (54%), Gaps = 48/765 (6%)
 Frame = -3

Query  2628  SNGVWEGPDPLAPMIPLFILQIMTAILSSRILNFVLKPFNQPPLVAEILSGIILGPSMLG  2449
             SNGV++G  PL   +PL ILQI   IL +R L F+L+P  QP ++AEI  GI+LGPS LG
Sbjct  16    SNGVFQGDSPLDFALPLAILQICLVILLTRGLAFILRPLRQPRVIAEITGGILLGPSALG  75

Query  2448  NIEEFRKHNFPNHNFETIETMGHFALVLYAFLTGLQMDVKAIVHTGTKSRIVAVSGSIFP  2269
               E F +  FP  +   ++T+ +  L+ + FL GL++D K++  TG K+  +A++G   P
Sbjct  76    RSERFLQAVFPPKSQTVLDTLANLGLIFFMFLVGLELDPKSLRQTGKKALGIAIAGISLP  135

Query  2268  FLIGAGFYFTLQ------TDTQSMIGFIFCGSALTVTGFSTLAKILDSKRLLNTEIGKIA  2107
             F +G G  F L+       D+ S +  +F G AL++T F  LA+IL   +LL  ++G++A
Sbjct  136   FALGIGSSFLLRETISKGVDSTSFL--VFMGVALSITAFPVLARILAELKLLTADVGRMA  193

Query  2106  ASSALINVALSWVLLTIGLLFTGSLDNV---QWAvlctvgfvvvcvnyVRPLLNWLISKT  1936
              S+A +N   +W+LL + +  +GS  +     W  L    FV+    +V P   W+  + 
Sbjct  194   MSAAAVNDVAAWILLALAVALSGSGQSSLVPVWVFLSGCVFVICLTLFVPPTFKWMARQC  253

Query  1935  PEGQGFSEFYICSFIAVICAFGCFTDAMGSHPMIGAFIFGLIMPNNELLRTAILDRLEDF  1756
              EG+   E Y+C+ +A + A G  TDA+G H M GAF+ G+++P       A+++++ED 
Sbjct  254   HEGEPVEETYVCATLAAVLAAGFITDAIGIHAMFGAFVVGVLVPKEGPFANALVEKVEDL  313

Query  1755  VMGILMPVFFLVCGLRTNIFTITDGDTSIFTALALILLACSAKIIAALVASCYTGMSTNE  1576
             V GI +P++F+  GL+TNI TI    +    AL +IL AC  KI+   V S    +   E
Sbjct  314   VSGIFLPLYFVSSGLKTNIATIQGLQSWGLLAL-VILTACLGKIVGTFVVSLSFKVPLRE  372

Query  1575  AIGLGVLTNTKSTMVMIILEVGqvqqvlsvqqysmmvVACLIMTIVATPLA-ARYCP--K  1405
             A+ LG+L NTK  + +I+L +G+ ++VL+ Q +++M++  ++ T + TPL  A Y P  +
Sbjct  373   ALALGILMNTKGLVELIVLNIGKDRKVLNDQVFAIMILMAVVTTFMTTPLVMAVYKPARR  432

Query  1404  QDLEPYKRRTIQNAKPGEELRILACIHGTNNLPAIISLLETSNSTVTSP-ITAFGVQLLE  1228
               +  YK RT++      + RILAC H   N+P+ I+LLE       S  +  + + L+E
Sbjct  433   ARVADYKHRTVERKNSKAQFRILACFHSARNIPSTINLLEALRGIQKSEGLCVYALHLME  492

Query  1227  LVGRAPA-MMvvhssgsgrhvggsHEEVQTSQIISTFDNYELRSHGVTAQVLTARWSYDT  1051
             L  R+ A +MV  +  +G        +   + I+  F+ ++  S  V+ + +TA  S   
Sbjct  493   LSERSSAILMVHKARRNGLPFWNRGRQSNPNHIVVAFEAFQQLSR-VSVRPMTAISSMSD  551

Query  1050  MAEDICKMAKEKRAAFLVLPFHKQQGTDGEMEDTNPAIQTVNEGVLLSAPCSVGILVERG  871
             M EDIC  A+ KRAA ++LPFHK Q  DG +E T    + VN+ VL  APCSVGIL++RG
Sbjct  552   MHEDICTTAESKRAAIIILPFHKHQRLDGSLETTRSDFRWVNQRVLKHAPCSVGILIDRG  611

Query  870   -------RPNQYAKNIAVLYLGGPDDREALTYARRMSGLPGVHLTVIRFVPAKDVSADGA  712
                      +  +  I VL+ GG DDREAL    RM+  PG+   VIRF+ A D   +  
Sbjct  612   LGGTTQVSASNVSYTITVLFFGGRDDREALACGARMAEHPGISFIVIRFLLAADAIGN--  669

Query  711   VEDPDLELELTRETSFVTVSIDPARDKEEDEELLNNFRTETAEDDSKTFMELVLDDEEEF  532
                              TVS+D A +   DEE+L+ F+ +T+ + S  + E ++ +  E 
Sbjct  670   -----------------TVSVDMAGNASMDEEVLSEFKLKTSRNGSVRYEERLVRNTAET  712

Query  531   TKAVKSLDDRSFDLYVAGRGRGVSSALTSGLADWCECPELGAVGD  397
                ++ +   +  L     GR     L   L+   +C ELG VG 
Sbjct  713   IAVIREVSRCNLLLV----GRMPDGELALALSTRSDCLELGPVGS  753



>ref|XP_010089837.1| Cation/H(+) antiporter 15 [Morus notabilis]
 gb|EXB38453.1| Cation/H(+) antiporter 15 [Morus notabilis]
Length=880

 Score =   412 bits (1059),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 270/810 (33%), Positives = 434/810 (54%), Gaps = 49/810 (6%)
 Frame = -3

Query  2697  TGPEVDL---------DRLGQVVMCFSQTIYRSNGVWEGPDPLAPMIPLFILQIMTAILS  2545
             TGP +DL           L  + +CF + +    G+W   +     +P F++Q++  +  
Sbjct  10    TGPILDLFNFQPCLEGQDLNYITLCFRKVMTYMTGIWRAENASTLALPAFVMQLLAILSL  69

Query  2544  SRILNFVLKPFNQPPLVAEILSGIILGPSMLGNIEEFRKHNFPNH-NFETIETMGHFALV  2368
             +R+L F  +  +   + AEIL GI+LGPS +G   EF   N     + +T+E +    L+
Sbjct  70    NRLLTFAFRYLHISRIAAEILGGILLGPSGIG-FSEFSIKNITQWGSIQTLENIASVGLI  128

Query  2367  LYAFLTGLQMDVKAIVHTGTKSRIVAVSGSIFPFLIGAGFYFTLQTD-------TQSMIG  2209
              + F+ GL+MD+K ++    K+   A++G I PF IG G ++ L  D         +  G
Sbjct  129   YFMFIVGLEMDLKPVLRGSKKALTTALAGIIIPFPIGFGLHYLLIDDFAVISKGKPNRFG  188

Query  2208  FIFCGSALTVTGFSTLAKILDSKRLLNTEIGKIAASSALINVALSWVLLTIGLLFTGSLD  2029
              +F G A+  T F  LA +L   +LL+T++G+ + +SA+++  L W L    L    + +
Sbjct  189   PLFWGLAIATTNFPDLAGLLADLKLLHTDVGRTSLTSAVVSDLLCWFLFV--LTMATAHN  246

Query  2028  NVQWAvlctvgfvvvcvnyVRPLLNWLISKTPEGQGFSEFYICSFIAVICAFGCFTDAMG  1849
                + ++ T  +V  C   VRP   W + +T + + +++ +I   +A +      TDA G
Sbjct  247   GRAFTIVTTTIYVGFCFFIVRPAAKWALRRTSKDENYNQKHIVFILAGVLLSAYITDACG  306

Query  1848  SHPMIGAFIFGLIMPNNELLRTAILDRLEDFVMGILMPVFFLVCGLRTNIFTITDGDTSI  1669
             SH   GAF+FG+I+P  E L+ A+++ +EDFV  IL P+FF   GLRTN   + +     
Sbjct  307   SHSFFGAFLFGVILPKGE-LKNAVMESVEDFVSEILTPLFFFCIGLRTNWHWMHERGVGA  365

Query  1668  FTALALILLACSAKIIAALVASCYTG-MSTNEAIGLGVLTNTKSTMVMIILEVGqvqqvl  1492
              + L +++LA  AK+ +  + + +   MS  + + LG+L NTK  + +II+  G+    L
Sbjct  366   GSILLVLVLAFVAKVFSTFIVAFFVNKMSARDGVALGLLMNTKGLLSLIIINAGRDILAL  425

Query  1491  svqqysmmvVACLIMTIVATP-LAARYCPKQDLEPYKRRTIQNAKPGEELRILACIHGTN  1315
              +Q ++++V+A  IMT    P LA  Y  K+    YK RTI++ +   E RILAC+H T 
Sbjct  426   DMQTFAVIVLALWIMTAAVGPILALTYKSKRRPGVYKYRTIRSIEGNSEFRILACLHSTR  485

Query  1314  NLPAIISLLETSNSTVTSPITAFGVQLLELVGRAPAMMvv----hssgsgrhvggsHEEV  1147
             N   ++SLL+ SN T  SPI+AF V L+EL+G A AM++V     ++ SG   G + ++V
Sbjct  486   NSGGLVSLLKDSNPTKQSPISAFAVHLVELIGHASAMLIVHETCKANASGGGSGAAAKDV  545

Query  1146  QTSQIISTFDNYE-LRSHGVTAQVLTARWSYDTMAEDICKMAKEKRAAFLVLPFHKQQGT  970
              +    S  + +E L     + Q LTA  +Y TM EDIC +A++KR    +LPFH Q   
Sbjct  546   GSQYGDSIHEAFEDLEGENFSIQSLTAVSAYSTMHEDICSLAEDKRVTLTILPFHVQSSV  605

Query  969   DG------EMEDTNPAIQTVNEGVLLSAPCSVGILVER-------------GRPNQYAKN  847
             +G           N   + VN+ VL +A CSV + V+R                  +   
Sbjct  606   EGVGVGAVSESGANSPFRAVNKNVLDNAACSVAVFVDRVFNTHSLGISASGSGGGGFRHQ  665

Query  846   IAVLYLGGPDDREALTYARRMSGLPGVHLTVIRFVPAKDVSADGAVEDPDLELELTRETS  667
             IA+++LGG DDR+AL YA R+S  P V LTVIRF+P K+ + D +   P  E +   +  
Sbjct  666   IAMIFLGGRDDRDALAYAWRISKSPRVSLTVIRFLPGKN-AVDVSGNIPGFEGDDKEDDG  724

Query  666   FVTVSIDPARDKEEDEELLNNFRTETAEDDSKTFMELVLDDEEEFTKAVKSLDDRSFDLY  487
              +    +  R+K  D++ +  F+ +T +  S   +E V D+ E+  + V  ++ R ++LY
Sbjct  725   ILKAIAESEREKPLDDQYIEEFKLKTRDQPSTRLVEQVADNGEDVVRIVSGMEGR-YNLY  783

Query  486   VAGRGRGVSSALTSGLADWCECPELGAVGD  397
             V GRG+GV S LT+GL DW E PELG +GD
Sbjct  784   VVGRGKGVVSPLTAGLLDWSEFPELGPLGD  813



>gb|KHN45029.1| Cation/H(+) antiporter 19 [Glycine soja]
Length=813

 Score =   410 bits (1053),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 273/781 (35%), Positives = 443/781 (57%), Gaps = 29/781 (4%)
 Frame = -3

Query  2628  SNGVWEGPDPLAPMIPLFILQIMTAILSSRILNFVLKPFNQPPLVAEILSGIILGPSMLG  2449
             SNG ++  +PL   +PL ILQI   ++ +R++ F+ +P  QP ++AEI+ GI+LGPS +G
Sbjct  17    SNGAFQHENPLDYALPLLILQICLVVVFTRVIAFLCRPLRQPRVIAEIIGGILLGPSAIG  76

Query  2448  NIEEFRKHNFPNHNFETIETMGHFALVLYAFLTGLQMDVKAIVHTGTKSRIVAVSGSIFP  2269
               E+F    FP  +   ++T+G+  L+ + FL GL++D++AI  TG K+  +A+ G   P
Sbjct  77    RNEKFLSTVFPKKSITVLDTLGNVGLLFFLFLVGLELDMRAIRRTGHKALAIALCGITVP  136

Query  2268  FLIGAGFYFTLQTDT----QSMIGFIFCGSALTVTGFSTLAKILDSKRLLNTEIGKIAAS  2101
             F++G G  F L+       + +   +F G AL++T F  LA+IL   +LL T++G+IA S
Sbjct  137   FVLGIGTSFALRATVSKGAEPVSFLVFMGVALSITAFPVLARILAELKLLTTDVGRIAMS  196

Query  2100  SALINVALSWVLLTIGLLFTGSLDN---VQWAvlctvgfvvvcvnyVRPLLNWLISKTPE  1930
             +A +N   +W+LL + +  +GS  +     W +L  V FV+  V  +RPLL  + +++PE
Sbjct  197   AAAVNDVAAWILLALAIAISGSNGSPFVPLWVLLSGVAFVIFAVFAIRPLLVAMANRSPE  256

Query  1929  GQGFSEFYICSFIAVICAFGCFTDAMGSHPMIGAFIFGLIMPNNELLRTAILDRLEDFVM  1750
             G+   E YIC  + ++ A    TD +G H + GAF+ G IMP        +++++ED V 
Sbjct  257   GEPVKEVYICITLTLVLACSFVTDTIGIHALFGAFVIGTIMPKEGSFSVVMIEKIEDLVS  316

Query  1749  GILMPVFFLVCGLRTNIFTITDGDTSIFTALALILLACSAKIIAALVASCYTGMSTNEAI  1570
             G+ +P+FF+  GL+TN+ TI+ G +     L +I  AC  KI+  +V S    + + EA+
Sbjct  317   GLFLPLFFVSSGLKTNVATISGGLSWAMLVL-VIFNACFGKIVGTIVVSLTCKVPSQEAV  375

Query  1569  GLGVLTNTKSTMVMIILEVGqvqqvlsvqqysmmvVACLIMTIVATPLA-ARYCPKQDLE  1393
              LG L NTK  + +I+L +G+ ++VL+ Q +++ V+  L  T + TP+  A Y P +   
Sbjct  376   ALGFLMNTKGLVELIVLNIGKDRKVLNDQAFAICVLMALFTTFITTPIVMAVYKPARRGA  435

Query  1392  PYKRRTIQNAKPGEELRILACIHGTNNLPAIISLLETSNSTVT-SPITAFGVQLLELVGR  1216
             PYK RTIQ   P  ELR+LAC H T N+P +I+L+E+S        +  + + L+EL  R
Sbjct  436   PYKHRTIQRRDPDTELRMLACFHTTRNIPTLINLIESSRGIRKRGKLCIYAMHLMELSER  495

Query  1215  APAMMvvhssgsgrhvggsHEEVQTSQIISTFDNYE-LRSHGVTAQVLTARWSYDTMAED  1039
             + A+ +VH +        + +     Q+I  F  YE LRS  V  + +TA  + +++ ED
Sbjct  496   SSAITMVHKARKNGMPFWNKKPDDKDQMIIAFQAYEKLRS--VNVRPMTAISALNSIHED  553

Query  1038  ICKMAKEKRAAFLVLPFHKQQGTDGEMEDTNPAIQTVNEGVLLSAPCSVGILVERG----  871
             IC  A +KRAA ++LPFHK Q  DG ME    ++  +N+ VL  APCSVGILV+RG    
Sbjct  554   ICTSAHQKRAAMIILPFHKHQRVDGSMESLGHSLHVMNQLVLSHAPCSVGILVDRGLGGT  613

Query  870   ---RPNQYAKNIAVLYLGGPDDREALTYARRMSGLPGVHLTVIRFVPAKDVSADGAVEDP  700
                + +  +  + V + GG DDREAL Y  RM+  PG+ L V++FVP    S     +  
Sbjct  614   SQVQASDVSYKVVVPFFGGRDDREALCYGMRMAEHPGILLNVVKFVPPPGASLAFGAKLV  673

Query  699   DLELELTRETSFVTVSIDPARDKEEDEELLNNFRTETAED-DSKTFMELVLDDEEEFTKA  523
              +     ++   V V      DK++D++L + F +    + +S  + + ++  + +   A
Sbjct  674   GMSSNKDKKAMEV-VGGSYYDDKQQDDQLWSEFLSACNNNQESMKYEQKLVASKGDIEAA  732

Query  522   VKSLDDRSFDLYVAGRGRGVSSALTSGLADWCECPELGAVGDllvtsefessfsvlvVQQ  343
             +K + +RS +L + GR   V       L    +CPELG VG  + +S+F +  SV+V+QQ
Sbjct  733   LKEM-NRS-NLILVGRMPSVGP-----LVSRSDCPELGPVGSYMASSDFSTVTSVMVIQQ  785

Query  342   Y  340
             Y
Sbjct  786   Y  786



>ref|XP_006439426.1| hypothetical protein CICLE_v10018864mg [Citrus clementina]
 gb|ESR52666.1| hypothetical protein CICLE_v10018864mg [Citrus clementina]
Length=832

 Score =   410 bits (1054),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 265/765 (35%), Positives = 415/765 (54%), Gaps = 48/765 (6%)
 Frame = -3

Query  2628  SNGVWEGPDPLAPMIPLFILQIMTAILSSRILNFVLKPFNQPPLVAEILSGIILGPSMLG  2449
             SNGV++G  PL   +PL ILQI   IL +R L F+L+P  QP ++AEI  GI+LGPS LG
Sbjct  52    SNGVFQGDSPLDFALPLAILQICLVILLTRGLAFILRPLRQPRVIAEITGGILLGPSALG  111

Query  2448  NIEEFRKHNFPNHNFETIETMGHFALVLYAFLTGLQMDVKAIVHTGTKSRIVAVSGSIFP  2269
               E F +  FP  +   ++T+ +  L+ + FL GL++D K++  TG K+  +A++G   P
Sbjct  112   RSERFLQAVFPPKSQTVLDTLANLGLIFFMFLVGLELDPKSLRQTGKKALGIAIAGISLP  171

Query  2268  FLIGAGFYFTLQ------TDTQSMIGFIFCGSALTVTGFSTLAKILDSKRLLNTEIGKIA  2107
             F +G G  F L+       D+ S +  +F G AL++T F  LA+IL   +LL  ++G++A
Sbjct  172   FALGIGSSFLLRETISKGVDSTSFL--VFMGVALSITAFPVLARILAELKLLTADVGRMA  229

Query  2106  ASSALINVALSWVLLTIGLLFTGSLDNV---QWAvlctvgfvvvcvnyVRPLLNWLISKT  1936
              S+A +N   +W+LL + +  +GS  +     W  L    FV+    +V P   W+  + 
Sbjct  230   MSAAAVNDVAAWILLALAVALSGSGQSSLVPVWVFLSGCVFVICLTLFVPPTFKWMARQC  289

Query  1935  PEGQGFSEFYICSFIAVICAFGCFTDAMGSHPMIGAFIFGLIMPNNELLRTAILDRLEDF  1756
              EG+   E Y+C+ +A + A G  TDA+G H M GAF+ G+++P       A+++++ED 
Sbjct  290   HEGEPVEETYVCATLAAVLAAGFITDAIGIHAMFGAFVVGVLVPKEGPFANALVEKVEDL  349

Query  1755  VMGILMPVFFLVCGLRTNIFTITDGDTSIFTALALILLACSAKIIAALVASCYTGMSTNE  1576
             V GI +P++F+  GL+TNI TI    +    AL +IL AC  KI+   V S    +   E
Sbjct  350   VSGIFLPLYFVSSGLKTNIATIQGLQSWGLLAL-VILTACLGKIVGTFVVSLSFKVPLRE  408

Query  1575  AIGLGVLTNTKSTMVMIILEVGqvqqvlsvqqysmmvVACLIMTIVATPLA-ARYCP--K  1405
             A+ LG+L NTK  + +I+L +G+ ++VL+ Q +++M++  ++ T + TPL  A Y P  +
Sbjct  409   ALALGILMNTKGLVELIVLNIGKDRKVLNDQVFAIMILMAVVTTFMTTPLVMAVYKPARR  468

Query  1404  QDLEPYKRRTIQNAKPGEELRILACIHGTNNLPAIISLLETSNSTVTSP-ITAFGVQLLE  1228
               +  YK RT++      + RILAC H   N+P+ I+LLE       S  +  + + L+E
Sbjct  469   ARVADYKHRTVERKNSKAQFRILACFHSARNIPSTINLLEALRGIQKSEGLCVYALHLME  528

Query  1227  LVGRAPA-MMvvhssgsgrhvggsHEEVQTSQIISTFDNYELRSHGVTAQVLTARWSYDT  1051
             L  R+ A +MV  +  +G        +   + I+  F+ ++  S  V+ + +TA  S   
Sbjct  529   LSERSSAILMVHKARRNGLPFWNRGRQSNPNHIVVAFEAFQQLSR-VSVRPMTAISSMSD  587

Query  1050  MAEDICKMAKEKRAAFLVLPFHKQQGTDGEMEDTNPAIQTVNEGVLLSAPCSVGILVERG  871
             M EDIC  A+ KRAA ++LPFHK Q  DG +E T    + VN+ VL  APCSVGIL++RG
Sbjct  588   MHEDICTTAESKRAAIIILPFHKHQRLDGSLETTRSDFRWVNQRVLKHAPCSVGILIDRG  647

Query  870   -------RPNQYAKNIAVLYLGGPDDREALTYARRMSGLPGVHLTVIRFVPAKDVSADGA  712
                      +  +  I VL+ GG DDREAL    RM+  PG+   VIRF+ A D   +  
Sbjct  648   LGGTTQVSASNVSYTITVLFFGGRDDREALACGARMAEHPGISFIVIRFLLAADAIGN--  705

Query  711   VEDPDLELELTRETSFVTVSIDPARDKEEDEELLNNFRTETAEDDSKTFMELVLDDEEEF  532
                              TVS+D A +   DEE+L+ F+ +T+ + S  + E ++ +  E 
Sbjct  706   -----------------TVSVDMAGNASMDEEVLSEFKLKTSRNGSVRYEERLVRNTAET  748

Query  531   TKAVKSLDDRSFDLYVAGRGRGVSSALTSGLADWCECPELGAVGD  397
                ++ +   +  L     GR     L   L+   +C ELG VG 
Sbjct  749   IAVIREVSRCNLLLV----GRMPDGELALALSTRSDCLELGPVGS  789



>ref|XP_010473909.1| PREDICTED: cation/H(+) antiporter 21-like [Camelina sativa]
Length=844

 Score =   410 bits (1055),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 270/816 (33%), Positives = 430/816 (53%), Gaps = 40/816 (5%)
 Frame = -3

Query  2709  PPPSTGPEVDLDRLGQVVMCFSQTIYRSNGVWEGPDP---LAPMIPLFILQIMTAILSSR  2539
             PP     EV   R G + MC++Q +    G   G +    L   +P+F+ Q+  A LS R
Sbjct  10    PPQVEFYEVSASRFGNI-MCYNQALMDLVGDHNGEESGSSLTAALPVFVTQLCVANLSYR  68

Query  2538  ILNFVLKPFNQPPLVAEILSGIILGPSMLGNIEEFRKHNFPNHNFETIETMGHFALVLYA  2359
             +L +  +P   PP VA+IL G++  PS+LG      +  FP      +ET  + ALV   
Sbjct  69    LLYYFTRPLRLPPFVAQILCGLLFSPSVLGKKNWVLERLFPYRFTMVLETFANLALVYNI  128

Query  2358  FLTGLQMDVKAIVHTGTKSRIVAVSGSIFPFLIGAGFYFTLQTDTQSMI--GFIFCGSAL  2185
             FL GL MD++ I    TK  I+A+ G +   L G GFY+         I  G I+   A 
Sbjct  129   FLLGLGMDLRMIKIKDTKPVIIAIVGLVAALLAGIGFYYLPGNGDPDTILAGGIYWSLAF  188

Query  2184  TVTGFSTLAKILDSKRLLNTEIGKIAASSALINVALSWVLLTIGLLF---TGSLDNVQ-W  2017
               T F  LA+IL   +LL +++G+ A S+A++    +W+L  IG+      G+ + +  +
Sbjct  189   GCTNFPDLARILADLKLLRSDMGRTAMSAAIVTDLCTWILFVIGMASFSKAGARNEMMPY  248

Query  2016  AvlctvgfvvvcvnyVRPLLNWLISKTPEGQGFSEFYICSFIAVICAFGCFTDAMGSHPM  1837
             +++ T  FV+ C   +RP + W  + T +G    E ++   +A +      T+  G   +
Sbjct  249   SLVSTTAFVLFCYFLIRPAVAWTFNNTVKGGHVDETHVWFILAGVILCSLMTELCGVQSI  308

Query  1836  IGAFIFGLIMPNNELLRTAILDRLEDFVMGILMPVFFLVCGLRTNIFTITDGDTSIFTAL  1657
              GAF+FGL +P++ ++R  I  +L D++ GILMP+F+++CGLR ++  +++   S+ T  
Sbjct  309   TGAFLFGLSIPHDHIIRNMIEQKLHDYISGILMPLFYIICGLRADLGYMSE-YVSVRTMA  367

Query  1656  ALILLACSAKIIAALVASCYTGMSTNEAIGLGVLTNTKSTMVMIILEVGqvqqvlsvqqy  1477
              +I  +   KI++ +  S +  +   + + +G L NTK TM ++IL  G+  + L V  Y
Sbjct  368   LVISASFLVKILSTVGCSIFLRIPFRDGLAIGSLMNTKGTMALVILNAGRDTKALDVIMY  427

Query  1476  smmvVACLIMTIVATP-LAARYCPKQDLEPYKRRTIQNAKPGEELRILACIHGTNNLPAI  1300
             + M +A L+M+IV  P L   Y PK+ +  YK RTIQ  +   EL +L C+H   N+  I
Sbjct  428   THMTLAFLVMSIVVQPLLTIFYRPKKKIVFYKNRTIQKHRGESELSVLTCVHMLPNVSGI  487

Query  1299  ISLLETSNSTVTSPITAFGVQLLELVGRAPA-MMvvhssgsgrhvggsHEEVQTSQIIST  1123
              +LL+ SN T  SP+    + L+EL GR  A +++++     +         ++ QI  T
Sbjct  488   TNLLQLSNPTKRSPLNVVAIHLIELTGRTTASLLIMNDEAKPKANFSDRVRAESDQIAET  547

Query  1122  FDNYELRSHGVTAQVLTARWSYDTMAEDICKMAKEKRAAFLVLPFHKQQGTDGEMEDTNP  943
             F   E+ + G+  Q +TA   Y TM EDI  +A++K+ +F+++P+HK   +DG + + N 
Sbjct  548   FAALEVDNEGILVQTITAVSPYATMHEDISLLAEDKQVSFILMPYHKNMMSDGRLTEGND  607

Query  942   AIQTVNEGVLLSAPCSVGILVERG---------RPNQYAKNIAVLYLGGPDDREALTYAR  790
                 +N  VL  APCSVG+LV+RG         R     K IA+++ GG DDREAL +A 
Sbjct  608   VHAEINRNVLGHAPCSVGVLVDRGMMIFRSESFRGETTKKEIAMIFAGGRDDREALAFAW  667

Query  789   RMSGLPGVHLTVIRFVPAKDVSADGAVEDPDLELELTRETSFVTVSIDPARDKEEDEELL  610
             RM G     LTV+RF+P ++                       T  ++  ++K  DEE L
Sbjct  668   RMVGQEMAKLTVVRFLPNQEALVSAG-----------------TAGVEYGKEKHIDEEYL  710

Query  609   NNFRTETAEDDSKTFMELVLDDEEEFTKAVKSL-DDRSFDLYVAGRGRGVSSALTSGLAD  433
               F  +T  D   T++E V+ D  +    +  + ++ S+DLY+ GRG  V + +T+GL D
Sbjct  711   YEFNFKTKNDPLVTYIEKVVKDGHDTIATIMEMEENNSYDLYILGRGYKVETPVTAGLMD  770

Query  432   WCECPELGAVGDllvtsefessfsvlvVQQYVRTNK  325
             W   P+LG +GD L +S F    SVLVVQQY   NK
Sbjct  771   WSSFPDLGVIGDTLASSNFTMQASVLVVQQYSSVNK  806



>ref|XP_002297994.1| cation/hydrogen exchanger family protein [Populus trichocarpa]
 gb|EEE82799.1| cation/hydrogen exchanger family protein [Populus trichocarpa]
Length=804

 Score =   409 bits (1052),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 277/787 (35%), Positives = 436/787 (55%), Gaps = 38/787 (5%)
 Frame = -3

Query  2628  SNGVWEGPDPLAPMIPLFILQIMTAILSSRILNFVLKPFNQPPLVAEILSGIILGPSMLG  2449
             SNGV++G +PL   +PL ILQI   ++ +R L F+L+P  QP ++AEI+ GI+LGPS LG
Sbjct  19    SNGVFQGDNPLDFALPLAILQICLVVVVTRGLAFLLRPLRQPRVIAEIIGGILLGPSALG  78

Query  2448  NIEEFRKHNFPNHNFETIETMGHFALVLYAFLTGLQMDVKAIVHTGTKSRIVAVSGSIFP  2269
               + + +  FP  +   ++T+ +  L+ + FL GL++D K++  TG K+  +A++G   P
Sbjct  79    RSKGYLQAVFPTRSLTVLDTLANIGLIFFLFLAGLELDPKSLGRTGKKALAIAMAGISLP  138

Query  2268  FLIGAGFYF----TLQTDTQSMIGFIFCGSALTVTGFSTLAKILDSKRLLNTEIGKIAAS  2101
             F +G G  F    T+  D  S    +F G AL++T F  LA+IL   +LL T+IG++A S
Sbjct  139   FAMGIGTSFILRLTISKDVNSTAFLVFMGVALSITAFPVLARILAELKLLTTDIGRMAMS  198

Query  2100  SALINVALSWVLLTIGLLFTGSLDNVQ-----WAvlctvgfvvvcvnyVRPLLNWLISKT  1936
             +A +N   +W+LL + +  +GS  N       W  L    FV+  +  V P+  W+    
Sbjct  199   AAAVNDVAAWILLALAISLSGS--NTSPIISFWVFLSGCIFVICSILIVPPIFKWMTKWC  256

Query  1935  PEGQGFSEFYICSFIAVICAFGCFTDAMGSHPMIGAFIFGLIMPNNELLRTAILDRLEDF  1756
              EG+   E Y+C+ +A + A G  TDA+G H M GAF+ G+++P       A+++++ED 
Sbjct  257   QEGEPVEEMYVCATLAAVLAAGFVTDAIGIHAMFGAFVIGILVPKEGPFAGALVEKVEDI  316

Query  1755  VMGILMPVFFLVCGLRTNIFTITDGDTSIFTALALILLACSAKIIAALVASCYTGMSTNE  1576
             V G+ +P++F+  GL+TN+ TI  G  S    + +I  AC  KI+   V S    +   E
Sbjct  317   VSGLFLPLYFVSSGLKTNVATI-QGLQSWGLLVLVIFTACFGKIVGTFVVSILCKVPLRE  375

Query  1575  AIGLGVLTNTKSTMVMIILEVGqvqqvlsvqqysmmvVACLIMTIVATPLA-ARYCPKQD  1399
             ++ +  L NTK  + +I+L +G+ ++VL+ + +S+MV+  L  T + TPL  A Y P + 
Sbjct  376   SLAMAFLMNTKGLVELIVLNIGKDRKVLNDETFSIMVLMALFTTFITTPLVTAVYKPARR  435

Query  1398  LE--PYKRRTIQNAKPGEELRILACIHGTNNLPAIISLLETSNSTVTSP-ITAFGVQLLE  1228
             ++   YK RT++      ELRILAC HG+ N+ +II+LLE S     +  +  + + L+E
Sbjct  436   VKMADYKYRTVERRSSNTELRILACFHGSRNISSIINLLEVSRGVEKAEGLCVYAMHLME  495

Query  1227  LVGRAPA-MMvvhssgsgrhvggsHEEVQTSQIISTFDNYELRSHGVTAQVLTARWSYDT  1051
             L  R  A +MV  +  +G       +   ++ ++  FD ++  S  V+ + +TA  S   
Sbjct  496   LSERTSAILMVHKARKNGLPFWNRGQRSGSNLVVVAFDAFQQLSR-VSVRPMTAISSMAD  554

Query  1050  MAEDICKMAKEKRAAFLVLPFHKQQGTDGEMEDTNPAIQTVNEGVLLSAPCSVGILVERG  871
             M EDIC  A+ KRAA ++LPFHK Q  DG +E T    Q VN  VL  APCSVGILV+RG
Sbjct  555   MHEDICTTAERKRAAMIILPFHKLQRLDGSLETTRTDFQLVNRRVLGDAPCSVGILVDRG  614

Query  870   -------RPNQYAKNIAVLYLGGPDDREALTYARRMSGLPGVHLTVIRFVPAKDVSADGA  712
                      +  +  I VL+ GG DDREAL Y  RM+  PGV L V RF+   +   + +
Sbjct  615   FGGTTQVSASNVSYVITVLFFGGRDDREALAYGARMAEHPGVSLKVFRFLVKPEAGGEIS  674

Query  711   VEDPDLELELTRETSFVTVSIDPA---RDKEEDEELLNNFRTETAEDDSKTFMELVLDDE  541
                P+   E++R      V +D +   R    DE+ ++  + + ++DDS    E  + + 
Sbjct  675   RVKPEAGGEISR------VDMDGSSSTRLGSLDEDFISELKQKMSKDDSVKLEEKFVGNA  728

Query  540   EEFTKAVKSLDDRSFDLYVAGRGRGVSSALTSGLADWCECPELGAVGDllvtsefessfs  361
              E   A+   + R  +L++ GR      AL   L    + PELG VG LL +S+  ++ S
Sbjct  729   AETIDAIH--EARHSNLFLVGRLPDGEIALD--LRSSSDSPELGPVGGLLASSDISTTAS  784

Query  360   vlvVQQY  340
             VLVV+QY
Sbjct  785   VLVVKQY  791



>ref|XP_003542393.1| PREDICTED: cation/H(+) antiporter 19-like [Glycine max]
Length=813

 Score =   409 bits (1052),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 273/781 (35%), Positives = 443/781 (57%), Gaps = 29/781 (4%)
 Frame = -3

Query  2628  SNGVWEGPDPLAPMIPLFILQIMTAILSSRILNFVLKPFNQPPLVAEILSGIILGPSMLG  2449
             SNG ++  +PL   +PL ILQI   ++ +R++ F+ +P  QP ++AEI+ GI+LGPS +G
Sbjct  17    SNGAFQHENPLDYALPLLILQICLVVVFTRVIAFLCRPLRQPRVIAEIIGGILLGPSAIG  76

Query  2448  NIEEFRKHNFPNHNFETIETMGHFALVLYAFLTGLQMDVKAIVHTGTKSRIVAVSGSIFP  2269
               E+F    FP  +   ++T+G+  L+ + FL GL++D++AI  TG K+  +A+ G   P
Sbjct  77    RNEKFLSTVFPKKSITVLDTLGNVGLLFFLFLVGLELDMRAIRRTGHKALAIALCGITVP  136

Query  2268  FLIGAGFYFTLQTDT----QSMIGFIFCGSALTVTGFSTLAKILDSKRLLNTEIGKIAAS  2101
             F++G G  F L+       + +   +F G AL++T F  LA+IL   +LL T++G+IA S
Sbjct  137   FVLGIGTSFALRATVSKGAEPVSFLVFMGVALSITAFPVLARILAELKLLTTDVGRIAMS  196

Query  2100  SALINVALSWVLLTIGLLFTGSLDN---VQWAvlctvgfvvvcvnyVRPLLNWLISKTPE  1930
             +A +N   +W+LL + +  +GS  +     W +L  V FV+  V  +RPLL  + +++PE
Sbjct  197   AAAVNDVAAWILLALAIAISGSNGSPFVPLWVLLSGVAFVIFAVFAIRPLLVAMANRSPE  256

Query  1929  GQGFSEFYICSFIAVICAFGCFTDAMGSHPMIGAFIFGLIMPNNELLRTAILDRLEDFVM  1750
             G+   E YIC  + ++ A    TD +G H + GAF+ G IMP        +++++ED V 
Sbjct  257   GEPVKEVYICITLTLVLACSFVTDTIGIHALFGAFVIGTIMPKEGSFSVVMIEKIEDLVS  316

Query  1749  GILMPVFFLVCGLRTNIFTITDGDTSIFTALALILLACSAKIIAALVASCYTGMSTNEAI  1570
             G+ +P+FF+  GL+TN+ TI+ G +     L +I  AC  KI+  +V S    + + EA+
Sbjct  317   GLFLPLFFVSSGLKTNVATISGGLSWAMLVL-VIFNACFGKIVGTIVVSLTCKVPSQEAV  375

Query  1569  GLGVLTNTKSTMVMIILEVGqvqqvlsvqqysmmvVACLIMTIVATPLA-ARYCPKQDLE  1393
              LG L NTK  + +I+L +G+ ++VL+ Q +++ V+  L  T + TP+  A Y P +   
Sbjct  376   ALGFLMNTKGLVELIVLNIGKDRKVLNDQAFAICVLMALFTTFITTPIVMAVYKPARRGA  435

Query  1392  PYKRRTIQNAKPGEELRILACIHGTNNLPAIISLLETSNSTVT-SPITAFGVQLLELVGR  1216
             PYK RTIQ   P  ELR+LAC H T N+P +I+L+E+S        +  + + L+EL  R
Sbjct  436   PYKHRTIQRRDPDTELRMLACFHTTRNIPTLINLIESSRGIRKRGKLCIYAMHLMELSER  495

Query  1215  APAMMvvhssgsgrhvggsHEEVQTSQIISTFDNYE-LRSHGVTAQVLTARWSYDTMAED  1039
             + A+ +VH +        + +     Q+I  F  YE LRS  V  + +TA  + +++ ED
Sbjct  496   SSAITMVHKARKNGMPFWNKKPDDKDQMIIAFQAYEKLRS--VNVRPMTAISALNSIHED  553

Query  1038  ICKMAKEKRAAFLVLPFHKQQGTDGEMEDTNPAIQTVNEGVLLSAPCSVGILVERG----  871
             IC  A +KRAA ++LPFHK Q  DG ME    ++  +N+ VL  APCSVGILV+RG    
Sbjct  554   ICTSAHQKRAAMIILPFHKHQRVDGSMESLGHSLHVMNQLVLSHAPCSVGILVDRGLGGT  613

Query  870   ---RPNQYAKNIAVLYLGGPDDREALTYARRMSGLPGVHLTVIRFVPAKDVSADGAVEDP  700
                + +  +  + V + GG DDREAL Y  RM+  PG+ L V++FVP    S     +  
Sbjct  614   SQVQASDVSYKVVVPFFGGRDDREALCYGMRMAEHPGILLNVVKFVPPPGASLAFGAKLV  673

Query  699   DLELELTRETSFVTVSIDPARDKEEDEELLNNFRTETAED-DSKTFMELVLDDEEEFTKA  523
              +     ++   V V      DK++D++L + F +    + +S  + + ++  + +   A
Sbjct  674   GMSSNKDKKAMEV-VGGSYYDDKQQDDQLWSEFLSACNNNQESMKYEQKLVASKGDIEAA  732

Query  522   VKSLDDRSFDLYVAGRGRGVSSALTSGLADWCECPELGAVGDllvtsefessfsvlvVQQ  343
             +K + +RS +L + GR   V       L    +CPELG VG  + +S+F +  SV+V+QQ
Sbjct  733   LKEM-NRS-NLILVGRMPSVGP-----LVSRSDCPELGPVGSYMASSDFSTVTSVMVIQQ  785

Query  342   Y  340
             Y
Sbjct  786   Y  786



>ref|XP_007040407.1| Cation/H+ exchanger 18 [Theobroma cacao]
 gb|EOY24908.1| Cation/H+ exchanger 18 [Theobroma cacao]
Length=806

 Score =   409 bits (1051),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 283/792 (36%), Positives = 448/792 (57%), Gaps = 38/792 (5%)
 Frame = -3

Query  2652  CFSQTIYRSNGVWEGPDPLAPMIPLFILQIMTAILSSRILNFVLKPFNQPPLVAEILSGI  2473
             C S     SNG+++G +PL   +PL ILQI   +  +RIL F+L+P  QP ++AEI+ GI
Sbjct  11    CPSPMKATSNGLFQGDNPLDYALPLAILQICLVVALTRILAFLLRPLRQPRVIAEIVGGI  70

Query  2472  ILGPSMLGNIEEFRKHNFPNHNFETIETMGHFALVLYAFLTGLQMDVKAIVHTGTKSRIV  2293
             +LGPS LG  E++    FP+ +   ++T+ +  L+ + FL GL++D K++  TG K+  +
Sbjct  71    LLGPSALGRNEKYLNAIFPSRSLTVLDTLANLGLLFFLFLVGLELDPKSLRRTGKKALCI  130

Query  2292  AVSGSIFPFLIGAGFYFTLQTDTQSMIG----FIFCGSALTVTGFSTLAKILDSKRLLNT  2125
             A++G   PF +G G  F L       +      +F G AL++T F  LA+IL   +LL T
Sbjct  131   ALAGISVPFALGIGTSFALHATISKGVDEAPFLVFMGVALSITAFPVLARILAELKLLTT  190

Query  2124  EIGKIAASSALINVALSWVLLTIGLLFTGSLDN---VQWAvlctvgfvvvcvnyVRPLLN  1954
             +IG++A S+A +N   +W+LL + +  +G+  +     W  LC  GFV+ C+  V P+  
Sbjct  191   DIGRMAMSAAAVNDVAAWILLALAIALSGTGHSPLVSLWVFLCGSGFVLCCIFIVPPIFK  250

Query  1953  WLISKTPEGQGFSEFYICSFIAVICAFGCFTDAMGSHPMIGAFIFGLIMPNNELLRTAIL  1774
             W+  + PEG+   E YIC+ +A + A G  TD++G H + GAF+ G+++P       A++
Sbjct  251   WMAQRCPEGEPVEELYICATLAAVLAAGFVTDSIGIHALFGAFVIGVLVPKEGPFAGALV  310

Query  1773  DRLEDFVMGILMPVFFLVCGLRTNIFTITDGDTSIFTALALILLACSAKIIAALVASCYT  1594
             +++ED V G+ +P++F+  GL+TN+ TI  G  S    + +I+ AC  KI+  +  S   
Sbjct  311   EKVEDLVSGLFLPLYFVSSGLKTNVATI-RGAQSWGLLVLVIITACLGKIVGTVSVSLMC  369

Query  1593  GMSTNEAIGLGVLTNTKSTMVMIILEVGqvqqvlsvqqysmmvVACLIMTIVATPLA-AR  1417
              +   EA  LG L NTK  + +I+L +G+ ++VL+ Q +++MV+  +  T + TPL  A 
Sbjct  370   KVPFQEAAALGFLMNTKGLVELIVLNIGKDRKVLNDQTFAIMVLMAIFTTFITTPLVMAV  429

Query  1416  YCPKQDLEP--YKRRTIQNAKPGEELRILACIHGTNNLPAIISLLETSNSTVTSP-ITAF  1246
             Y P + +    +K RTI+      +LRILAC H T N+P++I+L+E S  T     +  +
Sbjct  430   YKPAKRMSKRDHKYRTIERKDTNTQLRILACFHSTRNIPSMINLIEASRGTEKKEGLCVY  489

Query  1245  GVQLLELVGRAPA-MMvvhssgsgrhvggsHEEVQTSQIISTFDNYELRSHGVTAQVLTA  1069
              + L+EL  R  A +MV  +  +G       ++  + Q++  F+ +   S  V+ + +TA
Sbjct  490   AMHLMELSERPSAILMVHKARKNGLPFWNKGKQSNSDQVVVAFETFRQLSR-VSVRPMTA  548

Query  1068  RWSYDTMAEDICKMAKEKRAAFLVLPFHKQQGTDGEMEDTNPAIQTVNEGVLLSAPCSVG  889
               +   M EDIC  A+ KRAA ++LPFH+ Q  DG +E T     +VN+ VL  APCSVG
Sbjct  549   ISAMSGMHEDICTSAERKRAAVIILPFHRHQRLDGSLETTRTEFHSVNKQVLAEAPCSVG  608

Query  888   ILVER---GRPNQYAKNIA----VLYLGGPDDREALTYARRMSGLPGVHLTVIRFVPAKD  730
             ILV+R   G  +  A N++    VL+ GG DDREALTY  RM+  PG+ LTVIRF+P  +
Sbjct  609   ILVDRGLGGTTHISASNVSSITTVLFFGGHDDREALTYGARMAEHPGISLTVIRFLPGPE  668

Query  729   VSADGAVEDPDLELELTRETSFVTVSIDPARDKEEDEELLNNFRTETAEDDSKTFMELVL  550
             +S D          E+ R T   T+S   A +   DE  L  F+ + + D + ++ E V+
Sbjct  669   ISGD----------EIVR-TDINTIS--NASEGSTDERALIEFKKKISNDSTISYEERVV  715

Query  549   DDEEEFTKAVKSLDDRSFDLYVAGRGRGVSSALTSGLADWCECPELGAVGDllvtsefes  370
              +  E  + ++     +  L     GR   S + + L    +CPELG VG LL + EF +
Sbjct  716   QNSTETIEVIREFSRCNLFLV----GRMPESQVAATLNAKSDCPELGPVGTLLTSPEFST  771

Query  369   sfsvlvVQQYVR  334
             S SVLVVQQ+ +
Sbjct  772   SASVLVVQQFTK  783



>gb|KHN35057.1| Cation/H(+) antiporter 18 [Glycine soja]
Length=791

 Score =   408 bits (1049),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 268/767 (35%), Positives = 425/767 (55%), Gaps = 51/767 (7%)
 Frame = -3

Query  2628  SNGVWEGPDPLAPMIPLFILQIMTAILSSRILNFVLKPFNQPPLVAEILSGIILGPSMLG  2449
             SNG ++G +PL   +PL ILQI   ++ SR L ++LKPF QP ++AEI+ GIILGPS+LG
Sbjct  5     SNGAFQGDNPLDFALPLAILQICLVLVVSRGLAYLLKPFRQPRVIAEIIGGIILGPSVLG  64

Query  2448  NIEEFRKHNFPNHNFETIETMGHFALVLYAFLTGLQMDVKAIVHTGTKSRIVAVSGSIFP  2269
               + + +  FP  +   ++T+ +  L+ + FL GL++D+K++  +G +   +A++G   P
Sbjct  65    RNKSYMQKVFPPRSLPVLDTLANIGLIFFLFLAGLELDLKSLRQSGNRVLAIAMAGISLP  124

Query  2268  FLIGAGFYFTLQ------TDTQSMIGFIFCGSALTVTGFSTLAKILDSKRLLNTEIGKIA  2107
             F+IG G  F L+      +D  + +  +F G AL++T F  LA+IL   +LL T +GK A
Sbjct  125   FVIGIGTSFVLKQTIAKGSDNAAFL--VFMGVALSITAFPVLARILAELKLLTTNVGKTA  182

Query  2106  ASSALINVALSWVLLTIGLLFTGSLDN---VQWAvlctvgfvvvcvnyVRPLLNWLISKT  1936
              S+A IN   +W+LL + +  +G   +     W  L   GFV+  +  V P+  W+  + 
Sbjct  183   MSAAAINDIAAWILLALAVALSGHDRSPLVSLWVFLAGCGFVICAILIVPPIFKWMSQRC  242

Query  1935  PEGQGFSEFYICSFIAVICAFGCFTDAMGSHPMIGAFIFGLIMPNNELLRTAILDRLEDF  1756
              EG+   E YIC+ +A + A G  TDA+G H M GAF+ G+++PN+    +A+++++ED 
Sbjct  243   HEGEPVEEVYICATLAAVLAAGFVTDAIGIHAMFGAFVVGILVPNDGPFASALVEKVEDL  302

Query  1755  VMGILMPVFFLVCGLRTNIFTITDGDTSIFTALALILLACS-AKIIAALVASCYTGMSTN  1579
             V G+ +P++F+  GL+TN+ TI    +  +  LA ++   S  KI+  LV S +  +  N
Sbjct  303   VSGLFLPLYFVSSGLKTNVATIKGAQS--WGLLAFVIFTASFGKILGTLVVSLFCKVPFN  360

Query  1578  EAIGLGVLTNTKSTMVMIILEVGqvqqvlsvqqysmmvVACLIMTIVATPLA-ARYCP--  1408
             EA+ LG L N K  + +I+L +G+ ++VL+ Q +++MV+  +  T + TPL  A Y P  
Sbjct  361   EALVLGFLMNCKGLVELIVLNIGKDRKVLNDQTFAIMVLMAVFTTFITTPLVTAVYKPAR  420

Query  1407  KQDLEPYKRRTIQNAKPGEELRILACIHGTNNLPAIISLLETSNSTVT-SPITAFGVQLL  1231
             K  +  YK RTI       +LRILAC HG  N+P++I+L+E S        +  + + L 
Sbjct  421   KGKITNYKYRTIGRKNANSQLRILACFHGARNIPSMINLIEASRGIQKRDALCVYAMHLK  480

Query  1230  ELVGRAPAM-MvvhssgsgrhvggsHEEVQTSQIISTFDNYELRSHGVTAQVLTARWSYD  1054
             E   R+ +M MV  +  +G           ++ +I  F+ Y   S  V+ + + A  S +
Sbjct  481   EFSERSSSMLMVHKARRNGLPFWNKGHHADSNHVIVAFEAYRQLSQ-VSIRPMIAISSMN  539

Query  1053  TMAEDICKMAKEKRAAFLVLPFHKQQGTDGEMEDTNPAIQTVNEGVLLSAPCSVGILVER  874
              + EDIC  A+ K AA ++LPFHK Q  DG +  T    + VN+ VL  APCSVGI V+R
Sbjct  540   NIHEDICATAERKGAAVIILPFHKHQRLDGSLNITRNDFRWVNKRVLEHAPCSVGIFVDR  599

Query  873   G-------RPNQYAKNIAVLYLGGPDDREALTYARRMSGLPGVHLTVIRFVPAKDVSADG  715
             G         +  +  + VL+ GG DD EAL Y  RM+  PG+ L VIRFV       +G
Sbjct  600   GLGGTSHVSASNVSYRVTVLFFGGGDDHEALAYGARMAEHPGIRLLVIRFVGE---PMNG  656

Query  714   AVEDPDLELELTRETSFVTVSIDPARDKEEDEELLNNFRTETAEDDSKTFMELVLDDEEE  535
              +    + +++   TS   +S        +DEE L+  +T+ A DDS  + E V+ D  E
Sbjct  657   EI----VRVDVGDSTSTKLIS--------QDEEFLDEIKTKIANDDSIIYEEKVVKDGAE  704

Query  534   FTKAVKSLDDRSFDLYVAGR--GRGVSSALTSGLADWCECPELGAVG  400
                 ++ L  +S +L++ G      V+SA+        ECPELG VG
Sbjct  705   TVAIIREL--KSCNLFLVGSRPASEVASAMKRS-----ECPELGPVG  744



>ref|XP_003611041.1| Na+/H+ antiporter-like protein [Medicago truncatula]
 gb|AES93999.1| cation/H+ exchanger 3 [Medicago truncatula]
Length=800

 Score =   408 bits (1049),  Expect = 5e-124, Method: Compositional matrix adjust.
 Identities = 272/783 (35%), Positives = 433/783 (55%), Gaps = 44/783 (6%)
 Frame = -3

Query  2628  SNGVWEGPDPLAPMIPLFILQIMTAILSSRILNFVLKPFNQPPLVAEILSGIILGPSMLG  2449
             SNGV++G  PL   +PL ILQI   ++ +R L ++LKP  QP ++AEI+ GI+LGPS  G
Sbjct  19    SNGVFQGDHPLDYALPLAILQICLVLVVTRGLAYLLKPLRQPRVIAEIVGGILLGPSAFG  78

Query  2448  NIEEFRKHNFPNHNFETIETMGHFALVLYAFLTGLQMDVKAIVHTGTKSRIVAVSGSIFP  2269
               + +    FP  +   ++T+ +  L+ + FL G+++D K++  TG +   +A+ G   P
Sbjct  79    RNKSYLHAVFPPKSLPVLDTLANLGLIFFLFLAGIELDPKSLGKTGGRVLAIAMVGISLP  138

Query  2268  FLIGAGFYFTLQ----TDTQSMIGFIFCGSALTVTGFSTLAKILDSKRLLNTEIGKIAAS  2101
             F +G G  F L+     D  +    ++ G AL++T F  LA+IL   +LL T +G++A S
Sbjct  139   FALGIGSSFVLKETIAKDVNTSAFLVYMGVALSITAFPVLARILAELKLLTTSVGRMAMS  198

Query  2100  SALINVALSWVLLTIGLLFTGSLDN---VQWAvlctvgfvvvcvnyVRPLLNWLISKTPE  1930
             +A +N   +W+LL + +  +G+  +     W  L   GFVV  +  V P+  W+  +  E
Sbjct  199   AAAVNDVAAWILLALAVALSGNSQSPLVSLWVFLAGCGFVVCSILIVLPIFKWMAQQCHE  258

Query  1929  GQGFSEFYICSFIAVICAFGCFTDAMGSHPMIGAFIFGLIMPNNELLRTAILDRLEDFVM  1750
             G+   E YIC+ +A + A G  TDA+G H M GAF+FG+++P +     A+++++ED V 
Sbjct  259   GEPVDELYICATLASVLAAGFVTDAIGIHAMFGAFVFGILVPKDGPFSGALVEKIEDLVS  318

Query  1749  GILMPVFFLVCGLRTNIFTITDGDTSIFTALALILLACSAKIIAALVASCYTGMSTNEAI  1570
             G+L+P++F+  GL+TNI TI  G  S    + +   AC  KI+  +V S    +S NE++
Sbjct  319   GLLLPLYFVSSGLKTNIATI-QGLQSWGLLVFVTFTACFGKIVGTIVVSLLCKVSFNESL  377

Query  1569  GLGVLTNTKSTMVMIILEVGqvqqvlsvqqysmmvVACLIMTIVATPLA-ARYCPKQDLE  1393
              LG L N+K  + +I+L +G+ ++VL+ + +++MV+  L+ T + TPL  A Y  K  + 
Sbjct  378   VLGFLMNSKGLVELIVLNIGKDRKVLNDETFAIMVLMALVTTFMTTPLVMAAYKRKAKIS  437

Query  1392  PYKRRTIQNAKPGEELRILACIHGTNNLPAIISLLETSNSTVT-SPITAFGVQLLELVGR  1216
              YK +T++      ELRILAC HG  N+P++I+L+E S        +  + + L E   R
Sbjct  438   DYKYKTVERKNADSELRILACFHGARNIPSVINLIEASRGIKKRDALCVYAMHLKEFSER  497

Query  1215  APA-MMvvhssgsgrhvggsHEEVQTSQIISTFDNYELRSHGVTAQVLTARWSYDTMAED  1039
             + + +MV     +G           +  +I  F+ Y+  S  V  + + A  S   + ED
Sbjct  498   SSSILMVQKVRKNGLPFWNKGHRADSDHVIVAFEAYQKLSQ-VCVRPMVAISSMANIHED  556

Query  1038  ICKMAKEKRAAFLVLPFHKQQGTDGEMEDTNPAIQTVNEGVLLSAPCSVGILVERG----  871
             IC  A+ KRAA ++LPFH QQ  DG ++ T    + VN+ VL  APCSVGI V+RG    
Sbjct  557   ICATAERKRAAVIILPFHMQQRLDGSLDVTRNDFRFVNKRVLEHAPCSVGIFVDRGLGGT  616

Query  870   ---RPNQYAKNIAVLYLGGPDDREALTYARRMSGLPGVHLTVIRFVPAKDVSADGAVEDP  700
                  +  +  +AVL+ GG DDREAL Y  R +  PG+ L +IRF+              
Sbjct  617   CHVSASNVSYCVAVLFFGGGDDREALAYGARTAEHPGIRLVIIRFL--------------  662

Query  699   DLELELTRETSFVTVSIDP-ARDKEEDEELLNNFRTETAEDDSKTFMELVLDDEEEFTKA  523
              +E  +  E S V V      +   EDEE L  F+ +TA DDS  + E ++ D  E   +
Sbjct  663   -VESTILGEISSVDVGDSSIGKSISEDEEFLAEFKLKTASDDSVIYEEKIVKDAAETVAS  721

Query  522   VKSLDDRSFDLYVAG-RGRG-VSSALTSGLADWCECPELGAVGDllvtsefessfsvlvV  349
             ++  +  S +L++ G R  G ++ AL     +  ECPELG VG LL++ +  ++ SVLV+
Sbjct  722   IRKFN--SCNLFLVGLRPTGELACAL-----ERRECPELGPVGGLLISQDCPTTASVLVM  774

Query  348   QQY  340
             QQY
Sbjct  775   QQY  777



>ref|XP_007158549.1| hypothetical protein PHAVU_002G161600g [Phaseolus vulgaris]
 gb|ESW30543.1| hypothetical protein PHAVU_002G161600g [Phaseolus vulgaris]
Length=802

 Score =   408 bits (1049),  Expect = 5e-124, Method: Compositional matrix adjust.
 Identities = 280/785 (36%), Positives = 435/785 (55%), Gaps = 47/785 (6%)
 Frame = -3

Query  2628  SNGVWEGPDPLAPMIPLFILQIMTAILSSRILNFVLKPFNQPPLVAEILSGIILGPSMLG  2449
             SNGV++G +PL   +PL ILQI   ++ SR L ++LKP  QP ++AEI+ GI+LGPS LG
Sbjct  19    SNGVFQGDNPLDFALPLAILQICLVLVVSRGLAYLLKPLRQPRVIAEIIGGILLGPSALG  78

Query  2448  NIEEFRKHNFPNHNFETIETMGHFALVLYAFLTGLQMDVKAIVHTGTKSRIVAVSGSIFP  2269
               + + +  FP+ +   ++T+ +  L+ + FL GL++D+K++  +G +   +A++G   P
Sbjct  79    RSKSYMQAVFPSRSLTVLDTLANIGLIFFLFLAGLELDLKSLRQSGHRVLAIAMAGISLP  138

Query  2268  FLIGAGFYFTLQTD----TQSMIGFIFCGSALTVTGFSTLAKILDSKRLLNTEIGKIAAS  2101
             F++G G  F L+      + S    +F G AL++T F  LA+IL   +LL T +G+ A S
Sbjct  139   FVMGIGSSFVLKQSIAKGSDSAAFLVFMGVALSITAFPVLARILAELKLLTTNVGRTAMS  198

Query  2100  SALINVALSWVLLTIGLLFTGSLDN---VQWAvlctvgfvvvcvnyVRPLLNWLISKTPE  1930
             +A IN   +W+LL + +  +G   +     W  L   GFV+     V P+  W+  +  E
Sbjct  199   AAAINDIAAWILLALAVALSGHERSPLVSLWVFLAGCGFVICASIIVPPIFKWVSQRCHE  258

Query  1929  GQGFSEFYICSFIAVICAFGCFTDAMGSHPMIGAFIFGLIMPNNELLRTAILDRLEDFVM  1750
             G+   E YIC+ +A + A G  TDA+G H M GAF+ G+++PN+    +A+++++ED V 
Sbjct  259   GEPVEEIYICATLAAVLAAGFVTDAIGIHAMFGAFVVGILIPNDGPFASALVEKVEDLVS  318

Query  1749  GILMPVFFLVCGLRTNIFTITDGDTSIFTALALILLACSAKIIAALVASCYTGMSTNEAI  1570
             G+ +P++F+  GL+TNI TI  G  S    + +I  A   KI+   V S    +S N+A+
Sbjct  319   GLFLPLYFVSSGLKTNIATI-KGLQSWGLLVFVIFTASFGKILGTTVVSLLCKVSLNDAL  377

Query  1569  GLGVLTNTKSTMVMIILEVGqvqqvlsvqqysmmvVACLIMTIVATPLA-ARYCPKQDLE  1393
              LG L N K  + +I+L +G+ ++VL+ Q +++MV+  +  T V TPL  A Y P +   
Sbjct  378   VLGFLMNCKGLVELIVLNIGKDRKVLNDQTFAIMVLMAVFTTFVTTPLVTAIYKPARKRS  437

Query  1392  PYKRRTIQNAKPGEELRILACIHGTNNLPAIISLLETSNSTVTSP-ITAFGVQLLELVGR  1216
              YK RTI       +LRILAC H   N+P++I+L+E S        +  + + L E   R
Sbjct  438   DYKYRTIWRKNANSQLRILACFHCARNIPSMINLIEASRGIQKRDGLCMYAMHLKEFSER  497

Query  1215  APA-MMvvhssgsgrhvggsHEEVQTSQIISTFDNYELRSHG-VTAQVLTARWSYDTMAE  1042
             + + +MV  +  +G           + Q+I  F+ Y  R  G V+ + +TA  S   + E
Sbjct  498   SSSILMVHKARRNGLPFWNKGCHSHSDQVIVAFEAY--RQLGQVSIRPMTAISSMANIHE  555

Query  1041  DICKMAKEKRAAFLVLPFHKQQGTDGEMEDTNPAIQTVNEGVLLSAPCSVGILVERG---  871
             DIC+ A+ K AA ++LPFHK Q  DG +  T    + VN+ VL  APCSVGI V+RG   
Sbjct  556   DICETAERKEAAVIILPFHKHQSLDGSLNTTRNDFRGVNKRVLEHAPCSVGIFVDRGLGG  615

Query  870   ----RPNQYAKNIAVLYLGGPDDREALTYARRMSGLPGVHLTVIRFVPAKDVSADGAVED  703
                   +  +  + VL+ GG DD+EAL Y  RM+  PG+ L VIRFV          VE 
Sbjct  616   TSHVSASNVSYRVTVLFFGGGDDQEALAYGGRMAEHPGIKLVVIRFV----------VEP  665

Query  702   PDLELELTR----ETSFVTVSIDPARDKEEDEELLNNFRTETAEDDSKTFMELVLDDEEE  535
             P+ E E+ R    ++S  T SI       +DE+ L+ F+ +TA DDS  + E  + +  E
Sbjct  666   PN-EGEILRVDVDDSSSGTTSIS------QDEKFLDEFKVKTANDDSIIYEERRVKNTAE  718

Query  534   FTKAVKSLDDRSFDLYVAGRGRGVSSALTSGLADWCECPELGAVGDllvtsefessfsvl  355
                 +   +  S  L  +     V+SAL S      ECPELG VG LL + ++ ++ SVL
Sbjct  719   TIAIIHEFNSSSLFLVGSRPVSEVASALKSS-----ECPELGPVGGLLASHDYPTTASVL  773

Query  354   vVQQY  340
             V+QQY
Sbjct  774   VIQQY  778



>gb|KHG06329.1| hypothetical protein F383_32801 [Gossypium arboreum]
Length=802

 Score =   407 bits (1047),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 288/796 (36%), Positives = 448/796 (56%), Gaps = 46/796 (6%)
 Frame = -3

Query  2652  CFSQTIYRSNGVWEGPDPLAPMIPLFILQIMTAILSSRILNFVLKPFNQPPLVAEILSGI  2473
             C S     SNGV++G +PL   +PL ILQI   +  +RIL F+L+P  QP ++AEI+ GI
Sbjct  11    CPSPMKATSNGVFQGDNPLDFALPLAILQICLVVALTRILAFLLRPLRQPRVIAEIVGGI  70

Query  2472  ILGPSMLGNIEEFRKHNFPNHNFETIETMGHFALVLYAFLTGLQMDVKAIVHTGTKSRIV  2293
             +LGPS+LG  E++    FP  +   ++T+ +  L+ + FL GL++D K+I  TG K+  +
Sbjct  71    LLGPSVLGRNEKYLNAIFPAKSHTVLDTLANLGLLFFLFLVGLELDPKSIRRTGKKALSI  130

Query  2292  AVSGSIFPFLIGAGFYFTLQTDTQSMIG----FIFCGSALTVTGFSTLAKILDSKRLLNT  2125
             AV+G   PF++G G  + L+      +      +F G AL++T F  LA+IL   +LL T
Sbjct  131   AVAGISLPFMLGIGTSYALRATISKGVDEAPFLVFMGVALSITAFPVLARILAELKLLTT  190

Query  2124  EIGKIAASSALINVALSWVLLTIGLLFTGSLDN---VQWAvlctvgfvvvcvnyVRPLLN  1954
             +IG++A S+A +N   +W+LL + +  +G+ ++     W  LC  GFVV C   V P+  
Sbjct  191   DIGRMAMSAAAVNDVAAWILLALAIALSGTGNSPLVSLWVFLCGTGFVVGCTFIVPPIFK  250

Query  1953  WLISKTPEGQGFSEFYICSFIAVICAFGCFTDAMGSHPMIGAFIFGLIMPNNELLRTAIL  1774
             W++ + PEG+  +E Y+C+ +  + A G  TD +G H + GAF+ G+++P       A++
Sbjct  251   WMVQRCPEGEPVNELYVCATLTAVLAAGFVTDLIGIHALFGAFVIGVLVPKEGPFAGALV  310

Query  1773  DRLEDFVMGILMPVFFLVCGLRTNIFTITDGDTSIFTALALILLACSAKIIAALVASCYT  1594
             +++ED V G+ +P++F+  GL+TNI TI  G  S    + +I+ AC  KI   +  S   
Sbjct  311   EKVEDLVSGLFLPLYFVSSGLKTNIATI-QGAQSWGLLVLVIITACFGKIAGTVSVSLLC  369

Query  1593  GMSTNEAIGLGVLTNTKSTMVMIILEVGqvqqvlsvqqysmmvVACLIMTIVATPLA-AR  1417
              +  +EA+ LG L NTK  + +I+L +G+ ++VL+ Q +++MV+  +  T + TPL  A 
Sbjct  370   NVPFSEALALGFLMNTKGLVELIVLNIGKDRKVLNDQTFAIMVLMAVFTTFITTPLVMAV  429

Query  1416  YCP--KQDLEPYKRRTIQNAKPGEELRILACIHGTNNLPAIISLLETSNSTVTSP-ITAF  1246
             Y P  +Q    YK +TI+  +   +LRILAC H   N+P +I+L+E S  T     +  +
Sbjct  430   YKPAKRQGKGDYKHKTIERKESNSQLRILACFHSYRNIPTMINLIEASRGTEKKEGLCVY  489

Query  1245  GVQLLELVGRAPAM-MvvhssgsgrhvggsHEEVQTSQIISTFDNYELRSHGVTAQVLTA  1069
              + L+EL  R  AM MV  +  +G       ++    QI+  F+ +   S  V  + +TA
Sbjct  490   ALHLMELSERPSAMLMVHKARKNGLPFWNKVKQSGGDQIVVAFETFRQLSR-VVVRPMTA  548

Query  1068  RWSYDTMAEDICKMAKEKRAAFLVLPFHKQQGTDGEMEDTNPAIQTVNEGVLLSAPCSVG  889
               S  ++ EDIC+ A+ KRAA ++LPFHK Q  DG  E T    Q VN+ VL  APCSVG
Sbjct  549   ISSISSLHEDICESAERKRAAMIILPFHKHQRVDGTFETTRTDYQLVNKRVLEQAPCSVG  608

Query  888   ILVER---GRPNQYAKN----IAVLYLGGPDDREALTYARRMSGLPGVHLTVIRFVPAKD  730
             ILV+R   G  +  A N    I VL+ GG DDREAL Y  RM+  PG+ LTV+RFVP  +
Sbjct  609   ILVDRGLGGTTHISASNVDSIITVLFFGGHDDREALAYGTRMAEHPGISLTVVRFVPGPE  668

Query  729   VSADGAVEDPDLELELTRETSFVTVSIDPARDKEEDEELLNNFRTETAEDDSKTFMELVL  550
             VS +                  VT  I+ +     D+ +L  F+ + + ++S ++ E V+
Sbjct  669   VSGE-----------------IVTADINTS-----DDRVLMEFKNKASNENSISYEERVV  706

Query  549   DDEEEFTKAVKSLDDRSFDLYVAGRGRGVSSALTSGL-ADWCECPELGAVGDllvtsefe  373
                 E  +A++       +L++ G+        T+ L A   EC ELG +G LL ++EF 
Sbjct  707   RSSRETIEAIREFS--RCNLFLVGQMPENHVTATAKLNAAKTECLELGVIGSLLTSAEFS  764

Query  372   ssfsvlvVQQYVRTNK  325
             +S SVLVVQQY  T K
Sbjct  765   TSASVLVVQQYRTTKK  780



>ref|XP_010315616.1| PREDICTED: cation/H(+) antiporter 15-like isoform X2 [Solanum 
lycopersicum]
Length=689

 Score =   404 bits (1037),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 263/703 (37%), Positives = 406/703 (58%), Gaps = 31/703 (4%)
 Frame = -3

Query  2397  IETMGHFALVLYAFLTGLQMDVKAIVHTGTKSRIVAVSGSIFPFLIGAGFY-FTLQTDTQ  2221
             +ET+G+  L+ + FL GL+MD++A+   G K+  + +SG++FPF  GA  Y F  +    
Sbjct  3     METVGNLGLIYHVFLIGLEMDLRALTSVGPKALGIGISGALFPFFFGASLYTFIAEYPEN  62

Query  2220  SMIGFIFCGSALTVTGFSTLAKILDSKRLLNTEIGKIAASSALINVALSWVLLTIGLLFT  2041
                G ++ G AL+VTG   +A+I    +LL++EIG+IA SSAL+N   SWVLL   L  T
Sbjct  63    FRWGCLYWGVALSVTGLPVIAEIFAKLKLLHSEIGRIAMSSALVNDISSWVLLVFSLAVT  122

Query  2040  GSLDNVQWAvlctvgfvvvcvnyVRPLLNWLISK-TPEGQGFSEFYICSFIAVICAFGCF  1864
              S      ++   + FV+  V  +RP + W++ K T EG+ +SE  IC+ + ++ A G  
Sbjct  123   SSSSTTYLSLFSVLFFVIFSVFVIRPAILWMLRKITREGEDYSEATICAILTMVLACGLI  182

Query  1863  TDAMGSHPMIGAFIFGLIMPNNELLRTAILDRLEDFVMGILMPVFFLVCGLRTNIFTITD  1684
             TD  G   + GAF+FGLI+P++ L    +L  ++ FV  +L+P+++   G+RT++  I+ 
Sbjct  183   TDMCGVSSVFGAFVFGLIIPSHVLGHRFVL-MVQGFVSDLLLPLYYASLGMRTHLGGISR  241

Query  1683  GDTSIFTALALILLACSAKIIAALVASCYTGMSTNEAIGLGVLTNTKSTMVMIILEVGqv  1504
              D  +   ++L  L+   KI+  L  S +  +S +E   LG+L NTK  + ++ + +G+ 
Sbjct  242   EDMLMMVLISL--LSFIPKIVCTLAMSYFYRISLHEGFTLGILMNTKGLVAVMAMSLGRD  299

Query  1503  qqvlsvqqysmmvVACLIMTIVATPLAA-RYCPKQDLEPYKRRTIQNAKPGEELRILACI  1327
               V++   +++M+     MTIV +P+    Y   +   P + R +QN KP  ELRIL CI
Sbjct  300   HTVMNDDGFAIMLFTIFFMTIVTSPIVNFLYRRTKKFLPSQHRVLQNLKPDSELRILTCI  359

Query  1326  HGTNNLPAIISLLETSNSTVTSPITAFGVQLLELVGRAPAMMvvhssgsgrhvggsHEEV  1147
             H       I +LLE S+++  SPI  F +QL++L     A+++VH +G       S  + 
Sbjct  360   HEVQTAAGITALLEISHASRRSPICIFALQLMQLKKHTTALLIVHGAGGTSSESYSRADG  419

Query  1146  QTSQIISTFDNYELRSHGVTAQVLTARWSYDTMAEDICKMAKEKRAAFLVLPFHKQQGTD  967
             Q  Q+I+TF+N E +S  ++ Q+LTA   Y TM EDIC +A+EK+   ++LPFHK+Q   
Sbjct  420   QIDQLITTFNNLEHQSPMISVQLLTAISPYGTMHEDICSLAEEKQVTLIILPFHKRQTIH  479

Query  966   GEMEDTNPAIQTVNEGVLLSAPCSVGILVERG----------RPNQYAKNIAVLYLGGPD  817
               ME+ NPA + VN   L SAPC+VGILV+RG            N  +  IA++++GG D
Sbjct  480   NNMEEMNPAYKDVNNSTLESAPCAVGILVDRGFGTLLTSKIDDGNARSCRIAMIFIGGRD  539

Query  816   DREALTYARRMSGLPGVHLTVIRFVPAKDVSADGAVEDPDLELELTRETSFVTVSIDPAR  637
             DREALTYA RM+  P V L V+RF+  K  + +   +D DL L +  E            
Sbjct  540   DREALTYASRMARHPKVALIVLRFILDKTSAQN---DDADLFLTMEGED-----------  585

Query  636   DKEEDEELLNNFRTETAEDDSKTFMELVLDDEEEFTKAVKSLDDRSFDLYVAGRGRGVSS  457
             +K+ D+  +N FR +   DDS  + E +  +  E  K ++SL  + FDLYV GRG    S
Sbjct  586   EKKVDDHFVNEFRLKVQNDDSVVYTEQMSSNGAETVKTIRSL-GQDFDLYVLGRGLSFFS  644

Query  456   ALTSGLADWCECPELGAVGDllvtsefessfsvlvVQQYVRTN  328
              L  GL +W +CPELG++GDLL+TS+F S+ S+LVVQ +   N
Sbjct  645   PLKGGLDEWSDCPELGSIGDLLLTSDFSSTASILVVQHHAELN  687



>ref|XP_008369567.1| PREDICTED: cation/H(+) antiporter 19-like [Malus domestica]
Length=817

 Score =   407 bits (1047),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 289/824 (35%), Positives = 448/824 (54%), Gaps = 63/824 (8%)
 Frame = -3

Query  2715  APPPPSTGPEVDLDRLGQVVMCFSQTIYRSNGVWEGPDPLAPMIPLFILQIMTAILSSRI  2536
             APPPP   P                    SNG ++G +PL   IPL ILQI+  ++ +R 
Sbjct  2     APPPPLVAP----------------MKATSNGSFQGENPLDFAIPLLILQIVLVVVFTRT  45

Query  2535  LNFVLKPFNQPPLVAEILSGIILGPSMLGNIEEFRKHNFPNHNFETIETMGHFALVLYAF  2356
             L F+LKP  QP ++AE++ GI+LGPS  G  ++F    FP      ++T+ +  L+ + F
Sbjct  46    LAFLLKPLRQPRVIAEVIGGILLGPSAFGRSQKFLHTVFPAKAMTVLDTVANIGLLFFLF  105

Query  2355  LTGLQMDVKAIVHTGTKSRIVAVSGSIFPFLIGAGFYFTLQTDTQSMIG----FIFCGSA  2188
             L GL++D++AI  TG KS  +AV+G   PF++G    F L+      +      +F G A
Sbjct  106   LVGLELDIRAIRRTGKKSLGIAVAGITLPFVLGVFTSFALRATVSKGVSQGPFLVFIGVA  165

Query  2187  LTVTGFSTLAKILDSKRLLNTEIGKIAASSALINVALSWVLLTIGLLFTGS----LDNVQ  2020
             L++T F  LA+IL   +LL T++G+IA S+A +N   +W+LL + +  TG+    L +V 
Sbjct  166   LSITAFPVLARILAELKLLTTDVGRIAMSAAAVNDVAAWILLALAIALTGTNTSPLVSV-  224

Query  2019  WAvlctvgfvvvcvnyVRPLLNWLISKTPEGQGFSEFYICSFIAVICAFGCFTDAMGSHP  1840
             W +L   GFV  CV  +RPLL  +  ++P+G+   E YIC  ++++ +    TD +G H 
Sbjct  225   WVLLSGAGFVGFCVIALRPLLAMMARRSPDGEPVKELYICITLSLVLSASFVTDVIGIHA  284

Query  1839  MIGAFIFGLIMPNNELLRTAILDRLEDFVMGILMPVFFLVCGLRTNIFTITDGDTSIFTA  1660
             + GAF+ G+I+P        ++++LED V G+ +P++F+  GL+TN+ TI+ G +     
Sbjct  285   LFGAFVVGIIVPKEGPFAGVLIEKLEDLVSGLFLPLYFVSSGLKTNVATISGGQSWALL-  343

Query  1659  LALILLACSAKIIAALVASCYTGMSTNEAIGLGVLTNTKSTMVMIILEVGqvqqvlsvqq  1480
             L +I  A   KI+  +  S    +   EA+ LG L NTK  + +I+L +G+ ++VL+ Q 
Sbjct  344   LLVIFTASFGKIVGTVTVSMACKVPFREALALGFLMNTKGLVELIVLNIGKDRKVLNDQT  403

Query  1479  ysmmvVACLIMTIVATPLA-ARYCPKQDLEPYKRRTIQNAKPGEELRILACIHGTNNLPA  1303
             +++ V+  L  T + TPL  A Y P +   PYK R++    P  ELR+LAC H T N+P 
Sbjct  404   FAIFVLMALFTTFITTPLVMAVYKPARRGAPYKHRSVFRKNPDTELRMLACFHSTRNIPT  463

Query  1302  IISLLETSNSTVT-SPITAFGVQLLELVGRAPA--MMvvhssgsgrhvggsHEEVQTSQI  1132
             +I+L+E+S  T     +T + + L+EL  R+ A  M+    +         ++E    Q+
Sbjct  464   VINLIESSRGTRKRGRLTVYAMHLMELSERSSAISMVHKARNNGLPFWNKKNDENNKDQM  523

Query  1131  ISTFDNYELRSHGVTAQVLTARWSYDTMAEDICKMAKEKRAAFLVLPFHKQQGTDGEMED  952
             +  F+ YE  S  V  + +TA  S D + EDIC  A +K AA ++L FHK Q  DG ME 
Sbjct  524   VIAFEAYEQLS-SVKVRPMTAISSLDNIHEDICASAHQKNAAVILLRFHKHQRLDGNMES  582

Query  951   TNPAIQTVNEGVLLSAPCSVGILVERG-------RPNQYAKNIAVLYLGGPDDREALTYA  793
                A ++VNE VL  APCSVGILV+RG         ++ + NI V + GG DDREAL Y 
Sbjct  583   LGNAFRSVNERVLKHAPCSVGILVDRGLGGTAQVSASEVSYNIMVAFFGGRDDREALAYG  642

Query  792   RRMSGLPGVHLTVIRFV-PAKDVSADGAVE---DPDLELELTRETSFVTVSIDPARDKEE  625
              R++  PG+ +T+IRFV P     + GA       D   E+ +E        D   D++E
Sbjct  643   MRLAEHPGIVMTLIRFVAPQGKTLSFGAKLVGITSDKNKEILKEE-------DCGGDQKE  695

Query  624   DEELL---------NNFRTETAEDDSKTFMELVLDDEEEFTKAVKSLDDRSFDLYVAGRG  472
             D+E L         N+   E   + S  + E V+D + E    +KS+  ++ +L++ GR 
Sbjct  696   DDESLLAEYMNVMKNSGNKEGGGEPSMLYEEKVVDSKAEICVVLKSM-AKNVNLFIVGRM  754

Query  471   RGVSSALTSGLADWCECPELGAVGDllvtsefessfsvlvVQQY  340
                +  + S      +C ELG VG  L +S+F S+ SV+V QQY
Sbjct  755   PPTAPLVDSS----SDCAELGPVGSFLASSDFSSTASVVVFQQY  794



>ref|XP_004511538.1| PREDICTED: LOW QUALITY PROTEIN: cation/H(+) antiporter 18-like 
[Cicer arietinum]
Length=801

 Score =   407 bits (1046),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 273/781 (35%), Positives = 432/781 (55%), Gaps = 40/781 (5%)
 Frame = -3

Query  2628  SNGVWEGPDPLAPMIPLFILQIMTAILSSRILNFVLKPFNQPPLVAEILSGIILGPSMLG  2449
             SNG ++G +PL   +PL ILQI   ++ +R L ++ +P  QP ++AEI+ GI+LGPS LG
Sbjct  19    SNGAFQGDNPLDYALPLAILQICLVLVVTRGLAYLFRPLRQPRVIAEIVGGILLGPSALG  78

Query  2448  NIEEFRKHNFPNHNFETIETMGHFALVLYAFLTGLQMDVKAIVHTGTKSRIVAVSGSIFP  2269
               + +    FP  +   ++T+ +  L+ + FL G+++D K++  TG +   +A +G   P
Sbjct  79    RNKSYLNAVFPPKSLTVLDTLANLGLIFFLFLAGVELDPKSLRKTGGRVLAIATAGISLP  138

Query  2268  FLIGAGFYFTLQT----DTQSMIGFIFCGSALTVTGFSTLAKILDSKRLLNTEIGKIAAS  2101
             F +G G  F L+     D  +    ++ G AL++T F  LA+IL   +LL T +G++A S
Sbjct  139   FALGIGSSFVLKATIAKDVNTSAFVVYMGVALSITAFPVLARILAELKLLTTSVGRMAMS  198

Query  2100  SALINVALSWVLLTIGLLFTGSLDN---VQWAvlctvgfvvvcvnyVRPLLNWLISKTPE  1930
             +A +N   +W+LL + +  +G+  +     W  L   GFVV  +  V P+  W+  K  E
Sbjct  199   AAAVNDVAAWILLALAVALSGNSQSPLVSLWVFLGGCGFVVCSILIVLPIFKWMAQKCHE  258

Query  1929  GQGFSEFYICSFIAVICAFGCFTDAMGSHPMIGAFIFGLIMPNNELLRTAILDRLEDFVM  1750
             G+   E YIC+ +A + A G  TDA+G H M GAF+FG+++P +     A+++++ED V 
Sbjct  259   GEPVEELYICATLAAVLAAGFVTDAIGIHAMFGAFVFGILVPKDGPFAGALVEKIEDLVS  318

Query  1749  GILMPVFFLVCGLRTNIFTITDGDTSIFTALALILLACSAKIIAALVASCYTGMSTNEAI  1570
             G+L+P++F+  GL+TNI TI  G  S    + +   AC  KI+  +VA     +S NE++
Sbjct  319   GLLLPLYFVSSGLKTNIATI-QGLQSWGLVIFVTFTACFGKIVGTIVACLLCKVSFNESL  377

Query  1569  GLGVLTNTKSTMVMIILEVGqvqqvlsvqqysmmvVACLIMTIVATPLA-ARYCPKQDLE  1393
              LG L N+K  + +I+L +G+ ++VL+ Q +++MV+  L  T + TPL  A Y  K  + 
Sbjct  378   VLGFLMNSKGLVELIVLNIGKERKVLNDQTFAIMVLMALFTTFMTTPLVMAVYKRKARIS  437

Query  1392  PYKRRTIQNAKPGEELRILACIHGTNNLPAIISLLETSNSTVT-SPITAFGVQLLELVGR  1216
              YK RTI+      +LRIL C HG  N+P++I+L+E S        +  + + L E   R
Sbjct  438   DYKYRTIERKNANSQLRILVCFHGARNIPSVINLIEISRGIQKRDALCVYAMHLKEFSER  497

Query  1215  APAM-MvvhssgsgrhvggsHEEVQTSQIISTFDNYELRSHGVTAQVLTARWSYDTMAED  1039
             + +M MV     +G           +  +I  F+ Y+  S  V+ + + A  S   + ED
Sbjct  498   SSSMLMVQKVRKNGLPFWNKGPRADSDHVIVAFEAYQQLSQ-VSVRPMIAISSMANIHED  556

Query  1038  ICKMAKEKRAAFLVLPFHKQQGTDGEMEDTNPAIQTVNEGVLLSAPCSVGILVERG----  871
             IC  A+ K AA ++LPFHKQQ  DG ++ T    + VN+ VL +APCSVGILV+RG    
Sbjct  557   ICSTAERKSAAVIILPFHKQQRLDGSLDITRSDFRLVNKRVLDNAPCSVGILVDRGLGGT  616

Query  870   ---RPNQYAKNIAVLYLGGPDDREALTYARRMSGLPGVHLTVIRFVPAKDVSADGAVEDP  700
                  +  + +I VL+ GG DDREAL Y  RM+  PG+ L V+RF           + +P
Sbjct  617   CHVSASNVSYSIVVLFFGGGDDREALAYGARMAEHPGIRLVVVRF-----------LVEP  665

Query  699   DLELELTRETSFVTVSIDPARDKEEDEELLNNFRTETAEDDSKTFMELVLDDEEEFTKAV  520
             ++  E+TR     + S  P     ED+E L  FR +T  DDS  + E ++ D  E    +
Sbjct  666   NIVGEITRVDIGDSSSSKPI---SEDDEFLAEFRLKTTNDDSVIYGEKIVKDAAETVATI  722

Query  519   KSLDDRSFDLYVAG-RGRGVSSALTSGLADWCECPELGAVGDllvtsefessfsvlvVQQ  343
             +  +    +L+V G R  G    LT  L +  +  ELG VG LL + ++ ++ SVLV+QQ
Sbjct  723   REFN--CCNLFVVGLRPTG---ELTCAL-ERNDSSELGPVGGLLASQDYSTTASVLVMQQ  776

Query  342   Y  340
             Y
Sbjct  777   Y  777



>gb|KHG26273.1| Cation/H(+) antiporter 18 -like protein [Gossypium arboreum]
Length=801

 Score =   407 bits (1045),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 278/788 (35%), Positives = 422/788 (54%), Gaps = 38/788 (5%)
 Frame = -3

Query  2652  CFSQTIYRSNGVWEGPDPLAPMIPLFILQIMTAILSSRILNFVLKPFNQPPLVAEILSGI  2473
             C S     SNG ++G +PL   +PL ILQI   ++ +R L  +L+P  QP +VAEI+ GI
Sbjct  11    CPSPMKATSNGFFQGDNPLDYALPLAILQICLVVVLTRGLAVLLRPIRQPRVVAEIIGGI  70

Query  2472  ILGPSMLGNIEEFRKHNFPNHNFETIETMGHFALVLYAFLTGLQMDVKAIVHTGTKSRIV  2293
             +LGPS+LG  + + +  FP  +   ++T+ +  L+ + FL GL++D KA+  TG  +  +
Sbjct  71    LLGPSVLGRSKSYLEAIFPPKSLTVLDTLANLGLIFFLFLAGLEIDPKALRQTGKTALAI  130

Query  2292  AVSGSIFPFLIGAGFYFTLQTDTQSMIG----FIFCGSALTVTGFSTLAKILDSKRLLNT  2125
             A++G   PF +G G  F L+      +      IF G AL++T F  LA+IL   +LL T
Sbjct  131   ALAGIGLPFALGIGSSFLLRETISKGVNASAFLIFMGVALSITAFPVLARILAELKLLTT  190

Query  2124  EIGKIAASSALINVALSWVLLTIGLLFTGSLDN---VQWAvlctvgfvvvcvnyVRPLLN  1954
             ++G++A S+A +N   +W+LL + +  +GS  +     W  L    FV+     V P+  
Sbjct  191   DVGRMAMSAAAVNDVAAWILLALAVALSGSNTSPVVSLWVFLSGCVFVICLALIVPPIFK  250

Query  1953  WLISKTPEGQGFSEFYICSFIAVICAFGCFTDAMGSHPMIGAFIFGLIMPNNELLRTAIL  1774
             W+  +  EG+   E YIC+ +AV+ A G  TDA+G H M GAF+ G++ P       A++
Sbjct  251   WMARRCHEGEPVEEIYICATLAVVLAAGFVTDAIGIHAMFGAFVVGVLFPKEGPFAHALV  310

Query  1773  DRLEDFVMGILMPVFFLVCGLRTNIFTITDGDTSIFTALALILLACSAKIIAALVASCYT  1594
             +++ED V G+ +P++F+  GL+TNI TI    +    AL +I  AC  KII  +V S   
Sbjct  311   EKVEDLVSGLFLPLYFVSSGLKTNIATIQGLQSWGLLAL-VIFTACFGKIIGTVVVSLCC  369

Query  1593  GMSTNEAIGLGVLTNTKSTMVMIILEVGqvqqvlsvqqysmmvVACLIMTIVATPLA-AR  1417
              +    A+ LG L NTK  + +I+L +G+ ++VL+ Q +++MV+  L  T + TP+  A 
Sbjct  370   KVPLRGALALGFLMNTKGLVELIVLNIGKDRKVLNDQTFAIMVLMALFTTFITTPVVMAV  429

Query  1416  YCPKQDLEPYKRRTIQNAKPGEELRILACIHGTNNLPAIISLLETSNSTVTSP-ITAFGV  1240
             Y P +    YK RTI+      +LRILAC H   N+P++I+L E S        ++ + +
Sbjct  430   YKPARRKTDYKYRTIERKNSDAQLRILACFHSARNIPSMINLFEASRGVAKREGLSVYAL  489

Query  1239  QLLELVGRAPA-MMvvhssgsgrhvggsHEEVQTSQIISTFDNYELRSHGVTAQVLTARW  1063
              L+EL  R+ A +MV  +  +G           +  ++  F+ ++  S  VT + +T+  
Sbjct  490   HLMELSERSSAILMVHKARKNGLPFWSKGWRSDSDHVVVAFEAFQQLSQ-VTVRSMTSIS  548

Query  1062  SYDTMAEDICKMAKEKRAAFLVLPFHKQQGTDGEMEDTNPAIQTVNEGVLLSAPCSVGIL  883
             S   M EDIC  A+ KRAA ++LPFHK Q  DG  E T    + VN  VL  APCSVGIL
Sbjct  549   SIADMHEDICSTAESKRAAIIILPFHKHQRVDGSFETTRTDFRWVNRRVLEHAPCSVGIL  608

Query  882   VERG-------RPNQYAKNIAVLYLGGPDDREALTYARRMSGLPGVHLTVIRFVPAKDVS  724
             V+RG         +  +  I VL+ GGPDD EAL Y  RM+  PG+ L +I FV   +  
Sbjct  609   VDRGLGGTTHVSASNVSYLITVLFFGGPDDCEALAYGARMAEHPGISLNIICFVVEPETI  668

Query  723   ADGAVEDPDLELELTRETSFVTVSIDPARDKEEDEELLNNFRTETAEDDSKTFMELVLDD  544
               G +   +++     ET            K   EE L+ FR    +DDS  + E  + +
Sbjct  669   --GKISTINMQENAGIET------------KSSAEEFLSRFR-NLQKDDSVRYEEKAVRN  713

Query  543   EEEFTKAVKSLDDRSFDLYVAGRGRGVSSALTSGLADWCECPELGAVGDllvtsefessf  364
               E   A++  D  +  L     GR     L   L    ECPELGAVG LL+  +F  + 
Sbjct  714   VTEIIAAIRGADRSNLFLV----GRMPEGKLALALRRRSECPELGAVGSLLIAPDFSVTA  769

Query  363   svlvVQQY  340
             SVLV+QQY
Sbjct  770   SVLVIQQY  777



>ref|XP_011026948.1| PREDICTED: cation/H(+) antiporter 18-like [Populus euphratica]
 ref|XP_011026949.1| PREDICTED: cation/H(+) antiporter 18-like [Populus euphratica]
Length=792

 Score =   406 bits (1044),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 275/784 (35%), Positives = 426/784 (54%), Gaps = 44/784 (6%)
 Frame = -3

Query  2628  SNGVWEGPDPLAPMIPLFILQIMTAILSSRILNFVLKPFNQPPLVAEILSGIILGPSMLG  2449
             SNGV++G +PL   +PL ILQI   I+ +R L F+L+P  QP ++AEI+ GI+LGPS LG
Sbjct  19    SNGVFQGNNPLDFALPLAILQICLVIVVTRGLAFLLRPLRQPRVIAEIIGGILLGPSALG  78

Query  2448  NIEEFRKHNFPNHNFETIETMGHFALVLYAFLTGLQMDVKAIVHTGTKSRIVAVSGSIFP  2269
               + F    FP  +   ++T+ +  L+ + FL GL++D+K++  TG K+  +A++G   P
Sbjct  79    RSKGFLLAVFPTRSLTVLDTLANIGLIFFLFLAGLELDLKSLGRTGKKALAIAMAGISLP  138

Query  2268  FLIGAGFYF----TLQTDTQSMIGFIFCGSALTVTGFSTLAKILDSKRLLNTEIGKIAAS  2101
             F +G G  F    T+  D  S    +F G AL++T F  LA+IL   +LL T+IG++A S
Sbjct  139   FAMGIGTSFILRLTISKDVNSTAFLVFIGVALSITAFPVLARILAELKLLTTDIGRMAMS  198

Query  2100  SALINVALSWVLLTIGLLFTGSLDNVQ-----WAvlctvgfvvvcvnyVRPLLNWLISKT  1936
             +A +N   +W+LL + +  +GS  N       W  L    F +  +  V P+  W+    
Sbjct  199   AAAVNDVAAWILLALAISLSGS--NTSPIISFWVFLSGCIFFICSILIVPPIFKWMTKWC  256

Query  1935  PEGQGFSEFYICSFIAVICAFGCFTDAMGSHPMIGAFIFGLIMPNNELLRTAILDRLEDF  1756
              EG+   E Y+C+ +A + A G  TDA+G H M GAFI G+++P       A+++++ED 
Sbjct  257   QEGEPVEEMYVCATLAAVLAAGFVTDAIGIHAMFGAFIIGILVPKEGPFAGALVEKVEDI  316

Query  1755  VMGILMPVFFLVCGLRTNIFTITDGDTSIFTALALILLACSAKIIAALVASCYTGMSTNE  1576
             V G+ +P++F+  GL+TN+ TI  G  S    + +I  AC  KI+   V S    +   E
Sbjct  317   VSGLFLPLYFVSSGLKTNVATI-QGLQSWGLLVLVIFTACFGKIVGTFVVSLLCKVPLRE  375

Query  1575  AIGLGVLTNTKSTMVMIILEVGqvqqvlsvqqysmmvVACLIMTIVATPLA-ARYCPKQ-  1402
             ++ + +L NTK  + +I+L +G+ ++VL+ + +S+MV+  L  T + TPL  A Y P + 
Sbjct  376   SLAIAILMNTKGLVELIVLNIGKDRKVLNDETFSIMVLMALFTTFITTPLVTAVYKPARR  435

Query  1401  -DLEPYKRRTIQNAKPGEELRILACIHGTNNLPAIISLLETSNSTVTSP-ITAFGVQLLE  1228
               +  YK RT++      ELR+L C HG+ N+ +II+LLE S     +  +  + + L+E
Sbjct  436   VKMADYKYRTVERRSSNTELRVLVCFHGSRNISSIINLLEVSRGVEKAEGLCVYAMHLME  495

Query  1227  LVGRAPA-MMvvhssgsgrhvggsHEEVQTSQIISTFDNYELRSHGVTAQVLTARWSYDT  1051
                R  A +MV  +  +G       +   ++ ++  FD ++  S  V+ Q +TA  S   
Sbjct  496   HSERTSAILMVHKARKNGLPFWNRGQRSGSNLVVVAFDAFQQLSR-VSVQPMTAISSMAD  554

Query  1050  MAEDICKMAKEKRAAFLVLPFHKQQGTDGEMEDTNPAIQTVNEGVLLSAPCSVGILVERG  871
             M EDIC  A+ KR A ++LPFHK Q  DG +E T    Q VN  VL  APCSVGILV+RG
Sbjct  555   MHEDICTTAERKRVAMIILPFHKHQRMDGSLETTRTDFQLVNRRVLGDAPCSVGILVDRG  614

Query  870   -------RPNQYAKNIAVLYLGGPDDREALTYARRMSGLPGVHLTVIRFVPAKDVSADGA  712
                      +  +  I VL+ GG DDREAL Y  RM+  PGV L VIRF+   +    G 
Sbjct  615   FGGTTQVSASNVSYVITVLFFGGRDDREALAYGARMAEHPGVSLKVIRFLVKPEA---GE  671

Query  711   VEDPDLELELTRETSFVTVSIDPARDKEEDEELLNNFRTETAEDDSKTFMELVLDDEEEF  532
             +   D++                 R    DE+ ++  + + ++DDS    E  + +  E 
Sbjct  672   ISRVDMD------------GSSSTRLGSLDEDFISELKQKMSKDDSVKLEEKFVGNAAET  719

Query  531   TKAVKSLDDRSFDLYVAGRGRGVSSALTSGLADWCECPELGAVGDllvtsefessfsvlv  352
               A+   + R  +L++ GR      AL   L    + PELG VG LL +S+  ++ SVLV
Sbjct  720   IDAIH--EARHSNLFLVGRLPDGEIAL--ALRSSSDSPELGPVGGLLASSDISTTASVLV  775

Query  351   VQQY  340
             VQQY
Sbjct  776   VQQY  779



>gb|KHG06330.1| hypothetical protein F383_32801 [Gossypium arboreum]
Length=818

 Score =   407 bits (1046),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 288/796 (36%), Positives = 448/796 (56%), Gaps = 46/796 (6%)
 Frame = -3

Query  2652  CFSQTIYRSNGVWEGPDPLAPMIPLFILQIMTAILSSRILNFVLKPFNQPPLVAEILSGI  2473
             C S     SNGV++G +PL   +PL ILQI   +  +RIL F+L+P  QP ++AEI+ GI
Sbjct  27    CPSPMKATSNGVFQGDNPLDFALPLAILQICLVVALTRILAFLLRPLRQPRVIAEIVGGI  86

Query  2472  ILGPSMLGNIEEFRKHNFPNHNFETIETMGHFALVLYAFLTGLQMDVKAIVHTGTKSRIV  2293
             +LGPS+LG  E++    FP  +   ++T+ +  L+ + FL GL++D K+I  TG K+  +
Sbjct  87    LLGPSVLGRNEKYLNAIFPAKSHTVLDTLANLGLLFFLFLVGLELDPKSIRRTGKKALSI  146

Query  2292  AVSGSIFPFLIGAGFYFTLQTDTQSMIG----FIFCGSALTVTGFSTLAKILDSKRLLNT  2125
             AV+G   PF++G G  + L+      +      +F G AL++T F  LA+IL   +LL T
Sbjct  147   AVAGISLPFMLGIGTSYALRATISKGVDEAPFLVFMGVALSITAFPVLARILAELKLLTT  206

Query  2124  EIGKIAASSALINVALSWVLLTIGLLFTGSLDN---VQWAvlctvgfvvvcvnyVRPLLN  1954
             +IG++A S+A +N   +W+LL + +  +G+ ++     W  LC  GFVV C   V P+  
Sbjct  207   DIGRMAMSAAAVNDVAAWILLALAIALSGTGNSPLVSLWVFLCGTGFVVGCTFIVPPIFK  266

Query  1953  WLISKTPEGQGFSEFYICSFIAVICAFGCFTDAMGSHPMIGAFIFGLIMPNNELLRTAIL  1774
             W++ + PEG+  +E Y+C+ +  + A G  TD +G H + GAF+ G+++P       A++
Sbjct  267   WMVQRCPEGEPVNELYVCATLTAVLAAGFVTDLIGIHALFGAFVIGVLVPKEGPFAGALV  326

Query  1773  DRLEDFVMGILMPVFFLVCGLRTNIFTITDGDTSIFTALALILLACSAKIIAALVASCYT  1594
             +++ED V G+ +P++F+  GL+TNI TI  G  S    + +I+ AC  KI   +  S   
Sbjct  327   EKVEDLVSGLFLPLYFVSSGLKTNIATI-QGAQSWGLLVLVIITACFGKIAGTVSVSLLC  385

Query  1593  GMSTNEAIGLGVLTNTKSTMVMIILEVGqvqqvlsvqqysmmvVACLIMTIVATPLA-AR  1417
              +  +EA+ LG L NTK  + +I+L +G+ ++VL+ Q +++MV+  +  T + TPL  A 
Sbjct  386   NVPFSEALALGFLMNTKGLVELIVLNIGKDRKVLNDQTFAIMVLMAVFTTFITTPLVMAV  445

Query  1416  YCP--KQDLEPYKRRTIQNAKPGEELRILACIHGTNNLPAIISLLETSNSTVTSP-ITAF  1246
             Y P  +Q    YK +TI+  +   +LRILAC H   N+P +I+L+E S  T     +  +
Sbjct  446   YKPAKRQGKGDYKHKTIERKESNSQLRILACFHSYRNIPTMINLIEASRGTEKKEGLCVY  505

Query  1245  GVQLLELVGRAPAM-MvvhssgsgrhvggsHEEVQTSQIISTFDNYELRSHGVTAQVLTA  1069
              + L+EL  R  AM MV  +  +G       ++    QI+  F+ +   S  V  + +TA
Sbjct  506   ALHLMELSERPSAMLMVHKARKNGLPFWNKVKQSGGDQIVVAFETFRQLSR-VVVRPMTA  564

Query  1068  RWSYDTMAEDICKMAKEKRAAFLVLPFHKQQGTDGEMEDTNPAIQTVNEGVLLSAPCSVG  889
               S  ++ EDIC+ A+ KRAA ++LPFHK Q  DG  E T    Q VN+ VL  APCSVG
Sbjct  565   ISSISSLHEDICESAERKRAAMIILPFHKHQRVDGTFETTRTDYQLVNKRVLEQAPCSVG  624

Query  888   ILVER---GRPNQYAKN----IAVLYLGGPDDREALTYARRMSGLPGVHLTVIRFVPAKD  730
             ILV+R   G  +  A N    I VL+ GG DDREAL Y  RM+  PG+ LTV+RFVP  +
Sbjct  625   ILVDRGLGGTTHISASNVDSIITVLFFGGHDDREALAYGTRMAEHPGISLTVVRFVPGPE  684

Query  729   VSADGAVEDPDLELELTRETSFVTVSIDPARDKEEDEELLNNFRTETAEDDSKTFMELVL  550
             VS +                  VT  I+ +     D+ +L  F+ + + ++S ++ E V+
Sbjct  685   VSGE-----------------IVTADINTS-----DDRVLMEFKNKASNENSISYEERVV  722

Query  549   DDEEEFTKAVKSLDDRSFDLYVAGRGRGVSSALTSGL-ADWCECPELGAVGDllvtsefe  373
                 E  +A++       +L++ G+        T+ L A   EC ELG +G LL ++EF 
Sbjct  723   RSSRETIEAIREFS--RCNLFLVGQMPENHVTATAKLNAAKTECLELGVIGSLLTSAEFS  780

Query  372   ssfsvlvVQQYVRTNK  325
             +S SVLVVQQY  T K
Sbjct  781   TSASVLVVQQYRTTKK  796



>ref|XP_007028838.1| Cation/H+ exchanger 19 [Theobroma cacao]
 gb|EOY09340.1| Cation/H+ exchanger 19 [Theobroma cacao]
Length=796

 Score =   406 bits (1044),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 265/779 (34%), Positives = 440/779 (56%), Gaps = 44/779 (6%)
 Frame = -3

Query  2628  SNGVWEGPDPLAPMIPLFILQIMTAILSSRILNFVLKPFNQPPLVAEILSGIILGPSMLG  2449
             SNG ++  +PL   +PL I+QI+  +  +R+L F+L+P  QP ++AEI+ GI+LGPS LG
Sbjct  20    SNGAFQNENPLDFALPLLIVQIILVVTLTRVLAFMLRPLRQPRVIAEIIGGILLGPSALG  79

Query  2448  NIEEFRKHNFPNHNFETIETMGHFALVLYAFLTGLQMDVKAIVHTGTKSRIVAVSGSIFP  2269
               +EF    FP  +   ++T+ +  L+ + FL GL++D++AI  TG K+  +A +G   P
Sbjct  80    RNKEFMNKIFPKRSMTVLDTLANIGLLFFLFLVGLELDIRAIRRTGKKALGIAAAGISLP  139

Query  2268  FLIGAGFYFTLQTDTQSMIG----FIFCGSALTVTGFSTLAKILDSKRLLNTEIGKIAAS  2101
             F++G G  F L++     +G     +F G AL++T F  LA+IL   +LL T++G+IA S
Sbjct  140   FVLGIGTSFVLRSTINKGVGEIAFLVFMGVALSITAFPVLARILAELKLLTTDVGRIAMS  199

Query  2100  SALINVALSWVLLTIGLLFTGSLDN---VQWAvlctvgfvvvcvnyVRPLLNWLISKTPE  1930
             +A +N  ++W+LL + +  TGS ++     W +LC   FV+  +  ++P+L  +  +  +
Sbjct  200   AAAVNDVVAWILLALAIALTGSNNSPLVSVWVLLCGAAFVLFAIFLLKPILTLMARRCLD  259

Query  1929  GQGFSEFYICSFIAVICAFGCFTDAMGSHPMIGAFIFGLIMPNNELLRTAILDRLEDFVM  1750
             G+   E YIC  ++++ A G  TD +G H + GAF+ G+I+P +      +++++ED V 
Sbjct  260   GEPVKELYICITLSLVLAAGFVTDTIGIHALFGAFVVGIIVPKDGPFAGVLIEKIEDLVS  319

Query  1749  GILMPVFFLVCGLRTNIFTITDGDTSIFTALALILLACSAKIIAALVASCYTGMSTNEAI  1570
             G+ +P++F   GL+TN+ TI  G +     L +I  AC  KI+  +  S    +   EA+
Sbjct  320   GLFLPLYFASSGLKTNVATIKGGQSWGLLVL-VIFNACFGKIVGTIGVSMLFKVPFREAL  378

Query  1569  GLGVLTNTKSTMVMIILEVGqvqqvlsvqqysmmvVACLIMTIVATPLA-ARYCPKQDLE  1393
              LG L NTK  + +I+L +G+ ++VL+ Q ++++V+  L  T + TP+  A Y P +  E
Sbjct  379   TLGFLMNTKGLVELIVLNIGKDRKVLNDQSFAILVLMALFTTFITTPIVMAIYKPARKGE  438

Query  1392  PYKRRTIQNAKPGEELRILACIHGTNNLPAIISLLETSNSTVT-SPITAFGVQLLELVGR  1216
             PYK R I       ELRILAC H T N+P +I+L+E+S        +  + + L+EL  R
Sbjct  439   PYKHRRIHRKDFDTELRILACFHSTRNIPTLINLIESSRGIQKRGHLCVYAMHLMELSER  498

Query  1215  APAMMvvhssgsgrhvggsHEEVQTSQIISTFDNYELRSHGVTAQVLTARWSYDTMAEDI  1036
             + A+ ++H +        + +     Q++  F+ Y+  S  VT + +TA  +++++ EDI
Sbjct  499   SSAITMIHKARKNGLPFWNKKRQDQDQMVIAFEAYQQLS-SVTVRPMTAISAFNSIHEDI  557

Query  1035  CKMAKEKRAAFLVLPFHKQQGTDGEMEDTNPAIQTVNEGVLLSAPCSVGILVERGR----  868
             C  A  KRAA +++PFHK Q  DG ME    +   VN+ VL  APCSVGILV+RG     
Sbjct  558   CTSADRKRAALILMPFHKHQRLDGSMESLGYSFHLVNQRVLRHAPCSVGILVDRGLGGTT  617

Query  867   ---PNQYAKNIAVLYLGGPDDREALTYARRMSGLPGVHLTVIRFVPAKDVSADGAVEDPD  697
                 ++ + ++ V + GG DDREAL Y  RM+  PG++LTV++F     +S D       
Sbjct  618   QVVASEVSYSVVVPFFGGQDDREALAYGMRMAEHPGINLTVLKFTAKPGMSLDAKA----  673

Query  696   LELELTRETSFVTVSIDPARDKEEDEELLNNFRTETAEDDSKTFMELVLDDEEEFTKAVK  517
                             D   + ++D E+L+ F + +  ++S    E ++  +E+   A++
Sbjct  674   ----------------DVGAESDKDNEILSEFISLSKRNESIGHEEKIVGSKEDIIAALR  717

Query  516   SLDDRSFDLYVAGRGRGVSSALTSGLADWCECPELGAVGDllvtsefessfsvlvVQQY  340
             S+   S  L++ GR    +  LT    D   CPELG +G  L +S+F ++ S+LVVQQY
Sbjct  718   SMSKSS--LFLVGR-MSPTMPLTERSTD---CPELGHLGSYLASSDFSTTSSILVVQQY  770



>ref|XP_006285823.1| hypothetical protein CARUB_v10007299mg [Capsella rubella]
 gb|EOA18721.1| hypothetical protein CARUB_v10007299mg [Capsella rubella]
Length=811

 Score =   407 bits (1045),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 280/784 (36%), Positives = 438/784 (56%), Gaps = 35/784 (4%)
 Frame = -3

Query  2628  SNGVWEGPDPLAPMIPLFILQIMTAILSSRILNFVLKPFNQPPLVAEILSGIILGPSMLG  2449
             SNGV++G +P+   +PL ILQI+  I+ +R+L ++L+P  QP ++AE++ GI+LGPS+LG
Sbjct  17    SNGVFQGDNPIDFALPLAILQIVIVIVLTRVLAYLLRPLRQPRVIAEVIGGIMLGPSLLG  76

Query  2448  NIEEFRKHNFPNHNFETIETMGHFALVLYAFLTGLQMDVKAIVHTGTKSRIVAVSGSIFP  2269
               +EF    FP  +   +ET+ +  L+ + FL GL++D KA+ HTG K+  +A++G   P
Sbjct  77    RSKEFLDAVFPKKSLTVLETLANLGLLFFLFLAGLEIDTKALRHTGKKALGIALAGISLP  136

Query  2268  FLIGAGFYF----TLQTDTQSMIGFIFCGSALTVTGFSTLAKILDSKRLLNTEIGKIAAS  2101
             F +G G  F    T+     S    IF G AL++T F  LA+IL   +LL TEIG++A S
Sbjct  137   FALGIGSSFVLKATINKGVDSTAFLIFMGVALSITAFPVLARILAELKLLTTEIGRLAMS  196

Query  2100  SALINVALSWVLLTIGLLFTGSLDN---VQWAvlctvgfvvvcvnyVRPLLNWLISKTPE  1930
             +A +N   +W+LL + +  +GS  +     W  L    FV+     + P+  W+  +  E
Sbjct  197   AAAVNDVAAWILLALAIALSGSNTSPLVSLWVFLSGCAFVIGAAFIIPPIFRWIARRCHE  256

Query  1929  GQGFSEFYICSFIAVICAFGCFTDAMGSHPMIGAFIFGLIMPNNELLRTAILDRLEDFVM  1750
             G+   E YIC+ +AV+   G  TDA+G H M GAF+ G+++P       A+++++ED V 
Sbjct  257   GEPIEETYICATLAVVLVCGFITDAIGIHSMFGAFVVGVLIPKEGPFAGALVEKVEDLVS  316

Query  1749  GILMPVFFLVCGLRTNIFTITDGDTSIFTALALILLACSAKIIAALVASCYTGMSTNEAI  1570
             G+ +P++F+  GL+TN+ TI  G  S    + +   AC  KI+  L  S    +   EAI
Sbjct  317   GLFLPLYFVASGLKTNVATI-QGAQSWGLLVLVTFTACFGKIVGTLGVSLGFKIPMREAI  375

Query  1569  GLGVLTNTKSTMVMIILEVGqvqqvlsvqqysmmvVACLIMTIVATPLA-ARYCPKQDLE  1393
              LG L NTK  + +I+L +G+ ++VL+ Q +++MV+  L  T + TP+  A Y P +  +
Sbjct  376   TLGFLMNTKGLVELIVLNIGKDRKVLNDQTFAIMVLMALFTTFITTPIVMAVYKPARRAK  435

Query  1392  P---YKRRTIQNAKPGEELRILACIHGTNNLPAIISLLETSNSTVTSP-ITAFGVQLLEL  1225
                 YK RT++      +LRIL C HG  ++P+II+LLE S        +  + + L EL
Sbjct  436   KEGEYKNRTVERENTNTQLRILTCFHGAGSIPSIINLLEASRGIEKGEGLCVYALHLREL  495

Query  1224  VGRAPAMMvvhssgsgrhvggsHEEVQ--TSQIISTFDNYELRSHGVTAQVLTARWSYDT  1051
               R+ A+++VH          +   V     Q++  F  ++  S  V  + +TA  S   
Sbjct  496   SERSSAILMVHKVRKNGMPFWNRRGVNADADQVVVAFQAFQQLSR-VNVRPMTAISSMSD  554

Query  1050  MAEDICKMAKEKRAAFLVLPFHKQQGTDGEMEDTNPAIQTVNEGVLLSAPCSVGILVERG  871
             + EDIC  A  KRAA ++LPFHK Q  DG +E T    + VN  VLL APCSVGI V+RG
Sbjct  555   IHEDICTTAARKRAAIVILPFHKHQQLDGSLETTRGDYRWVNRRVLLEAPCSVGIFVDRG  614

Query  870   -------RPNQYAKNIAVLYLGGPDDREALTYARRMSGLPGVHLTVIRFVPAKDVSADGA  712
                         + ++ VL+ GG DDREAL Y  RM+  PG+ LTV RFV    VS + A
Sbjct  615   LGGSSQVSAQDVSYSVVVLFFGGRDDREALAYGLRMAEHPGIVLTVFRFV----VSPERA  670

Query  711   VEDPDLELELTRETSFVTVSIDPARDKEEDEELLNNFRTETAEDDSKTFMELVLDDEEEF  532
              E  ++E+  +            +++ + DEE+++  R +++ D+S  F+E  +++    
Sbjct  671   GEIVNVEVRDSNNEKN-----QSSKNPKLDEEIMSEIRKKSSVDESIKFVEKRIENAAVD  725

Query  531   TKAVKSLDDRSFDLYVAGRGRGVSSALTSGLADWCECPELGAVGDllvtsefessfsvlv  352
              ++      RS +L++ GR  G   AL   + +  ECPELG VG LL++ E  +  SVLV
Sbjct  726   VRSAIEEARRS-NLFLVGRMPGGEIAL--AIRENSECPELGPVGSLLISPESSTRASVLV  782

Query  351   VQQY  340
             +QQY
Sbjct  783   IQQY  786



>ref|XP_006467497.1| PREDICTED: cation/H(+) antiporter 15-like [Citrus sinensis]
Length=691

 Score =   402 bits (1033),  Expect = 6e-123, Method: Compositional matrix adjust.
 Identities = 255/675 (38%), Positives = 400/675 (59%), Gaps = 42/675 (6%)
 Frame = -3

Query  2376  ALVLYAFLTGLQMDVKAIVHTGTKSRIVAVSGSIFPFLIGAGFYF------TLQTDTQSM  2215
             AL LY FL GL+MDV +I  +  +   +A +G++ P  +GAG +F       L TD    
Sbjct  2     ALDLYIFLIGLEMDVNSIKSSAKRELNIAAAGALIPMGVGAGLFFLTARLLHLPTDPS--  59

Query  2214  IGFIFCGSALTVTGFSTLAKILDSKRLLNTEIGKIAASSALINVALSWVLLTIGLLFTGS  2035
              G +F G  LTVTGF  +  IL   +LL T+IG++A S A+I+   SW+L+ + L    S
Sbjct  60    -GCLFWGLTLTVTGFPAVTWILGELKLLQTDIGRLATSIAMISDVCSWILVAVVLPIRSS  118

Query  2034  LDNVQWAvlctvgfvvvcvnyVRPLLNWLISKTPEGQ--GFSEFYICSFI--AVICAFGC  1867
              +N   A++ T+ F + C+  VRP L WLI +T +G    +S+ Y+C F+   VIC+F  
Sbjct  119   PENAPAAIISTIAFSLTCIYAVRPGLEWLIRRTSKGNNNAYSDSYLCFFLIGVVICSF--  176

Query  1866  FTDAMGSHPMIGAFIFGLIMPNNELLRTAILDRLEDFVMGILMPVFFLVCGLRTNIFTIT  1687
              T+  G+  ++GAF+FG+IMP+ +L    + +R  DFV GI++P+FF +CG+RTN+  + 
Sbjct  177   VTEVTGTFSIVGAFVFGIIMPDRDL-GALLFERFADFVSGIMLPLFFAMCGIRTNVHKVH  235

Query  1686  DGDTSIFTALALILLACSAKIIAALVASCYTGMSTNEAIGLGVLTNTKSTMVMIILEVGq  1507
             +     F A  +I+L C  KI+  L+ S    M   + + LGVL NTK  + +++L +G 
Sbjct  236   NW----FLAGFVIILTCFCKILGTLLVSHSYHMPLQDRLALGVLMNTKGILAVVVLNLGW  291

Query  1506  vqqvlsvqqysmmvVACLIMTIVATPL-AARYCPKQDLEPYKRRTIQNAKPGEELRILAC  1330
              ++VL  Q+Y++MV+A +IMT    P+ +  Y     +  YK R+IQ AK G ELRILAC
Sbjct  292   DKKVLHDQEYAVMVIAIVIMTGGVAPIISTMYRSSTRIIKYKGRSIQRAKQGAELRILAC  351

Query  1329  IHGTNNLPAIISLLETSNSTVTSPITAFGVQLLELVGRAPAMMvvhssgsgrhvggsHEE  1150
             +HG  N+   I+LLE SN+T  SP+  F + L+EL G A A+++VH+S            
Sbjct  352   VHGVGNVLGTINLLELSNATKESPLCIFALHLVELRGSASAVLIVHTSSKNSAYKRVGSS  411

Query  1149  VQTSQIISTFDNYELRSHGVTAQVLTARWSYDTMAEDICKMAKEKRAAFLVLPFHKQQG-  973
               + +I++ F+ +E RS G++   LTA   + TM ED+C +A++K  AF++LPFH Q G 
Sbjct  412   -PSDRIVNIFEAFENRSTGISVHPLTAMSPFITMHEDVCNLAEDKHIAFMILPFHNQAGN  470

Query  972   TDGEMEDTNPAIQTVNEGVLLSAPCSVGILVERGR---PNQYAKNIAVLYLGGPDDREAL  802
             ++G+   ++P  + VN+ +L +APCSVGI V++G+    N   +++ ++++GGPDDREAL
Sbjct  471   SNGDTTGSSP-FREVNKNILANAPCSVGIFVDKGQGKSDNGRMQHVVMVFIGGPDDREAL  529

Query  801   TYARRMSGLPGVHLTVIRFVPAKDVSADGAVEDPDLELELTRETSFVTVSIDPARDKEED  622
               A RMS  P V LTV+R         +  V++ D+           +  ID  R  + D
Sbjct  530   ALAWRMSANPSVQLTVLRL----HSRYNNNVKEEDIRY---------SKCID-GRQSQVD  575

Query  621   EELLNNFRTETAEDDSKTFMELVLDDEEEFTKAVKSLDDRSFDLYVAGRGRGVSSALTSG  442
              E +N FR +TA + +  + E V+++ EE T A++ ++ +   LY+ GR   ++SA T+ 
Sbjct  576   AEFVNEFRLQTAGEHNVNYYEKVVNNREETTGALREMELQKVGLYIVGR-EVMASAATAD  634

Query  441   LADWCECPELGAVGD  397
             L  W ECPE+GA+GD
Sbjct  635   LLGWSECPEIGAIGD  649



>ref|XP_009402780.1| PREDICTED: cation/H(+) antiporter 19-like [Musa acuminata subsp. 
malaccensis]
Length=768

 Score =   404 bits (1038),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 266/786 (34%), Positives = 432/786 (55%), Gaps = 50/786 (6%)
 Frame = -3

Query  2655  MCFSQTIYRSNGVWEGPDPLAPMIPLFILQIMTAILSSRILNFVLKPFNQPPLVAEILSG  2476
             +C +     SNG W+G +PL   +PL ILQI   ++ +R L F+L+P  QP ++AEI+ G
Sbjct  6     VCPAPMTATSNGSWDGDNPLHHSLPLIILQICLVLVVTRSLAFLLRPLRQPRVIAEIIGG  65

Query  2475  IILGPSMLGNIEEFRKHNFPNHNFETIETMGHFALVLYAFLTGLQMDVKAIVHTGTKSRI  2296
             I+LGPS LG  + F  + FP      ++T+ +  L+ + FL GL++D+++I  TG  +  
Sbjct  66    ILLGPSALGRSKRFMDNVFPKQGMTVLDTLANIGLLFFLFLVGLELDLRSIRRTGKGALA  125

Query  2295  VAVSGSIFPFLIGAG----FYFTLQTDTQSMIGFIFCGSALTVTGFSTLAKILDSKRLLN  2128
             +A++G   PF++G G       T+          +F G AL++T F  LA+IL   +LL 
Sbjct  126   IAIAGITLPFVLGIGTSVVLRHTIVEGAHQGPFLVFMGVALSITAFPVLARILAELKLLT  185

Query  2127  TEIGKIAASSALINVALSWVLLTIGLLFTGSLDNV--QWAvlctvgfvvvcvnyVRPLLN  1954
             T++G++A S+A +N  ++W+LL + +  +GS   +   W +L  +GFV     ++RP+L 
Sbjct  186   TDVGRMAMSAAAVNDVVAWILLALAIALSGSGSPLISLWVLLAGIGFVACVAIFLRPVLA  245

Query  1953  WLISKTPEGQGFSEFYICSFIAVICAFGCFTDAMGSHPMIGAFIFGLIMPNNELLRTAIL  1774
             W+  ++ EG+   E Y+C+ +A++ A G  TDA+G H + GAF+ G+++P +      I+
Sbjct  246   WMARRSQEGEPVKESYVCATLAIVLAAGFATDAIGIHALFGAFMVGVVVPKDGPFAGVII  305

Query  1773  DRLEDFVMGILMPVFFLVCGLRTNIFTITDGDTSIFTALALILLACSAKIIAALVASCYT  1594
             +++ED V G+ +P++F+  GL+TN+ TI  G  S    + +I  AC  KI   ++AS   
Sbjct  306   EKVEDLVSGLFLPLYFVSSGLKTNVATI-RGARSWGLLVLVITNACLGKIAGTVIASLIA  364

Query  1593  GMSTNEAIGLGVLTNTKSTMVMIILEVGqvqqvlsvqqysmmvVACLIMTIVATPLA-AR  1417
              +   EA+ LG L NTK  + +I+L +G+ ++VL+ + +++MV+  L  T + TP+    
Sbjct  365   KIPIREALTLGFLMNTKGLVELIVLNIGKDRKVLNDETFAIMVLMALFTTFITTPIVMGI  424

Query  1416  YCPKQDLEPYKRRTIQNAKPGEELRILACIHGTNNLPAIISLLETSNSTVTSPITAFGVQ  1237
             Y P +   PY  RT++++  G ELR+LAC HG  N+P +I+L+E S       +T + + 
Sbjct  425   YKPARRAAPYNHRTVESSDMGSELRVLACFHGVRNIPTMINLVEISRGIHHRRLTLYAMH  484

Query  1236  LLELVGRAPAMMvvhssgsgrhvggsHEEVQTSQIISTFDNYELRSHGVTAQVLTARWSY  1057
             L+EL  R+ AM +VH +        +  +  T  ++  F+ Y   S  V  + +TA    
Sbjct  485   LMELSERSSAMSMVHKARRNGLPFWNRRD-NTDHMVVAFEAYRQLS-AVAIRPMTAISDL  542

Query  1056  DTMAEDICKMAKEKRAAFLVLPFHKQQGTDGEMEDTNPAIQTVNEGVLLSAPCSVGILVE  877
             DT+ EDI   A +KR A ++LPFHK Q  DG +E    A   +N+ VL  APCSV ILV+
Sbjct  543   DTIHEDIVASALQKRTALILLPFHKMQQLDGTLESVGHAYHLINQRVLRHAPCSVAILVD  602

Query  876   RG-------RPNQYAKNIAVLYLGGPDDREALTYARRMSGLPGVHLTVIRFVPAKDVSAD  718
             RG         ++ +  + VL+ GGPDDREAL+Y   M+  PG+ LTV+RF+PA   + D
Sbjct  603   RGLGGAAQVSSSEVSYTVVVLFFGGPDDREALSYGALMAEHPGIALTVLRFLPAPVENLD  662

Query  717   GAVEDPDLELELTRETSFVTVSIDPARDKEEDEELLNNFRTETAEDDSKTFMELVLDDEE  538
              +VED     + T  +                             D S  + E    D  
Sbjct  663   QSVEDEACIFKFTSNSQ--------------------------PSDGSLAYEESAAADMA  696

Query  537   EFTKAVKSLDDRSFDLYVAGRGRGVSSALTSGLADWCECPELGAVGDllvtsefessfsv  358
                 A+K+L     +L++ GR     S     L +  +CPELG VG  L ++EF ++ SV
Sbjct  697   GIIAAIKNLGRH--NLFLVGR-----SPPAVALVEKSDCPELGPVGSYLASAEFSTASSV  749

Query  357   lvVQQY  340
             L++Q+Y
Sbjct  750   LIIQRY  755



>ref|XP_006573800.1| PREDICTED: cation/H(+) antiporter 18-like isoform X1 [Glycine 
max]
 ref|XP_006573801.1| PREDICTED: cation/H(+) antiporter 18-like isoform X2 [Glycine 
max]
 ref|XP_006573802.1| PREDICTED: cation/H(+) antiporter 18-like isoform X3 [Glycine 
max]
Length=806

 Score =   405 bits (1040),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 279/786 (35%), Positives = 432/786 (55%), Gaps = 48/786 (6%)
 Frame = -3

Query  2628  SNGVWEGPDPLAPMIPLFILQIMTAILSSRILNFVLKPFNQPPLVAEILSGIILGPSMLG  2449
             SNG ++G DPL   +PL ILQI   ++ SR L ++LKP  QP ++AEI+ GIILGPS LG
Sbjct  19    SNGAFQGDDPLDFALPLAILQICLVLVVSRGLAYLLKPLRQPRVIAEIIGGIILGPSALG  78

Query  2448  NIEEFRKHNFPNHNFETIETMGHFALVLYAFLTGLQMDVKAIVHTGTKSRIVAVSGSIFP  2269
               + + ++ FP  +   ++T+ +  L+ + FL GL++D+K++  +G +   +A++G   P
Sbjct  79    RNKSYMQNVFPPRSLTVLDTLANIGLIFFLFLAGLELDLKSLRQSGNRVLAIAMAGISLP  138

Query  2268  FLIGAGFYFTLQ----TDTQSMIGFIFCGSALTVTGFSTLAKILDSKRLLNTEIGKIAAS  2101
             F+IG G  F L+        S    +F G AL++T F  LA+IL   +LL T +G+ A S
Sbjct  139   FVIGIGSSFVLKQTIAKGADSAAFLVFMGVALSITAFPVLARILAELKLLTTNVGRTAMS  198

Query  2100  SALINVALSWVLLTIGLLFTGSLDN---VQWAvlctvgfvvvcvnyVRPLLNWLISKTPE  1930
             +A IN   +W+LL + +  +G   +     W  L   GFV+  +  V P+  W+  +  E
Sbjct  199   AAAINDIAAWILLALAVALSGHDRSPLVSLWVFLAGCGFVICAILIVPPIFKWMSQRCHE  258

Query  1929  GQGFSEFYICSFIAVICAFGCFTDAMGSHPMIGAFIFGLIMPNNELLRTAILDRLEDFVM  1750
             G+   E YIC+ +A + A G  TDA+G H M GAF+ G+++P++    +A+++++ED V 
Sbjct  259   GEPVEEVYICATLAAVLAAGFVTDAIGIHAMFGAFVVGILVPSDGPFASALVEKVEDLVS  318

Query  1749  GILMPVFFLVCGLRTNIFTITDGDTSIFTALALILLACSAKIIAALVASCYTGMSTNEAI  1570
             G+ +P++F+  GL+TN+ TI  G  S    + +I  A   KI+  LV S +  +  NEA+
Sbjct  319   GLFLPLYFVSSGLKTNVATI-KGAQSWGLLVFVIFTASFGKILGTLVVSLFCKVPFNEAL  377

Query  1569  GLGVLTNTKSTMVMIILEVGqvqqvlsvqqysmmvVACLIMTIVATPLA-ARYCP--KQD  1399
              LG L N K  + +I+L +G+ ++VL+ Q +++MV+  +  T + TPL  A Y P  K  
Sbjct  378   VLGFLMNCKGLVELIVLNIGKDRKVLNDQTFAIMVLMAVFTTFITTPLVTAVYKPARKGK  437

Query  1398  LEPYKRRTIQNAKPGEELRILACIHGTNNLPAIISLLETSNSTVTS-PITAFGVQLLELV  1222
             +  YK RTI       +LRIL C HG  N+P++I+L+E S        +  + + L E  
Sbjct  438   IVDYKYRTIGRKNANSQLRILTCFHGARNIPSMINLIEASRGIRKGDALCVYAMHLKEFS  497

Query  1221  GRAPA-MMvvhssgsgrhvggsHEEVQTSQIISTFDNYELRSHGVTAQVLTARWSYDTMA  1045
              R+   +MV  +  +G           ++ +I  F+ Y   S  V+ + + A  S + + 
Sbjct  498   ERSSTILMVHKARRNGLPFWNKGHHADSNHVIVAFEAYRQLSQ-VSIRPMIAISSMNNIH  556

Query  1044  EDICKMAKEKRAAFLVLPFHKQQGTDGEMEDTNPAIQTVNEGVLLSAPCSVGILVERG--  871
             EDIC  A+ K AA ++LPFHK Q  DG +  T    + VN+ VL  APCSVGI V+RG  
Sbjct  557   EDICATAERKGAAVIILPFHKHQRLDGSLNITRNDFRWVNKRVLEHAPCSVGIFVDRGLG  616

Query  870   -----RPNQYAKNIAVLYLGGPDDREALTYARRMSGLPGVHLTVIRFVPAKDVSADGAVE  706
                    +  +  + VL+ GG DDREAL Y  RM+  PG+ L VIRF           V 
Sbjct  617   GTSHVSASNVSYRVTVLFFGGGDDREALAYGARMAEHPGIRLLVIRF-----------VG  665

Query  705   DPDLELELTRETSFVTVSIDPARDK--EEDEELLNNFRTETAEDDSKTFMELVLDDEEEF  532
             +P  E E+ R    V V  D    K   +DEE L+ F+ + A DDS  + E V+ D  E 
Sbjct  666   EPMNEGEIVR----VDVG-DSTGTKLISQDEEFLDEFKAKIANDDSIIYEEKVVKDGAET  720

Query  531   TKAVKSLDDRSFDLYVAGR--GRGVSSALTSGLADWCECPELGAVGDllvtsefessfsv  358
                +  L+  S +L++ G      V+SA+        ECPELG VG LL + ++ ++ SV
Sbjct  721   VAIICELN--SCNLFLVGSRPASEVASAMKRS-----ECPELGPVGGLLASQDYPTTASV  773

Query  357   lvVQQY  340
             LV+QQY
Sbjct  774   LVMQQY  779



>ref|XP_003538685.1| PREDICTED: cation/H(+) antiporter 18-like isoform X1 [Glycine 
max]
 ref|XP_006590501.1| PREDICTED: cation/H(+) antiporter 18-like isoform X2 [Glycine 
max]
 ref|XP_006590502.1| PREDICTED: cation/H(+) antiporter 18-like isoform X3 [Glycine 
max]
Length=805

 Score =   405 bits (1040),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 266/767 (35%), Positives = 423/767 (55%), Gaps = 51/767 (7%)
 Frame = -3

Query  2628  SNGVWEGPDPLAPMIPLFILQIMTAILSSRILNFVLKPFNQPPLVAEILSGIILGPSMLG  2449
             SNG ++G +PL   +PL ILQI   ++ SR L ++LKP  QP ++AEI+ GIILGPS+LG
Sbjct  19    SNGAFQGDNPLDFALPLAILQICLVLVVSRGLAYLLKPLRQPRVIAEIIGGIILGPSVLG  78

Query  2448  NIEEFRKHNFPNHNFETIETMGHFALVLYAFLTGLQMDVKAIVHTGTKSRIVAVSGSIFP  2269
               + + +  FP  +   ++T+ +  L+ + FL GL++D+K++  +G +   +A++G   P
Sbjct  79    RNKSYMQKVFPPRSLPVLDTLANIGLIFFLFLAGLELDLKSLRQSGNRVLAIAMAGISLP  138

Query  2268  FLIGAGFYFTLQ------TDTQSMIGFIFCGSALTVTGFSTLAKILDSKRLLNTEIGKIA  2107
             F+IG G  F L+      +D  + +  +F G AL++T F  LA+IL   +LL T +GK A
Sbjct  139   FVIGIGTSFVLKQTIAKGSDNAAFL--VFMGVALSITAFPVLARILAELKLLTTNVGKTA  196

Query  2106  ASSALINVALSWVLLTIGLLFTGSLDN---VQWAvlctvgfvvvcvnyVRPLLNWLISKT  1936
              S+A IN   +W+LL + +  +G   +     W  L   GFV+  +  V P+  W+  + 
Sbjct  197   MSAAAINDIAAWILLALAVALSGHDRSPLVSLWVFLAGCGFVICAILIVPPIFKWMSQRC  256

Query  1935  PEGQGFSEFYICSFIAVICAFGCFTDAMGSHPMIGAFIFGLIMPNNELLRTAILDRLEDF  1756
              EG+   E YIC+ +A + A G  TDA+G H M GAF+ G+++PN+    +A+++++ED 
Sbjct  257   HEGEPVEEVYICATLAAVLAAGFVTDAIGIHAMFGAFVVGILVPNDGPFASALVEKVEDL  316

Query  1755  VMGILMPVFFLVCGLRTNIFTITDGDTSIFTALALILLACS-AKIIAALVASCYTGMSTN  1579
             V G+ +P++F+  GL+TN+ TI    +  +  LA ++   S  KI+  L  S +  +  N
Sbjct  317   VSGLFLPLYFVSSGLKTNVATIKGAQS--WGLLAFVIFTASFGKILGTLFVSLFCKVPFN  374

Query  1578  EAIGLGVLTNTKSTMVMIILEVGqvqqvlsvqqysmmvVACLIMTIVATPLA-ARYCP--  1408
             EA+ LG L N K  + +I+L +G+ ++VL+ Q +++MV+  +  T + TPL  A Y P  
Sbjct  375   EALVLGFLMNCKGLVELIVLNIGKDRKVLNDQTFAIMVLMAVFTTFITTPLVTAVYKPAR  434

Query  1407  KQDLEPYKRRTIQNAKPGEELRILACIHGTNNLPAIISLLETSNSTVT-SPITAFGVQLL  1231
             K  +  YK RTI       +LRILAC HG  N+P++I+L+E S        +  + + L 
Sbjct  435   KGKITNYKYRTIGRKNANSQLRILACFHGARNIPSMINLIEASRGIQKRDALCVYAMHLK  494

Query  1230  ELVGRAPAM-MvvhssgsgrhvggsHEEVQTSQIISTFDNYELRSHGVTAQVLTARWSYD  1054
             E   R+ +M MV  +  +G           ++ +I  F+ Y   S  V+ + + A  S +
Sbjct  495   EFSERSSSMLMVHKARRNGLPFWNKGHHADSNHVIVAFEAYRQLSQ-VSIRPMIAISSMN  553

Query  1053  TMAEDICKMAKEKRAAFLVLPFHKQQGTDGEMEDTNPAIQTVNEGVLLSAPCSVGILVER  874
              + EDIC  A+ K AA ++LPFHK Q  DG +  T    + VN+ VL  APCSVGI V+R
Sbjct  554   NIHEDICATAERKGAAVIILPFHKHQRLDGSLNITRNDFRWVNKRVLEHAPCSVGIFVDR  613

Query  873   G-------RPNQYAKNIAVLYLGGPDDREALTYARRMSGLPGVHLTVIRFVPAKDVSADG  715
             G         +  +  + VL+ GG DD EAL Y  RM+  PG+ L VIRFV       +G
Sbjct  614   GLGGTSHVSASNVSYRVTVLFFGGGDDHEALAYGARMAEHPGIRLLVIRFVGEP---MNG  670

Query  714   AVEDPDLELELTRETSFVTVSIDPARDKEEDEELLNNFRTETAEDDSKTFMELVLDDEEE  535
              +    + +++   TS   +S        +DEE L+  +T+ A DDS  + E V+ D  E
Sbjct  671   EI----VRVDVGDSTSTKLIS--------QDEEFLDEIKTKIANDDSIIYEEKVVKDGAE  718

Query  534   FTKAVKSLDDRSFDLYVAGR--GRGVSSALTSGLADWCECPELGAVG  400
                 ++ L  +S +L++ G      V+SA+        ECPELG VG
Sbjct  719   TVAIIREL--KSCNLFLVGSRPASEVASAMKRS-----ECPELGPVG  758



>ref|XP_004298855.1| PREDICTED: cation/H(+) antiporter 18-like [Fragaria vesca subsp. 
vesca]
Length=803

 Score =   404 bits (1039),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 285/794 (36%), Positives = 436/794 (55%), Gaps = 45/794 (6%)
 Frame = -3

Query  2655  MCFSQTIYRSNGVWEGPDPLAPMIPLFILQIMTAILSSRILNFVLKPFNQPPLVAEILSG  2476
             +C S     SNGV++G +PL   +PL ILQI   +  +R L ++LKP  QP ++AEI+ G
Sbjct  10    ICPSPMKATSNGVFQGDNPLHFALPLAILQICIVVALTRGLAYLLKPLRQPRVIAEIIGG  69

Query  2475  IILGPSMLGNIEEFRKHNFPNHNFETIETMGHFALVLYAFLTGLQMDVKAIVHTGTKSRI  2296
             ++LGPS LG  + + +  FP  +   ++T+ +  L+ + FL GL++D KA+  TG K+  
Sbjct  70    VLLGPSALGRNKSYLQAIFPPKSITVLDTLANLGLLFFLFLAGLEIDPKALRQTGKKALA  129

Query  2295  VAVSGSIFPFLIGAGFYFTLQTDTQSMIG----FIFCGSALTVTGFSTLAKILDSKRLLN  2128
             +AV G   PF +G G  F L+      +      +F G AL++T F  LA+IL   +LL 
Sbjct  130   IAVIGISLPFALGIGSSFVLRATISKGVDLTAFLVFMGVALSITAFPVLARILAELKLLT  189

Query  2127  TEIGKIAASSALINVALSWVLLTIGLLFTGSLDN---VQWAvlctvgfvvvcvnyVRPLL  1957
             TEIG++A S+A +N   +WVLL + +  +GS  +     W +L    FV+  +  V  + 
Sbjct  190   TEIGRLAMSAAAVNDVAAWVLLALAIALSGSNQSPLVSLWVLLSGFVFVICAILVVPSIF  249

Query  1956  NWLISKTPEGQGFSEFYICSFIAVICAFGCFTDAMGSHPMIGAFIFGLIMPNNELLRTAI  1777
              W+  +  EG+   E Y+C+ +  + A G  TD +G H M GAF+ G+++P       ++
Sbjct  250   KWMAQRCHEGEPIDEIYVCATLTAVLAAGFITDTIGIHAMFGAFVIGVLVPKEGPFVGSL  309

Query  1776  LDRLEDFVMGILMPVFFLVCGLRTNIFTITDGDTSIFTALALILLACSAKIIAALVASCY  1597
             ++++ED V G+ +P++F+  GL+TN+ TI +G  S    + +I  AC  KI   ++ S  
Sbjct  310   VEKVEDLVSGLFLPLYFVSSGLKTNVATI-EGVQSWGLLVLVIFTACFGKIFGTVMVSLL  368

Query  1596  TGMSTNEAIGLGVLTNTKSTMVMIILEVGqvqqvlsvqqysmmvVACLIMTIVATPLA-A  1420
               +   EA+ LG L NTK  + +I+L +G+ ++VL+ Q +++MV+  L  T + TPL  A
Sbjct  369   CKVPVREALALGFLMNTKGLVELIVLNIGKDRKVLNDQTFAIMVLMALFTTFITTPLVTA  428

Query  1419  RYCP--KQDLEPYKRRTIQNAKPGEELRILACIHGTNNLPAIISLLETSNSTVTSP-ITA  1249
              Y P  +  +  YK +TI+      +LRIL+C H   N+P+II+LLE S  T     +  
Sbjct  429   VYKPAKRARMADYKYKTIERKNTNSQLRILSCFHSARNIPSIINLLEASRGTKKRDGLCV  488

Query  1248  FGVQLLELVGRAPA-MMvvhssgsgrhvggsHEEVQTSQIISTFDNYELRSHGVTAQVLT  1072
             + + L+EL  R+ A +MV  +  +G           T  ++  F+ Y+  SH V+ + +T
Sbjct  489   YAMHLMELSERSSAILMVHKARRNGLPFWNKGLRSNTDNVVVAFEAYQQLSH-VSIRPMT  547

Query  1071  ARWSYDTMAEDICKMAKEKRAAFLVLPFHKQQGTDGEMEDTNPAIQTVNEGVLLSAPCSV  892
                S   M EDIC  A+ KRAA ++LPFHK Q  DG +E T    + VN+ VL  APCSV
Sbjct  548   EISSVSNMHEDICATAENKRAAIIILPFHKHQRLDGTLETTRNDFRGVNKRVLEHAPCSV  607

Query  891   GILVERG-------RPNQYAKNIAVLYLGGPDDREALTYARRMSGLPGVHLTVIRFVPAK  733
             GILV+RG         +  +  I VLY GG DDREAL Y  RM+  PG+ L VIRF+   
Sbjct  608   GILVDRGLGGTTHIAASNVSYFITVLYFGGRDDREALAYGARMAEHPGIRLVVIRFL---  664

Query  732   DVSADGAVEDPDLELELTRETSFVTVSIDP---ARDKEEDEELLNNFRTETAEDDSKTFM  562
                         +E E+  E S  TV ID    ++    DEE L  F+    +DDS T+ 
Sbjct  665   ------------VEPEIVGEIS--TVDIDHNSGSKVGSVDEEFLAEFKHRIVQDDSITYE  710

Query  561   ELVLDDEEEFTKAVKSLDDRSFDLYVAGRGRGVSSALTSGLADWCECPELGAVGDllvts  382
             E V+ +E +    ++  +     L++ GR  G   AL   L    ECPELG VG LL++ 
Sbjct  711   EKVVRNEAQTIGVIR--EKGRCHLFLVGRCPGGEVAL--ALNKRSECPELGPVGSLLISP  766

Query  381   efessfsvlvVQQY  340
             +F +  SVLV+QQY
Sbjct  767   DFSTQASVLVLQQY  780



>gb|KHN25663.1| Cation/H(+) antiporter 18 [Glycine soja]
Length=806

 Score =   405 bits (1040),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 279/786 (35%), Positives = 432/786 (55%), Gaps = 48/786 (6%)
 Frame = -3

Query  2628  SNGVWEGPDPLAPMIPLFILQIMTAILSSRILNFVLKPFNQPPLVAEILSGIILGPSMLG  2449
             SNG ++G DPL   +PL ILQI   ++ SR L ++LKP  QP ++AEI+ GIILGPS LG
Sbjct  19    SNGAFQGDDPLDFALPLAILQICLVLVVSRGLAYLLKPLRQPRVIAEIIGGIILGPSALG  78

Query  2448  NIEEFRKHNFPNHNFETIETMGHFALVLYAFLTGLQMDVKAIVHTGTKSRIVAVSGSIFP  2269
               + + ++ FP  +   ++T+ +  L+ + FL GL++D+K++  +G +   +A++G   P
Sbjct  79    RNKSYMQNVFPPRSLTVLDTLANIGLIFFLFLAGLELDLKSLRQSGNRVLAIAMAGISLP  138

Query  2268  FLIGAGFYFTLQ----TDTQSMIGFIFCGSALTVTGFSTLAKILDSKRLLNTEIGKIAAS  2101
             F+IG G  F L+        S    +F G AL++T F  LA+IL   +LL T +G+ A S
Sbjct  139   FVIGIGSSFVLKQTIAKGADSAAFLVFMGVALSITAFPVLARILAELKLLTTNVGRTAMS  198

Query  2100  SALINVALSWVLLTIGLLFTGSLDN---VQWAvlctvgfvvvcvnyVRPLLNWLISKTPE  1930
             +A IN   +W+LL + +  +G   +     W  L   GFV+  +  V P+  W+  +  E
Sbjct  199   AAAINDIAAWILLALAVALSGHDRSPLVSLWVFLAGCGFVICAILIVPPIFKWMSQRCHE  258

Query  1929  GQGFSEFYICSFIAVICAFGCFTDAMGSHPMIGAFIFGLIMPNNELLRTAILDRLEDFVM  1750
             G+   E YIC+ +A + A G  TDA+G H M GAF+ G+++P++    +A+++++ED V 
Sbjct  259   GEPVEEVYICATLAAVLAAGFVTDAIGIHAMFGAFVVGILVPSDGPFASALVEKVEDLVS  318

Query  1749  GILMPVFFLVCGLRTNIFTITDGDTSIFTALALILLACSAKIIAALVASCYTGMSTNEAI  1570
             G+ +P++F+  GL+TN+ TI  G  S    + +I  A   KI+  LV S +  +  NEA+
Sbjct  319   GLFLPLYFVSSGLKTNVATI-KGAQSWGLLVFVIFTASFGKILGTLVVSLFCKVPFNEAL  377

Query  1569  GLGVLTNTKSTMVMIILEVGqvqqvlsvqqysmmvVACLIMTIVATPLA-ARYCP--KQD  1399
              LG L N K  + +I+L +G+ ++VL+ Q +++MV+  +  T + TPL  A Y P  K  
Sbjct  378   VLGFLMNCKGLVELIVLNIGKDRKVLNDQTFAIMVLMAVFTTFITTPLVTAVYKPARKGK  437

Query  1398  LEPYKRRTIQNAKPGEELRILACIHGTNNLPAIISLLETSNSTVTS-PITAFGVQLLELV  1222
             +  YK RTI       +LRIL C HG  N+P++I+L+E S        +  + + L E  
Sbjct  438   IVDYKYRTIGRKNANSQLRILTCFHGARNIPSMINLIEASRGIRKGDALCVYAMHLKEFS  497

Query  1221  GRAPA-MMvvhssgsgrhvggsHEEVQTSQIISTFDNYELRSHGVTAQVLTARWSYDTMA  1045
              R+   +MV  +  +G           ++ +I  F+ Y   S  V+ + + A  S + + 
Sbjct  498   ERSSTILMVHKARRNGLPFWNKGHHADSNHVIVAFEAYRQLSQ-VSIRPMIAISSMNNIH  556

Query  1044  EDICKMAKEKRAAFLVLPFHKQQGTDGEMEDTNPAIQTVNEGVLLSAPCSVGILVERG--  871
             EDIC  A+ K AA ++LPFHK Q  DG +  T    + VN+ VL  APCSVGI V+RG  
Sbjct  557   EDICATAERKGAAVIILPFHKHQRLDGSLNITRNDFRWVNKRVLEHAPCSVGIFVDRGLG  616

Query  870   -----RPNQYAKNIAVLYLGGPDDREALTYARRMSGLPGVHLTVIRFVPAKDVSADGAVE  706
                    +  +  + VL+ GG DDREAL Y  RM+  PG+ L VIRF           V 
Sbjct  617   GTSHVSASNVSYRVTVLFFGGGDDREALAYGTRMAEHPGIRLLVIRF-----------VG  665

Query  705   DPDLELELTRETSFVTVSIDPARDK--EEDEELLNNFRTETAEDDSKTFMELVLDDEEEF  532
             +P  E E+ R    V V  D    K   +DEE L+ F+ + A DDS  + E V+ D  E 
Sbjct  666   EPMNEGEIVR----VDVG-DSTGTKLISQDEEFLDEFKAKIANDDSIIYEEKVVKDGAET  720

Query  531   TKAVKSLDDRSFDLYVAGR--GRGVSSALTSGLADWCECPELGAVGDllvtsefessfsv  358
                +  L+  S +L++ G      V+SA+        ECPELG VG LL + ++ ++ SV
Sbjct  721   VAIICELN--SCNLFLVGSRPASEVASAMKRS-----ECPELGPVGGLLASQDYPTTASV  773

Query  357   lvVQQY  340
             LV+QQY
Sbjct  774   LVMQQY  779



>ref|XP_004146576.1| PREDICTED: cation/H(+) antiporter 18-like [Cucumis sativus]
 gb|KGN53371.1| hypothetical protein Csa_4G050260 [Cucumis sativus]
Length=799

 Score =   403 bits (1036),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 280/794 (35%), Positives = 444/794 (56%), Gaps = 42/794 (5%)
 Frame = -3

Query  2661  VVMCFSQTIYRSNGVWEGPDPLAPMIPLFILQIMTAILSSRILNFVLKPFNQPPLVAEIL  2482
             V +C +     SNG+++G +PL   +PL ILQI   +  +R L F+L+P  QP ++ EI+
Sbjct  8     VTLCPTPMKATSNGIFQGDNPLDFALPLIILQICLVVALTRGLAFLLRPLKQPRVIGEII  67

Query  2481  SGIILGPSMLGNIEEFRKHNFPNHNFETIETMGHFALVLYAFLTGLQMDVKAIVHTGTKS  2302
              GI+LGPS LG  + F    FP+++   ++T+ +  L+ + FL GL++D+K+I  TG K+
Sbjct  68    GGILLGPSALGRNKNFLHTIFPSNSITLLDTIANIGLLFFLFLVGLELDLKSIRRTGKKA  127

Query  2301  RIVAVSGSIFPFLIGAGFYFTLQTDTQSMIG----FIFCGSALTVTGFSTLAKILDSKRL  2134
               +A++G   PF +G G  F L+      +      IF G AL++T F  LA+IL   +L
Sbjct  128   FGIAITGICVPFALGIGSSFVLRETISKGVNASAFLIFMGVALSITAFPVLARILAELKL  187

Query  2133  LNTEIGKIAASSALINVALSWVLLTIGLLFTGSLDN---VQWAvlctvgfvvvcvnyVRP  1963
             L T++G++A S+A +N   +W+LL + +  +GS  +     W  L   GFVV  +  + P
Sbjct  188   LTTDVGRMAMSAAAVNDVAAWILLALAIALSGSDKSPLTAVWVFLSGCGFVVAAIVILSP  247

Query  1962  LLNWLISKTPEGQGFSEFYICSFIAVICAFGCFTDAMGSHPMIGAFIFGLIMPNNELLRT  1783
             +  W+  +  +G+   E YIC+ +A++ A G  TD +G H M GAF+ G+++P +  L  
Sbjct  248   VFKWMTKQCFQGEPVREIYICATLAIVLAAGFATDFIGIHAMFGAFVVGVLVPKDGPLVG  307

Query  1782  AILDRLEDFVMGILMPVFFLVCGLRTNIFTITDGDTSIFTALALILLACSAKIIAALVAS  1603
             A+++++ED V  + +P++F+  GL+TN+ TI  G  S    + +I+ ACS KI+   + S
Sbjct  308   ALVEKIEDLVSSLFLPLYFVSSGLKTNVATI-QGAQSWGLLVLVIVTACSGKILGTFLVS  366

Query  1602  CYTGMSTNEAIGLGVLTNTKSTMVMIILEVGqvqqvlsvqqysmmvVACLIMTIVATPLA  1423
                 +   EA+ LG L NTK  + +I+L +G+ ++VL+ Q +++M++  L  T + TPL 
Sbjct  367   LLCKVPVREALALGFLMNTKGLVELIVLNIGKDRKVLNDQTFAIMILMALFTTFITTPLV  426

Query  1422  -ARYCPKQD--LEPYKRRTIQNAKPGEELRILACIHGTNNLPAIISLLETSNSTVTS-PI  1255
              A Y P +   +  YK R I+      +LR+L C H   N+P+II+LLE S  T     +
Sbjct  427   IAVYKPARSAKIADYKHRKIERKNKNTQLRMLTCFHSAGNVPSIINLLEASRGTEKGEEL  486

Query  1254  TAFGVQLLELVGRAPA-MMvvhssgsgrhvggsHEEVQTSQIISTFDNYELRSHGVTAQV  1078
               + + L+EL  R+ A +MV  +  +G       +   ++ +I  F+ Y+  S  V  + 
Sbjct  487   CVYAMHLMELSERSSAILMVHKARKNGLPFWNKGQRSDSNHVIVAFEAYQQLSR-VFIRP  545

Query  1077  LTARWSYDTMAEDICKMAKEKRAAFLVLPFHKQQGTDGEMEDTNPAIQTVNEGVLLSAPC  898
             +TA  S   + EDIC  A+ KR A ++LPFHK Q  DG +E T  +I+ VN+ VL  A C
Sbjct  546   MTAISSMSDIHEDICATAERKRTAIIILPFHKHQRVDGSLETTRSSIRVVNQNVLEHARC  605

Query  897   SVGILVERG-------RPNQYAKNIAVLYLGGPDDREALTYARRMSGLPGVHLTVIRFVP  739
             SVGI V+RG         +  +  I VL+ GG DDREAL++  RM+  PG+ L VI F  
Sbjct  606   SVGIFVDRGLGGTTHVSSSNVSLFITVLFFGGGDDREALSFGVRMAEHPGIRLMVIHFF-  664

Query  738   AKDVSADGAVE-DPDLELELTRETSFVTVSIDPARDKEEDEELLNNFRTETAEDDSKTFM  562
                      VE +P  E+     TS  TV    A+   +D+E L+ FR   +++DS T++
Sbjct  665   ---------VEPEPIGEI-----TSADTVGNSLAKTVPQDDEFLSEFRHNASKNDSITYV  710

Query  561   ELVLDDEEEFTKAVKSLDDRSFDLYVAGRGRGVSSALTSGLADWCECPELGAVGDllvts  382
             E  +    E    V+ L  +  +LY+ GR  G++S+      D   CPELG VG+LL + 
Sbjct  711   ERTIKTAAEAMSTVQEL--KHCNLYLVGRTPGLNSSFALNRND---CPELGPVGNLLTSL  765

Query  381   efessfsvlvVQQY  340
              F  + SVLVVQQY
Sbjct  766   NFPITASVLVVQQY  779



>ref|XP_003611042.1| Cation proton exchanger [Medicago truncatula]
 gb|AES94000.1| cation/H+ exchanger 3 [Medicago truncatula]
Length=803

 Score =   403 bits (1036),  Expect = 5e-122, Method: Compositional matrix adjust.
 Identities = 270/781 (35%), Positives = 428/781 (55%), Gaps = 38/781 (5%)
 Frame = -3

Query  2628  SNGVWEGPDPLAPMIPLFILQIMTAILSSRILNFVLKPFNQPPLVAEILSGIILGPSMLG  2449
             SNGV++G  PL   +PL ILQI   ++ +R L ++L P  QP ++AEI+ GI+LGPS LG
Sbjct  19    SNGVFQGDHPLDYALPLAILQICLVLVVTRGLAYLLNPLRQPRVIAEIVGGILLGPSALG  78

Query  2448  NIEEFRKHNFPNHNFETIETMGHFALVLYAFLTGLQMDVKAIVHTGTKSRIVAVSGSIFP  2269
               + +    FP  +   ++T+ +  L+ + FL G+++D K++  TG +   +A++G   P
Sbjct  79    RNKGYLHAVFPPKSLPVLDTLANLGLIFFLFLAGIELDPKSLRKTGGRVLAIAIAGISLP  138

Query  2268  FLIGAGFYFTLQTDTQSMIG----FIFCGSALTVTGFSTLAKILDSKRLLNTEIGKIAAS  2101
             F +G G  F LQ      +      ++ G AL++T F  LA+IL   +LL T +G++A S
Sbjct  139   FALGIGSSFVLQRTIAKGVNTSAFLVYMGVALSITAFPVLARILAELKLLTTSVGRMAMS  198

Query  2100  SALINVALSWVLLTIGLLFTGSLDN---VQWAvlctvgfvvvcvnyVRPLLNWLISKTPE  1930
             +A +N   +W+LL + +  +G+  +     W  L   GFVV  +  V P+  W+  +  E
Sbjct  199   AAAVNDVAAWILLALAVALSGNSQSPFVSLWVFLSGCGFVVCSILIVLPIFKWMAQQCHE  258

Query  1929  GQGFSEFYICSFIAVICAFGCFTDAMGSHPMIGAFIFGLIMPNNELLRTAILDRLEDFVM  1750
             G+   E YIC+ +A + A G  TDA+G H M GAF+FG+++P +     A+++++ED V 
Sbjct  259   GEPVDELYICATLAAVLAAGFVTDAIGIHAMFGAFVFGILVPKDGAFAGALVEKIEDLVS  318

Query  1749  GILMPVFFLVCGLRTNIFTITDGDTSIFTALALILLACSAKIIAALVASCYTGMSTNEAI  1570
             G+L+P++F+  GL+T+I TI  G  S    + +   AC  KI+  +V S    +  NE++
Sbjct  319   GLLLPLYFVSSGLKTDIATI-QGLQSWGLLVFVTFTACFGKIVGTIVVSLICKVPFNESL  377

Query  1569  GLGVLTNTKSTMVMIILEVGqvqqvlsvqqysmmvVACLIMTIVATPLA-ARYCPKQDLE  1393
              LG L N+K  + +I+L +G+ ++VL+ Q +++MV+  LI T + TP   A Y  K+   
Sbjct  378   VLGFLMNSKGLVELIVLNIGKDRKVLNDQTFAIMVLMALITTFMTTPFVLAAYKRKERKS  437

Query  1392  PYKRRTIQNAKPGEELRILACIHGTNNLPAIISLLETSNSTVTS-PITAFGVQLLELVGR  1216
              YK RTI+      +LRILAC HG+ N+P++I+L+E S        +  + + L E   R
Sbjct  438   NYKYRTIERKNADGQLRILACFHGSRNIPSLINLIEASRGIKKHDALCVYAMHLKEFCER  497

Query  1215  APA-MMvvhssgsgrhvggsHEEVQTSQIISTFDNYELRSHGVTAQVLTARWSYDTMAED  1039
             + + +M      +G           +  +I  F+ Y+  S  V  + + A  S   + ED
Sbjct  498   SSSILMAQKVRQNGLPFWDKGRHGDSLHVIVAFEAYQKLSQ-VFVRPMIAISSMANIHED  556

Query  1038  ICKMAKEKRAAFLVLPFHKQQGTDGEMEDTNPAIQTVNEGVLLSAPCSVGILVERG----  871
             IC  A  KRAA ++LPFHKQQ  DG ++      + VN+ VL  APCSVGI V+RG    
Sbjct  557   ICTTADRKRAAVIILPFHKQQRVDGSLDIIRNDFRLVNKRVLEHAPCSVGIFVDRGLGGS  616

Query  870   ---RPNQYAKNIAVLYLGGPDDREALTYARRMSGLPGVHLTVIRFVPAKDVSADGAVEDP  700
                  +  +  IAVL+ GG DDREAL Y  RM+  PG+ L VI F+   +++  G +   
Sbjct  617   CHVSASNVSYCIAVLFFGGGDDREALAYGARMAEHPGIQLVVIHFLVEPNIA--GKITKV  674

Query  699   DLELELTRETSFVTVSIDPARDKEEDEELLNNFRTETAEDDSKTFMELVLDDEEEFTKAV  520
             D+    +  +              ED E L  F+ +TA DDS  + E ++ D EE    +
Sbjct  675   DVGDSSSNNSI----------SDSEDGEFLAEFKLKTANDDSIIYEERIVKDAEETVATI  724

Query  519   KSLDDRSFDLYVAGRGRGVSSALTSGLA-DWCECPELGAVGDllvtsefessfsvlvVQQ  343
             + ++    +L++ GR      A   G A +  ECPELG VG LL + +F ++ SVLV+QQ
Sbjct  725   REIN--FCNLFLVGR----RPAGELGFALERSECPELGPVGGLLASQDFRTTASVLVMQQ  778

Query  342   Y  340
             Y
Sbjct  779   Y  779



>ref|XP_006841535.1| hypothetical protein AMTR_s00003p00159310 [Amborella trichopoda]
 gb|ERN03210.1| hypothetical protein AMTR_s00003p00159310 [Amborella trichopoda]
Length=794

 Score =   402 bits (1034),  Expect = 7e-122, Method: Compositional matrix adjust.
 Identities = 268/768 (35%), Positives = 420/768 (55%), Gaps = 42/768 (5%)
 Frame = -3

Query  2652  CFSQTIYRSNGVWEGPDPLAPMIPLFILQIMTAILSSRILNFVLKPFNQPPLVAEILSGI  2473
             C S     SNG W+G +PL   +PL +LQI   ++ +R+L F+L+P  QP ++AEI+ GI
Sbjct  6     CPSPMKAVSNGAWQGDNPLDFALPLLMLQICLVLIVTRLLAFLLRPLRQPRVIAEIIGGI  65

Query  2472  ILGPSMLGNIEEFRKHNFPNHNFETIETMGHFALVLYAFLTGLQMDVKAIVHTGTKSRIV  2293
             +LGPS LG+ +++ +  FP  +   ++++ +  L+ + FL GL++DV +I  TG K+  +
Sbjct  66    LLGPSALGHNKDYLRRVFPPRSMTLLDSVANMGLLFFLFLIGLELDVNSIRRTGRKALGI  125

Query  2292  AVSGSIFPFLIGAGFYFTLQTDTQSMIG----FIFCGSALTVTGFSTLAKILDSKRLLNT  2125
             A++G   PFL+G G  F L++     +G     +F G AL++T F  LA+IL   +LL T
Sbjct  126   ALAGITLPFLLGVGTSFVLKSTVAKGVGTASFLVFMGVALSITAFPVLARILAELKLLTT  185

Query  2124  EIGKIAASSALINVALSWVLLTIGLLFTGSLDN---VQWAvlctvgfvvvcvnyVRPLLN  1954
             +IG+IA S+A +N   +W+LL + +  +G+  +     W +L  V FV+  V  VRP+L 
Sbjct  186   DIGRIAMSAAAVNDVAAWILLALAVALSGTGRSPLVSLWVLLSGVTFVIFAVLAVRPVLA  245

Query  1953  WLISKTPEGQGFSEFYICSFIAVICAFGCFTDAMGSHPMIGAFIFGLIMPNNELLRTAIL  1774
             W+  ++ +     E Y+C  +AV+ A G  TD++G H + G F+ GL+MP       +++
Sbjct  246   WMARRSDDNGPVHEGYVCVVLAVVLAAGFATDSIGIHVLFGGFVMGLVMPKEGAFAGSLI  305

Query  1773  DRLEDFVMGILMPVFFLVCGLRTNIFTITDGDTSIFTALALILLACSAKIIAALVASCYT  1594
             +++ED V G+ +P++F+  GL+T++ TI    +     L +I+ AC  K++  +  S   
Sbjct  306   EKIEDLVSGLFLPLYFVSSGLKTDVATIQGAQSWGMLGL-VIVTACVGKVLGTVGVSLAF  364

Query  1593  GMSTNEAIGLGVLTNTKSTMVMIILEVGqvqqvlsvqqysmmvVACLIMTIVATPLA-AR  1417
              M   EA  LG L NTK  + +I+L +G+ ++VL+ Q +++M++  L  T + TPL  A 
Sbjct  365   KMPCREAWALGFLMNTKGLVELIVLNIGKDRKVLNDQTFAIMILMALFTTFITTPLVTAV  424

Query  1416  YCPKQDLEPYKRRTIQNAKPGEELRILACIHGTNNLPAIISLLETSNSTVTSPITAFGVQ  1237
             Y P +   PYK RTIQ   P  EL ILAC+H   ++PA+I L+E S  T    +  + + 
Sbjct  425   YKPARKATPYKHRTIQRKNPDSELCILACLHNARSIPALIHLIEASRGTRRRSLCVYAMH  484

Query  1236  LLELVGRAPAMMvvhssgsgrhvggsHEEVQTSQIISTFDNYELRSHGVTAQVLTARWSY  1057
             L+EL  R  A+++ +          +     +   +  FD Y+  S  V+ + +TA  S 
Sbjct  485   LMELSERPSAIVMANKVRHNGLPFWNKSHPNSDHFVVAFDAYQSLS-SVSVRPMTAISSL  543

Query  1056  DTMAEDICKMAKEKRAAFLVLPFHKQQGTDGEMEDTNPAIQTVNEGVLLSAPCSVGILVE  877
              TM EDIC  A+ KRAA ++LPFHKQ   DG  E T P  + VN  VL +A CSV I V+
Sbjct  544   TTMHEDICSSAEHKRAALILLPFHKQARIDGNFEVTRPGFRQVNLHVLGNARCSVAIFVD  603

Query  876   RGR-------PNQYAKNIAVLYLGGPDDREALTYARRMSGLPGVHLTVIRFVPAKDVSAD  718
             RG         + +A +IA+L+ GG DDREAL+YA RM+  PGV L V+RF P    +  
Sbjct  604   RGLGGPARIPASNFASSIAMLFFGGQDDREALSYATRMAEHPGVSLIVLRFQPVPQTN--  661

Query  717   GAVEDPDLELELTRETSFVTVSID-PARDKEEDEELLNNFRTETAEDDSKTFMELVLDDE  541
                  PD             V ID      E+DE+ L +F      + S  + EL +   
Sbjct  662   ----QPD------------GVGIDMETGSHEDDEKFLADFHAMAKTNQSIRYEELEVRSR  705

Query  540   EEFTKAVKSLDDRSFDLYVAGRGRGVSSALTSGLADWCECPELGAVGD  397
             EE   A++++  R   L V  R       ++S      +C ELG VG 
Sbjct  706   EETVAAIRNV-ARCNLLLVGRRAEAPGFEMSS-----ADCTELGLVGS  747



>ref|XP_009353458.1| PREDICTED: cation/H(+) antiporter 19 [Pyrus x bretschneideri]
Length=818

 Score =   403 bits (1035),  Expect = 9e-122, Method: Compositional matrix adjust.
 Identities = 290/830 (35%), Positives = 446/830 (54%), Gaps = 74/830 (9%)
 Frame = -3

Query  2715  APPPPSTGPEVDLDRLGQVVMCFSQTIYRSNGVWEGPDPLAPMIPLFILQIMTAILSSRI  2536
             APPPP   P                    SNG ++G +PL   +PL ILQI+  ++ +R 
Sbjct  2     APPPPLIAP----------------MKATSNGSFQGENPLDFALPLLILQIVLVVVFTRT  45

Query  2535  LNFVLKPFNQPPLVAEILSGIILGPSMLGNIEEFRKHNFPNHNFETIETMGHFALVLYAF  2356
             L F+L+P  QP ++AE++ GI+LGPS LG  ++F    FP      ++T+ +  L+ + F
Sbjct  46    LAFLLRPLRQPRVIAEVIGGILLGPSALGRSQKFLHTVFPAKAMTVLDTVANIGLLFFLF  105

Query  2355  LTGLQMDVKAIVHTGTKSRIVAVSGSIFPFLIGAGFYFTLQTDTQSMIG----FIFCGSA  2188
             L GL++D++AI  TG KS  +AV+G   PF++G    F L+      +      +F G A
Sbjct  106   LVGLELDIRAIRRTGKKSLGIAVAGITLPFVLGVFTSFALRATVSKGVSQGPFLVFIGVA  165

Query  2187  LTVTGFSTLAKILDSKRLLNTEIGKIAASSALINVALSWVLLTIGLLFTGS----LDNVQ  2020
             L++T F  LA+IL   +LL T++G+IA S+A +N   +W+LL + +  TG+    L +V 
Sbjct  166   LSITAFPVLARILAELKLLTTDVGRIAMSAAAVNDVAAWILLALAIALTGTNTSPLVSV-  224

Query  2019  WAvlctvgfvvvcvnyVRPLLNWLISKTPEGQGFSEFYICSFIAVICAFGCFTDAMGSHP  1840
             W +L   GFV  C+  +RPLL  +  ++P+G+   E YIC  ++++ A    TD +G H 
Sbjct  225   WVLLSGAGFVGFCIFALRPLLAMMARRSPDGEPVKELYICITLSLVLAASFVTDVIGIHA  284

Query  1839  MIGAFIFGLIMPNNELLRTAILDRLEDFVMGILMPVFFLVCGLRTNIFTITDGDTSIFTA  1660
             + GAF+ G+I+P +      ++++LED V G+ +P++F+  GL+TN+ TI+ G +     
Sbjct  285   LFGAFVVGIIVPKDGPFAGVLIEKLEDLVSGLFLPLYFVSSGLKTNVATISGGQSWALL-  343

Query  1659  LALILLACSAKIIAALVASCYTGMSTNEAIGLGVLTNTKSTMVMIILEVGqvqqvlsvqq  1480
             L +I  A   KI+  +  S    +   EA+ LG L NTK  + +I+L +G+ ++VL+ Q 
Sbjct  344   LLVIFTATFGKIVGTVSLSMACKVPFREALALGFLMNTKGLVELIVLNIGKDRKVLNDQT  403

Query  1479  ysmmvVACLIMTIVATPL-AARYCPKQDLEPYKRRTIQNAKPGEELRILACIHGTNNLPA  1303
             +++ V+  L  T + TPL  A Y P +   PYK R++    P  ELR+LAC H T N+P 
Sbjct  404   FAIFVLMALFTTFITTPLVVAIYKPARRGAPYKHRSVFRKNPDTELRMLACFHSTRNIPT  463

Query  1302  IISLLETSNSTVT-SPITAFGVQLLELVGRAPA--MMvvhssgsgrhvggsHEEVQTSQI  1132
             +I+L+E+S  T     +T + + L+EL  R+ A  M+                E    Q+
Sbjct  464   MINLIESSRGTRKRGRLTVYAMHLMELSERSSAISMVHKARHNGLPFWNKKTNENNKDQM  523

Query  1131  ISTFDNYELRSHGVTAQVLTARWSYDTMAEDICKMAKEKRAAFLVLPFHKQQGTDGEMED  952
             +  F+ YE  S  V  + +TA  S + + EDIC  A +K AA ++LPFHK Q  DG ME 
Sbjct  524   VIAFEAYEQLS-SVKVRPMTAISSLNDIHEDICASAHQKNAAVILLPFHKHQRLDGTMES  582

Query  951   TNPAIQTVNEGVLLSAPCSVGILVERG-------RPNQYAKNIAVLYLGGPDDREALTYA  793
                A+++VNE VL  APCSVGILV+RG         +  + NI V + GG DDREAL Y 
Sbjct  583   LGNALRSVNERVLKHAPCSVGILVDRGLGGTAQVSASDVSYNIVVAFFGGRDDREALAYG  642

Query  792   RRMSGLPGVHLTVIRFVP---------AKDVSADGAVEDPDLELELTRETSFVTVSIDPA  640
              R+   PG+ +T+IRFV          AK V          LE E            D  
Sbjct  643   MRLVEHPGIVMTLIRFVAPEGKTLRFGAKLVGITSDNNKKILEEE------------DCG  690

Query  639   R--DKEEDEELL--------NNFRTETAEDDSKTFMELVLDDEEEFTKAVKSLDDRSFDL  490
             R  DKE+DE LL        N+   E   + S  + E V+D + +    +KS+  ++ +L
Sbjct  691   RGDDKEDDESLLAEYMNVRKNSGNKEGGGEPSMLYEEKVVDSKADICVVLKSM-AKNVNL  749

Query  489   YVAGRGRGVSSALTSGLADWCECPELGAVGDllvtsefessfsvlvVQQY  340
             ++ GR    +  + S      +C ELG VG  L +S+F S+ SV+V+QQY
Sbjct  750   FIVGRMPPTAPLVDSS----SDCAELGPVGSFLASSDFSSTASVMVLQQY  795



>ref|XP_004309917.1| PREDICTED: cation/H(+) antiporter 15-like [Fragaria vesca subsp. 
vesca]
Length=864

 Score =   404 bits (1038),  Expect = 9e-122, Method: Compositional matrix adjust.
 Identities = 262/806 (33%), Positives = 442/806 (55%), Gaps = 55/806 (7%)
 Frame = -3

Query  2694  GPEVDLDRLGQVVMCFSQTIYRSNGVWEGPDPLAPMIPLFILQIMTAILSSRILNFVLKP  2515
             G  + +D    V +C+ +   R++G+W   +PL   + + ++Q++  +  + +L F+L+P
Sbjct  14    GYHLQVDTNDNVTVCYLKNYSRNDGLWRTENPLINSLHVLVIQLVLILFLNHVLVFLLRP  73

Query  2514  FNQPPLVAEILSGIILGPSMLGNIEEFRKHNFPNHNFETIETMGHFALVLYAFLTGLQMD  2335
               QP +VA+IL+G++LGPS +GNI+  R+     ++  T+ET+ +  LV Y FL GL++D
Sbjct  74    LRQPRIVADILAGVLLGPSAIGNIDVIRRTTLSFNSLLTLETIANLGLVYYMFLLGLELD  133

Query  2334  VKAIVHTGTKSRIVAVSGSIFPFLIGAGFYF---------TLQTDTQSMI---GFIFCGS  2191
              + ++  G K+  +AV+G +    +G G ++          L+ D Q  +   G +F G 
Sbjct  134   FRPVIRAGKKALSIAVAGILVSVPVGWGLHYYVLRNQSHTDLKGDEQERLLKPGPLFWGI  193

Query  2190  ALTVTGFSTLAKILDSKRLLNTEIGKIAASSALINVALSWVLLTIGLLFTGSLDNVQWAv  2011
             +L  T F+ LA+IL   +LL +EIG++A S+A+I+   S  L  I + F   ++   W V
Sbjct  194   SLATTNFADLARILADLKLLQSEIGRLALSAAVISDMFSGFLFMIAMAF---VNFNWWLV  250

Query  2010  lctvgfvvvcvnyVRPLLNWLISKTPEGQGFSEFYICSFIAVICAFGCFTDAMGSHPMIG  1831
               T  F+ V +  VRP L+W++  T +    +E ++C  ++ I   G  TDA G+H ++G
Sbjct  251   GLTSVFIAVFIFVVRPALSWVLHNTTKKDSHNELHVCFILSWIVICGFITDACGAHSIVG  310

Query  1830  AFIFGLIMPNNELLRTAILDRLEDFVMGILMPVFFLVCGLRTNIFTI------TDGDTSI  1669
             AF+ G IMP    L++ +++R+ +FV  ++MP+F+LV GLR N+  I          T+ 
Sbjct  311   AFMLGAIMPKELELKSFLVERIGNFVSSMMMPLFYLVVGLRFNVDRILYVRKKEPNGTTK  370

Query  1668  FTALALILLACSAKIIAALVASCYTGMSTNEAIGLGVLTNTKSTMVMIILEVGqvqqvls  1489
             F  L ++ LA +AK++A  +A+    +   +++ LGVL NTK  + +IIL   +  +VL 
Sbjct  371   FDVLVVVALAFTAKLVATSIAALINKIKLRDSLILGVLMNTKGLLALIILSSARDLKVLD  430

Query  1488  vqqysmmvVACLIMTIVATP-LAARYCPKQDLEPYKRRTIQNA--KPGEELRILACIHGT  1318
              Q +++M++    +TI   P LA  Y   +    YK R IQ+   K   + RILAC H  
Sbjct  431   QQMFAIMLIIVWGITIPVGPILAFTYKSSKRSPRYKHRNIQSVGTKTSTDFRILACTHTV  490

Query  1317  NNLPAIISLLETSNSTVTSPITAFGVQLLELVGRAPAMMvvhssgsgrhvggsHEEVQTS  1138
              N   ++ L+E SN    SPI  F V L+EL G A AM++VH +          E   ++
Sbjct  491   TNTSGMVDLIEASNPLEHSPIHLFAVNLVELTGHASAMLIVHDACKSSKHRNEAELSNSA  550

Query  1137  QIISTFDNYELRSHGVTAQVLTARWSYDTMAEDICKMAKEKRAAFLVLPFHKQQGT-DGE  961
                + F+ Y  +   V  Q LT   +YDTM EDIC +A++K A  +++PFH++    DG 
Sbjct  551   S--NAFEAYASQRENVFVQALTVVSAYDTMHEDICTLAEDKNANLVIIPFHRKSNIDDGM  608

Query  960   MEDTNPAIQTVNEGVLLSAPCSVGILVERGRP-----NQY-----------AKNIAVLYL  829
             +ED NP+  ++N+ V+ ++PC+V + V+RG       + Y              + +L+L
Sbjct  609   LEDLNPSFLSINKNVIENSPCTVCVFVDRGLAACRIFSNYDSGSISARGVRGHKVTLLFL  668

Query  828   GGPDDREALTYARRMSGLPGVHLTVIRFVPAKDVSADGAVEDPDLELELTRETSFVTVSI  649
             GGPDDREAL YA RM+G  G+HLTVIR +  +  +AD    D +       + SFV ++ 
Sbjct  669   GGPDDREALAYALRMAGHSGIHLTVIRLIMPRTSTADPISLDEN-------DKSFVEMA-  720

Query  648   DPARDKEEDEELLNNFRTETAEDDSKTFMELVLDDEEEFTKAVKSLDDRSFDLYVAGR--  475
             +  R K+ D   ++ FR +T  + +    E  ++  EE    +++++ + + L + GR  
Sbjct  721   EIQRQKQLDNLYMDEFRLKTMNNTAVRLFEDQVNSWEEIHNILRNMEGK-YALCIVGRDH  779

Query  474   GRGVSSALTSGLADWCECPELGAVGD  397
             GR +S   TS L +  +  ELGA+G+
Sbjct  780   GRTLSFEETS-LDNTDDSDELGALGE  804



>ref|XP_006664748.1| PREDICTED: cation/H(+) antiporter 19-like, partial [Oryza brachyantha]
Length=781

 Score =   402 bits (1032),  Expect = 9e-122, Method: Compositional matrix adjust.
 Identities = 249/737 (34%), Positives = 404/737 (55%), Gaps = 47/737 (6%)
 Frame = -3

Query  2637  IYRSNGVWEGPDPLAPMIPLFILQIMTAILSSRILNFVLKPFNQPPLVAEILSGIILGPS  2458
             I  S G ++G  PL   +PL ILQI   ++ +R L ++L+P  QP ++AEI+ G++LGPS
Sbjct  3     IRTSQGAFQGDSPLDFALPLAILQICLVVVVTRGLAYLLRPLRQPRVIAEIIGGMLLGPS  62

Query  2457  MLGNIEEFRKHNFPNHNFETIETMGHFALVLYAFLTGLQMDVKAIVHTGTKSRIVAVSGS  2278
             +LG   +F +H FP  +   ++T+ +  L+ Y FL GL++D+ AI   GTK   +A++G 
Sbjct  63    VLGRSSQFMQHVFPPKSMSVLDTLANIGLLFYLFLVGLELDISAIRRAGTKVLAIALAGI  122

Query  2277  IFPFLIGAG----FYFTLQTDTQSMIGFIFCGSALTVTGFSTLAKILDSKRLLNTEIGKI  2110
               PF +G G    F  T+          +F G AL++T F  L +IL   +LL T++G++
Sbjct  123   SVPFALGIGTSFAFRATIVKGAPQAPFLVFMGVALSITAFPVLDRILAELKLLTTDVGRM  182

Query  2109  AASSALINVALSWVLLTIGLLFTGSLDNV--QWAvlctvgfvvvcvnyVRPLLNWLISKT  1936
             A S+A +N   +W+LL + +  +GS   +   W +L   GFVV  V  +RP+L W+  ++
Sbjct  183   AMSAAAVNDVAAWILLALAVALSGSGSPIISLWVLLTAAGFVVAVVLLLRPVLAWMARRS  242

Query  1935  PEGQGFSEFYICSFIAVICAFGCFTDAMGSHPMIGAFIFGLIMPNNELLRTAILDRLEDF  1756
             PEG+   E YIC+ +A++ A G  TD +G H + GAF+ G+++P +      ++++LED 
Sbjct  243   PEGEPIKESYICATLAIVLAAGFVTDTIGIHALFGAFVVGIVVPKDGPFAGVLIEKLEDL  302

Query  1755  VMGILMPVFFLVCGLRTNIFTITDGDTSIFTALALILLACSAKIIAALVASCYTGMSTNE  1576
             V  + +P++F+  GL+TN+ TI  G  S    + +I+ AC  KI   ++ S    +   E
Sbjct  303   VASLFLPLYFVSSGLKTNVATI-RGAKSWGLLVLVIVNACLGKIGGTVITSFLVKIPVRE  361

Query  1575  AIGLGVLTNTKSTMVMIILEVGqvqqvlsvqqysmmvVACLIMTIVATPLA-ARYCPKQD  1399
             A+ LG L NTK  + +I+L +G+ ++VL+ + +++MV+  L+ T + TP+  A Y P + 
Sbjct  362   AVTLGFLMNTKGLVELIVLNIGKDRKVLNDESFAIMVLMALVTTFITTPVVMAVYKPARP  421

Query  1398  LEPYKRRTIQNAKPGEELRILACIHGTNNLPAIISLLETSNSTVTSPITAFGVQLLELVG  1219
             + PYKRRT+ +     ELR+LAC H   N+P +++L+E+S  T    +  + + L+EL  
Sbjct  422   VVPYKRRTVDSRDADGELRVLACFHTNRNIPTLLNLVESSRGTGRGRLVMYAMHLVELSE  481

Query  1218  RAPAMMvvhssgsgrhvggsHEEVQTSQIISTFDNYELRSHGVTAQVLTARWSYDTMAED  1039
             R+ A+ +VH +        +  + QT Q++  F+ ++  S  V  + +TA         D
Sbjct  482   RSSAISLVHRARRNGMPFFNSGDKQTEQMVVVFEAFQQLSS-VRVRPMTAPPPPPPPPRD  540

Query  1038  ICKMAKEKRAAFLVLPFHKQQGTDGEMEDTNPAIQTVNEGVLLSAPCSVGILVER---GR  868
             +   A  KRAA +V+P+HK    DG  +    A   +N+ VL  APCSV +LV+R   G 
Sbjct  541   VVDSAVSKRAAIVVMPYHKVLQHDGAFQSLGSAYHAINKRVLREAPCSVAVLVDRGLGGH  600

Query  867   PNQYAKN----IAVLYLGGPDDREALTYARRMSGLPGVHLTVIRFVPAKDVSADGAVEDP  700
                 AKN    +A+L+ GGPDDREAL YA RM+  PGV +T+  F P++ V         
Sbjct  601   AQVSAKNVAFSVAMLFFGGPDDREALAYAARMAEHPGVAVTLSTFRPSRPV---------  651

Query  699   DLELELTRETSFVTVSIDPARDKEEDEELLNNFRTET--AEDDSKTFMELVLDDEEEFTK  526
                               P  D+  DE  +  F+++   A+D S  F E      EE  +
Sbjct  652   ------------------PGGDRATDEAAVAAFKSKVGMAKDGSVRFEEQEACTSEEVLE  693

Query  525   AVKSLDDRSFDLYVAGR  475
              + SL    F ++V GR
Sbjct  694   TINSLS--MFSVFVVGR  708



>ref|XP_002270854.1| PREDICTED: cation/H(+) antiporter 19 [Vitis vinifera]
Length=802

 Score =   402 bits (1033),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 274/803 (34%), Positives = 451/803 (56%), Gaps = 58/803 (7%)
 Frame = -3

Query  2667  GQVVMCFSQTIYRSNGVWEGPDPLAPMIPLFILQIMTAILSSRILNFVLKPFNQPPLVAE  2488
             G   +C +     SNG ++G +PL   +PL ILQI   ++ +R L  +LKP  QP ++AE
Sbjct  5     GTAKVCPAPMKATSNGSFQGDNPLDFALPLLILQICLVVVFTRTLALILKPLRQPRVIAE  64

Query  2487  ILSGIILGPSMLGNIEEFRKHNFPNHNFETIETMGHFALVLYAFLTGLQMDVKAIVHTGT  2308
             I+ GI+LGPS LG   +F    FP  +   ++T+ +  L+ + FL GL++D++AI  TG 
Sbjct  65    IIGGILLGPSALGRSTKFLHRVFPARSMTVLDTVANIGLLFFLFLVGLELDIRAIRRTGK  124

Query  2307  KSRIVAVSGSIFPFLIGAGFYFTLQTDTQSMIG----FIFCGSALTVTGFSTLAKILDSK  2140
             +S  +AV G  FPF++G G    L++     +      +F G +L++T F  LA+IL   
Sbjct  125   QSLGIAVVGITFPFVLGIGTSVVLRSTISKGVDHAPFLVFMGVSLSITAFPVLARILAEL  184

Query  2139  RLLNTEIGKIAASSALINVALSWVLLTIGLLFTGSLDNVQ-----WAvlctvgfvvvcvn  1975
             +LL T++G++A S+A +N   +W+LL + +  +G  DN       W +LC   FV   + 
Sbjct  185   KLLTTDVGRMAMSAAAVNDVAAWILLALAIALSG--DNTSPLVSVWVLLCGCAFVAAAIL  242

Query  1974  yVRPLLNWLISKTPEGQGFSEFYICSFIAVICAFGCFTDAMGSHPMIGAFIFGLIMPNNE  1795
             ++RP L ++  ++  G+  +E YIC  ++++ A G  TD +G H + GAF+ G+++P + 
Sbjct  243   FLRPALAFMARRSLGGEPVNELYICITLSLVLAAGFVTDTIGIHALFGAFVVGIVVPKDG  302

Query  1794  LLRTAILDRLEDFVMGILMPVFFLVCGLRTNIFTITDGDTSIFTALALILLACSAKIIAA  1615
                  +++++ED V G+ +P++F+  GL+TN+ TI+ G +     L +I  AC  KI+  
Sbjct  303   PFGEILIEKIEDLVSGLFLPLYFVSSGLKTNVATISGGQSWGLLVL-VIFNACFGKILGT  361

Query  1614  LVASCYTGMSTNEAIGLGVLTNTKSTMVMIILEVGqvqqvlsvqqysmmvVACLIMTIVA  1435
             +V S    +   EA+ LG L NTK  + +I+L +G+ ++VL+ Q ++++V+  L  T + 
Sbjct  362   VVVSRIFKVPMREAVVLGFLMNTKGLVELIVLNIGKDRKVLNDQTFAILVLMALFTTFIT  421

Query  1434  TPLA-ARYCPKQDLEPYKRRTIQNAKPGEELRILACIHGTNNLPAIISLLETSNSTVTSP  1258
             TP+  A Y P + +  Y  RT+Q   P  E RILAC H T N+P +I+L+E+S  T    
Sbjct  422   TPIVTALYKPARKIASYTHRTVQRRGPDSEFRILACFHSTRNIPTMINLIESSRGTRRGR  481

Query  1257  ITAFGVQLLELVGRAPAMMvvhssgsgrhvggsHEEVQTSQIISTFDNYELRSHGVTAQV  1078
             +  + + L+EL  R+ A+ +VH +        + +     Q++  F+ Y+  S  V+ + 
Sbjct  482   LCVYAMHLMELSERSSAISMVHKARRNGLPFWNKKRTHKDQMVIAFEAYQQLS-SVSVRP  540

Query  1077  LTARWSYDTMAEDICKMAKEKRAAFLVLPFHKQQGTDGEMEDTNPAIQTVNEGVLLSAPC  898
             +TA    +++ EDIC  A +K+ A ++LPFHK Q  DG ME    +   VN+ V+  APC
Sbjct  541   MTAISPLNSIHEDICTSAHQKQVAMILLPFHKYQRLDGVMESLGHSFHLVNQRVIRHAPC  600

Query  897   SVGILVERG-------RPNQYAKNIAVLYLGGPDDREALTYARRMSGLPGVHLTVIRFV-  742
             SVGILV+RG         +  + +IA+ + GG DDREAL Y  RM+  PG+ LTVI FV 
Sbjct  601   SVGILVDRGLGGTSQVSASHVSYSIAIPFFGGRDDREALAYGVRMAEHPGIKLTVINFVA  660

Query  741   -PAKDV----SADGAVEDPDLELELTRETSFVTVSIDPARD--KEEDEELLN--NFRTET  589
              P K +    S DGA                 TV I+      KE++++L +  NF    
Sbjct  661   PPGKSLLDWNSGDGA----------------ATVQINEITQDGKEDNDQLFSEPNF----  700

Query  588   AEDDSKTFMELVLDDEEEFTKAVKSLDDRSFDLYVAGRGRGVSSALTSGLADWCECPELG  409
              E++S ++ + V++++      + S+ +   +L++ GR   V     +GL +  +CPELG
Sbjct  701   TENESISYEKRVVEEKAGIVAKLTSMTNT--NLFLVGRMSAV-----AGLTERSDCPELG  753

Query  408   AVGDllvtsefessfsvlvVQQY  340
              VG  L +SEF ++ SVLV+QQY
Sbjct  754   PVGSFLASSEFSTTASVLVIQQY  776



>ref|XP_006841531.1| hypothetical protein AMTR_s00003p00155190 [Amborella trichopoda]
 gb|ERN03206.1| hypothetical protein AMTR_s00003p00155190 [Amborella trichopoda]
Length=797

 Score =   402 bits (1032),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 273/780 (35%), Positives = 435/780 (56%), Gaps = 44/780 (6%)
 Frame = -3

Query  2628  SNGVWEGPDPLAPMIPLFILQIMTAILSSRILNFVLKPFNQPPLVAEILSGIILGPSMLG  2449
             SNG ++  +PL   +PL ++QI   +  +R L F+LKP  QP ++AEI+ GI+LGPS +G
Sbjct  17    SNGAFQDENPLDYALPLAMVQICLVLTVTRSLAFLLKPLRQPRVIAEIIGGILLGPSAVG  76

Query  2448  NIEEFRKHNFPNHNFETIETMGHFALVLYAFLTGLQMDVKAIVHTGTKSRIVAVSGSIFP  2269
               + +    FP  +   ++T+ +  L+ + FL GL++D+K++  TG K+  +A++G   P
Sbjct  77    RNKAYLHRIFPPRSMTVLDTIANIGLLFFLFLVGLELDLKSVRRTGRKALGIALAGITLP  136

Query  2268  FLIGAGFYFTLQTDTQSMIG----FIFCGSALTVTGFSTLAKILDSKRLLNTEIGKIAAS  2101
             F++G G  F L++     +G     +F G AL++T F  LA+IL   +LL  ++G+IA S
Sbjct  137   FVLGVGTSFVLKSTIAKGVGTAPFLVFMGVALSITAFPVLARILAELKLLTKDVGRIAMS  196

Query  2100  SALINVALSWVLLTIGLLFTGSLDN---VQWAvlctvgfvvvcvnyVRPLLNWLISKTPE  1930
             +A +N  ++W+LL + +  +GS  +     W +L  + FV+  V  VRP L W+  +  +
Sbjct  197   AAAVNDVVAWILLALAVALSGSGGSPLVSLWVLLTGIAFVIFVVVAVRPGLAWMARQCDD  256

Query  1929  GQGFSEFYICSFIAVICAFGCFTDAMGSHPMIGAFIFGLIMPNNELLRTAILDRLEDFVM  1750
             G+  SE Y+C+ +AV+ A G  TD +G H + G F+ GL MP       A+++++ED V 
Sbjct  257   GEPVSEGYVCAALAVVLAGGFATDTIGIHALFGGFVVGLAMPKKGAFSGALIEKIEDLVS  316

Query  1749  GILMPVFFLVCGLRTNIFTITDGDTSIFTALALILLACSAKIIAALVASCYTGMSTNEAI  1570
             G+ +P++F+  GL+T++ TI  G  S    + +I+ AC  K++  +  S    +   EA+
Sbjct  317   GLFLPLYFVSSGLKTDVTTI-QGAQSWGLLVLVIVTACFGKVLGTVGVSLAFRVPFREAL  375

Query  1569  GLGVLTNTKSTMVMIILEVGqvqqvlsvqqysmmvVACLIMTIVATPLAAR-YCPKQDLE  1393
              LG L NTK  + +I+L +G+ ++VL+ Q +++MV+  L  T + TPL    Y P +   
Sbjct  376   ALGFLMNTKGLVELIVLNIGKDRKVLNDQTFAIMVLMALFTTFITTPLVMTIYKPARKSI  435

Query  1392  PYKRRTIQNAKPGEELRILACIHGTNNLPAIISLLETSNSTVTSPITAFGVQLLELVGRA  1213
             P K RTIQ      ELRILAC+H   ++PA+I L+E S      P+  + + L+EL  R 
Sbjct  436   PNKYRTIQRKNLDSELRILACLHNVKSVPALIHLIEASRGMRRRPLCVYAMHLMELSERP  495

Query  1212  PAMMvvhssgsgrhvggsHEEVQTSQIISTFDNYELRSHGVTAQVLTARWSYDTMAEDIC  1033
              A+++V+ +        +     +  I+  FD Y+  S  V+ + +TA  S  T+ EDIC
Sbjct  496   SAILMVNKARRNGLPFWNKSRPNSDHIVVAFDAYQCLS-SVSVRPMTAISSLTTIHEDIC  554

Query  1032  KMAKEKRAAFLVLPFHKQQGTDGEMEDTNPAIQTVNEGVLLSAPCSVGILVERG------  871
               A+EKRAA ++LPFHK    DG  E T+   + VNE VL  APCSVGIL++RG      
Sbjct  555   SSAEEKRAALIILPFHKHARIDGTFEPTHAGFRHVNEHVLDHAPCSVGILIDRGLGGAAR  614

Query  870   -RPNQYAKNIAVLYLGGPDDREALTYARRMSGLPGVHLTVIRFVPAKDVSADGAVEDPDL  694
                + ++ ++AVL+ GG DDREAL YA RM+  PGV LTV RF+P+ + +      + D+
Sbjct  615   IPASDFSSSVAVLFFGGRDDREALHYAARMAEHPGVTLTVFRFLPSGEPNRRNVKIEMDI  674

Query  693   ELELTRETSFVTVSIDPARDKEEDEELLNNFRTETAEDDSKTFMELVLDDEEEFTKAVKS  514
             E                  ++E D+    +F+T     +S  + E V   ++E   A+K+
Sbjct  675   E------------------EREADDAFFADFQTRAKTLESVKYEEKVAATKDETVAAIKT  716

Query  513   LDDRSFDLYVAGRGRGVSSALTSGLADWC--ECPELGAVGDllvtsefessfsvlvVQQY  340
             +     +L + GRG     A   G  +    +  ELG VG  L T EF +  SVLVVQQY
Sbjct  717   VA--RCNLVLVGRG-----AEAPGFDERVGSDSAELGPVGSYLATPEFSAGASVLVVQQY  769



>ref|XP_004500568.1| PREDICTED: cation/H(+) antiporter 15-like [Cicer arietinum]
Length=820

 Score =   402 bits (1034),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 256/789 (32%), Positives = 447/789 (57%), Gaps = 31/789 (4%)
 Frame = -3

Query  2652  CFSQTIYRSNGVWEGPDPLAPMIPLFILQIMTAILSSRILNFVLKPFNQPPLVAEILSGI  2473
             C+  T+   N +W+    L   +P F  Q+   +  +R L ++L+PFNQP  V EIL G+
Sbjct  8     CYETTVSNGNEIWQSESVLVFYLPNFAAQVAFTLFCNRGLYYLLRPFNQPRFVVEILVGL  67

Query  2472  ILGPSMLGNIEEFRKHNFPNHNFETIETMGHFALVLYAFLTGLQMDVKAIVHTGTKSRIV  2293
             ++ P +LG  + F  +  P  +  T ET+ +  LV Y FL GL M+++ I+    K+  +
Sbjct  68    MVSPEILGRYK-FFTNLIPLKSVITSETISYLGLVYYVFLAGLDMNLETIIKARKKATSI  126

Query  2292  AVSGSIFPFLIGAGFYFTLQT----------DTQSMIGFIFCGSALTVTGFSTLAKILDS  2143
             AV+G+I P +IG+  Y  LQ+             +   ++F     +VTGF T+ +I+  
Sbjct  127   AVAGTIIPMVIGSAVYTLLQSMYTGPPESLSHYNTRKAYMFWTLIYSVTGFPTVTQIVTD  186

Query  2142  KRLLNTEIGKIAASSALINVALSWVLLTIGLLFTGSLDNVQWAvlctvgfvvvcvnyVRP  1963
              +LL T +G++A ++A++    +WV+    + F  +     ++VL T+ FV+VC   +RP
Sbjct  187   LKLLYTGLGRVALTAAMMTGFFNWVMFAFLIPFALNEQVAIYSVLSTLLFVLVCFIVIRP  246

Query  1962  LLNWLISKTPEGQGFSEFYICSFIAVICAFGC--FTDAMGSHPMIGAFIFGLIMPNNELL  1789
              L  LI +      +  + +  F  V+ A+ C   TD +G+HP++GA ++G+++P+ +  
Sbjct  247   CLVQLIVRKTNQNEWDNYQL--FFVVMGAYICATVTDILGTHPVVGALVYGIMLPSGKF-  303

Query  1788  RTAILDRLEDFVMGILMPVFFLVCGLRTNIFTITDGDTSIFTALALILLACSAKIIAALV  1609
                ++D+ E F +  L P+FF  CG+R  I  +      +   + ++ L+C +KI++ ++
Sbjct  304   TDLLIDKTESFGVVYLAPLFFASCGVRLQIIDVIRSQ-GLVLVVLVVFLSCISKILSTVL  362

Query  1608  ASCYTGMSTNEAIGLGVLTNTKSTMVMIILEVGqvqqvlsvqqysmmvVACLIMTIVATP  1429
             A+ + GM   + + +G+L NTK  + +I+L +   +Q+LS + +S+ +V+ ++MT+V  P
Sbjct  363   ATQFFGMPALDGVAIGILMNTKGILPLIMLNIAWDKQILSEESFSITLVSVILMTVVV-P  421

Query  1428  LA--ARYCPKQDLEPYKRRTIQNAKPGEELRILACIHGTNNLPAIISLLETSNSTVTSPI  1255
             L   A Y P++  +  K RTIQN K   ELR+LAC+H   +   +I++LE SN+   SP+
Sbjct  422   LIINAIYKPRKLYKQNKLRTIQNLKVEAELRVLACVHNPCHATGMINILEASNAIKLSPL  481

Query  1254  TAFGVQLLELVGRAPAMMvvhssgsgrhvggsHEEVQTSQIIS-TFDNYELRSHGVTAQV  1078
               F +QL+E+     +++  H++            VQ  + I+  F +YE ++   + + 
Sbjct  482   RVFSLQLVEITETTTSLLAAHNNQQQSGSQAPSNSVQDLESITRIFKDYEEQNENASVET  541

Query  1077  LTARWSYDTMAEDICKMAKEKRAAFLVLPFHKQQGTDGEMEDTNPAIQTVNEGVLLSAPC  898
             L+A  +Y T+ +DI  +A+EK+   ++LPFHKQ    G +E TN A + +N+ V+  APC
Sbjct  542   LSAVSTYSTIHKDIHNVAQEKQTTLILLPFHKQSSIQGVLETTNEAFKDINQNVMRDAPC  601

Query  897   SVGILVERGRPNQYAKNIAVL--YLGGPDDREALTYARRMSGLPGVHLTVIRFVPAKDVS  724
             SVGI V+RG  + +  N+ +L  ++GGPDDREAL +A RMS   G+ LTV+RF     + 
Sbjct  602   SVGIFVDRGLGSLFKVNLRILMIFIGGPDDREALAFAWRMSKHRGIQLTVVRFY----LL  657

Query  723   ADGAVEDPDLELELTRETSFVTVSIDPARDKEEDEELLNNFRTETA-EDDSKTFMELVLD  547
              + A  DP   L+ +     ++  +D  + KE D+E +++FR +    +DS  + E  ++
Sbjct  658   GETAEVDP---LQQSESKGLLSTVLDWEKQKEFDDEYVSSFRLKAVNNEDSIHYSEKQVN  714

Query  546   DEEEFTKAVKSLDDRSFDLYVAGRGRGVSSALTSGLADWCECPELGAVGDllvtsefess  367
               E+  + +  LD   +DLY+ G+G G +S + S L  W +CPELG +GD++ ++ F S 
Sbjct  715   SWEDIPEVLNELDKSGYDLYILGQGTGRNSLVLSDLVKWTDCPELGLIGDMVASNSFGSC  774

Query  366   fsvlvVQQY  340
              S+LVVQQY
Sbjct  775   SSLLVVQQY  783



>ref|XP_008238996.1| PREDICTED: cation/H(+) antiporter 18-like [Prunus mume]
Length=800

 Score =   401 bits (1031),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 279/784 (36%), Positives = 437/784 (56%), Gaps = 43/784 (5%)
 Frame = -3

Query  2628  SNGVWEGPDPLAPMIPLFILQIMTAILSSRILNFVLKPFNQPPLVAEILSGIILGPSMLG  2449
             SNG+++G DPL   +PL ILQI   ++ +R L +VL+P  QP ++AEI+ GI+LGPS LG
Sbjct  19    SNGIFQGDDPLHFALPLAILQICIVVIVTRGLAYVLRPLRQPRVIAEIVGGILLGPSALG  78

Query  2448  NIEEFRKHNFPNHNFETIETMGHFALVLYAFLTGLQMDVKAIVHTGTKSRIVAVSGSIFP  2269
               + + +  FP  +   ++T+ +  L+ + FL GL++D K+I  TG K+  +A+ G   P
Sbjct  79    RNKSYLQAIFPPKSITVLDTLANLGLLFFLFLAGLEIDPKSIRQTGKKALAIAIVGISLP  138

Query  2268  FLIGAGFYFTLQTDTQSMIG----FIFCGSALTVTGFSTLAKILDSKRLLNTEIGKIAAS  2101
             F +G G  F L+      +      +F G AL++T F  LA+IL   +LL T+IG++A S
Sbjct  139   FALGIGSSFVLRETIAKGVDATAFLVFMGVALSITAFPVLARILAELKLLTTDIGRMAMS  198

Query  2100  SALINVALSWVLLTIGLLFTGSLDN---VQWAvlctvgfvvvcvnyVRPLLNWLISKTPE  1930
             +A +N   +W+LL + +  +GS  +     W  L    FV+  +  V P+  W+  +  E
Sbjct  199   AAAVNDVAAWILLALAVALSGSNQSPLVSLWVFLSGCVFVICAILIVPPVFKWMAQRCHE  258

Query  1929  GQGFSEFYICSFIAVICAFGCFTDAMGSHPMIGAFIFGLIMPNNELLRTAILDRLEDFVM  1750
             G+   E Y+C+ +  + A G  TD +G H M GAF+ G+++P       A+++++ED V 
Sbjct  259   GEPVDEIYVCATLTAVLAAGLITDTIGIHAMFGAFVVGVLVPKEGPFAGALVEKVEDLVS  318

Query  1749  GILMPVFFLVCGLRTNIFTITDGDTSIFTALALILLACSAKIIAALVASCYTGMSTNEAI  1570
             G+ +P++F+  GL+TN+ TI  G  S    + +I  AC  KI   ++ S +  +   EA+
Sbjct  319   GLFLPLYFVSSGLKTNVATI-QGLQSWGLLVLVIFTACFGKIFGTIMVSLFCKLPVREAL  377

Query  1569  GLGVLTNTKSTMVMIILEVGqvqqvlsvqqysmmvVACLIMTIVATPLA-ARYCP--KQD  1399
              LG L N+K  + +I+L +G+ ++VL+ Q +++MV+  L  T + TPL  A Y P  K  
Sbjct  378   ALGFLMNSKGLVELIVLNIGKDRKVLNDQTFAIMVLMALFTTFITTPLVIAVYKPAKKAG  437

Query  1398  LEPYKRRTIQNAKPGEELRILACIHGTNNLPAIISLLETSNSTVTSP-ITAFGVQLLELV  1222
             +  YK +TI+      +LRILAC H   N+P+II+LLE S  T     +  + + L EL 
Sbjct  438   MAVYKHKTIERKNMNTQLRILACFHSARNIPSIINLLEVSRGTKKREGLCVYAMHLKELS  497

Query  1221  GRAPA-MMvvhssgsgrhvggsHEEVQTSQIISTFDNYELRSHGVTAQVLTARWSYDTMA  1045
              R+ A +MV  +  +G       ++  +  ++  F+ Y+  S  V+ + +T   S   M 
Sbjct  498   ERSSAILMVHKARRNGLPFWNKSQQPNSDNVVVAFEAYQQLSR-VSIRPMTEISSISDMH  556

Query  1044  EDICKMAKEKRAAFLVLPFHKQQGTDGEMEDTNPAIQTVNEGVLLSAPCSVGILVERG--  871
             EDIC  A+ KRAA ++LPFHK Q  DG +E T    + VN+ VL  APCSVGILV+RG  
Sbjct  557   EDICATAESKRAAIVILPFHKHQRLDGTLETTRNDFRLVNQRVLQHAPCSVGILVDRGLG  616

Query  870   -----RPNQYAKNIAVLYLGGPDDREALTYARRMSGLPGVHLTVIRFVPAKDVSADGAVE  706
                    +  + NI VL+ GG DDREAL Y  RM+  PGV L VIRF+            
Sbjct  617   GATHVAASNVSYNITVLFFGGRDDREALAYGARMAEHPGVSLMVIRFL------------  664

Query  705   DPDLELELTRETSFVTVSIDPARDK--EEDEELLNNFRTETAEDDSKTFMELVLDDEEEF  532
                +E E+  E S + ++ D A  K    DEE+L  F+ + ++D+S  + E  + +  + 
Sbjct  665   ---VEPEVVGEISRININ-DNASTKVGSVDEEVLAEFKQKISKDNSIMYEEKAVRNNAQT  720

Query  531   TKAVKSLDDRSFDLYVAGRGRGVSSALTSGLADWCECPELGAVGDllvtsefessfsvlv  352
                ++ +     +L++ GR  G   AL   L    ECPELG +G LL++ +F +S SVLV
Sbjct  721   IAVIREVG--RCNLFLVGRTPGGEVAL--ALNRRSECPELGPLGSLLISPDFSTSASVLV  776

Query  351   VQQY  340
             VQQY
Sbjct  777   VQQY  780



>ref|NP_001030975.1| cation/H(+) antiporter 23 [Arabidopsis thaliana]
 gb|AEE27860.1| cation/H(+) antiporter 23 [Arabidopsis thaliana]
Length=756

 Score =   400 bits (1027),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 248/713 (35%), Positives = 398/713 (56%), Gaps = 44/713 (6%)
 Frame = -3

Query  2397  IETMGHFALVLYAFLTGLQMDVKAIVHTGTKSRIVAVSGSIFPFLIGAGFYFTLQTDTQS  2218
             +ET  + ALV   FL GL MD++ +  T  K  I+A +G +    +GA  Y+        
Sbjct  3     LETFANLALVYNIFLLGLGMDLRMVRITELKPVIIAFTGLLVALPVGAFLYYLPGNGHPD  62

Query  2217  MI--GFIFCGSALTVTGFSTLAKILDSKRLLNTEIGKIAASSALINVALSWVLLTIGLLF  2044
              I  G +F   AL  T F  LA+IL   +LL +++G+ A  +A++    +WVLL  G   
Sbjct  63    KIISGCVFWSVALACTNFPDLARILADLKLLRSDMGRTAMCAAIVTDLCTWVLLVFGFAS  122

Query  2043  ---TGSLDNVQ-WAvlctvgfvvvcvnyVRPLLNWLISKTPEGQGFSEFYICSFIAVICA  1876
                +G+ + +  + ++ T  FV++C+  +RP + W+ +KT +     + ++   +  +  
Sbjct  123   FSKSGTWNKMMPFVIITTAIFVLLCIFVIRPGIAWIFAKTVKAGHVGDTHVWFILGGVVL  182

Query  1875  FGCFTDAMGSHPMIGAFIFGLIMPNNELLRTAILDRLEDFVMGILMPVFFLVCGLRTNI-  1699
              G  TDA G H + GAF+FGL +P++ ++R  I ++L DF+ GILMP+F+++CGLR +I 
Sbjct  183   CGLITDACGVHSITGAFLFGLSIPHDHIIRNMIEEKLHDFLSGILMPLFYIICGLRADIG  242

Query  1698  FTITDGDTSIFTALALILLACSA---KIIAALVASCYTGMSTNEAIGLGVLTNTKSTMVM  1528
             F +   D        ++++ CS+   KI+  ++ S +  +   +A  +G L NTK T+ +
Sbjct  243   FMLQFTDK-----FMMVVVICSSFLVKIVTTVITSLFMHIPMRDAFAIGALMNTKGTLSL  297

Query  1527  IILEVGqvqqvlsvqqysmmvVACLIMTIVATPLAA-RYCPKQDLEPYKRRTIQNAKPGE  1351
             ++L  G+  + L    Y+ M +A L+M++V  PL A  Y PK+ L  YK RT+Q  K   
Sbjct  298   VVLNAGRDTKALDSPMYTHMTIALLVMSLVVEPLLAFAYKPKKKLAHYKHRTVQKIKGET  357

Query  1350  ELRILACIHGTNNLPAIISLLETSNSTVTSPITAFGVQLLELVGRAPA-MMvvhssgsgr  1174
             ELR+LAC+H   N+  I +LL+ SN+T  SP++ F + L+EL GR  A +++++     +
Sbjct  358   ELRVLACVHVLPNVSGITNLLQVSNATKQSPLSVFAIHLVELTGRTTASLLIMNDECKPK  417

Query  1173  hvggsHEEVQTSQIISTFDNYELRSHGVTAQVLTARWSYDTMAEDICKMAKEKRAAFLVL  994
                      ++ QI  TF+  E+ +  +T Q +TA   Y TM EDIC +A++KR  F++L
Sbjct  418   ANFSDRVRAESDQIAETFEAMEVNNDAMTVQTITAVSPYATMHEDICVLAEDKRVCFIIL  477

Query  993   PFHKQQGTDGEMEDTNPAIQTVNEGVLLSAPCSVGILVERG---------RPNQYAKNIA  841
             P+HK    DG M + N +   +N+ VL  APCSVGILV+RG         R     + +A
Sbjct  478   PYHKHLTPDGRMGEGNSSHAEINQNVLSHAPCSVGILVDRGMAMVRSESFRGESMKREVA  537

Query  840   VLYLGGPDDREALTYARRMSGLPGVHLTVIRFVPAKDVSADGAVEDPDLELELTRETSFV  661
             +L++GGPDDREAL+YA RM G   + LTV+RFVP ++                       
Sbjct  538   MLFVGGPDDREALSYAWRMVGQHVIKLTVVRFVPGREALISSG-----------------  580

Query  660   TVSIDPARDKEEDEELLNNFRTETAEDDSKTFMELVLDDEEEFTKAVKSL-DDRSFDLYV  484
              V+ +  R+K+ D+E +  F  +T  D S  ++E V++D ++    ++ + D+ S+DLYV
Sbjct  581   KVAAEYEREKQVDDECIYEFNFKTMNDSSVKYIEKVVNDGQDTIATIREMEDNNSYDLYV  640

Query  483   AGRGRGVSSALTSGLADWCECPELGAVGDllvtsefessfsvlvVQQYVRTNK  325
              GRG    S +T+GL DW   PELG +GD L +S F    SVLV+QQY  T +
Sbjct  641   VGRGYNSDSPVTAGLNDWSSSPELGTIGDTLASSNFTMHASVLVIQQYSATKR  693



>ref|XP_006646431.1| PREDICTED: cation/H(+) antiporter 15-like [Oryza brachyantha]
Length=1365

 Score =   414 bits (1063),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 247/630 (39%), Positives = 383/630 (61%), Gaps = 18/630 (3%)
 Frame = -3

Query  2658  VMCFSQTIYRSNGVWEGPDPLAPMIPLFILQIMTAILSSRILNFVLKPFNQPPLVAEILS  2479
             V+C+S  +  +NG+W+G +PL   +PLFILQ++  ++++R+L  +LKPF QP ++AEIL+
Sbjct  33    VVCYSPMMITTNGIWQGVNPLEFSLPLFILQVVVIVVTTRVLVLLLKPFRQPRVIAEILA  92

Query  2478  GIILGPSMLGNIEEFRKHNFPNHNFETIETMGHFALVLYAFLTGLQMDVKAIVHTGTKSR  2299
             G++LGPS++G +  +    FP  +  T+ET+ H  L+ + FL GL+MDV  I  +G K+ 
Sbjct  93    GVVLGPSVMGQVPVWATMVFPQRSLLTLETVAHLGLLYFLFLVGLEMDVNVIRRSGKKAL  152

Query  2298  IVAVSGSIFPFLIGAGFYFTLQTDTQSMIG----FIFCGSALTVTGFSTLAKILDSKRLL  2131
             I+AV+G   PF IG    F  +      +      +F G AL+VT F  LA+IL   +LL
Sbjct  153   IIAVAGMALPFCIGTATSFIFRHQVSKNVHQASFLLFLGVALSVTAFPVLARILAEIKLL  212

Query  2130  NTEIGKIAASSALINVALSWVLLTIGLLFT---GSLDNVQWAvlctvgfvvvcvnyVRPL  1960
             N+++G+IA S+A++N   +W+LL + +  +    S  +  W +L  V FV+ C   VRPL
Sbjct  213   NSDLGRIAMSAAIVNDMCAWILLALAIAISEVNSSAFSSLWVLLAGVAFVLACFYVVRPL  272

Query  1959  LNWLISKTPEGQGFSEFYICSFIAVICAFGCFTDAMGSHPMIGAFIFGLIMPNNELLRTA  1780
             + W+I + PEG+   + ++   +  +   G  TDA+G H + GAF++GL++P+   L   
Sbjct  273   MWWIIRRFPEGETIGDVHVTLILTGVMIAGVCTDAIGIHSVFGAFVYGLVIPSGP-LGVV  331

Query  1779  ILDRLEDFVMGILMPVFFLVCGLRTNIFTITDGDTSIFTALALILLACSAKIIAA-LVAS  1603
             ++++LEDFV G+L+P+FF + GLRTN+  + D  T     L  I +A  AKI+   L+A 
Sbjct  332   LIEKLEDFVTGLLLPLFFAISGLRTNMTKVRDPITVGLLVLVFI-MASFAKIMGTILIAV  390

Query  1602  CYTGMSTNEAIGLGVLTNTKSTMVMIILEVGq-vqqvlsvqqysmmvVACLIMTIVATPL  1426
              YT M+  + + LG L NT+  + MI+L +G+  + +       M++V+ ++ T+V   +
Sbjct  391   SYT-MTFRDGVALGFLMNTRGLVEMIVLNIGRDKEVLDDESFAVMVLVSVVMTTLVTPVV  449

Query  1425  AARYCPKQDLEPYKRRTIQNAKPGEELRILACIHGTNNLPAIISLLETSNSTVTSPITAF  1246
                Y P + L  YKRR +Q +K   ELR+LAC+H T N+P+IISLLE SN T  SPI  +
Sbjct  450   TTVYRPARRLIGYKRRNLQRSKHDAELRMLACVHTTRNVPSIISLLELSNPTKRSPIFIY  509

Query  1245  GVQLLELVGRAPAMMvvhssgsgrhvggsHEEVQTS-QIISTFDNYELRSHGVTAQVLTA  1069
              + L+EL GRA  M+  H + S +    +      S  I + F+NYE  + GV+ Q LTA
Sbjct  510   ALHLVELTGRASNMLAAHHTASNQSRSAAGSLPGASDHIFNAFENYEASAGGVSVQALTA  569

Query  1068  RWSYDTMAEDICKMAKEKRAAFLVLPFHKQQGTDGEMEDTNPAIQTVNEGVLLSAPCSVG  889
                Y TM ED+C +A++K  + +VLPFHKQQ  DG ME  N +++  NE +L S PCSVG
Sbjct  570   VSPYQTMHEDVCILAEDKHVSLIVLPFHKQQTVDGGMEPINASLRGFNESILASTPCSVG  629

Query  888   ILVERGRPNQYAK-----NIAVLYLGGPDD  814
             ILV+RG     A+     ++A+L+ GGPDD
Sbjct  630   ILVDRGLSAATARMATVHHVALLFFGGPDD  659


 Score =   390 bits (1001),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 246/643 (38%), Positives = 378/643 (59%), Gaps = 30/643 (5%)
 Frame = -3

Query  2208  FIFCGSALTVTGFSTLAKILDSKRLLNTEIGKIAASSALINVALSWVLLTIGLLFT---G  2038
              +F G AL+VT F  LA+IL   +LLNTE+G+IA S+A++N   +W+LL + +  T    
Sbjct  678   LLFLGVALSVTAFPVLARILAEIKLLNTELGRIAMSAAIVNDMCAWILLALAIAITEVNS  737

Query  2037  SLDNVQWAvlctvgfvvvcvnyVRPLLNWLISKTPEGQGFSEFYICSFIAVICAFGCFTD  1858
             +  +  W ++  V FV+ C   VRP + WLI + PEG+G S+  +   +  +   G  TD
Sbjct  738   TALSSLWVLISGVLFVLFCFYVVRPGMWWLIRRIPEGEGVSDMQVSLILTGVMLAGVCTD  797

Query  1857  AMGSHPMIGAFIFGLIMPNNELLRTAILDRLEDFVMGILMPVFFLVCGLRTNIFTITDGD  1678
             A+G H + GAF++GL++P   L   A++++LEDFV G+L+P+FF + GLRTNI  I D  
Sbjct  798   AIGIHSVFGAFVYGLVIPGGPL-GVALIEKLEDFVTGLLLPLFFAISGLRTNISRIRDPI  856

Query  1677  TSIFTALALILLACSAKIIAALVASCYTGMSTNEAIGLGVLTNTKSTMVMIILEVGqvqq  1498
             T     L  ++ A  AKI+  ++ +    M   E I LG L NT+  + MI+L +G+ ++
Sbjct  857   TVGLLILVFVM-ASFAKIMGTIIIAALYTMPFREGIALGFLMNTRGLVEMIVLNIGRDKE  915

Query  1497  vlsvqqysmmvVACLIMTIVATPLA-ARYCPKQDLEPYKRRTIQNAKPGEELRILACIHG  1321
             VL  + +++MV+  + MT + TP+    + P + L  YKRR +Q  +   ELR+L C+H 
Sbjct  916   VLDDESFAVMVLVSVAMTTLVTPVVTGVHRPSRRLVGYKRRNLQRIRHDSELRMLICVHT  975

Query  1320  TNNLPAIISLLETSNSTVTSPITAFGVQLLELVGRAPAMMvvhssgsgrhvggsHEEV--  1147
             T N+P+++SLLE SN T  SPI  + + L+EL GRA  M+   ++ + +    S      
Sbjct  976   TRNVPSVLSLLELSNPTKRSPIFIYALHLVELTGRASNMLAAAAASASKQSRSSSSSTLP  1035

Query  1146  -QTSQIISTFDNYELRSHGVTAQVLTARWSYDTMAEDICKMAKEKRAAFLVLPFHKQQGT  970
               T  I + F+NYE  + GV+ Q L A   Y +M +D+  +A++K  + +V+PFHKQQ  
Sbjct  1036  PVTEHIFNAFENYERHTGGVSIQTLAAVSPYQSMHDDVSVLAEDKHVSLIVVPFHKQQTV  1095

Query  969   DGEMEDTNPAIQTVNEGVLLSAPCSVGILVERGRPNQYAK-----NIAVLYLGGPDDREA  805
             DG ME  NP+I+  NE +L ++PCSV ILV+RG     A+     ++A+ + GGPDDREA
Sbjct  1096  DGGMEPINPSIRGFNESLLSTSPCSVSILVDRGLSAATARMAAEHHVALFFFGGPDDREA  1155

Query  804   LTYARRMSGLPGVHLTVIRFVPAK-------DVSADGAVEDPDLELELTRETSFVTVSID  646
             L YA RM   PGV LTV+RFVP +         S      D D     +R T      ++
Sbjct  1156  LAYAWRMVEHPGVTLTVVRFVPPEYRVRSFSHSSYRSTASDAD-----SRSTG---TYME  1207

Query  645   PARDKEEDEELLNNFRTETAEDDSKTFMELVLDDEEEFTKAVKSLDDRSFDLYVAGRGRG  466
                + + DE+ L  FR+    +++ T+ + V+ + EE    ++S+D+   +LY+ GR  G
Sbjct  1208  GKTELQMDEDYLGEFRSRNLGNEAITYSDQVVANSEETVATIRSMDNSLHELYIVGRRPG  1267

Query  465   -VSSALTSGLADWCECPELGAVGDllvtsefessfsvlvVQQY  340
                S +T+ L DW ECPELG +GD+LV+S+F  + SVLV+QQY
Sbjct  1268  EAGSPMTAALEDWMECPELGPIGDMLVSSDFSMAVSVLVIQQY  1310



>gb|KDP25352.1| hypothetical protein JCGZ_20508 [Jatropha curcas]
Length=802

 Score =   401 bits (1030),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 281/783 (36%), Positives = 427/783 (55%), Gaps = 40/783 (5%)
 Frame = -3

Query  2628  SNGVWEGPDPLAPMIPLFILQIMTAILSSRILNFVLKPFNQPPLVAEILSGIILGPSMLG  2449
             SNGV++G  PL   +PL ILQI   I+ +R L F+L+P  QP ++AEI++GI+LGPS LG
Sbjct  19    SNGVFQGDSPLNYSLPLAILQICMVIVLTRGLAFLLRPLRQPRVIAEIIAGILLGPSALG  78

Query  2448  NIEEFRKHNFPNHNFETIETMGHFALVLYAFLTGLQMDVKAIVHTGTKSRIVAVSGSIFP  2269
               E F    FP  +   ++T+ +  L+ + FL GL++D K++  TG KS  +A++G   P
Sbjct  79    RSERFLHAVFPTKSLTVLDTLANIGLIYFMFLVGLELDPKSLRQTGKKSLAIAIAGITLP  138

Query  2268  FLIGAGFYFTLQTDTQSMIG----FIFCGSALTVTGFSTLAKILDSKRLLNTEIGKIAAS  2101
             F +G G  F L+      +      +F G AL++T F  LA+IL   +LL T++G+IA S
Sbjct  139   FAMGIGSSFILRATIAKGVNGSSFLLFMGVALSITAFPVLARILAELKLLTTDLGRIAMS  198

Query  2100  SALINVALSWVLLTIGLLFTGSLDNVQ---WAvlctvgfvvvcvnyVRPLLNWLISKTPE  1930
             +A +N   +WVLL + +  +GS ++     W +L    FVV  V  VRP+   +  +  E
Sbjct  199   AAAVNDVAAWVLLALAIALSGSNNSPLVSFWVLLSGCVFVVCSVVIVRPIFKLMSQRCHE  258

Query  1929  GQGFSEFYICSFIAVICAFGCFTDAMGSHPMIGAFIFGLIMPNNELLRTAILDRLEDFVM  1750
             G+   E  +C+ +  + A G  TDA+G H M G F+ G+++P       A+++++ED V 
Sbjct  259   GEPIEEQIVCATLVTVLAAGFVTDAIGIHAMFGGFVIGVLVPKEGPFAHALVEKVEDLVS  318

Query  1749  GILMPVFFLVCGLRTNIFTITDGDTSIFTALALILLACSAKIIAALVASCYTGMSTNEAI  1570
             G+ +P++F+  GL+TN+ TI    +    AL +I  AC  KI+   + S    +   EA+
Sbjct  319   GLFLPLYFVSSGLKTNVATIHGLQSWGLLAL-VIFTACFGKIVGTFLVSLSCKVPFREAL  377

Query  1569  GLGVLTNTKSTMVMIILEVGqvqqvlsvqqysmmvVACLIMTIVATPLA-ARYCP--KQD  1399
              LG+L NTK  + +I+L +G+ ++VL+ Q +++MV+  L  T + TPL  A Y P  K  
Sbjct  378   ALGLLMNTKGLVELIVLNIGKDRKVLNDQTFAIMVLMALFTTFITTPLVMAVYKPARKVR  437

Query  1398  LEPYKRRTIQNAKPGEELRILACIHGTNNLPAIISLLETSN--STVTSPITAFGVQLLEL  1225
             +  YK RTI       +LRILAC H   N+P+II+LLE S         +  + + L+EL
Sbjct  438   MADYKYRTIDRKNSNTQLRILACFHSARNVPSIINLLEASRGIQKKAEALCVYALHLMEL  497

Query  1224  VGRAPA-MMvvhssgsgrhvggsHEEVQTSQIISTFDNYELRSHGVTAQVLTARWSYDTM  1048
               R  A +MV  +  +G            + +I  F+  E  S  V+ + +TA  S   +
Sbjct  498   SERPSAILMVHKARKNGLPTWNKDHRSNANHVIVAFEALEQLSQ-VSVRPMTAISSMSDL  556

Query  1047  AEDICKMAKEKRAAFLVLPFHKQQGTDGEMEDTNPAIQTVNEGVLLSAPCSVGILVERGR  868
              EDIC  A+ KRAA ++LPFHK Q  DG +E T    + VN  VL +APCSVGILV+RG 
Sbjct  557   HEDICATAERKRAAIIILPFHKHQRLDGSLETTRTDYRWVNRRVLENAPCSVGILVDRGL  616

Query  867   -------PNQYAKNIAVLYLGGPDDREALTYARRMSGLPGVHLTVIRFVPAKDVSADGAV  709
                     ++ +  I VL+ GG DDREAL Y  RM+  PG++L VIRF+ A + S D   
Sbjct  617   GGTTHIPASKVSCLIVVLFFGGHDDREALAYGARMAEHPGINLMVIRFLVAPE-SQD---  672

Query  708   EDPDLELELTRETSFVTVSIDPARDKEEDEELLNNFRTETAEDDSKTFMELVLDDEEEFT  529
             E   ++LE    T+              DE  L  F+ +   DDS  ++E ++ +     
Sbjct  673   EIIPVDLEGNSNTT----------PGSWDEVFLLEFKKKIVWDDSVNYIEKLVTNAAGII  722

Query  528   KAVKSLDDRSFDLYVAGRGRGVSSALTSGLADWCECPELGAVGDllvtsefessfsvlvV  349
               ++  +    +L++ GR R     L + L    EC ELG VG  L +S+  +  SVLVV
Sbjct  723   DVIR--ESSHCNLFLVGR-RPEGEILVA-LNRRNECSELGTVGSFLASSDSPTKASVLVV  778

Query  348   QQY  340
             QQY
Sbjct  779   QQY  781



>ref|XP_008390248.1| PREDICTED: cation/H(+) antiporter 19 [Malus domestica]
Length=817

 Score =   401 bits (1031),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 281/825 (34%), Positives = 444/825 (54%), Gaps = 65/825 (8%)
 Frame = -3

Query  2715  APPPPSTGPEVDLDRLGQVVMCFSQTIYRSNGVWEGPDPLAPMIPLFILQIMTAILSSRI  2536
             APPPP   P                    SNG ++G +PL   +PL ILQI+  ++ +R 
Sbjct  2     APPPPLVAP----------------MKATSNGSFQGENPLDFALPLLILQIVLVVVFTRT  45

Query  2535  LNFVLKPFNQPPLVAEILSGIILGPSMLGNIEEFRKHNFPNHNFETIETMGHFALVLYAF  2356
             L F+L+P  QP ++AE++ GI+LGPS LG  ++F    FP      ++T+ +  L+ + F
Sbjct  46    LAFLLRPLRQPRVIAEVIGGILLGPSALGRSQKFLHTVFPAKAMTVLDTVANIGLLFFLF  105

Query  2355  LTGLQMDVKAIVHTGTKSRIVAVSGSIFPFLIGAGFYFTLQTDTQSMIG----FIFCGSA  2188
             L GL++D++AI  TG KS  +AV+G   PF++G    F L+      +      +F G A
Sbjct  106   LVGLELDIRAIRRTGKKSLGIAVAGITLPFVLGVFTSFALRATVSKGVSQGPFLVFIGVA  165

Query  2187  LTVTGFSTLAKILDSKRLLNTEIGKIAASSALINVALSWVLLTIGLLFTGS----LDNVQ  2020
             L++T F  LA+IL   +LL T++G+IA S+A +N   +W+LL + +  TG+    L +V 
Sbjct  166   LSITAFPVLARILAELKLLTTDVGRIAMSAAAVNDVAAWILLALAIALTGTNTSPLVSV-  224

Query  2019  WAvlctvgfvvvcvnyVRPLLNWLISKTPEGQGFSEFYICSFIAVICAFGCFTDAMGSHP  1840
             W +L    FV  C+  +RPLL  +  ++P+G+   E YIC  ++++ A    TD +G H 
Sbjct  225   WVLLSGACFVGFCIFALRPLLVMMARRSPDGEPVKELYICITLSLVLAASFVTDVIGIHA  284

Query  1839  MIGAFIFGLIMPNNELLRTAILDRLEDFVMGILMPVFFLVCGLRTNIFTITDGDTSIFTA  1660
             + GAF+ G+I+P +      +++++ED V G+ +P++F+  GL+TN+ TI+ G +     
Sbjct  285   LFGAFVVGIIVPKDGPFAGVLIEKIEDLVSGLFLPLYFVSSGLKTNVATISGGQSWALL-  343

Query  1659  LALILLACSAKIIAALVASCYTGMSTNEAIGLGVLTNTKSTMVMIILEVGqvqqvlsvqq  1480
             L +I  A   KI+  +  S    +   EA+ LG L NTK  + +I+L +G+ ++VL+ Q 
Sbjct  344   LLVIFTASFGKIVGTVSLSMACKVPFREALALGFLMNTKGLVELIVLNIGKDRKVLNDQT  403

Query  1479  ysmmvVACLIMTIVATPL-AARYCPKQDLEPYKRRTIQNAKPGEELRILACIHGTNNLPA  1303
             +++ V+  L  T + TPL  A Y P +   PYK R++    P  ELR+LAC H T N+P 
Sbjct  404   FAIFVLMALFTTFITTPLVVAIYKPARRGAPYKHRSVFXKNPDTELRMLACFHSTRNIPT  463

Query  1302  IISLLETSNSTVT-SPITAFGVQLLELVGRAPA--MMvvhssgsgrhvggsHEEVQTSQI  1132
             +I+L+E+S  T     +T + + L+EL  R+ A  M+               +E    Q+
Sbjct  464   MINLIESSRGTRKRGRLTVYAMHLMELSERSSAISMVHKARHNGLPFWNKKTDENNKDQM  523

Query  1131  ISTFDNYELRSHGVTAQVLTARWSYDTMAEDICKMAKEKRAAFLVLPFHKQQGTDGEMED  952
             +  F+ YE  S  V  + +TA  S   + EDIC  A +K  A ++LPFHK Q  DG ME 
Sbjct  524   VIAFEAYEQLS-SVKVRPMTAISSLXDIHEDICASAHQKNTAVILLPFHKHQRLDGTMES  582

Query  951   TNPAIQTVNEGVLLSAPCSVGILVERG-------RPNQYAKNIAVLYLGGPDDREALTYA  793
                A+++VNE VL  APCSVGILV+RG         +  + NI V + GG DDREAL Y 
Sbjct  583   LGNALRSVNERVLKHAPCSVGILVDRGLGGTAQVSASDVSYNIVVAFFGGRDDREALAYG  642

Query  792   RRMSGLPGVHLTVIRFVPAKDVSAD------GAVEDPDLELELTRETSFVTVSIDPARDK  631
              R++  PG+ +T+IRFV  +  +        G   D ++++    +            +K
Sbjct  643   MRLAEHPGIVMTLIRFVAPEGKTLRFGAKLVGITSDKNMKILEEEDCG--------GDEK  694

Query  630   EEDEELLNNF--------RTETAEDDSKTFMELVLDDEEEFTKAVKSLDDRSFDLYVAGR  475
             E DE LL  F          E   + S  + E V+D + E    +KS+  ++ +L++ GR
Sbjct  695   ENDESLLAEFMNVRKNSGNKEGGGEPSMLYEEKVVDSKAEICVVLKSM-AKNVNLFIVGR  753

Query  474   GRGVSSALTSGLADWCECPELGAVGDllvtsefessfsvlvVQQY  340
                 +  + S      +C ELG VG  L +S+F S+ SV+V+QQY
Sbjct  754   MPPTAPLVNSS----SDCAELGPVGSFLASSDFSSTASVMVLQQY  794



>ref|XP_002868583.1| ATCHX18 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH44842.1| ATCHX18 [Arabidopsis lyrata subsp. lyrata]
Length=810

 Score =   401 bits (1030),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 276/785 (35%), Positives = 437/785 (56%), Gaps = 38/785 (5%)
 Frame = -3

Query  2628  SNGVWEGPDPLAPMIPLFILQIMTAILSSRILNFVLKPFNQPPLVAEILSGIILGPSMLG  2449
             SNGV++G +P+   +PL ILQI+  I+ +R+L ++L+P  QP ++AE++ GI+LGPS+LG
Sbjct  17    SNGVFQGDNPIDFALPLAILQIVIVIVLTRVLAYILRPLRQPRVIAEVIGGIMLGPSLLG  76

Query  2448  NIEEFRKHNFPNHNFETIETMGHFALVLYAFLTGLQMDVKAIVHTGTKSRIVAVSGSIFP  2269
               + F    FP  +   +ET+ +  L+ + FL GL++D KA+ HTG K+  +A++G   P
Sbjct  77    RSKVFLDAVFPKKSLTVLETLANLGLLFFLFLAGLEIDTKALRHTGKKALGIALAGITLP  136

Query  2268  FLIGAGFYF----TLQTDTQSMIGFIFCGSALTVTGFSTLAKILDSKRLLNTEIGKIAAS  2101
             F +G G  F    T+     S    +F G AL++T F  LA+IL   +LL TEIG++A S
Sbjct  137   FALGIGTSFVLKATISKGVDSTAFLVFMGVALSITAFPVLARILAELKLLTTEIGRLAMS  196

Query  2100  SALINVALSWVLLTIGLLFTGSLDN---VQWAvlctvgfvvvcvnyVRPLLNWLISKTPE  1930
             +A +N   +W+LL + +  +GS  +     W  L    FV+     + P+  W+  +  E
Sbjct  197   AAAVNDVAAWILLALAIALSGSNTSPLVSLWVFLSGCAFVIGAAFIIPPIFRWIARRCHE  256

Query  1929  GQGFSEFYICSFIAVICAFGCFTDAMGSHPMIGAFIFGLIMPNNELLRTAILDRLEDFVM  1750
             G+   E YIC+ +AV+   G  TDA+G H M GAF+ G+++P       A+++++ED V 
Sbjct  257   GEPIEETYICATLAVVLVCGFITDAIGIHSMFGAFVVGVLIPKEGPFAGALVEKVEDLVS  316

Query  1749  GILMPVFFLVCGLRTNIFTITDGDTSIFTALALILLACSAKIIAALVASCYTGMSTNEAI  1570
             G+ +P++F+  GL+TN+ TI  G  S    + +   AC  KI+  L  S    +   EAI
Sbjct  317   GLFLPLYFVASGLKTNVATI-QGAQSWGLLVLVTATACFGKILGTLGVSLAFKIPMREAI  375

Query  1569  GLGVLTNTKSTMVMIILEVGqvqqvlsvqqysmmvVACLIMTIVATPLA-ARYCPKQDLE  1393
              LG L NTK  + +I+L +G+ ++VL+ Q +++MV+  L  T + TP+  A Y P +  +
Sbjct  376   TLGFLMNTKGLVELIVLNIGKDRKVLNDQTFAIMVLMALFTTFITTPVVMAVYKPARRAK  435

Query  1392  P---YKRRTIQNAKPGEELRILACIHGTNNLPAIISLLETSNSTVTSP-ITAFGVQLLEL  1225
                 YK RT++      +LRIL C HG  ++P++I+LLE S        +  + + L EL
Sbjct  436   KEGEYKHRTVERENTNTQLRILTCFHGAGSIPSMINLLEASRGIEKGEGLCVYALHLREL  495

Query  1224  VGRAPAMMvvhssgsgrhvggsHEEV--QTSQIISTFDNYELRSHGVTAQVLTARWSYDT  1051
               R+ A+++VH          +   V     Q++  F  ++  S  V  + +TA  S   
Sbjct  496   SERSSAILMVHKVRKNGMPFWNRRGVNAHADQVVVAFQAFQQLSR-VNVRPMTAISSMSD  554

Query  1050  MAEDICKMAKEKRAAFLVLPFHKQQGTDGEMEDTNPAIQTVNEGVLLSAPCSVGILVERG  871
             + EDIC  A  K+AA ++LPFHK Q  DG +E T    + VN  VLL APCSVGI V+RG
Sbjct  555   IHEDICTTAARKKAAIVILPFHKHQQLDGSLETTRGDYRWVNRRVLLEAPCSVGIFVDRG  614

Query  870   -------RPNQYAKNIAVLYLGGPDDREALTYARRMSGLPGVHLTVIRFVPAKDVSADGA  712
                         + ++ VL+ GG DDREAL Y  RM+  PG+ LTV RFV    VS +  
Sbjct  615   LGGSSQVSAQDVSYSVVVLFFGGRDDREALAYGLRMAEHPGIALTVFRFV----VSPERV  670

Query  711   VEDPDLELELTRETSFVTVSIDPARDKEEDEELLNNFRTETAEDDSKTFMELVLDDEE-E  535
              E  ++E+  T   S         ++ + DEE+++  R  ++ ++S  F+E  +++   +
Sbjct  671   GEIVNVEVSNTNNES------QSVKNLKSDEEIISEIRKISSVEESVKFVEKRIENAAVD  724

Query  534   FTKAVKSLDDRSFDLYVAGRGRGVSSALTSGLADWCECPELGAVGDllvtsefessfsvl  355
                A++ +  R  +L++ GR  G   AL   + +  ECPELG VG LL++ E  +  SVL
Sbjct  725   VRSAIEEV--RRSNLFLVGRMPGGEIAL--AIRENSECPELGPVGSLLISPESSTKASVL  780

Query  354   vVQQY  340
             V+QQY
Sbjct  781   VIQQY  785



>ref|XP_004164366.1| PREDICTED: cation/H(+) antiporter 18-like [Cucumis sativus]
Length=799

 Score =   400 bits (1029),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 278/794 (35%), Positives = 443/794 (56%), Gaps = 42/794 (5%)
 Frame = -3

Query  2661  VVMCFSQTIYRSNGVWEGPDPLAPMIPLFILQIMTAILSSRILNFVLKPFNQPPLVAEIL  2482
             V +C +     SNG+++G +PL   +PL ILQI   +  +R L F+L+P  QP ++ EI+
Sbjct  8     VTLCPTPMKATSNGIFQGDNPLDFALPLIILQICLVVALTRGLAFLLRPLKQPRVIGEII  67

Query  2481  SGIILGPSMLGNIEEFRKHNFPNHNFETIETMGHFALVLYAFLTGLQMDVKAIVHTGTKS  2302
              GI+LGPS LG  + F    FP+++   ++T+ +  L+ + FL GL++D+K+I  TG K+
Sbjct  68    GGILLGPSALGRNKNFLHTIFPSNSITLLDTVANIGLLFFLFLVGLELDLKSIRRTGKKA  127

Query  2301  RIVAVSGSIFPFLIGAGFYFTLQTDTQSMIG----FIFCGSALTVTGFSTLAKILDSKRL  2134
               +A++G   PF +G G  F L+      +      IF G AL++T F  LA+IL   +L
Sbjct  128   LGIAITGICVPFALGIGSSFVLRETISKGVNASAFLIFMGVALSITAFPVLARILAELKL  187

Query  2133  LNTEIGKIAASSALINVALSWVLLTIGLLFTGSLDN---VQWAvlctvgfvvvcvnyVRP  1963
             L T++G++A S+A +N   +W+LL + +  +GS  +     W  L   GFVV  +  + P
Sbjct  188   LTTDVGRMAMSAAAVNDVAAWILLALAIALSGSDKSPLTAVWVFLSGCGFVVAAIVILSP  247

Query  1962  LLNWLISKTPEGQGFSEFYICSFIAVICAFGCFTDAMGSHPMIGAFIFGLIMPNNELLRT  1783
             +  W+  +  +G+   E YIC+ +A++ A G  TD +G H M GAF+ G+++P +  L  
Sbjct  248   VFKWMTKQCFQGEPVREIYICATLAIVLAAGFATDFIGIHAMFGAFVVGVLVPKDGPLVG  307

Query  1782  AILDRLEDFVMGILMPVFFLVCGLRTNIFTITDGDTSIFTALALILLACSAKIIAALVAS  1603
             A+++++ED V  + +P++F+  GL+TN+ TI  G  S    + +I+ ACS KI+   + S
Sbjct  308   ALVEKIEDLVSSLFLPLYFVSSGLKTNVATI-QGAQSWGLLVLVIVTACSGKILGTFLVS  366

Query  1602  CYTGMSTNEAIGLGVLTNTKSTMVMIILEVGqvqqvlsvqqysmmvVACLIMTIVATPLA  1423
                 +   EA+ LG L NTK  + +I+L +G+ ++VL+ Q +++M++  L  T + TPL 
Sbjct  367   LLCKVPVREALALGFLMNTKGLVELIVLNIGKDRKVLNDQTFAIMILMALFTTFITTPLV  426

Query  1422  -ARYCPKQD--LEPYKRRTIQNAKPGEELRILACIHGTNNLPAIISLLETSNSTVTS-PI  1255
              A Y P +   +  YK R I+      +LR+L C H   N+P+II+LLE S  T     +
Sbjct  427   IAVYKPARSAKIADYKHRKIERKNKNTQLRMLTCFHSAGNVPSIINLLEASRGTEKGEEL  486

Query  1254  TAFGVQLLELVGRAPA-MMvvhssgsgrhvggsHEEVQTSQIISTFDNYELRSHGVTAQV  1078
               + + L+EL  R+ A +MV  +  +G       +   ++ +I  F+ Y+  S  V  + 
Sbjct  487   CVYAMHLMELSERSSAILMVHKARKNGLPFWNKGQRSDSNHVIVAFEAYQQLSR-VFIRP  545

Query  1077  LTARWSYDTMAEDICKMAKEKRAAFLVLPFHKQQGTDGEMEDTNPAIQTVNEGVLLSAPC  898
             +TA  S   + EDIC  A+ KR A ++LPFHK Q  DG +E T  +I+ VN+ VL  A C
Sbjct  546   MTAISSMSDIHEDICATAERKRTAIIILPFHKHQRVDGSLETTRSSIRVVNQNVLEHARC  605

Query  897   SVGILVERG-------RPNQYAKNIAVLYLGGPDDREALTYARRMSGLPGVHLTVIRFVP  739
             SVGI V+RG         +  +  I VL+ GG DDREAL++  RM+  PG+ L VI F  
Sbjct  606   SVGIFVDRGLGGTTHVSSSNVSLFITVLFFGGGDDREALSFGVRMAEHPGIRLMVIHFF-  664

Query  738   AKDVSADGAVE-DPDLELELTRETSFVTVSIDPARDKEEDEELLNNFRTETAEDDSKTFM  562
                      VE +P  E+     TS  TV    A+   +D+E L+ FR   +++DS T++
Sbjct  665   ---------VEPEPIGEI-----TSADTVGNSLAKTVPQDDEFLSEFRHNASKNDSITYV  710

Query  561   ELVLDDEEEFTKAVKSLDDRSFDLYVAGRGRGVSSALTSGLADWCECPELGAVGDllvts  382
             E  +    E    ++ L  +  +LY+ GR   ++S+      D   CPELG VG+LL + 
Sbjct  711   ERTIKTAAEAMSTIQEL--KHCNLYLVGRTPSLNSSFALNRND---CPELGPVGNLLTSL  765

Query  381   efessfsvlvVQQY  340
              F  + SVLVVQQY
Sbjct  766   NFPITASVLVVQQY  779



>ref|XP_004298244.1| PREDICTED: cation/H(+) antiporter 19-like [Fragaria vesca subsp. 
vesca]
Length=845

 Score =   402 bits (1032),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 277/782 (35%), Positives = 433/782 (55%), Gaps = 32/782 (4%)
 Frame = -3

Query  2628  SNGVWEGPDPLAPMIPLFILQIMTAILSSRILNFVLKPFNQPPLVAEILSGIILGPSMLG  2449
             SNG ++G  PL   +PL ILQI+  ++ +R L ++LKP  QP ++AE++ GI+LGPS LG
Sbjct  5     SNGSFQGDSPLDYALPLLILQIILVVVFTRCLAYILKPLRQPRVIAEVIGGILLGPSALG  64

Query  2448  NIEEFRKHNFPNHNFETIETMGHFALVLYAFLTGLQMDVKAIVHTGTKSRIVAVSGSIFP  2269
               + F    FP      +ET+ +  L  + FL GL++D  +I  TG KS  +A+ G   P
Sbjct  65    RNKAFLNGIFPPKGMTVLETVANIGLCFFLFLVGLELDFNSIRRTGKKSLGIAICGITLP  124

Query  2268  FLIG----AGFYFTLQTDTQSMIGFIFCGSALTVTGFSTLAKILDSKRLLNTEIGKIAAS  2101
             F++G    A    T+    Q     +F G AL++T F  LA+IL   +LL T++G+IA S
Sbjct  125   FVLGIATSAILRATISKGVQHGPFLVFNGVALSITAFPVLARILAELKLLTTDVGRIAMS  184

Query  2100  SALINVALSWVLLTIGLLFTGSLDNV--QWAvlctvgfvvvcvnyVRPLLNWLISKTPEG  1927
             +A +N   +W+LL + +  TG+   +   W +LC  GFV   V  + PLL  +  K+P+G
Sbjct  185   AAAVNDVAAWILLALAIALTGTHSPLVSVWVLLCGAGFVGFAVVAILPLLAMMARKSPDG  244

Query  1926  QGFSEFYICSFIAVICAFGCFTDAMGSHPMIGAFIFGLIMPNNELLRTAILDRLEDFVMG  1747
             +   E YIC  ++++ A    TD +G H + GAF+ G+IMP        +++++ED V G
Sbjct  245   EPVKELYICVTLSIVLAAAFVTDTIGIHALFGAFVVGIIMPKEGPFAGVLIEKIEDLVSG  304

Query  1746  ILMPVFFLVCGLRTNIFTITDGDTSIFTALALILLACSAKIIAALVASCYTGMSTNEAIG  1567
             + +P++F+  GL+TN+ TI+ G  S    + +I  A   KI+  +  S +  +   EA+ 
Sbjct  305   LFLPLYFVSSGLKTNVATIS-GAQSWGLLVLVIFTASFGKIVGTVALSLFFKVPLREAVA  363

Query  1566  LGVLTNTKSTMVMIILEVGqvqqvlsvqqysmmvVACLIMTIVATPLA-ARYCPKQDLEP  1390
             LGVL NTK  + +I+L +G+ ++VL+ Q +++ V+  L  T + TPL  A Y P +   P
Sbjct  364   LGVLMNTKGLVELIVLNIGKDRKVLNDQTFAIFVMMALFTTFITTPLVMAVYKPARKGAP  423

Query  1389  YKRRTIQNAKPGEELRILACIHGTNNLPAIISLLETSNSTVT-SPITAFGVQLLELVGRA  1213
             YK RTI    P  ELRILAC H T N+P +I+++E+S  T     +T + + L+EL  R+
Sbjct  424   YKLRTIFRKNPDTELRILACFHTTRNIPTMINIIESSRGTRKRGRLTVYAMHLMELSERS  483

Query  1212  PAMMvvhssgsgrhvggsHEEVQTSQIISTFDNYELRSHGVTAQVLTARWSYDTMAEDIC  1033
              A+ +VH +        + +     Q++  F+ YE  S  V  +  TA  S + M EDIC
Sbjct  484   SAISMVHKARHNGLPFWNKKSDNKDQMVIAFEAYEQLST-VKIRPATAISSLNNMHEDIC  542

Query  1032  KMAKEKRAAFLVLPFHKQQGTDGEMEDTNPAIQTVNEGVLLSAPCSVGILVERG------  871
               A +K AA ++LPFHK Q  DG ME    + Q VNE VL  APCSVGILV+RG      
Sbjct  543   ACAHQKTAAMILLPFHKHQRLDGTMESLGHSFQVVNERVLRHAPCSVGILVDRGLGGTTQ  602

Query  870   -RPNQYAKNIAVLYLGGPDDREALTYARRMSGLPGVHLTVIRFVPAKDVSADGAVEDPDL  694
                +  +    V + GG DDREAL Y  R++  PG+ LTV RF+  K  +     +    
Sbjct  603   VSASDVSYTALVAFFGGRDDREALAYGMRLAEHPGIALTVFRFIARKGKTLRFGAQ----  658

Query  693   ELELTRETSFVTVSIDPARDKEEDEELLNNFR----TETAEDDSKTFMELVLDDEEEFTK  526
              + +T +   +    D +++ EEDE+ L  ++    +    ++S  + E ++D + E   
Sbjct  659   LVGITADNKKILKEEDSSQENEEDEKFLEEYKKLMSSSKENEESMLYEEKMVDSKGEIAV  718

Query  525   AVKSLDDRSFDLYVAGRGRGVSSALTSGLADWCECPELGAVGDllvtsefessfsvlvVQ  346
             A+K+L     +L++ GR        T  L +  +C ELG +G  L +S+F S+ SV+V+Q
Sbjct  719   ALKTLSKH--NLFIVGR-----MPPTLPLVESSDCAELGPIGSFLASSDFSSTASVVVIQ  771

Query  345   QY  340
             QY
Sbjct  772   QY  773



>ref|XP_004289599.1| PREDICTED: cation/H(+) antiporter 15-like [Fragaria vesca subsp. 
vesca]
Length=839

 Score =   401 bits (1030),  Expect = 7e-121, Method: Compositional matrix adjust.
 Identities = 268/796 (34%), Positives = 435/796 (55%), Gaps = 49/796 (6%)
 Frame = -3

Query  2712  PPP--PSTGPEVDLDRLGQVVMCFSQTIYRSNGVWEGPDPLAPMIPLFILQIMTAILSSR  2539
             PPP     G  + +     +++C+++TI  + GVW+  + L   +P F  Q+   +  + 
Sbjct  10    PPPILEDEGWRLQVYEKDTMLVCYNKTITHATGVWKAENALLNTLPTFFTQLALILTFTY  69

Query  2538  ILNFVLKPFNQPPLVAEILSGIILGPSMLGNIEEFRKHNFPNHNFETIETMGHFALVLYA  2359
             +L  + KP     LVA +L G+I+GPS     +    +  P  +  T+ET+ ++ L+ + 
Sbjct  70    LLKRLFKPLRISCLVANVLGGLIIGPSGFAFQKFSLNYIVPFGSIMTLETIANYGLIYFM  129

Query  2358  FLTGLQMDVKAIVHTGTKSRIVAVSGSIFPFLIGAGFYFTLQTDTQS------MIGFIFC  2197
             FL GL++D+K I+H   +   +A++  + P  IG   +  L  + +       M G +F 
Sbjct  130   FLKGLEVDLKPILHARNRVLSIAMASMVIPAPIGYALHKLLLKEAKIGAHNMLMNGSLFW  189

Query  2196  GSALTVTGFSTLAKILDSKRLLNTEIGKIAASSALINVALSWVLLTIGLLFTGSLDNVQW  2017
             G AL+ T FS LA++L S +LL +EIG+ A S  +I   +SWVLL I +    +++N   
Sbjct  190   GLALSTTNFSELAQLLASVKLLRSEIGRTALSITVITDFISWVLLVITM---AAVNNYHL  246

Query  2016  Avlctvgfvvvc-vnyVRPLLNWLISKTPEGQGFSEFYICSFIAVICAFGCFTDAMGSHP  1840
               + +    ++  +  +RP ++W++  T   + + E ++   +     FG  TD+ GSH 
Sbjct  247   HTMLSTLAFIIVCIFVLRPAISWIVHHTNIDEHYDEHHVSLALFGAVLFGYITDSCGSHS  306

Query  1839  MIGAFIFGLIMPNNELLRTAILDRLEDFVMGILMPVFFLVCGLRTNIFTITDGDTSIFTA  1660
             ++GAF+ G+I+P  EL +  I +++E FV  I++P+FFLV G+R +  T+T     +F  
Sbjct  307   IVGAFMLGVILPRGEL-KNTITEKVEYFVSEIMLPLFFLVIGMRLH-HTLTGIRIVLF--  362

Query  1659  LALILLACSAKIIAALVASCYTGMSTNEAIGLGVLTNTKSTMVMIILEVGqvqqvlsvqq  1480
             LA+I+LA  AK++   +A+  + MS  ++  LG+L NTK  + +IIL VG+  +VL  Q 
Sbjct  363   LAIIVLAFLAKLVVTSIAALISQMSLRDSFALGLLMNTKGVLALIILNVGRDLKVLDNQS  422

Query  1479  ysmmvVACLIMTIVATP----LAARYCPKQDLEPYKRRTIQNAKPGEELRILACIHGTNN  1312
             +S+MV A ++MT +  P    L       + ++    R+IQ +    E R+LACIH + N
Sbjct  423   FSIMVYAVVVMTGIIGPIMTILYESSGTSKQIQCKSIRSIQQSN--SEFRVLACIHKSQN  480

Query  1311  LPAIISLLETSNSTVTSPITAFGVQLLELVG-RAPAMMvvhssgsgrhvggsHEEVQTSQ  1135
             +P I++LLE S  T  SP++ F V L+EL    A AM++VH +      G      +   
Sbjct  481   VPGIVNLLEASYPTKESPMSVFAVHLVELTSSHASAMLIVHDTCKSTVGGSR----KGDD  536

Query  1134  IISTFDNYELRSHGVTAQVLTARWSYDTMAEDICKMAKEKRAAFLVLPFHKQQGTDGEME  955
             I++ F+N++  + G T Q LTA  SY TM EDI  ++ EK A  +++PFH +   DG +E
Sbjct  537   ILTAFENFQNENDGTTVQALTAISSYTTMHEDIRSLSGEKDANLIIVPFHNESTLDGGVE  596

Query  954   DTNPAIQTVNEGVLLSAPCSVGILVERG---------RPNQYAKNIAVLYLGGPDDREAL  802
             D N +I+ VN  VL ++PCSV + V+RG           N    + A+L+ GGPDDREAL
Sbjct  597   DVNSSIRLVNSNVLHNSPCSVAVFVDRGLKSTLTESSSGNNRRHHYAMLFTGGPDDREAL  656

Query  801   TYARRMSGLPGVHLTVIRFVPAKDVSADGAVEDPDLELELTRETSFVTVSIDPARDKEED  622
              YA RM+  P V+LTV+R +  +D + D    D D  L+  R         D    K  D
Sbjct  657   AYAWRMAENPNVNLTVVRIIAGEDATFD--FPDKDGILKAMR---------DSEMQKLLD  705

Query  621   EELLNNFRTETAEDDSKTFMELVLDDEEEFTKAVKSLDDRSFDLYVAGRGRGVSSALTSG  442
             ++ + +    T    S    E V+++ EE  + + S+ +  +DL + GRG  VSS LT G
Sbjct  706   DQYIESLLINTRNQPSIKLTEKVVNNGEETIQLISSMGN-DYDLCIVGRGTKVSSPLTFG  764

Query  441   L-ADWCECPELGAVGD  397
             L +DW +CPELG +GD
Sbjct  765   LSSDWGDCPELGPMGD  780



>ref|XP_003543796.1| PREDICTED: cation/H(+) antiporter 19-like [Glycine max]
Length=813

 Score =   400 bits (1028),  Expect = 7e-121, Method: Compositional matrix adjust.
 Identities = 272/786 (35%), Positives = 440/786 (56%), Gaps = 38/786 (5%)
 Frame = -3

Query  2628  SNGVWEGPDPLAPMIPLFILQIMTAILSSRILNFVLKPFNQPPLVAEILSGIILGPSMLG  2449
             SNG ++  +PL   +PL ILQI   ++ +R L F+ KP  QP ++AE++ GI+LGPS +G
Sbjct  16    SNGAFQHENPLDYALPLLILQICVVVVFTRFLAFICKPLRQPRVIAEVIGGILLGPSAMG  75

Query  2448  NIEEFRKHNFPNHNFETIETMGHFALVLYAFLTGLQMDVKAIVHTGTKSRIVAVSGSIFP  2269
               E+F    FP  +   +ET+ +  L+ + FL GL++D+++I  TG K+  +A+SG  FP
Sbjct  76    RSEKFLNTIFPKRSLTVLETVANIGLLFFLFLVGLELDLRSIRKTGHKALFIALSGITFP  135

Query  2268  FLIGAGFYF----TLQTDTQSMIGFIFCGSALTVTGFSTLAKILDSKRLLNTEIGKIAAS  2101
             F++G G  +    T+  +       +F G AL++T F  LA+IL   +LL T +G+IA S
Sbjct  136   FILGIGTSYALRATISKNANPTSFLVFMGVALSITAFPVLARILAELKLLTTNVGRIAMS  195

Query  2100  SALINVALSWVLLTIGLLFTGSLDN---VQWAvlctvgfvvvcvnyVRPLLNWLISKTPE  1930
             +A IN   +W+LL + +  +GS  +     W +LC  GFV+  +  + PLL  +  ++PE
Sbjct  196   AAAINDVAAWILLALAIALSGSNTSPLVSLWVILCAAGFVLFAMFAISPLLGMMAKRSPE  255

Query  1929  GQGFSEFYICSFIAVICAFGCFTDAMGSHPMIGAFIFGLIMPNNELLRTAILDRLEDFVM  1750
             G+   E YIC  + ++ A G  TD +G H + GAF+ G++MP +     A+++++ED VM
Sbjct  256   GEPVQEIYICITMTLVLACGFITDTIGIHALFGAFVVGIVMPKDGPFAGALIEKIEDLVM  315

Query  1749  GILMPVFFLVCGLRTNIFTITDGDTSIFTALALILLACSAKIIAALVASCYTGMSTNEAI  1570
              + +P++F+  GL+T++ +I+ G  S    + +I  AC  KII   + S    +   EA+
Sbjct  316   SLFLPLYFVSSGLKTDVASIS-GALSWGMLVLVIFTACFGKIIGTFLVSLLCKVPFREAL  374

Query  1569  GLGVLTNTKSTMVMIILEVGqvqqvlsvqqysmmvVACLIMTIVATPLA-ARYCPKQDLE  1393
              LG L NTK  + +I+L +G+ ++VL+ Q +++ V+  L  T + TP+  A Y P +   
Sbjct  375   ALGFLMNTKGLVELIVLNIGKDRKVLNDQAFAICVLMALFTTFITTPIVMAVYKPARTGS  434

Query  1392  PYKRRTIQNAKPGEELRILACIHGTNNLPAIISLLETSNSTVT-SPITAFGVQLLELVGR  1216
              Y  +T+Q   P  ELR+LAC H T N+P +I+L+E+S  T   + +  + + L+EL  R
Sbjct  435   RYTHKTVQRNDPNTELRVLACFHSTRNIPTLINLIESSRGTKKRAKLCVYAMHLMELSER  494

Query  1215  APAMMvvhssgsgrhvggsHEEVQTSQIISTFDNYELRSHGVTAQVLTARWSYDTMAEDI  1036
               A+ +VH++ +      + +     Q++  F  Y   S  V  + +TA  ++  + EDI
Sbjct  495   PSAITMVHTARNNGMPFWNKKHDNRDQVVIAFQAYGHLS-SVNVRPMTAISAFSNIHEDI  553

Query  1035  CKMAKEKRAAFLVLPFHKQQGTDGEMEDTNPAIQTVNEGVLLSAPCSVGILVERG-----  871
             C  A +KRAA + LPFHK Q  DG ME    +++ +N  VL  APCSVGILV+RG     
Sbjct  554   CTSAHQKRAAIIFLPFHKHQRFDGTMESVGNSLRAMNGLVLSHAPCSVGILVDRGLGGTS  613

Query  870   --RPNQYAKNIAVLYLGGPDDREALTYARRMSGLPGVHLTVIRF-VPAKDVSADGA----  712
               + +  +  + V + GG DDREAL Y  RM+  PGV +TV++F VP     A GA    
Sbjct  614   QVQASDVSYKVVVGFFGGRDDREALAYGMRMAEHPGVSITVVKFVVPPGMTLAFGAKLIG  673

Query  711   -VEDPDLELELTRETSFVTVSIDPARDKEEDEELLNNFRTETAED-DSKTFMELVLDDEE  538
                D D ++    E +   V      +K+EDE   + F     ++ +S  + E +++ +E
Sbjct  674   VTADKDRKVIKVAEGTTTDV------EKQEDEHFWSEFLGVCCKNAESIMYEERLVESKE  727

Query  537   EFTKAVKSLDDRSFDLYVAGRGRGVSSALTSGLADWCECPELGAVGDllvtsefessfsv  358
             +    ++ ++    +L + GR   V       L D  +CPELG VG  L +SEF +S SV
Sbjct  728   DILTTMREMNKS--NLILVGRMPPVVP-----LVDTSDCPELGPVGSYLASSEFSTSASV  780

Query  357   lvVQQY  340
             +V QQY
Sbjct  781   IVFQQY  786



>ref|XP_010039253.1| PREDICTED: cation/H(+) antiporter 15-like [Eucalyptus grandis]
Length=828

 Score =   400 bits (1029),  Expect = 8e-121, Method: Compositional matrix adjust.
 Identities = 271/775 (35%), Positives = 441/775 (57%), Gaps = 35/775 (5%)
 Frame = -3

Query  2604  DPLAPMIPLFILQIMTAILSSRILNFVLKPFNQPPLVAEILSGIILGPSMLGNIEEFRKH  2425
             DPLA  +P    QI+  I+ S  ++ +LKP +QP  VA+I++GI+ GP++LG+      H
Sbjct  37    DPLATSLPTMFSQILVMIVLSSFISVLLKPLHQPRFVADIIAGILTGPTLLGDDTSIHNH  96

Query  2424  NFPNHNFETIETMGHFALVLYAFLTGLQMDVKAIVHTGTKSRIVAVSGSIFPFLIGAGFY  2245
               P     T+E      ++ Y FL GL+M++  I+    KS  +A++G + P  IG G Y
Sbjct  97    LLPFWCAPTMEAFTTLGVMYYMFLVGLEMNLAPILRIRRKSIGIALAGILIPLAIGFGSY  156

Query  2244  FTL-----QTDTQSM--IGFIFCGSALTVTGFSTLAKILDSKRLLNTEIGKIAASSALIN  2086
             F +     QTD + +   G    G ALT T    + +IL   +LL TE G+IA S A ++
Sbjct  157   FVIAPKADQTDKKWLRQKGAFVWGIALTATNLPDVTRILSDLKLLRTETGRIALSCAYLS  216

Query  2085  VALSWVLLTIGLLFTGSLDNVQWAvlctvgfvvvcvnyVRPLLNWLISKTPEGQGFSEFY  1906
                +W+LL    L T S D+V    + TV FV+ C+   RP+L WLI++T +G+ ++E  
Sbjct  217   DIGTWLLLVT--LITISHDDVLPIAIGTVVFVLFCMFVARPVLLWLINQTMDGEEYTEHQ  274

Query  1905  ICSFIAVICAFGCFTDAMGSHPMIGAFIFGLIMPNNELLRTAILDRLEDFVMGILMPVFF  1726
             +   +  +  +G  TDA+G + + GAF+FG I+P+ + L T I +RLE     I++P++ 
Sbjct  275   VQFVLCGVMLWGFITDAIGLYSIFGAFMFGFILPSGQ-LATLITERLERVTSWIMLPLYC  333

Query  1725  LVCGLRTNIFTI-----TDGDTSIFTALALILLACSAKIIAALVASCYTGMSTNEAIGLG  1561
             L+ GLRTN+  +       G  ++F  LA +     AK +++L+ S Y      E++ LG
Sbjct  334   LLNGLRTNVPEMIPQGRNGGHIAVFICLAWV-----AKFLSSLLVSIYCNTERRESVTLG  388

Query  1560  VLTNTKSTMVMIILEVGqvqqvlsvqqysmmvVACLIMTIVATPLAAR-YCPKQDLEPYK  1384
             VL NTK  + +I++ +G+   +L ++  ++MV+A L+MT    P+    Y P++ +  +K
Sbjct  389   VLMNTKGLLAIIVINIGRDLMLLDIESSAVMVIALLVMTFTVPPIVRHTYKPEKPMMLHK  448

Query  1383  RRTIQNAKPGEELRILACIHGTNNLPAIISLLETSNSTVTSPITAFGVQLLELVGRAPAM  1204
             RRTIQ+      L++LA IH   ++  I++LL+ S++T  SPI    V L+EL     A 
Sbjct  449   RRTIQSNGLDSPLQVLAGIHSMQSMRGIVNLLQLSHATRQSPIHVVAVHLVELTEHTSAA  508

Query  1203  MvvhssgsgrhvggsHEE---VQTSQIISTFDNYELRSHGV-TAQVLTARWSYDTMAEDI  1036
             ++V           + EE    ++ QII  F++Y+  S+G  + +VLTA   Y T+  D+
Sbjct  509   LLVVHDSYKSSSFRASEENAKAESGQIIEAFEDYQRESNGTASVEVLTALSPYTTIHVDV  568

Query  1035  CKMAKEKRAAFLVLPFHKQQGTDGEMEDTNPAIQTVNEGVLLSAPCSVGILVER--GRPN  862
             C +A++KRA+ +++PFH Q   + E E ++ +I+ VN+ VL  APCSV +LV R  G  N
Sbjct  569   CSIAEDKRASIIIIPFHIQGKNNDEPESSSTSIKDVNQNVLAGAPCSVALLVNRGLGMSN  628

Query  861   QYAKNIAVLYLGGPDDREALTYARRMSGLPGVHLTVIRFVPAKDVSADGAVEDPDLELEL  682
                + + + ++ GPDDRE L YA RM+  P V L V+RF+   D  A   +++P      
Sbjct  629   HRPRALLMFFICGPDDREGLAYAWRMAFHPEVRLRVVRFL-GDDAKAPAPLDNPK-----  682

Query  681   TRETSFVTVSIDPARDKEEDEELLNNFRTETAEDDSKTFMELVLDDEEEFTKAVKSLDDR  502
               + +F T+  + AR +  DE+ LN F++ET    + T+ E V++D  E   A++ + +R
Sbjct  683   DSDGAF-TIYEEHARQRAIDEDYLNEFKSETMNSLAATYTEEVVNDLNETLTAIRRIMER  741

Query  501   S-FDLYVAGRGRGVSSALTSGLADWCECPELGAVGDllvtsefessfsvlvVQQY  340
                +L + GRG+  +S L + L ++ E PELGA+GD ++TS F  + SVLVVQQ+
Sbjct  742   EPCELCIVGRGKQSTSPLVANLLEFTEYPELGALGDAIITSNFAGNSSVLVVQQH  796



>ref|XP_008451983.1| PREDICTED: LOW QUALITY PROTEIN: cation/H(+) antiporter 18-like 
[Cucumis melo]
Length=799

 Score =   400 bits (1027),  Expect = 8e-121, Method: Compositional matrix adjust.
 Identities = 274/787 (35%), Positives = 438/787 (56%), Gaps = 50/787 (6%)
 Frame = -3

Query  2628  SNGVWEGPDPLAPMIPLFILQIMTAILSSRILNFVLKPFNQPPLVAEILSGIILGPSMLG  2449
             SNG+++G +PL   +PL ILQI   +  +R L F+L+P  QP ++ EI+ GI+LGPS LG
Sbjct  19    SNGIFQGDNPLDFALPLIILQICLVVALTRGLAFLLRPLKQPRVIGEIIGGILLGPSALG  78

Query  2448  NIEEFRKHNFPNHNFETIETMGHFALVLYAFLTGLQMDVKAIVHTGTKSRIVAVSGSIFP  2269
               + F    FP+++   ++T+ +  L+ + FL GL++D+K+I  TG K+  +A++G   P
Sbjct  79    RNKNFLHTIFPSNSITLLDTVANIGLLFFLFLVGLELDLKSIRRTGKKALGIAITGICVP  138

Query  2268  FLIGAGFYFTLQTDTQSMIG----FIFCGSALTVTGFSTLAKILDSKRLLNTEIGKIAAS  2101
             F +G G  F L+      +      IF G AL++T F  LA+IL   +LL T++G++A S
Sbjct  139   FALGIGSSFVLRETISKGVNASAFLIFMGVALSITAFPVLARILAELKLLTTDVGRMAMS  198

Query  2100  SALINVALSWVLLTIGLLFTGSLDN---VQWAvlctvgfvvvcvnyVRPLLNWLISKTPE  1930
             +A +N   +W+LL + +  +GS  +     W +L   GFVV  +  + P+  W+  +  +
Sbjct  199   AAAVNDVAAWILLALAIALSGSDKSPLTAVWVLLSGCGFVVAAIVILSPVFKWMTKQCFQ  258

Query  1929  GQGFSEFYICSFIAVICAFGCFTDAMGSHPMIGAFIFGLIMPNNELLRTAILDRLEDFVM  1750
             G+   E YIC+ +A++ A G  TD +G H M GAF+ G+++P +  L  A+++++ED V 
Sbjct  259   GEPVREIYICATLAIVLAAGFATDFIGIHAMFGAFVVGVLVPKDGPLIGALVEKIEDLVS  318

Query  1749  GILMPVFFLVCGLRTNIFTITDGDTSIFTALALILLACSAKIIAALVASCYTGMSTNEAI  1570
             G+ +P++F+  GL+TN+ TI  G  S    + +I+ ACS KI+   + S    +   EA+
Sbjct  319   GLFLPLYFVSSGLKTNVATI-QGAQSWGLLVLVIVTACSGKILGTFLVSLLCKVPVREAL  377

Query  1569  GLGVLTNTKSTMVMIILEVGqvqqvlsvqqysmmvVACLIMTIVATPLA-ARYCPKQD--  1399
              LG L NTK  + +I+L +G+ ++VL+ Q +++M++  L  T + TPL  A Y P +   
Sbjct  378   ALGFLMNTKGLVELIVLNIGKDRKVLNDQTFAIMILMALFTTFITTPLVIAVYKPARSAK  437

Query  1398  LEPYKRRTIQNAKPGEELRILACIHGTNNLPAIISLLETSNSTVTS-PITAFGVQLLELV  1222
             +  YK R I+      +LR+L C H   N+P+II+LLE S  T     +  + + L+EL 
Sbjct  438   IADYKHRKIEXKNKNTQLRMLTCFHSAGNVPSIINLLEASRGTGKGEELCVYAMHLMELS  497

Query  1221  GRAPA-MMvvhssgsgrhvggsHEEVQTSQIISTFDNYELRSHGVTAQVLTARWSYDTMA  1045
              R+ A +MV  +  +G       +   ++ +I  F+ Y+  S  V  + +TA  S   + 
Sbjct  498   ERSSAILMVHKARKNGLPFWNKGQRSDSNHVIVAFEAYQQLSR-VFIRPMTAISSMSDIH  556

Query  1044  EDICKMAKEKRAAFLVLPFHKQQGTDGEMEDTNPAIQTVNEGVLLSAPCSVGILVERG--  871
             EDIC  A+ KR A ++LPFHK Q  DG +E T  +I+ VN+ VL  A CSVGI  +RG  
Sbjct  557   EDICATAERKRTAIIILPFHKHQRVDGSLETTRSSIRVVNQNVLEHAQCSVGIFADRGLG  616

Query  870   -----RPNQYAKNIAVLYLGGPDDREALTYARRMSGLPGVHLTVIRFVPAKD-----VSA  721
                    +  +  I VL+ GG DDREAL++  RM+  PG+ L VI F    +     +SA
Sbjct  617   GTAHVSSSNVSLFITVLFFGGGDDREALSFGVRMAEHPGIRLMVIHFFVEPEPVGEIISA  676

Query  720   DGAVEDPDLELELTRETSFVTVSIDPARDKEEDEELLNNFRTETAEDDSKTFMELVLDDE  541
             D                   TV    A+   +D+E L+ FR   +++DS T++E  +   
Sbjct  677   D-------------------TVGNSLAKPVSQDDEFLSEFRYNASKNDSITYVEKTIKTA  717

Query  540   EEFTKAVKSLDDRSFDLYVAGRGRGVSSALTSGLADWCECPELGAVGDllvtsefessfs  361
              E    V+ L  +  +LY+ GR  G++S+      D   CPELG +G+LL +  F  + S
Sbjct  718   AEVMGIVQEL--KHCNLYLVGRTPGLNSSFALNRND---CPELGPIGNLLTSPNFPITAS  772

Query  360   vlvVQQY  340
             VLVVQQY
Sbjct  773   VLVVQQY  779



>ref|XP_008341283.1| PREDICTED: cation/H(+) antiporter 18-like [Malus domestica]
 ref|XP_008341284.1| PREDICTED: cation/H(+) antiporter 18-like [Malus domestica]
Length=806

 Score =   399 bits (1026),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 274/786 (35%), Positives = 445/786 (57%), Gaps = 46/786 (6%)
 Frame = -3

Query  2628  SNGVWEGPDPLAPMIPLFILQIMTAILSSRILNFVLKPFNQPPLVAEILSGIILGPSMLG  2449
             SNGV++G +PL   +PL ILQI   +  +RIL ++L+P  QP ++AEI+ GI+LGPS LG
Sbjct  19    SNGVFQGDNPLDYALPLAILQICLVVTLTRILAYLLRPLRQPRVIAEIVGGILLGPSALG  78

Query  2448  NIEEFRKHNFPNHNFETIETMGHFALVLYAFLTGLQMDVKAIVHTGTKSRIVAVSGSIFP  2269
             + +++ +  FP  +   ++T+ +  L+ + F+ GL++D K+I  TG K+  +A++G I P
Sbjct  79    HNKDYIEAIFPKRSLTVLDTLANLGLLFFLFIVGLELDPKSIRRTGKKALCIALAGIILP  138

Query  2268  FLIGAGFYFTL-QTDTQSMIG---FIFCGSALTVTGFSTLAKILDSKRLLNTEIGKIAAS  2101
             F++G G  F L +T ++ + G    +F G AL++T F  LA+IL   +LL T+IG++A S
Sbjct  139   FVLGIGTSFALKETISKGVDGPPFLVFMGVALSITAFPVLARILAELKLLTTDIGRMAMS  198

Query  2100  SALINVALSWVLLTIGLLFTGSLDN---VQWAvlctvgfvvvcvnyVRPLLNWLISKTPE  1930
             +A IN   +W+LL + +  +G+  +     W +LC   FV+ CV +VRP+  W+  + PE
Sbjct  199   AAAINDVAAWILLALAISLSGTGRSPLVSLWVLLCGCAFVLGCVFFVRPIFKWMAQRCPE  258

Query  1929  GQGFSEFYICSFIAVICAFGCFTDAMGSHPMIGAFIFGLIMPNNELLRTAILDRLEDFVM  1750
             G+   E Y+C+ +  + A G  TD +G H + GAF+ G+I+P       A+++++ED V 
Sbjct  259   GEPVEELYVCATLVAVLAAGFVTDTIGIHALFGAFVLGIIVPKEGPFAGALVEKVEDLVS  318

Query  1749  GILMPVFFLVCGLRTNIFTITDGDTSIFTALALILLACSAKIIAALVASCYTGMSTNEAI  1570
             G+ +P++F+  GL+T+I TI  G  S    + +I  AC  K+   +  S    +   EA+
Sbjct  319   GLFLPLYFVSSGLKTDIATI-HGAQSWGLLVLVISTACFGKVFGTVAVSLLCRLPFQEAL  377

Query  1569  GLGVLTNTKSTMVMIILEVGqvqqvlsvqqysmmvVACLIMTIVATPLA-ARYCP--KQD  1399
              LG L NTK  + +I+L +G+ ++VL+ Q +++MV+  +  T + TP+  A Y P  ++ 
Sbjct  378   ALGFLMNTKGLVELIVLNIGRERKVLNDQTFAIMVLMAIFTTFITTPVVMAVYKPAKRKS  437

Query  1398  LEPYKRRTIQNAKPGEELRILACIHGTNNLPAIISLLETSNST-VTSPITAFGVQLLELV  1222
                YK RTI+   P  EL+IL C HGT NLP +I+L+E S  T     +  + + L+EL 
Sbjct  438   TSDYKYRTIERKDPNTELQILTCFHGTRNLPTMINLIEASRGTGKKERLCVYAMHLMELN  497

Query  1221  GRAPA-MMvvhssgsgrhvggsHEEVQTSQIISTFDNYELRSHGVTAQVLTARWSYDTMA  1045
              R+ A +MV  +  +G        +   +Q++  F+ +E  S  V  + +TA  S  +M 
Sbjct  498   ERSSAILMVHKARRNGLPFWNKVTDSGNNQLVVAFETFEQLSR-VAIRPMTAISSVSSMH  556

Query  1044  EDICKMAKEKRAAFLVLPFHKQQGTDGEMEDTNPAIQTVNEGVLLSAPCSVGILVERGRP  865
             EDIC MA+ KRAA +++PFHK Q  DG +  T    + VN+ VL  APCSVGI+V+RG  
Sbjct  557   EDICAMAERKRAAIIIVPFHKHQRLDGVLVTTRTEYRGVNQRVLEHAPCSVGIMVDRGLG  616

Query  864   NQ-------YAKNIAVLYLGGPDDREALTYARRMSGLPGVHLTVIRFVPAKDVSADGAVE  706
                       + +I V++ GG DD EAL Y  RM+  PG +LTV+ F+ +          
Sbjct  617   GSTHVSASNVSSSIVVVFFGGSDDHEALAYGMRMAEHPGNNLTVVHFLAS----------  666

Query  705   DPDLELELTRETSFVTVSIDPARDKEE---DEELLNNFRTETAEDDSKTFMELVLDDEEE  535
              P+L+ E+      V V I+   +      +E+ +   + +   D S  + E V+ +  E
Sbjct  667   -PELQREI------VQVDINEGFNTSAGSVNEKFIAELK-KVPNDSSIKYEERVVRNAAE  718

Query  534   FTKAVKSLDDRSFDLYVAGRGRGVSSALTSGLADWCECPELGAVGDllvtsefessfsvl  355
              T  ++  +  +  L     GR     + + L    +CPELG VG LL + +F ++ SVL
Sbjct  719   TTDLIREFNRCNLFLV----GRRPEGQVAAALNIKGDCPELGPVGSLLTSPDFTTTASVL  774

Query  354   vVQQYV  337
             VVQQY+
Sbjct  775   VVQQYL  780



>ref|XP_007210361.1| hypothetical protein PRUPE_ppa001551mg [Prunus persica]
 gb|EMJ11560.1| hypothetical protein PRUPE_ppa001551mg [Prunus persica]
Length=804

 Score =   399 bits (1026),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 276/785 (35%), Positives = 438/785 (56%), Gaps = 45/785 (6%)
 Frame = -3

Query  2628  SNGVWEGPDPLAPMIPLFILQIMTAILSSRILNFVLKPFNQPPLVAEILSGIILGPSMLG  2449
             SNG+++G DPL   +PL ILQI   ++ +R L +VL+P  QP ++AEI+ GI+LGPS LG
Sbjct  19    SNGIFQGDDPLHFALPLAILQICVVVIVTRGLAYVLRPLRQPRVIAEIVGGILLGPSALG  78

Query  2448  NIEEFRKHNFPNHNFETIETMGHFALVLYAFLTGLQMDVKAIVHTGTKSRIVAVSGSIFP  2269
               + + +  FP  +   ++T+ +  L+ + FL GL++D K+I  TG K+  +A+ G   P
Sbjct  79    RNKSYLQAIFPPKSITVLDTLANLGLLFFLFLAGLEIDPKSIRQTGKKALAIAIVGISLP  138

Query  2268  FLIGAGFYFTLQTDTQSMIG----FIFCGSALTVTGFSTLAKILDSKRLLNTEIGKIAAS  2101
             F +G G  F L+      +      +F G AL++T F  LA+IL   +LL T+IG++A S
Sbjct  139   FALGIGSSFVLRETIAKGVDATAFLVFMGVALSITAFPVLARILAELKLLTTDIGRMAMS  198

Query  2100  SALINVALSWVLLTIGLLFTGSLDN---VQWAvlctvgfvvvcvnyVRPLLNWLISKTPE  1930
             +A +N   +W+LL + +  +GS  +     W  L    FV+  +  V P+  W+  +  E
Sbjct  199   AAAVNDVAAWILLALAVALSGSNQSPLVSLWVFLSGCVFVICAILIVPPIFKWMAQRCHE  258

Query  1929  GQGFSEFYICSFIAVICAFGCFTDAMGSHPMIGAFIFGLIMPNNELLRTAILDRLEDFVM  1750
             G+   E Y+C+ +  + A G  TD +G H M GAF+ G+++P       A+++++ED V 
Sbjct  259   GEPVDEIYVCATLTAVLAAGLITDTIGIHAMFGAFVVGVLVPKEGPFAGALVEKVEDLVS  318

Query  1749  GILMPVFFLVCGLRTNIFTITDGDTSIFTALALILLACSAKIIAALVASCYTGMSTNEAI  1570
             G+ +P++F+  GL+TN+ TI  G  S    + +I  AC  KI   ++ S +  +   EA+
Sbjct  319   GLFLPLYFVSSGLKTNVATI-QGLQSWGLLVLVIFTACFGKIFGTIMVSLFCKLPVREAL  377

Query  1569  GLGVLTNTKSTMVMIILEVGqvqqvlsvqqysmmvVACLIMTIVATPLA-ARYCP--KQD  1399
              LG L N+K  + +I+L +G+ ++VL+ Q +++MV+  L  T + TPL  A Y P  K  
Sbjct  378   ALGFLMNSKGLVELIVLNIGKDRKVLNDQTFAIMVLMALFTTFITTPLVIAVYKPAKKAG  437

Query  1398  LEPYKRRTIQNAKPGEELRILACIHGTNNLPAIISLLETSNSTVTSP-ITAFGVQLLELV  1222
             +  YK +TI+      +LRILAC H   N+P+II+LLE S  T     +  + + L EL 
Sbjct  438   MAVYKHKTIERKNMNTQLRILACFHSARNIPSIINLLEVSRGTKKREGLCVYAMHLKELS  497

Query  1221  GRAPA-MMvvhssgsgrhvggsHEEVQTSQIISTFDNYELRSHGVTAQVLTARWSYDTMA  1045
              R+ A +MV  +  +G       ++  +  ++  F+ Y+  S  V+ + +T   S   M 
Sbjct  498   ERSSAILMVHKARRNGLPFWNKSQQPNSDNVVVAFEAYQQLSR-VSIRPMTEISSISDMH  556

Query  1044  EDICKMAKEKRAAFLVLPFHKQQGTDGEMEDTNPAIQTVNEGVLLSAPCSVGILVERG--  871
             EDIC  A+ KRAA ++LPFHK Q  DG +E T    + VN+ VL  APCSVGILV+RG  
Sbjct  557   EDICATAESKRAAVVILPFHKHQRLDGTLETTRNDFRLVNQRVLQHAPCSVGILVDRGLG  616

Query  870   -----RPNQYAKNIAVLYLGGPDDREALTYARRMSGLPGVHLTVIRFVPAKDVSADGAVE  706
                    +  + NI VL+ GG DD EAL Y  RM+  PGV L VIRF           + 
Sbjct  617   GATHVAASNVSYNITVLFFGGRDDSEALAYGARMAEHPGVSLMVIRF-----------LV  665

Query  705   DPDLELELTRETSFVTVSID---PARDKEEDEELLNNFRTETAEDDSKTFMELVLDDEEE  535
             +P++  E++R      ++ID     +    DEE+L  F+ + ++D+S T+ E  + +  +
Sbjct  666   EPEVVGEISR------INIDENGSTKVGSVDEEVLAEFKQKISKDNSITYEEKTVRNNAQ  719

Query  534   FTKAVKSLDDRSFDLYVAGRGRGVSSALTSGLADWCECPELGAVGDllvtsefessfsvl  355
                 ++ +     +L++ GR  G   AL   +    ECPELG +G LL++ +F +S SVL
Sbjct  720   TIAVIREVG--RCNLFLVGRTPGGEVAL--AINRRSECPELGPLGSLLISPDFSTSASVL  775

Query  354   vVQQY  340
             VVQQY
Sbjct  776   VVQQY  780



>ref|XP_006343906.1| PREDICTED: cation/H(+) antiporter 18-like [Solanum tuberosum]
Length=802

 Score =   399 bits (1026),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 272/784 (35%), Positives = 447/784 (57%), Gaps = 44/784 (6%)
 Frame = -3

Query  2628  SNGVWEGPDPLAPMIPLFILQIMTAILSSRILNFVLKPFNQPPLVAEILSGIILGPSMLG  2449
             SNGV++G DPL   +PL I+QI   ++ +R+L ++L+P  QP +VAEI+ GI+LGPS LG
Sbjct  18    SNGVFQGDDPLDYALPLAIVQICLVLVLTRVLAYLLRPLRQPRVVAEIIGGILLGPSALG  77

Query  2448  NIEEFRKHNFPNHNFETIETMGHFALVLYAFLTGLQMDVKAIVHTGTKSRIVAVSGSIFP  2269
               E++    FP  +   ++T+ +F L+ + FL GL++D K++  TG K+  +A++G   P
Sbjct  78    RSEKYLHTIFPPKSLTVLDTLANFGLLFFLFLVGLELDPKSLRRTGKKALCIAIAGISVP  137

Query  2268  FLIGAGFYFTLQTDTQSMIG----FIFCGSALTVTGFSTLAKILDSKRLLNTEIGKIAAS  2101
             F++G G  F L+      +      +F G AL++T F  LA+IL   +LL T++G++A S
Sbjct  138   FVLGIGTSFALRATISQGVNQGPFLVFMGVALSITAFPVLARILAELKLLTTDVGRMAMS  197

Query  2100  SALINVALSWVLLTIGLLFTGSLDN---VQWAvlctvgfvvvcvnyVRPLLNWLISKTPE  1930
             +A +N   +W+LL + +  +G+  +     W +L   GFV++C+    P+  W+  +  +
Sbjct  198   AAAVNDVAAWILLALAIALSGNGSSPFISLWVLLSGAGFVLLCILIGPPIFTWMAKRCSD  257

Query  1929  GQGFSEFYICSFIAVICAFGCFTDAMGSHPMIGAFIFGLIMPNNELLRTAILDRLEDFVM  1750
             G+   E Y+C  +A + A G  TD++G H + GAF+ G+++P       A+++++ED V 
Sbjct  258   GEHVDEIYVCGTLAAVLAAGFVTDSIGIHALFGAFVLGVLVPKEGPFAGALVEKVEDLVS  317

Query  1749  GILMPVFFLVCGLRTNIFTITDGDTSIFTALALILLACSAKIIAALVASCYTGMSTNEAI  1570
             G+ +P++F+  GL+TN+ TI    +    AL +I  +C  KI+  +V S    M   EA+
Sbjct  318   GLFLPLYFVSSGLKTNVATIQGAQSWGLLAL-VIFTSCFGKIVGTIVVSLLCKMPVQEAL  376

Query  1569  GLGVLTNTKSTMVMIILEVGqvqqvlsvqqysmmvVACLIMTIVATPLA-ARYCP-KQDL  1396
              LG L NTK  + +I+L +G+ + VL+ Q +++MV+  L  T + TP+  + Y P K  +
Sbjct  377   TLGFLMNTKGLVELIVLNIGKDRGVLNDQTFAIMVLMALFTTFITTPIVISIYRPAKLAV  436

Query  1395  EPYKRRTIQNAKPGEELRILACIHGTNNLPAIISLLETSNSTVTSP-ITAFGVQLLELVG  1219
               YK RTI+     +++RIL+C + T N+P +I+L+E S  T     +  + + L+EL  
Sbjct  437   TKYKHRTIERKDTSKQVRILSCFYSTRNIPTLINLIEVSRGTAKKEGLRVYAMHLMELSE  496

Query  1218  RAPAMMvvhssgsgrhvggsHEEVQTS-QIISTFDNYELRSHGVTAQVLTARWSYDTMAE  1042
             R+ A+++VH          +  EV  S Q++  F+ +E  S  V+ +  TA    ++M E
Sbjct  497   RSSAILMVHKVKRNGLPFWNKGEVSDSNQVVVAFETFEHLSK-VSIRPTTAISPMNSMHE  555

Query  1041  DICKMAKEKRAAFLVLPFHKQQGTDGEMEDTNPAIQTVNEGVLLSAPCSVGILVER---G  871
             DI   A+ KR A ++LPFHK Q  DG  E T   ++ VN  VL  APCSVGILV+R   G
Sbjct  556   DIITSAENKRVAMIILPFHKHQRLDGHFETTRTDLRHVNRKVLQQAPCSVGILVDRGLGG  615

Query  870   RPNQYAKN----IAVLYLGGPDDREALTYARRMSGLPGVHLTVIRFVPAKDVSADGAVED  703
               +  A N    I +L+ GG DDREAL Y  RM+  PG+ L V+RF      + D A+  
Sbjct  616   ASHVPASNVNFTITILFFGGHDDREALAYGIRMAEHPGITLVVVRF------AVDPALAG  669

Query  702   PDLELELTRETSFVTVSIDPARDKEEDEELLNNFRTETAEDDSKTFMELVLDDEEEFTKA  523
               ++L++++ +S           + EDE +++  +   + D S  + E  + D  E  +A
Sbjct  670   GSVKLKMSQNSS--------PEVQPEDEVVISRLKESISTDGSIKYEERTVKDATELIEA  721

Query  522   VKSLDDRSFDLYVAGR---GRGVSSALTSGLADWCECPELGAVGDllvtsefessfsvlv  352
              KS +    +L++ GR   G+ V+S     L    ECPELG +G+LL +S+  ++ S+LV
Sbjct  722   TKSYNK--CNLFLVGRMPEGQVVAS-----LNKNSECPELGPIGNLLTSSDISTTASLLV  774

Query  351   VQQY  340
             VQQY
Sbjct  775   VQQY  778



>ref|XP_004245551.1| PREDICTED: cation/H(+) antiporter 18-like [Solanum lycopersicum]
 ref|XP_010325373.1| PREDICTED: cation/H(+) antiporter 18-like [Solanum lycopersicum]
 ref|XP_010325374.1| PREDICTED: cation/H(+) antiporter 18-like [Solanum lycopersicum]
Length=802

 Score =   399 bits (1025),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 273/784 (35%), Positives = 447/784 (57%), Gaps = 44/784 (6%)
 Frame = -3

Query  2628  SNGVWEGPDPLAPMIPLFILQIMTAILSSRILNFVLKPFNQPPLVAEILSGIILGPSMLG  2449
             SNGV++G DPL   +PL I+QI   ++ +R+L ++L+P  QP +VAEI+ GI+LGPS LG
Sbjct  18    SNGVFQGDDPLDYALPLAIVQICLVLVLTRVLAYILRPLRQPRVVAEIIGGILLGPSALG  77

Query  2448  NIEEFRKHNFPNHNFETIETMGHFALVLYAFLTGLQMDVKAIVHTGTKSRIVAVSGSIFP  2269
               E++    FP  +   ++T+ +F L+ + FL GL++D K++  TG K+  +A++G   P
Sbjct  78    RSEKYLHTIFPPKSLTVLDTLANFGLLFFLFLVGLELDPKSLRRTGKKALCIAIAGISVP  137

Query  2268  FLIGAGFYFTLQTDTQSMIG----FIFCGSALTVTGFSTLAKILDSKRLLNTEIGKIAAS  2101
             F++G G  F L+      +      +F G AL++T F  LA+IL   +LL T++G++A S
Sbjct  138   FVLGIGTSFALRATISQGVNQGPFLVFMGVALSITAFPVLARILAELKLLTTDVGRMAMS  197

Query  2100  SALINVALSWVLLTIGLLFTGSLDN---VQWAvlctvgfvvvcvnyVRPLLNWLISKTPE  1930
             +A +N   +W+LL + +  +G+  +     W +L   GFV++C+    P+  W+  +  +
Sbjct  198   AAAVNDVAAWILLALAIALSGNGSSPFISLWVLLSGAGFVLLCILIGPPIFTWMAKRCSD  257

Query  1929  GQGFSEFYICSFIAVICAFGCFTDAMGSHPMIGAFIFGLIMPNNELLRTAILDRLEDFVM  1750
             G+   E Y+C  +A + A G  TD++G H + GAF+ G+++P       A+++++ED V 
Sbjct  258   GEHVDEIYVCGTLAAVLAAGFVTDSIGIHALFGAFVLGVLVPKEGPFAGALVEKVEDLVS  317

Query  1749  GILMPVFFLVCGLRTNIFTITDGDTSIFTALALILLACSAKIIAALVASCYTGMSTNEAI  1570
             G+ +P++F+  GL+TN+ TI    +    AL +I  +C  KI+  +V S    M   EA+
Sbjct  318   GLFLPLYFVSSGLKTNVATIQGAQSWGLLAL-VIFTSCFGKIVGTIVVSLLCKMPVQEAL  376

Query  1569  GLGVLTNTKSTMVMIILEVGqvqqvlsvqqysmmvVACLIMTIVATPLA-ARYCP-KQDL  1396
              LG L NTK  + +I+L +G+ + VL+ Q +++MV+  L  T + TP+  + Y P K  +
Sbjct  377   TLGFLMNTKGLVELIVLNIGKDRGVLNDQTFAIMVLMALFTTFITTPIVISIYRPAKLAV  436

Query  1395  EPYKRRTIQNAKPGEELRILACIHGTNNLPAIISLLETSNSTVTSP-ITAFGVQLLELVG  1219
               YK RTI+     +++RIL+C + T N+P +I+L+E S  T     +  + + L+EL  
Sbjct  437   TKYKHRTIERKDTSKQVRILSCFYSTRNIPTLINLIEVSRGTAKKEGLRVYAMHLMELSE  496

Query  1218  RAPAMMvvhssgsgrhvggsHEEVQTS-QIISTFDNYELRSHGVTAQVLTARWSYDTMAE  1042
             R+ A+++VH          +  EV  S Q++  F+ +E  S  V+ +  TA    ++M E
Sbjct  497   RSSAILMVHKVKRNGLPFWNKGEVSDSNQVVVAFETFEHLSK-VSIRPTTAISPMNSMHE  555

Query  1041  DICKMAKEKRAAFLVLPFHKQQGTDGEMEDTNPAIQTVNEGVLLSAPCSVGILVER---G  871
             DI   A+ KR A ++LPFHK Q  DG  E T   ++ VN  VL  APCSVGILV+R   G
Sbjct  556   DIITSAENKRVAMIILPFHKHQRLDGHFETTRTDLRHVNRKVLQQAPCSVGILVDRGLGG  615

Query  870   RPNQYAKN----IAVLYLGGPDDREALTYARRMSGLPGVHLTVIRFVPAKDVSADGAVED  703
               +  A N    I +L+ GG DDREAL Y  RM+  PG+ L V+RF      + D A+  
Sbjct  616   ASHVPASNVDFTITILFFGGHDDREALAYGMRMAEHPGITLAVVRF------AVDPALAG  669

Query  702   PDLELELTRETSFVTVSIDPARDKEEDEELLNNFRTETAEDDSKTFMELVLDDEEEFTKA  523
               ++L+++  ++           + EDE +++  +   + D S  + E  + D  E  +A
Sbjct  670   GSVKLKMSHNSN--------PEVQPEDEVVISKLKESISTDGSIKYEEKTVKDSTELIEA  721

Query  522   VKSLDDRSFDLYVAGR---GRGVSSALTSGLADWCECPELGAVGDllvtsefessfsvlv  352
              KS +    +L++ GR   G+ V+S     L    ECPELG +G+LL +SEF ++ S+LV
Sbjct  722   TKSYNK--CNLFLVGRMPEGQVVAS-----LNKNSECPELGPIGNLLTSSEFSTTASLLV  774

Query  351   VQQY  340
             VQQY
Sbjct  775   VQQY  778



>ref|XP_010676379.1| PREDICTED: cation/H(+) antiporter 18-like [Beta vulgaris subsp. 
vulgaris]
 ref|XP_010676380.1| PREDICTED: cation/H(+) antiporter 18-like [Beta vulgaris subsp. 
vulgaris]
Length=800

 Score =   399 bits (1024),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 261/775 (34%), Positives = 420/775 (54%), Gaps = 39/775 (5%)
 Frame = -3

Query  2664  QVVMCFSQTIYRSNGVWEGPDPLAPMIPLFILQIMTAILSSRILNFVLKPFNQPPLVAEI  2485
              V  C       S GV++G +PL   +PL I+QI+  I+ +R L F+L+P  QP ++AEI
Sbjct  4     NVTACPKPMAATSTGVFQGENPLDFALPLVIVQIILVIVLTRTLAFLLRPLRQPRVIAEI  63

Query  2484  LSGIILGPSMLGNIEEFRKHNFPNHNFETIETMGHFALVLYAFLTGLQMDVKAIVHTGTK  2305
             + G++LGPS  G  E F    FP  +   ++T+ +  L+ + FL GL++D KA+  TG K
Sbjct  64    IGGVLLGPSAFGRSEAFLHTIFPAKSLPVLDTLANLGLIFFLFLVGLELDPKALRRTGKK  123

Query  2304  SRIVAVSGSIFPFLIGAGFYFTLQTDTQSMIG----FIFCGSALTVTGFSTLAKILDSKR  2137
             +  +A++G   PF +G G  F L+      +      +F G AL++T F  LA+IL   +
Sbjct  124   ALSIALAGISLPFAMGIGTSFVLRATISKGVNQAPFIVFMGVALSITAFPVLARILAELK  183

Query  2136  LLNTEIGKIAASSALINVALSWVLLTIGLLFTGSLDN---VQWAvlctvgfvvvcvnyVR  1966
             LL T++G++A S+A +N   +W+LL + +  +G+  +     W  LC   FV +C+  V 
Sbjct  184   LLTTDVGRMAMSAAAVNDVAAWILLALAIALSGTGQSPLISLWVFLCGAAFVGLCILIVP  243

Query  1965  PLLNWLISKTPEGQGFSEFYICSFIAVICAFGCFTDAMGSHPMIGAFIFGLIMPNNELLR  1786
              +  W+    P+G+   E YIC  +A + A G  TD +G H + GAF+ G++ P +  L 
Sbjct  244   RIFKWMTRHCPDGEPVEEIYICGTLAAVLAAGFVTDTIGIHALFGAFVLGILAPKDGPLA  303

Query  1785  TAILDRLEDFVMGILMPVFFLVCGLRTNIFTITDGDTSIFTALALILLACSAKIIAALVA  1606
              A+++++ED V G+L+P++F   GL+TN+ TI  G  S    L +IL AC  K++  +V 
Sbjct  304   GALVEKVEDLVSGLLLPLYFASSGLKTNVATI-QGAQSWGLLLLVILTACFGKVVGTVVV  362

Query  1605  SCYTGMSTNEAIGLGVLTNTKSTMVMIILEVGqvqqvlsvqqysmmvVACLIMTIVATPL  1426
             S    +  +E++ LGVL N+K  + +I+L +G+ ++VL+ Q +++MV+  L+ T + TP+
Sbjct  363   SRLCKIPLSESVALGVLMNSKGLVELIVLNIGKDRKVLNDQTFAIMVLMALVTTFMTTPI  422

Query  1425  A-ARYCPKQDLEPYKRRTIQNAKPGEELRILACIHGTNNLPAIISLLETSNSTVTSP-IT  1252
               A Y P +    YK RT+Q   P  +LR++AC H   ++P +I+L+E S  T     + 
Sbjct  423   VMAVYKPAKRGRAYKLRTVQRKDPSAQLRVMACFHSGRSIPTMINLIEASRGTEKKQGLA  482

Query  1251  AFGVQLLELVGRAPAM-MvvhssgsgrhvggsHEEVQTSQIISTFDNYELRSHGVTAQVL  1075
              + + L+EL  R+ A+ MV  +  +G        +  + Q++  F+ Y   S  V  + +
Sbjct  483   VYAMHLMELSERSSAIRMVHKARNNGLPFWNKGMQSDSDQVVVAFEAYGQLSQ-VQIRPM  541

Query  1074  TARWSYDTMAEDICKMAKEKRAAFLVLPFHKQQGTDGEMEDTNPAIQTVNEGVLLSAPCS  895
             TA   +  M EDIC  A+ KRAA ++LPFHK Q  DG +E T    + +N+ VL   PCS
Sbjct  542   TAISHFSDMHEDICASAESKRAALIILPFHKHQKFDGSLETTRHEYRVINKKVLQHTPCS  601

Query  894   VGILVERG-------RPNQYAKNIAVLYLGGPDDREALTYARRMSGLPGVHLTVIRFVPA  736
             VGILV+RG         +     I +L+ GGPDDREAL +  RMS  PG+ L V+ F   
Sbjct  602   VGILVDRGLGGSSQVSASNVDSTITILFFGGPDDREALAFGERMSEHPGITLVVVHF---  658

Query  735   KDVSADGAVEDPDLELELTRETSFVTVSIDPARDKEE---DEELLNNFRTETAEDDSKTF  565
                       DP++E     E   + VS D +  K+    DEE+++  + + ++D S  +
Sbjct  659   --------KADPNME---GGEMVAIDVS-DSSTGKDSKAADEEVIDVIKQKVSKDGSIKY  706

Query  564   MELVLDDEEEFTKAVKSLDDRSFDLYVAGRGRGVSSALTSGLADWCECPELGAVG  400
              E V+    + +  +K       +L + GR      A   GL    E PELG +G
Sbjct  707   EERVVKGSSDTSNVIKEFS--RCNLVLVGRSPEGMVATNFGLNVKTEYPELGPIG  759



>ref|XP_007210366.1| hypothetical protein PRUPE_ppa001527mg [Prunus persica]
 gb|EMJ11565.1| hypothetical protein PRUPE_ppa001527mg [Prunus persica]
Length=808

 Score =   399 bits (1024),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 277/787 (35%), Positives = 450/787 (57%), Gaps = 47/787 (6%)
 Frame = -3

Query  2628  SNGVWEGPDPLAPMIPLFILQIMTAILSSRILNFVLKPFNQPPLVAEILSGIILGPSMLG  2449
             SNGV++G +PL   +PL ILQI   +  +RIL ++L+P  QP ++AEI+ GI+LGPS LG
Sbjct  19    SNGVFQGDNPLDFALPLAILQICLVVALTRILAYLLRPLRQPRVIAEIVGGILLGPSALG  78

Query  2448  NIEEFRKHNFPNHNFETIETMGHFALVLYAFLTGLQMDVKAIVHTGTKSRIVAVSGSIFP  2269
             + + +    FP  +   ++T+ +  L+ + FL GL++D K+I  TG K+  +A +G   P
Sbjct  79    HSKNYLDTIFPKRSLTVLDTLANLGLLFFLFLVGLELDPKSIRRTGKKALCIAAAGITLP  138

Query  2268  FLIGAGFYFTLQ-TDTQSMIG---FIFCGSALTVTGFSTLAKILDSKRLLNTEIGKIAAS  2101
             F++G G  F L+ T ++ + G    +F G AL++T F  LA+IL   +LL T++G++A S
Sbjct  139   FVLGIGTSFALRATISKGVDGPPFLVFMGVALSITAFPVLARILAELKLLTTDVGRMAMS  198

Query  2100  SALINVALSWVLLTIGLLFTGSLDN---VQWAvlctvgfvvvcvnyVRPLLNWLISKTPE  1930
             +A +N   +WVLL + +  +G+  +     W  LC  GFV+ CV +VRP+  W+  + PE
Sbjct  199   AAAVNDVAAWVLLALAISLSGTGRSPLVSLWVFLCGCGFVLGCVFFVRPIFKWMAQRCPE  258

Query  1929  GQGFSEFYICSFIAVICAFGCFTDAMGSHPMIGAFIFGLIMPNNELLRTAILDRLEDFVM  1750
             G+   E Y+C+ +  + A G  TD +G H + GAF+ G+++P       A+++++ED V 
Sbjct  259   GEPVEELYVCATLVAVLAAGFVTDTIGIHALFGAFVLGILVPKEGPFAGALVEKVEDLVS  318

Query  1749  GILMPVFFLVCGLRTNIFTITDGDTSIFTALALILLACSAKIIAALVASCYTGMSTNEAI  1570
             G+ +P++F+  GL+T++ TI  G  S    + +I  AC  KII  +  S    M   EA+
Sbjct  319   GLFLPLYFVSSGLKTDVATI-RGAQSWGLLVLVISTACFGKIIGTIGVSLLCRMPFQEAM  377

Query  1569  GLGVLTNTKSTMVMIILEVGqvqqvlsvqqysmmvVACLIMTIVATPLA-ARYCP--KQD  1399
              LG L NTK  + +I+L +G+ ++VL+ Q +++MV+  +  T + TP+  A Y P  ++ 
Sbjct  378   ALGFLMNTKGLVELIVLNIGKDRKVLNDQTFAIMVLMAIFTTFITTPIVMAVYKPAKRKS  437

Query  1398  LEPYKRRTIQNAKPGEELRILACIHGTNNLPAIISLLETSNSTVTSP-ITAFGVQLLELV  1222
                YK RTI+   P  +LRIL C HGT NLP +I+L+E S  T     +  + + L+EL 
Sbjct  438   NSNYKYRTIERKDPSTQLRILTCFHGTRNLPTMINLIEASRGTEKRERLCVYAMHLMELN  497

Query  1221  GRAPAMMvvhssgsgrhvggsHEEVQTSQIISTFDNYELRSHGVTAQVLTARWSYDTMAE  1042
              R+ A++ +        +   ++    ++++  F+ +E  S  V  + +TA  S  +M E
Sbjct  498   ERSSAIV-MVHKARRNGLPFWNKGSDNNKVVVAFETFEQLSR-VAIRPMTAISSISSMHE  555

Query  1041  DICKMAKEKRAAFLVLPFHKQQGTDGEMEDTNPAIQTVNEGVLLSAPCSVGILVERG---  871
             DIC  A+ +RAA +++PFHK Q  DG +E T    + VN  VL +APCSVGI+V+RG   
Sbjct  556   DICASAERERAAMIIIPFHKHQRLDGALETTRTEYRGVNRRVLENAPCSVGIMVDRGLGG  615

Query  870   ----RPNQYAKNIAVLYLGGPDDREALTYARRMSGLPGVHLTVIRFVPAKDVSADGAVED  703
                   +  +  + VL+ GG DDREAL Y  RM+  PG +LTV+ F+ +           
Sbjct  616   TTHISASNVSSTVVVLFFGGSDDREALAYGMRMAEHPGNNLTVVHFLAS-----------  664

Query  702   PDLELELTRETSFVTVSIDPARDKEE---DEELLNNFRTETAEDDSKTFMELVLDDEEEF  532
             P+LE E+ R      V I+   D      +E+L+   + + + D S  + E  + +  E 
Sbjct  665   PELEKEIVR------VDINDGSDASAGPGNEKLIVELQQKISNDGSIKYEERTVRNVAET  718

Query  531   TKAVKSLDDRSFDLYVAGR---GRGVSSALTSGLADWCECPELGAVGDllvtsefessfs  361
             T +++  +    +L++ GR   G+ V++AL   L    +CPELG VG LL + +F ++ S
Sbjct  719   TDSIREFN--RCNLFLVGRRPEGQ-VAAALNVNLKVKSDCPELGPVGSLLTSPDFTTAAS  775

Query  360   vlvVQQY  340
             VLVVQQY
Sbjct  776   VLVVQQY  782



>ref|XP_002314344.2| hypothetical protein POPTR_0010s00740g [Populus trichocarpa]
 gb|EEF00515.2| hypothetical protein POPTR_0010s00740g [Populus trichocarpa]
Length=800

 Score =   398 bits (1023),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 276/783 (35%), Positives = 444/783 (57%), Gaps = 38/783 (5%)
 Frame = -3

Query  2628  SNGVWEGPDPLAPMIPLFILQIMTAILSSRILNFVLKPFNQPPLVAEILSGIILGPSMLG  2449
             SNG ++  +PL   +PL ILQI   +  +R L F+LKP  QP ++AEI+ GI+LGPS LG
Sbjct  5     SNGAFQHENPLDYALPLLILQICLVVAFTRTLAFLLKPLRQPRVIAEIIGGILLGPSALG  64

Query  2448  NIEEFRKHNFPNHNFETIETMGHFALVLYAFLTGLQMDVKAIVHTGTKSRIVAVSGSIFP  2269
               E F    FP  +   ++T+ +  L+ + FL GL++D+++I  TG KS  +A +G   P
Sbjct  65    RSERFLHTVFPPKSMTVLDTVANIGLLFFLFLVGLELDIRSIRRTGKKSLAIAGAGITLP  124

Query  2268  FLIGAGFYFTLQTDTQSMIG----FIFCGSALTVTGFSTLAKILDSKRLLNTEIGKIAAS  2101
             FL+G G  F L++            +F G +L++T F  LA+IL   +LL T++G+IA S
Sbjct  125   FLLGIGTSFVLRSTISKGSAHAPFLVFMGVSLSITAFPVLARILAELKLLTTDVGRIAMS  184

Query  2100  SALINVALSWVLLTIGLLFTGSLDN---VQWAvlctvgfvvvcvnyVRPLLNWLISKTPE  1930
             +A +N  ++W+LL + +  +GS  +     W +LC VGFVV  V  +RPLL  +  ++P+
Sbjct  185   AAAVNDVVAWILLALAIALSGSNTSPLISLWVLLCGVGFVVFSVYVIRPLLELMARRSPD  244

Query  1929  GQGFSEFYICSFIAVICAFGCFTDAMGSHPMIGAFIFGLIMPNNELLRTAILDRLEDFVM  1750
             G+   E YIC  ++++ A    TD++G H + GAF+ G+++P +      +++++ED V 
Sbjct  245   GEPVKEIYICITLSLVLASSFVTDSIGIHALFGAFVVGILVPKDSPFPGVLIEKIEDLVA  304

Query  1749  GILMPVFFLVCGLRTNIFTITDGDTSIFTALALILLACSAKIIAAL-VASCYTGMSTNEA  1573
             G+ +P++F   GL+TN+ TI+ G  S    + +I  AC  KII  + V+  +  +   EA
Sbjct  305   GLFLPLYFASSGLKTNVATIS-GAQSWGLLVLVIATACFGKIIGTMFVSRMFFKVPFREA  363

Query  1572  IGLGVLTNTKSTMVMIILEVGqvqqvlsvqqysmmvVACLIMTIVATPLA-ARYCPKQDL  1396
               LG L NTK  + +I+L +G+ ++VL+ Q ++++V+  L  T + TP+  A Y P + +
Sbjct  364   AALGFLMNTKGLVELIVLNIGKDRKVLNDQTFAVLVLMALFTTFITTPIVMAVYKPARRV  423

Query  1395  EPYKRRTIQNAKPGEELRILACIHGTNNLPAIISLLETSNSTVT-SPITAFGVQLLELVG  1219
              PYK RT++      ELR+LAC H + N+P +I+L+E S  T     +  + + L+EL  
Sbjct  424   APYKNRTVKRKDLDTELRLLACFHSSRNIPTMINLVECSRGTRKRGRLCVYAMHLMELSE  483

Query  1218  RAPAMMvvhssgsgrhvggsHEEVQTSQIISTFDNYELRSHGVTAQVLTARWSYDTMAED  1039
             R+ A+ +VH +        + +     Q++  F+ Y+  S  VT + +TA  + +T+ ED
Sbjct  484   RSSAISMVHKARKNGLPFWNKKRDDRDQMVIAFEAYQQLS-SVTIRPMTAISALNTIYED  542

Query  1038  ICKMAKEKRAAFLVLPFHKQQGTDGEMEDTNPAIQTVNEGVLLSAPCSVGILVERG----  871
             IC  A +KRAA ++LPFHK Q  DG +E    ++Q VN+ VL  +PCS GIL++RG    
Sbjct  543   ICTSAHQKRAAMILLPFHKHQRVDGSLESLGHSLQEVNQRVLRHSPCSAGILIDRGFGGT  602

Query  870   ---RPNQYAKNIAVLYLGGPDDREALTYARRMSGLPGVHLTVIRFVPAKDVSADGAVEDP  700
                  +  +  IAV + GG DD EAL Y  RM+  PG+ LTV++FVPA   +        
Sbjct  603   TQVSASDVSYKIAVPFFGGSDDMEALAYGIRMAEHPGIMLTVLKFVPASGKTL-------  655

Query  699   DLELELTRETSFVTVSIDPARDKEEDEELLNNFRTETAE---DDSKTFMELVLDDEEEFT  529
              L LE   +T+ + V  D   + E D E+  +   + A     DS T  E V++ + +  
Sbjct  656   -LTLE-GHDTNVIRVENDKNSNSEADSEIFFSEFVQLAAKKLQDSVTHEERVVESKADVV  713

Query  528   KAVKSLDDRSFDLYVAGRGRGVSSALTSGLADWCECPELGAVGDllvtsefessfsvlvV  349
              A+KS+     +L++ GR   ++  L S      + PELG VG  L +S F ++ SVLV+
Sbjct  714   AALKSMSKS--NLFLVGRMPPIAPLLIS-----TDTPELGPVGSFLASSNFSNTASVLVI  766

Query  348   QQY  340
             Q Y
Sbjct  767   QHY  769



>ref|XP_009354490.1| PREDICTED: cation/H(+) antiporter 15-like [Pyrus x bretschneideri]
Length=801

 Score =   398 bits (1022),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 260/787 (33%), Positives = 426/787 (54%), Gaps = 52/787 (7%)
 Frame = -3

Query  2640  TIYRSNGVWEGPDPLAPMIPLFILQIMTAILSSRILNFVLKPFNQPPLVAEILSGIILGP  2461
             T+Y++  +W         +P+ I+Q++ A+  +R+L  + KP +QP +V++IL G+++GP
Sbjct  2     TVYKTGEIWRVQSTFFRSVPMIIVQLIAAMSITRLLYHLFKPLHQPRIVSDILGGVMMGP  61

Query  2460  SMLGNIEEFRKHNFPNHNFETIETMGHFALVLYAFLTGLQMDVKAIVHTGTKSRIVAVSG  2281
             + +G I    ++  P  +   IET+ +  L  + F+ GL+++   ++ TG K+  VAV G
Sbjct  62    AFVGTIIFALQYVIPFFSLVNIETVANLGLGYHMFIMGLELEFVPVIRTGKKALSVAVVG  121

Query  2280  SIFPFLIGAGFY-FTLQTDTQSMI--------GFIFCGSALTVTGFSTLAKILDSKRLLN  2128
             S+   + G   Y F L  D    +        G+ F G AL  T F+ LA++L  K+LL+
Sbjct  122   SLVSLIWGWLLYRFVLFNDYGRALAEEIANDNGYAFWGIALASTNFTDLAQVLADKKLLH  181

Query  2127  TEIGKIAASSALINVALSWVLLTIGLLFTGSLDNVQWAvlctvgfvvvcvnyVRPLLNWL  1948
             ++ G++A SSA+I+  LSW LL  G+  T +  +     +  V F+++CV  +RP + W 
Sbjct  182   SDFGRLALSSAVISDVLSWFLLLAGM--TSAYTDQSIGAMSAVIFILLCVFVLRPAIPWF  239

Query  1947  ISKTP---EGQGFSEFYICSFIAVICAFGCFTDAMGSHPMIGAFIFGLIMPNNELLRTAI  1777
             I  T    +  G++E  +   ++V+  FG  +D  GSH ++G F+ G I+P+ E L+  +
Sbjct  240   IRNTTADNDSSGYNEQQVRFILSVVVLFGYVSDNFGSHSILGPFMLGTIIPSGE-LKKVL  298

Query  1776  LDRLEDFVMGILMPVFFLVCGLRTNIFTI--------TDGDTSIFTALALILLACSAKII  1621
             +DR++ FV  +LMP++FL  GLRTN   I        +  DT+++  +A+++LA   KI+
Sbjct  299   VDRIQTFVSHLLMPLYFLTVGLRTNFSYILTNENPKFSRADTNLWRVVAVVVLANIPKIL  358

Query  1620  AALVASCYTGMSTNEAIGLGVLTNTKSTMVMIILEVGqvqqvlsvqqysmmvVACLIMTI  1441
             +  +      MS  ++  LG+L NTK  M +IIL  G+  +VL  + + +M++A  +MT+
Sbjct  359   SNYIIGLMYKMSRGDSFALGILMNTKGLMGLIILGTGKDIKVLDNRTFGVMMIAMWLMTV  418

Query  1440  VATP-LAARYCPKQDLEPYKRRTIQNAKPGEELRILACIHGTNNLPAIISLLETSNSTVT  1264
                P LA  + P ++   YK R IQ+  P  EL+IL C H ++++  +I LLE SN T  
Sbjct  419   PVGPFLALVFKPTKNTAEYKLRNIQSVGPETELKILTCTHTSSSVSGVIDLLEASNPTRQ  478

Query  1263  SPITAFGVQLLELVGRAPAMMvvhssgsgrhvggsHEEVQTSQIIS--TFDNYELRSHGV  1090
             SPI  F VQL+E+     AM+        +       ++Q   IIS   F+ Y      V
Sbjct  479   SPICIFAVQLVEITDHGSAML--IVQEVCKENSNQGNQMQPEYIISENRFEKYAKNRENV  536

Query  1089  TAQVLTARWSYDTMAEDICKMAKEKRAAFLVLPFHKQQGTDGEMEDTNPAIQTVNEGVLL  910
             + Q LTA  SY+TM E IC +A EK    ++ PFH Q   DG MEDTNP ++ VN  ++ 
Sbjct  537   SIQTLTAFSSYNTMHEYICNLANEKFINIIITPFHNQFSIDGTMEDTNPNLKGVNNNLIK  596

Query  909   SAPCSVGILVERGRP-NQYAKN------------IAVLYLGGPDDREALTYARRMSGLPG  769
             ++PC+VGI V+RG   +Q +++             A+ + GG DDREAL YA RM+G P 
Sbjct  597   NSPCTVGIFVDRGLSVSQISESRNGSGSSPRYHLFAMFFFGGADDREALMYAWRMAGHPR  656

Query  768   VHLTVIRF--VPAKDVSADGAVEDPDLELELTRETSFVTVSIDPARDKEEDEELLNNFRT  595
             V+L V+RF  VP+         +D +           +  +++    K  D+  ++ FR 
Sbjct  657   VNLRVVRFIVVPSNATLGKFTCDDQN------DNDGDIHQAVNNRMQKHLDDTCMDEFRL  710

Query  594   ETAEDDSKTFMELVLDDEEEFTKAVKSLDDRSFDLYVAGRGRGVSSALTSGLADWC-ECP  418
             ++  + S  F+E ++   EE    V+ L    +DLY+ GR R   S+    L D+C +  
Sbjct  711   KSMHNPSTQFVEEIVKSWEETVNIVRGLQS-VYDLYLVGR-RYEKSSPAWSLLDYCSDYD  768

Query  417   ELGAVGD  397
             ELG +GD
Sbjct  769   ELGPLGD  775



>ref|XP_007131515.1| hypothetical protein PHAVU_011G019400g [Phaseolus vulgaris]
 gb|ESW03509.1| hypothetical protein PHAVU_011G019400g [Phaseolus vulgaris]
Length=814

 Score =   398 bits (1023),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 267/784 (34%), Positives = 442/784 (56%), Gaps = 34/784 (4%)
 Frame = -3

Query  2628  SNGVWEGPDPLAPMIPLFILQIMTAILSSRILNFVLKPFNQPPLVAEILSGIILGPSMLG  2449
             SNG ++  +PL   +PL ILQI   ++ +R L F+LKP  QP ++AE++ GI+LGPS +G
Sbjct  16    SNGAFQHENPLDYALPLLILQICLVVIFTRFLAFLLKPLRQPRVIAEVIGGILLGPSAIG  75

Query  2448  NIEEFRKHNFPNHNFETIETMGHFALVLYAFLTGLQMDVKAIVHTGTKSRIVAVSGSIFP  2269
               E+F    FP  +   +ET+ +  L+ + FL GL++D+++I  TG K+  +A++G   P
Sbjct  76    RNEKFLNTIFPKKSLTVLETVANLGLLFFLFLVGLELDMRSIRKTGHKALAIALAGISLP  135

Query  2268  FLIGAGFYFTLQTDTQSMIG----FIFCGSALTVTGFSTLAKILDSKRLLNTEIGKIAAS  2101
             F++  G  + L+      +      IF G AL++T F  LA+IL   +LL T+ G+IA S
Sbjct  136   FVLAIGTSYALRATISKNVDPTPFLIFMGVALSITAFPVLARILAELKLLTTDAGRIAMS  195

Query  2100  SALINVALSWVLLTIGLLFTGSLDN---VQWAvlctvgfvvvcvnyVRPLLNWLISKTPE  1930
             +A +N   +W+LL + +  +GS  +     W +LC + FV++ +  ++PLL  +  ++PE
Sbjct  196   AAAVNDVAAWILLALAIALSGSNSSPLVSLWVILCAIAFVLLAIFAIKPLLGIMAKRSPE  255

Query  1929  GQGFSEFYICSFIAVICAFGCFTDAMGSHPMIGAFIFGLIMPNNELLRTAILDRLEDFVM  1750
             G+   E YIC  + ++ A    TD +G H + GAF+ G++MP +      +++++ED VM
Sbjct  256   GEPVQEIYICITLTLVLACSFVTDTIGIHALFGAFVVGIVMPKDGPFAGVLIEKVEDLVM  315

Query  1749  GILMPVFFLVCGLRTNIFTITDGDTSIFTALALILLACSAKIIAALVASCYTGMSTNEAI  1570
              +L+P++F+  GL+T++ TI+ G  S    + +I  AC  KI+   + S    +   EA+
Sbjct  316   SLLLPLYFVSSGLKTDVTTIS-GALSWSMLVLVIFTACFGKIVGTFLVSLLCKVPFREAL  374

Query  1569  GLGVLTNTKSTMVMIILEVGqvqqvlsvqqysmmvVACLIMTIVATPLA-ARYCPKQDLE  1393
              LG L NTK  + +I+L +G+ ++VL+ Q +++ V+  L  T + TP+  A Y P +   
Sbjct  375   ALGFLMNTKGLVELIVLNIGKDRKVLNDQTFAICVLMALFTTFITTPIVMAVYKPARRGS  434

Query  1392  PYKRRTIQNAKPGEELRILACIHGTNNLPAIISLLETSNSTVT-SPITAFGVQLLELVGR  1216
             PY  +T+Q   P  ELR+L+C H T N+P +I+L+E+S  T     +  + + L+EL  R
Sbjct  435   PYTHKTVQRKDPDTELRVLSCFHSTCNIPTLINLIESSRGTRKRGKMCVYSMHLMELSER  494

Query  1215  APAMMvvhssgsgrhvggsHEEVQTSQIISTFDNYELRSHGVTAQVLTARWSYDTMAEDI  1036
               A+ +VH++ +      + +     Q++  F  Y   S  V  + +TA  ++  M EDI
Sbjct  495   PSAITMVHTARNNGLPFWNKKRDNRDQMVIAFQAYGQLS-SVDVRPMTAISAFSNMHEDI  553

Query  1035  CKMAKEKRAAFLVLPFHKQQGTDGEMEDTNPAIQTVNEGVLLSAPCSVGILVERG-----  871
             C  A +KRAA ++LPFHK Q  DG ME    +++ +N  VL  APCSVGILV+RG     
Sbjct  554   CTSAHQKRAAIILLPFHKHQHFDGTMESLGNSLRVMNGNVLSHAPCSVGILVDRGLGGKS  613

Query  870   --RPNQYAKNIAVLYLGGPDDREALTYARRMSGLPGVHLTVIRFV--PAKDVSADGAVED  703
               + +  + N+ V + GG DDREAL Y  R++  PG+ LTV++FV  P K  +    +  
Sbjct  614   QVQASDVSYNVVVGFFGGKDDREALAYGMRLAEHPGISLTVVKFVVAPGKTFAFGAKL--  671

Query  702   PDLELELTRETSFVTVS--IDPARDKEEDEELLNNFR-TETAEDDSKTFMELVLDDEEEF  532
               + +   R+   + V+       DK EDE+  + F   ++   DS    E +++ +E+ 
Sbjct  672   --IGITANRDKKVINVAEGTSYGEDKVEDEQFWSEFLGVKSNSTDSIMSEERMVESKEDV  729

Query  531   TKAVKSLDDRSFDLYVAGRGRGVSSALTSGLADWCECPELGAVGDllvtsefessfsvlv  352
                ++  +    +L + GR   V+      L D  +CPELG +G  L +SEF +S SVLV
Sbjct  730   IAVLR--EKNKSNLILVGRMPQVAP-----LVDKSDCPELGPIGSYLASSEFSTSASVLV  782

Query  351   VQQY  340
             +QQY
Sbjct  783   LQQY  786



>ref|XP_001770267.1| predicted protein [Physcomitrella patens]
 gb|EDQ64942.1| predicted protein [Physcomitrella patens]
Length=700

 Score =   395 bits (1014),  Expect = 5e-120, Method: Compositional matrix adjust.
 Identities = 237/656 (36%), Positives = 370/656 (56%), Gaps = 22/656 (3%)
 Frame = -3

Query  2628  SNGVWEGPDPLAPMIPLFILQIMTAILSSRILNFVLKPFNQPPLVAEILSGIILGPSMLG  2449
             SNGVW+G  P+   +PL I+QI+  +  +R L FVLKP  QP +VAEI+ GI+LGPS  G
Sbjct  5     SNGVWQGDVPVHFALPLLIVQIVLVLAITRALAFVLKPLKQPRVVAEIIGGILLGPSAFG  64

Query  2448  NIEEFRKHNFPNHNFETIETMGHFALVLYAFLTGLQMDVKAIVHTGTKSRIVAVSGSIFP  2269
               +++    FP+ +   +E      L+ + F+ GL++D+  I  TG ++  +A +G   P
Sbjct  65    RNKDYLHTIFPHESVIILEVFADMGLLFFLFMVGLELDMTQIRKTGKQAMSIAAAGITLP  124

Query  2268  FLIGAGFYFTLQTDTQSMIGF----IFCGSALTVTGFSTLAKILDSKRLLNTEIGKIAAS  2101
             F+ G G  F L         F    +F G A+++T F  LA+IL  ++LL TE+G++A S
Sbjct  125   FVAGVGVSFVLHLTIAPEGAFGPFLVFMGVAMSITAFPVLARILAERKLLTTEVGQLAMS  184

Query  2100  SALINVALSWVLLTIGLLFTGSLDN---VQWAvlctvgfvvvcvnyVRPLLNWLISKTPE  1930
             +A +N  ++WVLL + +  +GS  +   V W +LC + F +     V+P + W+  ++P+
Sbjct  185   AAAVNDVVAWVLLALAVALSGSGRSPAIVAWVLLCGIAFCLAIFLVVQPCMQWVAHRSPD  244

Query  1929  GQGFSEFYICSFIAVICAFGCFTDAMGSHPMIGAFIFGLIMPNNELLRTAILDRLEDFVM  1750
              +   E+ +   +  +   G  TDA+G H + GAF+FGL++P       A++++LEDFV 
Sbjct  245   NEPVKEYIVALTLLCVLVAGFCTDAIGVHSIFGAFLFGLVIPKEGPFAAALVEKLEDFVS  304

Query  1749  GILMPVFFLVCGLRTNIFTITDGDTSIFTALALIL-LACSAKIIAALVASCYTGMSTNEA  1573
              +L+P++F   GL+TNI  I    +  F  L L++ +AC  KI+    A+    +   +A
Sbjct  305   ILLLPLYFASSGLKTNIGAIHSAQS--FGLLVLVISVACLGKILGTFAAAKACRVDARKA  362

Query  1572  IGLGVLTNTKSTMVMIILEVGqvqqvlsvqqysmmvVACLIMTIVATPLA-ARYCPKQDL  1396
             + LG+L NTK  + +I+L +G  + VL+ + +++MV+  L  T + TPL  A Y P ++ 
Sbjct  363   LTLGILMNTKGLVELIVLNIGLDRGVLNSETFAIMVLMALFTTFMTTPLVMAIYKPARNP  422

Query  1395  EPYKRRTIQNAKPGEELRILACIHGTNNLPAIISLLETSNSTVTSPITAFGVQLLELVGR  1216
              PY RRT++     ++LRIL+C+HG  N+ A+I+L E +       +  + + L+EL  R
Sbjct  423   TPYTRRTLEMEDSKDDLRILSCVHGMKNVAAMINLTEATRGMRKRTLRLYILHLMELSER  482

Query  1215  APAMMvvhssgsgrh--vggsHEEVQTSQIISTFDNYELRSHGVTAQVLTARWSYDTMAE  1042
               A+M+V  +          S       QI++ F+ YE  S  VT + +TA   +D M E
Sbjct  483   TSAIMIVQRARRNGRPFFNQSKHSDNKDQIVAAFETYEQLSK-VTVRPMTAISGFDDMHE  541

Query  1041  DICKMAKEKRAAFLVLPFHKQQGTDGEMEDTNPAIQTVNEGVLLSAPCSVGILVERGR--  868
             DIC  A +KR A ++LPFHK    DG   D+ P  +TVN+ VL  APCSV IL++RG   
Sbjct  542   DICATAADKRTALIMLPFHKSPRLDGHF-DSTPGFRTVNQKVLKHAPCSVAILIDRGVGG  600

Query  867   -----PNQYAKNIAVLYLGGPDDREALTYARRMSGLPGVHLTVIRFVPAKDVSADG  715
                   +    N+ V + GGPDDREAL Y  RM+  PGV L VIRF+    V  DG
Sbjct  601   SAQVPSSNVDHNVVVYFFGGPDDREALAYGFRMAEHPGVKLHVIRFLSHSVVMDDG  656



>ref|XP_009802616.1| PREDICTED: cation/H(+) antiporter 18-like [Nicotiana sylvestris]
Length=801

 Score =   397 bits (1021),  Expect = 7e-120, Method: Compositional matrix adjust.
 Identities = 274/781 (35%), Positives = 444/781 (57%), Gaps = 39/781 (5%)
 Frame = -3

Query  2628  SNGVWEGPDPLAPMIPLFILQIMTAILSSRILNFVLKPFNQPPLVAEILSGIILGPSMLG  2449
             SNGV++G DPL   +PL I+QI   ++ +R+L ++L+P  QP +VAEI+ GI+LGPS LG
Sbjct  18    SNGVFQGDDPLDYALPLAIVQICLVLVLTRVLAYLLRPLRQPRVVAEIIGGILLGPSALG  77

Query  2448  NIEEFRKHNFPNHNFETIETMGHFALVLYAFLTGLQMDVKAIVHTGTKSRIVAVSGSIFP  2269
               E++    FP  +   ++T+ +F L+ + FL GL++D K++  TG K+  +AV+G   P
Sbjct  78    RNEKYLHTIFPPKSLTVLDTLANFGLLFFLFLVGLELDPKSLRRTGKKALCIAVAGISLP  137

Query  2268  FLIGAGFYFTLQTDTQSMIG----FIFCGSALTVTGFSTLAKILDSKRLLNTEIGKIAAS  2101
             F++G G  F L+      +      +F G AL++T F  LA+IL   +LL T++G++A S
Sbjct  138   FVLGIGTSFALRATISKGVNQGPFLVFMGVALSITAFPVLARILAELKLLTTDVGRMAMS  197

Query  2100  SALINVALSWVLLTIGLLFTGSLDN---VQWAvlctvgfvvvcvnyVRPLLNWLISKTPE  1930
             +A +N   +W+LL + +  +G+  +     W +LC  GFV++C+    P+  W+  +  +
Sbjct  198   AAAVNDVAAWILLALAIALSGTTSSPLISLWVLLCGAGFVILCIFIGPPIFKWMARRCSD  257

Query  1929  GQGFSEFYICSFIAVICAFGCFTDAMGSHPMIGAFIFGLIMPNNELLRTAILDRLEDFVM  1750
             G+   E Y+C+ +A + A G  TD +G H + GAF+ G+++P       A+++++ED V 
Sbjct  258   GEHVDEIYVCATLAAVLAAGFVTDTIGIHALFGAFVLGVLVPKEGPFAGALVEKVEDLVS  317

Query  1749  GILMPVFFLVCGLRTNIFTITDGDTSIFTALALILLACSAKIIAALVASCYTGMSTNEAI  1570
             G+ +P++F+  GL+TN+ TI  G  S    + +I  +C  KI+  +V S    M   EA+
Sbjct  318   GLFLPLYFVSSGLKTNVATI-QGAQSWGLLVLVIFTSCFGKIVGTIVVSLLCKMPMQEAL  376

Query  1569  GLGVLTNTKSTMVMIILEVGqvqqvlsvqqysmmvVACLIMTIVATPLA-ARYCP-KQDL  1396
              LG L NTK  + +I+L +G+ + VL+ Q +++MV+  L  T + TP+  + Y P K  +
Sbjct  377   TLGFLMNTKGLVELIVLNIGKDRGVLNDQTFAIMVLMALFTTFITTPIVISIYKPAKLAV  436

Query  1395  EPYKRRTIQNAKPGEELRILACIHGTNNLPAIISLLETSNSTVTSP-ITAFGVQLLELVG  1219
               YK RTI+     +++R+L C + T N+P +I+L+E S  T     +  + + L+EL  
Sbjct  437   TEYKHRTIERKDTSKQVRMLTCFYSTRNIPTLINLIEVSRGTEKREGLRVYAMHLMELSE  496

Query  1218  RAPAMMvvhssgsgrhvggsHEEVQTS-QIISTFDNYELRSHGVTAQVLTARWSYDTMAE  1042
             R+ A+++VH          +  EV  S Q++  F+ +E  S  V+ +  TA    ++M E
Sbjct  497   RSSAILMVHKVKRNGLPFWNKGEVTDSNQVVVAFETFEHLSK-VSIRPTTAISPMNSMHE  555

Query  1041  DICKMAKEKRAAFLVLPFHKQQGTDGEMEDTNPAIQTVNEGVLLSAPCSVGILVER---G  871
             DI   A+ KR A ++LPFHK Q  DG  E T   ++ VN  VL  APCSVGILV+R   G
Sbjct  556   DIITSAERKRVAMIILPFHKHQRLDGHFETTRTDLRHVNRRVLQHAPCSVGILVDRGLGG  615

Query  870   RPNQYAKN----IAVLYLGGPDDREALTYARRMSGLPGVHLTVIRFVPAKDVSADGAVED  703
               +  A N    I +L+ GG DDREAL Y  RM+  PGV L V+RFV       D  V  
Sbjct  616   ASHVSASNVDFTITILFFGGHDDREALAYGVRMAEHPGVTLIVVRFV------VDPEVAG  669

Query  702   PDLELELTRETSFVTVSIDPARDKEEDEELLNNFRTETAEDDSKTFMELVLDDEEEFTKA  523
               +++++ + +S          + + DE LL+  +   ++D S  + E  + D  E  +A
Sbjct  670   GSVKIDMNQNSSL---------EAQPDEVLLSGLKQRISKDGSIKYEERTIKDAAETFEA  720

Query  522   VKSLDDRSFDLYVAGRGRGVSSALTSGLADWCECPELGAVGDllvtsefessfsvlvVQQ  343
             +K+ +  +  L     GR     + + L    ECPELG +G+LL++SEF ++ SVLVVQQ
Sbjct  721   IKTYNRCNLFLV----GRMPEGQVVAALNKKSECPELGPIGNLLISSEFSTTASVLVVQQ  776

Query  342   Y  340
             Y
Sbjct  777   Y  777



>ref|XP_011036077.1| PREDICTED: cation/H(+) antiporter 15-like [Populus euphratica]
Length=812

 Score =   397 bits (1021),  Expect = 7e-120, Method: Compositional matrix adjust.
 Identities = 283/792 (36%), Positives = 416/792 (53%), Gaps = 71/792 (9%)
 Frame = -3

Query  2667  GQVVMCFSQTIYRSNGVWEGPDPLAPMIPLFILQIMTAILSSRILNFVLKPFNQPPLVAE  2488
             G + +C  + +  S  V +  +P     P F+  + TAIL  ++L  +      P   +E
Sbjct  30    GALNVCSYEAVSNSTTVRKISNPFLDATP-FVTNLCTAILLIQLLFLLFHRL--PRFFSE  86

Query  2487  ILSGIILGPSMLGNIEEFRKHNFPNHNFETIETMGHFALVLYAFLTGLQMDVKAIVHTGT  2308
             +++G+++GP  LG    F ++  P       ET+ +  ++ Y FL GLQMD+  I     
Sbjct  87    LITGLLMGPMALGANALFSEYTHPMRLTGATETLTNLGVIYYMFLVGLQMDLTTIRRISK  146

Query  2307  KSRIVAVSGSIFPFLIGAGFYFTL--QTDTQSMIGFIFCGSALTVTGFSTLAKILDSKRL  2134
              +   A+ G + P  +GAG +  L  +T  ++ +G  F   ALTVT F  LA+IL   +L
Sbjct  147   GAWGNALFGILLPLGMGAGLFHLLPGKTHFENPLGAWFWSVALTVTSFPDLAQILSDLKL  206

Query  2133  LNTEIGKIAASSALINVALSWVLLTIGLLFTGSLDNVQWAvlctvgfvvvcvnyVRPLLN  1954
             L TE+G++A SSA ++   SW  L + +                                
Sbjct  207   LRTEVGQMAISSAFVSDIASWSFLVVTIT-------------------------------  235

Query  1953  WLISK-TPEGQGFSEFYICSFIAVICAFGCFTDAMGSHPMIGAFIFGLIMPNNELLRTAI  1777
              +I K + +G  +S+  I S +  +   G  TDA GSH MIGAF+FGLI+P+ EL    I
Sbjct  236   -IIDKDSSKGGNYSDLCIYSILTGVVVCGFITDACGSHSMIGAFMFGLIIPDGEL-GMMI  293

Query  1776  LDRLEDFVMGILMPVFFLVCGLRTNIFTITDGDTSIFTALALILLACSAKIIAALVASCY  1597
             +++LEDFV  I++P FF++ G R NI  +   + + F  L +++LAC AKII+  + + Y
Sbjct  294   MEKLEDFVPVIMLPAFFVLTGTRCNILDMFY-NINPFAVLGIVVLACLAKIISGFLVAMY  352

Query  1596  TGMSTNEAIGLGVLTNTKSTMVMIILEVGqvqqvlsvqqysmmvVACLIMTIVATPLAAR  1417
              GM   E + LGVL N K  + +IIL VG+  + +  Q +++MV+  L MTI+  P+   
Sbjct  353   YGMPVREGVALGVLMNAKGVLALIILNVGRDIKAVDNQPFAIMVMTILFMTILVKPIPLW  412

Query  1416  YCPK-QDLEPYKRRTIQNAKPGEELRILACIHGTNNLPAIISLLETSNSTVTSPITAFGV  1240
              C   +    YK RT+Q +KP  ELRILACIH T NL  I++LLE SNST  SPI  F  
Sbjct  413   ACKTTKHFRKYKLRTLQESKPNSELRILACIHTTRNLSGILNLLELSNSTEKSPICVFAA  472

Query  1239  QLLELVGRAPAMMvvhssgsgrhvgg---sHEEVQTSQIISTFDNYELRSHGVTAQVLTA  1069
              L+ L GR  AM++VH             +        IIST +NYE R+  ++   LT 
Sbjct  473   CLVGLSGRTNAMLIVHDENRNSSGQNYPPARGRSDADHIISTLENYERRNQSMSLLPLTV  532

Query  1068  RWSYDTMAEDICKMAKEKRAAFLVLPFHKQQGTDGEMEDTNPAIQTVNEGVLLSAPCSVG  889
                Y +M EDI  +A++KR  F+++PFHKQ G +G M+  N +I+ VN+ +L  APCSVG
Sbjct  533   VSPYTSMHEDIHNLAEDKRVTFILIPFHKQSGAEG-MQQENSSIRLVNQNLLTKAPCSVG  591

Query  888   ILVER---------GRPNQYAKNIAVLYLGGPDDREALTYARRMSGLPGVHLTVIRFVPA  736
             I ++R         G   +   N A+ Y GG DDREALTYA RM+G   V L VIRF+P 
Sbjct  592   IFIDRGLSLKIYNEGSHRREKLNFAMFYTGGHDDREALTYACRMAGSLNVSLKVIRFLPG  651

Query  735   KDVSADGAVEDPDLELELTRETSFVTVSIDPARDKEEDEELLNNFRTETAEDDSKTFMEL  556
             K+      +E    E        FV            D+  LN  R  T  + S T+++ 
Sbjct  652   KEAIEMMDME----EEVEGENQRFV------------DDMYLNELRFMTMCNPSVTWVDK  695

Query  555   VLDDEEEFTKAVKSLDDRSFDLYVAGRGRGVSSALTSGLADWCECPELGAVGDllvtsef  376
              ++  +E   A K L D  +DLY+ GRG+G+      GL++W  C ELG +GD L TS+F
Sbjct  696   SVNSGDEIIIAAKDLADE-YDLYIVGRGQGMIKPFALGLSEWSNCEELGPLGDALSTSDF  754

Query  375   essfsvlvVQQY  340
                 S+LVVQQ+
Sbjct  755   VQHASILVVQQH  766



>ref|XP_010096456.1| Cation/H(+) antiporter 18 [Morus notabilis]
 ref|XP_010101601.1| Cation/H(+) antiporter 18 [Morus notabilis]
 gb|EXB64344.1| Cation/H(+) antiporter 18 [Morus notabilis]
 gb|EXB88791.1| Cation/H(+) antiporter 18 [Morus notabilis]
Length=792

 Score =   396 bits (1018),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 268/784 (34%), Positives = 447/784 (57%), Gaps = 40/784 (5%)
 Frame = -3

Query  2628  SNGVWEGPDPLAPMIPLFILQIMTAILSSRILNFVLKPFNQPPLVAEILSGIILGPSMLG  2449
             SNGV++G +PL   +PL ILQI+  ++ +R+L F+L+P  QP ++AEI+ GI+LGPS LG
Sbjct  19    SNGVFQGDNPLDYALPLAILQILLVVVVTRVLAFLLRPLRQPRVIAEIVGGILLGPSALG  78

Query  2448  NIEEFRKHNFPNHNFETIETMGHFALVLYAFLTGLQMDVKAIVHTGTKSRIVAVSGSIFP  2269
              I  +R   FP  +   ++T+ +  L+ + FL GL++D+KA+  TG K+  +A++G   P
Sbjct  79    RIASYRNAIFPAKSLTVLDTLANLGLLFFMFLVGLELDLKALHRTGKKAFSIALAGISLP  138

Query  2268  FLIGAGFYFTLQ-TDTQSMIG---FIFCGSALTVTGFSTLAKILDSKRLLNTEIGKIAAS  2101
             F++G G  F L+ T ++ + G    +F G AL++T F  LA+IL   +LL T++G++A S
Sbjct  139   FILGIGTSFALRATISKGVQGPAFLVFMGVALSITAFPVLARILAELKLLTTDVGRMAMS  198

Query  2100  SALINVALSWVLLTIGLLFTGSLDN---VQWAvlctvgfvvvcvnyVRPLLNWLISKTPE  1930
             +A +N   +W+LL + +  +G   +     W  LC   FV+ C   V P+  W+  + P+
Sbjct  199   AAAVNDVAAWILLALAIALSGDKSSPLVSLWVFLCGSAFVLCCAFGVPPIFKWMAQRCPK  258

Query  1929  GQGFSEFYICSFIAVICAFGCFTDAMGSHPMIGAFIFGLIMPNNELLRTAILDRLEDFVM  1750
              +   E Y+C+ +A + A G  TDA+G H + GAF+ G+++P       A+++++ED V 
Sbjct  259   DEPVKELYVCATLATVLAAGFVTDAIGIHALFGAFVIGVLVPKEGAFAGAMVEKVEDLVS  318

Query  1749  GILMPVFFLVCGLRTNIFTITDGDTSIFTALALILLACSAKIIAALVASCYTGMSTNEAI  1570
             G+ +P++F+  GL+T+I TI+ G  S    + +I+ AC  K++  +  S ++ +   E++
Sbjct  319   GLFLPLYFVSSGLKTDIATIS-GAQSWGLLVLVIITACFGKVVGTVAVSLFSKVPLQESL  377

Query  1569  GLGVLTNTKSTMVMIILEVGqvqqvlsvqqysmmvVACLIMTIVATPLA-ARYCP-KQDL  1396
              LG L NTK  + +I+L +G+ ++VL+ Q +++MV+  +  T + TPL  A Y P K+  
Sbjct  378   ALGFLMNTKGLVELIVLNIGKDRKVLNDQTFAIMVLMAVFTTFITTPLVMAVYKPTKRSK  437

Query  1395  EPYKRRTIQNAKPGEELRILACIHGTNNLPAIISLLETSNSTVTSP-ITAFGVQLLELVG  1219
               YK R+I       ELRILAC +   N+P +I+L+E S  T     +  + + L+EL  
Sbjct  438   NYYKDRSIGKKGTNTELRILACFYSIRNIPTMINLIEASRGTEKKERLCVYAMHLMELTE  497

Query  1218  RAPAMMvvhssgsgrhvggsHEEVQTS-QIISTFDNYELRSHGVTAQVLTARWSYDTMAE  1042
             R+ A+ +V  +        + E    S QI+  F+ ++  S  V+ + +TA  +   M E
Sbjct  498   RSSAIQMVQKARKNGLPFWNKESQSNSDQIVVAFEAFQQLSQ-VSIRPMTAISAMSEMHE  556

Query  1041  DICKMAKEKRAAFLVLPFHKQQGTDGEMEDTNPAIQTVNEGVLLSAPCSVGILVERG---  871
             DIC  A+ KRAA ++L FHK Q  DG +E T    + VN+ VL  APCSVGILV+RG   
Sbjct  557   DICMSAERKRAAMIILVFHKHQRLDGALETTRAEFRGVNKKVLEQAPCSVGILVDRGLGG  616

Query  870   ----RPNQYAKNIAVLYLGGPDDREALTYARRMSGLPGVHLTVIRFVPAKDVSADG-AVE  706
                   +  + NI +L+ GG DD EAL +  RM+  PG+ L VI  +P   ++    A+ 
Sbjct  617   TTHISASHVSSNITILFFGGHDDCEALAFGMRMAEHPGISLNVIHLLPCPTMTTKAKAIV  676

Query  705   DPDLELELTRETSFVTVSIDPARDKEEDEELLNNFRTETAEDDSKTFMELVLDDEEEFTK  526
               D       + S   +S +P     +DE  L   + + + + S  +    +   E +++
Sbjct  677   TVD------NQDSDSNISFEP-----QDENALAELKQKLSANGSIKYQ---VKRVENYSQ  722

Query  525   AVKSLDDRS-FDLYVAGRG-RGVSSALTSGLADWCECPELGAVGDllvtsefessfsvlv  352
             +V ++ + S  +L++ GR   GV   +    +   ECPELG VG+LL +++F ++ SVLV
Sbjct  723   SVAAIKEFSGCNLFLVGRNPEGV---VAKAFSVKSECPELGPVGNLLTSADFTTTASVLV  779

Query  351   VQQY  340
             VQQ+
Sbjct  780   VQQH  783



>ref|XP_007225273.1| hypothetical protein PRUPE_ppa001482mg [Prunus persica]
 gb|EMJ26472.1| hypothetical protein PRUPE_ppa001482mg [Prunus persica]
Length=816

 Score =   397 bits (1019),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 280/796 (35%), Positives = 446/796 (56%), Gaps = 50/796 (6%)
 Frame = -3

Query  2628  SNGVWEGPDPLAPMIPLFILQIMTAILSSRILNFVLKPFNQPPLVAEILSGIILGPSMLG  2449
             SNG ++G +PL   +PL ILQI   ++ +R L F+LKP  QP ++AE++ GI+LGPS LG
Sbjct  15    SNGSFQGENPLDFALPLLILQICLVVVFTRTLAFLLKPLRQPRVIAEVIGGILLGPSALG  74

Query  2448  NIEEFRKHNFPNHNFETIETMGHFALVLYAFLTGLQMDVKAIVHTGTKSRIVAVSGSIFP  2269
               E+F    FP  +   ++T+ +  L+ + FL GL++D++AI  TG KS  +AV+G   P
Sbjct  75    RSEKFLHTVFPAKSMTVLDTVANIGLLFFLFLIGLELDIRAIRRTGKKSLGIAVAGITLP  134

Query  2268  FLIGAGFYFTLQTDTQSMIG----FIFCGSALTVTGFSTLAKILDSKRLLNTEIGKIAAS  2101
             F++G    F L++     +      +F G AL++T F  LA+IL   +LL T++G+IA S
Sbjct  135   FVLGVFTSFVLRSTVSKGVSQGPFLVFIGVALSITAFPVLARILAELKLLTTDVGRIAMS  194

Query  2100  SALINVALSWVLLTIGLLFTGS----LDNVQWAvlctvgfvvvcvnyVRPLLNWLISKTP  1933
             +A IN   +W+LL + +  TG+    L +V W +LC  GFV  C+  +RPLL  +  ++P
Sbjct  195   AAAINDVAAWILLALAIALTGTNTSPLVSV-WVLLCGAGFVGFCIFALRPLLAMMARRSP  253

Query  1932  EGQGFSEFYICSFIAVICAFGCFTDAMGSHPMIGAFIFGLIMPNNELLRTAILDRLEDFV  1753
             EG+   E YIC  ++++ A    TD +G H + GAF+ G+++P +      +++++ED V
Sbjct  254   EGEPVKELYICITLSLVLAASFVTDTIGIHALFGAFVVGIVVPKDGPFAGVLIEKIEDLV  313

Query  1752  MGILMPVFFLVCGLRTNIFTITDGDTSIFTALALILLACS-AKIIAALVASCYTGMSTNE  1576
              G+ +P++F+  GL+TN+ TI+ G +  +  L L++   S  KI+  +  S    +   E
Sbjct  314   SGLFLPLYFVSSGLKTNVATISGGLS--WGLLVLVIFTASFGKIVGTVALSMMCKVHFRE  371

Query  1575  AIGLGVLTNTKSTMVMIILEVGqvqqvlsvqqysmmvVACLIMTIVATPLA-ARYCPKQD  1399
             A+ LG L NTK  + +I+L +G+ ++VL+ Q +++ V+  L  T + TPL  A Y P + 
Sbjct  372   ALALGFLMNTKGLVELIVLNIGKDRKVLNDQTFAIFVLMALFTTFITTPLVMAIYKPARR  431

Query  1398  LEPYKRRTIQNAKPGEELRILACIHGTNNLPAIISLLETSNSTVT-SPITAFGVQLLELV  1222
               PYK R+     P  ELR+LAC H T N+P +I+L+E+S  T     +T + + L+EL 
Sbjct  432   GAPYKNRSFFRKNPDTELRMLACFHSTRNIPTMINLIESSRGTRKRGRLTVYAMHLMELS  491

Query  1221  GRAPA--MMvvhssgsgrhvggsHEEVQTSQ--IISTFDNYELRSHGVTAQVLTARWSYD  1054
              R+ A  M+               ++  +++  ++  F+ YE  S  V  + +TA  S +
Sbjct  492   ERSSAISMVHKARYNGLPFWNKKTDDTNSNKDHMVIAFEAYEQLST-VKVRPMTAISSLN  550

Query  1053  TMAEDICKMAKEKRAAFLVLPFHKQQGTDGEMEDTNPAIQTVNEGVLLSAPCSVGILVER  874
              + EDIC  A  K  A ++LPFHK Q  DG ME    + ++VNE VL  APCSVGILV+R
Sbjct  551   DIHEDICASAHHKSVAMILLPFHKHQRLDGTMESLGNSFRSVNERVLRHAPCSVGILVDR  610

Query  873   G-------RPNQYAKNIAVLYLGGPDDREALTYARRMSGLPGVHLTVIRFV--PAKDV--  727
             G         +  + N+ V + GG DDREAL Y  R++  PG+ +T+++FV  P K +  
Sbjct  611   GLGGTAQVSASDVSYNVVVAFFGGRDDREALAYGMRLAEHPGIVMTLVKFVAPPGKTLIF  670

Query  726   SADGAVEDPDLELELTRETSFVTVSIDPARDKEEDEELL------NNFRTETAEDDSKTF  565
              A       D   ++ +E        D   +KE+DE  L       N + +   + S  +
Sbjct  671   GAKLVGITSDKNKKIVKEE-------DCGDEKEDDESFLAEYMSVRNSKNKEGGEPSMLY  723

Query  564   MELVLDDEEEFTKAVKSLDDRSFDLYVAGRGRGVSSALTSGLAD-WCECPELGAVGDllv  388
              E V++ + E    +KS+  R+ +L+V GR        T+ L D   +C ELG VG  L 
Sbjct  724   EEKVVESKAEICVVLKSM-GRNVNLFVVGR-----MPPTAPLVDSTSDCAELGPVGSFLA  777

Query  387   tsefessfsvlvVQQY  340
             +SEF S+ SV+V+QQY
Sbjct  778   SSEFSSTASVVVLQQY  793



>ref|XP_006405324.1| hypothetical protein EUTSA_v10027645mg [Eutrema salsugineum]
 gb|ESQ46777.1| hypothetical protein EUTSA_v10027645mg [Eutrema salsugineum]
Length=812

 Score =   396 bits (1018),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 272/783 (35%), Positives = 434/783 (55%), Gaps = 35/783 (4%)
 Frame = -3

Query  2628  SNGVWEGPDPLAPMIPLFILQIMTAILSSRILNFVLKPFNQPPLVAEILSGIILGPSMLG  2449
             SNGV++G +P+   +PL ILQI+  ++ +R+L ++L+P  QP ++AE++ GI+LGPS+LG
Sbjct  19    SNGVFQGDNPIDFALPLAILQIVIVVVLTRVLAYLLRPLRQPRVIAEVIGGIMLGPSLLG  78

Query  2448  NIEEFRKHNFPNHNFETIETMGHFALVLYAFLTGLQMDVKAIVHTGTKSRIVAVSGSIFP  2269
               + F    FP  +   +ET+ +  L+ + FL GL++D K++  TG K+  +A++G   P
Sbjct  79    RSKVFLDAVFPKKSLTVLETLANLGLLFFLFLAGLEIDTKSLRQTGKKALGIALAGISLP  138

Query  2268  FLIGAGFYF----TLQTDTQSMIGFIFCGSALTVTGFSTLAKILDSKRLLNTEIGKIAAS  2101
             F +G G  F    T+     S+   IF G AL++T F  LA+IL   +LL TEIG++A S
Sbjct  139   FALGIGSSFVLRATISKGVDSIAFLIFMGVALSITAFPVLARILAELKLLTTEIGRLAMS  198

Query  2100  SALINVALSWVLLTIGLLFTGSLDN---VQWAvlctvgfvvvcvnyVRPLLNWLISKTPE  1930
             +A +N   +W+LL + +  +GS  +     W  L    FV+V    + P+  W+  +  E
Sbjct  199   AAAVNDVAAWILLALAIALSGSDTSPLVSLWVFLSGCAFVIVAAIIIPPIFKWIARRCHE  258

Query  1929  GQGFSEFYICSFIAVICAFGCFTDAMGSHPMIGAFIFGLIMPNNELLRTAILDRLEDFVM  1750
             G+   E YIC+ +AV+   G  TDA+G H M GAF+ G+++P       A+++++ED V 
Sbjct  259   GEPVEETYICTTLAVVLVCGFITDAIGIHSMFGAFVVGVLIPKEGPFAGALVEKVEDLVS  318

Query  1749  GILMPVFFLVCGLRTNIFTITDGDTSIFTALALILLACSAKIIAALVASCYTGMSTNEAI  1570
             G+ +P++F+  GL+TN+ TI  G  S    + +   AC  KI   L  S    +   EA+
Sbjct  319   GLFLPLYFVASGLKTNVATI-QGAQSWGLLVLVTFTACFGKIAGTLGVSLAFKIPMREAV  377

Query  1569  GLGVLTNTKSTMVMIILEVGqvqqvlsvqqysmmvVACLIMTIVATPLA-ARYCPKQDLE  1393
              LG L NTK  + +I+L +G+ ++VL+ Q +++MV+  L  T + TP+  A Y P +  +
Sbjct  378   ALGFLMNTKGLVELIVLNIGKDRKVLNDQTFAIMVLMALFTTFITTPVVMAVYKPARRAK  437

Query  1392  P---YKRRTIQNAKPGEELRILACIHGTNNLPAIISLLETSNSTVTSP-ITAFGVQLLEL  1225
                 YK RT++      +LRIL C HG+ ++P+II+LLE S        +  + + L EL
Sbjct  438   KEGEYKHRTVERDNTNTQLRILTCFHGSGSIPSIINLLEASRGIEKGEGLCVYALHLREL  497

Query  1224  VGRAPAMMvvhssgsgrhvggsHEEVQTSQIISTFDNYELRSHGVTAQVLTARWSYDTMA  1045
               R+ A+++VH          +  E+   Q++  F  ++  S  VT + +TA  S   + 
Sbjct  498   SERSSAILMVHKVRRNGMPFWNRREINADQVVVAFQAFQQLSR-VTVRPMTAISSMSDIH  556

Query  1044  EDICKMAKEKRAAFLVLPFHKQQGTDGEMEDTNPAIQTVNEGVLLSAPCSVGILVERG--  871
             EDIC  A  KRAA ++LPFHK Q  DG +E T    + +N  VLL APCSVGI V+RG  
Sbjct  557   EDICTTASRKRAAIVILPFHKHQQLDGSLETTRGDYRWINRRVLLEAPCSVGIFVDRGLG  616

Query  870   -----RPNQYAKNIAVLYLGGPDDREALTYARRMSGLPGVHLTVIRFVPAKDVSADGAVE  706
                       + ++  L+ GG DDREAL Y  RM+  PG+ LTV RFV + +    G + 
Sbjct  617   GSSQVSAQDVSYSVVALFFGGCDDREALAYGLRMAEHPGISLTVFRFVVSPE--RIGEIT  674

Query  705   DPDLELELTRETSFVTVSIDPARDKEEDEELLNNFRTETAEDDSKTFMELVLDDEE-EFT  529
               D+      E           ++   DEE+++  R ++  D+S   +E  +++   +  
Sbjct  675   RVDVNNNNNSENQI-------GKNLNSDEEVMSVIRKKSEVDESIKLVERRVENAAVDVR  727

Query  528   KAVKSLDDRSFDLYVAGRGRGVSSALTSGLADWCECPELGAVGDllvtsefessfsvlvV  349
              A++ +  R  +L++ GR  G   AL   + +  ECPELG VG LL++ E  +  SVLV+
Sbjct  728   SAIEEM--RRSNLFLVGRMPGGEIAL--AIRENSECPELGPVGSLLISPESSTRASVLVI  783

Query  348   QQY  340
             QQY
Sbjct  784   QQY  786



>ref|XP_010921563.1| PREDICTED: cation/H(+) antiporter 15-like [Elaeis guineensis]
Length=855

 Score =   397 bits (1021),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 272/825 (33%), Positives = 448/825 (54%), Gaps = 63/825 (8%)
 Frame = -3

Query  2652  CFSQTIYRSNGVWEGPDPLAPMIPLFILQIMTAILSSRILNFVLKPFNQPPLVAEILSGI  2473
             C+S     S GVW G +    + P+F++Q++  +  +R+++F+LKP  QP +VAE L+GI
Sbjct  8     CYSPESIGSPGVW-GLNIFNYIFPVFMVQLLAVVFMTRVVSFLLKPLRQPNVVAETLAGI  66

Query  2472  ILGPSMLGNIEEFRKHNFPNHNFETIETMGHFALVLYAFLTGLQMDVKAIVHTGTKSRIV  2293
             +LGPS LG    +     P+ NF  ++   +FAL  Y F+  +++DV  I   G K  ++
Sbjct  67    LLGPSFLGLFFNYIYFRLPDQNFVILDVAANFALTYYMFMVAVELDVVTIWRMGKKVVVI  126

Query  2292  AVSGSIFPFLI-------------------GAGFYFTLQTDTQSMIGF-IFCGSALTVTG  2173
             AV G + PF++                   GA          Q ++ F +F   A+++TG
Sbjct  127   AVVGMVLPFVVSFTSARALGLRPGMTILKFGAVDPAIKAGKDQMLVPFLVFISLAVSLTG  186

Query  2172  FSTLAKILDSKRLLNTEIGKIAASSALINVALSWVLLTIGLLFTGSLDNVQ-------WA  2014
                L++I+   +LLN+ +G ++  SA+IN  ++W+LL      TG+ ++         W 
Sbjct  187   LPVLSRIITELKLLNSPLGPLSMGSAIINDMVAWILLAFVTAATGAKEDKPVFWLAPLWI  246

Query  2013  vlctvgfvvvcvnyVRPLLNWLISKTPEGQGFSEFYICSFIAVICAFGCFTDAMGSHPMI  1834
              +    FV++C   VRP + W+  +TPEG+  S+ ++   +A + A G  TD +G H   
Sbjct  247   TIAGAAFVLLCFYVVRPAIEWMARRTPEGERMSDLHLGIILAGVPAAGFLTDLIGIHSFF  306

Query  1833  GAFIFGLIMPNNELLRTAILDRLEDFVMGILMPVFFLVCGLRTNIFTITDGDTSIFTALA  1654
             G+F++GL +P   +    +++R+E F+  +L+P+FF   G R N+ +I     +I +  A
Sbjct  307   GSFMYGLAVPAGPI-TAHLIERMEPFLDNMLLPLFFANSGYRANLNSILP-PWAIGSCAA  364

Query  1653  LILLACSAKIIAALVASCYTGMSTNEAIGLGVLTNTKSTMVMIILEVGqvqqvlsvqqys  1474
             L++LA  AK+   ++ + +  MS  +++ L  L + +  + +IIL V   +++L    ++
Sbjct  365   LVILATFAKVAGTIIVALFYSMSFRDSLALAFLMSVRGPVEIIILNVAIDKRMLRGDMFA  424

Query  1473  mmvVACLIMTIVATPLA--ARYCPKQDLEPYKRRTIQNAKPGEELRILACIHGTNNLPAI  1300
             ++++  LI T +A P+   A   P + L  Y  R IQ A+P  ELR+LAC+H T ++ ++
Sbjct  425   VILITSLITTALAAPVVTLAYTKPSEPLAAYHLRNIQGARPEAELRMLACVHNTRHVHSL  484

Query  1299  ISLLETSNSTVTSPITAFGVQLLELVGRAPAMMvvhssgsgrhvggs-------------  1159
               LL+ SN +  SPI  + + L+E+VGR  +M+++H S    H   +             
Sbjct  485   TYLLDVSNPSKRSPIFIYALHLVEVVGRVSSMLIMHPSADQSHHNHNRGSGHGHRHRPSL  544

Query  1158  -HEEVQTSQIISTFDNYELRSHGVTAQVLTARWSYDTMAEDICKMAKEKRAAFLVLPFHK  982
              + + Q+  I++  + Y+  S GV+ Q LTA   + +M EDIC +A+E+  + +VLPFHK
Sbjct  545   PYGQAQSESILAAIEGYKQHSAGVSFQPLTAFSQHASMHEDICSVAEERHVSLIVLPFHK  604

Query  981   QQGTDGEMEDT-NPAIQTVNEGVLLSAPCSVGILVERGR--------PNQYAK-NIAVLY  832
                 DG ME+     ++ +N  VL +APCSV ILV+ G         P   A  ++A+++
Sbjct  605   YVTIDGAMEEVAGTDVRPINLNVLANAPCSVAILVDCGLDSGTTSHFPGHRASYHVALVF  664

Query  831   LGGPDDREALTYARRMSGLPGVHLTVIRFVPAKDVSADGAVEDPDLELELTRETSFVTVS  652
             +GGPDDREAL YA RM+  P + LTVIRF+    +S   ++   +   E+  + S +   
Sbjct  665   IGGPDDREALAYAWRMAEHPAIVLTVIRFIAVDPISRSQSMCSVN---EMENDMSLLA--  719

Query  651   IDPARDKEEDEELLNNFRTETAEDDSKTFMELVLDDEEEFTKAVKSLDDRSFDLYVAGRG  472
                  +KE DEE +  FR      +S  F E +  D  E    ++ +   ++DLYV GR 
Sbjct  720   -HHELEKERDEEAVKEFRLRFVSHESVVFTEKLASDSGETVAVLREMGS-NYDLYVVGRN  777

Query  471   RGVSSALTSGLADWCECPELGAVGDllvtsefessfsvlvVQQYV  337
              G  SALT+GL  W E PELG +GDLLV+S+F    SVLVVQQYV
Sbjct  778   HGRKSALTAGLEQWSEFPELGPIGDLLVSSDFGVKVSVLVVQQYV  822



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 9487269618948