BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c61030_g1_i1 len=124 path=[1:0-123]

Length=124
                                                                      Score     E

ref|WP_031390451.1|  ribose 5-phosphate isomerase                     61.2    2e-10   
ref|WP_033163481.1|  ribose 5-phosphate isomerase                     59.7    8e-10   
ref|WP_018373659.1|  ribose 5-phosphate isomerase                     59.3    1e-09   
ref|WP_026792942.1|  ribose 5-phosphate isomerase                     58.9    1e-09   
ref|WP_032091042.1|  ribose 5-phosphate isomerase                     58.9    2e-09   
ref|WP_026784939.1|  ribose 5-phosphate isomerase                     58.9    2e-09   
emb|CCZ24051.1|  ribose 5-phosphate isomerase B                       58.9    2e-09   
ref|WP_039299585.1|  ribose 5-phosphate isomerase                     58.2    3e-09   
ref|WP_008455737.1|  ribose 5-phosphate isomerase                     58.2    3e-09   
ref|WP_039289417.1|  ribose 5-phosphate isomerase                     58.2    3e-09   
ref|WP_038476549.1|  ribose 5-phosphate isomerase                     58.2    3e-09   
ref|WP_022937309.1|  ribose 5-phosphate isomerase                     58.2    3e-09   
ref|WP_024379342.1|  ribose 5-phosphate isomerase                     57.8    3e-09   
ref|WP_036378665.1|  ribose 5-phosphate isomerase                     57.8    4e-09   
ref|WP_005843053.1|  ribose 5-phosphate isomerase                     57.8    4e-09   
ref|WP_031540053.1|  ribose 5-phosphate isomerase                     57.4    6e-09   
ref|WP_011662024.1|  ribose 5-phosphate isomerase                     57.0    6e-09   
ref|WP_003089417.1|  ribose 5-phosphate isomerase                     57.0    7e-09   
ref|WP_002464416.1|  ribose 5-phosphate isomerase                     56.6    8e-09   
ref|WP_032272928.1|  ribose 5-phosphate isomerase                     55.8    1e-08   
ref|WP_026791197.1|  ribose 5-phosphate isomerase                     56.6    1e-08   
ref|WP_022693897.1|  ribose 5-phosphate isomerase                     56.6    1e-08   
ref|WP_004228017.1|  ribose 5-phosphate isomerase                     56.6    1e-08   
ref|WP_006443134.1|  ribose 5-phosphate isomerase [                   56.2    1e-08   
ref|WP_004711718.1|  ribose 5-phosphate isomerase                     56.2    1e-08   
ref|WP_004801223.1|  ribose 5-phosphate isomerase B                   56.2    1e-08   
ref|WP_008818196.1|  MULTISPECIES: ribose 5-phosphate isomerase       56.2    1e-08   
ref|WP_010258345.1|  ribose 5-phosphate isomerase                     56.2    1e-08   
ref|WP_038274267.1|  ribose 5-phosphate isomerase [                   56.2    1e-08   
ref|WP_002606900.1|  ribose 5-phosphate isomerase                     56.2    1e-08   
ref|WP_012862852.1|  ribose 5-phosphate isomerase                     56.2    1e-08   
ref|WP_024910707.1|  ribose 5-phosphate isomerase                     56.2    2e-08   
ref|WP_038430201.1|  ribose 5-phosphate isomerase                     55.8    2e-08   
ref|WP_021016588.1|  ribose 5-phosphate isomerase B                   55.8    2e-08   
ref|WP_032272785.1|  ribose 5-phosphate isomerase                     55.8    2e-08   
ref|WP_000716789.1|  ribose 5-phosphate isomerase                     55.8    2e-08   
ref|WP_017867199.1|  hypothetical protein                             55.8    2e-08   
ref|WP_001398149.1|  ribose 5-phosphate isomerase B                   55.8    2e-08   
ref|WP_000716791.1|  ribose 5-phosphate isomerase                     55.8    2e-08   
ref|WP_000716792.1|  MULTISPECIES: ribose 5-phosphate isomerase       55.8    2e-08   
ref|WP_022646445.1|  ribose-5-phosphate isomerase B                   55.8    2e-08   
ref|WP_001428658.1|  ribose 5-phosphate isomerase B                   55.8    2e-08   
ref|WP_000716790.1|  ribose 5-phosphate isomerase                     55.8    2e-08   
ref|WP_000717086.1|  ribose 5-phosphate isomerase                     55.8    2e-08   
ref|WP_001552220.1|  ribose-5-phosphate isomerase B                   55.8    2e-08   
ref|WP_000716796.1|  ribose 5-phosphate isomerase                     55.8    2e-08   
ref|WP_000716794.1|  MULTISPECIES: ribose 5-phosphate isomerase B...  55.8    2e-08   
ref|WP_033170658.1|  ribose 5-phosphate isomerase                     55.8    2e-08   
ref|WP_033810958.1|  ribose 5-phosphate isomerase                     55.8    2e-08   
gb|KDV89279.1|  ribose 5-phosphate isomerase B                        55.5    2e-08   
ref|WP_027975844.1|  ribose 5-phosphate isomerase                     55.8    2e-08   
ref|WP_021102210.1|  Ribose 5-phosphate isomerase B                   55.8    2e-08   
ref|WP_014425753.1|  ribose 5-phosphate isomerase                     55.8    2e-08   
ref|WP_001464890.1|  ribose 5-phosphate isomerase B                   55.8    2e-08   
ref|WP_014068558.1|  ribose 5-phosphate isomerase                     55.8    2e-08   
ref|WP_018373254.1|  ribose 5-phosphate isomerase                     55.8    2e-08   
ref|WP_032153422.1|  ribose 5-phosphate isomerase                     55.8    2e-08   
ref|WP_033555885.1|  ribose 5-phosphate isomerase                     55.5    2e-08   
ref|WP_026759815.1|  MULTISPECIES: ribose 5-phosphate isomerase       55.5    2e-08   
ref|WP_022081361.1|  ribose 5-phosphate isomerase B                   55.5    2e-08   
gb|EOV45686.1|  ribose-5-phosphate isomerase B                        55.1    2e-08   
ref|WP_017770238.1|  galactose-6-phosphate isomerase                  55.5    2e-08   
ref|WP_022144465.1|  ribose 5-phosphate isomerase B                   55.5    2e-08   
ref|WP_025048700.1|  ribose 5-phosphate isomerase                     55.5    2e-08   
ref|WP_032141534.1|  MULTISPECIES: ribose 5-phosphate isomerase       54.7    2e-08   
ref|WP_026782815.1|  ribose 5-phosphate isomerase                     55.5    2e-08   
ref|WP_000724668.1|  ribose 5-phosphate isomerase                     55.5    2e-08   
ref|WP_000716795.1|  ribose 5-phosphate isomerase                     55.5    3e-08   
ref|WP_037910675.1|  ribose 5-phosphate isomerase                     55.5    3e-08   
ref|WP_005226764.1|  ribose 5-phosphate isomerase                     55.5    3e-08   
ref|WP_032698366.1|  ribose 5-phosphate isomerase                     55.5    3e-08   
dbj|GAK85778.1|  ribose 5-phosphate isomerase B                       55.5    3e-08   
ref|WP_032689900.1|  MULTISPECIES: ribose 5-phosphate isomerase       55.5    3e-08   
ref|WP_004856568.1|  MULTISPECIES: ribose 5-phosphate isomerase       55.5    3e-08   
gb|AHE59670.1|  ribose 5-phosphate isomerase B                        55.1    3e-08   
ref|WP_000716787.1|  MULTISPECIES: ribose 5-phosphate isomerase       55.5    3e-08   
gb|EEA92193.1|  ribose-5-phosphate isomerase B                        54.3    3e-08   Pseudovibrio sp. JE062
ref|WP_022318011.1|  ribose-5-phosphate isomerase B                   55.1    3e-08   
ref|WP_034244852.1|  ribose 5-phosphate isomerase                     55.1    3e-08   
ref|WP_011701542.1|  ribose 5-phosphate isomerase                     55.1    3e-08   
ref|WP_009111920.1|  ribose 5-phosphate isomerase                     55.1    3e-08   
ref|WP_017694706.1|  MULTISPECIES: ribose 5-phosphate isomerase       55.1    3e-08   
ref|WP_020834455.1|  ribose-5-phosphate isomerase B                   55.1    3e-08   
ref|WP_023295775.1|  MULTISPECIES: ribose-5-phosphate isomerase B     55.1    3e-08   
ref|WP_010759061.1|  ribose 5-phosphate isomerase B                   55.1    3e-08   
ref|WP_000716788.1|  ribose 5-phosphate isomerase                     55.1    3e-08   
ref|WP_003253675.1|  MULTISPECIES: ribose 5-phosphate isomerase       55.1    3e-08   
ref|WP_016517486.1|  ribose-5-phosphate isomerase B                   55.1    3e-08   
ref|WP_017382646.1|  ribose 5-phosphate isomerase                     55.1    3e-08   
ref|WP_009169875.1|  ribose 5-phosphate isomerase                     55.1    3e-08   
ref|WP_015010770.1|  ribose 5-phosphate isomerase                     55.1    4e-08   
ref|WP_032335405.1|  ribose 5-phosphate isomerase                     54.3    4e-08   
gb|KEO20837.1|  ribose 5-phosphate isomerase B                        54.7    4e-08   
gb|EKI22236.1|  ribose 5-phosphate isomerase B                        54.7    4e-08   
ref|WP_000716786.1|  ribose 5-phosphate isomerase                     55.1    4e-08   
pdb|1NN4|A  Chain A, Structural Genomics, RpibALSB                    55.1    4e-08   
ref|WP_015570214.1|  ribose 5-phosphate isomerase B                   55.1    4e-08   
ref|WP_035886924.1|  ribose 5-phosphate isomerase                     55.1    4e-08   
ref|WP_004127907.1|  ribose 5-phosphate isomerase                     55.1    4e-08   
ref|WP_014092179.1|  ribose 5-phosphate isomerase                     55.1    4e-08   
ref|WP_016609115.1|  ribose-5-phosphate isomerase B                   54.7    4e-08   
ref|WP_008787787.1|  MULTISPECIES: ribose 5-phosphate isomerase       55.1    4e-08   
gb|EFR97769.1|  ribose 5-phosphate isomerase B                        54.7    4e-08   
gb|AIU73660.1|  ribose 5-phosphate isomerase                          54.7    4e-08   
ref|WP_038406878.1|  ribose 5-phosphate isomerase                     54.7    4e-08   
dbj|GAJ38411.1|  ribose 5-phosphate isomerase                         54.7    4e-08   
ref|WP_015865321.1|  ribose 5-phosphate isomerase                     54.7    4e-08   
ref|WP_005337976.1|  MULTISPECIES: ribose 5-phosphate isomerase       54.7    4e-08   
ref|WP_016318583.1|  ribose 5-phosphate isomerase B                   54.7    4e-08   
ref|WP_028041794.1|  ribose 5-phosphate isomerase                     54.7    5e-08   
ref|WP_016224269.1|  ribose 5-phosphate isomerase B                   54.7    5e-08   
ref|WP_009271729.1|  ribose 5-phosphate isomerase                     54.7    5e-08   
ref|WP_003539522.1|  MULTISPECIES: ribose 5-phosphate isomerase       54.7    5e-08   
ref|WP_028129981.1|  ribose 5-phosphate isomerase                     54.7    5e-08   
ref|WP_039774130.1|  ribose 5-phosphate isomerase                     54.3    5e-08   
ref|WP_034595954.1|  hypothetical protein                             54.7    5e-08   
ref|WP_007372516.1|  ribose 5-phosphate isomerase                     54.7    5e-08   
ref|WP_005331952.1|  ribose 5-phosphate isomerase                     54.7    5e-08   
ref|WP_017436879.1|  ribose 5-phosphate isomerase                     54.7    5e-08   
ref|WP_034883810.1|  ribose 5-phosphate isomerase                     54.7    5e-08   
ref|WP_039271998.1|  ribose 5-phosphate isomerase                     54.3    6e-08   
ref|WP_039293120.1|  ribose 5-phosphate isomerase                     54.3    6e-08   
ref|WP_003536003.1|  MULTISPECIES: ribose 5-phosphate isomerase       54.3    6e-08   
ref|WP_024626397.1|  ribose 5-phosphate isomerase                     54.3    6e-08   
ref|WP_036623778.1|  ribose 5-phosphate isomerase                     54.3    6e-08   
ref|WP_033126003.1|  ribose 5-phosphate isomerase                     54.3    6e-08   
gb|EZP75315.1|  ribose-5-phosphate isomerase B                        54.3    6e-08   
ref|WP_009571653.1|  ribose 5-phosphate isomerase                     54.3    6e-08   
ref|WP_025120662.1|  MULTISPECIES: ribose 5-phosphate isomerase       54.3    6e-08   
ref|WP_012907531.1|  ribose 5-phosphate isomerase                     54.3    6e-08   
ref|WP_014279657.1|  ribose 5-phosphate isomerase                     54.3    6e-08   
ref|WP_007428411.1|  ribose 5-phosphate isomerase                     54.3    7e-08   
ref|WP_023986894.1|  MULTISPECIES: ribose 5-phosphate isomerase       54.3    7e-08   
ref|WP_010348368.1|  ribose 5-phosphate isomerase                     54.3    7e-08   
ref|WP_004109409.1|  ribose 5-phosphate isomerase                     54.3    7e-08   
ref|WP_015044923.1|  MULTISPECIES: ribose 5-phosphate isomerase       54.3    7e-08   
ref|WP_026883619.1|  ribose 5-phosphate isomerase                     54.3    7e-08   
ref|WP_006808283.1|  ribose 5-phosphate isomerase                     54.3    7e-08   
ref|WP_009461527.1|  ribose 5-phosphate isomerase                     54.3    7e-08   
ref|WP_012134554.1|  ribose 5-phosphate isomerase                     54.3    8e-08   
ref|WP_025719991.1|  ribose 5-phosphate isomerase                     53.9    8e-08   
ref|WP_013779155.1|  ribose 5-phosphate isomerase                     53.9    8e-08   
ref|WP_024485143.1|  ribose 5-phosphate isomerase                     53.9    8e-08   
gb|AHE73609.1|  ribose 5-phosphate isomerase                          53.9    8e-08   
emb|CDZ85312.1|  ribose-5-phosphate isomerase B                       53.9    8e-08   
ref|WP_032681899.1|  ribose 5-phosphate isomerase                     53.9    8e-08   
ref|WP_014168253.1|  ribose 5-phosphate isomerase                     53.9    8e-08   
ref|WP_016611535.1|  ribose-5-phosphate isomerase B                   53.9    8e-08   
ref|WP_038286535.1|  ribose 5-phosphate isomerase                     53.9    9e-08   
ref|WP_039163183.1|  ribose 5-phosphate isomerase                     53.9    9e-08   
ref|WP_021973797.1|  ribose-5-phosphate isomerase B                   53.9    9e-08   
ref|WP_028092771.1|  ribose 5-phosphate isomerase                     53.9    9e-08   
ref|WP_016459704.1|  MULTISPECIES: ribose 5-phosphate isomerase B     53.9    9e-08   
ref|WP_003539915.1|  ribose 5-phosphate isomerase                     53.9    9e-08   
ref|WP_009015484.1|  MULTISPECIES: ribose 5-phosphate isomerase       53.9    1e-07   
ref|WP_002444945.1|  ribose 5-phosphate isomerase                     53.9    1e-07   
ref|WP_039763450.1|  ribose 5-phosphate isomerase                     53.9    1e-07   
dbj|GAK22348.1|  ribose 5-phosphate isomerase B                       53.5    1e-07   
ref|WP_010742328.1|  ribose 5-phosphate isomerase B                   53.9    1e-07   
ref|WP_008559012.1|  ribose 5-phosphate isomerase                     53.5    1e-07   
ref|WP_026765196.1|  ribose 5-phosphate isomerase                     53.5    1e-07   
ref|WP_011916739.1|  ribose 5-phosphate isomerase                     53.5    1e-07   
ref|WP_025107676.1|  ribose 5-phosphate isomerase                     53.5    1e-07   
ref|WP_032747528.1|  ribose 5-phosphate isomerase                     53.5    1e-07   
ref|WP_034437690.1|  ribose 5-phosphate isomerase                     53.5    1e-07   
ref|WP_004117284.1|  MULTISPECIES: ribose 5-phosphate isomerase       53.5    1e-07   
ref|WP_000444975.1|  ribose 5-phosphate isomerase                     53.5    1e-07   
ref|WP_009705066.1|  MULTISPECIES: ribose 5-phosphate isomerase       53.5    1e-07   
ref|WP_034554201.1|  ribose 5-phosphate isomerase                     53.5    1e-07   
ref|WP_005442339.1|  ribose 5-phosphate isomerase                     53.5    1e-07   
ref|WP_015708210.1|  ribose 5-phosphate isomerase                     53.5    1e-07   
ref|WP_013411501.1|  ribose 5-phosphate isomerase                     53.5    1e-07   
ref|WP_033827504.1|  ribose 5-phosphate isomerase                     53.5    1e-07   
ref|WP_013431970.1|  MULTISPECIES: ribose 5-phosphate isomerase       53.5    1e-07   
ref|WP_020007252.1|  hypothetical protein                             53.5    1e-07   
ref|WP_015879046.1|  ribose 5-phosphate isomerase                     53.5    1e-07   
ref|WP_000716793.1|  ribose 5-phosphate isomerase                     53.5    1e-07   
ref|WP_029542605.1|  ribose 5-phosphate isomerase                     53.1    1e-07   
ref|WP_018380741.1|  ribose 5-phosphate isomerase                     53.1    1e-07   
ref|WP_026486376.1|  ribose 5-phosphate isomerase                     53.1    1e-07   
ref|WP_024731748.1|  ribose 5-phosphate isomerase                     53.1    2e-07   
ref|WP_013711095.1|  ribose 5-phosphate isomerase                     53.1    2e-07   
ref|WP_010899892.1|  ribose 5-phosphate isomerase                     53.1    2e-07   
ref|WP_039125950.1|  ribose 5-phosphate isomerase                     53.1    2e-07   
ref|WP_029042399.1|  ribose 5-phosphate isomerase                     53.1    2e-07   
ref|WP_011652101.1|  ribose 5-phosphate isomerase                     53.1    2e-07   
ref|WP_026444845.1|  ribose 5-phosphate isomerase                     53.1    2e-07   
ref|WP_023458636.1|  ribose 5-phosphate isomerase                     53.1    2e-07   
ref|WP_005182666.1|  ribose 5-phosphate isomerase                     53.1    2e-07   
ref|WP_035602473.1|  ribose 5-phosphate isomerase                     53.1    2e-07   
ref|WP_004137473.1|  ribose-5-phosphate isomerase B                   53.1    2e-07   
ref|WP_010075847.1|  ribose 5-phosphate isomerase                     52.8    2e-07   
ref|WP_009532915.1|  ribose 5-phosphate isomerase                     52.8    2e-07   
ref|WP_026499761.1|  ribose 5-phosphate isomerase                     52.8    2e-07   
ref|WP_017988427.1|  ribose 5-phosphate isomerase                     52.8    2e-07   
ref|WP_027358457.1|  ribose 5-phosphate isomerase                     52.8    2e-07   
ref|WP_027339908.1|  ribose 5-phosphate isomerase                     52.8    2e-07   
ref|WP_027090055.1|  ribose 5-phosphate isomerase [                   52.8    2e-07   
ref|WP_025873458.1|  ribose 5-phosphate isomerase                     52.8    2e-07   
ref|WP_013114795.1|  ribose 5-phosphate isomerase                     52.8    2e-07   
ref|WP_026681786.1|  ribose 5-phosphate isomerase                     52.8    2e-07   
ref|WP_035247828.1|  ribose 5-phosphate isomerase                     52.8    2e-07   
ref|WP_013149976.1|  ribose 5-phosphate isomerase                     52.8    2e-07   
ref|WP_019542193.1|  ribose 5-phosphate isomerase                     52.8    2e-07   
ref|WP_019116882.1|  ribose 5-phosphate isomerase                     52.8    2e-07   
ref|WP_014227576.1|  ribose 5-phosphate isomerase                     52.8    2e-07   
ref|WP_035582669.1|  ribose 5-phosphate isomerase                     52.8    2e-07   
ref|WP_007157414.1|  ribose 5-phosphate isomerase                     52.8    3e-07   
ref|WP_024360216.1|  MULTISPECIES: ribose 5-phosphate isomerase       52.8    3e-07   
ref|WP_027320721.1|  ribose 5-phosphate isomerase                     52.8    3e-07   
ref|WP_005806578.1|  MULTISPECIES: ribose 5-phosphate isomerase       52.4    3e-07   
ref|WP_020961515.1|  ribose 5-phosphate isomerase                     52.4    3e-07   
ref|WP_021860151.1|  ribose-5-phosphate isomerase B                   52.4    3e-07   
emb|CDZ74679.1|  ribose 5-phosphate isomerase B                       52.4    3e-07   
emb|CBX29543.1|  Ribose-5-phosphate isomerase B                       52.8    3e-07   
ref|WP_036351991.1|  ribose 5-phosphate isomerase                     52.4    3e-07   
ref|WP_004097854.1|  MULTISPECIES: ribose 5-phosphate isomerase       52.4    3e-07   
pdb|2VVR|A  Chain A, Crystal Structure Of The H99n Mutant Of Ribo...  52.4    3e-07   
ref|WP_031605719.1|  ribose 5-phosphate isomerase                     52.4    3e-07   
ref|WP_038225066.1|  ribose 5-phosphate isomerase                     52.4    3e-07   
dbj|GAL36353.1|  ribose 5-phosphate isomerase B                       52.4    3e-07   
ref|WP_033813725.1|  ribose 5-phosphate isomerase                     52.4    3e-07   
ref|WP_015907207.1|  ribose 5-phosphate isomerase                     52.4    3e-07   
ref|WP_001545120.1|  ribose-5-phosphate isomerase B                   52.4    3e-07   
ref|WP_013430912.1|  ribose 5-phosphate isomerase                     52.4    3e-07   
ref|WP_005021654.1|  ribose 5-phosphate isomerase                     52.4    3e-07   
ref|WP_014452969.1|  ribose 5-phosphate isomerase                     52.4    3e-07   
ref|WP_021771729.1|  ribose-5-phosphate isomerase B                   52.4    3e-07   
ref|WP_031494670.1|  ribose 5-phosphate isomerase                     52.4    3e-07   
ref|WP_017549616.1|  hypothetical protein                             52.4    3e-07   
ref|WP_009354095.1|  ribose 5-phosphate isomerase                     52.4    3e-07   
ref|WP_019554288.1|  ribose 5-phosphate isomerase                     52.4    3e-07   
ref|WP_013146610.1|  ribose 5-phosphate isomerase                     52.4    3e-07   
ref|WP_033020509.1|  ribose 5-phosphate isomerase                     52.4    3e-07   
ref|WP_013524810.1|  MULTISPECIES: ribose 5-phosphate isomerase       52.4    3e-07   
ref|WP_013403883.1|  ribose 5-phosphate isomerase                     52.4    3e-07   
ref|WP_025949616.1|  MULTISPECIES: ribose 5-phosphate isomerase       52.4    3e-07   
ref|WP_008880705.1|  MULTISPECIES: ribose 5-phosphate isomerase       52.4    3e-07   
ref|WP_023633289.1|  MULTISPECIES: ribose 5-phosphate isomerase       52.4    3e-07   
ref|WP_026928178.1|  ribose 5-phosphate isomerase                     52.4    3e-07   
ref|WP_014196954.1|  ribose 5-phosphate isomerase                     52.4    3e-07   
ref|WP_033842868.1|  ribose 5-phosphate isomerase                     52.4    3e-07   
ref|WP_003721856.1|  ribose 5-phosphate isomerase                     52.4    3e-07   
ref|WP_011232838.1|  MULTISPECIES: ribose 5-phosphate isomerase       52.4    3e-07   
ref|WP_010763713.1|  ribose 5-phosphate isomerase B                   52.4    3e-07   
ref|WP_020004716.1|  ribose 5-phosphate isomerase                     52.4    4e-07   
ref|WP_033024472.1|  ribose 5-phosphate isomerase                     52.4    4e-07   
ref|WP_012951359.1|  ribose 5-phosphate isomerase                     52.4    4e-07   
ref|WP_021959711.1|  ribose 5-phosphate isomerase B                   52.4    4e-07   
ref|WP_014879618.1|  ribose 5-phosphate isomerase                     52.4    4e-07   
gb|EKE02208.1|  hypothetical protein ACD_20C00411G0009                52.0    4e-07   
ref|WP_035572471.1|  ribose 5-phosphate isomerase                     52.0    4e-07   
ref|WP_015808266.1|  ribose 5-phosphate isomerase                     52.0    4e-07   
ref|WP_025904473.1|  MULTISPECIES: ribose 5-phosphate isomerase       52.0    4e-07   
ref|WP_015596081.1|  ribose 5-phosphate isomerase                     52.0    4e-07   
ref|WP_036352022.1|  ribose 5-phosphate isomerase                     52.0    4e-07   
gb|EQB97588.1|  ribose 5-phosphate isomerase                          52.0    4e-07   
ref|WP_008727507.1|  ribose-5-phosphate isomerase B                   52.0    4e-07   
dbj|BAQ09901.1|  ribose 5-phosphate isomerase b                       52.0    4e-07   
ref|WP_009431620.1|  ribose 5-phosphate isomerase                     52.0    4e-07   
ref|WP_025042695.1|  ribose 5-phosphate isomerase                     52.0    4e-07   
ref|WP_013781375.1|  ribose 5-phosphate isomerase                     52.0    4e-07   
ref|WP_020491989.1|  ribose 5-phosphate isomerase                     52.0    4e-07   
ref|WP_011888404.1|  ribose 5-phosphate isomerase                     52.0    5e-07   
ref|WP_016910980.1|  hypothetical protein                             52.0    5e-07   
ref|WP_008724357.1|  ribose-5-phosphate isomerase B                   52.0    5e-07   
ref|WP_034773212.1|  ribose 5-phosphate isomerase                     52.0    5e-07   
ref|WP_033008391.1|  ribose 5-phosphate isomerase                     52.0    5e-07   
ref|WP_034763808.1|  ribose 5-phosphate isomerase                     52.0    5e-07   
ref|XP_003248525.1|  PREDICTED: putative ribose 5-phosphate isome...  52.0    5e-07   
ref|WP_014932978.1|  ribose-5-phosphate isomerase B                   52.0    5e-07   
ref|WP_004798988.1|  ribose 5-phosphate isomerase [                   52.0    5e-07   
dbj|GAL20608.1|  ribose 5-phosphate isomerase B                       51.6    5e-07   
ref|WP_011834899.1|  ribose 5-phosphate isomerase                     51.6    5e-07   
ref|WP_026943308.1|  ribose 5-phosphate isomerase                     51.6    5e-07   
ref|WP_032111239.1|  ribose 5-phosphate isomerase                     51.6    5e-07   
ref|WP_035446427.1|  ribose 5-phosphate isomerase                     52.0    5e-07   
ref|WP_005399025.1|  ribose 5-phosphate isomerase                     51.6    6e-07   
ref|WP_024721989.1|  ribose 5-phosphate isomerase                     51.6    6e-07   
ref|WP_013289911.1|  ribose 5-phosphate isomerase                     51.6    6e-07   
ref|WP_012670569.1|  ribose 5-phosphate isomerase                     51.6    6e-07   
ref|WP_033017315.1|  ribose 5-phosphate isomerase                     51.6    6e-07   
emb|CDO58884.1|  Ribose 5-phosphate isomerase B                       51.6    6e-07   
ref|WP_011196460.1|  ribose 5-phosphate isomerase                     51.6    6e-07   
ref|WP_008296647.1|  Ribose-5-phosphate isomerase B                   51.6    6e-07   
ref|WP_028030324.1|  ribose 5-phosphate isomerase                     51.6    6e-07   
ref|WP_026560673.1|  ribose 5-phosphate isomerase                     51.6    6e-07   
ref|WP_006306264.1|  Ribose 5-phosphate isomerase B                   51.6    6e-07   
ref|WP_019124029.1|  ribose 5-phosphate isomerase                     51.6    6e-07   
ref|WP_017725986.1|  ribose 5-phosphate isomerase                     51.6    6e-07   
ref|WP_037995829.1|  ribose 5-phosphate isomerase                     51.6    6e-07   
ref|WP_026701837.1|  ribose 5-phosphate isomerase                     51.6    6e-07   
ref|WP_028285434.1|  ribose 5-phosphate isomerase                     51.6    6e-07   
ref|WP_038321979.1|  ribose 5-phosphate isomerase                     51.6    6e-07   
ref|WP_028331291.1|  ribose 5-phosphate isomerase                     51.6    6e-07   
ref|WP_013279158.1|  ribose 5-phosphate isomerase                     51.6    6e-07   
ref|WP_027323475.1|  ribose 5-phosphate isomerase                     51.6    6e-07   
ref|WP_022344914.1|  ribose-5-phosphate isomerase B                   51.6    7e-07   
ref|WP_009537315.1|  MULTISPECIES: ribose 5-phosphate isomerase       51.6    7e-07   
gb|EGL37255.1|  ribose-5-phosphate isomerase B                        51.6    7e-07   
ref|WP_027408030.1|  ribose 5-phosphate isomerase                     51.2    7e-07   
ref|WP_013243142.1|  ribose 5-phosphate isomerase                     51.2    7e-07   
ref|WP_007289553.1|  ribose 5-phosphate isomerase                     51.2    7e-07   
ref|WP_021289832.1|  MULTISPECIES: ribose 5-phosphate isomerase       51.2    7e-07   
ref|WP_011676493.1|  ribose 5-phosphate isomerase                     51.2    7e-07   
ref|WP_028329654.1|  ribose 5-phosphate isomerase                     51.2    7e-07   
ref|WP_023613570.1|  MULTISPECIES: ribose 5-phosphate isomerase       51.2    8e-07   
ref|WP_028393434.1|  ribose 5-phosphate isomerase                     51.2    8e-07   
ref|WP_014966409.1|  ribose 5-phosphate isomerase                     51.2    8e-07   
ref|WP_038057781.1|  ribose 5-phosphate isomerase                     51.2    8e-07   
ref|WP_008404461.1|  MULTISPECIES: ribose 5-phosphate isomerase       51.2    8e-07   
gb|EPR27998.1|  Ribose 5-phosphate isomerase                          51.6    8e-07   
dbj|GAM12694.1|  ribose 5-phosphate isomerase B                       51.2    8e-07   
ref|WP_037125209.1|  ribose 5-phosphate isomerase                     51.2    9e-07   
ref|WP_007862120.1|  ribose 5-phosphate isomerase [                   51.2    9e-07   
ref|WP_012960715.1|  MULTISPECIES: ribose 5-phosphate isomerase       51.2    9e-07   
ref|WP_012230980.1|  putative sugar phosphate epimerase               51.2    9e-07   
ref|WP_004603062.1|  ribose 5-phosphate isomerase [                   51.2    9e-07   
ref|WP_022419694.1|  ribose-5-phosphate isomerase B                   51.2    9e-07   
ref|WP_020882820.1|  ribose 5-phosphate isomerase B                   51.2    9e-07   
ref|WP_010011947.1|  ribose 5-phosphate isomerase                     51.2    9e-07   
ref|WP_024811602.1|  ribose 5-phosphate isomerase                     50.8    1e-06   
ref|WP_010677206.1|  ribose 5-phosphate isomerase                     50.8    1e-06   
ref|WP_035408030.1|  ribose 5-phosphate isomerase                     50.8    1e-06   
ref|WP_021868692.1|  ribose-5-phosphate isomerase B                   50.8    1e-06   
ref|WP_013276792.1|  ribose 5-phosphate isomerase                     50.8    1e-06   
ref|WP_008723799.1|  ribose 5-phosphate isomerase                     50.8    1e-06   
ref|WP_027870941.1|  ribose 5-phosphate isomerase [                   50.8    1e-06   
ref|WP_008596364.1|  ribose 5-phosphate isomerase                     51.2    1e-06   
gb|KFC74454.1|  Ribose-5-phosphate isomerase                          50.8    1e-06   
ref|WP_029668520.1|  ribose 5-phosphate isomerase                     50.8    1e-06   
ref|WP_022274104.1|  ribose-5-phosphate isomerase                     50.8    1e-06   
ref|WP_039468559.1|  ribose 5-phosphate isomerase                     50.8    1e-06   
ref|WP_003570933.1|  ribose 5-phosphate isomerase                     50.8    1e-06   
dbj|GAF65070.1|  ribose 5-phosphate isomerase B                       50.8    1e-06   
ref|WP_036287862.1|  ribose 5-phosphate isomerase                     50.8    1e-06   
ref|WP_035242607.1|  ribose 5-phosphate isomerase                     50.8    1e-06   
ref|WP_032950261.1|  ribose 5-phosphate isomerase                     50.8    1e-06   
ref|WP_023025678.1|  Ribose 5-phosphate isomerase B                   50.8    1e-06   
ref|WP_011539634.1|  ribose 5-phosphate isomerase                     50.8    1e-06   
ref|WP_019297322.1|  MULTISPECIES: ribose 5-phosphate isomerase       50.8    1e-06   
ref|WP_028411981.1|  MULTISPECIES: ribose 5-phosphate isomerase       50.8    1e-06   
ref|WP_025601414.1|  MULTISPECIES: ribose 5-phosphate isomerase       50.8    1e-06   
ref|WP_013085468.1|  MULTISPECIES: ribose 5-phosphate isomerase       50.8    1e-06   
ref|WP_013059813.1|  ribose 5-phosphate isomerase                     50.8    1e-06   
ref|WP_024322679.1|  ribose 5-phosphate isomerase                     50.8    1e-06   
ref|WP_018481973.1|  ribose 5-phosphate isomerase                     50.8    1e-06   
ref|WP_020719807.1|  hypothetical protein                             50.8    1e-06   
ref|WP_022176224.1|  ribose-5-phosphate isomerase B                   50.8    1e-06   
ref|WP_034648272.1|  ribose 5-phosphate isomerase                     50.8    1e-06   
ref|WP_025752494.1|  ribose 5-phosphate isomerase                     50.8    1e-06   
ref|WP_006784597.1|  MULTISPECIES: ribose 5-phosphate isomerase       50.8    1e-06   
ref|WP_009158305.1|  ribose 5-phosphate isomerase                     50.4    1e-06   
ref|WP_033182733.1|  ribose 5-phosphate isomerase                     50.4    1e-06   
ref|WP_002604889.1|  ribose 5-phosphate isomerase B [                 50.4    1e-06   
ref|WP_014187709.1|  ribose 5-phosphate isomerase                     50.4    1e-06   
ref|WP_019134092.1|  hypothetical protein                             50.4    1e-06   
ref|WP_007938869.1|  MULTISPECIES: ribose 5-phosphate isomerase       50.4    1e-06   
ref|WP_009710467.1|  ribose 5-phosphate isomerase                     50.4    1e-06   
ref|WP_022449529.1|  putative uncharacterized protein                 50.4    1e-06   
ref|WP_026866009.1|  ribose 5-phosphate isomerase                     50.4    1e-06   
ref|WP_025727646.1|  ribose 5-phosphate isomerase                     50.4    1e-06   
ref|WP_038674041.1|  ribose 5-phosphate isomerase                     50.4    1e-06   
ref|WP_008328962.1|  ribose 5-phosphate isomerase                     50.4    1e-06   
ref|WP_021169364.1|  ribose 5-phosphate isomerase B                   50.4    1e-06   
ref|WP_012583174.1|  ribose 5-phosphate isomerase                     50.4    1e-06   
ref|WP_036578491.1|  ribose 5-phosphate isomerase                     50.4    1e-06   
gb|AJE48231.1|  ribose-5-phosphate isomerase                          50.4    1e-06   
ref|WP_007958815.1|  ribose 5-phosphate isomerase                     50.4    1e-06   
ref|WP_006656127.1|  ribose 5-phosphate isomerase                     50.4    1e-06   
emb|CDH89423.1|  ribose 5-phosphate isomerase                         50.4    2e-06   
ref|WP_022415704.1|  ribose-5-phosphate isomerase B                   50.4    2e-06   
emb|CCZ23665.1|  ribose-5-phosphate isomerase B                       50.4    2e-06   
ref|WP_015553253.1|  ribose-5-phosphate isomerase                     50.4    2e-06   
ref|WP_006770992.1|  MULTISPECIES: ribose 5-phosphate isomerase       50.4    2e-06   
ref|WP_012548727.1|  ribose 5-phosphate isomerase                     50.4    2e-06   
ref|WP_032090888.1|  ribose 5-phosphate isomerase                     50.4    2e-06   
ref|WP_005754359.1|  ribose 5-phosphate isomerase                     50.4    2e-06   
ref|WP_036936807.1|  ribose 5-phosphate isomerase                     50.4    2e-06   
ref|WP_021904490.1|  ribose-5-phosphate isomerase                     50.4    2e-06   
ref|WP_028086409.1|  ribose 5-phosphate isomerase                     50.4    2e-06   
ref|WP_011523611.1|  ribose 5-phosphate isomerase                     50.4    2e-06   
ref|WP_027415224.1|  ribose 5-phosphate isomerase                     50.4    2e-06   
ref|WP_014488503.1|  ribose 5-phosphate isomerase                     50.4    2e-06   
ref|WP_006428164.1|  ribose 5-phosphate isomerase                     50.4    2e-06   
ref|WP_034315832.1|  ribose 5-phosphate isomerase                     50.4    2e-06   
ref|WP_034287917.1|  ribose 5-phosphate isomerase                     50.1    2e-06   
ref|WP_010200406.1|  ribose 5-phosphate isomerase                     50.1    2e-06   
ref|WP_012861657.1|  ribose 5-phosphate isomerase                     50.1    2e-06   
ref|WP_024097810.1|  ribose 5-phosphate isomerase B                   50.4    2e-06   
ref|WP_012451234.1|  ribose 5-phosphate isomerase                     50.1    2e-06   
ref|WP_004610798.1|  ribose 5-phosphate isomerase [                   50.1    2e-06   
ref|WP_019378215.1|  ribose 5-phosphate isomerase                     50.1    2e-06   
ref|WP_004095220.1|  ribose 5-phosphate isomerase                     50.1    2e-06   
gb|KEY63091.1|  Ribose-5-phosphate isomerase                          50.1    2e-06   
ref|WP_007719500.1|  ribose 5-phosphate isomerase [                   50.1    2e-06   
ref|WP_018445253.1|  ribose 5-phosphate isomerase                     50.1    2e-06   
ref|WP_027684597.1|  ribose 5-phosphate isomerase                     50.1    2e-06   
ref|XP_001734751.1|  ribose-5-phosphate isomerase B                   50.1    2e-06   
ref|WP_022224214.1|  ribose-5-phosphate isomerase B                   50.1    2e-06   
ref|WP_037068844.1|  ribose 5-phosphate isomerase                     50.1    2e-06   
ref|WP_018242130.1|  ribose 5-phosphate isomerase                     50.1    2e-06   
ref|WP_012424929.1|  ribose 5-phosphate isomerase                     50.1    2e-06   
ref|WP_012757564.1|  ribose 5-phosphate isomerase                     50.1    2e-06   
ref|WP_002568998.1|  ribose 5-phosphate isomerase [                   50.1    2e-06   
gb|EFR95675.1|  ribose-5-phosphate isomerase B                        50.1    2e-06   
ref|WP_017994151.1|  ribose 5-phosphate isomerase                     50.1    2e-06   
ref|WP_005626198.1|  ribose-5-phosphate isomerase                     50.1    2e-06   
ref|WP_035661987.1|  ribose 5-phosphate isomerase                     50.1    2e-06   
ref|WP_010141519.1|  ribose 5-phosphate isomerase                     50.1    2e-06   
ref|WP_005957310.1|  ribose 5-phosphate isomerase                     50.1    2e-06   
ref|WP_021945396.1|  sugar-phosphate isomerase RpiB/LacA/LacB family  50.1    2e-06   
ref|WP_038407968.1|  ribose 5-phosphate isomerase                     50.1    2e-06   
ref|WP_002586761.1|  MULTISPECIES: ribose 5-phosphate isomerase       50.1    2e-06   
ref|WP_002576822.1|  MULTISPECIES: ribose 5-phosphate isomerase B     50.1    2e-06   
ref|WP_039666261.1|  ribose 5-phosphate isomerase                     50.1    2e-06   
ref|WP_017471044.1|  hypothetical protein                             50.1    2e-06   
ref|WP_016178989.1|  ribose 5-phosphate isomerase B                   50.1    2e-06   
ref|WP_025484358.1|  ribose 5-phosphate isomerase                     50.1    2e-06   
ref|WP_004074290.1|  ribose 5-phosphate isomerase                     50.1    2e-06   
ref|WP_006782537.1|  ribose 5-phosphate isomerase [                   50.1    2e-06   
ref|WP_026442683.1|  ribose 5-phosphate isomerase                     50.1    2e-06   
ref|WP_004801106.1|  RpiB/LacA/LacB family sugar-phosphate isomerase  50.1    2e-06   
ref|WP_015456022.1|  Putative sugar phosphate isomerase ywlF          49.7    2e-06   
ref|WP_024316158.1|  ribose 5-phosphate isomerase                     50.1    2e-06   
ref|WP_018248207.1|  hypothetical protein                             50.1    2e-06   
ref|WP_008240764.1|  ribose 5-phosphate isomerase                     50.1    2e-06   
ref|WP_026677279.1|  ribose 5-phosphate isomerase                     50.1    2e-06   
ref|WP_009766213.1|  ribose 5-phosphate isomerase                     50.1    2e-06   
ref|WP_022482808.1|  ribose-5-phosphate isomerase B                   50.1    2e-06   
ref|WP_009278722.1|  ribose 5-phosphate isomerase                     50.1    2e-06   
ref|WP_028390358.1|  ribose 5-phosphate isomerase                     50.1    2e-06   
ref|WP_035150561.1|  ribose 5-phosphate isomerase                     50.1    2e-06   
ref|WP_025025769.1|  ribose 5-phosphate isomerase                     49.7    2e-06   
ref|WP_034995561.1|  ribose 5-phosphate isomerase                     50.1    2e-06   
ref|WP_021095052.1|  ribose 5-phosphate isomerase                     49.7    2e-06   
ref|WP_003749785.1|  ribose 5-phosphate isomerase                     49.7    2e-06   
ref|WP_003722031.1|  ribose 5-phosphate isomerase                     49.7    2e-06   
ref|WP_009932826.1|  ribose 5-phosphate isomerase                     49.7    2e-06   
ref|WP_022312618.1|  ribose 5-phosphate isomerase B                   49.7    2e-06   
ref|WP_039175356.1|  ribose 5-phosphate isomerase                     49.7    2e-06   
ref|WP_014093855.1|  ribose 5-phosphate isomerase                     49.7    2e-06   
ref|WP_027247617.1|  ribose 5-phosphate isomerase                     49.7    3e-06   
emb|CDM65716.1|  ribose 5-phosphate isomerase B                       49.7    3e-06   
gb|EFS01942.1|  ribose-5-phosphate isomerase B                        49.7    3e-06   
ref|WP_026831913.1|  ribose 5-phosphate isomerase                     49.7    3e-06   
ref|WP_015897369.1|  ribose 5-phosphate isomerase                     49.7    3e-06   
gb|AIE93403.1|  ribose-5-phosphate isomerase B (rpiB)                 49.7    3e-06   
ref|WP_023056125.1|  ribose-5-phosphate isomerase B                   49.7    3e-06   
ref|WP_026830278.1|  ribose 5-phosphate isomerase                     49.7    3e-06   
ref|WP_015912267.1|  ribose 5-phosphate isomerase                     49.7    3e-06   
ref|WP_014930230.1|  ribose 5-phosphate isomerase                     49.7    3e-06   
ref|WP_013490641.1|  ribose 5-phosphate isomerase                     49.7    3e-06   
ref|WP_022026011.1|  putative uncharacterized protein                 49.7    3e-06   
ref|WP_027241833.1|  ribose 5-phosphate isomerase                     49.7    3e-06   
ref|WP_009810639.1|  ribose 5-phosphate isomerase                     49.7    3e-06   
ref|WP_012951109.1|  ribose 5-phosphate isomerase                     49.7    3e-06   
ref|WP_027890595.1|  ribose 5-phosphate isomerase                     49.7    3e-06   
ref|WP_009912542.1|  ribose-5-phosphate isomerase B                   49.7    3e-06   
ref|WP_019153973.1|  ribose 5-phosphate isomerase                     49.7    3e-06   
ref|WP_006417675.1|  ribose 5-phosphate isomerase                     49.7    3e-06   
ref|WP_015455296.1|  Putative sugar phosphate isomerase ywlF          49.7    3e-06   
ref|WP_034563874.1|  ribose 5-phosphate isomerase                     49.7    3e-06   
ref|WP_026827338.1|  ribose 5-phosphate isomerase                     49.7    3e-06   
ref|WP_031643966.1|  ribose 5-phosphate isomerase                     49.7    3e-06   
ref|WP_003728568.1|  ribose 5-phosphate isomerase                     49.7    3e-06   
ref|WP_003739881.1|  ribose 5-phosphate isomerase                     49.7    3e-06   
ref|WP_014601188.1|  ribose 5-phosphate isomerase                     49.7    3e-06   
ref|WP_010175590.1|  ribose 5-phosphate isomerase                     49.7    3e-06   
ref|WP_007392534.1|  ribose 5-phosphate isomerase                     49.7    3e-06   
ref|WP_026563102.1|  ribose 5-phosphate isomerase                     49.7    3e-06   
ref|WP_039086730.1|  ribose 5-phosphate isomerase                     49.7    3e-06   
ref|WP_007119910.1|  ribose 5-phosphate isomerase                     49.7    3e-06   
ref|WP_003724981.1|  MULTISPECIES: ribose 5-phosphate isomerase       49.7    3e-06   
ref|WP_014874188.1|  ribose 5-phosphate isomerase                     49.7    3e-06   
ref|WP_009792619.1|  MULTISPECIES: ribose 5-phosphate isomerase       49.7    3e-06   
ref|WP_003351746.1|  ribose 5-phosphate isomerase                     49.7    3e-06   
ref|WP_003397018.1|  ribose 5-phosphate isomerase                     49.7    3e-06   
ref|WP_008399146.1|  ribose 5-phosphate isomerase                     49.7    3e-06   
ref|WP_035049378.1|  ribose 5-phosphate isomerase                     49.7    3e-06   
ref|WP_006320966.1|  MULTISPECIES: ribose 5-phosphate isomerase       49.7    3e-06   
ref|WP_014971415.1|  ribose 5-phosphate isomerase                     49.7    3e-06   
ref|WP_039181207.1|  ribose 5-phosphate isomerase                     49.7    3e-06   
ref|WP_003765506.1|  ribose 5-phosphate isomerase                     49.7    3e-06   
ref|WP_033100409.1|  ribose 5-phosphate isomerase                     49.7    3e-06   
ref|WP_015573381.1|  MULTISPECIES: ribose-5-phosphate isomerase       49.7    3e-06   
ref|WP_039530344.1|  ribose 5-phosphate isomerase                     49.7    3e-06   
ref|WP_012576194.1|  ribose 5-phosphate isomerase                     49.7    3e-06   
ref|WP_003744648.1|  ribose 5-phosphate isomerase                     49.7    3e-06   
ref|WP_003346829.1|  ribose 5-phosphate isomerase                     49.3    3e-06   
gb|ETZ21585.1|  ribose 5-phosphate isomerase                          49.3    3e-06   
ref|WP_014931031.1|  ribose 5-phosphate isomerase                     49.7    3e-06   
ref|WP_034617102.1|  ribose 5-phosphate isomerase                     49.3    3e-06   
ref|WP_035419073.1|  MULTISPECIES: ribose 5-phosphate isomerase       49.3    3e-06   
gb|AIF44673.1|  ribose 5-phosphate isomerase                          49.3    3e-06   
ref|WP_007203761.1|  ribose 5-phosphate isomerase                     49.3    3e-06   
gb|EFR86545.1|  ribose 5-phosphate isomerase B                        49.3    3e-06   
ref|WP_008205261.1|  ribose 5-phosphate isomerase                     49.3    3e-06   
ref|WP_017756612.1|  ribose 5-phosphate isomerase                     49.3    3e-06   
ref|WP_010991390.1|  ribose 5-phosphate isomerase                     49.3    3e-06   



>ref|WP_031390451.1| ribose 5-phosphate isomerase [Clostridium sp. KNHs209]
Length=144

 Score = 61.2 bits (147),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 26/40 (65%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = +1

Query  1    IAANKFKGIRCVNCNDPYAALQGRQHENSNVLSMGCRVIG  120
            IAANK +GIRC  C++PY+AL  RQH NSN+LS+G RV+G
Sbjct  72   IAANKIRGIRCAVCSEPYSALLSRQHNNSNILSLGARVVG  111



>ref|WP_033163481.1| ribose 5-phosphate isomerase [Sharpea azabuensis]
Length=151

 Score = 59.7 bits (143),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 25/40 (63%), Positives = 32/40 (80%), Gaps = 0/40 (0%)
 Frame = +1

Query  1    IAANKFKGIRCVNCNDPYAALQGRQHENSNVLSMGCRVIG  120
            +AANK  GIRCV C++PY+AL  RQH N+N+LS G RV+G
Sbjct  74   LAANKVNGIRCVTCSEPYSALLSRQHNNTNMLSFGARVVG  113



>ref|WP_018373659.1| ribose 5-phosphate isomerase [Streptococcus merionis]
Length=148

 Score = 59.3 bits (142),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 27/40 (68%), Positives = 32/40 (80%), Gaps = 0/40 (0%)
 Frame = +1

Query  1    IAANKFKGIRCVNCNDPYAALQGRQHENSNVLSMGCRVIG  120
            IAANK KGIRCV C++PY+A   RQH ++NVLS G RVIG
Sbjct  74   IAANKVKGIRCVICSEPYSAKLSRQHNDTNVLSFGARVIG  113



>ref|WP_026792942.1| ribose 5-phosphate isomerase [Pleomorphomonas oryzae]
Length=153

 Score = 58.9 bits (141),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 24/41 (59%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    IAANKFKGIRCVNCNDPYAALQGRQHENSNVLSMGCRVIGE  123
            +AANK KGIRCV C++PY A   RQH N+N+L+ G RV+G+
Sbjct  77   LAANKLKGIRCVVCSEPYTARLSRQHNNANMLAFGARVVGQ  117



>ref|WP_032091042.1| ribose 5-phosphate isomerase [bacterium LF-3]
Length=151

 Score = 58.9 bits (141),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 32/40 (80%), Gaps = 0/40 (0%)
 Frame = +1

Query  1    IAANKFKGIRCVNCNDPYAALQGRQHENSNVLSMGCRVIG  120
            +AANK  GIRCV C++PY+AL  RQH N+N+L+ G RV+G
Sbjct  74   LAANKVNGIRCVTCSEPYSALLSRQHNNTNMLAFGARVVG  113



>ref|WP_026784939.1| ribose 5-phosphate isomerase [Pleomorphomonas koreensis]
Length=151

 Score = 58.9 bits (141),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 25/41 (61%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    IAANKFKGIRCVNCNDPYAALQGRQHENSNVLSMGCRVIGE  123
            +AANK KGIRCV C++PY A   RQH N+N+L+ G RV+GE
Sbjct  74   LAANKLKGIRCVVCSEPYTARLSRQHNNANMLAFGARVVGE  114



>emb|CCZ24051.1| ribose 5-phosphate isomerase B [Coprobacillus sp. CAG:235]
Length=151

 Score = 58.9 bits (141),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 32/40 (80%), Gaps = 0/40 (0%)
 Frame = +1

Query  1    IAANKFKGIRCVNCNDPYAALQGRQHENSNVLSMGCRVIG  120
            +AANK  GIRCV C++PY+AL  RQH N+N+L+ G RV+G
Sbjct  74   LAANKVNGIRCVTCSEPYSALLSRQHNNTNMLAFGARVVG  113



>ref|WP_039299585.1| ribose 5-phosphate isomerase [Cedecea neteri]
 gb|AIR64819.1| ribose 5-phosphate isomerase [Cedecea neteri]
Length=149

 Score = 58.2 bits (139),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 25/40 (63%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = +1

Query  1    IAANKFKGIRCVNCNDPYAALQGRQHENSNVLSMGCRVIG  120
            I ANKF GIR V C++PY+AL  RQH N+NVL+ G RV+G
Sbjct  74   ITANKFPGIRAVVCSEPYSALLSRQHNNTNVLAFGSRVVG  113



>ref|WP_008455737.1| ribose 5-phosphate isomerase [Enterobacter sp. Ag1]
 gb|EJF31967.1| ribose 5-phosphate isomerase B [Enterobacter sp. Ag1]
Length=149

 Score = 58.2 bits (139),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 25/40 (63%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = +1

Query  1    IAANKFKGIRCVNCNDPYAALQGRQHENSNVLSMGCRVIG  120
            I ANKF GIR V C++PY+AL  RQH N+NVL+ G RV+G
Sbjct  74   ITANKFPGIRAVVCSEPYSALLSRQHNNTNVLAFGSRVVG  113



>ref|WP_039289417.1| ribose 5-phosphate isomerase [Cedecea neteri]
 gb|AIR60401.1| ribose 5-phosphate isomerase [Cedecea neteri]
Length=149

 Score = 58.2 bits (139),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 25/40 (63%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = +1

Query  1    IAANKFKGIRCVNCNDPYAALQGRQHENSNVLSMGCRVIG  120
            I ANKF GIR V C++PY+AL  RQH N+NVL+ G RV+G
Sbjct  74   ITANKFPGIRAVVCSEPYSALLSRQHNNTNVLAFGSRVVG  113



>ref|WP_038476549.1| ribose 5-phosphate isomerase [Cedecea neteri]
 gb|AIR05080.1| ribose 5-phosphate isomerase [Cedecea neteri]
 gb|KHE38168.1| ribose 5-phosphate isomerase [Cedecea neteri]
Length=149

 Score = 58.2 bits (139),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 25/40 (63%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = +1

Query  1    IAANKFKGIRCVNCNDPYAALQGRQHENSNVLSMGCRVIG  120
            I ANKF GIR V C++PY+AL  RQH N+NVL+ G RV+G
Sbjct  74   ITANKFPGIRAVVCSEPYSALLSRQHNNTNVLAFGSRVVG  113



>ref|WP_022937309.1| ribose 5-phosphate isomerase [Dielma fastidiosa]
Length=146

 Score = 58.2 bits (139),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 26/41 (63%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    IAANKFKGIRCVNCNDPYAALQGRQHENSNVLSMGCRVIGE  123
            IAANK KGIRC  C+DP +A   R+H +SNVL+MG R+IGE
Sbjct  73   IAANKIKGIRCALCSDPLSARLTREHNDSNVLAMGQRIIGE  113



>ref|WP_024379342.1| ribose 5-phosphate isomerase [Streptococcus suis]
Length=151

 Score = 57.8 bits (138),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 25/40 (63%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = +1

Query  1    IAANKFKGIRCVNCNDPYAALQGRQHENSNVLSMGCRVIG  120
            I ANK KGIRCV C++PY+A   RQH ++NVLS G RV+G
Sbjct  74   ITANKIKGIRCVICSEPYSARLSRQHNDTNVLSFGARVVG  113



>ref|WP_036378665.1| ribose 5-phosphate isomerase [Mitsuokella jalaludinii]
Length=147

 Score = 57.8 bits (138),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 26/40 (65%), Positives = 32/40 (80%), Gaps = 0/40 (0%)
 Frame = +1

Query  1    IAANKFKGIRCVNCNDPYAALQGRQHENSNVLSMGCRVIG  120
            IAANK KGIRC  CND Y+A + R+H N+NVL+MG RV+G
Sbjct  74   IAANKVKGIRCALCNDVYSAKKAREHNNANVLAMGGRVLG  113



>ref|WP_005843053.1| ribose 5-phosphate isomerase [Mitsuokella multacida]
 gb|EEX67751.1| ribose-5-phosphate isomerase B [Mitsuokella multacida DSM 20544]
Length=147

 Score = 57.8 bits (138),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 26/40 (65%), Positives = 32/40 (80%), Gaps = 0/40 (0%)
 Frame = +1

Query  1    IAANKFKGIRCVNCNDPYAALQGRQHENSNVLSMGCRVIG  120
            IAANK KGIRC  CND Y+A + R+H N+NVL+MG RV+G
Sbjct  74   IAANKVKGIRCALCNDVYSAKKAREHNNANVLAMGGRVLG  113



>ref|WP_031540053.1| ribose 5-phosphate isomerase [Bacillus sp. MB2021]
Length=146

 Score = 57.4 bits (137),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 25/40 (63%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = +1

Query  1    IAANKFKGIRCVNCNDPYAALQGRQHENSNVLSMGCRVIG  120
            IAANK KGIRCV C++PY A   R H N+NVL++G RV+G
Sbjct  73   IAANKVKGIRCVVCSEPYTAKMSRSHNNTNVLAIGARVLG  112



>ref|WP_011662024.1| ribose 5-phosphate isomerase [Rhodopseudomonas palustris]
 ref|YP_779510.1| ribose 5-phosphate isomerase B [Rhodopseudomonas palustris BisA53]
 gb|ABJ04530.1| ribose-5-phosphate isomerase [Rhodopseudomonas palustris BisA53]
Length=120

 Score = 57.0 bits (136),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 23/40 (58%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = +1

Query  1    IAANKFKGIRCVNCNDPYAALQGRQHENSNVLSMGCRVIG  120
            IAANK  G+RCV C++PY+AL  R+H N+N+L++G RV+G
Sbjct  44   IAANKVPGVRCVVCSEPYSALMARRHNNANILALGQRVVG  83



>ref|WP_003089417.1| ribose 5-phosphate isomerase [Streptococcus ratti]
 gb|EJN94435.1| ribose-5-phosphate isomerase B [Streptococcus ratti FA-1 = DSM 
20564]
 gb|EMP70422.1| ribose-5-phosphate isomerase B [Streptococcus ratti FA-1 = DSM 
20564]
Length=149

 Score = 57.0 bits (136),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 32/40 (80%), Gaps = 0/40 (0%)
 Frame = +1

Query  1    IAANKFKGIRCVNCNDPYAALQGRQHENSNVLSMGCRVIG  120
            I+ANK KG+RCV C++PY+A   R+H NSNVL+ G RV+G
Sbjct  74   ISANKVKGVRCVICSEPYSAKLSREHNNSNVLAFGARVVG  113



>ref|WP_002464416.1| ribose 5-phosphate isomerase [Staphylococcus simiae]
 gb|EHJ07568.1| ribose-5-phosphate isomerase B [Staphylococcus simiae CCM 7213]
Length=149

 Score = 56.6 bits (135),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 26/40 (65%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = +1

Query  1    IAANKFKGIRCVNCNDPYAALQGRQHENSNVLSMGCRVIG  120
            IAANK KGIR V C+DPY A   R+H N+NVL+ G RVIG
Sbjct  73   IAANKVKGIRAVVCSDPYTAKLSREHNNTNVLAFGSRVIG  112



>ref|WP_032272928.1| ribose 5-phosphate isomerase, partial [Escherichia coli]
Length=84

 Score = 55.8 bits (133),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = +1

Query  1    IAANKFKGIRCVNCNDPYAALQGRQHENSNVLSMGCRVIG  120
            IAANKF GIR V C++PY+A   RQH ++NVL+ G RV+G
Sbjct  41   IAANKFAGIRAVVCSEPYSAQLSRQHNDTNVLAFGSRVVG  80



>ref|WP_026791197.1| ribose 5-phosphate isomerase [Pleomorphomonas oryzae]
Length=154

 Score = 56.6 bits (135),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 23/41 (56%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    IAANKFKGIRCVNCNDPYAALQGRQHENSNVLSMGCRVIGE  123
            +AANK +GIRCV C++PY A   RQH N+N+L+ G RV+G+
Sbjct  77   LAANKLRGIRCVVCSEPYTAKLSRQHNNANMLAFGARVVGQ  117



>ref|WP_022693897.1| ribose 5-phosphate isomerase [Ponticaulis koreensis]
Length=155

 Score = 56.6 bits (135),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 26/41 (63%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    IAANKFKGIRCVNCNDPYAALQGRQHENSNVLSMGCRVIGE  123
            +AANK KGIRC  C+D ++A   RQH N+N+LSMG RVIGE
Sbjct  83   MAANKVKGIRCGVCSDTFSARMIRQHNNANMLSMGARVIGE  123



>ref|WP_004228017.1| ribose 5-phosphate isomerase [Streptococcus criceti]
 gb|EHI74614.1| ribose-5-phosphate isomerase B [Streptococcus criceti HS-6]
Length=156

 Score = 56.6 bits (135),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 32/40 (80%), Gaps = 0/40 (0%)
 Frame = +1

Query  1    IAANKFKGIRCVNCNDPYAALQGRQHENSNVLSMGCRVIG  120
            I+ANK KGIRCV C++PY+A   RQH ++NVL+ G RV+G
Sbjct  74   ISANKVKGIRCVICSEPYSAKLSRQHNDTNVLAFGSRVVG  113



>ref|WP_006443134.1| ribose 5-phosphate isomerase [[Clostridium] hylemonae]
 gb|EEG73784.1| ribose-5-phosphate isomerase B [ [[Clostridium] hylemonae DSM 
15053]
Length=157

 Score = 56.2 bits (134),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 25/40 (63%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = +1

Query  1    IAANKFKGIRCVNCNDPYAALQGRQHENSNVLSMGCRVIG  120
            +AANK KGIR V C++PY+A   RQH N+NVL+ G RVIG
Sbjct  82   LAANKVKGIRAVVCSEPYSAKLSRQHNNTNVLAFGARVIG  121



>ref|WP_004711718.1| ribose 5-phosphate isomerase [Yersinia frederiksenii]
 gb|EEQ13381.1| Ribose-5-phosphate isomerase B [Yersinia frederiksenii ATCC 33641]
 gb|KGA44364.1| ribose 5-phosphate isomerase B [Yersinia frederiksenii ATCC 33641]
Length=148

 Score = 56.2 bits (134),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 26/40 (65%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = +1

Query  1    IAANKFKGIRCVNCNDPYAALQGRQHENSNVLSMGCRVIG  120
            IAANK KGIR V C++PY+A   R+H N+NVLS G RVIG
Sbjct  73   IAANKVKGIRAVVCSEPYSAKLSREHNNTNVLSFGSRVIG  112



>ref|WP_004801223.1| ribose 5-phosphate isomerase B [Eggerthia catenaformis]
 gb|EMD17425.1| ribose 5-phosphate isomerase B [Eggerthia catenaformis OT 569 
= DSM 20559]
Length=153

 Score = 56.2 bits (134),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = +1

Query  1    IAANKFKGIRCVNCNDPYAALQGRQHENSNVLSMGCRVIG  120
            +AANK  GIRCV C++PY+A   R+H N+NVLS G RV+G
Sbjct  74   LAANKVNGIRCVTCSEPYSAQFSRKHNNTNVLSFGARVVG  113



>ref|WP_008818196.1| MULTISPECIES: ribose 5-phosphate isomerase [Clostridiales]
 gb|EFR37485.1| ribose-5-phosphate isomerase B [Clostridium sp. HGF2]
 gb|EHO25505.1| RpiB/LacA/LacB family sugar-phosphate isomerase [Erysipelotrichaceae 
bacterium 6_1_45]
 gb|EHO25628.1| RpiB/LacA/LacB family sugar-phosphate isomerase [Erysipelotrichaceae 
bacterium 21_3]
 emb|CDC86297.1| rpiB/LacA/LacB family sugar-phosphate isomerase [Erysipelotrichaceae 
bacterium CAG:64]
 gb|EQJ56489.1| ribose 5-phosphate isomerase B [Clostridium difficile P28]
 gb|KGJ54532.1| ribose 5-phosphate isomerase [ [[Clostridium] innocuum]
Length=146

 Score = 56.2 bits (134),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 26/40 (65%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = +1

Query  1    IAANKFKGIRCVNCNDPYAALQGRQHENSNVLSMGCRVIG  120
            IAANK KGIRC  C+DP +A   R+H NSNVL+MG R+IG
Sbjct  73   IAANKIKGIRCALCSDPVSAKLTREHNNSNVLAMGQRIIG  112



>ref|WP_010258345.1| ribose 5-phosphate isomerase [Treponema primitia]
Length=154

 Score = 56.2 bits (134),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 23/40 (58%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = +1

Query  1    IAANKFKGIRCVNCNDPYAALQGRQHENSNVLSMGCRVIG  120
            ++ANK KGIRCV C D Y A+  RQH N+N+L++G RV+G
Sbjct  72   LSANKVKGIRCVACTDCYTAMLSRQHNNTNMLALGARVLG  111



>ref|WP_038274267.1| ribose 5-phosphate isomerase [[Clostridium] innocuum]
Length=146

 Score = 56.2 bits (134),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 26/40 (65%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = +1

Query  1    IAANKFKGIRCVNCNDPYAALQGRQHENSNVLSMGCRVIG  120
            IAANK KGIRC  C+DP +A   R+H NSNVL+MG R+IG
Sbjct  73   IAANKIKGIRCALCSDPVSAKLTREHNNSNVLAMGQRIIG  112



>ref|WP_002606900.1| ribose 5-phosphate isomerase [Erysipelotrichaceae bacterium 2_2_44A]
 gb|EGX74887.1| ribose 5-phosphate isomerase B [Erysipelotrichaceae bacterium 
2_2_44A]
 gb|ENY88752.1| RpiB/LacA/LacB family sugar-phosphate isomerase [ [[Clostridium] 
innocuum 2959]
Length=148

 Score = 56.2 bits (134),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 26/40 (65%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = +1

Query  1    IAANKFKGIRCVNCNDPYAALQGRQHENSNVLSMGCRVIG  120
            IAANK KGIRC  C+DP +A   R+H NSNVL+MG R+IG
Sbjct  75   IAANKIKGIRCALCSDPVSAKLTREHNNSNVLAMGQRIIG  114



>ref|WP_012862852.1| ribose 5-phosphate isomerase [Sebaldella termitidis]
 ref|YP_003310201.1| RpiB/LacA/LacB family sugar-phosphate isomerase [Sebaldella termitidis 
ATCC 33386]
 gb|ACZ10270.1| sugar-phosphate isomerase, RpiB/LacA/LacB family [Sebaldella 
termitidis ATCC 33386]
Length=147

 Score = 56.2 bits (134),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 24/40 (60%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = +1

Query  1    IAANKFKGIRCVNCNDPYAALQGRQHENSNVLSMGCRVIG  120
            IAANK KGIR V C++PY+A   R+H N+N+L+ G RVIG
Sbjct  73   IAANKVKGIRAVVCSEPYSAKLSREHNNTNILAFGARVIG  112



>ref|WP_024910707.1| ribose 5-phosphate isomerase [Serratia fonticola]
 gb|AHG22512.1| ribose 5-phosphate isomerase [Serratia fonticola RB-25]
Length=148

 Score = 56.2 bits (134),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 25/40 (63%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = +1

Query  1    IAANKFKGIRCVNCNDPYAALQGRQHENSNVLSMGCRVIG  120
            IAANK +GIR V C++PY+A   RQH N+NVL+ G RVIG
Sbjct  73   IAANKVRGIRAVVCSEPYSAKLSRQHNNTNVLAFGSRVIG  112



>ref|WP_038430201.1| ribose 5-phosphate isomerase, partial [Escherichia albertii]
Length=123

 Score = 55.8 bits (133),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = +1

Query  1    IAANKFKGIRCVNCNDPYAALQGRQHENSNVLSMGCRVIG  120
            IAANKF GIR V C++PY+A   RQH ++NVL+ G RV+G
Sbjct  74   IAANKFAGIRAVVCSEPYSAQLSRQHNDTNVLAFGSRVVG  113



>ref|WP_021016588.1| ribose 5-phosphate isomerase B [Serratia sp. ATCC 39006]
 gb|ESN62402.1| Ribose-5-phosphate isomerase [Serratia sp. ATCC 39006]
Length=151

 Score = 55.8 bits (133),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 24/40 (60%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = +1

Query  1    IAANKFKGIRCVNCNDPYAALQGRQHENSNVLSMGCRVIG  120
            IAANK  GIR V C++PY+A   R+H N+N+L+MG RVIG
Sbjct  73   IAANKMTGIRAVACSEPYSAKLSREHNNTNILAMGARVIG  112



>ref|WP_032272785.1| ribose 5-phosphate isomerase, partial [Escherichia coli]
Length=116

 Score = 55.8 bits (133),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = +1

Query  1    IAANKFKGIRCVNCNDPYAALQGRQHENSNVLSMGCRVIG  120
            IAANKF GIR V C++PY+A   RQH ++NVL+ G RV+G
Sbjct  74   IAANKFAGIRAVVCSEPYSAQLSRQHNDTNVLAFGSRVVG  113



>ref|WP_000716789.1| ribose 5-phosphate isomerase [Escherichia coli]
 gb|EIL51713.1| ribose-5-phosphate isomerase B [Escherichia coli KD1]
Length=149

 Score = 55.8 bits (133),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = +1

Query  1    IAANKFKGIRCVNCNDPYAALQGRQHENSNVLSMGCRVIG  120
            IAANKF GIR V C++PY+A   RQH ++NVL+ G RV+G
Sbjct  74   IAANKFAGIRAVVCSEPYSAQLSRQHNDTNVLAFGSRVVG  113



>ref|WP_017867199.1| hypothetical protein [Lactobacillus pobuzihii]
Length=165

 Score = 55.8 bits (133),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 24/40 (60%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = +1

Query  1    IAANKFKGIRCVNCNDPYAALQGRQHENSNVLSMGCRVIG  120
            +AANK KGIR V C++PY+A   RQH N+NVL+ G RV+G
Sbjct  74   LAANKVKGIRAVCCSEPYSAQLSRQHNNTNVLAFGSRVVG  113



>ref|WP_001398149.1| ribose 5-phosphate isomerase B [Escherichia coli]
 gb|ENA75128.1| ribose 5-phosphate isomerase B [Escherichia coli 2741950]
Length=149

 Score = 55.8 bits (133),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = +1

Query  1    IAANKFKGIRCVNCNDPYAALQGRQHENSNVLSMGCRVIG  120
            IAANKF GIR V C++PY+A   RQH ++NVL+ G RV+G
Sbjct  74   IAANKFAGIRAVVCSEPYSAQLSRQHNDTNVLAFGSRVVG  113



>ref|WP_000716791.1| ribose 5-phosphate isomerase [Escherichia coli]
 ref|NP_756947.1| ribose-5-phosphate isomerase B [Escherichia coli CFT073]
 ref|YP_006151816.1| ribose-5-phosphate isomerase B [Escherichia coli str. 'clone 
D i2']
 ref|YP_006156735.1| ribose-5-phosphate isomerase B [Escherichia coli str. 'clone 
D i14']
 ref|YP_006108567.1| ribose-5-phosphate isomerase B [Escherichia coli ABU 83972]
 gb|AAN83521.1|AE016771_32 Ribose 5-phosphate isomerase B [Escherichia coli CFT073]
 gb|EEJ46679.1| ribose-5-phosphate isomerase B [Escherichia coli 83972]
 gb|EFJ56822.1| ribose-5-phosphate isomerase B [Escherichia coli MS 185-1]
 gb|EFJ90987.1| ribose-5-phosphate isomerase B [Escherichia coli MS 45-1]
 gb|ADN49036.1| ribose-5-phosphate isomerase B [Escherichia coli ABU 83972]
 gb|EFU53346.1| ribose-5-phosphate isomerase B [Escherichia coli MS 153-1]
 gb|EFZ75305.1| ribose 5-phosphate isomerase B [Escherichia coli RN587/1]
 gb|AER87192.1| ribose-5-phosphate isomerase B [Escherichia coli str. 'clone 
D i2']
 gb|AER92111.1| ribose-5-phosphate isomerase B [Escherichia coli str. 'clone 
D i14']
 gb|EII87038.1| ribose-5-phosphate isomerase B [Escherichia coli 3003]
 gb|EII95033.1| ribose-5-phosphate isomerase B [Escherichia coli TW07793]
 gb|EKI21961.1| ribose 5-phosphate isomerase B [Escherichia coli ARS4.2123]
 gb|ELC59875.1| ribose-5-phosphate isomerase B [Escherichia coli KTE39]
 gb|ELC76356.1| ribose-5-phosphate isomerase B [Escherichia coli KTE187]
 gb|ELC77445.1| ribose-5-phosphate isomerase B [Escherichia coli KTE188]
 gb|ELC78484.1| ribose-5-phosphate isomerase B [Escherichia coli KTE189]
 gb|ELC87561.1| ribose-5-phosphate isomerase B [Escherichia coli KTE191]
 gb|ELD03801.1| ribose-5-phosphate isomerase B [Escherichia coli KTE201]
 gb|ELD43032.1| ribose-5-phosphate isomerase B [Escherichia coli KTE214]
 gb|ELD45859.1| ribose-5-phosphate isomerase B [Escherichia coli KTE220]
 gb|ELD56614.1| ribose-5-phosphate isomerase B [Escherichia coli KTE230]
 gb|ELE08396.1| ribose-5-phosphate isomerase B [Escherichia coli KTE53]
 gb|ELE36225.1| ribose-5-phosphate isomerase B [Escherichia coli KTE60]
 gb|ELE45010.1| ribose-5-phosphate isomerase B [Escherichia coli KTE67]
 gb|ELE85705.1| ribose-5-phosphate isomerase B [Escherichia coli KTE87]
 gb|ELG20534.1| ribose-5-phosphate isomerase B [Escherichia coli KTE63]
 gb|ELG82608.1| ribose-5-phosphate isomerase B [Escherichia coli KTE141]
 gb|ELH63664.1| ribose-5-phosphate isomerase B [Escherichia coli KTE209]
 gb|ELH90899.1| ribose-5-phosphate isomerase B [Escherichia coli KTE218]
 gb|ELH96168.1| ribose-5-phosphate isomerase B [Escherichia coli KTE223]
 gb|ELI02170.1| ribose-5-phosphate isomerase B [Escherichia coli KTE104]
 gb|ELI05905.1| ribose-5-phosphate isomerase B [Escherichia coli KTE106]
 gb|ELI37785.1| ribose-5-phosphate isomerase B [Escherichia coli KTE124]
 gb|ELI68913.1| ribose-5-phosphate isomerase B [Escherichia coli KTE137]
 gb|ELI97396.1| ribose-5-phosphate isomerase B [Escherichia coli KTE153]
 gb|ELJ06803.1| ribose-5-phosphate isomerase B [Escherichia coli KTE160]
 gb|ELJ21204.1| ribose-5-phosphate isomerase B [Escherichia coli KTE167]
 gb|ELJ32852.1| ribose-5-phosphate isomerase B [Escherichia coli KTE174]
 gb|ELJ91147.1| ribose-5-phosphate isomerase B [Escherichia coli KTE97]
 gb|ELJ93875.1| ribose-5-phosphate isomerase B [Escherichia coli KTE99]
 gb|ELL40050.1| ribose-5-phosphate isomerase B [Escherichia coli J96]
 emb|CCQ06866.1| D-allose-6-phosphate isomerase [Escherichia coli Nissle 1917]
 gb|EMZ39646.1| ribose-5-phosphate isomerase B [Escherichia coli SWW33]
 gb|EOR52654.1| ribose-5-phosphate isomerase B [Escherichia coli ATCC 25922]
 gb|EOV02985.1| ribose-5-phosphate isomerase B [Escherichia coli KTE195]
 gb|EOX03534.1| ribose-5-phosphate isomerase B [Escherichia coli KTE226]
 gb|EQM98937.1| ribose-5-phosphate isomerase B [Escherichia coli HVH 2 (4-6943160)]
 gb|EQN13948.1| ribose-5-phosphate isomerase B [Escherichia coli HVH 4 (4-7276109)]
 gb|EQN26957.1| ribose-5-phosphate isomerase B [Escherichia coli HVH 9 (4-6942539)]
 gb|EQN27538.1| ribose-5-phosphate isomerase B [Escherichia coli HVH 7 (4-7315031)]
 gb|EQN40238.1| ribose-5-phosphate isomerase B [Escherichia coli HVH 13 (4-7634056)]
 gb|EQN43549.1| ribose-5-phosphate isomerase B [Escherichia coli HVH 16 (4-7649002)]
 gb|EQN58290.1| ribose-5-phosphate isomerase B [Escherichia coli HVH 20 (4-5865042)]
 gb|EQN71521.1| ribose-5-phosphate isomerase B [Escherichia coli HVH 21 (4-4517873)]
 gb|EQN89553.1| ribose-5-phosphate isomerase B [Escherichia coli HVH 27 (4-7449267)]
 gb|EQO11129.1| ribose-5-phosphate isomerase B [Escherichia coli HVH 31 (4-2602156)]
 gb|EQO31441.1| ribose-5-phosphate isomerase B [Escherichia coli HVH 37 (4-2773848)]
 gb|EQO38284.1| ribose-5-phosphate isomerase B [Escherichia coli HVH 39 (4-2679949)]
 gb|EQO48778.1| ribose-5-phosphate isomerase B [Escherichia coli HVH 40 (4-1219782)]
 gb|EQO78894.1| ribose-5-phosphate isomerase B [Escherichia coli HVH 46 (4-2758776)]
 gb|EQO86582.1| ribose-5-phosphate isomerase B [Escherichia coli HVH 51 (4-2172526)]
 gb|EQP06233.1| ribose-5-phosphate isomerase B [Escherichia coli HVH 58 (4-2839709)]
 gb|EQP16053.1| ribose-5-phosphate isomerase B [Escherichia coli HVH 61 (4-2736020)]
 gb|EQP29880.1| ribose-5-phosphate isomerase B [Escherichia coli HVH 68 (4-0888028)]
 gb|EQP45372.1| ribose-5-phosphate isomerase B [Escherichia coli HVH 74 (4-1034782)]
 gb|EQP64533.1| ribose-5-phosphate isomerase B [Escherichia coli HVH 77 (4-2605759)]
 gb|EQP64770.1| ribose-5-phosphate isomerase B [Escherichia coli HVH 78 (4-2735946)]
 gb|EQP99944.1| ribose-5-phosphate isomerase B [Escherichia coli HVH 89 (4-5885604)]
 gb|EQQ19942.1| ribose-5-phosphate isomerase B [Escherichia coli HVH 92 (4-5930790)]
 gb|EQQ21741.1| ribose-5-phosphate isomerase B [Escherichia coli HVH 95 (4-6074464)]
 gb|EQQ31989.1| ribose-5-phosphate isomerase B [Escherichia coli HVH 96 (4-5934869)]
 gb|EQQ45512.1| ribose-5-phosphate isomerase B [Escherichia coli HVH 103 (4-5904188)]
 gb|EQQ63116.1| ribose-5-phosphate isomerase B [Escherichia coli HVH 109 (4-6977162)]
 gb|EQQ71557.1| ribose-5-phosphate isomerase B [Escherichia coli HVH 111 (4-7039018)]
 gb|EQQ83221.1| ribose-5-phosphate isomerase B [Escherichia coli HVH 114 (4-7037740)]
 gb|EQR02428.1| ribose-5-phosphate isomerase B [Escherichia coli HVH 116 (4-6879942)]
 gb|EQR10671.1| ribose-5-phosphate isomerase B [Escherichia coli HVH 117 (4-6857191)]
 gb|EQR24419.1| ribose-5-phosphate isomerase B [Escherichia coli HVH 120 (4-6978681)]
 gb|EQR60608.1| ribose-5-phosphate isomerase B [Escherichia coli HVH 132 (4-6876862)]
 gb|EQR89654.1| ribose-5-phosphate isomerase B [Escherichia coli HVH 138 (4-6066704)]
 gb|EQS09845.1| ribose-5-phosphate isomerase B [Escherichia coli HVH 143 (4-5674999)]
 gb|EQS11144.1| ribose-5-phosphate isomerase B [Escherichia coli HVH 142 (4-5627451)]
 gb|EQS12232.1| ribose-5-phosphate isomerase B [Escherichia coli HVH 144 (4-4451937)]
 gb|EQS34209.1| ribose-5-phosphate isomerase B [Escherichia coli HVH 149 (4-4451880)]
 gb|EQS45310.1| ribose-5-phosphate isomerase B [Escherichia coli HVH 153 (3-9344314)]
 gb|EQS69970.1| ribose-5-phosphate isomerase B [Escherichia coli HVH 161 (4-3119890)]
 gb|EQS92085.1| ribose-5-phosphate isomerase B [Escherichia coli HVH 169 (4-1075578)]
 gb|EQS95527.1| ribose-5-phosphate isomerase B [Escherichia coli HVH 171 (4-3191958)]
 gb|EQT06003.1| ribose-5-phosphate isomerase B [Escherichia coli HVH 172 (4-3248542)]
 gb|EQU08104.1| ribose-5-phosphate isomerase B [Escherichia coli HVH 197 (4-4466217)]
 gb|EQU36347.1| ribose-5-phosphate isomerase B [Escherichia coli HVH 204 (4-3112802)]
 gb|EQU51597.1| ribose-5-phosphate isomerase B [Escherichia coli HVH 207 (4-3113221)]
 gb|EQU67702.1| ribose-5-phosphate isomerase B [Escherichia coli HVH 212 (3-9305343)]
 gb|EQU89273.1| ribose-5-phosphate isomerase B [Escherichia coli HVH 216 (4-3042952)]
 gb|EQU95508.1| ribose-5-phosphate isomerase B [Escherichia coli HVH 218 (4-4500903)]
 gb|EQV03363.1| ribose-5-phosphate isomerase B [Escherichia coli HVH 220 (4-5876842)]
 gb|EQV21754.1| ribose-5-phosphate isomerase B [Escherichia coli HVH 227 (4-2277670)]
 gb|EQV48489.1| ribose-5-phosphate isomerase B [Escherichia coli KOEGE 43 (105a)]
 gb|EQV52815.1| ribose-5-phosphate isomerase B [Escherichia coli KOEGE 44 (106a)]
 gb|EQV61841.1| ribose-5-phosphate isomerase B [Escherichia coli KOEGE 61 (174a)]
 gb|EQW12481.1| ribose-5-phosphate isomerase B [Escherichia coli UMEA 3014-1]
 gb|EQW45810.1| ribose-5-phosphate isomerase B [Escherichia coli UMEA 3087-1]
 gb|EQW74224.1| ribose-5-phosphate isomerase B [Escherichia coli UMEA 3121-1]
 gb|EQX05679.1| ribose-5-phosphate isomerase B [Escherichia coli UMEA 3159-1]
 gb|EQX13944.1| ribose-5-phosphate isomerase B [Escherichia coli UMEA 3161-1]
 gb|EQX14568.1| ribose-5-phosphate isomerase B [Escherichia coli UMEA 3160-1]
 gb|EQX36459.1| ribose-5-phosphate isomerase B [Escherichia coli UMEA 3173-1]
 gb|EQX39742.1| ribose-5-phosphate isomerase B [Escherichia coli UMEA 3175-1]
 gb|EQX51468.1| ribose-5-phosphate isomerase B [Escherichia coli UMEA 3178-1]
 gb|EQX62619.1| ribose-5-phosphate isomerase B [Escherichia coli UMEA 3185-1]
 gb|EQX71867.1| ribose-5-phosphate isomerase B [Escherichia coli UMEA 3193-1]
 gb|EQY07007.1| ribose-5-phosphate isomerase B [Escherichia coli UMEA 3208-1]
 gb|EQY18072.1| ribose-5-phosphate isomerase B [Escherichia coli UMEA 3216-1]
 gb|EQY27387.1| ribose-5-phosphate isomerase B [Escherichia coli UMEA 3220-1]
 gb|EQY36785.1| ribose-5-phosphate isomerase B [Escherichia coli UMEA 3222-1]
 gb|EQY50352.1| ribose-5-phosphate isomerase B [Escherichia coli UMEA 3233-1]
 gb|EQY51220.1| ribose-5-phosphate isomerase B [Escherichia coli UMEA 3244-1]
 gb|EQY63558.1| ribose-5-phosphate isomerase B [Escherichia coli UMEA 3264-1]
 gb|EQY64609.1| ribose-5-phosphate isomerase B [Escherichia coli UMEA 3257-1]
 gb|EQY71312.1| ribose-5-phosphate isomerase B [Escherichia coli UMEA 3268-1]
 gb|EQY95887.1| ribose-5-phosphate isomerase B [Escherichia coli UMEA 3337-1]
 gb|EQZ18925.1| ribose-5-phosphate isomerase B [Escherichia coli UMEA 3490-1]
 gb|EQZ64632.1| ribose-5-phosphate isomerase B [Escherichia coli UMEA 3687-1]
 gb|EQZ71681.1| ribose-5-phosphate isomerase B [Escherichia coli UMEA 3694-1]
 gb|EQZ84949.1| ribose-5-phosphate isomerase B [Escherichia coli UMEA 3707-1]
 gb|EQZ85281.1| ribose-5-phosphate isomerase B [Escherichia coli UMEA 3705-1]
 gb|ERA03262.1| ribose-5-phosphate isomerase B [Escherichia coli UMEA 3821-1]
 gb|ERA29750.1| ribose-5-phosphate isomerase B [Escherichia coli UMEA 3955-1]
 gb|ERA30258.1| ribose-5-phosphate isomerase B [Escherichia coli UMEA 4075-1]
 gb|ERA40644.1| ribose-5-phosphate isomerase B [Escherichia coli UMEA 4076-1]
 gb|ERA41629.1| ribose-5-phosphate isomerase B [Escherichia coli UMEA 4207-1]
 gb|ERA64644.1| ribose-5-phosphate isomerase B [Escherichia coli HVH 156 (4-3206505)]
 gb|ERA65339.1| ribose-5-phosphate isomerase B [Escherichia coli HVH 157 (4-3406229)]
 gb|ERA72230.1| ribose-5-phosphate isomerase B [Escherichia coli HVH 159 (4-5818141)]
 gb|ERA81065.1| ribose-5-phosphate isomerase B [Escherichia coli HVH 160 (4-5695937)]
 gb|ERA87356.1| ribose-5-phosphate isomerase B [Escherichia coli HVH 228 (4-7787030)]
 gb|ERF51587.1| ribose-5-phosphate isomerase B [Escherichia coli UMEA 3652-1]
 gb|ESD00727.1| ribose-5-phosphate isomerase B [Escherichia coli 907391]
 gb|ESD38034.1| ribose-5-phosphate isomerase B [Escherichia coli 907892]
 gb|ESE36886.1| ribose-5-phosphate isomerase B [Escherichia coli A25922R]
 gb|ESK24187.1| ribose-5-phosphate isomerase B [Escherichia coli UMEA 3693-1]
 gb|ESK24369.1| ribose-5-phosphate isomerase B [Escherichia coli UMEA 3342-1]
 gb|ESP14611.1| ribose-5-phosphate isomerase B [Escherichia coli HVH 86 (4-7026218)]
 gb|ETE12390.1| ribose 5-phosphate isomerase [Escherichia coli LAU-EC6]
 gb|ETF19845.1| ribose-5-phosphate isomerase B [Escherichia coli HVH 23 (4-6066488)]
 gb|ETF20144.1| ribose-5-phosphate isomerase B [Escherichia coli HVH 83 (4-2051087)]
 gb|EWY51606.1| ribose 5-phosphate isomerase [Escherichia coli MP1]
 gb|EYB58975.1| ribose 5-phosphate isomerase [Escherichia coli]
 gb|EYT05956.1| ribose-5-phosphate isomerase B [Escherichia coli K02]
 gb|EYV95257.1| ribose 5-phosphate isomerase [Escherichia coli O86:H34 str. 99-3124]
 gb|EZQ58680.1| ribose-5-phosphate isomerase B [Escherichia coli BIDMC 83]
 gb|KDT44834.1| ribose 5-phosphate isomerase B [Escherichia coli 3-105-05_S4_C2]
 gb|KEJ04984.1| ribose 5-phosphate isomerase B [Escherichia coli 8-415-05_S4_C2]
 gb|KEJ05708.1| ribose 5-phosphate isomerase B [Escherichia coli 8-415-05_S4_C1]
 gb|KEJ25608.1| ribose 5-phosphate isomerase B [Escherichia coli 8-415-05_S4_C3]
 gb|KEJ73610.1| ribose 5-phosphate isomerase B [Escherichia coli 6-175-07_S3_C2]
 gb|KEL88334.1| ribose 5-phosphate isomerase B [Escherichia coli 6-175-07_S3_C1]
 gb|KEL97391.1| ribose 5-phosphate isomerase B [Escherichia coli 6-175-07_S3_C3]
 gb|KEM18560.1| ribose 5-phosphate isomerase B [Escherichia coli 6-319-05_S3_C1]
 gb|KEM26185.1| ribose 5-phosphate isomerase B [Escherichia coli 6-319-05_S3_C2]
 gb|KEM57145.1| ribose 5-phosphate isomerase B [Escherichia coli 6-319-05_S3_C3]
 gb|KEN30660.1| ribose 5-phosphate isomerase B [Escherichia coli 8-415-05_S3_C3]
 gb|KEN36762.1| ribose 5-phosphate isomerase B [Escherichia coli 8-415-05_S3_C1]
 gb|KEN68470.1| ribose 5-phosphate isomerase B [Escherichia coli 8-415-05_S3_C2]
 gb|AID81294.1| ribose 5-phosphate isomerase [Escherichia coli Nissle 1917]
 gb|KEP01609.1| ribose 5-phosphate isomerase [Escherichia coli]
 gb|KEP03781.1| ribose 5-phosphate isomerase [Escherichia coli]
 gb|AIL16449.1| ribose 5-phosphate isomerase B [Escherichia coli ATCC 25922]
Length=149

 Score = 55.8 bits (133),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = +1

Query  1    IAANKFKGIRCVNCNDPYAALQGRQHENSNVLSMGCRVIG  120
            IAANKF GIR V C++PY+A   RQH ++NVL+ G RV+G
Sbjct  74   IAANKFAGIRAVVCSEPYSAQLSRQHNDTNVLAFGSRVVG  113



>ref|WP_000716792.1| MULTISPECIES: ribose 5-phosphate isomerase [Escherichia]
 ref|YP_002331872.1| ribose-5-phosphate isomerase B [Escherichia coli O127:H6 str. 
E2348/69]
 ref|YP_002410385.1| ribose-5-phosphate isomerase B [Escherichia coli IAI39]
 ref|YP_002558953.1| ribose-5-phosphate isomerase B [Escherichia coli LF82]
 ref|YP_006141393.1| ribose 5-phosphate isomerase [Escherichia coli NA114]
 ref|YP_006146763.1| ribose 5-phosphate isomerase B/allose 6-phosphate isomerase [Escherichia 
coli O7:K1 str. CE10]
 ref|YP_006122446.1| ribose-5-phosphate isomerase B [Escherichia coli O83:H1 str. 
NRG 857C]
 ref|YP_003351961.1| ribose 5-phosphate isomerase [Escherichia coli SE15]
 ref|YP_008724484.1| ribose 5-phosphate isomerase [Escherichia coli JJ1886]
 emb|CAS11967.1| ribose 5-phosphate isomerase B/allose6-phosphate isomerase [Escherichia 
coli O127:H6 str. E2348/69]
 emb|CAR20619.1| ribose 5-phosphate isomerase B/allose 6-phosphate isomerase [Escherichia 
coli IAI39]
 emb|CAP78564.1| ribose-5-phosphate isomerase B [Escherichia coli LF82]
 dbj|BAI57511.1| ribose 5-phosphate isomerase [Escherichia coli SE15]
 gb|EFR17574.1| ribose 5-phosphate isomerase B [Escherichia coli 2362-75]
 gb|ADR29512.1| ribose-5-phosphate isomerase B [Escherichia coli O83:H1 str. 
NRG 857C]
 gb|EFW68106.1| ribose-5-phosphate isomerase B [Escherichia coli WV_060327]
 gb|EGB77887.1| ribose-5-phosphate isomerase B [Escherichia coli MS 57-2]
 gb|EGH36947.1| ribose 5-phosphate isomerase B [Escherichia coli AA86]
 gb|EGI13221.1| ribose 5-phosphate isomerase B [Escherichia coli M605]
 gb|EGI52408.1| ribose 5-phosphate isomerase B [Escherichia coli H299]
 gb|AEG39119.1| ribose 5-phosphate isomerase [Escherichia coli NA114]
 gb|AEQ15477.1| ribose 5-phosphate isomerase B/allose 6-phosphate isomerase [Escherichia 
coli O7:K1 str. CE10]
 gb|EHN86580.1| ribose-5-phosphate isomerase B [Escherichia coli TA124]
 gb|EHN98852.1| ribose-5-phosphate isomerase B [Escherichia coli B093]
 gb|EHU03206.1| ribose 5-phosphate isomerase B [Escherichia coli DEC1A]
 gb|EHU03325.1| ribose 5-phosphate isomerase B [Escherichia coli DEC1C]
 gb|EHU05478.1| ribose 5-phosphate isomerase B [Escherichia coli DEC1B]
 gb|EHU19715.1| ribose 5-phosphate isomerase B [Escherichia coli DEC1E]
 gb|EHU20961.1| ribose 5-phosphate isomerase B [Escherichia coli DEC2A]
 gb|EHU29598.1| ribose 5-phosphate isomerase B [Escherichia coli DEC1D]
 gb|EHU34373.1| ribose 5-phosphate isomerase B [Escherichia coli DEC2B]
 gb|EHU35740.1| ribose 5-phosphate isomerase B [Escherichia coli DEC2C]
 gb|EHU37550.1| ribose 5-phosphate isomerase B [Escherichia coli DEC2D]
 gb|EHU49087.1| ribose 5-phosphate isomerase B [Escherichia coli DEC2E]
 gb|EIA34145.1| ribose-5-phosphate isomerase B [Escherichia coli SCI-07]
 gb|EKI34071.1| ribose 5-phosphate isomerase B [Escherichia coli 07798]
 gb|ELC40435.1| ribose-5-phosphate isomerase B [Escherichia coli KTE25]
 gb|ELC46027.1| ribose-5-phosphate isomerase B [Escherichia coli KTE28]
 gb|ELC68101.1| ribose-5-phosphate isomerase B [Escherichia coli KTE178]
 gb|ELD05708.1| ribose-5-phosphate isomerase B [Escherichia coli KTE205]
 gb|ELD38075.1| ribose-5-phosphate isomerase B [Escherichia coli KTE216]
 gb|ELE01295.1| ribose-5-phosphate isomerase B [Escherichia coli KTE49]
 gb|ELE26217.1| ribose-5-phosphate isomerase B [Escherichia coli KTE57]
 gb|ELF26049.1| ribose-5-phosphate isomerase B [Escherichia coli KTE162]
 gb|ELF46640.1| ribose-5-phosphate isomerase B [Escherichia coli KTE6]
 gb|ELF60464.1| ribose-5-phosphate isomerase B [Escherichia coli KTE9]
 gb|ELF60828.1| ribose-5-phosphate isomerase B [Escherichia coli KTE17]
 gb|ELF69048.1| ribose-5-phosphate isomerase B [Escherichia coli KTE18]
 gb|ELF70355.1| ribose-5-phosphate isomerase B [Escherichia coli KTE45]
 gb|ELF78299.1| ribose-5-phosphate isomerase B [Escherichia coli KTE23]
 gb|ELF92538.1| ribose-5-phosphate isomerase B [Escherichia coli KTE46]
 gb|ELG39654.1| ribose-5-phosphate isomerase B [Escherichia coli KTE84]
 gb|ELH09696.1| ribose-5-phosphate isomerase B [Escherichia coli KTE165]
 gb|ELH31009.1| ribose-5-phosphate isomerase B [Escherichia coli KTE173]
 gb|ELH31394.1| ribose-5-phosphate isomerase B [Escherichia coli KTE175]
 gb|ELH79343.1| ribose-5-phosphate isomerase B [Escherichia coli KTE211]
 gb|ELH80261.1| ribose-5-phosphate isomerase B [Escherichia coli KTE217]
 gb|ELI53500.1| ribose-5-phosphate isomerase B [Escherichia coli KTE129]
 gb|ELI80761.1| ribose-5-phosphate isomerase B [Escherichia coli KTE139]
 gb|ELI91228.1| ribose-5-phosphate isomerase B [Escherichia coli KTE148]
 gb|ELI91799.1| ribose-5-phosphate isomerase B [Escherichia coli KTE150]
 gb|ELJ05782.1| ribose-5-phosphate isomerase B [Escherichia coli KTE157]
 gb|ELJ65434.1| ribose-5-phosphate isomerase B [Escherichia coli KTE85]
 gb|EMW72097.1| ribose 5-phosphate isomerase B [Escherichia coli 2731150]
 emb|CCW27726.1| ribose 5-phosphate isomerase B [Escherichia coli O25b:H4-ST131 
str. EC958]
 gb|EOU59446.1| ribose-5-phosphate isomerase B [Escherichia coli KTE19]
 gb|EOV30198.1| ribose-5-phosphate isomerase B [Escherichia coli KTE219]
 gb|EOW91103.1| ribose-5-phosphate isomerase B [Escherichia coli KTE182]
 emb|CDC84119.1| ribose-5-phosphate isomerase B [Escherichia coli CAG:4]
 gb|EQN48571.1| ribose-5-phosphate isomerase B [Escherichia coli HVH 17 (4-7473087)]
 gb|EQN79782.1| ribose-5-phosphate isomerase B [Escherichia coli HVH 24 (4-5985145)]
 gb|EQN88557.1| ribose-5-phosphate isomerase B [Escherichia coli HVH 26 (4-5703913)]
 gb|EQO92646.1| ribose-5-phosphate isomerase B [Escherichia coli HVH 53 (4-0631051)]
 gb|EQO94663.1| ribose-5-phosphate isomerase B [Escherichia coli HVH 55 (4-2646161)]
 gb|EQP43876.1| ribose-5-phosphate isomerase B [Escherichia coli HVH 70 (4-2963531)]
 gb|EQP67182.1| ribose-5-phosphate isomerase B [Escherichia coli HVH 79 (4-2512823)]
 gb|EQP86062.1| ribose-5-phosphate isomerase B [Escherichia coli HVH 84 (4-1021478)]
 gb|EQQ09610.1| ribose-5-phosphate isomerase B [Escherichia coli HVH 90 (4-3191362)]
 gb|EQQ64383.1| ribose-5-phosphate isomerase B [Escherichia coli HVH 107 (4-5860571)]
 gb|EQR37962.1| ribose-5-phosphate isomerase B [Escherichia coli HVH 125 (4-2634716)]
 gb|EQR55137.1| ribose-5-phosphate isomerase B [Escherichia coli HVH 128 (4-7030436)]
 gb|EQR98827.1| ribose-5-phosphate isomerase B [Escherichia coli HVH 141 (4-5995973)]
 gb|EQS29947.1| ribose-5-phosphate isomerase B [Escherichia coli HVH 146 (4-3189767)]
 gb|EQS57373.1| ribose-5-phosphate isomerase B [Escherichia coli HVH 158 (4-3224287)]
 gb|EQS61196.1| ribose-5-phosphate isomerase B [Escherichia coli HVH 154 (4-5636698)]
 gb|EQS75259.1| ribose-5-phosphate isomerase B [Escherichia coli HVH 162 (4-5627982)]
 gb|EQT17968.1| ribose-5-phosphate isomerase B [Escherichia coli HVH 176 (4-3428664)]
 gb|EQT19201.1| ribose-5-phosphate isomerase B [Escherichia coli HVH 175 (4-3405184)]
 gb|EQT39699.1| ribose-5-phosphate isomerase B [Escherichia coli HVH 184 (4-3343286)]
 gb|EQT52651.1| ribose-5-phosphate isomerase B [Escherichia coli HVH 186 (4-3405044)]
 gb|EQT54373.1| ribose-5-phosphate isomerase B [Escherichia coli HVH 187 (4-4471660)]
 gb|EQT56624.1| ribose-5-phosphate isomerase B [Escherichia coli HVH 188 (4-2356988)]
 gb|EQT71597.1| ribose-5-phosphate isomerase B [Escherichia coli HVH 190 (4-3255514)]
 gb|EQT84965.1| ribose-5-phosphate isomerase B [Escherichia coli HVH 193 (4-3331423)]
 gb|EQT99461.1| ribose-5-phosphate isomerase B [Escherichia coli HVH 194 (4-2356805)]
 gb|EQU05762.1| ribose-5-phosphate isomerase B [Escherichia coli HVH 198 (4-3206106)]
 gb|EQU29011.1| ribose-5-phosphate isomerase B [Escherichia coli HVH 202 (4-3163997)]
 gb|EQU42133.1| ribose-5-phosphate isomerase B [Escherichia coli HVH 205 (4-3094677)]
 gb|EQU75868.1| ribose-5-phosphate isomerase B [Escherichia coli HVH 213 (4-3042928)]
 gb|EQV21846.1| ribose-5-phosphate isomerase B [Escherichia coli HVH 225 (4-1273116)]
 gb|EQV61063.1| ribose-5-phosphate isomerase B [Escherichia coli KOEGE 56 (169a)]
 gb|EQV96467.1| ribose-5-phosphate isomerase B [Escherichia coli KOEGE 118 (317a)]
 gb|EQW36944.1| ribose-5-phosphate isomerase B [Escherichia coli UMEA 3053-1]
 gb|EQW56213.1| ribose-5-phosphate isomerase B [Escherichia coli UMEA 3088-1]
 gb|EQW61842.1| ribose-5-phosphate isomerase B [Escherichia coli UMEA 3108-1]
 gb|EQW70114.1| ribose-5-phosphate isomerase B [Escherichia coli UMEA 3117-1]
 gb|EQW78726.1| ribose-5-phosphate isomerase B [Escherichia coli UMEA 3122-1]
 gb|EQW97474.1| ribose-5-phosphate isomerase B [Escherichia coli UMEA 3152-1]
 gb|EQX06034.1| ribose-5-phosphate isomerase B [Escherichia coli UMEA 3155-1]
 gb|EQY09513.1| ribose-5-phosphate isomerase B [Escherichia coli UMEA 3215-1]
 gb|EQY35540.1| ribose-5-phosphate isomerase B [Escherichia coli UMEA 3221-1]
 gb|EQY38549.1| ribose-5-phosphate isomerase B [Escherichia coli UMEA 3230-1]
 gb|EQZ85704.1| ribose-5-phosphate isomerase B [Escherichia coli UMEA 3703-1]
 gb|ERA33525.1| ribose-5-phosphate isomerase B [Escherichia coli UMEA 3899-1]
 gb|ERB01469.1| ribose-5-phosphate isomerase B [Escherichia coli KOEGE 10 (25a)]
 gb|ERO93248.1| ribose-5-phosphate isomerase B [Escherichia coli BWH 24]
 gb|ESA91548.1| ribose-5-phosphate isomerase B [Escherichia coli 907779]
 gb|ESC96674.1| ribose-5-phosphate isomerase B [Escherichia coli 907446]
 gb|ESD15527.1| ribose-5-phosphate isomerase B [Escherichia coli 907700]
 gb|ESD21821.1| ribose-5-phosphate isomerase B [Escherichia coli 907701]
 gb|ESD39134.1| ribose-5-phosphate isomerase B [Escherichia coli 908519]
 gb|ESD61186.1| ribose-5-phosphate isomerase B [Escherichia coli 908524]
 gb|ESD96898.1| ribose-5-phosphate isomerase B [Escherichia coli 908624]
 gb|ESE06882.1| ribose-5-phosphate isomerase B [Escherichia coli 908632]
 gb|ESE19796.1| ribose-5-phosphate isomerase B [Escherichia coli 910096-2]
 gb|ESE22005.1| ribose-5-phosphate isomerase B [Escherichia coli 908691]
 gb|AGY86725.1| ribose 5-phosphate isomerase [Escherichia coli JJ1886]
 gb|ESL31589.1| ribose-5-phosphate isomerase B [Escherichia coli BIDMC 38]
 gb|ESP40700.1| ribose-5-phosphate isomerase B [Escherichia coli HVH 108 (4-6924867)]
 gb|ETE30028.1| ribose 5-phosphate isomerase [Escherichia coli LAU-EC7]
 gb|ETF14573.1| ribose-5-phosphate isomerase B [Escherichia coli HVH 177 (4-2876612)]
 gb|ETF33344.1| ribose-5-phosphate isomerase B [Escherichia coli UMEA 3489-1]
 emb|CDK87779.1| Ribose 5-phosphate isomerase B [Escherichia coli IS29]
 gb|ETX87348.1| ribose-5-phosphate isomerase B [Escherichia coli BIDMC 20B]
 gb|ETX90242.1| ribose-5-phosphate isomerase B [Escherichia coli BIDMC 20A]
 gb|ETY47605.1| ribose-5-phosphate isomerase B [Escherichia coli BWH 34]
 emb|CDL45307.1| ribose 5-phosphate isomerase B [Escherichia coli ISC41]
 gb|AHM41855.1| ribose 5-phosphate isomerase [Escherichia coli]
 gb|AHM46489.1| ribose 5-phosphate isomerase [Escherichia coli]
 gb|AHM51044.1| ribose 5-phosphate isomerase [Escherichia coli]
 gb|EYB53902.1| ribose 5-phosphate isomerase [Escherichia coli]
 gb|EYZ99514.1| ribose 5-phosphate isomerase [Escherichia coli O119:H4 str. 03-3458]
 gb|KCW96384.1| ribose 5-phosphate isomerase [Escherichia coli]
 gb|KDF70120.1| ribose-5-phosphate isomerase B [Escherichia coli BIDMC 58]
 gb|KDF79626.1| ribose-5-phosphate isomerase B [Escherichia coli BIDMC 63]
 gb|KDF81346.1| ribose-5-phosphate isomerase B [Escherichia coli BIDMC 62]
 gb|KDF87464.1| ribose-5-phosphate isomerase B [Escherichia coli BIDMC 64]
 gb|KDF96803.1| ribose-5-phosphate isomerase B [Escherichia coli BIDMC 70]
 gb|KDG08009.1| ribose-5-phosphate isomerase B [Escherichia coli BIDMC 72]
 gb|KDG13078.1| ribose-5-phosphate isomerase B [Escherichia coli BIDMC 73]
 gb|KDG22753.1| ribose-5-phosphate isomerase B [Escherichia coli BIDMC 75]
 gb|KDG24731.1| ribose-5-phosphate isomerase B [Escherichia coli BIDMC 76]
 gb|KDG38090.1| ribose-5-phosphate isomerase B [Escherichia coli BIDMC 78]
 gb|KDG42173.1| ribose-5-phosphate isomerase B [Escherichia coli BIDMC 79]
 gb|KDG48058.1| ribose-5-phosphate isomerase B [Escherichia coli CHS 68]
 gb|KDG55973.1| ribose-5-phosphate isomerase B [Escherichia coli CHS 69]
 gb|KDG68285.1| ribose-5-phosphate isomerase B [Escherichia coli UCI 51]
 gb|KDG81671.1| ribose-5-phosphate isomerase B [Escherichia coli UCI 57]
 gb|KDG84692.1| ribose-5-phosphate isomerase B [Escherichia coli UCI 58]
 gb|KDN06185.1| Ribose 5-phosphate isomerase B [Escherichia coli]
 emb|CDN84961.1| ribose 5-phosphate isomerase B [Escherichia coli O25b:H4-ST131 
str. EC958]
 gb|KDX49510.1| ribose 5-phosphate isomerase B [Escherichia coli 2-177-06_S4_C1]
 gb|KDY15441.1| ribose 5-phosphate isomerase B [Escherichia coli 2-316-03_S4_C3]
 gb|KDY45929.1| ribose 5-phosphate isomerase B [Escherichia coli 2-427-07_S4_C2]
 gb|KDZ53380.1| ribose 5-phosphate isomerase B [Escherichia coli 3-073-06_S1_C1]
 gb|KEJ37059.1| ribose 5-phosphate isomerase B [Escherichia coli 2-460-02_S1_C3]
 gb|KEJ53802.1| ribose 5-phosphate isomerase B [Escherichia coli 3-020-07_S4_C1]
 gb|KEL52146.1| ribose 5-phosphate isomerase B [Escherichia coli 6-175-07_S1_C1]
 gb|KEO36085.1| ribose 5-phosphate isomerase B [Escherichia coli 2-460-02_S1_C2]
 gb|KEP15331.1| ribose 5-phosphate isomerase [Escherichia coli]
 gb|KFH86405.1| ribose 5-phosphate isomerase [Escherichia coli]
 gb|KFH90590.1| ribose 5-phosphate isomerase [Escherichia coli]
 gb|KGP48107.1| ribose 5-phosphate isomerase [Escherichia coli]
 gb|KGP50344.1| ribose 5-phosphate isomerase [Escherichia coli]
Length=149

 Score = 55.8 bits (133),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = +1

Query  1    IAANKFKGIRCVNCNDPYAALQGRQHENSNVLSMGCRVIG  120
            IAANKF GIR V C++PY+A   RQH ++NVL+ G RV+G
Sbjct  74   IAANKFAGIRAVVCSEPYSAQLSRQHNDTNVLAFGSRVVG  113



>ref|WP_022646445.1| ribose-5-phosphate isomerase B [Escherichia coli]
 gb|ERO99198.1| ribose-5-phosphate isomerase B [Escherichia coli BIDMC 19C]
 gb|ETE10928.1| ribose 5-phosphate isomerase [Escherichia coli LAU-EC8]
 gb|ETE38164.1| ribose 5-phosphate isomerase [Escherichia coli LAU-EC9]
 emb|CDK49682.1| D-allose-6-phosphate isomerase / Ribose 5-phosphate isomerase 
B [Escherichia coli IS5]
 gb|ETX76690.1| ribose-5-phosphate isomerase B [Escherichia coli BIDMC 43b]
 gb|ETX81840.1| ribose-5-phosphate isomerase B [Escherichia coli BIDMC 43a]
 gb|ETX96401.1| ribose-5-phosphate isomerase B [Escherichia coli BIDMC 19B]
 gb|ETY08968.1| ribose-5-phosphate isomerase B [Escherichia coli BIDMC 19A]
 gb|ETY13203.1| ribose-5-phosphate isomerase B [Escherichia coli BIDMC 17A]
 gb|ETY13934.1| ribose-5-phosphate isomerase B [Escherichia coli BIDMC 17B]
 gb|ETY20125.1| ribose-5-phosphate isomerase B [Escherichia coli BIDMC 15]
 gb|ETY23562.1| ribose-5-phosphate isomerase B [Escherichia coli BIDMC 9]
 gb|ETY30252.1| ribose-5-phosphate isomerase B [Escherichia coli BIDMC 3]
 gb|ETY35116.1| ribose-5-phosphate isomerase B [Escherichia coli BIDMC 2B]
 gb|ETY61546.1| ribose-5-phosphate isomerase B [Escherichia coli BIDMC 6]
 gb|EZQ68522.1| ribose-5-phosphate isomerase B [Escherichia coli BIDMC 82]
 gb|KDG01719.1| ribose-5-phosphate isomerase B [Escherichia coli BIDMC 71]
 gb|AIX66160.1| ribose 5-phosphate isomerase [Escherichia coli]
Length=149

 Score = 55.8 bits (133),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = +1

Query  1    IAANKFKGIRCVNCNDPYAALQGRQHENSNVLSMGCRVIG  120
            IAANKF GIR V C++PY+A   RQH ++NVL+ G RV+G
Sbjct  74   IAANKFAGIRAVVCSEPYSAQLSRQHNDTNVLAFGSRVVG  113



>ref|WP_001428658.1| ribose 5-phosphate isomerase B [Escherichia coli]
 gb|EMW16396.1| ribose 5-phosphate isomerase B [Escherichia coli 2848050]
 gb|ENB53321.1| ribose 5-phosphate isomerase B [Escherichia coli P0298942.12]
 gb|ENB94315.1| ribose 5-phosphate isomerase B [Escherichia coli P0299438.3]
 gb|END36774.1| ribose 5-phosphate isomerase B [Escherichia coli 2733950]
 gb|ENF30301.1| ribose 5-phosphate isomerase B [Escherichia coli P0304816.14]
 gb|ENF85300.1| ribose 5-phosphate isomerase B [Escherichia coli P0305260.13]
 gb|ENG29100.1| ribose 5-phosphate isomerase B [Escherichia coli P0305260.9]
 gb|KDU15258.1| ribose 5-phosphate isomerase B [Escherichia coli 3-105-05_S3_C3]
 gb|KEL07951.1| ribose 5-phosphate isomerase B [Escherichia coli 4-203-08_S4_C2]
Length=149

 Score = 55.8 bits (133),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = +1

Query  1    IAANKFKGIRCVNCNDPYAALQGRQHENSNVLSMGCRVIG  120
            IAANKF GIR V C++PY+A   RQH ++NVL+ G RV+G
Sbjct  74   IAANKFAGIRAVVCSEPYSAQLSRQHNDTNVLAFGSRVVG  113



>ref|WP_000716790.1| ribose 5-phosphate isomerase [Escherichia coli]
 ref|YP_672178.1| ribose-5-phosphate isomerase B [Escherichia coli 536]
 gb|ABG72277.1| ribose 5-phosphate isomerase B [Escherichia coli 536]
 gb|EDV67337.1| ribose 5-phosphate isomerase B [Escherichia coli F11]
 gb|EFJ59393.1| ribose-5-phosphate isomerase B [Escherichia coli MS 200-1]
 gb|EGB85018.1| ribose-5-phosphate isomerase B [Escherichia coli MS 60-1]
 gb|ELD11069.1| ribose-5-phosphate isomerase B [Escherichia coli KTE206]
 gb|ELE50916.1| ribose-5-phosphate isomerase B [Escherichia coli KTE75]
 gb|ELF44281.1| ribose-5-phosphate isomerase B [Escherichia coli KTE8]
 gb|ELI62634.1| ribose-5-phosphate isomerase B [Escherichia coli KTE131]
 gb|EQO02247.1| ribose-5-phosphate isomerase B [Escherichia coli HVH 28 (4-0907367)]
 gb|EQP03858.1| ribose-5-phosphate isomerase B [Escherichia coli HVH 56 (4-2153033)]
 gb|EQQ43823.1| ribose-5-phosphate isomerase B [Escherichia coli HVH 100 (4-2850729)]
 gb|EQQ81202.1| ribose-5-phosphate isomerase B [Escherichia coli HVH 112 (4-5987253)]
 gb|EQT45237.1| ribose-5-phosphate isomerase B [Escherichia coli HVH 185 (4-2876639)]
 gb|EQV28658.1| ribose-5-phosphate isomerase B [Escherichia coli KOEGE 30 (63a)]
 gb|EQV62403.1| ribose-5-phosphate isomerase B [Escherichia coli KOEGE 58 (171a)]
 gb|EQV76164.1| ribose-5-phosphate isomerase B [Escherichia coli KOEGE 70 (185a)]
 gb|EQW13994.1| ribose-5-phosphate isomerase B [Escherichia coli UMEA 3022-1]
 gb|EQW50957.1| ribose-5-phosphate isomerase B [Escherichia coli UMEA 3097-1]
 gb|EQW60553.1| ribose-5-phosphate isomerase B [Escherichia coli UMEA 3113-1]
 gb|EQY24536.1| ribose-5-phosphate isomerase B [Escherichia coli UMEA 3217-1]
 gb|EQZ06763.1| ribose-5-phosphate isomerase B [Escherichia coli UMEA 3341-1]
 gb|EQZ29161.1| ribose-5-phosphate isomerase B [Escherichia coli UMEA 3585-1]
 gb|EQZ34004.1| ribose-5-phosphate isomerase B [Escherichia coli UMEA 3617-1]
 gb|ESE37365.1| ribose-5-phosphate isomerase B [Escherichia coli A35218R]
 gb|ESK12517.1| ribose-5-phosphate isomerase B [Escherichia coli UMEA 3290-1]
 gb|ESK22529.1| ribose-5-phosphate isomerase B [Escherichia coli UMEA 3426-1]
 gb|KDO87891.1| ribose 5-phosphate isomerase [Escherichia coli]
Length=149

 Score = 55.8 bits (133),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = +1

Query  1    IAANKFKGIRCVNCNDPYAALQGRQHENSNVLSMGCRVIG  120
            IAANKF GIR V C++PY+A   RQH ++NVL+ G RV+G
Sbjct  74   IAANKFAGIRAVVCSEPYSAQLSRQHNDTNVLAFGSRVVG  113



>ref|WP_000717086.1| ribose 5-phosphate isomerase [Escherichia coli]
 gb|EFK20276.1| ribose-5-phosphate isomerase B [Escherichia coli MS 21-1]
 gb|ELF13741.1| ribose-5-phosphate isomerase B [Escherichia coli KTE143]
 gb|EOU66775.1| ribose-5-phosphate isomerase B [Escherichia coli KTE24]
 gb|EOU85263.1| ribose-5-phosphate isomerase B [Escherichia coli KTE36]
 gb|EOU85931.1| ribose-5-phosphate isomerase B [Escherichia coli KTE37]
 gb|EOU99983.1| ribose-5-phosphate isomerase B [Escherichia coli KTE38]
 gb|EOV59090.1| ribose-5-phosphate isomerase B [Escherichia coli KTE69]
 gb|EOV68575.1| ribose-5-phosphate isomerase B [Escherichia coli KTE70]
 gb|EOV83826.1| ribose-5-phosphate isomerase B [Escherichia coli KTE74]
 gb|EOW05345.1| ribose-5-phosphate isomerase B [Escherichia coli KTE98]
 gb|EQP98977.1| ribose-5-phosphate isomerase B [Escherichia coli HVH 87 (4-5977630)]
 gb|EQX74465.1| ribose-5-phosphate isomerase B [Escherichia coli UMEA 3190-1]
 gb|EQY79813.1| ribose-5-phosphate isomerase B [Escherichia coli UMEA 3304-1]
Length=149

 Score = 55.8 bits (133),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = +1

Query  1    IAANKFKGIRCVNCNDPYAALQGRQHENSNVLSMGCRVIG  120
            IAANKF GIR V C++PY+A   RQH ++NVL+ G RV+G
Sbjct  74   IAANKFAGIRAVVCSEPYSAQLSRQHNDTNVLAFGSRVVG  113



>ref|WP_001552220.1| ribose-5-phosphate isomerase B [Escherichia coli]
 gb|ELD93338.1| ribose-5-phosphate isomerase B [Escherichia coli KTE47]
 gb|EOW41527.1| ribose-5-phosphate isomerase B [Escherichia coli KTE126]
Length=149

 Score = 55.8 bits (133),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = +1

Query  1    IAANKFKGIRCVNCNDPYAALQGRQHENSNVLSMGCRVIG  120
            IAANKF GIR V C++PY+A   RQH ++NVL+ G RV+G
Sbjct  74   IAANKFAGIRAVVCSEPYSAQLSRQHNDTNVLAFGSRVVG  113



>ref|WP_000716796.1| ribose 5-phosphate isomerase [Escherichia coli]
 ref|YP_001746484.1| ribose-5-phosphate isomerase B [Escherichia coli SMS-3-5]
 gb|ACB19758.1| ribose 5-phosphate isomerase B [Escherichia coli SMS-3-5]
 gb|ESD06443.1| ribose-5-phosphate isomerase B [Escherichia coli 907672]
 gb|ESD75237.1| ribose-5-phosphate isomerase B [Escherichia coli 908525]
Length=149

 Score = 55.8 bits (133),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = +1

Query  1    IAANKFKGIRCVNCNDPYAALQGRQHENSNVLSMGCRVIG  120
            IAANKF GIR V C++PY+A   RQH ++NVL+ G RV+G
Sbjct  74   IAANKFAGIRAVVCSEPYSAQLSRQHNDTNVLAFGSRVVG  113



>ref|WP_000716794.1| MULTISPECIES: ribose 5-phosphate isomerase B/allose 6-phosphate 
isomerase [Enterobacteriaceae]
 ref|NP_418514.1| ribose 5-phosphate isomerase B/allose 6-phosphate isomerase [Escherichia 
coli str. K-12 substr. MG1655]
 ref|YP_001726864.1| ribose-5-phosphate isomerase B [Escherichia coli ATCC 8739]
 ref|YP_001732864.1| ribose-5-phosphate isomerase B [Escherichia coli str. K-12 substr. 
DH10B]
 ref|YP_002295664.1| ribose-5-phosphate isomerase B [Escherichia coli SE11]
 ref|YP_002928996.1| ribose-5-phosphate isomerase B [Escherichia coli BW2952]
 ref|YP_003001648.1| allose-6-phosphate isomerase / ribose-5-phosphate isomerase B 
monomer, subunit of allose-6-phosphate isomerase / ribose-5-phosphate 
isomerase B [Escherichia coli BL21(DE3)]
 ref|YP_003038111.1| ribose-5-phosphate isomerase B [Escherichia coli 'BL21-Gold(DE3)pLysS 
AG']
 ref|YP_003047133.1| ribose-5-phosphate isomerase B [Escherichia coli B str. REL606]
 ref|YP_003056523.1| ribose-5-phosphate isomerase B [Escherichia coli BL21(DE3)]
 ref|YP_005279853.1| ribose 5-phosphate isomerase B [Escherichia coli KO11FL]
 ref|YP_006093790.1| ribose 5-phosphate isomerase B [Escherichia coli DH1]
 ref|YP_006136595.1| ribose 5-phosphate isomerase B RpiB [Escherichia coli UMNK88]
 ref|YP_006162720.1| ribose-5-phosphate isomerase B [Escherichia coli KO11FL]
 ref|YP_006117939.1| ribose 5-phosphate isomerase B/allose 6-phosphate isomerase [Escherichia 
coli ETEC H10407]
 ref|YP_006131350.1| ribose-5-phosphate isomerase B [Escherichia coli DH1]
 ref|YP_492234.1| ribose 5-phosphate isomerase B/allose 6-phosphate isomerase [Escherichia 
coli str. K-12 substr. W3110]
 ref|YP_007379458.1| ribose-5-phosphate isomerase B [Escherichia coli APEC O78]
 ref|YP_007559040.1| ribose 5-phosphate isomerase B/allose 6-phosphate isomerase [Escherichia 
coli str. K-12 substr. MDS42]
 ref|YP_008567308.1| ribose 5-phosphate isomerase [Escherichia coli LY180]
 sp|P37351.2|RPIB_ECOLI RecName: Full=Ribose-5-phosphate isomerase B; AltName: Full=Phosphoriboisomerase 
B [Escherichia coli K-12]
 gb|AAA96989.1| yjcA [Escherichia coli str. K-12 substr. MG1655]
 emb|CAA57688.1| ribose phosphate isomerase B [Escherichia coli]
 gb|AAC77051.1| ribose 5-phosphate isomerase B/allose 6-phosphate isomerase [Escherichia 
coli str. K-12 substr. MG1655]
 dbj|BAE78093.1| ribose 5-phosphate isomerase B/allose 6-phosphate isomerase [Escherichia 
coli str. K-12 substr. W3110]
 gb|ACA79537.1| ribose 5-phosphate isomerase B [Escherichia coli ATCC 8739]
 gb|ACB05086.1| ribose 5-phosphate isomerase B/allose 6-phosphate isomerase [Escherichia 
coli str. K-12 substr. DH10B]
 gb|EDU63977.1| ribose 5-phosphate isomerase B [Escherichia coli 53638]
 gb|EDV60971.1| ribose 5-phosphate isomerase B [Escherichia coli B7A]
 gb|EDX39748.1| ribose 5-phosphate isomerase B [Escherichia coli 101-1]
 dbj|BAG79913.1| ribose 5-phosphate isomerase [Escherichia coli SE11]
 gb|EEH72209.1| ribose-5-phosphate isomerase B [Escherichia sp. 1_1_43]
 gb|ACR65480.1| ribose 5-phosphate isomerase B/allose 6-phosphate isomerase [Escherichia 
coli BW2952]
 emb|CAQ34439.1| allose-6-phosphate isomerase / ribose-5-phosphate isomerase B 
monomer, subunit of allose-6-phosphate isomerase / ribose-5-phosphate 
isomerase B [Escherichia coli BL21(DE3)]
 gb|ACT30926.1| ribose 5-phosphate isomerase B [Escherichia coli 'BL21-Gold(DE3)pLysS 
AG']
 gb|ACT41597.1| ribose-5-phosphate isomerase B [Escherichia coli B str. REL606]
 gb|ACT45752.1| ribose-5-phosphate isomerase B [Escherichia coli BL21(DE3)]
 gb|ACX41501.1| ribose 5-phosphate isomerase B [Escherichia coli DH1]
 gb|EFI90516.1| ribose-5-phosphate isomerase B [Escherichia coli MS 196-1]
 gb|EFJ65575.1| ribose-5-phosphate isomerase B [Escherichia coli MS 175-1]
 gb|EFJ85402.1| ribose-5-phosphate isomerase B [Escherichia coli MS 84-1]
 gb|EFK17280.1| ribose-5-phosphate isomerase B [Escherichia coli MS 116-1]
 gb|EFK23657.1| ribose-5-phosphate isomerase B [Escherichia coli MS 187-1]
 gb|EFK69766.1| ribose-5-phosphate isomerase B [Escherichia coli MS 124-1]
 gb|EFK92350.1| ribose-5-phosphate isomerase B [Escherichia coli MS 146-1]
 gb|EFO57826.1| ribose-5-phosphate isomerase B [Escherichia coli MS 145-7]
 emb|CBJ03908.1| ribose 5-phosphate isomerase B/allose 6-phosphate isomerase [Escherichia 
coli ETEC H10407]
 gb|EFP98897.1| ribose 5-phosphate isomerase B [Escherichia coli 1827-70]
 dbj|BAJ45805.1| ribose-5-phosphate isomerase B [Escherichia coli DH1]
 gb|EFU33740.1| ribose-5-phosphate isomerase B [Escherichia coli MS 85-1]
 gb|EFU98075.1| ribose 5-phosphate isomerase B [Escherichia coli 3431]
 gb|ADX52789.1| ribose 5-phosphate isomerase B [Escherichia coli KO11FL]
 gb|EGB31833.1| ribose 5-phosphate isomerase B [Escherichia coli E1520]
 gb|EGB36469.1| ribose 5-phosphate isomerase B [Escherichia coli E482]
 gb|EGB56040.1| ribose 5-phosphate isomerase B [Escherichia coli H489]
 gb|EGB65131.1| ribose 5-phosphate isomerase B [Escherichia coli TA007]
 gb|EGB86397.1| ribose-5-phosphate isomerase B [Escherichia coli MS 117-3]
 gb|EGI08051.1| ribose 5-phosphate isomerase B [Escherichia coli H736]
 gb|AEE59432.1| ribose 5-phosphate isomerase B RpiB [Escherichia coli UMNK88]
 gb|AEJ59497.1| ribose 5-phosphate isomerase B [Escherichia coli UMNF18]
 gb|EGU27577.1| ribose-5-phosphate isomerase B [Escherichia coli XH140A]
 gb|EGV46135.1| ribose-5-phosphate isomerase B [Escherichia coli XH001]
 gb|EGW79326.1| ribose 5-phosphate isomerase B [Escherichia coli 3030-1]
 gb|EGW89113.1| ribose 5-phosphate isomerase B [Escherichia coli STEC_EH250]
 gb|EGX00460.1| ribose 5-phosphate isomerase B [Escherichia coli G58-1]
 gb|EGX14209.1| ribose 5-phosphate isomerase B [Escherichia coli STEC_S1191]
 gb|EGX19455.1| ribose 5-phosphate isomerase B [Escherichia coli TX1999]
 dbj|BAL40647.1| ribose 5-phosphate isomerase B/allose 6-phosphate isomerase [Escherichia 
coli str. K-12 substr. MDS42]
 gb|EHP66929.1| ribose-5-phosphate isomerase B [Escherichia coli 4_1_47FAA]
 gb|EHV50840.1| ribose 5-phosphate isomerase B [Escherichia coli DEC6B]
 gb|EHV51264.1| ribose 5-phosphate isomerase B [Escherichia coli DEC6A]
 gb|EHV54026.1| ribose 5-phosphate isomerase B [Escherichia coli DEC6C]
 gb|EHV66143.1| ribose 5-phosphate isomerase B [Escherichia coli DEC6D]
 gb|EHV68377.1| ribose 5-phosphate isomerase B [Escherichia coli DEC6E]
 gb|EHV71952.1| ribose 5-phosphate isomerase B [Escherichia coli DEC7A]
 gb|EHV83179.1| ribose 5-phosphate isomerase B [Escherichia coli DEC7C]
 gb|EHV85679.1| ribose 5-phosphate isomerase B [Escherichia coli DEC7D]
 gb|EHV89949.1| ribose 5-phosphate isomerase B [Escherichia coli DEC7B]
 gb|EHV96299.1| ribose 5-phosphate isomerase B [Escherichia coli DEC7E]
 gb|EHW83859.1| ribose 5-phosphate isomerase B [Escherichia coli DEC10E]
 gb|EHX73539.1| ribose 5-phosphate isomerase B [Escherichia coli DEC14B]
 gb|EHX83230.1| ribose 5-phosphate isomerase B [Escherichia coli DEC14C]
 gb|EHX86028.1| ribose 5-phosphate isomerase B [Escherichia coli DEC14D]
 gb|AFH15368.1| ribose-5-phosphate isomerase B [Escherichia coli KO11FL]
 gb|EIE35027.1| ribose 5-phosphate isomerase B [Escherichia coli J53]
 gb|EIF15807.1| ribose-5-phosphate isomerase B [Escherichia coli O32:H37 str. 
P4]
 gb|EIF87720.1| ribose-5-phosphate isomerase B [Escherichia coli M919]
 gb|EIG72796.1| ribose-5-phosphate isomerase B [Escherichia sp. 4_1_40B]
 gb|EII10297.1| ribose-5-phosphate isomerase B [Escherichia coli 5.0959]
 gb|EII23831.1| ribose-5-phosphate isomerase B [Escherichia coli 9.0111]
 gb|EII47643.1| ribose-5-phosphate isomerase B [Escherichia coli 2.3916]
 gb|EII66128.1| ribose-5-phosphate isomerase B [Escherichia coli 2.4168]
 gb|EII74390.1| ribose-5-phosphate isomerase B [Escherichia coli 3.2303]
 gb|EIJ01229.1| ribose-5-phosphate isomerase B [Escherichia coli B41]
 gb|EIL71046.1| ribose-5-phosphate isomerase B [Escherichia coli 75]
 gb|EIQ58681.1| ribose 5-phosphate isomerase B [Escherichia coli EPECa12]
 gb|EKI15014.1| ribose 5-phosphate isomerase B [Escherichia coli TW15901]
 gb|EKK38398.1| ribose 5-phosphate isomerase B [Escherichia coli 8.0566]
 gb|EKK39696.1| ribose 5-phosphate isomerase B [Escherichia coli 8.0569]
 emb|CCK49427.1| ribose 5-phosphate isomerase B [Escherichia coli chi7122]
 emb|CCJ46743.1| ribose 5-phosphate isomerase B [Escherichia coli]
 gb|ELC66186.1| ribose-5-phosphate isomerase B [Escherichia coli KTE44]
 gb|ELD26522.1| ribose-5-phosphate isomerase B [Escherichia coli KTE212]
 gb|ELE07141.1| ribose-5-phosphate isomerase B [Escherichia coli KTE51]
 gb|ELE14528.1| ribose-5-phosphate isomerase B [Escherichia coli KTE56]
 gb|ELE67286.1| ribose-5-phosphate isomerase B [Escherichia coli KTE77]
 gb|ELE75533.1| ribose-5-phosphate isomerase B [Escherichia coli KTE81]
 gb|ELF03396.1| ribose-5-phosphate isomerase B [Escherichia coli KTE111]
 gb|ELF13156.1| ribose-5-phosphate isomerase B [Escherichia coli KTE119]
 gb|ELF23950.1| ribose-5-phosphate isomerase B [Escherichia coli KTE156]
 gb|ELF29094.1| ribose-5-phosphate isomerase B [Escherichia coli KTE161]
 gb|ELF42866.1| ribose-5-phosphate isomerase B [Escherichia coli KTE171]
 gb|ELF79696.1| ribose-5-phosphate isomerase B [Escherichia coli KTE42]
 gb|ELG08607.1| ribose-5-phosphate isomerase B [Escherichia coli KTE50]
 gb|ELG93698.1| ribose-5-phosphate isomerase B [Escherichia coli KTE146]
 gb|ELG98483.1| ribose-5-phosphate isomerase B [Escherichia coli KTE154]
 gb|ELH56087.1| ribose-5-phosphate isomerase B [Escherichia coli KTE197]
 gb|ELH64582.1| ribose-5-phosphate isomerase B [Escherichia coli KTE202]
 gb|ELI34343.1| ribose-5-phosphate isomerase B [Escherichia coli KTE120]
 gb|ELI49832.1| ribose-5-phosphate isomerase B [Escherichia coli KTE125]
 gb|ELJ08754.1| ribose-5-phosphate isomerase B [Escherichia coli KTE163]
 gb|ELJ19639.1| ribose-5-phosphate isomerase B [Escherichia coli KTE166]
 gb|ELJ51183.1| ribose-5-phosphate isomerase B [Escherichia coli KTE232]
 emb|CCP97872.1| D-allose-6-phosphate isomerase [Escherichia coli O10:K5(L):H4 
str. ATCC 23506]
 emb|CCQ02034.1| D-allose-6-phosphate isomerase [Escherichia coli O5:K4(L):H4 
str. ATCC 23502]
 gb|AGC85014.1| ribose-5-phosphate isomerase B [Escherichia coli APEC O78]
 gb|EMD03595.1| ribose-5-phosphate isomerase B [Escherichia coli S17]
 gb|EMR92281.1| ribose 5-phosphate isomerase B/allose 6-phosphate isomerase [Escherichia 
coli ONT:H33 str. C48/93]
 gb|EMS04221.1| ribose 5-phosphate isomerase B/allose 6-phosphate isomerase [Escherichia 
coli O127:H27 str. C43/90]
 gb|EMU56856.1| ribose 5-phosphate isomerase B [Escherichia coli MP021552.11]
 gb|EMU56942.1| ribose 5-phosphate isomerase B [Escherichia coli MP021552.7]
 gb|EMU65331.1| ribose 5-phosphate isomerase B [Escherichia coli MP021552.12]
 gb|EMV15215.1| ribose 5-phosphate isomerase B [Escherichia coli C-34666]
 gb|EMV34526.1| ribose 5-phosphate isomerase B [Escherichia coli BCE019_MS-13]
 gb|EMV51281.1| ribose 5-phosphate isomerase B [Escherichia coli 2871950]
 gb|EMV51359.1| ribose 5-phosphate isomerase B [Escherichia coli 2872000]
 gb|EMW27310.1| ribose 5-phosphate isomerase B [Escherichia coli 2845350]
 gb|EMW31158.1| ribose 5-phosphate isomerase B [Escherichia coli 2785200]
 gb|EMW51532.1| ribose 5-phosphate isomerase B [Escherichia coli 2762100]
 gb|EMW83145.1| ribose 5-phosphate isomerase B [Escherichia coli 180050]
 gb|EMW91036.1| ribose 5-phosphate isomerase B [Escherichia coli 174750]
 gb|EMW92315.1| ribose 5-phosphate isomerase B [Escherichia coli ThroopD]
 gb|EMX27004.1| ribose 5-phosphate isomerase B [Escherichia coli MP021566.1]
 gb|EMX33502.1| ribose 5-phosphate isomerase B [Escherichia coli MP021561.2]
 gb|EMX34225.1| ribose 5-phosphate isomerase B [Escherichia coli MP021552.8]
 gb|EMX47421.1| ribose 5-phosphate isomerase B [Escherichia coli MP020940.1]
 gb|EMZ60102.1| ribose 5-phosphate isomerase B [Escherichia coli 174900]
 gb|EMZ60433.1| ribose 5-phosphate isomerase B [Escherichia coli 2846750]
 gb|EMZ74653.1| ribose 5-phosphate isomerase B [Escherichia coli 2722950]
 gb|EMZ89515.1| ribose 5-phosphate isomerase B [Escherichia coli P0305260.1]
 gb|EMZ92582.1| ribose 5-phosphate isomerase B [Escherichia coli P0304816.1]
 gb|ENA00054.1| ribose 5-phosphate isomerase B [Escherichia coli P0299438.2]
 gb|ENA09813.1| ribose 5-phosphate isomerase B [Escherichia coli P0298942.1]
 gb|ENA25549.1| ribose 5-phosphate isomerase B [Escherichia coli 201600.1]
 gb|ENA26853.1| ribose 5-phosphate isomerase B [Escherichia coli BCE007_MS-11]
 gb|ENA47238.1| ribose 5-phosphate isomerase B [Escherichia coli 2726950]
 gb|ENA73752.1| ribose 5-phosphate isomerase B [Escherichia coli 2730450]
 gb|ENA74682.1| ribose 5-phosphate isomerase B [Escherichia coli 2730350]
 gb|ENA89563.1| ribose 5-phosphate isomerase B [Escherichia coli 2862600]
 gb|ENB18185.1| ribose 5-phosphate isomerase B [Escherichia coli BCE011_MS-01]
 gb|ENB29563.1| ribose 5-phosphate isomerase B [Escherichia coli BCE032_MS-12]
 gb|ENB35001.1| ribose 5-phosphate isomerase B [Escherichia coli P0298942.10]
 gb|ENB44347.1| ribose 5-phosphate isomerase B [Escherichia coli P0298942.11]
 gb|ENB50711.1| ribose 5-phosphate isomerase B [Escherichia coli P0298942.14]
 gb|ENB56571.1| ribose 5-phosphate isomerase B [Escherichia coli P0298942.15]
 gb|ENB56756.1| ribose 5-phosphate isomerase B [Escherichia coli P0298942.6]
 gb|ENB57070.1| ribose 5-phosphate isomerase B [Escherichia coli P0298942.2]
 gb|ENB71588.1| ribose 5-phosphate isomerase B [Escherichia coli P0298942.8]
 gb|ENB74046.1| ribose 5-phosphate isomerase B [Escherichia coli P0298942.7]
 gb|ENB84605.1| ribose 5-phosphate isomerase B [Escherichia coli P0299438.10]
 gb|ENB91978.1| ribose 5-phosphate isomerase B [Escherichia coli P0299438.11]
 gb|ENB98665.1| ribose 5-phosphate isomerase B [Escherichia coli P0299438.4]
 gb|ENC09870.1| ribose 5-phosphate isomerase B [Escherichia coli P0299438.6]
 gb|ENC20098.1| ribose 5-phosphate isomerase B [Escherichia coli P0299438.8]
 gb|ENC37415.1| ribose 5-phosphate isomerase B [Escherichia coli P0299438.9]
 gb|END52787.1| ribose 5-phosphate isomerase B [Escherichia coli BCE006_MS-23]
 gb|END61567.1| ribose 5-phosphate isomerase B [Escherichia coli P0298942.4]
 gb|END62158.1| ribose 5-phosphate isomerase B [Escherichia coli P0298942.3]
 gb|END87945.1| ribose 5-phosphate isomerase B [Escherichia coli P0301904.3]
 gb|ENE03768.1| ribose 5-phosphate isomerase B [Escherichia coli P0305260.2]
 gb|ENF20363.1| ribose 5-phosphate isomerase B [Escherichia coli P0304816.10]
 gb|ENF27692.1| ribose 5-phosphate isomerase B [Escherichia coli P0304816.12]
 gb|ENF36582.1| ribose 5-phosphate isomerase B [Escherichia coli P0304816.13]
 gb|ENF45882.1| ribose 5-phosphate isomerase B [Escherichia coli P0304816.2]
 gb|ENF46239.1| ribose 5-phosphate isomerase B [Escherichia coli P0304816.6]
 gb|ENF59382.1| ribose 5-phosphate isomerase B [Escherichia coli P0304816.7]
 gb|ENF70508.1| ribose 5-phosphate isomerase B [Escherichia coli P0305260.10]
 gb|ENF81454.1| ribose 5-phosphate isomerase B [Escherichia coli P0305260.12]
 gb|ENF93602.1| ribose 5-phosphate isomerase B [Escherichia coli P0305260.15]
 gb|ENF97842.1| ribose 5-phosphate isomerase B [Escherichia coli P0305260.3]
 gb|ENF99481.1| ribose 5-phosphate isomerase B [Escherichia coli P0305260.4]
 gb|ENG09160.1| ribose 5-phosphate isomerase B [Escherichia coli P0305260.5]
 gb|ENG11253.1| ribose 5-phosphate isomerase B [Escherichia coli P0305260.6]
 gb|ENG11698.1| ribose 5-phosphate isomerase B [Escherichia coli P0305260.7]
 gb|ENG21836.1| ribose 5-phosphate isomerase B [Escherichia coli P0305260.8]
 gb|ENG85502.1| ribose 5-phosphate isomerase B [Escherichia coli 178850]
 gb|ENH28358.1| ribose 5-phosphate isomerase B [Escherichia coli P0304816.4]
 gb|ENH28557.1| ribose 5-phosphate isomerase B [Escherichia coli P0304816.3]
 gb|ENH35143.1| ribose 5-phosphate isomerase B [Escherichia coli P0304816.5]
 gb|EOU54811.1| ribose-5-phosphate isomerase B [Escherichia coli KTE14]
 gb|EOU58027.1| ribose-5-phosphate isomerase B [Escherichia coli KTE35]
 gb|EOV01187.1| ribose-5-phosphate isomerase B [Escherichia coli KTE34]
 gb|EOV32060.1| ribose-5-phosphate isomerase B [Escherichia coli KTE221]
 gb|EOV32742.1| ribose-5-phosphate isomerase B [Escherichia coli KTE198]
 gb|EOV39648.1| ribose-5-phosphate isomerase B [Escherichia coli KTE222]
 gb|EOV45212.1| ribose-5-phosphate isomerase B [Escherichia coli KTE61]
 gb|EOV73817.1| ribose-5-phosphate isomerase B [Escherichia coli KTE73]
 gb|EOV86141.1| ribose-5-phosphate isomerase B [Escherichia coli KTE71]
 gb|EOW21066.1| ribose-5-phosphate isomerase B [Escherichia coli KTE103]
 gb|EOW30325.1| ribose-5-phosphate isomerase B [Escherichia coli KTE107]
 gb|EOW54818.1| ribose-5-phosphate isomerase B [Escherichia coli KTE132]
 gb|EOW55107.1| ribose-5-phosphate isomerase B [Escherichia coli KTE130]
 gb|EOW65471.1| ribose-5-phosphate isomerase B [Escherichia coli KTE155]
 gb|EQN59748.1| ribose-5-phosphate isomerase B [Escherichia coli HVH 18 (4-8589585)]
 gb|EQO37257.1| ribose-5-phosphate isomerase B [Escherichia coli HVH 33 (4-2174936)]
 gb|EQO58271.1| ribose-5-phosphate isomerase B [Escherichia coli HVH 43 (4-2173468)]
 gb|EQO66691.1| ribose-5-phosphate isomerase B [Escherichia coli HVH 44 (4-2298570)]
 gb|EQP93434.1| ribose-5-phosphate isomerase B [Escherichia coli HVH 82 (4-2209276)]
 gb|EQQ15395.1| ribose-5-phosphate isomerase B [Escherichia coli HVH 91 (4-4638751)]
 gb|EQR31057.1| ribose-5-phosphate isomerase B [Escherichia coli HVH 121 (4-6877826)]
 gb|EQS49562.1| ribose-5-phosphate isomerase B [Escherichia coli HVH 150 (4-3258106)]
 gb|EQS79306.1| ribose-5-phosphate isomerase B [Escherichia coli HVH 164 (4-5953081)]
 gb|EQT32320.1| ribose-5-phosphate isomerase B [Escherichia coli HVH 182 (4-0985554)]
 gb|EQU18107.1| ribose-5-phosphate isomerase B [Escherichia coli HVH 200 (4-4449924)]
 gb|EQU61984.1| ribose-5-phosphate isomerase B [Escherichia coli HVH 209 (4-3062651)]
 gb|EQV02154.1| ribose-5-phosphate isomerase B [Escherichia coli HVH 221 (4-3136817)]
 gb|EQV40624.1| ribose-5-phosphate isomerase B [Escherichia coli KOEGE 40 (102a)]
 gb|EQW08597.1| ribose-5-phosphate isomerase B [Escherichia coli KOEGE 131 (358a)]
 gb|EQW39783.1| ribose-5-phosphate isomerase B [Escherichia coli UMEA 3065-1]
 gb|EQW86573.1| ribose-5-phosphate isomerase B [Escherichia coli UMEA 3139-1]
 gb|EQX46903.1| ribose-5-phosphate isomerase B [Escherichia coli UMEA 3174-1]
 gb|EQX64412.1| ribose-5-phosphate isomerase B [Escherichia coli UMEA 3180-1]
 gb|EQX79529.1| ribose-5-phosphate isomerase B [Escherichia coli UMEA 3199-1]
 gb|EQX82522.1| ribose-5-phosphate isomerase B [Escherichia coli UMEA 3200-1]
 gb|EQY09898.1| ribose-5-phosphate isomerase B [Escherichia coli UMEA 3212-1]
 gb|EQY51635.1| ribose-5-phosphate isomerase B [Escherichia coli UMEA 3240-1]
 gb|EQY82219.1| ribose-5-phosphate isomerase B [Escherichia coli UMEA 3317-1]
 gb|EQY82698.1| ribose-5-phosphate isomerase B [Escherichia coli UMEA 3314-1]
 gb|EQY94107.1| ribose-5-phosphate isomerase B [Escherichia coli UMEA 3329-1]
 gb|EQY94174.1| ribose-5-phosphate isomerase B [Escherichia coli UMEA 3318-1]
 gb|EQZ09920.1| ribose-5-phosphate isomerase B [Escherichia coli UMEA 3355-1]
 gb|EQZ29125.1| ribose-5-phosphate isomerase B [Escherichia coli UMEA 3592-1]
 gb|EQZ34646.1| ribose-5-phosphate isomerase B [Escherichia coli UMEA 3609-1]
 gb|EQZ60149.1| ribose-5-phosphate isomerase B [Escherichia coli UMEA 3682-1]
 gb|ERA13419.1| ribose-5-phosphate isomerase B [Escherichia coli UMEA 3889-1]
 gb|ERA97192.1| ribose-5-phosphate isomerase B [Escherichia coli KOEGE 3 (4a)]
 gb|ERA99573.1| ribose-5-phosphate isomerase B [Escherichia coli KOEGE 7 (16a)]
 gb|ERB10358.1| ribose-5-phosphate isomerase B [Escherichia coli UMEA 3144-1]
 gb|ERB12360.1| ribose-5-phosphate isomerase B [Escherichia coli UMEA 3150-1]
 gb|ERB13490.1| ribose-5-phosphate isomerase B [Escherichia coli UMEA 3151-1]
 gb|ERB24372.1| ribose-5-phosphate isomerase B [Escherichia coli UMEA 3271-1]
 gb|ERF93704.1| ribose 5-phosphate isomerase [Escherichia coli O104:H21 str. 
CFSAN002236]
 gb|ERF96875.1| ribose 5-phosphate isomerase [Escherichia coli O104:H21 str. 
CFSAN002237]
 gb|AGW11136.1| ribose 5-phosphate isomerase [Escherichia coli LY180]
 gb|AGX36002.1| ribose 5-phosphate isomerase B/allose 6-phosphate isomerase [Escherichia 
coli C321.deltaA]
 gb|ESA91123.1| ribose-5-phosphate isomerase B [Escherichia coli 909945-2]
 gb|ESD65173.1| ribose-5-phosphate isomerase B [Escherichia coli 908555]
 gb|ESE00333.1| ribose-5-phosphate isomerase B [Escherichia coli 908658]
 gb|ESL17259.1| ribose-5-phosphate isomerase B [Escherichia coli BIDMC 39]
 gb|ESL31148.1| ribose-5-phosphate isomerase B [Escherichia coli BIDMC 37]
 gb|ESP11985.1| ribose-5-phosphate isomerase B [Escherichia coli HVH 136 (4-5970458)]
 gb|ESP35738.1| ribose-5-phosphate isomerase B [Escherichia coli HVH 152 (4-3447545)]
 gb|ESP40016.1| ribose-5-phosphate isomerase B [Escherichia coli UMEA 3148-1]
 emb|CDJ74324.1| ribose-5-phosphate isomerase B [Escherichia coli str. K-12 substr. 
MC4100]
 gb|ESS97492.1| D-allose-6-phosphate isomerase / Ribose 5-phosphate isomerase 
B [Escherichia coli CE549]
 gb|ESS99470.1| D-allose-6-phosphate isomerase / Ribose 5-phosphate isomerase 
B [Escherichia coli CE418]
 gb|EST64860.1| ribose-5-phosphate isomerase B [Escherichia coli ECC-Z]
 gb|EST75888.1| ribose-5-phosphate isomerase B [Escherichia coli ECA-727]
 gb|EST76050.1| ribose-5-phosphate isomerase B [Escherichia coli ECA-0157]
 gb|ETI79740.1| ribose 5-phosphate isomerase [Escherichia coli ATCC BAA-2219]
 emb|CDK84806.1| Ribose 5-phosphate isomerase B [Escherichia coli IS25]
 emb|CDK79342.1| Ribose 5-phosphate isomerase B [Klebsiella pneumoniae IS22]
 gb|ETS27262.1| ribose 5-phosphate isomerase [Escherichia coli O6:H16:CFA/II 
str. B2C]
 gb|AHM30436.1| ribose 5-phosphate isomerase [Escherichia coli]
 gb|AHM36544.1| ribose 5-phosphate isomerase [Escherichia coli]
 gb|AHM41143.1| ribose 5-phosphate isomerase [Escherichia coli]
 gb|EYB43852.1| ribose 5-phosphate isomerase [Escherichia coli]
 gb|EYB54734.1| ribose 5-phosphate isomerase [Escherichia coli]
 gb|EYD78795.1| ribose 5-phosphate isomerase B [Escherichia coli 1-176-05_S1_C1]
 gb|EYD79336.1| ribose 5-phosphate isomerase B [Escherichia coli 1-176-05_S3_C1]
 gb|EYD93967.1| ribose 5-phosphate isomerase B [Escherichia coli 1-110-08_S4_C3]
 gb|EYD94719.1| ribose 5-phosphate isomerase B [Escherichia coli 1-110-08_S4_C2]
 gb|EYE09686.1| ribose 5-phosphate isomerase B [Escherichia coli 1-110-08_S3_C3]
 gb|EYE16139.1| ribose 5-phosphate isomerase B [Escherichia coli 1-110-08_S3_C2]
 gb|EYE16871.1| ribose 5-phosphate isomerase B [Escherichia coli 1-110-08_S1_C3]
 gb|EYE18185.1| ribose 5-phosphate isomerase B [Escherichia coli 1-110-08_S3_C1]
 gb|EYE31909.1| ribose 5-phosphate isomerase B [Escherichia coli 1-110-08_S1_C1]
 gb|EYU79040.1| ribose 5-phosphate isomerase [Escherichia coli O121:H19 str. 
2010C-4254]
 gb|EYV04338.1| ribose 5-phosphate isomerase [Escherichia coli O121:H19 str. 
2010C-3840]
 gb|EYV04381.1| ribose 5-phosphate isomerase [Escherichia coli O121:H19 str. 
2010C-3840]
 gb|EYV07500.1| ribose 5-phosphate isomerase [Escherichia coli O121:H19 str. 
2010C-3609]
 gb|EYV72511.1| ribose 5-phosphate isomerase [Escherichia coli O121:H19 str. 
2009EL1412]
 gb|EYV76341.1| ribose 5-phosphate isomerase [Escherichia coli O121:H19 str. 
2009C-4659]
 gb|EYV98263.1| ribose 5-phosphate isomerase [Escherichia coli O6:H16 str. 99-3165]
 gb|EYX95616.1| ribose 5-phosphate isomerase [Escherichia coli O121:H19 str. 
2011C-3537]
 gb|EYY01321.1| ribose 5-phosphate isomerase [Escherichia coli O121:H19 str. 
2011C-3500]
 gb|EYY08399.1| ribose 5-phosphate isomerase [Escherichia coli O121:H19 str. 
2011C-3216]
 gb|EYY24533.1| ribose 5-phosphate isomerase [Escherichia coli O121:H19 str. 
2011C-3108]
 gb|EYY26231.1| ribose 5-phosphate isomerase [Escherichia coli O121:H19 str. 
2011C-3072]
 gb|EYY34002.1| ribose 5-phosphate isomerase [Escherichia coli O121:H19 str. 
2010EL1058]
 gb|EYY35500.1| ribose 5-phosphate isomerase [Escherichia coli O121:H19 str. 
2010C-4989]
 gb|EYY53172.1| ribose 5-phosphate isomerase [Escherichia coli O121:H19 str. 
2010C-4966]
 gb|EYY60014.1| ribose 5-phosphate isomerase [Escherichia coli O121:H19 str. 
2010C-4824]
 gb|EYY92698.1| ribose 5-phosphate isomerase [Escherichia coli O121:H19 str. 
2010C-4732]
 gb|EYZ44552.1| ribose 5-phosphate isomerase [Escherichia coli O121:H19 str. 
06-3822]
 gb|EYZ85391.1| ribose 5-phosphate isomerase [Escherichia coli O121:H19 str. 
06-3003]
 gb|EZA09932.1| ribose 5-phosphate isomerase [Escherichia coli O121:H19 str. 
03-3227]
 gb|EZA39481.1| ribose 5-phosphate isomerase [Escherichia coli O103:H11 str. 
04-3023]
 gb|EZA64717.1| ribose 5-phosphate isomerase [Escherichia coli O104:H21 str. 
94-3025]
 gb|EZA69138.1| ribose 5-phosphate isomerase [Escherichia coli O157:H16 str. 
98-3133]
 gb|EZA76615.1| ribose 5-phosphate isomerase [Escherichia coli O25:NM str. E2539C1]
 gb|EZA78089.1| ribose 5-phosphate isomerase [Escherichia coli O6:H16 str. F5656C1]
 gb|EZA94205.1| ribose 5-phosphate isomerase [Escherichia coli O121:H19 str. 
F6714]
 gb|EZB63765.1| ribose 5-phosphate isomerase [Escherichia coli O15:H18 str. K1516]
 gb|EZC49773.1| ribose 5-phosphate isomerase [Escherichia coli O121:H19 str. 
K5198]
 gb|EZC55076.1| ribose 5-phosphate isomerase [Escherichia coli O121:H19 str. 
K5269]
 gb|EZE41243.1| ribose 5-phosphate isomerase [Escherichia coli O121:H19 str. 
2009C-4050]
 gb|EZE72962.1| ribose 5-phosphate isomerase [Escherichia coli O121:H19 str. 
2009C-4750]
 gb|EZE80402.1| ribose 5-phosphate isomerase [Escherichia coli O121:H19 str. 
2009EL1302]
 gb|EZE95988.1| ribose 5-phosphate isomerase [Escherichia coli O121:H19 str. 
2010C-3794]
 gb|EZJ15699.1| ribose 5-phosphate isomerase B [Escherichia coli 1-176-05_S4_C3]
 gb|EZJ25540.1| ribose 5-phosphate isomerase B [Escherichia coli 1-392-07_S4_C2]
 gb|EZJ65017.1| ribose 5-phosphate isomerase B [Escherichia coli 1-392-07_S3_C3]
 gb|EZJ65508.1| ribose 5-phosphate isomerase B [Escherichia coli 1-176-05_S4_C1]
 gb|EZJ79484.1| ribose 5-phosphate isomerase B [Escherichia coli 1-182-04_S3_C2]
 gb|EZJ80565.1| ribose 5-phosphate isomerase B [Escherichia coli 1-182-04_S3_C3]
 gb|EZJ87217.1| ribose 5-phosphate isomerase B [Escherichia coli 1-182-04_S3_C1]
 gb|EZJ91487.1| ribose 5-phosphate isomerase B [Escherichia coli 1-182-04_S1_C3]
 gb|EZJ91958.1| ribose 5-phosphate isomerase B [Escherichia coli 1-250-04_S1_C3]
 gb|EZK04979.1| ribose 5-phosphate isomerase B [Escherichia coli 1-176-05_S1_C3]
 gb|EZK10543.1| ribose 5-phosphate isomerase B [Escherichia coli 2-005-03_S1_C3]
 gb|EZK13736.1| ribose 5-phosphate isomerase B [Escherichia coli 1-176-05_S1_C2]
 gb|EZK25896.1| ribose 5-phosphate isomerase B [Escherichia coli 1-182-04_S1_C1]
 gb|EZK26863.1| ribose 5-phosphate isomerase B [Escherichia coli 2-005-03_S1_C2]
 gb|EZK35868.1| ribose 5-phosphate isomerase B [Escherichia coli 2-005-03_S1_C1]
 gb|KDA61072.1| ribose 5-phosphate isomerase B [Escherichia coli 2-052-05_S1_C1]
 gb|KDA66210.1| ribose 5-phosphate isomerase B [Escherichia coli 1-182-04_S1_C2]
 gb|KDA77266.1| ribose 5-phosphate isomerase B [Escherichia coli 2-011-08_S3_C2]
 gb|KDA82460.1| ribose 5-phosphate isomerase B [Escherichia coli 2-011-08_S3_C3]
 gb|KDA87585.1| ribose 5-phosphate isomerase B [Escherichia coli 1-176-05_S4_C2]
 emb|CDP73054.1| Ribose 5-phosphate isomerase B [Escherichia coli]
 emb|CDP74708.1| Putative uncharacterized protein [Escherichia coli D6-117.29]
 gb|KDG61276.1| ribose-5-phosphate isomerase B [Escherichia coli MGH 57]
 gb|KDG73736.1| ribose-5-phosphate isomerase B [Escherichia coli UCI 53]
 gb|KDG92987.1| ribose-5-phosphate isomerase B [Escherichia coli UCI 66]
 gb|KDP14743.1| ribose 5-phosphate isomerase [Escherichia coli]
 gb|KDS94842.1| ribose 5-phosphate isomerase B [Escherichia coli 2-011-08_S3_C1]
 gb|KDS95306.1| ribose 5-phosphate isomerase B [Escherichia coli 2-011-08_S1_C3]
 gb|KDS99391.1| ribose 5-phosphate isomerase B [Escherichia coli 2-011-08_S4_C1]
 gb|KDT09818.1| ribose 5-phosphate isomerase B [Escherichia coli 2-052-05_S1_C3]
 gb|KDT12937.1| ribose 5-phosphate isomerase B [Escherichia coli 2-011-08_S4_C3]
 gb|KDT14488.1| ribose 5-phosphate isomerase B [Escherichia coli 2-052-05_S3_C1]
 gb|KDT36419.1| ribose 5-phosphate isomerase B [Escherichia coli 3-105-05_S1_C1]
 gb|KDT39725.1| ribose 5-phosphate isomerase B [Escherichia coli 3-105-05_S3_C1]
 gb|KDT46619.1| ribose 5-phosphate isomerase B [Escherichia coli 3-105-05_S3_C2]
 gb|KDT52712.1| ribose 5-phosphate isomerase B [Escherichia coli 3-105-05_S4_C3]
 gb|KDT66341.1| ribose 5-phosphate isomerase B [Escherichia coli 3-267-03_S3_C1]
 gb|KDT67950.1| ribose 5-phosphate isomerase B [Escherichia coli 3-373-03_S3_C1]
 gb|KDT75886.1| ribose 5-phosphate isomerase B [Escherichia coli 3-373-03_S3_C3]
 gb|KDT80581.1| ribose 5-phosphate isomerase B [Escherichia coli 3-373-03_S1_C2]
 gb|KDT86683.1| ribose 5-phosphate isomerase B [Escherichia coli 3-475-03_S1_C1]
 gb|KDT87945.1| ribose 5-phosphate isomerase B [Escherichia coli 3-475-03_S4_C1]
 gb|KDT92664.1| ribose 5-phosphate isomerase B [Escherichia coli 3-105-05_S4_C1]
 gb|KDU13020.1| ribose 5-phosphate isomerase B [Escherichia coli 3-373-03_S3_C2]
 gb|KDU31890.1| ribose 5-phosphate isomerase B [Escherichia coli 3-373-03_S4_C2]
 gb|KDU35030.1| ribose 5-phosphate isomerase B [Escherichia coli 3-373-03_S1_C3]
 gb|KDU39518.1| ribose 5-phosphate isomerase B [Escherichia coli 3-073-06_S4_C1]
 gb|KDU48754.1| ribose 5-phosphate isomerase B [Escherichia coli 3-373-03_S1_C1]
 gb|KDU54304.1| ribose 5-phosphate isomerase B [Escherichia coli 3-373-03_S4_C1]
 gb|KDU58210.1| ribose 5-phosphate isomerase B [Escherichia coli 3-475-03_S4_C2]
 gb|KDU63045.1| ribose 5-phosphate isomerase B [Escherichia coli 4-203-08_S1_C1]
 gb|KDU66713.1| ribose 5-phosphate isomerase B [Escherichia coli 4-203-08_S4_C3]
 gb|KDV49606.1| ribose 5-phosphate isomerase [Escherichia coli O121:H19 str. 
2011C-3609]
 gb|KDV62425.1| ribose 5-phosphate isomerase [Escherichia coli O128:H2 str. 2011C-3317]
 gb|KDV76972.1| ribose 5-phosphate isomerase B [Escherichia coli 2-052-05_S4_C3]
 gb|KDV97125.1| ribose 5-phosphate isomerase B [Escherichia coli 2-156-04_S1_C3]
 gb|KDW03172.1| ribose 5-phosphate isomerase B [Escherichia coli 2-156-04_S3_C3]
 gb|KDW14003.1| ribose 5-phosphate isomerase B [Escherichia coli 2-156-04_S4_C1]
 gb|KDW13725.1| ribose 5-phosphate isomerase B [Escherichia coli 2-177-06_S1_C1]
 gb|KDW27410.1| ribose 5-phosphate isomerase B [Escherichia coli 2-177-06_S1_C2]
 gb|KDW36608.1| ribose 5-phosphate isomerase B [Escherichia coli 2-177-06_S1_C3]
 gb|KDW54626.1| ribose 5-phosphate isomerase B [Escherichia coli 2-210-07_S1_C3]
 gb|KDW59304.1| ribose 5-phosphate isomerase B [Escherichia coli 1-392-07_S3_C2]
 gb|KDW80153.1| ribose 5-phosphate isomerase B [Escherichia coli 2-005-03_S4_C1]
 gb|KDW86305.1| ribose 5-phosphate isomerase B [Escherichia coli 2-210-07_S4_C1]
 gb|KDW92736.1| ribose 5-phosphate isomerase B [Escherichia coli 2-210-07_S1_C2]
 gb|KDX01551.1| ribose 5-phosphate isomerase B [Escherichia coli 1-392-07_S3_C1]
 gb|KDX22083.1| ribose 5-phosphate isomerase B [Escherichia coli 2-210-07_S3_C3]
 gb|KDX31937.1| ribose 5-phosphate isomerase B [Escherichia coli 1-250-04_S1_C2]
 gb|KDX33002.1| ribose 5-phosphate isomerase B [Escherichia coli 1-250-04_S1_C1]
 gb|KDX45499.1| ribose 5-phosphate isomerase B [Escherichia coli 2-177-06_S3_C2]
 gb|KDX55609.1| ribose 5-phosphate isomerase B [Escherichia coli 2-210-07_S3_C1]
 gb|KDX62566.1| ribose 5-phosphate isomerase B [Escherichia coli 2-210-07_S4_C2]
 gb|KDX71584.1| ribose 5-phosphate isomerase B [Escherichia coli 2-210-07_S4_C3]
 gb|KDX85303.1| ribose 5-phosphate isomerase B [Escherichia coli 2-222-05_S4_C2]
 gb|KDX88775.1| ribose 5-phosphate isomerase B [Escherichia coli 2-222-05_S3_C3]
 gb|KDX97962.1| ribose 5-phosphate isomerase B [Escherichia coli 2-316-03_S3_C1]
 gb|KDY20112.1| ribose 5-phosphate isomerase B [Escherichia coli 2-316-03_S4_C2]
 gb|KDY49340.1| ribose 5-phosphate isomerase B [Escherichia coli 2-427-07_S4_C1]
 gb|KDY50649.1| ribose 5-phosphate isomerase B [Escherichia coli 2-460-02_S3_C1]
 gb|KDY59200.1| ribose 5-phosphate isomerase B [Escherichia coli 2-460-02_S3_C2]
 gb|KDY66108.1| ribose 5-phosphate isomerase B [Escherichia coli 2-460-02_S3_C3]
 gb|KDY67738.1| ribose 5-phosphate isomerase B [Escherichia coli 2-460-02_S4_C2]
 gb|KDY75544.1| ribose 5-phosphate isomerase B [Escherichia coli 2-460-02_S4_C3]
 gb|KDY80045.1| ribose 5-phosphate isomerase B [Escherichia coli 2-474-04_S1_C1]
 gb|KDY89600.1| ribose 5-phosphate isomerase B [Escherichia coli 2-474-04_S3_C1]
 gb|KDY98707.1| ribose 5-phosphate isomerase B [Escherichia coli 2-474-04_S3_C2]
 gb|KDZ01764.1| ribose 5-phosphate isomerase B [Escherichia coli 2-474-04_S1_C2]
 gb|KDZ19309.1| ribose 5-phosphate isomerase B [Escherichia coli 2-474-04_S3_C3]
 gb|KDZ24035.1| ribose 5-phosphate isomerase B [Escherichia coli 3-020-07_S1_C1]
 gb|KDZ27860.1| ribose 5-phosphate isomerase B [Escherichia coli 3-020-07_S1_C2]
 gb|KDZ32691.1| ribose 5-phosphate isomerase B [Escherichia coli 3-020-07_S1_C3]
 gb|KDZ36847.1| ribose 5-phosphate isomerase B [Escherichia coli 3-020-07_S3_C1]
 gb|KDZ64307.1| ribose 5-phosphate isomerase B [Escherichia coli 3-073-06_S1_C2]
 gb|KDZ68805.1| ribose 5-phosphate isomerase B [Escherichia coli 3-073-06_S3_C2]
 gb|KDZ70960.1| ribose 5-phosphate isomerase B [Escherichia coli 3-073-06_S3_C1]
 gb|KDZ75266.1| ribose 5-phosphate isomerase B [Escherichia coli 3-073-06_S4_C2]
 gb|KDZ83472.1| ribose 5-phosphate isomerase B [Escherichia coli 3-105-05_S1_C2]
 gb|KDZ85234.1| ribose 5-phosphate isomerase B [Escherichia coli 3-073-06_S4_C3]
 gb|KDZ92034.1| ribose 5-phosphate isomerase B [Escherichia coli 3-105-05_S1_C3]
 gb|KEJ45831.1| ribose 5-phosphate isomerase B [Escherichia coli 2-460-02_S4_C1]
 gb|KEJ64740.1| ribose 5-phosphate isomerase B [Escherichia coli 3-020-07_S3_C2]
 gb|KEK84573.1| ribose 5-phosphate isomerase B [Escherichia coli 3-475-03_S1_C2]
 gb|KEK94728.1| ribose 5-phosphate isomerase B [Escherichia coli 4-203-08_S1_C2]
 gb|KEK98553.1| ribose 5-phosphate isomerase B [Escherichia coli 4-203-08_S3_C3]
 gb|KEK99870.1| ribose 5-phosphate isomerase B [Escherichia coli 4-203-08_S1_C3]
 gb|KEL09661.1| ribose 5-phosphate isomerase B [Escherichia coli 4-203-08_S3_C2]
 gb|KEL16594.1| ribose 5-phosphate isomerase B [Escherichia coli 4-203-08_S3_C1]
 gb|KEL26422.1| ribose 5-phosphate isomerase B [Escherichia coli 3-373-03_S4_C3]
 gb|KEL29267.1| ribose 5-phosphate isomerase B [Escherichia coli 5-172-05_S4_C2]
 gb|KEL33365.1| ribose 5-phosphate isomerase B [Escherichia coli 5-366-08_S4_C2]
 gb|KEL41218.1| ribose 5-phosphate isomerase B [Escherichia coli 5-172-05_S4_C1]
 gb|KEL45283.1| ribose 5-phosphate isomerase B [Escherichia coli 5-172-05_S3_C3]
 gb|KEL49410.1| ribose 5-phosphate isomerase B [Escherichia coli 5-172-05_S3_C1]
 gb|KEL59550.1| ribose 5-phosphate isomerase B [Escherichia coli 5-172-05_S4_C3]
 gb|KEL65072.1| ribose 5-phosphate isomerase B [Escherichia coli 5-172-05_S1_C3]
 gb|KEL73971.1| ribose 5-phosphate isomerase B [Escherichia coli 5-366-08_S3_C3]
 gb|KEL92383.1| ribose 5-phosphate isomerase B [Escherichia coli 5-366-08_S3_C1]
 gb|KEM00020.1| ribose 5-phosphate isomerase B [Escherichia coli 6-175-07_S4_C2]
 gb|KEM01196.1| ribose 5-phosphate isomerase B [Escherichia coli 6-175-07_S4_C1]
 gb|KEM25422.1| ribose 5-phosphate isomerase B [Escherichia coli 6-319-05_S4_C2]
 gb|KEM45150.1| ribose 5-phosphate isomerase B [Escherichia coli 6-175-07_S4_C3]
 gb|KEM55370.1| ribose 5-phosphate isomerase B [Escherichia coli 6-319-05_S4_C3]
 gb|KEM57939.1| ribose 5-phosphate isomerase B [Escherichia coli 7-233-03_S1_C2]
 gb|KEM68112.1| ribose 5-phosphate isomerase B [Escherichia coli 7-233-03_S3_C1]
 gb|KEM86048.1| ribose 5-phosphate isomerase B [Escherichia coli 2-222-05_S4_C1]
 gb|KEM87325.1| ribose 5-phosphate isomerase B [Escherichia coli 6-537-08_S4_C1]
 gb|KEM96237.1| ribose 5-phosphate isomerase B [Escherichia coli 7-233-03_S1_C3]
 gb|KEM97049.1| ribose 5-phosphate isomerase B [Escherichia coli 7-233-03_S3_C3]
 gb|KEN18867.1| ribose 5-phosphate isomerase B [Escherichia coli 7-233-03_S3_C2]
 gb|KEN19637.1| ribose 5-phosphate isomerase B [Escherichia coli 8-415-05_S1_C1]
 gb|KEN37837.1| ribose 5-phosphate isomerase B [Escherichia coli 7-233-03_S4_C1]
 gb|KEN50523.1| ribose 5-phosphate isomerase B [Escherichia coli 7-233-03_S4_C3]
 gb|KEN58090.1| ribose 5-phosphate isomerase B [Escherichia coli 6-537-08_S4_C2]
 gb|KEN71394.1| ribose 5-phosphate isomerase B [Escherichia coli 2-052-05_S3_C2]
 gb|KEN85222.1| ribose 5-phosphate isomerase B [Escherichia coli 2-222-05_S3_C1]
 gb|KEN94051.1| ribose 5-phosphate isomerase B [Escherichia coli 2-222-05_S3_C2]
 gb|KEO04987.1| ribose 5-phosphate isomerase B [Escherichia coli 8-415-05_S1_C2]
 gb|KEO05554.1| ribose 5-phosphate isomerase B [Escherichia coli 2-177-06_S3_C3]
 gb|KEO11885.1| ribose 5-phosphate isomerase B [Escherichia coli 2-222-05_S4_C3]
 gb|KEO95566.1| ribose 5-phosphate isomerase [Escherichia coli]
 gb|KEP12433.1| ribose 5-phosphate isomerase [Escherichia coli]
 gb|AIF39344.1| ribose 5-phosphate isomerase [Escherichia coli KLY]
 gb|AIF62560.1| ribose 5-phosphate isomerase B/allose 6-phosphate isomerase [Escherichia 
coli B7A]
 emb|CDU40245.1| Ribose 5-phosphate isomerase B [Escherichia coli]
 gb|KFF39325.1| ribose 5-phosphate isomerase [Escherichia coli]
 gb|KFF54175.1| ribose 5-phosphate isomerase [Escherichia coli]
 gb|KFH78554.1| ribose 5-phosphate isomerase [Escherichia coli]
 gb|KFI00353.1| ribose 5-phosphate isomerase [Escherichia coli]
 emb|CEE07811.1| ribose 5-phosphate isomerase B [Escherichia coli]
 gb|AIN34378.1| ribose 5-phosphate isomerase B/allose 6-phosphate isomerase [Escherichia 
coli BW25113]
 gb|KGA84901.1| ribose 5-phosphate isomerase [Escherichia coli]
 emb|CDY63969.1| allose-6-phosphate isomerase / ribose-5-phosphate isomerase B 
[Escherichia coli]
 emb|CDZ22840.1| allose-6-phosphate isomerase / ribose-5-phosphate isomerase B 
[Escherichia coli]
 gb|KGL71700.1| ribose 5-phosphate isomerase B/allose 6-phosphate isomerase [Escherichia 
coli NCTC 50110]
 gb|KGM63211.1| ribose 5-phosphate isomerase B [Escherichia coli]
 gb|KGM67570.1| Ribose-5-phosphate isomerase B [Escherichia coli]
 gb|KGM71331.1| Ribose-5-phosphate isomerase B [Escherichia coli]
 gb|KGM76926.1| Ribose-5-phosphate isomerase B [Escherichia coli]
 gb|KGM79021.1| ribose 5-phosphate isomerase B [Escherichia coli]
 gb|KGP13183.1| ribose 5-phosphate isomerase [Escherichia coli]
 gb|KGP13676.1| ribose 5-phosphate isomerase [Escherichia coli]
 gb|KGP19819.1| ribose 5-phosphate isomerase [Escherichia coli]
 gb|KGP38495.1| ribose 5-phosphate isomerase [Escherichia coli]
 gb|KGT05725.1| ribose 5-phosphate isomerase [Escherichia coli]
 gb|KGT14397.1| ribose 5-phosphate isomerase [Escherichia coli]
 gb|KGT19443.1| ribose 5-phosphate isomerase [Escherichia coli]
 gb|KGT22452.1| ribose 5-phosphate isomerase [Escherichia coli]
 gb|KGT26755.1| ribose 5-phosphate isomerase [Escherichia coli]
 gb|KGT31827.1| ribose 5-phosphate isomerase [Escherichia coli]
 gb|KHD39245.1| ribose 5-phosphate isomerase [Escherichia coli]
 gb|KHD53387.1| ribose 5-phosphate isomerase [Escherichia coli]
 gb|KHD53856.1| ribose 5-phosphate isomerase [Escherichia coli]
 gb|KHD57377.1| ribose 5-phosphate isomerase [Escherichia coli]
 gb|KHG77524.1| ribose 5-phosphate isomerase [Escherichia coli]
 gb|KHG94926.1| ribose 5-phosphate isomerase [Escherichia coli]
 gb|KHH15011.1| ribose 5-phosphate isomerase [Escherichia coli]
 gb|KHH21177.1| ribose 5-phosphate isomerase [Escherichia coli]
 gb|KHH48482.1| ribose 5-phosphate isomerase [Escherichia coli]
 gb|KHH55765.1| ribose 5-phosphate isomerase [Escherichia coli]
 gb|KHH58598.1| ribose 5-phosphate isomerase [Escherichia coli]
 gb|KHH69542.1| ribose 5-phosphate isomerase [Escherichia coli]
 gb|KHH74068.1| ribose 5-phosphate isomerase [Escherichia coli]
 gb|KHH98136.1| ribose 5-phosphate isomerase [Escherichia coli]
 gb|KHI10659.1| ribose 5-phosphate isomerase [Escherichia coli]
 gb|KHI16674.1| ribose 5-phosphate isomerase [Escherichia coli]
 gb|KHI16772.1| ribose 5-phosphate isomerase [Escherichia coli]
 gb|KHI23992.1| ribose 5-phosphate isomerase [Escherichia coli]
 gb|KHI62994.1| ribose 5-phosphate isomerase [Escherichia coli]
 gb|KHI98477.1| ribose 5-phosphate isomerase [Escherichia coli]
 gb|KHJ11896.1| ribose 5-phosphate isomerase [Escherichia coli]
 gb|AIZ30580.1| ribose 5-phosphate isomerase B/allose 6-phosphate isomerase [Escherichia 
coli ER2796]
 gb|AIZ53904.1| ribose 5-phosphate isomerase B/allose 6-phosphate isomerase [Escherichia 
coli K-12]
 gb|AIZ85283.1| ribose 5-phosphate isomerase [Escherichia coli]
 gb|AIZ93139.1| ribose 5-phosphate isomerase [Escherichia coli str. K-12 substr. 
MG1655]
 gb|AJB54132.1| ribose 5-phosphate isomerase [Escherichia coli]
 gb|KIE78958.1| ribose 5-phosphate isomerase [Escherichia coli]
 gb|KIG25915.1| ribose 5-phosphate isomerase [Escherichia coli C691-71 (14b)]
 gb|KIG37594.1| ribose 5-phosphate isomerase [Escherichia coli]
 gb|KIG45169.1| ribose 5-phosphate isomerase [Escherichia coli]
 gb|KIG50735.1| ribose 5-phosphate isomerase [Escherichia coli]
 gb|KIG74450.1| ribose 5-phosphate isomerase [Escherichia coli]
 gb|KIG75496.1| ribose 5-phosphate isomerase [Escherichia coli]
 gb|KIG83629.1| ribose 5-phosphate isomerase [Escherichia coli]
 gb|KIG84494.1| ribose 5-phosphate isomerase [Escherichia coli]
 gb|KIH01154.1| ribose 5-phosphate isomerase [Escherichia coli]
 gb|KIH13504.1| ribose 5-phosphate isomerase [Escherichia coli]
 gb|AJE58658.1| ribose-5-phosphate isomerase B [Escherichia coli]
Length=149

 Score = 55.8 bits (133),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = +1

Query  1    IAANKFKGIRCVNCNDPYAALQGRQHENSNVLSMGCRVIG  120
            IAANKF GIR V C++PY+A   RQH ++NVL+ G RV+G
Sbjct  74   IAANKFAGIRAVVCSEPYSAQLSRQHNDTNVLAFGSRVVG  113



>ref|WP_033170658.1| ribose 5-phosphate isomerase [Selenomonas sp. ND2010]
Length=147

 Score = 55.8 bits (133),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 26/40 (65%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = +1

Query  1    IAANKFKGIRCVNCNDPYAALQGRQHENSNVLSMGCRVIG  120
            IA NK KGIRC  CND Y+A   RQH N+NVL+MG RV+G
Sbjct  74   IACNKVKGIRCALCNDVYSAKMSRQHNNANVLAMGGRVVG  113



>ref|WP_033810958.1| ribose 5-phosphate isomerase [Escherichia coli]
 gb|KHH88402.1| ribose 5-phosphate isomerase [Escherichia coli]
Length=149

 Score = 55.8 bits (133),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = +1

Query  1    IAANKFKGIRCVNCNDPYAALQGRQHENSNVLSMGCRVIG  120
            IAANKF GIR V C++PY+A   RQH ++NVL+ G RV+G
Sbjct  74   IAANKFAGIRAVVCSEPYSAQLSRQHNDTNVLAFGSRVVG  113



>gb|KDV89279.1| ribose 5-phosphate isomerase B [Escherichia coli 2-156-04_S1_C1]
 gb|KDX09171.1| ribose 5-phosphate isomerase B [Escherichia coli 2-156-04_S1_C2]
Length=120

 Score = 55.5 bits (132),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = +1

Query  1    IAANKFKGIRCVNCNDPYAALQGRQHENSNVLSMGCRVIG  120
            I ANK+ GIR V C++PY+A   RQH N+NVL+ G RVIG
Sbjct  45   ITANKYPGIRAVVCSEPYSAQLSRQHNNTNVLAFGARVIG  84



>ref|WP_027975844.1| ribose 5-phosphate isomerase [Streptococcus devriesei]
Length=149

 Score = 55.8 bits (133),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 22/40 (55%), Positives = 32/40 (80%), Gaps = 0/40 (0%)
 Frame = +1

Query  1    IAANKFKGIRCVNCNDPYAALQGRQHENSNVLSMGCRVIG  120
            I+ANK KG+RCV C++PY+A   R+H N+N+L+ G RV+G
Sbjct  74   ISANKVKGVRCVICSEPYSAKLSREHNNTNILAFGARVVG  113



>ref|WP_021102210.1| Ribose 5-phosphate isomerase B [Thalassobacter arenae]
 gb|EPX77139.1| Ribose 5-phosphate isomerase B [Thalassobacter arenae DSM 19593]
Length=149

 Score = 55.8 bits (133),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 26/41 (63%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    IAANKFKGIRCVNCNDPYAALQGRQHENSNVLSMGCRVIGE  123
            +AANK KGIRC  C+D ++A   RQH N+N+LSMG RVIGE
Sbjct  77   MAANKVKGIRCGVCSDTFSARMIRQHNNANMLSMGARVIGE  117



>ref|WP_014425753.1| ribose 5-phosphate isomerase [Selenomonas ruminantium]
 ref|YP_005434358.1| putative ribose-5-phosphate isomerase B [Selenomonas ruminantium 
subsp. lactilytica TAM6421]
 dbj|BAL84335.1| putative ribose-5-phosphate isomerase B [Selenomonas ruminantium 
subsp. lactilytica TAM6421]
Length=147

 Score = 55.8 bits (133),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 25/40 (63%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = +1

Query  1    IAANKFKGIRCVNCNDPYAALQGRQHENSNVLSMGCRVIG  120
            IAANK KGIRC  CND ++A   RQH ++NVL+MG RV+G
Sbjct  74   IAANKIKGIRCALCNDVFSAKMSRQHNDANVLAMGGRVLG  113



>ref|WP_001464890.1| ribose 5-phosphate isomerase B [Escherichia coli]
 gb|ENC05946.1| ribose 5-phosphate isomerase B [Escherichia coli P0299438.5]
 gb|ENF16761.1| ribose 5-phosphate isomerase B [Escherichia coli P0304816.11]
 gb|ENF42881.1| ribose 5-phosphate isomerase B [Escherichia coli P0304816.15]
 gb|ENF67489.1| ribose 5-phosphate isomerase B [Escherichia coli P0304816.9]
 gb|ENF79349.1| ribose 5-phosphate isomerase B [Escherichia coli P0305260.11]
Length=149

 Score = 55.8 bits (133),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = +1

Query  1    IAANKFKGIRCVNCNDPYAALQGRQHENSNVLSMGCRVIG  120
            IAANKF GIR V C++PY+A   RQH ++NVL+ G RV+G
Sbjct  74   IAANKFAGIRAVVCSEPYSAQLSRQHNDTNVLAFGSRVVG  113



>ref|WP_014068558.1| ribose 5-phosphate isomerase [Enterobacter asburiae]
 ref|YP_004826870.1| ribose 5-phosphate isomerase B [Enterobacter asburiae LF7a]
 gb|AEN63085.1| ribose 5-phosphate isomerase B [Enterobacter asburiae LF7a]
Length=149

 Score = 55.8 bits (133),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = +1

Query  1    IAANKFKGIRCVNCNDPYAALQGRQHENSNVLSMGCRVIG  120
            I ANKF GIR V C++PY+A   RQH N+NVL+ G RV+G
Sbjct  74   ITANKFPGIRAVVCSEPYSAQLSRQHNNTNVLAFGSRVVG  113



>ref|WP_018373254.1| ribose 5-phosphate isomerase [Streptococcus merionis]
Length=156

 Score = 55.8 bits (133),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 24/40 (60%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = +1

Query  1    IAANKFKGIRCVNCNDPYAALQGRQHENSNVLSMGCRVIG  120
            IAANK KGIR V C++PY+A   R+H N+N+L+ G RVIG
Sbjct  73   IAANKVKGIRAVVCSEPYSAKLSREHNNTNILAFGSRVIG  112



>ref|WP_032153422.1| ribose 5-phosphate isomerase [Escherichia coli]
 gb|KDF95769.1| ribose-5-phosphate isomerase B [Escherichia coli BIDMC 65]
Length=149

 Score = 55.8 bits (133),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = +1

Query  1    IAANKFKGIRCVNCNDPYAALQGRQHENSNVLSMGCRVIG  120
            IAANKF GIR V C++PY+A   RQH ++NVL+ G RV+G
Sbjct  74   IAANKFAGIRAVVCSEPYSAQLSRQHNDTNVLAFGSRVVG  113



>ref|WP_033555885.1| ribose 5-phosphate isomerase [Escherichia coli]
Length=149

 Score = 55.5 bits (132),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = +1

Query  1    IAANKFKGIRCVNCNDPYAALQGRQHENSNVLSMGCRVIG  120
            IAANKF GIR V C++PY+A   RQH ++NVL+ G RV+G
Sbjct  74   IAANKFAGIRSVVCSEPYSAQLSRQHNDTNVLAFGSRVVG  113



>ref|WP_026759815.1| MULTISPECIES: ribose 5-phosphate isomerase [Selenomonas]
Length=146

 Score = 55.5 bits (132),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 25/40 (63%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = +1

Query  1    IAANKFKGIRCVNCNDPYAALQGRQHENSNVLSMGCRVIG  120
            IAANK KGIRC  CND ++A   RQH ++NVL+MG RV+G
Sbjct  74   IAANKIKGIRCALCNDVFSAKMSRQHNDANVLAMGGRVLG  113



>ref|WP_022081361.1| ribose 5-phosphate isomerase B [Ruminococcus sp. CAG:488]
 emb|CDA20722.1| ribose 5-phosphate isomerase B [Ruminococcus sp. CAG:488]
Length=147

 Score = 55.5 bits (132),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 24/40 (60%), Positives = 32/40 (80%), Gaps = 0/40 (0%)
 Frame = +1

Query  1    IAANKFKGIRCVNCNDPYAALQGRQHENSNVLSMGCRVIG  120
            +AANK KGIR V C++PY+AL  RQH ++NVL+ G RV+G
Sbjct  73   LAANKVKGIRAVVCSEPYSALLSRQHNDTNVLAFGARVVG  112



>gb|EOV45686.1| ribose-5-phosphate isomerase B [Escherichia sp. KTE52]
 gb|EOW56656.1| ribose-5-phosphate isomerase B [Escherichia sp. KTE159]
Length=86

 Score = 55.1 bits (131),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 23/40 (58%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = +1

Query  1    IAANKFKGIRCVNCNDPYAALQGRQHENSNVLSMGCRVIG  120
            IAANKF G+R V C++PY+A   RQH ++NVL+ G RV+G
Sbjct  11   IAANKFAGVRAVVCSEPYSAQLSRQHNDTNVLAFGSRVVG  50



>ref|WP_017770238.1| galactose-6-phosphate isomerase [Streptococcus agalactiae]
 gb|ESV55239.1| galactose-6-phosphate isomerase [Streptococcus agalactiae LMG 
14747]
Length=153

 Score = 55.5 bits (132),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = +1

Query  1    IAANKFKGIRCVNCNDPYAALQGRQHENSNVLSMGCRVIG  120
            I+ANK  G+RCV C++PY+A   R+H N+NVLS G RVIG
Sbjct  74   ISANKVPGVRCVICSEPYSARLSREHNNTNVLSFGSRVIG  113



>ref|WP_022144465.1| ribose 5-phosphate isomerase B [Ruminococcus sp. CAG:563]
 emb|CDA88734.1| ribose 5-phosphate isomerase B [Ruminococcus sp. CAG:563]
Length=147

 Score = 55.5 bits (132),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 24/40 (60%), Positives = 32/40 (80%), Gaps = 0/40 (0%)
 Frame = +1

Query  1    IAANKFKGIRCVNCNDPYAALQGRQHENSNVLSMGCRVIG  120
            +AANK KGIR V C++PY+AL  RQH ++NVL+ G RV+G
Sbjct  73   LAANKVKGIRAVVCSEPYSALLSRQHNDTNVLAFGARVVG  112



>ref|WP_025048700.1| ribose 5-phosphate isomerase [Sulfitobacter mediterraneus]
Length=149

 Score = 55.5 bits (132),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 24/41 (59%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    IAANKFKGIRCVNCNDPYAALQGRQHENSNVLSMGCRVIGE  123
            +AANK KG+RC  C+D ++A   RQH ++N+LSMG RVIGE
Sbjct  77   MAANKVKGVRCGVCSDTFSAAMIRQHNDANILSMGARVIGE  117



>ref|WP_032141534.1| MULTISPECIES: ribose 5-phosphate isomerase, partial [Escherichia]
Length=88

 Score = 54.7 bits (130),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 23/40 (58%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = +1

Query  1    IAANKFKGIRCVNCNDPYAALQGRQHENSNVLSMGCRVIG  120
            IAANKF G+R V C++PY+A   RQH ++NVL+ G RV+G
Sbjct  13   IAANKFAGVRAVVCSEPYSAQLSRQHNDTNVLAFGSRVVG  52



>ref|WP_026782815.1| ribose 5-phosphate isomerase [Pleomorphomonas koreensis]
Length=154

 Score = 55.5 bits (132),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 23/41 (56%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    IAANKFKGIRCVNCNDPYAALQGRQHENSNVLSMGCRVIGE  123
            +AANK  GIRCV C++PY A   RQH N+N+L+ G RV+G+
Sbjct  77   LAANKLAGIRCVVCSEPYTAKLSRQHNNANMLAFGARVVGQ  117



>ref|WP_000724668.1| ribose 5-phosphate isomerase [Escherichia coli]
 gb|EHW84525.1| ribose 5-phosphate isomerase B [Escherichia coli DEC11A]
 gb|EHW98756.1| ribose 5-phosphate isomerase B [Escherichia coli DEC11B]
 gb|EII36818.1| ribose-5-phosphate isomerase B [Escherichia coli 4.0967]
Length=149

 Score = 55.5 bits (132),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 24/40 (60%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = +1

Query  1    IAANKFKGIRCVNCNDPYAALQGRQHENSNVLSMGCRVIG  120
            IAANKF GIR V C++PY+A   RQH ++NVL+ G RV+G
Sbjct  74   IAANKFAGIRAVVCSEPYSAQLSRQHNDTNVLAFGSRVVG  113



>ref|WP_000716795.1| ribose 5-phosphate isomerase [Escherichia coli]
 ref|YP_003224664.1| ribose-5-phosphate isomerase B [Escherichia coli O103:H2 str. 
12009]
 gb|EDV83881.1| ribose 5-phosphate isomerase B [Escherichia coli E22]
 dbj|BAI33530.1| ribose-5-phosphate isomerase B [Escherichia coli O103:H2 str. 
12009]
 gb|EGX01909.1| ribose 5-phosphate isomerase B [Escherichia coli STEC_H.1.8]
 gb|EHX04332.1| ribose 5-phosphate isomerase B [Escherichia coli DEC11D]
 gb|EHX06249.1| ribose 5-phosphate isomerase B [Escherichia coli DEC11C]
 gb|EHX14923.1| ribose 5-phosphate isomerase B [Escherichia coli DEC11E]
 gb|EIH56806.1| ribose-5-phosphate isomerase B [Escherichia coli 3.2608]
 gb|EIH64377.1| ribose-5-phosphate isomerase B [Escherichia coli 93.0624]
 gb|EIK99724.1| ribose-5-phosphate isomerase B [Escherichia coli O103:H2 str. 
CVM9450]
 gb|EQS29004.1| ribose-5-phosphate isomerase B [Escherichia coli HVH 147 (4-5893887)]
 gb|ETD57844.1| ribose 5-phosphate isomerase [Escherichia coli ATCC BAA-2215]
 gb|EYU92932.1| ribose 5-phosphate isomerase [Escherichia coli O45:H2 str. 2010C-3876]
 gb|EYX85232.1| ribose 5-phosphate isomerase [Escherichia coli O103:H2 str. 2011C-3750]
 gb|EYY41568.1| ribose 5-phosphate isomerase [Escherichia coli O153:H2 str. 2010C-5034]
 gb|EYZ19221.1| ribose 5-phosphate isomerase [Escherichia coli O103:H2 str. 2010C-4433]
 gb|EZA27746.1| ribose 5-phosphate isomerase [Escherichia coli O45:H2 str. 01-3147]
 gb|EZE10934.1| ribose 5-phosphate isomerase [Escherichia coli O103:H2 str. 2009C-3279]
 gb|EZE25139.1| ribose 5-phosphate isomerase [Escherichia coli O45:H2 str. 2009C-3686]
 gb|EZE70495.1| ribose 5-phosphate isomerase [Escherichia coli O45:H2 str. 2009C-4780]
 gb|KDM87657.1| ribose 5-phosphate isomerase [Escherichia coli]
 gb|KDV59334.1| ribose 5-phosphate isomerase [Escherichia coli O45:H2 str. 2010C-4211]
Length=149

 Score = 55.5 bits (132),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 24/40 (60%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = +1

Query  1    IAANKFKGIRCVNCNDPYAALQGRQHENSNVLSMGCRVIG  120
            IAANKF GIR V C++PY+A   RQH ++NVL+ G RV+G
Sbjct  74   IAANKFAGIRAVVCSEPYSAQLSRQHNDTNVLAFGSRVVG  113



>ref|WP_037910675.1| ribose 5-phosphate isomerase [Sulfitobacter mediterraneus]
 gb|KAJ01889.1| ribose 5-phosphate isomerase [Sulfitobacter mediterraneus]
Length=149

 Score = 55.5 bits (132),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 24/41 (59%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    IAANKFKGIRCVNCNDPYAALQGRQHENSNVLSMGCRVIGE  123
            +AANK KG+RC  C+D ++A   RQH ++N+LSMG RVIGE
Sbjct  77   MAANKVKGVRCGVCSDTFSAAMIRQHNDANILSMGARVIGE  117



>ref|WP_005226764.1| ribose 5-phosphate isomerase [Enterococcus casseliflavus]
 gb|EEV29456.1| sugar-phosphate isomerase [Enterococcus casseliflavus EC30]
 gb|EEV36001.1| sugar-phosphate isomerase [Enterococcus casseliflavus EC10]
Length=146

 Score = 55.5 bits (132),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 24/40 (60%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = +1

Query  1    IAANKFKGIRCVNCNDPYAALQGRQHENSNVLSMGCRVIG  120
            IAANK KGIR V C++PY+A   R+H N+NVL+ G RV+G
Sbjct  73   IAANKIKGIRAVVCSEPYSAKLSREHNNTNVLAFGSRVVG  112



>ref|WP_032698366.1| ribose 5-phosphate isomerase [Raoultella planticola]
 gb|KFD12332.1| D-allose-6-phosphate isomerase/ribose 5-phosphate isomerase B 
[Raoultella planticola ATCC 33531]
Length=149

 Score = 55.5 bits (132),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 24/40 (60%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = +1

Query  1    IAANKFKGIRCVNCNDPYAALQGRQHENSNVLSMGCRVIG  120
            I ANK+ GIR V C++PY+A   RQH N+NVL+ G RVIG
Sbjct  74   ITANKYPGIRAVVCSEPYSAQLSRQHNNTNVLAFGARVIG  113



>dbj|GAK85778.1| ribose 5-phosphate isomerase B [Vibrio ponticus]
Length=146

 Score = 55.5 bits (132),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = +1

Query  1    IAANKFKGIRCVNCNDPYAALQGRQHENSNVLSMGCRVIG  120
            +AANK KGIR V C+DPY A   +QH N+N+L+ G RVIG
Sbjct  73   LAANKVKGIRAVVCSDPYTAQLSKQHNNTNILAFGSRVIG  112



>ref|WP_032689900.1| MULTISPECIES: ribose 5-phosphate isomerase [Raoultella]
 gb|KAJ94283.1| ribose 5-phosphate isomerase [Raoultella ornithinolytica]
 gb|KGZ16371.1| ribose 5-phosphate isomerase [Klebsiella pneumoniae]
Length=149

 Score = 55.5 bits (132),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 24/40 (60%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = +1

Query  1    IAANKFKGIRCVNCNDPYAALQGRQHENSNVLSMGCRVIG  120
            I ANK+ GIR V C++PY+A   RQH N+NVL+ G RVIG
Sbjct  74   ITANKYPGIRAVVCSEPYSAQLSRQHNNTNVLAFGARVIG  113



>ref|WP_004856568.1| MULTISPECIES: ribose 5-phosphate isomerase [Enterobacteriaceae]
 ref|YP_007875638.1| ribose-5-phosphate isomerase B [Raoultella ornithinolytica B6]
 gb|EHT14947.1| ribose-5-phosphate isomerase B [Klebsiella oxytoca 10-5246]
 gb|AGJ88086.1| ribose-5-phosphate isomerase B [Raoultella ornithinolytica B6]
Length=149

 Score = 55.5 bits (132),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 24/40 (60%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = +1

Query  1    IAANKFKGIRCVNCNDPYAALQGRQHENSNVLSMGCRVIG  120
            I ANK+ GIR V C++PY+A   RQH N+NVL+ G RVIG
Sbjct  74   ITANKYPGIRAVVCSEPYSAQLSRQHNNTNVLAFGARVIG  113



>gb|AHE59670.1| ribose 5-phosphate isomerase B [Escherichia albertii KF1]
Length=124

 Score = 55.1 bits (131),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 24/40 (60%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = +1

Query  1    IAANKFKGIRCVNCNDPYAALQGRQHENSNVLSMGCRVIG  120
            IAANKF GIR V C++PY+A   RQH ++NVL+ G RV+G
Sbjct  74   IAANKFAGIRAVVCSEPYSAQLSRQHNDTNVLAFGSRVVG  113



>ref|WP_000716787.1| MULTISPECIES: ribose 5-phosphate isomerase [Escherichia]
 ref|YP_543624.1| ribose-5-phosphate isomerase B [Escherichia coli UTI89]
 ref|YP_859701.1| ribose-5-phosphate isomerase B [Escherichia coli APEC O1]
 ref|YP_002394093.1| ribose-5-phosphate isomerase B [Escherichia coli S88]
 ref|YP_006103663.1| ribose 5-phosphate isomerase B [Escherichia coli IHE3034]
 ref|YP_006112977.1| ribose-5-phosphate isomerase B [Escherichia coli UM146]
 ref|YP_008574257.1| Ribose-5-phosphate isomerase B [Escherichia coli PMV-1]
 gb|ABE10093.1| ribose 5-phosphate isomerase B [Escherichia coli UTI89]
 gb|ABJ03577.1| ribose 5-phosphate isomerase B [Escherichia coli APEC O1]
 emb|CAR05749.1| ribose 5-phosphate isomerase B/allose 6-phosphate isomerase [Escherichia 
coli S88]
 gb|EEH87850.1| ribose-5-phosphate isomerase B [Escherichia sp. 3_2_53FAA]
 gb|ADE89089.1| ribose 5-phosphate isomerase B [Escherichia coli IHE3034]
 gb|ADN73465.1| ribose-5-phosphate isomerase B [Escherichia coli UM146]
 gb|EFU47284.1| ribose-5-phosphate isomerase B [Escherichia coli MS 110-3]
 gb|EGB46224.1| ribose 5-phosphate isomerase B [Escherichia coli H252]
 gb|EGB50207.1| ribose 5-phosphate isomerase B [Escherichia coli H263]
 gb|EHF98488.1| ribose-5-phosphate isomerase B [Escherichia coli cloneA_i1]
 gb|EHN94731.1| ribose-5-phosphate isomerase B [Escherichia coli H397]
 gb|EIL81347.1| ribose-5-phosphate isomerase B [Escherichia coli HM605]
 gb|ELB95912.1| ribose-5-phosphate isomerase B [Escherichia coli KTE4]
 gb|ELC05735.1| ribose-5-phosphate isomerase B [Escherichia coli KTE5]
 gb|ELE16595.1| ribose-5-phosphate isomerase B [Escherichia coli KTE55]
 gb|ELE27632.1| ribose-5-phosphate isomerase B [Escherichia coli KTE58]
 gb|ELE37271.1| ribose-5-phosphate isomerase B [Escherichia coli KTE62]
 gb|ELF88184.1| ribose-5-phosphate isomerase B [Escherichia coli KTE22]
 gb|ELG20422.1| ribose-5-phosphate isomerase B [Escherichia coli KTE59]
 gb|ELG21554.1| ribose-5-phosphate isomerase B [Escherichia coli KTE65]
 gb|ELG57822.1| ribose-5-phosphate isomerase B [Escherichia coli KTE118]
 gb|ELG62190.1| ribose-5-phosphate isomerase B [Escherichia coli KTE123]
 gb|ELH97548.1| ribose-5-phosphate isomerase B [Escherichia coli KTE229]
 gb|ELH97831.1| ribose-5-phosphate isomerase B [Escherichia coli KTE227]
 gb|ELJ35426.1| ribose-5-phosphate isomerase B [Escherichia coli KTE176]
 gb|ELJ48126.1| ribose-5-phosphate isomerase B [Escherichia coli KTE179]
 gb|ELJ48442.1| ribose-5-phosphate isomerase B [Escherichia coli KTE180]
 gb|EOU40116.1| ribose-5-phosphate isomerase B [Escherichia coli KTE7]
 gb|EOU42102.1| ribose-5-phosphate isomerase B [Escherichia coli KTE3]
 gb|EOU80431.1| ribose-5-phosphate isomerase B [Escherichia coli KTE27]
 gb|EOX05276.1| ribose-5-phosphate isomerase B [Escherichia coli KTE240]
 gb|EQN01479.1| ribose-5-phosphate isomerase B [Escherichia coli HVH 3 (4-7276001)]
 gb|EQN03800.1| ribose-5-phosphate isomerase B [Escherichia coli HVH 1 (4-6876161)]
 gb|EQN23608.1| ribose-5-phosphate isomerase B [Escherichia coli HVH 5 (4-7148410)]
 gb|EQN65356.1| ribose-5-phosphate isomerase B [Escherichia coli HVH 19 (4-7154984)]
 gb|EQO10328.1| ribose-5-phosphate isomerase B [Escherichia coli HVH 30 (4-2661829)]
 gb|EQO18833.1| ribose-5-phosphate isomerase B [Escherichia coli HVH 32 (4-3773988)]
 gb|EQO27220.1| ribose-5-phosphate isomerase B [Escherichia coli HVH 35 (4-2962667)]
 gb|EQO56631.1| ribose-5-phosphate isomerase B [Escherichia coli HVH 42 (4-2100061)]
 gb|EQO80203.1| ribose-5-phosphate isomerase B [Escherichia coli HVH 48 (4-2658593)]
 gb|EQP12074.1| ribose-5-phosphate isomerase B [Escherichia coli HVH 59 (4-1119338)]
 gb|EQP46447.1| ribose-5-phosphate isomerase B [Escherichia coli HVH 73 (4-2393174)]
 gb|EQP58421.1| ribose-5-phosphate isomerase B [Escherichia coli HVH 76 (4-2538717)]
 gb|EQP82972.1| ribose-5-phosphate isomerase B [Escherichia coli HVH 80 (4-2428830)]
 gb|EQQ44469.1| ribose-5-phosphate isomerase B [Escherichia coli HVH 102 (4-6906788)]
 gb|EQQ46026.1| ribose-5-phosphate isomerase B [Escherichia coli HVH 104 (4-6977960)]
 gb|EQR13112.1| ribose-5-phosphate isomerase B [Escherichia coli HVH 118 (4-7345399)]
 gb|EQR44794.1| ribose-5-phosphate isomerase B [Escherichia coli HVH 126 (4-6034225)]
 gb|EQR49627.1| ribose-5-phosphate isomerase B [Escherichia coli HVH 127 (4-7303629)]
 gb|EQR83703.1| ribose-5-phosphate isomerase B [Escherichia coli HVH 137 (4-2124971)]
 gb|EQS98576.1| ribose-5-phosphate isomerase B [Escherichia coli HVH 170 (4-3026949)]
 gb|EQT23090.1| ribose-5-phosphate isomerase B [Escherichia coli HVH 180 (4-3051617)]
 gb|EQT72419.1| ribose-5-phosphate isomerase B [Escherichia coli HVH 191 (3-9341900)]
 gb|EQT78702.1| ribose-5-phosphate isomerase B [Escherichia coli HVH 192 (4-3054470)]
 gb|EQT96940.1| ribose-5-phosphate isomerase B [Escherichia coli HVH 196 (4-4530470)]
 gb|EQU06726.1| ribose-5-phosphate isomerase B [Escherichia coli HVH 199 (4-5670322)]
 gb|EQU19237.1| ribose-5-phosphate isomerase B [Escherichia coli HVH 201 (4-4459431)]
 gb|EQU30239.1| ribose-5-phosphate isomerase B [Escherichia coli HVH 203 (4-3126218)]
 gb|EQU66405.1| ribose-5-phosphate isomerase B [Escherichia coli HVH 211 (4-3041891)]
 gb|EQU88071.1| ribose-5-phosphate isomerase B [Escherichia coli HVH 217 (4-1022806)]
 gb|EQV08945.1| ribose-5-phosphate isomerase B [Escherichia coli HVH 222 (4-2977443)]
 gb|EQV37450.1| ribose-5-phosphate isomerase B [Escherichia coli KOEGE 32 (66a)]
 gb|EQW27209.1| ribose-5-phosphate isomerase B [Escherichia coli UMEA 3041-1]
 gb|EQW97841.1| ribose-5-phosphate isomerase B [Escherichia coli UMEA 3140-1]
 gb|EQX22793.1| ribose-5-phosphate isomerase B [Escherichia coli UMEA 3162-1]
 gb|EQX95078.1| ribose-5-phosphate isomerase B [Escherichia coli UMEA 3203-1]
 gb|EQX95250.1| ribose-5-phosphate isomerase B [Escherichia coli UMEA 3206-1]
 gb|EQZ46461.1| ribose-5-phosphate isomerase B [Escherichia coli UMEA 3632-1]
 gb|EQZ49676.1| ribose-5-phosphate isomerase B [Escherichia coli UMEA 3662-1]
 gb|EQZ73153.1| ribose-5-phosphate isomerase B [Escherichia coli UMEA 3702-1]
 gb|ERA15079.1| ribose-5-phosphate isomerase B [Escherichia coli UMEA 3834-1]
 gb|ERA15476.1| ribose-5-phosphate isomerase B [Escherichia coli UMEA 3893-1]
 gb|ERA85777.1| ribose-5-phosphate isomerase B [Escherichia coli HVH 210 (4-3042480)]
 gb|ERB29384.1| ribose-5-phosphate isomerase B [Escherichia coli UMEA 3298-1]
 emb|CDH67843.1| Ribose-5-phosphate isomerase B [Escherichia coli PMV-1]
 gb|ESE12592.1| ribose-5-phosphate isomerase B [Escherichia coli 908675]
 gb|ESP13343.1| ribose-5-phosphate isomerase B [Escherichia coli HVH 12 (4-7653042)]
 gb|ESP28139.1| ribose-5-phosphate isomerase B [Escherichia coli HVH 178 (4-3189163)]
 gb|ESP35823.1| ribose-5-phosphate isomerase B [Escherichia coli HVH 148 (4-3192490)]
 gb|ETF27753.1| ribose-5-phosphate isomerase B [Escherichia coli HVH 214 (4-3062198)]
 gb|ETY53086.1| ribose-5-phosphate isomerase B [Escherichia coli BIDMC 49b]
 gb|ETY56671.1| ribose-5-phosphate isomerase B [Escherichia coli BIDMC 49a]
 gb|KFB91049.1| D-allose-6-phosphate isomerase/ribose 5-phosphate isomerase B 
[Escherichia coli DSM 30083 = JCM 1649 = ATCC 11775]
 gb|AJB37380.1| ribose-5-phosphate isomerase B [Escherichia coli APEC IMT5155]
 gb|KIE72991.1| ribose 5-phosphate isomerase [Escherichia coli]
 gb|KIE81324.1| ribose 5-phosphate isomerase [Escherichia coli RS218]
Length=149

 Score = 55.5 bits (132),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 24/40 (60%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = +1

Query  1    IAANKFKGIRCVNCNDPYAALQGRQHENSNVLSMGCRVIG  120
            IAANKF GIR V C++PY+A   RQH ++NVL+ G RV+G
Sbjct  74   IAANKFAGIRAVVCSEPYSAQLSRQHNDTNVLAFGSRVVG  113



>gb|EEA92193.1| ribose-5-phosphate isomerase B [Pseudovibrio sp. JE062]
Length=73

 Score = 54.3 bits (129),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 24/41 (59%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    IAANKFKGIRCVNCNDPYAALQGRQHENSNVLSMGCRVIGE  123
            +AANK KG+RC  C+D ++A   R+H N+N+LSMG RVIGE
Sbjct  1    MAANKIKGVRCGVCSDTFSARMIREHNNANMLSMGVRVIGE  41



>ref|WP_022318011.1| ribose-5-phosphate isomerase B [Dorea sp. CAG:317]
 emb|CDD06858.1| ribose-5-phosphate isomerase B [Dorea sp. CAG:317]
Length=146

 Score = 55.1 bits (131),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = +1

Query  1    IAANKFKGIRCVNCNDPYAALQGRQHENSNVLSMGCRVIG  120
            +AANK KG+R V C++PY+A   RQH N+NVL+ G RVIG
Sbjct  73   LAANKVKGVRAVVCSEPYSAKLSRQHNNTNVLAFGARVIG  112



>ref|WP_034244852.1| ribose 5-phosphate isomerase [Actinotalea fermentans]
 gb|KGM17074.1| ribose 5-phosphate isomerase [Actinotalea fermentans ATCC 43279 
= JCM 9966 = DSM 3133]
Length=149

 Score = 55.1 bits (131),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 22/40 (55%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = +1

Query  1    IAANKFKGIRCVNCNDPYAALQGRQHENSNVLSMGCRVIG  120
            IAANK  GIRCV C++PY+A+  R H ++N L++G RV+G
Sbjct  73   IAANKIPGIRCVACSEPYSAVLSRHHNDTNALALGARVVG  112



>ref|WP_011701542.1| ribose 5-phosphate isomerase [Listeria welshimeri]
 ref|YP_848906.1| ribose-5-phosphate isomerase B [Listeria welshimeri serovar 6b 
str. SLCC5334]
 emb|CAK20123.1| ribose 5-phosphate isomerase B [Listeria welshimeri serovar 6b 
str. SLCC5334]
Length=146

 Score = 55.1 bits (131),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = +1

Query  1    IAANKFKGIRCVNCNDPYAALQGRQHENSNVLSMGCRVIG  120
            IAANK KGIR V C++PY+A   R+H N+N+L+ G RVIG
Sbjct  73   IAANKVKGIRAVVCSEPYSAKLSREHNNTNILAFGSRVIG  112



>ref|WP_009111920.1| ribose 5-phosphate isomerase [Brenneria sp. EniD312]
 gb|EHD20614.1| ribose 5-phosphate isomerase B [Brenneria sp. EniD312]
Length=150

 Score = 55.1 bits (131),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 23/40 (58%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = +1

Query  1    IAANKFKGIRCVNCNDPYAALQGRQHENSNVLSMGCRVIG  120
            I ANKF GIR V C++PY+A   RQH N+N+L+ G RV+G
Sbjct  74   ITANKFPGIRAVVCSEPYSAQLSRQHNNTNILAFGSRVVG  113



>ref|WP_017694706.1| MULTISPECIES: ribose 5-phosphate isomerase [Enterobacter cloacae 
complex]
Length=149

 Score = 55.1 bits (131),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = +1

Query  1    IAANKFKGIRCVNCNDPYAALQGRQHENSNVLSMGCRVIG  120
            I ANKF GIR V C++PY+A   RQH N+NVL+ G RV+G
Sbjct  74   ITANKFPGIRAVVCSEPYSAQLSRQHNNTNVLAFGSRVVG  113



>ref|WP_020834455.1| ribose-5-phosphate isomerase B [Spiroplasma taiwanense]
 ref|YP_008311613.1| ribose-5-phosphate isomerase B [Spiroplasma taiwanense CT-1]
 gb|AGR41316.1| ribose-5-phosphate isomerase B [Spiroplasma taiwanense CT-1]
Length=141

 Score = 55.1 bits (131),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 23/40 (58%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = +1

Query  1    IAANKFKGIRCVNCNDPYAALQGRQHENSNVLSMGCRVIG  120
            +AANK  GIR V C++PY+A   ++H N+N+LSMG RVIG
Sbjct  73   LAANKVDGIRAVVCSEPYSAKLSKEHNNTNILSMGSRVIG  112



>ref|WP_023295775.1| MULTISPECIES: ribose-5-phosphate isomerase B [Enterobacter cloacae 
complex]
 gb|ESL81004.1| ribose-5-phosphate isomerase B [Enterobacter cloacae UCICRE 11]
 gb|ESM23299.1| ribose-5-phosphate isomerase B [Enterobacter cloacae UCICRE 5]
 gb|EUM16788.1| ribose-5-phosphate isomerase B [Enterobacter sp. BIDMC 28]
 gb|EUM23571.1| ribose-5-phosphate isomerase B [Enterobacter sp. BIDMC 27]
 gb|EUM50716.1| ribose-5-phosphate isomerase B [Enterobacter sp. MGH 15]
 gb|EUM81822.1| ribose-5-phosphate isomerase B [Enterobacter sp. MGH 10]
 gb|EUM86489.1| ribose-5-phosphate isomerase B [Enterobacter sp. MGH 6]
 gb|EUN03615.1| ribose-5-phosphate isomerase B [Enterobacter sp. MGH 1]
 gb|KDF64020.1| ribose-5-phosphate isomerase B [Enterobacter cloacae MGH 53]
 gb|AIE62307.1| ribose 5-phosphate isomerase [Enterobacter cloacae ECNIH2]
 gb|KGY89945.1| ribose 5-phosphate isomerase [Enterobacter cloacae]
 gb|KGZ08806.1| ribose 5-phosphate isomerase [Enterobacter cloacae]
 gb|KHM16817.1| ribose 5-phosphate isomerase [Enterobacter cloacae]
 gb|AJB60929.1| ribose 5-phosphate isomerase [Enterobacter cloacae]
Length=149

 Score = 55.1 bits (131),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = +1

Query  1    IAANKFKGIRCVNCNDPYAALQGRQHENSNVLSMGCRVIG  120
            I ANKF GIR V C++PY+A   RQH N+NVL+ G RV+G
Sbjct  74   ITANKFPGIRAVVCSEPYSAQLSRQHNNTNVLAFGSRVVG  113



>ref|WP_010759061.1| ribose 5-phosphate isomerase B [Enterococcus pallens]
 gb|EOH90287.1| ribose 5-phosphate isomerase B [Enterococcus pallens ATCC BAA-351]
 gb|EOU15107.1| ribose 5-phosphate isomerase B [Enterococcus pallens ATCC BAA-351]
Length=146

 Score = 55.1 bits (131),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 24/40 (60%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = +1

Query  1    IAANKFKGIRCVNCNDPYAALQGRQHENSNVLSMGCRVIG  120
            IAANK  GIR V C+DPY+A   R+H N+N+L+ G RVIG
Sbjct  73   IAANKIAGIRAVVCSDPYSAKLSREHNNTNILAFGSRVIG  112



>ref|WP_000716788.1| ribose 5-phosphate isomerase [Escherichia coli]
 ref|YP_002400599.1| ribose-5-phosphate isomerase B [Escherichia coli ED1a]
 emb|CAR10784.1| ribose 5-phosphate isomerase B/allose 6-phosphate isomerase [Escherichia 
coli ED1a]
 gb|EFM51892.1| ribose-5-phosphate isomerase B [Escherichia coli NC101]
 gb|EFU55414.1| ribose-5-phosphate isomerase B [Escherichia coli MS 16-3]
 gb|EGI23761.1| ribose 5-phosphate isomerase B [Escherichia coli TA206]
 gb|ELC24357.1| ribose-5-phosphate isomerase B [Escherichia coli KTE15]
 gb|ELC32449.1| ribose-5-phosphate isomerase B [Escherichia coli KTE16]
 gb|ELD47688.1| ribose-5-phosphate isomerase B [Escherichia coli KTE224]
 gb|ELE46879.1| ribose-5-phosphate isomerase B [Escherichia coli KTE72]
 gb|ELE76687.1| ribose-5-phosphate isomerase B [Escherichia coli KTE86]
 gb|ELE86251.1| ribose-5-phosphate isomerase B [Escherichia coli KTE93]
 gb|ELF33740.1| ribose-5-phosphate isomerase B [Escherichia coli KTE169]
 gb|ELF79411.1| ribose-5-phosphate isomerase B [Escherichia coli KTE43]
 gb|ELH07234.1| ribose-5-phosphate isomerase B [Escherichia coli KTE194]
 gb|ELH13973.1| ribose-5-phosphate isomerase B [Escherichia coli KTE192]
 gb|ELH39327.1| ribose-5-phosphate isomerase B [Escherichia coli KTE183]
 gb|ELH68270.1| ribose-5-phosphate isomerase B [Escherichia coli KTE207]
 gb|ELH71060.1| ribose-5-phosphate isomerase B [Escherichia coli KTE215]
 gb|ELI14726.1| ribose-5-phosphate isomerase B [Escherichia coli KTE109]
 gb|ELI21344.1| ribose-5-phosphate isomerase B [Escherichia coli KTE113]
 gb|ELI66687.1| ribose-5-phosphate isomerase B [Escherichia coli KTE133]
 gb|ELI83405.1| ribose-5-phosphate isomerase B [Escherichia coli KTE145]
 gb|ELJ23043.1| ribose-5-phosphate isomerase B [Escherichia coli KTE168]
 gb|ELJ65319.1| ribose-5-phosphate isomerase B [Escherichia coli KTE88]
 gb|ELJ79612.1| ribose-5-phosphate isomerase B [Escherichia coli KTE94]
 gb|EOV85679.1| ribose-5-phosphate isomerase B [Escherichia coli KTE89]
 gb|EOX20386.1| ribose-5-phosphate isomerase B [Escherichia coli KTE185]
 gb|EOX27271.1| ribose-5-phosphate isomerase B [Escherichia coli KTE186]
 gb|EQO40434.1| ribose-5-phosphate isomerase B [Escherichia coli HVH 38 (4-2774682)]
 gb|EQZ12098.1| ribose-5-phosphate isomerase B [Escherichia coli UMEA 3391-1]
 gb|EQZ47778.1| ribose-5-phosphate isomerase B [Escherichia coli UMEA 3656-1]
 gb|EZA14444.1| ribose 5-phosphate isomerase [Escherichia coli O81:NM str. 02-3012]
 gb|EZJ34104.1| ribose 5-phosphate isomerase B [Escherichia coli 2-005-03_S4_C3]
 gb|EZJ47790.1| ribose 5-phosphate isomerase B [Escherichia coli 2-005-03_S4_C2]
 gb|KDT24625.1| ribose 5-phosphate isomerase B [Escherichia coli 2-052-05_S4_C1]
 gb|KIE66384.1| ribose 5-phosphate isomerase [Escherichia coli]
Length=149

 Score = 55.1 bits (131),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 24/40 (60%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = +1

Query  1    IAANKFKGIRCVNCNDPYAALQGRQHENSNVLSMGCRVIG  120
            IAANKF GIR V C++PY+A   RQH ++NVL+ G RV+G
Sbjct  74   IAANKFAGIRAVVCSEPYSAQLSRQHNDTNVLAFGSRVVG  113



>ref|WP_003253675.1| MULTISPECIES: ribose 5-phosphate isomerase [Geobacillus]
 ref|YP_003990946.1| RpiB/LacA/LacB family sugar-phosphate isomerase [Geobacillus 
sp. Y4.1MC1]
 ref|YP_004589708.1| RpiB/LacA/LacB family sugar-phosphate isomerase [Geobacillus 
thermoglucosidasius C56-YS93]
 gb|ADP76335.1| sugar-phosphate isomerase, RpiB/LacA/LacB family [Geobacillus 
sp. Y4.1MC1]
 gb|AEH49627.1| sugar-phosphate isomerase, RpiB/LacA/LacB family [Geobacillus 
thermoglucosidasius C56-YS93]
 gb|EID42688.1| sugar-phosphate isomerase, rpiB/lacA/lacB family [Geobacillus 
thermoglucosidans TNO-09.020]
 dbj|GAJ43528.1| ribose 5-phosphate isomerase [Geobacillus thermoglucosidasius 
NBRC 107763]
Length=147

 Score = 55.1 bits (131),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 26/40 (65%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = +1

Query  1    IAANKFKGIRCVNCNDPYAALQGRQHENSNVLSMGCRVIG  120
            IAANK KG+RC  C+D Y+A   RQH +SNVL+MG RVIG
Sbjct  73   IAANKVKGVRCALCHDVYSARLTRQHNDSNVLAMGERVIG  112



>ref|WP_016517486.1| ribose-5-phosphate isomerase B [Cedecea davisae]
 gb|EPF20399.1| ribose-5-phosphate isomerase B [Cedecea davisae DSM 4568]
Length=149

 Score = 55.1 bits (131),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 23/40 (58%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = +1

Query  1    IAANKFKGIRCVNCNDPYAALQGRQHENSNVLSMGCRVIG  120
            I ANKF GIR V C++PY+A   RQH N+N+L+ G RV+G
Sbjct  74   ITANKFPGIRAVVCSEPYSAQLSRQHNNTNILAFGSRVVG  113



>ref|WP_017382646.1| ribose 5-phosphate isomerase [Enterobacter cloacae]
Length=149

 Score = 55.1 bits (131),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = +1

Query  1    IAANKFKGIRCVNCNDPYAALQGRQHENSNVLSMGCRVIG  120
            I ANKF GIR V C++PY+A   RQH N+NVL+ G RV+G
Sbjct  74   ITANKFPGIRAVVCSEPYSAQLSRQHNNTNVLAFGSRVVG  113



>ref|WP_009169875.1| ribose 5-phosphate isomerase [Clostridium sp. DL-VIII]
 gb|EHI99203.1| ribose 5-phosphate isomerase B [Clostridium sp. DL-VIII]
Length=148

 Score = 55.1 bits (131),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 23/40 (58%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = +1

Query  1    IAANKFKGIRCVNCNDPYAALQGRQHENSNVLSMGCRVIG  120
            IAANK  GIR V C++PY+A+  +QH NSN+L+ G RV+G
Sbjct  73   IAANKVNGIRAVVCSEPYSAMLSKQHNNSNILAFGARVVG  112



>ref|WP_015010770.1| ribose 5-phosphate isomerase [Amphibacillus xylanus]
 ref|YP_006845946.1| ribose-5-phosphate isomerase B [Amphibacillus xylanus NBRC 15112]
 dbj|BAM48184.1| ribose-5-phosphate isomerase B [Amphibacillus xylanus NBRC 15112]
Length=148

 Score = 55.1 bits (131),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 26/40 (65%), Positives = 29/40 (73%), Gaps = 0/40 (0%)
 Frame = +1

Query  1    IAANKFKGIRCVNCNDPYAALQGRQHENSNVLSMGCRVIG  120
            IAANK KGIRC   +D Y A   R+H NSNVL+MG RVIG
Sbjct  73   IAANKVKGIRCALVHDVYTARVTREHNNSNVLAMGARVIG  112



>ref|WP_032335405.1| ribose 5-phosphate isomerase, partial [Escherichia sp. TW09308]
Length=88

 Score = 54.3 bits (129),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 22/40 (55%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = +1

Query  1    IAANKFKGIRCVNCNDPYAALQGRQHENSNVLSMGCRVIG  120
            IAANKF G+R + C++PY+A   RQH ++NVL+ G RV+G
Sbjct  13   IAANKFAGVRAIVCSEPYSAQLSRQHNDTNVLAFGSRVVG  52



>gb|KEO20837.1| ribose 5-phosphate isomerase B [Escherichia coli 5-366-08_S4_C1]
Length=130

 Score = 54.7 bits (130),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 24/40 (60%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = +1

Query  1    IAANKFKGIRCVNCNDPYAALQGRQHENSNVLSMGCRVIG  120
            IAANKF GIR V C++PY+A   RQH ++NVL+ G RV+G
Sbjct  55   IAANKFAGIRAVVCSEPYSAQLSRQHNDTNVLAFGSRVVG  94



>gb|EKI22236.1| ribose 5-phosphate isomerase B [Escherichia coli TW00353]
 gb|ENB24148.1| ribose 5-phosphate isomerase B [Escherichia coli BCE030_MS-09]
 gb|ENB72525.1| ribose 5-phosphate isomerase B [Escherichia coli P0298942.9]
 gb|ENC10766.1| ribose 5-phosphate isomerase B [Escherichia coli P0299438.7]
 gb|ENF65006.1| ribose 5-phosphate isomerase B [Escherichia coli P0304816.8]
 gb|KDV77570.1| ribose 5-phosphate isomerase B [Escherichia coli 2-052-05_S3_C3]
 gb|KDX38097.1| ribose 5-phosphate isomerase B [Escherichia coli 2-156-04_S4_C3]
Length=130

 Score = 54.7 bits (130),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 24/40 (60%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = +1

Query  1    IAANKFKGIRCVNCNDPYAALQGRQHENSNVLSMGCRVIG  120
            IAANKF GIR V C++PY+A   RQH ++NVL+ G RV+G
Sbjct  55   IAANKFAGIRAVVCSEPYSAQLSRQHNDTNVLAFGSRVVG  94



>ref|WP_000716786.1| ribose 5-phosphate isomerase [Escherichia fergusonii]
 ref|YP_002385289.1| ribose-5-phosphate isomerase B [Escherichia fergusonii ATCC 35469]
 emb|CAQ91699.1| ribose 5-phosphate isomerase B/allose 6-phosphate isomerase [Escherichia 
fergusonii ATCC 35469]
 gb|EGC06153.1| ribose 5-phosphate isomerase B [Escherichia fergusonii B253]
 gb|EGC97620.1| ribose-5-phosphate isomerase B [Escherichia fergusonii ECD227]
Length=149

 Score = 55.1 bits (131),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 23/40 (58%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = +1

Query  1    IAANKFKGIRCVNCNDPYAALQGRQHENSNVLSMGCRVIG  120
            I ANKF GIR V C++PY+A   RQH ++NVL+ G RV+G
Sbjct  74   ITANKFAGIRAVVCSEPYSAQLSRQHNDTNVLAFGSRVVG  113



>pdb|1NN4|A Chain A, Structural Genomics, RpibALSB
 pdb|1NN4|B Chain B, Structural Genomics, RpibALSB
 pdb|1NN4|C Chain C, Structural Genomics, RpibALSB
 pdb|1NN4|D Chain D, Structural Genomics, RpibALSB
Length=162

 Score = 55.1 bits (131),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 24/40 (60%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = +1

Query  1    IAANKFKGIRCVNCNDPYAALQGRQHENSNVLSMGCRVIG  120
            IAANKF GIR V C++PY+A   RQH ++NVL+ G RV+G
Sbjct  87   IAANKFAGIRAVVCSEPYSAQLSRQHNDTNVLAFGSRVVG  126



>ref|WP_015570214.1| ribose 5-phosphate isomerase B [Enterobacter cloacae]
 ref|YP_007844629.1| ribose 5-phosphate isomerase B [Enterobacter cloacae subsp. cloacae 
NCTC 9394]
 emb|CBK84542.1| ribose 5-phosphate isomerase B [Enterobacter cloacae subsp. cloacae 
NCTC 9394]
Length=149

 Score = 55.1 bits (131),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = +1

Query  1    IAANKFKGIRCVNCNDPYAALQGRQHENSNVLSMGCRVIG  120
            I ANKF GIR V C++PY+A   RQH N+NVL+ G RV+G
Sbjct  74   ITANKFPGIRAVVCSEPYSAQLSRQHNNTNVLAFGSRVVG  113



>ref|WP_035886924.1| ribose 5-phosphate isomerase [Kosakonia radicincitans]
 gb|KDE36251.1| ribose 5-phosphate isomerase [Kosakonia radicincitans UMEnt01/12]
Length=153

 Score = 55.1 bits (131),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 24/40 (60%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = +1

Query  1    IAANKFKGIRCVNCNDPYAALQGRQHENSNVLSMGCRVIG  120
            I ANKF GIR V C++PY+A   RQH ++NVL+ G RVIG
Sbjct  74   ITANKFPGIRAVVCSEPYSAQLSRQHNDTNVLAFGSRVIG  113



>ref|WP_004127907.1| ribose 5-phosphate isomerase [Klebsiella oxytoca]
 gb|EHT09025.1| ribose-5-phosphate isomerase B [Klebsiella oxytoca 10-5250]
Length=149

 Score = 55.1 bits (131),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 24/40 (60%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = +1

Query  1    IAANKFKGIRCVNCNDPYAALQGRQHENSNVLSMGCRVIG  120
            IAANK+ GIR V C++PY+A   RQH ++NVL+ G RVIG
Sbjct  74   IAANKYPGIRAVVCSEPYSAQLSRQHNDTNVLAFGARVIG  113



>ref|WP_014092179.1| ribose 5-phosphate isomerase [Listeria ivanovii]
 ref|YP_004854479.1| putative ribose 5-phosphate isomerase [Listeria ivanovii subsp. 
ivanovii PAM 55]
 emb|CBW85153.1| Putative ribose 5-phosphate isomerase [Listeria ivanovii subsp. 
ivanovii PAM 55]
 gb|AHI55254.1| ribose 5-phosphate isomerase [Listeria ivanovii WSLC3009]
 gb|AIS64708.1| ribose 5-phosphate isomerase [Listeria ivanovii subsp. ivanovii]
Length=149

 Score = 55.1 bits (131),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 23/40 (58%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = +1

Query  1    IAANKFKGIRCVNCNDPYAALQGRQHENSNVLSMGCRVIG  120
            IAANK KGIR V C++PY+A   R+H N+N+L+ G RV+G
Sbjct  73   IAANKVKGIRAVVCSEPYSAKLSREHNNTNILAFGSRVVG  112



>ref|WP_016609115.1| ribose-5-phosphate isomerase B [Enterococcus casseliflavus]
 gb|EPH64966.1| ribose-5-phosphate isomerase B [Enterococcus casseliflavus 14-MB-W-14]
Length=146

 Score = 54.7 bits (130),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 24/40 (60%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = +1

Query  1    IAANKFKGIRCVNCNDPYAALQGRQHENSNVLSMGCRVIG  120
            IAANK KGIR V C++PY+A   R+H N+NVL+ G RV+G
Sbjct  73   IAANKIKGIRAVVCSEPYSAKLSREHNNTNVLAFGSRVVG  112



>ref|WP_008787787.1| MULTISPECIES: ribose 5-phosphate isomerase [Coprobacillus]
 gb|EFW06032.1| ribose 5-phosphate isomerase [Coprobacillus sp. 29_1]
Length=153

 Score = 55.1 bits (131),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 22/40 (55%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = +1

Query  1    IAANKFKGIRCVNCNDPYAALQGRQHENSNVLSMGCRVIG  120
            +AANK  GIRCV C++PY+A   R+H N+N+L+ G RV+G
Sbjct  74   LAANKVNGIRCVTCSEPYSAKLSREHNNTNMLAFGARVVG  113



>gb|EFR97769.1| ribose 5-phosphate isomerase B [Listeria ivanovii FSL F6-596]
Length=148

 Score = 54.7 bits (130),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 23/40 (58%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = +1

Query  1    IAANKFKGIRCVNCNDPYAALQGRQHENSNVLSMGCRVIG  120
            IAANK KGIR V C++PY+A   R+H N+N+L+ G RV+G
Sbjct  73   IAANKVKGIRAVVCSEPYSAKLSREHNNTNILAFGSRVVG  112



>gb|AIU73660.1| ribose 5-phosphate isomerase [Hafnia alvei FB1]
Length=147

 Score = 54.7 bits (130),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 25/40 (63%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = +1

Query  1    IAANKFKGIRCVNCNDPYAALQGRQHENSNVLSMGCRVIG  120
            IAANK  GIR V C++PY+A   RQH N+NVL+ G RVIG
Sbjct  74   IAANKVHGIRAVVCSEPYSAKLSRQHNNTNVLAFGSRVIG  113



>ref|WP_038406878.1| ribose 5-phosphate isomerase [Listeria ivanovii]
 gb|AIS59154.1| ribose 5-phosphate isomerase [Listeria ivanovii subsp. londoniensis]
 gb|AIS61998.1| ribose 5-phosphate isomerase [Listeria ivanovii subsp. londoniensis]
Length=148

 Score = 54.7 bits (130),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 23/40 (58%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = +1

Query  1    IAANKFKGIRCVNCNDPYAALQGRQHENSNVLSMGCRVIG  120
            IAANK KGIR V C++PY+A   R+H N+N+L+ G RV+G
Sbjct  73   IAANKVKGIRAVVCSEPYSAKLSREHNNTNILAFGSRVVG  112



>dbj|GAJ38411.1| ribose 5-phosphate isomerase [Geobacillus caldoxylosilyticus 
NBRC 107762]
Length=148

 Score = 54.7 bits (130),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 26/40 (65%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = +1

Query  1    IAANKFKGIRCVNCNDPYAALQGRQHENSNVLSMGCRVIG  120
            IAANK KGIRC  C+D Y+A   RQH +SN+L+MG RVIG
Sbjct  73   IAANKVKGIRCALCHDVYSAKLTRQHNDSNILAMGERVIG  112



>ref|WP_015865321.1| ribose 5-phosphate isomerase [Geobacillus sp. WCH70]
 ref|YP_002951221.1| ribose-5-phosphate isomerase B [Geobacillus sp. WCH70]
 gb|ACS25955.1| sugar-phosphate isomerase, RpiB/LacA/LacB family [Geobacillus 
sp. WCH70]
Length=148

 Score = 54.7 bits (130),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 26/40 (65%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = +1

Query  1    IAANKFKGIRCVNCNDPYAALQGRQHENSNVLSMGCRVIG  120
            IAANK KGIRC  C+D Y+A   RQH +SN+L+MG RVIG
Sbjct  73   IAANKVKGIRCALCHDVYSAKLTRQHNDSNILAMGERVIG  112



>ref|WP_005337976.1| MULTISPECIES: ribose 5-phosphate isomerase [Firmicutes]
 gb|EGX76119.1| ribose-5-phosphate isomerase B [Dorea formicigenerans 4_6_53AFAA]
 emb|CCX56449.1| ribose-5-phosphate isomerase B [Veillonella sp. CAG:933]
 emb|CDC58206.1| ribose-5-phosphate isomerase B [Dorea formicigenerans CAG:28]
Length=146

 Score = 54.7 bits (130),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 23/40 (58%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = +1

Query  1    IAANKFKGIRCVNCNDPYAALQGRQHENSNVLSMGCRVIG  120
            +AANK KG+R V C++PY+A   RQH N+N+L+ G RVIG
Sbjct  73   LAANKVKGVRAVVCSEPYSAKLSRQHNNTNILAFGARVIG  112



>ref|WP_016318583.1| ribose 5-phosphate isomerase B [Firmicutes bacterium M10-2]
 gb|EOS61722.1| ribose 5-phosphate isomerase B [Firmicutes bacterium M10-2]
Length=151

 Score = 54.7 bits (130),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 22/40 (55%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = +1

Query  1    IAANKFKGIRCVNCNDPYAALQGRQHENSNVLSMGCRVIG  120
            +AANK  GIRCV C++PY+A   R+H N+N+L+ G RV+G
Sbjct  74   LAANKVNGIRCVTCSEPYSAKLSREHNNTNMLAFGARVVG  113



>ref|WP_028041794.1| ribose 5-phosphate isomerase [Candidatus Stoquefichus massiliensis]
Length=150

 Score = 54.7 bits (130),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 22/40 (55%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = +1

Query  1    IAANKFKGIRCVNCNDPYAALQGRQHENSNVLSMGCRVIG  120
            +AANK  GIRCV C++PY+A   R+H N+N+L+ G RV+G
Sbjct  74   LAANKVNGIRCVTCSEPYSAKLSREHNNTNMLAFGARVVG  113



>ref|WP_016224269.1| ribose 5-phosphate isomerase B [Lachnospiraceae bacterium 3-2]
 gb|EOS70138.1| ribose 5-phosphate isomerase B [Lachnospiraceae bacterium 3-2]
Length=146

 Score = 54.7 bits (130),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 23/40 (58%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = +1

Query  1    IAANKFKGIRCVNCNDPYAALQGRQHENSNVLSMGCRVIG  120
            +AANK KG+R V C++PY+A   RQH N+NVL+ G RV+G
Sbjct  73   LAANKVKGVRAVVCSEPYSAKLSRQHNNTNVLAFGARVVG  112



>ref|WP_009271729.1| ribose 5-phosphate isomerase [Erysipelotrichaceae bacterium 3_1_53]
 gb|EFP62762.1| ribose-5-phosphate isomerase B [Erysipelotrichaceae bacterium 
3_1_53]
Length=146

 Score = 54.7 bits (130),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 25/40 (63%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = +1

Query  1    IAANKFKGIRCVNCNDPYAALQGRQHENSNVLSMGCRVIG  120
            IAANK KGIRC  C DP +A   R+H +SNVL+MG R+IG
Sbjct  73   IAANKIKGIRCALCGDPVSAKLTREHNDSNVLAMGQRIIG  112



>ref|WP_003539522.1| MULTISPECIES: ribose 5-phosphate isomerase [Erysipelotrichaceae]
 gb|EDS17166.1| ribose-5-phosphate isomerase B [Erysipelatoclostridium ramosum 
DSM 1402]
 gb|EHM91069.1| ribose 5-phosphate isomerase B [Coprobacillus sp. 3_3_56FAA]
 gb|EHQ45544.1| ribose 5-phosphate isomerase B [Coprobacillus sp. 8_2_54BFAA]
 gb|EQM95707.1| ribose 5-phosphate isomerase B [Coprobacillus sp. D7]
Length=151

 Score = 54.7 bits (130),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 22/40 (55%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = +1

Query  1    IAANKFKGIRCVNCNDPYAALQGRQHENSNVLSMGCRVIG  120
            +AANK  GIRCV C++PY+A   R+H N+N+L+ G RV+G
Sbjct  74   LAANKVNGIRCVTCSEPYSAKLSREHNNTNMLAFGARVVG  113



>ref|WP_028129981.1| ribose 5-phosphate isomerase [Selenomonas sp. AE3005]
Length=146

 Score = 54.7 bits (130),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 26/40 (65%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = +1

Query  1    IAANKFKGIRCVNCNDPYAALQGRQHENSNVLSMGCRVIG  120
            IA+NK KGIRC  CND Y+A   RQH N+NVL+MG RV G
Sbjct  74   IASNKIKGIRCALCNDVYSAKMCRQHNNANVLAMGGRVTG  113



>ref|WP_039774130.1| ribose 5-phosphate isomerase, partial [Paenibacillus peoriae]
Length=99

 Score = 54.3 bits (129),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = +1

Query  1    IAANKFKGIRCVNCNDPYAALQGRQHENSNVLSMGCRVIG  120
            IAANK KGIR V C++PY A   +QH N+N+L+ G RVIG
Sbjct  22   IAANKVKGIRAVVCSEPYTAQLSKQHNNTNILAFGSRVIG  61



>ref|WP_034595954.1| hypothetical protein, partial [Helcococcus sueciensis]
Length=150

 Score = 54.7 bits (130),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 24/40 (60%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = +1

Query  1    IAANKFKGIRCVNCNDPYAALQGRQHENSNVLSMGCRVIG  120
            IAANK KGIR V C++PY+A   R+H +SN+L+ G RVIG
Sbjct  73   IAANKVKGIRAVCCSEPYSAKLSREHNDSNILAFGARVIG  112



>ref|WP_007372516.1| ribose 5-phosphate isomerase [Kosakonia radicincitans]
 gb|EJI89859.1| ribose 5-phosphate isomerase B [Kosakonia radicincitans DSM 16656]
Length=153

 Score = 54.7 bits (130),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 24/40 (60%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = +1

Query  1    IAANKFKGIRCVNCNDPYAALQGRQHENSNVLSMGCRVIG  120
            I ANKF GIR V C++PY+A   RQH ++NVL+ G RVIG
Sbjct  74   ITANKFPGIRAVVCSEPYSAQLSRQHNDTNVLAFGSRVIG  113



>ref|WP_005331952.1| ribose 5-phosphate isomerase [Dorea formicigenerans]
 gb|EDR47571.1| ribose-5-phosphate isomerase B [Dorea formicigenerans ATCC 27755]
Length=154

 Score = 54.7 bits (130),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 23/40 (58%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = +1

Query  1    IAANKFKGIRCVNCNDPYAALQGRQHENSNVLSMGCRVIG  120
            +AANK KG+R V C++PY+A   RQH N+N+L+ G RVIG
Sbjct  81   LAANKVKGVRAVVCSEPYSAKLSRQHNNTNILAFGARVIG  120



>ref|WP_017436879.1| ribose 5-phosphate isomerase [Geobacillus caldoxylosilyticus]
Length=148

 Score = 54.7 bits (130),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 26/40 (65%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = +1

Query  1    IAANKFKGIRCVNCNDPYAALQGRQHENSNVLSMGCRVIG  120
            IAANK KGIRC  C+D Y+A   RQH +SN+L+MG RVIG
Sbjct  73   IAANKVKGIRCALCHDVYSAKLTRQHNDSNILAMGERVIG  112



>ref|WP_034883810.1| ribose 5-phosphate isomerase [Gilliamella apicola]
 gb|KES17740.1| Ribose 5-phosphate isomerase RpiB [Gilliamella apicola SCGC AB-598-I20]
Length=150

 Score = 54.7 bits (130),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 23/40 (58%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = +1

Query  1    IAANKFKGIRCVNCNDPYAALQGRQHENSNVLSMGCRVIG  120
            IAANK +GIR V C+DPY+A   R+H N+N+L+ G RV+G
Sbjct  73   IAANKCQGIRAVVCSDPYSAKLSREHNNTNILAFGSRVVG  112



>ref|WP_039271998.1| ribose 5-phosphate isomerase [Enterobacter cloacae]
 gb|KHQ43847.1| ribose 5-phosphate isomerase [Enterobacter cloacae]
Length=149

 Score = 54.3 bits (129),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = +1

Query  1    IAANKFKGIRCVNCNDPYAALQGRQHENSNVLSMGCRVIG  120
            I ANKF GIR V C++PY+A   RQH N+NVL+ G RV+G
Sbjct  74   IMANKFPGIRAVVCSEPYSAQLSRQHNNTNVLAFGSRVVG  113



>ref|WP_039293120.1| ribose 5-phosphate isomerase [Paenibacillus sp. IHB B 3415]
 gb|KHL97163.1| ribose 5-phosphate isomerase [Paenibacillus sp. IHB B 3415]
Length=149

 Score = 54.3 bits (129),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 24/40 (60%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = +1

Query  1    IAANKFKGIRCVNCNDPYAALQGRQHENSNVLSMGCRVIG  120
            I+ANK KGIR V C++PY A   +QH N+NVL+ G RVIG
Sbjct  73   ISANKVKGIRAVVCSEPYTAQLSKQHNNTNVLAFGSRVIG  112



>ref|WP_003536003.1| MULTISPECIES: ribose 5-phosphate isomerase [Erysipelotrichaceae]
 gb|EDS18940.1| ribose-5-phosphate isomerase B [Erysipelatoclostridium ramosum 
DSM 1402]
 gb|EHM92166.1| ribose 5-phosphate isomerase B [Coprobacillus sp. 3_3_56FAA]
 gb|EHQ47750.1| ribose 5-phosphate isomerase B [Coprobacillus sp. 8_2_54BFAA]
 gb|EQM95816.1| ribose 5-phosphate isomerase B [Coprobacillus sp. D7]
Length=150

 Score = 54.3 bits (129),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 22/40 (55%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = +1

Query  1    IAANKFKGIRCVNCNDPYAALQGRQHENSNVLSMGCRVIG  120
            +AANK  GIRCV C++PY+A   R+H N+N+L+ G RV+G
Sbjct  74   LAANKVNGIRCVTCSEPYSAKLSREHNNTNMLAFGARVVG  113



>ref|WP_024626397.1| ribose 5-phosphate isomerase [Lactobacillus fabifermentans]
 gb|ETY72637.1| ribose 5-phosphate isomerase [Lactobacillus fabifermentans T30PCM01]
Length=166

 Score = 54.3 bits (129),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 23/40 (58%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = +1

Query  1    IAANKFKGIRCVNCNDPYAALQGRQHENSNVLSMGCRVIG  120
            +AANK  GIR V C++PY+A   RQH N+NVL+ G RV+G
Sbjct  74   LAANKVAGIRAVVCSEPYSAQLSRQHNNTNVLAFGSRVVG  113



>ref|WP_036623778.1| ribose 5-phosphate isomerase [Paenibacillus macerans]
 gb|KFM95967.1| ribose 5-phosphate isomerase B [Paenibacillus macerans]
Length=143

 Score = 54.3 bits (129),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 22/40 (55%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = +1

Query  1    IAANKFKGIRCVNCNDPYAALQGRQHENSNVLSMGCRVIG  120
            I+ANK KGIR V C++PY+A   +QH N+N+L+ G RV+G
Sbjct  73   ISANKVKGIRAVVCSEPYSAQLSKQHNNTNILAFGARVVG  112



>ref|WP_033126003.1| ribose 5-phosphate isomerase [Eubacterium sp. ER2]
Length=148

 Score = 54.3 bits (129),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 22/40 (55%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = +1

Query  1    IAANKFKGIRCVNCNDPYAALQGRQHENSNVLSMGCRVIG  120
            +AANK KG+R V C++PY+A   RQH N+N+L+ G RV+G
Sbjct  73   LAANKVKGVRAVVCSEPYSARLSRQHNNTNILAFGARVVG  112



>gb|EZP75315.1| ribose-5-phosphate isomerase B [Geobacillus stearothermophilus 
NUB3621]
Length=148

 Score = 54.3 bits (129),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 26/40 (65%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = +1

Query  1    IAANKFKGIRCVNCNDPYAALQGRQHENSNVLSMGCRVIG  120
            IAANK KGIRC  C+D Y+A   RQH +SN+L+MG RVIG
Sbjct  73   IAANKVKGIRCALCHDVYSAKLTRQHNDSNILAMGERVIG  112



>ref|WP_009571653.1| ribose 5-phosphate isomerase [Celeribacter baekdonensis]
 gb|EKE71808.1| ribose-5-phosphate isomerase [Celeribacter baekdonensis B30]
Length=149

 Score = 54.3 bits (129),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 25/41 (61%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    IAANKFKGIRCVNCNDPYAALQGRQHENSNVLSMGCRVIGE  123
            +AANK KGIRC  C D ++A   RQH N+N+LS+G RVIGE
Sbjct  77   MAANKVKGIRCGVCTDEFSARMIRQHNNANMLSLGARVIGE  117



>ref|WP_025120662.1| MULTISPECIES: ribose 5-phosphate isomerase [Serratia]
Length=147

 Score = 54.3 bits (129),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = +1

Query  1    IAANKFKGIRCVNCNDPYAALQGRQHENSNVLSMGCRVIG  120
            IAANK  GIR V C++PY+A   RQH N+N+L+ G RVIG
Sbjct  73   IAANKVNGIRAVVCSEPYSAKLSRQHNNTNILAFGSRVIG  112



>ref|WP_012907531.1| ribose 5-phosphate isomerase [Citrobacter rodentium]
 ref|YP_003366935.1| allose 6-phosphate isomerase/ribose-5-phosphate isomerase B [Citrobacter 
rodentium ICC168]
 emb|CBG90189.1| allose 6-phosphate isomerase/ribose-5-phosphate isomerase B [Citrobacter 
rodentium ICC168]
Length=147

 Score = 54.3 bits (129),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 23/40 (58%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = +1

Query  1    IAANKFKGIRCVNCNDPYAALQGRQHENSNVLSMGCRVIG  120
            I ANKF GIR V C++PY+A   RQH ++NVL+ G RV+G
Sbjct  74   ITANKFAGIRAVVCSEPYSAQLSRQHNDTNVLAFGSRVVG  113



>ref|WP_014279657.1| ribose 5-phosphate isomerase [Paenibacillus terrae]
 ref|YP_005075147.1| ribose-5-phosphate isomerase B [Paenibacillus terrae HPL-003]
 gb|AET58924.1| ribose-5-phosphate isomerase B [Paenibacillus terrae HPL-003]
Length=149

 Score = 54.3 bits (129),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 23/40 (58%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = +1

Query  1    IAANKFKGIRCVNCNDPYAALQGRQHENSNVLSMGCRVIG  120
            I+ANK KGIR V C++PY+A   +QH N+NVL+ G RV+G
Sbjct  73   ISANKVKGIRAVVCSEPYSAQLSKQHNNTNVLAFGARVVG  112



>ref|WP_007428411.1| ribose 5-phosphate isomerase [Paenibacillus sp. Aloe-11]
 gb|EHS59649.1| ribose-5-phosphate isomerase B [Paenibacillus sp. Aloe-11]
Length=149

 Score = 54.3 bits (129),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 23/40 (58%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = +1

Query  1    IAANKFKGIRCVNCNDPYAALQGRQHENSNVLSMGCRVIG  120
            I+ANK KGIR V C++PY+A   +QH N+NVL+ G RV+G
Sbjct  73   ISANKVKGIRAVVCSEPYSAQLSKQHNNTNVLAFGARVVG  112



>ref|WP_023986894.1| MULTISPECIES: ribose 5-phosphate isomerase [Paenibacillus]
 ref|YP_008910097.1| ribose 5-phosphate isomerase [Paenibacillus polymyxa CR1]
 gb|AHC18269.1| ribose 5-phosphate isomerase [Paenibacillus polymyxa CR1]
Length=149

 Score = 54.3 bits (129),  Expect = 7e-08, Method: Composition-based stats.
 Identities = 23/40 (58%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = +1

Query  1    IAANKFKGIRCVNCNDPYAALQGRQHENSNVLSMGCRVIG  120
            I+ANK KGIR V C++PY+A   +QH N+NVL+ G RV+G
Sbjct  73   ISANKVKGIRAVVCSEPYSAQLSKQHNNTNVLAFGARVVG  112



>ref|WP_010348368.1| ribose 5-phosphate isomerase [Paenibacillus peoriae]
Length=149

 Score = 54.3 bits (129),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 23/40 (58%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = +1

Query  1    IAANKFKGIRCVNCNDPYAALQGRQHENSNVLSMGCRVIG  120
            I+ANK KGIR V C++PY+A   +QH N+NVL+ G RV+G
Sbjct  73   ISANKVKGIRAVVCSEPYSAQLSKQHNNTNVLAFGARVVG  112



>ref|WP_004109409.1| ribose 5-phosphate isomerase [Klebsiella oxytoca]
 gb|EHS88117.1| ribose-5-phosphate isomerase B [Klebsiella oxytoca 10-5243]
 gb|EUC86912.1| ribose-5-phosphate isomerase B [Klebsiella oxytoca KA-2]
Length=149

 Score = 54.3 bits (129),  Expect = 7e-08, Method: Composition-based stats.
 Identities = 24/40 (60%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = +1

Query  1    IAANKFKGIRCVNCNDPYAALQGRQHENSNVLSMGCRVIG  120
            IAANK  GIR V C++PY+A   RQH N+N+L+ G RVIG
Sbjct  74   IAANKHPGIRAVVCSEPYSAQLSRQHNNTNILAFGARVIG  113



>ref|WP_015044923.1| MULTISPECIES: ribose 5-phosphate isomerase [Dehalobacter]
 ref|YP_006911900.1| Ribose 5-phosphate isomerase B [Dehalobacter sp. DCA]
 ref|YP_006914879.1| Ribose 5-phosphate isomerase B [Dehalobacter sp. CF]
 gb|AFV03915.1| Ribose 5-phosphate isomerase B [Dehalobacter sp. DCA]
 gb|AFV06894.1| Ribose 5-phosphate isomerase B [Dehalobacter sp. CF]
 gb|EQB19902.1| Ribose 5-phosphate isomerase B [Dehalobacter sp. UNSWDHB]
 gb|AHF11088.1| ribose 5-phosphate isomerase [Dehalobacter restrictus DSM 9455]
Length=147

 Score = 54.3 bits (129),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 24/41 (59%), Positives = 29/41 (71%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    IAANKFKGIRCVNCNDPYAALQGRQHENSNVLSMGCRVIGE  123
            IAANK KGIR   C D Y A   RQH N+N+L++G RVIG+
Sbjct  73   IAANKVKGIRAALCTDSYMAKMARQHNNANILALGARVIGQ  113



>ref|WP_026883619.1| ribose 5-phosphate isomerase [Clostridium akagii]
Length=149

 Score = 54.3 bits (129),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 22/40 (55%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = +1

Query  1    IAANKFKGIRCVNCNDPYAALQGRQHENSNVLSMGCRVIG  120
            IAANK  GIR V C++PY+A+  +QH N+N+L+ G RV+G
Sbjct  73   IAANKVNGIRAVVCSEPYSAMLSKQHNNTNILAFGARVVG  112



>ref|WP_006808283.1| ribose 5-phosphate isomerase [Leptotrichia goodfellowii]
 gb|EEY34099.1| ribose-5-phosphate isomerase B [Leptotrichia goodfellowii F0264]
Length=143

 Score = 54.3 bits (129),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 23/40 (58%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = +1

Query  1    IAANKFKGIRCVNCNDPYAALQGRQHENSNVLSMGCRVIG  120
            IAANK KGIR V C++PY+A   ++H N+N+L+ G RVIG
Sbjct  73   IAANKIKGIRAVVCSEPYSAKLSKEHNNTNILAFGSRVIG  112



>ref|WP_009461527.1| ribose 5-phosphate isomerase [Lachnospiraceae bacterium 2_1_46FAA]
 gb|EGG82289.1| ribose 5-phosphate isomerase B [Lachnospiraceae bacterium 2_1_46FAA]
Length=146

 Score = 54.3 bits (129),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 23/40 (58%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = +1

Query  1    IAANKFKGIRCVNCNDPYAALQGRQHENSNVLSMGCRVIG  120
            IAANK KG+R V C++PY+A   +QH N+N+L+ G RVIG
Sbjct  73   IAANKVKGVRAVVCSEPYSAKLSKQHNNTNILAFGARVIG  112



>ref|WP_012134554.1| ribose 5-phosphate isomerase [Citrobacter koseri]
 ref|YP_001455294.1| ribose-5-phosphate isomerase B [Citrobacter koseri ATCC BAA-895]
 gb|ABV14858.1| hypothetical protein CKO_03782 [Citrobacter koseri ATCC BAA-895]
Length=151

 Score = 54.3 bits (129),  Expect = 8e-08, Method: Composition-based stats.
 Identities = 22/40 (55%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = +1

Query  1    IAANKFKGIRCVNCNDPYAALQGRQHENSNVLSMGCRVIG  120
            I ANKF G+R V C++PY+A   RQH ++NVL+ G RV+G
Sbjct  76   ITANKFAGVRAVVCSEPYSAQLSRQHNDTNVLAFGSRVVG  115



>ref|WP_025719991.1| ribose 5-phosphate isomerase [Paenibacillus polymyxa]
Length=149

 Score = 53.9 bits (128),  Expect = 8e-08, Method: Composition-based stats.
 Identities = 23/40 (58%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = +1

Query  1    IAANKFKGIRCVNCNDPYAALQGRQHENSNVLSMGCRVIG  120
            I+ANK KGIR V C++PY+A   +QH N+NVL+ G RV+G
Sbjct  73   ISANKVKGIRAVVCSEPYSAQLSKQHNNTNVLAFGARVVG  112



>ref|WP_013779155.1| ribose 5-phosphate isomerase [Tepidanaerobacter acetatoxydans]
 ref|YP_004461542.1| RpiB/LacA/LacB family sugar-phosphate isomerase [Tepidanaerobacter 
acetatoxydans Re1]
 ref|YP_007273082.1| ribose 5-phosphate epimerase [Tepidanaerobacter acetatoxydans 
Re1]
 gb|AEE92235.1| sugar-phosphate isomerase, RpiB/LacA/LacB family [Tepidanaerobacter 
acetatoxydans Re1]
 emb|CCP27106.1| ribose 5-phosphate epimerase [Tepidanaerobacter acetatoxydans 
Re1]
Length=147

 Score = 53.9 bits (128),  Expect = 8e-08, Method: Composition-based stats.
 Identities = 25/40 (63%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = +1

Query  1    IAANKFKGIRCVNCNDPYAALQGRQHENSNVLSMGCRVIG  120
            IAANK KGIR   C+D ++A   RQH N+NVL+MG RVIG
Sbjct  73   IAANKVKGIRAALCHDTFSARMSRQHNNANVLTMGGRVIG  112



>ref|WP_024485143.1| ribose 5-phosphate isomerase [Serratia fonticola]
Length=147

 Score = 53.9 bits (128),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = +1

Query  1    IAANKFKGIRCVNCNDPYAALQGRQHENSNVLSMGCRVIG  120
            IAANK  GIR V C++PY+A   RQH N+N+L+ G RVIG
Sbjct  73   IAANKVNGIRAVVCSEPYSAKLSRQHNNTNILAFGSRVIG  112



>gb|AHE73609.1| ribose 5-phosphate isomerase [Enterobacter cloacae P101]
Length=149

 Score = 53.9 bits (128),  Expect = 8e-08, Method: Composition-based stats.
 Identities = 22/40 (55%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = +1

Query  1    IAANKFKGIRCVNCNDPYAALQGRQHENSNVLSMGCRVIG  120
            I ANK+ GIR V C++PY+A   RQH N+N+L+ G RV+G
Sbjct  74   ITANKYPGIRAVVCSEPYSAQLSRQHNNTNILAFGSRVVG  113



>emb|CDZ85312.1| ribose-5-phosphate isomerase B [Citrobacter koseri]
 gb|KGY20579.1| ribose 5-phosphate isomerase [Citrobacter koseri]
Length=149

 Score = 53.9 bits (128),  Expect = 8e-08, Method: Composition-based stats.
 Identities = 22/40 (55%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = +1

Query  1    IAANKFKGIRCVNCNDPYAALQGRQHENSNVLSMGCRVIG  120
            I ANKF G+R V C++PY+A   RQH ++NVL+ G RV+G
Sbjct  74   ITANKFAGVRAVVCSEPYSAQLSRQHNDTNVLAFGSRVVG  113



>ref|WP_032681899.1| ribose 5-phosphate isomerase [Enterobacter sp. BIDMC 30]
 gb|EUM04422.1| ribose-5-phosphate isomerase B [Enterobacter sp. BIDMC 30]
Length=149

 Score = 53.9 bits (128),  Expect = 8e-08, Method: Composition-based stats.
 Identities = 22/40 (55%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = +1

Query  1    IAANKFKGIRCVNCNDPYAALQGRQHENSNVLSMGCRVIG  120
            I ANK+ GIR V C++PY+A   RQH N+N+L+ G RV+G
Sbjct  74   ITANKYPGIRAVVCSEPYSAQLSRQHNNTNILAFGSRVVG  113



>ref|WP_014168253.1| ribose 5-phosphate isomerase [Enterobacter cloacae]
 ref|YP_004950174.1| ribose-5-phosphate isomerase B [Enterobacter cloacae EcWSU1]
 gb|AEW71753.1| Ribose-5-phosphate isomerase B [Enterobacter cloacae EcWSU1]
Length=149

 Score = 53.9 bits (128),  Expect = 8e-08, Method: Composition-based stats.
 Identities = 22/40 (55%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = +1

Query  1    IAANKFKGIRCVNCNDPYAALQGRQHENSNVLSMGCRVIG  120
            I ANK+ GIR V C++PY+A   RQH N+N+L+ G RV+G
Sbjct  74   ITANKYPGIRAVVCSEPYSAQLSRQHNNTNILAFGSRVVG  113



>ref|WP_016611535.1| ribose-5-phosphate isomerase B [Enterococcus faecium]
 gb|EPH67754.1| ribose-5-phosphate isomerase B [Enterococcus faecium 13.SD.W.09]
Length=146

 Score = 53.9 bits (128),  Expect = 8e-08, Method: Composition-based stats.
 Identities = 23/40 (58%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = +1

Query  1    IAANKFKGIRCVNCNDPYAALQGRQHENSNVLSMGCRVIG  120
            IAANK KGIR V C++PY+A   ++H N+NVL+ G RV+G
Sbjct  73   IAANKIKGIRAVVCSEPYSAKLSKEHNNTNVLAFGSRVVG  112



>ref|WP_038286535.1| ribose 5-phosphate isomerase [actinobacterium acAcidi]
 gb|KGA09892.1| putative ribose-5-phosphate isomerase B [actinobacterium acAcidi]
Length=151

 Score = 53.9 bits (128),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 24/41 (59%), Positives = 28/41 (68%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    IAANKFKGIRCVNCNDPYAALQGRQHENSNVLSMGCRVIGE  123
            +AANK  G+R   CND Y A   R H N+NVLSMG RV+GE
Sbjct  74   LAANKVHGVRAALCNDLYTARMARSHNNANVLSMGARVVGE  114



>ref|WP_039163183.1| ribose 5-phosphate isomerase [Leisingera sp. ANG-M1]
 gb|KIC10053.1| ribose 5-phosphate isomerase [Leisingera sp. ANG-M1]
Length=149

 Score = 53.9 bits (128),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 24/41 (59%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    IAANKFKGIRCVNCNDPYAALQGRQHENSNVLSMGCRVIGE  123
            +AANK KGIRC  C+D ++A   RQH N+N+LS+G RV+GE
Sbjct  77   MAANKVKGIRCGVCSDTFSAAMIRQHNNANMLSIGARVVGE  117



>ref|WP_021973797.1| ribose-5-phosphate isomerase B [Eubacterium sp. CAG:180]
 emb|CCY92827.1| ribose-5-phosphate isomerase B [Eubacterium sp. CAG:180]
Length=150

 Score = 53.9 bits (128),  Expect = 9e-08, Method: Composition-based stats.
 Identities = 22/40 (55%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = +1

Query  1    IAANKFKGIRCVNCNDPYAALQGRQHENSNVLSMGCRVIG  120
            +AANK  GIR V C++PY+AL  RQH ++N+L+ G RV+G
Sbjct  73   LAANKVNGIRAVVCSEPYSALLSRQHNDTNILAFGARVVG  112



>ref|WP_028092771.1| ribose 5-phosphate isomerase [Donghicola xiamenensis]
Length=149

 Score = 53.9 bits (128),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 24/41 (59%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    IAANKFKGIRCVNCNDPYAALQGRQHENSNVLSMGCRVIGE  123
            +AANK KGIRC  C+D ++A   RQH N+N+LS+G RV+GE
Sbjct  77   MAANKVKGIRCGVCSDSFSARMIRQHNNANMLSLGARVVGE  117



>ref|WP_016459704.1| MULTISPECIES: ribose 5-phosphate isomerase B [Acidaminococcus]
 gb|EPD72912.1| ribose 5-phosphate isomerase B [Acidaminococcus sp. HPA0509]
 emb|CDB94482.1| ribose-5-phosphate isomerase B [Acidaminococcus intestini CAG:325]
Length=145

 Score = 53.9 bits (128),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 25/40 (63%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = +1

Query  1    IAANKFKGIRCVNCNDPYAALQGRQHENSNVLSMGCRVIG  120
            IAANK KG+R   CND Y+A + RQH N+NVL MG RV+G
Sbjct  73   IAANKVKGVRAALCNDCYSAAKARQHNNANVLCMGARVLG  112



>ref|WP_003539915.1| ribose 5-phosphate isomerase [Rhizobium leguminosarum]
 gb|EJC66529.1| ribose 5-phosphate isomerase B [Rhizobium leguminosarum bv. viciae 
WSM1455]
Length=149

 Score = 53.9 bits (128),  Expect = 9e-08, Method: Composition-based stats.
 Identities = 24/41 (59%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    IAANKFKGIRCVNCNDPYAALQGRQHENSNVLSMGCRVIGE  123
            +AANK KGIRC  C DP++A   RQH ++N+LS+G RV+GE
Sbjct  77   MAANKVKGIRCGVCADPFSARMIRQHNDANMLSIGVRVVGE  117



>ref|WP_009015484.1| MULTISPECIES: ribose 5-phosphate isomerase [Acidaminococcus]
 ref|YP_004895933.1| ribose-5-phosphate isomerase B [Acidaminococcus intestini RyC-MR95]
 gb|EEH90655.1| ribose-5-phosphate isomerase B [Acidaminococcus sp. D21]
 gb|AEQ21793.1| ribose-5-phosphate isomerase B [Acidaminococcus intestini RyC-MR95]
 gb|ERL17777.1| ribose-5-phosphate isomerase B [Acidaminococcus sp. BV3L6]
Length=146

 Score = 53.9 bits (128),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 25/40 (63%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = +1

Query  1    IAANKFKGIRCVNCNDPYAALQGRQHENSNVLSMGCRVIG  120
            IAANK KG+R   CND Y+A + RQH N+NVL MG RV+G
Sbjct  74   IAANKVKGVRAALCNDCYSAAKARQHNNANVLCMGARVLG  113



>ref|WP_002444945.1| ribose 5-phosphate isomerase [Shimwellia blattae]
 ref|YP_006318310.1| ribose-5-phosphate isomerase B [Shimwellia blattae DSM 4481 = 
NBRC 105725]
 gb|AFJ45799.1| ribose-5-phosphate isomerase B [Shimwellia blattae DSM 4481 = 
NBRC 105725]
 dbj|GAB82929.1| ribose-5-phosphate isomerase B [Shimwellia blattae DSM 4481 = 
NBRC 105725]
Length=143

 Score = 53.9 bits (128),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 24/41 (59%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    IAANKFKGIRCVNCNDPYAALQGRQHENSNVLSMGCRVIGE  123
            IAANK  GIR V C++PY+A   RQH ++NVL+ G RV+GE
Sbjct  74   IAANKVAGIRAVVCSEPYSAQLSRQHNDTNVLAFGARVVGE  114



>ref|WP_039763450.1| ribose 5-phosphate isomerase [Caldicellulosiruptor sp. F32]
Length=148

 Score = 53.9 bits (128),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 24/41 (59%), Positives = 30/41 (73%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    IAANKFKGIRCVNCNDPYAALQGRQHENSNVLSMGCRVIGE  123
            IAANK KGIR   C+D ++A   R H N+N+L+MG RVIGE
Sbjct  73   IAANKIKGIRAALCHDTFSAKAARAHNNANILAMGARVIGE  113



>dbj|GAK22348.1| ribose 5-phosphate isomerase B [Vibrio sp. JCM 19052]
Length=117

 Score = 53.5 bits (127),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 23/40 (58%), Positives = 29/40 (73%), Gaps = 0/40 (0%)
 Frame = +1

Query  1    IAANKFKGIRCVNCNDPYAALQGRQHENSNVLSMGCRVIG  120
            +AANK  GIR V C+DPY A   +QH N+N+L+ G RVIG
Sbjct  73   LAANKVPGIRAVVCSDPYTAQLSKQHNNTNILAFGSRVIG  112



>ref|WP_010742328.1| ribose 5-phosphate isomerase B [Enterococcus malodoratus]
 gb|EOH73860.1| ribose 5-phosphate isomerase B [Enterococcus malodoratus ATCC 
43197]
 gb|EOT67198.1| ribose 5-phosphate isomerase B [Enterococcus malodoratus ATCC 
43197]
Length=148

 Score = 53.9 bits (128),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 23/40 (58%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = +1

Query  1    IAANKFKGIRCVNCNDPYAALQGRQHENSNVLSMGCRVIG  120
            I+ANK  GIR V C++PY+A   RQH N+N+L+ G RVIG
Sbjct  73   ISANKVHGIRAVVCSEPYSAKLSRQHNNTNILAFGSRVIG  112



>ref|WP_008559012.1| ribose 5-phosphate isomerase [Ruegeria sp. R11]
 gb|EEB69648.1| ribose 5-phosphate isomerase B [Ruegeria sp. R11]
Length=147

 Score = 53.5 bits (127),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 24/41 (59%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    IAANKFKGIRCVNCNDPYAALQGRQHENSNVLSMGCRVIGE  123
            +AANK KGIRC  C+D ++A   RQH N+N+LS+G RV+GE
Sbjct  77   MAANKVKGIRCGVCSDTFSAAMIRQHNNANMLSIGARVVGE  117



>ref|WP_026765196.1| ribose 5-phosphate isomerase [Selenomonas ruminantium]
Length=146

 Score = 53.5 bits (127),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 25/40 (63%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = +1

Query  1    IAANKFKGIRCVNCNDPYAALQGRQHENSNVLSMGCRVIG  120
            IAANK KGIRC  CND ++A   RQH ++NVL+MG RV+G
Sbjct  74   IAANKIKGIRCALCNDVFSAKMCRQHNDANVLAMGGRVMG  113



>ref|WP_011916739.1| ribose 5-phosphate isomerase [Caldicellulosiruptor saccharolyticus]
 ref|YP_001179994.1| RpiB/LacA/LacB family sugar-phosphate isomerase [Caldicellulosiruptor 
saccharolyticus DSM 8903]
 gb|ABP66803.1| sugar-phosphate isomerase, RpiB/LacA/LacB family [Caldicellulosiruptor 
saccharolyticus DSM 8903]
Length=150

 Score = 53.5 bits (127),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 24/41 (59%), Positives = 30/41 (73%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    IAANKFKGIRCVNCNDPYAALQGRQHENSNVLSMGCRVIGE  123
            IAANK KGIR   C+D ++A   R H N+N+L+MG RVIGE
Sbjct  75   IAANKIKGIRAALCHDTFSAKAARAHNNANILAMGARVIGE  115



>ref|WP_025107676.1| ribose 5-phosphate isomerase [Klebsiella oxytoca]
Length=149

 Score = 53.5 bits (127),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = +1

Query  1    IAANKFKGIRCVNCNDPYAALQGRQHENSNVLSMGCRVIG  120
            IAANK  GIR V C++PY+A   RQH N+N+L+ G RVIG
Sbjct  74   IAANKHPGIRAVVCSEPYSAQLSRQHNNTNILAFGARVIG  113



>ref|WP_032747528.1| ribose 5-phosphate isomerase [Klebsiella oxytoca]
 gb|EWF77445.1| ribose-5-phosphate isomerase B [Klebsiella oxytoca MGH 41]
Length=149

 Score = 53.5 bits (127),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = +1

Query  1    IAANKFKGIRCVNCNDPYAALQGRQHENSNVLSMGCRVIG  120
            IAANK  GIR V C++PY+A   RQH N+N+L+ G RVIG
Sbjct  74   IAANKHPGIRAVVCSEPYSAQLSRQHNNTNILAFGARVIG  113



>ref|WP_034437690.1| ribose 5-phosphate isomerase [Clostridiales bacterium S5-A11]
 gb|KGF11502.1| ribose 5-phosphate isomerase [Clostridiales bacterium S5-A11]
Length=152

 Score = 53.5 bits (127),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = +1

Query  1    IAANKFKGIRCVNCNDPYAALQGRQHENSNVLSMGCRVIG  120
            IAANK KG+RCV  +DPY+A   R+H N NV++MG R IG
Sbjct  73   IAANKVKGVRCVRAHDPYSAEMSRRHNNCNVIAMGGRFIG  112



>ref|WP_004117284.1| MULTISPECIES: ribose 5-phosphate isomerase [Klebsiella]
 gb|EHS88400.1| ribose-5-phosphate isomerase B [Klebsiella oxytoca 10-5245]
 gb|ESM78052.1| ribose-5-phosphate isomerase B [Klebsiella oxytoca MGH 42]
 gb|ESN07902.1| ribose-5-phosphate isomerase B [Klebsiella oxytoca MGH 28]
 gb|EUC91939.1| ribose-5-phosphate isomerase B [Klebsiella oxytoca OK-1]
 gb|EYT06260.1| ribose-5-phosphate isomerase B [Klebsiella oxytoca G54]
Length=149

 Score = 53.5 bits (127),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = +1

Query  1    IAANKFKGIRCVNCNDPYAALQGRQHENSNVLSMGCRVIG  120
            IAANK  GIR V C++PY+A   RQH N+N+L+ G RVIG
Sbjct  74   IAANKHPGIRAVVCSEPYSAQLSRQHNNTNILAFGARVIG  113



>ref|WP_000444975.1| ribose 5-phosphate isomerase [Escherichia coli]
 gb|EFZ48326.1| ribose 5-phosphate isomerase B [Escherichia coli E128010]
Length=150

 Score = 53.5 bits (127),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 23/40 (58%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = +1

Query  1    IAANKFKGIRCVNCNDPYAALQGRQHENSNVLSMGCRVIG  120
            IAA KF GIR V C++PY+A   RQH ++NVL+ G RV+G
Sbjct  75   IAAKKFAGIRAVVCSEPYSAQLSRQHNDTNVLAFGSRVVG  114



>ref|WP_009705066.1| MULTISPECIES: ribose 5-phosphate isomerase [Vibrio]
 gb|EKM27306.1| ribose 5-phosphate isomerase B [Vibrio sp. HENC-03]
 gb|KIF51171.1| ribose 5-phosphate isomerase [Vibrio owensii CAIM 1854 = LMG 
25443]
Length=146

 Score = 53.5 bits (127),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 23/40 (58%), Positives = 29/40 (73%), Gaps = 0/40 (0%)
 Frame = +1

Query  1    IAANKFKGIRCVNCNDPYAALQGRQHENSNVLSMGCRVIG  120
            +AANK  GIR V C+DPY A   +QH N+N+L+ G RVIG
Sbjct  73   LAANKVPGIRAVVCSDPYTAQLSKQHNNTNILAFGSRVIG  112



>ref|WP_034554201.1| ribose 5-phosphate isomerase [Helicobacter apodemus]
 gb|KGL17606.1| ribose 5-phosphate isomerase [Helicobacter apodemus]
Length=140

 Score = 53.5 bits (127),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = +1

Query  1    IAANKFKGIRCVNCNDPYAALQGRQHENSNVLSMGCRVIG  120
            IAAN+FKGIR   C +PY+A   R+H N+NVL +G RVIG
Sbjct  73   IAANRFKGIRAALCYEPYSAAMSRKHNNANVLCLGARVIG  112



>ref|WP_005442339.1| ribose 5-phosphate isomerase [Vibrio harveyi]
 gb|EEZ85905.1| hypothetical protein VME_41850 [Vibrio harveyi 1DA3]
 gb|KIF44802.1| ribose 5-phosphate isomerase [Vibrio owensii 47666-1]
Length=146

 Score = 53.5 bits (127),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 23/40 (58%), Positives = 29/40 (73%), Gaps = 0/40 (0%)
 Frame = +1

Query  1    IAANKFKGIRCVNCNDPYAALQGRQHENSNVLSMGCRVIG  120
            +AANK  GIR V C+DPY A   +QH N+N+L+ G RVIG
Sbjct  73   LAANKVPGIRAVVCSDPYTAQLSKQHNNTNILAFGSRVIG  112



>ref|WP_015708210.1| ribose 5-phosphate isomerase [Treponema primitia]
 ref|YP_004531082.1| ribose-5-phosphate isomerase B [Treponema primitia ZAS-2]
 gb|AEF84164.1| ribose-5-phosphate isomerase B [Treponema primitia ZAS-2]
Length=151

 Score = 53.5 bits (127),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 24/40 (60%), Positives = 29/40 (73%), Gaps = 0/40 (0%)
 Frame = +1

Query  1    IAANKFKGIRCVNCNDPYAALQGRQHENSNVLSMGCRVIG  120
            +AANK KGIR V C D Y AL  RQH N+N+L++G RVI 
Sbjct  72   LAANKVKGIRAVVCTDCYTALLSRQHNNANILALGARVIA  111



>ref|WP_013411501.1| ribose 5-phosphate isomerase [Caldicellulosiruptor owensensis]
 ref|YP_004001891.1| sugar-phosphate isomerase, rpib/laca/lacb family [Caldicellulosiruptor 
owensensis OL]
 gb|ADQ04091.1| sugar-phosphate isomerase, RpiB/LacA/LacB family [Caldicellulosiruptor 
owensensis OL]
Length=148

 Score = 53.5 bits (127),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 24/41 (59%), Positives = 30/41 (73%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    IAANKFKGIRCVNCNDPYAALQGRQHENSNVLSMGCRVIGE  123
            IAANK KGIR   C+D ++A   R H N+N+L+MG RVIGE
Sbjct  73   IAANKVKGIRAALCHDTFSAKAARAHNNANILAMGARVIGE  113



>ref|WP_033827504.1| ribose 5-phosphate isomerase [Bacillus sp. KW-12]
Length=147

 Score = 53.5 bits (127),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 25/40 (63%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = +1

Query  1    IAANKFKGIRCVNCNDPYAALQGRQHENSNVLSMGCRVIG  120
            IAANK KGIRC  C+D ++A   R+H ++NVLSMG RVIG
Sbjct  73   IAANKVKGIRCALCHDVFSAKATREHNDTNVLSMGERVIG  112



>ref|WP_013431970.1| MULTISPECIES: ribose 5-phosphate isomerase [Caldicellulosiruptor]
 ref|YP_004025748.1| sugar-phosphate isomerase, rpib/laca/lacb family [Caldicellulosiruptor 
kristjanssonii I77R1B]
 ref|YP_004799328.1| RpiB/LacA/LacB family sugar-phosphate isomerase [Caldicellulosiruptor 
lactoaceticus 6A]
 gb|ADQ40135.1| sugar-phosphate isomerase, RpiB/LacA/LacB family [Caldicellulosiruptor 
kristjanssonii I77R1B]
 gb|AEM74351.1| sugar-phosphate isomerase, RpiB/LacA/LacB family [Caldicellulosiruptor 
lactoaceticus 6A]
Length=148

 Score = 53.5 bits (127),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 24/41 (59%), Positives = 30/41 (73%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    IAANKFKGIRCVNCNDPYAALQGRQHENSNVLSMGCRVIGE  123
            IAANK KGIR   C+D ++A   R H N+N+L+MG RVIGE
Sbjct  73   IAANKVKGIRAALCHDTFSAKAARAHNNANILAMGARVIGE  113



>ref|WP_020007252.1| hypothetical protein [Salinicoccus albus]
Length=142

 Score = 53.5 bits (127),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 25/40 (63%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = +1

Query  1    IAANKFKGIRCVNCNDPYAALQGRQHENSNVLSMGCRVIG  120
            I+ANK KGIRC   +D ++A   RQH NSNVL+MG RVIG
Sbjct  73   ISANKVKGIRCALVHDSFSAKAARQHNNSNVLAMGERVIG  112



>ref|WP_015879046.1| ribose 5-phosphate isomerase [Tolumonas auensis]
 ref|YP_002893164.1| ribose 5-phosphate isomerase B [Tolumonas auensis DSM 9187]
 gb|ACQ93578.1| ribose 5-phosphate isomerase B [Tolumonas auensis DSM 9187]
Length=155

 Score = 53.5 bits (127),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = +1

Query  1    IAANKFKGIRCVNCNDPYAALQGRQHENSNVLSMGCRVIG  120
            IAANK  GIR V C++PY+A   RQH N+NVL+ G RV+G
Sbjct  73   IAANKVNGIRAVVCSEPYSAQLSRQHNNTNVLAFGARVVG  112



>ref|WP_000716793.1| ribose 5-phosphate isomerase [Escherichia coli]
 gb|EDX31437.1| ribose 5-phosphate isomerase B [Escherichia coli B171]
 gb|EHX21022.1| ribose 5-phosphate isomerase B [Escherichia coli DEC12B]
 gb|EHX24280.1| ribose 5-phosphate isomerase B [Escherichia coli DEC12A]
 gb|EHX25171.1| ribose 5-phosphate isomerase B [Escherichia coli DEC12C]
 gb|EHX39074.1| ribose 5-phosphate isomerase B [Escherichia coli DEC12D]
 gb|EHX41889.1| ribose 5-phosphate isomerase B [Escherichia coli DEC12E]
 gb|EIQ66453.1| ribose 5-phosphate isomerase B [Escherichia coli EPEC C342-62]
Length=149

 Score = 53.5 bits (127),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 23/40 (58%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = +1

Query  1    IAANKFKGIRCVNCNDPYAALQGRQHENSNVLSMGCRVIG  120
            IAA KF GIR V C++PY+A   RQH ++NVL+ G RV+G
Sbjct  74   IAAKKFAGIRAVVCSEPYSAQLSRQHNDTNVLAFGSRVVG  113



>ref|WP_029542605.1| ribose 5-phosphate isomerase [Selenomonas ruminantium]
Length=147

 Score = 53.1 bits (126),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 25/40 (63%), Positives = 28/40 (70%), Gaps = 0/40 (0%)
 Frame = +1

Query  1    IAANKFKGIRCVNCNDPYAALQGRQHENSNVLSMGCRVIG  120
            IAANK KGIRC  C D Y+A   R H N+NVL+MG RV G
Sbjct  74   IAANKIKGIRCALCTDVYSARMSRAHNNANVLAMGGRVTG  113



>ref|WP_018380741.1| ribose 5-phosphate isomerase [Streptococcus thoraltensis]
Length=145

 Score = 53.1 bits (126),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 24/40 (60%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = +1

Query  1    IAANKFKGIRCVNCNDPYAALQGRQHENSNVLSMGCRVIG  120
            I+ANK   IRCV C++PY+A   RQH ++NVLS G RVIG
Sbjct  74   ISANKVPRIRCVICSEPYSAKLSRQHNDTNVLSFGSRVIG  113



>ref|WP_026486376.1| ribose 5-phosphate isomerase [Caldanaerobius polysaccharolyticus]
Length=146

 Score = 53.1 bits (126),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 23/41 (56%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    IAANKFKGIRCVNCNDPYAALQGRQHENSNVLSMGCRVIGE  123
            IAANK  GIR  NC+DPY+A   ++H N+NVL +G RV+G+
Sbjct  72   IAANKIPGIRAANCSDPYSARMAKEHNNANVLCIGGRVVGK  112



>ref|WP_024731748.1| ribose 5-phosphate isomerase [Clostridiales bacterium VE202-14]
Length=149

 Score = 53.1 bits (126),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 23/40 (58%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = +1

Query  1    IAANKFKGIRCVNCNDPYAALQGRQHENSNVLSMGCRVIG  120
            +AANK +GIR V C++PY A   RQH ++NVL+ G RVIG
Sbjct  73   LAANKVRGIRAVVCSEPYTARLARQHNDANVLAFGARVIG  112



>ref|WP_013711095.1| ribose 5-phosphate isomerase [Carnobacterium sp. 17-4]
 ref|YP_004375169.1| ribose-5-phosphate isomerase B [Carnobacterium sp. 17-4]
 gb|AEB30153.1| ribose-5-phosphate isomerase B [Carnobacterium sp. 17-4]
Length=150

 Score = 53.1 bits (126),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 22/40 (55%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = +1

Query  1    IAANKFKGIRCVNCNDPYAALQGRQHENSNVLSMGCRVIG  120
            IAANK KGIR V C++PY+A   ++H N+N+L+ G RV+G
Sbjct  73   IAANKVKGIRAVVCSEPYSAKLSKEHNNTNILAFGSRVVG  112



>ref|WP_010899892.1| ribose 5-phosphate isomerase [Bacillus halodurans]
 ref|NP_244634.1| ribose-5-phosphate isomerase B [Bacillus halodurans C-125]
 dbj|BAB07486.1| ribose 5-phosphate epimerase (pentose phosphate) [Bacillus halodurans 
C-125]
Length=145

 Score = 53.1 bits (126),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 25/40 (63%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = +1

Query  1    IAANKFKGIRCVNCNDPYAALQGRQHENSNVLSMGCRVIG  120
            IAANK KGIRC  C+D ++A   R+H +SNVL+MG RVIG
Sbjct  73   IAANKVKGIRCALCHDVFSAKATREHNDSNVLAMGERVIG  112



>ref|WP_039125950.1| ribose 5-phosphate isomerase [Leisingera sp. ANG-Vp]
 gb|KIC20991.1| ribose 5-phosphate isomerase [Leisingera sp. ANG-Vp]
Length=149

 Score = 53.1 bits (126),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 24/41 (59%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    IAANKFKGIRCVNCNDPYAALQGRQHENSNVLSMGCRVIGE  123
            +AANK KGIRC  C D ++A   RQH N+N+LS+G RV+GE
Sbjct  77   MAANKVKGIRCGVCADTFSAAMIRQHNNANMLSIGARVVGE  117



>ref|WP_029042399.1| ribose 5-phosphate isomerase [Cucumibacter marinus]
Length=149

 Score = 53.1 bits (126),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 23/41 (56%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    IAANKFKGIRCVNCNDPYAALQGRQHENSNVLSMGCRVIGE  123
            +AANK KG+RC  C+D ++A   RQH N+N+LS+G RV+GE
Sbjct  77   MAANKVKGVRCGVCSDTFSARMIRQHNNANMLSIGARVVGE  117



>ref|WP_011652101.1| ribose 5-phosphate isomerase [Rhizobium leguminosarum]
 ref|YP_768131.1| ribose-5-phosphate isomerase B [Rhizobium leguminosarum bv. viciae 
3841]
 emb|CAK08035.1| ribose-5-phosphate isomerase B [Rhizobium leguminosarum bv. viciae 
3841]
Length=149

 Score = 53.1 bits (126),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 23/41 (56%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    IAANKFKGIRCVNCNDPYAALQGRQHENSNVLSMGCRVIGE  123
            +AANK +GIRC  C DP++A   RQH ++N+LS+G RV+GE
Sbjct  77   MAANKVRGIRCGVCADPFSARMIRQHNDANMLSIGVRVVGE  117



>ref|WP_026444845.1| ribose 5-phosphate isomerase [Acidobacteriaceae bacterium URHE0068]
Length=149

 Score = 53.1 bits (126),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 22/40 (55%), Positives = 32/40 (80%), Gaps = 0/40 (0%)
 Frame = +1

Query  1    IAANKFKGIRCVNCNDPYAALQGRQHENSNVLSMGCRVIG  120
            I+ANK KGIR V C++PY+A   R+H ++NVL++G RV+G
Sbjct  72   ISANKVKGIRAVVCSEPYSARLSREHNDTNVLALGARVVG  111



>ref|WP_023458636.1| ribose 5-phosphate isomerase [Asticcacaulis sp. AC466]
 gb|ESQ83202.1| ribose 5-phosphate isomerase [Asticcacaulis sp. AC466]
Length=149

 Score = 53.1 bits (126),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 23/41 (56%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    IAANKFKGIRCVNCNDPYAALQGRQHENSNVLSMGCRVIGE  123
            +AANK KGIRC  C+D ++A   RQH ++N+LS+G RV+GE
Sbjct  77   MAANKVKGIRCGVCSDTFSARMIRQHNDANMLSLGARVVGE  117



>ref|WP_005182666.1| ribose 5-phosphate isomerase [Yersinia intermedia]
 gb|EEQ20750.1| Ribose-5-phosphate isomerase B [Yersinia intermedia ATCC 29909]
Length=151

 Score = 53.1 bits (126),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 23/40 (58%), Positives = 29/40 (73%), Gaps = 0/40 (0%)
 Frame = +1

Query  1    IAANKFKGIRCVNCNDPYAALQGRQHENSNVLSMGCRVIG  120
            I ANK  GIR V C++PY+A   RQH N+NVL+ G RV+G
Sbjct  74   ITANKHPGIRAVVCSEPYSAQLSRQHNNTNVLAFGSRVVG  113



>ref|WP_035602473.1| ribose 5-phosphate isomerase [Hyphomonas polymorpha]
 gb|KCZ96688.1| ribose-5-phosphate isomerase [Hyphomonas polymorpha PS728]
Length=149

 Score = 53.1 bits (126),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 24/41 (59%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    IAANKFKGIRCVNCNDPYAALQGRQHENSNVLSMGCRVIGE  123
            +AANK KGIRC  C+D ++A   RQH ++N+LS+G RVIGE
Sbjct  77   MAANKVKGIRCGVCSDTFSARMIRQHNDANMLSLGVRVIGE  117



>ref|WP_004137473.1| ribose-5-phosphate isomerase B [Klebsiella oxytoca]
 gb|EKP26276.1| ribose-5-phosphate isomerase B [Klebsiella oxytoca M5al]
Length=149

 Score = 53.1 bits (126),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 24/40 (60%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = +1

Query  1    IAANKFKGIRCVNCNDPYAALQGRQHENSNVLSMGCRVIG  120
            IAANK  GIR V C++PY+A   RQH ++NVL+ G RVIG
Sbjct  74   IAANKHPGIRAVVCSEPYSAQLSRQHNDTNVLAFGARVIG  113



>ref|WP_010075847.1| ribose 5-phosphate isomerase [Clostridium cellulovorans]
 ref|YP_003844516.1| RpiB/LacA/LacB family sugar-phosphate isomerase [Clostridium 
cellulovorans 743B]
 gb|ADL52752.1| sugar-phosphate isomerase, RpiB/LacA/LacB family [Clostridium 
cellulovorans 743B]
Length=149

 Score = 52.8 bits (125),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 23/41 (56%), Positives = 30/41 (73%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    IAANKFKGIRCVNCNDPYAALQGRQHENSNVLSMGCRVIGE  123
            IAANK  GIR   C+D ++A   RQH N+N+L+MG RV+GE
Sbjct  73   IAANKVPGIRAALCHDTFSAHSTRQHNNANILAMGARVVGE  113



>ref|WP_009532915.1| ribose 5-phosphate isomerase [Stomatobaculum longum]
 gb|EHO17483.1| ribose 5-phosphate isomerase B [Stomatobaculum longum]
Length=152

 Score = 52.8 bits (125),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 21/41 (51%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    IAANKFKGIRCVNCNDPYAALQGRQHENSNVLSMGCRVIGE  123
            +AANK KGIR   C++PY+A   R+H N+N+++ G RV+GE
Sbjct  73   LAANKVKGIRAAVCSEPYSAKMAREHNNANMIAFGARVVGE  113



>ref|WP_026499761.1| ribose 5-phosphate isomerase [Caldibacillus debilis]
Length=148

 Score = 52.8 bits (125),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 24/40 (60%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = +1

Query  1    IAANKFKGIRCVNCNDPYAALQGRQHENSNVLSMGCRVIG  120
            IAANK KGIRC  C+D ++A   R+H +SN+L+MG RVIG
Sbjct  73   IAANKVKGIRCALCHDVFSAKATREHNDSNILAMGERVIG  112



>ref|WP_017988427.1| ribose 5-phosphate isomerase [Rhizobium leguminosarum]
Length=149

 Score = 52.8 bits (125),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 23/41 (56%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    IAANKFKGIRCVNCNDPYAALQGRQHENSNVLSMGCRVIGE  123
            +AANK +GIRC  C DP++A   RQH ++N+LS+G RV+GE
Sbjct  77   MAANKVRGIRCGVCADPFSARMIRQHNDANMLSIGVRVVGE  117



>ref|WP_027358457.1| ribose 5-phosphate isomerase [Desulforegula conservatrix]
Length=144

 Score = 52.8 bits (125),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 23/41 (56%), Positives = 29/41 (71%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    IAANKFKGIRCVNCNDPYAALQGRQHENSNVLSMGCRVIGE  123
            I AN+FKGIR   CND + A   RQH +SN+L +G RVIG+
Sbjct  73   ITANRFKGIRAALCNDVFLAKLSRQHNDSNILVLGARVIGD  113



>ref|WP_027339908.1| ribose 5-phosphate isomerase [Halonatronum saccharophilum]
Length=145

 Score = 52.8 bits (125),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 24/40 (60%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = +1

Query  1    IAANKFKGIRCVNCNDPYAALQGRQHENSNVLSMGCRVIG  120
            IAANK KG+R   C+D ++A   RQH NSN+L+MG RVIG
Sbjct  73   IAANKVKGVRAALCHDLFSAKATRQHNNSNILAMGERVIG  112



>ref|WP_027090055.1| ribose 5-phosphate isomerase [[Clostridium] saccharogumia]
Length=147

 Score = 52.8 bits (125),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 25/41 (61%), Positives = 30/41 (73%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    IAANKFKGIRCVNCNDPYAALQGRQHENSNVLSMGCRVIGE  123
            I ANK KGIRC  C+D Y+A   R H +SN+L+MG RVIGE
Sbjct  73   ITANKVKGIRCALCHDVYSAKMTRAHNDSNMLAMGQRVIGE  113



>ref|WP_025873458.1| ribose 5-phosphate isomerase [Enterococcus sp. TR]
Length=145

 Score = 52.8 bits (125),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 21/40 (53%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = +1

Query  1    IAANKFKGIRCVNCNDPYAALQGRQHENSNVLSMGCRVIG  120
            I+ANK KGIR V C++PY+A   ++H N+N+L+ G RV+G
Sbjct  73   ISANKVKGIRAVVCSEPYSAKLSKEHNNTNILAFGSRVVG  112



>ref|WP_013114795.1| ribose 5-phosphate isomerase [Brachyspira murdochii]
 ref|YP_003634656.1| ribose 5-phosphate isomerase B [Brachyspira murdochii DSM 12563]
 gb|ADG72457.1| ribose 5-phosphate isomerase B [Brachyspira murdochii DSM 12563]
Length=149

 Score = 52.8 bits (125),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 21/40 (53%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = +1

Query  1    IAANKFKGIRCVNCNDPYAALQGRQHENSNVLSMGCRVIG  120
            +AANK KGIR   C++PY+A   +QH NSN+++ G RV+G
Sbjct  73   LAANKVKGIRAAVCSEPYSAKLSKQHNNSNIIAFGARVVG  112



>ref|WP_026681786.1| ribose 5-phosphate isomerase [Bacillus megaterium]
Length=146

 Score = 52.8 bits (125),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 26/40 (65%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = +1

Query  1    IAANKFKGIRCVNCNDPYAALQGRQHENSNVLSMGCRVIG  120
            IAANK KGIRC   +D Y+A   RQH NSNVL+MG RV+G
Sbjct  73   IAANKVKGIRCALTHDVYSAKLTRQHNNSNVLAMGERVVG  112



>ref|WP_035247828.1| ribose 5-phosphate isomerase [Actibacterium atlanticum]
 gb|KCV83708.1| ribose-5-phosphate isomerase [Actibacterium atlanticum]
Length=149

 Score = 52.8 bits (125),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 25/41 (61%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    IAANKFKGIRCVNCNDPYAALQGRQHENSNVLSMGCRVIGE  123
            +AANK KGIRC  C D ++A   RQH N+N+LS+G RVIGE
Sbjct  77   MAANKVKGIRCGVCCDTFSAKMIRQHNNANMLSLGARVIGE  117



>ref|WP_013149976.1| ribose 5-phosphate isomerase [Thermoanaerobacter mathranii]
 ref|YP_003676429.1| RpiB/LacA/LacB family sugar-phosphate isomerase [Thermoanaerobacter 
mathranii subsp. mathranii str. A3]
 gb|ADH60418.1| sugar-phosphate isomerase, RpiB/LacA/LacB family [Thermoanaerobacter 
mathranii subsp. mathranii str. A3]
Length=148

 Score = 52.8 bits (125),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 22/40 (55%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = +1

Query  1    IAANKFKGIRCVNCNDPYAALQGRQHENSNVLSMGCRVIG  120
            IAANK  GIR V C++PY+A   +QH N+N+L++G RV+G
Sbjct  73   IAANKVGGIRAVVCSEPYSAKLSKQHNNTNILTLGARVVG  112



>ref|WP_019542193.1| ribose 5-phosphate isomerase [Selenomonas bovis]
Length=147

 Score = 52.8 bits (125),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 24/40 (60%), Positives = 29/40 (73%), Gaps = 0/40 (0%)
 Frame = +1

Query  1    IAANKFKGIRCVNCNDPYAALQGRQHENSNVLSMGCRVIG  120
            IA NK KGIRC  CND Y+A   R H ++NVL+MG RV+G
Sbjct  74   IACNKIKGIRCALCNDVYSAKMSRHHNDANVLAMGGRVLG  113



>ref|WP_019116882.1| ribose 5-phosphate isomerase [Anaerococcus sp. PH9]
Length=145

 Score = 52.8 bits (125),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 22/40 (55%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = +1

Query  1    IAANKFKGIRCVNCNDPYAALQGRQHENSNVLSMGCRVIG  120
            IAANK KGIR V C++PY+A   ++H N+N+L+ G RV+G
Sbjct  73   IAANKVKGIRAVVCSEPYSAKLSKEHNNTNILAFGSRVVG  112



>ref|WP_014227576.1| ribose 5-phosphate isomerase [Klebsiella oxytoca]
 ref|YP_005017669.1| ribose-5-phosphate isomerase B [Klebsiella oxytoca KCTC 1686]
 gb|AEX03430.1| ribose-5-phosphate isomerase B [Klebsiella oxytoca KCTC 1686]
 gb|AHW85811.1| ribose-5-phosphate isomerase B [Klebsiella oxytoca HKOPL1]
Length=149

 Score = 52.8 bits (125),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 23/40 (58%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = +1

Query  1    IAANKFKGIRCVNCNDPYAALQGRQHENSNVLSMGCRVIG  120
            IAANK  GIR V C++PY+A   RQH ++N+L+ G RVIG
Sbjct  74   IAANKHPGIRAVVCSEPYSAQLSRQHNDTNILAFGARVIG  113



>ref|WP_035582669.1| ribose 5-phosphate isomerase [Hyphomonas jannaschiana]
 gb|KCZ87778.1| ribose-5-phosphate isomerase [Hyphomonas jannaschiana VP2]
Length=149

 Score = 52.8 bits (125),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 24/41 (59%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    IAANKFKGIRCVNCNDPYAALQGRQHENSNVLSMGCRVIGE  123
            +AANK KGIRC  C+D ++A   RQH ++N+LS+G RVIGE
Sbjct  77   MAANKVKGIRCGVCSDTFSARMIRQHNDANMLSLGARVIGE  117



>ref|WP_007157414.1| ribose 5-phosphate isomerase [Oribacterium sinus]
 gb|EEJ50459.1| ribose-5-phosphate isomerase B [Oribacterium sinus F0268]
Length=156

 Score = 52.8 bits (125),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 22/40 (55%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = +1

Query  1    IAANKFKGIRCVNCNDPYAALQGRQHENSNVLSMGCRVIG  120
            +AANK  GIR   C++PY+A  GR+H N+NVL +G RV+G
Sbjct  75   LAANKVPGIRAFPCSEPYSAAMGRRHNNANVLCLGARVVG  114



>ref|WP_024360216.1| MULTISPECIES: ribose 5-phosphate isomerase [Klebsiella]
Length=149

 Score = 52.8 bits (125),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 23/40 (58%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = +1

Query  1    IAANKFKGIRCVNCNDPYAALQGRQHENSNVLSMGCRVIG  120
            IAANK  GIR V C++PY+A   RQH ++N+L+ G RVIG
Sbjct  74   IAANKHPGIRAVVCSEPYSAQLSRQHNDTNILAFGARVIG  113



>ref|WP_027320721.1| ribose 5-phosphate isomerase [Bacillus sp. URHB0009]
Length=150

 Score = 52.8 bits (125),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 23/40 (58%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = +1

Query  1    IAANKFKGIRCVNCNDPYAALQGRQHENSNVLSMGCRVIG  120
            +AANK +GIR V C+D Y A+  +QH NSN+LS+G RV+G
Sbjct  72   LAANKVEGIRAVVCSDCYTAVLSKQHNNSNILSLGSRVVG  111



>ref|WP_005806578.1| MULTISPECIES: ribose 5-phosphate isomerase [Candidatus Arthromitus]
 ref|YP_004771113.1| ribose 5-phosphate isomerase [Candidatus Arthromitus sp. SFB-mouse-Japan]
 ref|YP_005668272.1| ribose 5-phosphate isomerase B [Candidatus Arthromitus sp. SFB-mouse-Yit]
 dbj|BAK56371.1| ribose 5-phosphate isomerase [Candidatus Arthromitus sp. SFB-mouse-Japan]
 gb|EGX28952.1| ribose 5-phosphate isomerase B [Candidatus Arthromitus sp. SFB-mouse-NYU]
 dbj|BAK79696.1| ribose 5-phosphate isomerase B [Candidatus Arthromitus sp. SFB-mouse-Yit]
 gb|EIA21737.1| Ribose 5-phosphate isomerase b [Candidatus Arthromitus sp. SFB-1]
 gb|EIA26605.1| Ribose 5-phosphate isomerase b [Candidatus Arthromitus sp. SFB-4]
 gb|EIA27157.1| Ribose 5-phosphate isomerase b [Candidatus Arthromitus sp. SFB-co]
 gb|EIA30642.1| Ribose 5-phosphate isomerase b [Candidatus Arthromitus sp. SFB-mouse-SU]
 gb|AID44540.1| Ribose 5-phosphate isomerase B [Candidatus Arthromitus sp. SFB-mouse-NL]
Length=149

 Score = 52.4 bits (124),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 25/40 (63%), Positives = 29/40 (73%), Gaps = 0/40 (0%)
 Frame = +1

Query  1    IAANKFKGIRCVNCNDPYAALQGRQHENSNVLSMGCRVIG  120
            IAANK KGIR   CND ++A   RQH N+NVL +G RVIG
Sbjct  75   IAANKIKGIRAALCNDIFSARLARQHNNANVLVLGSRVIG  114



>ref|WP_020961515.1| ribose 5-phosphate isomerase [Geobacillus sp. JF8]
 ref|YP_008419309.1| ribose 5-phosphate isomerase [Geobacillus sp. JF8]
 gb|AGT33732.1| ribose 5-phosphate isomerase [Geobacillus sp. JF8]
Length=148

 Score = 52.4 bits (124),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 24/40 (60%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = +1

Query  1    IAANKFKGIRCVNCNDPYAALQGRQHENSNVLSMGCRVIG  120
            IAANK KG+RC  C+D Y+A   R H +SN+L+MG RVIG
Sbjct  73   IAANKVKGVRCALCHDVYSAKLTRMHNDSNILAMGERVIG  112



>ref|WP_021860151.1| ribose-5-phosphate isomerase B [Dorea sp. CAG:105]
 emb|CCX75697.1| ribose-5-phosphate isomerase B [Dorea sp. CAG:105]
Length=148

 Score = 52.4 bits (124),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 21/40 (53%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = +1

Query  1    IAANKFKGIRCVNCNDPYAALQGRQHENSNVLSMGCRVIG  120
            +AANK KG+R V C++PY+A   +QH N+N+L+ G RV+G
Sbjct  73   LAANKVKGVRAVVCSEPYSAKLSKQHNNTNILAFGARVVG  112



>emb|CDZ74679.1| ribose 5-phosphate isomerase B [Peptoniphilus sp. 1-1]
Length=149

 Score = 52.4 bits (124),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 21/41 (51%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    IAANKFKGIRCVNCNDPYAALQGRQHENSNVLSMGCRVIGE  123
            +AANK KGIR   C++PY A+   +H N+N+++MG RV+GE
Sbjct  73   LAANKIKGIRACVCSEPYTAMMSARHNNANIIAMGGRVVGE  113



>emb|CBX29543.1| Ribose-5-phosphate isomerase B [uncultured Desulfobacterium sp.]
Length=167

 Score = 52.8 bits (125),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 24/41 (59%), Positives = 29/41 (71%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    IAANKFKGIRCVNCNDPYAALQGRQHENSNVLSMGCRVIGE  123
            I AN+F  IR   CND ++A+  R+H NSNVL MG RVIGE
Sbjct  86   IVANRFSNIRAALCNDVFSAIISRKHNNSNVLVMGARVIGE  126



>ref|WP_036351991.1| ribose 5-phosphate isomerase [Microvirga lupini]
Length=149

 Score = 52.4 bits (124),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 24/41 (59%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    IAANKFKGIRCVNCNDPYAALQGRQHENSNVLSMGCRVIGE  123
            +AANK KGIRC  C D ++A   RQH ++N+LSMG RV+GE
Sbjct  77   MAANKVKGIRCGVCGDTFSARMIRQHNDANMLSMGVRVVGE  117



>ref|WP_004097854.1| MULTISPECIES: ribose 5-phosphate isomerase [Klebsiella]
 ref|YP_006496147.1| D-allose-6-phosphate isomerase [Klebsiella oxytoca E718]
 gb|EHS92048.1| ribose-5-phosphate isomerase B [Klebsiella oxytoca 10-5242]
 gb|AFN30271.1| D-allose-6-phosphate isomerase [Klebsiella oxytoca E718]
 gb|EJU31150.1| ribose-5-phosphate isomerase B [Klebsiella sp. OBRC7]
 gb|EUB34043.1| ribose-5-phosphate isomerase B [Klebsiella sp. AS10]
 gb|EWF92348.1| ribose-5-phosphate isomerase B [Klebsiella oxytoca MGH 27]
 gb|AID87896.1| ribose 5-phosphate isomerase [Klebsiella oxytoca KONIH1]
 gb|AIE68235.1| ribose 5-phosphate isomerase [Klebsiella oxytoca]
 gb|KFC42703.1| ribose 5-phosphate isomerase [Klebsiella oxytoca]
 gb|KGZ21011.1| ribose 5-phosphate isomerase [Klebsiella oxytoca]
Length=149

 Score = 52.4 bits (124),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 23/40 (58%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = +1

Query  1    IAANKFKGIRCVNCNDPYAALQGRQHENSNVLSMGCRVIG  120
            IAANK  GIR V C++PY+A   RQH ++N+L+ G RVIG
Sbjct  74   IAANKHPGIRAVVCSEPYSAQLSRQHNDTNILAFGARVIG  113



>pdb|2VVR|A Chain A, Crystal Structure Of The H99n Mutant Of Ribose-5-Phosphate 
Isomerase B From E. Coli Soaked With Ribose 5-Phosphate
 pdb|2VVR|B Chain B, Crystal Structure Of The H99n Mutant Of Ribose-5-Phosphate 
Isomerase B From E. Coli Soaked With Ribose 5-Phosphate
 pdb|2VVR|C Chain C, Crystal Structure Of The H99n Mutant Of Ribose-5-Phosphate 
Isomerase B From E. Coli Soaked With Ribose 5-Phosphate
 pdb|2VVR|D Chain D, Crystal Structure Of The H99n Mutant Of Ribose-5-Phosphate 
Isomerase B From E. Coli Soaked With Ribose 5-Phosphate
 pdb|2VVR|E Chain E, Crystal Structure Of The H99n Mutant Of Ribose-5-Phosphate 
Isomerase B From E. Coli Soaked With Ribose 5-Phosphate
 pdb|2VVR|F Chain F, Crystal Structure Of The H99n Mutant Of Ribose-5-Phosphate 
Isomerase B From E. Coli Soaked With Ribose 5-Phosphate
Length=149

 Score = 52.4 bits (124),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 23/40 (58%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = +1

Query  1    IAANKFKGIRCVNCNDPYAALQGRQHENSNVLSMGCRVIG  120
            IAANKF GIR V C++PY+A   RQ+ ++NVL+ G RV+G
Sbjct  74   IAANKFAGIRAVVCSEPYSAQLSRQNNDTNVLAFGSRVVG  113



>ref|WP_031605719.1| ribose 5-phosphate isomerase [Salmonella enterica]
 gb|EXX81307.1| ribose 5-phosphate isomerase [Salmonella enterica subsp. enterica 
serovar Namur str. 05-2929]
Length=149

 Score = 52.4 bits (124),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 23/40 (58%), Positives = 29/40 (73%), Gaps = 0/40 (0%)
 Frame = +1

Query  1    IAANKFKGIRCVNCNDPYAALQGRQHENSNVLSMGCRVIG  120
            I ANK  GIR V C++PY+A   RQH N+NVL+ G RV+G
Sbjct  74   ITANKVAGIRAVVCSEPYSAQLSRQHNNTNVLAFGSRVVG  113



>ref|WP_038225066.1| ribose 5-phosphate isomerase [Vibrio sp. ER1A]
 gb|KFA99340.1| ribose 5-phosphate isomerase [Vibrio sp. ER1A]
Length=150

 Score = 52.4 bits (124),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 22/40 (55%), Positives = 29/40 (73%), Gaps = 0/40 (0%)
 Frame = +1

Query  1    IAANKFKGIRCVNCNDPYAALQGRQHENSNVLSMGCRVIG  120
            +AANK  GIR V C+DPY A   R+H ++N+LS G RV+G
Sbjct  73   LAANKVPGIRAVVCSDPYTAQLSREHNDTNILSFGSRVVG  112



>dbj|GAL36353.1| ribose 5-phosphate isomerase B [Vibrio maritimus]
Length=150

 Score = 52.4 bits (124),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 22/40 (55%), Positives = 29/40 (73%), Gaps = 0/40 (0%)
 Frame = +1

Query  1    IAANKFKGIRCVNCNDPYAALQGRQHENSNVLSMGCRVIG  120
            +AANK  GIR V C+DPY A   R+H ++N+LS G RV+G
Sbjct  73   LAANKVPGIRAVVCSDPYTAQLSREHNDTNILSFGSRVVG  112



>ref|WP_033813725.1| ribose 5-phosphate isomerase [Escherichia coli]
Length=149

 Score = 52.4 bits (124),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 23/40 (58%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = +1

Query  1    IAANKFKGIRCVNCNDPYAALQGRQHENSNVLSMGCRVIG  120
            IAANKF  IR V C++PY+A   RQH ++NVL+ G RV+G
Sbjct  74   IAANKFARIRAVVCSEPYSAQLSRQHNDTNVLAFGSRVVG  113



>ref|WP_015907207.1| ribose 5-phosphate isomerase [Caldicellulosiruptor bescii]
 ref|YP_002572529.1| RpiB/LacA/LacB family sugar-phosphate isomerase [Caldicellulosiruptor 
bescii DSM 6725]
 gb|ACM59756.1| sugar-phosphate isomerase, RpiB/LacA/LacB family [Caldicellulosiruptor 
bescii DSM 6725]
Length=148

 Score = 52.4 bits (124),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 23/41 (56%), Positives = 30/41 (73%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    IAANKFKGIRCVNCNDPYAALQGRQHENSNVLSMGCRVIGE  123
            IAANK +GIR   C+D ++A   R H N+N+L+MG RVIGE
Sbjct  73   IAANKVRGIRAALCHDTFSAKAARAHNNANILAMGARVIGE  113



>ref|WP_001545120.1| ribose-5-phosphate isomerase B [Escherichia coli]
 gb|ELD29306.1| ribose-5-phosphate isomerase B [Escherichia coli KTE213]
 gb|ELG77532.1| ribose-5-phosphate isomerase B [Escherichia coli KTE140]
 gb|ELJ78846.1| ribose-5-phosphate isomerase B [Escherichia coli KTE95]
 gb|KDU03050.1| ribose 5-phosphate isomerase B [Escherichia coli 3-267-03_S1_C2]
 gb|KDY08463.1| ribose 5-phosphate isomerase B [Escherichia coli 2-316-03_S4_C1]
Length=149

 Score = 52.4 bits (124),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 23/40 (58%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = +1

Query  1    IAANKFKGIRCVNCNDPYAALQGRQHENSNVLSMGCRVIG  120
            IAANKF  IR V C++PY+A   RQH ++NVL+ G RV+G
Sbjct  74   IAANKFARIRAVVCSEPYSAQLSRQHNDTNVLAFGSRVVG  113



>ref|WP_013430912.1| ribose 5-phosphate isomerase [Caldicellulosiruptor kronotskyensis]
 ref|YP_004024657.1| sugar-phosphate isomerase, rpib/laca/lacb family [Caldicellulosiruptor 
kronotskyensis 2002]
 gb|ADQ46838.1| sugar-phosphate isomerase, RpiB/LacA/LacB family [Caldicellulosiruptor 
kronotskyensis 2002]
Length=148

 Score = 52.4 bits (124),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 23/41 (56%), Positives = 30/41 (73%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    IAANKFKGIRCVNCNDPYAALQGRQHENSNVLSMGCRVIGE  123
            IAANK +GIR   C+D ++A   R H N+N+L+MG RVIGE
Sbjct  73   IAANKVRGIRAALCHDTFSAKAARAHNNANILAMGARVIGE  113



>ref|WP_005021654.1| ribose 5-phosphate isomerase [Helicobacter pullorum]
 gb|EEQ63343.1| ribose-5-phosphate isomerase B [Helicobacter pullorum MIT 98-5489]
Length=141

 Score = 52.4 bits (124),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 23/40 (58%), Positives = 29/40 (73%), Gaps = 0/40 (0%)
 Frame = +1

Query  1    IAANKFKGIRCVNCNDPYAALQGRQHENSNVLSMGCRVIG  120
            IAAN+ KGIR   CN+PY A+  R H ++NVL +G RVIG
Sbjct  73   IAANRHKGIRAALCNEPYGAMMARAHNDANVLCLGARVIG  112



>ref|WP_014452969.1| ribose 5-phosphate isomerase [Caldisericum exile]
 ref|YP_005472666.1| ribose-5-phosphate isomerase B [Caldisericum exile AZM16c01]
 dbj|BAL80563.1| ribose-5-phosphate isomerase B [Caldisericum exile AZM16c01]
Length=146

 Score = 52.4 bits (124),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 25/41 (61%), Positives = 29/41 (71%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    IAANKFKGIRCVNCNDPYAALQGRQHENSNVLSMGCRVIGE  123
            IAANK KGIR   CND Y A   R+H N+NVL MG RV+G+
Sbjct  73   IAANKVKGIRASLCNDLYTAHASREHNNANVLCMGGRVVGD  113



>ref|WP_021771729.1| ribose-5-phosphate isomerase B [Mitsuokella sp. oral taxon 131]
 gb|ERL25354.1| ribose-5-phosphate isomerase B [Mitsuokella sp. oral taxon 131 
str. W9106]
Length=158

 Score = 52.4 bits (124),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = +1

Query  1    IAANKFKGIRCVNCNDPYAALQGRQHENSNVLSMGCRVIG  120
            IAANK  GIRC  C+D Y+A + R H ++NVL+MG RVIG
Sbjct  74   IAANKVAGIRCALCHDVYSAKKARAHNDANVLAMGGRVIG  113



>ref|WP_031494670.1| ribose 5-phosphate isomerase [Vibrio shilonii]
Length=150

 Score = 52.4 bits (124),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 22/40 (55%), Positives = 29/40 (73%), Gaps = 0/40 (0%)
 Frame = +1

Query  1    IAANKFKGIRCVNCNDPYAALQGRQHENSNVLSMGCRVIG  120
            +AANK  GIR V C+DPY A   R+H ++N+LS G RV+G
Sbjct  73   LAANKVPGIRAVVCSDPYTAQLSREHNDTNILSFGSRVVG  112



>ref|WP_017549616.1| hypothetical protein [Salinicoccus carnicancri]
Length=142

 Score = 52.4 bits (124),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 25/40 (63%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = +1

Query  1    IAANKFKGIRCVNCNDPYAALQGRQHENSNVLSMGCRVIG  120
            IAANK KGIRC   +D ++A   RQH NSN+L+MG RVIG
Sbjct  73   IAANKVKGIRCALVHDSFSAKATRQHNNSNMLAMGERVIG  112



>ref|WP_009354095.1| ribose 5-phosphate isomerase [Veillonella sp. oral taxon 780]
 gb|EGS32681.1| ribose-5-phosphate isomerase B [Veillonella sp. oral taxon 780 
str. F0422]
Length=145

 Score = 52.4 bits (124),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 23/41 (56%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    IAANKFKGIRCVNCNDPYAALQGRQHENSNVLSMGCRVIGE  123
            IAANK KG+R   C+D ++A   R+H N+NVL+MG RVIG+
Sbjct  73   IAANKVKGVRAALCHDTFSAHASREHNNANVLTMGERVIGQ  113



>ref|WP_019554288.1| ribose 5-phosphate isomerase [Zymophilus raffinosivorans]
Length=147

 Score = 52.4 bits (124),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 24/40 (60%), Positives = 28/40 (70%), Gaps = 0/40 (0%)
 Frame = +1

Query  1    IAANKFKGIRCVNCNDPYAALQGRQHENSNVLSMGCRVIG  120
            IAANK KGIR   C D Y+A   R+H N+NVL+MG RV G
Sbjct  74   IAANKIKGIRAALCTDVYSAKMSREHNNANVLAMGGRVTG  113



>ref|WP_013146610.1| ribose 5-phosphate isomerase [Geobacillus sp. C56-T3]
 ref|YP_003672845.1| RpiB/LacA/LacB family sugar-phosphate isomerase [Geobacillus 
sp. C56-T3]
 gb|ADI28268.1| sugar-phosphate isomerase, RpiB/LacA/LacB family [Geobacillus 
sp. C56-T3]
Length=149

 Score = 52.4 bits (124),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 24/40 (60%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = +1

Query  1    IAANKFKGIRCVNCNDPYAALQGRQHENSNVLSMGCRVIG  120
            IAANK KG+RC  C+D Y+A   R H +SN+L+MG RVIG
Sbjct  74   IAANKVKGVRCALCHDVYSAKLTRMHNDSNILAMGERVIG  113



>ref|WP_033020509.1| ribose 5-phosphate isomerase [Geobacillus sp. G1w1]
 gb|KFX33095.1| ribose 5-phosphate isomerase [Geobacillus sp. G1w1]
Length=150

 Score = 52.4 bits (124),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 24/40 (60%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = +1

Query  1    IAANKFKGIRCVNCNDPYAALQGRQHENSNVLSMGCRVIG  120
            IAANK KG+RC  C+D Y+A   R H +SN+L+MG RVIG
Sbjct  73   IAANKVKGVRCALCHDVYSAKLTRMHNDSNILAMGERVIG  112



>ref|WP_013524810.1| MULTISPECIES: ribose 5-phosphate isomerase [Geobacillus]
 ref|YP_003254457.1| ribose-5-phosphate isomerase B [Geobacillus sp. Y412MC61]
 ref|YP_004133946.1| RpiB/LacA/LacB family sugar-phosphate isomerase [Geobacillus 
sp. Y412MC52]
 ref|YP_007403706.1| sugar phosphate isomerase [Geobacillus sp. GHH01]
 gb|ACX79975.1| sugar-phosphate isomerase, RpiB/LacA/LacB family [Geobacillus 
sp. Y412MC61]
 gb|ADU95803.1| sugar-phosphate isomerase, RpiB/LacA/LacB family [Geobacillus 
sp. Y412MC52]
 gb|AGE23955.1| sugar phosphate isomerase [Geobacillus sp. GHH01]
Length=149

 Score = 52.4 bits (124),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 24/40 (60%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = +1

Query  1    IAANKFKGIRCVNCNDPYAALQGRQHENSNVLSMGCRVIG  120
            IAANK KG+RC  C+D Y+A   R H +SN+L+MG RVIG
Sbjct  74   IAANKVKGVRCALCHDVYSAKLTRMHNDSNILAMGERVIG  113



>ref|WP_013403883.1| ribose 5-phosphate isomerase [Caldicellulosiruptor hydrothermalis]
 ref|YP_003993103.1| sugar-phosphate isomerase, rpib/laca/lacb family [Caldicellulosiruptor 
hydrothermalis 108]
 gb|ADQ07734.1| sugar-phosphate isomerase, RpiB/LacA/LacB family [Caldicellulosiruptor 
hydrothermalis 108]
Length=148

 Score = 52.4 bits (124),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 23/41 (56%), Positives = 30/41 (73%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    IAANKFKGIRCVNCNDPYAALQGRQHENSNVLSMGCRVIGE  123
            IAANK +GIR   C+D ++A   R H N+N+L+MG RVIGE
Sbjct  73   IAANKVRGIRAALCHDTFSAKAARAHNNANILAMGARVIGE  113



>ref|WP_025949616.1| MULTISPECIES: ribose 5-phosphate isomerase [Geobacillus]
Length=148

 Score = 52.4 bits (124),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 24/40 (60%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = +1

Query  1    IAANKFKGIRCVNCNDPYAALQGRQHENSNVLSMGCRVIG  120
            IAANK KG+RC  C+D Y+A   R H +SN+L+MG RVIG
Sbjct  73   IAANKVKGVRCALCHDVYSAKLTRMHNDSNILAMGERVIG  112



>ref|WP_008880705.1| MULTISPECIES: ribose 5-phosphate isomerase [Geobacillus]
 gb|EDY05404.1| sugar-phosphate isomerase, RpiB/LacA/LacB family [Geobacillus 
sp. G11MC16]
Length=148

 Score = 52.4 bits (124),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 24/40 (60%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = +1

Query  1    IAANKFKGIRCVNCNDPYAALQGRQHENSNVLSMGCRVIG  120
            IAANK KG+RC  C+D Y+A   R H +SN+L+MG RVIG
Sbjct  73   IAANKVKGVRCALCHDVYSAKLTRMHNDSNILAMGERVIG  112



>ref|WP_023633289.1| MULTISPECIES: ribose 5-phosphate isomerase [Geobacillus]
 gb|ESU73824.1| ribose 5-phosphate isomerase [Geobacillus sp. MAS1]
 gb|KDE45901.1| ribose 5-phosphate isomerase [Geobacillus sp. CAMR12739]
Length=148

 Score = 52.4 bits (124),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 24/40 (60%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = +1

Query  1    IAANKFKGIRCVNCNDPYAALQGRQHENSNVLSMGCRVIG  120
            IAANK KG+RC  C+D Y+A   R H +SN+L+MG RVIG
Sbjct  73   IAANKVKGVRCALCHDVYSAKLTRMHNDSNILAMGERVIG  112



>ref|WP_026928178.1| ribose 5-phosphate isomerase [Granulicoccus phenolivorans]
Length=149

 Score = 52.4 bits (124),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 22/40 (55%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = +1

Query  1    IAANKFKGIRCVNCNDPYAALQGRQHENSNVLSMGCRVIG  120
            IAANK  G RCV C +PY+A  GR+H N+N+L++G R +G
Sbjct  73   IAANKVPGARCVVCTEPYSAQMGRRHNNANMLALGERFVG  112



>ref|WP_014196954.1| ribose 5-phosphate isomerase [Geobacillus thermoleovorans]
 ref|YP_004984184.1| ribose 5-phosphate isomerase [Geobacillus thermoleovorans CCB_US3_UF5]
 gb|AEV21084.1| Ribose 5-phosphate isomerase [Geobacillus thermoleovorans CCB_US3_UF5]
 dbj|GAJ57168.1| ribose-5-phosphate isomerase B [Geobacillus thermoleovorans B23]
Length=149

 Score = 52.4 bits (124),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 24/40 (60%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = +1

Query  1    IAANKFKGIRCVNCNDPYAALQGRQHENSNVLSMGCRVIG  120
            IAANK KG+RC  C+D Y+A   R H +SN+L+MG RVIG
Sbjct  74   IAANKVKGVRCALCHDVYSAKLTRMHNDSNILAMGERVIG  113



>ref|WP_033842868.1| ribose 5-phosphate isomerase [Geobacillus subterraneus]
Length=150

 Score = 52.4 bits (124),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 24/40 (60%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = +1

Query  1    IAANKFKGIRCVNCNDPYAALQGRQHENSNVLSMGCRVIG  120
            IAANK KG+RC  C+D Y+A   R H +SN+L+MG RVIG
Sbjct  73   IAANKVKGVRCALCHDVYSAKLTRMHNDSNILAMGERVIG  112



>ref|WP_003721856.1| ribose 5-phosphate isomerase [Listeria monocytogenes]
 ref|NP_464263.1| ribose-5-phosphate isomerase B [Listeria monocytogenes EGD-e]
 ref|YP_005961869.1| ribose 5-phosphate isomerase B [Listeria monocytogenes 10403S]
 ref|YP_005964729.1| ribose 5-phosphate isomerase B [Listeria monocytogenes J0161]
 ref|YP_005967654.1| sugar-phosphate isomerase [Listeria monocytogenes FSL R2-561]
 ref|YP_005970559.1| ribose 5-phosphate isomerase B [Listeria monocytogenes Finland 
1998]
 ref|YP_006684074.1| ribose-5-phosphate isomerase B [Listeria monocytogenes SLCC2372]
 ref|YP_006695566.1| ribose-5-phosphate isomerase B [Listeria monocytogenes SLCC5850]
 ref|YP_006698408.1| ribose-5-phosphate isomerase B [Listeria monocytogenes SLCC7179]
 ref|YP_006687008.1| ribose-5-phosphate isomerase B [Listeria monocytogenes SLCC2479]
 ref|YP_007602996.1| Ribose-5-phosphate isomerase B [Listeria monocytogenes]
 ref|YP_007606129.1| Ribose-5-phosphate isomerase B [Listeria monocytogenes N53-1]
 ref|YP_008271133.1| ribose 5-phosphate isomerase [Listeria monocytogenes]
 ref|YP_008666405.1| D-allose-6-phosphate isomerase [Listeria monocytogenes EGD]
 emb|CAC98814.1| lmo0736 [Listeria monocytogenes EGD-e]
 gb|EAL07294.1| sugar-phosphate isomerases, RpiB/LacA/LacB family subfamily [Listeria 
monocytogenes str. 1/2a F6854]
 gb|EEW14557.1| sugar-phosphate isomerase [Listeria monocytogenes FSL N3-165]
 gb|EEW20938.1| sugar-phosphate isomerase [Listeria monocytogenes F6900]
 gb|EFF97695.1| sugar-phosphate isomerase [Listeria monocytogenes J2818]
 gb|AEO02829.1| ribose 5-phosphate isomerase B [Listeria monocytogenes J0161]
 gb|AEO05738.1| ribose 5-phosphate isomerase B [Listeria monocytogenes 10403S]
 gb|AEO25034.1| sugar-phosphate isomerase [Listeria monocytogenes FSL R2-561]
 gb|AEO38277.1| ribose 5-phosphate isomerase B [Listeria monocytogenes Finland 
1998]
 gb|AEV92933.1| ribose-5-phosphate isomerase B [Listeria monocytogenes]
 gb|AEV92944.1| ribose-5-phosphate isomerase B [Listeria monocytogenes]
 emb|CBY51208.1| ribose-5-phosphate isomerase B [Listeria monocytogenes SLCC5850]
 emb|CBY54082.1| ribose-5-phosphate isomerase B [Listeria monocytogenes SLCC2372]
 emb|CBY57016.1| ribose-5-phosphate isomerase B [Listeria monocytogenes SLCC2479]
 emb|CBY59921.1| ribose-5-phosphate isomerase B [Listeria monocytogenes SLCC7179]
 emb|CCQ20082.1| Ribose-5-phosphate isomerase B [Listeria monocytogenes]
 emb|CCQ23215.1| Ribose-5-phosphate isomerase B [Listeria monocytogenes N53-1]
 gb|AGR00643.1| ribose 5-phosphate isomerase [Listeria monocytogenes]
 gb|ERH75202.1| ribose 5-phosphate isomerase [Listeria monocytogenes serotype 
4bV str. LS645]
 gb|ERH75876.1| ribose 5-phosphate isomerase [Listeria monocytogenes serotype 
4bV str. LS642]
 gb|ERH85174.1| ribose 5-phosphate isomerase [Listeria monocytogenes serotype 
4bV str. LS644]
 gb|ERH85813.1| ribose 5-phosphate isomerase [Listeria monocytogenes serotype 
4bV str. LS542]
 gb|ERH86122.1| ribose 5-phosphate isomerase [Listeria monocytogenes serotype 
4bV str. LS643]
 emb|CDG44603.1| D-allose-6-phosphate isomerase [Listeria monocytogenes EGD]
 gb|EUJ19114.1| ribose-5-phosphate isomerase B [Listeria monocytogenes FSL F6-684]
 emb|CDM19311.1| ribose 5-phosphate isomerase B/allose 6-phosphate isomerase [Listeria 
monocytogenes 6179]
 gb|AHJ05235.1| ribose 5-phosphate isomerase [Listeria monocytogenes WSLC1001]
 gb|EXL14333.1| Ribose-5-phosphate isomerase B [Listeria monocytogenes Lm_1840]
 gb|EXL25866.1| Ribose-5-phosphate isomerase B [Listeria monocytogenes Lm_1880]
 emb|CDK31952.1| ribose 5-phosphate isomerase B/allose 6-phosphate isomerase [Listeria 
monocytogenes QOC2]
 emb|CDK42081.1| ribose 5-phosphate isomerase B/allose 6-phosphate isomerase [Listeria 
monocytogenes QOC1]
 gb|EZH69689.1| ribose 5-phosphate isomerase [Listeria monocytogenes N53-1]
 emb|CDN69184.1| ribose 5-phosphate isomerase B/allose 6-phosphate isomerase [Listeria 
monocytogenes 4423]
 gb|KEU37790.1| ribose 5-phosphate isomerase [Listeria monocytogenes]
 gb|KEV42416.1| ribose 5-phosphate isomerase [Listeria monocytogenes]
 gb|KEX87072.1| ribose 5-phosphate isomerase [Listeria monocytogenes]
 gb|KFL18812.1| ribose 5-phosphate isomerase B [Listeria monocytogenes FSL F6-684]
 gb|KHK13349.1| ribose-5-phosphate isomerase B [Listeria monocytogenes SHL001]
 gb|KHK15888.1| ribose-5-phosphate isomerase B [Listeria monocytogenes SHL005]
 gb|KHK19680.1| ribose-5-phosphate isomerase B [Listeria monocytogenes SHL006]
 gb|KHK28764.1| ribose-5-phosphate isomerase B [Listeria monocytogenes SHL009]
 gb|KHK30243.1| ribose-5-phosphate isomerase B [Listeria monocytogenes SHL011]
 gb|KHK36963.1| ribose-5-phosphate isomerase B [Listeria monocytogenes SHL013]
 gb|KID13291.1| ribose 5-phosphate isomerase [Listeria monocytogenes]
 gb|KID16258.1| ribose 5-phosphate isomerase [Listeria monocytogenes]
 gb|KID17885.1| ribose 5-phosphate isomerase [Listeria monocytogenes]
 gb|KID23551.1| ribose 5-phosphate isomerase [Listeria monocytogenes]
 gb|KID24632.1| ribose 5-phosphate isomerase [Listeria monocytogenes]
Length=148

 Score = 52.4 bits (124),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 22/40 (55%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = +1

Query  1    IAANKFKGIRCVNCNDPYAALQGRQHENSNVLSMGCRVIG  120
            IAANK  GIR V C++PY+A   R+H N+N+L+ G RV+G
Sbjct  73   IAANKVNGIRAVVCSEPYSAKLSREHNNTNILAFGSRVVG  112



>ref|WP_011232838.1| MULTISPECIES: ribose 5-phosphate isomerase [Geobacillus]
 ref|YP_149224.1| ribose-5-phosphate isomerase B [Geobacillus kaustophilus HTA426]
 dbj|BAD77656.1| ribose 5-phosphate isomerase [Geobacillus kaustophilus HTA426]
 dbj|GAD12910.1| ribose-5-phosphate isomerase B [Geobacillus kaustophilus GBlys]
Length=148

 Score = 52.4 bits (124),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 24/40 (60%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = +1

Query  1    IAANKFKGIRCVNCNDPYAALQGRQHENSNVLSMGCRVIG  120
            IAANK KG+RC  C+D Y+A   R H +SN+L+MG RVIG
Sbjct  73   IAANKVKGVRCALCHDVYSAKLTRMHNDSNILAMGERVIG  112



>ref|WP_010763713.1| ribose 5-phosphate isomerase B [Enterococcus moraviensis]
 gb|EOI06948.1| ribose 5-phosphate isomerase B [Enterococcus moraviensis ATCC 
BAA-383]
 gb|EOT65290.1| ribose 5-phosphate isomerase B [Enterococcus moraviensis ATCC 
BAA-383]
Length=145

 Score = 52.4 bits (124),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 20/40 (50%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = +1

Query  1    IAANKFKGIRCVNCNDPYAALQGRQHENSNVLSMGCRVIG  120
            I+ANK  GIR V C++PY+A+  ++H N+N+L+ G RV+G
Sbjct  73   ISANKVNGIRAVVCSEPYSAILSKEHNNTNILAFGSRVVG  112



>ref|WP_020004716.1| ribose 5-phosphate isomerase [Brachyspira innocens]
Length=149

 Score = 52.4 bits (124),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 21/40 (53%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = +1

Query  1    IAANKFKGIRCVNCNDPYAALQGRQHENSNVLSMGCRVIG  120
            +AANK KGIR   C++PY+A   +QH NSN+++ G RV+G
Sbjct  73   LAANKVKGIRAAVCSEPYSAKLSKQHNNSNIIAFGARVVG  112



>ref|WP_033024472.1| ribose 5-phosphate isomerase [Geobacillus sp. CAMR5420]
 gb|KDE50613.1| ribose 5-phosphate isomerase [Geobacillus sp. CAMR5420]
Length=148

 Score = 52.4 bits (124),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 24/40 (60%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = +1

Query  1    IAANKFKGIRCVNCNDPYAALQGRQHENSNVLSMGCRVIG  120
            IAANK KG+RC  C+D Y+A   R H +SN+L+MG RVIG
Sbjct  73   IAANKVKGVRCALCHDVYSAKLTRMHNDSNILAMGERVIG  112



>ref|WP_012951359.1| ribose 5-phosphate isomerase [Listeria monocytogenes]
 ref|YP_003412932.1| ribose-5-phosphate isomerase B [Listeria monocytogenes 08-5578]
 ref|YP_003415977.1| ribose-5-phosphate isomerase B [Listeria monocytogenes 08-5923]
 ref|YP_008297348.1| ribose 5-phosphate isomerase [Listeria monocytogenes]
 gb|ADB67570.1| ribose-5-phosphate isomerase B [Listeria monocytogenes 08-5578]
 gb|ADB70615.1| ribose-5-phosphate isomerase B [Listeria monocytogenes 08-5923]
 gb|AGR09434.1| ribose 5-phosphate isomerase [Listeria monocytogenes]
 gb|EXL15805.1| ribose-5-phosphate isomerase B [Listeria monocytogenes Lm_1823]
 gb|EXL20814.1| ribose-5-phosphate isomerase B [Listeria monocytogenes Lm_1889]
 emb|CDM15977.1| Ribose-5-phosphate isomerase B [Listeria monocytogenes R479a]
 gb|KEK04265.1| ribose 5-phosphate isomerase [Listeria monocytogenes]
 gb|KEK06258.1| ribose 5-phosphate isomerase [Listeria monocytogenes]
 gb|KES32534.1| ribose 5-phosphate isomerase [Listeria monocytogenes]
 gb|KES39259.1| ribose 5-phosphate isomerase [Listeria monocytogenes]
 gb|KEU55993.1| ribose 5-phosphate isomerase [Listeria monocytogenes]
 gb|KEX17115.1| ribose 5-phosphate isomerase [Listeria monocytogenes]
 gb|KEX35941.1| ribose 5-phosphate isomerase [Listeria monocytogenes]
 gb|KEX48752.1| ribose 5-phosphate isomerase [Listeria monocytogenes]
 gb|KEX51684.1| ribose 5-phosphate isomerase [Listeria monocytogenes]
 gb|AIL67462.1| ribose 5-phosphate isomerase [Listeria monocytogenes]
 gb|KHK07918.1| ribose-5-phosphate isomerase B [Listeria monocytogenes SHL004]
 gb|KHS59418.1| ribose 5-phosphate isomerase [Listeria monocytogenes]
 gb|KHS61872.1| ribose 5-phosphate isomerase [Listeria monocytogenes]
Length=148

 Score = 52.4 bits (124),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 22/40 (55%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = +1

Query  1    IAANKFKGIRCVNCNDPYAALQGRQHENSNVLSMGCRVIG  120
            IAANK  GIR V C++PY+A   R+H N+N+L+ G RV+G
Sbjct  73   IAANKVNGIRAVVCSEPYSAKLSREHNNTNILAFGSRVVG  112



>ref|WP_021959711.1| ribose 5-phosphate isomerase B [Brachyspira sp. CAG:700]
 emb|CCY77728.1| ribose 5-phosphate isomerase B [Brachyspira sp. CAG:700]
Length=149

 Score = 52.4 bits (124),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 21/40 (53%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = +1

Query  1    IAANKFKGIRCVNCNDPYAALQGRQHENSNVLSMGCRVIG  120
            +AANK KGIR   C++PY+A   +QH NSN+++ G RV+G
Sbjct  73   LAANKVKGIRAAVCSEPYSAKLSKQHNNSNIIAFGARVVG  112



>ref|WP_014879618.1| ribose 5-phosphate isomerase [Phaeobacter gallaeciensis]
 ref|YP_006572511.1| ribose-5-phosphate isomerase B [Phaeobacter inhibens DSM 17395]
 gb|AFO90792.1| ribose-5-phosphate isomerase B [Phaeobacter inhibens DSM 17395]
Length=151

 Score = 52.4 bits (124),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 23/41 (56%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    IAANKFKGIRCVNCNDPYAALQGRQHENSNVLSMGCRVIGE  123
            +AANK KGIRC  C+D ++A   RQH N+N+LS+G RV+G+
Sbjct  79   MAANKVKGIRCGVCSDTFSAKMIRQHNNANMLSIGARVVGD  119



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 516678285084