BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c60648_g1_i1 len=146 path=[124:0-145]

Length=146
                                                                      Score     E

gb|ABG37663.1|  CCHC-type integrase                                   71.6    1e-12   Populus trichocarpa [western balsam poplar]
ref|XP_007134258.1|  hypothetical protein PHAVU_010G032000g           65.5    1e-10   
ref|XP_008350876.1|  PREDICTED: G-type lectin S-receptor-like ser...  63.2    8e-10   
ref|XP_011013447.1|  PREDICTED: G-type lectin S-receptor-like ser...  62.8    9e-10   
ref|XP_008354967.1|  PREDICTED: G-type lectin S-receptor-like ser...  62.8    1e-09   
ref|XP_006386079.1|  hypothetical protein POPTR_0003s21910g           62.8    1e-09   
ref|XP_011025239.1|  PREDICTED: G-type lectin S-receptor-like ser...  62.4    1e-09   
ref|XP_011025240.1|  PREDICTED: G-type lectin S-receptor-like ser...  62.4    1e-09   
ref|XP_006354210.1|  PREDICTED: G-type lectin S-receptor-like ser...  62.0    2e-09   
gb|KDP20397.1|  hypothetical protein JCGZ_05280                       61.6    2e-09   
gb|KDO56486.1|  hypothetical protein CISIN_1g037189mg                 61.6    3e-09   
ref|XP_006386082.1|  hypothetical protein POPTR_0003s21940g           61.2    3e-09   
ref|XP_008363356.1|  PREDICTED: G-type lectin S-receptor-like ser...  61.2    4e-09   
ref|XP_009802537.1|  PREDICTED: G-type lectin S-receptor-like ser...  60.8    5e-09   
ref|XP_008231373.1|  PREDICTED: G-type lectin S-receptor-like ser...  59.7    7e-09   
ref|XP_006369448.1|  hypothetical protein POPTR_0001s23530g           60.1    7e-09   
ref|XP_008231371.1|  PREDICTED: G-type lectin S-receptor-like ser...  60.1    8e-09   
gb|KDP25138.1|  hypothetical protein JCGZ_22673                       60.1    8e-09   
ref|XP_006494292.1|  PREDICTED: G-type lectin S-receptor-like ser...  59.7    2e-08   
gb|KDO56484.1|  hypothetical protein CISIN_1g042262mg                 59.3    2e-08   
ref|XP_006445948.1|  hypothetical protein CICLE_v10017506mg           59.3    2e-08   
ref|XP_007014864.1|  CCHC-type integrase, putative                    59.3    2e-08   
ref|XP_009621260.1|  PREDICTED: G-type lectin S-receptor-like ser...  58.5    2e-08   
ref|XP_008231372.1|  PREDICTED: G-type lectin S-receptor-like ser...  58.9    2e-08   
ref|XP_009588962.1|  PREDICTED: G-type lectin S-receptor-like ser...  58.9    2e-08   
ref|XP_009588963.1|  PREDICTED: G-type lectin S-receptor-like ser...  58.9    2e-08   
gb|AET01339.2|  G-type lectin S-receptor-like Serine/Threonine-ki...  58.5    3e-08   
ref|XP_003626863.1|  Kinase-like protein                              58.5    4e-08   
ref|XP_010673560.1|  PREDICTED: G-type lectin S-receptor-like ser...  58.2    4e-08   
ref|XP_006361291.1|  PREDICTED: G-type lectin S-receptor-like ser...  57.4    4e-08   
ref|XP_008231374.1|  PREDICTED: G-type lectin S-receptor-like ser...  57.8    5e-08   
ref|XP_010547742.1|  PREDICTED: G-type lectin S-receptor-like ser...  57.8    6e-08   
ref|XP_003626867.1|  Kinase-like protein                              57.8    6e-08   
ref|XP_006386078.1|  hypothetical protein POPTR_0003s21900g           57.4    8e-08   
gb|KCW85884.1|  hypothetical protein EUGRSUZ_B02606                   57.4    8e-08   
ref|XP_010046456.1|  PREDICTED: G-type lectin S-receptor-like ser...  57.4    8e-08   
ref|XP_009374910.1|  PREDICTED: G-type lectin S-receptor-like ser...  57.0    1e-07   
ref|XP_004308204.1|  PREDICTED: G-type lectin S-receptor-like ser...  56.6    1e-07   
ref|XP_010265874.1|  PREDICTED: G-type lectin S-receptor-like ser...  56.6    1e-07   
ref|XP_006354209.1|  PREDICTED: G-type lectin S-receptor-like ser...  56.2    2e-07   
ref|XP_010265867.1|  PREDICTED: G-type lectin S-receptor-like ser...  56.2    2e-07   
ref|XP_008243608.1|  PREDICTED: G-type lectin S-receptor-like ser...  55.8    2e-07   
gb|KCW85883.1|  hypothetical protein EUGRSUZ_B02605                   56.2    2e-07   
gb|KCW45166.1|  hypothetical protein EUGRSUZ_L01215                   56.2    2e-07   
ref|XP_010040493.1|  PREDICTED: G-type lectin S-receptor-like ser...  56.2    2e-07   
ref|XP_010043873.1|  PREDICTED: G-type lectin S-receptor-like ser...  56.2    2e-07   
ref|XP_004228922.1|  PREDICTED: G-type lectin S-receptor-like ser...  56.2    2e-07   
ref|XP_008243607.1|  PREDICTED: G-type lectin S-receptor-like ser...  55.8    2e-07   
ref|XP_006494291.1|  PREDICTED: G-type lectin S-receptor-like ser...  55.8    3e-07   
gb|KDO56480.1|  hypothetical protein CISIN_1g045343mg                 55.8    3e-07   
ref|XP_009766762.1|  PREDICTED: G-type lectin S-receptor-like ser...  55.1    3e-07   
ref|XP_006445946.1|  hypothetical protein CICLE_v10017810mg           55.5    3e-07   
ref|XP_010042853.1|  PREDICTED: G-type lectin S-receptor-like ser...  54.7    3e-07   
ref|XP_008451127.1|  PREDICTED: G-type lectin S-receptor-like ser...  55.5    4e-07   
ref|XP_006361290.1|  PREDICTED: G-type lectin S-receptor-like ser...  55.1    5e-07   
ref|XP_010265870.1|  PREDICTED: G-type lectin S-receptor-like ser...  54.7    6e-07   
gb|KHN23696.1|  G-type lectin S-receptor-like serine/threonine-pr...  54.7    6e-07   
ref|XP_003545892.1|  PREDICTED: G-type lectin S-receptor-like ser...  54.7    7e-07   
ref|XP_007014867.1|  CCHC-type integrase, putative                    54.7    7e-07   
ref|XP_010043872.1|  PREDICTED: G-type lectin S-receptor-like ser...  54.3    8e-07   
ref|XP_009621259.1|  PREDICTED: G-type lectin S-receptor-like ser...  54.3    8e-07   
ref|XP_008348731.1|  PREDICTED: G-type lectin S-receptor-like ser...  54.3    9e-07   
ref|XP_008344689.1|  PREDICTED: G-type lectin S-receptor-like ser...  54.3    9e-07   
ref|XP_007014871.1|  Receptor protein kinase 1                        54.3    1e-06   
ref|XP_006354207.1|  PREDICTED: G-type lectin S-receptor-like ser...  53.9    1e-06   
ref|XP_006282444.1|  hypothetical protein CARUB_v10004135mg           53.5    1e-06   
ref|XP_004228923.1|  PREDICTED: G-type lectin S-receptor-like ser...  53.5    2e-06   
ref|XP_008243606.1|  PREDICTED: G-type lectin S-receptor-like ser...  53.5    2e-06   
ref|XP_003626869.1|  Receptor-like protein kinase                     53.5    2e-06   
ref|XP_004154672.1|  PREDICTED: G-type lectin S-receptor-like ser...  53.1    2e-06   
ref|XP_004149036.1|  PREDICTED: G-type lectin S-receptor-like ser...  53.1    2e-06   
emb|CDP14422.1|  unnamed protein product                              53.1    2e-06   
ref|XP_007014873.1|  Receptor-like protein kinase 1                   53.5    2e-06   
ref|XP_004309464.1|  PREDICTED: G-type lectin S-receptor-like ser...  52.8    3e-06   
gb|KCW45168.1|  hypothetical protein EUGRSUZ_L012161                  52.4    3e-06   
ref|XP_010040494.1|  PREDICTED: G-type lectin S-receptor-like ser...  52.8    3e-06   
ref|XP_008355015.1|  PREDICTED: G-type lectin S-receptor-like ser...  52.4    3e-06   
ref|XP_006445954.1|  hypothetical protein CICLE_v10014312mg           52.8    3e-06   
ref|XP_006494281.1|  PREDICTED: G-type lectin S-receptor-like ser...  52.8    3e-06   
gb|KDO56493.1|  hypothetical protein CISIN_1g047263mg                 52.8    3e-06   
ref|XP_008243605.1|  PREDICTED: G-type lectin S-receptor-like ser...  52.8    3e-06   
ref|XP_008357867.1|  PREDICTED: G-type lectin S-receptor-like ser...  52.4    4e-06   
ref|XP_007134257.1|  hypothetical protein PHAVU_010G031900g           52.4    4e-06   
ref|XP_007014868.1|  Receptor-like protein kinase 1, putative         52.4    4e-06   
ref|XP_007048804.1|  Receptor-like protein kinase 1, putative         51.6    7e-06   
ref|XP_010265873.1|  PREDICTED: G-type lectin S-receptor-like ser...  51.6    7e-06   
ref|XP_010520634.1|  PREDICTED: G-type lectin S-receptor-like ser...  51.6    7e-06   
ref|XP_006368559.1|  hypothetical protein POPTR_0001s05240g           51.6    7e-06   
gb|KCW45165.1|  hypothetical protein EUGRSUZ_L01214                   51.2    7e-06   
ref|XP_007206931.1|  hypothetical protein PRUPE_ppb015337mg           50.4    7e-06   
ref|XP_002513434.1|  ATP binding protein, putative                    51.6    8e-06   Ricinus communis
emb|CDP14444.1|  unnamed protein product                              51.6    8e-06   
ref|XP_011037892.1|  PREDICTED: G-type lectin S-receptor-like ser...  51.6    8e-06   
ref|XP_010040492.1|  PREDICTED: G-type lectin S-receptor-like ser...  51.6    8e-06   
emb|CDP14429.1|  unnamed protein product                              51.2    9e-06   
ref|XP_010087375.1|  G-type lectin S-receptor-like serine/threoni...  51.2    9e-06   
gb|AFK47146.1|  unknown                                               50.8    9e-06   
ref|XP_003626868.1|  S-locus-specific glycoprotein S6                 50.8    9e-06   
emb|CDY16833.1|  BnaA09g05490D                                        51.2    1e-05   
gb|AET01344.2|  lectin kinase family protein                          50.8    1e-05   
gb|KEH18099.1|  hypothetical protein MTR_8g011377                     51.2    1e-05   
ref|XP_010044982.1|  PREDICTED: G-type lectin S-receptor-like ser...  50.8    1e-05   
ref|XP_010265861.1|  PREDICTED: G-type lectin S-receptor-like ser...  50.8    1e-05   
ref|XP_009364739.1|  PREDICTED: G-type lectin S-receptor-like ser...  50.8    1e-05   
ref|XP_010087374.1|  G-type lectin S-receptor-like serine/threoni...  50.8    1e-05   
ref|XP_002283186.2|  PREDICTED: G-type lectin S-receptor-like ser...  50.8    2e-05   Vitis vinifera
ref|XP_006577592.1|  PREDICTED: G-type lectin S-receptor-like ser...  50.4    2e-05   
ref|XP_004154673.1|  PREDICTED: G-type lectin S-receptor-like ser...  50.4    2e-05   
ref|XP_004149037.1|  PREDICTED: G-type lectin S-receptor-like ser...  50.1    2e-05   
gb|KGN66445.1|  hypothetical protein Csa_1G605740                     50.4    2e-05   
ref|XP_003555643.1|  PREDICTED: G-type lectin S-receptor-like ser...  50.1    2e-05   
ref|XP_003611353.1|  Kinase-like protein                              50.1    2e-05   
gb|KHN27126.1|  G-type lectin S-receptor-like serine/threonine-pr...  50.1    2e-05   
gb|KHN48904.1|  G-type lectin S-receptor-like serine/threonine-pr...  50.1    2e-05   
ref|XP_003611359.1|  Kinase-like protein                              50.1    2e-05   
ref|XP_008451130.1|  PREDICTED: G-type lectin S-receptor-like ser...  50.1    2e-05   
ref|XP_003611351.1|  hypothetical protein MTR_5g013050                47.4    2e-05   
ref|XP_010046455.1|  PREDICTED: G-type lectin S-receptor-like ser...  49.7    3e-05   
ref|XP_006368557.1|  hypothetical protein POPTR_0001s05190g           50.1    3e-05   
ref|XP_003532956.1|  PREDICTED: G-type lectin S-receptor-like ser...  50.1    3e-05   
gb|KHN26772.1|  G-type lectin S-receptor-like serine/threonine-pr...  50.1    3e-05   
ref|XP_008451129.1|  PREDICTED: G-type lectin S-receptor-like ser...  49.7    3e-05   
ref|XP_009772210.1|  PREDICTED: G-type lectin S-receptor-like ser...  49.3    4e-05   
gb|AIE56229.1|  lectin receptor kinase                                49.3    5e-05   
emb|CAE03338.2|  OSJNBb0005B05.5                                      49.3    5e-05   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010674604.1|  PREDICTED: G-type lectin S-receptor-like ser...  49.3    5e-05   
ref|XP_010928440.1|  PREDICTED: G-type lectin S-receptor-like ser...  49.3    5e-05   
ref|NP_001052225.2|  Os04g0201900                                     49.3    5e-05   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004149038.1|  PREDICTED: G-type lectin S-receptor-like ser...  48.9    5e-05   
emb|CBI32191.3|  unnamed protein product                              49.3    5e-05   
gb|AGT37611.1|  G-type lectin receptor kinase                         49.3    5e-05   
ref|XP_006445951.1|  hypothetical protein CICLE_v10017816mg           48.9    6e-05   
ref|XP_004154674.1|  PREDICTED: G-type lectin S-receptor-like ser...  48.9    6e-05   
gb|AIE56222.1|  lectin receptor kinase                                48.9    6e-05   
ref|XP_008243609.1|  PREDICTED: G-type lectin S-receptor-like ser...  48.9    6e-05   
ref|XP_010257446.1|  PREDICTED: G-type lectin S-receptor-like ser...  48.9    6e-05   
ref|XP_007020823.1|  Brassinosteroid insensitive 1-associated rec...  48.9    6e-05   
emb|CAH67714.1|  H0512B01.9                                           48.5    6e-05   Oryza sativa [red rice]
gb|EAY93041.1|  hypothetical protein OsI_14840                        48.5    7e-05   Oryza sativa Indica Group [Indian rice]
ref|XP_009769630.1|  PREDICTED: G-type lectin S-receptor-like ser...  48.5    9e-05   
ref|XP_004511723.1|  PREDICTED: G-type lectin S-receptor-like ser...  48.5    9e-05   
ref|XP_009365142.1|  PREDICTED: G-type lectin S-receptor-like ser...  48.5    9e-05   
ref|XP_006440216.1|  hypothetical protein CICLE_v10018901mg           48.1    1e-04   
ref|XP_009376525.1|  PREDICTED: G-type lectin S-receptor-like ser...  48.1    1e-04   
ref|XP_009364705.1|  PREDICTED: G-type lectin S-receptor-like ser...  48.1    1e-04   
ref|XP_008782878.1|  PREDICTED: G-type lectin S-receptor-like ser...  48.1    1e-04   
ref|XP_008352754.1|  PREDICTED: G-type lectin S-receptor-like ser...  47.4    1e-04   
ref|XP_009364740.1|  PREDICTED: G-type lectin S-receptor-like ser...  47.8    1e-04   
gb|KFK27854.1|  hypothetical protein AALP_AA8G438100                  47.8    1e-04   
ref|XP_009364742.1|  PREDICTED: G-type lectin S-receptor-like ser...  47.8    1e-04   
ref|XP_006368974.1|  hypothetical protein POPTR_0001s15360g           47.8    2e-04   
gb|KDO36845.1|  hypothetical protein CISIN_1g041576mg                 47.4    2e-04   
ref|XP_008366172.1|  PREDICTED: G-type lectin S-receptor-like ser...  47.4    2e-04   
ref|XP_006440220.1|  hypothetical protein CICLE_v10018902mg           47.4    2e-04   
ref|XP_008367506.1|  PREDICTED: G-type lectin S-receptor-like ser...  47.0    2e-04   
ref|XP_004228920.1|  PREDICTED: G-type lectin S-receptor-like ser...  47.0    2e-04   
emb|CAN59767.1|  hypothetical protein VITISV_011718                   47.0    3e-04   Vitis vinifera
ref|XP_008392855.1|  PREDICTED: G-type lectin S-receptor-like ser...  47.0    3e-04   
ref|XP_010265966.1|  PREDICTED: LOW QUALITY PROTEIN: G-type lecti...  47.0    3e-04   
gb|KDO38591.1|  hypothetical protein CISIN_1g039324mg                 46.6    3e-04   
gb|KCW45163.1|  hypothetical protein EUGRSUZ_L01210                   46.6    4e-04   
ref|XP_006440225.1|  hypothetical protein CICLE_v10018906mg           46.6    4e-04   
emb|CBI16445.3|  unnamed protein product                              46.2    4e-04   
ref|XP_007020824.1|  Brassinosteroid insensitive 1-associated rec...  46.6    4e-04   
ref|XP_002283213.1|  PREDICTED: G-type lectin S-receptor-like ser...  46.6    4e-04   Vitis vinifera
emb|CAN59768.1|  hypothetical protein VITISV_011719                   46.2    4e-04   Vitis vinifera
emb|CBI16444.3|  unnamed protein product                              46.2    4e-04   
ref|XP_006477571.1|  PREDICTED: G-type lectin S-receptor-like ser...  46.2    5e-04   
ref|XP_007207728.1|  hypothetical protein PRUPE_ppb016806mg           45.4    6e-04   
ref|XP_006388389.1|  hypothetical protein POPTR_0200s00210g           45.8    6e-04   
ref|XP_006598212.1|  PREDICTED: G-type lectin S-receptor-like ser...  45.8    6e-04   
ref|XP_010265967.1|  PREDICTED: G-type lectin S-receptor-like ser...  45.8    8e-04   
ref|XP_007020825.1|  Brassinosteroid insensitive 1-associated rec...  45.4    8e-04   
emb|CDP14432.1|  unnamed protein product                              45.4    9e-04   
ref|XP_010673551.1|  PREDICTED: G-type lectin S-receptor-like ser...  45.4    0.001   



>gb|ABG37663.1| CCHC-type integrase [Populus trichocarpa]
Length=2037

 Score = 71.6 bits (174),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 28/47 (60%), Positives = 38/47 (81%), Gaps = 3/47 (6%)
 Frame = +3

Query  3    TWTSIWSQPDNICYAMYFGNDNLGGGACGYNSVCSVDANKRPSCECP  143
            +W+S+WS+PD+IC  M  G D LG GACGYNS+C++ A+KRP C+CP
Sbjct  317  SWSSVWSKPDDICVNM--GAD-LGSGACGYNSICNLKADKRPECKCP  360



>ref|XP_007134258.1| hypothetical protein PHAVU_010G032000g [Phaseolus vulgaris]
 gb|ESW06252.1| hypothetical protein PHAVU_010G032000g [Phaseolus vulgaris]
Length=832

 Score = 65.5 bits (158),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 25/46 (54%), Positives = 34/46 (74%), Gaps = 3/46 (7%)
 Frame = +3

Query  6    WTSIWSQPDNICYAMYFGNDNLGGGACGYNSVCSVDANKRPSCECP  143
            W++IWSQPDNIC +        G G CG+NSVC++ +N+RPSC+CP
Sbjct  303  WSAIWSQPDNICLSRLATE---GSGVCGFNSVCTLGSNQRPSCQCP  345



>ref|XP_008350876.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase RLK1 [Malus domestica]
Length=810

 Score = 63.2 bits (152),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 27/48 (56%), Positives = 35/48 (73%), Gaps = 3/48 (6%)
 Frame = +3

Query  3    TWTSIWSQPDNICYAMYFGNDNLGGGACGYNSVCSVDANKRPSCECPP  146
            +W  +WS PDNIC+ +   N +LG G CGYN+VC +DAN+RP CEC P
Sbjct  287  SWLPLWSIPDNICFXV---NGDLGSGPCGYNTVCRLDANRRPICECLP  331



>ref|XP_011013447.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase RLK1 [Populus euphratica]
Length=811

 Score = 62.8 bits (151),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 30/48 (63%), Positives = 33/48 (69%), Gaps = 3/48 (6%)
 Frame = +3

Query  3    TWTSIWSQPDNICYAMYFGNDNLGGGACGYNSVCSVDANKRPSCECPP  146
            TW  IWS PDNIC      N +LGGG CGYNS C + AN+RPSCEC P
Sbjct  288  TWVPIWSVPDNICTD---SNGDLGGGPCGYNSYCKLGANRRPSCECLP  332



>ref|XP_008354967.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase RLK1 [Malus domestica]
Length=711

 Score = 62.8 bits (151),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 27/48 (56%), Positives = 35/48 (73%), Gaps = 3/48 (6%)
 Frame = +3

Query  3    TWTSIWSQPDNICYAMYFGNDNLGGGACGYNSVCSVDANKRPSCECPP  146
            +W  +WS PDNIC+ +   N +LG G CGYN+VC +DAN+RP CEC P
Sbjct  188  SWLPLWSIPDNICFDV---NGDLGSGPCGYNTVCRLDANRRPICECLP  232



>ref|XP_006386079.1| hypothetical protein POPTR_0003s21910g [Populus trichocarpa]
 gb|ERP63876.1| hypothetical protein POPTR_0003s21910g [Populus trichocarpa]
Length=791

 Score = 62.8 bits (151),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 28/47 (60%), Positives = 38/47 (81%), Gaps = 3/47 (6%)
 Frame = +3

Query  3    TWTSIWSQPDNICYAMYFGNDNLGGGACGYNSVCSVDANKRPSCECP  143
            +W+S+WS+PD+IC  M  G D LG GACGYNS+C++ A+KRP C+CP
Sbjct  266  SWSSVWSKPDDICVNM--GAD-LGSGACGYNSICNLKADKRPECKCP  309



>ref|XP_011025239.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase RLK1 isoform X1 [Populus euphratica]
Length=805

 Score = 62.4 bits (150),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 26/47 (55%), Positives = 36/47 (77%), Gaps = 3/47 (6%)
 Frame = +3

Query  3    TWTSIWSQPDNICYAMYFGNDNLGGGACGYNSVCSVDANKRPSCECP  143
            +W+S+WS+PD+IC  M     +LG GACGYNS+C++ A+KRP C CP
Sbjct  280  SWSSVWSKPDDICVNM---QADLGSGACGYNSICNLKADKRPECNCP  323



>ref|XP_011025240.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase RLK1 isoform X2 [Populus euphratica]
Length=803

 Score = 62.4 bits (150),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 26/47 (55%), Positives = 36/47 (77%), Gaps = 3/47 (6%)
 Frame = +3

Query  3    TWTSIWSQPDNICYAMYFGNDNLGGGACGYNSVCSVDANKRPSCECP  143
            +W+S+WS+PD+IC  M     +LG GACGYNS+C++ A+KRP C CP
Sbjct  272  SWSSVWSKPDDICVNM---QADLGSGACGYNSICNLKADKRPECNCP  315



>ref|XP_006354210.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase RLK1-like [Solanum tuberosum]
Length=619

 Score = 62.0 bits (149),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 22/46 (48%), Positives = 31/46 (67%), Gaps = 3/46 (7%)
 Frame = +3

Query  6    WTSIWSQPDNICYAMYFGNDNLGGGACGYNSVCSVDANKRPSCECP  143
            W+++WS PDNICY++       G G CGYN +C +  +KRP C+CP
Sbjct  96   WSTVWSVPDNICYSL---PSEKGSGVCGYNRICRLSIDKRPDCQCP  138



>gb|KDP20397.1| hypothetical protein JCGZ_05280 [Jatropha curcas]
Length=785

 Score = 61.6 bits (148),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 28/48 (58%), Positives = 35/48 (73%), Gaps = 3/48 (6%)
 Frame = +3

Query  3    TWTSIWSQPDNICYAMYFGNDNLGGGACGYNSVCSVDANKRPSCECPP  146
            TW++IWS P+NIC A+   N +LGGG CGYNS C +D  +RP CEC P
Sbjct  262  TWSAIWSVPNNICSAI---NGDLGGGPCGYNSYCRLDDKRRPLCECLP  306



>gb|KDO56486.1| hypothetical protein CISIN_1g037189mg, partial [Citrus sinensis]
Length=766

 Score = 61.6 bits (148),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 25/47 (53%), Positives = 35/47 (74%), Gaps = 3/47 (6%)
 Frame = +3

Query  6    WTSIWSQPDNICYAMYFGNDNLGGGACGYNSVCSVDANKRPSCECPP  146
            W+ +WSQPDNIC  +   +  LG GACG+NS+CS++ +KRP C+CP 
Sbjct  265  WSVVWSQPDNICVNL---DGELGSGACGFNSICSLNGDKRPMCDCPK  308



>ref|XP_006386082.1| hypothetical protein POPTR_0003s21940g [Populus trichocarpa]
 gb|ERP63879.1| hypothetical protein POPTR_0003s21940g [Populus trichocarpa]
Length=801

 Score = 61.2 bits (147),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 26/46 (57%), Positives = 34/46 (74%), Gaps = 3/46 (7%)
 Frame = +3

Query  6    WTSIWSQPDNICYAMYFGNDNLGGGACGYNSVCSVDANKRPSCECP  143
            WT IWSQPDNIC A +  +   G G CG+NSVC +++++RP CECP
Sbjct  281  WTPIWSQPDNICQASFVSS---GSGTCGFNSVCRLNSDRRPICECP  323



>ref|XP_008363356.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase RLK1 [Malus domestica]
Length=809

 Score = 61.2 bits (147),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 22/47 (47%), Positives = 34/47 (72%), Gaps = 3/47 (6%)
 Frame = +3

Query  3    TWTSIWSQPDNICYAMYFGNDNLGGGACGYNSVCSVDANKRPSCECP  143
            +W+ +W QP++IC A+    ++ G G CGYNSVC ++ + RP+CECP
Sbjct  283  SWSXLWYQPNDICQALM---EDTGVGVCGYNSVCKMNQDHRPTCECP  326



>ref|XP_009802537.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase RLK1 [Nicotiana sylvestris]
Length=806

 Score = 60.8 bits (146),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 22/46 (48%), Positives = 30/46 (65%), Gaps = 3/46 (7%)
 Frame = +3

Query  6    WTSIWSQPDNICYAMYFGNDNLGGGACGYNSVCSVDANKRPSCECP  143
            W+++WS PDNICY+        G G CGYN +C +  +KRP C+CP
Sbjct  282  WSAVWSIPDNICYSF---PTERGSGVCGYNRICRLSIDKRPDCQCP  324



>ref|XP_008231373.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase RLK1 [Prunus mume]
Length=396

 Score = 59.7 bits (143),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 26/48 (54%), Positives = 34/48 (71%), Gaps = 3/48 (6%)
 Frame = +3

Query  3    TWTSIWSQPDNICYAMYFGNDNLGGGACGYNSVCSVDANKRPSCECPP  146
            +W+ +WS PDNIC+     N +LG G CGYNS C ++AN+RP CEC P
Sbjct  283  SWSPVWSIPDNICFE---ANGDLGSGPCGYNSYCRLNANRRPICECLP  327



>ref|XP_006369448.1| hypothetical protein POPTR_0001s23530g [Populus trichocarpa]
 gb|ERP66017.1| hypothetical protein POPTR_0001s23530g [Populus trichocarpa]
Length=714

 Score = 60.1 bits (144),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 28/48 (58%), Positives = 32/48 (67%), Gaps = 3/48 (6%)
 Frame = +3

Query  3    TWTSIWSQPDNICYAMYFGNDNLGGGACGYNSVCSVDANKRPSCECPP  146
            TW +IWS PDNIC      N +LGGG CGYNS C +  N+RP CEC P
Sbjct  243  TWVAIWSVPDNICTD---SNGDLGGGPCGYNSYCKLGTNRRPICECLP  287



>ref|XP_008231371.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase RLK1 [Prunus mume]
Length=805

 Score = 60.1 bits (144),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 26/48 (54%), Positives = 34/48 (71%), Gaps = 3/48 (6%)
 Frame = +3

Query  3    TWTSIWSQPDNICYAMYFGNDNLGGGACGYNSVCSVDANKRPSCECPP  146
            +W+ +WS PDNIC+     N +LG G CGYNS C ++AN+RP CEC P
Sbjct  281  SWSPVWSIPDNICFE---ANGDLGSGPCGYNSYCRLNANRRPICECLP  325



>gb|KDP25138.1| hypothetical protein JCGZ_22673 [Jatropha curcas]
Length=803

 Score = 60.1 bits (144),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 25/46 (54%), Positives = 33/46 (72%), Gaps = 3/46 (7%)
 Frame = +3

Query  6    WTSIWSQPDNICYAMYFGNDNLGGGACGYNSVCSVDANKRPSCECP  143
            WT++WS+PDNIC A        G G CG+NSVC +D ++RP+CECP
Sbjct  283  WTTLWSEPDNICQA---SRVTAGSGICGFNSVCRLDPDRRPTCECP  325



>ref|XP_006494292.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase RLK1-like, partial [Citrus sinensis]
Length=1304

 Score = 59.7 bits (143),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 23/47 (49%), Positives = 35/47 (74%), Gaps = 3/47 (6%)
 Frame = +3

Query  6    WTSIWSQPDNICYAMYFGNDNLGGGACGYNSVCSVDANKRPSCECPP  146
            W+++WSQP+NIC  +   +   G GACG+NS+C++D ++RP CECP 
Sbjct  785  WSAVWSQPENICDNI---SGEFGSGACGFNSICTLDGDRRPMCECPK  828



>gb|KDO56484.1| hypothetical protein CISIN_1g042262mg [Citrus sinensis]
Length=814

 Score = 59.3 bits (142),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 23/47 (49%), Positives = 35/47 (74%), Gaps = 3/47 (6%)
 Frame = +3

Query  6    WTSIWSQPDNICYAMYFGNDNLGGGACGYNSVCSVDANKRPSCECPP  146
            W+++WSQP+NIC  +   +   G GACG+NS+C++D ++RP CECP 
Sbjct  288  WSAVWSQPENICDNI---SGEFGSGACGFNSICTLDGDRRPMCECPK  331



>ref|XP_006445948.1| hypothetical protein CICLE_v10017506mg [Citrus clementina]
 gb|ESR59188.1| hypothetical protein CICLE_v10017506mg [Citrus clementina]
Length=814

 Score = 59.3 bits (142),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 23/47 (49%), Positives = 35/47 (74%), Gaps = 3/47 (6%)
 Frame = +3

Query  6    WTSIWSQPDNICYAMYFGNDNLGGGACGYNSVCSVDANKRPSCECPP  146
            W+++WSQP+NIC  +   +   G GACG+NS+C++D ++RP CECP 
Sbjct  288  WSAVWSQPENICDNI---SGEFGSGACGFNSICTLDGDRRPMCECPK  331



>ref|XP_007014864.1| CCHC-type integrase, putative [Theobroma cacao]
 gb|EOY32483.1| CCHC-type integrase, putative [Theobroma cacao]
Length=811

 Score = 59.3 bits (142),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 24/48 (50%), Positives = 35/48 (73%), Gaps = 4/48 (8%)
 Frame = +3

Query  3    TWTSIWSQPDNICYAMYFGNDNLGGGACGYNSVCSVDANKRPSCECPP  146
            +W+++W QP+NIC  +      LG GACG+NS+CS++ N RP+C CPP
Sbjct  287  SWSTVWYQPENICLRV----GGLGSGACGFNSICSLNENGRPTCNCPP  330



>ref|XP_009621260.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase RLK1 [Nicotiana tomentosiformis]
Length=435

 Score = 58.5 bits (140),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 25/46 (54%), Positives = 31/46 (67%), Gaps = 3/46 (7%)
 Frame = +3

Query  6    WTSIWSQPDNICYAMYFGNDNLGGGACGYNSVCSVDANKRPSCECP  143
            WT +WS PDNIC A+    +  G G CGYN+VC +  N+RP CECP
Sbjct  283  WTILWSVPDNICLAIL---EETGSGVCGYNNVCHLSENQRPDCECP  325



>ref|XP_008231372.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase RLK1 [Prunus mume]
Length=807

 Score = 58.9 bits (141),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 26/48 (54%), Positives = 32/48 (67%), Gaps = 3/48 (6%)
 Frame = +3

Query  3    TWTSIWSQPDNICYAMYFGNDNLGGGACGYNSVCSVDANKRPSCECPP  146
            +W  +WS P+NIC+     N +LG G CGYNS C +DAN RP CEC P
Sbjct  283  SWLPVWSIPENICFE---ANGDLGSGPCGYNSYCRLDANTRPICECLP  327



>ref|XP_009588962.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase RLK1 isoform X1 [Nicotiana tomentosiformis]
Length=803

 Score = 58.9 bits (141),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 26/46 (57%), Positives = 33/46 (72%), Gaps = 4/46 (9%)
 Frame = +3

Query  6    WTSIWSQPDNICYAMYFGNDNLGGGACGYNSVCSVDANKRPSCECP  143
            W  +WSQPDNIC+ ++ G    G GACGYN+VC++  NKRP C CP
Sbjct  281  WNILWSQPDNICFNIFGG----GIGACGYNNVCNLGTNKRPVCNCP  322



>ref|XP_009588963.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase RLK1 isoform X2 [Nicotiana tomentosiformis]
Length=803

 Score = 58.9 bits (141),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 26/46 (57%), Positives = 33/46 (72%), Gaps = 4/46 (9%)
 Frame = +3

Query  6    WTSIWSQPDNICYAMYFGNDNLGGGACGYNSVCSVDANKRPSCECP  143
            W  +WSQPDNIC+ ++ G    G GACGYN+VC++  NKRP C CP
Sbjct  281  WNILWSQPDNICFNIFGG----GIGACGYNNVCNLGTNKRPVCNCP  322



>gb|AET01339.2| G-type lectin S-receptor-like Serine/Threonine-kinase RLK1, putative 
[Medicago truncatula]
Length=816

 Score = 58.5 bits (140),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 23/46 (50%), Positives = 34/46 (74%), Gaps = 4/46 (9%)
 Frame = +3

Query  6    WTSIWSQPDNICYAMYFGNDNLGGGACGYNSVCSVDANKRPSCECP  143
            WT++WS+PDNIC  +     + G G CGYNS+C+++ +KRP C+CP
Sbjct  280  WTTVWSKPDNICTYIV----SAGSGVCGYNSLCTLEVDKRPKCQCP  321



>ref|XP_003626863.1| Kinase-like protein [Medicago truncatula]
Length=1459

 Score = 58.5 bits (140),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 23/46 (50%), Positives = 34/46 (74%), Gaps = 4/46 (9%)
 Frame = +3

Query  6    WTSIWSQPDNICYAMYFGNDNLGGGACGYNSVCSVDANKRPSCECP  143
            WT++WS+PDNIC  +     + G G CGYNS+C+++ +KRP C+CP
Sbjct  280  WTTVWSKPDNICTYIV----SAGSGVCGYNSLCTLEVDKRPKCQCP  321


 Score = 51.2 bits (121),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 22/46 (48%), Positives = 31/46 (67%), Gaps = 4/46 (9%)
 Frame = +3

Query  6    WTSIWSQPDNICYAMYFGNDNLGGGACGYNSVCSVDANKRPSCECP  143
            WT++WS P NIC+  YF  +  G G CGYNS+C++  + RP+  CP
Sbjct  932  WTTVWSHPRNICH--YFVTE--GSGVCGYNSICTLGDDTRPAFRCP  973



>ref|XP_010673560.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase RLK1 [Beta vulgaris subsp. vulgaris]
Length=822

 Score = 58.2 bits (139),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 26/48 (54%), Positives = 35/48 (73%), Gaps = 2/48 (4%)
 Frame = +3

Query  6    WTSIWSQPDNICYAMY-FGNDNLGGGACGYNSVCSVDANKRPSCECPP  146
            W+ I S PDNIC ++  FG D    GACGYNS+CS++ ++RP C+CPP
Sbjct  290  WSKIQSFPDNICMSIASFGGD-FDSGACGYNSICSIEVDQRPRCQCPP  336



>ref|XP_006361291.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase RLK1-like [Solanum tuberosum]
Length=431

 Score = 57.4 bits (137),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 23/46 (50%), Positives = 35/46 (76%), Gaps = 3/46 (7%)
 Frame = +3

Query  6    WTSIWSQPDNICYAMYFGNDNLGGGACGYNSVCSVDANKRPSCECP  143
            W+++WS PDNIC A+    +++G G CG+N+VC++  N+RP CECP
Sbjct  281  WSTLWSLPDNICLAIL---EDVGSGVCGFNNVCNLGENQRPYCECP  323



>ref|XP_008231374.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase RLK1 [Prunus mume]
Length=807

 Score = 57.8 bits (138),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 25/48 (52%), Positives = 31/48 (65%), Gaps = 3/48 (6%)
 Frame = +3

Query  3    TWTSIWSQPDNICYAMYFGNDNLGGGACGYNSVCSVDANKRPSCECPP  146
            +W  IWS P+NIC+       +LG   CGYNS C +DAN+RP CEC P
Sbjct  283  SWLPIWSIPENICFE---AKGDLGSAPCGYNSYCRIDANRRPICECLP  327



>ref|XP_010547742.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase RLK1 [Tarenaya hassleriana]
Length=815

 Score = 57.8 bits (138),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 22/50 (44%), Positives = 35/50 (70%), Gaps = 3/50 (6%)
 Frame = +3

Query  3    TWTSIWSQPDNICYAMY---FGNDNLGGGACGYNSVCSVDANKRPSCECP  143
            +W+ +WS+PDNIC  ++   F  + +G  ACGYN+VC++   +RP C+CP
Sbjct  290  SWSMLWSKPDNICAKLFGSDFAENEIGRQACGYNNVCTLGKERRPICKCP  339



>ref|XP_003626867.1| Kinase-like protein [Medicago truncatula]
 gb|AET01343.1| cysteine-rich RLK (receptor-like kinase) protein [Medicago truncatula]
Length=1017

 Score = 57.8 bits (138),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 25/47 (53%), Positives = 33/47 (70%), Gaps = 4/47 (9%)
 Frame = +3

Query  3    TWTSIWSQPDNICYAMYFGNDNLGGGACGYNSVCSVDANKRPSCECP  143
             WT +WS+PDNIC   Y  N+  G G CGYNS C++  +KRP+C+CP
Sbjct  279  VWTIVWSKPDNICN--YIANE--GSGVCGYNSFCTLGVDKRPTCQCP  321



>ref|XP_006386078.1| hypothetical protein POPTR_0003s21900g [Populus trichocarpa]
 gb|ERP63875.1| hypothetical protein POPTR_0003s21900g [Populus trichocarpa]
Length=791

 Score = 57.4 bits (137),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 26/46 (57%), Positives = 33/46 (72%), Gaps = 3/46 (7%)
 Frame = +3

Query  6    WTSIWSQPDNICYAMYFGNDNLGGGACGYNSVCSVDANKRPSCECP  143
            WT IWSQPDNIC A    + + G G CG+NSVC ++++ RP CECP
Sbjct  267  WTPIWSQPDNICQA---SSVSAGSGTCGFNSVCRLNSDGRPICECP  309



>gb|KCW85884.1| hypothetical protein EUGRSUZ_B02606 [Eucalyptus grandis]
Length=795

 Score = 57.4 bits (137),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 26/47 (55%), Positives = 32/47 (68%), Gaps = 3/47 (6%)
 Frame = +3

Query  3    TWTSIWSQPDNICYAMYFGNDNLGGGACGYNSVCSVDANKRPSCECP  143
            TWTS+WS+P+NIC A+       G G CGYNS+CS+  N RP C CP
Sbjct  257  TWTSLWSEPENICTAVLAPR---GSGVCGYNSICSLGNNNRPKCGCP  300



>ref|XP_010046456.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase RLK1 [Eucalyptus grandis]
Length=819

 Score = 57.4 bits (137),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 26/47 (55%), Positives = 32/47 (68%), Gaps = 3/47 (6%)
 Frame = +3

Query  3    TWTSIWSQPDNICYAMYFGNDNLGGGACGYNSVCSVDANKRPSCECP  143
            TWTS+WS+P+NIC A+       G G CGYNS+CS+  N RP C CP
Sbjct  281  TWTSLWSEPENICTAVLAPR---GSGVCGYNSICSLGNNNRPKCGCP  324



>ref|XP_009374910.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase RLK1 [Pyrus x bretschneideri]
Length=802

 Score = 57.0 bits (136),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 22/47 (47%), Positives = 35/47 (74%), Gaps = 3/47 (6%)
 Frame = +3

Query  3    TWTSIWSQPDNICYAMYFGNDNLGGGACGYNSVCSVDANKRPSCECP  143
            +W+ +W +PD+IC A+    +++G G CGYNSVC ++ + RP+CECP
Sbjct  286  SWSPLWYKPDDICQALM---EDMGVGVCGYNSVCKMNQDHRPTCECP  329



>ref|XP_004308204.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase RLK1-like [Fragaria vesca subsp. vesca]
Length=800

 Score = 56.6 bits (135),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 26/47 (55%), Positives = 32/47 (68%), Gaps = 2/47 (4%)
 Frame = +3

Query  6    WTSIWSQPDNICYAMYFGNDNLGGGACGYNSVCSVDANKRPSCECPP  146
            W  +WS P NIC++   G+  LGGG CGYNS+C +D N RP CEC P
Sbjct  279  WLIMWSIPGNICFSSSAGD--LGGGPCGYNSLCRLDPNTRPICECLP  323



>ref|XP_010265874.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase RLK1 [Nelumbo nucifera]
Length=809

 Score = 56.6 bits (135),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 23/47 (49%), Positives = 32/47 (68%), Gaps = 3/47 (6%)
 Frame = +3

Query  6    WTSIWSQPDNICYAMYFGNDNLGGGACGYNSVCSVDANKRPSCECPP  146
            W+ +W  PD+IC A       LG G CG+NS+C++ A+KRP+C CPP
Sbjct  285  WSMVWHIPDDICMA---SKATLGSGTCGFNSICNLTADKRPTCYCPP  328



>ref|XP_006354209.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase RLK1-like [Solanum tuberosum]
Length=684

 Score = 56.2 bits (134),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 27/46 (59%), Positives = 32/46 (70%), Gaps = 3/46 (7%)
 Frame = +3

Query  6    WTSIWSQPDNICYAMYFGNDNLGGGACGYNSVCSVDANKRPSCECP  143
            W  +WSQPDNIC  +    DN G G+CGYN+VCS+D N RP C CP
Sbjct  157  WNILWSQPDNICIKI--DGDN-GPGSCGYNNVCSLDTNNRPVCNCP  199



>ref|XP_010265867.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase RLK1 [Nelumbo nucifera]
 ref|XP_010265868.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase RLK1 [Nelumbo nucifera]
 ref|XP_010265869.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase RLK1 [Nelumbo nucifera]
Length=798

 Score = 56.2 bits (134),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 24/48 (50%), Positives = 34/48 (71%), Gaps = 3/48 (6%)
 Frame = +3

Query  3    TWTSIWSQPDNICYAMYFGNDNLGGGACGYNSVCSVDANKRPSCECPP  146
            +W+ +W  P+NIC A++      G GACG+NS C +D NK+P+CECPP
Sbjct  280  SWSPVWFVPENICTAIF---GPYGSGACGFNSYCILDENKKPNCECPP  324



>ref|XP_008243608.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase RLK1 [Prunus mume]
Length=463

 Score = 55.8 bits (133),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 23/47 (49%), Positives = 34/47 (72%), Gaps = 3/47 (6%)
 Frame = +3

Query  3    TWTSIWSQPDNICYAMYFGNDNLGGGACGYNSVCSVDANKRPSCECP  143
            +WT +WS+PDNIC  +    ++ G G CGYNS+C++  +KRP+C CP
Sbjct  295  SWTILWSEPDNICQRI---TESSGVGVCGYNSICTLKGDKRPTCGCP  338



>gb|KCW85883.1| hypothetical protein EUGRSUZ_B02605 [Eucalyptus grandis]
Length=805

 Score = 56.2 bits (134),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 24/46 (52%), Positives = 32/46 (70%), Gaps = 3/46 (7%)
 Frame = +3

Query  6    WTSIWSQPDNICYAMYFGNDNLGGGACGYNSVCSVDANKRPSCECP  143
            W+ +W+QPDNIC A+   N   G G CGYNS+C++  N RP+C CP
Sbjct  267  WSILWTQPDNICSAIVSRN---GIGVCGYNSICTLGENNRPNCRCP  309



>gb|KCW45166.1| hypothetical protein EUGRSUZ_L01215 [Eucalyptus grandis]
Length=626

 Score = 56.2 bits (134),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 24/46 (52%), Positives = 32/46 (70%), Gaps = 3/46 (7%)
 Frame = +3

Query  6    WTSIWSQPDNICYAMYFGNDNLGGGACGYNSVCSVDANKRPSCECP  143
            W+ +W+QPDNIC A+   N   G G CGYNS+C++  N RP+C CP
Sbjct  88   WSILWTQPDNICSAIVSRN---GIGVCGYNSICTLGENNRPNCRCP  130



>ref|XP_010040493.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase RLK1 [Eucalyptus grandis]
Length=830

 Score = 56.2 bits (134),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 24/46 (52%), Positives = 32/46 (70%), Gaps = 3/46 (7%)
 Frame = +3

Query  6    WTSIWSQPDNICYAMYFGNDNLGGGACGYNSVCSVDANKRPSCECP  143
            W+ +W+QPDNIC A+   N   G G CGYNS+C++  N RP+C CP
Sbjct  292  WSILWTQPDNICSAIVSRN---GIGVCGYNSICTLGENNRPNCRCP  334



>ref|XP_010043873.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase RLK1 [Eucalyptus grandis]
Length=882

 Score = 56.2 bits (134),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 24/46 (52%), Positives = 32/46 (70%), Gaps = 3/46 (7%)
 Frame = +3

Query  6    WTSIWSQPDNICYAMYFGNDNLGGGACGYNSVCSVDANKRPSCECP  143
            W+ +W+QPDNIC A+   N   G G CGYNS+C++  N RP+C CP
Sbjct  344  WSILWTQPDNICSAIVSRN---GIGVCGYNSICTLGENNRPNCRCP  386



>ref|XP_004228922.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase RLK1 [Solanum lycopersicum]
Length=805

 Score = 56.2 bits (134),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 23/47 (49%), Positives = 33/47 (70%), Gaps = 3/47 (6%)
 Frame = +3

Query  3    TWTSIWSQPDNICYAMYFGNDNLGGGACGYNSVCSVDANKRPSCECP  143
             W+++WS PDNICY+  F ++  G G CGYN +C +  +KRP C+CP
Sbjct  281  VWSTVWSVPDNICYS--FPSEK-GSGVCGYNRICRLSIDKRPDCQCP  324



>ref|XP_008243607.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase RLK1 [Prunus mume]
Length=802

 Score = 55.8 bits (133),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 22/47 (47%), Positives = 35/47 (74%), Gaps = 3/47 (6%)
 Frame = +3

Query  3    TWTSIWSQPDNICYAMYFGNDNLGGGACGYNSVCSVDANKRPSCECP  143
            +WT +WS+PD+IC  +    ++ G G CGYNS+C ++A+ RP+C+CP
Sbjct  283  SWTLLWSEPDDICRRV---TEDSGFGICGYNSICKLNADNRPTCQCP  326



>ref|XP_006494291.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase RLK1-like [Citrus sinensis]
Length=813

 Score = 55.8 bits (133),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 22/47 (47%), Positives = 33/47 (70%), Gaps = 3/47 (6%)
 Frame = +3

Query  6    WTSIWSQPDNICYAMYFGNDNLGGGACGYNSVCSVDANKRPSCECPP  146
            W+  WS+P+NIC  +      +G GACG+NS+CS+D+++RP C CP 
Sbjct  288  WSVAWSEPENICVNI---GGEMGSGACGFNSICSLDSDRRPKCACPK  331



>gb|KDO56480.1| hypothetical protein CISIN_1g045343mg [Citrus sinensis]
Length=813

 Score = 55.8 bits (133),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 22/47 (47%), Positives = 33/47 (70%), Gaps = 3/47 (6%)
 Frame = +3

Query  6    WTSIWSQPDNICYAMYFGNDNLGGGACGYNSVCSVDANKRPSCECPP  146
            W+  WS+P+NIC  +      +G GACG+NS+CS+D+++RP C CP 
Sbjct  288  WSVAWSEPENICVNI---GGEMGSGACGFNSICSLDSDRRPKCACPK  331



>ref|XP_009766762.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase RLK1 [Nicotiana sylvestris]
Length=435

 Score = 55.1 bits (131),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 24/46 (52%), Positives = 30/46 (65%), Gaps = 3/46 (7%)
 Frame = +3

Query  6    WTSIWSQPDNICYAMYFGNDNLGGGACGYNSVCSVDANKRPSCECP  143
            WT +WS PDNIC A+    +  G G CGYN+VC +  N+ P CECP
Sbjct  283  WTILWSVPDNICLAIL---EETGSGVCGYNNVCHLSENQMPYCECP  325



>ref|XP_006445946.1| hypothetical protein CICLE_v10017810mg [Citrus clementina]
 gb|ESR59186.1| hypothetical protein CICLE_v10017810mg [Citrus clementina]
Length=775

 Score = 55.5 bits (132),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 22/46 (48%), Positives = 33/46 (72%), Gaps = 3/46 (7%)
 Frame = +3

Query  6    WTSIWSQPDNICYAMYFGNDNLGGGACGYNSVCSVDANKRPSCECP  143
            W+  WS+P+NIC  +      +G GACG+NS+CS+D+++RP C CP
Sbjct  288  WSVAWSEPENICVNI---GGEMGSGACGFNSICSLDSDRRPKCACP  330



>ref|XP_010042853.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase RLK1 [Eucalyptus grandis]
Length=393

 Score = 54.7 bits (130),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 25/47 (53%), Positives = 31/47 (66%), Gaps = 3/47 (6%)
 Frame = +3

Query  3    TWTSIWSQPDNICYAMYFGNDNLGGGACGYNSVCSVDANKRPSCECP  143
            TW S+WS+P+NIC A+       G G CGYNS+CS+  N RP C CP
Sbjct  230  TWISLWSEPENICTAVLAPR---GSGVCGYNSICSLGNNNRPKCGCP  273



>ref|XP_008451127.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase RLK1 [Cucumis melo]
Length=802

 Score = 55.5 bits (132),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 24/48 (50%), Positives = 32/48 (67%), Gaps = 3/48 (6%)
 Frame = +3

Query  3    TWTSIWSQPDNICYAMYFGNDNLGGGACGYNSVCSVDANKRPSCECPP  146
            TW      P+NIC AM     NL  G CGYNS+C+++ ++RPSC+CPP
Sbjct  271  TWMHFKKIPNNICVAM---RGNLSSGVCGYNSICTLNNDQRPSCKCPP  315



>ref|XP_006361290.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase RLK1-like [Solanum tuberosum]
Length=798

 Score = 55.1 bits (131),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 22/46 (48%), Positives = 35/46 (76%), Gaps = 3/46 (7%)
 Frame = +3

Query  6    WTSIWSQPDNICYAMYFGNDNLGGGACGYNSVCSVDANKRPSCECP  143
            W+S+++ PDNIC ++     + GGGACG+NS+CS+  ++RP C+CP
Sbjct  276  WSSLYNIPDNICLSI---RQSTGGGACGFNSLCSIGTDQRPRCDCP  318



>ref|XP_010265870.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase RLK1 [Nelumbo nucifera]
Length=797

 Score = 54.7 bits (130),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 24/48 (50%), Positives = 32/48 (67%), Gaps = 3/48 (6%)
 Frame = +3

Query  3    TWTSIWSQPDNICYAMYFGNDNLGGGACGYNSVCSVDANKRPSCECPP  146
            +WT IW  PDNIC  ++      G GACG+NS C +D N++P C+CPP
Sbjct  282  SWTPIWFIPDNICLQIF---GPYGSGACGFNSYCGLDDNQKPYCKCPP  326



>gb|KHN23696.1| G-type lectin S-receptor-like serine/threonine-protein kinase 
RLK1 [Glycine soja]
Length=746

 Score = 54.7 bits (130),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 25/47 (53%), Positives = 32/47 (68%), Gaps = 3/47 (6%)
 Frame = +3

Query  6    WTSIWSQPDNICYAMYFGNDNLGGGACGYNSVCSVDANKRPSCECPP  146
            WT +WS PDNIC   Y  +   G G CGYNS+CS+  +KRP+C+CP 
Sbjct  221  WTPVWSHPDNICKD-YVAS--AGSGVCGYNSICSLRDDKRPNCKCPK  264



>ref|XP_003545892.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase RLK1-like [Glycine max]
Length=815

 Score = 54.7 bits (130),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 24/46 (52%), Positives = 31/46 (67%), Gaps = 3/46 (7%)
 Frame = +3

Query  6    WTSIWSQPDNICYAMYFGNDNLGGGACGYNSVCSVDANKRPSCECP  143
            WT +WS PDNIC        + G G CGYNS+CS+  +KRP+C+CP
Sbjct  290  WTPVWSHPDNICKDYV---ASAGSGVCGYNSICSLRDDKRPNCKCP  332



>ref|XP_007014867.1| CCHC-type integrase, putative [Theobroma cacao]
 gb|EOY32486.1| CCHC-type integrase, putative [Theobroma cacao]
Length=803

 Score = 54.7 bits (130),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 23/46 (50%), Positives = 31/46 (67%), Gaps = 3/46 (7%)
 Frame = +3

Query  6    WTSIWSQPDNICYAMYFGNDNLGGGACGYNSVCSVDANKRPSCECP  143
            WT++WS PDNIC A          G CG+NS+CS++A +RP+C CP
Sbjct  278  WTTVWSNPDNICTASLV---TASSGVCGFNSICSLNAERRPNCGCP  320



>ref|XP_010043872.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase RLK1 [Eucalyptus grandis]
 gb|KCW85881.1| hypothetical protein EUGRSUZ_B02603 [Eucalyptus grandis]
Length=827

 Score = 54.3 bits (129),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 22/47 (47%), Positives = 32/47 (68%), Gaps = 3/47 (6%)
 Frame = +3

Query  3    TWTSIWSQPDNICYAMYFGNDNLGGGACGYNSVCSVDANKRPSCECP  143
            +W ++WSQPD+IC  +   +   G G CGYNS+C++  N RP C+CP
Sbjct  292  SWATLWSQPDDICAKVQVRD---GIGVCGYNSICTMGENNRPKCDCP  335



>ref|XP_009621259.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase RLK1 [Nicotiana tomentosiformis]
Length=786

 Score = 54.3 bits (129),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 23/47 (49%), Positives = 33/47 (70%), Gaps = 4/47 (9%)
 Frame = +3

Query  3    TWTSIWSQPDNICYAMYFGNDNLGGGACGYNSVCSVDANKRPSCECP  143
            TW+++ + PDNIC         +GGGACG+NS+CS+  N+RP C+CP
Sbjct  268  TWSTLHNIPDNICAI----RQRVGGGACGFNSLCSMGTNRRPRCDCP  310



>ref|XP_008348731.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase RLK1 [Malus domestica]
Length=812

 Score = 54.3 bits (129),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 22/47 (47%), Positives = 33/47 (70%), Gaps = 3/47 (6%)
 Frame = +3

Query  3    TWTSIWSQPDNICYAMYFGNDNLGGGACGYNSVCSVDANKRPSCECP  143
            +W+ +W QP++IC A+    ++ G G CGYNSVC  + + RP+CECP
Sbjct  286  SWSPLWYQPNDICQALM---EDTGVGVCGYNSVCKXNQDHRPTCECP  329



>ref|XP_008344689.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase RLK1 [Malus domestica]
Length=812

 Score = 54.3 bits (129),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 22/47 (47%), Positives = 33/47 (70%), Gaps = 3/47 (6%)
 Frame = +3

Query  3    TWTSIWSQPDNICYAMYFGNDNLGGGACGYNSVCSVDANKRPSCECP  143
            +W+ +W QP++IC A+    ++ G G CGYNSVC  + + RP+CECP
Sbjct  286  SWSPLWYQPNDICQALM---EDTGVGVCGYNSVCKXNQDHRPTCECP  329



>ref|XP_007014871.1| Receptor protein kinase 1 [Theobroma cacao]
 gb|EOY32490.1| Receptor protein kinase 1 [Theobroma cacao]
Length=804

 Score = 54.3 bits (129),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 24/47 (51%), Positives = 33/47 (70%), Gaps = 3/47 (6%)
 Frame = +3

Query  3    TWTSIWSQPDNICYAMYFGNDNLGGGACGYNSVCSVDANKRPSCECP  143
            +W  I + PDNIC  M   N  +G GACG+NS+C+++ NKRP+C CP
Sbjct  281  SWAVIRTFPDNICIRM---NGAMGSGACGFNSICTLNNNKRPTCGCP  324



>ref|XP_006354207.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase RLK1-like [Solanum tuberosum]
Length=684

 Score = 53.9 bits (128),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 26/46 (57%), Positives = 32/46 (70%), Gaps = 3/46 (7%)
 Frame = +3

Query  6    WTSIWSQPDNICYAMYFGNDNLGGGACGYNSVCSVDANKRPSCECP  143
            W  +WSQPDNIC  +    DN G G+CGYN+VCS+ +N RP C CP
Sbjct  157  WNILWSQPDNICIKI--DGDN-GPGSCGYNNVCSLGSNNRPVCNCP  199



>ref|XP_006282444.1| hypothetical protein CARUB_v10004135mg [Capsella rubella]
 gb|EOA15342.1| hypothetical protein CARUB_v10004135mg [Capsella rubella]
Length=825

 Score = 53.5 bits (127),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 26/48 (54%), Positives = 32/48 (67%), Gaps = 6/48 (13%)
 Frame = +3

Query  6    WTSIWSQPDNICYAMYFGN-DNLGGGACGYNSVCSVDANKRPSCECPP  146
            W   W+ PDNIC     GN D+LG  ACGYN++CS+  N+RP CECP 
Sbjct  285  WVFDWAVPDNIC-----GNSDSLGNTACGYNNICSLSNNQRPRCECPK  327



>ref|XP_004228923.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase RLK1 [Solanum lycopersicum]
Length=827

 Score = 53.5 bits (127),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 24/46 (52%), Positives = 30/46 (65%), Gaps = 3/46 (7%)
 Frame = +3

Query  6    WTSIWSQPDNICYAMYFGNDNLGGGACGYNSVCSVDANKRPSCECP  143
            W  +WSQPDNIC  +   N   G G+CGYN+VC++  N RP C CP
Sbjct  300  WNVLWSQPDNICIEIRGNN---GPGSCGYNNVCTLGTNDRPVCNCP  342



>ref|XP_008243606.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase RLK1 [Prunus mume]
Length=827

 Score = 53.5 bits (127),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 22/47 (47%), Positives = 33/47 (70%), Gaps = 3/47 (6%)
 Frame = +3

Query  3    TWTSIWSQPDNICYAMYFGNDNLGGGACGYNSVCSVDANKRPSCECP  143
            +WT  WS+PD+IC  +    ++ G G CGYNS+C++  +KRP+C CP
Sbjct  294  SWTLRWSEPDDICQRI---TEDSGVGVCGYNSICTLKGDKRPTCGCP  337



>ref|XP_003626869.1| Receptor-like protein kinase [Medicago truncatula]
 gb|AET01345.1| cysteine-rich RLK (receptor-like kinase) protein [Medicago truncatula]
Length=1195

 Score = 53.5 bits (127),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 25/45 (56%), Positives = 31/45 (69%), Gaps = 4/45 (9%)
 Frame = +3

Query  6     WTSIWSQPDNICYAMYFGNDNLGGGACGYNSVCSVDANKRPSCEC  140
             WT +WSQP+NIC+  YF    LG G CGYNS C++  NKRP+  C
Sbjct  1065  WTIVWSQPENICH--YF--PKLGSGVCGYNSYCTLGENKRPTRRC  1105


 Score = 52.8 bits (125),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 21/46 (46%), Positives = 31/46 (67%), Gaps = 4/46 (9%)
 Frame = +3

Query  6    WTSIWSQPDNICYAMYFGNDNLGGGACGYNSVCSVDANKRPSCECP  143
            WT++WS P NIC  +     + G G CGYN++C++  +KRP+C CP
Sbjct  290  WTTVWSHPKNICQYIV----SSGSGVCGYNTICTLGDDKRPTCRCP  331



>ref|XP_004154672.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase RLK1-like [Cucumis sativus]
 gb|KGN66444.1| hypothetical protein Csa_1G605730 [Cucumis sativus]
Length=792

 Score = 53.1 bits (126),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 24/48 (50%), Positives = 32/48 (67%), Gaps = 3/48 (6%)
 Frame = +3

Query  3    TWTSIWSQPDNICYAMYFGNDNLGGGACGYNSVCSVDANKRPSCECPP  146
            TW    + P+NIC AM     NL  GACGYNS+C+++ ++RPSC C P
Sbjct  271  TWIHFKTIPNNICVAM---RGNLSSGACGYNSICTLNNDQRPSCNCAP  315



>ref|XP_004149036.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase RLK1-like [Cucumis sativus]
Length=792

 Score = 53.1 bits (126),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 24/48 (50%), Positives = 32/48 (67%), Gaps = 3/48 (6%)
 Frame = +3

Query  3    TWTSIWSQPDNICYAMYFGNDNLGGGACGYNSVCSVDANKRPSCECPP  146
            TW    + P+NIC AM     NL  GACGYNS+C+++ ++RPSC C P
Sbjct  271  TWIHFKTIPNNICVAM---RGNLSSGACGYNSICTLNNDQRPSCNCAP  315



>emb|CDP14422.1| unnamed protein product [Coffea canephora]
Length=797

 Score = 53.1 bits (126),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 25/46 (54%), Positives = 32/46 (70%), Gaps = 4/46 (9%)
 Frame = +3

Query  6    WTSIWSQPDNICYAMYFGNDNLGGGACGYNSVCSVDANKRPSCECP  143
            WT +WS+PD+IC A        G GACGYNS+C++  N RP+CECP
Sbjct  282  WTVLWSEPDDICSA---AAAETGSGACGYNSICNL-VNGRPACECP  323



>ref|XP_007014873.1| Receptor-like protein kinase 1 [Theobroma cacao]
 gb|EOY32492.1| Receptor-like protein kinase 1 [Theobroma cacao]
Length=1174

 Score = 53.5 bits (127),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 24/48 (50%), Positives = 31/48 (65%), Gaps = 3/48 (6%)
 Frame = +3

Query  3    TWTSIWSQPDNICYAMYFGNDNLGGGACGYNSVCSVDANKRPSCECPP  146
            +WT++   P NIC  M  G DN G GACGYNS C +  ++RP C+C P
Sbjct  183  SWTTLSLIPSNIC--MRIGRDN-GSGACGYNSYCILGDDQRPICDCVP  227



>ref|XP_004309464.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase RLK1-like [Fragaria vesca subsp. vesca]
Length=832

 Score = 52.8 bits (125),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 23/47 (49%), Positives = 33/47 (70%), Gaps = 5/47 (11%)
 Frame = +3

Query  3    TWTSIWSQPDNICYAMYFGNDNLGGGACGYNSVCSVDANKRPSCECP  143
            +W+ +WS PDNIC  +     + G G CGYNS+C++  N+RP+CECP
Sbjct  312  SWSRVWSVPDNICKMLV----DAGLGVCGYNSICTL-RNQRPTCECP  353



>gb|KCW45168.1| hypothetical protein EUGRSUZ_L012161, partial [Eucalyptus grandis]
Length=411

 Score = 52.4 bits (124),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 22/47 (47%), Positives = 31/47 (66%), Gaps = 3/47 (6%)
 Frame = +3

Query  3    TWTSIWSQPDNICYAMYFGNDNLGGGACGYNSVCSVDANKRPSCECP  143
            +W ++WSQP++IC      +   G G CGYNS+C++D N RP C CP
Sbjct  290  SWGTLWSQPEDICTDASVRD---GIGVCGYNSICTLDENNRPKCNCP  333



>ref|XP_010040494.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase RLK1 [Eucalyptus grandis]
Length=686

 Score = 52.8 bits (125),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 22/47 (47%), Positives = 31/47 (66%), Gaps = 3/47 (6%)
 Frame = +3

Query  3    TWTSIWSQPDNICYAMYFGNDNLGGGACGYNSVCSVDANKRPSCECP  143
            +W ++WSQP++IC      +   G G CGYNS+C++D N RP C CP
Sbjct  290  SWGTLWSQPEDICTDASVRD---GIGVCGYNSICTLDENNRPKCNCP  333



>ref|XP_008355015.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase RLK1 [Malus domestica]
Length=470

 Score = 52.4 bits (124),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 23/48 (48%), Positives = 35/48 (73%), Gaps = 4/48 (8%)
 Frame = +3

Query  3    TWTS-IWSQPDNICYAMYFGNDNLGGGACGYNSVCSVDANKRPSCECP  143
            +W S +W +PD+IC A+    ++ G G CGYNSVC ++ +KRP+C+CP
Sbjct  285  SWRSPLWYKPDDICQALL---EDEGVGVCGYNSVCKINPDKRPTCDCP  329



>ref|XP_006445954.1| hypothetical protein CICLE_v10014312mg [Citrus clementina]
 gb|ESR59194.1| hypothetical protein CICLE_v10014312mg [Citrus clementina]
Length=804

 Score = 52.8 bits (125),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 24/46 (52%), Positives = 31/46 (67%), Gaps = 4/46 (9%)
 Frame = +3

Query  6    WTSIWSQPDNICYAMYFGNDNLGGGACGYNSVCSVDANKRPSCECP  143
            WT+ WS PD+IC A +      G G CG+NSVC ++ N+RP CECP
Sbjct  277  WTAFWSLPDDICKASFVST---GSGTCGFNSVCRLN-NRRPICECP  318



>ref|XP_006494281.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase RLK1-like [Citrus sinensis]
Length=804

 Score = 52.8 bits (125),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 24/46 (52%), Positives = 31/46 (67%), Gaps = 4/46 (9%)
 Frame = +3

Query  6    WTSIWSQPDNICYAMYFGNDNLGGGACGYNSVCSVDANKRPSCECP  143
            WT+ WS PD+IC A +      G G CG+NSVC ++ N+RP CECP
Sbjct  277  WTAFWSLPDDICKASFVST---GSGTCGFNSVCRLN-NRRPICECP  318



>gb|KDO56493.1| hypothetical protein CISIN_1g047263mg [Citrus sinensis]
Length=804

 Score = 52.8 bits (125),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 24/46 (52%), Positives = 31/46 (67%), Gaps = 4/46 (9%)
 Frame = +3

Query  6    WTSIWSQPDNICYAMYFGNDNLGGGACGYNSVCSVDANKRPSCECP  143
            WT+ WS PD+IC A +      G G CG+NSVC ++ N+RP CECP
Sbjct  277  WTAFWSLPDDICKASFVST---GSGTCGFNSVCRLN-NRRPICECP  318



>ref|XP_008243605.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase RLK1 [Prunus mume]
Length=812

 Score = 52.8 bits (125),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 21/47 (45%), Positives = 33/47 (70%), Gaps = 3/47 (6%)
 Frame = +3

Query  3    TWTSIWSQPDNICYAMYFGNDNLGGGACGYNSVCSVDANKRPSCECP  143
            +W  +WS+PD+IC +     +  G G CGYNS+C++  +KRP+C+CP
Sbjct  285  SWNLLWSEPDDICRSQ---PETSGVGICGYNSICTLKEDKRPTCKCP  328



>ref|XP_008357867.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase RLK1 [Malus domestica]
Length=595

 Score = 52.4 bits (124),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 23/48 (48%), Positives = 35/48 (73%), Gaps = 4/48 (8%)
 Frame = +3

Query  3    TWTS-IWSQPDNICYAMYFGNDNLGGGACGYNSVCSVDANKRPSCECP  143
            +W+S +W QP +IC A+    +++G G CGYNSVC ++ + RP+CECP
Sbjct  99   SWSSPLWYQPVDICQALM---EDMGVGVCGYNSVCKMNQDHRPTCECP  143



>ref|XP_007134257.1| hypothetical protein PHAVU_010G031900g [Phaseolus vulgaris]
 gb|ESW06251.1| hypothetical protein PHAVU_010G031900g [Phaseolus vulgaris]
Length=812

 Score = 52.4 bits (124),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 24/46 (52%), Positives = 31/46 (67%), Gaps = 3/46 (7%)
 Frame = +3

Query  6    WTSIWSQPDNICYAMYFGNDNLGGGACGYNSVCSVDANKRPSCECP  143
            WT +WS PDNIC   Y    +   G CGYNS+CS+  +KRP+C+CP
Sbjct  286  WTPVWSYPDNIC-KNYLAAAS--SGVCGYNSICSLRDDKRPTCQCP  328



>ref|XP_007014868.1| Receptor-like protein kinase 1, putative [Theobroma cacao]
 gb|EOY32487.1| Receptor-like protein kinase 1, putative [Theobroma cacao]
Length=799

 Score = 52.4 bits (124),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 23/48 (48%), Positives = 33/48 (69%), Gaps = 3/48 (6%)
 Frame = +3

Query  3    TWTSIWSQPDNICYAMYFGNDNLGGGACGYNSVCSVDANKRPSCECPP  146
            +WT I + P+NIC ++Y     +G GACGYN+VC +  + RP C+CPP
Sbjct  280  SWTVIKTIPENICRSIY---GEIGSGACGYNNVCILKNDGRPMCKCPP  324



>ref|XP_007048804.1| Receptor-like protein kinase 1, putative [Theobroma cacao]
 gb|EOX92961.1| Receptor-like protein kinase 1, putative [Theobroma cacao]
Length=766

 Score = 51.6 bits (122),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 21/48 (44%), Positives = 32/48 (67%), Gaps = 3/48 (6%)
 Frame = +3

Query  3    TWTSIWSQPDNICYAMYFGNDNLGGGACGYNSVCSVDANKRPSCECPP  146
            +WT +W +P +IC  +     +LGGG CG+NS C++ +N RP C+C P
Sbjct  319  SWTPVWFEPKDICSDI---KGDLGGGVCGFNSYCTLQSNGRPDCQCLP  363



>ref|XP_010265873.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase RLK1 [Nelumbo nucifera]
Length=809

 Score = 51.6 bits (122),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 21/47 (45%), Positives = 29/47 (62%), Gaps = 3/47 (6%)
 Frame = +3

Query  6    WTSIWSQPDNICYAMYFGNDNLGGGACGYNSVCSVDANKRPSCECPP  146
            W+ +W  P NIC A       LG G CG+N++C++ A  RP+C CPP
Sbjct  289  WSMVWHLPGNICLA---SRSKLGSGTCGFNNICNLTAENRPTCYCPP  332



>ref|XP_010520634.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase RLK1 [Tarenaya hassleriana]
Length=619

 Score = 51.6 bits (122),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 25/46 (54%), Positives = 33/46 (72%), Gaps = 4/46 (9%)
 Frame = +3

Query  3    TWTSIWSQPDNICYAMYFGNDNLGGGACGYNSVCSVDANKRPSCEC  140
            TW+ +WS+PD+IC A+  G   LG G CG+NSVC V  N+R SC+C
Sbjct  100  TWSMVWSKPDDICKALTNG---LGSGVCGFNSVC-VGENQRVSCKC  141



>ref|XP_006368559.1| hypothetical protein POPTR_0001s05240g [Populus trichocarpa]
 gb|ERP65128.1| hypothetical protein POPTR_0001s05240g [Populus trichocarpa]
Length=809

 Score = 51.6 bits (122),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 23/48 (48%), Positives = 31/48 (65%), Gaps = 3/48 (6%)
 Frame = +3

Query  3    TWTSIWSQPDNICYAMYFGNDNLGGGACGYNSVCSVDANKRPSCECPP  146
            TWT I + P NIC  +   N   G G CG+N+VC +  ++RP+CECPP
Sbjct  284  TWTVITTIPTNICLEL---NGPRGSGICGFNNVCKLKDDQRPTCECPP  328



>gb|KCW45165.1| hypothetical protein EUGRSUZ_L01214 [Eucalyptus grandis]
Length=443

 Score = 51.2 bits (121),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 23/47 (49%), Positives = 29/47 (62%), Gaps = 3/47 (6%)
 Frame = +3

Query  3    TWTSIWSQPDNICYAMYFGNDNLGGGACGYNSVCSVDANKRPSCECP  143
            TW  +WS+P+NIC A+       G G CGYNS+C +  N RP C CP
Sbjct  281  TWIPVWSEPENICTAVLAPR---GSGVCGYNSICFLGNNNRPKCGCP  324



>ref|XP_007206931.1| hypothetical protein PRUPE_ppb015337mg [Prunus persica]
 gb|EMJ08130.1| hypothetical protein PRUPE_ppb015337mg [Prunus persica]
Length=295

 Score = 50.4 bits (119),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 22/46 (48%), Positives = 31/46 (67%), Gaps = 3/46 (7%)
 Frame = +3

Query  3    TWTSIWSQPDNICYAMYFGNDNLGGGACGYNSVCSVDANKRPSCEC  140
            +W+ I ++PDNIC  +      LG G CGYNSVC++  ++RPSC C
Sbjct  253  SWSVIHTEPDNICVKI---AGELGTGPCGYNSVCTLKEDRRPSCRC  295



>ref|XP_002513434.1| ATP binding protein, putative [Ricinus communis]
 gb|EEF48837.1| ATP binding protein, putative [Ricinus communis]
Length=800

 Score = 51.6 bits (122),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 21/47 (45%), Positives = 33/47 (70%), Gaps = 4/47 (9%)
 Frame = +3

Query  6    WTSIWSQPDNICYAMYFGNDNLGGGACGYNSVCSVDANKRPSCECPP  146
            W+ I+S P+NIC+ +     ++G G CG+NSVC ++A++R  C CPP
Sbjct  282  WSIIFSAPENICFLI----TDIGTGPCGFNSVCQLNADQRAICRCPP  324



>emb|CDP14444.1| unnamed protein product [Coffea canephora]
Length=686

 Score = 51.6 bits (122),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 24/46 (52%), Positives = 31/46 (67%), Gaps = 4/46 (9%)
 Frame = +3

Query  6    WTSIWSQPDNICYAMYFGNDNLGGGACGYNSVCSVDANKRPSCECP  143
            WT+ W+ P+NIC AM   +   G G CGYNSVCS+   ++P CECP
Sbjct  252  WTAFWAIPENICTAM---DGTKGSGVCGYNSVCSL-VGRKPVCECP  293



>ref|XP_011037892.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase RLK1 isoform X1 [Populus euphratica]
 ref|XP_011037893.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase RLK1 isoform X2 [Populus euphratica]
Length=808

 Score = 51.6 bits (122),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 22/48 (46%), Positives = 31/48 (65%), Gaps = 3/48 (6%)
 Frame = +3

Query  3    TWTSIWSQPDNICYAMYFGNDNLGGGACGYNSVCSVDANKRPSCECPP  146
            TWT I + P NIC  +   N   G G CG+N++C +  ++RP+CECPP
Sbjct  284  TWTVITTIPKNICLGL---NGPRGSGICGFNNICKLKDDQRPTCECPP  328



>ref|XP_010040492.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase RLK1 [Eucalyptus grandis]
Length=791

 Score = 51.6 bits (122),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 23/47 (49%), Positives = 29/47 (62%), Gaps = 3/47 (6%)
 Frame = +3

Query  3    TWTSIWSQPDNICYAMYFGNDNLGGGACGYNSVCSVDANKRPSCECP  143
            TW  +WS+P+NIC A+       G G CGYNS+C +  N RP C CP
Sbjct  281  TWIPVWSEPENICTAVLAPR---GSGVCGYNSICFLGNNNRPKCGCP  324



>emb|CDP14429.1| unnamed protein product [Coffea canephora]
Length=583

 Score = 51.2 bits (121),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 23/46 (50%), Positives = 29/46 (63%), Gaps = 4/46 (9%)
 Frame = +3

Query  6    WTSIWSQPDNICYAMYFGNDNLGGGACGYNSVCSVDANKRPSCECP  143
            WT  W  P NICY        +G GACG+NSVC ++ N RP+C+CP
Sbjct  159  WTIFWYVPINICYI----QGEMGSGACGFNSVCYLEDNGRPACKCP  200



>ref|XP_010087375.1| G-type lectin S-receptor-like serine/threonine-protein kinase 
RLK1 [Morus notabilis]
 gb|EXB28985.1| G-type lectin S-receptor-like serine/threonine-protein kinase 
RLK1 [Morus notabilis]
Length=821

 Score = 51.2 bits (121),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 23/48 (48%), Positives = 32/48 (67%), Gaps = 4/48 (8%)
 Frame = +3

Query  3    TWTSIWSQPDNICYAMYFGNDNLGGGACGYNSVCSV-DANKRPSCECP  143
            +WT IWS PD+IC  +   +   G G CGYNS+C++ +  KRP C+CP
Sbjct  287  SWTYIWSIPDDICQDVRVES---GAGVCGYNSICTIKEEQKRPKCDCP  331



>gb|AFK47146.1| unknown [Medicago truncatula]
Length=446

 Score = 50.8 bits (120),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 22/46 (48%), Positives = 30/46 (65%), Gaps = 4/46 (9%)
 Frame = +3

Query  6    WTSIWSQPDNICYAMYFGNDNLGGGACGYNSVCSVDANKRPSCECP  143
            WT++WS+P NIC        + G G CGYNS C++  +KRP C+CP
Sbjct  282  WTTVWSKPFNICTYTV----SAGSGVCGYNSFCTLGDDKRPKCQCP  323



>ref|XP_003626868.1| S-locus-specific glycoprotein S6 [Medicago truncatula]
Length=446

 Score = 50.8 bits (120),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 22/46 (48%), Positives = 30/46 (65%), Gaps = 4/46 (9%)
 Frame = +3

Query  6    WTSIWSQPDNICYAMYFGNDNLGGGACGYNSVCSVDANKRPSCECP  143
            WT++WS+P NIC        + G G CGYNS C++  +KRP C+CP
Sbjct  282  WTTVWSKPFNICTYTV----SAGSGVCGYNSFCTLGDDKRPKCQCP  323



>emb|CDY16833.1| BnaA09g05490D [Brassica napus]
Length=1258

 Score = 51.2 bits (121),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 22/49 (45%), Positives = 31/49 (63%), Gaps = 3/49 (6%)
 Frame = +3

Query  6     WTSIWSQPDNIC---YAMYFGNDNLGGGACGYNSVCSVDANKRPSCECP  143
             W+  WS+P+NIC   +  Y   + LG  ACG+N++C +  N RP CECP
Sbjct  1091  WSLAWSEPENICAKRFGPYLDANELGNLACGFNNICILGDNNRPRCECP  1139


 Score = 48.1 bits (113),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 19/46 (41%), Positives = 32/46 (70%), Gaps = 2/46 (4%)
 Frame = +3

Query  6    WTSIWSQPDNICYAMYFGNDNLGGGACGYNSVCSVDANKRPSCECP  143
            W  +W+ P+NIC +    + ++G  ACG+NS+CS++  +RP C+CP
Sbjct  293  WELVWAVPENICRSS--SDISVGNVACGFNSICSLEDTQRPRCQCP  336



>gb|AET01344.2| lectin kinase family protein [Medicago truncatula]
Length=452

 Score = 50.8 bits (120),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 22/46 (48%), Positives = 30/46 (65%), Gaps = 4/46 (9%)
 Frame = +3

Query  6    WTSIWSQPDNICYAMYFGNDNLGGGACGYNSVCSVDANKRPSCECP  143
            WT++WS+P NIC        + G G CGYNS C++  +KRP C+CP
Sbjct  288  WTTVWSKPFNICTYTV----SAGSGVCGYNSFCTLGDDKRPKCQCP  329



>gb|KEH18099.1| hypothetical protein MTR_8g011377 [Medicago truncatula]
Length=639

 Score = 51.2 bits (121),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 22/46 (48%), Positives = 31/46 (67%), Gaps = 4/46 (9%)
 Frame = +3

Query  6    WTSIWSQPDNICYAMYFGNDNLGGGACGYNSVCSVDANKRPSCECP  143
            WT++WS P NIC+  YF  +  G G CGYNS+C++  + RP+  CP
Sbjct  112  WTTVWSHPRNICH--YFVTE--GSGVCGYNSICTLGDDTRPAFRCP  153



>ref|XP_010044982.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase RLK1 [Eucalyptus grandis]
Length=801

 Score = 50.8 bits (120),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 21/46 (46%), Positives = 26/46 (57%), Gaps = 4/46 (9%)
 Frame = +3

Query  6    WTSIWSQPDNICYAMYFGNDNLGGGACGYNSVCSVDANKRPSCECP  143
            W   W  P+NIC        N+G G CG+N +C +D N RP CECP
Sbjct  280  WMVDWPMPENICKT----GQNIGSGICGFNRICRLDVNDRPVCECP  321



>ref|XP_010265861.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase RLK1 [Nelumbo nucifera]
 ref|XP_010265862.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase RLK1 [Nelumbo nucifera]
 ref|XP_010265863.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase RLK1 [Nelumbo nucifera]
 ref|XP_010265864.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase RLK1 [Nelumbo nucifera]
 ref|XP_010265865.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase RLK1 [Nelumbo nucifera]
 ref|XP_010265866.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase RLK1 [Nelumbo nucifera]
Length=796

 Score = 50.8 bits (120),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 23/48 (48%), Positives = 30/48 (63%), Gaps = 3/48 (6%)
 Frame = +3

Query  3    TWTSIWSQPDNICYAMYFGNDNLGGGACGYNSVCSVDANKRPSCECPP  146
            +WT IW  PDNIC  ++      G GACG+NS C +D  ++  CECPP
Sbjct  282  SWTPIWFIPDNICLQIF---GPYGSGACGFNSYCRLDDYQKTYCECPP  326



>ref|XP_009364739.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase RLK1 [Pyrus x bretschneideri]
Length=808

 Score = 50.8 bits (120),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 20/43 (47%), Positives = 29/43 (67%), Gaps = 3/43 (7%)
 Frame = +3

Query  15   IWSQPDNICYAMYFGNDNLGGGACGYNSVCSVDANKRPSCECP  143
            +W  PD+IC  +    +++G G CGYNSVC +  + RP+CECP
Sbjct  291  LWYTPDDICQTL---REDMGVGVCGYNSVCKLKTDNRPTCECP  330



>ref|XP_010087374.1| G-type lectin S-receptor-like serine/threonine-protein kinase 
RLK1 [Morus notabilis]
 gb|EXB28984.1| G-type lectin S-receptor-like serine/threonine-protein kinase 
RLK1 [Morus notabilis]
Length=679

 Score = 50.8 bits (120),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 21/47 (45%), Positives = 35/47 (74%), Gaps = 3/47 (6%)
 Frame = +3

Query  3    TWTSIWSQPDNICYAMYFGNDNLGGGACGYNSVCSVDANKRPSCECP  143
            TW  I + P++IC A++    +LG G CG+NS+C+++ ++RPSC+CP
Sbjct  159  TWNQIKAIPNDICVAVH---GDLGTGPCGHNSICTLNEDQRPSCKCP  202



>ref|XP_002283186.2| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase RLK1 [Vitis vinifera]
Length=1468

 Score = 50.8 bits (120),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 21/46 (46%), Positives = 30/46 (65%), Gaps = 3/46 (7%)
 Frame = +3

Query  6    WTSIWSQPDNICYAMYFGNDNLGGGACGYNSVCSVDANKRPSCECP  143
            W+   S P NIC  +    +N GGGACG+NS C +  ++RP+C+CP
Sbjct  950  WSPSPSIPGNICMRI---TENTGGGACGFNSYCILGDDQRPNCKCP  992



>ref|XP_006577592.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase RLK1-like [Glycine max]
Length=1166

 Score = 50.4 bits (119),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 23/46 (50%), Positives = 27/46 (59%), Gaps = 3/46 (7%)
 Frame = +3

Query  6    WTSIWSQPDNICYAMYFGNDNLGGGACGYNSVCSVDANKRPSCECP  143
            WT +WS PDNIC            G CGYNS+CS+   KRP C+CP
Sbjct  284  WTPVWSHPDNICKDYLSAT---SSGVCGYNSICSLGDYKRPICKCP  326



>ref|XP_004154673.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase RLK1-like [Cucumis sativus]
Length=731

 Score = 50.4 bits (119),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 22/48 (46%), Positives = 29/48 (60%), Gaps = 3/48 (6%)
 Frame = +3

Query  3    TWTSIWSQPDNICYAMYFGNDNLGGGACGYNSVCSVDANKRPSCECPP  146
            TW      P NIC  M     N   G CGYNS+C+++ ++RPSC+CPP
Sbjct  211  TWMDFKKIPHNICVTM---RGNYSSGICGYNSICTLNNDQRPSCKCPP  255



>ref|XP_004149037.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase RLK1-like [Cucumis sativus]
Length=723

 Score = 50.1 bits (118),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 22/48 (46%), Positives = 29/48 (60%), Gaps = 3/48 (6%)
 Frame = +3

Query  3    TWTSIWSQPDNICYAMYFGNDNLGGGACGYNSVCSVDANKRPSCECPP  146
            TW      P NIC  M     N   G CGYNS+C+++ ++RPSC+CPP
Sbjct  249  TWMDFKKIPHNICVTM---RGNYSSGICGYNSICTLNNDQRPSCKCPP  293



>gb|KGN66445.1| hypothetical protein Csa_1G605740 [Cucumis sativus]
Length=791

 Score = 50.4 bits (119),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 22/48 (46%), Positives = 29/48 (60%), Gaps = 3/48 (6%)
 Frame = +3

Query  3    TWTSIWSQPDNICYAMYFGNDNLGGGACGYNSVCSVDANKRPSCECPP  146
            TW      P NIC  M     N   G CGYNS+C+++ ++RPSC+CPP
Sbjct  271  TWMDFKKIPHNICVTM---RGNYSSGICGYNSICTLNNDQRPSCKCPP  315



>ref|XP_003555643.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase RLK1-like [Glycine max]
Length=800

 Score = 50.1 bits (118),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 22/47 (47%), Positives = 32/47 (68%), Gaps = 2/47 (4%)
 Frame = +3

Query  3    TWTSIWSQPDNICYAMYFGNDNLGGGACGYNSVCSVDANKRPSCECP  143
            +WT + + PDNIC  +  GN   G G CG+NS+C++ A++RP C CP
Sbjct  279  SWTVMKTLPDNICMNL-LGNTG-GSGVCGFNSICTLKADQRPKCSCP  323



>ref|XP_003611353.1| Kinase-like protein [Medicago truncatula]
 gb|AES94311.1| malectin/receptor-like kinase family protein [Medicago truncatula]
Length=803

 Score = 50.1 bits (118),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 23/46 (50%), Positives = 33/46 (72%), Gaps = 4/46 (9%)
 Frame = +3

Query  6    WTSIWSQPDNICYAMYFGNDNLGGGACGYNSVCSVDANKRPSCECP  143
            WT +   PDNIC A++   + +G G CGYNS CS++ N+RP+C+CP
Sbjct  284  WTIMRYVPDNICIAIF---NEMGSGTCGYNSYCSME-NQRPTCKCP  325



>gb|KHN27126.1| G-type lectin S-receptor-like serine/threonine-protein kinase 
RLK1 [Glycine soja]
Length=676

 Score = 50.1 bits (118),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 22/47 (47%), Positives = 32/47 (68%), Gaps = 2/47 (4%)
 Frame = +3

Query  3    TWTSIWSQPDNICYAMYFGNDNLGGGACGYNSVCSVDANKRPSCECP  143
            +WT + + PDNIC  +  GN   G G CG+NS+C++ A++RP C CP
Sbjct  155  SWTVMKTLPDNICMNL-LGNTG-GSGVCGFNSICTLKADQRPKCSCP  199



>gb|KHN48904.1| G-type lectin S-receptor-like serine/threonine-protein kinase 
RLK1 [Glycine soja]
Length=669

 Score = 50.1 bits (118),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 19/46 (41%), Positives = 30/46 (65%), Gaps = 3/46 (7%)
 Frame = +3

Query  6    WTSIWSQPDNICYAMYFGNDNLGGGACGYNSVCSVDANKRPSCECP  143
            W +  + P+NIC +  F +   G G CG+NS+C++ A++RP C CP
Sbjct  245  WVTTKTIPENICLSSTFTD---GEGVCGFNSICNLKADQRPICNCP  287



>ref|XP_003611359.1| Kinase-like protein [Medicago truncatula]
 gb|AES94317.1| malectin/receptor-like kinase family protein [Medicago truncatula]
Length=800

 Score = 50.1 bits (118),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 23/46 (50%), Positives = 33/46 (72%), Gaps = 4/46 (9%)
 Frame = +3

Query  6    WTSIWSQPDNICYAMYFGNDNLGGGACGYNSVCSVDANKRPSCECP  143
            WT +   PDNIC A++   + +G G CGYNS CS++ N+RP+C+CP
Sbjct  283  WTIMRYVPDNICIAIF---NEMGSGTCGYNSYCSME-NQRPTCKCP  324



>ref|XP_008451130.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase RLK1 [Cucumis melo]
Length=806

 Score = 50.1 bits (118),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 21/45 (47%), Positives = 30/45 (67%), Gaps = 0/45 (0%)
 Frame = +3

Query  6    WTSIWSQPDNICYAMYFGNDNLGGGACGYNSVCSVDANKRPSCEC  140
            W  ++  PDNIC ++     +LG G CG+NS+CS+ +N RPSC C
Sbjct  286  WKDLFRIPDNICLSIENPIGSLGSGICGFNSICSLKSNGRPSCNC  330



>ref|XP_003611351.1| hypothetical protein MTR_5g013050 [Medicago truncatula]
 gb|AES94309.1| hypothetical protein MTR_5g013050 [Medicago truncatula]
Length=159

 Score = 47.4 bits (111),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 21/43 (49%), Positives = 30/43 (70%), Gaps = 4/43 (9%)
 Frame = +3

Query  6    WTSIWSQPDNICYAMYFGNDNLGGGACGYNSVCSVDANKRPSC  134
            WT +   PDNIC A++   + +G G CGYNS CS++ N+RP+C
Sbjct  118  WTIMRYVPDNICTAIF---NEMGSGTCGYNSYCSME-NQRPTC  156



>ref|XP_010046455.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase RLK1 [Eucalyptus grandis]
Length=555

 Score = 49.7 bits (117),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 21/47 (45%), Positives = 32/47 (68%), Gaps = 3/47 (6%)
 Frame = +3

Query  3    TWTSIWSQPDNICYAMYFGNDNLGGGACGYNSVCSVDANKRPSCECP  143
            +W+ +W+QP+NIC A+       G G CGYNS+C++  + RP+C CP
Sbjct  291  SWSILWTQPENICSAVV---SQGGIGVCGYNSICTLGEHNRPNCGCP  334



>ref|XP_006368557.1| hypothetical protein POPTR_0001s05190g [Populus trichocarpa]
 gb|ERP65126.1| hypothetical protein POPTR_0001s05190g [Populus trichocarpa]
Length=804

 Score = 50.1 bits (118),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 22/48 (46%), Positives = 30/48 (63%), Gaps = 3/48 (6%)
 Frame = +3

Query  3    TWTSIWSQPDNICYAMYFGNDNLGGGACGYNSVCSVDANKRPSCECPP  146
            TWT I + P  IC  +   N   G G CG+N+VC +  ++RP+CECPP
Sbjct  284  TWTVITTIPKKICLEL---NGPQGSGICGFNNVCKLKDDQRPTCECPP  328



>ref|XP_003532956.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase RLK1-like [Glycine max]
Length=816

 Score = 50.1 bits (118),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 23/44 (52%), Positives = 29/44 (66%), Gaps = 3/44 (7%)
 Frame = +3

Query  12   SIWSQPDNICYAMYFGNDNLGGGACGYNSVCSVDANKRPSCECP  143
             +WS PDNIC   Y  +   G G CGYNS+CS+  +KRP+C CP
Sbjct  292  QVWSHPDNICKD-YVASA--GSGVCGYNSICSLRDDKRPNCRCP  332



>gb|KHN26772.1| G-type lectin S-receptor-like serine/threonine-protein kinase 
RLK1 [Glycine soja]
Length=816

 Score = 50.1 bits (118),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 23/44 (52%), Positives = 29/44 (66%), Gaps = 3/44 (7%)
 Frame = +3

Query  12   SIWSQPDNICYAMYFGNDNLGGGACGYNSVCSVDANKRPSCECP  143
             +WS PDNIC   Y  +   G G CGYNS+CS+  +KRP+C CP
Sbjct  292  QVWSHPDNICKD-YVASA--GSGVCGYNSICSLRDDKRPNCRCP  332



>ref|XP_008451129.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase RLK1 [Cucumis melo]
Length=575

 Score = 49.7 bits (117),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 22/48 (46%), Positives = 28/48 (58%), Gaps = 3/48 (6%)
 Frame = +3

Query  3    TWTSIWSQPDNICYAMYFGNDNLGGGACGYNSVCSVDANKRPSCECPP  146
            TW      P NIC  M     N   G CGYNS+C ++ ++RPSC+CPP
Sbjct  49   TWMHFKKIPHNICVTM---RGNYSSGVCGYNSICILNNDQRPSCKCPP  93



>ref|XP_009772210.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase RLK1 [Nicotiana sylvestris]
Length=802

 Score = 49.3 bits (116),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 21/48 (44%), Positives = 31/48 (65%), Gaps = 3/48 (6%)
 Frame = +3

Query  3    TWTSIWSQPDNICYAMYFGNDNLGGGACGYNSVCSVDANKRPSCECPP  146
            +W  +WS+PD+IC A+       G G CG+NS C +++N RP+C C P
Sbjct  285  SWFRVWSKPDDICSAI---QGQFGIGTCGFNSYCMLNSNGRPNCNCLP  329



>gb|AIE56229.1| lectin receptor kinase [Oryza sativa Japonica Group]
Length=813

 Score = 49.3 bits (116),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 23/50 (46%), Positives = 33/50 (66%), Gaps = 5/50 (10%)
 Frame = +3

Query  3    TWTSIWSQPDNICYAMYFGNDNLGGGACGYNSVCSVDA--NKRPSCECPP  146
            TWT++  QP NIC+A+     ++G G CG+NS C+ D   N+  SC+CPP
Sbjct  285  TWTAVSMQPQNICHAIV---SDVGSGVCGFNSYCTFDGTRNQIASCQCPP  331



>emb|CAE03338.2| OSJNBb0005B05.5 [Oryza sativa Japonica Group]
 gb|EEE60504.1| hypothetical protein OsJ_13804 [Oryza sativa Japonica Group]
Length=813

 Score = 49.3 bits (116),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 23/50 (46%), Positives = 33/50 (66%), Gaps = 5/50 (10%)
 Frame = +3

Query  3    TWTSIWSQPDNICYAMYFGNDNLGGGACGYNSVCSVDA--NKRPSCECPP  146
            TWT++  QP NIC+A+     ++G G CG+NS C+ D   N+  SC+CPP
Sbjct  285  TWTAVSMQPQNICHAIV---SDVGSGVCGFNSYCTFDGTRNQIASCQCPP  331



>ref|XP_010674604.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase RLK1 [Beta vulgaris subsp. vulgaris]
Length=819

 Score = 49.3 bits (116),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 22/46 (48%), Positives = 29/46 (63%), Gaps = 0/46 (0%)
 Frame = +3

Query  6    WTSIWSQPDNICYAMYFGNDNLGGGACGYNSVCSVDANKRPSCECP  143
            W    + PDNIC      + +LG G+CG+NS+CS   NKRP+C CP
Sbjct  285  WFMAQALPDNICMTNRSPDPDLGSGSCGFNSICSHGDNKRPTCTCP  330



>ref|XP_010928440.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase RLK1 [Elaeis guineensis]
Length=803

 Score = 49.3 bits (116),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 22/47 (47%), Positives = 30/47 (64%), Gaps = 3/47 (6%)
 Frame = +3

Query  6    WTSIWSQPDNICYAMYFGNDNLGGGACGYNSVCSVDANKRPSCECPP  146
            WTS+ ++P +IC A+       G GACGYNS C++D  +   CECPP
Sbjct  282  WTSVDAKPTDICQAI---AAKTGSGACGYNSYCTIDERQHVDCECPP  325



>ref|NP_001052225.2| Os04g0201900 [Oryza sativa Japonica Group]
 dbj|BAF14139.2| Os04g0201900 [Oryza sativa Japonica Group]
Length=917

 Score = 49.3 bits (116),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 23/50 (46%), Positives = 33/50 (66%), Gaps = 5/50 (10%)
 Frame = +3

Query  3    TWTSIWSQPDNICYAMYFGNDNLGGGACGYNSVCSVDA--NKRPSCECPP  146
            TWT++  QP NIC+A+     ++G G CG+NS C+ D   N+  SC+CPP
Sbjct  324  TWTAVSMQPQNICHAIV---SDVGSGVCGFNSYCTFDGTRNQIASCQCPP  370



>ref|XP_004149038.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase RLK1-like [Cucumis sativus]
Length=752

 Score = 48.9 bits (115),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 21/46 (46%), Positives = 29/46 (63%), Gaps = 0/46 (0%)
 Frame = +3

Query  3    TWTSIWSQPDNICYAMYFGNDNLGGGACGYNSVCSVDANKRPSCEC  140
            +W  ++  PDNIC +       LG G CG+NS+CS+ +N RPSC C
Sbjct  231  SWKDLFRIPDNICLSNENPITRLGSGICGFNSICSLKSNGRPSCNC  276



>emb|CBI32191.3| unnamed protein product [Vitis vinifera]
Length=2000

 Score = 49.3 bits (116),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 22/48 (46%), Positives = 28/48 (58%), Gaps = 3/48 (6%)
 Frame = +3

Query  3    TWTSIWSQPDNICYAMYFGNDNLGGGACGYNSVCSVDANKRPSCECPP  146
            +W   W  P +IC  +      LGGG+CG+NS C  D N RP+CEC P
Sbjct  292  SWVQSWHVPKDICSEI---RGELGGGSCGFNSYCVYDKNGRPTCECLP  336



>gb|AGT37611.1| G-type lectin receptor kinase [Oryza sativa Indica Group]
Length=959

 Score = 49.3 bits (116),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 23/50 (46%), Positives = 33/50 (66%), Gaps = 5/50 (10%)
 Frame = +3

Query  3    TWTSIWSQPDNICYAMYFGNDNLGGGACGYNSVCSVDA--NKRPSCECPP  146
            TWT++  QP NIC+A+     ++G G CG+NS C+ D   N+  SC+CPP
Sbjct  285  TWTALSMQPQNICHAIV---SDVGSGVCGFNSYCTFDGTRNQIASCQCPP  331



>ref|XP_006445951.1| hypothetical protein CICLE_v10017816mg [Citrus clementina]
 gb|ESR59191.1| hypothetical protein CICLE_v10017816mg [Citrus clementina]
Length=697

 Score = 48.9 bits (115),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 21/40 (53%), Positives = 29/40 (73%), Gaps = 3/40 (8%)
 Frame = +3

Query  27   PDNICYAMYFGNDNLGGGACGYNSVCSVDANKRPSCECPP  146
            PDNIC  +   +  LG GACG+NS+CS++ +KRP C+CP 
Sbjct  196  PDNICVNI---DGELGSGACGFNSICSLNGDKRPMCDCPK  232



>ref|XP_004154674.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase RLK1-like [Cucumis sativus]
 gb|KGN66446.1| hypothetical protein Csa_1G605750 [Cucumis sativus]
Length=812

 Score = 48.9 bits (115),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 21/46 (46%), Positives = 29/46 (63%), Gaps = 0/46 (0%)
 Frame = +3

Query  3    TWTSIWSQPDNICYAMYFGNDNLGGGACGYNSVCSVDANKRPSCEC  140
            +W  ++  PDNIC +       LG G CG+NS+CS+ +N RPSC C
Sbjct  291  SWKDLFRIPDNICLSNENPITRLGSGICGFNSICSLKSNGRPSCNC  336



>gb|AIE56222.1| lectin receptor kinase [Oryza sativa Indica Group]
 gb|AIE56223.1| lectin receptor kinase [Oryza sativa Indica Group]
 gb|AIE56224.1| lectin receptor kinase [Oryza sativa Indica Group]
 gb|AIE56225.1| lectin receptor kinase [Oryza sativa Indica Group]
 gb|AIE56226.1| lectin receptor kinase [Oryza sativa Indica Group]
 gb|AIE56227.1| lectin receptor kinase [Oryza sativa Indica Group]
 gb|AIE56228.1| lectin receptor kinase [Oryza sativa Japonica Group]
Length=813

 Score = 48.9 bits (115),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 23/50 (46%), Positives = 33/50 (66%), Gaps = 5/50 (10%)
 Frame = +3

Query  3    TWTSIWSQPDNICYAMYFGNDNLGGGACGYNSVCSVDA--NKRPSCECPP  146
            TWT++  QP NIC+A+     ++G G CG+NS C+ D   N+  SC+CPP
Sbjct  285  TWTALSMQPQNICHAIV---SDVGSGVCGFNSYCTFDGTRNQIASCQCPP  331



>ref|XP_008243609.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase RLK1 [Prunus mume]
Length=807

 Score = 48.9 bits (115),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 22/48 (46%), Positives = 33/48 (69%), Gaps = 4/48 (8%)
 Frame = +3

Query  3    TWTSIWSQPDNICYAMYFGNDNLGGGACGYNSVCSVD-ANKRPSCECP  143
            +W  +WS P+NIC  +   + + G G CG+NS+C++  A+KRP CECP
Sbjct  287  SWEPLWSLPENICLDI---DADSGPGVCGFNSICALSAADKRPKCECP  331



>ref|XP_010257446.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase RLK1 [Nelumbo nucifera]
Length=809

 Score = 48.9 bits (115),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 23/47 (49%), Positives = 29/47 (62%), Gaps = 4/47 (9%)
 Frame = +3

Query  3    TWTSIWSQPDNICYAMYFGNDNLGGGACGYNSVCSVDANKRPSCECP  143
            +W  +W  PDNIC       D+LG G CGYNS C++  + RPSC CP
Sbjct  280  SWQQLWIIPDNICLGTL---DDLGSGVCGYNSYCTL-KDGRPSCNCP  322



>ref|XP_007020823.1| Brassinosteroid insensitive 1-associated receptor kinase 1 precursor 
[Theobroma cacao]
 gb|EOY12348.1| Brassinosteroid insensitive 1-associated receptor kinase 1 precursor 
[Theobroma cacao]
Length=812

 Score = 48.9 bits (115),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 20/48 (42%), Positives = 29/48 (60%), Gaps = 0/48 (0%)
 Frame = +3

Query  3    TWTSIWSQPDNICYAMYFGNDNLGGGACGYNSVCSVDANKRPSCECPP  146
            +W++ W +P +IC +       LG G CGYN++C    N RP+C CPP
Sbjct  276  SWSAWWIRPKDICSSFVDSTARLGNGPCGYNTICESLNNGRPNCSCPP  323



>emb|CAH67714.1| H0512B01.9 [Oryza sativa Indica Group]
Length=385

 Score = 48.5 bits (114),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 23/50 (46%), Positives = 33/50 (66%), Gaps = 5/50 (10%)
 Frame = +3

Query  3    TWTSIWSQPDNICYAMYFGNDNLGGGACGYNSVCSVDA--NKRPSCECPP  146
            TWT++  QP NIC+A+     ++G G CG+NS C+ D   N+  SC+CPP
Sbjct  285  TWTAVSMQPQNICHAIV---SDVGSGVCGFNSYCTFDGTRNQIASCQCPP  331



>gb|EAY93041.1| hypothetical protein OsI_14840 [Oryza sativa Indica Group]
Length=590

 Score = 48.5 bits (114),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 23/50 (46%), Positives = 33/50 (66%), Gaps = 5/50 (10%)
 Frame = +3

Query  3    TWTSIWSQPDNICYAMYFGNDNLGGGACGYNSVCSVDA--NKRPSCECPP  146
            TWT++  QP NIC+A+     ++G G CG+NS C+ D   N+  SC+CPP
Sbjct  285  TWTALSMQPQNICHAIV---SDVGSGVCGFNSYCTFDGTRNQIASCQCPP  331



>ref|XP_009769630.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase RLK1 [Nicotiana sylvestris]
Length=790

 Score = 48.5 bits (114),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 21/46 (46%), Positives = 31/46 (67%), Gaps = 4/46 (9%)
 Frame = +3

Query  6    WTSIWSQPDNICYAMYFGNDNLGGGACGYNSVCSVDANKRPSCECP  143
            W+++ + PDNIC        ++GGGACG+NS+CS+  N+R  C CP
Sbjct  273  WSTLHNIPDNICTL----RQSVGGGACGFNSICSMGTNQRSRCICP  314



>ref|XP_004511723.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase RLK1-like [Cicer arietinum]
Length=806

 Score = 48.5 bits (114),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 23/46 (50%), Positives = 32/46 (70%), Gaps = 4/46 (9%)
 Frame = +3

Query  6    WTSIWSQPDNICYAMYFGNDNLGGGACGYNSVCSVDANKRPSCECP  143
            W+ +   PDNIC A++   +  G G CGYNS CS++ N+RPSC+CP
Sbjct  281  WSIVRYVPDNICIAIF---NEKGSGTCGYNSYCSME-NQRPSCKCP  322



>ref|XP_009365142.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At1g11330 [Pyrus x bretschneideri]
Length=764

 Score = 48.5 bits (114),  Expect = 9e-05, Method: Composition-based stats.
 Identities = 21/47 (45%), Positives = 30/47 (64%), Gaps = 8/47 (17%)
 Frame = +3

Query  3    TWTS-IWSQPDNICYAMYFGNDNLGGGACGYNSVCSVDANKRPSCEC  140
            +W S +   PD+IC         LG G CGYNS+C++ ++KRP+CEC
Sbjct  288  SWISPLVYMPDDICL-------KLGVGVCGYNSICTLKSDKRPNCEC  327



>ref|XP_006440216.1| hypothetical protein CICLE_v10018901mg [Citrus clementina]
 gb|ESR53456.1| hypothetical protein CICLE_v10018901mg [Citrus clementina]
Length=804

 Score = 48.1 bits (113),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 24/48 (50%), Positives = 31/48 (65%), Gaps = 4/48 (8%)
 Frame = +3

Query  3    TWTSIWSQPDNICYAMYFGNDNLGGGACGYNSVCSVDANKRPSCECPP  146
            +W +I   P+NIC A+   +D  G GACG+NS C +  N RP CECPP
Sbjct  280  SWFTIRRLPNNICTAI---SDEFGSGACGFNSYCLLQ-NGRPFCECPP  323



>ref|XP_009376525.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase RLK1 [Pyrus x bretschneideri]
Length=446

 Score = 48.1 bits (113),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 21/48 (44%), Positives = 32/48 (67%), Gaps = 4/48 (8%)
 Frame = +3

Query  3    TWTS-IWSQPDNICYAMYFGNDNLGGGACGYNSVCSVDANKRPSCECP  143
            +W+S +W QP +IC  +    ++ G G CGYNS+C +  + RP+CECP
Sbjct  286  SWSSPLWYQPVDICQTLL---EDAGVGVCGYNSICKLKPDNRPTCECP  330



>ref|XP_009364705.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase RLK1 [Pyrus x bretschneideri]
Length=808

 Score = 48.1 bits (113),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 22/49 (45%), Positives = 34/49 (69%), Gaps = 5/49 (10%)
 Frame = +3

Query  3    TWTS-IWSQPDN-ICYAMYFGNDNLGGGACGYNSVCSVDANKRPSCECP  143
            +W+S +W +PD+ IC  +    +++G G CGYNSVC +  + RP+CECP
Sbjct  285  SWSSPLWYKPDDDICQTLL---EDMGVGVCGYNSVCKLKTDNRPTCECP  330



>ref|XP_008782878.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase RLK1 [Phoenix dactylifera]
Length=811

 Score = 48.1 bits (113),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 21/46 (46%), Positives = 29/46 (63%), Gaps = 3/46 (7%)
 Frame = +3

Query  6    WTSIWSQPDNICYAMYFGNDNLGGGACGYNSVCSVDANKRPSCECP  143
            WT++   P +IC  +     ++G GACG+NS C +D NKRP C CP
Sbjct  290  WTAVDVIPSDICTRVL---TDVGSGACGFNSFCVLDENKRPDCRCP  332



>ref|XP_008352754.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase RLK1 [Malus domestica]
Length=445

 Score = 47.4 bits (111),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 22/48 (46%), Positives = 31/48 (65%), Gaps = 4/48 (8%)
 Frame = +3

Query  3    TWTS-IWSQPDNICYAMYFGNDNLGGGACGYNSVCSVDANKRPSCECP  143
            +W+S +W QP +IC  +  G    G G CGYNS+C +  + RP+CECP
Sbjct  285  SWSSPLWYQPVDICQTLLEG---AGVGVCGYNSICKLKPDNRPTCECP  329



>ref|XP_009364740.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase RLK1 isoform X1 [Pyrus x bretschneideri]
Length=808

 Score = 47.8 bits (112),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 22/48 (46%), Positives = 33/48 (69%), Gaps = 5/48 (10%)
 Frame = +3

Query  6    WTS-IWSQPDN-ICYAMYFGNDNLGGGACGYNSVCSVDANKRPSCECP  143
            W+S +W +PD+ IC  +    +++G G CGYNSVC +  + RP+CECP
Sbjct  286  WSSPLWYKPDDDICQTLL---EDMGVGVCGYNSVCKLKTDNRPTCECP  330



>gb|KFK27854.1| hypothetical protein AALP_AA8G438100 [Arabis alpina]
Length=836

 Score = 47.8 bits (112),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 22/46 (48%), Positives = 30/46 (65%), Gaps = 3/46 (7%)
 Frame = +3

Query  6    WTSIWSQPDNICYAMYFGNDNLGGGACGYNSVCSVDANKRPSCECP  143
            WT  WS+P+NIC        N+   ACG+NS+C++  NKRP C+CP
Sbjct  292  WTLAWSEPENICDRSAADVLNI---ACGFNSICNLGNNKRPKCQCP  334



>ref|XP_009364742.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase RLK1 isoform X2 [Pyrus x bretschneideri]
Length=763

 Score = 47.8 bits (112),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 22/48 (46%), Positives = 33/48 (69%), Gaps = 5/48 (10%)
 Frame = +3

Query  6    WTS-IWSQPDN-ICYAMYFGNDNLGGGACGYNSVCSVDANKRPSCECP  143
            W+S +W +PD+ IC  +    +++G G CGYNSVC +  + RP+CECP
Sbjct  286  WSSPLWYKPDDDICQTLL---EDMGVGVCGYNSVCKLKTDNRPTCECP  330



>ref|XP_006368974.1| hypothetical protein POPTR_0001s15360g [Populus trichocarpa]
 gb|ERP65543.1| hypothetical protein POPTR_0001s15360g [Populus trichocarpa]
Length=776

 Score = 47.8 bits (112),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 19/47 (40%), Positives = 33/47 (70%), Gaps = 3/47 (6%)
 Frame = +3

Query  6    WTSIWSQPDNICYAMYFGNDNLGGGACGYNSVCSVDANKRPSCECPP  146
            W  + S P ++C A++   +++G G CG+NS CS+  N++P+C+CPP
Sbjct  253  WWPVQSIPLDMCTAIF---NDIGSGPCGFNSYCSIQENRKPTCDCPP  296



>gb|KDO36845.1| hypothetical protein CISIN_1g041576mg [Citrus sinensis]
Length=714

 Score = 47.4 bits (111),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/48 (48%), Positives = 31/48 (65%), Gaps = 4/48 (8%)
 Frame = +3

Query  3    TWTSIWSQPDNICYAMYFGNDNLGGGACGYNSVCSVDANKRPSCECPP  146
            +W +I   P+NIC ++   +D  G GACG+NS C +  N RP CECPP
Sbjct  223  SWFTIQRLPNNICTSI---SDEFGSGACGFNSYCLLQ-NGRPFCECPP  266



>ref|XP_008366172.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase RLK1, partial [Malus domestica]
Length=592

 Score = 47.4 bits (111),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 20/48 (42%), Positives = 31/48 (65%), Gaps = 4/48 (8%)
 Frame = +3

Query  3    TWTSIWSQPD-NICYAMYFGNDNLGGGACGYNSVCSVDANKRPSCECP  143
            +W++ W  PD +IC  +    ++ G G CGYNS+C +  + RP+CECP
Sbjct  68   SWSTPWYMPDGDICQTL---REDTGVGVCGYNSICKLKTDNRPTCECP  112



>ref|XP_006440220.1| hypothetical protein CICLE_v10018902mg [Citrus clementina]
 gb|ESR53460.1| hypothetical protein CICLE_v10018902mg [Citrus clementina]
Length=804

 Score = 47.4 bits (111),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/48 (48%), Positives = 31/48 (65%), Gaps = 4/48 (8%)
 Frame = +3

Query  3    TWTSIWSQPDNICYAMYFGNDNLGGGACGYNSVCSVDANKRPSCECPP  146
            +W +I   P+NIC ++   +D  G GACG+NS C +  N RP CECPP
Sbjct  280  SWFTIQRLPNNICTSI---SDEFGSGACGFNSYCLLQ-NGRPFCECPP  323



>ref|XP_008367506.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase RLK1 [Malus domestica]
Length=601

 Score = 47.0 bits (110),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 21/48 (44%), Positives = 29/48 (60%), Gaps = 8/48 (17%)
 Frame = +3

Query  3    TWTSIWS-QPDNICYAMYFGNDNLGGGACGYNSVCSVDANKRPSCECP  143
            +W+S  S +PD+IC         LG G CG NS+C +  + RP+CECP
Sbjct  80   SWSSPLSYKPDDICLT-------LGAGVCGNNSICKLKPDNRPTCECP  120



>ref|XP_004228920.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase RLK1 [Solanum lycopersicum]
Length=593

 Score = 47.0 bits (110),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 22/46 (48%), Positives = 29/46 (63%), Gaps = 3/46 (7%)
 Frame = +3

Query  6    WTSIWSQPDNICYAMYFGNDNLGGGACGYNSVCSVDANKRPSCECP  143
            W  +WSQ +NIC  +   + N G G+C YN+VCS+  N RP C CP
Sbjct  203  WNILWSQQNNICIEI---DGNNGPGSCSYNNVCSLGTNNRPVCNCP  245



>emb|CAN59767.1| hypothetical protein VITISV_011718 [Vitis vinifera]
Length=771

 Score = 47.0 bits (110),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 20/40 (50%), Positives = 29/40 (73%), Gaps = 3/40 (8%)
 Frame = +3

Query  27   PDNICYAMYFGNDNLGGGACGYNSVCSVDANKRPSCECPP  146
            P+NIC ++     + GGGACG+NS C +  ++RPSC+CPP
Sbjct  286  PENICTSI---GASTGGGACGFNSYCRLGDBQRPSCQCPP  322



>ref|XP_008392855.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase RLK1 [Malus domestica]
Length=809

 Score = 47.0 bits (110),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 20/48 (42%), Positives = 31/48 (65%), Gaps = 4/48 (8%)
 Frame = +3

Query  3    TWTSIWSQPD-NICYAMYFGNDNLGGGACGYNSVCSVDANKRPSCECP  143
            +W++ W  PD +IC  +    ++ G G CGYNS+C +  + RP+CECP
Sbjct  285  SWSTPWYMPDGDICQTL---REDTGVGVCGYNSICKLKTDNRPTCECP  329



>ref|XP_010265966.1| PREDICTED: LOW QUALITY PROTEIN: G-type lectin S-receptor-like 
serine/threonine-protein kinase RLK1 [Nelumbo nucifera]
Length=787

 Score = 47.0 bits (110),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 23/48 (48%), Positives = 28/48 (58%), Gaps = 4/48 (8%)
 Frame = +3

Query  3    TWTSIWSQPDNICYAMYFGNDNLGGGACGYNSVCSVDANKRPSCECPP  146
            +W S+W  P+NIC A     +N G G CGYNS C +    RP C CPP
Sbjct  261  SWQSLWRIPNNICLA---APNNFGSGPCGYNSYCRLHEG-RPVCYCPP  304



>gb|KDO38591.1| hypothetical protein CISIN_1g039324mg, partial [Citrus sinensis]
Length=462

 Score = 46.6 bits (109),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 23/48 (48%), Positives = 31/48 (65%), Gaps = 4/48 (8%)
 Frame = +3

Query  3    TWTSIWSQPDNICYAMYFGNDNLGGGACGYNSVCSVDANKRPSCECPP  146
            +W +I   P+NIC ++   +D  G GACG+NS C +  N RP CECPP
Sbjct  280  SWFTIQRLPNNICTSI---SDEFGSGACGFNSYCLLQ-NGRPFCECPP  323



>gb|KCW45163.1| hypothetical protein EUGRSUZ_L01210 [Eucalyptus grandis]
Length=670

 Score = 46.6 bits (109),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 19/45 (42%), Positives = 29/45 (64%), Gaps = 3/45 (7%)
 Frame = +3

Query  3    TWTSIWSQPDNICYAMYFGNDNLGGGACGYNSVCSVDANKRPSCE  137
            +W  +WSQP++IC  +   +   G G CGYNS+C++  N RP C+
Sbjct  156  SWKPLWSQPEDICAKVQVRD---GIGVCGYNSICTMGENNRPKCD  197



>ref|XP_006440225.1| hypothetical protein CICLE_v10018906mg [Citrus clementina]
 gb|ESR53465.1| hypothetical protein CICLE_v10018906mg [Citrus clementina]
Length=801

 Score = 46.6 bits (109),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 24/48 (50%), Positives = 31/48 (65%), Gaps = 4/48 (8%)
 Frame = +3

Query  3    TWTSIWSQPDNICYAMYFGNDNLGGGACGYNSVCSVDANKRPSCECPP  146
            +W +I   P+N C A+   +D LG GACG+NS C +  N RP CECPP
Sbjct  280  SWFTIQRLPNNKCRAI---SDMLGSGACGFNSYCLMQ-NGRPFCECPP  323



>emb|CBI16445.3| unnamed protein product [Vitis vinifera]
Length=596

 Score = 46.2 bits (108),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 23/48 (48%), Positives = 33/48 (69%), Gaps = 4/48 (8%)
 Frame = +3

Query  6    WTSIWS-QPDNICYAMYFGNDNLGGGACGYNSVCSVDANKRPSCECPP  146
            W+S+ S  P+NIC A+  G    G GACG+NS C++  ++RP C+CPP
Sbjct  307  WSSLSSFIPENICTAITAGT---GSGACGFNSYCTLGDDQRPYCQCPP  351



>ref|XP_007020824.1| Brassinosteroid insensitive 1-associated receptor kinase 1 precursor 
[Theobroma cacao]
 gb|EOY12349.1| Brassinosteroid insensitive 1-associated receptor kinase 1 precursor 
[Theobroma cacao]
Length=811

 Score = 46.6 bits (109),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 21/48 (44%), Positives = 29/48 (60%), Gaps = 1/48 (2%)
 Frame = +3

Query  3    TWTSIWSQPDNICYAMYFGNDNLGGGACGYNSVCSVDANKRPSCECPP  146
            +W++ W +P +IC +       LG G CGYNS+C    N RP+C CPP
Sbjct  276  SWSAWWFRPKDICSSFVDSTARLGNGPCGYNSICE-PINGRPNCTCPP  322



>ref|XP_002283213.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase RLK1 [Vitis vinifera]
Length=800

 Score = 46.6 bits (109),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 21/40 (53%), Positives = 27/40 (68%), Gaps = 3/40 (8%)
 Frame = +3

Query  27   PDNICYAMYFGNDNLGGGACGYNSVCSVDANKRPSCECPP  146
            P+NIC  +     + GGGACG+NS C +  N+RPSC CPP
Sbjct  286  PENICTRI---GASTGGGACGFNSYCRLGDNQRPSCHCPP  322



>emb|CAN59768.1| hypothetical protein VITISV_011719 [Vitis vinifera]
Length=794

 Score = 46.2 bits (108),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 23/48 (48%), Positives = 33/48 (69%), Gaps = 4/48 (8%)
 Frame = +3

Query  6    WTSIWS-QPDNICYAMYFGNDNLGGGACGYNSVCSVDANKRPSCECPP  146
            W+S+ S  P+NIC A+  G    G GACG+NS C++  ++RP C+CPP
Sbjct  282  WSSLSSFIPENICTAITAGT---GSGACGFNSYCTLGDDQRPYCQCPP  326



>emb|CBI16444.3| unnamed protein product [Vitis vinifera]
Length=804

 Score = 46.2 bits (108),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 21/40 (53%), Positives = 27/40 (68%), Gaps = 3/40 (8%)
 Frame = +3

Query  27   PDNICYAMYFGNDNLGGGACGYNSVCSVDANKRPSCECPP  146
            P+NIC  +     + GGGACG+NS C +  N+RPSC CPP
Sbjct  134  PENICTRI---GASTGGGACGFNSYCRLGDNQRPSCHCPP  170



>ref|XP_006477571.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase RLK1-like [Citrus sinensis]
Length=747

 Score = 46.2 bits (108),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 23/48 (48%), Positives = 30/48 (63%), Gaps = 4/48 (8%)
 Frame = +3

Query  3    TWTSIWSQPDNICYAMYFGNDNLGGGACGYNSVCSVDANKRPSCECPP  146
            +W +    P+NIC A+   +D  G GACG+NS C +  N RP CECPP
Sbjct  223  SWFTTRRLPNNICTAI---SDEFGSGACGFNSYCLLQ-NGRPFCECPP  266



>ref|XP_007207728.1| hypothetical protein PRUPE_ppb016806mg [Prunus persica]
 gb|EMJ08927.1| hypothetical protein PRUPE_ppb016806mg [Prunus persica]
Length=377

 Score = 45.4 bits (106),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 21/48 (44%), Positives = 31/48 (65%), Gaps = 4/48 (8%)
 Frame = +3

Query  3    TWTSIWSQPDNICYAMYFGNDNLGGGACGYNSVCSVD-ANKRPSCECP  143
            +W  +WS P+NIC  +   + + G G CG  S+C++  A+KRP CECP
Sbjct  193  SWEPLWSLPENICLDI---DADKGPGVCGLTSICTLSAADKRPKCECP  237



>ref|XP_006388389.1| hypothetical protein POPTR_0200s00210g [Populus trichocarpa]
 gb|ERP47303.1| hypothetical protein POPTR_0200s00210g [Populus trichocarpa]
Length=834

 Score = 45.8 bits (107),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 23/48 (48%), Positives = 31/48 (65%), Gaps = 4/48 (8%)
 Frame = +3

Query  6    WTSIW-SQPDNICYAMYFGNDNLGGGACGYNSVCSVDANKRPSCECPP  146
            WT++  S P NIC  +       GGGACG+NS C +  ++RPSC+CPP
Sbjct  282  WTTLSNSIPSNICLRI---TGQEGGGACGFNSYCRLADDQRPSCKCPP  326



>ref|XP_006598212.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase RLK1-like [Glycine max]
Length=885

 Score = 45.8 bits (107),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 19/46 (41%), Positives = 30/46 (65%), Gaps = 3/46 (7%)
 Frame = +3

Query  6    WTSIWSQPDNICYAMYFGNDNLGGGACGYNSVCSVDANKRPSCECP  143
            W +  + P+NIC +  F +   G G CG+NS+C++ A++RP C CP
Sbjct  368  WVTTKTIPENICLSSTFTD---GEGVCGFNSICNLKADQRPICNCP  410



>ref|XP_010265967.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase RLK1 [Nelumbo nucifera]
Length=805

 Score = 45.8 bits (107),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 23/48 (48%), Positives = 27/48 (56%), Gaps = 4/48 (8%)
 Frame = +3

Query  3    TWTSIWSQPDNICYAMYFGNDNLGGGACGYNSVCSVDANKRPSCECPP  146
            +W S+W  PDNIC       + LG G CGYNS C +    RP C CPP
Sbjct  279  SWKSLWIIPDNICLTT---PNKLGSGPCGYNSYCRLHEG-RPVCYCPP  322



>ref|XP_007020825.1| Brassinosteroid insensitive 1-associated receptor kinase 1 precursor 
[Theobroma cacao]
 gb|EOY12350.1| Brassinosteroid insensitive 1-associated receptor kinase 1 precursor 
[Theobroma cacao]
Length=812

 Score = 45.4 bits (106),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 21/48 (44%), Positives = 28/48 (58%), Gaps = 1/48 (2%)
 Frame = +3

Query  3    TWTSIWSQPDNICYAMYFGNDNLGGGACGYNSVCSVDANKRPSCECPP  146
            +W++ W +P +IC         LG G CGYNS+C    N RP+C CPP
Sbjct  276  SWSAWWFRPRDICSRFVDSTARLGNGPCGYNSICE-PINGRPNCTCPP  322



>emb|CDP14432.1| unnamed protein product [Coffea canephora]
Length=732

 Score = 45.4 bits (106),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 22/46 (48%), Positives = 29/46 (63%), Gaps = 4/46 (9%)
 Frame = +3

Query  6    WTSIWSQPDNICYAMYFGNDNLGGGACGYNSVCSVDANKRPSCECP  143
            WT +WS+PDNIC  +       G GACG+NSVC ++ + R  C CP
Sbjct  247  WTILWSKPDNICIRI---AGEKGSGACGFNSVCHLE-HGRAVCACP  288



>ref|XP_010673551.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase RLK1 [Beta vulgaris subsp. vulgaris]
Length=824

 Score = 45.4 bits (106),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 19/47 (40%), Positives = 30/47 (64%), Gaps = 4/47 (9%)
 Frame = +3

Query  3    TWTSIWSQPDNICYAMYFGNDNLGGGACGYNSVCSVDANKRPSCECP  143
             W +  ++PDNIC  +       G G CGYNS+C++  ++RP+C+CP
Sbjct  294  VWPTTNTRPDNICNYVAIA----GSGICGYNSICNIGQDQRPTCKCP  336



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 518927142240