BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c60603_g1_i1 len=284 path=[262:0-283]

Length=284
                                                                      Score     E

emb|CDP04546.1|  unnamed protein product                                113   8e-28   
gb|AIY24422.1|  fpps protein                                            111   3e-27   
gb|AAK63847.1|AF384040_1  farnesyl diphosphate synthase                 110   6e-27   Mentha x piperita
ref|XP_011095887.1|  PREDICTED: farnesyl pyrophosphate synthase 1       110   9e-27   
gb|ADV03080.1|  farnesyl diphosphate synthase                           108   3e-26   
gb|ABV08819.1|  farnesyl diphosphate synthetase                         108   5e-26   
gb|AGQ04160.1|  farnesyl diphosphate synthase                           108   7e-26   
ref|XP_010245026.1|  PREDICTED: farnesyl pyrophosphate synthase 1...    107   8e-26   
ref|XP_010252841.1|  PREDICTED: farnesyl pyrophosphate synthase 1...    107   1e-25   
gb|AGH33733.1|  farnesyl diphosphate synthase                           106   1e-25   
gb|ADH95185.1|  putative farnesyl diphosphate synthase                  105   4e-25   
gb|AHG54251.1|  farnesyl pyrophosphate synthase 1                       105   8e-25   
dbj|BAA88844.1|  Farnesyl pyrophosphate synthase                        103   2e-24   Gentiana lutea
gb|ABR09548.1|  farnesyl diphosphate synthase isoform                   103   3e-24   Hevea brasiliensis [jebe]
dbj|BAF98301.1|  farnesyl-diphosphate synthase                          103   3e-24   Hevea brasiliensis [jebe]
gb|AAM98379.1|  farnesyl diphosphate synthase                           103   4e-24   Hevea brasiliensis [jebe]
gb|EYU34872.1|  hypothetical protein MIMGU_mgv1a014839mg                100   4e-24   
gb|ACN63187.1|  farnesyl diphosphate synthase                           102   5e-24   Euphorbia pekinensis
gb|AHC30884.1|  farnesyl pyrophosphate synthetase 1                     102   5e-24   
sp|P49352.1|FPPS2_LUPAL  RecName: Full=Farnesyl pyrophosphate syn...    102   6e-24   Lupinus albus
gb|AGS79228.1|  farnesyl diphosphate synthase                           102   9e-24   
gb|AFP19446.1|  farnesyl pyrophosphate synthase                         102   9e-24   
dbj|BAB40665.1|  farnesyl pyrophosphate synthase                        102   9e-24   Humulus lupulus [common hop]
gb|ADK12004.1|  farnesyl diphosphate synthase                           102   9e-24   
gb|ADJ68004.1|  farnesyl diphosphate synthase                           102   1e-23   
gb|AAY53905.1|  farnesyl pyrophosphate synthase                         102   1e-23   Panax notoginseng [san-qi]
gb|AAY87903.1|  farnesyl diphosphate synthase                           102   1e-23   Panax ginseng [Chinese ginseng]
ref|XP_010538436.1|  PREDICTED: farnesyl pyrophosphate synthase 2...    102   1e-23   
ref|XP_008463030.1|  PREDICTED: farnesyl pyrophosphate synthase 1...    102   1e-23   
ref|XP_010103952.1|  Farnesyl pyrophosphate synthase 1                  101   1e-23   
gb|KDP35531.1|  hypothetical protein JCGZ_08969                         101   1e-23   
ref|XP_004149409.1|  PREDICTED: farnesyl pyrophosphate synthase 1...    101   2e-23   
gb|EYU33721.1|  hypothetical protein MIMGU_mgv1a008270mg                101   2e-23   
gb|AAV58896.1|  farnesyl diphosphate synthase                           100   2e-23   Centella asiatica [Asiatic pennywort]
gb|ADL74465.1|  farnesyl diphosphate synthase                           100   3e-23   
gb|AFX68799.1|  farnesyl pyrophosphate synthase                         100   3e-23   
sp|P49351.1|FPPS1_LUPAL  RecName: Full=Farnesyl pyrophosphate syn...    100   3e-23   Lupinus albus
gb|ACJ38671.1|  farnesyl pyrophosphate synthase                         100   4e-23   Chimonanthus praecox [wintersweet]
gb|AHI44281.1|  farnesyl pyrophosphate synthase                         100   4e-23   
ref|XP_006352551.1|  PREDICTED: farnesyl pyrophosphate synthase 1...    100   4e-23   
gb|KHG28027.1|  Farnesyl pyrophosphate synthase 1                       100   4e-23   
gb|AFO67222.1|  putative farnesyl diphosphate synthase                99.4    4e-23   
ref|XP_011086283.1|  PREDICTED: farnesyl pyrophosphate synthase 1...    100   5e-23   
ref|XP_006352550.1|  PREDICTED: farnesyl pyrophosphate synthase 1...    100   5e-23   
gb|ACS74708.1|  farnesyl pyrophosphate synthase                         100   5e-23   Magnolia chapensis
emb|CAA72793.1|  farnesyl pyrophosphate synthase                        100   5e-23   Gossypium arboreum [tree cotton]
emb|CDP13684.1|  unnamed protein product                                100   6e-23   
gb|AEG47693.1|  farnesyl diphosphate synthase                         99.8    6e-23   
ref|XP_007026400.1|  Farnesyl diphosphate synthase 1 isoform 3        99.4    7e-23   
ref|XP_010675977.1|  PREDICTED: farnesyl pyrophosphate synthase 1...  99.8    8e-23   
gb|AAK58594.1|AF268889_1  farnesyl pyrophosphate synthase             99.8    8e-23   Humulus lupulus [common hop]
gb|AEH30663.1|  farnesyl diphosphate synthase                         99.4    8e-23   
ref|XP_007026399.1|  Farnesyl diphosphate synthase 1 isoform 2        99.4    8e-23   
ref|XP_002534338.1|  farnesyl-pyrophosphate synthetase, putative      99.4    1e-22   Ricinus communis
ref|XP_009374835.1|  PREDICTED: farnesyl pyrophosphate synthase 1     99.0    1e-22   
ref|XP_008366094.1|  PREDICTED: farnesyl pyrophosphate synthase 2     99.0    1e-22   
gb|AFW98439.1|  farnesyl diphosphate synthase                         99.0    1e-22   
ref|XP_007026398.1|  Farnesyl diphosphate synthase 1 isoform 1        99.0    1e-22   
ref|XP_008370962.1|  PREDICTED: farnesyl pyrophosphate synthase 2...  99.0    1e-22   
ref|XP_007211529.1|  hypothetical protein PRUPE_ppa008181mg           98.6    2e-22   
ref|NP_001280802.1|  farnesyl pyrophosphate synthase 2                98.6    2e-22   
dbj|BAB60822.1|  putative FPP synthase 2                              98.6    2e-22   Eucommia ulmoides
gb|AGJ03663.1|  putative farnesyl diphosphate synthase 2              98.6    2e-22   
ref|XP_011005729.1|  PREDICTED: farnesyl pyrophosphate synthase 1     98.6    2e-22   
gb|AEY77151.1|  farnesyl diphosphate synthase                         98.6    2e-22   
gb|AFW98436.1|  farnesyl diphosphate synthase                         98.6    2e-22   
ref|XP_008384598.1|  PREDICTED: farnesyl pyrophosphate synthase 2...  98.2    2e-22   
sp|O24242.1|FPPS2_PARAR  RecName: Full=Farnesyl pyrophosphate syn...  98.2    2e-22   Parthenium argentatum
gb|AFW98444.1|  farnesyl diphosphate synthase                         98.2    2e-22   
gb|AII72208.1|  farnesyl diphosphate synthase                         98.2    2e-22   
ref|NP_001267864.1|  farnesyl diphosphate synthase                    98.2    2e-22   
emb|CBI39786.3|  unnamed protein product                              98.2    3e-22   
gb|AFJ52720.1|  farnesyl pyrophosphate synthase                       98.2    3e-22   
ref|XP_007147577.1|  hypothetical protein PHAVU_006G136300g           97.8    3e-22   
ref|XP_009367257.1|  PREDICTED: farnesyl pyrophosphate synthase 2...  97.8    3e-22   
ref|XP_006414262.1|  hypothetical protein EUTSA_v10025643mg           97.8    4e-22   
sp|O64905.1|FPPS_HELAN  RecName: Full=Farnesyl pyrophosphate synt...  97.8    4e-22   Helianthus annuus
gb|EPS73263.1|  farnesyl diphosphate synthase                         92.4    4e-22   
ref|XP_008218685.1|  PREDICTED: farnesyl pyrophosphate synthase 1...  97.4    4e-22   
ref|XP_002308751.2|  farnesyl-pyrophosphate synthetase fps2 famil...  97.4    4e-22   Populus trichocarpa [western balsam poplar]
ref|XP_009347512.1|  PREDICTED: farnesyl pyrophosphate synthase 2...  97.4    4e-22   
ref|XP_008344722.1|  PREDICTED: farnesyl pyrophosphate synthase 2...  97.4    4e-22   
gb|ACD54840.1|  farnesyl pyrophosphate syntethase                     95.5    4e-22   Olea europaea
gb|ACD54842.1|  farnesyl pyrophosphate syntethase                     95.1    5e-22   Olea europaea
ref|XP_007205488.1|  hypothetical protein PRUPE_ppa008174mg           97.4    5e-22   
gb|ACD54841.1|  farnesyl pyrophosphate syntethase                     95.5    5e-22   Olea europaea
sp|O24241.1|FPPS1_PARAR  RecName: Full=Farnesyl pyrophosphate syn...  97.4    5e-22   Parthenium argentatum
ref|XP_006452656.1|  hypothetical protein CICLE_v10008832mg           97.1    5e-22   
dbj|BAB16687.2|  putative FPP synthase 1                              97.4    6e-22   Eucommia ulmoides
ref|XP_006452657.1|  hypothetical protein CICLE_v10008832mg           97.1    6e-22   
ref|XP_004248322.2|  PREDICTED: farnesyl pyrophosphate synthase 1...  97.1    6e-22   
gb|KHG22761.1|  Farnesyl pyrophosphate synthase 2                     97.1    6e-22   
gb|ACJ84427.1|  unknown                                               96.3    6e-22   Medicago truncatula
gb|AAN62522.1|  farnesyl pyrophosphate synthetase                     96.7    7e-22   Eucommia ulmoides
sp|P49350.1|FPPS_ARTAN  RecName: Full=Farnesyl pyrophosphate synt...  97.1    7e-22   Artemisia annua [sweet Annie]
gb|KHN14411.1|  Farnesyl pyrophosphate synthase 1                     97.1    7e-22   
ref|XP_003594327.1|  Farnesyl pyrophosphate synthase                  96.7    8e-22   
gb|ADZ57167.1|  farnesyl pyrophosphate synthase                       97.1    8e-22   
ref|XP_009621499.1|  PREDICTED: farnesyl pyrophosphate synthase 1...  96.7    8e-22   
gb|ADC32809.1|  farnesyl pyrophosphate synthase                       96.7    8e-22   Medicago sativa [alfalfa]
ref|NP_001242101.1|  uncharacterized protein LOC100782137             96.7    8e-22   
ref|XP_004486372.1|  PREDICTED: farnesyl pyrophosphate synthase 1...  96.7    8e-22   
gb|AFW98437.1|  farnesyl diphosphate synthase                         96.7    8e-22   
gb|AHN96159.1|  farnesyl diphosphate synthase 1                       96.7    9e-22   
gb|AFW98432.1|  farnesyl diphosphate synthase                         96.7    9e-22   
gb|AHZ21075.1|  farnesyl diphosphate synthase                         96.7    1e-21   
gb|AFW98438.1|  farnesyl diphosphate synthase                         96.7    1e-21   
gb|AID51444.1|  farnesyl diphosphate synthase                         96.3    1e-21   
gb|ABS11699.1|  farnesyl diphosphate synthase                         96.3    1e-21   Matricaria chamomilla var. recutita [German chamomile]
gb|AFW98435.1|  farnesyl diphosphate synthase                         96.3    1e-21   
gb|AGC03153.1|  farnesyl diphosphate synthase                         96.3    1e-21   
gb|AAD17204.1|  farnesyl diphosphate synthase                         96.3    1e-21   Artemisia annua [sweet Annie]
gb|AHA51120.1|  farnesyl pyrophosphate synthase                       96.3    1e-21   
gb|KGN45890.1|  hypothetical protein Csa_6G017060                     96.3    1e-21   
gb|AAD32648.1|  farnesyl diphosphate synthase                         95.9    1e-21   Artemisia annua [sweet Annie]
ref|XP_010057770.1|  PREDICTED: farnesyl pyrophosphate synthase 1...  95.9    2e-21   
ref|XP_008463060.1|  PREDICTED: farnesyl pyrophosphate synthase 1     95.9    2e-21   
gb|ADJ67472.1|  farnesyl pyrophosphate synthase                       95.9    2e-21   
sp|Q7XYS9.1|FPPS1_ARTSI  RecName: Full=Farnesyl diphosphate synth...  95.9    2e-21   Artemisia spiciformis
ref|XP_010057769.1|  PREDICTED: farnesyl pyrophosphate synthase 1...  95.9    2e-21   
emb|CDY17706.1|  BnaA06g35250D                                        95.9    2e-21   
ref|XP_009101386.1|  PREDICTED: LOW QUALITY PROTEIN: farnesyl pyr...  95.9    2e-21   
ref|XP_004138366.1|  PREDICTED: farnesyl pyrophosphate synthase 1...  95.9    2e-21   
ref|XP_004169698.1|  PREDICTED: farnesyl pyrophosphate synthase 1...  95.9    2e-21   
gb|ADR10437.1|  farnesyl pyrophosphate synthase                       95.9    2e-21   
emb|CDX77796.1|  BnaC07g20500D                                        95.9    2e-21   
gb|AGJ71757.1|  farnesyl pyrophosphate synthase                       95.5    2e-21   
ref|XP_004293412.1|  PREDICTED: farnesyl pyrophosphate synthase 1...  95.5    2e-21   
ref|XP_009594047.1|  PREDICTED: farnesyl pyrophosphate synthase 1...  95.5    2e-21   
ref|XP_009764692.1|  PREDICTED: farnesyl pyrophosphate synthase 1...  95.1    3e-21   
ref|XP_006857726.1|  hypothetical protein AMTR_s00061p00181710        95.1    3e-21   
gb|KHN40776.1|  Farnesyl pyrophosphate synthase 1                     95.1    3e-21   
gb|KCW75066.1|  hypothetical protein EUGRSUZ_E038361                  92.4    3e-21   
ref|XP_003534984.1|  PREDICTED: farnesyl pyrophosphate synthase 1...  95.1    3e-21   
gb|AFW98433.1|  farnesyl diphosphate synthase                         95.1    3e-21   
gb|AFO67224.1|  putative farnesyl diphosphate synthase                91.7    3e-21   
gb|KFK31348.1|  farnesyl diphosphate synthase                         95.1    3e-21   
ref|XP_009360776.1|  PREDICTED: farnesyl pyrophosphate synthase 2...  95.1    3e-21   
ref|XP_006286338.1|  hypothetical protein CARUB_v100056561mg          93.2    3e-21   
ref|XP_007205487.1|  hypothetical protein PRUPE_ppa008174mg           94.4    3e-21   
gb|AIU80188.1|  farnesyl pyrophosphate synthase                       95.1    4e-21   
ref|XP_007020420.1|  Farnesyl diphosphate synthase 2                  94.7    4e-21   
ref|XP_004302404.1|  PREDICTED: farnesyl pyrophosphate synthase 1...  94.7    4e-21   
gb|ADE18770.1|  farnesyl-diphosphate synthase                         94.7    4e-21   
ref|XP_003567976.1|  PREDICTED: farnesyl pyrophosphate synthase       94.7    4e-21   
gb|AFK38522.1|  unknown                                               94.7    5e-21   
gb|AAR27053.1|  farnesyl diphosphate synthetase                       94.7    5e-21   Ginkgo biloba [ginkgo]
gb|AFW98443.1|  farnesyl diphosphate synthase                         94.4    6e-21   
gb|AFW98442.1|  farnesyl diphosphate synthase                         94.4    6e-21   
gb|AAK68152.1|  farnesyldiphosphate synthase                          94.4    6e-21   Citrus x microcarpa [golden lime]
gb|AFW98445.1|  farnesyl diphosphate synthase                         94.0    8e-21   
gb|AFW98440.1|  farnesyl diphosphate synthase                         94.0    8e-21   
ref|XP_008792798.1|  PREDICTED: farnesyl pyrophosphate synthase 1...  94.0    8e-21   
gb|ADO95193.1|  farnesyl diphosphate synthase                         94.0    9e-21   
ref|XP_009759138.1|  PREDICTED: farnesyl pyrophosphate synthase 1...  93.6    1e-20   
gb|AFW98441.1|  farnesyl diphosphate synthase                         93.6    1e-20   
gb|AEM42979.1|  farnesyl diphosphate synthase                         93.6    1e-20   
gb|ACY80695.1|  farnesyl pyrophosphate synthase                       93.6    1e-20   Cyclocarya paliurus [qing qian liu]
emb|CDY28904.1|  BnaA02g25720D                                        93.6    1e-20   
ref|XP_006398480.1|  hypothetical protein EUTSA_v10000912mg           94.0    1e-20   
ref|XP_010924112.1|  PREDICTED: farnesyl pyrophosphate synthase-l...  93.2    1e-20   
ref|XP_010924111.1|  PREDICTED: farnesyl pyrophosphate synthase-l...  93.2    1e-20   
sp|Q7XYT0.1|FPPS2_ARTSI  RecName: Full=Farnesyl diphosphate synth...  93.2    1e-20   Artemisia spiciformis
ref|XP_010924109.1|  PREDICTED: farnesyl pyrophosphate synthase 1...  93.2    1e-20   
ref|XP_010449657.1|  PREDICTED: farnesyl pyrophosphate synthase 2...  93.2    1e-20   
ref|XP_009128999.1|  PREDICTED: farnesyl pyrophosphate synthase 2     93.6    2e-20   
ref|XP_011097731.1|  PREDICTED: farnesyl pyrophosphate synthase-like  93.2    2e-20   
ref|XP_010494928.1|  PREDICTED: farnesyl pyrophosphate synthase 2...  93.2    2e-20   
ref|XP_010481370.1|  PREDICTED: farnesyl pyrophosphate synthase 1...  93.2    2e-20   
gb|AFV51840.1|  farnesyl pyrophosphate synthase                       92.8    2e-20   
ref|NP_193452.1|  farnesyl diphosphate synthase 2                     92.4    2e-20   Arabidopsis thaliana [mouse-ear cress]
gb|AFW98434.1|  farnesyl diphosphate synthase                         92.4    3e-20   
ref|XP_010434707.1|  PREDICTED: LOW QUALITY PROTEIN: farnesyl pyr...  92.4    3e-20   
ref|XP_002868080.1|  hypothetical protein ARALYDRAFT_493157           92.4    3e-20   
gb|ADO87007.1|  E,E-farnesyl diphosphate synthase                     92.0    4e-20   
gb|AEY80378.1|  farnesyl diphosphate synthase                         92.0    4e-20   
gb|AFV51836.1|  farnesyl pyrophosphate synthase                       92.0    4e-20   
gb|ADR83704.1|  farnesyl pyrophosphate synthase                       91.7    5e-20   
gb|AFV51839.1|  farnesyl pyrophosphate synthase                       92.0    5e-20   
emb|CAA59170.1|  dimethylallyltransferase                             91.7    5e-20   Capsicum annuum
gb|ADV03674.1|  farnesyl pyrophosphate synthase                       91.7    5e-20   
gb|AFV51841.1|  farnesyl pyrophosphate synthase                       90.9    6e-20   
ref|NP_001056204.1|  Os05g0543400                                     91.7    6e-20   Oryza sativa Japonica Group [Japonica rice]
emb|CDY68039.1|  BnaCnng57390D                                        91.7    7e-20   
ref|XP_008791170.1|  PREDICTED: farnesyl pyrophosphate synthase-l...  91.3    7e-20   
gb|EPS58847.1|  farnesyl diphosphate synthase                         86.7    7e-20   
ref|XP_004294906.1|  PREDICTED: farnesyl pyrophosphate synthase 1...  91.3    8e-20   
ref|XP_002522802.1|  farnesyl-pyrophosphate synthetase, putative      90.9    1e-19   Ricinus communis
ref|XP_006281527.1|  hypothetical protein CARUB_v10027627mg           90.9    1e-19   
gb|EMS61433.1|  Farnesyl pyrophosphate synthase                       90.5    1e-19   
dbj|BAJ84778.1|  predicted protein                                    90.5    1e-19   
gb|AIG15449.1|  farnesyl diphosphate synthase                         90.5    2e-19   
gb|ACA21460.1|  farnesyl diphosphate synthase 4                       90.5    2e-19   Picea abies
gb|AAS19931.1|  farnesyl diphosphate synthase                         90.1    2e-19   Taxus x media [hybrid yew]
ref|XP_002863368.1|  farnesyl diphosphate synthase short form         90.1    2e-19   
ref|XP_006644578.1|  PREDICTED: farnesyl pyrophosphate synthase-like  90.1    2e-19   
gb|EEC79629.1|  hypothetical protein OsI_20844                        90.1    2e-19   Oryza sativa Indica Group [Indian rice]
gb|ACN40171.1|  unknown                                               89.7    3e-19   Picea sitchensis
ref|XP_003569635.1|  PREDICTED: farnesyl pyrophosphate synthase-like  89.4    3e-19   
ref|XP_009418471.1|  PREDICTED: farnesyl pyrophosphate synthase 1...  89.0    5e-19   
gb|KDP39323.1|  hypothetical protein JCGZ_01080                       89.0    5e-19   
ref|NP_001141329.1|  hypothetical protein                             89.0    6e-19   Zea mays [maize]
gb|AER12202.1|  farnesyl pyrophosphate synthase                       88.6    7e-19   
ref|XP_009394514.1|  PREDICTED: farnesyl pyrophosphate synthase 1...  88.6    7e-19   
gb|AHM22931.1|  farnesyl pyrophosphate synthase 1                     88.6    7e-19   
ref|XP_006654732.1|  PREDICTED: farnesyl pyrophosphate synthase-like  87.8    1e-18   
ref|XP_010922982.1|  PREDICTED: farnesyl pyrophosphate synthase-l...  87.8    1e-18   
ref|XP_010922976.1|  PREDICTED: farnesyl pyrophosphate synthase-l...  87.8    1e-18   
gb|AAQ14872.1|AF330037_1  truncated farnesyl diphosphate synthase     87.4    2e-18   
ref|NP_001105039.1|  farnesyl pyrophosphate synthase                  87.4    2e-18   Zea mays [maize]
ref|XP_006344903.1|  PREDICTED: farnesyl pyrophosphate synthase 1...  87.4    2e-18   
gb|AAB07264.1|  farnesyl diphosphate synthase short form              87.4    2e-18   Arabidopsis thaliana [mouse-ear cress]
emb|CAA53433.1|  dimethylallyltransferase                             87.4    2e-18   Arabidopsis thaliana [mouse-ear cress]
gb|AAL82595.1|AF470318_1  farnesyl pyrophosphare synthase             87.4    2e-18   Musa acuminata [banana]
ref|NP_001234068.1|  farnesyl pyrophosphate synthase                  87.4    2e-18   
gb|AGC11811.1|  farnesyl pyrophosphate synthase B2                    87.0    3e-18   
ref|NP_199588.1|  farnesyl diphosphate synthase 1                     87.4    3e-18   Arabidopsis thaliana [mouse-ear cress]
gb|ACG34051.1|  farnesyl pyrophosphate synthetase                     86.7    4e-18   Zea mays [maize]
gb|ACG25973.1|  farnesyl pyrophosphate synthetase                     86.3    5e-18   Zea mays [maize]
ref|NP_001130900.1|  uncharacterized protein LOC100192004             86.3    5e-18   Zea mays [maize]
gb|AFW83683.1|  farnesyl pyrophosphate synthetase                     86.3    5e-18   
ref|XP_004969674.1|  PREDICTED: farnesyl pyrophosphate synthase-like  85.9    6e-18   
ref|XP_006652944.1|  PREDICTED: farnesyl pyrophosphate synthase-like  85.9    7e-18   
gb|AIL88642.1|  farnesyl diphosphate synthase                         85.9    8e-18   
gb|AEW09365.1|  hypothetical protein UMN_6728_01                      82.0    8e-18   
gb|AEW09366.1|  hypothetical protein UMN_6728_01                      81.6    9e-18   
ref|XP_002456217.1|  hypothetical protein SORBIDRAFT_03g032280        85.1    1e-17   Sorghum bicolor [broomcorn]
gb|AFZ61535.1|  chrysanthemol synthase                                85.5    1e-17   
sp|P0C565.1|CPPAS_TANCI  RecName: Full=Chrysanthemyl diphosphate ...  85.5    2e-17   Tanacetum cinerariifolium [pyrethrum]
gb|AGC11812.1|  farnesyl pyrophosphate synthase D2                    84.0    3e-17   
gb|AFG60626.1|  hypothetical protein UMN_6728_01                      80.1    4e-17   
ref|XP_008791173.1|  PREDICTED: farnesyl pyrophosphate synthase-l...  83.2    5e-17   
ref|XP_008791172.1|  PREDICTED: farnesyl pyrophosphate synthase-l...  83.2    5e-17   
ref|XP_008791171.1|  PREDICTED: farnesyl pyrophosphate synthase-l...  83.2    5e-17   
ref|XP_008791169.1|  PREDICTED: farnesyl pyrophosphate synthase-l...  83.2    6e-17   
ref|NP_001044000.1|  Os01g0703400                                     83.2    6e-17   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001054122.1|  Os04g0657300                                     84.0    7e-17   Oryza sativa Japonica Group [Japonica rice]
emb|CAH66696.1|  OSIGBa0158D24.4                                      83.6    7e-17   Oryza sativa [red rice]
ref|NP_001054121.1|  Os04g0657100                                     83.6    7e-17   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003580726.1|  PREDICTED: farnesyl pyrophosphate synthase 1...  83.6    9e-17   
gb|AFW98448.1|  chrysanthemyl diphosphate synthase                    83.2    1e-16   
emb|CAE03415.3|  OSJNBa0071I13.16                                     83.6    1e-16   Oryza sativa Japonica Group [Japonica rice]
dbj|BAJ90047.1|  predicted protein                                    82.0    2e-16   
pdb|4KK2|A  Chain A, Crystal Structure Of A Chimeric Fpp/gfpp Syn...  82.4    2e-16   
gb|EMS46921.1|  Farnesyl pyrophosphate synthase                       81.6    2e-16   
gb|AGC11810.1|  farnesyl pyrophosphate synthase A2                    81.6    2e-16   
sp|Q7XYS8.1|CHRDS_ARTSI  RecName: Full=Monoterpene synthase FDS-5...  82.4    2e-16   Artemisia spiciformis
ref|XP_010686608.1|  PREDICTED: farnesyl pyrophosphate synthase 1     81.3    3e-16   
ref|XP_006652943.1|  PREDICTED: farnesyl pyrophosphate synthase 1...  81.6    4e-16   
ref|XP_004961345.1|  PREDICTED: farnesyl pyrophosphate synthase-like  80.9    4e-16   
gb|AEY78646.1|  chrysanthemyl diphosphate synthase                    81.3    6e-16   
ref|XP_002441458.1|  hypothetical protein SORBIDRAFT_09g027190        80.5    7e-16   Sorghum bicolor [broomcorn]
gb|AFW98446.1|  chrysanthemyl diphosphate synthase                    80.5    9e-16   
dbj|BAJ84838.1|  predicted protein                                    80.1    2e-15   
dbj|BAJ92388.1|  predicted protein                                    79.7    2e-15   
gb|EMS60317.1|  Farnesyl pyrophosphate synthase                       79.3    4e-15   
ref|XP_002987912.1|  hypothetical protein SELMODRAFT_127038           78.2    6e-15   
gb|AFO53556.1|  farnesyl pyrophosphate synthase                       77.4    1e-14   
ref|XP_010449655.1|  PREDICTED: farnesyl pyrophosphate synthase 2...  76.3    3e-14   
gb|ADO17798.1|  chrysanthemyl diphosphate synthase                    76.6    3e-14   
gb|AFO53558.1|  farnesyl pyrophosphate synthase                       75.1    9e-14   
ref|XP_006352553.1|  PREDICTED: farnesyl pyrophosphate synthase 1...  73.9    2e-13   
gb|EEC71327.1|  hypothetical protein OsI_03373                        73.9    2e-13   Oryza sativa Indica Group [Indian rice]
ref|XP_010232182.1|  PREDICTED: farnesyl pyrophosphate synthase-l...  72.0    6e-13   
gb|AHG98061.1|  farnesyl diphosphate synthase                         72.0    7e-13   
ref|XP_010232181.1|  PREDICTED: farnesyl pyrophosphate synthase-l...  72.0    7e-13   
ref|XP_003569616.1|  PREDICTED: farnesyl pyrophosphate synthase-l...  72.0    8e-13   
gb|EEE61826.1|  hypothetical protein OsJ_16466                        72.8    8e-13   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004963391.1|  PREDICTED: LOW QUALITY PROTEIN: farnesyl pyr...  72.8    1e-12   
ref|XP_004248320.1|  PREDICTED: farnesyl pyrophosphate synthase 2...  70.9    2e-12   
gb|AFM78687.1|  farnesyl pyrophosphate synthase                       71.2    2e-12   
gb|EPT02690.1|  hypothetical protein FOMPIDRAFT_1015216               70.9    3e-12   
gb|EAZ13243.1|  hypothetical protein OsJ_03166                        70.5    4e-12   Oryza sativa Japonica Group [Japonica rice]
gb|AFW98447.1|  chrysanthemyl diphosphate synthase                    70.9    4e-12   
ref|XP_002972713.1|  hypothetical protein SELMODRAFT_173042           70.1    6e-12   
ref|XP_001768279.1|  predicted protein                                69.3    8e-12   
gb|KDD77020.1|  polyprenyl synthetase                                 68.9    1e-11   
ref|XP_002991307.1|  hypothetical protein SELMODRAFT_236261           66.6    7e-11   
ref|XP_002988082.1|  hypothetical protein SELMODRAFT_159144           66.2    1e-10   
gb|EMT15971.1|  Farnesyl pyrophosphate synthetase                     66.2    1e-10   
ref|XP_009551226.1|  hypothetical protein HETIRDRAFT_389280           65.1    3e-10   
ref|XP_007388550.1|  isoprenoid biosynthesis-like protein             65.1    3e-10   
gb|EAY75519.1|  hypothetical protein OsI_03423                        63.9    9e-10   
ref|XP_002554410.1|  KLTH0F04642p                                     63.5    9e-10   
emb|CDK25572.1|  unnamed protein product                              62.8    2e-09   
gb|ACB37020.1|  farnesyl-diphosphate synthase                         62.4    2e-09   
gb|EJU05113.1|  hypothetical protein DACRYDRAFT_20653                 62.4    3e-09   
ref|XP_001879398.1|  predicted protein                                62.4    3e-09   
ref|XP_007270730.1|  farnesyl-diphosphate synthase                    61.6    5e-09   
ref|XP_002498790.1|  ZYRO0G18634p                                     61.2    7e-09   
ref|XP_007868634.1|  farnesyl-diphosphate synthase                    61.2    9e-09   
gb|AFR13039.1|  farnesyl-diphosphate synthase                         60.8    9e-09   
gb|AFR13038.1|  farnesyl-diphosphate synthase                         60.8    9e-09   
ref|XP_008044628.1|  farnesyl-diphosphate synthase                    60.8    1e-08   
gb|EIE89971.1|  farnesyl pyrophosphate synthase                       60.5    1e-08   
gb|EMD31540.1|  hypothetical protein CERSUDRAFT_88901                 59.7    3e-08   
gb|EGN97321.1|  hypothetical protein SERLA73DRAFT_169696              59.7    3e-08   
ref|XP_008556783.1|  PREDICTED: farnesyl pyrophosphate synthase       59.7    3e-08   
ref|XP_007371273.1|  farnesyl-diphosphate synthase                    59.7    3e-08   
ref|XP_007320148.1|  hypothetical protein SERLADRAFT_471439           59.7    3e-08   
gb|KFM24775.1|  Glucose-1-phosphate adenylyltransferase small sub...  60.1    3e-08   
emb|CDO91830.1|  unnamed protein product                              59.3    4e-08   
gb|ESX02224.1|  Farnesyl pyrophosphate synthase                       59.3    4e-08   
ref|XP_005851791.1|  hypothetical protein CHLNCDRAFT_33543            58.9    4e-08   
ref|XP_006462763.1|  putative farnesyl diphosphate synthase           58.9    4e-08   
emb|CCU98963.1|  unnamed protein product                              58.9    4e-08   
ref|XP_007330115.1|  hypothetical protein AGABI1DRAFT_114026          58.9    5e-08   
gb|EEE55234.1|  hypothetical protein OsJ_03111                        58.9    5e-08   
gb|AFC92797.1|  farnesyl pyrophosphate synthase                       58.5    6e-08   
gb|KDQ49721.1|  hypothetical protein JAAARDRAFT_617078                58.9    6e-08   
gb|AAY33492.1|  bifunctional GPPS/FPPS isoprenyl diphosphate synt...  58.5    7e-08   
ref|XP_451300.1|  hypothetical protein                                58.5    7e-08   
emb|CDS06678.1|  Putative Farnesyl pyrophosphate synthase             58.2    7e-08   
gb|AAY33491.1|  bifunctional putative mitochondrial GPPS/FPPS iso...  58.5    8e-08   
ref|XP_002957674.1|  hypothetical protein VOLCADRAFT_98778            58.2    8e-08   
emb|CAD42869.1|  farnesyl pyrophosphate synthase                      58.2    8e-08   
gb|EPB84273.1|  farnesyl pyrophosphate synthase                       58.2    8e-08   
gb|ABY19312.1|  farnesyl diphosphate synthase 1                       58.5    8e-08   
emb|CDH56278.1|  farnesyl pyrophosphate synthase                      58.2    9e-08   
gb|AAY33490.3|  putative mitochondrial isoprenyl diphosphate synt...  58.2    9e-08   
ref|XP_003032976.1|  farnesyl-diphosphate synthase                    58.2    9e-08   
emb|CCM04365.1|  predicted protein                                    58.2    9e-08   
ref|NP_001119633.3|  mitochondrial isoprenyl diphosphate synthase     58.2    9e-08   
ref|XP_002390180.1|  hypothetical protein MPER_10587                  55.8    1e-07   
ref|XP_641990.1|  farnesyl diphosphate synthase                       58.2    1e-07   
ref|XP_001889078.1|  predicted protein                                57.8    1e-07   
dbj|BAD15361.1|  farnesyl diphosphate synthase                        57.8    1e-07   
gb|AAY33489.2|  putative mitochondrial isoprenyl diphosphate synt...  57.8    1e-07   
emb|CAR64517.1|  geranyltranstransferase                              57.4    2e-07   
emb|CCA68513.1|  related to ERG20-Farnesyl-pyrophosphate synthetase   58.2    2e-07   
emb|CDO75215.1|  hypothetical protein BN946_scf184958.g3              55.1    2e-07   
gb|AAD27558.1|AF111710_4  putative farnesyl pyrophosphate synthase    57.8    2e-07   
ref|XP_001950423.2|  PREDICTED: farnesyl pyrophosphate synthase-like  57.0    2e-07   
gb|KDQ57258.1|  hypothetical protein JAAARDRAFT_35886                 57.0    2e-07   
emb|CDF90315.1|  ZYBA0S06-05710g1_1                                   57.0    2e-07   
gb|ACA48701.1|  farnesyl diphosphate synthase 1                       57.0    2e-07   
gb|KDQ26338.1|  hypothetical protein PLEOSDRAFT_1113039               57.0    2e-07   
ref|XP_007405307.1|  hypothetical protein MELLADRAFT_41913            57.0    3e-07   
ref|XP_007368325.1|  farnesyl-diphosphate synthase                    56.6    3e-07   
emb|CCO36825.1|  hypothetical protein BN14_10971                      54.3    3e-07   
ref|XP_003307564.1|  farnesyl diphosphate synthase                    56.6    3e-07   
ref|XP_007401714.1|  hypothetical protein PHACADRAFT_265218           56.6    3e-07   
ref|XP_003283879.1|  farnesyl diphosphate synthase                    56.6    3e-07   
gb|AAY33488.2|  putative mitochondrial isoprenyl diphosphate synt...  56.6    3e-07   
gb|EMS21600.1|  farnesyl diphosphate synthase                         56.6    3e-07   
ref|XP_007370582.1|  farnesyl-diphosphate synthase                    56.6    3e-07   
ref|XP_007398569.1|  hypothetical protein PHACADRAFT_260435           56.6    3e-07   
ref|XP_789761.2|  PREDICTED: farnesyl pyrophosphate synthase-like     53.5    4e-07   
gb|KDR80645.1|  hypothetical protein GALMADRAFT_61244                 56.2    4e-07   
ref|XP_002501309.1|  farnesyl-pyrophosphate synthetase                56.2    4e-07   
ref|XP_007304630.1|  farnesyl-diphosphate synthase                    56.2    4e-07   
emb|CCH43512.1|  Farnesyl pyrophosphate synthetase                    56.2    4e-07   
ref|XP_001732045.1|  hypothetical protein MGL_0638                    56.2    4e-07   
emb|CCO36903.1|  hypothetical protein BN14_11050                      53.9    5e-07   
dbj|GAM24548.1|  hypothetical protein SAMD00019534_077230             56.2    5e-07   
gb|ACZ80672.1|  putative isoprenoid biosynthesis-related protein      56.2    5e-07   
gb|KDQ06585.1|  hypothetical protein BOTBODRAFT_181455                55.8    5e-07   
gb|ABU87585.1|  farnesyl diphosphate synthase                         52.4    5e-07   
gb|ACT79808.1|  mitochondrial farnesyl diphosphate synthase           55.8    5e-07   
gb|ACT79809.3|  mitochondrial farnesyl diphosphate synthase           55.8    6e-07   
dbj|BAO38011.1|  farnesyl pyrophosphate synthetase                    55.8    6e-07   
emb|CEI88550.1|  Putative Farnesyl pyrophosphate synthase             53.9    6e-07   
gb|EPX74795.1|  geranyltranstransferase Fps1                          55.5    7e-07   
gb|AHA42463.1|  farnesyl diphosphate synthase                         54.7    7e-07   
ref|XP_001416643.1|  predicted protein                                55.5    7e-07   
ref|XP_009269232.1|  Farnesyl pyrophosphate synthase                  55.5    7e-07   
emb|CEG66116.1|  Putative Farnesyl pyrophosphate synthase             55.5    8e-07   
emb|CEI88549.1|  Putative Farnesyl pyrophosphate synthase             55.5    8e-07   
gb|AEK32003.1|  isoprenyl diphosphate synthase                        55.5    9e-07   
ref|XP_003062388.1|  predicted protein                                55.1    1e-06   
ref|XP_004357467.1|  putative protein serine/threonine kinase         56.2    1e-06   
ref|XP_007310116.1|  farnesyl diphosphate synthase                    55.1    1e-06   
gb|AEK32004.1|  mitochondrial isoprenyl diphosphate synthase          55.1    1e-06   
gb|ABY19313.1|  farnesyl diphosphate synthase 2                       55.1    1e-06   
dbj|GAA95763.1|  hypothetical protein E5Q_02420                       54.7    1e-06   
ref|XP_002428407.1|  farnesyl-pyrophosphate synthetase, putative      55.1    1e-06   
gb|EWG95282.1|  Erg20p                                                54.7    1e-06   
ref|XP_004160244.1|  PREDICTED: farnesyl pyrophosphate synthase 1...  54.7    1e-06   
emb|CDH16468.1|  probable Farnesyl pyrophosphate synthase             54.7    1e-06   
gb|EFW40736.2|  geranyltranstransferase                               54.7    2e-06   
ref|XP_004345458.1|  geranyltranstransferase                          54.7    2e-06   
ref|XP_007845552.1|  farnesyl pyrophosphate synthetase                54.3    2e-06   
ref|XP_001646858.1|  hypothetical protein Kpol_2002p71                54.3    2e-06   
gb|EPY50917.1|  geranyltranstransferase Fps1                          54.3    2e-06   
gb|KGK39507.1|  hypothetical protein JL09_g1346                       53.9    2e-06   
gb|EFN60361.1|  Farnesyl pyrophosphate synthetase                     54.3    2e-06   
dbj|BAB60821.1|  putative FPP synthase 1                              53.9    2e-06   
gb|KDQ22239.1|  hypothetical protein PLEOSDRAFT_41938                 53.9    2e-06   
ref|XP_010538437.1|  PREDICTED: farnesyl pyrophosphate synthase 1...  53.5    2e-06   
ref|XP_781908.3|  PREDICTED: farnesyl pyrophosphate synthase-like     53.9    3e-06   
ref|XP_005537135.1|  farnesyl-diphosphate synthetase                  53.5    3e-06   
ref|XP_006959775.1|  farnesyl pyrophosphate synthetase                53.5    3e-06   
ref|XP_008472135.1|  PREDICTED: farnesyl pyrophosphate synthase       53.1    4e-06   
ref|NP_984739.1|  AEL122Wp                                            53.5    4e-06   
ref|XP_009552563.1|  hypothetical protein HETIRDRAFT_442424           53.5    4e-06   
ref|XP_003648213.1|  hypothetical protein Ecym_8102                   53.1    4e-06   
gb|ELU37339.1|  isoprenoid biosynthesis-related protein               53.1    4e-06   
ref|XP_571137.1|  isoprenoid biosynthesis-related protein             53.1    5e-06   
gb|KDR23124.1|  Farnesyl pyrophosphate synthetase                     53.5    5e-06   
gb|KGB79395.1|  farnesyl diphosphate synthase                         53.1    5e-06   
ref|XP_001400163.1|  geranyltranstransferase                          52.8    6e-06   
gb|EHA23307.1|  hypothetical protein ASPNIDRAFT_55618                 52.8    6e-06   
dbj|GAA84528.1|  farnesyl pyrophosphate synthetase 1                  52.8    6e-06   
ref|XP_001693168.1|  farnesyl diphosphate synthase                    52.8    6e-06   
gb|AGO12237.1|  AaceriAEL122Wp                                        52.8    6e-06   
gb|ERZ99608.1|  hypothetical protein GLOINDRAFT_338997                52.4    7e-06   
ref|XP_001840117.1|  farnesyldiphosphatesynthetase                    52.8    7e-06   
ref|XP_007729043.1|  farnesyl pyrophosphate synthase                  52.8    7e-06   
ref|XP_001485796.1|  hypothetical protein PGUG_01467                  52.8    7e-06   
ref|XP_006398479.1|  hypothetical protein EUTSA_v10000912mg           52.4    7e-06   
ref|XP_006688948.1|  hypothetical protein CANTEDRAFT_115573           52.4    7e-06   
gb|EXX51311.1|  bifunctional (2E,6E)-farnesyl diphosphate synthas...  52.4    8e-06   
ref|XP_001527130.1|  farnesyl pyrophosphate synthetase                52.4    8e-06   
ref|XP_003078152.1|  farnesyl pyrophosphate synthase (ISS)            52.4    9e-06   
gb|AHW57996.1|  farnesyl pyrophosphate synthase                       52.4    9e-06   
ref|XP_001384571.1|  arnesyl diphosphate synthetase (FPP synthetase)  52.4    1e-05   
gb|EHN01778.1|  Erg20p                                                51.2    1e-05   
emb|CCK69214.1|  hypothetical protein KNAG_0C01010                    52.0    1e-05   
ref|XP_011104003.1|  erg20p                                           52.0    1e-05   
ref|XP_006373579.1|  hypothetical protein POPTR_0016s00570g           50.4    1e-05   
ref|XP_002174505.1|  geranyltranstransferase Fps1                     52.0    1e-05   
ref|XP_003194529.1|  isoprenoid biosynthesis-related protein          52.0    1e-05   
ref|XP_003680478.1|  hypothetical protein TDEL_0C03780                51.6    1e-05   
ref|XP_009492925.1|  isoprenoid biosynthesis-like protein             51.6    1e-05   
ref|XP_002184024.1|  predicted protein                                51.6    1e-05   
gb|KDE07734.1|  farnesyl pyrophosphate synthase                       51.6    2e-05   
gb|EKD02817.1|  isoprenoid biosynthesis-related protein               51.6    2e-05   
gb|EJT51641.1|  isoprenoid biosynthesis-related protein               51.6    2e-05   
ref|XP_007511050.1|  predicted protein                                51.6    2e-05   
emb|CDR41679.1|  CYFA0S07e04962g1_1                                   51.6    2e-05   
gb|EDK37369.2|  hypothetical protein PGUG_01467                       51.6    2e-05   
gb|EST07426.1|  polyprenyl synthetase                                 51.6    2e-05   
ref|XP_503599.1|  YALI0E05753p                                        51.2    2e-05   
ref|XP_002490436.1|  Farnesyl pyrophosphate synthetase                51.2    2e-05   
ref|XP_001633044.1|  predicted protein                                51.2    2e-05   
ref|XP_011114236.1|  hypothetical protein H072_8539                   51.2    2e-05   
ref|NP_012368.1|  bifunctional (2E,6E)-farnesyl diphosphate synth...  51.2    2e-05   
gb|EIW09696.1|  Erg20p                                                51.2    2e-05   
gb|EHN06415.1|  Erg20p                                                51.2    2e-05   
dbj|GAA24199.1|  K7_Erg20p                                            51.2    2e-05   
gb|EGA61811.1|  Erg20p                                                51.2    2e-05   
gb|EGA58189.1|  Erg20p                                                51.2    2e-05   
gb|EDN63217.1|  FPP synthetase                                        51.2    2e-05   
gb|AFR95734.2|  farnesyl diphosphate synthase                         51.2    3e-05   
ref|XP_007342866.1|  terpenoid synthase                               51.2    3e-05   
ref|XP_007772019.1|  farnesyl-pyrophosphate synthetase                51.2    3e-05   
ref|XP_004196767.1|  Piso0_003992                                     50.8    3e-05   
ref|XP_003685858.1|  hypothetical protein TPHA_0E03340                50.8    3e-05   
ref|NP_001036889.1|  farnesyl pyrophosphate syntase                   51.2    3e-05   
dbj|BAF62113.1|  farnesyl diphosphate synthase                        51.2    3e-05   
ref|XP_009800092.1|  PREDICTED: farnesyl pyrophosphate synthase 1...  50.4    3e-05   
ref|XP_004345905.1|  farnesyl pyrophosphate synthetase                50.8    3e-05   
dbj|GAC76389.1|  polyprenyl synthetase                                50.8    3e-05   
ref|XP_003675288.1|  hypothetical protein NCAS_0B08330                50.8    3e-05   
ref|XP_005649050.1|  farnesyl diphosphate synthase                    50.8    3e-05   
ref|XP_007374557.1|  hypothetical protein SPAPADRAFT_60359            50.8    3e-05   
gb|EWM21458.1|  farnesyl pyrophosphate synthase                       50.8    3e-05   
gb|KDN48472.1|  putative ERG20-farnesyl-pyrophosphate synthetase      50.8    3e-05   
ref|XP_002617167.1|  conserved hypothetical protein                   50.8    3e-05   
gb|EMG50815.1|  Farnesyl pyrophosphate synthetase                     50.4    4e-05   
gb|EFA85849.1|  hypothetical protein PPL_01081                        51.2    4e-05   
ref|XP_007371242.1|  farnesyl-diphosphate synthase                    50.4    4e-05   
ref|XP_001217832.1|  farnesyl pyrophosphate synthetase 1              50.4    4e-05   
ref|XP_448787.1|  hypothetical protein                                50.4    5e-05   
emb|CCA26954.1|  farnesyl pyrophosphate synthetase putative           50.1    5e-05   
ref|XP_002568534.1|  Pc21g15240                                       50.1    5e-05   
ref|XP_003867660.1|  Erg20 farnesyl pyrophosphate synthetase          50.1    5e-05   
gb|EJT43164.1|  ERG20-like protein                                    50.1    5e-05   
dbj|BAJ95824.1|  predicted protein                                    50.1    5e-05   
ref|XP_009599476.1|  PREDICTED: farnesyl pyrophosphate synthase 1...  49.7    6e-05   
gb|KDN34476.1|  hypothetical protein RSAG8_12414                      49.7    6e-05   
ref|XP_004522644.1|  PREDICTED: farnesyl pyrophosphate synthase-like  50.1    6e-05   
ref|XP_006680644.1|  hypothetical protein BATDEDRAFT_17386            49.7    7e-05   
ref|XP_001743857.1|  hypothetical protein                             49.7    8e-05   
emb|CCE40357.1|  hypothetical protein CPAR2_103950                    49.7    8e-05   
dbj|GAC96549.1|  hypothetical protein PHSY_004129                     49.7    8e-05   
ref|XP_002116714.1|  hypothetical protein TRIADDRAFT_31406            49.7    8e-05   
emb|CDI52323.1|  probable ERG20-farnesyl-pyrophosphate synthetase     49.3    9e-05   
emb|CCA25012.1|  farnesyl pyrophosphate synthetase putative           49.3    1e-04   
ref|XP_009154762.1|  farnesyl pyrophosphate synthase                  49.3    1e-04   
gb|EIF46704.1|  farnesyl pyrophosphate synthetase                     49.3    1e-04   
ref|XP_003667492.1|  hypothetical protein NDAI_0A00910                49.3    1e-04   
gb|EEQ45876.1|  farnesyl pyrophosphate synthetase                     49.3    1e-04   
ref|XP_712917.1|  likely farnesyl diphosphate synthetase              49.3    1e-04   
emb|CCI49531.1|  unnamed protein product                              49.3    1e-04   
dbj|GAK63264.1|  isoprenoid biosynthesis-related protein              49.3    1e-04   
gb|KHC80265.1|  farnesyl pyrophosphate synthase                       49.3    1e-04   
gb|ETS62676.1|  hypothetical protein PaG_02410                        49.3    1e-04   
dbj|BAD20729.1|  farnesyl pyrophosphate synthase                      48.1    1e-04   
ref|XP_007876505.1|  hypothetical protein PFL1_00812                  48.9    1e-04   
gb|AFW97772.1|  farnesyl diphosphate synthase                         48.5    1e-04   
ref|XP_003958211.1|  hypothetical protein KAFR_0G00430                48.9    1e-04   
emb|CCG81894.1|  Farnesyl pyrophosphate synthase                      48.9    1e-04   
emb|CBN75787.1|  Farnesyl pyrophosphate synthase                      48.9    2e-04   
ref|XP_001543367.1|  farnesyl pyrophosphate synthetase                48.5    2e-04   
gb|EEH05265.1|  farnesyl-pyrophosphate synthetase                     48.5    2e-04   
dbj|BAM20287.1|  farnesyl pyrophosphate synthase                      46.2    2e-04   
ref|XP_007006928.1|  hypothetical protein TREMEDRAFT_69786            48.5    2e-04   
emb|CAA08918.2|  dimethylallyltransferase                             48.5    2e-04   
emb|CCF53585.1|  probable ERG20-farnesyl-pyrophosphate synthetase     48.5    2e-04   



>emb|CDP04546.1| unnamed protein product [Coffea canephora]
Length=349

 Score =   113 bits (283),  Expect = 8e-28, Method: Composition-based stats.
 Identities = 52/69 (75%), Positives = 59/69 (86%), Gaps = 0/69 (0%)
 Frame = -2

Query  208  MATQNGTAADPRSDFVGVYAKLKSELLNDPAIQLTPDSRQWVQRMLEYNVPGGKLNRGLS  29
            MA  NGT +D R+ F+GVY+ LKSELLNDPA + T DSR+WV RML+YNVPGGKLNRGLS
Sbjct  1    MANLNGTTSDLRTTFLGVYSVLKSELLNDPAFEWTDDSRRWVDRMLDYNVPGGKLNRGLS  60

Query  28   VIDSYKLLK  2
            VIDSYKLLK
Sbjct  61   VIDSYKLLK  69



>gb|AIY24422.1| fpps protein [Jasminum sambac]
Length=349

 Score =   111 bits (278),  Expect = 3e-27, Method: Composition-based stats.
 Identities = 51/69 (74%), Positives = 59/69 (86%), Gaps = 0/69 (0%)
 Frame = -2

Query  208  MATQNGTAADPRSDFVGVYAKLKSELLNDPAIQLTPDSRQWVQRMLEYNVPGGKLNRGLS  29
            MA QNG  +D R+ F+ VY+ LKSELLNDPA + T +SRQWV+RML+YNVPGGKLNRGLS
Sbjct  1    MANQNGANSDLRTKFLEVYSVLKSELLNDPAFEWTDNSRQWVERMLDYNVPGGKLNRGLS  60

Query  28   VIDSYKLLK  2
            VIDSYKLLK
Sbjct  61   VIDSYKLLK  69



>gb|AAK63847.1|AF384040_1 farnesyl diphosphate synthase [Mentha x piperita]
Length=349

 Score =   110 bits (276),  Expect = 6e-27, Method: Composition-based stats.
 Identities = 51/69 (74%), Positives = 58/69 (84%), Gaps = 0/69 (0%)
 Frame = -2

Query  208  MATQNGTAADPRSDFVGVYAKLKSELLNDPAIQLTPDSRQWVQRMLEYNVPGGKLNRGLS  29
            MA  NG A+D R  F+GVY+ LKSELLNDPA + T  SRQWV+RML+YNVPGGKLNRGLS
Sbjct  1    MANLNGAASDLRKTFLGVYSTLKSELLNDPAFEWTDGSRQWVERMLDYNVPGGKLNRGLS  60

Query  28   VIDSYKLLK  2
            VIDSY+LLK
Sbjct  61   VIDSYQLLK  69



>ref|XP_011095887.1| PREDICTED: farnesyl pyrophosphate synthase 1 [Sesamum indicum]
Length=349

 Score =   110 bits (275),  Expect = 9e-27, Method: Composition-based stats.
 Identities = 50/69 (72%), Positives = 59/69 (86%), Gaps = 0/69 (0%)
 Frame = -2

Query  208  MATQNGTAADPRSDFVGVYAKLKSELLNDPAIQLTPDSRQWVQRMLEYNVPGGKLNRGLS  29
            MA  NGT +D R++F+ VY+ LKSELLNDPA + T  SRQWV+RML+YNVPGGKLNRGLS
Sbjct  1    MANLNGTTSDLRTEFLKVYSVLKSELLNDPAFEWTDGSRQWVERMLDYNVPGGKLNRGLS  60

Query  28   VIDSYKLLK  2
            V+DSYKLLK
Sbjct  61   VVDSYKLLK  69



>gb|ADV03080.1| farnesyl diphosphate synthase [Bacopa monnieri]
Length=349

 Score =   108 bits (271),  Expect = 3e-26, Method: Composition-based stats.
 Identities = 50/69 (72%), Positives = 56/69 (81%), Gaps = 0/69 (0%)
 Frame = -2

Query  208  MATQNGTAADPRSDFVGVYAKLKSELLNDPAIQLTPDSRQWVQRMLEYNVPGGKLNRGLS  29
            MA  NG   D R  F+GVY+ LKSELLNDPA + T  SR+WV+RML+YNVPGGKLNRGLS
Sbjct  1    MANHNGQTTDLREAFLGVYSVLKSELLNDPAFEWTDASREWVERMLDYNVPGGKLNRGLS  60

Query  28   VIDSYKLLK  2
            VIDSYKLLK
Sbjct  61   VIDSYKLLK  69



>gb|ABV08819.1| farnesyl diphosphate synthetase [Salvia miltiorrhiza]
 gb|ADT70780.1| farnesyl pyrophosphate synthase [Salvia miltiorrhiza]
Length=349

 Score =   108 bits (270),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 52/69 (75%), Positives = 59/69 (86%), Gaps = 0/69 (0%)
 Frame = -2

Query  208  MATQNGTAADPRSDFVGVYAKLKSELLNDPAIQLTPDSRQWVQRMLEYNVPGGKLNRGLS  29
            MA  NG +AD R+ F+GVY+ LKSELLNDPA + T  SRQWV+RML+YNVPGGKLNRGLS
Sbjct  1    MANLNGESADLRATFLGVYSVLKSELLNDPAFEWTDGSRQWVERMLDYNVPGGKLNRGLS  60

Query  28   VIDSYKLLK  2
            VIDSYKLLK
Sbjct  61   VIDSYKLLK  69



>gb|AGQ04160.1| farnesyl diphosphate synthase [Lavandula angustifolia]
Length=349

 Score =   108 bits (269),  Expect = 7e-26, Method: Composition-based stats.
 Identities = 50/69 (72%), Positives = 57/69 (83%), Gaps = 0/69 (0%)
 Frame = -2

Query  208  MATQNGTAADPRSDFVGVYAKLKSELLNDPAIQLTPDSRQWVQRMLEYNVPGGKLNRGLS  29
            MA  +G  ADP + F+ VY+ LKSELLNDPA + T  SRQWV+RML+YNVPGGKLNRGLS
Sbjct  1    MANPDGAVADPMAKFLEVYSVLKSELLNDPAFEWTDGSRQWVERMLDYNVPGGKLNRGLS  60

Query  28   VIDSYKLLK  2
            VIDSYKLLK
Sbjct  61   VIDSYKLLK  69



>ref|XP_010245026.1| PREDICTED: farnesyl pyrophosphate synthase 1-like [Nelumbo nucifera]
Length=349

 Score =   107 bits (268),  Expect = 8e-26, Method: Composition-based stats.
 Identities = 51/69 (74%), Positives = 54/69 (78%), Gaps = 0/69 (0%)
 Frame = -2

Query  208  MATQNGTAADPRSDFVGVYAKLKSELLNDPAIQLTPDSRQWVQRMLEYNVPGGKLNRGLS  29
            MA  NG A D +S F  VY+ LKSELL DPA   T DSRQWV RMLEYNVPGGKLNRGLS
Sbjct  1    MAALNGAATDMKSTFRRVYSTLKSELLQDPAFDFTDDSRQWVDRMLEYNVPGGKLNRGLS  60

Query  28   VIDSYKLLK  2
            VIDSYKLL+
Sbjct  61   VIDSYKLLQ  69



>ref|XP_010252841.1| PREDICTED: farnesyl pyrophosphate synthase 1-like [Nelumbo nucifera]
Length=349

 Score =   107 bits (268),  Expect = 1e-25, Method: Composition-based stats.
 Identities = 50/69 (72%), Positives = 56/69 (81%), Gaps = 0/69 (0%)
 Frame = -2

Query  208  MATQNGTAADPRSDFVGVYAKLKSELLNDPAIQLTPDSRQWVQRMLEYNVPGGKLNRGLS  29
            MA  NG   D +S F  VY+KLKS+LL DPA + T DSRQWV+RML+YNVPGGKLNRGLS
Sbjct  1    MAALNGATGDLKSTFRLVYSKLKSQLLQDPAFEFTDDSRQWVERMLDYNVPGGKLNRGLS  60

Query  28   VIDSYKLLK  2
            VIDSYKLLK
Sbjct  61   VIDSYKLLK  69



>gb|AGH33733.1| farnesyl diphosphate synthase [Asparagus officinalis]
Length=249

 Score =   106 bits (264),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 48/69 (70%), Positives = 58/69 (84%), Gaps = 0/69 (0%)
 Frame = -2

Query  208  MATQNGTAADPRSDFVGVYAKLKSELLNDPAIQLTPDSRQWVQRMLEYNVPGGKLNRGLS  29
            MA  NG+A D +S FV +YA+LKSE+L DPA+  T DSRQW+ RML+YNVPGGKLNRG+S
Sbjct  27   MADSNGSAVDTKSRFVEIYARLKSEILEDPALDYTDDSRQWIDRMLDYNVPGGKLNRGIS  86

Query  28   VIDSYKLLK  2
            VIDSY+LLK
Sbjct  87   VIDSYQLLK  95



>gb|ADH95185.1| putative farnesyl diphosphate synthase [Aquilaria microcarpa]
Length=342

 Score =   105 bits (263),  Expect = 4e-25, Method: Composition-based stats.
 Identities = 48/61 (79%), Positives = 54/61 (89%), Gaps = 0/61 (0%)
 Frame = -2

Query  184  ADPRSDFVGVYAKLKSELLNDPAIQLTPDSRQWVQRMLEYNVPGGKLNRGLSVIDSYKLL  5
            AD +S F+ VY+KLKSELLNDPA + T DSR+WV RML+YNVPGGKLNRGLSVIDSYKLL
Sbjct  2    ADLKSTFLDVYSKLKSELLNDPAFEFTDDSREWVDRMLDYNVPGGKLNRGLSVIDSYKLL  61

Query  4    K  2
            K
Sbjct  62   K  62



>gb|AHG54251.1| farnesyl pyrophosphate synthase 1 [Aquilaria sinensis]
Length=342

 Score =   105 bits (261),  Expect = 8e-25, Method: Composition-based stats.
 Identities = 48/61 (79%), Positives = 54/61 (89%), Gaps = 0/61 (0%)
 Frame = -2

Query  184  ADPRSDFVGVYAKLKSELLNDPAIQLTPDSRQWVQRMLEYNVPGGKLNRGLSVIDSYKLL  5
            AD RS F+ VY+KLKSELL+DPA + T DSR+WV RML+YNVPGGKLNRGLSVIDSYKLL
Sbjct  2    ADLRSTFLDVYSKLKSELLHDPAFEFTDDSREWVDRMLDYNVPGGKLNRGLSVIDSYKLL  61

Query  4    K  2
            K
Sbjct  62   K  62



>dbj|BAA88844.1| Farnesyl pyrophosphate synthase [Gentiana lutea]
 gb|ACF21779.1| farnesyl pyrophosphate synthase [Gentiana lutea]
Length=349

 Score =   103 bits (258),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 49/69 (71%), Positives = 58/69 (84%), Gaps = 0/69 (0%)
 Frame = -2

Query  208  MATQNGTAADPRSDFVGVYAKLKSELLNDPAIQLTPDSRQWVQRMLEYNVPGGKLNRGLS  29
            MA  NGT +D R+ F+ VY+ LKSELLND A + +PDSRQWV+RML+YNVPGGKLNRGLS
Sbjct  1    MANLNGTTSDLRTTFLQVYSVLKSELLNDLAFEWSPDSRQWVERMLDYNVPGGKLNRGLS  60

Query  28   VIDSYKLLK  2
            VIDSY+ LK
Sbjct  61   VIDSYEQLK  69



>gb|ABR09548.1| farnesyl diphosphate synthase isoform [Hevea brasiliensis]
Length=342

 Score =   103 bits (257),  Expect = 3e-24, Method: Composition-based stats.
 Identities = 47/61 (77%), Positives = 53/61 (87%), Gaps = 0/61 (0%)
 Frame = -2

Query  184  ADPRSDFVGVYAKLKSELLNDPAIQLTPDSRQWVQRMLEYNVPGGKLNRGLSVIDSYKLL  5
            AD +S F+ VY+ LK ELL DPA + TPDSRQWV+RML+YNVPGGKLNRGLSVIDSYKLL
Sbjct  2    ADLKSTFLKVYSVLKQELLEDPAFEWTPDSRQWVERMLDYNVPGGKLNRGLSVIDSYKLL  61

Query  4    K  2
            K
Sbjct  62   K  62



>dbj|BAF98301.1| farnesyl-diphosphate synthase [Hevea brasiliensis]
Length=342

 Score =   103 bits (257),  Expect = 3e-24, Method: Composition-based stats.
 Identities = 47/61 (77%), Positives = 53/61 (87%), Gaps = 0/61 (0%)
 Frame = -2

Query  184  ADPRSDFVGVYAKLKSELLNDPAIQLTPDSRQWVQRMLEYNVPGGKLNRGLSVIDSYKLL  5
            AD +S F+ VY+ LK ELL DPA + TPDSRQWV+RML+YNVPGGKLNRGLSVIDSYKLL
Sbjct  2    ADLKSTFLKVYSVLKQELLEDPAFEWTPDSRQWVERMLDYNVPGGKLNRGLSVIDSYKLL  61

Query  4    K  2
            K
Sbjct  62   K  62



>gb|AAM98379.1| farnesyl diphosphate synthase [Hevea brasiliensis]
 gb|AAQ56011.1| farnesyl diphosphate synthase [Hevea brasiliensis]
Length=342

 Score =   103 bits (256),  Expect = 4e-24, Method: Composition-based stats.
 Identities = 47/61 (77%), Positives = 53/61 (87%), Gaps = 0/61 (0%)
 Frame = -2

Query  184  ADPRSDFVGVYAKLKSELLNDPAIQLTPDSRQWVQRMLEYNVPGGKLNRGLSVIDSYKLL  5
            AD +S F+ VY+ LK ELL DPA + TPDSRQWV+RML+YNVPGGKLNRGLSVIDSYKLL
Sbjct  2    ADLKSTFLKVYSVLKQELLEDPAFEWTPDSRQWVERMLDYNVPGGKLNRGLSVIDSYKLL  61

Query  4    K  2
            K
Sbjct  62   K  62



>gb|EYU34872.1| hypothetical protein MIMGU_mgv1a014839mg [Erythranthe guttata]
Length=176

 Score =   100 bits (249),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 48/69 (70%), Positives = 56/69 (81%), Gaps = 0/69 (0%)
 Frame = -2

Query  208  MATQNGTAADPRSDFVGVYAKLKSELLNDPAIQLTPDSRQWVQRMLEYNVPGGKLNRGLS  29
            MA  NG  AD R+ F+ VY+ LKSELL+DPA +    SRQWV+RML+YNVPGGKLNRGLS
Sbjct  1    MANLNGATADLRATFLEVYSVLKSELLSDPAFEWNEGSRQWVERMLDYNVPGGKLNRGLS  60

Query  28   VIDSYKLLK  2
            VIDSYK+LK
Sbjct  61   VIDSYKILK  69



>gb|ACN63187.1| farnesyl diphosphate synthase [Euphorbia pekinensis]
Length=342

 Score =   102 bits (255),  Expect = 5e-24, Method: Composition-based stats.
 Identities = 46/61 (75%), Positives = 55/61 (90%), Gaps = 0/61 (0%)
 Frame = -2

Query  184  ADPRSDFVGVYAKLKSELLNDPAIQLTPDSRQWVQRMLEYNVPGGKLNRGLSVIDSYKLL  5
            AD +S F+ VY++LK+ELLND A + +PDSRQWV+RML+YNVPGGKLNRGLSVIDSYKLL
Sbjct  2    ADLKSTFLDVYSQLKTELLNDTAFEWSPDSRQWVERMLDYNVPGGKLNRGLSVIDSYKLL  61

Query  4    K  2
            K
Sbjct  62   K  62



>gb|AHC30884.1| farnesyl pyrophosphate synthetase 1 [Dendrobium huoshanense]
 gb|AHC30885.1| farnesyl pyrophosphate synthetase 2 [Dendrobium huoshanense]
Length=348

 Score =   102 bits (255),  Expect = 5e-24, Method: Composition-based stats.
 Identities = 42/69 (61%), Positives = 57/69 (83%), Gaps = 0/69 (0%)
 Frame = -2

Query  208  MATQNGTAADPRSDFVGVYAKLKSELLNDPAIQLTPDSRQWVQRMLEYNVPGGKLNRGLS  29
            MA  NG   D +++F+ +Y++LKS+LL+DPA   T DSRQW+ RML+YNVPGGKLNRG+S
Sbjct  1    MAEANGKTVDLKTNFLQIYSRLKSDLLDDPAFSFTEDSRQWIDRMLDYNVPGGKLNRGIS  60

Query  28   VIDSYKLLK  2
            V+DSY++LK
Sbjct  61   VVDSYEILK  69



>sp|P49352.1|FPPS2_LUPAL RecName: Full=Farnesyl pyrophosphate synthase 2; Short=FPP synthase 
2; Short=FPS 2; AltName: Full=(2E,6E)-farnesyl diphosphate 
synthase 2; AltName: Full=Dimethylallyltranstransferase 
2; AltName: Full=Farnesyl diphosphate synthase 2; AltName: 
Full=Geranyltranstransferase 2 [Lupinus albus]
 gb|AAA87729.1| farnesyl pyrophosphate synthase [Lupinus albus]
Length=342

 Score =   102 bits (255),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 47/61 (77%), Positives = 54/61 (89%), Gaps = 0/61 (0%)
 Frame = -2

Query  184  ADPRSDFVGVYAKLKSELLNDPAIQLTPDSRQWVQRMLEYNVPGGKLNRGLSVIDSYKLL  5
            ADP+S F+ VY+ LKSELL DPA + + DSRQWV+RML+YNVPGGKLNRGLSVIDSYKLL
Sbjct  2    ADPKSSFLNVYSILKSELLQDPAFEFSTDSRQWVERMLDYNVPGGKLNRGLSVIDSYKLL  61

Query  4    K  2
            K
Sbjct  62   K  62



>gb|AGS79228.1| farnesyl diphosphate synthase [Panax notoginseng]
 gb|AIK21789.1| farnesyl diphosphate synthase [Panax notoginseng]
Length=342

 Score =   102 bits (254),  Expect = 9e-24, Method: Composition-based stats.
 Identities = 46/61 (75%), Positives = 54/61 (89%), Gaps = 0/61 (0%)
 Frame = -2

Query  184  ADPRSDFVGVYAKLKSELLNDPAIQLTPDSRQWVQRMLEYNVPGGKLNRGLSVIDSYKLL  5
            +D ++ F+ VY+ LKSELLNDPA + T DSRQWV+RML+YNVPGGKLNRGLSVIDSYKLL
Sbjct  2    SDLKTRFLEVYSVLKSELLNDPAFEFTDDSRQWVERMLDYNVPGGKLNRGLSVIDSYKLL  61

Query  4    K  2
            K
Sbjct  62   K  62



>gb|AFP19446.1| farnesyl pyrophosphate synthase [Cymbidium goeringii]
Length=348

 Score =   102 bits (254),  Expect = 9e-24, Method: Composition-based stats.
 Identities = 43/69 (62%), Positives = 56/69 (81%), Gaps = 0/69 (0%)
 Frame = -2

Query  208  MATQNGTAADPRSDFVGVYAKLKSELLNDPAIQLTPDSRQWVQRMLEYNVPGGKLNRGLS  29
            MA  NG A D ++ F+ +Y++LKSELL DPA   T DSR+WV RML+YNVPGGKLNRG+S
Sbjct  1    MAEANGEAVDLKASFLQIYSRLKSELLEDPAFSFTEDSREWVDRMLDYNVPGGKLNRGIS  60

Query  28   VIDSYKLLK  2
            V+DS+++LK
Sbjct  61   VVDSFQILK  69



>dbj|BAB40665.1| farnesyl pyrophosphate synthase [Humulus lupulus]
 dbj|BAB40666.1| farnesyl pyrophophate synthase [Humulus lupulus]
Length=342

 Score =   102 bits (253),  Expect = 9e-24, Method: Composition-based stats.
 Identities = 46/58 (79%), Positives = 52/58 (90%), Gaps = 0/58 (0%)
 Frame = -2

Query  175  RSDFVGVYAKLKSELLNDPAIQLTPDSRQWVQRMLEYNVPGGKLNRGLSVIDSYKLLK  2
            RS F+ VY+ LKSELLNDPA + T DSRQWV+RML+YNVPGGKLNRGLSVIDSY+LLK
Sbjct  5    RSKFMEVYSILKSELLNDPAFEFTDDSRQWVERMLDYNVPGGKLNRGLSVIDSYQLLK  62



>gb|ADK12004.1| farnesyl diphosphate synthase [Aralia elata]
Length=342

 Score =   102 bits (253),  Expect = 9e-24, Method: Composition-based stats.
 Identities = 46/61 (75%), Positives = 54/61 (89%), Gaps = 0/61 (0%)
 Frame = -2

Query  184  ADPRSDFVGVYAKLKSELLNDPAIQLTPDSRQWVQRMLEYNVPGGKLNRGLSVIDSYKLL  5
            +D ++ F+ VY+ LKSELLNDPA + T DSRQWV+RML+YNVPGGKLNRGLSVIDSYKLL
Sbjct  2    SDLKTRFLEVYSVLKSELLNDPAFEFTDDSRQWVERMLDYNVPGGKLNRGLSVIDSYKLL  61

Query  4    K  2
            K
Sbjct  62   K  62



>gb|ADJ68004.1| farnesyl diphosphate synthase [Panax quinquefolius]
 gb|AGK62445.1| farnesyl diphosphate synthase [Panax quinquefolius]
Length=342

 Score =   102 bits (253),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 46/61 (75%), Positives = 54/61 (89%), Gaps = 0/61 (0%)
 Frame = -2

Query  184  ADPRSDFVGVYAKLKSELLNDPAIQLTPDSRQWVQRMLEYNVPGGKLNRGLSVIDSYKLL  5
            +D ++ F+ VY+ LKSELLNDPA + T DSRQWV+RML+YNVPGGKLNRGLSVIDSYKLL
Sbjct  2    SDLKTRFLEVYSVLKSELLNDPAFEFTDDSRQWVERMLDYNVPGGKLNRGLSVIDSYKLL  61

Query  4    K  2
            K
Sbjct  62   K  62



>gb|AAY53905.1| farnesyl pyrophosphate synthase [Panax notoginseng]
Length=343

 Score =   102 bits (253),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 46/61 (75%), Positives = 54/61 (89%), Gaps = 0/61 (0%)
 Frame = -2

Query  184  ADPRSDFVGVYAKLKSELLNDPAIQLTPDSRQWVQRMLEYNVPGGKLNRGLSVIDSYKLL  5
            +D ++ F+ VY+ LKSELLNDPA + T DSRQWV+RML+YNVPGGKLNRGLSVIDSYKLL
Sbjct  2    SDLKTRFLEVYSVLKSELLNDPAFEFTDDSRQWVERMLDYNVPGGKLNRGLSVIDSYKLL  61

Query  4    K  2
            K
Sbjct  62   K  62



>gb|AAY87903.1| farnesyl diphosphate synthase [Panax ginseng]
Length=342

 Score =   102 bits (253),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 46/61 (75%), Positives = 54/61 (89%), Gaps = 0/61 (0%)
 Frame = -2

Query  184  ADPRSDFVGVYAKLKSELLNDPAIQLTPDSRQWVQRMLEYNVPGGKLNRGLSVIDSYKLL  5
            +D ++ F+ VY+ LKSELLNDPA + T DSRQWV+RML+YNVPGGKLNRGLSVIDSYKLL
Sbjct  2    SDLKTRFLEVYSVLKSELLNDPAFEFTDDSRQWVERMLDYNVPGGKLNRGLSVIDSYKLL  61

Query  4    K  2
            K
Sbjct  62   K  62



>ref|XP_010538436.1| PREDICTED: farnesyl pyrophosphate synthase 2 isoform X1 [Tarenaya 
hassleriana]
Length=342

 Score =   102 bits (253),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 45/61 (74%), Positives = 54/61 (89%), Gaps = 0/61 (0%)
 Frame = -2

Query  184  ADPRSDFVGVYAKLKSELLNDPAIQLTPDSRQWVQRMLEYNVPGGKLNRGLSVIDSYKLL  5
            AD +S F+ VY++LKSELL DPA + T +SRQWV+RML+YNVPGGKLNRGLSV+DSYKLL
Sbjct  2    ADLKSTFLDVYSRLKSELLQDPAFEFTAESRQWVERMLDYNVPGGKLNRGLSVVDSYKLL  61

Query  4    K  2
            K
Sbjct  62   K  62



>ref|XP_008463030.1| PREDICTED: farnesyl pyrophosphate synthase 1-like [Cucumis melo]
Length=342

 Score =   102 bits (253),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 46/58 (79%), Positives = 52/58 (90%), Gaps = 0/58 (0%)
 Frame = -2

Query  175  RSDFVGVYAKLKSELLNDPAIQLTPDSRQWVQRMLEYNVPGGKLNRGLSVIDSYKLLK  2
            RS F+ VY+ LKSELL+DPA + T DSRQWV+RML+YNVPGGKLNRGLSVIDSYKLLK
Sbjct  5    RSKFLDVYSLLKSELLHDPAFEFTDDSRQWVERMLDYNVPGGKLNRGLSVIDSYKLLK  62



>ref|XP_010103952.1| Farnesyl pyrophosphate synthase 1 [Morus notabilis]
 gb|EXB97655.1| Farnesyl pyrophosphate synthase 1 [Morus notabilis]
Length=342

 Score =   101 bits (252),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 46/58 (79%), Positives = 52/58 (90%), Gaps = 0/58 (0%)
 Frame = -2

Query  175  RSDFVGVYAKLKSELLNDPAIQLTPDSRQWVQRMLEYNVPGGKLNRGLSVIDSYKLLK  2
            R+ FV VY+ LKSE+LNDPA + T DSRQWV+RML+YNVPGGKLNRGLSVIDSYKLLK
Sbjct  5    RAKFVEVYSFLKSEILNDPAFEYTDDSRQWVERMLDYNVPGGKLNRGLSVIDSYKLLK  62



>gb|KDP35531.1| hypothetical protein JCGZ_08969 [Jatropha curcas]
Length=342

 Score =   101 bits (252),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 46/61 (75%), Positives = 53/61 (87%), Gaps = 0/61 (0%)
 Frame = -2

Query  184  ADPRSDFVGVYAKLKSELLNDPAIQLTPDSRQWVQRMLEYNVPGGKLNRGLSVIDSYKLL  5
            AD +S F+ VY+ LK ELL DPA + TPDSR+WV+RML+YNVPGGKLNRGLSVIDSYKLL
Sbjct  2    ADLKSTFLEVYSVLKKELLQDPAFEWTPDSREWVERMLDYNVPGGKLNRGLSVIDSYKLL  61

Query  4    K  2
            K
Sbjct  62   K  62



>ref|XP_004149409.1| PREDICTED: farnesyl pyrophosphate synthase 1-like [Cucumis sativus]
 gb|KGN44386.1| hypothetical protein Csa_7G278210 [Cucumis sativus]
Length=342

 Score =   101 bits (252),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 46/58 (79%), Positives = 52/58 (90%), Gaps = 0/58 (0%)
 Frame = -2

Query  175  RSDFVGVYAKLKSELLNDPAIQLTPDSRQWVQRMLEYNVPGGKLNRGLSVIDSYKLLK  2
            RS F+ VY+ LKSELL+DPA + T DSRQWV+RML+YNVPGGKLNRGLSVIDSYKLLK
Sbjct  5    RSKFLEVYSLLKSELLHDPAFEFTDDSRQWVERMLDYNVPGGKLNRGLSVIDSYKLLK  62



>gb|EYU33721.1| hypothetical protein MIMGU_mgv1a008270mg [Erythranthe guttata]
Length=379

 Score =   101 bits (251),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 45/63 (71%), Positives = 54/63 (86%), Gaps = 0/63 (0%)
 Frame = -2

Query  190  TAADPRSDFVGVYAKLKSELLNDPAIQLTPDSRQWVQRMLEYNVPGGKLNRGLSVIDSYK  11
            T AD +S F+ VY+ LKSELLNDP  + T DSRQW++RML+YNVPGGKLNRGLSV++SYK
Sbjct  37   TMADLKSKFLQVYSVLKSELLNDPNFEFTDDSRQWIERMLDYNVPGGKLNRGLSVVESYK  96

Query  10   LLK  2
            LLK
Sbjct  97   LLK  99



>gb|AAV58896.1| farnesyl diphosphate synthase [Centella asiatica]
Length=342

 Score =   100 bits (250),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 45/61 (74%), Positives = 54/61 (89%), Gaps = 0/61 (0%)
 Frame = -2

Query  184  ADPRSDFVGVYAKLKSELLNDPAIQLTPDSRQWVQRMLEYNVPGGKLNRGLSVIDSYKLL  5
            +D ++ F+ VY+ LKS+LLNDPA + T DSRQWV+RML+YNVPGGKLNRGLSVIDSYKLL
Sbjct  2    SDLKTRFLEVYSVLKSDLLNDPAFEFTDDSRQWVERMLDYNVPGGKLNRGLSVIDSYKLL  61

Query  4    K  2
            K
Sbjct  62   K  62



>gb|ADL74465.1| farnesyl diphosphate synthase [Bupleurum chinense]
Length=342

 Score =   100 bits (250),  Expect = 3e-23, Method: Composition-based stats.
 Identities = 45/62 (73%), Positives = 52/62 (84%), Gaps = 0/62 (0%)
 Frame = -2

Query  187  AADPRSDFVGVYAKLKSELLNDPAIQLTPDSRQWVQRMLEYNVPGGKLNRGLSVIDSYKL  8
              D ++ F+ VY+ LKSELL DPA + TPDSR+WV RML+YNVPGGKLNRGLSVIDSYKL
Sbjct  2    GGDLKTKFLEVYSVLKSELLTDPAFEFTPDSREWVDRMLDYNVPGGKLNRGLSVIDSYKL  61

Query  7    LK  2
            LK
Sbjct  62   LK  63



>gb|AFX68799.1| farnesyl pyrophosphate synthase [Dendrobium catenatum]
Length=348

 Score =   100 bits (250),  Expect = 3e-23, Method: Composition-based stats.
 Identities = 42/69 (61%), Positives = 57/69 (83%), Gaps = 0/69 (0%)
 Frame = -2

Query  208  MATQNGTAADPRSDFVGVYAKLKSELLNDPAIQLTPDSRQWVQRMLEYNVPGGKLNRGLS  29
            MA  NG A D +++F+ +Y++LKS+LL+DPA   T DSRQW+ RML+YNVPGGKLNRG+S
Sbjct  1    MAEANGKAVDLKTNFLQIYSRLKSDLLDDPAFSFTEDSRQWIDRMLDYNVPGGKLNRGIS  60

Query  28   VIDSYKLLK  2
            V+DS ++LK
Sbjct  61   VVDSCEILK  69



>sp|P49351.1|FPPS1_LUPAL RecName: Full=Farnesyl pyrophosphate synthase 1; Short=FPP synthase 
1; Short=FPS 1; AltName: Full=(2E,6E)-farnesyl diphosphate 
synthase 1; AltName: Full=Dimethylallyltranstransferase 
1; AltName: Full=Farnesyl diphosphate synthase 1; AltName: 
Full=Geranyltranstransferase 1 [Lupinus albus]
 gb|AAA86687.1| farnesyl pyrophosphate synthase [Lupinus albus]
Length=342

 Score =   100 bits (249),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 46/61 (75%), Positives = 54/61 (89%), Gaps = 0/61 (0%)
 Frame = -2

Query  184  ADPRSDFVGVYAKLKSELLNDPAIQLTPDSRQWVQRMLEYNVPGGKLNRGLSVIDSYKLL  5
            AD RS F+ VY+ LKSELL+DPA + +PDSRQW+ RML+YNVPGGKLNRGLSVIDSY+LL
Sbjct  2    ADLRSTFLNVYSVLKSELLHDPAFEFSPDSRQWLDRMLDYNVPGGKLNRGLSVIDSYRLL  61

Query  4    K  2
            K
Sbjct  62   K  62



>gb|ACJ38671.1| farnesyl pyrophosphate synthase [Chimonanthus praecox]
Length=358

 Score =   100 bits (249),  Expect = 4e-23, Method: Composition-based stats.
 Identities = 46/65 (71%), Positives = 51/65 (78%), Gaps = 0/65 (0%)
 Frame = -2

Query  196  NGTAADPRSDFVGVYAKLKSELLNDPAIQLTPDSRQWVQRMLEYNVPGGKLNRGLSVIDS  17
            NG  +DPRS F+  Y +LKSELL D A   T DSRQW+ RML+YNVPGGKLNRGLSVIDS
Sbjct  14   NGKISDPRSAFMRAYDRLKSELLQDSAFDFTDDSRQWIDRMLDYNVPGGKLNRGLSVIDS  73

Query  16   YKLLK  2
            YK LK
Sbjct  74   YKSLK  78



>gb|AHI44281.1| farnesyl pyrophosphate synthase [Gossypium hirsutum]
Length=342

 Score =   100 bits (249),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 46/61 (75%), Positives = 54/61 (89%), Gaps = 0/61 (0%)
 Frame = -2

Query  184  ADPRSDFVGVYAKLKSELLNDPAIQLTPDSRQWVQRMLEYNVPGGKLNRGLSVIDSYKLL  5
            AD RS F+ VY++LKSELL DP+ + T DSRQWV+RML+YNVPGGKLNRGLSVIDSY+LL
Sbjct  2    ADLRSAFLNVYSQLKSELLQDPSFEFTDDSRQWVERMLDYNVPGGKLNRGLSVIDSYRLL  61

Query  4    K  2
            K
Sbjct  62   K  62



>ref|XP_006352551.1| PREDICTED: farnesyl pyrophosphate synthase 1-like isoform X2 
[Solanum tuberosum]
Length=342

 Score =   100 bits (249),  Expect = 4e-23, Method: Composition-based stats.
 Identities = 45/61 (74%), Positives = 51/61 (84%), Gaps = 0/61 (0%)
 Frame = -2

Query  184  ADPRSDFVGVYAKLKSELLNDPAIQLTPDSRQWVQRMLEYNVPGGKLNRGLSVIDSYKLL  5
            +D +S F+GVY  LKSELLNDP  + T D RQWV+RML+YNVPGGKLNRGLSVIDSY LL
Sbjct  2    SDLKSKFLGVYKVLKSELLNDPDFEFTDDDRQWVERMLDYNVPGGKLNRGLSVIDSYSLL  61

Query  4    K  2
            K
Sbjct  62   K  62



>gb|KHG28027.1| Farnesyl pyrophosphate synthase 1 [Gossypium arboreum]
Length=342

 Score =   100 bits (249),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 46/61 (75%), Positives = 54/61 (89%), Gaps = 0/61 (0%)
 Frame = -2

Query  184  ADPRSDFVGVYAKLKSELLNDPAIQLTPDSRQWVQRMLEYNVPGGKLNRGLSVIDSYKLL  5
            AD RS F+ VY++LKSELL DP+ + T DSRQWV+RML+YNVPGGKLNRGLSVIDSY+LL
Sbjct  2    ADLRSAFLNVYSQLKSELLQDPSFEFTDDSRQWVERMLDYNVPGGKLNRGLSVIDSYRLL  61

Query  4    K  2
            K
Sbjct  62   K  62



>gb|AFO67222.1| putative farnesyl diphosphate synthase, partial [Aralia elata]
Length=245

 Score = 99.4 bits (246),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 46/61 (75%), Positives = 54/61 (89%), Gaps = 0/61 (0%)
 Frame = -2

Query  184  ADPRSDFVGVYAKLKSELLNDPAIQLTPDSRQWVQRMLEYNVPGGKLNRGLSVIDSYKLL  5
            +D ++ F+ VY+ LKSELLNDPA + T DSRQWV+RML+YNVPGGKLNRGLSVIDSYKLL
Sbjct  2    SDLKTRFLEVYSVLKSELLNDPAFEFTDDSRQWVERMLDYNVPGGKLNRGLSVIDSYKLL  61

Query  4    K  2
            K
Sbjct  62   K  62



>ref|XP_011086283.1| PREDICTED: farnesyl pyrophosphate synthase 1-like [Sesamum indicum]
 ref|XP_011086284.1| PREDICTED: farnesyl pyrophosphate synthase 1-like [Sesamum indicum]
Length=345

 Score =   100 bits (248),  Expect = 5e-23, Method: Composition-based stats.
 Identities = 45/61 (74%), Positives = 54/61 (89%), Gaps = 0/61 (0%)
 Frame = -2

Query  184  ADPRSDFVGVYAKLKSELLNDPAIQLTPDSRQWVQRMLEYNVPGGKLNRGLSVIDSYKLL  5
            +D R+ F+GVY+ LKS+LLNDPA + T  SRQWV+RML+YNVPGGKLNRGLSV+DSYKLL
Sbjct  5    SDLRTVFLGVYSVLKSDLLNDPAFEWTDASRQWVERMLDYNVPGGKLNRGLSVVDSYKLL  64

Query  4    K  2
            K
Sbjct  65   K  65



>ref|XP_006352550.1| PREDICTED: farnesyl pyrophosphate synthase 1-like isoform X1 
[Solanum tuberosum]
Length=345

 Score =   100 bits (248),  Expect = 5e-23, Method: Composition-based stats.
 Identities = 45/61 (74%), Positives = 51/61 (84%), Gaps = 0/61 (0%)
 Frame = -2

Query  184  ADPRSDFVGVYAKLKSELLNDPAIQLTPDSRQWVQRMLEYNVPGGKLNRGLSVIDSYKLL  5
            +D +S F+GVY  LKSELLNDP  + T D RQWV+RML+YNVPGGKLNRGLSVIDSY LL
Sbjct  2    SDLKSKFLGVYKVLKSELLNDPDFEFTDDDRQWVERMLDYNVPGGKLNRGLSVIDSYSLL  61

Query  4    K  2
            K
Sbjct  62   K  62



>gb|ACS74708.1| farnesyl pyrophosphate synthase [Magnolia chapensis]
Length=351

 Score =   100 bits (248),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 48/68 (71%), Positives = 54/68 (79%), Gaps = 0/68 (0%)
 Frame = -2

Query  205  ATQNGTAADPRSDFVGVYAKLKSELLNDPAIQLTPDSRQWVQRMLEYNVPGGKLNRGLSV  26
            A  NG  +  RS F+ VYA+LKS+LL DPA   T DSRQW+ RMLEYNVPGGKLNRGLSV
Sbjct  4    ANSNGKTSGLRSVFLQVYARLKSDLLQDPAFDWTEDSRQWIDRMLEYNVPGGKLNRGLSV  63

Query  25   IDSYKLLK  2
            IDSY+LLK
Sbjct  64   IDSYQLLK  71



>emb|CAA72793.1| farnesyl pyrophosphate synthase [Gossypium arboreum]
Length=342

 Score =   100 bits (248),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 46/61 (75%), Positives = 55/61 (90%), Gaps = 0/61 (0%)
 Frame = -2

Query  184  ADPRSDFVGVYAKLKSELLNDPAIQLTPDSRQWVQRMLEYNVPGGKLNRGLSVIDSYKLL  5
            AD RS F+ VY++LKSELL DP+ +LT +SRQWV+RML+YNVPGGKLNRGLSVIDSY+LL
Sbjct  2    ADLRSAFLNVYSQLKSELLQDPSFELTDESRQWVERMLDYNVPGGKLNRGLSVIDSYRLL  61

Query  4    K  2
            K
Sbjct  62   K  62



>emb|CDP13684.1| unnamed protein product [Coffea canephora]
Length=342

 Score =   100 bits (248),  Expect = 6e-23, Method: Composition-based stats.
 Identities = 44/61 (72%), Positives = 53/61 (87%), Gaps = 0/61 (0%)
 Frame = -2

Query  184  ADPRSDFVGVYAKLKSELLNDPAIQLTPDSRQWVQRMLEYNVPGGKLNRGLSVIDSYKLL  5
            +D ++ F+ VY+ LKSELLNDPA + T DSRQW+ RML+YNVPGGKLNRGLSV+DSYKLL
Sbjct  2    SDLKTKFLEVYSVLKSELLNDPAFEFTDDSRQWLDRMLDYNVPGGKLNRGLSVVDSYKLL  61

Query  4    K  2
            K
Sbjct  62   K  62



>gb|AEG47693.1| farnesyl diphosphate synthase [Allium sativum]
Length=341

 Score = 99.8 bits (247),  Expect = 6e-23, Method: Composition-based stats.
 Identities = 43/61 (70%), Positives = 54/61 (89%), Gaps = 0/61 (0%)
 Frame = -2

Query  184  ADPRSDFVGVYAKLKSELLNDPAIQLTPDSRQWVQRMLEYNVPGGKLNRGLSVIDSYKLL  5
            ++ ++ F+ VY+ LKSELLNDPA + T DSRQWV+RML+YNVPGGKLNRGLSV+DSYKLL
Sbjct  2    SETKAKFLEVYSVLKSELLNDPAFEFTDDSRQWVERMLDYNVPGGKLNRGLSVVDSYKLL  61

Query  4    K  2
            +
Sbjct  62   Q  62



>ref|XP_007026400.1| Farnesyl diphosphate synthase 1 isoform 3, partial [Theobroma 
cacao]
 gb|EOY29022.1| Farnesyl diphosphate synthase 1 isoform 3, partial [Theobroma 
cacao]
Length=292

 Score = 99.4 bits (246),  Expect = 7e-23, Method: Composition-based stats.
 Identities = 52/83 (63%), Positives = 59/83 (71%), Gaps = 2/83 (2%)
 Frame = -2

Query  244  ASPVPRCRLVGEMATQNGTA--ADPRSDFVGVYAKLKSELLNDPAIQLTPDSRQWVQRML  71
            A  VP  R     + +N  A  AD RS F+ VY KLKSELL DP+ + T  SRQWV RML
Sbjct  25   AFTVPEERRGAFQSQKNTLALMADRRSAFLQVYYKLKSELLEDPSFEFTDVSRQWVDRML  84

Query  70   EYNVPGGKLNRGLSVIDSYKLLK  2
            +YNVPGGKLNRGLSVIDSY+LLK
Sbjct  85   DYNVPGGKLNRGLSVIDSYRLLK  107



>ref|XP_010675977.1| PREDICTED: farnesyl pyrophosphate synthase 1-like [Beta vulgaris 
subsp. vulgaris]
Length=342

 Score = 99.8 bits (247),  Expect = 8e-23, Method: Composition-based stats.
 Identities = 46/61 (75%), Positives = 52/61 (85%), Gaps = 0/61 (0%)
 Frame = -2

Query  184  ADPRSDFVGVYAKLKSELLNDPAIQLTPDSRQWVQRMLEYNVPGGKLNRGLSVIDSYKLL  5
            +D RS F+ VY  LKSELLNDPA + T  SRQWV+RML+YNVPGGKLNRG+SVIDSYKLL
Sbjct  2    SDLRSKFLEVYEILKSELLNDPAFEWTQTSRQWVERMLDYNVPGGKLNRGVSVIDSYKLL  61

Query  4    K  2
            K
Sbjct  62   K  62



>gb|AAK58594.1|AF268889_1 farnesyl pyrophosphate synthase [Humulus lupulus]
Length=342

 Score = 99.8 bits (247),  Expect = 8e-23, Method: Composition-based stats.
 Identities = 45/58 (78%), Positives = 51/58 (88%), Gaps = 0/58 (0%)
 Frame = -2

Query  175  RSDFVGVYAKLKSELLNDPAIQLTPDSRQWVQRMLEYNVPGGKLNRGLSVIDSYKLLK  2
            R  F+ VY+ LKSELLNDPA + T DSRQWV+RML+YNVPGGKLNRGLSVIDSY+LLK
Sbjct  5    RLKFMEVYSILKSELLNDPAFEFTDDSRQWVERMLDYNVPGGKLNRGLSVIDSYQLLK  62



>gb|AEH30663.1| farnesyl diphosphate synthase [Malus domestica]
Length=304

 Score = 99.4 bits (246),  Expect = 8e-23, Method: Composition-based stats.
 Identities = 45/61 (74%), Positives = 52/61 (85%), Gaps = 0/61 (0%)
 Frame = -2

Query  184  ADPRSDFVGVYAKLKSELLNDPAIQLTPDSRQWVQRMLEYNVPGGKLNRGLSVIDSYKLL  5
            AD +S F+ VY+ LKSELL DPA   T DSRQWV+RML+YNVPGGKLNRGLSVIDSY+LL
Sbjct  2    ADLKSKFLKVYSVLKSELLEDPAFDFTKDSRQWVERMLDYNVPGGKLNRGLSVIDSYQLL  61

Query  4    K  2
            +
Sbjct  62   Q  62



>ref|XP_007026399.1| Farnesyl diphosphate synthase 1 isoform 2, partial [Theobroma 
cacao]
 gb|EOY29021.1| Farnesyl diphosphate synthase 1 isoform 2, partial [Theobroma 
cacao]
Length=339

 Score = 99.4 bits (246),  Expect = 8e-23, Method: Composition-based stats.
 Identities = 52/83 (63%), Positives = 59/83 (71%), Gaps = 2/83 (2%)
 Frame = -2

Query  244  ASPVPRCRLVGEMATQNGTA--ADPRSDFVGVYAKLKSELLNDPAIQLTPDSRQWVQRML  71
            A  VP  R     + +N  A  AD RS F+ VY KLKSELL DP+ + T  SRQWV RML
Sbjct  21   AFTVPEERRGAFQSQKNTLALMADRRSAFLQVYYKLKSELLEDPSFEFTDVSRQWVDRML  80

Query  70   EYNVPGGKLNRGLSVIDSYKLLK  2
            +YNVPGGKLNRGLSVIDSY+LLK
Sbjct  81   DYNVPGGKLNRGLSVIDSYRLLK  103



>ref|XP_002534338.1| farnesyl-pyrophosphate synthetase, putative [Ricinus communis]
 gb|EEF28044.1| farnesyl-pyrophosphate synthetase, putative [Ricinus communis]
Length=333

 Score = 99.4 bits (246),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 44/61 (72%), Positives = 52/61 (85%), Gaps = 0/61 (0%)
 Frame = -2

Query  184  ADPRSDFVGVYAKLKSELLNDPAIQLTPDSRQWVQRMLEYNVPGGKLNRGLSVIDSYKLL  5
            AD +S F+ VY+ LK +LL DPA + TPDSR+WV RML+YNVPGGKLNRGLSVIDSY+LL
Sbjct  2    ADLKSTFLNVYSILKKQLLEDPAFEWTPDSREWVNRMLDYNVPGGKLNRGLSVIDSYQLL  61

Query  4    K  2
            K
Sbjct  62   K  62



>ref|XP_009374835.1| PREDICTED: farnesyl pyrophosphate synthase 1 [Pyrus x bretschneideri]
Length=342

 Score = 99.0 bits (245),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 45/61 (74%), Positives = 52/61 (85%), Gaps = 0/61 (0%)
 Frame = -2

Query  184  ADPRSDFVGVYAKLKSELLNDPAIQLTPDSRQWVQRMLEYNVPGGKLNRGLSVIDSYKLL  5
            AD +S F+ VY+ LKSELL DPA   T DSRQWV+RML+YNVPGGKLNRGLSVIDSY+LL
Sbjct  2    ADLKSKFLKVYSVLKSELLEDPAFDFTKDSRQWVERMLDYNVPGGKLNRGLSVIDSYQLL  61

Query  4    K  2
            +
Sbjct  62   Q  62



>ref|XP_008366094.1| PREDICTED: farnesyl pyrophosphate synthase 2 [Malus domestica]
Length=342

 Score = 99.0 bits (245),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 45/61 (74%), Positives = 52/61 (85%), Gaps = 0/61 (0%)
 Frame = -2

Query  184  ADPRSDFVGVYAKLKSELLNDPAIQLTPDSRQWVQRMLEYNVPGGKLNRGLSVIDSYKLL  5
            AD +S F+ VY+ LKSELL DPA   T DSRQWV+RML+YNVPGGKLNRGLSVIDSY+LL
Sbjct  2    ADLKSKFLKVYSVLKSELLEDPAFDFTKDSRQWVERMLDYNVPGGKLNRGLSVIDSYQLL  61

Query  4    K  2
            +
Sbjct  62   Q  62



>gb|AFW98439.1| farnesyl diphosphate synthase [Leibnitzia anandria]
Length=342

 Score = 99.0 bits (245),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 44/62 (71%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = -2

Query  187  AADPRSDFVGVYAKLKSELLNDPAIQLTPDSRQWVQRMLEYNVPGGKLNRGLSVIDSYKL  8
            A+D +S F+ VY  LKSELL+DPA +   DSRQWV++ML+YNVPGGKLNRGLSV+DSYKL
Sbjct  2    ASDLKSKFLEVYEALKSELLHDPAFEFDDDSRQWVEKMLDYNVPGGKLNRGLSVVDSYKL  61

Query  7    LK  2
            LK
Sbjct  62   LK  63



>ref|XP_007026398.1| Farnesyl diphosphate synthase 1 isoform 1 [Theobroma cacao]
 gb|EOY29020.1| Farnesyl diphosphate synthase 1 isoform 1 [Theobroma cacao]
Length=342

 Score = 99.0 bits (245),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 46/61 (75%), Positives = 51/61 (84%), Gaps = 0/61 (0%)
 Frame = -2

Query  184  ADPRSDFVGVYAKLKSELLNDPAIQLTPDSRQWVQRMLEYNVPGGKLNRGLSVIDSYKLL  5
            AD RS F+ VY KLKSELL DP+ + T  SRQWV RML+YNVPGGKLNRGLSVIDSY+LL
Sbjct  2    ADRRSAFLQVYYKLKSELLEDPSFEFTDVSRQWVDRMLDYNVPGGKLNRGLSVIDSYRLL  61

Query  4    K  2
            K
Sbjct  62   K  62



>ref|XP_008370962.1| PREDICTED: farnesyl pyrophosphate synthase 2-like [Malus domestica]
Length=342

 Score = 99.0 bits (245),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 45/61 (74%), Positives = 52/61 (85%), Gaps = 0/61 (0%)
 Frame = -2

Query  184  ADPRSDFVGVYAKLKSELLNDPAIQLTPDSRQWVQRMLEYNVPGGKLNRGLSVIDSYKLL  5
            AD +S F+ VY+ LKSELL DPA   T DSRQWV+RML+YNVPGGKLNRGLSVIDSY+LL
Sbjct  2    ADLKSKFLKVYSVLKSELLEDPAFDFTNDSRQWVERMLDYNVPGGKLNRGLSVIDSYQLL  61

Query  4    K  2
            +
Sbjct  62   Q  62



>ref|XP_007211529.1| hypothetical protein PRUPE_ppa008181mg [Prunus persica]
 ref|XP_008224644.1| PREDICTED: farnesyl pyrophosphate synthase 2 [Prunus mume]
 gb|EMJ12728.1| hypothetical protein PRUPE_ppa008181mg [Prunus persica]
Length=342

 Score = 98.6 bits (244),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 44/61 (72%), Positives = 53/61 (87%), Gaps = 0/61 (0%)
 Frame = -2

Query  184  ADPRSDFVGVYAKLKSELLNDPAIQLTPDSRQWVQRMLEYNVPGGKLNRGLSVIDSYKLL  5
            AD +S F+ VY+ LKSELL DPA + T DSRQWV+RM++YNVPGGKLNRGLSVIDSY+LL
Sbjct  2    ADLKSKFLQVYSVLKSELLEDPAFEFTNDSRQWVERMMDYNVPGGKLNRGLSVIDSYQLL  61

Query  4    K  2
            +
Sbjct  62   Q  62



>ref|NP_001280802.1| farnesyl pyrophosphate synthase 2 [Malus domestica]
 gb|AAM08927.1| farnesyl pyrophosphate synthase [Malus domestica]
Length=342

 Score = 98.6 bits (244),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 45/61 (74%), Positives = 52/61 (85%), Gaps = 0/61 (0%)
 Frame = -2

Query  184  ADPRSDFVGVYAKLKSELLNDPAIQLTPDSRQWVQRMLEYNVPGGKLNRGLSVIDSYKLL  5
            AD +S F+ VY+ LKSELL DPA   T DSRQWV+RML+YNVPGGKLNRGLSVIDSY+LL
Sbjct  2    ADLKSKFLKVYSVLKSELLEDPAFDFTNDSRQWVERMLDYNVPGGKLNRGLSVIDSYQLL  61

Query  4    K  2
            +
Sbjct  62   Q  62



>dbj|BAB60822.1| putative FPP synthase 2 [Eucommia ulmoides]
Length=342

 Score = 98.6 bits (244),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 45/61 (74%), Positives = 52/61 (85%), Gaps = 0/61 (0%)
 Frame = -2

Query  184  ADPRSDFVGVYAKLKSELLNDPAIQLTPDSRQWVQRMLEYNVPGGKLNRGLSVIDSYKLL  5
            +D +S F+ VY+ LKSELLNDPA   T DSR WV+RML+YNVPGGKLNRGLSVIDS+KLL
Sbjct  2    SDLKSKFLEVYSVLKSELLNDPAFDFTDDSRLWVERMLDYNVPGGKLNRGLSVIDSFKLL  61

Query  4    K  2
            K
Sbjct  62   K  62



>gb|AGJ03663.1| putative farnesyl diphosphate synthase 2 [Eucommia ulmoides]
Length=342

 Score = 98.6 bits (244),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 45/61 (74%), Positives = 52/61 (85%), Gaps = 0/61 (0%)
 Frame = -2

Query  184  ADPRSDFVGVYAKLKSELLNDPAIQLTPDSRQWVQRMLEYNVPGGKLNRGLSVIDSYKLL  5
            +D +S F+ VY+ LKSELLNDPA   T DSR WV+RML+YNVPGGKLNRGLSVIDS+KLL
Sbjct  2    SDLKSKFLEVYSVLKSELLNDPAFDFTDDSRLWVERMLDYNVPGGKLNRGLSVIDSFKLL  61

Query  4    K  2
            K
Sbjct  62   K  62



>ref|XP_011005729.1| PREDICTED: farnesyl pyrophosphate synthase 1 [Populus euphratica]
Length=342

 Score = 98.6 bits (244),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 44/61 (72%), Positives = 51/61 (84%), Gaps = 0/61 (0%)
 Frame = -2

Query  184  ADPRSDFVGVYAKLKSELLNDPAIQLTPDSRQWVQRMLEYNVPGGKLNRGLSVIDSYKLL  5
            AD +S F+ VY+ LK ELL DPA + +PDSR WV+RML+YNVPGGKLNRGLSVIDSYK L
Sbjct  2    ADLKSTFLNVYSVLKKELLEDPAFEWSPDSRDWVERMLDYNVPGGKLNRGLSVIDSYKYL  61

Query  4    K  2
            K
Sbjct  62   K  62



>gb|AEY77151.1| farnesyl diphosphate synthase [Eleutherococcus senticosus]
Length=342

 Score = 98.6 bits (244),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 44/61 (72%), Positives = 53/61 (87%), Gaps = 0/61 (0%)
 Frame = -2

Query  184  ADPRSDFVGVYAKLKSELLNDPAIQLTPDSRQWVQRMLEYNVPGGKLNRGLSVIDSYKLL  5
            +D ++ F+ VY+ LKSELLNDPA + T DSRQW ++ML+YNVPGGKLNRGLSVIDSYKLL
Sbjct  2    SDLKARFLEVYSVLKSELLNDPAFEFTDDSRQWFEQMLDYNVPGGKLNRGLSVIDSYKLL  61

Query  4    K  2
            K
Sbjct  62   K  62



>gb|AFW98436.1| farnesyl diphosphate synthase [Aster ageratoides]
Length=344

 Score = 98.6 bits (244),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 43/64 (67%), Positives = 53/64 (83%), Gaps = 0/64 (0%)
 Frame = -2

Query  193  GTAADPRSDFVGVYAKLKSELLNDPAIQLTPDSRQWVQRMLEYNVPGGKLNRGLSVIDSY  14
            G ++D +S F+ VY  LKSEL+NDPA +   DSRQWV +ML+YNVPGGKLNRGLSV+DSY
Sbjct  2    GGSSDLKSKFMDVYKTLKSELINDPAFEFDDDSRQWVDKMLDYNVPGGKLNRGLSVVDSY  61

Query  13   KLLK  2
            +LLK
Sbjct  62   QLLK  65



>ref|XP_008384598.1| PREDICTED: farnesyl pyrophosphate synthase 2-like [Malus domestica]
Length=342

 Score = 98.2 bits (243),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 45/61 (74%), Positives = 51/61 (84%), Gaps = 0/61 (0%)
 Frame = -2

Query  184  ADPRSDFVGVYAKLKSELLNDPAIQLTPDSRQWVQRMLEYNVPGGKLNRGLSVIDSYKLL  5
             D RS F+GVY+ LKSELLNDPA + T  SRQWV+RML+Y VPGGKLNRGLSV+DS KLL
Sbjct  2    GDLRSKFLGVYSVLKSELLNDPAFEFTDVSRQWVERMLDYTVPGGKLNRGLSVVDSLKLL  61

Query  4    K  2
            K
Sbjct  62   K  62



>sp|O24242.1|FPPS2_PARAR RecName: Full=Farnesyl pyrophosphate synthase 2; Short=FPP synthase 
2; Short=FPS 2; AltName: Full=(2E,6E)-farnesyl diphosphate 
synthase 2; AltName: Full=Dimethylallyltranstransferase 
2; AltName: Full=Farnesyl diphosphate synthase 2; AltName: 
Full=Geranyltranstransferase 2 [Parthenium argentatum]
 emb|CAA57893.1| farnesyl diphosphate synthase [Parthenium argentatum]
Length=342

 Score = 98.2 bits (243),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 43/62 (69%), Positives = 52/62 (84%), Gaps = 0/62 (0%)
 Frame = -2

Query  187  AADPRSDFVGVYAKLKSELLNDPAIQLTPDSRQWVQRMLEYNVPGGKLNRGLSVIDSYKL  8
            + D RS F+ VY  LKSEL+NDPA +   DSRQW+++ML+YNVPGGKLNRGLSVIDSY+L
Sbjct  2    STDIRSKFLQVYDTLKSELINDPAFEFDDDSRQWIEKMLDYNVPGGKLNRGLSVIDSYQL  61

Query  7    LK  2
            LK
Sbjct  62   LK  63



>gb|AFW98444.1| farnesyl diphosphate synthase [Taraxacum mongolicum]
Length=343

 Score = 98.2 bits (243),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 43/62 (69%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = -2

Query  187  AADPRSDFVGVYAKLKSELLNDPAIQLTPDSRQWVQRMLEYNVPGGKLNRGLSVIDSYKL  8
            ++D +S F+ VY  LKSEL++DPA +   DSRQWV+RML+YNVPGGKLNRGLSV+DSYKL
Sbjct  2    SSDLKSKFLEVYETLKSELIHDPAFEFDDDSRQWVERMLDYNVPGGKLNRGLSVVDSYKL  61

Query  7    LK  2
            LK
Sbjct  62   LK  63



>gb|AII72208.1| farnesyl diphosphate synthase [Gynostemma pentaphyllum]
Length=342

 Score = 98.2 bits (243),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 45/61 (74%), Positives = 52/61 (85%), Gaps = 0/61 (0%)
 Frame = -2

Query  184  ADPRSDFVGVYAKLKSELLNDPAIQLTPDSRQWVQRMLEYNVPGGKLNRGLSVIDSYKLL  5
            AD +S F+ VY  LKSELL DPA + + DSRQWV+RML+YNVPGGKLNRGLSVIDSY+LL
Sbjct  2    ADLKSIFLDVYYVLKSELLQDPAFEFSDDSRQWVERMLDYNVPGGKLNRGLSVIDSYRLL  61

Query  4    K  2
            K
Sbjct  62   K  62



>ref|NP_001267864.1| farnesyl diphosphate synthase [Vitis vinifera]
 gb|AAX76910.1| farnesyl diphosphate synthase [Vitis vinifera]
Length=341

 Score = 98.2 bits (243),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 44/61 (72%), Positives = 54/61 (89%), Gaps = 0/61 (0%)
 Frame = -2

Query  184  ADPRSDFVGVYAKLKSELLNDPAIQLTPDSRQWVQRMLEYNVPGGKLNRGLSVIDSYKLL  5
            ++ +S F+ VY+ LKSELLNDPA + T DSRQWV+RML+YNVPGGKLNRGLSV+DSYKLL
Sbjct  2    SETKSKFLEVYSVLKSELLNDPAFEFTDDSRQWVERMLDYNVPGGKLNRGLSVVDSYKLL  61

Query  4    K  2
            +
Sbjct  62   Q  62



>emb|CBI39786.3| unnamed protein product [Vitis vinifera]
Length=341

 Score = 98.2 bits (243),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 44/61 (72%), Positives = 54/61 (89%), Gaps = 0/61 (0%)
 Frame = -2

Query  184  ADPRSDFVGVYAKLKSELLNDPAIQLTPDSRQWVQRMLEYNVPGGKLNRGLSVIDSYKLL  5
            ++ +S F+ VY+ LKSELLNDPA + T DSRQWV+RML+YNVPGGKLNRGLSV+DSYKLL
Sbjct  2    SETKSKFLEVYSVLKSELLNDPAFEFTDDSRQWVERMLDYNVPGGKLNRGLSVVDSYKLL  61

Query  4    K  2
            +
Sbjct  62   Q  62



>gb|AFJ52720.1| farnesyl pyrophosphate synthase [Mangifera indica]
 gb|AFJ53077.1| farnesyl pyrophosphate synthase [Mangifera indica]
Length=342

 Score = 98.2 bits (243),  Expect = 3e-22, Method: Composition-based stats.
 Identities = 45/61 (74%), Positives = 51/61 (84%), Gaps = 0/61 (0%)
 Frame = -2

Query  184  ADPRSDFVGVYAKLKSELLNDPAIQLTPDSRQWVQRMLEYNVPGGKLNRGLSVIDSYKLL  5
            +D +S FV VY  LK ELLNDPA + T  SRQWV+RML+YNVPGGKLNRGLSV+DSYKLL
Sbjct  2    SDLKSKFVEVYNILKQELLNDPAFEFTDVSRQWVERMLDYNVPGGKLNRGLSVVDSYKLL  61

Query  4    K  2
            K
Sbjct  62   K  62



>ref|XP_007147577.1| hypothetical protein PHAVU_006G136300g [Phaseolus vulgaris]
 gb|ESW19571.1| hypothetical protein PHAVU_006G136300g [Phaseolus vulgaris]
Length=342

 Score = 97.8 bits (242),  Expect = 3e-22, Method: Composition-based stats.
 Identities = 43/61 (70%), Positives = 53/61 (87%), Gaps = 0/61 (0%)
 Frame = -2

Query  184  ADPRSDFVGVYAKLKSELLNDPAIQLTPDSRQWVQRMLEYNVPGGKLNRGLSVIDSYKLL  5
            AD +S F+ VY+ LK+ELL+DPA + + D+RQWV RML+YNVPGGKLNRGLSVIDSY+LL
Sbjct  2    ADLKSTFLNVYSVLKAELLHDPAFEFSDDARQWVDRMLDYNVPGGKLNRGLSVIDSYRLL  61

Query  4    K  2
            K
Sbjct  62   K  62



>ref|XP_009367257.1| PREDICTED: farnesyl pyrophosphate synthase 2-like [Pyrus x bretschneideri]
Length=342

 Score = 97.8 bits (242),  Expect = 3e-22, Method: Composition-based stats.
 Identities = 44/61 (72%), Positives = 51/61 (84%), Gaps = 0/61 (0%)
 Frame = -2

Query  184  ADPRSDFVGVYAKLKSELLNDPAIQLTPDSRQWVQRMLEYNVPGGKLNRGLSVIDSYKLL  5
             D RS F+GVY+ LKSELLNDPA + T  SRQW++RML+Y VPGGKLNRGLSV+DS KLL
Sbjct  2    GDLRSKFLGVYSVLKSELLNDPAFEFTDVSRQWIERMLDYTVPGGKLNRGLSVVDSLKLL  61

Query  4    K  2
            K
Sbjct  62   K  62



>ref|XP_006414262.1| hypothetical protein EUTSA_v10025643mg [Eutrema salsugineum]
 gb|ESQ55715.1| hypothetical protein EUTSA_v10025643mg [Eutrema salsugineum]
Length=342

 Score = 97.8 bits (242),  Expect = 4e-22, Method: Composition-based stats.
 Identities = 42/61 (69%), Positives = 54/61 (89%), Gaps = 0/61 (0%)
 Frame = -2

Query  184  ADPRSDFVGVYAKLKSELLNDPAIQLTPDSRQWVQRMLEYNVPGGKLNRGLSVIDSYKLL  5
            AD +S F+ VY+ LK++LL+DPA + T +SRQW++RML+YNVPGGKLNRGLSV+DSYKLL
Sbjct  2    ADMKSTFLDVYSTLKTDLLHDPAFEFTHESRQWLERMLDYNVPGGKLNRGLSVVDSYKLL  61

Query  4    K  2
            K
Sbjct  62   K  62



>sp|O64905.1|FPPS_HELAN RecName: Full=Farnesyl pyrophosphate synthase; Short=FPP synthase; 
Short=FPS; AltName: Full=(2E,6E)-farnesyl diphosphate 
synthase; AltName: Full=Dimethylallyltranstransferase; AltName: 
Full=Farnesyl diphosphate synthase; AltName: Full=Geranyltranstransferase 
[Helianthus annuus]
 gb|AAC78557.1| farnesyl pyrophosphate synthase [Helianthus annuus]
Length=341

 Score = 97.8 bits (242),  Expect = 4e-22, Method: Composition-based stats.
 Identities = 43/62 (69%), Positives = 52/62 (84%), Gaps = 0/62 (0%)
 Frame = -2

Query  187  AADPRSDFVGVYAKLKSELLNDPAIQLTPDSRQWVQRMLEYNVPGGKLNRGLSVIDSYKL  8
            A+D +S F+ VY  LKSELLNDPA +   DSRQW+ +ML+YNVPGGKLNRGLSV+DSY+L
Sbjct  2    ASDLKSKFLHVYQTLKSELLNDPAFEFHHDSRQWIDKMLDYNVPGGKLNRGLSVVDSYQL  61

Query  7    LK  2
            LK
Sbjct  62   LK  63



>gb|EPS73263.1| farnesyl diphosphate synthase, partial [Genlisea aurea]
Length=69

 Score = 92.4 bits (228),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 41/69 (59%), Positives = 56/69 (81%), Gaps = 0/69 (0%)
 Frame = -2

Query  208  MATQNGTAADPRSDFVGVYAKLKSELLNDPAIQLTPDSRQWVQRMLEYNVPGGKLNRGLS  29
            MA  NG   D ++ F+GVY+ LKSELLNDP+ + +  S +WV+RM++YNVPGGKLNRGLS
Sbjct  1    MANPNGWPTDLKASFIGVYSTLKSELLNDPSFEWSDVSLKWVERMMDYNVPGGKLNRGLS  60

Query  28   VIDSYKLLK  2
            V+DS++LL+
Sbjct  61   VVDSFRLLQ  69



>ref|XP_008218685.1| PREDICTED: farnesyl pyrophosphate synthase 1-like [Prunus mume]
Length=342

 Score = 97.4 bits (241),  Expect = 4e-22, Method: Composition-based stats.
 Identities = 46/61 (75%), Positives = 51/61 (84%), Gaps = 0/61 (0%)
 Frame = -2

Query  184  ADPRSDFVGVYAKLKSELLNDPAIQLTPDSRQWVQRMLEYNVPGGKLNRGLSVIDSYKLL  5
            +D RS F+ VY+ LKSELLNDPA + T  SRQWV RML+YNVPGGKLNRGLSVIDS KLL
Sbjct  2    SDLRSKFLEVYSVLKSELLNDPAFEFTDVSRQWVDRMLDYNVPGGKLNRGLSVIDSLKLL  61

Query  4    K  2
            K
Sbjct  62   K  62



>ref|XP_002308751.2| farnesyl-pyrophosphate synthetase fps2 family protein [Populus 
trichocarpa]
 gb|ABK95166.1| unknown [Populus trichocarpa]
 gb|EEE92274.2| farnesyl-pyrophosphate synthetase fps2 family protein [Populus 
trichocarpa]
Length=342

 Score = 97.4 bits (241),  Expect = 4e-22, Method: Composition-based stats.
 Identities = 44/61 (72%), Positives = 50/61 (82%), Gaps = 0/61 (0%)
 Frame = -2

Query  184  ADPRSDFVGVYAKLKSELLNDPAIQLTPDSRQWVQRMLEYNVPGGKLNRGLSVIDSYKLL  5
            AD +S F+ VY+ LK ELL DPA + +PDSR WV RML+YNVPGGKLNRGLSVIDSYK L
Sbjct  2    ADLKSTFLNVYSVLKKELLEDPAFEWSPDSRDWVDRMLDYNVPGGKLNRGLSVIDSYKYL  61

Query  4    K  2
            K
Sbjct  62   K  62



>ref|XP_009347512.1| PREDICTED: farnesyl pyrophosphate synthase 2-like [Pyrus x bretschneideri]
 ref|XP_009347524.1| PREDICTED: farnesyl pyrophosphate synthase 2-like [Pyrus x bretschneideri]
Length=343

 Score = 97.4 bits (241),  Expect = 4e-22, Method: Composition-based stats.
 Identities = 45/62 (73%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = -2

Query  187  AADPRSDFVGVYAKLKSELLNDPAIQLTPDSRQWVQRMLEYNVPGGKLNRGLSVIDSYKL  8
              D RS F+ VY+ LKSELLNDPA + T  SRQWV+RML+YNVPGGKLNRGLSV+DS KL
Sbjct  2    GGDLRSKFLEVYSVLKSELLNDPAFEFTDVSRQWVERMLDYNVPGGKLNRGLSVVDSLKL  61

Query  7    LK  2
            LK
Sbjct  62   LK  63



>ref|XP_008344722.1| PREDICTED: farnesyl pyrophosphate synthase 2-like isoform X1 
[Malus domestica]
 ref|XP_008344723.1| PREDICTED: farnesyl pyrophosphate synthase 2-like isoform X2 
[Malus domestica]
Length=343

 Score = 97.4 bits (241),  Expect = 4e-22, Method: Composition-based stats.
 Identities = 45/62 (73%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = -2

Query  187  AADPRSDFVGVYAKLKSELLNDPAIQLTPDSRQWVQRMLEYNVPGGKLNRGLSVIDSYKL  8
              D RS F+ VY+ LKSELLNDPA + T  SRQWV+RML+YNVPGGKLNRGLSV+DS KL
Sbjct  2    GGDLRSKFLEVYSVLKSELLNDPAFEFTDVSRQWVERMLDYNVPGGKLNRGLSVVDSLKL  61

Query  7    LK  2
            LK
Sbjct  62   LK  63



>gb|ACD54840.1| farnesyl pyrophosphate syntethase [Olea europaea]
Length=186

 Score = 95.5 bits (236),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 45/61 (74%), Positives = 53/61 (87%), Gaps = 0/61 (0%)
 Frame = -2

Query  184  ADPRSDFVGVYAKLKSELLNDPAIQLTPDSRQWVQRMLEYNVPGGKLNRGLSVIDSYKLL  5
            +D +S F+ VY+ LKSELLNDPA + T DSRQ V+RML+YNVPGGKLNRGLSV+DSYKLL
Sbjct  2    SDLKSKFLEVYSVLKSELLNDPAFEFTDDSRQRVERMLDYNVPGGKLNRGLSVVDSYKLL  61

Query  4    K  2
            K
Sbjct  62   K  62



>gb|ACD54842.1| farnesyl pyrophosphate syntethase [Olea europaea]
Length=181

 Score = 95.1 bits (235),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 45/61 (74%), Positives = 53/61 (87%), Gaps = 0/61 (0%)
 Frame = -2

Query  184  ADPRSDFVGVYAKLKSELLNDPAIQLTPDSRQWVQRMLEYNVPGGKLNRGLSVIDSYKLL  5
            +D +S F+ VY+ LKSELLNDPA + T DSRQ V+RML+YNVPGGKLNRGLSV+DSYKLL
Sbjct  2    SDLKSKFLEVYSVLKSELLNDPAFEFTDDSRQRVERMLDYNVPGGKLNRGLSVVDSYKLL  61

Query  4    K  2
            K
Sbjct  62   K  62



>ref|XP_007205488.1| hypothetical protein PRUPE_ppa008174mg [Prunus persica]
 gb|EMJ06687.1| hypothetical protein PRUPE_ppa008174mg [Prunus persica]
Length=342

 Score = 97.4 bits (241),  Expect = 5e-22, Method: Composition-based stats.
 Identities = 46/61 (75%), Positives = 51/61 (84%), Gaps = 0/61 (0%)
 Frame = -2

Query  184  ADPRSDFVGVYAKLKSELLNDPAIQLTPDSRQWVQRMLEYNVPGGKLNRGLSVIDSYKLL  5
            +D RS F+ VY+ LKSELLNDPA + T  SRQWV RML+YNVPGGKLNRGLSVIDS KLL
Sbjct  2    SDLRSKFLEVYSVLKSELLNDPAFEFTDVSRQWVDRMLDYNVPGGKLNRGLSVIDSLKLL  61

Query  4    K  2
            K
Sbjct  62   K  62



>gb|ACD54841.1| farnesyl pyrophosphate syntethase [Olea europaea]
Length=186

 Score = 95.5 bits (236),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 45/61 (74%), Positives = 53/61 (87%), Gaps = 0/61 (0%)
 Frame = -2

Query  184  ADPRSDFVGVYAKLKSELLNDPAIQLTPDSRQWVQRMLEYNVPGGKLNRGLSVIDSYKLL  5
            +D +S F+ VY+ LKSELLNDPA + T DSRQ V+RML+YNVPGGKLNRGLSV+DSYKLL
Sbjct  2    SDLKSKFLEVYSVLKSELLNDPAFEFTDDSRQRVERMLDYNVPGGKLNRGLSVVDSYKLL  61

Query  4    K  2
            K
Sbjct  62   K  62



>sp|O24241.1|FPPS1_PARAR RecName: Full=Farnesyl pyrophosphate synthase 1; Short=FPP synthase 
1; Short=FPS 1; AltName: Full=(2E,6E)-farnesyl diphosphate 
synthase 1; AltName: Full=Dimethylallyltranstransferase 
1; AltName: Full=Farnesyl diphosphate synthase 1; AltName: 
Full=Geranyltranstransferase 1 [Parthenium argentatum]
 emb|CAA57892.1| farnesyl diphosphate synthase [Parthenium argentatum]
Length=342

 Score = 97.4 bits (241),  Expect = 5e-22, Method: Composition-based stats.
 Identities = 43/62 (69%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = -2

Query  187  AADPRSDFVGVYAKLKSELLNDPAIQLTPDSRQWVQRMLEYNVPGGKLNRGLSVIDSYKL  8
            ++D +S F+ VY  LKSEL+NDPA +   DSRQWV++ML+YNVPGGKLNRGLSVIDSY+L
Sbjct  2    SSDLKSRFLQVYDTLKSELINDPAFEFDDDSRQWVEKMLDYNVPGGKLNRGLSVIDSYQL  61

Query  7    LK  2
            LK
Sbjct  62   LK  63



>ref|XP_006452656.1| hypothetical protein CICLE_v10008832mg [Citrus clementina]
 gb|ESR65896.1| hypothetical protein CICLE_v10008832mg [Citrus clementina]
Length=337

 Score = 97.1 bits (240),  Expect = 5e-22, Method: Composition-based stats.
 Identities = 43/61 (70%), Positives = 50/61 (82%), Gaps = 0/61 (0%)
 Frame = -2

Query  184  ADPRSDFVGVYAKLKSELLNDPAIQLTPDSRQWVQRMLEYNVPGGKLNRGLSVIDSYKLL  5
            +D +S F+ VY  LK ELLNDPA +   DSRQWV RML+YNVPGGKLNRGLSV+DSY+LL
Sbjct  2    SDLKSRFIEVYGVLKQELLNDPAFEFDHDSRQWVDRMLDYNVPGGKLNRGLSVVDSYRLL  61

Query  4    K  2
            K
Sbjct  62   K  62



>dbj|BAB16687.2| putative FPP synthase 1 [Eucommia ulmoides]
 gb|AGJ03662.1| putative farnesyl diphosphate synthase 1 [Eucommia ulmoides]
Length=348

 Score = 97.4 bits (241),  Expect = 6e-22, Method: Composition-based stats.
 Identities = 43/61 (70%), Positives = 52/61 (85%), Gaps = 0/61 (0%)
 Frame = -2

Query  184  ADPRSDFVGVYAKLKSELLNDPAIQLTPDSRQWVQRMLEYNVPGGKLNRGLSVIDSYKLL  5
            A+ + +F+ VY+ LK ELL+DPA  LT DSR WV+RML+YNVPGGKLNRGLSV+DSYKLL
Sbjct  2    AELKKEFLNVYSVLKKELLHDPAFSLTEDSRNWVERMLDYNVPGGKLNRGLSVVDSYKLL  61

Query  4    K  2
            K
Sbjct  62   K  62



>ref|XP_006452657.1| hypothetical protein CICLE_v10008832mg [Citrus clementina]
 ref|XP_006474825.1| PREDICTED: farnesyl pyrophosphate synthase 1-like [Citrus sinensis]
 gb|ESR65897.1| hypothetical protein CICLE_v10008832mg [Citrus clementina]
 gb|KDO59203.1| hypothetical protein CISIN_1g019339mg [Citrus sinensis]
Length=342

 Score = 97.1 bits (240),  Expect = 6e-22, Method: Composition-based stats.
 Identities = 43/61 (70%), Positives = 50/61 (82%), Gaps = 0/61 (0%)
 Frame = -2

Query  184  ADPRSDFVGVYAKLKSELLNDPAIQLTPDSRQWVQRMLEYNVPGGKLNRGLSVIDSYKLL  5
            +D +S F+ VY  LK ELLNDPA +   DSRQWV RML+YNVPGGKLNRGLSV+DSY+LL
Sbjct  2    SDLKSRFIEVYGVLKQELLNDPAFEFDHDSRQWVDRMLDYNVPGGKLNRGLSVVDSYRLL  61

Query  4    K  2
            K
Sbjct  62   K  62



>ref|XP_004248322.2| PREDICTED: farnesyl pyrophosphate synthase 1-like [Solanum lycopersicum]
Length=342

 Score = 97.1 bits (240),  Expect = 6e-22, Method: Composition-based stats.
 Identities = 44/61 (72%), Positives = 50/61 (82%), Gaps = 0/61 (0%)
 Frame = -2

Query  184  ADPRSDFVGVYAKLKSELLNDPAIQLTPDSRQWVQRMLEYNVPGGKLNRGLSVIDSYKLL  5
            +D +S F+ VY  LKSELLNDP  + T D RQWV+RML+YNVPGGKLNRGLSVIDSY LL
Sbjct  2    SDLKSKFLDVYKILKSELLNDPDFEFTDDGRQWVERMLDYNVPGGKLNRGLSVIDSYSLL  61

Query  4    K  2
            K
Sbjct  62   K  62



>gb|KHG22761.1| Farnesyl pyrophosphate synthase 2 [Gossypium arboreum]
Length=342

 Score = 97.1 bits (240),  Expect = 6e-22, Method: Composition-based stats.
 Identities = 43/61 (70%), Positives = 52/61 (85%), Gaps = 0/61 (0%)
 Frame = -2

Query  184  ADPRSDFVGVYAKLKSELLNDPAIQLTPDSRQWVQRMLEYNVPGGKLNRGLSVIDSYKLL  5
            +D +  F+ VY+ LKSELL+DPA + T +SRQWV+RML+YNVPGGKLNRGLSVIDSY LL
Sbjct  2    SDIKPKFLEVYSALKSELLDDPAFEFTDNSRQWVERMLDYNVPGGKLNRGLSVIDSYNLL  61

Query  4    K  2
            K
Sbjct  62   K  62



>gb|ACJ84427.1| unknown [Medicago truncatula]
Length=251

 Score = 96.3 bits (238),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 45/61 (74%), Positives = 53/61 (87%), Gaps = 0/61 (0%)
 Frame = -2

Query  184  ADPRSDFVGVYAKLKSELLNDPAIQLTPDSRQWVQRMLEYNVPGGKLNRGLSVIDSYKLL  5
            AD +S F+ VY+ LKSELL+DPA + + DSRQWV RML+YNVPGGKLNRGLSVIDSY+LL
Sbjct  2    ADLKSTFLNVYSVLKSELLHDPAFEWSEDSRQWVDRMLDYNVPGGKLNRGLSVIDSYRLL  61

Query  4    K  2
            K
Sbjct  62   K  62



>gb|AAN62522.1| farnesyl pyrophosphate synthetase [Eucommia ulmoides]
Length=319

 Score = 96.7 bits (239),  Expect = 7e-22, Method: Composition-based stats.
 Identities = 43/61 (70%), Positives = 52/61 (85%), Gaps = 0/61 (0%)
 Frame = -2

Query  184  ADPRSDFVGVYAKLKSELLNDPAIQLTPDSRQWVQRMLEYNVPGGKLNRGLSVIDSYKLL  5
            A+ + +F+ VY+ LK ELL+DPA  LT DSR WV+RML+YNVPGGKLNRGLSV+DSYKLL
Sbjct  2    AELKKEFLNVYSVLKKELLHDPAFSLTEDSRNWVERMLDYNVPGGKLNRGLSVVDSYKLL  61

Query  4    K  2
            K
Sbjct  62   K  62



>sp|P49350.1|FPPS_ARTAN RecName: Full=Farnesyl pyrophosphate synthase; Short=FPP synthase; 
Short=FPS; AltName: Full=(2E,6E)-farnesyl diphosphate 
synthase; AltName: Full=Dimethylallyltranstransferase; AltName: 
Full=Farnesyl diphosphate synthase; AltName: Full=Geranyltranstransferase 
[Artemisia annua]
 gb|AAC49452.1| farnesyl diphosphate synthase [Artemisia annua]
Length=343

 Score = 97.1 bits (240),  Expect = 7e-22, Method: Composition-based stats.
 Identities = 41/63 (65%), Positives = 53/63 (84%), Gaps = 0/63 (0%)
 Frame = -2

Query  190  TAADPRSDFVGVYAKLKSELLNDPAIQLTPDSRQWVQRMLEYNVPGGKLNRGLSVIDSYK  11
            ++ D +S F+ VY  LKSEL+NDPA +   DSRQW+++ML+YNVPGGKLNRGLSV+DSY+
Sbjct  2    SSTDLKSKFLKVYDTLKSELINDPAFEFDDDSRQWIEKMLDYNVPGGKLNRGLSVVDSYQ  61

Query  10   LLK  2
            LLK
Sbjct  62   LLK  64



>gb|KHN14411.1| Farnesyl pyrophosphate synthase 1 [Glycine soja]
Length=342

 Score = 97.1 bits (240),  Expect = 7e-22, Method: Composition-based stats.
 Identities = 43/61 (70%), Positives = 52/61 (85%), Gaps = 0/61 (0%)
 Frame = -2

Query  184  ADPRSDFVGVYAKLKSELLNDPAIQLTPDSRQWVQRMLEYNVPGGKLNRGLSVIDSYKLL  5
            AD +S F+ VY+ LKSELL+DPA + + D+R WV RML+YNVPGGKLNRGLSVIDSY+LL
Sbjct  2    ADLKSTFLNVYSVLKSELLHDPAFEFSDDARNWVDRMLDYNVPGGKLNRGLSVIDSYRLL  61

Query  4    K  2
            K
Sbjct  62   K  62



>ref|XP_003594327.1| Farnesyl pyrophosphate synthase [Medicago truncatula]
 gb|AES64578.1| geranylgeranyl pyrophosphate synthase [Medicago truncatula]
 gb|AFK44819.1| unknown [Medicago truncatula]
Length=342

 Score = 96.7 bits (239),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 45/61 (74%), Positives = 53/61 (87%), Gaps = 0/61 (0%)
 Frame = -2

Query  184  ADPRSDFVGVYAKLKSELLNDPAIQLTPDSRQWVQRMLEYNVPGGKLNRGLSVIDSYKLL  5
            AD +S F+ VY+ LKSELL+DPA + + DSRQWV RML+YNVPGGKLNRGLSVIDSY+LL
Sbjct  2    ADLKSTFLNVYSVLKSELLHDPAFEWSEDSRQWVDRMLDYNVPGGKLNRGLSVIDSYRLL  61

Query  4    K  2
            K
Sbjct  62   K  62



>gb|ADZ57167.1| farnesyl pyrophosphate synthase [Lilium longiflorum]
Length=351

 Score = 97.1 bits (240),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 44/68 (65%), Positives = 55/68 (81%), Gaps = 0/68 (0%)
 Frame = -2

Query  205  ATQNGTAADPRSDFVGVYAKLKSELLNDPAIQLTPDSRQWVQRMLEYNVPGGKLNRGLSV  26
            A  NGT+ D ++ F  VY++LKSELL DPA   T DSR W+++ML+Y+VPGGKLNRG+SV
Sbjct  4    AAVNGTSVDLKAAFREVYSQLKSELLEDPAFDYTEDSRSWIEQMLDYDVPGGKLNRGISV  63

Query  25   IDSYKLLK  2
            IDSYKLLK
Sbjct  64   IDSYKLLK  71



>ref|XP_009621499.1| PREDICTED: farnesyl pyrophosphate synthase 1-like [Nicotiana 
tomentosiformis]
Length=342

 Score = 96.7 bits (239),  Expect = 8e-22, Method: Composition-based stats.
 Identities = 44/60 (73%), Positives = 50/60 (83%), Gaps = 0/60 (0%)
 Frame = -2

Query  184  ADPRSDFVGVYAKLKSELLNDPAIQLTPDSRQWVQRMLEYNVPGGKLNRGLSVIDSYKLL  5
            +D +S F+ VYA LKSELLNDP  + T DSRQWV +ML+YNVPGGKLNRGLSVIDSY LL
Sbjct  2    SDLKSKFLDVYAVLKSELLNDPDFEFTDDSRQWVDKMLDYNVPGGKLNRGLSVIDSYSLL  61



>gb|ADC32809.1| farnesyl pyrophosphate synthase [Medicago sativa]
Length=342

 Score = 96.7 bits (239),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 45/61 (74%), Positives = 53/61 (87%), Gaps = 0/61 (0%)
 Frame = -2

Query  184  ADPRSDFVGVYAKLKSELLNDPAIQLTPDSRQWVQRMLEYNVPGGKLNRGLSVIDSYKLL  5
            AD +S F+ VY+ LKSELL+DPA + + DSRQWV RML+YNVPGGKLNRGLSVIDSY+LL
Sbjct  2    ADLKSTFLNVYSVLKSELLHDPAFEWSEDSRQWVDRMLDYNVPGGKLNRGLSVIDSYRLL  61

Query  4    K  2
            K
Sbjct  62   K  62



>ref|NP_001242101.1| uncharacterized protein LOC100782137 [Glycine max]
 gb|ACU21393.1| unknown [Glycine max]
Length=342

 Score = 96.7 bits (239),  Expect = 8e-22, Method: Composition-based stats.
 Identities = 43/61 (70%), Positives = 52/61 (85%), Gaps = 0/61 (0%)
 Frame = -2

Query  184  ADPRSDFVGVYAKLKSELLNDPAIQLTPDSRQWVQRMLEYNVPGGKLNRGLSVIDSYKLL  5
            AD +S F+ VY+ LKSELL+DPA + + D+R WV RML+YNVPGGKLNRGLSVIDSY+LL
Sbjct  2    ADLKSTFLNVYSVLKSELLHDPAFEFSDDARNWVDRMLDYNVPGGKLNRGLSVIDSYRLL  61

Query  4    K  2
            K
Sbjct  62   K  62



>ref|XP_004486372.1| PREDICTED: farnesyl pyrophosphate synthase 1-like [Cicer arietinum]
Length=342

 Score = 96.7 bits (239),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 45/61 (74%), Positives = 53/61 (87%), Gaps = 0/61 (0%)
 Frame = -2

Query  184  ADPRSDFVGVYAKLKSELLNDPAIQLTPDSRQWVQRMLEYNVPGGKLNRGLSVIDSYKLL  5
            AD +S F+ VY+ LKSELL+DPA + + DSRQWV RML+YNVPGGKLNRGLSVIDSY+LL
Sbjct  2    ADLKSTFLNVYSVLKSELLHDPAFEWSDDSRQWVDRMLDYNVPGGKLNRGLSVIDSYRLL  61

Query  4    K  2
            K
Sbjct  62   K  62



>gb|AFW98437.1| farnesyl diphosphate synthase [Helianthus annuus]
Length=342

 Score = 96.7 bits (239),  Expect = 8e-22, Method: Composition-based stats.
 Identities = 43/60 (72%), Positives = 51/60 (85%), Gaps = 0/60 (0%)
 Frame = -2

Query  181  DPRSDFVGVYAKLKSELLNDPAIQLTPDSRQWVQRMLEYNVPGGKLNRGLSVIDSYKLLK  2
            D +S F+ VY  LKSEL+NDPA +   DSRQWV++ML+YNVPGGKLNRGLSVIDSY+LLK
Sbjct  4    DLKSRFLQVYDTLKSELINDPAFEFDEDSRQWVEKMLDYNVPGGKLNRGLSVIDSYQLLK  63



>gb|AHN96159.1| farnesyl diphosphate synthase 1 [Matricaria chamomilla var. recutita]
Length=343

 Score = 96.7 bits (239),  Expect = 9e-22, Method: Composition-based stats.
 Identities = 42/60 (70%), Positives = 51/60 (85%), Gaps = 0/60 (0%)
 Frame = -2

Query  181  DPRSDFVGVYAKLKSELLNDPAIQLTPDSRQWVQRMLEYNVPGGKLNRGLSVIDSYKLLK  2
            D +S F+ VY  LKSEL+NDPA +   DSRQWV++ML+YNVPGGKLNRGLSV+DSY+LLK
Sbjct  5    DLKSKFLKVYDTLKSELINDPAFEFDDDSRQWVEKMLDYNVPGGKLNRGLSVVDSYQLLK  64



>gb|AFW98432.1| farnesyl diphosphate synthase [Achillea asiatica]
Length=342

 Score = 96.7 bits (239),  Expect = 9e-22, Method: Composition-based stats.
 Identities = 41/62 (66%), Positives = 52/62 (84%), Gaps = 0/62 (0%)
 Frame = -2

Query  187  AADPRSDFVGVYAKLKSELLNDPAIQLTPDSRQWVQRMLEYNVPGGKLNRGLSVIDSYKL  8
            + D +S F+ VY  LKSEL+NDPA +   DSRQW+++ML+YNVPGGKLNRGLSV+DSY+L
Sbjct  2    STDLKSKFLKVYDTLKSELINDPAFEFDDDSRQWIEKMLDYNVPGGKLNRGLSVVDSYQL  61

Query  7    LK  2
            LK
Sbjct  62   LK  63



>gb|AHZ21075.1| farnesyl diphosphate synthase [Taraxacum kok-saghyz]
Length=342

 Score = 96.7 bits (239),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 42/60 (70%), Positives = 51/60 (85%), Gaps = 0/60 (0%)
 Frame = -2

Query  181  DPRSDFVGVYAKLKSELLNDPAIQLTPDSRQWVQRMLEYNVPGGKLNRGLSVIDSYKLLK  2
            D +S F+ VY  LKSEL+NDPA +   DSRQWV++ML+YNVPGGKLNRGLSV+DSY+LLK
Sbjct  4    DLKSKFLQVYDTLKSELINDPAFEFDDDSRQWVEKMLDYNVPGGKLNRGLSVVDSYQLLK  63



>gb|AFW98438.1| farnesyl diphosphate synthase [Taraxacum mongolicum]
Length=342

 Score = 96.7 bits (239),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 42/60 (70%), Positives = 51/60 (85%), Gaps = 0/60 (0%)
 Frame = -2

Query  181  DPRSDFVGVYAKLKSELLNDPAIQLTPDSRQWVQRMLEYNVPGGKLNRGLSVIDSYKLLK  2
            D +S F+ VY  LKSEL+NDPA +   DSRQWV++ML+YNVPGGKLNRGLSV+DSY+LLK
Sbjct  4    DLKSKFLQVYDTLKSELINDPAFEFDDDSRQWVEKMLDYNVPGGKLNRGLSVVDSYQLLK  63



>gb|AID51444.1| farnesyl diphosphate synthase [Astragalus membranaceus]
Length=342

 Score = 96.3 bits (238),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 45/61 (74%), Positives = 53/61 (87%), Gaps = 0/61 (0%)
 Frame = -2

Query  184  ADPRSDFVGVYAKLKSELLNDPAIQLTPDSRQWVQRMLEYNVPGGKLNRGLSVIDSYKLL  5
            AD +S F+ VY+ LKSELL+DPA + + DSRQWV RML+YNVPGGKLNRGLSVIDSY+LL
Sbjct  2    ADLKSTFLNVYSVLKSELLHDPAFEWSDDSRQWVDRMLDYNVPGGKLNRGLSVIDSYRLL  61

Query  4    K  2
            K
Sbjct  62   K  62



>gb|ABS11699.1| farnesyl diphosphate synthase [Matricaria chamomilla var. recutita]
Length=343

 Score = 96.3 bits (238),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 42/60 (70%), Positives = 51/60 (85%), Gaps = 0/60 (0%)
 Frame = -2

Query  181  DPRSDFVGVYAKLKSELLNDPAIQLTPDSRQWVQRMLEYNVPGGKLNRGLSVIDSYKLLK  2
            D +S F+ VY  LKSEL+NDPA +   DSRQWV++ML+YNVPGGKLNRGLSV+DSY+LLK
Sbjct  5    DLKSKFLKVYDTLKSELINDPAFEFDDDSRQWVEKMLDYNVPGGKLNRGLSVVDSYQLLK  64



>gb|AFW98435.1| farnesyl diphosphate synthase [Tanacetum coccineum]
Length=342

 Score = 96.3 bits (238),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 41/62 (66%), Positives = 52/62 (84%), Gaps = 0/62 (0%)
 Frame = -2

Query  187  AADPRSDFVGVYAKLKSELLNDPAIQLTPDSRQWVQRMLEYNVPGGKLNRGLSVIDSYKL  8
            + D +S F+ VY  LKSEL+NDPA +   DSRQW+++ML+YNVPGGKLNRGLSV+DSY+L
Sbjct  2    STDLKSKFLKVYDTLKSELINDPAFEFDDDSRQWIEKMLDYNVPGGKLNRGLSVVDSYQL  61

Query  7    LK  2
            LK
Sbjct  62   LK  63



>gb|AGC03153.1| farnesyl diphosphate synthase [Tanacetum cinerariifolium]
Length=342

 Score = 96.3 bits (238),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 41/62 (66%), Positives = 52/62 (84%), Gaps = 0/62 (0%)
 Frame = -2

Query  187  AADPRSDFVGVYAKLKSELLNDPAIQLTPDSRQWVQRMLEYNVPGGKLNRGLSVIDSYKL  8
            + D +S F+ VY  LKSEL+NDPA +   DSRQW+++ML+YNVPGGKLNRGLSV+DSY+L
Sbjct  2    STDLKSKFLKVYDTLKSELINDPAFEFDDDSRQWIEKMLDYNVPGGKLNRGLSVVDSYQL  61

Query  7    LK  2
            LK
Sbjct  62   LK  63



>gb|AAD17204.1| farnesyl diphosphate synthase [Artemisia annua]
Length=343

 Score = 96.3 bits (238),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 41/63 (65%), Positives = 53/63 (84%), Gaps = 0/63 (0%)
 Frame = -2

Query  190  TAADPRSDFVGVYAKLKSELLNDPAIQLTPDSRQWVQRMLEYNVPGGKLNRGLSVIDSYK  11
            ++ D +S F+ VY  LKSEL+NDPA +   DSRQW+++ML+YNVPGGKLNRGLSV+DSY+
Sbjct  2    SSIDLKSKFLKVYDTLKSELINDPAFEFDDDSRQWIEKMLDYNVPGGKLNRGLSVVDSYQ  61

Query  10   LLK  2
            LLK
Sbjct  62   LLK  64



>gb|AHA51120.1| farnesyl pyrophosphate synthase [Galtonia saundersiae]
Length=347

 Score = 96.3 bits (238),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 44/69 (64%), Positives = 54/69 (78%), Gaps = 2/69 (3%)
 Frame = -2

Query  208  MATQNGTAADPRSDFVGVYAKLKSELLNDPAIQLTPDSRQWVQRMLEYNVPGGKLNRGLS  29
            MA  NG   D +S F+ +Y +LKSELL DPA   T D+RQW+ RML+YNVPGGKLNRG+S
Sbjct  1    MADSNGL--DTKSRFLQIYGRLKSELLEDPAFDFTDDARQWIDRMLDYNVPGGKLNRGIS  58

Query  28   VIDSYKLLK  2
            V+DSYKLL+
Sbjct  59   VVDSYKLLR  67



>gb|KGN45890.1| hypothetical protein Csa_6G017060 [Cucumis sativus]
Length=327

 Score = 96.3 bits (238),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 45/61 (74%), Positives = 52/61 (85%), Gaps = 0/61 (0%)
 Frame = -2

Query  184  ADPRSDFVGVYAKLKSELLNDPAIQLTPDSRQWVQRMLEYNVPGGKLNRGLSVIDSYKLL  5
            AD +S F+ VY+ LKSELL DPA + T  SRQWV+RML+YNVPGGKLNRGLSVIDSY+LL
Sbjct  2    ADLKSTFLKVYSVLKSELLQDPAFEFTDASRQWVERMLDYNVPGGKLNRGLSVIDSYRLL  61

Query  4    K  2
            K
Sbjct  62   K  62



>gb|AAD32648.1| farnesyl diphosphate synthase [Artemisia annua]
Length=343

 Score = 95.9 bits (237),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 41/63 (65%), Positives = 53/63 (84%), Gaps = 0/63 (0%)
 Frame = -2

Query  190  TAADPRSDFVGVYAKLKSELLNDPAIQLTPDSRQWVQRMLEYNVPGGKLNRGLSVIDSYK  11
            ++ D +S F+ VY  LKSEL+NDPA +   DSRQW+++ML+YNVPGGKLNRGLSV+DSY+
Sbjct  2    SSIDLKSKFLKVYDTLKSELINDPAFEFDDDSRQWIEKMLDYNVPGGKLNRGLSVVDSYQ  61

Query  10   LLK  2
            LLK
Sbjct  62   LLK  64



>ref|XP_010057770.1| PREDICTED: farnesyl pyrophosphate synthase 1 isoform X2 [Eucalyptus 
grandis]
Length=342

 Score = 95.9 bits (237),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 44/61 (72%), Positives = 50/61 (82%), Gaps = 0/61 (0%)
 Frame = -2

Query  184  ADPRSDFVGVYAKLKSELLNDPAIQLTPDSRQWVQRMLEYNVPGGKLNRGLSVIDSYKLL  5
            AD +S F+  YA LK ELL DPA + + +SRQWV RML+YNVPGGKLNRGLSVIDSYKLL
Sbjct  2    ADLKSKFMEAYAVLKKELLADPAFEFSDESRQWVDRMLDYNVPGGKLNRGLSVIDSYKLL  61

Query  4    K  2
            K
Sbjct  62   K  62



>ref|XP_008463060.1| PREDICTED: farnesyl pyrophosphate synthase 1 [Cucumis melo]
Length=342

 Score = 95.9 bits (237),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 45/61 (74%), Positives = 52/61 (85%), Gaps = 0/61 (0%)
 Frame = -2

Query  184  ADPRSDFVGVYAKLKSELLNDPAIQLTPDSRQWVQRMLEYNVPGGKLNRGLSVIDSYKLL  5
            AD +S F+ VY+ LKSELL DPA + T  SRQWV+RML+YNVPGGKLNRGLSVIDSY+LL
Sbjct  2    ADLKSTFLKVYSVLKSELLQDPAFEFTDASRQWVERMLDYNVPGGKLNRGLSVIDSYRLL  61

Query  4    K  2
            K
Sbjct  62   K  62



>gb|ADJ67472.1| farnesyl pyrophosphate synthase [Artemisia annua]
Length=343

 Score = 95.9 bits (237),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 40/63 (63%), Positives = 53/63 (84%), Gaps = 0/63 (0%)
 Frame = -2

Query  190  TAADPRSDFVGVYAKLKSELLNDPAIQLTPDSRQWVQRMLEYNVPGGKLNRGLSVIDSYK  11
            ++ D +S F+ VY  LKSEL+NDPA +   DSRQW+++ML+YN+PGGKLNRGLSV+DSY+
Sbjct  2    SSIDLKSKFLKVYDTLKSELINDPAFEFDDDSRQWIEKMLDYNIPGGKLNRGLSVVDSYQ  61

Query  10   LLK  2
            LLK
Sbjct  62   LLK  64



>sp|Q7XYS9.1|FPPS1_ARTSI RecName: Full=Farnesyl diphosphate synthase 1; Includes: RecName: 
Full=Dimethylallyltranstransferase; Includes: RecName: 
Full=(2E,6E)-farnesyl diphosphate synthase [Artemisia spiciformis]
 gb|AAP74720.1| farnesyl diphosphate synthase [Artemisia spiciformis]
Length=346

 Score = 95.9 bits (237),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 41/60 (68%), Positives = 51/60 (85%), Gaps = 0/60 (0%)
 Frame = -2

Query  181  DPRSDFVGVYAKLKSELLNDPAIQLTPDSRQWVQRMLEYNVPGGKLNRGLSVIDSYKLLK  2
            D +S F+ VY  LKS+L+NDPA +   DSRQW+Q+ML+YNVPGGKLNRGLSV+DSY+LLK
Sbjct  8    DLKSKFLKVYDTLKSDLINDPAFEFDDDSRQWIQKMLDYNVPGGKLNRGLSVVDSYQLLK  67



>ref|XP_010057769.1| PREDICTED: farnesyl pyrophosphate synthase 1 isoform X1 [Eucalyptus 
grandis]
Length=342

 Score = 95.9 bits (237),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 44/61 (72%), Positives = 50/61 (82%), Gaps = 0/61 (0%)
 Frame = -2

Query  184  ADPRSDFVGVYAKLKSELLNDPAIQLTPDSRQWVQRMLEYNVPGGKLNRGLSVIDSYKLL  5
            AD +S F+  YA LK ELL DPA + + +SRQWV RML+YNVPGGKLNRGLSVIDSYKLL
Sbjct  2    ADLKSKFMEAYAVLKKELLADPAFEFSDESRQWVDRMLDYNVPGGKLNRGLSVIDSYKLL  61

Query  4    K  2
            K
Sbjct  62   K  62



>emb|CDY17706.1| BnaA06g35250D [Brassica napus]
Length=343

 Score = 95.9 bits (237),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 42/62 (68%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = -2

Query  187  AADPRSDFVGVYAKLKSELLNDPAIQLTPDSRQWVQRMLEYNVPGGKLNRGLSVIDSYKL  8
            A D +S F+ VY+ LKSELL+DP+ + T +SR WV+RML+YNVPGGKLNRGLSV+DS+KL
Sbjct  2    AKDLKSTFLNVYSTLKSELLHDPSFEFTDESRLWVERMLDYNVPGGKLNRGLSVVDSFKL  61

Query  7    LK  2
            LK
Sbjct  62   LK  63



>ref|XP_009101386.1| PREDICTED: LOW QUALITY PROTEIN: farnesyl pyrophosphate synthase 
1, mitochondrial [Brassica rapa]
Length=344

 Score = 95.9 bits (237),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 42/62 (68%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = -2

Query  187  AADPRSDFVGVYAKLKSELLNDPAIQLTPDSRQWVQRMLEYNVPGGKLNRGLSVIDSYKL  8
            A D +S F+ VY+ LKSELL+DP+ + T +SR WV+RML+YNVPGGKLNRGLSV+DS+KL
Sbjct  2    AKDLKSTFLNVYSTLKSELLHDPSFEFTDESRLWVERMLDYNVPGGKLNRGLSVVDSFKL  61

Query  7    LK  2
            LK
Sbjct  62   LK  63



>ref|XP_004138366.1| PREDICTED: farnesyl pyrophosphate synthase 1-like [Cucumis sativus]
Length=342

 Score = 95.9 bits (237),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 45/61 (74%), Positives = 52/61 (85%), Gaps = 0/61 (0%)
 Frame = -2

Query  184  ADPRSDFVGVYAKLKSELLNDPAIQLTPDSRQWVQRMLEYNVPGGKLNRGLSVIDSYKLL  5
            AD +S F+ VY+ LKSELL DPA + T  SRQWV+RML+YNVPGGKLNRGLSVIDSY+LL
Sbjct  2    ADLKSTFLKVYSVLKSELLQDPAFEFTDASRQWVERMLDYNVPGGKLNRGLSVIDSYRLL  61

Query  4    K  2
            K
Sbjct  62   K  62



>ref|XP_004169698.1| PREDICTED: farnesyl pyrophosphate synthase 1-like [Cucumis sativus]
Length=342

 Score = 95.9 bits (237),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 45/61 (74%), Positives = 52/61 (85%), Gaps = 0/61 (0%)
 Frame = -2

Query  184  ADPRSDFVGVYAKLKSELLNDPAIQLTPDSRQWVQRMLEYNVPGGKLNRGLSVIDSYKLL  5
            AD +S F+ VY+ LKSELL DPA + T  SRQWV+RML+YNVPGGKLNRGLSVIDSY+LL
Sbjct  2    ADLKSTFLKVYSVLKSELLQDPAFEFTDASRQWVERMLDYNVPGGKLNRGLSVIDSYRLL  61

Query  4    K  2
            K
Sbjct  62   K  62



>gb|ADR10437.1| farnesyl pyrophosphate synthase [Withania somnifera]
Length=343

 Score = 95.9 bits (237),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 43/59 (73%), Positives = 50/59 (85%), Gaps = 0/59 (0%)
 Frame = -2

Query  181  DPRSDFVGVYAKLKSELLNDPAIQLTPDSRQWVQRMLEYNVPGGKLNRGLSVIDSYKLL  5
            D +S F+ VY+ LKSELLNDP ++ T DSRQWV +ML+YNVPGGKLNRGLSVIDSY LL
Sbjct  3    DLKSKFLDVYSVLKSELLNDPDLEFTDDSRQWVDKMLDYNVPGGKLNRGLSVIDSYSLL  61



>emb|CDX77796.1| BnaC07g20500D [Brassica napus]
Length=343

 Score = 95.9 bits (237),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 42/62 (68%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = -2

Query  187  AADPRSDFVGVYAKLKSELLNDPAIQLTPDSRQWVQRMLEYNVPGGKLNRGLSVIDSYKL  8
            A D +S F+ VY+ LKSELL+DP+ + T +SR WV+RML+YNVPGGKLNRGLSV+DS+KL
Sbjct  2    AEDLKSTFLNVYSTLKSELLHDPSFEFTDESRLWVERMLDYNVPGGKLNRGLSVVDSFKL  61

Query  7    LK  2
            LK
Sbjct  62   LK  63



>gb|AGJ71757.1| farnesyl pyrophosphate synthase [Sonneratia alba]
Length=342

 Score = 95.5 bits (236),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 43/60 (72%), Positives = 50/60 (83%), Gaps = 0/60 (0%)
 Frame = -2

Query  184  ADPRSDFVGVYAKLKSELLNDPAIQLTPDSRQWVQRMLEYNVPGGKLNRGLSVIDSYKLL  5
            AD +S FV VY+ LK ELL DPA + T + RQWV+RML+YNVPGGKLNRGLSV+DSYKLL
Sbjct  2    ADLKSKFVRVYSVLKEELLQDPAFEFTDNDRQWVERMLDYNVPGGKLNRGLSVLDSYKLL  61



>ref|XP_004293412.1| PREDICTED: farnesyl pyrophosphate synthase 1-like [Fragaria vesca 
subsp. vesca]
Length=342

 Score = 95.5 bits (236),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 43/61 (70%), Positives = 52/61 (85%), Gaps = 0/61 (0%)
 Frame = -2

Query  184  ADPRSDFVGVYAKLKSELLNDPAIQLTPDSRQWVQRMLEYNVPGGKLNRGLSVIDSYKLL  5
            AD RS F+ VY+ LKS+LL DPA + T  SRQWV++ML+YNVPGGKLNRGLSVIDSY+LL
Sbjct  2    ADLRSKFMNVYSVLKSDLLEDPAFEFTDTSRQWVEQMLDYNVPGGKLNRGLSVIDSYQLL  61

Query  4    K  2
            +
Sbjct  62   Q  62



>ref|XP_009594047.1| PREDICTED: farnesyl pyrophosphate synthase 1-like [Nicotiana 
tomentosiformis]
Length=342

 Score = 95.5 bits (236),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 42/61 (69%), Positives = 52/61 (85%), Gaps = 0/61 (0%)
 Frame = -2

Query  184  ADPRSDFVGVYAKLKSELLNDPAIQLTPDSRQWVQRMLEYNVPGGKLNRGLSVIDSYKLL  5
            +D +S F+ VY+ LKSELLNDP  + T ++RQWV+RML+YNVPGGKLNRG+SVIDSY LL
Sbjct  2    SDLKSKFLEVYSVLKSELLNDPDFEFTDEARQWVERMLDYNVPGGKLNRGISVIDSYSLL  61

Query  4    K  2
            K
Sbjct  62   K  62



>ref|XP_009764692.1| PREDICTED: farnesyl pyrophosphate synthase 1-like [Nicotiana 
sylvestris]
Length=342

 Score = 95.1 bits (235),  Expect = 3e-21, Method: Composition-based stats.
 Identities = 43/60 (72%), Positives = 49/60 (82%), Gaps = 0/60 (0%)
 Frame = -2

Query  184  ADPRSDFVGVYAKLKSELLNDPAIQLTPDSRQWVQRMLEYNVPGGKLNRGLSVIDSYKLL  5
            +D +S F+ VY  LKSELLNDP  + T DSRQWV +ML+YNVPGGKLNRGLSVIDSY LL
Sbjct  2    SDLKSKFLDVYTVLKSELLNDPDFEFTDDSRQWVDKMLDYNVPGGKLNRGLSVIDSYSLL  61



>ref|XP_006857726.1| hypothetical protein AMTR_s00061p00181710 [Amborella trichopoda]
 gb|ERN19193.1| hypothetical protein AMTR_s00061p00181710 [Amborella trichopoda]
Length=343

 Score = 95.1 bits (235),  Expect = 3e-21, Method: Composition-based stats.
 Identities = 42/62 (68%), Positives = 52/62 (84%), Gaps = 0/62 (0%)
 Frame = -2

Query  187  AADPRSDFVGVYAKLKSELLNDPAIQLTPDSRQWVQRMLEYNVPGGKLNRGLSVIDSYKL  8
            A++ +S F+ VY +LKSELL DPA   T DS+ W++RML+YNVPGGKLNRGLSVIDSYK+
Sbjct  2    ASNGKSRFLQVYNRLKSELLQDPAFDFTDDSQHWIERMLDYNVPGGKLNRGLSVIDSYKV  61

Query  7    LK  2
            LK
Sbjct  62   LK  63



>gb|KHN40776.1| Farnesyl pyrophosphate synthase 1 [Glycine soja]
Length=338

 Score = 95.1 bits (235),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 43/61 (70%), Positives = 52/61 (85%), Gaps = 0/61 (0%)
 Frame = -2

Query  184  ADPRSDFVGVYAKLKSELLNDPAIQLTPDSRQWVQRMLEYNVPGGKLNRGLSVIDSYKLL  5
            AD +S F+ VY+ LKSELL+DPA + + D+R WV RML+YNVPGGKLNRGLSVIDSY+LL
Sbjct  2    ADLKSTFLNVYSVLKSELLHDPAFEFSDDARHWVDRMLDYNVPGGKLNRGLSVIDSYRLL  61

Query  4    K  2
            K
Sbjct  62   K  62



>gb|KCW75066.1| hypothetical protein EUGRSUZ_E038361, partial [Eucalyptus grandis]
Length=152

 Score = 92.4 bits (228),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 44/61 (72%), Positives = 50/61 (82%), Gaps = 0/61 (0%)
 Frame = -2

Query  184  ADPRSDFVGVYAKLKSELLNDPAIQLTPDSRQWVQRMLEYNVPGGKLNRGLSVIDSYKLL  5
            AD +S F+  YA LK ELL DPA + + +SRQWV RML+YNVPGGKLNRGLSVIDSYKLL
Sbjct  2    ADLKSKFMEAYAVLKKELLADPAFEFSDESRQWVDRMLDYNVPGGKLNRGLSVIDSYKLL  61

Query  4    K  2
            K
Sbjct  62   K  62



>ref|XP_003534984.1| PREDICTED: farnesyl pyrophosphate synthase 1-like [Glycine max]
Length=342

 Score = 95.1 bits (235),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 43/61 (70%), Positives = 52/61 (85%), Gaps = 0/61 (0%)
 Frame = -2

Query  184  ADPRSDFVGVYAKLKSELLNDPAIQLTPDSRQWVQRMLEYNVPGGKLNRGLSVIDSYKLL  5
            AD +S F+ VY+ LKSELL+DPA + + D+R WV RML+YNVPGGKLNRGLSVIDSY+LL
Sbjct  2    ADLKSTFLNVYSVLKSELLHDPAFEFSDDARHWVDRMLDYNVPGGKLNRGLSVIDSYRLL  61

Query  4    K  2
            K
Sbjct  62   K  62



>gb|AFW98433.1| farnesyl diphosphate synthase [Chrysanthemum lavandulifolium]
Length=344

 Score = 95.1 bits (235),  Expect = 3e-21, Method: Composition-based stats.
 Identities = 40/63 (63%), Positives = 52/63 (83%), Gaps = 0/63 (0%)
 Frame = -2

Query  190  TAADPRSDFVGVYAKLKSELLNDPAIQLTPDSRQWVQRMLEYNVPGGKLNRGLSVIDSYK  11
            ++ D +S F+ VY  LK EL+NDPA +   DSRQW+++ML+YNVPGGKLNRGLSV+DSY+
Sbjct  3    SSIDLKSKFLKVYDTLKQELINDPAFEFDEDSRQWIEKMLDYNVPGGKLNRGLSVVDSYQ  62

Query  10   LLK  2
            LLK
Sbjct  63   LLK  65



>gb|AFO67224.1| putative farnesyl diphosphate synthase, partial [Aralia elata]
Length=126

 Score = 91.7 bits (226),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 42/58 (72%), Positives = 49/58 (84%), Gaps = 0/58 (0%)
 Frame = -2

Query  175  RSDFVGVYAKLKSELLNDPAIQLTPDSRQWVQRMLEYNVPGGKLNRGLSVIDSYKLLK  2
            +S F+ VY  LKSELL DP +Q T +SRQWV+RML+YNVPGGKLNRGLSV+DSY LLK
Sbjct  25   KSAFLEVYTVLKSELLQDPLVQFTKESRQWVERMLDYNVPGGKLNRGLSVVDSYLLLK  82



>gb|KFK31348.1| farnesyl diphosphate synthase [Arabis alpina]
Length=371

 Score = 95.1 bits (235),  Expect = 3e-21, Method: Composition-based stats.
 Identities = 47/86 (55%), Positives = 61/86 (71%), Gaps = 0/86 (0%)
 Frame = -2

Query  259  LVGGEASPVPRCRLVGEMATQNGTAADPRSDFVGVYAKLKSELLNDPAIQLTPDSRQWVQ  80
            L GG  S   R +      + + + AD +S F+ VY+ LKSELL+DP+ + T +SR WV 
Sbjct  6    LCGGSTSLFRRIQSYQLSFSSSSSMADLKSTFLNVYSILKSELLHDPSFEFTDESRLWVD  65

Query  79   RMLEYNVPGGKLNRGLSVIDSYKLLK  2
            RML+YNVPGGKLNRGLSV+DS+KLLK
Sbjct  66   RMLDYNVPGGKLNRGLSVVDSFKLLK  91



>ref|XP_009360776.1| PREDICTED: farnesyl pyrophosphate synthase 2-like [Pyrus x bretschneideri]
 gb|AHH93009.1| farnesyl pyrophosphate synthase [Pyrus communis]
Length=342

 Score = 95.1 bits (235),  Expect = 3e-21, Method: Composition-based stats.
 Identities = 42/61 (69%), Positives = 50/61 (82%), Gaps = 0/61 (0%)
 Frame = -2

Query  184  ADPRSDFVGVYAKLKSELLNDPAIQLTPDSRQWVQRMLEYNVPGGKLNRGLSVIDSYKLL  5
            AD +S F+  Y+ LKSELL DP    T DSRQWV+RML+YNVPGGKLNRGLSV+DSY+LL
Sbjct  2    ADLKSKFLKAYSVLKSELLEDPTFDFTNDSRQWVERMLDYNVPGGKLNRGLSVVDSYQLL  61

Query  4    K  2
            +
Sbjct  62   Q  62



>ref|XP_006286338.1| hypothetical protein CARUB_v100056561mg, partial [Capsella rubella]
 gb|EOA19236.1| hypothetical protein CARUB_v100056561mg, partial [Capsella rubella]
Length=199

 Score = 93.2 bits (230),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 43/61 (70%), Positives = 52/61 (85%), Gaps = 0/61 (0%)
 Frame = -2

Query  184  ADPRSDFVGVYAKLKSELLNDPAIQLTPDSRQWVQRMLEYNVPGGKLNRGLSVIDSYKLL  5
            AD +S F+ VY+ LKSELL DP+ + T +SRQWV+RML+YNV GGKLNRGLSV+DSYKLL
Sbjct  2    ADLKSTFLDVYSILKSELLQDPSFEFTHESRQWVERMLDYNVRGGKLNRGLSVVDSYKLL  61

Query  4    K  2
            K
Sbjct  62   K  62



>ref|XP_007205487.1| hypothetical protein PRUPE_ppa008174mg [Prunus persica]
 gb|EMJ06686.1| hypothetical protein PRUPE_ppa008174mg [Prunus persica]
Length=274

 Score = 94.4 bits (233),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 46/61 (75%), Positives = 51/61 (84%), Gaps = 0/61 (0%)
 Frame = -2

Query  184  ADPRSDFVGVYAKLKSELLNDPAIQLTPDSRQWVQRMLEYNVPGGKLNRGLSVIDSYKLL  5
            +D RS F+ VY+ LKSELLNDPA + T  SRQWV RML+YNVPGGKLNRGLSVIDS KLL
Sbjct  2    SDLRSKFLEVYSVLKSELLNDPAFEFTDVSRQWVDRMLDYNVPGGKLNRGLSVIDSLKLL  61

Query  4    K  2
            K
Sbjct  62   K  62



>gb|AIU80188.1| farnesyl pyrophosphate synthase [Chlorophytum borivilianum]
Length=342

 Score = 95.1 bits (235),  Expect = 4e-21, Method: Composition-based stats.
 Identities = 43/61 (70%), Positives = 49/61 (80%), Gaps = 0/61 (0%)
 Frame = -2

Query  184  ADPRSDFVGVYAKLKSELLNDPAIQLTPDSRQWVQRMLEYNVPGGKLNRGLSVIDSYKLL  5
             D +S FV VY+ LK ELL DPA +   D+RQWV +ML+YNVPGGKLNRGLSVIDSYKLL
Sbjct  2    GDLKSTFVKVYSVLKQELLEDPAFEWNDDARQWVHKMLDYNVPGGKLNRGLSVIDSYKLL  61

Query  4    K  2
            K
Sbjct  62   K  62



>ref|XP_007020420.1| Farnesyl diphosphate synthase 2 [Theobroma cacao]
 gb|EOY11945.1| Farnesyl diphosphate synthase 2 [Theobroma cacao]
Length=342

 Score = 94.7 bits (234),  Expect = 4e-21, Method: Composition-based stats.
 Identities = 43/60 (72%), Positives = 49/60 (82%), Gaps = 0/60 (0%)
 Frame = -2

Query  181  DPRSDFVGVYAKLKSELLNDPAIQLTPDSRQWVQRMLEYNVPGGKLNRGLSVIDSYKLLK  2
            D +  F  V++ LKSELLNDPA + T DSRQWV R++EYNVPGGKLNRGLSVIDSYK LK
Sbjct  3    DIKDKFKEVFSVLKSELLNDPAFEFTDDSRQWVDRVVEYNVPGGKLNRGLSVIDSYKFLK  62



>ref|XP_004302404.1| PREDICTED: farnesyl pyrophosphate synthase 1-like [Fragaria vesca 
subsp. vesca]
Length=342

 Score = 94.7 bits (234),  Expect = 4e-21, Method: Composition-based stats.
 Identities = 43/61 (70%), Positives = 51/61 (84%), Gaps = 0/61 (0%)
 Frame = -2

Query  184  ADPRSDFVGVYAKLKSELLNDPAIQLTPDSRQWVQRMLEYNVPGGKLNRGLSVIDSYKLL  5
            AD RS F+ VY+ LK ELL DPA + T  SRQWV++ML+YNVPGGKLNRGLSVIDSY+LL
Sbjct  2    ADLRSKFMNVYSVLKYELLEDPAFEFTDTSRQWVEQMLDYNVPGGKLNRGLSVIDSYQLL  61

Query  4    K  2
            +
Sbjct  62   Q  62



>gb|ADE18770.1| farnesyl-diphosphate synthase [Glycyrrhiza uralensis]
 gb|ADE18771.1| farnesyl-diphosphate synthase [Glycyrrhiza uralensis]
Length=342

 Score = 94.7 bits (234),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 44/61 (72%), Positives = 52/61 (85%), Gaps = 0/61 (0%)
 Frame = -2

Query  184  ADPRSDFVGVYAKLKSELLNDPAIQLTPDSRQWVQRMLEYNVPGGKLNRGLSVIDSYKLL  5
            AD +S F+ VY+ LKSELL+DPA + + DSRQW  RML+YNVPGGKLNRGLSVIDSY+LL
Sbjct  2    ADLKSTFLNVYSVLKSELLHDPAFEWSDDSRQWADRMLDYNVPGGKLNRGLSVIDSYRLL  61

Query  4    K  2
            K
Sbjct  62   K  62



>ref|XP_003567976.1| PREDICTED: farnesyl pyrophosphate synthase [Brachypodium distachyon]
Length=352

 Score = 94.7 bits (234),  Expect = 4e-21, Method: Composition-based stats.
 Identities = 41/68 (60%), Positives = 50/68 (74%), Gaps = 0/68 (0%)
 Frame = -2

Query  205  ATQNGTAADPRSDFVGVYAKLKSELLNDPAIQLTPDSRQWVQRMLEYNVPGGKLNRGLSV  26
            A +NG   D ++DF  +Y  LK ELL DPA + T +S QW+ RML+YNV GGK NRGLSV
Sbjct  5    AVKNGAGGDTKADFARIYEALKEELLRDPAFEFTDESHQWIDRMLDYNVLGGKCNRGLSV  64

Query  25   IDSYKLLK  2
            +DSYKLLK
Sbjct  65   VDSYKLLK  72



>gb|AFK38522.1| unknown [Lotus japonicus]
Length=342

 Score = 94.7 bits (234),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 44/61 (72%), Positives = 53/61 (87%), Gaps = 0/61 (0%)
 Frame = -2

Query  184  ADPRSDFVGVYAKLKSELLNDPAIQLTPDSRQWVQRMLEYNVPGGKLNRGLSVIDSYKLL  5
            AD +S F+ VY+ LKSELL+DPA + + +SRQWV RML+YNVPGGKLNRGLSVIDSY+LL
Sbjct  2    ADLKSTFLNVYSVLKSELLHDPAFEWSDESRQWVDRMLDYNVPGGKLNRGLSVIDSYRLL  61

Query  4    K  2
            K
Sbjct  62   K  62



>gb|AAR27053.1| farnesyl diphosphate synthetase [Ginkgo biloba]
Length=390

 Score = 94.7 bits (234),  Expect = 5e-21, Method: Composition-based stats.
 Identities = 43/71 (61%), Positives = 55/71 (77%), Gaps = 0/71 (0%)
 Frame = -2

Query  214  GEMATQNGTAADPRSDFVGVYAKLKSELLNDPAIQLTPDSRQWVQRMLEYNVPGGKLNRG  35
            G  A ++   A+ RS F+ VY  LKS++LND A Q T D+RQW+++ML+Y VPGGKLNRG
Sbjct  40   GFAAMESNCNANTRSKFLEVYNVLKSQILNDSAFQCTDDARQWIEKMLDYTVPGGKLNRG  99

Query  34   LSVIDSYKLLK  2
            LSVIDSY+LLK
Sbjct  100  LSVIDSYRLLK  110



>gb|AFW98443.1| farnesyl diphosphate synthase [Tanacetum coccineum]
Length=342

 Score = 94.4 bits (233),  Expect = 6e-21, Method: Composition-based stats.
 Identities = 41/62 (66%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = -2

Query  187  AADPRSDFVGVYAKLKSELLNDPAIQLTPDSRQWVQRMLEYNVPGGKLNRGLSVIDSYKL  8
            + D +S F+ VY  LKS+L++DPA +   DSR WV+RML+YNVPGGKLNRGLSV+DSYKL
Sbjct  2    STDLKSKFLQVYDSLKSDLIHDPAFEFDDDSRHWVERMLDYNVPGGKLNRGLSVVDSYKL  61

Query  7    LK  2
            LK
Sbjct  62   LK  63



>gb|AFW98442.1| farnesyl diphosphate synthase [Leucanthemum vulgare]
Length=342

 Score = 94.4 bits (233),  Expect = 6e-21, Method: Composition-based stats.
 Identities = 41/62 (66%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = -2

Query  187  AADPRSDFVGVYAKLKSELLNDPAIQLTPDSRQWVQRMLEYNVPGGKLNRGLSVIDSYKL  8
            + D +S F+ VY  LKS+L++DPA +   DSR WV+RML+YNVPGGKLNRGLSV+DSYKL
Sbjct  2    STDLKSKFLQVYDSLKSDLIHDPAFEFDDDSRHWVERMLDYNVPGGKLNRGLSVVDSYKL  61

Query  7    LK  2
            LK
Sbjct  62   LK  63



>gb|AAK68152.1| farnesyldiphosphate synthase [Citrus x microcarpa]
Length=341

 Score = 94.4 bits (233),  Expect = 6e-21, Method: Composition-based stats.
 Identities = 42/61 (69%), Positives = 49/61 (80%), Gaps = 0/61 (0%)
 Frame = -2

Query  184  ADPRSDFVGVYAKLKSELLNDPAIQLTPDSRQWVQRMLEYNVPGGKLNRGLSVIDSYKLL  5
            +D +S F+ VY  LK ELL DPA +   DSRQWV RML+YNVPGGKLNRGLSV+DSY+LL
Sbjct  2    SDLKSRFIDVYGVLKQELLYDPAFEFDHDSRQWVDRMLDYNVPGGKLNRGLSVVDSYRLL  61

Query  4    K  2
            K
Sbjct  62   K  62



>gb|AFW98445.1| farnesyl diphosphate synthase [Leibnitzia anandria]
Length=342

 Score = 94.0 bits (232),  Expect = 8e-21, Method: Composition-based stats.
 Identities = 41/62 (66%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = -2

Query  187  AADPRSDFVGVYAKLKSELLNDPAIQLTPDSRQWVQRMLEYNVPGGKLNRGLSVIDSYKL  8
            + D +S F+ VY  LKSEL++DP+ +   DS QWV+RML+YNVPGGKLNRGLSV+DSYKL
Sbjct  2    SCDLKSKFLQVYDSLKSELIHDPSFEFDEDSSQWVERMLDYNVPGGKLNRGLSVVDSYKL  61

Query  7    LK  2
            LK
Sbjct  62   LK  63



>gb|AFW98440.1| farnesyl diphosphate synthase [Achillea asiatica]
Length=342

 Score = 94.0 bits (232),  Expect = 8e-21, Method: Composition-based stats.
 Identities = 41/60 (68%), Positives = 49/60 (82%), Gaps = 0/60 (0%)
 Frame = -2

Query  181  DPRSDFVGVYAKLKSELLNDPAIQLTPDSRQWVQRMLEYNVPGGKLNRGLSVIDSYKLLK  2
            D +S F+ VY  LKS+L+ DPA +   DSR WV+RML+YNVPGGKLNRGLSV+DSYKLLK
Sbjct  4    DLKSKFLQVYESLKSDLIKDPAFEFDDDSRHWVERMLDYNVPGGKLNRGLSVVDSYKLLK  63



>ref|XP_008792798.1| PREDICTED: farnesyl pyrophosphate synthase 1-like [Phoenix dactylifera]
Length=350

 Score = 94.0 bits (232),  Expect = 8e-21, Method: Composition-based stats.
 Identities = 44/66 (67%), Positives = 51/66 (77%), Gaps = 1/66 (2%)
 Frame = -2

Query  196  NGTAA-DPRSDFVGVYAKLKSELLNDPAIQLTPDSRQWVQRMLEYNVPGGKLNRGLSVID  20
            NG A  D RS F  +Y +LK+ELL DPA   T + RQW+ RML+YNVPGGKLNRG+SVID
Sbjct  6    NGRAGGDVRSIFPQIYFRLKAELLEDPAFDFTDEGRQWINRMLDYNVPGGKLNRGISVID  65

Query  19   SYKLLK  2
            SYKLLK
Sbjct  66   SYKLLK  71



>gb|ADO95193.1| farnesyl diphosphate synthase [Catharanthus roseus]
Length=345

 Score = 94.0 bits (232),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 44/64 (69%), Positives = 51/64 (80%), Gaps = 0/64 (0%)
 Frame = -2

Query  193  GTAADPRSDFVGVYAKLKSELLNDPAIQLTPDSRQWVQRMLEYNVPGGKLNRGLSVIDSY  14
               +D R+ F+ VY  LKS+LL DPA + T DSRQWV RML+YNVPGGKLNRGLSVIDSY
Sbjct  2    ANTSDLRTSFLKVYEILKSQLLADPAFEWTEDSRQWVDRMLDYNVPGGKLNRGLSVIDSY  61

Query  13   KLLK  2
            KLL+
Sbjct  62   KLLR  65



>ref|XP_009759138.1| PREDICTED: farnesyl pyrophosphate synthase 1-like [Nicotiana 
sylvestris]
Length=342

 Score = 93.6 bits (231),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 41/58 (71%), Positives = 50/58 (86%), Gaps = 0/58 (0%)
 Frame = -2

Query  175  RSDFVGVYAKLKSELLNDPAIQLTPDSRQWVQRMLEYNVPGGKLNRGLSVIDSYKLLK  2
            +S F+ VY+ LKSELLNDP  + T ++RQWV+RML+YNVPGGKLNRG+SVIDSY LLK
Sbjct  5    KSKFLEVYSVLKSELLNDPDFEFTDEARQWVERMLDYNVPGGKLNRGISVIDSYSLLK  62



>gb|AFW98441.1| farnesyl diphosphate synthase [Chrysanthemum lavandulifolium]
Length=342

 Score = 93.6 bits (231),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 41/60 (68%), Positives = 50/60 (83%), Gaps = 0/60 (0%)
 Frame = -2

Query  181  DPRSDFVGVYAKLKSELLNDPAIQLTPDSRQWVQRMLEYNVPGGKLNRGLSVIDSYKLLK  2
            D +S F+ VY  LKS+L++DPA +   DSR WV+RML+YNVPGGKLNRGLSV+DSYKLLK
Sbjct  4    DLKSKFLQVYDSLKSDLIHDPAFEFDDDSRNWVERMLDYNVPGGKLNRGLSVVDSYKLLK  63



>gb|AEM42979.1| farnesyl diphosphate synthase [Siraitia grosvenorii]
Length=342

 Score = 93.6 bits (231),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 42/61 (69%), Positives = 50/61 (82%), Gaps = 0/61 (0%)
 Frame = -2

Query  184  ADPRSDFVGVYAKLKSELLNDPAIQLTPDSRQWVQRMLEYNVPGGKLNRGLSVIDSYKLL  5
            AD +S F+ VY+ LK E L DPA + T  SRQW++RML+YNVPGGKLNRGLSVIDSY+LL
Sbjct  2    ADLKSTFLKVYSVLKEEPLQDPAFEFTDASRQWIERMLDYNVPGGKLNRGLSVIDSYRLL  61

Query  4    K  2
            K
Sbjct  62   K  62



>gb|ACY80695.1| farnesyl pyrophosphate synthase [Cyclocarya paliurus]
Length=342

 Score = 93.6 bits (231),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 43/61 (70%), Positives = 49/61 (80%), Gaps = 0/61 (0%)
 Frame = -2

Query  184  ADPRSDFVGVYAKLKSELLNDPAIQLTPDSRQWVQRMLEYNVPGGKLNRGLSVIDSYKLL  5
            +D RS F+  Y+ LKSEL+ DP    T DSR WV+RML+YNVPGGKLNRGLSVIDSYKLL
Sbjct  2    SDFRSRFLEAYSVLKSELIQDPDFDFTEDSRLWVERMLDYNVPGGKLNRGLSVIDSYKLL  61

Query  4    K  2
            K
Sbjct  62   K  62



>emb|CDY28904.1| BnaA02g25720D [Brassica napus]
Length=342

 Score = 93.6 bits (231),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 40/61 (66%), Positives = 53/61 (87%), Gaps = 0/61 (0%)
 Frame = -2

Query  184  ADPRSDFVGVYAKLKSELLNDPAIQLTPDSRQWVQRMLEYNVPGGKLNRGLSVIDSYKLL  5
            AD +S F+ VY+ LKS+LL+DP+ + T +SR WV++ML+YNVPGGKLNRGLSV+DS+KLL
Sbjct  2    ADLKSTFLNVYSTLKSDLLHDPSFEFTEESRLWVEKMLDYNVPGGKLNRGLSVVDSFKLL  61

Query  4    K  2
            K
Sbjct  62   K  62



>ref|XP_006398480.1| hypothetical protein EUTSA_v10000912mg [Eutrema salsugineum]
 gb|ESQ39933.1| hypothetical protein EUTSA_v10000912mg [Eutrema salsugineum]
Length=394

 Score = 94.0 bits (232),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 41/61 (67%), Positives = 53/61 (87%), Gaps = 0/61 (0%)
 Frame = -2

Query  184  ADPRSDFVGVYAKLKSELLNDPAIQLTPDSRQWVQRMLEYNVPGGKLNRGLSVIDSYKLL  5
            AD +S F+ VY+ LKS+LL+DP+ + T +SR WV+RML+YNVPGGKLNRGLSV+DS+KLL
Sbjct  54   ADLKSTFLNVYSILKSDLLHDPSFEFTDESRLWVERMLDYNVPGGKLNRGLSVVDSFKLL  113

Query  4    K  2
            K
Sbjct  114  K  114



>ref|XP_010924112.1| PREDICTED: farnesyl pyrophosphate synthase-like isoform X3 [Elaeis 
guineensis]
Length=318

 Score = 93.2 bits (230),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 43/66 (65%), Positives = 51/66 (77%), Gaps = 1/66 (2%)
 Frame = -2

Query  196  NGTAA-DPRSDFVGVYAKLKSELLNDPAIQLTPDSRQWVQRMLEYNVPGGKLNRGLSVID  20
            NG A  D +S F  +Y +LK+ELL DPA   T + RQW+ RML+YNVPGGKLNRG+SVID
Sbjct  6    NGRAGGDVKSTFRQIYFRLKAELLEDPAFDFTDEGRQWINRMLDYNVPGGKLNRGISVID  65

Query  19   SYKLLK  2
            SYKLLK
Sbjct  66   SYKLLK  71



>ref|XP_010924111.1| PREDICTED: farnesyl pyrophosphate synthase-like isoform X2 [Elaeis 
guineensis]
Length=334

 Score = 93.2 bits (230),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 43/66 (65%), Positives = 51/66 (77%), Gaps = 1/66 (2%)
 Frame = -2

Query  196  NGTAA-DPRSDFVGVYAKLKSELLNDPAIQLTPDSRQWVQRMLEYNVPGGKLNRGLSVID  20
            NG A  D +S F  +Y +LK+ELL DPA   T + RQW+ RML+YNVPGGKLNRG+SVID
Sbjct  6    NGRAGGDVKSTFRQIYFRLKAELLEDPAFDFTDEGRQWINRMLDYNVPGGKLNRGISVID  65

Query  19   SYKLLK  2
            SYKLLK
Sbjct  66   SYKLLK  71



>sp|Q7XYT0.1|FPPS2_ARTSI RecName: Full=Farnesyl diphosphate synthase 2; Includes: RecName: 
Full=Dimethylallyltranstransferase; Includes: RecName: 
Full=(2E,6E)-farnesyl diphosphate synthase [Artemisia spiciformis]
 gb|AAP74719.1| farnesyl diphosphate synthase [Artemisia spiciformis]
Length=342

 Score = 93.2 bits (230),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 41/60 (68%), Positives = 50/60 (83%), Gaps = 0/60 (0%)
 Frame = -2

Query  181  DPRSDFVGVYAKLKSELLNDPAIQLTPDSRQWVQRMLEYNVPGGKLNRGLSVIDSYKLLK  2
            D +S F+ VY  LKS+L++DPA +   DSR WV+RML+YNVPGGKLNRGLSV+DSYKLLK
Sbjct  4    DLKSRFLQVYDSLKSDLIHDPAFEFDDDSRNWVERMLDYNVPGGKLNRGLSVVDSYKLLK  63



>ref|XP_010924109.1| PREDICTED: farnesyl pyrophosphate synthase 1-like isoform X1 
[Elaeis guineensis]
Length=350

 Score = 93.2 bits (230),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 43/66 (65%), Positives = 51/66 (77%), Gaps = 1/66 (2%)
 Frame = -2

Query  196  NGTAA-DPRSDFVGVYAKLKSELLNDPAIQLTPDSRQWVQRMLEYNVPGGKLNRGLSVID  20
            NG A  D +S F  +Y +LK+ELL DPA   T + RQW+ RML+YNVPGGKLNRG+SVID
Sbjct  6    NGRAGGDVKSTFRQIYFRLKAELLEDPAFDFTDEGRQWINRMLDYNVPGGKLNRGISVID  65

Query  19   SYKLLK  2
            SYKLLK
Sbjct  66   SYKLLK  71



>ref|XP_010449657.1| PREDICTED: farnesyl pyrophosphate synthase 2-like isoform X2 
[Camelina sativa]
 ref|XP_010449659.1| PREDICTED: farnesyl pyrophosphate synthase 2-like isoform X2 
[Camelina sativa]
 ref|XP_010449661.1| PREDICTED: farnesyl pyrophosphate synthase 2-like isoform X2 
[Camelina sativa]
Length=342

 Score = 93.2 bits (230),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 41/61 (67%), Positives = 52/61 (85%), Gaps = 0/61 (0%)
 Frame = -2

Query  184  ADPRSDFVGVYAKLKSELLNDPAIQLTPDSRQWVQRMLEYNVPGGKLNRGLSVIDSYKLL  5
            AD +S F+ VY+ LKS+LL DP+ + T +SRQW++RML+YNV GGKLNRGLSV+DSYKLL
Sbjct  2    ADLKSTFLDVYSTLKSDLLQDPSFEFTHESRQWLERMLDYNVRGGKLNRGLSVVDSYKLL  61

Query  4    K  2
            K
Sbjct  62   K  62



>ref|XP_009128999.1| PREDICTED: farnesyl pyrophosphate synthase 2 [Brassica rapa]
Length=387

 Score = 93.6 bits (231),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 40/61 (66%), Positives = 53/61 (87%), Gaps = 0/61 (0%)
 Frame = -2

Query  184  ADPRSDFVGVYAKLKSELLNDPAIQLTPDSRQWVQRMLEYNVPGGKLNRGLSVIDSYKLL  5
            AD +S F+ VY+ LKS+LL+DP+ + T +SR WV++ML+YNVPGGKLNRGLSV+DS+KLL
Sbjct  47   ADLKSTFLNVYSTLKSDLLHDPSFEFTEESRLWVEKMLDYNVPGGKLNRGLSVVDSFKLL  106

Query  4    K  2
            K
Sbjct  107  K  107



>ref|XP_011097731.1| PREDICTED: farnesyl pyrophosphate synthase-like [Sesamum indicum]
Length=342

 Score = 93.2 bits (230),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 42/60 (70%), Positives = 50/60 (83%), Gaps = 0/60 (0%)
 Frame = -2

Query  181  DPRSDFVGVYAKLKSELLNDPAIQLTPDSRQWVQRMLEYNVPGGKLNRGLSVIDSYKLLK  2
            D ++ F+ VY+ LKSELLNDP  + T DSR WV+RML+YNV GGKLNRGLSV+DSYKLLK
Sbjct  3    DLKTRFLQVYSVLKSELLNDPDFEFTDDSRHWVERMLDYNVLGGKLNRGLSVVDSYKLLK  62



>ref|XP_010494928.1| PREDICTED: farnesyl pyrophosphate synthase 2-like [Camelina sativa]
Length=388

 Score = 93.2 bits (230),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 42/61 (69%), Positives = 52/61 (85%), Gaps = 0/61 (0%)
 Frame = -2

Query  184  ADPRSDFVGVYAKLKSELLNDPAIQLTPDSRQWVQRMLEYNVPGGKLNRGLSVIDSYKLL  5
            AD +S F+ VY+ LKS+LLNDPA + T +SR WV+RML+YNV GGKLNRGLSV+DS+KLL
Sbjct  48   ADLKSTFLNVYSVLKSDLLNDPAFEFTDESRLWVERMLDYNVRGGKLNRGLSVVDSFKLL  107

Query  4    K  2
            K
Sbjct  108  K  108



>ref|XP_010481370.1| PREDICTED: farnesyl pyrophosphate synthase 1, mitochondrial [Camelina 
sativa]
Length=388

 Score = 93.2 bits (230),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 42/61 (69%), Positives = 52/61 (85%), Gaps = 0/61 (0%)
 Frame = -2

Query  184  ADPRSDFVGVYAKLKSELLNDPAIQLTPDSRQWVQRMLEYNVPGGKLNRGLSVIDSYKLL  5
            AD +S F+ VY+ LKS+LLNDPA + T +SR WV+RML+YNV GGKLNRGLSV+DS+KLL
Sbjct  48   ADLKSTFLNVYSVLKSDLLNDPAFEFTDESRLWVERMLDYNVRGGKLNRGLSVVDSFKLL  107

Query  4    K  2
            K
Sbjct  108  K  108



>gb|AFV51840.1| farnesyl pyrophosphate synthase [Triticum aestivum]
 gb|AGC11809.1| farnesyl pyrophosphate synthase D1 [Triticum aestivum]
Length=354

 Score = 92.8 bits (229),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 39/69 (57%), Positives = 53/69 (77%), Gaps = 0/69 (0%)
 Frame = -2

Query  208  MATQNGTAADPRSDFVGVYAKLKSELLNDPAIQLTPDSRQWVQRMLEYNVPGGKLNRGLS  29
            +A  NG+  D +++F  +Y++LK E+L DPA + T +S QW++RML+YNV GGK NRGLS
Sbjct  6    VALSNGSGGDSKAEFAEIYSRLKEEMLEDPAFEFTDESLQWIERMLDYNVLGGKCNRGLS  65

Query  28   VIDSYKLLK  2
            VIDSYK LK
Sbjct  66   VIDSYKTLK  74



>ref|NP_193452.1| farnesyl diphosphate synthase 2 [Arabidopsis thaliana]
 sp|Q43315.1|FPPS2_ARATH RecName: Full=Farnesyl pyrophosphate synthase 2; Short=FPP synthase 
2; Short=FPS 2; AltName: Full=(2E,6E)-farnesyl diphosphate 
synthase 2; AltName: Full=Dimethylallyltranstransferase 
2; AltName: Full=Farnesyl diphosphate synthase 2; AltName: 
Full=Geranyltranstransferase 2 [Arabidopsis thaliana]
 gb|AAB07247.1| farnesyl diphosphate synthase [Arabidopsis thaliana]
 gb|AAB07248.1| farnesyl diphosphate synthase [Arabidopsis thaliana]
 emb|CAB10500.1| dl4630c [Arabidopsis thaliana]
 emb|CAB80990.1| AT4g17190 [Arabidopsis thaliana]
 gb|AAL60028.1| putative farnesyl-pyrophosphate synthetase FPS2 [Arabidopsis 
thaliana]
 gb|AAM51429.1| putative farnesyl-pyrophosphate synthetase FPS2 [Arabidopsis 
thaliana]
 gb|AEE83860.1| farnesyl diphosphate synthase 2 [Arabidopsis thaliana]
Length=342

 Score = 92.4 bits (228),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 41/61 (67%), Positives = 52/61 (85%), Gaps = 0/61 (0%)
 Frame = -2

Query  184  ADPRSDFVGVYAKLKSELLNDPAIQLTPDSRQWVQRMLEYNVPGGKLNRGLSVIDSYKLL  5
            AD +S F+ VY+ LKS+LL DP+ + T +SRQW++RML+YNV GGKLNRGLSV+DSYKLL
Sbjct  2    ADLKSTFLDVYSVLKSDLLQDPSFEFTHESRQWLERMLDYNVRGGKLNRGLSVVDSYKLL  61

Query  4    K  2
            K
Sbjct  62   K  62



>gb|AFW98434.1| farnesyl diphosphate synthase [Leucanthemum vulgare]
Length=342

 Score = 92.4 bits (228),  Expect = 3e-20, Method: Composition-based stats.
 Identities = 42/62 (68%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = -2

Query  187  AADPRSDFVGVYAKLKSELLNDPAIQLTPDSRQWVQRMLEYNVPGGKLNRGLSVIDSYKL  8
            + D +S F+ VY  LKSEL+NDPA +    SRQWV++ML+YNVPGGKLNRGLSVIDSY+L
Sbjct  2    STDLKSKFLKVYDILKSELINDPAFESDEASRQWVEKMLDYNVPGGKLNRGLSVIDSYQL  61

Query  7    LK  2
            LK
Sbjct  62   LK  63



>ref|XP_010434707.1| PREDICTED: LOW QUALITY PROTEIN: farnesyl pyrophosphate synthase 
2-like [Camelina sativa]
Length=342

 Score = 92.4 bits (228),  Expect = 3e-20, Method: Composition-based stats.
 Identities = 41/61 (67%), Positives = 52/61 (85%), Gaps = 0/61 (0%)
 Frame = -2

Query  184  ADPRSDFVGVYAKLKSELLNDPAIQLTPDSRQWVQRMLEYNVPGGKLNRGLSVIDSYKLL  5
            AD +S F+ VY+ LKS+LL DP+ + T +SRQW++RML+YNV GGKLNRGLSV+DSYKLL
Sbjct  2    ADLKSTFLDVYSILKSDLLQDPSFEFTHESRQWLERMLDYNVRGGKLNRGLSVVDSYKLL  61

Query  4    K  2
            K
Sbjct  62   K  62



>ref|XP_002868080.1| hypothetical protein ARALYDRAFT_493157 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH44339.1| hypothetical protein ARALYDRAFT_493157 [Arabidopsis lyrata subsp. 
lyrata]
Length=342

 Score = 92.4 bits (228),  Expect = 3e-20, Method: Composition-based stats.
 Identities = 41/61 (67%), Positives = 52/61 (85%), Gaps = 0/61 (0%)
 Frame = -2

Query  184  ADPRSDFVGVYAKLKSELLNDPAIQLTPDSRQWVQRMLEYNVPGGKLNRGLSVIDSYKLL  5
            AD +S F+ VY+ LKS+LL DP+ + T +SRQW++RML+YNV GGKLNRGLSV+DSYKLL
Sbjct  2    ADLKSTFLDVYSILKSDLLQDPSFEFTHESRQWLERMLDYNVRGGKLNRGLSVVDSYKLL  61

Query  4    K  2
            K
Sbjct  62   K  62



>gb|ADO87007.1| E,E-farnesyl diphosphate synthase [Santalum album]
 gb|AGV01244.1| farnesyl diphosphate synthase [Santalum album]
Length=342

 Score = 92.0 bits (227),  Expect = 4e-20, Method: Composition-based stats.
 Identities = 42/61 (69%), Positives = 48/61 (79%), Gaps = 0/61 (0%)
 Frame = -2

Query  184  ADPRSDFVGVYAKLKSELLNDPAIQLTPDSRQWVQRMLEYNVPGGKLNRGLSVIDSYKLL  5
             D ++ F+  Y+ LKSELL DPA   T  SRQWV RML+YNVPGGKLNRGLSVIDSY+LL
Sbjct  2    GDRKTKFLEAYSVLKSELLRDPAFNFTDASRQWVDRMLDYNVPGGKLNRGLSVIDSYELL  61

Query  4    K  2
            K
Sbjct  62   K  62



>gb|AEY80378.1| farnesyl diphosphate synthase [Santalum album]
Length=342

 Score = 92.0 bits (227),  Expect = 4e-20, Method: Composition-based stats.
 Identities = 42/61 (69%), Positives = 48/61 (79%), Gaps = 0/61 (0%)
 Frame = -2

Query  184  ADPRSDFVGVYAKLKSELLNDPAIQLTPDSRQWVQRMLEYNVPGGKLNRGLSVIDSYKLL  5
             D ++ F+  Y+ LKSELL DPA   T  SRQWV RML+YNVPGGKLNRGLSVIDSY+LL
Sbjct  2    GDRKTKFLEAYSVLKSELLRDPAFNFTDASRQWVDRMLDYNVPGGKLNRGLSVIDSYELL  61

Query  4    K  2
            K
Sbjct  62   K  62



>gb|AFV51836.1| farnesyl pyrophosphate synthase [Triticum aestivum]
 gb|AGC11807.1| farnesyl pyrophosphate synthase A1 [Triticum aestivum]
Length=354

 Score = 92.0 bits (227),  Expect = 4e-20, Method: Composition-based stats.
 Identities = 39/69 (57%), Positives = 52/69 (75%), Gaps = 0/69 (0%)
 Frame = -2

Query  208  MATQNGTAADPRSDFVGVYAKLKSELLNDPAIQLTPDSRQWVQRMLEYNVPGGKLNRGLS  29
            +A  NG+  D +++F  +Y++LK E+L DPA + T +S QW+ RML+YNV GGK NRGLS
Sbjct  6    VALSNGSGGDSKAEFAEIYSRLKEEMLEDPAFEFTDESLQWIDRMLDYNVLGGKCNRGLS  65

Query  28   VIDSYKLLK  2
            VIDSYK LK
Sbjct  66   VIDSYKTLK  74



>gb|ADR83704.1| farnesyl pyrophosphate synthase [Alisma plantago-aquatica]
Length=343

 Score = 91.7 bits (226),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 40/62 (65%), Positives = 50/62 (81%), Gaps = 0/62 (0%)
 Frame = -2

Query  187  AADPRSDFVGVYAKLKSELLNDPAIQLTPDSRQWVQRMLEYNVPGGKLNRGLSVIDSYKL  8
            + D R  F  +Y +LKSELL DPA   T D+R+W+++ML+YNVPGGKLNRGLSV+DSYKL
Sbjct  14   SGDVRPLFCQIYCRLKSELLEDPAFDFTDDAREWIEKMLDYNVPGGKLNRGLSVVDSYKL  73

Query  7    LK  2
            LK
Sbjct  74   LK  75



>gb|AFV51839.1| farnesyl pyrophosphate synthase [Triticum aestivum]
 gb|AGC11808.1| farnesyl pyrophosphate synthase B1 [Triticum aestivum]
Length=354

 Score = 92.0 bits (227),  Expect = 5e-20, Method: Composition-based stats.
 Identities = 39/69 (57%), Positives = 52/69 (75%), Gaps = 0/69 (0%)
 Frame = -2

Query  208  MATQNGTAADPRSDFVGVYAKLKSELLNDPAIQLTPDSRQWVQRMLEYNVPGGKLNRGLS  29
            +A  NG+  D +++F  +Y++LK E+L DPA + T +S QW+ RML+YNV GGK NRGLS
Sbjct  6    VALSNGSGGDSKAEFAEIYSRLKEEMLEDPAFEFTDESLQWIDRMLDYNVLGGKCNRGLS  65

Query  28   VIDSYKLLK  2
            VIDSYK LK
Sbjct  66   VIDSYKTLK  74



>emb|CAA59170.1| dimethylallyltransferase [Capsicum annuum]
Length=342

 Score = 91.7 bits (226),  Expect = 5e-20, Method: Composition-based stats.
 Identities = 41/60 (68%), Positives = 48/60 (80%), Gaps = 0/60 (0%)
 Frame = -2

Query  184  ADPRSDFVGVYAKLKSELLNDPAIQLTPDSRQWVQRMLEYNVPGGKLNRGLSVIDSYKLL  5
            +D +S F+  Y  LKSELLNDP  + T DSR+WV +MLEYNVPGGKLNRGLSVIDSY L+
Sbjct  2    SDFKSKFMEAYYVLKSELLNDPGFEFTDDSREWVDKMLEYNVPGGKLNRGLSVIDSYSLV  61



>gb|ADV03674.1| farnesyl pyrophosphate synthase [Alisma plantago-aquatica subsp. 
orientale]
Length=343

 Score = 91.7 bits (226),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 42/68 (62%), Positives = 53/68 (78%), Gaps = 3/68 (4%)
 Frame = -2

Query  196  NGTAA---DPRSDFVGVYAKLKSELLNDPAIQLTPDSRQWVQRMLEYNVPGGKLNRGLSV  26
            NG+ +   D R  F  +Y +LKSELL DPA   T D+R+W+++ML+YNVPGGKLNRGLSV
Sbjct  8    NGSVSGSDDVRPLFCQIYCRLKSELLEDPAFDFTDDAREWIEKMLDYNVPGGKLNRGLSV  67

Query  25   IDSYKLLK  2
            +DSYKLLK
Sbjct  68   VDSYKLLK  75



>gb|AFV51841.1| farnesyl pyrophosphate synthase [Triticum aestivum]
Length=250

 Score = 90.9 bits (224),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 39/69 (57%), Positives = 52/69 (75%), Gaps = 0/69 (0%)
 Frame = -2

Query  208  MATQNGTAADPRSDFVGVYAKLKSELLNDPAIQLTPDSRQWVQRMLEYNVPGGKLNRGLS  29
            +A  NG+  D +++F  +Y++LK E+L DPA + T +S QW+ RML+YNV GGK NRGLS
Sbjct  6    VALSNGSGGDSKAEFAEIYSRLKEEMLEDPAFEFTDESLQWIDRMLDYNVLGGKCNRGLS  65

Query  28   VIDSYKLLK  2
            VIDSYK LK
Sbjct  66   VIDSYKTLK  74



>ref|NP_001056204.1| Os05g0543400 [Oryza sativa Japonica Group]
 gb|AAU43998.1| putative farnesyl pyrophosphate synthase [Oryza sativa Japonica 
Group]
 dbj|BAF18118.1| Os05g0543400 [Oryza sativa Japonica Group]
 dbj|BAG93657.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG94527.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE64559.1| hypothetical protein OsJ_19411 [Oryza sativa Japonica Group]
Length=355

 Score = 91.7 bits (226),  Expect = 6e-20, Method: Composition-based stats.
 Identities = 43/75 (57%), Positives = 51/75 (68%), Gaps = 6/75 (8%)
 Frame = -2

Query  208  MATQNGTAA------DPRSDFVGVYAKLKSELLNDPAIQLTPDSRQWVQRMLEYNVPGGK  47
            MA  NG+A         + +F  +Y  LK ELL DPA + T  SRQW+ RML+YNVPGGK
Sbjct  1    MAAANGSACGGGGVDKEKEEFKQIYGVLKEELLRDPAFEFTDSSRQWIDRMLDYNVPGGK  60

Query  46   LNRGLSVIDSYKLLK  2
             NRGLSV+DSYKLLK
Sbjct  61   CNRGLSVVDSYKLLK  75



>emb|CDY68039.1| BnaCnng57390D [Brassica napus]
Length=386

 Score = 91.7 bits (226),  Expect = 7e-20, Method: Composition-based stats.
 Identities = 40/61 (66%), Positives = 52/61 (85%), Gaps = 0/61 (0%)
 Frame = -2

Query  184  ADPRSDFVGVYAKLKSELLNDPAIQLTPDSRQWVQRMLEYNVPGGKLNRGLSVIDSYKLL  5
            AD +S F+ VY+ LKS+LL+DP+ + T  SR WV++ML+YNVPGGKLNRGLSV+DS+KLL
Sbjct  46   ADLKSTFLNVYSTLKSDLLHDPSFEFTDASRLWVEKMLDYNVPGGKLNRGLSVVDSFKLL  105

Query  4    K  2
            K
Sbjct  106  K  106



>ref|XP_008791170.1| PREDICTED: farnesyl pyrophosphate synthase-like isoform X2 [Phoenix 
dactylifera]
Length=334

 Score = 91.3 bits (225),  Expect = 7e-20, Method: Composition-based stats.
 Identities = 42/66 (64%), Positives = 51/66 (77%), Gaps = 1/66 (2%)
 Frame = -2

Query  196  NGTAA-DPRSDFVGVYAKLKSELLNDPAIQLTPDSRQWVQRMLEYNVPGGKLNRGLSVID  20
            NG A  D ++ F  +Y  LK+ELL DPA   T D+RQW+ +ML+YNVPGGKLNRG+SVID
Sbjct  6    NGRAGGDVKAIFRQIYLTLKAELLEDPAFDFTDDARQWIDKMLDYNVPGGKLNRGISVID  65

Query  19   SYKLLK  2
            SYKLLK
Sbjct  66   SYKLLK  71



>gb|EPS58847.1| farnesyl diphosphate synthase, partial [Genlisea aurea]
Length=65

 Score = 86.7 bits (213),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 38/65 (58%), Positives = 51/65 (78%), Gaps = 0/65 (0%)
 Frame = -2

Query  208  MATQNGTAADPRSDFVGVYAKLKSELLNDPAIQLTPDSRQWVQRMLEYNVPGGKLNRGLS  29
            MA  NG   D ++ F+GVY+ LKSELLN P+ + +  S +W++RML+YNVPGGKLNRGLS
Sbjct  1    MANPNGVPTDLKAAFIGVYSTLKSELLNGPSFEWSDGSLKWIERMLDYNVPGGKLNRGLS  60

Query  28   VIDSY  14
            V+DS+
Sbjct  61   VVDSF  65



>ref|XP_004294906.1| PREDICTED: farnesyl pyrophosphate synthase 1-like [Fragaria vesca 
subsp. vesca]
Length=342

 Score = 91.3 bits (225),  Expect = 8e-20, Method: Composition-based stats.
 Identities = 40/55 (73%), Positives = 48/55 (87%), Gaps = 0/55 (0%)
 Frame = -2

Query  166  FVGVYAKLKSELLNDPAIQLTPDSRQWVQRMLEYNVPGGKLNRGLSVIDSYKLLK  2
            F+ VY+ LKSEL+NDPA + T  SRQW++RML+YNVPGGKLNRGLSV+DS KLLK
Sbjct  8    FLEVYSVLKSELINDPAFEFTDVSRQWIERMLDYNVPGGKLNRGLSVVDSLKLLK  62



>ref|XP_002522802.1| farnesyl-pyrophosphate synthetase, putative [Ricinus communis]
 gb|EEF39653.1| farnesyl-pyrophosphate synthetase, putative [Ricinus communis]
Length=352

 Score = 90.9 bits (224),  Expect = 1e-19, Method: Composition-based stats.
 Identities = 40/60 (67%), Positives = 49/60 (82%), Gaps = 0/60 (0%)
 Frame = -2

Query  181  DPRSDFVGVYAKLKSELLNDPAIQLTPDSRQWVQRMLEYNVPGGKLNRGLSVIDSYKLLK  2
            DP+S F+ VY+ LKS+LLNDPA + T DSRQW++ ML+YNVP GKL RGL+VID YK LK
Sbjct  3    DPKSKFLEVYSLLKSQLLNDPAFEFTDDSRQWLEHMLDYNVPRGKLYRGLAVIDCYKALK  62



>ref|XP_006281527.1| hypothetical protein CARUB_v10027627mg [Capsella rubella]
 gb|EOA14425.1| hypothetical protein CARUB_v10027627mg [Capsella rubella]
Length=383

 Score = 90.9 bits (224),  Expect = 1e-19, Method: Composition-based stats.
 Identities = 41/61 (67%), Positives = 52/61 (85%), Gaps = 0/61 (0%)
 Frame = -2

Query  184  ADPRSDFVGVYAKLKSELLNDPAIQLTPDSRQWVQRMLEYNVPGGKLNRGLSVIDSYKLL  5
            AD +S F+ VY+ LKS+LL+DPA + T +SR WV+RML+YNV GGKLNRGLSV+DS+KLL
Sbjct  43   ADLKSTFLNVYSVLKSDLLHDPAFEFTNESRLWVERMLDYNVRGGKLNRGLSVVDSFKLL  102

Query  4    K  2
            K
Sbjct  103  K  103



>gb|EMS61433.1| Farnesyl pyrophosphate synthase [Triticum urartu]
Length=354

 Score = 90.5 bits (223),  Expect = 1e-19, Method: Composition-based stats.
 Identities = 38/65 (58%), Positives = 50/65 (77%), Gaps = 0/65 (0%)
 Frame = -2

Query  196  NGTAADPRSDFVGVYAKLKSELLNDPAIQLTPDSRQWVQRMLEYNVPGGKLNRGLSVIDS  17
            NG+  D +++F  +Y++LK E+L DPA + T +S QW+ RML+YNV GGK NRGLSVIDS
Sbjct  10   NGSGGDSKAEFAEIYSRLKEEMLEDPAFEFTDESLQWIDRMLDYNVLGGKCNRGLSVIDS  69

Query  16   YKLLK  2
            YK LK
Sbjct  70   YKTLK  74



>dbj|BAJ84778.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=355

 Score = 90.5 bits (223),  Expect = 1e-19, Method: Composition-based stats.
 Identities = 38/65 (58%), Positives = 50/65 (77%), Gaps = 0/65 (0%)
 Frame = -2

Query  196  NGTAADPRSDFVGVYAKLKSELLNDPAIQLTPDSRQWVQRMLEYNVPGGKLNRGLSVIDS  17
            NG+  D +++F  +Y++LK E+L DPA + T +S QW+ RML+YNV GGK NRGLSVIDS
Sbjct  11   NGSGGDSKAEFAEIYSRLKEEMLEDPAFEFTDESLQWIDRMLDYNVLGGKCNRGLSVIDS  70

Query  16   YKLLK  2
            YK LK
Sbjct  71   YKTLK  75



>gb|AIG15449.1| farnesyl diphosphate synthase [Azadirachta indica]
Length=342

 Score = 90.5 bits (223),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 42/61 (69%), Positives = 47/61 (77%), Gaps = 0/61 (0%)
 Frame = -2

Query  184  ADPRSDFVGVYAKLKSELLNDPAIQLTPDSRQWVQRMLEYNVPGGKLNRGLSVIDSYKLL  5
            +D  S F   Y  LK ELLNDPA +    SRQWV+RML+YNVPGGKLNRGLSV+DSYKLL
Sbjct  2    SDLHSKFREAYPVLKEELLNDPAFEYDDASRQWVERMLDYNVPGGKLNRGLSVLDSYKLL  61

Query  4    K  2
            K
Sbjct  62   K  62



>gb|ACA21460.1| farnesyl diphosphate synthase 4 [Picea abies]
Length=347

 Score = 90.5 bits (223),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 38/60 (63%), Positives = 50/60 (83%), Gaps = 0/60 (0%)
 Frame = -2

Query  181  DPRSDFVGVYAKLKSELLNDPAIQLTPDSRQWVQRMLEYNVPGGKLNRGLSVIDSYKLLK  2
            D ++ F  +Y +LK+++LNDPA   T D+RQWV++ML+Y VPGGKLNRGLSVIDSY+LLK
Sbjct  8    DVKTKFEEIYLELKAQILNDPAFDYTEDARQWVEKMLDYTVPGGKLNRGLSVIDSYRLLK  67



>gb|AAS19931.1| farnesyl diphosphate synthase [Taxus x media]
Length=351

 Score = 90.1 bits (222),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 43/68 (63%), Positives = 52/68 (76%), Gaps = 3/68 (4%)
 Frame = -2

Query  196  NGTA---ADPRSDFVGVYAKLKSELLNDPAIQLTPDSRQWVQRMLEYNVPGGKLNRGLSV  26
            NG A    D +S F+ VY  LK+E+L DPA   T D+R WV++ML+YNVPGGKLNRGLSV
Sbjct  4    NGNANFSVDMKSKFLQVYEHLKAEILRDPAFDYTEDARVWVEKMLDYNVPGGKLNRGLSV  63

Query  25   IDSYKLLK  2
            IDSY+LLK
Sbjct  64   IDSYRLLK  71



>ref|XP_002863368.1| farnesyl diphosphate synthase short form [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH39627.1| farnesyl diphosphate synthase short form [Arabidopsis lyrata 
subsp. lyrata]
Length=343

 Score = 90.1 bits (222),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 40/61 (66%), Positives = 52/61 (85%), Gaps = 0/61 (0%)
 Frame = -2

Query  184  ADPRSDFVGVYAKLKSELLNDPAIQLTPDSRQWVQRMLEYNVPGGKLNRGLSVIDSYKLL  5
            AD +S F+ VY+ LKS+LL+DP+ + T +SR WV+RML+YNV GGKLNRGLSV+DS+KLL
Sbjct  3    ADLKSTFLNVYSVLKSDLLHDPSFEFTDESRLWVERMLDYNVRGGKLNRGLSVVDSFKLL  62

Query  4    K  2
            K
Sbjct  63   K  63



>ref|XP_006644578.1| PREDICTED: farnesyl pyrophosphate synthase-like [Oryza brachyantha]
Length=353

 Score = 90.1 bits (222),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 37/65 (57%), Positives = 51/65 (78%), Gaps = 0/65 (0%)
 Frame = -2

Query  196  NGTAADPRSDFVGVYAKLKSELLNDPAIQLTPDSRQWVQRMLEYNVPGGKLNRGLSVIDS  17
            NG++ D ++ F  +Y++LK E+L DPA + T +S QW+ RML+YNV GGK NRG+SVIDS
Sbjct  9    NGSSGDSKAAFAEIYSRLKEEMLEDPAFEFTDESLQWIDRMLDYNVLGGKCNRGISVIDS  68

Query  16   YKLLK  2
            YK+LK
Sbjct  69   YKMLK  73



>gb|EEC79629.1| hypothetical protein OsI_20844 [Oryza sativa Indica Group]
Length=355

 Score = 90.1 bits (222),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 43/75 (57%), Positives = 51/75 (68%), Gaps = 6/75 (8%)
 Frame = -2

Query  208  MATQNGTAA------DPRSDFVGVYAKLKSELLNDPAIQLTPDSRQWVQRMLEYNVPGGK  47
            MA  NG+A         + +F  +Y  LK ELL DPA + T  SRQW+ RML+YNVPGGK
Sbjct  1    MAAANGSACGGGGVDKEKEEFKQIYGVLKEELLRDPAFEFTDSSRQWIDRMLDYNVPGGK  60

Query  46   LNRGLSVIDSYKLLK  2
             NRGLSV+DSYKLLK
Sbjct  61   CNRGLSVVDSYKLLK  75



>gb|ACN40171.1| unknown [Picea sitchensis]
Length=347

 Score = 89.7 bits (221),  Expect = 3e-19, Method: Composition-based stats.
 Identities = 37/60 (62%), Positives = 50/60 (83%), Gaps = 0/60 (0%)
 Frame = -2

Query  181  DPRSDFVGVYAKLKSELLNDPAIQLTPDSRQWVQRMLEYNVPGGKLNRGLSVIDSYKLLK  2
            D ++ F  +Y +LK+++LNDPA   T D+RQWV++ML+Y VPGGKLNRG+SVIDSY+LLK
Sbjct  8    DVKTKFEEIYLELKAQILNDPAFDYTEDARQWVEKMLDYTVPGGKLNRGMSVIDSYRLLK  67



>ref|XP_003569635.1| PREDICTED: farnesyl pyrophosphate synthase-like [Brachypodium 
distachyon]
Length=353

 Score = 89.4 bits (220),  Expect = 3e-19, Method: Composition-based stats.
 Identities = 38/65 (58%), Positives = 49/65 (75%), Gaps = 0/65 (0%)
 Frame = -2

Query  196  NGTAADPRSDFVGVYAKLKSELLNDPAIQLTPDSRQWVQRMLEYNVPGGKLNRGLSVIDS  17
            NG+  D +++F  +Y KLK E+L DPA + T +S  W+ RML+YNV GGK NRGLSVIDS
Sbjct  9    NGSGGDTKAEFAEIYNKLKEEMLEDPAFEFTDESLHWIDRMLDYNVLGGKCNRGLSVIDS  68

Query  16   YKLLK  2
            YK+LK
Sbjct  69   YKILK  73



>ref|XP_009418471.1| PREDICTED: farnesyl pyrophosphate synthase 1-like [Musa acuminata 
subsp. malaccensis]
Length=357

 Score = 89.0 bits (219),  Expect = 5e-19, Method: Composition-based stats.
 Identities = 40/61 (66%), Positives = 48/61 (79%), Gaps = 0/61 (0%)
 Frame = -2

Query  184  ADPRSDFVGVYAKLKSELLNDPAIQLTPDSRQWVQRMLEYNVPGGKLNRGLSVIDSYKLL  5
             D ++ F  +Y +LKSELL D A   T ++RQW+ RML+YNVPGGKLNRGLSVIDSYKLL
Sbjct  17   GDLKATFRQIYDRLKSELLQDDAFDCTDEARQWIDRMLDYNVPGGKLNRGLSVIDSYKLL  76

Query  4    K  2
            K
Sbjct  77   K  77



>gb|KDP39323.1| hypothetical protein JCGZ_01080 [Jatropha curcas]
Length=350

 Score = 89.0 bits (219),  Expect = 5e-19, Method: Composition-based stats.
 Identities = 40/61 (66%), Positives = 49/61 (80%), Gaps = 0/61 (0%)
 Frame = -2

Query  184  ADPRSDFVGVYAKLKSELLNDPAIQLTPDSRQWVQRMLEYNVPGGKLNRGLSVIDSYKLL  5
            +D +S F+ VY+ LKS+LLNDPA + T DSRQW+ RML+YNVP GKL RGL+VID YK L
Sbjct  2    SDLKSKFLEVYSTLKSQLLNDPAFEFTDDSRQWLDRMLDYNVPRGKLYRGLAVIDCYKSL  61

Query  4    K  2
            K
Sbjct  62   K  62



>ref|NP_001141329.1| hypothetical protein [Zea mays]
 gb|ACF86086.1| unknown [Zea mays]
 gb|ACR35378.1| unknown [Zea mays]
 tpg|DAA57961.1| TPA: hypothetical protein ZEAMMB73_236425 [Zea mays]
Length=355

 Score = 89.0 bits (219),  Expect = 6e-19, Method: Composition-based stats.
 Identities = 40/72 (56%), Positives = 53/72 (74%), Gaps = 1/72 (1%)
 Frame = -2

Query  214  GEMATQNGTA-ADPRSDFVGVYAKLKSELLNDPAIQLTPDSRQWVQRMLEYNVPGGKLNR  38
             E+   NG+  AD ++ F  +Y+KLK E+L DPA + T +S QW+ RML+YNV GGK NR
Sbjct  4    AEVVVANGSGGADTKTAFKEIYSKLKQEMLEDPAFEFTDESLQWIDRMLDYNVLGGKCNR  63

Query  37   GLSVIDSYKLLK  2
            GLSV+DSYK+LK
Sbjct  64   GLSVVDSYKILK  75



>gb|AER12202.1| farnesyl pyrophosphate synthase [Hedychium coccineum]
Length=356

 Score = 88.6 bits (218),  Expect = 7e-19, Method: Composition-based stats.
 Identities = 37/60 (62%), Positives = 50/60 (83%), Gaps = 0/60 (0%)
 Frame = -2

Query  181  DPRSDFVGVYAKLKSELLNDPAIQLTPDSRQWVQRMLEYNVPGGKLNRGLSVIDSYKLLK  2
            D ++ F+ +Y +LK +LL DPA   T +SR+W+++ML+YNVPGGKLNRG+SVIDSYKLLK
Sbjct  17   DRKAAFLQIYVQLKEDLLRDPAFDYTDESREWIEKMLDYNVPGGKLNRGISVIDSYKLLK  76



>ref|XP_009394514.1| PREDICTED: farnesyl pyrophosphate synthase 1-like [Musa acuminata 
subsp. malaccensis]
Length=356

 Score = 88.6 bits (218),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 40/64 (63%), Positives = 48/64 (75%), Gaps = 0/64 (0%)
 Frame = -2

Query  193  GTAADPRSDFVGVYAKLKSELLNDPAIQLTPDSRQWVQRMLEYNVPGGKLNRGLSVIDSY  14
            G   D ++ F  VY +LKSEL  D A   T ++RQW+ RML+YNVPGGKLNRG+SVIDSY
Sbjct  13   GDEGDLKATFRQVYGRLKSELFEDAAFDYTDEARQWIDRMLDYNVPGGKLNRGISVIDSY  72

Query  13   KLLK  2
            KLLK
Sbjct  73   KLLK  76



>gb|AHM22931.1| farnesyl pyrophosphate synthase 1 [Nicotiana tabacum]
Length=341

 Score = 88.6 bits (218),  Expect = 7e-19, Method: Composition-based stats.
 Identities = 41/61 (67%), Positives = 51/61 (84%), Gaps = 1/61 (2%)
 Frame = -2

Query  184  ADPRSDFVGVYAKLKSELLNDPAIQLTPDSRQWVQRMLEYNVPGGKLNRGLSVIDSYKLL  5
            +D +S F+ VY+ LKSELLNDP  + T ++RQWV+RML+YNVP GKLNRG+SVIDSY LL
Sbjct  2    SDLKSKFLEVYSVLKSELLNDPDFEFTDEARQWVERMLDYNVP-GKLNRGISVIDSYSLL  60

Query  4    K  2
            K
Sbjct  61   K  61



>ref|XP_006654732.1| PREDICTED: farnesyl pyrophosphate synthase-like [Oryza brachyantha]
Length=353

 Score = 87.8 bits (216),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 39/60 (65%), Positives = 46/60 (77%), Gaps = 0/60 (0%)
 Frame = -2

Query  181  DPRSDFVGVYAKLKSELLNDPAIQLTPDSRQWVQRMLEYNVPGGKLNRGLSVIDSYKLLK  2
            D R +F  +Y  LK+ELL DPA + T  SRQW+ RML+YNV GGK NRGLSV+DSYKLLK
Sbjct  14   DTREEFKRIYGVLKAELLGDPAFEFTDSSRQWIDRMLDYNVLGGKCNRGLSVVDSYKLLK  73



>ref|XP_010922982.1| PREDICTED: farnesyl pyrophosphate synthase-like isoform X2 [Elaeis 
guineensis]
Length=334

 Score = 87.8 bits (216),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 40/66 (61%), Positives = 51/66 (77%), Gaps = 1/66 (2%)
 Frame = -2

Query  196  NGTAA-DPRSDFVGVYAKLKSELLNDPAIQLTPDSRQWVQRMLEYNVPGGKLNRGLSVID  20
            NG A  D ++ F  +Y  LK+ELL DPA   T ++R+W+ +ML+YNVPGGKLNRG+SVID
Sbjct  6    NGRAGGDVKAIFRQIYFDLKAELLEDPAFDFTDEAREWIDKMLDYNVPGGKLNRGISVID  65

Query  19   SYKLLK  2
            SYKLLK
Sbjct  66   SYKLLK  71



>ref|XP_010922976.1| PREDICTED: farnesyl pyrophosphate synthase-like isoform X1 [Elaeis 
guineensis]
Length=350

 Score = 87.8 bits (216),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 40/66 (61%), Positives = 51/66 (77%), Gaps = 1/66 (2%)
 Frame = -2

Query  196  NGTAA-DPRSDFVGVYAKLKSELLNDPAIQLTPDSRQWVQRMLEYNVPGGKLNRGLSVID  20
            NG A  D ++ F  +Y  LK+ELL DPA   T ++R+W+ +ML+YNVPGGKLNRG+SVID
Sbjct  6    NGRAGGDVKAIFRQIYFDLKAELLEDPAFDFTDEAREWIDKMLDYNVPGGKLNRGISVID  65

Query  19   SYKLLK  2
            SYKLLK
Sbjct  66   SYKLLK  71



>gb|AAQ14872.1|AF330037_1 truncated farnesyl diphosphate synthase [Zea mays]
Length=341

 Score = 87.4 bits (215),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 38/60 (63%), Positives = 46/60 (77%), Gaps = 0/60 (0%)
 Frame = -2

Query  181  DPRSDFVGVYAKLKSELLNDPAIQLTPDSRQWVQRMLEYNVPGGKLNRGLSVIDSYKLLK  2
            D R+ F  +Y  LK ELL DPA + T +SRQW+ RM++YNV GGK NRGLSV+DSYKLLK
Sbjct  2    DTRAAFARIYKTLKEELLTDPAFEFTEESRQWIDRMVDYNVLGGKCNRGLSVVDSYKLLK  61



>ref|NP_001105039.1| farnesyl pyrophosphate synthase [Zea mays]
 sp|P49353.1|FPPS_MAIZE RecName: Full=Farnesyl pyrophosphate synthase; Short=FPP synthase; 
Short=FPS; AltName: Full=(2E,6E)-farnesyl diphosphate 
synthase; AltName: Full=Dimethylallyltranstransferase; AltName: 
Full=Farnesyl diphosphate synthase; AltName: Full=Geranyltranstransferase 
[Zea mays]
 gb|AAQ14871.1|AF330036_1 farnesyl diphosphate synthase [Zea mays]
 gb|AAB39276.1| farnesyl pyrophosphate synthetase [Zea mays]
 gb|ACF85258.1| unknown [Zea mays]
 gb|ACF88176.1| unknown [Zea mays]
 gb|ACG33796.1| farnesyl pyrophosphate synthetase [Zea mays]
 gb|AFW80960.1| farnesyl pyrophosphate synthase1 [Zea mays]
Length=350

 Score = 87.4 bits (215),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 38/60 (63%), Positives = 46/60 (77%), Gaps = 0/60 (0%)
 Frame = -2

Query  181  DPRSDFVGVYAKLKSELLNDPAIQLTPDSRQWVQRMLEYNVPGGKLNRGLSVIDSYKLLK  2
            D R+ F  +Y  LK ELL DPA + T +SRQW+ RM++YNV GGK NRGLSV+DSYKLLK
Sbjct  11   DTRAAFARIYKTLKEELLTDPAFEFTEESRQWIDRMVDYNVLGGKCNRGLSVVDSYKLLK  70



>ref|XP_006344903.1| PREDICTED: farnesyl pyrophosphate synthase 1-like [Solanum tuberosum]
Length=342

 Score = 87.4 bits (215),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 39/59 (66%), Positives = 48/59 (81%), Gaps = 0/59 (0%)
 Frame = -2

Query  181  DPRSDFVGVYAKLKSELLNDPAIQLTPDSRQWVQRMLEYNVPGGKLNRGLSVIDSYKLL  5
            D ++ F+ VY+ LKS+LL DP  + T DSRQWV++ML+YNVPGGKLNRGLSVIDS  LL
Sbjct  3    DLKAKFLEVYSVLKSDLLKDPDFEFTDDSRQWVEKMLDYNVPGGKLNRGLSVIDSLSLL  61



>gb|AAB07264.1| farnesyl diphosphate synthase short form [Arabidopsis thaliana]
Length=343

 Score = 87.4 bits (215),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 39/60 (65%), Positives = 50/60 (83%), Gaps = 0/60 (0%)
 Frame = -2

Query  181  DPRSDFVGVYAKLKSELLNDPAIQLTPDSRQWVQRMLEYNVPGGKLNRGLSVIDSYKLLK  2
            D +S F+ VY+ LKS+LL+DP+ + T +SR WV RML+YNV GGKLNRGLSV+DS+KLLK
Sbjct  4    DLKSTFLNVYSVLKSDLLHDPSFEFTNESRLWVDRMLDYNVRGGKLNRGLSVVDSFKLLK  63



>emb|CAA53433.1| dimethylallyltransferase [Arabidopsis thaliana]
Length=343

 Score = 87.4 bits (215),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 39/60 (65%), Positives = 50/60 (83%), Gaps = 0/60 (0%)
 Frame = -2

Query  181  DPRSDFVGVYAKLKSELLNDPAIQLTPDSRQWVQRMLEYNVPGGKLNRGLSVIDSYKLLK  2
            D +S F+ VY+ LKS+LL+DP+ + T +SR WV RML+YNV GGKLNRGLSV+DS+KLLK
Sbjct  4    DLKSTFLNVYSVLKSDLLHDPSFEFTNESRLWVDRMLDYNVRGGKLNRGLSVVDSFKLLK  63



>gb|AAL82595.1|AF470318_1 farnesyl pyrophosphare synthase [Musa acuminata]
Length=357

 Score = 87.4 bits (215),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 40/61 (66%), Positives = 48/61 (79%), Gaps = 0/61 (0%)
 Frame = -2

Query  184  ADPRSDFVGVYAKLKSELLNDPAIQLTPDSRQWVQRMLEYNVPGGKLNRGLSVIDSYKLL  5
             D ++ F  +Y +LKSELL D A   T ++RQW+ RML+YNVPGGKLNRGLSVIDSYKLL
Sbjct  17   GDLKATFRQIYDRLKSELLQDDAFDCTDEARQWIDRMLDYNVPGGKLNRGLSVIDSYKLL  76

Query  4    K  2
            K
Sbjct  77   K  77



>ref|NP_001234068.1| farnesyl pyrophosphate synthase [Solanum lycopersicum]
 gb|AAC73051.1| farnesyl pyrophosphate synthase [Solanum lycopersicum]
Length=342

 Score = 87.4 bits (215),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 40/61 (66%), Positives = 48/61 (79%), Gaps = 0/61 (0%)
 Frame = -2

Query  184  ADPRSDFVGVYAKLKSELLNDPAIQLTPDSRQWVQRMLEYNVPGGKLNRGLSVIDSYKLL  5
            AD +  F+ VY+ LKS+LL D A + T DSR+WV +ML+YNVPGGKLNRGLSVIDS  LL
Sbjct  2    ADLKKKFLDVYSVLKSDLLEDTAFEFTDDSRKWVDKMLDYNVPGGKLNRGLSVIDSLSLL  61

Query  4    K  2
            K
Sbjct  62   K  62



>gb|AGC11811.1| farnesyl pyrophosphate synthase B2 [Triticum aestivum]
Length=350

 Score = 87.0 bits (214),  Expect = 3e-18, Method: Composition-based stats.
 Identities = 38/68 (56%), Positives = 49/68 (72%), Gaps = 0/68 (0%)
 Frame = -2

Query  205  ATQNGTAADPRSDFVGVYAKLKSELLNDPAIQLTPDSRQWVQRMLEYNVPGGKLNRGLSV  26
            A +NG   + ++ F  +Y  LK+ELL DPA + T  S +W+ RML+YNV GGK NRGLSV
Sbjct  3    AAENGGGGESKAAFARIYDALKAELLRDPAFEYTESSHEWIDRMLDYNVLGGKCNRGLSV  62

Query  25   IDSYKLLK  2
            +DSYKLLK
Sbjct  63   VDSYKLLK  70



>ref|NP_199588.1| farnesyl diphosphate synthase 1 [Arabidopsis thaliana]
 sp|Q09152.2|FPPS1_ARATH RecName: Full=Farnesyl pyrophosphate synthase 1, mitochondrial; 
Short=FPP synthase 1; Short=FPS 1; AltName: Full=(2E,6E)-farnesyl 
diphosphate synthase 1; AltName: Full=Dimethylallyltranstransferase 
1; AltName: Full=Farnesyl diphosphate synthase 
1; AltName: Full=Geranyltranstransferase 1; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAK44139.1|AF370324_1 putative farnesyl diphosphate synthase precursor [Arabidopsis 
thaliana]
 gb|AAB49290.1| farnesyl diphosphate synthase precursor [Arabidopsis thaliana]
 gb|AAF44787.1| farnesyl diphosphate synthase long form [Arabidopsis thaliana]
 dbj|BAB11324.1| farnesyl diphosphate synthase precursor [Arabidopsis thaliana]
 gb|AAL34286.1| putative farnesyl diphosphate synthase precursor [Arabidopsis 
thaliana]
 gb|AED95570.1| farnesyl diphosphate synthase 1 [Arabidopsis thaliana]
Length=384

 Score = 87.4 bits (215),  Expect = 3e-18, Method: Composition-based stats.
 Identities = 39/60 (65%), Positives = 50/60 (83%), Gaps = 0/60 (0%)
 Frame = -2

Query  181  DPRSDFVGVYAKLKSELLNDPAIQLTPDSRQWVQRMLEYNVPGGKLNRGLSVIDSYKLLK  2
            D +S F+ VY+ LKS+LL+DP+ + T +SR WV RML+YNV GGKLNRGLSV+DS+KLLK
Sbjct  45   DLKSTFLNVYSVLKSDLLHDPSFEFTNESRLWVDRMLDYNVRGGKLNRGLSVVDSFKLLK  104



>gb|ACG34051.1| farnesyl pyrophosphate synthetase [Zea mays]
Length=355

 Score = 86.7 bits (213),  Expect = 4e-18, Method: Composition-based stats.
 Identities = 40/71 (56%), Positives = 53/71 (75%), Gaps = 1/71 (1%)
 Frame = -2

Query  211  EMATQNGT-AADPRSDFVGVYAKLKSELLNDPAIQLTPDSRQWVQRMLEYNVPGGKLNRG  35
            E+   NG  +AD ++ F   Y+KLK E+L+DPA + T +S QW+ RML+YNV GGK NRG
Sbjct  5    EVVVANGLGSADTKTVFKETYSKLKEEMLDDPAFEFTDESLQWIDRMLDYNVLGGKCNRG  64

Query  34   LSVIDSYKLLK  2
            LSVIDSY++LK
Sbjct  65   LSVIDSYRILK  75



>gb|ACG25973.1| farnesyl pyrophosphate synthetase [Zea mays]
Length=355

 Score = 86.3 bits (212),  Expect = 5e-18, Method: Composition-based stats.
 Identities = 40/71 (56%), Positives = 52/71 (73%), Gaps = 1/71 (1%)
 Frame = -2

Query  211  EMATQNGTA-ADPRSDFVGVYAKLKSELLNDPAIQLTPDSRQWVQRMLEYNVPGGKLNRG  35
            E+   NG   AD ++ F   Y+KLK E+L+DPA + T +S QW+ RML+YNV GGK NRG
Sbjct  5    EVVVANGLGGADTKTVFKETYSKLKEEMLDDPAFEFTDESLQWIDRMLDYNVLGGKCNRG  64

Query  34   LSVIDSYKLLK  2
            LSVIDSY++LK
Sbjct  65   LSVIDSYRILK  75



>ref|NP_001130900.1| uncharacterized protein LOC100192004 [Zea mays]
 gb|ACF79284.1| unknown [Zea mays]
Length=355

 Score = 86.3 bits (212),  Expect = 5e-18, Method: Composition-based stats.
 Identities = 40/71 (56%), Positives = 52/71 (73%), Gaps = 1/71 (1%)
 Frame = -2

Query  211  EMATQNGTA-ADPRSDFVGVYAKLKSELLNDPAIQLTPDSRQWVQRMLEYNVPGGKLNRG  35
            E+   NG   AD ++ F   Y+KLK E+L+DPA + T +S QW+ RML+YNV GGK NRG
Sbjct  5    EVVVANGLGGADTKTVFKETYSKLKEEMLDDPAFEFTDESLQWIDRMLDYNVLGGKCNRG  64

Query  34   LSVIDSYKLLK  2
            LSVIDSY++LK
Sbjct  65   LSVIDSYRILK  75



>gb|AFW83683.1| farnesyl pyrophosphate synthetase [Zea mays]
Length=355

 Score = 86.3 bits (212),  Expect = 5e-18, Method: Composition-based stats.
 Identities = 40/71 (56%), Positives = 52/71 (73%), Gaps = 1/71 (1%)
 Frame = -2

Query  211  EMATQNGTA-ADPRSDFVGVYAKLKSELLNDPAIQLTPDSRQWVQRMLEYNVPGGKLNRG  35
            E+   NG   AD ++ F   Y+KLK E+L+DPA + T +S QW+ RML+YNV GGK NRG
Sbjct  5    EVVVANGLGGADTKTVFKETYSKLKEEMLDDPAFEFTDESLQWIDRMLDYNVLGGKCNRG  64

Query  34   LSVIDSYKLLK  2
            LSVIDSY++LK
Sbjct  65   LSVIDSYRILK  75



>ref|XP_004969674.1| PREDICTED: farnesyl pyrophosphate synthase-like [Setaria italica]
Length=355

 Score = 85.9 bits (211),  Expect = 6e-18, Method: Composition-based stats.
 Identities = 38/71 (54%), Positives = 49/71 (69%), Gaps = 0/71 (0%)
 Frame = -2

Query  214  GEMATQNGTAADPRSDFVGVYAKLKSELLNDPAIQLTPDSRQWVQRMLEYNVPGGKLNRG  35
            G +        D R+ F  +Y+KLK E+L DPA + T +S QW+ RM++YNV GGK NRG
Sbjct  5    GAVVANGSGGPDTRAAFKEIYSKLKEEMLEDPAFEFTDESLQWIDRMVDYNVLGGKCNRG  64

Query  34   LSVIDSYKLLK  2
            LSVIDSYK+LK
Sbjct  65   LSVIDSYKILK  75



>ref|XP_006652944.1| PREDICTED: farnesyl pyrophosphate synthase-like [Oryza brachyantha]
Length=342

 Score = 85.9 bits (211),  Expect = 7e-18, Method: Composition-based stats.
 Identities = 39/60 (65%), Positives = 47/60 (78%), Gaps = 2/60 (3%)
 Frame = -2

Query  175  RSDFVGVYAKLKSELLNDPAIQL--TPDSRQWVQRMLEYNVPGGKLNRGLSVIDSYKLLK  2
            R  FV  Y +LKSELLND A     TP++RQWV +M++YNVPGGKLNRGLSV+DSY LL+
Sbjct  3    RERFVRAYERLKSELLNDRAFNFDFTPETRQWVAKMMDYNVPGGKLNRGLSVVDSYMLLR  62



>gb|AIL88642.1| farnesyl diphosphate synthase [Pinus massoniana]
Length=347

 Score = 85.9 bits (211),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 38/61 (62%), Positives = 48/61 (79%), Gaps = 0/61 (0%)
 Frame = -2

Query  184  ADPRSDFVGVYAKLKSELLNDPAIQLTPDSRQWVQRMLEYNVPGGKLNRGLSVIDSYKLL  5
             D R  F  +Y++LK+++L DPA   T D+RQWV +ML+Y VPGGKLNRGLSVIDSY+LL
Sbjct  7    VDVRPKFEKIYSELKAQILADPAFDYTEDARQWVNKMLDYTVPGGKLNRGLSVIDSYRLL  66

Query  4    K  2
            K
Sbjct  67   K  67



>gb|AEW09365.1| hypothetical protein UMN_6728_01, partial [Pinus radiata]
 gb|AFG60627.1| hypothetical protein UMN_6728_01, partial [Pinus taeda]
 gb|AFG60629.1| hypothetical protein UMN_6728_01, partial [Pinus taeda]
 gb|AFG60631.1| hypothetical protein UMN_6728_01, partial [Pinus taeda]
 gb|AFG60632.1| hypothetical protein UMN_6728_01, partial [Pinus taeda]
 gb|AFG60637.1| hypothetical protein UMN_6728_01, partial [Pinus taeda]
Length=89

 Score = 82.0 bits (201),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 37/60 (62%), Positives = 47/60 (78%), Gaps = 0/60 (0%)
 Frame = -2

Query  181  DPRSDFVGVYAKLKSELLNDPAIQLTPDSRQWVQRMLEYNVPGGKLNRGLSVIDSYKLLK  2
            D R  F  +Y++LK+++L DPA   T D+RQWV +ML+Y VPGGKLNRGLSVIDSY+ LK
Sbjct  8    DVRPKFEKIYSELKAQILADPAFDYTEDARQWVDKMLDYTVPGGKLNRGLSVIDSYRPLK  67



>gb|AEW09366.1| hypothetical protein UMN_6728_01, partial [Pinus lambertiana]
Length=89

 Score = 81.6 bits (200),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 37/61 (61%), Positives = 47/61 (77%), Gaps = 0/61 (0%)
 Frame = -2

Query  184  ADPRSDFVGVYAKLKSELLNDPAIQLTPDSRQWVQRMLEYNVPGGKLNRGLSVIDSYKLL  5
             D R  F  +Y +LK+++L DPA   T D+RQWV +ML+Y VPGGKLNRGLSVID+Y+LL
Sbjct  7    VDVRPKFEEIYFELKAQILADPAFDYTVDARQWVDKMLDYTVPGGKLNRGLSVIDNYRLL  66

Query  4    K  2
            K
Sbjct  67   K  67



>ref|XP_002456217.1| hypothetical protein SORBIDRAFT_03g032280 [Sorghum bicolor]
 gb|EES01337.1| hypothetical protein SORBIDRAFT_03g032280 [Sorghum bicolor]
Length=356

 Score = 85.1 bits (209),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 39/66 (59%), Positives = 50/66 (76%), Gaps = 1/66 (2%)
 Frame = -2

Query  196  NGTA-ADPRSDFVGVYAKLKSELLNDPAIQLTPDSRQWVQRMLEYNVPGGKLNRGLSVID  20
            NG+  AD ++ F   Y+KLK E+L DPA + T +S QW+ RM++YNV GGK NRGLSVID
Sbjct  11   NGSGGADTKAAFKETYSKLKEEMLQDPAFEFTDESLQWIDRMVDYNVLGGKCNRGLSVID  70

Query  19   SYKLLK  2
            SYK+LK
Sbjct  71   SYKILK  76



>gb|AFZ61535.1| chrysanthemol synthase (chloroplast) [Tanacetum cinerariifolium]
 gb|AGC03154.1| chrysanthemol synthase [Tanacetum cinerariifolium]
Length=393

 Score = 85.5 bits (210),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 36/57 (63%), Positives = 47/57 (82%), Gaps = 0/57 (0%)
 Frame = -2

Query  172  SDFVGVYAKLKSELLNDPAIQLTPDSRQWVQRMLEYNVPGGKLNRGLSVIDSYKLLK  2
            S F+ VY  LKSEL++DP+ +   DSRQWV+RM++YNVPGGK+ RG SV+DSY+LLK
Sbjct  58   SQFMQVYETLKSELIHDPSFEFDDDSRQWVERMIDYNVPGGKMVRGYSVVDSYQLLK  114



>sp|P0C565.1|CPPAS_TANCI RecName: Full=Chrysanthemyl diphosphate synthase, chloroplastic; 
Short=CPPase; Flags: Precursor [Tanacetum cinerariifolium]
Length=395

 Score = 85.5 bits (210),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 36/57 (63%), Positives = 47/57 (82%), Gaps = 0/57 (0%)
 Frame = -2

Query  172  SDFVGVYAKLKSELLNDPAIQLTPDSRQWVQRMLEYNVPGGKLNRGLSVIDSYKLLK  2
            S F+ VY  LKSEL++DP+ +   DSRQWV+RM++YNVPGGK+ RG SV+DSY+LLK
Sbjct  60   SQFMQVYETLKSELIHDPSFEFDDDSRQWVERMIDYNVPGGKMVRGYSVVDSYQLLK  116



>gb|AGC11812.1| farnesyl pyrophosphate synthase D2 [Triticum aestivum]
Length=351

 Score = 84.0 bits (206),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 37/58 (64%), Positives = 45/58 (78%), Gaps = 0/58 (0%)
 Frame = -2

Query  175  RSDFVGVYAKLKSELLNDPAIQLTPDSRQWVQRMLEYNVPGGKLNRGLSVIDSYKLLK  2
            ++ F  +Y  LK+ELL DPA + T  SRQW+ RML+YNV GGK NRGLSV+DSYKLLK
Sbjct  14   KAAFARIYDALKAELLRDPAFEYTESSRQWIDRMLDYNVLGGKCNRGLSVVDSYKLLK  71



>gb|AFG60626.1| hypothetical protein UMN_6728_01, partial [Pinus taeda]
 gb|AFG60628.1| hypothetical protein UMN_6728_01, partial [Pinus taeda]
 gb|AFG60630.1| hypothetical protein UMN_6728_01, partial [Pinus taeda]
 gb|AFG60633.1| hypothetical protein UMN_6728_01, partial [Pinus taeda]
 gb|AFG60634.1| hypothetical protein UMN_6728_01, partial [Pinus taeda]
 gb|AFG60635.1| hypothetical protein UMN_6728_01, partial [Pinus taeda]
 gb|AFG60636.1| hypothetical protein UMN_6728_01, partial [Pinus taeda]
 gb|AFG60638.1| hypothetical protein UMN_6728_01, partial [Pinus taeda]
 gb|AFG60639.1| hypothetical protein UMN_6728_01, partial [Pinus taeda]
 gb|AFG60640.1| hypothetical protein UMN_6728_01, partial [Pinus taeda]
 gb|AFG60641.1| hypothetical protein UMN_6728_01, partial [Pinus taeda]
 gb|AFG60642.1| hypothetical protein UMN_6728_01, partial [Pinus taeda]
Length=89

 Score = 80.1 bits (196),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 36/60 (60%), Positives = 46/60 (77%), Gaps = 0/60 (0%)
 Frame = -2

Query  181  DPRSDFVGVYAKLKSELLNDPAIQLTPDSRQWVQRMLEYNVPGGKLNRGLSVIDSYKLLK  2
            D R  F  +Y++LK+++L DP    T D+RQWV +ML+Y VPGGKLNRGLSVIDSY+ LK
Sbjct  8    DVRPKFEKIYSELKAQILADPVFDYTEDARQWVDKMLDYTVPGGKLNRGLSVIDSYRPLK  67



>ref|XP_008791173.1| PREDICTED: farnesyl pyrophosphate synthase-like isoform X5 [Phoenix 
dactylifera]
Length=326

 Score = 83.2 bits (204),  Expect = 5e-17, Method: Composition-based stats.
 Identities = 42/76 (55%), Positives = 51/76 (67%), Gaps = 11/76 (14%)
 Frame = -2

Query  196  NGTAA-DPRSDFVGVYAKLKSELLNDPAIQLTPDSRQWVQR----------MLEYNVPGG  50
            NG A  D ++ F  +Y  LK+ELL DPA   T D+RQW+ +          ML+YNVPGG
Sbjct  6    NGRAGGDVKAIFRQIYLTLKAELLEDPAFDFTDDARQWIDKKKREILHMLQMLDYNVPGG  65

Query  49   KLNRGLSVIDSYKLLK  2
            KLNRG+SVIDSYKLLK
Sbjct  66   KLNRGISVIDSYKLLK  81



>ref|XP_008791172.1| PREDICTED: farnesyl pyrophosphate synthase-like isoform X4 [Phoenix 
dactylifera]
Length=332

 Score = 83.2 bits (204),  Expect = 5e-17, Method: Composition-based stats.
 Identities = 42/76 (55%), Positives = 51/76 (67%), Gaps = 11/76 (14%)
 Frame = -2

Query  196  NGTAA-DPRSDFVGVYAKLKSELLNDPAIQLTPDSRQWVQR----------MLEYNVPGG  50
            NG A  D ++ F  +Y  LK+ELL DPA   T D+RQW+ +          ML+YNVPGG
Sbjct  6    NGRAGGDVKAIFRQIYLTLKAELLEDPAFDFTDDARQWIDKKKREILHMLQMLDYNVPGG  65

Query  49   KLNRGLSVIDSYKLLK  2
            KLNRG+SVIDSYKLLK
Sbjct  66   KLNRGISVIDSYKLLK  81



>ref|XP_008791171.1| PREDICTED: farnesyl pyrophosphate synthase-like isoform X3 [Phoenix 
dactylifera]
Length=333

 Score = 83.2 bits (204),  Expect = 5e-17, Method: Composition-based stats.
 Identities = 42/76 (55%), Positives = 51/76 (67%), Gaps = 11/76 (14%)
 Frame = -2

Query  196  NGTAA-DPRSDFVGVYAKLKSELLNDPAIQLTPDSRQWVQR----------MLEYNVPGG  50
            NG A  D ++ F  +Y  LK+ELL DPA   T D+RQW+ +          ML+YNVPGG
Sbjct  6    NGRAGGDVKAIFRQIYLTLKAELLEDPAFDFTDDARQWIDKKKREILHMLQMLDYNVPGG  65

Query  49   KLNRGLSVIDSYKLLK  2
            KLNRG+SVIDSYKLLK
Sbjct  66   KLNRGISVIDSYKLLK  81



>ref|XP_008791169.1| PREDICTED: farnesyl pyrophosphate synthase-like isoform X1 [Phoenix 
dactylifera]
Length=344

 Score = 83.2 bits (204),  Expect = 6e-17, Method: Composition-based stats.
 Identities = 42/76 (55%), Positives = 51/76 (67%), Gaps = 11/76 (14%)
 Frame = -2

Query  196  NGTAA-DPRSDFVGVYAKLKSELLNDPAIQLTPDSRQWVQR----------MLEYNVPGG  50
            NG A  D ++ F  +Y  LK+ELL DPA   T D+RQW+ +          ML+YNVPGG
Sbjct  6    NGRAGGDVKAIFRQIYLTLKAELLEDPAFDFTDDARQWIDKKKREILHMLQMLDYNVPGG  65

Query  49   KLNRGLSVIDSYKLLK  2
            KLNRG+SVIDSYKLLK
Sbjct  66   KLNRGISVIDSYKLLK  81



>ref|NP_001044000.1| Os01g0703400 [Oryza sativa Japonica Group]
 dbj|BAA19856.1| farnesyl pyrophosphate synthase [Oryza sativa Japonica Group]
 dbj|BAA36276.1| farnesyl diphosphate synthase [Oryza sativa Japonica Group]
 dbj|BAB92292.2| putative farnesyl pyrophosphate synthetase [Oryza sativa Japonica 
Group]
 dbj|BAF05914.1| Os01g0703400 [Oryza sativa Japonica Group]
 dbj|BAG88049.1| unnamed protein product [Oryza sativa Japonica Group]
Length=353

 Score = 83.2 bits (204),  Expect = 6e-17, Method: Composition-based stats.
 Identities = 36/66 (55%), Positives = 50/66 (76%), Gaps = 1/66 (2%)
 Frame = -2

Query  196  NGTAADP-RSDFVGVYAKLKSELLNDPAIQLTPDSRQWVQRMLEYNVPGGKLNRGLSVID  20
            NG + D  ++ F  +Y++LK E+L DPA + T +S QW+ RML+YNV GGK NRG+SVID
Sbjct  8    NGASGDSSKAAFAEIYSRLKEEMLEDPAFEFTDESLQWIDRMLDYNVLGGKCNRGISVID  67

Query  19   SYKLLK  2
            S+K+LK
Sbjct  68   SFKMLK  73



>ref|NP_001054122.1| Os04g0657300 [Oryza sativa Japonica Group]
 emb|CAE75966.1| OSJNBa0071I13.18 [Oryza sativa Japonica Group]
 dbj|BAF16036.1| Os04g0657300 [Oryza sativa Japonica Group]
 gb|EAY95876.1| hypothetical protein OsI_17742 [Oryza sativa Indica Group]
Length=407

 Score = 84.0 bits (206),  Expect = 7e-17, Method: Composition-based stats.
 Identities = 39/68 (57%), Positives = 48/68 (71%), Gaps = 2/68 (3%)
 Frame = -2

Query  199  QNGTAADPRSDFVGVYAKLKSELLNDPAIQL--TPDSRQWVQRMLEYNVPGGKLNRGLSV  26
            + G     R  FV  Y +LKSELLND A     T ++RQWV +M++YNVPGGKLNRGLSV
Sbjct  60   EQGQGEQTRDRFVRAYERLKSELLNDRAFNFDFTEETRQWVAKMMDYNVPGGKLNRGLSV  119

Query  25   IDSYKLLK  2
            +DSY LL+
Sbjct  120  VDSYMLLR  127



>emb|CAH66696.1| OSIGBa0158D24.4 [Oryza sativa Indica Group]
 gb|EEC78166.1| hypothetical protein OsI_17740 [Oryza sativa Indica Group]
Length=392

 Score = 83.6 bits (205),  Expect = 7e-17, Method: Composition-based stats.
 Identities = 40/83 (48%), Positives = 56/83 (67%), Gaps = 1/83 (1%)
 Frame = -2

Query  250  GEASPVPRCRLVGEMATQNGTAADPRSDFVGVYAKLKSELLNDPAIQLTPDSRQWVQRML  71
            G+ASP    R      + +G   D R  FV  Y +L+ +L+ D + +LT ++R+W+ +M+
Sbjct  31   GDASPAKCTRQEQRWRSDHGIV-DARERFVQAYGRLRDDLVGDDSCELTDEARRWLAQMI  89

Query  70   EYNVPGGKLNRGLSVIDSYKLLK  2
            +YNVPGGKLNRGLSVIDSY LLK
Sbjct  90   DYNVPGGKLNRGLSVIDSYLLLK  112



>ref|NP_001054121.1| Os04g0657100 [Oryza sativa Japonica Group]
 dbj|BAF16035.1| Os04g0657100 [Oryza sativa Japonica Group]
 dbj|BAG93128.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE61825.1| hypothetical protein OsJ_16465 [Oryza sativa Japonica Group]
Length=392

 Score = 83.6 bits (205),  Expect = 7e-17, Method: Composition-based stats.
 Identities = 40/83 (48%), Positives = 56/83 (67%), Gaps = 1/83 (1%)
 Frame = -2

Query  250  GEASPVPRCRLVGEMATQNGTAADPRSDFVGVYAKLKSELLNDPAIQLTPDSRQWVQRML  71
            G+ASP    R      + +G   D R  FV  Y +L+ +L+ D + +LT ++R+W+ +M+
Sbjct  31   GDASPAKCTRQEQRWRSDHGIV-DARERFVQAYGRLRDDLVGDDSCELTDEARRWLAQMI  89

Query  70   EYNVPGGKLNRGLSVIDSYKLLK  2
            +YNVPGGKLNRGLSVIDSY LLK
Sbjct  90   DYNVPGGKLNRGLSVIDSYLLLK  112



>ref|XP_003580726.1| PREDICTED: farnesyl pyrophosphate synthase 1-like [Brachypodium 
distachyon]
Length=401

 Score = 83.6 bits (205),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 40/60 (67%), Positives = 47/60 (78%), Gaps = 2/60 (3%)
 Frame = -2

Query  175  RSDFVGVYAKLKSELLNDPAIQL--TPDSRQWVQRMLEYNVPGGKLNRGLSVIDSYKLLK  2
            R  F+  Y +LKSELLND A     TP++RQWV +ML+YNVPGGKLNRGLSVIDSY LL+
Sbjct  62   RERFLRAYERLKSELLNDRAFNFDFTPETRQWVAKMLDYNVPGGKLNRGLSVIDSYMLLR  121



>gb|AFW98448.1| chrysanthemyl diphosphate synthase [Tanacetum coccineum]
Length=393

 Score = 83.2 bits (204),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 35/57 (61%), Positives = 46/57 (81%), Gaps = 0/57 (0%)
 Frame = -2

Query  172  SDFVGVYAKLKSELLNDPAIQLTPDSRQWVQRMLEYNVPGGKLNRGLSVIDSYKLLK  2
            S F+ VY  LKSEL++DP+ +   DSRQWV+RM++Y VPGGK+ RG SV+DSY+LLK
Sbjct  58   SQFMQVYETLKSELIHDPSFEFDDDSRQWVERMIDYTVPGGKMVRGYSVVDSYQLLK  114



>emb|CAE03415.3| OSJNBa0071I13.16 [Oryza sativa Japonica Group]
Length=434

 Score = 83.6 bits (205),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 40/83 (48%), Positives = 56/83 (67%), Gaps = 1/83 (1%)
 Frame = -2

Query  250  GEASPVPRCRLVGEMATQNGTAADPRSDFVGVYAKLKSELLNDPAIQLTPDSRQWVQRML  71
            G+ASP    R      + +G   D R  FV  Y +L+ +L+ D + +LT ++R+W+ +M+
Sbjct  31   GDASPAKCTRQEQRWRSDHGIV-DARERFVQAYGRLRDDLVGDDSCELTDEARRWLAQMI  89

Query  70   EYNVPGGKLNRGLSVIDSYKLLK  2
            +YNVPGGKLNRGLSVIDSY LLK
Sbjct  90   DYNVPGGKLNRGLSVIDSYLLLK  112



>dbj|BAJ90047.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ97886.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=352

 Score = 82.0 bits (201),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 37/60 (62%), Positives = 43/60 (72%), Gaps = 0/60 (0%)
 Frame = -2

Query  181  DPRSDFVGVYAKLKSELLNDPAIQLTPDSRQWVQRMLEYNVPGGKLNRGLSVIDSYKLLK  2
            D ++ F  +Y  LK ELL DPA   T  S QW+ RML+YNV GGK NRGLSV+DSYKLLK
Sbjct  13   DTKAAFARIYDALKEELLRDPAFDYTESSHQWIDRMLDYNVLGGKCNRGLSVVDSYKLLK  72



>pdb|4KK2|A Chain A, Crystal Structure Of A Chimeric Fpp/gfpp Synthase (target 
Efi-502313c) From Artemisia Spiciformis (1-72:gi751454468,73-346:gi75233326), 
Apo Structure
 pdb|4KK2|B Chain B, Crystal Structure Of A Chimeric Fpp/gfpp Synthase (target 
Efi-502313c) From Artemisia Spiciformis (1-72:gi751454468,73-346:gi75233326), 
Apo Structure
Length=366

 Score = 82.4 bits (202),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 35/62 (56%), Positives = 48/62 (77%), Gaps = 0/62 (0%)
 Frame = -2

Query  187  AADPRSDFVGVYAKLKSELLNDPAIQLTPDSRQWVQRMLEYNVPGGKLNRGLSVIDSYKL  8
            +++  S F+ VY  LKSEL++DP  +   DSRQWV+RM++Y VPGGK+ RG SV+DSY+L
Sbjct  26   SSNLNSQFMQVYETLKSELIHDPLFEFDDDSRQWVERMIDYTVPGGKMVRGYSVVDSYQL  85

Query  7    LK  2
            LK
Sbjct  86   LK  87



>gb|EMS46921.1| Farnesyl pyrophosphate synthase [Triticum urartu]
Length=350

 Score = 81.6 bits (200),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 36/60 (60%), Positives = 45/60 (75%), Gaps = 0/60 (0%)
 Frame = -2

Query  181  DPRSDFVGVYAKLKSELLNDPAIQLTPDSRQWVQRMLEYNVPGGKLNRGLSVIDSYKLLK  2
            + ++ F  +Y  LK+ELL DPA + T  S QW+ RML+YNV GGK NRGLSV+DSYKLLK
Sbjct  11   ETKAAFARIYDALKAELLRDPAFEYTESSHQWIDRMLDYNVLGGKCNRGLSVVDSYKLLK  70



>gb|AGC11810.1| farnesyl pyrophosphate synthase A2 [Triticum aestivum]
Length=350

 Score = 81.6 bits (200),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 36/60 (60%), Positives = 45/60 (75%), Gaps = 0/60 (0%)
 Frame = -2

Query  181  DPRSDFVGVYAKLKSELLNDPAIQLTPDSRQWVQRMLEYNVPGGKLNRGLSVIDSYKLLK  2
            + ++ F  +Y  LK+ELL DPA + T  S QW+ RML+YNV GGK NRGLSV+DSYKLLK
Sbjct  11   ETKAAFARIYDALKAELLRDPAFEYTESSHQWIDRMLDYNVLGGKCNRGLSVVDSYKLLK  70



>sp|Q7XYS8.1|CHRDS_ARTSI RecName: Full=Monoterpene synthase FDS-5, chloroplastic; AltName: 
Full=Chrysanthemyl diphosphate synthase; Short=CPP synthase; 
AltName: Full=Dimethylallyltranstransferase; AltName: 
Full=Lavandulyl diphosphate synthase; Short=LPP synthase; Flags: 
Precursor [Artemisia spiciformis]
 gb|AAP74721.1| chrysanthemyl diphosphate synthase [Artemisia spiciformis]
Length=394

 Score = 82.4 bits (202),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 35/62 (56%), Positives = 48/62 (77%), Gaps = 0/62 (0%)
 Frame = -2

Query  187  AADPRSDFVGVYAKLKSELLNDPAIQLTPDSRQWVQRMLEYNVPGGKLNRGLSVIDSYKL  8
            +++  S F+ VY  LKSEL++DP  +   DSRQWV+RM++Y VPGGK+ RG SV+DSY+L
Sbjct  54   SSNLNSQFMQVYETLKSELIHDPLFEFDDDSRQWVERMIDYTVPGGKMVRGYSVVDSYQL  113

Query  7    LK  2
            LK
Sbjct  114  LK  115



>ref|XP_010686608.1| PREDICTED: farnesyl pyrophosphate synthase 1 [Beta vulgaris subsp. 
vulgaris]
Length=345

 Score = 81.3 bits (199),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 38/59 (64%), Positives = 44/59 (75%), Gaps = 0/59 (0%)
 Frame = -2

Query  181  DPRSDFVGVYAKLKSELLNDPAIQLTPDSRQWVQRMLEYNVPGGKLNRGLSVIDSYKLL  5
            D R  F  VY  LK+ELL DP  +    SRQWV +ML+YNVPGGKLNRGLSVI++YKLL
Sbjct  6    DERERFKQVYQVLKTELLQDPNFEYDHISRQWVHQMLDYNVPGGKLNRGLSVIETYKLL  64



>ref|XP_006652943.1| PREDICTED: farnesyl pyrophosphate synthase 1, mitochondrial-like 
[Oryza brachyantha]
Length=393

 Score = 81.6 bits (200),  Expect = 4e-16, Method: Composition-based stats.
 Identities = 41/83 (49%), Positives = 55/83 (66%), Gaps = 1/83 (1%)
 Frame = -2

Query  250  GEASPVPRCRLVGEMATQNGTAADPRSDFVGVYAKLKSELLNDPAIQLTPDSRQWVQRML  71
            GEAS V   R      + +G A D R  F+  Y +L+ +L+ D +  LT ++R W+ +M+
Sbjct  32   GEASSVKCTRQEQRWQSDHGIA-DARERFMLAYGRLRDDLVGDDSCDLTDEARSWLAQMI  90

Query  70   EYNVPGGKLNRGLSVIDSYKLLK  2
            +YNVPGGKLNRGLSVIDSY LLK
Sbjct  91   DYNVPGGKLNRGLSVIDSYLLLK  113



>ref|XP_004961345.1| PREDICTED: farnesyl pyrophosphate synthase-like [Setaria italica]
Length=354

 Score = 80.9 bits (198),  Expect = 4e-16, Method: Composition-based stats.
 Identities = 35/60 (58%), Positives = 44/60 (73%), Gaps = 0/60 (0%)
 Frame = -2

Query  181  DPRSDFVGVYAKLKSELLNDPAIQLTPDSRQWVQRMLEYNVPGGKLNRGLSVIDSYKLLK  2
            D ++ F  +Y  LK ELL DPA + T +S QW+ RM++Y V GGK NRGLSV+DSYKLLK
Sbjct  15   DTKAAFAQIYNTLKEELLADPAFEFTAESHQWIDRMIDYTVLGGKCNRGLSVVDSYKLLK  74



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 511126208520