BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c6054_g1_i1 len=3091 path=[249:0-2232 248:2233-3090]

Length=3091
                                                                      Score     E

ref|XP_009802692.1|  PREDICTED: TSL-kinase interacting protein 1 ...    912   0.0      
ref|XP_009802688.1|  PREDICTED: TSL-kinase interacting protein 1 ...    912   0.0      
ref|XP_009802690.1|  PREDICTED: TSL-kinase interacting protein 1 ...    907   0.0      
ref|XP_009610182.1|  PREDICTED: TSL-kinase interacting protein 1 ...    902   0.0      
ref|XP_009802691.1|  PREDICTED: TSL-kinase interacting protein 1 ...    897   0.0      
ref|XP_009610184.1|  PREDICTED: TSL-kinase interacting protein 1 ...    897   0.0      
ref|XP_009610185.1|  PREDICTED: TSL-kinase interacting protein 1 ...    892   0.0      
ref|XP_004246638.1|  PREDICTED: TSL-kinase interacting protein 1 ...    886   0.0      
ref|XP_010325975.1|  PREDICTED: TSL-kinase interacting protein 1 ...    882   0.0      
ref|XP_006354356.1|  PREDICTED: TSL-kinase interacting protein 1-...    878   0.0      
ref|XP_006354358.1|  PREDICTED: TSL-kinase interacting protein 1-...    870   0.0      
ref|XP_010325976.1|  PREDICTED: TSL-kinase interacting protein 1 ...    872   0.0      
ref|XP_011077326.1|  PREDICTED: TSL-kinase interacting protein 1        843   0.0      
ref|XP_010653608.1|  PREDICTED: TSL-kinase interacting protein 1 ...    812   0.0      
ref|XP_010653605.1|  PREDICTED: TSL-kinase interacting protein 1 ...    812   0.0      
ref|XP_007027385.1|  TSL-kinase interacting protein 1, putative i...    801   0.0      
emb|CDP16915.1|  unnamed protein product                                798   0.0      
ref|XP_007027386.1|  TSL-kinase interacting protein 1, putative i...    793   0.0      
ref|XP_006493020.1|  PREDICTED: TSL-kinase interacting protein 1-...    786   0.0      
ref|XP_006493023.1|  PREDICTED: TSL-kinase interacting protein 1-...    786   0.0      
ref|XP_006493024.1|  PREDICTED: TSL-kinase interacting protein 1-...    785   0.0      
ref|XP_006428399.1|  hypothetical protein CICLE_v10011099mg             785   0.0      
gb|KDO49330.1|  hypothetical protein CISIN_1g0038981mg                  779   0.0      
ref|XP_006493025.1|  PREDICTED: TSL-kinase interacting protein 1-...    779   0.0      
gb|KDO49331.1|  hypothetical protein CISIN_1g0038981mg                  779   0.0      
ref|XP_006428401.1|  hypothetical protein CICLE_v10011099mg             777   0.0      
gb|KDP29153.1|  hypothetical protein JCGZ_16542                         777   0.0      
ref|XP_002323473.1|  myb family transcription factor family protein     773   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_006381423.1|  myb family transcription factor family protein     774   0.0      
ref|XP_011018734.1|  PREDICTED: TSL-kinase interacting protein 1 ...    768   0.0      
gb|KHG12089.1|  TSL-kinase interacting 1 -like protein                  767   0.0      
ref|XP_006373881.1|  hypothetical protein POPTR_0016s09290g             766   0.0      
ref|XP_011018736.1|  PREDICTED: TSL-kinase interacting protein 1 ...    764   0.0      
ref|XP_011030216.1|  PREDICTED: TSL-kinase interacting protein 1-...    763   0.0      
ref|XP_011018737.1|  PREDICTED: TSL-kinase interacting protein 1 ...    763   0.0      
gb|KHG04889.1|  TSL-kinase interacting 1 -like protein                  756   0.0      
ref|XP_008243985.1|  PREDICTED: TSL-kinase interacting protein 1 ...    751   0.0      
ref|XP_002519505.1|  DNA binding protein, putative                      741   0.0      Ricinus communis
ref|XP_004304454.1|  PREDICTED: TSL-kinase interacting protein 1-...    737   0.0      
ref|XP_008243983.1|  PREDICTED: TSL-kinase interacting protein 1 ...    739   0.0      
ref|XP_003519867.1|  PREDICTED: TSL-kinase interacting protein 1-...    736   0.0      
ref|XP_003547937.1|  PREDICTED: TSL-kinase interacting protein 1-...    734   0.0      
ref|XP_009334660.1|  PREDICTED: TSL-kinase interacting protein 1-...    733   0.0      
ref|XP_009376820.1|  PREDICTED: TSL-kinase interacting protein 1-...    732   0.0      
gb|KHN08826.1|  TSL-kinase interacting protein 1                        733   0.0      
ref|XP_004509591.1|  PREDICTED: TSL-kinase interacting protein 1-...    732   0.0      
ref|XP_008243984.1|  PREDICTED: TSL-kinase interacting protein 1 ...    733   0.0      
ref|XP_010107483.1|  hypothetical protein L484_024333                   731   0.0      
ref|XP_004509590.1|  PREDICTED: TSL-kinase interacting protein 1-...    730   0.0      
ref|XP_008442698.1|  PREDICTED: TSL-kinase interacting protein 1 ...    728   0.0      
gb|KGN58972.1|  hypothetical protein Csa_3G740150                       728   0.0      
ref|XP_010241825.1|  PREDICTED: TSL-kinase interacting protein 1        728   0.0      
ref|XP_004509592.1|  PREDICTED: TSL-kinase interacting protein 1-...    728   0.0      
ref|XP_008442695.1|  PREDICTED: TSL-kinase interacting protein 1 ...    725   0.0      
ref|XP_004137974.1|  PREDICTED: TSL-kinase interacting protein 1-...    725   0.0      
ref|XP_007156135.1|  hypothetical protein PHAVU_003G261500g             723   0.0      
ref|XP_010050972.1|  PREDICTED: TSL-kinase interacting protein 1        719   0.0      
gb|KDO49334.1|  hypothetical protein CISIN_1g0038981mg                  717   0.0      
ref|XP_004509589.1|  PREDICTED: TSL-kinase interacting protein 1-...    718   0.0      
ref|XP_004509588.1|  PREDICTED: TSL-kinase interacting protein 1-...    716   0.0      
ref|XP_004166172.1|  PREDICTED: TSL-kinase interacting protein 1-...    713   0.0      
gb|EYU38554.1|  hypothetical protein MIMGU_mgv1a022732mg                706   0.0      
gb|KEH20230.1|  TSL-kinase interacting protein                          706   0.0      
ref|XP_007027387.1|  TSL-kinase interacting protein 1, putative i...    702   0.0      
ref|XP_007208078.1|  hypothetical protein PRUPE_ppa001536mg             694   0.0      
ref|XP_010253972.1|  PREDICTED: TSL-kinase interacting protein 1-...    691   0.0      
ref|XP_010253973.1|  PREDICTED: TSL-kinase interacting protein 1-...    687   0.0      
ref|XP_010253971.1|  PREDICTED: TSL-kinase interacting protein 1-...    687   0.0      
ref|XP_006428403.1|  hypothetical protein CICLE_v10011099mg             671   0.0      
ref|XP_006428405.1|  hypothetical protein CICLE_v10011099mg             664   0.0      
ref|XP_010529729.1|  PREDICTED: TSL-kinase interacting protein 1 ...    656   0.0      
ref|XP_010529705.1|  PREDICTED: TSL-kinase interacting protein 1 ...    655   0.0      
ref|XP_010684064.1|  PREDICTED: TSL-kinase interacting protein 1        654   0.0      
ref|NP_850274.1|  TSL-kinase interacting protein 1                      645   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|NP_001189693.1|  TSL-kinase interacting protein 1                   645   0.0      
gb|AAM94622.1|  myb/SANT domain protein                                 645   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|NP_850273.1|  TSL-kinase interacting protein 1                      644   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_002879635.1|  tsl-kinase interacting protein 1                   641   0.0      
ref|XP_010923251.1|  PREDICTED: TSL-kinase interacting protein 1 ...    641   0.0      
ref|XP_010516930.1|  PREDICTED: TSL-kinase interacting protein 1-...    635   0.0      
ref|XP_010516928.1|  PREDICTED: TSL-kinase interacting protein 1-...    635   0.0      
ref|XP_010516931.1|  PREDICTED: TSL-kinase interacting protein 1-...    634   0.0      
ref|XP_010516929.1|  PREDICTED: TSL-kinase interacting protein 1-...    634   0.0      
ref|XP_010505244.1|  PREDICTED: TSL-kinase interacting protein 1-...    634   0.0      
ref|XP_010505245.1|  PREDICTED: TSL-kinase interacting protein 1-...    633   0.0      
ref|XP_010509410.1|  PREDICTED: TSL-kinase interacting protein 1 ...    627   0.0      
ref|XP_010509412.1|  PREDICTED: TSL-kinase interacting protein 1 ...    627   0.0      
ref|XP_006410872.1|  hypothetical protein EUTSA_v10016298mg             627   0.0      
ref|XP_008791201.1|  PREDICTED: TSL-kinase interacting protein 1 ...    627   0.0      
ref|XP_009143542.1|  PREDICTED: TSL-kinase interacting protein 1 ...    616   0.0      
ref|XP_009143543.1|  PREDICTED: TSL-kinase interacting protein 1 ...    615   0.0      
emb|CDY33210.1|  BnaC04g08290D                                          614   0.0      
ref|XP_008791198.1|  PREDICTED: TSL-kinase interacting protein 1 ...    618   0.0      
emb|CDX75001.1|  BnaA05g07470D                                          612   0.0      
ref|XP_010923259.1|  PREDICTED: TSL-kinase interacting protein 1 ...    602   0.0      
gb|AAD31581.1|  hypothetical protein                                    599   0.0      Arabidopsis thaliana [mouse-ear cress]
gb|EPS71953.1|  hypothetical protein M569_02804                         583   0.0      
ref|XP_006428400.1|  hypothetical protein CICLE_v10011099mg             558   0.0      
ref|XP_006649712.1|  PREDICTED: TSL-kinase interacting protein 1-...    558   0.0      
ref|XP_004985049.1|  PREDICTED: TSL-kinase interacting protein 1-...    558   0.0      
ref|XP_010228893.1|  PREDICTED: TSL-kinase interacting protein 1-...    553   2e-179   
ref|XP_006293769.1|  hypothetical protein CARUB_v10022743mg             548   7e-178   
ref|NP_001049513.1|  Os03g0241100                                       545   1e-176   Oryza sativa Japonica Group [Japonica rice]
gb|AAP68898.1|  hypothetical protein                                    546   1e-176   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008658849.1|  PREDICTED: uncharacterized protein LOC100383...    544   2e-176   
gb|EAY89204.1|  hypothetical protein OsI_10700                          544   3e-176   Oryza sativa Indica Group [Indian rice]
gb|ABF99104.1|  ribosomal protein S14p/S29e containing protein, e...    545   5e-175   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008658848.1|  PREDICTED: uncharacterized protein LOC100383...    540   2e-174   
gb|EEC76251.1|  hypothetical protein OsI_13694                          541   7e-174   Oryza sativa Indica Group [Indian rice]
gb|AGC14139.1|  MYB1                                                    538   2e-173   
gb|AFW89044.1|  putative MYB DNA-binding domain superfamily protein     534   4e-172   
ref|XP_009391059.1|  PREDICTED: TSL-kinase interacting protein 1 ...    532   2e-171   
ref|XP_009391062.1|  PREDICTED: TSL-kinase interacting protein 1 ...    516   1e-165   
ref|XP_008653331.1|  PREDICTED: TSL-kinase interacting protein 1        506   3e-162   
ref|XP_008653313.1|  PREDICTED: TSL-kinase interacting protein 1-...    506   6e-161   
gb|AFW89045.1|  putative MYB DNA-binding domain superfamily protein     487   2e-154   
ref|XP_006854485.1|  hypothetical protein AMTR_s00175p00030950          481   2e-151   
ref|XP_008791204.1|  PREDICTED: TSL-kinase interacting protein 1 ...    476   9e-151   
gb|AEV91169.1|  MYB-related protein                                     476   1e-149   
gb|ACN26933.1|  unknown                                                 462   3e-146   Zea mays [maize]
ref|XP_008387641.1|  PREDICTED: TSL-kinase interacting protein 1        432   8e-136   
tpg|DAA44324.1|  TPA: putative MYB DNA-binding domain superfamily...    402   3e-125   
ref|XP_002468193.1|  hypothetical protein SORBIDRAFT_01g041425          405   7e-124   Sorghum bicolor [broomcorn]
gb|ABE77201.1|  unknown                                                 404   2e-123   Sorghum bicolor [broomcorn]
ref|NP_001169354.1|  uncharacterized protein LOC100383221               385   3e-120   Zea mays [maize]
ref|XP_008387567.1|  PREDICTED: TSL-kinase interacting protein 1-...    311   2e-94    
emb|CDY18470.1|  BnaA04g21170D                                          226   1e-63    
ref|XP_010929796.1|  PREDICTED: TSL-kinase interacting protein 1-...    231   9e-63    
ref|XP_010929794.1|  PREDICTED: TSL-kinase interacting protein 1-...    231   1e-62    
ref|XP_010261014.1|  PREDICTED: TSL-kinase interacting protein 1-...    231   1e-62    
ref|XP_010929795.1|  PREDICTED: TSL-kinase interacting protein 1-...    229   5e-62    
ref|XP_010925333.1|  PREDICTED: TSL-kinase interacting protein 1        228   2e-61    
ref|XP_010268735.1|  PREDICTED: TSL-kinase interacting protein 1-...    219   1e-58    
ref|XP_008794942.1|  PREDICTED: TSL-kinase interacting protein 1-...    219   2e-58    
ref|XP_008359658.1|  PREDICTED: TSL-kinase interacting protein 1-...    206   3e-58    
ref|XP_008786422.1|  PREDICTED: TSL-kinase interacting protein 1 ...    210   1e-55    
ref|XP_008786456.1|  PREDICTED: TSL-kinase interacting protein 1 ...    209   2e-55    
gb|ABR18267.1|  unknown                                                 199   2e-55    Picea sitchensis
emb|CDY66143.1|  BnaAnng21650D                                          195   9e-52    
ref|NP_001051415.1|  Os03g0773100                                       187   5e-51    Oryza sativa Japonica Group [Japonica rice]
ref|XP_004968436.1|  PREDICTED: TSL-kinase interacting protein 1-...    197   6e-51    
ref|XP_003564346.1|  PREDICTED: TSL-kinase interacting protein 1        195   2e-50    
ref|XP_009388542.1|  PREDICTED: TSL-kinase interacting protein 1-...    190   6e-50    
ref|XP_007048175.1|  N-terminal nucleophile aminohydrolases super...    194   1e-49    
gb|KHN34026.1|  TSL-kinase interacting protein 1                        192   3e-49    
ref|XP_006580315.1|  PREDICTED: TSL-kinase interacting protein 1-...    192   3e-49    
emb|CDM81780.1|  unnamed protein product                                192   5e-49    
emb|CDJ26673.1|  unnamed protein product                                189   4e-48    
gb|EMS59913.1|  hypothetical protein TRIUR3_34375                       191   8e-48    
ref|XP_002306364.1|  hypothetical protein POPTR_0005s08900g             186   1e-47    Populus trichocarpa [western balsam poplar]
emb|CDP19449.1|  unnamed protein product                                183   1e-47    
ref|XP_004968437.1|  PREDICTED: TSL-kinase interacting protein 1-...    186   2e-47    
gb|EEC70059.1|  hypothetical protein OsI_00661                          187   2e-47    Oryza sativa Indica Group [Indian rice]
ref|NP_001042218.2|  Os01g0182400                                       187   3e-47    Oryza sativa Japonica Group [Japonica rice]
gb|EEE53998.1|  hypothetical protein OsJ_00639                          186   8e-47    Oryza sativa Japonica Group [Japonica rice]
gb|EMT18634.1|  hypothetical protein F775_12182                         186   1e-46    
ref|XP_006643835.1|  PREDICTED: TSL-kinase interacting protein 1-...    180   4e-46    
ref|XP_002310046.2|  hypothetical protein POPTR_0007s06970g             180   1e-45    Populus trichocarpa [western balsam poplar]
ref|XP_007159787.1|  hypothetical protein PHAVU_002G267200g             181   2e-45    
ref|XP_011021967.1|  PREDICTED: TSL-kinase interacting protein 1-...    179   3e-45    
ref|XP_010027744.1|  PREDICTED: TSL-kinase interacting protein 1        181   3e-45    
ref|NP_001060378.1|  Os07g0634100                                       179   4e-45    Oryza sativa Japonica Group [Japonica rice]
dbj|BAK04474.1|  predicted protein                                      180   5e-45    
ref|XP_003532854.1|  PREDICTED: TSL-kinase interacting protein 1-...    179   1e-44    
gb|EAZ04820.1|  hypothetical protein OsI_26998                          176   2e-44    Oryza sativa Indica Group [Indian rice]
ref|XP_010096476.1|  hypothetical protein L484_006723                   178   3e-44    
ref|XP_002455055.1|  hypothetical protein SORBIDRAFT_03g003670          177   3e-44    Sorghum bicolor [broomcorn]
ref|NP_001145214.1|  uncharacterized protein LOC100278472               177   6e-44    Zea mays [maize]
gb|KHG25426.1|  TSL-kinase interacting 1 -like protein                  173   7e-44    
tpg|DAA53147.1|  TPA: hypothetical protein ZEAMMB73_791365              176   1e-43    
ref|XP_006427927.1|  hypothetical protein CICLE_v10025563mg             174   2e-43    
ref|XP_004503992.1|  PREDICTED: TSL-kinase interacting protein 1-...    175   4e-43    
ref|XP_006427928.1|  hypothetical protein CICLE_v10025563mg             173   1e-42    
gb|EMS50457.1|  hypothetical protein TRIUR3_05392                       173   2e-42    
ref|XP_008672649.1|  PREDICTED: uncharacterized protein LOC100278...    172   2e-42    
gb|AFK47950.1|  unknown                                                 172   3e-42    
ref|XP_002970087.1|  hypothetical protein SELMODRAFT_410828             171   3e-41    
ref|XP_002985278.1|  hypothetical protein SELMODRAFT_424296             170   5e-41    
ref|XP_002275388.2|  PREDICTED: TSL-kinase interacting protein 1 ...    170   1e-40    Vitis vinifera
ref|XP_010652887.1|  PREDICTED: TSL-kinase interacting protein 1 ...    169   1e-40    
ref|XP_008440116.1|  PREDICTED: TSL-kinase interacting protein 1 ...    165   7e-40    
emb|CAN64858.1|  hypothetical protein VITISV_030493                     165   3e-39    Vitis vinifera
ref|XP_011025644.1|  PREDICTED: LOW QUALITY PROTEIN: TSL-kinase i...    161   4e-39    
ref|XP_008440117.1|  PREDICTED: TSL-kinase interacting protein 1 ...    160   8e-39    
ref|XP_008440095.1|  PREDICTED: TSL-kinase interacting protein 1 ...    160   3e-38    
gb|KCW54332.1|  hypothetical protein EUGRSUZ_I00296                     159   3e-38    
ref|XP_003630143.1|  TSL-kinase interacting protein                     160   2e-37    
ref|XP_007207640.1|  hypothetical protein PRUPE_ppa020776mg             158   2e-37    
ref|XP_002533886.1|  conserved hypothetical protein                     154   5e-37    Ricinus communis
ref|XP_004503995.1|  PREDICTED: TSL-kinase interacting protein 1-...    155   1e-36    
gb|KGN48412.1|  hypothetical protein Csa_6G486850                       154   2e-36    
ref|NP_195648.1|  uncharacterized protein                               150   1e-34    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010526627.1|  PREDICTED: TSL-kinase interacting protein 1 ...    148   7e-34    
ref|NP_001190966.1|  uncharacterized protein                            147   9e-34    
ref|XP_010526629.1|  PREDICTED: TSL-kinase interacting protein 1 ...    147   9e-34    
ref|XP_010437057.1|  PREDICTED: TSL-kinase interacting protein 1        145   3e-33    
tpg|DAA44326.1|  TPA: hypothetical protein ZEAMMB73_008667              140   9e-33    
ref|XP_008392022.1|  PREDICTED: TSL-kinase interacting protein 1 ...    143   1e-32    
ref|XP_008351519.1|  PREDICTED: TSL-kinase interacting protein 1-...    143   2e-32    
ref|XP_004288089.1|  PREDICTED: uncharacterized protein LOC101311903    143   2e-32    
ref|XP_002868902.1|  hypothetical protein ARALYDRAFT_490714             143   2e-32    
ref|XP_008392019.1|  PREDICTED: TSL-kinase interacting protein 1 ...    143   2e-32    
ref|XP_010446477.1|  PREDICTED: TSL-kinase interacting protein 1-...    143   3e-32    
ref|XP_010446476.1|  PREDICTED: TSL-kinase interacting protein 1-...    143   3e-32    
ref|XP_011100920.1|  PREDICTED: TSL-kinase interacting protein 1 ...    142   3e-32    
ref|XP_010446478.1|  PREDICTED: TSL-kinase interacting protein 1-...    142   3e-32    
ref|XP_011100921.1|  PREDICTED: TSL-kinase interacting protein 1 ...    141   4e-32    
ref|XP_011100918.1|  PREDICTED: TSL-kinase interacting protein 1 ...    141   7e-32    
ref|XP_006357346.1|  PREDICTED: uncharacterized protein LOC102603...    141   8e-32    
tpg|DAA51642.1|  TPA: putative MYB DNA-binding domain superfamily...    136   3e-31    
ref|XP_009623564.1|  PREDICTED: TSL-kinase interacting protein 1        139   9e-31    
ref|XP_010431906.1|  PREDICTED: TSL-kinase interacting protein 1-...    138   9e-31    
tpg|DAA51643.1|  TPA: putative MYB DNA-binding domain superfamily...    137   1e-30    
ref|XP_009109472.1|  PREDICTED: uncharacterized protein LOC103835124    137   2e-30    
emb|CDX90330.1|  BnaA08g16540D                                          137   2e-30    
ref|XP_008232546.1|  PREDICTED: TSL-kinase interacting protein 1-...    129   3e-30    
ref|XP_009785146.1|  PREDICTED: uncharacterized protein LOC104233448    132   4e-30    
ref|XP_010319799.1|  PREDICTED: uncharacterized protein LOC101262...    136   4e-30    
emb|CDY12141.1|  BnaC03g60570D                                          136   5e-30    
ref|XP_010680320.1|  PREDICTED: TSL-kinase interacting protein 1        135   6e-30    
ref|XP_004237480.1|  PREDICTED: uncharacterized protein LOC101262...    135   7e-30    
gb|KDP35287.1|  hypothetical protein JCGZ_09446                         132   3e-29    
gb|EYU24059.1|  hypothetical protein MIMGU_mgv1a026856mg                132   5e-29    
emb|CDP12865.1|  unnamed protein product                                133   5e-29    
ref|XP_006411741.1|  hypothetical protein EUTSA_v10024889mg             132   6e-29    
ref|XP_006283503.1|  hypothetical protein CARUB_v10004555mg             129   5e-28    
ref|XP_009772002.1|  PREDICTED: TSL-kinase interacting protein 1-...    127   2e-27    
ref|XP_004157878.1|  PREDICTED: TSL-kinase interacting protein 1-...    124   5e-27    
ref|XP_010652888.1|  PREDICTED: TSL-kinase interacting protein 1 ...    115   2e-23    
ref|XP_004142043.1|  PREDICTED: TSL-kinase interacting protein 1-...    104   3e-21    
ref|XP_002501770.1|  predicted protein                                  107   2e-20    Micromonas commoda
ref|XP_003058530.1|  predicted protein                                75.9    2e-10    
gb|KDO57107.1|  hypothetical protein CISIN_1g040686mg                 66.6    3e-08    
emb|CEG01572.1|  unnamed product                                      60.8    4e-06    
ref|XP_003080903.1|  unnamed protein product                          60.8    5e-06    
gb|AFP49344.1|  TSL-kinase interacting protein 1-like protein         55.5    9e-06    
ref|XP_001631610.1|  predicted protein                                59.7    2e-05    Nematostella vectensis
ref|XP_010872237.1|  PREDICTED: protein cramped-like isoform X2       58.2    5e-05    
ref|XP_010872236.1|  PREDICTED: protein cramped-like isoform X1       58.2    5e-05    
ref|XP_002112544.1|  hypothetical protein TRIADDRAFT_56673            57.4    8e-05    Trichoplax adhaerens
ref|XP_002985276.1|  hypothetical protein SELMODRAFT_424293           55.5    2e-04    
emb|CDQ66747.1|  unnamed protein product                              55.8    2e-04    
ref|XP_002734793.1|  PREDICTED: protein cramped-like                  55.8    2e-04    Saccoglossus kowalevskii
ref|XP_003724342.1|  PREDICTED: protein cramped-like                  55.8    3e-04    
emb|CDQ72273.1|  unnamed protein product                              54.7    4e-04    
ref|XP_004918071.1|  PREDICTED: protein cramped-like isoform X2       55.1    4e-04    
ref|XP_004918072.1|  PREDICTED: protein cramped-like isoform X3       55.1    4e-04    
ref|XP_002932497.2|  PREDICTED: protein cramped-like isoform X1       55.1    4e-04    
ref|XP_008327995.1|  PREDICTED: protein cramped-like isoform X2       54.7    5e-04    
ref|XP_008327994.1|  PREDICTED: protein cramped-like isoform X1       54.7    5e-04    
ref|XP_010743395.1|  PREDICTED: protein cramped-like isoform X1       54.7    5e-04    
ref|XP_010743396.1|  PREDICTED: protein cramped-like isoform X2       54.7    5e-04    
ref|XP_008414815.1|  PREDICTED: protein cramped-like isoform X2       54.7    5e-04    
ref|XP_005468377.1|  PREDICTED: protein cramped-like isoform X2       54.7    5e-04    
ref|XP_008414814.1|  PREDICTED: protein cramped-like isoform X1       54.7    5e-04    
ref|XP_003964514.1|  PREDICTED: LOW QUALITY PROTEIN: protein cram...  54.7    5e-04    
ref|XP_004071777.1|  PREDICTED: protein cramped-like                  54.7    5e-04    
ref|XP_007562895.1|  PREDICTED: protein cramped-like isoform X2       54.7    5e-04    
ref|XP_007562894.1|  PREDICTED: protein cramped-like isoform X1       54.7    6e-04    
ref|XP_005750101.1|  PREDICTED: protein cramped-like isoform X2       54.7    6e-04    
gb|KDR16416.1|  Protein cramped                                       54.3    6e-04    
ref|XP_003454061.2|  PREDICTED: protein cramped-like isoform X1       54.7    6e-04    
ref|XP_007256365.1|  PREDICTED: protein cramped-like isoform X1       54.7    6e-04    
ref|XP_006809224.1|  PREDICTED: protein cramped-like                  54.7    6e-04    
ref|XP_007256366.1|  PREDICTED: protein cramped-like isoform X2       54.7    6e-04    
ref|XP_005750100.1|  PREDICTED: protein cramped-like isoform X1       54.7    6e-04    
ref|XP_008303459.1|  PREDICTED: protein cramped-like                  54.7    6e-04    
ref|XP_005940837.1|  PREDICTED: protein cramped-like isoform X2       54.7    6e-04    
ref|XP_005163896.1|  PREDICTED: protein cramped-like isoform X2       54.7    6e-04    
ref|XP_003198126.2|  PREDICTED: protein cramped-like isoform X1       54.3    6e-04    
ref|XP_005940836.1|  PREDICTED: protein cramped-like isoform X1       54.3    6e-04    
ref|XP_004093082.1|  PREDICTED: LOW QUALITY PROTEIN: protein cram...  54.3    7e-04    
ref|XP_010766314.1|  PREDICTED: protein cramped-like                  53.5    7e-04    
ref|XP_006637082.1|  PREDICTED: protein cramped-like                  53.9    8e-04    
ref|XP_007903096.1|  PREDICTED: protein cramped-like                  53.9    0.001    



>ref|XP_009802692.1| PREDICTED: TSL-kinase interacting protein 1 isoform X4 [Nicotiana 
sylvestris]
 ref|XP_009802693.1| PREDICTED: TSL-kinase interacting protein 1 isoform X4 [Nicotiana 
sylvestris]
 ref|XP_009802694.1| PREDICTED: TSL-kinase interacting protein 1 isoform X4 [Nicotiana 
sylvestris]
 ref|XP_009802695.1| PREDICTED: TSL-kinase interacting protein 1 isoform X4 [Nicotiana 
sylvestris]
 ref|XP_009802696.1| PREDICTED: TSL-kinase interacting protein 1 isoform X4 [Nicotiana 
sylvestris]
 ref|XP_009802697.1| PREDICTED: TSL-kinase interacting protein 1 isoform X4 [Nicotiana 
sylvestris]
Length=821

 Score =   912 bits (2358),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 488/813 (60%), Positives = 587/813 (72%), Gaps = 41/813 (5%)
 Frame = +1

Query  211   IQMELQLTLGSEADHYLRSSPRKDGDFTFGKVNCVEQQIASSQEHAIPEQAMFSQDHSVT  390
             +QME Q++L  +   +  +   KDG     +     Q + +S++H   + ++   DH+VT
Sbjct  1     MQMEPQVSLECDRCLHPETLMCKDGVSDDTQHPAAAQPVITSEDHPAAQLSVLIYDHAVT  60

Query  391   EQLASFEEHSALQQPVKRQTRKWAAWTREEEESFFSALRHVGKNFEKITSRVQSKNKDQV  570
             +Q++  ++   LQ+P KRQTR+WAAWTR+EEESFFSALR VGKNFEKITSRVQSKNKDQV
Sbjct  61    QQVSLSQDQVMLQKPAKRQTRQWAAWTRQEEESFFSALRQVGKNFEKITSRVQSKNKDQV  120

Query  571   RHYYYRLVRRMNKLLGPELCLNAKNSRDTNAAMLRWWSLLEKYSCKASKLHLKPRRFKIF  750
             RHYYYRLVRRMNKLLGPEL L+AKNS+DTNAAMLRWWSLLEK SCKASKLHLKPRRFKIF
Sbjct  121   RHYYYRLVRRMNKLLGPELSLDAKNSKDTNAAMLRWWSLLEKSSCKASKLHLKPRRFKIF  180

Query  751   IETLENQLLKDRKKNVRRCFSQGENTSTAPISVSNQGRGASGHDGRSVKVVLLDNQDIHK  930
             IETLE+QLLKDRKKNVRR  SQGE++STA  S+S+  R  S +D R+VKVVLLDNQD+ K
Sbjct  181   IETLESQLLKDRKKNVRRRPSQGESSSTAAASLSSHSR-VSTNDSRTVKVVLLDNQDVQK  239

Query  931   FGSGKGSSLKRHINIGANSTSCKADSSLLKTARHRRKIG--ATAAYKRWEKAAIAGVSLV  1104
             FGSGKGSSLKRH+ +G N ++ K DSS +K ARHRRKIG  +TAAYKRWEKAAIAGVSLV
Sbjct  240   FGSGKGSSLKRHVTMGVNRSNTKVDSSPVKNARHRRKIGSVSTAAYKRWEKAAIAGVSLV  299

Query  1105  ADAAEHLERTTTDKEDGHFQDSNVRNVFEHSGKDPHVFPDLLHNSFNETNLQNSGKLKLQ  1284
             ADAAEHLER T DK+ G  Q+S   N FEH GKD    P L  N  NETNLQ+  KLKLQ
Sbjct  300   ADAAEHLERATIDKDVGLVQNSQGINGFEHVGKDVPSLPTLSQNLLNETNLQSCMKLKLQ  359

Query  1285  LFPVDDGTRRALELDNHNPYLELTLSTRKKMSSVLEHLNRKWGNSSMACGDLMLFPYHLH  1464
             LFPVD+GTRRALE+DNHNPYLELTLS RKKMSS+LEHLNRKWG+SS+A G L+LFPYH+ 
Sbjct  360   LFPVDEGTRRALEMDNHNPYLELTLSNRKKMSSILEHLNRKWGSSSIATGKLVLFPYHVQ  419

Query  1465  KENLVHFQKWTKDTTLTAADVYALTGSPPVFRLRYGWFSNAEVA-FRAPVSSAIPSRHDA  1641
              ENLV   +WTKDTTL+AADVY L GSPPVFRLRYGWF N+E+  F+AP+SS  P   + 
Sbjct  420   MENLVQSLRWTKDTTLSAADVYNLIGSPPVFRLRYGWFPNSELGTFQAPLSSTTPFTQNT  479

Query  1642  NMNIMPESSVGVL-----------------------QAPSTDPPKEAN--GCVSMNTVNA  1746
             N NI  E +  VL                        + ST+   E+N    + +NT N 
Sbjct  480   NTNITEEKNEEVLASSHGKLVRFSKEPLVSNPRMTVTSSSTELSGESNLQATMGVNTYN-  538

Query  1747  SRSSDHTEAVLWENPE--TVVTEAEVD--DLQFNKAGTSCVGEWADSLTNISVGDLLSEA  1914
                SDH E +L    +   + TE +V+  D+Q +K      G+W DSLTNISVGDLLS+A
Sbjct  539   ---SDHNETLLMHRRDNGAITTEKQVEMHDMQGSKNSALSAGDWEDSLTNISVGDLLSDA  595

Query  1915  PDMEDANCITSSIHSSSNYIHQIPFSCDSFDAAIAAHIKKHQNVTDSQAALPSQLSSIWG  2094
             PD E+ +CI S++  SS+++ Q+PFSCDSFDAAIAAHI KHQ+  +SQ ALP Q SSIW 
Sbjct  596   PDDEETDCIESTLPGSSHFLQQMPFSCDSFDAAIAAHIYKHQSKAESQMALPPQASSIWN  655

Query  2095  AEDTCDAFAFQRH-SLSEKVQNASKHTSLETCKQITLANTTALGASVEDLPGARNPVDGD  2271
             AEDTCDAFAFQ+  +      N+S +   E  + I+ +++  L A V+DLPG   P+  +
Sbjct  656   AEDTCDAFAFQKDVAFRRTANNSSSNVGAENRQHISQSSSLLLDAGVKDLPGKMEPLTDE  715

Query  2272  AATAD-LESVHYSPTSDVVKDFNGLSDVYWPDSLGPLDLDIPSSRYHSE-LILSD-SLGG  2442
              A  D ++  H        KD +GLSD+YWPDSLGPL+LD PS RYHSE LILSD SLGG
Sbjct  716   LAHEDPVDECHAQALGGSTKDLSGLSDIYWPDSLGPLELDAPSCRYHSEDLILSDNSLGG  775

Query  2443  LTQLIASSLDAFQNCSFFGADKKEPVSTTEAQE  2541
             L +LIASSLDAFQNCSFFG DKKEP ST EA E
Sbjct  776   LNRLIASSLDAFQNCSFFGLDKKEPGSTVEAVE  808



>ref|XP_009802688.1| PREDICTED: TSL-kinase interacting protein 1 isoform X1 [Nicotiana 
sylvestris]
Length=845

 Score =   912 bits (2356),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 488/813 (60%), Positives = 587/813 (72%), Gaps = 41/813 (5%)
 Frame = +1

Query  211   IQMELQLTLGSEADHYLRSSPRKDGDFTFGKVNCVEQQIASSQEHAIPEQAMFSQDHSVT  390
             +QME Q++L  +   +  +   KDG     +     Q + +S++H   + ++   DH+VT
Sbjct  25    MQMEPQVSLECDRCLHPETLMCKDGVSDDTQHPAAAQPVITSEDHPAAQLSVLIYDHAVT  84

Query  391   EQLASFEEHSALQQPVKRQTRKWAAWTREEEESFFSALRHVGKNFEKITSRVQSKNKDQV  570
             +Q++  ++   LQ+P KRQTR+WAAWTR+EEESFFSALR VGKNFEKITSRVQSKNKDQV
Sbjct  85    QQVSLSQDQVMLQKPAKRQTRQWAAWTRQEEESFFSALRQVGKNFEKITSRVQSKNKDQV  144

Query  571   RHYYYRLVRRMNKLLGPELCLNAKNSRDTNAAMLRWWSLLEKYSCKASKLHLKPRRFKIF  750
             RHYYYRLVRRMNKLLGPEL L+AKNS+DTNAAMLRWWSLLEK SCKASKLHLKPRRFKIF
Sbjct  145   RHYYYRLVRRMNKLLGPELSLDAKNSKDTNAAMLRWWSLLEKSSCKASKLHLKPRRFKIF  204

Query  751   IETLENQLLKDRKKNVRRCFSQGENTSTAPISVSNQGRGASGHDGRSVKVVLLDNQDIHK  930
             IETLE+QLLKDRKKNVRR  SQGE++STA  S+S+  R  S +D R+VKVVLLDNQD+ K
Sbjct  205   IETLESQLLKDRKKNVRRRPSQGESSSTAAASLSSHSR-VSTNDSRTVKVVLLDNQDVQK  263

Query  931   FGSGKGSSLKRHINIGANSTSCKADSSLLKTARHRRKIG--ATAAYKRWEKAAIAGVSLV  1104
             FGSGKGSSLKRH+ +G N ++ K DSS +K ARHRRKIG  +TAAYKRWEKAAIAGVSLV
Sbjct  264   FGSGKGSSLKRHVTMGVNRSNTKVDSSPVKNARHRRKIGSVSTAAYKRWEKAAIAGVSLV  323

Query  1105  ADAAEHLERTTTDKEDGHFQDSNVRNVFEHSGKDPHVFPDLLHNSFNETNLQNSGKLKLQ  1284
             ADAAEHLER T DK+ G  Q+S   N FEH GKD    P L  N  NETNLQ+  KLKLQ
Sbjct  324   ADAAEHLERATIDKDVGLVQNSQGINGFEHVGKDVPSLPTLSQNLLNETNLQSCMKLKLQ  383

Query  1285  LFPVDDGTRRALELDNHNPYLELTLSTRKKMSSVLEHLNRKWGNSSMACGDLMLFPYHLH  1464
             LFPVD+GTRRALE+DNHNPYLELTLS RKKMSS+LEHLNRKWG+SS+A G L+LFPYH+ 
Sbjct  384   LFPVDEGTRRALEMDNHNPYLELTLSNRKKMSSILEHLNRKWGSSSIATGKLVLFPYHVQ  443

Query  1465  KENLVHFQKWTKDTTLTAADVYALTGSPPVFRLRYGWFSNAEVA-FRAPVSSAIPSRHDA  1641
              ENLV   +WTKDTTL+AADVY L GSPPVFRLRYGWF N+E+  F+AP+SS  P   + 
Sbjct  444   MENLVQSLRWTKDTTLSAADVYNLIGSPPVFRLRYGWFPNSELGTFQAPLSSTTPFTQNT  503

Query  1642  NMNIMPESSVGVL-----------------------QAPSTDPPKEAN--GCVSMNTVNA  1746
             N NI  E +  VL                        + ST+   E+N    + +NT N 
Sbjct  504   NTNITEEKNEEVLASSHGKLVRFSKEPLVSNPRMTVTSSSTELSGESNLQATMGVNTYN-  562

Query  1747  SRSSDHTEAVLWENPE--TVVTEAEVD--DLQFNKAGTSCVGEWADSLTNISVGDLLSEA  1914
                SDH E +L    +   + TE +V+  D+Q +K      G+W DSLTNISVGDLLS+A
Sbjct  563   ---SDHNETLLMHRRDNGAITTEKQVEMHDMQGSKNSALSAGDWEDSLTNISVGDLLSDA  619

Query  1915  PDMEDANCITSSIHSSSNYIHQIPFSCDSFDAAIAAHIKKHQNVTDSQAALPSQLSSIWG  2094
             PD E+ +CI S++  SS+++ Q+PFSCDSFDAAIAAHI KHQ+  +SQ ALP Q SSIW 
Sbjct  620   PDDEETDCIESTLPGSSHFLQQMPFSCDSFDAAIAAHIYKHQSKAESQMALPPQASSIWN  679

Query  2095  AEDTCDAFAFQRH-SLSEKVQNASKHTSLETCKQITLANTTALGASVEDLPGARNPVDGD  2271
             AEDTCDAFAFQ+  +      N+S +   E  + I+ +++  L A V+DLPG   P+  +
Sbjct  680   AEDTCDAFAFQKDVAFRRTANNSSSNVGAENRQHISQSSSLLLDAGVKDLPGKMEPLTDE  739

Query  2272  AATAD-LESVHYSPTSDVVKDFNGLSDVYWPDSLGPLDLDIPSSRYHSE-LILSD-SLGG  2442
              A  D ++  H        KD +GLSD+YWPDSLGPL+LD PS RYHSE LILSD SLGG
Sbjct  740   LAHEDPVDECHAQALGGSTKDLSGLSDIYWPDSLGPLELDAPSCRYHSEDLILSDNSLGG  799

Query  2443  LTQLIASSLDAFQNCSFFGADKKEPVSTTEAQE  2541
             L +LIASSLDAFQNCSFFG DKKEP ST EA E
Sbjct  800   LNRLIASSLDAFQNCSFFGLDKKEPGSTVEAVE  832



>ref|XP_009802690.1| PREDICTED: TSL-kinase interacting protein 1 isoform X2 [Nicotiana 
sylvestris]
Length=841

 Score =   907 bits (2345),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 487/811 (60%), Positives = 586/811 (72%), Gaps = 41/811 (5%)
 Frame = +1

Query  211   IQMELQLTLGSEADHYLRSSPRKDGDFTFGKVNCVEQQIASSQEHAIPEQAMFSQDHSVT  390
             +QME Q++L  +   +  +   KDG     +     Q + +S++H   + ++   DH+VT
Sbjct  25    MQMEPQVSLECDRCLHPETLMCKDGVSDDTQHPAAAQPVITSEDHPAAQLSVLIYDHAVT  84

Query  391   EQLASFEEHSALQQPVKRQTRKWAAWTREEEESFFSALRHVGKNFEKITSRVQSKNKDQV  570
             +Q++  ++   LQ+P KRQTR+WAAWTR+EEESFFSALR VGKNFEKITSRVQSKNKDQV
Sbjct  85    QQVSLSQDQVMLQKPAKRQTRQWAAWTRQEEESFFSALRQVGKNFEKITSRVQSKNKDQV  144

Query  571   RHYYYRLVRRMNKLLGPELCLNAKNSRDTNAAMLRWWSLLEKYSCKASKLHLKPRRFKIF  750
             RHYYYRLVRRMNKLLGPEL L+AKNS+DTNAAMLRWWSLLEK SCKASKLHLKPRRFKIF
Sbjct  145   RHYYYRLVRRMNKLLGPELSLDAKNSKDTNAAMLRWWSLLEKSSCKASKLHLKPRRFKIF  204

Query  751   IETLENQLLKDRKKNVRRCFSQGENTSTAPISVSNQGRGASGHDGRSVKVVLLDNQDIHK  930
             IETLE+QLLKDRKKNVRR  SQGE++STA  S+S+  R  S +D R+VKVVLLDNQD+ K
Sbjct  205   IETLESQLLKDRKKNVRRRPSQGESSSTAAASLSSHSR-VSTNDSRTVKVVLLDNQDVQK  263

Query  931   FGSGKGSSLKRHINIGANSTSCKADSSLLKTARHRRKIG--ATAAYKRWEKAAIAGVSLV  1104
             FGSGKGSSLKRH+ +G N ++ K DSS +K ARHRRKIG  +TAAYKRWEKAAIAGVSLV
Sbjct  264   FGSGKGSSLKRHVTMGVNRSNTKVDSSPVKNARHRRKIGSVSTAAYKRWEKAAIAGVSLV  323

Query  1105  ADAAEHLERTTTDKEDGHFQDSNVRNVFEHSGKDPHVFPDLLHNSFNETNLQNSGKLKLQ  1284
             ADAAEHLER T DK+ G  Q+S   N FEH GKD    P L  N  NETNLQ+  KLKLQ
Sbjct  324   ADAAEHLERATIDKDVGLVQNSQGINGFEHVGKDVPSLPTLSQNLLNETNLQSCMKLKLQ  383

Query  1285  LFPVDDGTRRALELDNHNPYLELTLSTRKKMSSVLEHLNRKWGNSSMACGDLMLFPYHLH  1464
             LFPVD+GTRRALE+DNHNPYLELTLS RKKMSS+LEHLNRKWG+SS+A G L+LFPYH+ 
Sbjct  384   LFPVDEGTRRALEMDNHNPYLELTLSNRKKMSSILEHLNRKWGSSSIATGKLVLFPYHVQ  443

Query  1465  KENLVHFQKWTKDTTLTAADVYALTGSPPVFRLRYGWFSNAEVA-FRAPVSSAIPSRHDA  1641
              ENLV   +WTKDTTL+AADVY L GSPPVFRLRYGWF N+E+  F+AP+SS  P   + 
Sbjct  444   MENLVQSLRWTKDTTLSAADVYNLIGSPPVFRLRYGWFPNSELGTFQAPLSSTTPFTQNT  503

Query  1642  NMNIMPESSVGVL-----------------------QAPSTDPPKEAN--GCVSMNTVNA  1746
             N NI  E +  VL                        + ST+   E+N    + +NT N 
Sbjct  504   NTNITEEKNEEVLASSHGKLVRFSKEPLVSNPRMTVTSSSTELSGESNLQATMGVNTYN-  562

Query  1747  SRSSDHTEAVLWENPE--TVVTEAEVDDLQFNKAGTSCVGEWADSLTNISVGDLLSEAPD  1920
                SDH E +L    +   + TE +V+    N A ++  G+W DSLTNISVGDLLS+APD
Sbjct  563   ---SDHNETLLMHRRDNGAITTEKQVEMGSKNSALSA--GDWEDSLTNISVGDLLSDAPD  617

Query  1921  MEDANCITSSIHSSSNYIHQIPFSCDSFDAAIAAHIKKHQNVTDSQAALPSQLSSIWGAE  2100
              E+ +CI S++  SS+++ Q+PFSCDSFDAAIAAHI KHQ+  +SQ ALP Q SSIW AE
Sbjct  618   DEETDCIESTLPGSSHFLQQMPFSCDSFDAAIAAHIYKHQSKAESQMALPPQASSIWNAE  677

Query  2101  DTCDAFAFQRH-SLSEKVQNASKHTSLETCKQITLANTTALGASVEDLPGARNPVDGDAA  2277
             DTCDAFAFQ+  +      N+S +   E  + I+ +++  L A V+DLPG   P+  + A
Sbjct  678   DTCDAFAFQKDVAFRRTANNSSSNVGAENRQHISQSSSLLLDAGVKDLPGKMEPLTDELA  737

Query  2278  TAD-LESVHYSPTSDVVKDFNGLSDVYWPDSLGPLDLDIPSSRYHSE-LILSD-SLGGLT  2448
               D ++  H        KD +GLSD+YWPDSLGPL+LD PS RYHSE LILSD SLGGL 
Sbjct  738   HEDPVDECHAQALGGSTKDLSGLSDIYWPDSLGPLELDAPSCRYHSEDLILSDNSLGGLN  797

Query  2449  QLIASSLDAFQNCSFFGADKKEPVSTTEAQE  2541
             +LIASSLDAFQNCSFFG DKKEP ST EA E
Sbjct  798   RLIASSLDAFQNCSFFGLDKKEPGSTVEAVE  828



>ref|XP_009610182.1| PREDICTED: TSL-kinase interacting protein 1 isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009610183.1| PREDICTED: TSL-kinase interacting protein 1 isoform X1 [Nicotiana 
tomentosiformis]
Length=823

 Score =   902 bits (2330),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 488/815 (60%), Positives = 584/815 (72%), Gaps = 43/815 (5%)
 Frame = +1

Query  211   IQMELQLTLGSEADHYLRSSPRKDGDFTFGKVNCVEQQIASSQEHAIPEQAMFSQDHSVT  390
             +QME Q+ L  +   +  +   KDG     +     Q +  S++H + + ++ + DH+VT
Sbjct  1     MQMEPQVALECDRCLHPETLMCKDGVSDVTQHPAAAQPVIPSEDHPVSQLSVPTHDHAVT  60

Query  391   EQLASFEEHSALQQPVKRQTRKWAAWTREEEESFFSALRHVGKNFEKITSRVQSKNKDQV  570
             +Q++S ++   LQ+P KRQTR+WAAWTR+EEESFFSALR VGKNFEKITSRVQSKNKDQV
Sbjct  61    QQVSSSQDRVTLQKPAKRQTRQWAAWTRQEEESFFSALRQVGKNFEKITSRVQSKNKDQV  120

Query  571   RHYYYRLVRRMNKLLGPELCLNAKNSRDTNAAMLRWWSLLEKYSCKASKLHLKPRRFKIF  750
             RHYYYRLVRRMNKLLGPELCL+AKNS+DTNAAMLRWWSLLEK SCKASKLHLKPRRFKIF
Sbjct  121   RHYYYRLVRRMNKLLGPELCLDAKNSKDTNAAMLRWWSLLEKSSCKASKLHLKPRRFKIF  180

Query  751   IETLENQLLKDRKKNVRRCFSQGENTSTAPISVSNQGRGASGHDGRSVKVVLLDNQDIHK  930
             IETLE+QLLKDRKKNVRR  SQGE++STA  S+S+  R  S +D R+VKVVLLD+Q I K
Sbjct  181   IETLESQLLKDRKKNVRRRPSQGESSSTAAASLSSHSR-VSTNDSRTVKVVLLDDQGIQK  239

Query  931   FGSGKGSSLKRHINIGANSTSCKADSSLLKTARHRRKIGAT--AAYKRWEKAAIAGVSLV  1104
             FGSGKGSSLKRH+ +G N ++ K DSS +K ARHRRKIG+   AAYKRWEKAAIAGVSLV
Sbjct  240   FGSGKGSSLKRHVTMGVNRSNAKVDSSPVKNARHRRKIGSVSAAAYKRWEKAAIAGVSLV  299

Query  1105  ADAAEHLERTTTDKEDGHFQDSNVRNVFEHSGKDPHVFPDLLHNSFNETNLQNSGKLKLQ  1284
             ADAAEHLER T  K+    Q+S   N FEH GKD H    L  N  NETNLQ+  KLKLQ
Sbjct  300   ADAAEHLERATIGKDVELVQNSQGINGFEHVGKDVHSLLTLSQNLLNETNLQSCMKLKLQ  359

Query  1285  LFPVDDGTRRALELDNHNPYLELTLSTRKKMSSVLEHLNRKWGNSSMACGDLMLFPYHLH  1464
             LFPVD+GTRRALE+DNHNPYLELTLS RKKMSSVLEHLNRKWG+SS+A G+L+LFPYH+ 
Sbjct  360   LFPVDEGTRRALEMDNHNPYLELTLSNRKKMSSVLEHLNRKWGSSSIATGELVLFPYHVQ  419

Query  1465  KENLVHFQKWTKDTTLTAADVYALTGSPPVFRLRYGWFSNAEVA-FRAPVSSAIPSRHDA  1641
              ENLV   +WTKDTTL+AADV  L GSPPVFRLRYGWF N+E+  F+AP+SS  P   + 
Sbjct  420   MENLVQSLRWTKDTTLSAADVNNLIGSPPVFRLRYGWFPNSELGTFQAPLSSTTPFTQNT  479

Query  1642  NMNIMPESSVGVL-----------------------QAPSTDPPKEANGCVSM--NTVNA  1746
             N NI  E +  +L                        + ST+   E+N   SM  NT N 
Sbjct  480   NTNITEEMNAEILASSHGKLVRFSKEPLVSNPRMTVTSSSTELSGESNLQASMGLNTYN-  538

Query  1747  SRSSDHTEAVLWENPE--TVVTEAEVD--DLQFNKAGTSCVGEWADSLTNISVGDLLSEA  1914
                SDH E +     E   + TE +V+  D+Q +K      G+W DSLTNISVGDLLS+A
Sbjct  539   ---SDHNETLPSHRREKGAITTEKQVEMHDMQGSKTSALSAGDWEDSLTNISVGDLLSDA  595

Query  1915  PDMEDANCITSSIHSSSNYIHQIPFSCDSFDAAIAAHIKKHQNVTDSQAALPSQLSSIWG  2094
             PD E+ +CI S++  SS+++ Q+PFSCDSFDAAIAAHI KHQ+  +SQ ALP Q SSIW 
Sbjct  596   PDDEETDCIESTLPGSSHFLQQMPFSCDSFDAAIAAHIYKHQSKAESQMALPPQASSIWN  655

Query  2095  AEDTCDAFAFQRHSLSE-KVQNASKHTSLETCKQITLANTTALGASVEDLPGARNPVDGD  2271
             AEDTCDAFAFQ+   S  K  N+S +   E C+ I+ +++  L A ++DLPG   P+  +
Sbjct  656   AEDTCDAFAFQKDVASRLKAHNSSSNVGAENCQHISQSSSLLLDAGIKDLPGKMEPITDE  715

Query  2272  AATADLESVHYSPTSDV---VKDFNGLSDVYWPDSLGPLDLDIPSSRYHSE-LILSD-SL  2436
              A  D      S    +    KD + LSD+YWPDSLGPL+LD PS RYHSE LILSD SL
Sbjct  716   PAHEDPVDECQSNAQALGGSTKDLSLLSDIYWPDSLGPLELDAPSCRYHSEDLILSDNSL  775

Query  2437  GGLTQLIASSLDAFQNCSFFGADKKEPVSTTEAQE  2541
             GGL +LIASSLDAFQNCSFFG DKKEP ST EA E
Sbjct  776   GGLNRLIASSLDAFQNCSFFGLDKKEPGSTVEAVE  810



>ref|XP_009802691.1| PREDICTED: TSL-kinase interacting protein 1 isoform X3 [Nicotiana 
sylvestris]
Length=834

 Score =   897 bits (2317),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 483/813 (59%), Positives = 580/813 (71%), Gaps = 52/813 (6%)
 Frame = +1

Query  211   IQMELQLTLGSEADHYLRSSPRKDGDFTFGKVNCVEQQIASSQEHAIPEQAMFSQDHSVT  390
             +QME Q++L  +   +  +   KDG     +     Q + +S++H   + ++   DH+VT
Sbjct  25    MQMEPQVSLECDRCLHPETLMCKDGVSDDTQHPAAAQPVITSEDHPAAQLSVLIYDHAVT  84

Query  391   EQLASFEEHSALQQPVKRQTRKWAAWTREEEESFFSALRHVGKNFEKITSRVQSKNKDQV  570
             +Q++  ++   LQ+P KRQTR+WAAWTR+EEESFFSALR VGKNFEKITSRVQSKNKDQV
Sbjct  85    QQVSLSQDQVMLQKPAKRQTRQWAAWTRQEEESFFSALRQVGKNFEKITSRVQSKNKDQV  144

Query  571   RHYYYRLVRRMNKLLGPELCLNAKNSRDTNAAMLRWWSLLEKYSCKASKLHLKPRRFKIF  750
             RHYYYRLVRRMNKLLGPEL L+AKNS+DTNAAMLRWWSLLEK SCKASKLHLKPRRFKIF
Sbjct  145   RHYYYRLVRRMNKLLGPELSLDAKNSKDTNAAMLRWWSLLEKSSCKASKLHLKPRRFKIF  204

Query  751   IETLENQLLKDRKKNVRRCFSQGENTSTAPISVSNQGRGASGHDGRSVKVVLLDNQDIHK  930
             IETLE+QLLKDRKKNVRR  SQGE++STA  S+S+  R  S +D R+VKVVLLDNQD+ K
Sbjct  205   IETLESQLLKDRKKNVRRRPSQGESSSTAAASLSSHSR-VSTNDSRTVKVVLLDNQDVQK  263

Query  931   FGSGKGSSLKRHINIGANSTSCKADSSLLKTARHRRKIG--ATAAYKRWEKAAIAGVSLV  1104
             FGSGKGSSLKRH+ +G N ++ K DSS +K ARHRRKIG  +TAAYKRWEKAAIAGVSLV
Sbjct  264   FGSGKGSSLKRHVTMGVNRSNTKVDSSPVKNARHRRKIGSVSTAAYKRWEKAAIAGVSLV  323

Query  1105  ADAAEHLERTTTDKEDGHFQDSNVRNVFEHSGKDPHVFPDLLHNSFNETNLQNSGKLKLQ  1284
             ADAAEHLER T              N FEH GKD    P L  N  NETNLQ+  KLKLQ
Sbjct  324   ADAAEHLERATIGI-----------NGFEHVGKDVPSLPTLSQNLLNETNLQSCMKLKLQ  372

Query  1285  LFPVDDGTRRALELDNHNPYLELTLSTRKKMSSVLEHLNRKWGNSSMACGDLMLFPYHLH  1464
             LFPVD+GTRRALE+DNHNPYLELTLS RKKMSS+LEHLNRKWG+SS+A G L+LFPYH+ 
Sbjct  373   LFPVDEGTRRALEMDNHNPYLELTLSNRKKMSSILEHLNRKWGSSSIATGKLVLFPYHVQ  432

Query  1465  KENLVHFQKWTKDTTLTAADVYALTGSPPVFRLRYGWFSNAEVA-FRAPVSSAIPSRHDA  1641
              ENLV   +WTKDTTL+AADVY L GSPPVFRLRYGWF N+E+  F+AP+SS  P   + 
Sbjct  433   MENLVQSLRWTKDTTLSAADVYNLIGSPPVFRLRYGWFPNSELGTFQAPLSSTTPFTQNT  492

Query  1642  NMNIMPESSVGVL-----------------------QAPSTDPPKEAN--GCVSMNTVNA  1746
             N NI  E +  VL                        + ST+   E+N    + +NT N 
Sbjct  493   NTNITEEKNEEVLASSHGKLVRFSKEPLVSNPRMTVTSSSTELSGESNLQATMGVNTYN-  551

Query  1747  SRSSDHTEAVLWENPE--TVVTEAEVD--DLQFNKAGTSCVGEWADSLTNISVGDLLSEA  1914
                SDH E +L    +   + TE +V+  D+Q +K      G+W DSLTNISVGDLLS+A
Sbjct  552   ---SDHNETLLMHRRDNGAITTEKQVEMHDMQGSKNSALSAGDWEDSLTNISVGDLLSDA  608

Query  1915  PDMEDANCITSSIHSSSNYIHQIPFSCDSFDAAIAAHIKKHQNVTDSQAALPSQLSSIWG  2094
             PD E+ +CI S++  SS+++ Q+PFSCDSFDAAIAAHI KHQ+  +SQ ALP Q SSIW 
Sbjct  609   PDDEETDCIESTLPGSSHFLQQMPFSCDSFDAAIAAHIYKHQSKAESQMALPPQASSIWN  668

Query  2095  AEDTCDAFAFQRH-SLSEKVQNASKHTSLETCKQITLANTTALGASVEDLPGARNPVDGD  2271
             AEDTCDAFAFQ+  +      N+S +   E  + I+ +++  L A V+DLPG   P+  +
Sbjct  669   AEDTCDAFAFQKDVAFRRTANNSSSNVGAENRQHISQSSSLLLDAGVKDLPGKMEPLTDE  728

Query  2272  AATAD-LESVHYSPTSDVVKDFNGLSDVYWPDSLGPLDLDIPSSRYHSE-LILSD-SLGG  2442
              A  D ++  H        KD +GLSD+YWPDSLGPL+LD PS RYHSE LILSD SLGG
Sbjct  729   LAHEDPVDECHAQALGGSTKDLSGLSDIYWPDSLGPLELDAPSCRYHSEDLILSDNSLGG  788

Query  2443  LTQLIASSLDAFQNCSFFGADKKEPVSTTEAQE  2541
             L +LIASSLDAFQNCSFFG DKKEP ST EA E
Sbjct  789   LNRLIASSLDAFQNCSFFGLDKKEPGSTVEAVE  821



>ref|XP_009610184.1| PREDICTED: TSL-kinase interacting protein 1 isoform X2 [Nicotiana 
tomentosiformis]
Length=819

 Score =   897 bits (2317),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 486/820 (59%), Positives = 581/820 (71%), Gaps = 57/820 (7%)
 Frame = +1

Query  211   IQMELQLTLGSEADHYLRSSPRKDGDFTFGKVNCVEQQIASSQEHAIPEQAMFSQDHSVT  390
             +QME Q+ L  +   +  +   KDG     +     Q +  S++H + + ++ + DH+VT
Sbjct  1     MQMEPQVALECDRCLHPETLMCKDGVSDVTQHPAAAQPVIPSEDHPVSQLSVPTHDHAVT  60

Query  391   EQLASFEEHSALQQPVKRQTRKWAAWTREEEESFFSALRHVGKNFEKITSRVQSKNKDQV  570
             +Q++S ++   LQ+P KRQTR+WAAWTR+EEESFFSALR VGKNFEKITSRVQSKNKDQV
Sbjct  61    QQVSSSQDRVTLQKPAKRQTRQWAAWTRQEEESFFSALRQVGKNFEKITSRVQSKNKDQV  120

Query  571   RHYYYRLVRRMNKLLGPELCLNAKNSRDTNAAMLRWWSLLEKYSCKASKLHLKPRRFKIF  750
             RHYYYRLVRRMNKLLGPELCL+AKNS+DTNAAMLRWWSLLEK SCKASKLHLKPRRFKIF
Sbjct  121   RHYYYRLVRRMNKLLGPELCLDAKNSKDTNAAMLRWWSLLEKSSCKASKLHLKPRRFKIF  180

Query  751   IETLENQLLKDRKKNVRRCFSQGENTSTAPISVSNQGRGASGHDGRSVKVVLLDNQDIHK  930
             IETLE+QLLKDRKKNVRR  SQGE++STA  S+S+  R  S +D R+VKVVLLD+Q I K
Sbjct  181   IETLESQLLKDRKKNVRRRPSQGESSSTAAASLSSHSR-VSTNDSRTVKVVLLDDQGIQK  239

Query  931   FGSGKGSSLKRHINIGANSTSCKADSSLLKTARHRRKIGAT--AAYKRWEKAAIAGVSLV  1104
             FGSGKGSSLKRH+ +G N ++ K DSS +K ARHRRKIG+   AAYKRWEKAAIAGVSLV
Sbjct  240   FGSGKGSSLKRHVTMGVNRSNAKVDSSPVKNARHRRKIGSVSAAAYKRWEKAAIAGVSLV  299

Query  1105  ADAAEHLERTTTDKEDGHFQDSNVRNVFEHSGKDPHVFPDLLHNSFNETNLQNSGKLKLQ  1284
             ADAAEHLER T  K+    Q+S   N FEH GKD H    L  N  NETNLQ+  KLKLQ
Sbjct  300   ADAAEHLERATIGKDVELVQNSQGINGFEHVGKDVHSLLTLSQNLLNETNLQSCMKLKLQ  359

Query  1285  LFPVDDGTRRALELDNHNPYLELTLSTRKKMSSVLEHLNRKWGNSSMACGDLMLFPYHLH  1464
             LFPVD+GTRRALE+DNHNPYLELTLS RKKMSSVLEHLNRKWG+SS+A G+L+LFPYH+ 
Sbjct  360   LFPVDEGTRRALEMDNHNPYLELTLSNRKKMSSVLEHLNRKWGSSSIATGELVLFPYHVQ  419

Query  1465  KENLVHFQKWTKDTTLTAADVYALTGSPPVFRLRYGWFSNAEVA-FRAPVSSAIPSRHDA  1641
              ENLV   +WTKDTTL+AADV  L GSPPVFRLRYGWF N+E+  F+AP+SS  P   + 
Sbjct  420   MENLVQSLRWTKDTTLSAADVNNLIGSPPVFRLRYGWFPNSELGTFQAPLSSTTPFTQNT  479

Query  1642  NMNIMPESSVGVL-----------------------QAPSTDPPKEANGCVSM--NTVNA  1746
             N NI  E +  +L                        + ST+   E+N   SM  NT N 
Sbjct  480   NTNITEEMNAEILASSHGKLVRFSKEPLVSNPRMTVTSSSTELSGESNLQASMGLNTYN-  538

Query  1747  SRSSDHTEAVLWENPE--TVVTEAEVDDLQFNKAGTSCVGEWADSLTNISVGDLLSEAPD  1920
                SDH E +     E   + TE +V+    +K      G+W DSLTNISVGDLLS+APD
Sbjct  539   ---SDHNETLPSHRREKGAITTEKQVE--MGSKTSALSAGDWEDSLTNISVGDLLSDAPD  593

Query  1921  MEDANCITSSIHSSSNYIHQIPFSCDSFDAAIAAHIKKHQNVTDSQAALPSQLSSIWGAE  2100
              E+ +CI S++  SS+++ Q+PFSCDSFDAAIAAHI KHQ+  +SQ ALP Q SSIW AE
Sbjct  594   DEETDCIESTLPGSSHFLQQMPFSCDSFDAAIAAHIYKHQSKAESQMALPPQASSIWNAE  653

Query  2101  DTCDAFAFQRHSLSE-KVQNASKHTSLETCKQITLANTTALGASVEDLPGARNPVDGDAA  2277
             DTCDAFAFQ+   S  K  N+S +   E C+ I+ +++  L A ++DLPG   P+  + A
Sbjct  654   DTCDAFAFQKDVASRLKAHNSSSNVGAENCQHISQSSSLLLDAGIKDLPGKMEPITDEPA  713

Query  2278  TADLESVHYSPTSDV----------VKDFNGLSDVYWPDSLGPLDLDIPSSRYHSE-LIL  2424
                    H  P  +            KD + LSD+YWPDSLGPL+LD PS RYHSE LIL
Sbjct  714   -------HEDPVDECQSNAQALGGSTKDLSLLSDIYWPDSLGPLELDAPSCRYHSEDLIL  766

Query  2425  SD-SLGGLTQLIASSLDAFQNCSFFGADKKEPVSTTEAQE  2541
             SD SLGGL +LIASSLDAFQNCSFFG DKKEP ST EA E
Sbjct  767   SDNSLGGLNRLIASSLDAFQNCSFFGLDKKEPGSTVEAVE  806



>ref|XP_009610185.1| PREDICTED: TSL-kinase interacting protein 1 isoform X3 [Nicotiana 
tomentosiformis]
Length=812

 Score =   892 bits (2305),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 485/815 (60%), Positives = 579/815 (71%), Gaps = 54/815 (7%)
 Frame = +1

Query  211   IQMELQLTLGSEADHYLRSSPRKDGDFTFGKVNCVEQQIASSQEHAIPEQAMFSQDHSVT  390
             +QME Q+ L  +   +  +   KDG     +     Q +  S++H + + ++ + DH+VT
Sbjct  1     MQMEPQVALECDRCLHPETLMCKDGVSDVTQHPAAAQPVIPSEDHPVSQLSVPTHDHAVT  60

Query  391   EQLASFEEHSALQQPVKRQTRKWAAWTREEEESFFSALRHVGKNFEKITSRVQSKNKDQV  570
             +Q++S ++   LQ+P KRQTR+WAAWTR+EEESFFSALR VGKNFEKITSRVQSKNKDQV
Sbjct  61    QQVSSSQDRVTLQKPAKRQTRQWAAWTRQEEESFFSALRQVGKNFEKITSRVQSKNKDQV  120

Query  571   RHYYYRLVRRMNKLLGPELCLNAKNSRDTNAAMLRWWSLLEKYSCKASKLHLKPRRFKIF  750
             RHYYYRLVRRMNKLLGPELCL+AKNS+DTNAAMLRWWSLLEK SCKASKLHLKPRRFKIF
Sbjct  121   RHYYYRLVRRMNKLLGPELCLDAKNSKDTNAAMLRWWSLLEKSSCKASKLHLKPRRFKIF  180

Query  751   IETLENQLLKDRKKNVRRCFSQGENTSTAPISVSNQGRGASGHDGRSVKVVLLDNQDIHK  930
             IETLE+QLLKDRKKNVRR  SQGE++STA  S+S+  R  S +D R+VKVVLLD+Q I K
Sbjct  181   IETLESQLLKDRKKNVRRRPSQGESSSTAAASLSSHSR-VSTNDSRTVKVVLLDDQGIQK  239

Query  931   FGSGKGSSLKRHINIGANSTSCKADSSLLKTARHRRKIGAT--AAYKRWEKAAIAGVSLV  1104
             FGSGKGSSLKRH+ +G N ++ K DSS +K ARHRRKIG+   AAYKRWEKAAIAGVSLV
Sbjct  240   FGSGKGSSLKRHVTMGVNRSNAKVDSSPVKNARHRRKIGSVSAAAYKRWEKAAIAGVSLV  299

Query  1105  ADAAEHLERTTTDKEDGHFQDSNVRNVFEHSGKDPHVFPDLLHNSFNETNLQNSGKLKLQ  1284
             ADAAEHLER T              N FEH GKD H    L  N  NETNLQ+  KLKLQ
Sbjct  300   ADAAEHLERATIGI-----------NGFEHVGKDVHSLLTLSQNLLNETNLQSCMKLKLQ  348

Query  1285  LFPVDDGTRRALELDNHNPYLELTLSTRKKMSSVLEHLNRKWGNSSMACGDLMLFPYHLH  1464
             LFPVD+GTRRALE+DNHNPYLELTLS RKKMSSVLEHLNRKWG+SS+A G+L+LFPYH+ 
Sbjct  349   LFPVDEGTRRALEMDNHNPYLELTLSNRKKMSSVLEHLNRKWGSSSIATGELVLFPYHVQ  408

Query  1465  KENLVHFQKWTKDTTLTAADVYALTGSPPVFRLRYGWFSNAEVA-FRAPVSSAIPSRHDA  1641
              ENLV   +WTKDTTL+AADV  L GSPPVFRLRYGWF N+E+  F+AP+SS  P   + 
Sbjct  409   MENLVQSLRWTKDTTLSAADVNNLIGSPPVFRLRYGWFPNSELGTFQAPLSSTTPFTQNT  468

Query  1642  NMNIMPESSVGVL-----------------------QAPSTDPPKEANGCVSM--NTVNA  1746
             N NI  E +  +L                        + ST+   E+N   SM  NT N 
Sbjct  469   NTNITEEMNAEILASSHGKLVRFSKEPLVSNPRMTVTSSSTELSGESNLQASMGLNTYN-  527

Query  1747  SRSSDHTEAVLWENPE--TVVTEAEVD--DLQFNKAGTSCVGEWADSLTNISVGDLLSEA  1914
                SDH E +     E   + TE +V+  D+Q +K      G+W DSLTNISVGDLLS+A
Sbjct  528   ---SDHNETLPSHRREKGAITTEKQVEMHDMQGSKTSALSAGDWEDSLTNISVGDLLSDA  584

Query  1915  PDMEDANCITSSIHSSSNYIHQIPFSCDSFDAAIAAHIKKHQNVTDSQAALPSQLSSIWG  2094
             PD E+ +CI S++  SS+++ Q+PFSCDSFDAAIAAHI KHQ+  +SQ ALP Q SSIW 
Sbjct  585   PDDEETDCIESTLPGSSHFLQQMPFSCDSFDAAIAAHIYKHQSKAESQMALPPQASSIWN  644

Query  2095  AEDTCDAFAFQRHSLSE-KVQNASKHTSLETCKQITLANTTALGASVEDLPGARNPVDGD  2271
             AEDTCDAFAFQ+   S  K  N+S +   E C+ I+ +++  L A ++DLPG   P+  +
Sbjct  645   AEDTCDAFAFQKDVASRLKAHNSSSNVGAENCQHISQSSSLLLDAGIKDLPGKMEPITDE  704

Query  2272  AATADLESVHYSPTSDV---VKDFNGLSDVYWPDSLGPLDLDIPSSRYHSE-LILSD-SL  2436
              A  D      S    +    KD + LSD+YWPDSLGPL+LD PS RYHSE LILSD SL
Sbjct  705   PAHEDPVDECQSNAQALGGSTKDLSLLSDIYWPDSLGPLELDAPSCRYHSEDLILSDNSL  764

Query  2437  GGLTQLIASSLDAFQNCSFFGADKKEPVSTTEAQE  2541
             GGL +LIASSLDAFQNCSFFG DKKEP ST EA E
Sbjct  765   GGLNRLIASSLDAFQNCSFFGLDKKEPGSTVEAVE  799



>ref|XP_004246638.1| PREDICTED: TSL-kinase interacting protein 1 isoform X3 [Solanum 
lycopersicum]
 ref|XP_010325977.1| PREDICTED: TSL-kinase interacting protein 1 isoform X3 [Solanum 
lycopersicum]
 ref|XP_010325978.1| PREDICTED: TSL-kinase interacting protein 1 isoform X3 [Solanum 
lycopersicum]
Length=817

 Score =   886 bits (2290),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 474/807 (59%), Positives = 575/807 (71%), Gaps = 36/807 (4%)
 Frame = +1

Query  211   IQMELQLTLGSEADHYLRSSPRKDGDFTFGKVNCVEQQIASSQEHAIPEQAMFSQDHSVT  390
             +QM  Q++L  +   +  +   KDG     +   V   +  S +H   +Q++ + DH+VT
Sbjct  1     MQMVQQVSLERDTCLHPETFMGKDGLSGVTQHPAVALSVIPSNDHLASQQSVLTHDHAVT  60

Query  391   EQLASFEEHSALQQPVKRQTRKWAAWTREEEESFFSALRHVGKNFEKITSRVQSKNKDQV  570
             + + S ++H  LQ P KRQ R+WAAWTR+EEESFFSALR VGKNFEKITSRVQSKNKDQV
Sbjct  61    QLVPSSQDHVMLQLPAKRQPRQWAAWTRQEEESFFSALRQVGKNFEKITSRVQSKNKDQV  120

Query  571   RHYYYRLVRRMNKLLGPELCLNAKNSRDTNAAMLRWWSLLEKYSCKASKLHLKPRRFKIF  750
             RHYYYRLVRRMNKLLGPELCL+AKNS+DTNAAMLRWWSLLEKYSCKASKLHLKPRRFKIF
Sbjct  121   RHYYYRLVRRMNKLLGPELCLDAKNSKDTNAAMLRWWSLLEKYSCKASKLHLKPRRFKIF  180

Query  751   IETLENQLLKDRKKNVRRCFSQGENTSTAPISVSNQGRGASGHDGRSVKVVLLDNQDIHK  930
             IETLE+QLLKDRKKNVRR  SQGE++STA  S S+ GR  S +D R+VKVVLLDNQD+ K
Sbjct  181   IETLESQLLKDRKKNVRRRPSQGESSSTAAGSPSSHGR-VSTNDSRTVKVVLLDNQDVQK  239

Query  931   FGSGKGSSLKRHINIGANSTSCKADSSLLKTARHRRKIG--ATAAYKRWEKAAIAGVSLV  1104
             FGSGKGSS+KRH+ +G N ++ K DSS +K ARHRR+ G  +TAAYKRWEKAAIAGVSLV
Sbjct  240   FGSGKGSSIKRHV-MGVNRSNAKVDSS-VKNARHRRRTGSASTAAYKRWEKAAIAGVSLV  297

Query  1105  ADAAEHLERTTTDKEDGHFQDSNVRNVFEHSGKDPHVFPDLLHNSFNETNLQNSGKLKLQ  1284
             ADAAEHLER T DK+ G  Q+S   N FEH GK+ H  P L  N  NETNLQ+  KLKLQ
Sbjct  298   ADAAEHLERATIDKDVGLVQNSQAINGFEHVGKNVHSLPTLSQNLLNETNLQSCMKLKLQ  357

Query  1285  LFPVDDGTRRALELDNHNPYLELTLSTRKKMSSVLEHLNRKWGNSSMACGDLMLFPYHLH  1464
             LFPVD+GTRR+LE+DNHNPYLELTLS RKKMSSVLEHLNRKWG+SS+A G+L+LFPYH+ 
Sbjct  358   LFPVDEGTRRSLEMDNHNPYLELTLSNRKKMSSVLEHLNRKWGSSSIATGELVLFPYHVQ  417

Query  1465  KENLVHFQKWTKDTTLTAADVYALTGSPPVFRLRYGWFSNAEVAFRAP-VSSAIPSRHDA  1641
              ENLV   +WTKDTT +AADV+ L GSPPVFRLRYGWF NAE+      +SSAIP   + 
Sbjct  418   MENLVQSLRWTKDTTQSAADVHNLIGSPPVFRLRYGWFPNAELGTPLELLSSAIPFMQNI  477

Query  1642  NMNIMPESSVGVL-----------QAPSTDPPK------------EANGCVSMNTVNASR  1752
             N NI  E++  +L           + P    P+            E+N   SM     + 
Sbjct  478   NPNITNENNAEILASSPGKLVRFSKEPLASNPRMTVTSSSIKLSGESNLQASMGLNTYTY  537

Query  1753  SSDHTEAV-LWENPE-TVVTEAEVDDLQFNKAGTSCVGEWADSLTNISVGDLLSEAPDME  1926
               D T  +   EN + T   +AE+ D+Q +KA     G+W DSLTNISVGDLL +APD E
Sbjct  538   DHDGTLPLNRRENGDATTAEQAEMHDMQGSKASALSAGDWEDSLTNISVGDLLFDAPDDE  597

Query  1927  DANCITSSIHSSSNYIHQIPFSCDSFDAAIAAHIKKHQNVTDSQAALPSQLSSIWGAEDT  2106
             + +CI S++  SS+++ Q+P SCDSFDAAIAAHI KHQ+  DSQ ALP Q SSIW AEDT
Sbjct  598   ETDCIDSALCGSSHFLSQMPLSCDSFDAAIAAHIYKHQSKADSQMALPPQASSIWNAEDT  657

Query  2107  CDAFAFQRH-SLSEKVQNASKHTSLETCKQITLANTTALGASVEDLPGARNPVDGDAATA  2283
             CDAFAF+++ + S+K Q +S +   E  ++I  +++  L A ++DLPG     +G+ A  
Sbjct  658   CDAFAFKKNVAFSDKSQCSSSNVGAENSQRIAQSSSLVLDAVIKDLPGNMESFNGEPAHD  717

Query  2284  DLESVHYSPTSDV---VKDFNGLSDVYWPDSLGPLDLDIPSSRYHSE-LILSDSLGGLTQ  2451
             D      S    +    KD NGLS +YW DSLGPL+LD PS RYHSE + LSDSLGG  +
Sbjct  718   DAVDECQSDAQALDGSSKDLNGLSGIYWTDSLGPLELDAPSCRYHSEDITLSDSLGGFNR  777

Query  2452  LIASSLDAFQNCSFFGADKKEPVSTTE  2532
             LI +SLDAFQNCSFFG DK EP ST E
Sbjct  778   LIVNSLDAFQNCSFFGLDKTEPGSTVE  804



>ref|XP_010325975.1| PREDICTED: TSL-kinase interacting protein 1 isoform X1 [Solanum 
lycopersicum]
Length=928

 Score =   882 bits (2279),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 474/807 (59%), Positives = 575/807 (71%), Gaps = 36/807 (4%)
 Frame = +1

Query  211   IQMELQLTLGSEADHYLRSSPRKDGDFTFGKVNCVEQQIASSQEHAIPEQAMFSQDHSVT  390
             +QM  Q++L  +   +  +   KDG     +   V   +  S +H   +Q++ + DH+VT
Sbjct  112   MQMVQQVSLERDTCLHPETFMGKDGLSGVTQHPAVALSVIPSNDHLASQQSVLTHDHAVT  171

Query  391   EQLASFEEHSALQQPVKRQTRKWAAWTREEEESFFSALRHVGKNFEKITSRVQSKNKDQV  570
             + + S ++H  LQ P KRQ R+WAAWTR+EEESFFSALR VGKNFEKITSRVQSKNKDQV
Sbjct  172   QLVPSSQDHVMLQLPAKRQPRQWAAWTRQEEESFFSALRQVGKNFEKITSRVQSKNKDQV  231

Query  571   RHYYYRLVRRMNKLLGPELCLNAKNSRDTNAAMLRWWSLLEKYSCKASKLHLKPRRFKIF  750
             RHYYYRLVRRMNKLLGPELCL+AKNS+DTNAAMLRWWSLLEKYSCKASKLHLKPRRFKIF
Sbjct  232   RHYYYRLVRRMNKLLGPELCLDAKNSKDTNAAMLRWWSLLEKYSCKASKLHLKPRRFKIF  291

Query  751   IETLENQLLKDRKKNVRRCFSQGENTSTAPISVSNQGRGASGHDGRSVKVVLLDNQDIHK  930
             IETLE+QLLKDRKKNVRR  SQGE++STA  S S+ GR  S +D R+VKVVLLDNQD+ K
Sbjct  292   IETLESQLLKDRKKNVRRRPSQGESSSTAAGSPSSHGR-VSTNDSRTVKVVLLDNQDVQK  350

Query  931   FGSGKGSSLKRHINIGANSTSCKADSSLLKTARHRRKIG--ATAAYKRWEKAAIAGVSLV  1104
             FGSGKGSS+KRH+ +G N ++ K DSS +K ARHRR+ G  +TAAYKRWEKAAIAGVSLV
Sbjct  351   FGSGKGSSIKRHV-MGVNRSNAKVDSS-VKNARHRRRTGSASTAAYKRWEKAAIAGVSLV  408

Query  1105  ADAAEHLERTTTDKEDGHFQDSNVRNVFEHSGKDPHVFPDLLHNSFNETNLQNSGKLKLQ  1284
             ADAAEHLER T DK+ G  Q+S   N FEH GK+ H  P L  N  NETNLQ+  KLKLQ
Sbjct  409   ADAAEHLERATIDKDVGLVQNSQAINGFEHVGKNVHSLPTLSQNLLNETNLQSCMKLKLQ  468

Query  1285  LFPVDDGTRRALELDNHNPYLELTLSTRKKMSSVLEHLNRKWGNSSMACGDLMLFPYHLH  1464
             LFPVD+GTRR+LE+DNHNPYLELTLS RKKMSSVLEHLNRKWG+SS+A G+L+LFPYH+ 
Sbjct  469   LFPVDEGTRRSLEMDNHNPYLELTLSNRKKMSSVLEHLNRKWGSSSIATGELVLFPYHVQ  528

Query  1465  KENLVHFQKWTKDTTLTAADVYALTGSPPVFRLRYGWFSNAEVAFRAP-VSSAIPSRHDA  1641
              ENLV   +WTKDTT +AADV+ L GSPPVFRLRYGWF NAE+      +SSAIP   + 
Sbjct  529   MENLVQSLRWTKDTTQSAADVHNLIGSPPVFRLRYGWFPNAELGTPLELLSSAIPFMQNI  588

Query  1642  NMNIMPESSVGVL-----------QAPSTDPPK------------EANGCVSMNTVNASR  1752
             N NI  E++  +L           + P    P+            E+N   SM     + 
Sbjct  589   NPNITNENNAEILASSPGKLVRFSKEPLASNPRMTVTSSSIKLSGESNLQASMGLNTYTY  648

Query  1753  SSDHTEAV-LWENPE-TVVTEAEVDDLQFNKAGTSCVGEWADSLTNISVGDLLSEAPDME  1926
               D T  +   EN + T   +AE+ D+Q +KA     G+W DSLTNISVGDLL +APD E
Sbjct  649   DHDGTLPLNRRENGDATTAEQAEMHDMQGSKASALSAGDWEDSLTNISVGDLLFDAPDDE  708

Query  1927  DANCITSSIHSSSNYIHQIPFSCDSFDAAIAAHIKKHQNVTDSQAALPSQLSSIWGAEDT  2106
             + +CI S++  SS+++ Q+P SCDSFDAAIAAHI KHQ+  DSQ ALP Q SSIW AEDT
Sbjct  709   ETDCIDSALCGSSHFLSQMPLSCDSFDAAIAAHIYKHQSKADSQMALPPQASSIWNAEDT  768

Query  2107  CDAFAFQRH-SLSEKVQNASKHTSLETCKQITLANTTALGASVEDLPGARNPVDGDAATA  2283
             CDAFAF+++ + S+K Q +S +   E  ++I  +++  L A ++DLPG     +G+ A  
Sbjct  769   CDAFAFKKNVAFSDKSQCSSSNVGAENSQRIAQSSSLVLDAVIKDLPGNMESFNGEPAHD  828

Query  2284  DLESVHYSPTSDV---VKDFNGLSDVYWPDSLGPLDLDIPSSRYHSE-LILSDSLGGLTQ  2451
             D      S    +    KD NGLS +YW DSLGPL+LD PS RYHSE + LSDSLGG  +
Sbjct  829   DAVDECQSDAQALDGSSKDLNGLSGIYWTDSLGPLELDAPSCRYHSEDITLSDSLGGFNR  888

Query  2452  LIASSLDAFQNCSFFGADKKEPVSTTE  2532
             LI +SLDAFQNCSFFG DK EP ST E
Sbjct  889   LIVNSLDAFQNCSFFGLDKTEPGSTVE  915



>ref|XP_006354356.1| PREDICTED: TSL-kinase interacting protein 1-like isoform X1 [Solanum 
tuberosum]
 ref|XP_006354357.1| PREDICTED: TSL-kinase interacting protein 1-like isoform X2 [Solanum 
tuberosum]
Length=818

 Score =   878 bits (2269),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 472/807 (58%), Positives = 571/807 (71%), Gaps = 35/807 (4%)
 Frame = +1

Query  211   IQMELQLTLGSEADHYLRSSPRKDGDFTFGKVNCVEQQIASSQEHAIPEQAMFSQDHSVT  390
             +QM  Q++L  +   +  +   KDG     +   V   +  S++H   +Q++ + DH+VT
Sbjct  1     MQMVQQVSLERDTCLHPETFMGKDGLSGVTQHPAVALSVIPSKDHLASQQSVLTHDHAVT  60

Query  391   EQLASFEEHSALQQPVKRQTRKWAAWTREEEESFFSALRHVGKNFEKITSRVQSKNKDQV  570
             + + S ++   LQ P KRQ R+WAAWTR+EEESFFSALR VGKNFEKITSRV SKNKDQV
Sbjct  61    QLVPSSQDQVMLQLPAKRQPRQWAAWTRQEEESFFSALRQVGKNFEKITSRVHSKNKDQV  120

Query  571   RHYYYRLVRRMNKLLGPELCLNAKNSRDTNAAMLRWWSLLEKYSCKASKLHLKPRRFKIF  750
             RHYYYRLVRRMNKLLGPELCL+AKNS+DTNAAMLRWWSLLEKYSCKASKLHLKPRRFKIF
Sbjct  121   RHYYYRLVRRMNKLLGPELCLDAKNSKDTNAAMLRWWSLLEKYSCKASKLHLKPRRFKIF  180

Query  751   IETLENQLLKDRKKNVRRCFSQGENTSTAPISVSNQGRGASGHDGRSVKVVLLDNQDIHK  930
             IETLE+QLLKDRKKNVRR  SQGE++STA  S S+ GR  S +D R+VKVVLLDNQD+ +
Sbjct  181   IETLESQLLKDRKKNVRRRPSQGESSSTAAGSPSSHGR-VSTNDSRTVKVVLLDNQDVQQ  239

Query  931   FGSGKGSSLKRHINIGANSTSCKADSSLLKTARHRRKIG--ATAAYKRWEKAAIAGVSLV  1104
             FGSGKGSS+KRH+++G N ++ K DSS +K  RHRR+ G  +TAAYKRWEKAAIAGVSLV
Sbjct  240   FGSGKGSSIKRHVSMGVNRSNAKVDSS-VKNTRHRRRTGSASTAAYKRWEKAAIAGVSLV  298

Query  1105  ADAAEHLERTTTDKEDGHFQDSNVRNVFEHSGKDPHVFPDLLHNSFNETNLQNSGKLKLQ  1284
             ADAAEHLER T DK+ G  Q+S   N FEH GK+ H  P L  N  NETNLQ+  KLKLQ
Sbjct  299   ADAAEHLERATIDKDVGLVQNSQGINGFEHVGKNVHSLPTLSQNLLNETNLQSCMKLKLQ  358

Query  1285  LFPVDDGTRRALELDNHNPYLELTLSTRKKMSSVLEHLNRKWGNSSMACGDLMLFPYHLH  1464
             LFPVD+GTRRALE+DNHNPYLELTLS RKKMSSVLEHLNRKWG+SS+A G+L+LFPYH+ 
Sbjct  359   LFPVDEGTRRALEMDNHNPYLELTLSNRKKMSSVLEHLNRKWGSSSIAAGELVLFPYHVQ  418

Query  1465  KENLVHFQKWTKDTTLTAADVYALTGSPPVFRLRYGWFSNAEVAFRAP-VSSAIPSRHDA  1641
              ENLV   +WTKDTT +AADV+ L GSPPVFRLRYGWF NAE+      +SS IP   + 
Sbjct  419   MENLVQSLRWTKDTTQSAADVHNLIGSPPVFRLRYGWFPNAELGTPLELLSSTIPFMQNI  478

Query  1642  NMNIMPE-------SSVGVLQAPSTDP----PK------------EANGCVSMNTVNASR  1752
             N NI  E       SS G L   S +P    P+            E+N   SM     + 
Sbjct  479   NPNITNEYNAEILASSPGKLVRFSKEPLASNPRMTVTSSSIKLSGESNLQASMGLNTYTY  538

Query  1753  SSDHTEAV-LWENPE-TVVTEAEVDDLQFNKAGTSCVGEWADSLTNISVGDLLSEAPDME  1926
               D T  +   EN + T   + E+ D+Q +K      G+W DSLTNISVGDLL +APD E
Sbjct  539   DHDGTLPLNRRENGDATTAEQTEMHDMQGSKTSAFSAGDWEDSLTNISVGDLLFDAPDDE  598

Query  1927  DANCITSSIHSSSNYIHQIPFSCDSFDAAIAAHIKKHQNVTDSQAALPSQLSSIWGAEDT  2106
             + +CI S++  SS+++ Q+P SCDSFDAAIAAHI KHQ+  DSQ ALP Q SSIW AEDT
Sbjct  599   ETDCIDSALCRSSHFLSQMPLSCDSFDAAIAAHIYKHQSKADSQMALPPQASSIWNAEDT  658

Query  2107  CDAFAFQRH-SLSEKVQNASKHTSLETCKQITLANTTALGASVEDLPGARNPVDGDAATA  2283
             CDAFAF+++ + S+K Q +S +   E  ++I  +++  L A ++DLPG      G+ A  
Sbjct  659   CDAFAFKKNVAFSDKAQCSSSNVGAENSQRIAQSSSLVLDARIKDLPGNMESFTGEPAHD  718

Query  2284  DLESVHYSPTSDV---VKDFNGLSDVYWPDSLGPLDLDIPSSRYHSE-LILSDSLGGLTQ  2451
             D      S    +    KD NGLS +YW DSLGPL+LD PS RYHSE + LSDS GG  +
Sbjct  719   DPVDECQSDAQALDGSAKDLNGLSGIYWTDSLGPLELDAPSCRYHSEDITLSDSFGGFNR  778

Query  2452  LIASSLDAFQNCSFFGADKKEPVSTTE  2532
             LI +SLDAFQNCSFFG DKKEP ST E
Sbjct  779   LIVNSLDAFQNCSFFGLDKKEPGSTVE  805



>ref|XP_006354358.1| PREDICTED: TSL-kinase interacting protein 1-like isoform X3 [Solanum 
tuberosum]
Length=814

 Score =   870 bits (2248),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 471/806 (58%), Positives = 569/806 (71%), Gaps = 37/806 (5%)
 Frame = +1

Query  211   IQMELQLTLGSEADHYLRSSPRKDGDFTFGKVNCVEQQIASSQEHAIPEQAMFSQDHSVT  390
             +QM  Q++L  +   +  +   KDG     +   V   +  S++H   +Q++ + DH+VT
Sbjct  1     MQMVQQVSLERDTCLHPETFMGKDGLSGVTQHPAVALSVIPSKDHLASQQSVLTHDHAVT  60

Query  391   EQLASFEEHSALQQPVKRQTRKWAAWTREEEESFFSALRHVGKNFEKITSRVQSKNKDQV  570
             + + S ++   LQ P KRQ R+WAAWTR+EEESFFSALR VGKNFEKITSRV SKNKDQV
Sbjct  61    QLVPSSQDQVMLQLPAKRQPRQWAAWTRQEEESFFSALRQVGKNFEKITSRVHSKNKDQV  120

Query  571   RHYYYRLVRRMNKLLGPELCLNAKNSRDTNAAMLRWWSLLEKYSCKASKLHLKPRRFKIF  750
             RHYYYRLVRRMNKLLGPELCL+AKNS+DTNAAMLRWWSLLEKYSCKASKLHLKPRRFKIF
Sbjct  121   RHYYYRLVRRMNKLLGPELCLDAKNSKDTNAAMLRWWSLLEKYSCKASKLHLKPRRFKIF  180

Query  751   IETLENQLLKDRKKNVRRCFSQGENTSTAPISVSNQGRGASGHDGRSVKVVLLDNQDIHK  930
             IETLE+QLLKDRKKNVRR  SQGE++STA  S S+ GR  S +D R+VKVVLLDNQD+ +
Sbjct  181   IETLESQLLKDRKKNVRRRPSQGESSSTAAGSPSSHGR-VSTNDSRTVKVVLLDNQDVQQ  239

Query  931   FGSGKGSSLKRHINIGANSTSCKADSSLLKTARHRRKIG--ATAAYKRWEKAAIAGVSLV  1104
             FGSGKGSS+KRH+++G N ++ K DSS +K  RHRR+ G  +TAAYKRWEKAAIAGVSLV
Sbjct  240   FGSGKGSSIKRHVSMGVNRSNAKVDSS-VKNTRHRRRTGSASTAAYKRWEKAAIAGVSLV  298

Query  1105  ADAAEHLERTTTDKEDGHFQDSNVRNVFEHSGKDPHVFPDLLHNSFNETNLQNSGKLKLQ  1284
             ADAAEHLER T DK+ G  Q+S   N FEH GK+ H  P L  N  NETNLQ+  KLKLQ
Sbjct  299   ADAAEHLERATIDKDVGLVQNSQGINGFEHVGKNVHSLPTLSQNLLNETNLQSCMKLKLQ  358

Query  1285  LFPVDDGTRRALELDNHNPYLELTLSTRKKMSSVLEHLNRKWGNSSMACGDLMLFPYHLH  1464
             LFPVD+GTRRALE+DNHNPYLELTLS RKKMSSVLEHLNRKWG+SS+A G+L+LFPYH+ 
Sbjct  359   LFPVDEGTRRALEMDNHNPYLELTLSNRKKMSSVLEHLNRKWGSSSIAAGELVLFPYHVQ  418

Query  1465  KENLVHFQKWTKDTTLTAADVYALTGSPPVFRLRYGWFSNAEVAFRAP-VSSAIPSRHDA  1641
              ENLV   +WTKDTT +AADV+ L GSPPVFRLRYGWF NAE+      +SS IP   + 
Sbjct  419   MENLVQSLRWTKDTTQSAADVHNLIGSPPVFRLRYGWFPNAELGTPLELLSSTIPFMQNI  478

Query  1642  NMNIMPE-------SSVGVLQAPSTDP----PK------------EANGCVSMNTVNASR  1752
             N NI  E       SS G L   S +P    P+            E+N   SM     + 
Sbjct  479   NPNITNEYNAEILASSPGKLVRFSKEPLASNPRMTVTSSSIKLSGESNLQASMGLNTYTY  538

Query  1753  SSDHTEAV-LWENPETVVTEAEVDDLQFNKAGTSCVGEWADSLTNISVGDLLSEAPDMED  1929
               D T  +   EN +   T AE  ++  +K      G+W DSLTNISVGDLL +APD E+
Sbjct  539   DHDGTLPLNRRENGD--ATTAEQTEMG-SKTSAFSAGDWEDSLTNISVGDLLFDAPDDEE  595

Query  1930  ANCITSSIHSSSNYIHQIPFSCDSFDAAIAAHIKKHQNVTDSQAALPSQLSSIWGAEDTC  2109
              +CI S++  SS+++ Q+P SCDSFDAAIAAHI KHQ+  DSQ ALP Q SSIW AEDTC
Sbjct  596   TDCIDSALCRSSHFLSQMPLSCDSFDAAIAAHIYKHQSKADSQMALPPQASSIWNAEDTC  655

Query  2110  DAFAFQRH-SLSEKVQNASKHTSLETCKQITLANTTALGASVEDLPGARNPVDGDAATAD  2286
             DAFAF+++ + S+K Q +S +   E  ++I  +++  L A ++DLPG      G+ A  D
Sbjct  656   DAFAFKKNVAFSDKAQCSSSNVGAENSQRIAQSSSLVLDARIKDLPGNMESFTGEPAHDD  715

Query  2287  LESVHYSPTSDV---VKDFNGLSDVYWPDSLGPLDLDIPSSRYHSE-LILSDSLGGLTQL  2454
                   S    +    KD NGLS +YW DSLGPL+LD PS RYHSE + LSDS GG  +L
Sbjct  716   PVDECQSDAQALDGSAKDLNGLSGIYWTDSLGPLELDAPSCRYHSEDITLSDSFGGFNRL  775

Query  2455  IASSLDAFQNCSFFGADKKEPVSTTE  2532
             I +SLDAFQNCSFFG DKKEP ST E
Sbjct  776   IVNSLDAFQNCSFFGLDKKEPGSTVE  801



>ref|XP_010325976.1| PREDICTED: TSL-kinase interacting protein 1 isoform X2 [Solanum 
lycopersicum]
Length=924

 Score =   872 bits (2254),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 472/807 (58%), Positives = 572/807 (71%), Gaps = 40/807 (5%)
 Frame = +1

Query  211   IQMELQLTLGSEADHYLRSSPRKDGDFTFGKVNCVEQQIASSQEHAIPEQAMFSQDHSVT  390
             +QM  Q++L  +   +  +   KDG     +   V   +  S +H   +Q++ + DH+VT
Sbjct  112   MQMVQQVSLERDTCLHPETFMGKDGLSGVTQHPAVALSVIPSNDHLASQQSVLTHDHAVT  171

Query  391   EQLASFEEHSALQQPVKRQTRKWAAWTREEEESFFSALRHVGKNFEKITSRVQSKNKDQV  570
             + + S ++H  LQ P KRQ R+WAAWTR+EEESFFSALR VGKNFEKITSRVQSKNKDQV
Sbjct  172   QLVPSSQDHVMLQLPAKRQPRQWAAWTRQEEESFFSALRQVGKNFEKITSRVQSKNKDQV  231

Query  571   RHYYYRLVRRMNKLLGPELCLNAKNSRDTNAAMLRWWSLLEKYSCKASKLHLKPRRFKIF  750
             RHYYYRLVRRMNKLLGPELCL+AKNS+DTNAAMLRWWSLLEKYSCKASKLHLKPRRFKIF
Sbjct  232   RHYYYRLVRRMNKLLGPELCLDAKNSKDTNAAMLRWWSLLEKYSCKASKLHLKPRRFKIF  291

Query  751   IETLENQLLKDRKKNVRRCFSQGENTSTAPISVSNQGRGASGHDGRSVKVVLLDNQDIHK  930
             IETLE+QLLKDRKKNVRR  SQGE++STA  S S+ GR  S +D R+VKVVLLDNQD+ K
Sbjct  292   IETLESQLLKDRKKNVRRRPSQGESSSTAAGSPSSHGR-VSTNDSRTVKVVLLDNQDVQK  350

Query  931   FGSGKGSSLKRHINIGANSTSCKADSSLLKTARHRRKIG--ATAAYKRWEKAAIAGVSLV  1104
             FGSGKGSS+KRH+ +G N ++ K DSS +K ARHRR+ G  +TAAYKRWEKAAIAGVSLV
Sbjct  351   FGSGKGSSIKRHV-MGVNRSNAKVDSS-VKNARHRRRTGSASTAAYKRWEKAAIAGVSLV  408

Query  1105  ADAAEHLERTTTDKEDGHFQDSNVRNVFEHSGKDPHVFPDLLHNSFNETNLQNSGKLKLQ  1284
             ADAAEHLER T DK+ G  Q+S   N FEH GK+ H  P L  N  NETNLQ+  KLKLQ
Sbjct  409   ADAAEHLERATIDKDVGLVQNSQAINGFEHVGKNVHSLPTLSQNLLNETNLQSCMKLKLQ  468

Query  1285  LFPVDDGTRRALELDNHNPYLELTLSTRKKMSSVLEHLNRKWGNSSMACGDLMLFPYHLH  1464
             LFPVD+GTRR+LE+DNHNPYLELTLS RKKMSSVLEHLNRKWG+SS+A G+L+LFPYH+ 
Sbjct  469   LFPVDEGTRRSLEMDNHNPYLELTLSNRKKMSSVLEHLNRKWGSSSIATGELVLFPYHVQ  528

Query  1465  KENLVHFQKWTKDTTLTAADVYALTGSPPVFRLRYGWFSNAEVAFRAP-VSSAIPSRHDA  1641
              ENLV   +WTKDTT +AADV+ L GSPPVFRLRYGWF NAE+      +SSAIP   + 
Sbjct  529   MENLVQSLRWTKDTTQSAADVHNLIGSPPVFRLRYGWFPNAELGTPLELLSSAIPFMQNI  588

Query  1642  NMNIMPESSVGVL-----------QAPSTDPPK------------EANGCVSMNTVNASR  1752
             N NI  E++  +L           + P    P+            E+N   SM     + 
Sbjct  589   NPNITNENNAEILASSPGKLVRFSKEPLASNPRMTVTSSSIKLSGESNLQASMGLNTYTY  648

Query  1753  SSDHTEAV-LWENPE-TVVTEAEVDDLQFNKAGTSCVGEWADSLTNISVGDLLSEAPDME  1926
               D T  +   EN + T   +AE+     +KA     G+W DSLTNISVGDLL +APD E
Sbjct  649   DHDGTLPLNRRENGDATTAEQAEMG----SKASALSAGDWEDSLTNISVGDLLFDAPDDE  704

Query  1927  DANCITSSIHSSSNYIHQIPFSCDSFDAAIAAHIKKHQNVTDSQAALPSQLSSIWGAEDT  2106
             + +CI S++  SS+++ Q+P SCDSFDAAIAAHI KHQ+  DSQ ALP Q SSIW AEDT
Sbjct  705   ETDCIDSALCGSSHFLSQMPLSCDSFDAAIAAHIYKHQSKADSQMALPPQASSIWNAEDT  764

Query  2107  CDAFAFQRH-SLSEKVQNASKHTSLETCKQITLANTTALGASVEDLPGARNPVDGDAATA  2283
             CDAFAF+++ + S+K Q +S +   E  ++I  +++  L A ++DLPG     +G+ A  
Sbjct  765   CDAFAFKKNVAFSDKSQCSSSNVGAENSQRIAQSSSLVLDAVIKDLPGNMESFNGEPAHD  824

Query  2284  DLESVHYSPTSDV---VKDFNGLSDVYWPDSLGPLDLDIPSSRYHSE-LILSDSLGGLTQ  2451
             D      S    +    KD NGLS +YW DSLGPL+LD PS RYHSE + LSDSLGG  +
Sbjct  825   DAVDECQSDAQALDGSSKDLNGLSGIYWTDSLGPLELDAPSCRYHSEDITLSDSLGGFNR  884

Query  2452  LIASSLDAFQNCSFFGADKKEPVSTTE  2532
             LI +SLDAFQNCSFFG DK EP ST E
Sbjct  885   LIVNSLDAFQNCSFFGLDKTEPGSTVE  911



>ref|XP_011077326.1| PREDICTED: TSL-kinase interacting protein 1 [Sesamum indicum]
Length=779

 Score =   843 bits (2177),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 443/742 (60%), Positives = 530/742 (71%), Gaps = 38/742 (5%)
 Frame = +1

Query  409   EEHSALQQPVKRQTRKWAAWTREEEESFFSALRHVGKNFEKITSRVQSKNKDQVRHYYYR  588
             +EH+A Q PVK+QTR+WAAWTR+EEESFF+ALR VGKNFEKIT RVQSKNKDQVRHYYYR
Sbjct  32    QEHAAPQMPVKKQTRQWAAWTRQEEESFFAALRQVGKNFEKITCRVQSKNKDQVRHYYYR  91

Query  589   LVRRMNKLLGPELCLNAKNSRDTNAAMLRWWSLLEKYSCKASKLHLKPRRFKIFIETLEN  768
             LVRRMNKLLGPELCL+AKNS+DTNAAMLRWWSLLEKYSCKASKLHLKPRRFKIF+ETLEN
Sbjct  92    LVRRMNKLLGPELCLDAKNSKDTNAAMLRWWSLLEKYSCKASKLHLKPRRFKIFVETLEN  151

Query  769   QLLKDRKKNVRRCFSQGENTSTAP-ISVSNQGRGASGHDGRSVKVVLLDNQDIHKFGSGK  945
             QLLKDRKKN+++  S GEN S+ P I   NQ R ASGHD R+VK+VL+D+Q+I K G+GK
Sbjct  152   QLLKDRKKNIKKRLSTGENNSSIPNIPAGNQVR-ASGHDNRAVKMVLVDSQNIQKVGTGK  210

Query  946   GSSLKRHINIGANSTSCKADSSLLKTARHRRKIG--ATAAYKRWEKAAIAGVSLVADAAE  1119
             G+  KRHINIG + T+CK D + +KTA+HRRK G  +TAAYKRWEKAAIAGVSLVADAAE
Sbjct  211   GALFKRHINIGMSRTNCKVDPASMKTAKHRRKTGLASTAAYKRWEKAAIAGVSLVADAAE  270

Query  1120  HLERTTTDKEDGHFQDSNVRNVFEHSGKDPHVFPDLLHNSFNETNLQNSGKLKLQLFPVD  1299
             HLER  TDKE  + Q++   +  +  GK          + FNE N+ NS KLKLQLFP+D
Sbjct  271   HLERVDTDKEIDNVQETPGHDGSQLVGKVVQSLHASSQSMFNENNIHNSAKLKLQLFPID  330

Query  1300  DGTRRALELDNHNPYLELTLSTRKKMSSVLEHLNRKWGNSSMACGDLMLFPYHLHKENLV  1479
             + TR+ALE+DNHNP+LELTLSTRKK+SS+LEHLNRKWGNSS    +LMLFPY   +ENLV
Sbjct  331   ECTRKALEMDNHNPHLELTLSTRKKLSSILEHLNRKWGNSSSLSKELMLFPYWAQRENLV  390

Query  1480  HFQKWTKDTTLTAADVYALTGSPPVFRLRYGWFSNAEV--AFRAPVSSAIPSRHDANMNI  1653
              +QKWTKD+ L AADVY L GSPP+FRLRYGWFS AEV  A    +S A     + N+NI
Sbjct  391   GYQKWTKDSPLCAADVYYLIGSPPIFRLRYGWFSKAEVESATAQALSCANIKEQNLNINI  450

Query  1654  MPE---------SSVG----------VLQAPSTDPPKEANGC-VSMNTVNASRSSDHTEA  1773
              PE         S +G           L   ST  P     C VS++ +N SR  D T  
Sbjct  451   APEQNAEAENPNSPLGDQLVSAEKLITLSPSSTRTPITTVECGVSVSKINTSRFQDSTAG  510

Query  1774  V--LWENPETVVTEAEVDDLQFNKAGTSCVGEWADSLTNISVGDLLSEAPDMEDANCITS  1947
             +  L E    +    +V++++     T   GEWADSLTNISVGDLLSE+    D NC   
Sbjct  511   LSSLREESGDLAVTRQVENMKNIALST---GEWADSLTNISVGDLLSESTQSTDVNCTEF  567

Query  1948  SIHSSSNYIHQIPFSCDSFDAAIAAHIKKHQNVTDSQAALPSQLSSIWGAEDTCDAFAFQ  2127
              +   SN   Q+PFSCDSFDAAIAAHI KHQN  D Q  L S   SIW  E+TCDAFAFQ
Sbjct  568   PMPLGSNCFQQMPFSCDSFDAAIAAHIYKHQNKVDLQQGLASHAPSIWDGEETCDAFAFQ  627

Query  2128  R-HSLSEKVQNASKHTSLETCKQITLANTTALGASVEDLPGARNPVDGDAATADL--ESV  2298
             +  +   K Q+ S + +++ CKQ T+ + +   AS E+LP        D A  DL  + +
Sbjct  628   KTGAFCNKEQDVSMNDTMDACKQATVPSPS---ASHEELPEMEKVTSSDLACGDLMDDGM  684

Query  2299  HYSPTSDVVKDFNGLSDVYWPDSLGPLDLDIPSSRYHS-ELILSDSLGGLTQLIASSLDA  2475
                P+ +  KDF GL+D+YWPDSLGPLDLDIPS RYHS +LILSDSL GL +LIA+S+DA
Sbjct  685   SDHPSENSTKDFGGLTDIYWPDSLGPLDLDIPSCRYHSNDLILSDSLSGLNRLIANSVDA  744

Query  2476  FQNCSFFGADKKEPVSTTEAQE  2541
             FQ+CSFFG DKKEP ST EA++
Sbjct  745   FQSCSFFGLDKKEPASTAEARQ  766



>ref|XP_010653608.1| PREDICTED: TSL-kinase interacting protein 1 isoform X2 [Vitis 
vinifera]
 emb|CBI32767.3| unnamed protein product [Vitis vinifera]
Length=803

 Score =   812 bits (2097),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 435/757 (57%), Positives = 535/757 (71%), Gaps = 59/757 (8%)
 Frame = +1

Query  430   QPVKRQTRKWAAWTREEEESFFSALRHVGKNFEKITSRVQSKNKDQVRHYYYRLVRRMNK  609
             +PVKRQTR+WAAWTR+EEESFF+ALR VGKNFEKIT RVQSKNKDQVRHYYYRLVRRMNK
Sbjct  40    KPVKRQTRQWAAWTRQEEESFFTALRQVGKNFEKITCRVQSKNKDQVRHYYYRLVRRMNK  99

Query  610   LLGPELCLNAKNSRDTNAAMLRWWSLLEKYSCKASKLHLKPRRFKIFIETLENQLLKDRK  789
             LLGP   L+AKNS+DTNAAMLRWWSLLEKYSCKASKLHLKPRRFKIFIE LE+QLLKDRK
Sbjct  100   LLGPGFSLDAKNSKDTNAAMLRWWSLLEKYSCKASKLHLKPRRFKIFIEALEHQLLKDRK  159

Query  790   KNVRRCFSQGEN-TSTAPISVSNQGRGASGHDGRSVKVVLLDNQDIHKFGSGKGSSLKRH  966
             KN+R+  SQG N +STAP +VS+Q R ASG++ R+VK+VL+++Q++ K G GKGSSLKR+
Sbjct  160   KNIRKRPSQGGNCSSTAPNTVSSQSR-ASGNETRAVKLVLVESQNVQKLGPGKGSSLKRN  218

Query  967   INIGANSTSCKADSSLLKTARHRRKIGA--TAAYKRWEKAAIAGVSLVADAAEHLERTTT  1140
             +N+G N ++ K DSS +KTAR R+K  A  +AAYKRWEKAAIAGVSLVADAAEHLERTT 
Sbjct  219   VNVGVNRSNSKGDSSAMKTARQRQKPAAVSSAAYKRWEKAAIAGVSLVADAAEHLERTTN  278

Query  1141  DKEDGHFQDSNVRNVFEHSGKDPHVFPDLLHNSFNETNLQNSGKLKLQLFPVDDGTRRAL  1320
             DKE  H Q +  +  F+  G+     P    N F ++N+Q S KLKLQLFP+D+GTRRAL
Sbjct  279   DKEVEHDQSAPGQRGFDAVGEVLPPVPTFSQNMFVKSNVQTSTKLKLQLFPIDEGTRRAL  338

Query  1321  ELDNHNPYLELTLSTRKKMSSVLEHLNRKWGNSSMACGDLMLFPYHLHKENLVHFQKWTK  1500
             E+D HNP+LELTLSTRKK+SSVLEHL RKWGNS +A G+LMLFPY + + NL    +WT+
Sbjct  339   EMDKHNPHLELTLSTRKKISSVLEHLTRKWGNSGIASGELMLFPYSVQRGNLAGHPRWTQ  398

Query  1501  DTTLTAADVYALTGSPPVFRLRYGWFSNAE---VAFRAPVSS-AIPSRHDANMN-----I  1653
             D+++TAADVY + GSPPVFRLRYGWFSN E   VAF+AP++S  I   H+  +N     I
Sbjct  399   DSSVTAADVYEIIGSPPVFRLRYGWFSNTEISSVAFQAPLASCTILGEHNMEVNNRKKQI  458

Query  1654  MPESSVGVLQAPSTDPP--------KEANGCVSMNTV---------------------NA  1746
             M   S  +   P TD          K+ +  ++ NTV                     N 
Sbjct  459   M--DSRPIHAPPPTDHQSEKLVERCKDRSTLLTGNTVVPSSNNAQEEMTRYVNVASNSNL  516

Query  1747  SRSSDHTEAVLW-----ENPETVVTEAEVDDLQFNKAGTSCVGEWADSLTNISVGDLLSE  1911
               SS+    + W     E+   ++   EVDDL+ + +     GEWADSLTNISVGDLL++
Sbjct  517   MESSEAAANISWHQRESEDDSIMMPLEEVDDLRISSSTALSTGEWADSLTNISVGDLLAD  576

Query  1912  APDMEDANCITSSIHSSSNYIHQIPFSCDSFDAAIAAHIKKHQNVTDSQAALPSQLSSIW  2091
                  D +C+   +  SS Y  QIPFSCDSFDAAIAAHI KHQ+ T  Q+AL S   SIW
Sbjct  577   VSQEMDTSCVNPPVSGSSQYPQQIPFSCDSFDAAIAAHISKHQDKTSFQSALVSHAPSIW  636

Query  2092  GAEDTCDAFAFQRHSL-SEKVQNASKHTSLETCKQITLANTTALGASVEDLPGARNPVDG  2268
              AE+TCD F+FQ++ +  ++V ++SK  S    +QI   N+   G  +E+LP     +D 
Sbjct  637   DAEETCDGFSFQKNPVFHQEVLSSSKIASPGASEQIARINSVGSGCLIEELPNVERLLD-  695

Query  2269  DAATADLESVHYSPT-----SDVVKDFNGLSDVYWPDSLGPLDLDIPSSRYHSE-LILSD  2430
             D A  DL  +  SP+         KD +GL+D+YWPDSLGPLDLDIPSSRYH+E LILS+
Sbjct  696   DPAHGDL--MDDSPSDPHMLDSTAKDLSGLADIYWPDSLGPLDLDIPSSRYHNEDLILSE  753

Query  2431  SLGGLTQLIASSLDAFQNCSFFGADKKEPVSTTEAQE  2541
             SL GL  LIA+S+DAFQNCSFFG DKKEP ST EA+E
Sbjct  754   SLSGLKSLIANSVDAFQNCSFFGLDKKEPASTVEARE  790



>ref|XP_010653605.1| PREDICTED: TSL-kinase interacting protein 1 isoform X1 [Vitis 
vinifera]
 ref|XP_010653606.1| PREDICTED: TSL-kinase interacting protein 1 isoform X1 [Vitis 
vinifera]
 ref|XP_010653607.1| PREDICTED: TSL-kinase interacting protein 1 isoform X1 [Vitis 
vinifera]
Length=804

 Score =   812 bits (2097),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 435/758 (57%), Positives = 535/758 (71%), Gaps = 60/758 (8%)
 Frame = +1

Query  430   QPVKRQTRKWAAWTREEEESFFSALRHVGKNFEKITSRVQSKNKDQVRHYYYRLVRRMNK  609
             +PVKRQTR+WAAWTR+EEESFF+ALR VGKNFEKIT RVQSKNKDQVRHYYYRLVRRMNK
Sbjct  40    KPVKRQTRQWAAWTRQEEESFFTALRQVGKNFEKITCRVQSKNKDQVRHYYYRLVRRMNK  99

Query  610   LLGPELCLNAKNSRDTNAAMLRWWSLLEKYSCKASKLHLKPRRFKIFIETLENQLLKDRK  789
             LLGP   L+AKNS+DTNAAMLRWWSLLEKYSCKASKLHLKPRRFKIFIE LE+QLLKDRK
Sbjct  100   LLGPGFSLDAKNSKDTNAAMLRWWSLLEKYSCKASKLHLKPRRFKIFIEALEHQLLKDRK  159

Query  790   KNVRRCFSQGEN-TSTAPISVSNQGRGASGHDGRSVKVVLLDNQDIHKFGSGKGSSLKRH  966
             KN+R+  SQG N +STAP +VS+Q R ASG++ R+VK+VL+++Q++ K G GKGSSLKR+
Sbjct  160   KNIRKRPSQGGNCSSTAPNTVSSQSR-ASGNETRAVKLVLVESQNVQKLGPGKGSSLKRN  218

Query  967   INIGANSTSCKADSSLLKTARHRRKIGA---TAAYKRWEKAAIAGVSLVADAAEHLERTT  1137
             +N+G N ++ K DSS +KTAR R+K  A   +AAYKRWEKAAIAGVSLVADAAEHLERTT
Sbjct  219   VNVGVNRSNSKGDSSAMKTARQRQKPAAAVSSAAYKRWEKAAIAGVSLVADAAEHLERTT  278

Query  1138  TDKEDGHFQDSNVRNVFEHSGKDPHVFPDLLHNSFNETNLQNSGKLKLQLFPVDDGTRRA  1317
              DKE  H Q +  +  F+  G+     P    N F ++N+Q S KLKLQLFP+D+GTRRA
Sbjct  279   NDKEVEHDQSAPGQRGFDAVGEVLPPVPTFSQNMFVKSNVQTSTKLKLQLFPIDEGTRRA  338

Query  1318  LELDNHNPYLELTLSTRKKMSSVLEHLNRKWGNSSMACGDLMLFPYHLHKENLVHFQKWT  1497
             LE+D HNP+LELTLSTRKK+SSVLEHL RKWGNS +A G+LMLFPY + + NL    +WT
Sbjct  339   LEMDKHNPHLELTLSTRKKISSVLEHLTRKWGNSGIASGELMLFPYSVQRGNLAGHPRWT  398

Query  1498  KDTTLTAADVYALTGSPPVFRLRYGWFSNAE---VAFRAPVSS-AIPSRHDANMN-----  1650
             +D+++TAADVY + GSPPVFRLRYGWFSN E   VAF+AP++S  I   H+  +N     
Sbjct  399   QDSSVTAADVYEIIGSPPVFRLRYGWFSNTEISSVAFQAPLASCTILGEHNMEVNNRKKQ  458

Query  1651  IMPESSVGVLQAPSTDPP--------KEANGCVSMNTV---------------------N  1743
             IM   S  +   P TD          K+ +  ++ NTV                     N
Sbjct  459   IM--DSRPIHAPPPTDHQSEKLVERCKDRSTLLTGNTVVPSSNNAQEEMTRYVNVASNSN  516

Query  1744  ASRSSDHTEAVLW-----ENPETVVTEAEVDDLQFNKAGTSCVGEWADSLTNISVGDLLS  1908
                SS+    + W     E+   ++   EVDDL+ + +     GEWADSLTNISVGDLL+
Sbjct  517   LMESSEAAANISWHQRESEDDSIMMPLEEVDDLRISSSTALSTGEWADSLTNISVGDLLA  576

Query  1909  EAPDMEDANCITSSIHSSSNYIHQIPFSCDSFDAAIAAHIKKHQNVTDSQAALPSQLSSI  2088
             +     D +C+   +  SS Y  QIPFSCDSFDAAIAAHI KHQ+ T  Q+AL S   SI
Sbjct  577   DVSQEMDTSCVNPPVSGSSQYPQQIPFSCDSFDAAIAAHISKHQDKTSFQSALVSHAPSI  636

Query  2089  WGAEDTCDAFAFQRHSL-SEKVQNASKHTSLETCKQITLANTTALGASVEDLPGARNPVD  2265
             W AE+TCD F+FQ++ +  ++V ++SK  S    +QI   N+   G  +E+LP     +D
Sbjct  637   WDAEETCDGFSFQKNPVFHQEVLSSSKIASPGASEQIARINSVGSGCLIEELPNVERLLD  696

Query  2266  GDAATADLESVHYSPT-----SDVVKDFNGLSDVYWPDSLGPLDLDIPSSRYHSE-LILS  2427
              D A  DL  +  SP+         KD +GL+D+YWPDSLGPLDLDIPSSRYH+E LILS
Sbjct  697   -DPAHGDL--MDDSPSDPHMLDSTAKDLSGLADIYWPDSLGPLDLDIPSSRYHNEDLILS  753

Query  2428  DSLGGLTQLIASSLDAFQNCSFFGADKKEPVSTTEAQE  2541
             +SL GL  LIA+S+DAFQNCSFFG DKKEP ST EA+E
Sbjct  754   ESLSGLKSLIANSVDAFQNCSFFGLDKKEPASTVEARE  791



>ref|XP_007027385.1| TSL-kinase interacting protein 1, putative isoform 1 [Theobroma 
cacao]
 gb|EOY07887.1| TSL-kinase interacting protein 1, putative isoform 1 [Theobroma 
cacao]
Length=805

 Score =   801 bits (2070),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 451/840 (54%), Positives = 558/840 (66%), Gaps = 110/840 (13%)
 Frame = +1

Query  211   IQMELQLTLGSEADHYLRSSPRKDGDFTFGKVNCVEQQIASSQEHAIPEQAMFSQDHSVT  390
             +Q E Q++L SEA+ +    P + GD       CV    +S+  +A+PEQ          
Sbjct  1     MQTESQVSLASEANCHQEHIPIQIGD------PCV---ASSTPNNAVPEQ----------  41

Query  391   EQLASFEEHSALQQPVKRQTRKWAAWTREEEESFFSALRHVGKNFEKITSRVQSKNKDQV  570
                           P K+ TR+WAAWTR+EEESFF+ALR VGKNFEKIT RVQSKNKDQV
Sbjct  42    --------------PAKKPTRQWAAWTRQEEESFFTALRQVGKNFEKITCRVQSKNKDQV  87

Query  571   RHYYYRLVRRMNKLLGPELCLNAKNSRDTNAAMLRWWSLLEKYSCKASKLHLKPRRFKIF  750
             RHYYYRLVRRMNKLLGP LCL+AKNS+DTNAAMLRWWSLLEKYSC+ASKLHLKPRRFKIF
Sbjct  88    RHYYYRLVRRMNKLLGPGLCLDAKNSKDTNAAMLRWWSLLEKYSCRASKLHLKPRRFKIF  147

Query  751   IETLENQLLKDRKKNVRRCFSQGENTS-TAPISVSNQGRGASGHDGRSVKVVLLDNQDIH  927
             +E LE+QLLKDRKKNVR+  SQGEN+S T+P +V+NQ R ASGHD R+VK+VL+D+Q+I 
Sbjct  148   VEALEHQLLKDRKKNVRKRPSQGENSSPTSPSTVTNQSR-ASGHDARTVKLVLVDSQNIQ  206

Query  928   KFGSGKGSSLKRHINIGANSTSCKADSSLLKTARHRRKIG-ATAAYKRWEKAAIAGVSLV  1104
             K G GKG S KR+ N+G N ++ K +S+ +K AR RRK G ++AAYK+WEKAAIAGVSLV
Sbjct  207   KLGPGKG-SFKRNTNVGVNRSNSKGESNTMKPARQRRKPGSSSAAYKKWEKAAIAGVSLV  265

Query  1105  ADAAEHLERTTTDKEDGHFQDSNV--RNVFEHSGKDPHVFPDLLHNSFNETNLQNSGKLK  1278
             ADAAEHLERTTTDKE  H QDS+V    + +    +    P    N   E+N+ ++GKLK
Sbjct  266   ADAAEHLERTTTDKEAEHDQDSSVPGHKILDPVETNQPPLPVFSQNPLVESNIHSAGKLK  325

Query  1279  LQLFPVDDGTRRALELDNHNPYLELTLSTRKKMSSVLEHLNRKWGNSSMACGDLMLFPYH  1458
             LQLFP+DD TRRALE+D HNP+LELTLSTRKK+SSVLEHL RKWGNSS+A G+LMLFPY 
Sbjct  326   LQLFPIDDSTRRALEMDKHNPHLELTLSTRKKISSVLEHLTRKWGNSSVASGELMLFPYG  385

Query  1459  LHKENLVHFQKWTKDTTLTAADVYALTGSPPVFRLRYGWFSNAEVA---FRAPVSSAIPS  1629
             + +ENL+ +Q+WT+ + ++AADVYA+ GSP VFRLRYGWFS+AEVA   ++APVSS IPS
Sbjct  386   VQRENLMGYQRWTQASIVSAADVYAMIGSPQVFRLRYGWFSDAEVASLTWQAPVSSYIPS  445

Query  1630  RHDANMN-----IMPESSVG--------------------------VLQAPSTDPPKE--  1710
              H+ N+      I  E  V                            LQ P T+ P E  
Sbjct  446   EHNVNVEGRNGCIAEEVQVSALSTSDQSKKLDDPCNNQPTLRKENHALQPPLTNFPSEIS  505

Query  1711  -----------ANGCVSMNTVNASRSSDHTEAVLWENPETVVTEAEVDDLQFNKAGTSC-  1854
                         +  + +   +A RS     A+L +         +VDD + N    +  
Sbjct  506   RFICAGPKDNLGDSPIPVRHASADRSETCNVAILRQ-------LEDVDDQRLNNNTAALS  558

Query  1855  VGEWADSLTNISVGDLLSEAPDMEDANCITSSIHSSSNYIHQIPFSCDSFDAAIAAHIKK  2034
              GEWADSLTNISVGDLL+E P   D NC+   +  SS  + QIPFSCDSFDAAIAAHI +
Sbjct  559   AGEWADSLTNISVGDLLAEVPHDLDDNCVDHPVAESSQCLQQIPFSCDSFDAAIAAHISR  618

Query  2035  HQNVTDSQAALPSQLSSIWGAEDTCDAFAFQR-HSLSEKVQNASKHTSLETCKQITLANT  2211
             HQN  +   +L S  SSIW AE+TCDAF+F + H     V   S   +   CKQIT +N+
Sbjct  619   HQNKMEV-PSLASHPSSIWDAEETCDAFSFSKNHIPCADVPRLSSAVA-AACKQITRSNS  676

Query  2212  TALGA----SVEDLPGARNPVDGDAATADLESVHYSPTSDVV-----KDFNGLSDVYWPD  2364
                G       ++ P    P++ ++A  DL  V  SP+   +     KDFNGL+D+YWPD
Sbjct  677   AGSGTLNKLLPQESPDLEEPME-NSACEDL--VDESPSDPHIMDTTEKDFNGLTDIYWPD  733

Query  2365  SLGPLDLDIPSSRYHSE-LILSDSLGGLTQLIASSLDAFQNCSFFGADKKEPVSTTEAQE  2541
             SLGPLDLD+PS +YH+E LIL DSLGGL +LIASSLDAFQNCSFFG DKKE  ST  A++
Sbjct  734   SLGPLDLDVPSCKYHNEDLILGDSLGGLNRLIASSLDAFQNCSFFGLDKKESTSTVGARD  793



>emb|CDP16915.1| unnamed protein product [Coffea canephora]
Length=783

 Score =   798 bits (2061),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 436/757 (58%), Positives = 534/757 (71%), Gaps = 59/757 (8%)
 Frame = +1

Query  403   SFEEHSALQQPVKRQTRKWAAWTREEEESFFSALRHVGKNFEKITSRVQSKNKDQVRHYY  582
             S ++ +A   PVKR TR+WAAWT +EEESFFSALR   +NFEKIT RVQSKNKDQVRHYY
Sbjct  31    SLQDKNASTLPVKRPTRQWAAWTHQEEESFFSALR---QNFEKITCRVQSKNKDQVRHYY  87

Query  583   YRLVRRMNKLLGPELCLNAKNSRDTNAAMLRWWSLLEKYSCKASKLHLKPRRFKIFIETL  762
             YRLVRRMNKLLGPELCL+AKNS+DTNAAMLRWWSLLEKYSCKASKLHLKPRRFK+F+ETL
Sbjct  88    YRLVRRMNKLLGPELCLDAKNSKDTNAAMLRWWSLLEKYSCKASKLHLKPRRFKLFVETL  147

Query  763   ENQLLKDRKKNVRRCFSQGENTS-TAPISVSNQGRGASGHDGRSVKVVLLDNQDIHKFGS  939
             E QLLKDRKKNVR+  SQGEN+S TAP  + NQG+  S H+ R VK VL+D+Q+I K G 
Sbjct  148   ETQLLKDRKKNVRKRASQGENSSITAPTGLPNQGK-VSCHESRVVKDVLIDSQNIPKPGI  206

Query  940   GKGSSLKRHINIGANSTSCKADSSLLKTARHRRKIGAT--AAYKRWEKAAIAGVSLVADA  1113
             GKGSS+ RH+NIG N  + K+  S LKTAR++RK GAT  AAYKRWEKAAIAGVSLVADA
Sbjct  207   GKGSSIYRHLNIGINRGNYKSGPSALKTARYQRKAGATSKAAYKRWEKAAIAGVSLVADA  266

Query  1114  AEHLERTTTDKEDGHFQDSNVRNVFEHSGKDPHVFPDLLHNSFNETNLQNSGKLKLQLFP  1293
             AEHLERT TD+E  H +D++V+N F++ GK   V P +L+      N+Q+S KLKLQLFP
Sbjct  267   AEHLERTATDREVEHVEDAHVQNAFDYCGK---VMPSILN------NMQSSMKLKLQLFP  317

Query  1294  VDDGTRRALELDNHNPYLELTLSTRKKMSSVLEHLNRKWGNSSMACGDLMLFPYHLHKEN  1473
             +D+ TRRALE+D HNPYLELTLSTRKK+SSVLEHLNRKWG SS+A G+LML PY + + N
Sbjct  318   IDEATRRALEMDKHNPYLELTLSTRKKISSVLEHLNRKWGQSSIASGELMLLPYFVQQAN  377

Query  1474  LVHFQKWTKDTTLTAADVYALTGSPPVFRLRYGWFSNAEVAFRAPVSS-AIPSRHDANMN  1650
              V   KW KD+ L+A+DVYA  G+PPVFRLRYGWF +A+      ++S + P++H    +
Sbjct  378   QVSCPKWAKDSVLSASDVYAQIGNPPVFRLRYGWFPHADPGSATSLASLSCPTQHHTETS  437

Query  1651  IMPESSV----------------------GVLQA-------PSTDPPKEANGCVSMNT-V  1740
             I+ E  V                      G+L A       PS+  P    GC  +   V
Sbjct  438   IVNEQIVDTTPKSSPPTYQEAENLLGIHEGLLSAAKMTTLTPSSRLPNHTIGCAGIGPDV  497

Query  1741  NASRSSDHTEAVLWENPET-----VVTEAEVDDLQFNKAGTSCVGEWADSLTNISVGDLL  1905
             N  +SS+HT A +    E+     VV E  +DDL+ +K      GEWADSLTNIS+GDLL
Sbjct  498   NTVKSSNHTAAHVLNRRESTTDTVVVQEENLDDLRPHKTVALSAGEWADSLTNISIGDLL  557

Query  1906  SEAPDMEDANCITSSIHSSSNYIHQIPFSCDSFDAAIAAHIKKHQNVTDSQAALPSQLSS  2085
             +EA    + NCI S+   +S+ + QIPFSCDSFDAAIAAHI KHQ+ +  Q  L +  SS
Sbjct  558   TEASHNGEVNCIDSTELRNSHCLQQIPFSCDSFDAAIAAHIYKHQSRSALQPPLHTNTSS  617

Query  2086  IWGAEDTCDAFAFQRHSL-SEKVQNASKHTSLETCKQITLANTTALGASVEDLPGARNPV  2262
             IW  E+TCDAF FQ++S+ SE+ QNAS+ +  ET ++I   ++ A G + E  P    P+
Sbjct  618   IWDGEETCDAFVFQKNSVFSEEFQNASRISPPETSREIASTSSAASGKAQESDP--EEPL  675

Query  2263  DGDAATADL-ESVHYSPTS--DVVKDFNGLSDVYWPDSLGPLDLDIPSSRYHS-ELILSD  2430
               D    D+ +  H    S  D  +D NGL+D+YWPDSLG LDLDI S RY S +LILSD
Sbjct  676   PDDPMHGDIVDKCHADQHSFDDSQRDLNGLTDIYWPDSLGALDLDISSCRYRSDDLILSD  735

Query  2431  SLGGLTQLIASSLDAFQNCSFFGADKKEPVSTTEAQE  2541
             SLGGL +LIASSLDAFQ+CSFFG+DKKE  S  EA E
Sbjct  736   SLGGLNRLIASSLDAFQSCSFFGSDKKESASAVEAGE  772



>ref|XP_007027386.1| TSL-kinase interacting protein 1, putative isoform 2 [Theobroma 
cacao]
 gb|EOY07888.1| TSL-kinase interacting protein 1, putative isoform 2 [Theobroma 
cacao]
Length=780

 Score =   793 bits (2048),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 449/838 (54%), Positives = 553/838 (66%), Gaps = 131/838 (16%)
 Frame = +1

Query  211   IQMELQLTLGSEADHYLRSSPRKDGDFTFGKVNCVEQQIASSQEHAIPEQAMFSQDHSVT  390
             +Q E Q++L SEA+ +    P + GD       CV    +S+  +A+PEQ          
Sbjct  1     MQTESQVSLASEANCHQEHIPIQIGD------PCV---ASSTPNNAVPEQ----------  41

Query  391   EQLASFEEHSALQQPVKRQTRKWAAWTREEEESFFSALRHVGKNFEKITSRVQSKNKDQV  570
                           P K+ TR+WAAWTR+EEESFF+ALR VGKNFEKIT RVQSKNKDQV
Sbjct  42    --------------PAKKPTRQWAAWTRQEEESFFTALRQVGKNFEKITCRVQSKNKDQV  87

Query  571   RHYYYRLVRRMNKLLGPELCLNAKNSRDTNAAMLRWWSLLEKYSCKASKLHLKPRRFKIF  750
             RHYYYRLVRRMNKLLGP LCL+AKNS+DTNAAMLRWWSLLEKYSC+ASKLHLKPRRFKIF
Sbjct  88    RHYYYRLVRRMNKLLGPGLCLDAKNSKDTNAAMLRWWSLLEKYSCRASKLHLKPRRFKIF  147

Query  751   IETLENQLLKDRKKNVRRCFSQGENTS-TAPISVSNQGRGASGHDGRSVKVVLLDNQDIH  927
             +E LE+QLLKDRKKNVR+  SQGEN+S T+P +V+NQ R ASGHD R+VK+VL+D+Q+I 
Sbjct  148   VEALEHQLLKDRKKNVRKRPSQGENSSPTSPSTVTNQSR-ASGHDARTVKLVLVDSQNIQ  206

Query  928   KFGSGKGSSLKRHINIGANSTSCKADSSLLKTARHRRKIG-ATAAYKRWEKAAIAGVSLV  1104
             K G GKG S KR+ N+G N ++ K +S+ +K AR RRK G ++AAYK+WEKAAIAGVSLV
Sbjct  207   KLGPGKG-SFKRNTNVGVNRSNSKGESNTMKPARQRRKPGSSSAAYKKWEKAAIAGVSLV  265

Query  1105  ADAAEHLERTTTDKEDGHFQDSNVRNVFEHSGKDPHVFPDLLHNSFNETNLQNSGKLKLQ  1284
             ADAAEHLERTTTDKE  H QDS+V                       E+N+ ++GKLKLQ
Sbjct  266   ADAAEHLERTTTDKEAEHDQDSSV-----------------------ESNIHSAGKLKLQ  302

Query  1285  LFPVDDGTRRALELDNHNPYLELTLSTRKKMSSVLEHLNRKWGNSSMACGDLMLFPYHLH  1464
             LFP+DD TRRALE+D HNP+LELTLSTRKK+SSVLEHL RKWGNSS+A G+LMLFPY + 
Sbjct  303   LFPIDDSTRRALEMDKHNPHLELTLSTRKKISSVLEHLTRKWGNSSVASGELMLFPYGVQ  362

Query  1465  KENLVHFQKWTKDTTLTAADVYALTGSPPVFRLRYGWFSNAEVA---FRAPVSSAIPSRH  1635
             +ENL+ +Q+WT+ + ++AADVYA+ GSP VFRLRYGWFS+AEVA   ++APVSS IPS H
Sbjct  363   RENLMGYQRWTQASIVSAADVYAMIGSPQVFRLRYGWFSDAEVASLTWQAPVSSYIPSEH  422

Query  1636  DANMN-----IMPESSVG--------------------------VLQAPSTDPPKE----  1710
             + N+      I  E  V                            LQ P T+ P E    
Sbjct  423   NVNVEGRNGCIAEEVQVSALSTSDQSKKLDDPCNNQPTLRKENHALQPPLTNFPSEISRF  482

Query  1711  ---------ANGCVSMNTVNASRSSDHTEAVLWENPETVVTEAEVDDLQFNKAGTSC-VG  1860
                       +  + +   +A RS     A+L +         +VDD + N    +   G
Sbjct  483   ICAGPKDNLGDSPIPVRHASADRSETCNVAILRQ-------LEDVDDQRLNNNTAALSAG  535

Query  1861  EWADSLTNISVGDLLSEAPDMEDANCITSSIHSSSNYIHQIPFSCDSFDAAIAAHIKKHQ  2040
             EWADSLTNISVGDLL+E P   D NC+   +  SS  + QIPFSCDSFDAAIAAHI +HQ
Sbjct  536   EWADSLTNISVGDLLAEVPHDLDDNCVDHPVAESSQCLQQIPFSCDSFDAAIAAHISRHQ  595

Query  2041  NVTDSQAALPSQLSSIWGAEDTCDAFAFQR-HSLSEKVQNASKHTSLETCKQITLANTTA  2217
             N  +   +L S  SSIW AE+TCDAF+F + H     V   S   +   CKQIT +N+  
Sbjct  596   NKMEV-PSLASHPSSIWDAEETCDAFSFSKNHIPCADVPRLSSAVA-AACKQITRSNSAG  653

Query  2218  LGA----SVEDLPGARNPVDGDAATADLESVHYSPTSDVV-----KDFNGLSDVYWPDSL  2370
              G       ++ P    P++ ++A  DL  V  SP+   +     KDFNGL+D+YWPDSL
Sbjct  654   SGTLNKLLPQESPDLEEPME-NSACEDL--VDESPSDPHIMDTTEKDFNGLTDIYWPDSL  710

Query  2371  GPLDLDIPSSRYHSE-LILSDSLGGLTQLIASSLDAFQNCSFFGADKKEPVSTTEAQE  2541
             GPLDLD+PS +YH+E LIL DSLGGL +LIASSLDAFQNCSFFG DKKE  ST  A++
Sbjct  711   GPLDLDVPSCKYHNEDLILGDSLGGLNRLIASSLDAFQNCSFFGLDKKESTSTVGARD  768



>ref|XP_006493020.1| PREDICTED: TSL-kinase interacting protein 1-like isoform X1 [Citrus 
sinensis]
 ref|XP_006493021.1| PREDICTED: TSL-kinase interacting protein 1-like isoform X2 [Citrus 
sinensis]
 ref|XP_006493022.1| PREDICTED: TSL-kinase interacting protein 1-like isoform X3 [Citrus 
sinensis]
Length=799

 Score =   786 bits (2030),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 440/827 (53%), Positives = 545/827 (66%), Gaps = 91/827 (11%)
 Frame = +1

Query  211   IQMELQLTLGSEADHYLRSSPRKDGDFTFGKVNCVEQQIASSQEHAIPEQAMFSQDHSVT  390
             +QME QL++ SE   + R++P +D D          + +ASS           + D+ + 
Sbjct  1     MQMESQLSMNSEVHLHPRNTPVQDED---------PRVVASS-----------TLDNVI-  39

Query  391   EQLASFEEHSALQQPVKRQTRKWAAWTREEEESFFSALRHVGKNFEKITSRVQSKNKDQV  570
                        LQQ  KR TR+WAAWTREEEESFF+ALR VGKNFEKIT RV+SKNKDQV
Sbjct  40    -----------LQQSAKRPTRQWAAWTREEEESFFTALRQVGKNFEKITHRVRSKNKDQV  88

Query  571   RHYYYRLVRRMNKLLGPELCLNAKNSRDTNAAMLRWWSLLEKYSCKASKLHLKPRRFKIF  750
             RHYYYRLVRRMNKLLGP LCL+AKNS+DTNAAMLRWWSLLEKYSCKASKLHLKPRRFKIF
Sbjct  89    RHYYYRLVRRMNKLLGPGLCLDAKNSKDTNAAMLRWWSLLEKYSCKASKLHLKPRRFKIF  148

Query  751   IETLENQLLKDRKKNVRRCFSQGENTS-TAPISVSNQGRGASGHDGRSVKVVLLDNQDIH  927
             +E LE+QLLKDRK++VR+  SQ ++ S TAP  + NQ R  SG D  +VK+VL+D+Q+I 
Sbjct  149   VEALEHQLLKDRKRSVRKRPSQRDSYSPTAPTPIPNQSR-TSGQDTCTVKLVLVDSQNIQ  207

Query  928   KFGSGKGSSLKRHINIGANSTSCKADSSLLKTARHRRKIG---ATAAYKRWEKAAIAGVS  1098
             K G  KG SLKR++NIG N ++ KADS+ LK  R RRK     ++AAYK+WEKAAIAGVS
Sbjct  208   KLGPAKG-SLKRNVNIGINRSNNKADSATLK-PRQRRKPADSISSAAYKKWEKAAIAGVS  265

Query  1099  LVADAAEHLERTTTDKEDGHFQDSNVRNVFEHSGKDPHVFPDLLHNSFNETNLQNSGKLK  1278
             LVADAAEHLERT+TDKE    Q        E + K     P +    F E N+Q   KLK
Sbjct  266   LVADAAEHLERTSTDKEVERQQGELEHTALETADKVLPPLPTISPTLFAEGNVQTPVKLK  325

Query  1279  LQLFPVDDGTRRALELDNHNPYLELTLSTRKKMSSVLEHLNRKWGNSSMACGDLMLFPYH  1458
             LQL+P+DDGTR+ALE+DNHNP+LELTLSTRKK+SSVLEHLNRKWGN+S+A G+LMLFPY 
Sbjct  326   LQLYPIDDGTRKALEMDNHNPHLELTLSTRKKISSVLEHLNRKWGNASVASGELMLFPYG  385

Query  1459  LHKENLVHFQKWTKDTTLTAADVYALTGSPPVFRLRYGWFSNAEVAFRAP----VSSAIP  1626
               +ENLV +Q+WT+D+  +AADVYA+ GSPP+FRLRYGWFS+ E+ + AP     S  +P
Sbjct  386   AQRENLVGYQRWTQDSVFSAADVYAMIGSPPMFRLRYGWFSDTELGYVAPHAPSASGCVP  445

Query  1627  SRHDANMNIMPESSVGVL--QAPST--------DP--------------------PKEAN  1716
             S H+ N+    E  V  +  + PST        DP                    PKE +
Sbjct  446   SFHNINVENKKEQIVDSVPGRVPSTSDQSENFVDPYKKLTSVKENDTFATSSSSMPKETS  505

Query  1717  GCVSMNTVNASRSSDHTEAVLWENPET----VVTEAE-VDDLQFNKAGTSCVGEWADSLT  1881
               +S +  + + +SD    V W   ET    +  +AE + D + +       GEWADSLT
Sbjct  506   SYISTSKCDIADTSDPAANVSWPRKETGNEIITGQAEDMGDERLSSGTALSAGEWADSLT  565

Query  1882  NISVGDLLSEAPDMEDANCITSSIHSSSNYIHQIPFSCDSFDAAIAAHIKKHQNVTDSQA  2061
             NISVGDLL+E P   DA    + +  SS  + QIPFSCDSFDAAIAAHI +HQN   + +
Sbjct  566   NISVGDLLAEVPHDLDA----APVAESSQCLQQIPFSCDSFDAAIAAHISRHQNKMGALS  621

Query  2062  ALPSQLSSIWGAEDTCDAFAFQRHSLSEKVQNASKHTSLET----CKQITLANTTALGAS  2229
              L S  SSIW AE+TCDAF+FQ++ +       S+   +      C+QI   N+   G  
Sbjct  622   TLASHASSIWDAEETCDAFSFQKNPV--LCNGVSRLPDIAPPAADCEQIARTNSVGSGGF  679

Query  2230  VEDLPGARNPVDGDAATADLESVHYSPTS--DVVKDFNGLSDVYWPDSLGPLDLDIPSSR  2403
              E+L  A  P D  A    ++    +P +  + V DFNGL+D+YWPDSLGPLDLDIPSS+
Sbjct  680   FEELLDAEGPTDYPAHEDPMDDCLRNPHTLDNSVNDFNGLTDIYWPDSLGPLDLDIPSSK  739

Query  2404  YHSE-LILSDSLGGLTQLIASSLDAFQNCSFFGADKKEPVSTTEAQE  2541
             Y  E +ILSDSLGGL +LIASSLDAFQNCSFFG DKKEP  T EA E
Sbjct  740   YRGEDIILSDSLGGLNRLIASSLDAFQNCSFFGLDKKEPTPTVEAGE  786



>ref|XP_006493023.1| PREDICTED: TSL-kinase interacting protein 1-like isoform X4 [Citrus 
sinensis]
Length=798

 Score =   786 bits (2030),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 440/826 (53%), Positives = 545/826 (66%), Gaps = 90/826 (11%)
 Frame = +1

Query  211   IQMELQLTLGSEADHYLRSSPRKDGDFTFGKVNCVEQQIASSQEHAIPEQAMFSQDHSVT  390
             +QME QL++ SE   + R++P +D D          + +ASS           + D+ + 
Sbjct  1     MQMESQLSMNSEVHLHPRNTPVQDED---------PRVVASS-----------TLDNVI-  39

Query  391   EQLASFEEHSALQQPVKRQTRKWAAWTREEEESFFSALRHVGKNFEKITSRVQSKNKDQV  570
                        LQQ  KR TR+WAAWTREEEESFF+ALR VGKNFEKIT RV+SKNKDQV
Sbjct  40    -----------LQQSAKRPTRQWAAWTREEEESFFTALRQVGKNFEKITHRVRSKNKDQV  88

Query  571   RHYYYRLVRRMNKLLGPELCLNAKNSRDTNAAMLRWWSLLEKYSCKASKLHLKPRRFKIF  750
             RHYYYRLVRRMNKLLGP LCL+AKNS+DTNAAMLRWWSLLEKYSCKASKLHLKPRRFKIF
Sbjct  89    RHYYYRLVRRMNKLLGPGLCLDAKNSKDTNAAMLRWWSLLEKYSCKASKLHLKPRRFKIF  148

Query  751   IETLENQLLKDRKKNVRRCFSQGENTS-TAPISVSNQGRGASGHDGRSVKVVLLDNQDIH  927
             +E LE+QLLKDRK++VR+  SQ ++ S TAP  + NQ R  SG D  +VK+VL+D+Q+I 
Sbjct  149   VEALEHQLLKDRKRSVRKRPSQRDSYSPTAPTPIPNQSR-TSGQDTCTVKLVLVDSQNIQ  207

Query  928   KFGSGKGSSLKRHINIGANSTSCKADSSLLKTARHRRKIG--ATAAYKRWEKAAIAGVSL  1101
             K G  KG SLKR++NIG N ++ KADS+ LK  R RRK    ++AAYK+WEKAAIAGVSL
Sbjct  208   KLGPAKG-SLKRNVNIGINRSNNKADSATLK-PRQRRKPDSISSAAYKKWEKAAIAGVSL  265

Query  1102  VADAAEHLERTTTDKEDGHFQDSNVRNVFEHSGKDPHVFPDLLHNSFNETNLQNSGKLKL  1281
             VADAAEHLERT+TDKE    Q        E + K     P +    F E N+Q   KLKL
Sbjct  266   VADAAEHLERTSTDKEVERQQGELEHTALETADKVLPPLPTISPTLFAEGNVQTPVKLKL  325

Query  1282  QLFPVDDGTRRALELDNHNPYLELTLSTRKKMSSVLEHLNRKWGNSSMACGDLMLFPYHL  1461
             QL+P+DDGTR+ALE+DNHNP+LELTLSTRKK+SSVLEHLNRKWGN+S+A G+LMLFPY  
Sbjct  326   QLYPIDDGTRKALEMDNHNPHLELTLSTRKKISSVLEHLNRKWGNASVASGELMLFPYGA  385

Query  1462  HKENLVHFQKWTKDTTLTAADVYALTGSPPVFRLRYGWFSNAEVAFRAP----VSSAIPS  1629
              +ENLV +Q+WT+D+  +AADVYA+ GSPP+FRLRYGWFS+ E+ + AP     S  +PS
Sbjct  386   QRENLVGYQRWTQDSVFSAADVYAMIGSPPMFRLRYGWFSDTELGYVAPHAPSASGCVPS  445

Query  1630  RHDANMNIMPESSVGVL--QAPST--------DP--------------------PKEANG  1719
              H+ N+    E  V  +  + PST        DP                    PKE + 
Sbjct  446   FHNINVENKKEQIVDSVPGRVPSTSDQSENFVDPYKKLTSVKENDTFATSSSSMPKETSS  505

Query  1720  CVSMNTVNASRSSDHTEAVLWENPET----VVTEAE-VDDLQFNKAGTSCVGEWADSLTN  1884
              +S +  + + +SD    V W   ET    +  +AE + D + +       GEWADSLTN
Sbjct  506   YISTSKCDIADTSDPAANVSWPRKETGNEIITGQAEDMGDERLSSGTALSAGEWADSLTN  565

Query  1885  ISVGDLLSEAPDMEDANCITSSIHSSSNYIHQIPFSCDSFDAAIAAHIKKHQNVTDSQAA  2064
             ISVGDLL+E P   DA    + +  SS  + QIPFSCDSFDAAIAAHI +HQN   + + 
Sbjct  566   ISVGDLLAEVPHDLDA----APVAESSQCLQQIPFSCDSFDAAIAAHISRHQNKMGALST  621

Query  2065  LPSQLSSIWGAEDTCDAFAFQRHSLSEKVQNASKHTSLET----CKQITLANTTALGASV  2232
             L S  SSIW AE+TCDAF+FQ++ +       S+   +      C+QI   N+   G   
Sbjct  622   LASHASSIWDAEETCDAFSFQKNPV--LCNGVSRLPDIAPPAADCEQIARTNSVGSGGFF  679

Query  2233  EDLPGARNPVDGDAATADLESVHYSPTS--DVVKDFNGLSDVYWPDSLGPLDLDIPSSRY  2406
             E+L  A  P D  A    ++    +P +  + V DFNGL+D+YWPDSLGPLDLDIPSS+Y
Sbjct  680   EELLDAEGPTDYPAHEDPMDDCLRNPHTLDNSVNDFNGLTDIYWPDSLGPLDLDIPSSKY  739

Query  2407  HSE-LILSDSLGGLTQLIASSLDAFQNCSFFGADKKEPVSTTEAQE  2541
               E +ILSDSLGGL +LIASSLDAFQNCSFFG DKKEP  T EA E
Sbjct  740   RGEDIILSDSLGGLNRLIASSLDAFQNCSFFGLDKKEPTPTVEAGE  785



>ref|XP_006493024.1| PREDICTED: TSL-kinase interacting protein 1-like isoform X5 [Citrus 
sinensis]
Length=796

 Score =   785 bits (2026),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 440/827 (53%), Positives = 546/827 (66%), Gaps = 94/827 (11%)
 Frame = +1

Query  211   IQMELQLTLGSEADHYLRSSPRKDGDFTFGKVNCVEQQIASSQEHAIPEQAMFSQDHSVT  390
             +QME QL++ SE   + R++P +D D          + +ASS           + D+ + 
Sbjct  1     MQMESQLSMNSEVHLHPRNTPVQDED---------PRVVASS-----------TLDNVI-  39

Query  391   EQLASFEEHSALQQPVKRQTRKWAAWTREEEESFFSALRHVGKNFEKITSRVQSKNKDQV  570
                        LQQ  KR TR+WAAWTREEEESFF+ALR VGKNFEKIT RV+SKNKDQV
Sbjct  40    -----------LQQSAKRPTRQWAAWTREEEESFFTALRQVGKNFEKITHRVRSKNKDQV  88

Query  571   RHYYYRLVRRMNKLLGPELCLNAKNSRDTNAAMLRWWSLLEKYSCKASKLHLKPRRFKIF  750
             RHYYYRLVRRMNKLLGP LCL+AKNS+DTNAAMLRWWSLLEKYSCKASKLHLKPRRFKIF
Sbjct  89    RHYYYRLVRRMNKLLGPGLCLDAKNSKDTNAAMLRWWSLLEKYSCKASKLHLKPRRFKIF  148

Query  751   IETLENQLLKDRKKNVRRCFSQGENTS-TAPISVSNQGRGASGHDGRSVKVVLLDNQDIH  927
             +E LE+QLLKDRK++VR+  SQ ++ S TAP  + NQ R  SG D  +VK+VL+D+Q+I 
Sbjct  149   VEALEHQLLKDRKRSVRKRPSQRDSYSPTAPTPIPNQSR-TSGQDTCTVKLVLVDSQNIQ  207

Query  928   KFGSGKGSSLKRHINIGANSTSCKADSSLLKTARHRRKIG---ATAAYKRWEKAAIAGVS  1098
             K G  KG SLKR++NIG N ++ KADS+ LK  R RRK     ++AAYK+WEKAAIAGVS
Sbjct  208   KLGPAKG-SLKRNVNIGINRSNNKADSATLK-PRQRRKPADSISSAAYKKWEKAAIAGVS  265

Query  1099  LVADAAEHLERTTTDKEDGHFQDSNVRNVFEHSGKDPHVFPDLLHNSFNETNLQNSGKLK  1278
             LVADAAEHLERT+TDKE    Q+       E + K     P +    F E N+Q   KLK
Sbjct  266   LVADAAEHLERTSTDKEVERQQE---HTALETADKVLPPLPTISPTLFAEGNVQTPVKLK  322

Query  1279  LQLFPVDDGTRRALELDNHNPYLELTLSTRKKMSSVLEHLNRKWGNSSMACGDLMLFPYH  1458
             LQL+P+DDGTR+ALE+DNHNP+LELTLSTRKK+SSVLEHLNRKWGN+S+A G+LMLFPY 
Sbjct  323   LQLYPIDDGTRKALEMDNHNPHLELTLSTRKKISSVLEHLNRKWGNASVASGELMLFPYG  382

Query  1459  LHKENLVHFQKWTKDTTLTAADVYALTGSPPVFRLRYGWFSNAEVAFRAP----VSSAIP  1626
               +ENLV +Q+WT+D+  +AADVYA+ GSPP+FRLRYGWFS+ E+ + AP     S  +P
Sbjct  383   AQRENLVGYQRWTQDSVFSAADVYAMIGSPPMFRLRYGWFSDTELGYVAPHAPSASGCVP  442

Query  1627  SRHDANMNIMPESSVGVL--QAPST--------DP--------------------PKEAN  1716
             S H+ N+    E  V  +  + PST        DP                    PKE +
Sbjct  443   SFHNINVENKKEQIVDSVPGRVPSTSDQSENFVDPYKKLTSVKENDTFATSSSSMPKETS  502

Query  1717  GCVSMNTVNASRSSDHTEAVLWENPET----VVTEAE-VDDLQFNKAGTSCVGEWADSLT  1881
               +S +  + + +SD    V W   ET    +  +AE + D + +       GEWADSLT
Sbjct  503   SYISTSKCDIADTSDPAANVSWPRKETGNEIITGQAEDMGDERLSSGTALSAGEWADSLT  562

Query  1882  NISVGDLLSEAPDMEDANCITSSIHSSSNYIHQIPFSCDSFDAAIAAHIKKHQNVTDSQA  2061
             NISVGDLL+E P   DA    + +  SS  + QIPFSCDSFDAAIAAHI +HQN   + +
Sbjct  563   NISVGDLLAEVPHDLDA----APVAESSQCLQQIPFSCDSFDAAIAAHISRHQNKMGALS  618

Query  2062  ALPSQLSSIWGAEDTCDAFAFQRHSLSEKVQNASKHTSLET----CKQITLANTTALGAS  2229
              L S  SSIW AE+TCDAF+FQ++ +       S+   +      C+QI   N+   G  
Sbjct  619   TLASHASSIWDAEETCDAFSFQKNPV--LCNGVSRLPDIAPPAADCEQIARTNSVGSGGF  676

Query  2230  VEDLPGARNPVDGDAATADLESVHYSPTS--DVVKDFNGLSDVYWPDSLGPLDLDIPSSR  2403
              E+L  A  P D  A    ++    +P +  + V DFNGL+D+YWPDSLGPLDLDIPSS+
Sbjct  677   FEELLDAEGPTDYPAHEDPMDDCLRNPHTLDNSVNDFNGLTDIYWPDSLGPLDLDIPSSK  736

Query  2404  YHSE-LILSDSLGGLTQLIASSLDAFQNCSFFGADKKEPVSTTEAQE  2541
             Y  E +ILSDSLGGL +LIASSLDAFQNCSFFG DKKEP  T EA E
Sbjct  737   YRGEDIILSDSLGGLNRLIASSLDAFQNCSFFGLDKKEPTPTVEAGE  783



>ref|XP_006428399.1| hypothetical protein CICLE_v10011099mg [Citrus clementina]
 ref|XP_006428404.1| hypothetical protein CICLE_v10011099mg [Citrus clementina]
 gb|ESR41639.1| hypothetical protein CICLE_v10011099mg [Citrus clementina]
 gb|ESR41644.1| hypothetical protein CICLE_v10011099mg [Citrus clementina]
Length=795

 Score =   785 bits (2026),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 440/826 (53%), Positives = 546/826 (66%), Gaps = 93/826 (11%)
 Frame = +1

Query  211   IQMELQLTLGSEADHYLRSSPRKDGDFTFGKVNCVEQQIASSQEHAIPEQAMFSQDHSVT  390
             +QME QL++ SE   + R++P +D D          + +ASS           + D+ + 
Sbjct  1     MQMESQLSMNSEVHLHPRNTPVQDED---------PRVVASS-----------TLDNVI-  39

Query  391   EQLASFEEHSALQQPVKRQTRKWAAWTREEEESFFSALRHVGKNFEKITSRVQSKNKDQV  570
                        LQQ  KR TR+WAAWTREEEESFF+ALR VGKNFEKIT RV+SKNKDQV
Sbjct  40    -----------LQQSAKRPTRQWAAWTREEEESFFTALRQVGKNFEKITHRVRSKNKDQV  88

Query  571   RHYYYRLVRRMNKLLGPELCLNAKNSRDTNAAMLRWWSLLEKYSCKASKLHLKPRRFKIF  750
             RHYYYRLVRRMNKLLGP LCL+AKNS+DTNAAMLRWWSLLEKYSCKASKLHLKPRRFKIF
Sbjct  89    RHYYYRLVRRMNKLLGPGLCLDAKNSKDTNAAMLRWWSLLEKYSCKASKLHLKPRRFKIF  148

Query  751   IETLENQLLKDRKKNVRRCFSQGENTS-TAPISVSNQGRGASGHDGRSVKVVLLDNQDIH  927
             +E LE+QLLKDRK++VR+  SQ ++ S TAP  + NQ R  SG D  +VK+VL+D+Q+I 
Sbjct  149   VEALEHQLLKDRKRSVRKRPSQRDSYSPTAPTPIPNQSR-TSGQDTCTVKLVLVDSQNIQ  207

Query  928   KFGSGKGSSLKRHINIGANSTSCKADSSLLKTARHRRKIG--ATAAYKRWEKAAIAGVSL  1101
             K G  KG SLKR++NIG N ++ KADS+ LK  R RRK    ++AAYK+WEKAAIAGVSL
Sbjct  208   KLGPAKG-SLKRNVNIGINRSNNKADSATLK-PRQRRKPDSISSAAYKKWEKAAIAGVSL  265

Query  1102  VADAAEHLERTTTDKEDGHFQDSNVRNVFEHSGKDPHVFPDLLHNSFNETNLQNSGKLKL  1281
             VADAAEHLERT+TDKE    Q+       E + K     P +    F E N+Q   KLKL
Sbjct  266   VADAAEHLERTSTDKEVERQQE---HTALETADKVLPPLPTISPTLFAEGNVQTPVKLKL  322

Query  1282  QLFPVDDGTRRALELDNHNPYLELTLSTRKKMSSVLEHLNRKWGNSSMACGDLMLFPYHL  1461
             QL+P+DDGTR+ALE+DNHNP+LELTLSTRKK+SSVLEHLNRKWGN+S+A G+LMLFPY  
Sbjct  323   QLYPIDDGTRKALEMDNHNPHLELTLSTRKKISSVLEHLNRKWGNASVASGELMLFPYGA  382

Query  1462  HKENLVHFQKWTKDTTLTAADVYALTGSPPVFRLRYGWFSNAEVAFRAP----VSSAIPS  1629
              +ENLV +Q+WT+D+  +AADVYA+ GSPP+FRLRYGWFS+ E+ + AP     S  +PS
Sbjct  383   QRENLVGYQRWTQDSVFSAADVYAMIGSPPMFRLRYGWFSDTELGYVAPHAPSASGCVPS  442

Query  1630  RHDANMNIMPESSVGVL--QAPST--------DP--------------------PKEANG  1719
              H+ N+    E  V  +  + PST        DP                    PKE + 
Sbjct  443   FHNINVENKKEQIVDSVPGRVPSTSDQSENFVDPYKKLTSVKENDTFATSSSSMPKETSS  502

Query  1720  CVSMNTVNASRSSDHTEAVLWENPET----VVTEAE-VDDLQFNKAGTSCVGEWADSLTN  1884
              +S +  + + +SD    V W   ET    +  +AE + D + +       GEWADSLTN
Sbjct  503   YISTSKCDIADTSDPAANVSWPRKETGNEIITGQAEDMGDERLSSGTALSAGEWADSLTN  562

Query  1885  ISVGDLLSEAPDMEDANCITSSIHSSSNYIHQIPFSCDSFDAAIAAHIKKHQNVTDSQAA  2064
             ISVGDLL+E P   DA    + +  SS  + QIPFSCDSFDAAIAAHI +HQN   + + 
Sbjct  563   ISVGDLLAEVPHDLDA----APVAESSQCLQQIPFSCDSFDAAIAAHISRHQNKMGALST  618

Query  2065  LPSQLSSIWGAEDTCDAFAFQRHSLSEKVQNASKHTSLET----CKQITLANTTALGASV  2232
             L S  SSIW AE+TCDAF+FQ++ +       S+   +      C+QI   N+   G   
Sbjct  619   LASHASSIWDAEETCDAFSFQKNPV--LCNGVSRLPDIAPPAADCEQIARTNSVGSGGFF  676

Query  2233  EDLPGARNPVDGDAATADLESVHYSPTS--DVVKDFNGLSDVYWPDSLGPLDLDIPSSRY  2406
             E+L  A  P D  A    ++    +P +  + V DFNGL+D+YWPDSLGPLDLDIPSS+Y
Sbjct  677   EELLDAEGPTDYPAHEDPMDDCLRNPHTLDNSVNDFNGLTDIYWPDSLGPLDLDIPSSKY  736

Query  2407  HSE-LILSDSLGGLTQLIASSLDAFQNCSFFGADKKEPVSTTEAQE  2541
               E +ILSDSLGGL +LIASSLDAFQNCSFFG DKKEP  T EA E
Sbjct  737   RGEDIILSDSLGGLNRLIASSLDAFQNCSFFGLDKKEPTPTVEAGE  782



>gb|KDO49330.1| hypothetical protein CISIN_1g0038981mg [Citrus sinensis]
Length=788

 Score =   779 bits (2012),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 442/824 (54%), Positives = 546/824 (66%), Gaps = 96/824 (12%)
 Frame = +1

Query  211   IQMELQLTLGSEADHYLRSSPRKDGDFTFGKVNCVEQQIASSQEHAIPEQAMFSQDHSVT  390
             +QME QL++ SE   + R++P +D D          + +ASS           + D+ + 
Sbjct  1     MQMESQLSMNSEVHLHPRNTPVQDED---------PRVVASS-----------TLDNVI-  39

Query  391   EQLASFEEHSALQQPVKRQTRKWAAWTREEEESFFSALRHVGKNFEKITSRVQSKNKDQV  570
                        LQQ  KR TR+WAAWTREEEESFF+ALR VGKNFEKIT RV+SKNKDQV
Sbjct  40    -----------LQQSAKRPTRQWAAWTREEEESFFTALRQVGKNFEKITHRVRSKNKDQV  88

Query  571   RHYYYRLVRRMNKLLGPELCLNAKNSRDTNAAMLRWWSLLEKYSCKASKLHLKPRRFKIF  750
             RHYYYRLVRRMNKLLGP LCL+AKNS+DTNAAMLRWWSLLEKYSCKASKLHLKPRRFKIF
Sbjct  89    RHYYYRLVRRMNKLLGPGLCLDAKNSKDTNAAMLRWWSLLEKYSCKASKLHLKPRRFKIF  148

Query  751   IETLENQLLKDRKKNVRRCFSQGENTS-TAPISVSNQGRGASGHDGRSVKVVLLDNQDIH  927
             +E LE+QLLKDRK++VR+  SQ +N S T P  + NQ R  SG D  +VK+VL+D+Q+I 
Sbjct  149   VEALEHQLLKDRKRSVRKRPSQRDNYSPTVPTPIPNQSR-TSGQDTCTVKLVLVDSQNIQ  207

Query  928   KFGSGKGSSLKRHINIGANSTSCKADSSLLKTARHRRKIG---ATAAYKRWEKAAIAGVS  1098
             K G  KG SLKR++NIG N ++ KADS+ LK  R RRK     ++AAYK+WEKAAIAGVS
Sbjct  208   KLGPAKG-SLKRNVNIGINRSNNKADSATLK-PRQRRKPADSISSAAYKKWEKAAIAGVS  265

Query  1099  LVADAAEHLERTTTDKEDGHFQDSNVRNVFEHSGKDPHVFPDLLHNSFNETNLQNSGKLK  1278
             LVADAAEHLERT+TDKE    Q+       E + K     P +    F E N+Q   KLK
Sbjct  266   LVADAAEHLERTSTDKEVERQQE---HTALETADKVLPPLPTISPTLFAEGNVQTPVKLK  322

Query  1279  LQLFPVDDGTRRALELDNHNPYLELTLSTRKKMSSVLEHLNRKWGNSSMACGDLMLFPYH  1458
             LQL+P+DDGTR+ALE+DNHNP+LELTLSTRKK+SSVLEHLNRKWGN+S+A G+LMLFPY 
Sbjct  323   LQLYPIDDGTRKALEMDNHNPHLELTLSTRKKISSVLEHLNRKWGNASVASGELMLFPYG  382

Query  1459  LHKENLVHFQKWTKDTTLTAADVYALTGSPPVFRLRYGWFSNAEVAFRAP----VSSAIP  1626
               +ENLV +Q+WT+D+  +AADVYA+ GSPP+FRLRYGWFS+ E+ + AP     S  +P
Sbjct  383   AQRENLVGYQRWTQDSVFSAADVYAMIGSPPMFRLRYGWFSDTELGYVAPHAPSASGCVP  442

Query  1627  SRHDANMNIMPESSVGVL--QAPST--------DP--------------------PKEAN  1716
             S H+ N+    E  V  +  + PST        DP                    PKE +
Sbjct  443   SFHNINVENKKEQIVDSVPGRVPSTSDQSENFVDPYKKLTSVKENDTFATSSSSMPKETS  502

Query  1717  GCVSMNTVNASRSSDHTEAVLWENPET--VVTEAEVDDLQFNK--AGTSC-VGEWADSLT  1881
               +S +  + + +SD    V W   ET   +   +V+D+   +  +GT+   GEWADSLT
Sbjct  503   SYISASKRDIADTSDPAANVSWPRKETGNEIITGQVEDMGDERLSSGTALSAGEWADSLT  562

Query  1882  NISVGDLLSEAPDMEDANCITSSIHSSSNYIHQIPFSCDSFDAAIAAHIKKHQNVTDSQA  2061
             NISVGDLL+E P   DA    + +  SS  + QIPFSCDSFDAAIAAHI +HQN   + +
Sbjct  563   NISVGDLLAEVPHDLDA----APVAESSQCLQQIPFSCDSFDAAIAAHISRHQNKMGALS  618

Query  2062  ALPSQLSSIWGAEDTCDAFAFQRHSL--SEKVQNASKHTSLETCKQITLANTTALGA-SV  2232
              L S  SSIW AE+TCDAF+FQ++ +  +E  +          C+QI   N+  L A   
Sbjct  619   TLASHASSIWDAEETCDAFSFQKNPVLCNEVSRLPDIAPPAADCEQIARTNSELLDAEGP  678

Query  2233  EDLPGARNPVDGDAATADLESVHYSPTSDVVKDFNGLSDVYWPDSLGPLDLDIPSSRYHS  2412
              D P   +P+D       L + H    S  V DFNGL+D+YWPDSLGPLDLDIPSS+Y  
Sbjct  679   TDYPAHEDPMDD-----CLRNPHTLDNS--VNDFNGLTDIYWPDSLGPLDLDIPSSKYRG  731

Query  2413  E-LILSDSLGGLTQLIASSLDAFQNCSFFGADKKEPVSTTEAQE  2541
             E +ILSDSLGGL +LIASSLDAFQNCSFFG DKKEP  T EA E
Sbjct  732   EDIILSDSLGGLNRLIASSLDAFQNCSFFGLDKKEPTPTVEAGE  775



>ref|XP_006493025.1| PREDICTED: TSL-kinase interacting protein 1-like isoform X6 [Citrus 
sinensis]
Length=791

 Score =   779 bits (2012),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 441/826 (53%), Positives = 543/826 (66%), Gaps = 97/826 (12%)
 Frame = +1

Query  211   IQMELQLTLGSEADHYLRSSPRKDGDFTFGKVNCVEQQIASSQEHAIPEQAMFSQDHSVT  390
             +QME QL++ SE   + R++P +D D          + +ASS           + D+ + 
Sbjct  1     MQMESQLSMNSEVHLHPRNTPVQDED---------PRVVASS-----------TLDNVI-  39

Query  391   EQLASFEEHSALQQPVKRQTRKWAAWTREEEESFFSALRHVGKNFEKITSRVQSKNKDQV  570
                        LQQ  KR TR+WAAWTREEEESFF+ALR VGKNFEKIT RV+SKNKDQV
Sbjct  40    -----------LQQSAKRPTRQWAAWTREEEESFFTALRQVGKNFEKITHRVRSKNKDQV  88

Query  571   RHYYYRLVRRMNKLLGPELCLNAKNSRDTNAAMLRWWSLLEKYSCKASKLHLKPRRFKIF  750
             RHYYYRLVRRMNKLLGP LCL+AKNS+DTNAAMLRWWSLLEKYSCKASKLHLKPRRFKIF
Sbjct  89    RHYYYRLVRRMNKLLGPGLCLDAKNSKDTNAAMLRWWSLLEKYSCKASKLHLKPRRFKIF  148

Query  751   IETLENQLLKDRKKNVRRCFSQGENTS-TAPISVSNQGRGASGHDGRSVKVVLLDNQDIH  927
             +E LE+QLLKDRK++VR+  SQ ++ S TAP  + NQ R  SG D  +VK+VL+D+Q+I 
Sbjct  149   VEALEHQLLKDRKRSVRKRPSQRDSYSPTAPTPIPNQSR-TSGQDTCTVKLVLVDSQNIQ  207

Query  928   KFGSGKGSSLKRHINIGANSTSCKADSSLLKTARHRRKIG---ATAAYKRWEKAAIAGVS  1098
             K G  KG SLKR++NIG N ++ KADS+ LK  R RRK     ++AAYK+WEKAAIAGVS
Sbjct  208   KLGPAKG-SLKRNVNIGINRSNNKADSATLK-PRQRRKPADSISSAAYKKWEKAAIAGVS  265

Query  1099  LVADAAEHLERTTTDKEDGHFQDSNVRNVFEHSGKDPHVFPDLLHNSFNETNLQNSGKLK  1278
             LVADAAEHLERT+TDKE    Q        E + K     P +    F E N+Q   KLK
Sbjct  266   LVADAAEHLERTSTDKEVERQQGELEHTALETADKVLPPLPTISPTLFAEGNVQTPVKLK  325

Query  1279  LQLFPVDDGTRRALELDNHNPYLELTLSTRKKMSSVLEHLNRKWGNSSMACGDLMLFPYH  1458
             LQL+P+DDGTR+ALE+DNHNP+LELTLSTRKK+SSVLEHLNRKWGN+S+A G+LMLFPY 
Sbjct  326   LQLYPIDDGTRKALEMDNHNPHLELTLSTRKKISSVLEHLNRKWGNASVASGELMLFPYG  385

Query  1459  LHKENLVHFQKWTKDTTLTAADVYALTGSPPVFRLRYGWFSNAEVAFRAP----VSSAIP  1626
               +ENLV +Q+WT+D+  +AADVYA+ GSPP+FRLRYGWFS+ E+ + AP     S  +P
Sbjct  386   AQRENLVGYQRWTQDSVFSAADVYAMIGSPPMFRLRYGWFSDTELGYVAPHAPSASGCVP  445

Query  1627  SRHDANMNIMPESSVGVL--QAPST--------DP--------------------PKEAN  1716
             S H+ N+    E  V  +  + PST        DP                    PKE +
Sbjct  446   SFHNINVENKKEQIVDSVPGRVPSTSDQSENFVDPYKKLTSVKENDTFATSSSSMPKETS  505

Query  1717  GCVSMNTVNASRSSDHTEAVLWENPET----VVTEAE-VDDLQFNKAGTSCVGEWADSLT  1881
               +S +  + + +SD    V W   ET    +  +AE + D + +       GEWADSLT
Sbjct  506   SYISTSKCDIADTSDPAANVSWPRKETGNEIITGQAEDMGDERLSSGTALSAGEWADSLT  565

Query  1882  NISVGDLLSEAPDMEDANCITSSIHSSSNYIHQIPFSCDSFDAAIAAHIKKHQNVTDSQA  2061
             NISVGDLL+E P   DA    + +  SS  + QIPFSCDSFDAAIAAHI +HQN   + +
Sbjct  566   NISVGDLLAEVPHDLDA----APVAESSQCLQQIPFSCDSFDAAIAAHISRHQNKMGALS  621

Query  2062  ALPSQLSSIWGAEDTCDAFAFQRHSLSEKVQNASKHTSLET----CKQITLANTTALGA-  2226
              L S  SSIW AE+TCDAF+FQ++ +       S+   +      C+QI   N+  L A 
Sbjct  622   TLASHASSIWDAEETCDAFSFQKNPV--LCNGVSRLPDIAPPAADCEQIARTNSELLDAE  679

Query  2227  SVEDLPGARNPVDGDAATADLESVHYSPTSDVVKDFNGLSDVYWPDSLGPLDLDIPSSRY  2406
                D P   +P+D       L + H    S  V DFNGL+D+YWPDSLGPLDLDIPSS+Y
Sbjct  680   GPTDYPAHEDPMDD-----CLRNPHTLDNS--VNDFNGLTDIYWPDSLGPLDLDIPSSKY  732

Query  2407  HSE-LILSDSLGGLTQLIASSLDAFQNCSFFGADKKEPVSTTEAQE  2541
               E +ILSDSLGGL +LIASSLDAFQNCSFFG DKKEP  T EA E
Sbjct  733   RGEDIILSDSLGGLNRLIASSLDAFQNCSFFGLDKKEPTPTVEAGE  778



>gb|KDO49331.1| hypothetical protein CISIN_1g0038981mg [Citrus sinensis]
 gb|KDO49332.1| hypothetical protein CISIN_1g0038981mg [Citrus sinensis]
 gb|KDO49333.1| hypothetical protein CISIN_1g0038981mg [Citrus sinensis]
Length=787

 Score =   779 bits (2011),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 442/823 (54%), Positives = 546/823 (66%), Gaps = 95/823 (12%)
 Frame = +1

Query  211   IQMELQLTLGSEADHYLRSSPRKDGDFTFGKVNCVEQQIASSQEHAIPEQAMFSQDHSVT  390
             +QME QL++ SE   + R++P +D D          + +ASS           + D+ + 
Sbjct  1     MQMESQLSMNSEVHLHPRNTPVQDED---------PRVVASS-----------TLDNVI-  39

Query  391   EQLASFEEHSALQQPVKRQTRKWAAWTREEEESFFSALRHVGKNFEKITSRVQSKNKDQV  570
                        LQQ  KR TR+WAAWTREEEESFF+ALR VGKNFEKIT RV+SKNKDQV
Sbjct  40    -----------LQQSAKRPTRQWAAWTREEEESFFTALRQVGKNFEKITHRVRSKNKDQV  88

Query  571   RHYYYRLVRRMNKLLGPELCLNAKNSRDTNAAMLRWWSLLEKYSCKASKLHLKPRRFKIF  750
             RHYYYRLVRRMNKLLGP LCL+AKNS+DTNAAMLRWWSLLEKYSCKASKLHLKPRRFKIF
Sbjct  89    RHYYYRLVRRMNKLLGPGLCLDAKNSKDTNAAMLRWWSLLEKYSCKASKLHLKPRRFKIF  148

Query  751   IETLENQLLKDRKKNVRRCFSQGENTS-TAPISVSNQGRGASGHDGRSVKVVLLDNQDIH  927
             +E LE+QLLKDRK++VR+  SQ +N S T P  + NQ R  SG D  +VK+VL+D+Q+I 
Sbjct  149   VEALEHQLLKDRKRSVRKRPSQRDNYSPTVPTPIPNQSR-TSGQDTCTVKLVLVDSQNIQ  207

Query  928   KFGSGKGSSLKRHINIGANSTSCKADSSLLKTARHRRKIG--ATAAYKRWEKAAIAGVSL  1101
             K G  KG SLKR++NIG N ++ KADS+ LK  R RRK    ++AAYK+WEKAAIAGVSL
Sbjct  208   KLGPAKG-SLKRNVNIGINRSNNKADSATLK-PRQRRKPDSISSAAYKKWEKAAIAGVSL  265

Query  1102  VADAAEHLERTTTDKEDGHFQDSNVRNVFEHSGKDPHVFPDLLHNSFNETNLQNSGKLKL  1281
             VADAAEHLERT+TDKE    Q+       E + K     P +    F E N+Q   KLKL
Sbjct  266   VADAAEHLERTSTDKEVERQQE---HTALETADKVLPPLPTISPTLFAEGNVQTPVKLKL  322

Query  1282  QLFPVDDGTRRALELDNHNPYLELTLSTRKKMSSVLEHLNRKWGNSSMACGDLMLFPYHL  1461
             QL+P+DDGTR+ALE+DNHNP+LELTLSTRKK+SSVLEHLNRKWGN+S+A G+LMLFPY  
Sbjct  323   QLYPIDDGTRKALEMDNHNPHLELTLSTRKKISSVLEHLNRKWGNASVASGELMLFPYGA  382

Query  1462  HKENLVHFQKWTKDTTLTAADVYALTGSPPVFRLRYGWFSNAEVAFRAP----VSSAIPS  1629
              +ENLV +Q+WT+D+  +AADVYA+ GSPP+FRLRYGWFS+ E+ + AP     S  +PS
Sbjct  383   QRENLVGYQRWTQDSVFSAADVYAMIGSPPMFRLRYGWFSDTELGYVAPHAPSASGCVPS  442

Query  1630  RHDANMNIMPESSVGVL--QAPST--------DP--------------------PKEANG  1719
              H+ N+    E  V  +  + PST        DP                    PKE + 
Sbjct  443   FHNINVENKKEQIVDSVPGRVPSTSDQSENFVDPYKKLTSVKENDTFATSSSSMPKETSS  502

Query  1720  CVSMNTVNASRSSDHTEAVLWENPET--VVTEAEVDDLQFNK--AGTSC-VGEWADSLTN  1884
              +S +  + + +SD    V W   ET   +   +V+D+   +  +GT+   GEWADSLTN
Sbjct  503   YISASKRDIADTSDPAANVSWPRKETGNEIITGQVEDMGDERLSSGTALSAGEWADSLTN  562

Query  1885  ISVGDLLSEAPDMEDANCITSSIHSSSNYIHQIPFSCDSFDAAIAAHIKKHQNVTDSQAA  2064
             ISVGDLL+E P   DA    + +  SS  + QIPFSCDSFDAAIAAHI +HQN   + + 
Sbjct  563   ISVGDLLAEVPHDLDA----APVAESSQCLQQIPFSCDSFDAAIAAHISRHQNKMGALST  618

Query  2065  LPSQLSSIWGAEDTCDAFAFQRHSL--SEKVQNASKHTSLETCKQITLANTTALGA-SVE  2235
             L S  SSIW AE+TCDAF+FQ++ +  +E  +          C+QI   N+  L A    
Sbjct  619   LASHASSIWDAEETCDAFSFQKNPVLCNEVSRLPDIAPPAADCEQIARTNSELLDAEGPT  678

Query  2236  DLPGARNPVDGDAATADLESVHYSPTSDVVKDFNGLSDVYWPDSLGPLDLDIPSSRYHSE  2415
             D P   +P+D       L + H    S  V DFNGL+D+YWPDSLGPLDLDIPSS+Y  E
Sbjct  679   DYPAHEDPMDD-----CLRNPHTLDNS--VNDFNGLTDIYWPDSLGPLDLDIPSSKYRGE  731

Query  2416  -LILSDSLGGLTQLIASSLDAFQNCSFFGADKKEPVSTTEAQE  2541
              +ILSDSLGGL +LIASSLDAFQNCSFFG DKKEP  T EA E
Sbjct  732   DIILSDSLGGLNRLIASSLDAFQNCSFFGLDKKEPTPTVEAGE  774



>ref|XP_006428401.1| hypothetical protein CICLE_v10011099mg [Citrus clementina]
 gb|ESR41641.1| hypothetical protein CICLE_v10011099mg [Citrus clementina]
Length=787

 Score =   777 bits (2007),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 441/825 (53%), Positives = 544/825 (66%), Gaps = 99/825 (12%)
 Frame = +1

Query  211   IQMELQLTLGSEADHYLRSSPRKDGDFTFGKVNCVEQQIASSQEHAIPEQAMFSQDHSVT  390
             +QME QL++ SE   + R++P +D D          + +ASS           + D+ + 
Sbjct  1     MQMESQLSMNSEVHLHPRNTPVQDED---------PRVVASS-----------TLDNVI-  39

Query  391   EQLASFEEHSALQQPVKRQTRKWAAWTREEEESFFSALRHVGKNFEKITSRVQSKNKDQV  570
                        LQQ  KR TR+WAAWTREEEESFF+ALR VGKNFEKIT RV+SKNKDQV
Sbjct  40    -----------LQQSAKRPTRQWAAWTREEEESFFTALRQVGKNFEKITHRVRSKNKDQV  88

Query  571   RHYYYRLVRRMNKLLGPELCLNAKNSRDTNAAMLRWWSLLEKYSCKASKLHLKPRRFKIF  750
             RHYYYRLVRRMNKLLGP LCL+AKNS+DTNAAMLRWWSLLEKYSCKASKLHLKPRRFKIF
Sbjct  89    RHYYYRLVRRMNKLLGPGLCLDAKNSKDTNAAMLRWWSLLEKYSCKASKLHLKPRRFKIF  148

Query  751   IETLENQLLKDRKKNVRRCFSQGENTS-TAPISVSNQGRGASGHDGRSVKVVLLDNQDIH  927
             +E LE+QLLKDRK++VR+  SQ ++ S TAP  + NQ R  SG D  +VK+VL+D+Q+I 
Sbjct  149   VEALEHQLLKDRKRSVRKRPSQRDSYSPTAPTPIPNQSR-TSGQDTCTVKLVLVDSQNIQ  207

Query  928   KFGSGKGSSLKRHINIGANSTSCKADSSLLKTARHRRKIG--ATAAYKRWEKAAIAGVSL  1101
             K G  KG SLKR++NIG N ++ KADS+ LK  R RRK    ++AAYK+WEKAAIAGVSL
Sbjct  208   KLGPAKG-SLKRNVNIGINRSNNKADSATLK-PRQRRKPDSISSAAYKKWEKAAIAGVSL  265

Query  1102  VADAAEHLERTTTDKEDGHFQDSNVRNVFEHSGKDPHVFPDLLHNSFNETNLQNSGKLKL  1281
             VADAAEHLERT+TDKE    Q+       E + K     P +    F E N+Q   KLKL
Sbjct  266   VADAAEHLERTSTDKEVERQQE---HTALETADKVLPPLPTISPTLFAEGNVQTPVKLKL  322

Query  1282  QLFPVDDGTRRALELDNHNPYLELTLSTRKKMSSVLEHLNRKWGNSSMACGDLMLFPYHL  1461
             QL+P+DDGTR+ALE+DNHNP+LELTLSTRKK+SSVLEHLNRKWGN+S+A G+LMLFPY  
Sbjct  323   QLYPIDDGTRKALEMDNHNPHLELTLSTRKKISSVLEHLNRKWGNASVASGELMLFPYGA  382

Query  1462  HKENLVHFQKWTKDTTLTAADVYALTGSPPVFRLRYGWFSNAEVAFRAP----VSSAIPS  1629
              +ENLV +Q+WT+D+  +AADVYA+ GSPP+FRLRYGWFS+ E+ + AP     S  +PS
Sbjct  383   QRENLVGYQRWTQDSVFSAADVYAMIGSPPMFRLRYGWFSDTELGYVAPHAPSASGCVPS  442

Query  1630  RHDANMNIMPESSVGVL--QAPST--------DP--------------------PKEANG  1719
              H+ N+    E  V  +  + PST        DP                    PKE + 
Sbjct  443   FHNINVENKKEQIVDSVPGRVPSTSDQSENFVDPYKKLTSVKENDTFATSSSSMPKETSS  502

Query  1720  CVSMNTVNASRSSDHTEAVLWENPET----VVTEAE-VDDLQFNKAGTSCVGEWADSLTN  1884
              +S +  + + +SD    V W   ET    +  +AE + D + +       GEWADSLTN
Sbjct  503   YISTSKCDIADTSDPAANVSWPRKETGNEIITGQAEDMGDERLSSGTALSAGEWADSLTN  562

Query  1885  ISVGDLLSEAPDMEDANCITSSIHSSSNYIHQIPFSCDSFDAAIAAHIKKHQNVTDSQAA  2064
             ISVGDLL+E P   DA    + +  SS  + QIPFSCDSFDAAIAAHI +HQN   + + 
Sbjct  563   ISVGDLLAEVPHDLDA----APVAESSQCLQQIPFSCDSFDAAIAAHISRHQNKMGALST  618

Query  2065  LPSQLSSIWGAEDTCDAFAFQRHSLSEKVQNASKHTSLET----CKQITLANTTALGA-S  2229
             L S  SSIW AE+TCDAF+FQ++ +       S+   +      C+QI   N+  L A  
Sbjct  619   LASHASSIWDAEETCDAFSFQKNPV--LCNGVSRLPDIAPPAADCEQIARTNSELLDAEG  676

Query  2230  VEDLPGARNPVDGDAATADLESVHYSPTSDVVKDFNGLSDVYWPDSLGPLDLDIPSSRYH  2409
               D P   +P+D       L + H    S  V DFNGL+D+YWPDSLGPLDLDIPSS+Y 
Sbjct  677   PTDYPAHEDPMDD-----CLRNPHTLDNS--VNDFNGLTDIYWPDSLGPLDLDIPSSKYR  729

Query  2410  SE-LILSDSLGGLTQLIASSLDAFQNCSFFGADKKEPVSTTEAQE  2541
              E +ILSDSLGGL +LIASSLDAFQNCSFFG DKKEP  T EA E
Sbjct  730   GEDIILSDSLGGLNRLIASSLDAFQNCSFFGLDKKEPTPTVEAGE  774



>gb|KDP29153.1| hypothetical protein JCGZ_16542 [Jatropha curcas]
Length=794

 Score =   777 bits (2006),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 429/766 (56%), Positives = 521/766 (68%), Gaps = 65/766 (8%)
 Frame = +1

Query  397   LASFEEHSALQQPVKRQTRKWAAWTREEEESFFSALRHVGKNFEKITSRVQSKNKDQVRH  576
             ++S  +H   QQP K+ TR+WAAWTREEEESFF+ALR VGKNFEKIT RVQSKNKDQVRH
Sbjct  30    VSSIPDHVEPQQPAKKPTRQWAAWTREEEESFFTALRQVGKNFEKITRRVQSKNKDQVRH  89

Query  577   YYYRLVRRMNKLLGPELCLNAKNSRDTNAAMLRWWSLLEKYSCKASKLHLKPRRFKIFIE  756
             YYYRLVRRMNKLLGP LCL+AKNS+DTNAAMLRWWSLLEKYSCKASKLHLKPRRFKIFIE
Sbjct  90    YYYRLVRRMNKLLGPGLCLDAKNSKDTNAAMLRWWSLLEKYSCKASKLHLKPRRFKIFIE  149

Query  757   TLENQLLKDRKKNVRRCFSQGENTS-TAPISVSNQGRGASGHDGRSVKVVLLDNQDIHKF  933
              LENQLLKDRKKN+R+  S  EN S   P  ++NQ R AS H+ R+VK+VL+D+Q++ + 
Sbjct  150   ALENQLLKDRKKNIRKRPSPVENVSPIVPSVITNQNR-ASAHETRTVKLVLVDSQNLQRL  208

Query  934   GSGKGSSLKRHINIGANSTSCKADSSLLKTARHRRKIG--ATAAYKRWEKAAIAGVSLVA  1107
             GSGKG SLKR++NIG    + + DS+ +K AR RRK G  +TAAYK+WEKAAIAGVSLVA
Sbjct  209   GSGKG-SLKRNVNIGVIRNN-RGDSNAMKPARQRRKQGVVSTAAYKKWEKAAIAGVSLVA  266

Query  1108  DAAEHLERTTTDKEDGHFQDSNVRNVFEHSGKDPHVFPDLLHNSFNETNLQNSGKLKLQL  1287
             DAAEHLERT  +KE  H Q     +  E+      VF     N + E+N   + KLKLQL
Sbjct  267   DAAEHLERTAINKEVEHEQAQKSPDQIENILPSVPVFS---QNHYVESNAHTNMKLKLQL  323

Query  1288  FPVDDGTRRALELDNHNPYLELTLSTRKKMSSVLEHLNRKWGNSSMACGDLMLFPYHLHK  1467
             FP+DDGTRRALE+D HNP+LELTLSTRKK+SS+L+HLNRKWGNSS+A GDLMLFPY  H+
Sbjct  324   FPIDDGTRRALEMDKHNPHLELTLSTRKKISSILDHLNRKWGNSSIASGDLMLFPYSAHR  383

Query  1468  ENLVHFQKWTKDTTLTAADVYALTGSPPVFRLRYGWFSNAE---VAFRAP-VSSAIPSRH  1635
             E LV +Q+WT+D+ ++AADVY   GSPPVFRLRYGWFSN E   VA +AP  SS+IP  +
Sbjct  384   EKLVGYQRWTQDSVVSAADVYTSIGSPPVFRLRYGWFSNVEFASVALQAPSASSSIPGGN  443

Query  1636  DA-------NMNIMPESSVGV----------------------LQAP-STDPPKEANGC-  1722
              A       N++ +P+S +                          AP S D P E +GC 
Sbjct  444   AADLQNEKRNLDSIPKSRLLTNNQTEEHMDLYENQLSAVNKSHASAPFSVDVPNETSGCN  503

Query  1723  -------VSMNTVNASRSSDHTEAVLWENPETVVTEAEVDDLQFNKAGTSCVGEWADSLT  1881
                      M++  A+R+S H +     + E +  + + DD++          EWADSLT
Sbjct  504   DSGPRNNFVMSSDPAARASWHEKGT--GDGENMKQKDDADDMKLCSGTPLSAVEWADSLT  561

Query  1882  NISVGDLLSEAPDMEDANCITSSIHSSSNYIHQIPFSCDSFDAAIAAHIKKHQNVTDSQA  2061
             NISVGDLLSE  D+ D +CI   I  S   + QIPFSCDSFDAAIAAH+ KHQN T   A
Sbjct  562   NISVGDLLSEVRDV-DTDCIEPPIAQSVQCLQQIPFSCDSFDAAIAAHMSKHQNKTVFPA  620

Query  2062  ALPSQLSSIWGAEDTCDAFAFQR-HSLSEKVQNASKHTSLETCKQITLANTTALGASVED  2238
              + S  SSIW AE+TCDAF+FQ+ H+  +++  +    S    KQ +   +   G  VE 
Sbjct  621   TVVSHTSSIWDAEETCDAFSFQKNHASCQEIPTSIGVVSAAAGKQTS---SITSGVFVEV  677

Query  2239  LPGARNPV----DGDAATADLESVHYSPTSDVVKDFNGLSDVYWPDSLGPLDLDIPSSRY  2406
             LP    PV    DGD     L       +S   KDF GL+D+YWP+SLGPLDLD+PSS+Y
Sbjct  678   LPSEDEPVDYPTDGDPMDECLPDPQVVDSS--AKDFTGLTDIYWPESLGPLDLDMPSSKY  735

Query  2407  HS-ELILSDSLGGLTQLIASSLDAFQNCSFFGADKKEPVSTTEAQE  2541
             H+ E IL DSL GL +LIASSLDAFQNCSFFG DKKE     EA+E
Sbjct  736   HNEEFILGDSLSGLNRLIASSLDAFQNCSFFGLDKKEITPVVEARE  781



>ref|XP_002323473.1| myb family transcription factor family protein [Populus trichocarpa]
 gb|EEF05234.1| myb family transcription factor family protein [Populus trichocarpa]
Length=753

 Score =   773 bits (1997),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 423/722 (59%), Positives = 514/722 (71%), Gaps = 35/722 (5%)
 Frame = +1

Query  427   QQPVKRQTRKWAAWTREEEESFFSALRHVGKNFEKITSRVQSKNKDQVRHYYYRLVRRMN  606
             +QP KR TR+WAAWTR+EEESFF+ALR VGKNFEKIT  VQSKNKDQVRHYYYRLVRRMN
Sbjct  37    RQPEKRPTRQWAAWTRQEEESFFTALRQVGKNFEKITHHVQSKNKDQVRHYYYRLVRRMN  96

Query  607   KLLGPELCLNAKNSRDTNAAMLRWWSLLEKYSCKASKLHLKPRRFKIFIETLENQLLKDR  786
             KLLGP LCL+AKNS+DTNAAMLRWWSLLEKYSCKASKLHLKPRRFKIFIE LENQLLKD+
Sbjct  97    KLLGPGLCLDAKNSKDTNAAMLRWWSLLEKYSCKASKLHLKPRRFKIFIEALENQLLKDQ  156

Query  787   KKNVRRCFSQGENTS-TAPISVSNQGRGASGHDGRSVKVVLLDNQDIHKFGSGKGSSLKR  963
             +KNVR+  SQGEN S T P  ++NQ R AS HD R+VK+V++D+Q+I K G GKG SLKR
Sbjct  157   RKNVRKRSSQGENGSPTTPSIITNQNR-ASVHDTRTVKLVIVDSQNIQKLG-GKG-SLKR  213

Query  964   HINIGANSTSCKADSSLLKTARHRRKIGATAAYKRWEKAAIAGVSLVADAAEHLERTTTD  1143
             ++N+G    + K DS+ +K AR RRK    AAYK+WEKAAIAGVSLVADAAEHLERT TD
Sbjct  214   NVNMGVVRNNNKGDSTAMKPARQRRK---PAAYKKWEKAAIAGVSLVADAAEHLERTATD  270

Query  1144  KEDGHFQDSNVRNVFEHSGK-DPHVFPDLLHNSFNETNLQNSGKLKLQLFPVDDGTRRAL  1320
             KED H Q    +   +   K  PH  P L      E+N   + KLKLQLFP+DDGTRRAL
Sbjct  271   KEDEHDQGMVGKKGLDPVEKLLPHFHPSL---RCVESNALTNMKLKLQLFPIDDGTRRAL  327

Query  1321  ELDNHNPYLELTLSTRKKMSSVLEHLNRKWGNSSMACGDLMLFPYHLHKENLVHFQKWTK  1500
             E+D HNP+LELTLSTRKK+SSVLEHLNRKWG+S++A G+LMLFPY +++ENLV +Q+WT+
Sbjct  328   EMDKHNPHLELTLSTRKKISSVLEHLNRKWGDSTVASGELMLFPYSVNRENLVSYQRWTQ  387

Query  1501  DTTLTAADVYALTGSPPVFRLRYGWFSN---AEVAFRAPVS-SAIP---SRHDANMNIMP  1659
             D+ ++AADVY   GSPPVFRLRYGWF N   A V  +AP + S +P   +  D  M+ +P
Sbjct  388   DSLVSAADVYFSIGSPPVFRLRYGWFFNVNFASVTLQAPSTYSCLPVGGNEKDKTMDSVP  447

Query  1660  ESSVGVLQAPSTDP--PKEANGCVSMNTV--NASRSSDHTEAVLWENPETVVTEAEVDDL  1827
              +       PST     K  N C    T   N   S  H+  V  EN E V T    + +
Sbjct  448   TAE------PSTSDQFEKPENPCRDCPTSENNNHASILHSAGVTNENNEFVATGPRNNLV  501

Query  1828  QFNKAGTSCVGEWADSLTNISVGDLLSEAPDMEDANCITSSIHSSSNYIHQIPFSCDSFD  2007
             + +       GEWADSLTN+S+GDLLSE P + + NCI S I  S+  + +IPFSCDSFD
Sbjct  502   KLSNVNPLSAGEWADSLTNVSIGDLLSELPHVANHNCIESLIVQSNQCLQEIPFSCDSFD  561

Query  2008  AAIAAHIKKHQNVTDSQAALPSQLSSIWGAEDTCDAFAFQR-HSLSEKVQNASKHTSLET  2184
             AAIAAHI +HQ      +A+ S  SSIW  E+TCDAFAFQ+ HSL ++V  +S   ++ +
Sbjct  562   AAIAAHISRHQGKMGFHSAVASYTSSIWDGEETCDAFAFQKNHSLRKEVTTSS---AVAS  618

Query  2185  CKQITLANTTALGASVEDLPGARNPVDGDAATADLE--SVHYSPTSDVVKDFNGLSDVYW  2358
              ++  L         +++LP    P D       ++  S      S+ VKDFNGL+D+YW
Sbjct  619   PRKGGLIKGNVFTLVLQELPVIEGPNDYPTGGEPMDECSSDSQVVSNQVKDFNGLTDIYW  678

Query  2359  PDSLGPLDLDIPSSRYHSE-LILSDSLGGLTQLIASSLDAFQNCSFFGADKKEPVSTTEA  2535
             PDSLG LDLDIPSS+YH+E LILSDSLGGL  LIASSLDAFQNCSFFG +KK+ +ST EA
Sbjct  679   PDSLGLLDLDIPSSKYHTEDLILSDSLGGLNHLIASSLDAFQNCSFFGLNKKDSISTVEA  738

Query  2536  QE  2541
             +E
Sbjct  739   RE  740



>ref|XP_006381423.1| myb family transcription factor family protein [Populus trichocarpa]
 gb|ERP59220.1| myb family transcription factor family protein [Populus trichocarpa]
Length=781

 Score =   774 bits (1999),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 423/746 (57%), Positives = 516/746 (69%), Gaps = 55/746 (7%)
 Frame = +1

Query  427   QQPVKRQTRKWAAWTREEEESFFSALRHVGKNFEKITSRVQSKNKDQVRHYYYRLVRRMN  606
             +QP KR TR+WAAWT +EEESFF+ALR   +NFEKIT  VQSKNKDQVRHYYYRLVRRMN
Sbjct  37    RQPEKRPTRQWAAWTHQEEESFFNALR---QNFEKITRHVQSKNKDQVRHYYYRLVRRMN  93

Query  607   KLLGPELCLNAKNSRDTNAAMLRWWSLLEKYSCKASKLHLKPRRFKIFIETLENQLLKDR  786
             KLLGP LCL+AKNS+DTNAAMLRWWSLL KYSCKASKLHLKPRRFKIF+E LENQLLKDR
Sbjct  94    KLLGPGLCLDAKNSKDTNAAMLRWWSLLAKYSCKASKLHLKPRRFKIFVEALENQLLKDR  153

Query  787   KKNVRRCFSQGENTS-TAPISVSNQGRGASGHDGRSVKVVLLDNQDIHKFGSGKGSSLKR  963
             +KNVR+  SQGEN S T P  ++NQ R ASGHD R+VK+VL+D+Q+I K G GKG SLKR
Sbjct  154   RKNVRKRSSQGENGSPTTPSIITNQNR-ASGHDTRTVKLVLVDSQNIQKLGGGKG-SLKR  211

Query  964   HINIGANSTSCKADSSLLKTARHRRKIGATAAYKRWEKAAIAGVSLVADAAEHLERTTTD  1143
             ++N+G    + K DS+ +K AR RRK  ++AAYK+WEKAAIAGVSLVADAAEHLERT  D
Sbjct  212   NVNLGVIRNNNKGDSTAMKPARQRRKPASSAAYKKWEKAAIAGVSLVADAAEHLERTAPD  271

Query  1144  KEDGHFQDSN----VRNVFEHSGKDPHVFPDLLHNSFNETNLQNSGKLKLQLFPVDDGTR  1311
             KE  H Q  N    V NV       PH+   LLH  + E++  N+ KLKLQLFP+DDGTR
Sbjct  272   KEFEHDQGQNGLDSVENVL------PHLPASLLH--YVESSAHNNMKLKLQLFPIDDGTR  323

Query  1312  RALELDNHNPYLELTLSTRKKMSSVLEHLNRKWGNSSMACGDLMLFPYHLHKENLVHFQK  1491
             RALE+D HNP+LELTLSTRKK+SSVLEHLNRKWGNS++A G+LMLFPY +++ENLV +Q+
Sbjct  324   RALEMDKHNPHLELTLSTRKKISSVLEHLNRKWGNSTVASGELMLFPYVVNRENLVGYQR  383

Query  1492  WTKDTTLTAADVYALTGSPPVFRLRYGWFSNAEVA---FRAPVSSAIPS--------RHD  1638
             WT+D+ ++AADVY   GSPPVFRLRYGWFSNA  A    RAP + +  +          D
Sbjct  384   WTQDSLVSAADVYLSIGSPPVFRLRYGWFSNANFASMTLRAPSTYSCLTDGGNEKGKAMD  443

Query  1639  ANMNIMPESSVGVLQAPSTDPP-----------------KEANGCVSMNTV-NASRSSDH  1764
             +     P +    L+ PS D P                  E N  +++  + N  +S D 
Sbjct  444   SVSTTEPSTGDQFLEDPSRDCPTSMNSNHASTPHSAGVSNETNEFIAIGPINNLVKSFDP  503

Query  1765  TEAVLWENPET-----VVTEAEVDDLQFNKAGTSCVGEWADSLTNISVGDLLSEAPDMED  1929
                  W   ET          +VD L+ +       GEWADSLT++S+GDLLSE P   D
Sbjct  504   AANTSWHRTETDDRTSTQQLEDVDGLRLSNVNVLSAGEWADSLTDVSIGDLLSELPHEAD  563

Query  1930  ANCITSSIHSSSNYIHQIPFSCDSFDAAIAAHIKKHQNVTDSQAALPSQLSSIWGAEDTC  2109
              NC+   I  S+  + QIPFSCDSFDAAIAAHI +HQ+     +++ S  SSIW  E+TC
Sbjct  564   FNCVEPPIVQSNQCLQQIPFSCDSFDAAIAAHISRHQSKVGFVSSVTSHTSSIWDGEETC  623

Query  2110  DAFAFQR-HSLSEKVQNASKHTSLETCKQITLANTTALGASVEDLPGARNPVDGDAATAD  2286
             DAFAFQR HSL ++V   S   S +  KQ+   ++ A GA +E+LP    P+D       
Sbjct  624   DAFAFQRNHSLRKEV-TTSAVASPQVGKQMDRTSSIASGAFLEELPDFVGPMDYPTGEDR  682

Query  2287  LESVHYSPTSDVVKDFNGLSDVYWPDSLGPLDLDIPSSRYHSE-LILSDSLGGLTQLIAS  2463
             +        ++  K+FNGL+D+YWPDSLG LDLDIPSS+YH+E LILSDSLGGL  LIAS
Sbjct  683   MCLSDLQVVNNQAKNFNGLTDIYWPDSLGLLDLDIPSSKYHAEDLILSDSLGGLNHLIAS  742

Query  2464  SLDAFQNCSFFGADKKEPVSTTEAQE  2541
             SLDAFQNCSFFG +KK+  ST EA+E
Sbjct  743   SLDAFQNCSFFGLNKKDSTSTVEARE  768



>ref|XP_011018734.1| PREDICTED: TSL-kinase interacting protein 1 isoform X1 [Populus 
euphratica]
 ref|XP_011018735.1| PREDICTED: TSL-kinase interacting protein 1 isoform X1 [Populus 
euphratica]
Length=783

 Score =   768 bits (1984),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 422/746 (57%), Positives = 516/746 (69%), Gaps = 53/746 (7%)
 Frame = +1

Query  427   QQPVKRQTRKWAAWTREEEESFFSALRHVGKNFEKITSRVQSKNKDQVRHYYYRLVRRMN  606
             +QP KR TR+WAAWT +EEESFF+ALR VGKNFEKIT  VQSKNKDQVRHYYYRLVRRMN
Sbjct  37    RQPEKRPTRQWAAWTHQEEESFFNALRQVGKNFEKITRHVQSKNKDQVRHYYYRLVRRMN  96

Query  607   KLLGPELCLNAKNSRDTNAAMLRWWSLLEKYSCKASKLHLKPRRFKIFIETLENQLLKDR  786
             KLLGP LCL+AKNS+DTNAAMLRWWSLL KYSCKASKLHLKPRRFKIF+E LENQLLKDR
Sbjct  97    KLLGPGLCLDAKNSKDTNAAMLRWWSLLAKYSCKASKLHLKPRRFKIFVEALENQLLKDR  156

Query  787   KKNVRRCFSQGENTS-TAPISVSNQGRGASGHDGRSVKVVLLDNQDIHKFGSGKGSSLKR  963
             +KNVR+  SQGEN S T P  ++NQ R ASGHD R+VK+VL+D+Q+I K G GKG SLKR
Sbjct  157   RKNVRKRSSQGENGSPTTPSIITNQNR-ASGHDTRTVKLVLVDSQNIQKLGGGKG-SLKR  214

Query  964   HINIGANSTSCKADSSLLKTARHRRKIGATAAYKRWEKAAIAGVSLVADAAEHLERTTTD  1143
             ++N+G    + K DS+ +K AR RRK  ++AAYK+WEKAAIAGVSLVADAAEHLERT  D
Sbjct  215   NVNLGVIRNNNKGDSTAMKPARQRRKPASSAAYKKWEKAAIAGVSLVADAAEHLERTAPD  274

Query  1144  KEDGHFQDS----NVRNVFEHSGKDPHVFPDLLHNSFNETNLQNSGKLKLQLFPVDDGTR  1311
             KE  H Q      +V NV       P +   LLH+   E++  N+ KLKLQLFP+DDGTR
Sbjct  275   KEFEHDQGQKGLDSVENVL------PQLPASLLHDV--ESSAHNNMKLKLQLFPIDDGTR  326

Query  1312  RALELDNHNPYLELTLSTRKKMSSVLEHLNRKWGNSSMACGDLMLFPYHLHKENLVHFQK  1491
             RALE+D HNP+LELTLSTRKK+SSVLEHLNRKWGNS++A G+LMLFPY +++ENLV +Q+
Sbjct  327   RALEMDKHNPHLELTLSTRKKISSVLEHLNRKWGNSTVASGELMLFPYVVNRENLVGYQR  386

Query  1492  WTKDTTLTAADVYALTGSPPVFRLRYGWFSNAEVA---FRAPVS-SAIPSRHDANMNIM-  1656
             WT+++ ++AADVY   GSPPVFRLRYGWFSNA  A    +AP + S +    +     M 
Sbjct  387   WTQESLVSAADVYLSIGSPPVFRLRYGWFSNANFASMTLQAPSTYSCLTDGGNEKGKAMD  446

Query  1657  ------PESSVGVLQAPSTDPP-----------------KEANGCVSMNTV-NASRSSDH  1764
                   P +    L+ PS D P                  E N  + +  + N  +S D 
Sbjct  447   SVSITEPSTGDQFLEEPSRDCPTSMNSNHASTPHSAGVSNETNEFIDIGPINNLVKSFDP  506

Query  1765  TEAVLWENPET-----VVTEAEVDDLQFNKAGTSCVGEWADSLTNISVGDLLSEAPDMED  1929
                  W   ET          +VD L+ +       GEWADSLT++S+GDLLSE P   D
Sbjct  507   AANTSWHRTETDDRTGTQQLEDVDGLRLSNVNVLSAGEWADSLTDVSIGDLLSELPHEAD  566

Query  1930  ANCITSSIHSSSNYIHQIPFSCDSFDAAIAAHIKKHQNVTDSQAALPSQLSSIWGAEDTC  2109
              NC+   I  S+  + QIPFSCDSFDAAIAAHI +HQ+     +++ S  SSIW  E+TC
Sbjct  567   FNCV-EPIVQSNQCLQQIPFSCDSFDAAIAAHISRHQSKMGFVSSVTSHTSSIWDGEETC  625

Query  2110  DAFAFQR-HSLSEKVQNASKHTSLETCKQITLANTTALGASVEDLPGARNPVDGDAATAD  2286
             DAFAFQR HSL ++V   S   S +  KQ+   ++ A GA +E+LP    P+D       
Sbjct  626   DAFAFQRNHSLRKEV-TTSAVASPQVGKQMDRTSSIASGAFLEELPDFVGPMDYPTGEDC  684

Query  2287  LESVHYSPTSDVVKDFNGLSDVYWPDSLGPLDLDIPSSRYHSE-LILSDSLGGLTQLIAS  2463
             +        ++  K+FNGL+D+YWPDSLG LDLDIPS++YH+E LILSDSLGGL  LIAS
Sbjct  685   MCLSDSQAGNNQAKNFNGLTDIYWPDSLGQLDLDIPSTKYHAEDLILSDSLGGLNHLIAS  744

Query  2464  SLDAFQNCSFFGADKKEPVSTTEAQE  2541
             SLDAFQNCSFFG +KK+  ST EA+E
Sbjct  745   SLDAFQNCSFFGLNKKDLTSTVEARE  770



>gb|KHG12089.1| TSL-kinase interacting 1 -like protein [Gossypium arboreum]
Length=802

 Score =   767 bits (1981),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 439/837 (52%), Positives = 539/837 (64%), Gaps = 107/837 (13%)
 Frame = +1

Query  211   IQMELQLTLGSEADHYLRSSPRKDGDFTFGKVNCVEQQIASSQEHAIPEQAMFSQDHSVT  390
             +Q E  ++L SEA H   + P + GD             +S+  + +PEQ          
Sbjct  1     MQTESLVSLPSEAQHNQENVPIQVGDLDVA---------SSTSNNTVPEQ----------  41

Query  391   EQLASFEEHSALQQPVKRQTRKWAAWTREEEESFFSALRHVGKNFEKITSRVQSKNKDQV  570
                           P K+ TR+WAAWTR+EEESFF+ALR VGKNFEKIT RVQSKNKDQV
Sbjct  42    --------------PAKKPTRQWAAWTRQEEESFFTALRQVGKNFEKITCRVQSKNKDQV  87

Query  571   RHYYYRLVRRMNKLLGPELCLNAKNSRDTNAAMLRWWSLLEKYSCKASKLHLKPRRFKIF  750
             RHYYYRLVRRMNKLLGP LCL+AKNS+DTNAAMLRWWSLLEKYSC+ASKLHLKPRRFKIF
Sbjct  88    RHYYYRLVRRMNKLLGPRLCLDAKNSKDTNAAMLRWWSLLEKYSCRASKLHLKPRRFKIF  147

Query  751   IETLENQLLKDRKKNVRRCFSQGENTS-TAPISVSNQGRGASGHDGRSVKVVLLDNQDIH  927
             +E LE+QLLKDRKK VR+  SQGEN+S T+P SV+NQ R ASG D R+VK+ L+D+Q+I 
Sbjct  148   VEALEHQLLKDRKKTVRKRPSQGENSSPTSPNSVTNQSR-ASGQDARTVKLFLVDSQNIQ  206

Query  928   KFGSGKGSSLKRHINIGANSTSCKADSSLLKTARHRRKIGA-TAAYKRWEKAAIAGVSLV  1104
             K G GKG S KR+ N+G N ++ K +S+ +K AR R K GA ++AYK+WEKAAIAGVSLV
Sbjct  207   KLGPGKG-SFKRNNNVGVNRSNSKGESNTMKPARQRLKPGASSSAYKKWEKAAIAGVSLV  265

Query  1105  ADAAEHLERTTTDKEDGHFQDSNVRNVFEHSGKDPHVFPDLLHNSFNETNLQNSGKLKLQ  1284
             ADAAEHLE+T  D    H QD+      +    +    P   HN F E  +  +GKLKLQ
Sbjct  266   ADAAEHLEKTINDNGGEHEQDTAGPGQHDPVENNQLPLPSFSHNPFTENYIHATGKLKLQ  325

Query  1285  LFPVDDGTRRALELDNHNPYLELTLSTRKKMSSVLEHLNRKWGNSSMACGDLMLFPYHLH  1464
             LFP+DD TRRALE+D HNP+LELTLSTRKK+SSVLEHLNRKWG+SS+A G+LMLFPY + 
Sbjct  326   LFPIDDSTRRALEMDKHNPHLELTLSTRKKISSVLEHLNRKWGHSSIASGELMLFPYGVQ  385

Query  1465  KENLVHFQKWTKDTTLTAADVYALTGSPPVFRLRYGWFSNAEVA---FRAPVSSA-IPSR  1632
             +ENL   Q+W + TT++AADV+A+ GSP VFRLRYGWFS+ EVA   ++APVS A IPS 
Sbjct  386   RENLRGHQRWNQATTVSAADVFAMVGSPQVFRLRYGWFSDTEVASLSWQAPVSLAYIPSV  445

Query  1633  HDANMNI--------------------------------MPESSVGVLQAPSTDPPKEAN  1716
             H  NMN+                                M +    VL+   TDP  E N
Sbjct  446   H--NMNVENRKGQIVKEVQAVSCTSDQCKELNDRYKNQPMIQKENLVLEPSLTDPHDEIN  503

Query  1717  GCVSMNTVN---------ASRSSDHTEAVLWENPETVVTEAEVDDLQFNKAGTS-CVGEW  1866
               ++ ++ +          + SSD +E     N   +    + DD + N + T+ C GEW
Sbjct  504   TYLNTSSKDDLGDSLVPARNASSDRSETC---NVAIMRRLEDTDDQRLNNSSTALCAGEW  560

Query  1867  ADSLTNISVGDLLSEAPDMEDANCITSSIHSSSNYIHQIPFSCDSFDAAIAAHIKKHQNV  2046
             ADSLTNISVGDLL+E P   + NC+   +  SS    QIPFSCDSFDAAIAAHI +HQN 
Sbjct  561   ADSLTNISVGDLLAEVPQDLNDNCVDHPVPESSLCFQQIPFSCDSFDAAIAAHISRHQNK  620

Query  2047  TDSQAALPSQLSSIWGAEDTCDAFAFQRHSLSEKVQNA--SKHTSLETCKQITLANTTAL  2220
                  +L S+ SSIW AE+TCDAF F ++ +   V  A  S   S   CKQI  A + + 
Sbjct  621   M-GVPSLASRASSIWDAEETCDAFLFPKNPIP-CVDGARLSGDASPAACKQI--ATSDSA  676

Query  2221  GASVEDL----PGARNPVDGDAATADLESVHYSPTSDVV-----KDFNGLSDVYWPDSLG  2373
             G+    L    P    P++  A     E V   P+   +     KDFNGL+D+YWPDSLG
Sbjct  677   GSEYMQLFVQSPDPEEPMENSACE---ELVDEHPSDPYIVDTTEKDFNGLTDIYWPDSLG  733

Query  2374  PLDLDIPSSRYHSE-LILSDSLGGLTQLIASSLDAFQNCSFFGADKKEPVSTTEAQE  2541
             PLDLD PS +YHSE LIL DSLGGL +LIASSLDAFQNCSFFG DKKE  ST E ++
Sbjct  734   PLDLDAPSRKYHSEDLILGDSLGGLNRLIASSLDAFQNCSFFGLDKKESTSTVEGRD  790



>ref|XP_006373881.1| hypothetical protein POPTR_0016s09290g [Populus trichocarpa]
 gb|ERP51678.1| hypothetical protein POPTR_0016s09290g [Populus trichocarpa]
Length=784

 Score =   766 bits (1977),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 426/753 (57%), Positives = 516/753 (69%), Gaps = 66/753 (9%)
 Frame = +1

Query  427   QQPVKRQTRKWAAWTREEEESFFSALRHVGKNFEKITSRVQSKNKDQVRHYYYRLVRRMN  606
             +QP KR TR+WAAWTR+EEESFF+ALR VGKNFEKIT  VQSKNKDQVRHYYYRLVRRMN
Sbjct  37    RQPEKRPTRQWAAWTRQEEESFFTALRQVGKNFEKITHHVQSKNKDQVRHYYYRLVRRMN  96

Query  607   KLLGPELCLNAKNSRDTNAAMLRWWSLLEKYSCKASKLHLKPRRFKIFIETLENQLLKDR  786
             KLLGP LCL+AKNS+DTNAAMLRWWSLLEKYSCKASKLHLKPRRFKIFIE LENQLLKD+
Sbjct  97    KLLGPGLCLDAKNSKDTNAAMLRWWSLLEKYSCKASKLHLKPRRFKIFIEALENQLLKDQ  156

Query  787   KKNVRRCFSQGENTS-TAPISVSNQGRGASGHDGRSVKVVLLDNQDIHKFGSGKGSSLKR  963
             +KNVR+  SQGEN S T P  ++NQ R AS HD R+VK+V++D+Q+I K G GKG SLKR
Sbjct  157   RKNVRKRSSQGENGSPTTPSIITNQNR-ASVHDTRTVKLVIVDSQNIQKLG-GKG-SLKR  213

Query  964   HINIGANSTSCKADSSLLKTARHRRKIGATAAYKRWEKAAIAGVSLVADAAEHLERTTTD  1143
             ++N+G    + K DS+ +K AR RRK    AAYK+WEKAAIAGVSLVADAAEHLERT TD
Sbjct  214   NVNMGVVRNNNKGDSTAMKPARQRRK---PAAYKKWEKAAIAGVSLVADAAEHLERTATD  270

Query  1144  KEDGHFQDSNVRNVFEHSGK-DPHVFPDLLHNSFNETNLQNSGKLKLQLFPVDDGTRRAL  1320
             KED H Q    +   +   K  PH  P L      E+N   + KLKLQLFP+DDGTRRAL
Sbjct  271   KEDEHDQGMVGKKGLDPVEKLLPHFHPSL---RCVESNALTNMKLKLQLFPIDDGTRRAL  327

Query  1321  ELDNHNPYLELTLSTRKKMSSVLEHLNRKWGNSSMACGDLMLFPYHLHKENLVHFQKWTK  1500
             E+D HNP+LELTLSTRKK+SSVLEHLNRKWG+S++A G+LMLFPY +++ENLV +Q+WT+
Sbjct  328   EMDKHNPHLELTLSTRKKISSVLEHLNRKWGDSTVASGELMLFPYSVNRENLVSYQRWTQ  387

Query  1501  DTTLTAADVYALTGSPPVFRLRYGWFSN---AEVAFRAPVS-SAIP---SRHDANMNIMP  1659
             D+ ++AADVY   GSPPVFRLRYGWF N   A V  +AP + S +P   +  D  M+ +P
Sbjct  388   DSLVSAADVYFSIGSPPVFRLRYGWFFNVNFASVTLQAPSTYSCLPVGGNEKDKTMDSVP  447

Query  1660  ESSVGVLQAPSTDP--PKEANGCVSMNTV--NASRSSDHTEAVLWENPETVVT-------  1806
              +       PST     K  N C    T   N   S  H+  V  EN E V T       
Sbjct  448   TAE------PSTSDQFEKPENPCRDCPTSENNNHASILHSAGVTNENNEFVATGPRNNLV  501

Query  1807  ------------------------EAEVDDLQFNKAGTSCVGEWADSLTNISVGDLLSEA  1914
                                       +VD L+ +       GEWADSLTN+S+GDLLSE 
Sbjct  502   KSFDPAANISLHRKETDDRTNTQQSEDVDGLRLSNVNPLSAGEWADSLTNVSIGDLLSEL  561

Query  1915  PDMEDANCITSSIHSSSNYIHQIPFSCDSFDAAIAAHIKKHQNVTDSQAALPSQLSSIWG  2094
             P + + NCI S I  S+  + +IPFSCDSFDAAIAAHI +HQ      +A+ S  SSIW 
Sbjct  562   PHVANHNCIESLIVQSNQCLQEIPFSCDSFDAAIAAHISRHQGKMGFHSAVASYTSSIWD  621

Query  2095  AEDTCDAFAFQR-HSLSEKVQNASKHTSLETCKQITLANTTALGASVEDLPGARNPVDGD  2271
              E+TCDAFAFQ+ HSL ++V  +S   ++ + ++  L         +++LP    P D  
Sbjct  622   GEETCDAFAFQKNHSLRKEVTTSS---AVASPRKGGLIKGNVFTLVLQELPVIEGPNDYP  678

Query  2272  AATADLE--SVHYSPTSDVVKDFNGLSDVYWPDSLGPLDLDIPSSRYHSE-LILSDSLGG  2442
                  ++  S      S+ VKDFNGL+D+YWPDSLG LDLDIPSS+YH+E LILSDSLGG
Sbjct  679   TGGEPMDECSSDSQVVSNQVKDFNGLTDIYWPDSLGLLDLDIPSSKYHTEDLILSDSLGG  738

Query  2443  LTQLIASSLDAFQNCSFFGADKKEPVSTTEAQE  2541
             L  LIASSLDAFQNCSFFG +KK+ +ST EA+E
Sbjct  739   LNHLIASSLDAFQNCSFFGLNKKDSISTVEARE  771



>ref|XP_011018736.1| PREDICTED: TSL-kinase interacting protein 1 isoform X2 [Populus 
euphratica]
Length=782

 Score =   764 bits (1972),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 422/746 (57%), Positives = 515/746 (69%), Gaps = 54/746 (7%)
 Frame = +1

Query  427   QQPVKRQTRKWAAWTREEEESFFSALRHVGKNFEKITSRVQSKNKDQVRHYYYRLVRRMN  606
             +QP KR TR+WAAWT +EEESFF+ALR VGKNFEKIT  VQSKNKDQVRHYYYRLVRRMN
Sbjct  37    RQPEKRPTRQWAAWTHQEEESFFNALRQVGKNFEKITRHVQSKNKDQVRHYYYRLVRRMN  96

Query  607   KLLGPELCLNAKNSRDTNAAMLRWWSLLEKYSCKASKLHLKPRRFKIFIETLENQLLKDR  786
             KLLGP LCL+AKNS+DTNAAMLRWWSLL KYSCKASKLHLKPRRFKIF+E LENQLLKDR
Sbjct  97    KLLGPGLCLDAKNSKDTNAAMLRWWSLLAKYSCKASKLHLKPRRFKIFVEALENQLLKDR  156

Query  787   KKNVRRCFSQGENTS-TAPISVSNQGRGASGHDGRSVKVVLLDNQDIHKFGSGKGSSLKR  963
             +KNVR+  SQGEN S T P  ++NQ R ASGHD R+VK+VL+D+Q+I K G GKG SLKR
Sbjct  157   RKNVRKRSSQGENGSPTTPSIITNQNR-ASGHDTRTVKLVLVDSQNIQKLGGGKG-SLKR  214

Query  964   HINIGANSTSCKADSSLLKTARHRRKIGATAAYKRWEKAAIAGVSLVADAAEHLERTTTD  1143
             ++N+G    + K DS+ +K AR RRK  ++AAYK+WEKAAIAGVSLVADAAEHLERT  D
Sbjct  215   NVNLGVIRNNNKGDSTAMKPARQRRKPASSAAYKKWEKAAIAGVSLVADAAEHLERTAPD  274

Query  1144  KEDGHFQDS----NVRNVFEHSGKDPHVFPDLLHNSFNETNLQNSGKLKLQLFPVDDGTR  1311
             KE  H Q      +V NV       P +   LLH+   E++  N+ KLKLQLFP+DDGTR
Sbjct  275   KEFEHDQGQKGLDSVENVL------PQLPASLLHDV--ESSAHNNMKLKLQLFPIDDGTR  326

Query  1312  RALELDNHNPYLELTLSTRKKMSSVLEHLNRKWGNSSMACGDLMLFPYHLHKENLVHFQK  1491
             RALE+D HNP+LELTLSTRKK+SSVLEHLNRKWGNS++A G+LMLFPY +++ENLV +Q+
Sbjct  327   RALEMDKHNPHLELTLSTRKKISSVLEHLNRKWGNSTVASGELMLFPYVVNRENLVGYQR  386

Query  1492  WTKDTTLTAADVYALTGSPPVFRLRYGWFSNAEVA---FRAPVS-SAIPSRHDANMNIM-  1656
             WT+++ ++AADVY   GSPPVFRLRYGWFSNA  A    +AP + S +    +     M 
Sbjct  387   WTQESLVSAADVYLSIGSPPVFRLRYGWFSNANFASMTLQAPSTYSCLTDGGNEKGKAMD  446

Query  1657  ------PESSVGVLQAPSTDPP-----------------KEANGCVSMNTV-NASRSSDH  1764
                   P +    L+ PS D P                  E N  + +  + N  +S D 
Sbjct  447   SVSITEPSTGDQFLEEPSRDCPTSMNSNHASTPHSAGVSNETNEFIDIGPINNLVKSFDP  506

Query  1765  TEAVLWENPET-----VVTEAEVDDLQFNKAGTSCVGEWADSLTNISVGDLLSEAPDMED  1929
                  W   ET          +VD L+ +       GEWADSLT++S+GDLLSE P   D
Sbjct  507   AANTSWHRTETDDRTGTQQLEDVDGLRLSNVNVLSAGEWADSLTDVSIGDLLSELPHEAD  566

Query  1930  ANCITSSIHSSSNYIHQIPFSCDSFDAAIAAHIKKHQNVTDSQAALPSQLSSIWGAEDTC  2109
              NC+   I  S+  + QIPFSCDSFDAAIAAHI +HQ+     +++ S  SSIW  E+TC
Sbjct  567   FNCV-EPIVQSNQCLQQIPFSCDSFDAAIAAHISRHQSKMGFVSSVTSHTSSIWDGEETC  625

Query  2110  DAFAFQR-HSLSEKVQNASKHTSLETCKQITLANTTALGASVEDLPGARNPVDGDAATAD  2286
             DAFAFQR HSL ++V   S   S +  KQ+   ++ A GA +E LP    P+D       
Sbjct  626   DAFAFQRNHSLRKEV-TTSAVASPQVGKQMDRTSSIASGAFLE-LPDFVGPMDYPTGEDC  683

Query  2287  LESVHYSPTSDVVKDFNGLSDVYWPDSLGPLDLDIPSSRYHSE-LILSDSLGGLTQLIAS  2463
             +        ++  K+FNGL+D+YWPDSLG LDLDIPS++YH+E LILSDSLGGL  LIAS
Sbjct  684   MCLSDSQAGNNQAKNFNGLTDIYWPDSLGQLDLDIPSTKYHAEDLILSDSLGGLNHLIAS  743

Query  2464  SLDAFQNCSFFGADKKEPVSTTEAQE  2541
             SLDAFQNCSFFG +KK+  ST EA+E
Sbjct  744   SLDAFQNCSFFGLNKKDLTSTVEARE  769



>ref|XP_011030216.1| PREDICTED: TSL-kinase interacting protein 1-like [Populus euphratica]
Length=784

 Score =   763 bits (1971),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 424/750 (57%), Positives = 513/750 (68%), Gaps = 60/750 (8%)
 Frame = +1

Query  427   QQPVKRQTRKWAAWTREEEESFFSALRHVGKNFEKITSRVQSKNKDQVRHYYYRLVRRMN  606
             +QP KR TR+WAAWTR+EEESFF+ALR VGKNFEKIT  VQSKNKDQVRHYYYRLVRRMN
Sbjct  37    RQPEKRPTRQWAAWTRQEEESFFTALRQVGKNFEKITHHVQSKNKDQVRHYYYRLVRRMN  96

Query  607   KLLGPELCLNAKNSRDTNAAMLRWWSLLEKYSCKASKLHLKPRRFKIFIETLENQLLKDR  786
             KLLGP LCL+AKNS+DTNAAMLRWWSLLEKYSCKASKLHLKPRRFKIFIE LENQLLKD+
Sbjct  97    KLLGPGLCLDAKNSKDTNAAMLRWWSLLEKYSCKASKLHLKPRRFKIFIEALENQLLKDQ  156

Query  787   KKNVRRCFSQGENTS-TAPISVSNQGRGASGHDGRSVKVVLLDNQDIHKFGSGKGSSLKR  963
             +KNVR+  SQGEN S T P  ++NQ R AS HD R+VK+V++D+Q+I K G GKG SLKR
Sbjct  157   RKNVRKRSSQGENGSPTTPSIITNQNR-ASVHDTRTVKLVIVDSQNIQKLG-GKG-SLKR  213

Query  964   HINIGANSTSCKADSSLLKTARHRRKIGATAAYKRWEKAAIAGVSLVADAAEHLERTTTD  1143
             ++N+G    + K DS+ +K AR RRK  ++AAYK+WEKAAIAGVSLVADAAEHLERT TD
Sbjct  214   NVNMGVVRNNNKGDSTAMKPARQRRKPVSSAAYKKWEKAAIAGVSLVADAAEHLERTATD  273

Query  1144  KEDGHFQDSNVRNVFEHSGKDPHVFPDLLHNSFNETNLQNSGKLKLQLFPVDDGTRRALE  1323
             KED H Q     +  E     PH  P L      E+N   + KLKLQLFP+DDGTRRALE
Sbjct  274   KEDEHDQGKKGLDPVEKLL--PHFHPSL---RCVESNALTNMKLKLQLFPIDDGTRRALE  328

Query  1324  LDNHNPYLELTLSTRKKMSSVLEHLNRKWGNSSMACGDLMLFPYHLHKENLVHFQKWTKD  1503
             +D HNP+LELTLSTRKK+SSVLEHLNRKWG+S++A G+LMLFPY +++ENLV +Q+WT+D
Sbjct  329   MDKHNPHLELTLSTRKKISSVLEHLNRKWGDSTVASGELMLFPYGVNRENLVGYQRWTQD  388

Query  1504  TTLTAADVYALTGSPPVFRLRYGWFSN---AEVAFRAPVS-SAIPSRHDANMNIMPESSV  1671
             + ++AADVY   GSPPVFRLRYGWFS+   A V  +AP + S +P   +     M   SV
Sbjct  389   SLVSAADVYFSIGSPPVFRLRYGWFSSVNFASVTLQAPSTYSCLPVGGNEKEKTM--DSV  446

Query  1672  GVLQAPSTDP-PKEANGCVSMNTVNASRSSDHTEAVLWENPETVVT--------------  1806
                +  ++D   K  N C    T   +  +    +    N E V T              
Sbjct  447   SAAEPSTSDQFEKPENPCRDCPTSENNNHASILHSAGVTNNEFVATGPRNKLVKSFDPAA  506

Query  1807  -----EAEVDDL-----------QFNKAGTSCVGEWADSLTNISVGDLLSEAPDMEDANC  1938
                    E DD            + +       GEWADSLTN S+GDLLSE P + + NC
Sbjct  507   NISLHRKEADDRTNMQQLEDVDGRLSNVNPLSAGEWADSLTNASIGDLLSELPHVANHNC  566

Query  1939  ITSSIHSSSNYIHQIPFSCDSFDAAIAAHIKKHQNVTDSQAALPSQLSSIWGAEDTCDAF  2118
             I   I  S+  + +IPFSCDSFDAAIAAHI +HQ      +A+ S  SSIW  E+TCDAF
Sbjct  567   IEPLIVQSNQCLQEIPFSCDSFDAAIAAHISRHQGKMGFHSAVASHTSSIWDGEETCDAF  626

Query  2119  AFQR-HSLSEKVQNASKHTSLETCKQITLANTTALGASVEDLPGARNPVD-------GDA  2274
             AFQ+ HSL ++V   S   S    KQ+   ++ A  A +E+LP    P D        D 
Sbjct  627   AFQKNHSLCKEVTTRSAVASPRVSKQMDRTSSIASSAFLEELPVIEGPHDYPTGGDPMDE  686

Query  2275  ATADLESVHYSPTSDVVKDFNGLSDVYWPDSLGPLDLDIPSSRYHSE-LILSDSLGGLTQ  2451
              ++D + V     S+ VKDFNGL+D+YWPDSLG LDLDI SS+YH+E LILSDSLGGL  
Sbjct  687   CSSDSQVV-----SNQVKDFNGLTDIYWPDSLGLLDLDIQSSKYHTEDLILSDSLGGLNH  741

Query  2452  LIASSLDAFQNCSFFGADKKEPVSTTEAQE  2541
             LIASSLDAFQNCSFFG +KK+ +ST EA+E
Sbjct  742   LIASSLDAFQNCSFFGLNKKDSISTVEARE  771



>ref|XP_011018737.1| PREDICTED: TSL-kinase interacting protein 1 isoform X3 [Populus 
euphratica]
Length=780

 Score =   763 bits (1969),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 422/746 (57%), Positives = 514/746 (69%), Gaps = 56/746 (8%)
 Frame = +1

Query  427   QQPVKRQTRKWAAWTREEEESFFSALRHVGKNFEKITSRVQSKNKDQVRHYYYRLVRRMN  606
             +QP KR TR+WAAWT +EEESFF+ALR VGKNFEKIT  VQSKNKDQVRHYYYRLVRRMN
Sbjct  37    RQPEKRPTRQWAAWTHQEEESFFNALRQVGKNFEKITRHVQSKNKDQVRHYYYRLVRRMN  96

Query  607   KLLGPELCLNAKNSRDTNAAMLRWWSLLEKYSCKASKLHLKPRRFKIFIETLENQLLKDR  786
             KLLGP LCL+AKNS+DTNAAMLRWWSLL KYSCKASKLHLKPRRFKIF+E LENQLLKDR
Sbjct  97    KLLGPGLCLDAKNSKDTNAAMLRWWSLLAKYSCKASKLHLKPRRFKIFVEALENQLLKDR  156

Query  787   KKNVRRCFSQGENTS-TAPISVSNQGRGASGHDGRSVKVVLLDNQDIHKFGSGKGSSLKR  963
             +KNVR+  SQGEN S T P  ++NQ R ASGHD R+VK+VL+D+Q+I K G GKG SLKR
Sbjct  157   RKNVRKRSSQGENGSPTTPSIITNQNR-ASGHDTRTVKLVLVDSQNIQKLGGGKG-SLKR  214

Query  964   HINIGANSTSCKADSSLLKTARHRRKIGATAAYKRWEKAAIAGVSLVADAAEHLERTTTD  1143
             ++N+G    + K DS+ +K AR RRK    AAYK+WEKAAIAGVSLVADAAEHLERT  D
Sbjct  215   NVNLGVIRNNNKGDSTAMKPARQRRK---PAAYKKWEKAAIAGVSLVADAAEHLERTAPD  271

Query  1144  KEDGHFQDS----NVRNVFEHSGKDPHVFPDLLHNSFNETNLQNSGKLKLQLFPVDDGTR  1311
             KE  H Q      +V NV       P +   LLH+   E++  N+ KLKLQLFP+DDGTR
Sbjct  272   KEFEHDQGQKGLDSVENVL------PQLPASLLHDV--ESSAHNNMKLKLQLFPIDDGTR  323

Query  1312  RALELDNHNPYLELTLSTRKKMSSVLEHLNRKWGNSSMACGDLMLFPYHLHKENLVHFQK  1491
             RALE+D HNP+LELTLSTRKK+SSVLEHLNRKWGNS++A G+LMLFPY +++ENLV +Q+
Sbjct  324   RALEMDKHNPHLELTLSTRKKISSVLEHLNRKWGNSTVASGELMLFPYVVNRENLVGYQR  383

Query  1492  WTKDTTLTAADVYALTGSPPVFRLRYGWFSNAEVA---FRAPVS-SAIPSRHDANMNIM-  1656
             WT+++ ++AADVY   GSPPVFRLRYGWFSNA  A    +AP + S +    +     M 
Sbjct  384   WTQESLVSAADVYLSIGSPPVFRLRYGWFSNANFASMTLQAPSTYSCLTDGGNEKGKAMD  443

Query  1657  ------PESSVGVLQAPSTDPP-----------------KEANGCVSMNTV-NASRSSDH  1764
                   P +    L+ PS D P                  E N  + +  + N  +S D 
Sbjct  444   SVSITEPSTGDQFLEEPSRDCPTSMNSNHASTPHSAGVSNETNEFIDIGPINNLVKSFDP  503

Query  1765  TEAVLWENPET-----VVTEAEVDDLQFNKAGTSCVGEWADSLTNISVGDLLSEAPDMED  1929
                  W   ET          +VD L+ +       GEWADSLT++S+GDLLSE P   D
Sbjct  504   AANTSWHRTETDDRTGTQQLEDVDGLRLSNVNVLSAGEWADSLTDVSIGDLLSELPHEAD  563

Query  1930  ANCITSSIHSSSNYIHQIPFSCDSFDAAIAAHIKKHQNVTDSQAALPSQLSSIWGAEDTC  2109
              NC+   I  S+  + QIPFSCDSFDAAIAAHI +HQ+     +++ S  SSIW  E+TC
Sbjct  564   FNCV-EPIVQSNQCLQQIPFSCDSFDAAIAAHISRHQSKMGFVSSVTSHTSSIWDGEETC  622

Query  2110  DAFAFQR-HSLSEKVQNASKHTSLETCKQITLANTTALGASVEDLPGARNPVDGDAATAD  2286
             DAFAFQR HSL ++V   S   S +  KQ+   ++ A GA +E+LP    P+D       
Sbjct  623   DAFAFQRNHSLRKEV-TTSAVASPQVGKQMDRTSSIASGAFLEELPDFVGPMDYPTGEDC  681

Query  2287  LESVHYSPTSDVVKDFNGLSDVYWPDSLGPLDLDIPSSRYHSE-LILSDSLGGLTQLIAS  2463
             +        ++  K+FNGL+D+YWPDSLG LDLDIPS++YH+E LILSDSLGGL  LIAS
Sbjct  682   MCLSDSQAGNNQAKNFNGLTDIYWPDSLGQLDLDIPSTKYHAEDLILSDSLGGLNHLIAS  741

Query  2464  SLDAFQNCSFFGADKKEPVSTTEAQE  2541
             SLDAFQNCSFFG +KK+  ST EA+E
Sbjct  742   SLDAFQNCSFFGLNKKDLTSTVEARE  767



>gb|KHG04889.1| TSL-kinase interacting 1 -like protein [Gossypium arboreum]
Length=807

 Score =   756 bits (1952),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 423/775 (55%), Positives = 514/775 (66%), Gaps = 69/775 (9%)
 Frame = +1

Query  397   LASFEEHSALQQPVKRQTRKWAAWTREEEESFFSALRHVGKNFEKITSRVQSKNKDQVRH  576
             + S   +S L+QP K+ TR+WAAWTR+EEESFF+ALR   +NFEKIT RVQSKNKDQVRH
Sbjct  30    VPSTSNNSVLEQPAKKPTRQWAAWTRQEEESFFTALR---QNFEKITCRVQSKNKDQVRH  86

Query  577   YYYRLVRRMNKLLGPELCLNAKNSRDTNAAMLRWWSLLEKYSCKASKLHLKPRRFKIFIE  756
             YYYRLVRRMNKLLGP LCL+AKNS+DTNAAMLRWWSLLEKYSCKASKLHLKPRRFKIFIE
Sbjct  87    YYYRLVRRMNKLLGPGLCLDAKNSKDTNAAMLRWWSLLEKYSCKASKLHLKPRRFKIFIE  146

Query  757   TLENQLLKDRKKNVRRCFSQGENTS-TAPISVSNQGRGASGHDGRSVKVVLLDNQDIHKF  933
              LE+QLLKDRKKNVR+  S GEN S T+P + +NQ R ASGHD  +VK+VL+++Q+I K 
Sbjct  147   ALEHQLLKDRKKNVRKRPSHGENISPTSPNTTTNQSR-ASGHDAHTVKLVLVESQNIQKL  205

Query  934   GSGKGSSLKRHINIGAN-------STSCKADSSLLKTARHRRK-IGATAAYKRWEKAAIA  1089
             G GKG S KR+ N+G N       S + K  S+ +K AR R K + ++AAYK+WEKAAIA
Sbjct  206   GPGKG-SFKRNSNVGVNRSNNKGESNTMKVASNTMKPARQRWKSVASSAAYKKWEKAAIA  264

Query  1090  GVSLVADAAEHLERTTTDKEDGHFQDS--NVRNVFEHSGKDPHVFPDLLHNSFNETNLQN  1263
             GVSLVADAAEHLERTT+DKE  H QD+      + E    +    P    N F E+N+  
Sbjct  265   GVSLVADAAEHLERTTSDKEVEHEQDTPDPEHKILEPVDNNQLPLPAFSQNPFAESNVHA  324

Query  1264  SGKLKLQLFPVDDGTRRALELDNHNPYLELTLSTRKKMSSVLEHLNRKWGNSSMACGDLM  1443
             + KLKLQLFP+DD TRRALE+D HNPYLELTLS RKK+SSVLEHLNRKWGNSS+A G +M
Sbjct  325   TVKLKLQLFPIDDNTRRALEMDKHNPYLELTLSIRKKISSVLEHLNRKWGNSSVASGVVM  384

Query  1444  LFPYHLHKENLVHFQKWTKDTTLTAADVYALTGSPPVFRLRYGWFSNAEV---AFRAPVS  1614
             LFPY + +ENL  +Q+WT+   ++AADVYA+ G P VFRLRYGW S+AEV     +APVS
Sbjct  385   LFPYGVQRENLRAYQRWTQAAIVSAADVYAMIGRPQVFRLRYGWVSDAEVESLTRQAPVS  444

Query  1615  SAIPSR-HDANMN-----IMPESSVGV---------LQAPSTDPP---KEAN-------G  1719
             S+  S  H+ N       +M E+ V           L  P  + P   KE N       G
Sbjct  445   SSYLSNVHNMNAESRKSCVMEEAQVSASSNNDMSKKLDDPCKNQPILQKENNALEPPRTG  504

Query  1720  CVSMNTVNASR----------------SSDHTEAVLWENPETVVTEAEVDDLQF-NKAGT  1848
               ++   N S                 SSD +E     N   +   A+ DD +  N    
Sbjct  505   FPTLTEKNLSTGLKDNFGDSPIPARNASSDRSETC---NLAIMRWLADADDQRLRNSTAA  561

Query  1849  SCVGEWADSLTNISVGDLLSEAPDMEDANCITSSIHSSSNYIHQIPFSCDSFDAAIAAHI  2028
                GEWADSLTNISVG+LL+E P   D NC+  ++  +S  + QIPFSCDSFDAAIAAHI
Sbjct  562   LSAGEWADSLTNISVGELLAEVPHDLDGNCVDCAVTENSQCLQQIPFSCDSFDAAIAAHI  621

Query  2029  KKHQNVTDSQAALPSQLSSIWGAEDTCDAFAFQRHSL-SEKVQNASKHTSLETCKQITLA  2205
               HQN  D   ++PS  SSIW AEDTCDAF F+++ +    V   S  TS   CKQI   
Sbjct  622   SMHQNKMDI-PSIPSHASSIWDAEDTCDAFLFRKNPIPCTNVPRFSGITSQAACKQIARQ  680

Query  2206  NTTALGASVEDLPGARNPVDGDAATADLESVHYSP--TSDVVKDFNGLSDVYWPDSLGPL  2379
             N   L    ++ P    P++  A     +     P        DFNGL+D+YWP+SLGPL
Sbjct  681   NLAELSTHSKESPDPVEPMENSACEDLTDECPSDPHIMDTTENDFNGLTDIYWPESLGPL  740

Query  2380  DLDIPSSRYHS-ELILSDSLGGLTQLIASSLDAFQNCSFFGADKKEPVSTTEAQE  2541
             DLDIP+ +YH+ ELI SDSLGGL++LIASSLDAFQNCSFFG DK+EP ST  AQ+
Sbjct  741   DLDIPTCKYHTEELIFSDSLGGLSRLIASSLDAFQNCSFFGTDKREPTSTVGAQD  795



>ref|XP_008243985.1| PREDICTED: TSL-kinase interacting protein 1 isoform X3 [Prunus 
mume]
Length=739

 Score =   751 bits (1940),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 416/763 (55%), Positives = 506/763 (66%), Gaps = 68/763 (9%)
 Frame = +1

Query  325   IASSQEHAIPEQAMFSQDHSVTEQLASFEEHSALQQPVKRQTRKWAAWTREEEESFFSAL  504
             I +S+ H  P Q  F           S   H ALQQPVK+ TR+WAAWT +EEESFF+AL
Sbjct  8     IVNSEAH--PHQGGFFVQDGGPGLAPSTSNHVALQQPVKKPTRQWAAWTHQEEESFFAAL  65

Query  505   RHVGKNFEKITSRVQSKNKDQVRHYYYRLVRRMNKLLGPELCLNAKNSRDTNAAMLRWWS  684
             R VGKNFEKIT RVQSKNKDQVRHYYYRLVRRMNKLLGP L L++KNS+DTNAAMLRWWS
Sbjct  66    RQVGKNFEKITCRVQSKNKDQVRHYYYRLVRRMNKLLGPGLYLDSKNSKDTNAAMLRWWS  125

Query  685   LLEKYSCKASKLHLKPRRFKIFIETLENQLLKDRKKNVRRCFSQGENT-STAPISVSNQG  861
             LLEKYSCKASKLHLKPRRFKIFIE LE+QLLKDRKK+VR+  SQGEN    AP ++SNQ 
Sbjct  126   LLEKYSCKASKLHLKPRRFKIFIEALEHQLLKDRKKSVRKRPSQGENCPPNAPSTLSNQN  185

Query  862   RGASGHDGRSVKVVLLDNQDIHKFGSGKGSSLKRHINIGANSTSCKADSSLLKTARHRRK  1041
             R  SGHD R+VK+VL+D+ +I K G GK +SLKR++NIG N ++ K DSS +K AR RRK
Sbjct  186   R-PSGHDNRTVKLVLVDSHNIQKLGPGK-ASLKRNVNIGVNRSN-KGDSSTMKPARQRRK  242

Query  1042  IGA--TAAYKRWEKAAIAGVSLVADAAEHLERTTTDKEDGHFQDSNVRNVFEHSGKDPHV  1215
              GA  +AAYK+WEKAAIAGVSLVADAAEHLER  TDKE    + +  ++     GK    
Sbjct  243   PGALSSAAYKKWEKAAIAGVSLVADAAEHLERAITDKEVEQDRSAAGQSSAVPVGKILPP  302

Query  1216  FPDLLHNSFNETNLQNSGKLKLQLFPVDDGTRRALELDNHNPYLELTLSTRKKMSSVLEH  1395
              P  + N   E+ + N  KLKLQLFP+DDGTRRALE D HNPYLELTLSTRKK+SSVL+H
Sbjct  303   LPAFVQNIDAESGINNCMKLKLQLFPIDDGTRRALENDKHNPYLELTLSTRKKISSVLDH  362

Query  1396  LNRKWGNSSMACGDLMLFPYHLHKENLVHFQKWTKDTTLTAADVYALTGSPPVFRLRYGW  1575
             LNRKWGNS++A G+L LF Y + ++NL+ + +W +D+ ++AADVYA  G PPVFRLRYGW
Sbjct  363   LNRKWGNSNVASGELTLFHYSVQRDNLMGYPRWMQDSIVSAADVYATIGCPPVFRLRYGW  422

Query  1576  FSNAE---VAFRAPVSSAIPSRHDANMNIMPESSVGVLQAPSTDPPKEANG--CVSMNTV  1740
             FSNAE   V  + PV+S      ++N                     E NG  CVS N  
Sbjct  423   FSNAELGSVGLQTPVASCSNQAEESN---------------------EINGYICVSPNN-  460

Query  1741  NASRSSDHTEAVLWENPE-----TVVTEAEVDDLQFNKAGTSCVGEWADSLTNISVGDLL  1905
               +   D TE   W   E     T     +VDDL+         G WADSLTNIS+GDLL
Sbjct  461   --NFVGDPTEITSWHKKEAGDQSTSRHRGDVDDLRSITGTALSAGVWADSLTNISMGDLL  518

Query  1906  SEAPDMEDANCITSSIHSSSNYIHQIPFSCDSFDAAIAAHIKKHQNVTDSQAALPSQLSS  2085
             S      D NCI   +   S  + QIPFSCDSFDA IAAHI + QN    Q  +   +SS
Sbjct  519   SGVSHDLDTNCIDPPVAEGSQCLQQIPFSCDSFDAVIAAHISR-QNKMGCQPTMECHVSS  577

Query  2086  IWGAEDTCDAFAFQRHSLSEKVQNASKHTSLETCKQI-TLANTTALGAS-------VEDL  2241
             IW AE+TCDAF+FQ++S+               C+++ +L+     GAS       VE++
Sbjct  578   IWDAEETCDAFSFQKNSV--------------FCQEVSSLSAVAPPGASSVGSDCMVEEI  623

Query  2242  PGARNPVDGDAATADLESVHYSP--TSDVVKDFNGLSDVYWPDSLGPLDLDIPSSRYHSE  2415
                  P+D        +     P      VKDFN L+D+YWP+SLGPLDL++PSS+YHSE
Sbjct  624   SVVERPIDDPPQGGPTDECQSDPRILESSVKDFNALTDIYWPESLGPLDLEMPSSKYHSE  683

Query  2416  -LILSDSLGGLTQLIASSLDAFQNCSFFGADKKEPVSTTEAQE  2541
               +LSDSL GL +LIASSLDAFQNCSFFGA+K+EP ++ EA+E
Sbjct  684   DFVLSDSLSGLNRLIASSLDAFQNCSFFGANKREPTASVEARE  726



>ref|XP_002519505.1| DNA binding protein, putative [Ricinus communis]
 gb|EEF42919.1| DNA binding protein, putative [Ricinus communis]
Length=748

 Score =   741 bits (1912),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 424/755 (56%), Positives = 508/755 (67%), Gaps = 74/755 (10%)
 Frame = +1

Query  373   QDHSVTEQLASFEEHSALQQPV------------KRQTRKWAAWTREEEESFFSALRHVG  516
             +D S+T  +  + E    QQPV            K+ TR+WAAWTREEEESFF+ALR VG
Sbjct  23    RDPSITSLIPDYVEP---QQPVRNLITGKMLNAVKKPTRQWAAWTREEEESFFTALRQVG  79

Query  517   KNFEKITSRVQSKNKDQVRHYYYRLVRRMNKLLGPELCLNAKNSRDTNAAMLRWWSLLEK  696
             KNFEKIT RVQSKNKDQVRHYYYRLVRRMNKLLGP LCL+AKNS+DTNAAMLRWWSLLEK
Sbjct  80    KNFEKITRRVQSKNKDQVRHYYYRLVRRMNKLLGPGLCLDAKNSKDTNAAMLRWWSLLEK  139

Query  697   YSCKASKLHLKPRRFKIFIETLENQLLKDRKKNVRRCFSQGENTS-TAPISVSNQGRGAS  873
             YSCKASKLHLKPRRFKIFIE LENQLLKDRKKNVRR  SQ EN S + P +V+NQ R A 
Sbjct  140   YSCKASKLHLKPRRFKIFIEALENQLLKDRKKNVRRRPSQLENGSPSVPSNVNNQNR-AP  198

Query  874   GHDGRSVKVVLLDNQDIHKFGSGKGSSLKRHINIGANSTSCKADSSLLKTARHRRKIGAT  1053
             G++ R+VK+VL+D Q++ + GSGKG SLKR++NI     S + DS+ +K AR RRK    
Sbjct  199   GNETRTVKLVLMDTQNLQRLGSGKG-SLKRNMNISI-IRSNRGDSAAMKPARQRRK---Q  253

Query  1054  AAYKRWEKAAIAGVSLVADAAEHLERTTTDKEDGHFQDSNVRNVFEHSGKDPHVFPDLLH  1233
             AAYK+WEKAAIAGVSLVADAAEHLER TTDKE  H Q    +   +   K     P    
Sbjct  254   AAYKKWEKAAIAGVSLVADAAEHLERETTDKEVEHDQGMADQKSPDPVEKGLRPLPSFSQ  313

Query  1234  NSFNE--TNLQNSGKLKLQLFPVDDGTRRALELDNHNPYLELTLSTRKKMSSVLEHLNRK  1407
             N   +  TN+    KLKLQLFP+DDGTRRALE+DNHNP+LELTLSTRK++SSVLEHLNRK
Sbjct  314   NHCVDSYTNI----KLKLQLFPIDDGTRRALEMDNHNPHLELTLSTRKRISSVLEHLNRK  369

Query  1408  WGNSSMACGDLMLFPYHLHKENLVHFQKWTKDTTLTAADVYALTGSPPVFRLRYGWFSNA  1587
             WGNSS+A G+LMLFPY +H+ENL  +Q+WT+D+ ++A DVY   GSP VFRLRYGWFSN 
Sbjct  370   WGNSSIASGELMLFPYSVHRENLTGYQRWTQDSIVSAVDVYTSIGSPSVFRLRYGWFSNT  429

Query  1588  EVAFRA----PVSSAIPSRHDANM----NIM-PESSVGVLQAPSTDPPKEANGCVSMNTV  1740
             +VA  A    P SS IP  +  ++     IM P S+ G+     ++  K+    V  +  
Sbjct  430   DVASVALQATPSSSYIPGGNTLDIENETRIMNPVSTSGLSTNDLSETCKDQLATVKKSHA  489

Query  1741  NASRSSDHTEAVLWENPETVVTEAEVDDLQFNKAGTSCVGEWADSLTNISVGDLLSEAPD  1920
             +A  S+D                +E+  L  N A  S  GEWADSLTNISVGDLLSE   
Sbjct  490   SAPSSTD--------------VSSEISGLS-NSAALS-AGEWADSLTNISVGDLLSEVSR  533

Query  1921  MEDANCITSSIHSSSNYIHQIPFSCDSFDAAIAAHIKKHQNVTDSQAALPSQL----SSI  2088
                 NCI + +  S   + QIPFSCDSFDAAIAAH+ +HQN       LPS L    SSI
Sbjct  534   DVIPNCIETPLAQSGQCLQQIPFSCDSFDAAIAAHMSRHQN-----KILPSTLTSHTSSI  588

Query  2089  WGAEDTCDAFAFQRHSLSEKVQNASKHTSLETCKQITLANTTALGASVEDLPGARNPVDG  2268
             W AE+TCDAF FQ++  + + +N +        +Q T  N    G  VE L G   P  G
Sbjct  589   WDAEETCDAFIFQKNR-ALRQENPTSAVDSAGIEQQT--NKLTSGTFVERLAGGDCPAAG  645

Query  2269  DA---ATADLESVHYSPTSDVVKDFNGLSDVYWPDSLGPLDLDIPSSRYHS-ELILSDSL  2436
             D       DL+       S+  KDF GL+D+YWP+SLGPLDLD+P S+YHS E ILSDSL
Sbjct  646   DPMDECPPDLQVF-----SNSAKDFTGLTDIYWPESLGPLDLDLPPSKYHSEEFILSDSL  700

Query  2437  GGLTQLIASSLDAFQNCSFFGADKKEPVSTTEAQE  2541
              GL +LIASSLDAFQNCSFFG D+K+  +  EA+E
Sbjct  701   SGLNRLIASSLDAFQNCSFFGLDRKDGTTILEARE  735



>ref|XP_004304454.1| PREDICTED: TSL-kinase interacting protein 1-like [Fragaria vesca 
subsp. vesca]
Length=766

 Score =   737 bits (1903),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 408/747 (55%), Positives = 506/747 (68%), Gaps = 51/747 (7%)
 Frame = +1

Query  403   SFEEHSALQQPVKRQTRKWAAWTREEEESFFSALRHVGKNFEKITSRVQSKNKDQVRHYY  582
             S   H A+QQPVK+ TR+WAAWT EEE+SFF+ALR VGKNFEKIT RVQSKNKDQVRHYY
Sbjct  24    STSNHVAVQQPVKKPTRQWAAWTHEEEQSFFAALRQVGKNFEKITRRVQSKNKDQVRHYY  83

Query  583   YRLVRRMNKLLGPELCLNAKNSRDTNAAMLRWWSLLEKYSCKASKLHLKPRRFKIFIETL  762
             YRLVRRMNKLLGP L L++KNS+DTNAAMLRWWSLLEKYSCKASKLHLKPRRFKIF+E L
Sbjct  84    YRLVRRMNKLLGPGLYLDSKNSKDTNAAMLRWWSLLEKYSCKASKLHLKPRRFKIFMEAL  143

Query  763   ENQLLKDRKKNVRRCFSQGENTST-APISVSNQGRGASGHDGRSVKVVLLDNQDIHKFGS  939
             E+QLLKDRKK VR+  SQGEN    AP +V NQ R  S HD R VK++L+D+ +I K G 
Sbjct  144   EHQLLKDRKKTVRKRPSQGENCPPEAPSTVPNQNR-PSEHD-RPVKLILVDSHNIQKSGP  201

Query  940   GKGSSLKRHINIGANSTSCKADSSLLKTARHRRKIGATAAYKRWEKAAIAGVSLVADAAE  1119
             GK +SLKR   +G N  + K D+S +K AR RRK     AYK+WEKAAIAGVSLVADAAE
Sbjct  202   GK-ASLKRS-GVGVNRGN-KGDASTVKPARQRRK---PIAYKKWEKAAIAGVSLVADAAE  255

Query  1120  HLERTTTDKEDGHFQDSNVRNVFEHSGKDPHVFPDLLHNSFNETNLQNSGKLKLQLFPVD  1299
             HLERT  +KE G  Q S  RN     G      PD   N + E N+ NS KLKLQLFP+D
Sbjct  256   HLERTI-EKEVGQDQSSAERNSAVPVGNFLPPMPDFSQNIYAENNIHNSMKLKLQLFPID  314

Query  1300  DGTRRALELDNHNPYLELTLSTRKKMSSVLEHLNRKWGNSSMACGDLMLFPYHLHKENLV  1479
             D TRRALE+D HNP+LELTL TRKK+SSV+EHLNRKWG+SS+A G+LMLFP  + +++  
Sbjct  315   DSTRRALEMDKHNPHLELTLPTRKKISSVMEHLNRKWGSSSVASGELMLFPNSVQQDSPT  374

Query  1480  HFQKWTKDTTLTAADVYALTGSPPVFRLRYGWFSNAE---VAFRAPVSS-AIPSRHDANM  1647
              + +WT+D+ ++A DVY++ GSPPVFRLRYGWFS+ E   V  +APV+   I   HD N+
Sbjct  375   GYLRWTQDSNVSAGDVYSMIGSPPVFRLRYGWFSSTELGSVLSQAPVAPFRILGEHD-NV  433

Query  1648  NIMPESSVGVLQAPSTDPPKEANGCVSM-NTVNASRSSDH--------------------  1764
               M +    V+++  T PP  +N C  + N +  S + +H                    
Sbjct  434   EKMKDP---VMESTPTSPPSASNQCGDIHNDLLTSVTKNHSLDQTSDGEPNQKNNLVGDP  490

Query  1765  TEAVLWE-----NPETVVTEAEVDDLQFNKAGTSCVGEWADSLTNISVGDLLSEAPDMED  1929
             T++  W      +   +  + EVD L+ +K       EWADSLTNISVGDLL+      D
Sbjct  491   TKSTSWHEKVAGDQGILRHQGEVDGLRLHKGTALSAKEWADSLTNISVGDLLTGVTHDLD  550

Query  1930  ANCITSSIHSSSNYIHQIPFSCDSFDAAIAAHIKKHQNVTDSQAALPSQLSSIWGAEDTC  2109
             ANCI  ++   S  + QIPFSCDSFDAAIAAHI + +N  + +  + S +SSIW AE+TC
Sbjct  551   ANCIDQTLTGRSQCLPQIPFSCDSFDAAIAAHISRQKNKMECEPPMVSHVSSIWDAEETC  610

Query  2110  DAFAFQRHSLSEKVQNASKHTSLETCKQITLANTTALGASVEDLPGARNPVDGDAATADL  2289
             DAF FQ++S        S       CKQI   ++      VEDLP    P++ D     +
Sbjct  611   DAFVFQKNS---AFHQQSGIALPGDCKQIASTSSAGCDRMVEDLPVVETPIN-DPQGDPM  666

Query  2290  ESVHYSP--TSDVVKDFNGLSDVYWPDSLGPLDLDIPSSRYHSE-LILSDSLGGLTQLIA  2460
             +     P    + VKDFN L+D+YWP+SLGPLDLD+PSS+YH+E LIL+DSL GL +LIA
Sbjct  667   DECQSDPHILGNSVKDFNALADIYWPESLGPLDLDLPSSKYHNEDLILNDSLSGLNRLIA  726

Query  2461  SSLDAFQNCSFFGADKKEPVSTTEAQE  2541
             SSLDAFQNCSFFG++KKEP  + EA+E
Sbjct  727   SSLDAFQNCSFFGSNKKEPTPSVEARE  753



>ref|XP_008243983.1| PREDICTED: TSL-kinase interacting protein 1 isoform X1 [Prunus 
mume]
Length=813

 Score =   739 bits (1907),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 423/816 (52%), Positives = 515/816 (63%), Gaps = 100/816 (12%)
 Frame = +1

Query  325   IASSQEHAIPEQAMFSQDHSVTEQLASFEEHSALQQPVKRQTRKWAAWTREEEESFFSAL  504
             I +S+ H  P Q  F           S   H ALQQPVK+ TR+WAAWT +EEESFF+AL
Sbjct  8     IVNSEAH--PHQGGFFVQDGGPGLAPSTSNHVALQQPVKKPTRQWAAWTHQEEESFFAAL  65

Query  505   RHVGKNFEKITSRVQSKNKDQVRHYYYRLVRRMNKLLGPELCLNAKNSRDTNAAMLRWWS  684
             R VGKNFEKIT RVQSKNKDQVRHYYYRLVRRMNKLLGP L L++KNS+DTNAAMLRWWS
Sbjct  66    RQVGKNFEKITCRVQSKNKDQVRHYYYRLVRRMNKLLGPGLYLDSKNSKDTNAAMLRWWS  125

Query  685   LLEKYSCKASKLHLKPRRFKIFIETLENQLLKDRKKNVRRCFSQGENT-STAPISVSNQG  861
             LLEKYSCKASKLHLKPRRFKIFIE LE+QLLKDRKK+VR+  SQGEN    AP ++SNQ 
Sbjct  126   LLEKYSCKASKLHLKPRRFKIFIEALEHQLLKDRKKSVRKRPSQGENCPPNAPSTLSNQN  185

Query  862   RGASGHDGRSVKVVLLDNQDIHKFGSGKGSSLKRHINIGANSTSCKADSSLLKTARHRRK  1041
             R  SGHD R+VK+VL+D+ +I K G GK +SLKR++NIG N ++ K DSS +K AR RRK
Sbjct  186   R-PSGHDNRTVKLVLVDSHNIQKLGPGK-ASLKRNVNIGVNRSN-KGDSSTMKPARQRRK  242

Query  1042  IGA--TAAYKRWEKAAIAGVSLVADAAEHLERTTTDKEDGHFQDSNVRNVFEHSGKDPHV  1215
              GA  +AAYK+WEKAAIAGVSLVADAAEHLER  TDKE    + +  ++     GK    
Sbjct  243   PGALSSAAYKKWEKAAIAGVSLVADAAEHLERAITDKEVEQDRSAAGQSSAVPVGKILPP  302

Query  1216  FPDLLHNSFNETNLQNSGKLKLQLFPVDDGTRRALELDNHNPYLELTLSTRKKMSSVLEH  1395
              P  + N   E+ + N  KLKLQLFP+DDGTRRALE D HNPYLELTLSTRKK+SSVL+H
Sbjct  303   LPAFVQNIDAESGINNCMKLKLQLFPIDDGTRRALENDKHNPYLELTLSTRKKISSVLDH  362

Query  1396  LNRKWGNSSMACGDLMLFPYHLHKENLVHFQKWTKDTTLTAADVYALTGSPPVFRLRYGW  1575
             LNRKWGNS++A G+L LF Y + ++NL+ + +W +D+ ++AADVYA  G PPVFRLRYGW
Sbjct  363   LNRKWGNSNVASGELTLFHYSVQRDNLMGYPRWMQDSIVSAADVYATIGCPPVFRLRYGW  422

Query  1576  FSNAE---VAFRAPVSSAI-PSRHDAN-----MNIMPESSVGVL----------------  1680
             FSNAE   V  + PV+S      HD N       I+  + +  L                
Sbjct  423   FSNAELGSVGLQTPVASCSNQGEHDINEEKRKEQIVDSAPISPLSTDNQSADIHKDHLTS  482

Query  1681  -----------------QAPSTDPPK--------------EANG--CVSMNTVNASRSSD  1761
                              Q P    P+              E NG  CVS N    +   D
Sbjct  483   TNNSCVLSALDYQHSQPQLPERGKPRYNHSLGLTSAEESNEINGYICVSPNN---NFVGD  539

Query  1762  HTEAVLWENPE-----TVVTEAEVDDLQFNKAGTSCVGEWADSLTNISVGDLLSEAPDME  1926
              TE   W   E     T     +VDDL+         G WADSLTNIS+GDLLS      
Sbjct  540   PTEITSWHKKEAGDQSTSRHRGDVDDLRSITGTALSAGVWADSLTNISMGDLLSGVSHDL  599

Query  1927  DANCITSSIHSSSNYIHQIPFSCDSFDAAIAAHIKKHQNVTDSQAALPSQLSSIWGAEDT  2106
             D NCI   +   S  + QIPFSCDSFDA IAAHI + QN    Q  +   +SSIW AE+T
Sbjct  600   DTNCIDPPVAEGSQCLQQIPFSCDSFDAVIAAHISR-QNKMGCQPTMECHVSSIWDAEET  658

Query  2107  CDAFAFQRHSLSEKVQNASKHTSLETCKQI-TLANTTALGAS-------VEDLPGARNPV  2262
             CDAF+FQ++S+               C+++ +L+     GAS       VE++     P+
Sbjct  659   CDAFSFQKNSV--------------FCQEVSSLSAVAPPGASSVGSDCMVEEISVVERPI  704

Query  2263  DGDAATADLESVHYSP--TSDVVKDFNGLSDVYWPDSLGPLDLDIPSSRYHSE-LILSDS  2433
             D        +     P      VKDFN L+D+YWP+SLGPLDL++PSS+YHSE  +LSDS
Sbjct  705   DDPPQGGPTDECQSDPRILESSVKDFNALTDIYWPESLGPLDLEMPSSKYHSEDFVLSDS  764

Query  2434  LGGLTQLIASSLDAFQNCSFFGADKKEPVSTTEAQE  2541
             L GL +LIASSLDAFQNCSFFGA+K+EP ++ EA+E
Sbjct  765   LSGLNRLIASSLDAFQNCSFFGANKREPTASVEARE  800



>ref|XP_003519867.1| PREDICTED: TSL-kinase interacting protein 1-like [Glycine max]
 gb|KHN00475.1| TSL-kinase interacting protein 1 [Glycine soja]
Length=782

 Score =   736 bits (1901),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 418/747 (56%), Positives = 520/747 (70%), Gaps = 61/747 (8%)
 Frame = +1

Query  427   QQPVKRQTRKWAAWTREEEESFFSALRHVGKNFEKITSRVQSKNKDQVRHYYYRLVRRMN  606
             QQ  K+ TR+WAAWTR+EEESFF+ALR VGKNFEKITSRVQSKNKDQVRHYYYRLVRRMN
Sbjct  42    QQATKKPTRQWAAWTRQEEESFFTALRQVGKNFEKITSRVQSKNKDQVRHYYYRLVRRMN  101

Query  607   KLLGPELCLNAKNSRDTNAAMLRWWSLLEKYSCKASKLHLKPRRFKIFIETLENQLLKDR  786
             KLLGP LCL+AKNS+DTNAAMLRWWSLLEKYSCKASKLHLKPRRFKIF+E LE+QLLKDR
Sbjct  102   KLLGPGLCLDAKNSKDTNAAMLRWWSLLEKYSCKASKLHLKPRRFKIFLEALEHQLLKDR  161

Query  787   KKNVRRCFSQGENT-STAPISVSNQGRGASGHDGRSVKVVLLDNQDIHKFGSGKGSSLKR  963
             KKNVR+   QG N   +AP +VSNQ R ASG+D  +VK+VL+D+Q+I K G  K S+ KR
Sbjct  162   KKNVRKRPLQGGNCLPSAPTTVSNQSR-ASGNDAYAVKLVLVDSQNILKLGPSKPST-KR  219

Query  964   HINIGANSTSCKADSSLLKTARHRRKIG--ATAAYKRWEKAAIAGVSLVADAAEHLERTT  1137
             ++N+G N ++ K DS+ +K  R R+K G  +TAAY++WEKAAIAGVSLVADAAEHLER  
Sbjct  220   NVNMGVNRSNTKGDSNTMKPTRQRKKSGTISTAAYRKWEKAAIAGVSLVADAAEHLERAA  279

Query  1138  TDKEDGHFQDSNVRNVFEHSGK---DP--HVFPDL---LHNSFNETNLQNSGKLKLQLFP  1293
             T K  G  QD       E+ G+   DP  +V P L     N F + N+ N  KLKLQLFP
Sbjct  280   TVK--GIEQDQ------ENPGEKCSDPADYVLPSLPTCPQNQFVDNNVNNIMKLKLQLFP  331

Query  1294  VDDGTRRALELDNHNPYLELTLSTRKKMSSVLEHLNRKWGNSSMACGDLMLFPYHLHKEN  1473
             +D+ TRRALE+D HNP+LELTLSTRKK+SS+LEHLNRKWGNSS+A G++MLFPY + +EN
Sbjct  332   IDEPTRRALEMDKHNPHLELTLSTRKKISSILEHLNRKWGNSSIAAGEVMLFPYGIQREN  391

Query  1474  LVHFQKWTKDTTLTAADVYALTGSPPVFRLRYGWFSNAEVAF---RAPVSS-AIPSRHDA  1641
             LV+  +WT+++TL+AAD+YA+ GSPP+FRLRYGWFSN E+     + PV+S ++  ++ +
Sbjct  392   LVNCPRWTQESTLSAADIYAMIGSPPIFRLRYGWFSNTELGLLNMQVPVASGSMLRQYKS  451

Query  1642  NMNIMPESSVGVLQAPS----TDPPKEANGC-VSMN------TVNASRSSDHTEAVLWEN  1788
              ++   +  V  +  P+    T   + +  C  SMN      T +   S D T   LW  
Sbjct  452   TVDNAKDQIVNSVSFPTPLTNTHSMELSEDCRTSMNRNRTLITASTEESRDPTANTLWHG  511

Query  1789  PET----VVTEAE-VDDLQFNKAGTSCVGEWADSLTNISVGDLLSEAPDMEDANCITSSI  1953
              +     V T+ E +D+L+ +       GEWADSLTNISVGDLLS      D NCI   I
Sbjct  512   KDVRDGAVSTQLEDMDELKISSGAGLSAGEWADSLTNISVGDLLSGVSQDLD-NCIDPPI  570

Query  1954  HSSSNYIHQIPFSCDSFDAAIAAHIKKHQNVTDSQAALPSQLSSIWGAEDTCDAFAFQRH  2133
               + + I QIPFS DSFDAAIAAHI +HQ+    Q++L S +SSIW AE+TCDAF F++ 
Sbjct  571   AENFHDIQQIPFSSDSFDAAIAAHISRHQDRM-GQSSLASHMSSIWDAEETCDAFLFKKD  629

Query  2134  S-LSEKVQNASKHTSLETCKQITLANTTALGA-------SVEDLPGAR-NPVDGDAATAD  2286
               L E     S   SLE+ K++T  +   L          V+D      NP+D   + AD
Sbjct  630   PILHEDHPRLSPVASLESEKKVTKRSFDKLDELSPERERLVDDCAQTDPNPMDSSESDAD  689

Query  2287  LESVHYSPTSDVVKDFNGLSDVYWPDSLGPLDLDIPSS-RYHSE-LILSDSLGGLTQLIA  2460
             ++         + KDF+ L+D+YWPDSLGPLDLDI SS +YHSE LI SDSL GL +LIA
Sbjct  690   IQ-------EHLGKDFSALADMYWPDSLGPLDLDISSSTKYHSEDLIFSDSLSGLNRLIA  742

Query  2461  SSLDAFQNCSFFGADKKEPVSTTEAQE  2541
             SSLDAFQNCSFFG DKKE  ST EA+E
Sbjct  743   SSLDAFQNCSFFGFDKKEAPSTVEARE  769



>ref|XP_003547937.1| PREDICTED: TSL-kinase interacting protein 1-like isoform X1 [Glycine 
max]
 ref|XP_006599337.1| PREDICTED: TSL-kinase interacting protein 1-like isoform X2 [Glycine 
max]
Length=798

 Score =   734 bits (1896),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 415/759 (55%), Positives = 514/759 (68%), Gaps = 68/759 (9%)
 Frame = +1

Query  427   QQP-VKRQTRKWAAWTREEEESFFSALRHVGKNFEKITSRVQSKNKDQVRHYYYRLVRRM  603
             QQP  K+ TR+WAAWTR+EEESFF+ALR VGKNFEKITSRVQSKNKDQVRHYYYRLVRRM
Sbjct  41    QQPATKKPTRQWAAWTRQEEESFFTALRQVGKNFEKITSRVQSKNKDQVRHYYYRLVRRM  100

Query  604   NKLLGPELCLNAKNSRDTNAAMLRWWSLLEKYSCKASKLHLKPRRFKIFIETLENQLLKD  783
             NKLLGP LCL+AKNS+DTNAAMLRWWSLLEKYSCKASKLHLKPRRFKIF+E LE+QLLKD
Sbjct  101   NKLLGPGLCLDAKNSKDTNAAMLRWWSLLEKYSCKASKLHLKPRRFKIFLEALEHQLLKD  160

Query  784   RKKNVRRCFSQGENT-STAPISVSNQGRGASGHDGRSVKVVLLDNQDIHKFGSGKGSSLK  960
             RKKNVR+   QG N    AP +VSNQ R ASG+D R+VK+VL+DNQ+I K G  K S+ K
Sbjct  161   RKKNVRKRPLQGGNCLPAAPTAVSNQSR-ASGNDARAVKLVLVDNQNILKLGPSKPST-K  218

Query  961   RHINIGANSTSCKADSSLLKTARHRRKIG--ATAAYKRWEKAAIAGVSLVADAAEHLERT  1134
             R +N+G N ++ K DS+ +K  R R+K G  +TAAYK+WEKAAIAGVSLVADAAEHLER 
Sbjct  219   RTVNMGVNHSNTKGDSNTMKPTRQRKKSGTISTAAYKKWEKAAIAGVSLVADAAEHLERA  278

Query  1135  TTDKEDGHFQDSNVRNVFEHSGKDP--HVFPDLL---HNSFNETNLQNSGKLKLQLFPVD  1299
              T KE    Q+    N  E    DP  +V P L       F + N+ N  KLKLQLFP+D
Sbjct  279   ATVKEIEQDQE----NPGERCS-DPADYVLPSLAKCPQKQFVDNNVNNIMKLKLQLFPID  333

Query  1300  DGTRRALELDNHNPYLELTLSTRKKMSSVLEHLNRKWGNSSMACGDLMLFPYHLHKENLV  1479
             + TRRALE+D HNP+LELTLSTRKK+SS+LEHLNRKWGNSS+A G++MLFPY + +ENLV
Sbjct  334   EPTRRALEMDKHNPHLELTLSTRKKISSILEHLNRKWGNSSIAAGEVMLFPYGIQRENLV  393

Query  1480  HFQKWTKDTTLTAADVYALTGSPPVFRLRYGWFSNAEVAF--------------------  1599
             ++ +WT+++TL+AAD+YA+ GSPP+FRLRYGWFSN E+                      
Sbjct  394   NYPRWTQESTLSAADIYAMIGSPPIFRLRYGWFSNTELGLLNMQVPEASGSMLRQYKSSV  453

Query  1600  ---RAPVSSAI----PSRHDANMNIMPESSVGV-----LQAPSTDPPKEANGCVSMNTVN  1743
                + P+ +++    P  +  +M +  +    +     L   STD        V +NT +
Sbjct  454   DNAKDPIVNSVSFPTPLTNTLSMELSEDCRTSMNRNHTLMTASTDLSNARGNNVYLNT-S  512

Query  1744  ASRSSDHTEAVLWENPET----VVTEAE-VDDLQFNKAGTSCVGEWADSLTNISVGDLLS  1908
                S D T    W   +     V T+ E +D+L+ +       GEWADSLTNISVGDLLS
Sbjct  513   TVESRDPTANTPWHGKDVRDGAVTTQLEDMDELKLSSGAGLSAGEWADSLTNISVGDLLS  572

Query  1909  EAPDMEDANCITSSIHSSSNYIHQIPFSCDSFDAAIAAHIKKHQNVTDSQAALPSQLSSI  2088
                   D NCI   I  S   + QIPFS DSFDAAIAAHI +HQ+    +++L S +SSI
Sbjct  573   GVSQDLD-NCINPPIAESCYDVQQIPFSSDSFDAAIAAHISRHQDRM-GRSSLASHMSSI  630

Query  2089  WGAEDTCDAFAFQRHSLSEKVQNA-SKHTSLETCKQITLANTTALGASVEDLPGARNPVD  2265
             W AE+TCDAF F++  + ++ +   S   SLE+ K++T  +   L    ++L   R  + 
Sbjct  631   WDAEETCDAFLFKKDPILQEYRPCLSPVASLESEKKVTKRSFDKL----DELSPERERLV  686

Query  2266  GDAATADLESVHYSPTSDVV-----KDFNGLSDVYWPDSLGPLDLDIPSS-RYHSE-LIL  2424
              D A  D   +  S +   V     KDF+ L+D+YWPDSLGPLDL+IPSS +YHSE LI 
Sbjct  687   DDCAQTDPMPMDSSESDADVQEHLGKDFSALADMYWPDSLGPLDLEIPSSTKYHSEDLIF  746

Query  2425  SDSLGGLTQLIASSLDAFQNCSFFGADKKEPVSTTEAQE  2541
             SDSL GL +LIASSLDAFQNCSFFG DKKE  ST EA+E
Sbjct  747   SDSLSGLNRLIASSLDAFQNCSFFGFDKKEAPSTVEARE  785



>ref|XP_009334660.1| PREDICTED: TSL-kinase interacting protein 1-like [Pyrus x bretschneideri]
Length=778

 Score =   733 bits (1893),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 410/773 (53%), Positives = 513/773 (66%), Gaps = 49/773 (6%)
 Frame = +1

Query  325   IASSQEHAIPEQAMFSQDHSVTEQLASFEEHSALQQPVKRQTRKWAAWTREEEESFFSAL  504
             I  S+ H  P Q  F           +   H A QQP+K+ TR+WAAWT +EEESFFSAL
Sbjct  8     IMDSEVH--PHQGSFLVQDGGPVVAPTISTHVAQQQPMKKTTRQWAAWTHQEEESFFSAL  65

Query  505   RHVGKNFEKITSRVQSKNKDQVRHYYYRLVRRMNKLLGPELCLNAKNSRDTNAAMLRWWS  684
             R VGKNFEKIT RVQSKNKDQVRHYYYRLVRRMNKLLGPEL L++KNS+DTNAAMLRWWS
Sbjct  66    RQVGKNFEKITRRVQSKNKDQVRHYYYRLVRRMNKLLGPELYLDSKNSKDTNAAMLRWWS  125

Query  685   LLEKYSCKASKLHLKPRRFKIFIETLENQLLKDRKKNVRRCFSQGENT-STAPISVSNQG  861
             LLEKYSCKASKLHLKPRRFKIFIE LE+QLLKDRKK+VR+  SQGEN    AP +VSNQ 
Sbjct  126   LLEKYSCKASKLHLKPRRFKIFIEALEHQLLKDRKKSVRKRPSQGENCPPNAPSTVSNQN  185

Query  862   RGASGHDGRSVKVVLLDNQDIHKFGSGKGSSLKRHINIGANSTSCKADSSLLKTARHRRK  1041
             R  SGHD R+VK+VL+D+ +I K G GK +S+KR++NIG N ++ K DSS +K AR RRK
Sbjct  186   R-PSGHDNRTVKLVLVDSHNIQKLGPGK-ASMKRNVNIGVNRSN-KGDSSTMKPARQRRK  242

Query  1042  IGA--TAAYKRWEKAAIAGVSLVADAAEHLERTTTDKEDGHFQDSNV--RNVFEHSGKDP  1209
              GA  + AYK+WEKAAIAGVSLVADAAEHLER  TDKE    QD +   ++     G   
Sbjct  243   PGAVSSVAYKKWEKAAIAGVSLVADAAEHLERAATDKEVQQ-QDRSTEGQSCSVPVGTVL  301

Query  1210  HVFPDLLHNSFNETNLQNSGKLKLQLFPVDDGTRRALELDNHNPYLELTLSTRKKMSSVL  1389
                P      + E N     KLKLQLFP+DD TRRALE+D HNP+LELTLSTRKK+SSVL
Sbjct  302   SPMPTFPQKIYAENNCM---KLKLQLFPIDDVTRRALEIDKHNPHLELTLSTRKKISSVL  358

Query  1390  EHLNRKWGNSSMACGDLMLFPYHLHKENLVHFQKWTKDTTLTAADVYALTGSPPVFRLRY  1569
             EHLNRKWGNS++A G+LMLFPY + +ENL+ + +W +D+ ++AADVY+  GSPPVFRLRY
Sbjct  359   EHLNRKWGNSNVASGELMLFPYSVQRENLMGYPRWAQDSVVSAADVYSTIGSPPVFRLRY  418

Query  1570  GWFSNAE---VAFRAPVSSA--------IPSRHDANMNIMPESSVGV---------LQAP  1689
             GWFSN E   V F+AP++S         +  R++  ++  P S +           L   
Sbjct  419   GWFSNTELRSVEFQAPIASCSIQGEHMNVEKRNEQIVDSTPISHLSTNNQSVDKNSLALT  478

Query  1690  STDPPKEANGCVSMNTVNASRSSD----HTEAVLWENPETVVTEAEVDDLQFNKAGTSCV  1857
             STD P E +G VS +  N    ++    H +    +N  T V   ++D  +     +   
Sbjct  479   STDEPNEISGYVSSSPNNVGAPTEIRTLHRKEAGDQN--TSVHRGDLDGTRLINGNSLSS  536

Query  1858  GEWADSLTNISVGDLLSEAPDMEDANCITSSIHSSSNYIHQIPFSCDSFDAAIAAHIKKH  2037
             G+WADSLTNISVGDLL       D+N I      +S  + QIPFSCDSFDA IAAHI + 
Sbjct  537   GDWADSLTNISVGDLLVGVSHDLDSNRIDPPAAETSQCLQQIPFSCDSFDAVIAAHIAR-  595

Query  2038  QNVTDSQAALPSQLSSIWGAEDTCDAFAFQRHSL-SEKVQNASKHTSLETCKQITLANTT  2214
             Q+    Q  + S +SSIW AE+TCD F+F ++ +  ++V +         CKQ    ++ 
Sbjct  596   QDKMGCQHIMESHVSSIWDAEETCDGFSFPKNPVFCQEVPSLPGVAPPGPCKQTVCTSSA  655

Query  2215  ALGASVEDLPGARNPVD---GDAATADLESVHYSPTSDVVKDFNGLSDVYWPDSLGPLDL  2385
                  VED+P    P+D   GD        +H   +   VKDFN L+D+YWP+SLGPLDL
Sbjct  656   GSDLMVEDIPVVDRPIDPPQGDRVDQCQPDLHIESS---VKDFNALADIYWPESLGPLDL  712

Query  2386  DIPSSRYHS-ELILSDSLGGLTQLIASSLDAFQNCSFFGADKKEPVSTTEAQE  2541
             ++PSS+Y++ + +LSDSL GL +LIASSLDAFQNCSFFG +KKE   + E +E
Sbjct  713   EMPSSKYNNDDFMLSDSLSGLNRLIASSLDAFQNCSFFGVNKKEATPSAEGRE  765



>ref|XP_009376820.1| PREDICTED: TSL-kinase interacting protein 1-like [Pyrus x bretschneideri]
Length=778

 Score =   732 bits (1890),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 409/773 (53%), Positives = 512/773 (66%), Gaps = 49/773 (6%)
 Frame = +1

Query  325   IASSQEHAIPEQAMFSQDHSVTEQLASFEEHSALQQPVKRQTRKWAAWTREEEESFFSAL  504
             I  S+ H  P Q  F           +   H A QQP+K+ TR+WAAWT +EEESFFSAL
Sbjct  8     IMDSEVH--PHQGSFLVQDGGPVVAPTISTHVAQQQPMKKTTRQWAAWTHQEEESFFSAL  65

Query  505   RHVGKNFEKITSRVQSKNKDQVRHYYYRLVRRMNKLLGPELCLNAKNSRDTNAAMLRWWS  684
             R VGKNFEKIT RVQSKNKDQVRHYYYRLVRRMNKLLGPEL L++KNS+DTNAAMLRWWS
Sbjct  66    RQVGKNFEKITRRVQSKNKDQVRHYYYRLVRRMNKLLGPELYLDSKNSKDTNAAMLRWWS  125

Query  685   LLEKYSCKASKLHLKPRRFKIFIETLENQLLKDRKKNVRRCFSQGENT-STAPISVSNQG  861
             LLEKYSCKASKLHLKPRRFKIFIE LE+QLLKDRKK+VR+  SQGEN    AP +VSNQ 
Sbjct  126   LLEKYSCKASKLHLKPRRFKIFIEALEHQLLKDRKKSVRKRPSQGENCPPNAPSTVSNQN  185

Query  862   RGASGHDGRSVKVVLLDNQDIHKFGSGKGSSLKRHINIGANSTSCKADSSLLKTARHRRK  1041
             R  SGHD R+VK+VL+D+ +I K G GK +S+KR++NIG N ++ K DSS +K AR RRK
Sbjct  186   R-PSGHDNRTVKLVLVDSHNIQKLGPGK-ASMKRNVNIGVNRSN-KGDSSTMKPARQRRK  242

Query  1042  IGA--TAAYKRWEKAAIAGVSLVADAAEHLERTTTDKEDGHFQDSNV--RNVFEHSGKDP  1209
              GA  + AYK+WEKAAIAGVSLVADAAEHLER  TDKE G  QD +   ++     G   
Sbjct  243   PGAVSSVAYKKWEKAAIAGVSLVADAAEHLERAATDKE-GQQQDRSTEGQSCSVPVGTVL  301

Query  1210  HVFPDLLHNSFNETNLQNSGKLKLQLFPVDDGTRRALELDNHNPYLELTLSTRKKMSSVL  1389
                P      + E N     KLKLQLFP+DD TRRALE+D HNP+LELTLSTRKK+SSVL
Sbjct  302   SPMPTFPQKIYAENNCM---KLKLQLFPIDDVTRRALEIDKHNPHLELTLSTRKKISSVL  358

Query  1390  EHLNRKWGNSSMACGDLMLFPYHLHKENLVHFQKWTKDTTLTAADVYALTGSPPVFRLRY  1569
             EHLNRKWGNS++A G+LMLFPY + +ENL+ + +W +D+ ++AADVY+  GSP VFRLRY
Sbjct  359   EHLNRKWGNSNVASGELMLFPYSVQRENLMGYPRWAQDSVVSAADVYSTIGSPQVFRLRY  418

Query  1570  GWFSNAE---VAFRAPVSSA--------IPSRHDANMNIMPESSVGV---------LQAP  1689
             GWFSN E   V F+AP++S         +  R++  ++  P S +           L   
Sbjct  419   GWFSNTELRSVEFQAPIASCSIQGEHMNVEKRNEQIVDSTPISHLSTNNQSVDKNSLALT  478

Query  1690  STDPPKEANGCVSMNTVNASRSSD----HTEAVLWENPETVVTEAEVDDLQFNKAGTSCV  1857
             STD P E +G VS +  N    ++    H +    +N  T V   ++D  +     +   
Sbjct  479   STDEPNEISGYVSSSPNNVGTPTEIRTLHRKEAGDQN--TSVHRGDLDGTRLINGNSLSS  536

Query  1858  GEWADSLTNISVGDLLSEAPDMEDANCITSSIHSSSNYIHQIPFSCDSFDAAIAAHIKKH  2037
             G+WADSLTNISVGDLL       D+N I      +S  + QIPFSCDSFDA IAAHI + 
Sbjct  537   GDWADSLTNISVGDLLVGVSHDLDSNRIDPPAAETSQCLQQIPFSCDSFDAVIAAHIAR-  595

Query  2038  QNVTDSQAALPSQLSSIWGAEDTCDAFAFQRHSL-SEKVQNASKHTSLETCKQITLANTT  2214
             Q+    Q  + S +SSIW AE+TCD F+F ++ +  ++V +         CKQ    ++ 
Sbjct  596   QDKMGCQHIMESHVSSIWDAEETCDGFSFPKNPVFCQEVPSLPGVAPPGPCKQTVCTSSA  655

Query  2215  ALGASVEDLPGARNPVD---GDAATADLESVHYSPTSDVVKDFNGLSDVYWPDSLGPLDL  2385
                  VED+P    P+D   GD        +H   +   VKDFN L+D+YWP+SLGPLDL
Sbjct  656   GSDLMVEDIPVVDRPIDPPQGDCVDQCQPDLHIESS---VKDFNALADIYWPESLGPLDL  712

Query  2386  DIPSSRYHS-ELILSDSLGGLTQLIASSLDAFQNCSFFGADKKEPVSTTEAQE  2541
             ++PS +Y++ + +LSDSL GL +LIASSLDAFQNCSFFG +KKE   + E +E
Sbjct  713   EMPSPKYNNDDFMLSDSLSGLNRLIASSLDAFQNCSFFGVNKKEATPSAEGRE  765



>gb|KHN08826.1| TSL-kinase interacting protein 1 [Glycine soja]
Length=798

 Score =   733 bits (1891),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 415/762 (54%), Positives = 514/762 (67%), Gaps = 74/762 (10%)
 Frame = +1

Query  427   QQP-VKRQTRKWAAWTREEEESFFSALRHVGKNFEKITSRVQSKNKDQVRHYYYRLVRRM  603
             QQP  K+ TR+WAAWTR+EEESFF+ALR VGKNFEKITSRVQSKNKDQVRHYYYRLVRRM
Sbjct  41    QQPATKKPTRQWAAWTRQEEESFFTALRQVGKNFEKITSRVQSKNKDQVRHYYYRLVRRM  100

Query  604   NKLLGPELCLNAKNSRDTNAAMLRWWSLLEKYSCKASKLHLKPRRFKIFIETLENQLLKD  783
             NKLLGP LCL+AKNS+DTNAAMLRWWSLLEKYSCKASKLHLKPRRFKIF+E LE+QLLKD
Sbjct  101   NKLLGPGLCLDAKNSKDTNAAMLRWWSLLEKYSCKASKLHLKPRRFKIFLEALEHQLLKD  160

Query  784   RKKNVRRCFSQGENT-STAPISVSNQGRGASGHDGRSVKVVLLDNQDIHKFGSGKGSSLK  960
             RKKNVR+   QG N    AP +VSNQ R ASG+D R+VK+VL+DNQ+I K G  K S+ K
Sbjct  161   RKKNVRKRPLQGGNCLPAAPTAVSNQSR-ASGNDARAVKLVLVDNQNILKLGPSKPST-K  218

Query  961   RHINIGANSTSCKADSSLLKTARHRRKIG--ATAAYKRWEKAAIAGVSLVADAAEHLERT  1134
             R +N+G N ++ K DS+ +K  R R+K G  +TAAYK+WEKAAIAGVSLVADAAEHLER 
Sbjct  219   RTVNMGVNHSNTKGDSNTMKPTRQRKKSGTISTAAYKKWEKAAIAGVSLVADAAEHLERA  278

Query  1135  TTDKEDGHFQDSNVRNVFEHSGK---DP--HVFPDLL---HNSFNETNLQNSGKLKLQLF  1290
              T KE    Q        E+ G+   DP  +V   L       F + N+ NS KLKLQLF
Sbjct  279   ATVKEIEQDQ--------ENPGERCSDPADYVLASLAKCPQKQFVDNNVNNSMKLKLQLF  330

Query  1291  PVDDGTRRALELDNHNPYLELTLSTRKKMSSVLEHLNRKWGNSSMACGDLMLFPYHLHKE  1470
             P+D+ TRRALE+D HNP+LELTLSTRKK+SS+LEHLNRKWGNSS+A G++MLFPY + +E
Sbjct  331   PIDEPTRRALEMDKHNPHLELTLSTRKKISSILEHLNRKWGNSSIAAGEVMLFPYGIQRE  390

Query  1471  NLVHFQKWTKDTTLTAADVYALTGSPPVFRLRYGWFSNAEVAF-----------------  1599
             NLV++ +WT+++TL+AAD+YA+ GSPP+FRLRYGWFSN E                    
Sbjct  391   NLVNYPRWTQESTLSAADIYAMIGSPPIFRLRYGWFSNTEFGLLNMQVPEASGSMLRQYK  450

Query  1600  ------RAPVSSAI----PSRHDANMNIMPESSVGV-----LQAPSTDPPKEANGCVSMN  1734
                   + P+ +++    P  +  +M +  +    +     L   STD        V +N
Sbjct  451   SSVDNAKDPIVNSVSFPTPLTNTLSMELSEDCRTSMNRNHTLMTASTDLSNARGNNVYLN  510

Query  1735  TVNASRSSDHTEAVLWENPET----VVTEAE-VDDLQFNKAGTSCVGEWADSLTNISVGD  1899
             T +   S D T    W   +     V T+ E +D+L+ +       GEWADSLTNISVGD
Sbjct  511   T-STVESRDPTANTPWHGKDVRDGAVTTQLEDMDELKLSSGAGLSAGEWADSLTNISVGD  569

Query  1900  LLSEAPDMEDANCITSSIHSSSNYIHQIPFSCDSFDAAIAAHIKKHQNVTDSQAALPSQL  2079
             LLS      D NCI   I  S   + QIPFS DSFDAAIAAHI +HQ+    +++L S +
Sbjct  570   LLSGVSQDLD-NCINPPIAESCYDVQQIPFSSDSFDAAIAAHISRHQDRM-GRSSLASHM  627

Query  2080  SSIWGAEDTCDAFAFQRHSLSEKVQNA-SKHTSLETCKQITLANTTALGASVEDLPGARN  2256
             SSIW AE+TCDAF F++  + ++ +   S   SLE+ K++T  +   L    ++L   R 
Sbjct  628   SSIWDAEETCDAFLFKKDPILQEYRPCLSPVASLESEKKVTKRSFDKL----DELSPERE  683

Query  2257  PVDGDAATADLESVHYSPTSDVV-----KDFNGLSDVYWPDSLGPLDLDIPSS-RYHSE-  2415
              +  D A  D   +  S +   V     KDF+ L+D+YWPDSLGPLDL+IPSS +YHSE 
Sbjct  684   RLVDDCAQTDPMPMDSSESDADVQEHLGKDFSALADMYWPDSLGPLDLEIPSSTKYHSED  743

Query  2416  LILSDSLGGLTQLIASSLDAFQNCSFFGADKKEPVSTTEAQE  2541
             LI SDSL GL +LIASSLDAFQNCSFFG DKKE  ST EA+E
Sbjct  744   LIFSDSLSGLNRLIASSLDAFQNCSFFGFDKKEAPSTVEARE  785



>ref|XP_004509591.1| PREDICTED: TSL-kinase interacting protein 1-like isoform X4 [Cicer 
arietinum]
Length=797

 Score =   732 bits (1890),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 405/751 (54%), Positives = 507/751 (68%), Gaps = 54/751 (7%)
 Frame = +1

Query  427   QQPV-KRQTRKWAAWTREEEESFFSALRHVGKNFEKITSRVQSKNKDQVRHYYYRLVRRM  603
             QQPV K+ TR+WAAWTR+EEESFF+ALR VGKNFEKITSRVQSKNKDQVRHYYYRLVRRM
Sbjct  42    QQPVLKKPTRQWAAWTRQEEESFFTALRQVGKNFEKITSRVQSKNKDQVRHYYYRLVRRM  101

Query  604   NKLLGPELCLNAKNSRDTNAAMLRWWSLLEKYSCKASKLHLKPRRFKIFIETLENQLLKD  783
             NKLLGP LCL+AKNS+DTNAAMLRWWSLLEKYSCKASKLHLKPRRFKIF+E LE+QLLKD
Sbjct  102   NKLLGPGLCLDAKNSKDTNAAMLRWWSLLEKYSCKASKLHLKPRRFKIFLEALEHQLLKD  161

Query  784   RKKNVRRCFSQGENTSTAPI-SVSNQGRGASGHDGRSVKVVLLDNQDIHKFGSGKGSSLK  960
             RKKNVR+   QG N   + + +VSNQ RG SG+D R+VK++L+D+Q+I K G  K   LK
Sbjct  162   RKKNVRKRPLQGGNCQPSALNAVSNQARG-SGNDTRAVKMILVDSQNIIKLGPSK-PPLK  219

Query  961   RHINIGANSTSCKADSSLLKTARHRRKIGATAAYKRWEKAAIAGVSLVADAAEHLERTTT  1140
             R++N+G N ++ K DS+  K  R R+K   +AAY++WEKAAIAGVSLVADAAEHLER  T
Sbjct  220   RNVNMGVNRSNAKGDSNNSKPTRQRKKSATSAAYRKWEKAAIAGVSLVADAAEHLERAAT  279

Query  1141  DKEDGHFQDSNVRNVFEHSGKDPHVFPDLLHNSFNETNLQNSGKLKLQLFPVDDGTRRAL  1320
              K+  H Q++      E   +     P    N F + N+QN  KLKLQLFP+D+ TRRAL
Sbjct  280   VKDVEHGQENPGEKCSEPVDQVLSSLPTFPPNHFVDNNVQNIMKLKLQLFPIDEPTRRAL  339

Query  1321  ELDNHNPYLELTLSTRKKMSSVLEHLNRKWGNSSMACGDLMLFPYHLHKENLVHFQKWTK  1500
             E+D HNPYLELTLSTRKK+SS+LEHLNRKWGNSS+A G+L+LFPY + KENL ++Q+W +
Sbjct  340   EMDKHNPYLELTLSTRKKISSILEHLNRKWGNSSIAIGELVLFPYGVQKENLNNYQRWNQ  399

Query  1501  DTTLTAADVYALTGSPPVFRLRYGWFSNAE---VAFRAPVSSAIPSRHDAN-MNIMPESS  1668
             ++TL+AAD+YA+ GSPP+FRLRYGWFSN +   +  +APV+S+  +R   N  + M +  
Sbjct  400   ESTLSAADIYAVIGSPPIFRLRYGWFSNTKHGALNMQAPVASSCLARQSKNGGDNMKDQI  459

Query  1669  VGVLQAPSTDPPKEANGC----------VSMNTVNASRSSDHTEAVLWENPETV------  1800
             V +   P       +  C              T  ++  S+  +   ++N  T       
Sbjct  460   VNLASLPIPSTNNYSTECAVDCGTSLIKTGALTTTSTYLSNARDDSTYQNTSTEEPCGPT  519

Query  1801  ---------VTEAEV-------DDLQFNKAGTSCVGEWADSLTNISVGDLLSEAPDMEDA  1932
                      VT+  V       DDL+ N       GEWADSLTNISVGDLL       D 
Sbjct  520   AFISLHGKDVTDGAVTRKLEDMDDLKSNSGSGVSAGEWADSLTNISVGDLLLGVSQNLDD  579

Query  1933  NCITSSIHSSSNYIHQIPFSCDSFDAAIAAHIKKHQNVTDSQAALPSQLSSIWGAEDTCD  2112
             NCI   I  + + +HQIPFS DSFDAAIAAHI KHQ+    Q+ + S +SSIW AE+T D
Sbjct  580   NCINPLIGENCHSVHQIPFSSDSFDAAIAAHISKHQDKI-GQSTMASHMSSIWDAEETRD  638

Query  2113  AFAFQRHS-LSEKVQNASKHTSLETCKQI---TLANTTALGASVEDLP---GARNPVDGD  2271
             AF+F++   L E     S   SL++ K++   +  N   L    E L       +P+  D
Sbjct  639   AFSFKKDPILHENGPCLSFIVSLDSDKKVPGRSFENLDKLSPEKESLVDDIAQTDPMAMD  698

Query  2272  AATADLESVHYSPTSDVVKDFNGLSDVYWPDSLGPLDLDIPSSRYH-SELILSDSLGGLT  2448
             +  +D + + Y     + KD  GL+D+YWPDSLGPLDL+IPS++Y   +LILSDSL GL 
Sbjct  699   SCESDAD-IQYQ----LAKDLTGLADMYWPDSLGPLDLNIPSTKYDGGDLILSDSLSGLN  753

Query  2449  QLIASSLDAFQNCSFFGADKKEPVSTTEAQE  2541
             +LIASSLDAFQNCSFFG DKKE  ST EAQE
Sbjct  754   RLIASSLDAFQNCSFFGIDKKETPSTVEAQE  784



>ref|XP_008243984.1| PREDICTED: TSL-kinase interacting protein 1 isoform X2 [Prunus 
mume]
Length=807

 Score =   733 bits (1891),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 420/814 (52%), Positives = 511/814 (63%), Gaps = 102/814 (13%)
 Frame = +1

Query  325   IASSQEHAIPEQAMFSQDHSVTEQLASFEEHSALQQPVKRQTRKWAAWTREEEESFFSAL  504
             I +S+ H  P Q  F           S   H ALQQPVK+ TR+WAAWT +EEESFF+AL
Sbjct  8     IVNSEAH--PHQGGFFVQDGGPGLAPSTSNHVALQQPVKKPTRQWAAWTHQEEESFFAAL  65

Query  505   RHVGKNFEKITSRVQSKNKDQVRHYYYRLVRRMNKLLGPELCLNAKNSRDTNAAMLRWWS  684
             R VGKNFEKIT RVQSKNKDQVRHYYYRLVRRMNKLLGP L L++KNS+DTNAAMLRWWS
Sbjct  66    RQVGKNFEKITCRVQSKNKDQVRHYYYRLVRRMNKLLGPGLYLDSKNSKDTNAAMLRWWS  125

Query  685   LLEKYSCKASKLHLKPRRFKIFIETLENQLLKDRKKNVRRCFSQGENT-STAPISVSNQG  861
             LLEKYSCKASKLHLKPRRFKIFIE LE+QLLKDRKK+VR+  SQGEN    AP ++SNQ 
Sbjct  126   LLEKYSCKASKLHLKPRRFKIFIEALEHQLLKDRKKSVRKRPSQGENCPPNAPSTLSNQN  185

Query  862   RGASGHDGRSVKVVLLDNQDIHKFGSGKGSSLKRHINIGANSTSCKADSSLLKTARHRRK  1041
             R  SGHD R+VK+VL+D+ +I K G GK +SLKR++NIG N ++ K DSS +K AR RRK
Sbjct  186   R-PSGHDNRTVKLVLVDSHNIQKLGPGK-ASLKRNVNIGVNRSN-KGDSSTMKPARQRRK  242

Query  1042  IGATAAYKRWEKAAIAGVSLVADAAEHLERTTTDKEDGHFQDSNVRNVFEHSGKDPHVFP  1221
                  AYK+WEKAAIAGVSLVADAAEHLER  TDKE    + +  ++     GK     P
Sbjct  243   ----PAYKKWEKAAIAGVSLVADAAEHLERAITDKEVEQDRSAAGQSSAVPVGKILPPLP  298

Query  1222  DLLHNSFNETNLQNSGKLKLQLFPVDDGTRRALELDNHNPYLELTLSTRKKMSSVLEHLN  1401
               + N   E+ + N  KLKLQLFP+DDGTRRALE D HNPYLELTLSTRKK+SSVL+HLN
Sbjct  299   AFVQNIDAESGINNCMKLKLQLFPIDDGTRRALENDKHNPYLELTLSTRKKISSVLDHLN  358

Query  1402  RKWGNSSMACGDLMLFPYHLHKENLVHFQKWTKDTTLTAADVYALTGSPPVFRLRYGWFS  1581
             RKWGNS++A G+L LF Y + ++NL+ + +W +D+ ++AADVYA  G PPVFRLRYGWFS
Sbjct  359   RKWGNSNVASGELTLFHYSVQRDNLMGYPRWMQDSIVSAADVYATIGCPPVFRLRYGWFS  418

Query  1582  NAE---VAFRAPVSSAI-PSRHDAN-----MNIMPESSVGVL------------------  1680
             NAE   V  + PV+S      HD N       I+  + +  L                  
Sbjct  419   NAELGSVGLQTPVASCSNQGEHDINEEKRKEQIVDSAPISPLSTDNQSADIHKDHLTSTN  478

Query  1681  ---------------QAPSTDPPK--------------EANG--CVSMNTVNASRSSDHT  1767
                            Q P    P+              E NG  CVS N    +   D T
Sbjct  479   NSCVLSALDYQHSQPQLPERGKPRYNHSLGLTSAEESNEINGYICVSPNN---NFVGDPT  535

Query  1768  EAVLWENPE-----TVVTEAEVDDLQFNKAGTSCVGEWADSLTNISVGDLLSEAPDMEDA  1932
             E   W   E     T     +VDDL+         G WADSLTNIS+GDLLS      D 
Sbjct  536   EITSWHKKEAGDQSTSRHRGDVDDLRSITGTALSAGVWADSLTNISMGDLLSGVSHDLDT  595

Query  1933  NCITSSIHSSSNYIHQIPFSCDSFDAAIAAHIKKHQNVTDSQAALPSQLSSIWGAEDTCD  2112
             NCI   +   S  + QIPFSCDSFDA IAAHI + QN    Q  +   +SSIW AE+TCD
Sbjct  596   NCIDPPVAEGSQCLQQIPFSCDSFDAVIAAHISR-QNKMGCQPTMECHVSSIWDAEETCD  654

Query  2113  AFAFQRHSLSEKVQNASKHTSLETCKQI-TLANTTALGAS-------VEDLPGARNPVDG  2268
             AF+FQ++S+               C+++ +L+     GAS       VE++     P+D 
Sbjct  655   AFSFQKNSV--------------FCQEVSSLSAVAPPGASSVGSDCMVEEISVVERPIDD  700

Query  2269  DAATADLESVHYSP--TSDVVKDFNGLSDVYWPDSLGPLDLDIPSSRYHSE-LILSDSLG  2439
                    +     P      VKDFN L+D+YWP+SLGPLDL++PSS+YHSE  +LSDSL 
Sbjct  701   PPQGGPTDECQSDPRILESSVKDFNALTDIYWPESLGPLDLEMPSSKYHSEDFVLSDSLS  760

Query  2440  GLTQLIASSLDAFQNCSFFGADKKEPVSTTEAQE  2541
             GL +LIASSLDAFQNCSFFGA+K+EP ++ EA+E
Sbjct  761   GLNRLIASSLDAFQNCSFFGANKREPTASVEARE  794



>ref|XP_010107483.1| hypothetical protein L484_024333 [Morus notabilis]
 gb|EXC16165.1| hypothetical protein L484_024333 [Morus notabilis]
Length=789

 Score =   731 bits (1887),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 412/770 (54%), Positives = 510/770 (66%), Gaps = 57/770 (7%)
 Frame = +1

Query  361   AMFSQDHSVTEQLASFEEHSALQQPVKRQTRKWAAWTREEEESFFSALRHVGKNFEKITS  540
             A+  +DH V   LA    +   QQPVK+ TR+WAAWTR+EEE+FF+ LR   +NFEKIT 
Sbjct  21    AIHERDHGVAS-LAPI--NIVPQQPVKKPTRQWAAWTRQEEENFFTGLR---QNFEKITC  74

Query  541   RVQSKNKDQVRHYYYRLVRRMNKLLGPELCLNAKNSRDTNAAMLRWWSLLEKYSCKASKL  720
             RVQSKNKDQVRHYYYRLVRRMNKLLGP L L+AKNS+DTNAAMLRWWSLLEKYSCKASKL
Sbjct  75    RVQSKNKDQVRHYYYRLVRRMNKLLGPGLYLDAKNSKDTNAAMLRWWSLLEKYSCKASKL  134

Query  721   HLKPRRFKIFIETLENQLLKDRKKNVRRCFSQGENTSTAPISVSNQGRGASGHDGRSVKV  900
             HLKPRRFKIF+E LE+QLLKDRKK+VR+   QGE +S    S  +      G D R+VK+
Sbjct  135   HLKPRRFKIFVEALEHQLLKDRKKSVRKRPPQGEYSSPV-SSSVSNQSRVPGQDNRTVKL  193

Query  901   VLLDNQDIHKFGSGKGSSLKRHINIGANSTSCKADSSLLKTARHRRK--IGATAAYKRWE  1074
             VL+D+Q+I K GSGK SS KR++N+  N  + K DS+ +K AR RRK  + ++AAYK+WE
Sbjct  194   VLVDSQNIQKVGSGKASS-KRNVNVSTNRGNSKGDSTTMKPARQRRKPAVVSSAAYKKWE  252

Query  1075  KAAIAGVSLVADAAEHLERTTTDKEDGHFQDSNVRNVFEHS-GKDPHVFPDLLHNSFNET  1251
             KAAIAGVSLVADAAEHLERTT DKE    Q ++ +    +  G+  H  P    + F E 
Sbjct  253   KAAIAGVSLVADAAEHLERTTIDKEIEQDQSTSGQTKSSYPLGQVLHSLPTFPQSPFVEN  312

Query  1252  NLQNSGKLKLQLFPVDDGTRRALELDNHNPYLELTLSTRKKMSSVLEHLNRKWGNSSMAC  1431
             N+ ++ KLKLQLFP+DDGTRRALE+D HNP+LELTLS+RK++SSVLEHLNRKWG+SS+A 
Sbjct  313   NIHSAMKLKLQLFPIDDGTRRALEMDKHNPHLELTLSSRKRISSVLEHLNRKWGSSSIAS  372

Query  1432  GDLMLFPYHLHKENLVHFQKWTKDTTLTAADVYALTGSPPVFRLRYGWFSNAE---VAF-  1599
             G+LMLFPY   +++LV  Q+WT+D+ ++AADVYA+ GSPPVFRLRY WF  +E   +A  
Sbjct  373   GELMLFPYGAQRDSLVGCQRWTQDSVVSAADVYAMIGSPPVFRLRYCWFPTSEHETIALQ  432

Query  1600  -RAPVSS-AIPSRHDANMNIMPES--SVGVLQAPSTDPPKEA---NGCVSMN--------  1734
              +AP +S  IP  HD NM    E+  S   +  P+T+        N  VS+N        
Sbjct  433   EKAPAASCCIPREHDPNMETRDEAIMSSASISQPATNYQATGPNNNNLVSVNKNHTYTLT  492

Query  1735  --------------TVNASRSSDHTEAVLWENP---ETVVTE--AEVDDLQFNKAGTSCV  1857
                             N   SSD T    W      E  +T    ++D ++         
Sbjct  493   STNVPNERPNVEGPVDNLVESSDPTVNKSWHGKGAGEETITRHLGDMDGMRLCNGSGLSA  552

Query  1858  GEWADSLTNISVGDLLSEAPDMEDANCITSSIHSSSNYIHQIPFSCDSFDAAIAAHIKKH  2037
             GEWADSLTN+SVGDLLS      +ANC+   I  SS+ + Q+PFSCDSFDAAIAAHI + 
Sbjct  553   GEWADSLTNVSVGDLLSGMSQDINANCMHPPIPESSHCLQQVPFSCDSFDAAIAAHISRQ  612

Query  2038  QNVTDSQAALPSQLSSIWGAEDTCDAFAFQRHSL-SEKVQNASKHTSLETCKQITLANTT  2214
             Q+    Q  L SQ  SI  AE+TCD F FQR+ +  E+ Q      S+ T KQ    +  
Sbjct  613   QDKMGCQPILESQAPSILDAEETCDGFLFQRNQVHREETQCFLGVASVSTYKQTARTSLM  672

Query  2215  ALGASVEDLPGARNPVDGDAATADLESVHYSPTSDVVKDFNGLSDVYWPDSLGPLDLDIP  2394
               G   E+L     P D  +    ++        + VKDFN L+D+YWPDSLGPLDLDIP
Sbjct  673   DSGYLDEELSDVDGPTDNSSQGDPMDEC------EPVKDFNDLADIYWPDSLGPLDLDIP  726

Query  2395  SSRYHSE-LILSDSLGGLTQLIASSLDAFQNCSFFGADKKEPVSTTEAQE  2541
             SS+YHSE +ILSDSLGGL +LIASSLDAFQNCSFFG DKKE  ST EA+E
Sbjct  727   SSKYHSEDIILSDSLGGLNRLIASSLDAFQNCSFFGMDKKESASTVEARE  776



>ref|XP_004509590.1| PREDICTED: TSL-kinase interacting protein 1-like isoform X3 [Cicer 
arietinum]
Length=799

 Score =   730 bits (1884),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 406/753 (54%), Positives = 508/753 (67%), Gaps = 56/753 (7%)
 Frame = +1

Query  427   QQPV-KRQTRKWAAWTREEEESFFSALRHVGKNFEKITSRVQSKNKDQVRHYYYRLVRRM  603
             QQPV K+ TR+WAAWTR+EEESFF+ALR VGKNFEKITSRVQSKNKDQVRHYYYRLVRRM
Sbjct  42    QQPVLKKPTRQWAAWTRQEEESFFTALRQVGKNFEKITSRVQSKNKDQVRHYYYRLVRRM  101

Query  604   NKLLGPELCLNAKNSRDTNAAMLRWWSLLEKYSCKASKLHLKPRRFKIFIETLENQLLKD  783
             NKLLGP LCL+AKNS+DTNAAMLRWWSLLEKYSCKASKLHLKPRRFKIF+E LE+QLLKD
Sbjct  102   NKLLGPGLCLDAKNSKDTNAAMLRWWSLLEKYSCKASKLHLKPRRFKIFLEALEHQLLKD  161

Query  784   RKKNVRRCFSQGENTSTAPI-SVSNQGRGASGHDGRSVKVVLLDNQDIHKFGSGKGSSLK  960
             RKKNVR+   QG N   + + +VSNQ RG SG+D R+VK++L+D+Q+I K G  K   LK
Sbjct  162   RKKNVRKRPLQGGNCQPSALNAVSNQARG-SGNDTRAVKMILVDSQNIIKLGPSK-PPLK  219

Query  961   RHINIGANSTSCKADSSLLKTARHRRK--IGATAAYKRWEKAAIAGVSLVADAAEHLERT  1134
             R++N+G N ++ K DS+  K  R R+K  I  +AAY++WEKAAIAGVSLVADAAEHLER 
Sbjct  220   RNVNMGVNRSNAKGDSNNSKPTRQRKKSGIATSAAYRKWEKAAIAGVSLVADAAEHLERA  279

Query  1135  TTDKEDGHFQDSNVRNVFEHSGKDPHVFPDLLHNSFNETNLQNSGKLKLQLFPVDDGTRR  1314
              T K+  H Q++      E   +     P    N F + N+QN  KLKLQLFP+D+ TRR
Sbjct  280   ATVKDVEHGQENPGEKCSEPVDQVLSSLPTFPPNHFVDNNVQNIMKLKLQLFPIDEPTRR  339

Query  1315  ALELDNHNPYLELTLSTRKKMSSVLEHLNRKWGNSSMACGDLMLFPYHLHKENLVHFQKW  1494
             ALE+D HNPYLELTLSTRKK+SS+LEHLNRKWGNSS+A G+L+LFPY + KENL ++Q+W
Sbjct  340   ALEMDKHNPYLELTLSTRKKISSILEHLNRKWGNSSIAIGELVLFPYGVQKENLNNYQRW  399

Query  1495  TKDTTLTAADVYALTGSPPVFRLRYGWFSNAE---VAFRAPVSSAIPSRHDAN-MNIMPE  1662
              +++TL+AAD+YA+ GSPP+FRLRYGWFSN +   +  +APV+S+  +R   N  + M +
Sbjct  400   NQESTLSAADIYAVIGSPPIFRLRYGWFSNTKHGALNMQAPVASSCLARQSKNGGDNMKD  459

Query  1663  SSVGVLQAPSTDPPKEANGC----------VSMNTVNASRSSDHTEAVLWENPETV----  1800
               V +   P       +  C              T  ++  S+  +   ++N  T     
Sbjct  460   QIVNLASLPIPSTNNYSTECAVDCGTSLIKTGALTTTSTYLSNARDDSTYQNTSTEEPCG  519

Query  1801  -----------VTEAEV-------DDLQFNKAGTSCVGEWADSLTNISVGDLLSEAPDME  1926
                        VT+  V       DDL+ N       GEWADSLTNISVGDLL       
Sbjct  520   PTAFISLHGKDVTDGAVTRKLEDMDDLKSNSGSGVSAGEWADSLTNISVGDLLLGVSQNL  579

Query  1927  DANCITSSIHSSSNYIHQIPFSCDSFDAAIAAHIKKHQNVTDSQAALPSQLSSIWGAEDT  2106
             D NCI   I  + + +HQIPFS DSFDAAIAAHI KHQ+    Q+ + S +SSIW AE+T
Sbjct  580   DDNCINPLIGENCHSVHQIPFSSDSFDAAIAAHISKHQDKI-GQSTMASHMSSIWDAEET  638

Query  2107  CDAFAFQRHS-LSEKVQNASKHTSLETCKQI---TLANTTALGASVEDLP---GARNPVD  2265
              DAF+F++   L E     S   SL++ K++   +  N   L    E L       +P+ 
Sbjct  639   RDAFSFKKDPILHENGPCLSFIVSLDSDKKVPGRSFENLDKLSPEKESLVDDIAQTDPMA  698

Query  2266  GDAATADLESVHYSPTSDVVKDFNGLSDVYWPDSLGPLDLDIPSSRYH-SELILSDSLGG  2442
              D+  +D + + Y     + KD  GL+D+YWPDSLGPLDL+IPS++Y   +LILSDSL G
Sbjct  699   MDSCESDAD-IQYQ----LAKDLTGLADMYWPDSLGPLDLNIPSTKYDGGDLILSDSLSG  753

Query  2443  LTQLIASSLDAFQNCSFFGADKKEPVSTTEAQE  2541
             L +LIASSLDAFQNCSFFG DKKE  ST EAQE
Sbjct  754   LNRLIASSLDAFQNCSFFGIDKKETPSTVEAQE  786



>ref|XP_008442698.1| PREDICTED: TSL-kinase interacting protein 1 isoform X2 [Cucumis 
melo]
Length=770

 Score =   728 bits (1880),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 402/740 (54%), Positives = 503/740 (68%), Gaps = 39/740 (5%)
 Frame = +1

Query  400   ASFEEHSALQQPVKRQTRKWAAWTREEEESFFSALRHVGKNFEKITSRVQSKNKDQVRHY  579
             AS  +H     P K+ TR+WAAWTREEEESFF+ALR VGKNFEKIT  VQSKNKDQVRHY
Sbjct  31    ASTPDHVIEPLPAKKPTRQWAAWTREEEESFFTALRQVGKNFEKITCHVQSKNKDQVRHY  90

Query  580   YYRLVRRMNKLLGPELCLNAKNSRDTNAAMLRWWSLLEKYSCKASKLHLKPRRFKIFIET  759
             YYRLVRRMNKLL P LCL+AKNS+DTNAAMLRWWSLLEKYSCKASKLHLKPRRFKIF+E 
Sbjct  91    YYRLVRRMNKLLAPGLCLDAKNSKDTNAAMLRWWSLLEKYSCKASKLHLKPRRFKIFVEA  150

Query  760   LENQLLKDRKKNVRRCFSQGENTSTA-PISVSNQGRGASGHDGRSVKVVLLDNQDIHKFG  936
             LE+QLLKDRKKNVR+   QGEN     P +VSNQ R A GHDGR+VK+VL+D Q+I K G
Sbjct  151   LEHQLLKDRKKNVRKRPLQGENCPPPIPNAVSNQSR-ALGHDGRAVKLVLVDTQNIPKLG  209

Query  937   SGKGSSLKRHINIGANSTSCKADSSLLKTARHRRKIG--ATAAYKRWEKAAIAGVSLVAD  1110
               K +S +R++N+G N  +     ++LK +R RRK G  ++AAYK+WEKAAIAGVSLVAD
Sbjct  210   PRKTTS-RRNVNVGINRGNNGGYPTVLKPSRQRRKSGGVSSAAYKKWEKAAIAGVSLVAD  268

Query  1111  AAEHLERTTTDKEDGHFQDSNVRNVFEHSGKDPHVFPDLLHNSFNETNLQNSGKLKLQLF  1290
             AAEHLERT T+K+    Q++  +   + +G    + P L  NS  +     S KLKLQLF
Sbjct  269   AAEHLERTITNKDVLRDQNTLGKKSTDPAGSPLLLLPPLQPNSLIDV---ASIKLKLQLF  325

Query  1291  PVDDGTRRALELDNHNPYLELTLSTRKKMSSVLEHLNRKWGNSSMACGDLMLFPYHLHKE  1470
             PVDDGTRRALE D HNPYLELTLSTRKK+SSVLEHL+RKWGNSS A G+LMLFPY + ++
Sbjct  326   PVDDGTRRALESDKHNPYLELTLSTRKKISSVLEHLSRKWGNSSAAHGELMLFPYSIQRK  385

Query  1471  NLVHFQKWTKDTTLTAADVYALTGSPPVFRLRYGWFSNAE---VAFRAPVSSA-------  1620
             +L   Q+WT+D+  +A DVYA  G P VFRLRYGW SNAE   V  +  V +        
Sbjct  386   SLTDCQRWTQDSFESAGDVYATIGRPQVFRLRYGWCSNAEHESVELQTSVPAYCIQDDHI  445

Query  1621  -----IPSR--HDANMNIMP----ESSVGVLQAPSTDP--PKEANGCVSMNTVNASRSSD  1761
                  I  R  H A+++  P    +  VG      + P  P E+  C+S    +  RSSD
Sbjct  446   MDARDIEGRIVHAASIDAQPVDFNKDEVGTFTKNMSTPTAPCESERCISARPNDLLRSSD  505

Query  1762  HTEAVLWENP----ETVVTEA-EVDDLQFNKAGTSCVGEWADSLTNISVGDLLSEAPDME  1926
                 + W+       T++  + +VD+L+ +   +   GEWADSLTNIS+GDLLS      
Sbjct  506   PVLNMSWDKKNAADRTIIQRSDDVDELKLSNGTSLSAGEWADSLTNISIGDLLSGVSQDV  565

Query  1927  DANCITSSIHSSSNYIHQIPFSCDSFDAAIAAHIKKHQNVTDSQAALPSQLSSIWGAEDT  2106
             DANC+ + +   +  + QIPFSCDSFDAAIAAHI + Q+ T +Q  L S  SSIW AE+T
Sbjct  566   DANCVDTPLAEGTQCLQQIPFSCDSFDAAIAAHISRQQDKTVTQPTLASHASSIWDAEET  625

Query  2107  CDAFAFQRHSLS-EKVQNASKHTSLETCKQITLANTTALGASVEDLPGARNPVDGDAATA  2283
             CDAF+FQ++ ++ ++V ++   +SL  CK +   N+       EDLPG+ +  +      
Sbjct  626   CDAFSFQKNPVTLQEVPSSFTFSSLRGCKHVARTNSMGYSHMTEDLPGSESRTEDHIQGD  685

Query  2284  DLESVHYSPTSDVVKDFNGLSDVYWPDSLGPLDLDIPSS-RYHS-ELILSDSLGGLTQLI  2457
              ++     P     KD + L+D+YWPDSLGPLDLD+PS+ +YH+ ELIL DSL  L +LI
Sbjct  686   LMDECQSDPQIAETKDIDELADIYWPDSLGPLDLDLPSTNKYHNEELILGDSLSSLNRLI  745

Query  2458  ASSLDAFQNCSFFGADKKEP  2517
             ASSLDAFQNCSFFG DKKEP
Sbjct  746   ASSLDAFQNCSFFGFDKKEP  765



>gb|KGN58972.1| hypothetical protein Csa_3G740150 [Cucumis sativus]
Length=771

 Score =   728 bits (1878),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 400/740 (54%), Positives = 502/740 (68%), Gaps = 40/740 (5%)
 Frame = +1

Query  400   ASFEEHSALQQPVKRQTRKWAAWTREEEESFFSALRHVGKNFEKITSRVQSKNKDQVRHY  579
             AS  +H     P KR TR+WAAWTREEEESFF+ALR VGKNFEKIT  VQSKNKDQVRHY
Sbjct  31    ASTPDHVIEPLPAKRPTRQWAAWTREEEESFFTALRQVGKNFEKITCHVQSKNKDQVRHY  90

Query  580   YYRLVRRMNKLLGPELCLNAKNSRDTNAAMLRWWSLLEKYSCKASKLHLKPRRFKIFIET  759
             YYRLVRRMNKLL P LCL+AKNS+DTNAAMLRWWSLLEKYSCKASKLHLKPRRFKIF+E 
Sbjct  91    YYRLVRRMNKLLAPGLCLDAKNSKDTNAAMLRWWSLLEKYSCKASKLHLKPRRFKIFVEA  150

Query  760   LENQLLKDRKKNVRRCFSQGENTSTA-PISVSNQGRGASGHDGRSVKVVLLDNQDIHKFG  936
             LE+QLLKDRKKNVR+   QGEN     P +VSNQ R A GHDGR+VK+VL+D Q+I K G
Sbjct  151   LEHQLLKDRKKNVRKRPLQGENCPPPIPNAVSNQSR-ALGHDGRAVKLVLVDTQNIPKLG  209

Query  937   SGKGSSLKRHINIGANSTSCKADSSLLKTARHRRKIG---ATAAYKRWEKAAIAGVSLVA  1107
               K +S +R++N+G N  +     ++LK +R RRK     ++AAYK+WEKAAIAGVSLVA
Sbjct  210   PRKTAS-RRNVNVGINRGNNGGYPTVLKPSRQRRKSEGGVSSAAYKKWEKAAIAGVSLVA  268

Query  1108  DAAEHLERTTTDKEDGHFQDSNVRNVFEHSGKDPHVFPDLLHNSFNETNLQNSGKLKLQL  1287
             DAAEHLERT T+++    Q++  +   + +G    + P L  NS  +     S KLKLQL
Sbjct  269   DAAEHLERTITNRDVLRDQNTLGKKSTDPAGSPLLLLPPLQPNSLIDV---ASIKLKLQL  325

Query  1288  FPVDDGTRRALELDNHNPYLELTLSTRKKMSSVLEHLNRKWGNSSMACGDLMLFPYHLHK  1467
             FPVDDGTRRALE D HNPYLELTLSTRKK+SSVLEHL+RKWGNSS A G+LMLFPY + +
Sbjct  326   FPVDDGTRRALESDKHNPYLELTLSTRKKISSVLEHLSRKWGNSSAAHGELMLFPYSIQR  385

Query  1468  ENLVHFQKWTKDTTLTAADVYALTGSPPVFRLRYGWFSNAE---VAFRAPVSSA------  1620
             ++L   Q+WT+D+  +A DVYA  G P VFRLRYGW SNAE   V  +  V +       
Sbjct  386   KSLADCQRWTQDSFESAGDVYATIGRPQVFRLRYGWCSNAEHESVELQTSVPAYCIQDDH  445

Query  1621  ------IPSR--HDANMNIMP----ESSVGVLQAPSTDP--PKEANGCVSMNTVNASRSS  1758
                   I  R  H A+++  P    +  VG L   ++ P  P E+  C+S    +  +SS
Sbjct  446   IMDARDIEGRIVHAASIDAQPVDFNKDEVGTLTKNTSTPTAPCESERCISARPNDLLKSS  505

Query  1759  DHTEAVLWENP----ETVVTEA-EVDDLQFNKAGTSCVGEWADSLTNISVGDLLSEAPDM  1923
             D    + W+       T++  + +VDDL+ +   +   GEWADSLTNIS+GDLLS     
Sbjct  506   DPVLNMSWDKKNAADRTIIQRSDDVDDLKLSNGTSLSAGEWADSLTNISIGDLLSGVSQD  565

Query  1924  EDANCITSSIHSSSNYIHQIPFSCDSFDAAIAAHIKKHQNVTDSQAALPSQLSSIWGAED  2103
              DANC+ + +   +  + QIPFSCDSFDAAIAAHI + Q+ T  Q  L S  SSIW AE+
Sbjct  566   VDANCVDTPLAEGTQCLQQIPFSCDSFDAAIAAHISRQQDKTVPQPTLASHASSIWDAEE  625

Query  2104  TCDAFAFQRHSLS-EKVQNASKHTSLETCKQITLANTTALGASVEDLPGARNPVDGDAAT  2280
             TCDAF+FQ++ ++ ++V ++   +SL  CK +   N+       ED P + +P++     
Sbjct  626   TCDAFSFQKNPVTLQEVPSSFTFSSLRGCKHVARTNSMGFSHMTEDFPRSESPIEDHIQE  685

Query  2281  ADLESVHYSPTSDVVKDFNGLSDVYWPDSLGPLDLDIPSS-RYHS-ELILSDSLGGLTQL  2454
               ++     P     KD + L+D+YWPDSLGPLDLD+PS+ +YH+ ELIL DSL  L +L
Sbjct  686   DLMDECQSDPQITETKDIDELADIYWPDSLGPLDLDLPSTNKYHNEELILGDSLSSLNRL  745

Query  2455  IASSLDAFQNCSFFGADKKE  2514
             IASSLDAFQNCSFFG DKKE
Sbjct  746   IASSLDAFQNCSFFGLDKKE  765



>ref|XP_010241825.1| PREDICTED: TSL-kinase interacting protein 1 [Nelumbo nucifera]
 ref|XP_010241826.1| PREDICTED: TSL-kinase interacting protein 1 [Nelumbo nucifera]
 ref|XP_010241827.1| PREDICTED: TSL-kinase interacting protein 1 [Nelumbo nucifera]
Length=810

 Score =   728 bits (1880),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 410/773 (53%), Positives = 510/773 (66%), Gaps = 90/773 (12%)
 Frame = +1

Query  427   QQPVKRQTRKWAAWTREEEESFFSALRHVGKNFEKITSRVQSKNKDQVRHYYYRLVRRMN  606
             QQPVK+QTR+WAAWTR+EEESFF+ALR VGKNFEKIT RVQSKNKDQVRHYYYRLVRRMN
Sbjct  45    QQPVKKQTRQWAAWTRQEEESFFNALRQVGKNFEKITCRVQSKNKDQVRHYYYRLVRRMN  104

Query  607   KLLGPELCLNAKNSRDTNAAMLRWWSLLEKYSCKASKLHLKPRRFKIFIETLENQLLKDR  786
             KLLGP + L+AKNS+DTNAAMLRWWSLLEKYSCK+SKLHLKPRR KIF+E LE+QLLKDR
Sbjct  105   KLLGPGISLDAKNSKDTNAAMLRWWSLLEKYSCKSSKLHLKPRRLKIFVEALEHQLLKDR  164

Query  787   KKNVRRCFSQGENT-STAPISVSNQGRGASGHDGRSVKVVLLDNQDIHKFGSGKGSSLKR  963
             KKN+R+  SQG+N  ST+P +V    +   G+D   VK+V +DNQ I K GSGKGSSLKR
Sbjct  165   KKNIRKQPSQGDNCLSTSPTTVLLHSK-TPGNDTNLVKLVTVDNQSIQKVGSGKGSSLKR  223

Query  964   HINIGANSTSCKADSSLLKTARHRRKIGAT-AAYKRWEKAAIAGVSLVADAAEHLERTTT  1140
             ++N G N ++ K  SS  KT R RRK GA+ AAYKRWEKAA+AGVSLVADAAEHLER T 
Sbjct  224   NVNTGINRSNNKGHSSTSKT-RQRRKTGASPAAYKRWEKAAMAGVSLVADAAEHLERETA  282

Query  1141  DKEDGHFQDSNVRNVFEHSGKDPHVFPD-------------LLHNSFNET---NLQNSGK  1272
             ++     +DS  +     S   P V  +             +L +S  +    N Q S K
Sbjct  283   NQ-----KDSQAQRFLNESFSGPVVLSNAQTDAAPLVPTLPVLTSSAPQVIDGNAQQSLK  337

Query  1273  LKLQLFPVDDGTRRALELDNHNPYLELTLSTRKKMSSVLEHLNRKWGNSSMACGDLMLFP  1452
             LKLQLFP+D+ TR+ALE D HNPYLELTLS RKK+SSVLEHLNRKWGNSS+A GDL+LFP
Sbjct  338   LKLQLFPIDEVTRKALEKDEHNPYLELTLSGRKKISSVLEHLNRKWGNSSIASGDLILFP  397

Query  1453  YHLHKENLVHFQKWTKDTTLTAADVYALTGSPPVFRLRYGWFSNAEV--AFRAPVSS---  1617
             Y + +ENLV + +W +DT  +AADVYA+ GSPP+FRLRYGWFS+ E+   F+A  +S   
Sbjct  398   YSVQRENLVGYPRWKQDTVASAADVYAIIGSPPIFRLRYGWFSDTELDRTFQASTTSNHV  457

Query  1618  ----AIPSRH------------DANMNIMP---ESSVGVLQAPSTDPPKEANGCVSMNTV  1740
                 A+ + H             A  +I+P   + S G+    + DP    +G + +++V
Sbjct  458   REEPALSTSHLVECFKDRVTSMTAETSILPSYTDCSKGMTGNTAIDP----DGNLPVSSV  513

Query  1741  NAS----RSSDHTEAVLWENPETVVTEAEVDDLQFNKAGTSCVGEWADSLTNISVGDLLS  1908
             N+S       D +    WE         EVD+L+ + +     GEWADSLTNIS+GDLLS
Sbjct  514   NSSWFRKEIGDGSTRRQWE---------EVDNLRMSNSTQLSAGEWADSLTNISIGDLLS  564

Query  1909  EAPDMEDANCITSSIHSSSNYIHQIPFSCDSFDAAIAAHIKKHQNVTDSQAALPSQLSSI  2088
             EA    D NC    I  S  Y+ QIPFSCDSFDAAIAAHI  H+     Q+   S  +S+
Sbjct  565   EASRAADNNCTDQPILGSFQYLQQIPFSCDSFDAAIAAHIGGHKEKMGFQSTQVSHATSL  624

Query  2089  WGAEDTCDAFAFQR-HSLSEKVQNASKHTSLETCKQITLANTTALGASVEDLPGAR----  2253
             W AE+TCDAFAFQ+  + +++VQ+ SK  SLE C+QI   ++T+     E+LP  R    
Sbjct  625   WDAEETCDAFAFQKIRAFNQEVQSPSKIASLEACRQIANTSSTSFRGLTEELPEVRPKSS  684

Query  2254  ----NPVD---GDAATADLESVHYSPTSDV--------VKDFNGLSDVYWPDSLGPLDLD  2388
                 +P+D    D  + D  +    P +            D + L+D+YWPDSLGPLDLD
Sbjct  685   TCEGDPLDNCQSDVDSPDSSAKELIPENSAKDLSPKNSSDDLDELTDIYWPDSLGPLDLD  744

Query  2389  IPSSRYH-SELILSD--SLGGLTQLIASSLDAFQNCSFFGADKKEPVSTTEAQ  2538
             IPS +YH  +L + D  S  GL +LIASSLD FQNCSFFG D KE  ST EA+
Sbjct  745   IPSPKYHRQDLFIGDSTSFSGLNRLIASSLDVFQNCSFFGLD-KESSSTGEAR  796



>ref|XP_004509592.1| PREDICTED: TSL-kinase interacting protein 1-like isoform X5 [Cicer 
arietinum]
Length=794

 Score =   728 bits (1878),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 405/751 (54%), Positives = 507/751 (68%), Gaps = 57/751 (8%)
 Frame = +1

Query  427   QQPV-KRQTRKWAAWTREEEESFFSALRHVGKNFEKITSRVQSKNKDQVRHYYYRLVRRM  603
             QQPV K+ TR+WAAWTR+EEESFF+ALR VGKNFEKITSRVQSKNKDQVRHYYYRLVRRM
Sbjct  42    QQPVLKKPTRQWAAWTRQEEESFFTALRQVGKNFEKITSRVQSKNKDQVRHYYYRLVRRM  101

Query  604   NKLLGPELCLNAKNSRDTNAAMLRWWSLLEKYSCKASKLHLKPRRFKIFIETLENQLLKD  783
             NKLLGP LCL+AKNS+DTNAAMLRWWSLLEKYSCKASKLHLKPRRFKIF+E LE+QLLKD
Sbjct  102   NKLLGPGLCLDAKNSKDTNAAMLRWWSLLEKYSCKASKLHLKPRRFKIFLEALEHQLLKD  161

Query  784   RKKNVRRCFSQGENTSTAPI-SVSNQGRGASGHDGRSVKVVLLDNQDIHKFGSGKGSSLK  960
             RKKNVR+   QG N   + + +VSNQ RG SG+D R+VK++L+D+Q+I K G  K   LK
Sbjct  162   RKKNVRKRPLQGGNCQPSALNAVSNQARG-SGNDTRAVKMILVDSQNIIKLGPSK-PPLK  219

Query  961   RHINIGANSTSCKADSSLLKTARHRRKIGATAAYKRWEKAAIAGVSLVADAAEHLERTTT  1140
             R++N+G N ++ K DS+  K  R R+K   +AAY++WEKAAIAGVSLVADAAEHLER  T
Sbjct  220   RNVNMGVNRSNAKGDSNNSKPTRQRKK---SAAYRKWEKAAIAGVSLVADAAEHLERAAT  276

Query  1141  DKEDGHFQDSNVRNVFEHSGKDPHVFPDLLHNSFNETNLQNSGKLKLQLFPVDDGTRRAL  1320
              K+  H Q++      E   +     P    N F + N+QN  KLKLQLFP+D+ TRRAL
Sbjct  277   VKDVEHGQENPGEKCSEPVDQVLSSLPTFPPNHFVDNNVQNIMKLKLQLFPIDEPTRRAL  336

Query  1321  ELDNHNPYLELTLSTRKKMSSVLEHLNRKWGNSSMACGDLMLFPYHLHKENLVHFQKWTK  1500
             E+D HNPYLELTLSTRKK+SS+LEHLNRKWGNSS+A G+L+LFPY + KENL ++Q+W +
Sbjct  337   EMDKHNPYLELTLSTRKKISSILEHLNRKWGNSSIAIGELVLFPYGVQKENLNNYQRWNQ  396

Query  1501  DTTLTAADVYALTGSPPVFRLRYGWFSNAE---VAFRAPVSSAIPSRHDAN-MNIMPESS  1668
             ++TL+AAD+YA+ GSPP+FRLRYGWFSN +   +  +APV+S+  +R   N  + M +  
Sbjct  397   ESTLSAADIYAVIGSPPIFRLRYGWFSNTKHGALNMQAPVASSCLARQSKNGGDNMKDQI  456

Query  1669  VGVLQAPSTDPPKEANGC----------VSMNTVNASRSSDHTEAVLWENPETV------  1800
             V +   P       +  C              T  ++  S+  +   ++N  T       
Sbjct  457   VNLASLPIPSTNNYSTECAVDCGTSLIKTGALTTTSTYLSNARDDSTYQNTSTEEPCGPT  516

Query  1801  ---------VTEAEV-------DDLQFNKAGTSCVGEWADSLTNISVGDLLSEAPDMEDA  1932
                      VT+  V       DDL+ N       GEWADSLTNISVGDLL       D 
Sbjct  517   AFISLHGKDVTDGAVTRKLEDMDDLKSNSGSGVSAGEWADSLTNISVGDLLLGVSQNLDD  576

Query  1933  NCITSSIHSSSNYIHQIPFSCDSFDAAIAAHIKKHQNVTDSQAALPSQLSSIWGAEDTCD  2112
             NCI   I  + + +HQIPFS DSFDAAIAAHI KHQ+    Q+ + S +SSIW AE+T D
Sbjct  577   NCINPLIGENCHSVHQIPFSSDSFDAAIAAHISKHQDKI-GQSTMASHMSSIWDAEETRD  635

Query  2113  AFAFQRHS-LSEKVQNASKHTSLETCKQI---TLANTTALGASVEDLP---GARNPVDGD  2271
             AF+F++   L E     S   SL++ K++   +  N   L    E L       +P+  D
Sbjct  636   AFSFKKDPILHENGPCLSFIVSLDSDKKVPGRSFENLDKLSPEKESLVDDIAQTDPMAMD  695

Query  2272  AATADLESVHYSPTSDVVKDFNGLSDVYWPDSLGPLDLDIPSSRYH-SELILSDSLGGLT  2448
             +  +D + + Y     + KD  GL+D+YWPDSLGPLDL+IPS++Y   +LILSDSL GL 
Sbjct  696   SCESDAD-IQYQ----LAKDLTGLADMYWPDSLGPLDLNIPSTKYDGGDLILSDSLSGLN  750

Query  2449  QLIASSLDAFQNCSFFGADKKEPVSTTEAQE  2541
             +LIASSLDAFQNCSFFG DKKE  ST EAQE
Sbjct  751   RLIASSLDAFQNCSFFGIDKKETPSTVEAQE  781



>ref|XP_008442695.1| PREDICTED: TSL-kinase interacting protein 1 isoform X1 [Cucumis 
melo]
 ref|XP_008442696.1| PREDICTED: TSL-kinase interacting protein 1 isoform X1 [Cucumis 
melo]
 ref|XP_008442697.1| PREDICTED: TSL-kinase interacting protein 1 isoform X1 [Cucumis 
melo]
Length=771

 Score =   725 bits (1871),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 401/741 (54%), Positives = 502/741 (68%), Gaps = 40/741 (5%)
 Frame = +1

Query  400   ASFEEHSALQQPVKRQTRKWAAWTREEEESFFSALRHVGKNFEKITSRVQSKNKDQVRHY  579
             AS  +H     P K+ TR+WAAWTREEEESFF+ALR VGKNFEKIT  VQSKNKDQVRHY
Sbjct  31    ASTPDHVIEPLPAKKPTRQWAAWTREEEESFFTALRQVGKNFEKITCHVQSKNKDQVRHY  90

Query  580   YYRLVRRMNKLLGPELCLNAKNSRDTNAAMLRWWSLLEKYSCKASKLHLKPRRFKIFIET  759
             YYRLVRRMNKLL P LCL+AKNS+DTNAAMLRWWSLLEKYSCKASKLHLKPRRFKIF+E 
Sbjct  91    YYRLVRRMNKLLAPGLCLDAKNSKDTNAAMLRWWSLLEKYSCKASKLHLKPRRFKIFVEA  150

Query  760   LENQLLKDRKKNVRRCFSQGENTSTA-PISVSNQGRGASGHDGRSVKVVLLDNQDIHKFG  936
             LE+QLLKDRKKNVR+   QGEN     P +VSNQ R A GHDGR+VK+VL+D Q+I K G
Sbjct  151   LEHQLLKDRKKNVRKRPLQGENCPPPIPNAVSNQSR-ALGHDGRAVKLVLVDTQNIPKLG  209

Query  937   SGKGSSLKRHINIGANSTSCKADSSLLKTARHRRKIG---ATAAYKRWEKAAIAGVSLVA  1107
               K +S +R++N+G N  +     ++LK +R RRK     ++AAYK+WEKAAIAGVSLVA
Sbjct  210   PRKTTS-RRNVNVGINRGNNGGYPTVLKPSRQRRKSEGGVSSAAYKKWEKAAIAGVSLVA  268

Query  1108  DAAEHLERTTTDKEDGHFQDSNVRNVFEHSGKDPHVFPDLLHNSFNETNLQNSGKLKLQL  1287
             DAAEHLERT T+K+    Q++  +   + +G    + P L  NS  +     S KLKLQL
Sbjct  269   DAAEHLERTITNKDVLRDQNTLGKKSTDPAGSPLLLLPPLQPNSLIDV---ASIKLKLQL  325

Query  1288  FPVDDGTRRALELDNHNPYLELTLSTRKKMSSVLEHLNRKWGNSSMACGDLMLFPYHLHK  1467
             FPVDDGTRRALE D HNPYLELTLSTRKK+SSVLEHL+RKWGNSS A G+LMLFPY + +
Sbjct  326   FPVDDGTRRALESDKHNPYLELTLSTRKKISSVLEHLSRKWGNSSAAHGELMLFPYSIQR  385

Query  1468  ENLVHFQKWTKDTTLTAADVYALTGSPPVFRLRYGWFSNAE---VAFRAPVSSA------  1620
             ++L   Q+WT+D+  +A DVYA  G P VFRLRYGW SNAE   V  +  V +       
Sbjct  386   KSLTDCQRWTQDSFESAGDVYATIGRPQVFRLRYGWCSNAEHESVELQTSVPAYCIQDDH  445

Query  1621  ------IPSR--HDANMNIMP----ESSVGVLQAPSTDP--PKEANGCVSMNTVNASRSS  1758
                   I  R  H A+++  P    +  VG      + P  P E+  C+S    +  RSS
Sbjct  446   IMDARDIEGRIVHAASIDAQPVDFNKDEVGTFTKNMSTPTAPCESERCISARPNDLLRSS  505

Query  1759  DHTEAVLWENP----ETVVTEA-EVDDLQFNKAGTSCVGEWADSLTNISVGDLLSEAPDM  1923
             D    + W+       T++  + +VD+L+ +   +   GEWADSLTNIS+GDLLS     
Sbjct  506   DPVLNMSWDKKNAADRTIIQRSDDVDELKLSNGTSLSAGEWADSLTNISIGDLLSGVSQD  565

Query  1924  EDANCITSSIHSSSNYIHQIPFSCDSFDAAIAAHIKKHQNVTDSQAALPSQLSSIWGAED  2103
              DANC+ + +   +  + QIPFSCDSFDAAIAAHI + Q+ T +Q  L S  SSIW AE+
Sbjct  566   VDANCVDTPLAEGTQCLQQIPFSCDSFDAAIAAHISRQQDKTVTQPTLASHASSIWDAEE  625

Query  2104  TCDAFAFQRHSLS-EKVQNASKHTSLETCKQITLANTTALGASVEDLPGARNPVDGDAAT  2280
             TCDAF+FQ++ ++ ++V ++   +SL  CK +   N+       EDLPG+ +  +     
Sbjct  626   TCDAFSFQKNPVTLQEVPSSFTFSSLRGCKHVARTNSMGYSHMTEDLPGSESRTEDHIQG  685

Query  2281  ADLESVHYSPTSDVVKDFNGLSDVYWPDSLGPLDLDIPSS-RYHS-ELILSDSLGGLTQL  2454
               ++     P     KD + L+D+YWPDSLGPLDLD+PS+ +YH+ ELIL DSL  L +L
Sbjct  686   DLMDECQSDPQIAETKDIDELADIYWPDSLGPLDLDLPSTNKYHNEELILGDSLSSLNRL  745

Query  2455  IASSLDAFQNCSFFGADKKEP  2517
             IASSLDAFQNCSFFG DKKEP
Sbjct  746   IASSLDAFQNCSFFGFDKKEP  766



>ref|XP_004137974.1| PREDICTED: TSL-kinase interacting protein 1-like [Cucumis sativus]
Length=791

 Score =   725 bits (1871),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 398/731 (54%), Positives = 498/731 (68%), Gaps = 40/731 (5%)
 Frame = +1

Query  418   SALQQPVKRQTRKWAAWTREEEESFFSALRHVGKNFEKITSRVQSKNKDQVRHYYYRLVR  597
             S L    KR TR+WAAWTREEEESFF+ALR VGKNFEKIT  VQSKNKDQVRHYYYRLVR
Sbjct  63    SLLVHAAKRPTRQWAAWTREEEESFFTALRQVGKNFEKITCHVQSKNKDQVRHYYYRLVR  122

Query  598   RMNKLLGPELCLNAKNSRDTNAAMLRWWSLLEKYSCKASKLHLKPRRFKIFIETLENQLL  777
             RMNKLL P LCL+AKNS+DTNAAMLRWWSLLEKYSCKASKLHLKPRRFKIF+E LE+QLL
Sbjct  123   RMNKLLAPGLCLDAKNSKDTNAAMLRWWSLLEKYSCKASKLHLKPRRFKIFVEALEHQLL  182

Query  778   KDRKKNVRRCFSQGENTSTA-PISVSNQGRGASGHDGRSVKVVLLDNQDIHKFGSGKGSS  954
             KDRKKNVR+   QGEN     P +VSNQ R A GHDGR+VK+VL+D Q+I K G  K +S
Sbjct  183   KDRKKNVRKRPLQGENCPPPIPNAVSNQSR-ALGHDGRAVKLVLVDTQNIPKLGPRKTAS  241

Query  955   LKRHINIGANSTSCKADSSLLKTARHRRKIGATAAYKRWEKAAIAGVSLVADAAEHLERT  1134
              +R++N+G N  +     ++LK +R RRK   +AAYK+WEKAAIAGVSLVADAAEHLERT
Sbjct  242   -RRNVNVGINRGNNGGYPTVLKPSRQRRK---SAAYKKWEKAAIAGVSLVADAAEHLERT  297

Query  1135  TTDKEDGHFQDSNVRNVFEHSGKDPHVFPDLLHNSFNETNLQNSGKLKLQLFPVDDGTRR  1314
              T+++    Q++  +   + +G    + P L  NS  +     S KLKLQLFPVDDGTRR
Sbjct  298   ITNRDVLRDQNTLGKKSTDPAGSPLLLLPPLQPNSLIDV---ASIKLKLQLFPVDDGTRR  354

Query  1315  ALELDNHNPYLELTLSTRKKMSSVLEHLNRKWGNSSMACGDLMLFPYHLHKENLVHFQKW  1494
             ALE D HNPYLELTLSTRKK+SSVLEHL+RKWGNSS A G+LMLFPY + +++L   Q+W
Sbjct  355   ALESDKHNPYLELTLSTRKKISSVLEHLSRKWGNSSAAHGELMLFPYSIQRKSLADCQRW  414

Query  1495  TKDTTLTAADVYALTGSPPVFRLRYGWFSNAE---VAFRAPVSSA------------IPS  1629
             T+D+  +A DVYA  G P VFRLRYGW SNAE   V  +  V +             I  
Sbjct  415   TQDSFESAGDVYATIGRPQVFRLRYGWCSNAEHESVELQTSVPAYCIQDDHIMDARDIEG  474

Query  1630  R--HDANMNIMP----ESSVGVLQAPSTDP--PKEANGCVSMNTVNASRSSDHTEAVLWE  1785
             R  H A+++  P    +  VG L   ++ P  P E+  C+S    +  +SSD    + W+
Sbjct  475   RIVHAASIDAQPVDFNKDEVGTLTKNTSTPTAPCESERCISARPNDLLKSSDPVLNMSWD  534

Query  1786  NP----ETVVTEA-EVDDLQFNKAGTSCVGEWADSLTNISVGDLLSEAPDMEDANCITSS  1950
                    T++  + +VDDL+ +   +   GEWADSLTNIS+GDLLS      DANC+ + 
Sbjct  535   KKNAADRTIIQRSDDVDDLKLSNGTSLSAGEWADSLTNISIGDLLSGVSQDVDANCVDTP  594

Query  1951  IHSSSNYIHQIPFSCDSFDAAIAAHIKKHQNVTDSQAALPSQLSSIWGAEDTCDAFAFQR  2130
             +   +  + QIPFSCDSFDAAIAAHI + Q+ T  Q  L S  SSIW AE+TCDAF+FQ+
Sbjct  595   LAEGTQCLQQIPFSCDSFDAAIAAHISRQQDKTVPQPTLASHASSIWDAEETCDAFSFQK  654

Query  2131  HSLS-EKVQNASKHTSLETCKQITLANTTALGASVEDLPGARNPVDGDAATADLESVHYS  2307
             + ++ ++V ++   +SL  CK +   N+       ED P + +P++       ++     
Sbjct  655   NPVTLQEVPSSFTFSSLRGCKHVARTNSMGFSHMTEDFPRSESPIEDHIQEDLMDECQSD  714

Query  2308  PTSDVVKDFNGLSDVYWPDSLGPLDLDIPSS-RYHS-ELILSDSLGGLTQLIASSLDAFQ  2481
             P     KD + L+D+YWPDSLGPLDLD+PS+ +YH+ ELIL DSL  L +LIASSLDAFQ
Sbjct  715   PQITETKDIDELADIYWPDSLGPLDLDLPSTNKYHNEELILGDSLSSLNRLIASSLDAFQ  774

Query  2482  NCSFFGADKKE  2514
             NCSFFG DKKE
Sbjct  775   NCSFFGLDKKE  785



>ref|XP_007156135.1| hypothetical protein PHAVU_003G261500g [Phaseolus vulgaris]
 gb|ESW28129.1| hypothetical protein PHAVU_003G261500g [Phaseolus vulgaris]
Length=798

 Score =   723 bits (1867),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 405/761 (53%), Positives = 512/761 (67%), Gaps = 72/761 (9%)
 Frame = +1

Query  427   QQP-VKRQTRKWAAWTREEEESFFSALRHVGKNFEKITSRVQSKNKDQVRHYYYRLVRRM  603
             QQP  K+ TR+WAAWTR+EEESFF+ALR VGKNFEKITSRVQSKNKDQVRHYYYRLVRRM
Sbjct  41    QQPATKKPTRQWAAWTRQEEESFFTALRQVGKNFEKITSRVQSKNKDQVRHYYYRLVRRM  100

Query  604   NKLLGPELCLNAKNSRDTNAAMLRWWSLLEKYSCKASKLHLKPRRFKIFIETLENQLLKD  783
             NKLLGP LCL+AKNS+DTNAAMLRWWSLLEKYSCKASKLHLKPRRFKIF+E LE+QLLKD
Sbjct  101   NKLLGPGLCLDAKNSKDTNAAMLRWWSLLEKYSCKASKLHLKPRRFKIFLEALEHQLLKD  160

Query  784   RKKNVRRCFSQGENT-STAPISVSNQGRGASGHDGRSVKVVLLDNQDIHKFGSGKGSSLK  960
             RKKNVR+   QG N     P +VSNQ R ASG++ R+VK+VL+D+Q+I K G  K SS+K
Sbjct  161   RKKNVRKRPLQGGNCLPPLPSTVSNQSR-ASGNEARAVKLVLVDSQNILKLGPSK-SSMK  218

Query  961   RHINIGANSTSCKADSSLLKTARHRRKIG--ATAAYKRWEKAAIAGVSLVADAAEHLERT  1134
             R+IN+G + ++ K DS+ +K+ R R+K G  +TAAYK+WEKAAIAGVSLVADAAEHLER 
Sbjct  219   RNINMGVSRSNTKGDSNAIKSTRQRKKSGMISTAAYKKWEKAAIAGVSLVADAAEHLERA  278

Query  1135  TTDKEDGHFQDSNVRNVFEHSGKDPHVFPDLLHNSFNETNLQNSGKLKLQLFPVDDGTRR  1314
              T +E    Q++     F+ +       P    N F + N+ N+ KLKLQLFP+D+ TRR
Sbjct  279   ATVREIEQDQENPGEKCFDPTDYVLPSLPTCPQNQFVDNNV-NNMKLKLQLFPIDEPTRR  337

Query  1315  ALELDNHNPYLELTLSTRKKMSSVLEHLNRKWGNSSMACGDLMLFPYHLHKENLVHFQKW  1494
             ALE+D HNP+LELTLSTRKK+SS+LEHLNRKWG+SS+A G+LMLFPY + +ENLV++Q+W
Sbjct  338   ALEVDKHNPHLELTLSTRKKISSILEHLNRKWGHSSIAVGELMLFPYGIQRENLVNYQRW  397

Query  1495  TKDTTLTAADVYALTGSPPVFRLRYGWFSNAEVAF-------------------------  1599
             T+++ L+AAD+YA+ GSPP+FRLRYGWFSN E+                           
Sbjct  398   TQESILSAADIYAMIGSPPIFRLRYGWFSNTELGLLNMQVTVASGSMLTQSKSSVYSKDR  457

Query  1600  -RAPVSSAIPSRHDANMNIMPESSVGV-----LQAPSTDPPKEANGCVSMNTVNASRSSD  1761
                 VS   PS +  ++ +  +  + +     L   S D P         NT ++  S  
Sbjct  458   IMNSVSFPTPSTNSHSLELSEDCRISMNRNHTLMTSSPDVPNTRGNNAHPNT-SSEESRR  516

Query  1762  HTEAVLWENPET----VVTEAE-VDDLQFNKAGTSCVGEWADSLTNISVGDLLSE-APDM  1923
              T   LW   +     V T+ E +D+L+ +       GEWADSLTNISVGDLLS  + D+
Sbjct  517   PTANSLWHEKDVRDGAVTTQLEDLDELKLSSGTGQSAGEWADSLTNISVGDLLSGVSQDL  576

Query  1924  EDANCITSSIHSSSNYIHQIPFSCDSFDAAIAAHIKKHQNVTDSQAALPSQLSSIWGAED  2103
             ED +CI   I  + + I QIPFS DSFDAAIAAHI +HQ+    Q++L + +SSIW AE+
Sbjct  577   ED-DCINPPIAENCHDIQQIPFSSDSFDAAIAAHISRHQDKM-GQSSLAAHMSSIWDAEE  634

Query  2104  TCDAFAFQRHSL------------SEKVQNASKHTSLETCKQITLANTTALGASVEDLPG  2247
             TCDAF F++  +            S + +N     S E   + +      +   V+  P 
Sbjct  635   TCDAFLFRKDPILHVDRPCLSPVASLESENKVPERSFEKLDEFSPERERLVEDFVQSDPL  694

Query  2248  ARNPVDGDAAT-ADLESVHYSPTSDVVKDFNGLSDVYWPDSLGPLDLDIPSS-RYHSE-L  2418
                P+D  + + AD++         + KDF  L+D+YWPDSLGPLDLDIPSS +YH+E L
Sbjct  695   ---PMDNSSESDADIQ-------DHLGKDFTALTDIYWPDSLGPLDLDIPSSTKYHTEDL  744

Query  2419  ILSDSLGGLTQLIASSLDAFQNCSFFGADKKEPVSTTEAQE  2541
             I SDSL GL +LIASSLDAFQNCSFFG DKKE  ST EA+E
Sbjct  745   IFSDSLSGLNRLIASSLDAFQNCSFFGFDKKEAPSTVEARE  785



>ref|XP_010050972.1| PREDICTED: TSL-kinase interacting protein 1 [Eucalyptus grandis]
 gb|KCW89398.1| hypothetical protein EUGRSUZ_A01690 [Eucalyptus grandis]
Length=777

 Score =   719 bits (1856),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 397/744 (53%), Positives = 501/744 (67%), Gaps = 47/744 (6%)
 Frame = +1

Query  427   QQPVKRQTRKWAAWTREEEESFFSALRHVGKNFEKITSRVQSKNKDQVRHYYYRLVRRMN  606
             QQP KR TR+WAAWTR+EEESFF+ALR VGKNFEKIT RVQSKNKDQVRHYYYRLVRRMN
Sbjct  40    QQPAKRPTRQWAAWTRQEEESFFAALRQVGKNFEKITCRVQSKNKDQVRHYYYRLVRRMN  99

Query  607   KLLGPELCLNAKNSRDTNAAMLRWWSLLEKYSCKASKLHLKPRRFKIFIETLENQLLKDR  786
             KLLGP LCL+AKNS+DTNAAMLRWWSLLEKYSCKASKLHLKPRRFKIF+E LE+QLLKDR
Sbjct  100   KLLGPGLCLDAKNSKDTNAAMLRWWSLLEKYSCKASKLHLKPRRFKIFVEALEHQLLKDR  159

Query  787   KKNVRRCFSQGENTSTAPISVSNQGRGASGHDGRSVKVVLLDNQDIHKFGSGKGSSLKRH  966
             KKNVR+  SQGEN S+ P ++S+ GR  SGHD R+V++VL+D+Q+I K GSGK   LKR 
Sbjct  160   KKNVRK-RSQGENCSS-PSTISSHGR-TSGHDNRAVRLVLVDSQNIQKLGSGK-PPLKRP  215

Query  967   INIGANSTSCKADSSLLKTARHRRKIG---ATAAYKRWEKAAIAGVSLVADAAEHLERTT  1137
             +N+G + ++ K +S+ +K AR RRK G   ++AAYK+WEKAAIAGVSLVADAAEHLERT 
Sbjct  216   VNVGVHRSNGKVESTTMKPARQRRKPGGALSSAAYKKWEKAAIAGVSLVADAAEHLERTA  275

Query  1138  TDKEDGHFQDSNVRNVFEHSGKDPHVFPDLLHNSFNETNLQNSGKLKLQLFPVDDGTRRA  1317
               KE  + Q     N  +H+ +D    P    N F E++LQ S KLKLQLFP+DD TRR+
Sbjct  276   VSKEVENDQCIPKENGSDHTEEDLPPPPCFSKNQFVESSLQASMKLKLQLFPIDDATRRS  335

Query  1318  LELDNHNPYLELTLSTRKKMSSVLEHLNRKWGNSSMACGDLMLFPYHLHKENLVHFQKWT  1497
             LE DNHNP+LELTLS RKK+SSV+EHLNRKWG+SS+ACG+LML PY + +E +V  Q+WT
Sbjct  336   LEKDNHNPFLELTLSNRKKISSVMEHLNRKWGSSSVACGELMLCPYGVEREKMVGCQRWT  395

Query  1498  KDTTLTAADVYALTGSPPVFRLRYGWFSNAEVAF------RAPV--------------SS  1617
             +DT ++AADVY +  +PPVFRLRYGWFS  E+        +AP               S 
Sbjct  396   QDTAMSAADVYTVLENPPVFRLRYGWFSKDELTSITVQERQAPCLPRESVMACNSTVDSE  455

Query  1618  AIPSR---------HDANMNIMPESSVGVLQAPSTDPPKEANGCVSMNTVNASR-SSDHT  1767
              IP           H     ++  S+   L  PS    + +    + +  N  + S+  T
Sbjct  456   QIPPSANHQSEEVGHTYEDQLLSVSATSGLACPSIVSEERSGYIAAGSKSNLMKPSATGT  515

Query  1768  EAVLWENPETVVTEAEVDDLQFNKAGTSC---VGEWADSLTNISVGDLLSEAPDMEDANC  1938
             + + + N        +++D    ++G++      EWADSLTNIS+GDLL  + D+  ANC
Sbjct  516   DTMCYPNETGGGIMRQLNDGDELRSGSNISVSACEWADSLTNISIGDLLEASYDLH-ANC  574

Query  1939  ITSSIHSSS-NYIHQIPFSCDSFDAAIAAHIKKHQNVTDSQAALPSQLSSIWGAEDTCDA  2115
                 + + S   + QI +SCDSFDAAIAAHI ++QN   S++ L S  +SIW AE+TCDA
Sbjct  575   DDEGVAAKSPQCMPQISYSCDSFDAAIAAHISRYQNKMGSESILSSHATSIWDAEETCDA  634

Query  2116  FAFQRHSLSEKVQNASKHTSLETCKQITLANTTALGASVEDLPGARNPV-DGDAATA--D  2286
             F+FQR++   K   +   T  E   Q T      L  S+E+L  A     D D A    +
Sbjct  635   FSFQRNAAVRKEVTSMSATQSEDSVQ-TRTGPVGLDGSIEELRRAEKATYDSDPADPMDE  693

Query  2287  LESVHYSPTSDVVKDFNGLSDVYWPDSLGPLDLDIPSSRYHSE-LILSDSLGGLTQLIAS  2463
              +        +   D  GL+D+YWPDSLGPLDL++PSS+YH+E LIL DSL  L +L+AS
Sbjct  694   CQPQDQHTVENTANDVFGLTDIYWPDSLGPLDLEVPSSKYHAEDLILGDSLSSLNRLMAS  753

Query  2464  SLDAFQNCSFFGADKKEPVSTTEA  2535
             SLDAFQNCSFFG DKK+  ST EA
Sbjct  754   SLDAFQNCSFFGMDKKDSGSTVEA  777



>gb|KDO49334.1| hypothetical protein CISIN_1g0038981mg [Citrus sinensis]
Length=752

 Score =   717 bits (1852),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 401/720 (56%), Positives = 491/720 (68%), Gaps = 63/720 (9%)
 Frame = +1

Query  520   NFEKITSRVQSKNKDQVRHYYYRLVRRMNKLLGPELCLNAKNSRDTNAAMLRWWSLLEKY  699
             NFEKIT RV+SKNKDQVRHYYYRLVRRMNKLLGP LCL+AKNS+DTNAAMLRWWSLLEKY
Sbjct  37    NFEKITHRVRSKNKDQVRHYYYRLVRRMNKLLGPGLCLDAKNSKDTNAAMLRWWSLLEKY  96

Query  700   SCKASKLHLKPRRFKIFIETLENQLLKDRKKNVRRCFSQGENTS-TAPISVSNQGRGASG  876
             SCKASKLHLKPRRFKIF+E LE+QLLKDRK++VR+  SQ +N S T P  + NQ R  SG
Sbjct  97    SCKASKLHLKPRRFKIFVEALEHQLLKDRKRSVRKRPSQRDNYSPTVPTPIPNQSR-TSG  155

Query  877   HDGRSVKVVLLDNQDIHKFGSGKGSSLKRHINIGANSTSCKADSSLLKTARHRRKIGA--  1050
              D  +VK+VL+D+Q+I K G  KGS LKR++NIG N ++ KADS+ LK  R RRK  +  
Sbjct  156   QDTCTVKLVLVDSQNIQKLGPAKGS-LKRNVNIGINRSNNKADSATLK-PRQRRKPDSIS  213

Query  1051  TAAYKRWEKAAIAGVSLVADAAEHLERTTTDKEDGHFQDSNVRNVFEHSGKDPHVFPDLL  1230
             +AAYK+WEKAAIAGVSLVADAAEHLERT+TDKE    Q+       E + K     P + 
Sbjct  214   SAAYKKWEKAAIAGVSLVADAAEHLERTSTDKEVERQQE---HTALETADKVLPPLPTIS  270

Query  1231  HNSFNETNLQNSGKLKLQLFPVDDGTRRALELDNHNPYLELTLSTRKKMSSVLEHLNRKW  1410
                F E N+Q   KLKLQL+P+DDGTR+ALE+DNHNP+LELTLSTRKK+SSVLEHLNRKW
Sbjct  271   PTLFAEGNVQTPVKLKLQLYPIDDGTRKALEMDNHNPHLELTLSTRKKISSVLEHLNRKW  330

Query  1411  GNSSMACGDLMLFPYHLHKENLVHFQKWTKDTTLTAADVYALTGSPPVFRLRYGWFSNAE  1590
             GN+S+A G+LMLFPY   +ENLV +Q+WT+D+  +AADVYA+ GSPP+FRLRYGWFS+ E
Sbjct  331   GNASVASGELMLFPYGAQRENLVGYQRWTQDSVFSAADVYAMIGSPPMFRLRYGWFSDTE  390

Query  1591  VAFRAP----VSSAIPSRHDANMNIMPESSVGVL--QAPST--------DP---------  1701
             + + AP     S  +PS H+ N+    E  V  +  + PST        DP         
Sbjct  391   LGYVAPHAPSASGCVPSFHNINVENKKEQIVDSVPGRVPSTSDQSENFVDPYKKLTSVKE  450

Query  1702  -----------PKEANGCVSMNTVNASRSSDHTEAVLWENPET--VVTEAEVDDLQFNK-  1839
                        PKE +  +S +  + + +SD    V W   ET   +   +V+D+   + 
Sbjct  451   NDTFATSSSSMPKETSSYISASKRDIADTSDPAANVSWPRKETGNEIITGQVEDMGDERL  510

Query  1840  -AGTSC-VGEWADSLTNISVGDLLSEAPDMEDANCITSSIHSSSNYIHQIPFSCDSFDAA  2013
              +GT+   GEWADSLTNISVGDLL+E P   DA    + +  SS  + QIPFSCDSFDAA
Sbjct  511   SSGTALSAGEWADSLTNISVGDLLAEVPHDLDA----APVAESSQCLQQIPFSCDSFDAA  566

Query  2014  IAAHIKKHQNVTDSQAALPSQLSSIWGAEDTCDAFAFQRHSL--SEKVQNASKHTSLETC  2187
             IAAHI +HQN   + + L S  SSIW AE+TCDAF+FQ++ +  +E  +          C
Sbjct  567   IAAHISRHQNKMGALSTLASHASSIWDAEETCDAFSFQKNPVLCNEVSRLPDIAPPAADC  626

Query  2188  KQITLANTTALGA-SVEDLPGARNPVDGDAATADLESVHYSPTSDVVKDFNGLSDVYWPD  2364
             +QI   N+  L A    D P   +P+D       L + H    S  V DFNGL+D+YWPD
Sbjct  627   EQIARTNSELLDAEGPTDYPAHEDPMDD-----CLRNPHTLDNS--VNDFNGLTDIYWPD  679

Query  2365  SLGPLDLDIPSSRYHSE-LILSDSLGGLTQLIASSLDAFQNCSFFGADKKEPVSTTEAQE  2541
             SLGPLDLDIPSS+Y  E +ILSDSLGGL +LIASSLDAFQNCSFFG DKKEP  T EA E
Sbjct  680   SLGPLDLDIPSSKYRGEDIILSDSLGGLNRLIASSLDAFQNCSFFGLDKKEPTPTVEAGE  739



>ref|XP_004509589.1| PREDICTED: TSL-kinase interacting protein 1-like isoform X2 [Cicer 
arietinum]
Length=831

 Score =   718 bits (1854),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 407/785 (52%), Positives = 512/785 (65%), Gaps = 88/785 (11%)
 Frame = +1

Query  427   QQPV-KRQTRKWAAWTREEEESFFSALRHVGKNFEKITSRVQSKNKDQVRHYYYRLVRRM  603
             QQPV K+ TR+WAAWTR+EEESFF+ALR VGKNFEKITSRVQSKNKDQVRHYYYRLVRRM
Sbjct  42    QQPVLKKPTRQWAAWTRQEEESFFTALRQVGKNFEKITSRVQSKNKDQVRHYYYRLVRRM  101

Query  604   NKLLGPELCLNAKNSRDTNAAMLRWWSLLEKYSCKASKLHLKPRRFKIFIETLENQLLKD  783
             NKLLGP LCL+AKNS+DTNAAMLRWWSLLEKYSCKASKLHLKPRRFKIF+E LE+QLLKD
Sbjct  102   NKLLGPGLCLDAKNSKDTNAAMLRWWSLLEKYSCKASKLHLKPRRFKIFLEALEHQLLKD  161

Query  784   RKKNVRRCFSQGENTSTAPI-SVSNQGRGASGHDGRSVKVVLLDNQDIHKFGSGKGSSLK  960
             RKKNVR+   QG N   + + +VSNQ RG SG+D R+VK++L+D+Q+I K G  K   LK
Sbjct  162   RKKNVRKRPLQGGNCQPSALNAVSNQARG-SGNDTRAVKMILVDSQNIIKLGPSK-PPLK  219

Query  961   RHINIGANSTSCKADSSLLKTARHRRKIGATAAYKRWEKAAIAGVSLVADAAEHLERTTT  1140
             R++N+G N ++ K DS+  K  R R+K   +AAY++WEKAAIAGVSLVADAAEHLER  T
Sbjct  220   RNVNMGVNRSNAKGDSNNSKPTRQRKKSATSAAYRKWEKAAIAGVSLVADAAEHLERAAT  279

Query  1141  DKEDGHFQDS----NVRNVFEHSGKDPHVFPDLLH-------------------------  1233
              K+  H Q++    ++  +   S     +  DLL                          
Sbjct  280   VKDVEHGQENPGSYHISGICFRSLLRLEISRDLLRLNAGLSMFIPGEKCSEPVDQVLSSL  339

Query  1234  -----NSFNETNLQNSGKLKLQLFPVDDGTRRALELDNHNPYLELTLSTRKKMSSVLEHL  1398
                  N F + N+QN  KLKLQLFP+D+ TRRALE+D HNPYLELTLSTRKK+SS+LEHL
Sbjct  340   PTFPPNHFVDNNVQNIMKLKLQLFPIDEPTRRALEMDKHNPYLELTLSTRKKISSILEHL  399

Query  1399  NRKWGNSSMACGDLMLFPYHLHKENLVHFQKWTKDTTLTAADVYALTGSPPVFRLRYGWF  1578
             NRKWGNSS+A G+L+LFPY + KENL ++Q+W +++TL+AAD+YA+ GSPP+FRLRYGWF
Sbjct  400   NRKWGNSSIAIGELVLFPYGVQKENLNNYQRWNQESTLSAADIYAVIGSPPIFRLRYGWF  459

Query  1579  SNAE---VAFRAPVSSAIPSRHDAN-MNIMPESSVGVLQAPSTDPPKEANGC--------  1722
             SN +   +  +APV+S+  +R   N  + M +  V +   P       +  C        
Sbjct  460   SNTKHGALNMQAPVASSCLARQSKNGGDNMKDQIVNLASLPIPSTNNYSTECAVDCGTSL  519

Query  1723  --VSMNTVNASRSSDHTEAVLWENPETV---------------VTEAEV-------DDLQ  1830
                   T  ++  S+  +   ++N  T                VT+  V       DDL+
Sbjct  520   IKTGALTTTSTYLSNARDDSTYQNTSTEEPCGPTAFISLHGKDVTDGAVTRKLEDMDDLK  579

Query  1831  FNKAGTSCVGEWADSLTNISVGDLLSEAPDMEDANCITSSIHSSSNYIHQIPFSCDSFDA  2010
              N       GEWADSLTNISVGDLL       D NCI   I  + + +HQIPFS DSFDA
Sbjct  580   SNSGSGVSAGEWADSLTNISVGDLLLGVSQNLDDNCINPLIGENCHSVHQIPFSSDSFDA  639

Query  2011  AIAAHIKKHQNVTDSQAALPSQLSSIWGAEDTCDAFAFQRHS-LSEKVQNASKHTSLETC  2187
             AIAAHI KHQ+    Q+ + S +SSIW AE+T DAF+F++   L E     S   SL++ 
Sbjct  640   AIAAHISKHQDKI-GQSTMASHMSSIWDAEETRDAFSFKKDPILHENGPCLSFIVSLDSD  698

Query  2188  KQI---TLANTTALGASVEDLP---GARNPVDGDAATADLESVHYSPTSDVVKDFNGLSD  2349
             K++   +  N   L    E L       +P+  D+  +D + + Y     + KD  GL+D
Sbjct  699   KKVPGRSFENLDKLSPEKESLVDDIAQTDPMAMDSCESDAD-IQYQ----LAKDLTGLAD  753

Query  2350  VYWPDSLGPLDLDIPSSRYH-SELILSDSLGGLTQLIASSLDAFQNCSFFGADKKEPVST  2526
             +YWPDSLGPLDL+IPS++Y   +LILSDSL GL +LIASSLDAFQNCSFFG DKKE  ST
Sbjct  754   MYWPDSLGPLDLNIPSTKYDGGDLILSDSLSGLNRLIASSLDAFQNCSFFGIDKKETPST  813

Query  2527  TEAQE  2541
              EAQE
Sbjct  814   VEAQE  818



>ref|XP_004509588.1| PREDICTED: TSL-kinase interacting protein 1-like isoform X1 [Cicer 
arietinum]
Length=833

 Score =   716 bits (1849),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 408/787 (52%), Positives = 513/787 (65%), Gaps = 90/787 (11%)
 Frame = +1

Query  427   QQPV-KRQTRKWAAWTREEEESFFSALRHVGKNFEKITSRVQSKNKDQVRHYYYRLVRRM  603
             QQPV K+ TR+WAAWTR+EEESFF+ALR VGKNFEKITSRVQSKNKDQVRHYYYRLVRRM
Sbjct  42    QQPVLKKPTRQWAAWTRQEEESFFTALRQVGKNFEKITSRVQSKNKDQVRHYYYRLVRRM  101

Query  604   NKLLGPELCLNAKNSRDTNAAMLRWWSLLEKYSCKASKLHLKPRRFKIFIETLENQLLKD  783
             NKLLGP LCL+AKNS+DTNAAMLRWWSLLEKYSCKASKLHLKPRRFKIF+E LE+QLLKD
Sbjct  102   NKLLGPGLCLDAKNSKDTNAAMLRWWSLLEKYSCKASKLHLKPRRFKIFLEALEHQLLKD  161

Query  784   RKKNVRRCFSQGENTSTAPI-SVSNQGRGASGHDGRSVKVVLLDNQDIHKFGSGKGSSLK  960
             RKKNVR+   QG N   + + +VSNQ RG SG+D R+VK++L+D+Q+I K G  K   LK
Sbjct  162   RKKNVRKRPLQGGNCQPSALNAVSNQARG-SGNDTRAVKMILVDSQNIIKLGPSK-PPLK  219

Query  961   RHINIGANSTSCKADSSLLKTARHRRK--IGATAAYKRWEKAAIAGVSLVADAAEHLERT  1134
             R++N+G N ++ K DS+  K  R R+K  I  +AAY++WEKAAIAGVSLVADAAEHLER 
Sbjct  220   RNVNMGVNRSNAKGDSNNSKPTRQRKKSGIATSAAYRKWEKAAIAGVSLVADAAEHLERA  279

Query  1135  TTDKEDGHFQDS----NVRNVFEHSGKDPHVFPDLLH-----------------------  1233
              T K+  H Q++    ++  +   S     +  DLL                        
Sbjct  280   ATVKDVEHGQENPGSYHISGICFRSLLRLEISRDLLRLNAGLSMFIPGEKCSEPVDQVLS  339

Query  1234  -------NSFNETNLQNSGKLKLQLFPVDDGTRRALELDNHNPYLELTLSTRKKMSSVLE  1392
                    N F + N+QN  KLKLQLFP+D+ TRRALE+D HNPYLELTLSTRKK+SS+LE
Sbjct  340   SLPTFPPNHFVDNNVQNIMKLKLQLFPIDEPTRRALEMDKHNPYLELTLSTRKKISSILE  399

Query  1393  HLNRKWGNSSMACGDLMLFPYHLHKENLVHFQKWTKDTTLTAADVYALTGSPPVFRLRYG  1572
             HLNRKWGNSS+A G+L+LFPY + KENL ++Q+W +++TL+AAD+YA+ GSPP+FRLRYG
Sbjct  400   HLNRKWGNSSIAIGELVLFPYGVQKENLNNYQRWNQESTLSAADIYAVIGSPPIFRLRYG  459

Query  1573  WFSNAE---VAFRAPVSSAIPSRHDAN-MNIMPESSVGVLQAPSTDPPKEANGC------  1722
             WFSN +   +  +APV+S+  +R   N  + M +  V +   P       +  C      
Sbjct  460   WFSNTKHGALNMQAPVASSCLARQSKNGGDNMKDQIVNLASLPIPSTNNYSTECAVDCGT  519

Query  1723  ----VSMNTVNASRSSDHTEAVLWENPETV---------------VTEAEV-------DD  1824
                     T  ++  S+  +   ++N  T                VT+  V       DD
Sbjct  520   SLIKTGALTTTSTYLSNARDDSTYQNTSTEEPCGPTAFISLHGKDVTDGAVTRKLEDMDD  579

Query  1825  LQFNKAGTSCVGEWADSLTNISVGDLLSEAPDMEDANCITSSIHSSSNYIHQIPFSCDSF  2004
             L+ N       GEWADSLTNISVGDLL       D NCI   I  + + +HQIPFS DSF
Sbjct  580   LKSNSGSGVSAGEWADSLTNISVGDLLLGVSQNLDDNCINPLIGENCHSVHQIPFSSDSF  639

Query  2005  DAAIAAHIKKHQNVTDSQAALPSQLSSIWGAEDTCDAFAFQRHS-LSEKVQNASKHTSLE  2181
             DAAIAAHI KHQ+    Q+ + S +SSIW AE+T DAF+F++   L E     S   SL+
Sbjct  640   DAAIAAHISKHQDKI-GQSTMASHMSSIWDAEETRDAFSFKKDPILHENGPCLSFIVSLD  698

Query  2182  TCKQI---TLANTTALGASVEDLP---GARNPVDGDAATADLESVHYSPTSDVVKDFNGL  2343
             + K++   +  N   L    E L       +P+  D+  +D + + Y     + KD  GL
Sbjct  699   SDKKVPGRSFENLDKLSPEKESLVDDIAQTDPMAMDSCESDAD-IQYQ----LAKDLTGL  753

Query  2344  SDVYWPDSLGPLDLDIPSSRYH-SELILSDSLGGLTQLIASSLDAFQNCSFFGADKKEPV  2520
             +D+YWPDSLGPLDL+IPS++Y   +LILSDSL GL +LIASSLDAFQNCSFFG DKKE  
Sbjct  754   ADMYWPDSLGPLDLNIPSTKYDGGDLILSDSLSGLNRLIASSLDAFQNCSFFGIDKKETP  813

Query  2521  STTEAQE  2541
             ST EAQE
Sbjct  814   STVEAQE  820



>ref|XP_004166172.1| PREDICTED: TSL-kinase interacting protein 1-like [Cucumis sativus]
Length=799

 Score =   713 bits (1840),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 393/730 (54%), Positives = 494/730 (68%), Gaps = 40/730 (5%)
 Frame = +1

Query  418   SALQQPVKRQTRKWAAWTREEEESFFSALRHVGKNFEKITSRVQSKNKDQVRHYYYRLVR  597
             S L    KR TR+WAAWTREEEESFF+ALR VGKNFEKIT  VQSKNKDQVRHYYYRLVR
Sbjct  63    SLLVHAAKRPTRQWAAWTREEEESFFTALRQVGKNFEKITCHVQSKNKDQVRHYYYRLVR  122

Query  598   RMNKLLGPELCLNAKNSRDTNAAMLRWWSLLEKYSCKASKLHLKPRRFKIFIETLENQLL  777
             RMNKLL P LCL+AKNS+DTNAAMLRWWSLLEKYSCKASKLHLKPRRFKIF+E LE+QLL
Sbjct  123   RMNKLLAPGLCLDAKNSKDTNAAMLRWWSLLEKYSCKASKLHLKPRRFKIFVEALEHQLL  182

Query  778   KDRKKNVRRCFSQGENTSTA-PISVSNQGRGASGHDGRSVKVVLLDNQDIHKFGSGKGSS  954
             KDRKKNVR+   QGEN     P +VSNQ R A GHDGR+VK+VL+D Q+I K G  K +S
Sbjct  183   KDRKKNVRKRPLQGENCPPPIPNAVSNQSR-ALGHDGRAVKLVLVDTQNIPKLGPRKTAS  241

Query  955   LKRHINIGANSTSCKADSSLLKTARHRRKIGATAAYKRWEKAAIAGVSLVADAAEHLERT  1134
              +R++N+G N  +     ++LK +R RRK   +AAYK+WEKAAIAGVSLVADAAEHLERT
Sbjct  242   -RRNVNVGINRGNNGGYPTVLKPSRQRRK---SAAYKKWEKAAIAGVSLVADAAEHLERT  297

Query  1135  TTDKEDGHFQDSNVRNVFEHSGKDPHVFPDLLHNSFNETNLQNSGKLKLQLFPVDDGTRR  1314
              T+++    Q++  +   + +G    + P L  NS  +     S KLKLQLFPVDDGTRR
Sbjct  298   ITNRDVLRDQNTLGKKSTDPAGSPLLLLPPLQPNSLIDV---ASIKLKLQLFPVDDGTRR  354

Query  1315  ALELDNHNPYLELTLSTRKKMSSVLEHLNRKWGNSSMACGDLMLFPYHLHKENLVHFQKW  1494
             ALE D HNPYLELTLSTRKK+SSVLEHL+RKWGNSS A G+LMLFPY + +++L   Q+W
Sbjct  355   ALESDKHNPYLELTLSTRKKISSVLEHLSRKWGNSSAAHGELMLFPYSIQRKSLADCQRW  414

Query  1495  TKDTTLTAADVYALTGSPPVFRLRYGWFSNAE---VAFRAPVSSA------------IPS  1629
             T+D+  +A DVYA  G P VFRLRYGW SNAE   V  +  V +             I  
Sbjct  415   TQDSFESAGDVYATIGRPQVFRLRYGWCSNAEHESVELQTSVPAYCIQDDHIMDARDIEG  474

Query  1630  R--HDANMNIMP----ESSVGVLQAPSTDP--PKEANGCVSMNTVNASRSSDHTEAVLWE  1785
             R  H A+++  P    +  VG L   ++ P  P E+  C+S    +  +SSD    + W+
Sbjct  475   RIVHAASIDAQPVDFNKDEVGTLTKNTSTPTAPCESERCISARPNDLLKSSDPVLNMSWD  534

Query  1786  NP----ETVVTEA-EVDDLQFNKAGTSCVGEWADSLTNISVGDLLSEAPDMEDANCITSS  1950
                    T++  + +VDDL+ +   +   GEWADSLTNIS+GDLLS      DANC+ + 
Sbjct  535   KKNAADRTIIQRSDDVDDLKLSNGTSLSAGEWADSLTNISIGDLLSGVSQDVDANCVDTP  594

Query  1951  IHSSSNYIHQIPFSCDSFDAAIAAHIKKHQNVTDSQAALPSQLSSIWGAEDTCDAFAFQR  2130
             +   +  + QIPFSCDSFDAAIAAHI + Q+ T  Q  L S  SSIW AE+TCDAF+FQ+
Sbjct  595   LAEGTQCLQQIPFSCDSFDAAIAAHISRQQDKTVPQPTLASHASSIWDAEETCDAFSFQK  654

Query  2131  HSLS-EKVQNASKHTSLETCKQITLANTTALGASVEDLPGARNPVDGDAATADLESVHYS  2307
             + ++ ++V ++   +SL  CK +   N+       ED P + +P++       ++     
Sbjct  655   NPVTLQEVPSSFTFSSLRGCKHVARTNSMGFSHMTEDFPRSESPIEDHIQEDLMDECQSD  714

Query  2308  PTSDVVKDFNGLSDVYWPDSLGPLDLDIPSS-RYHS-ELILSDSLGGLTQLIASSLDAFQ  2481
             P     KD + L+D+YWPDSLGPLDLD+PS+ +YH+ ELIL DSL  L +LIASSLDAFQ
Sbjct  715   PQITETKDIDELADIYWPDSLGPLDLDLPSTNKYHNEELILGDSLSSLNRLIASSLDAFQ  774

Query  2482  NCSFFGADKK  2511
             NCSF    +K
Sbjct  775   NCSFSAWTRK  784



>gb|EYU38554.1| hypothetical protein MIMGU_mgv1a022732mg, partial [Erythranthe 
guttata]
Length=734

 Score =   706 bits (1823),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 417/736 (57%), Positives = 511/736 (69%), Gaps = 71/736 (10%)
 Frame = +1

Query  400   ASFEEHSALQQPVKRQTRKWAAWTREEEESFFSALRHVGKNFEKITSRVQSKNKDQVRHY  579
             +S +E++  ++PVK+QTR+WAAWTR+EEESFF+ALR  GKNFEKITSRVQSKNKDQVR+Y
Sbjct  30    SSPQENTDPKRPVKKQTRQWAAWTRQEEESFFAALRQYGKNFEKITSRVQSKNKDQVRYY  89

Query  580   YYRLVRRMNKLLGPELCLNAKNSRDTNAAMLRWWSLLEKYSCKASKLHLKPRRFKIFIET  759
             YYRLVRRMNKLLGPELCL+AKNS+DTN AMLRWWSLLEKYSCKASKLHLKPRRFKIF+E 
Sbjct  90    YYRLVRRMNKLLGPELCLDAKNSKDTNGAMLRWWSLLEKYSCKASKLHLKPRRFKIFVEA  149

Query  760   LENQLLKDRKKNVRRCFSQ-GENTSTAPISVSNQGRGASGHDGRSVKVVLLDNQDIHKFG  936
             LENQLLKDRKKN++R  S  G N+  A I  SNQ R A GHD R+VK+VL     + K G
Sbjct  150   LENQLLKDRKKNIKRRLSTGGMNSPVADIPASNQVR-APGHDNRAVKMVL-----VEKVG  203

Query  937   SGKGSSLKRHINIGANSTSCKADSSLLKTARHRRKIG--ATAAYKRWEKAAIAGVSLVAD  1110
             +GKG+  KRH+N G + T+CK D++ +KT +H+RK G  + AA K+WEKAAIAGVSLVAD
Sbjct  204   TGKGALFKRHVNTGISRTNCKVDTASVKTTKHKRKTGLASAAACKKWEKAAIAGVSLVAD  263

Query  1111  AAEHLERTTTDKEDGHFQDSNVRNVFEHSGKDPHVFPDLLHNSFNETNLQNSGKLKLQLF  1290
             AAEHLER  TDKE             E S ++P   P    N FN+ N+ NS KLKLQLF
Sbjct  264   AAEHLERAETDKE------------MEKS-QEPQSVPS--QNMFNDNNIHNSTKLKLQLF  308

Query  1291  PVDDGTRRALELDNHNPYLELTLSTRKKMSSVLEHLNRKWGNSSMACGDLMLFPYHLHKE  1470
             P+D+ T++ALE+D+ NP+LELTLSTRKK+SSVLEHLNRKWGNS + C DLMLFPY   +E
Sbjct  309   PIDECTQKALEMDHRNPHLELTLSTRKKISSVLEHLNRKWGNSKLLCEDLMLFPYWAQRE  368

Query  1471  NLVHFQKWTKDTTLTAADVYALTGSPPVFRLRYGWFSNAEV--AFRAPVSSAIPSRHDAN  1644
             NL+ +QKWTKD+TL AADVY L GSPP+FRLRYGWFS +E+  A   P+S       ++N
Sbjct  369   NLLEYQKWTKDSTLCAADVYYLIGSPPIFRLRYGWFSKSELESATAQPLSCTNIKEKNSN  428

Query  1645  MNIM-PESSVGVLQAPSTDPPKEANGCVSMN-----------TVNASRSSDHTEAVLWEN  1788
             +NI  P       QA S      A   +++N            +N SR  D T AVL   
Sbjct  429   INIENPSGPRNNHQAVS------AEQIITLNSSSVQSGVSVSNINNSRYRDST-AVL---  478

Query  1789  PETVVTEAEVDDLQFNKAGTSCVGEWADSLTNISVGDLLSEAPDMEDANCITSSIHSSSN  1968
               + + EA  D    N       GEWAD+LTN+S+GDLLS++ +  DANC   S+  SSN
Sbjct  479   --SSIGEASEDLAPENTDMAFSAGEWADTLTNVSMGDLLSDSHNNADANCTDFSLPLSSN  536

Query  1969  YIHQIPFSCDSFDAAIAAHIKKHQNVTDSQAALPSQLSSIWGAEDTCDAFAFQRH-SLSE  2145
              + Q+PF+CDSFDAAIAAHI KH N  DSQ  L S   SIW AE TCDAFAFQ++ +   
Sbjct  537   CLQQMPFTCDSFDAAIAAHIYKH-NKADSQQILASHAPSIWDAEVTCDAFAFQKNGAFCG  595

Query  2146  KVQNASKHTSLETCKQI-TLANTTALGASVEDLPGARNPVDGDAATADLESVHY--SPTS  2316
             + +NA  ++S  + K++  L +      S  DL    + VD      D  S H   +PT 
Sbjct  596   EDKNACMNSSPSSDKEVEELLDVDKFAYS--DL-NCEDIVD------DCRSDHLLENPT-  645

Query  2317  DVVKDFNGLSDVYWPDSLGPLDLDIPSS-RYH-SELILSD-SLGGLTQLIASSLDAFQNC  2487
                KDF GL+D+YWP+SLG LDLDIPSS RY+ S+LIL+D SLGGL +LIA+SLDAFQ+C
Sbjct  646   ---KDFGGLTDIYWPNSLGALDLDIPSSCRYNSSDLILNDNSLGGLNRLIANSLDAFQSC  702

Query  2488  SFFGADKKEPVSTTEA  2535
             SFFG DK EP  T EA
Sbjct  703   SFFGLDKNEPPLTAEA  718



>gb|KEH20230.1| TSL-kinase interacting protein [Medicago truncatula]
Length=798

 Score =   706 bits (1823),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 405/764 (53%), Positives = 508/764 (66%), Gaps = 79/764 (10%)
 Frame = +1

Query  427   QQPV-KRQTRKWAAWTREEEESFFSALRHVGKNFEKITSRVQSKNKDQVRHYYYRLVRRM  603
             QQP  K+ TR+WAAWTR EEESFF+ALR VGKNFEKITSRVQSKNKDQVRHYYYRLVRRM
Sbjct  42    QQPAPKKPTRQWAAWTRNEEESFFTALRQVGKNFEKITSRVQSKNKDQVRHYYYRLVRRM  101

Query  604   NKLLGPELCLNAKNSRDTNAAMLRWWSLLEKYSCKASKLHLKPRRFKIFIETLENQLLKD  783
             NK LGPELCL+AKNS+DTNAAMLRWWSLLEKY  KASKLHLKPRRFKIF+E LE+QLLKD
Sbjct  102   NKHLGPELCLDAKNSKDTNAAMLRWWSLLEKYRFKASKLHLKPRRFKIFLEALEHQLLKD  161

Query  784   RKKNVRRCFSQGENTSTAPI-SVSNQGRGASGHDGRSVKVVLLDNQDIHKFGSGKGSSLK  960
             RKK+VR+   QG N     + +VSNQ R ASG+D R++K++L+++Q+I K G  K   LK
Sbjct  162   RKKSVRKRPLQGGNCQPPGLNTVSNQAR-ASGNDSRAIKMILVESQNIIKLGPSK-PPLK  219

Query  961   RHINIGANSTSCKADSSLLKTARHRRKIGA--TAAYKRWEKAAIAGVSLVADAAEHLERT  1134
             R++++G N ++ K DS+  K  R R+K G   +AAYK+WEKAAIAGVSLVADAAEHLER 
Sbjct  220   RNVSMGVNRSNAKGDSNNSKPTRQRKKSGVITSAAYKKWEKAAIAGVSLVADAAEHLERA  279

Query  1135  TTDKEDGHFQDSNVRNVFEHSGK---DP--HVFPDLL---HNSFNETNLQNSGKLKLQLF  1290
              T  E  H Q        E+ G+   DP  HV P L     N   + N+QN  KLKLQLF
Sbjct  280   ATVNEVEHDQ--------ENPGEKCSDPADHVLPSLRTFPQNHSVDNNVQNIVKLKLQLF  331

Query  1291  PVDDGTRRALELDNHNPYLELTLSTRKKMSSVLEHLNRKWGNSSMACGDLMLFPYHLHKE  1470
             P+D+ TRRALE++ HNPYLELT+STRKK+SS+LEHLNRKWGNSS+A G+LMLFPY + KE
Sbjct  332   PIDEPTRRALEMEKHNPYLELTVSTRKKISSILEHLNRKWGNSSIAVGELMLFPYGVQKE  391

Query  1471  NLVHFQKWTKDTTLTAADVYALTGSPPVFRLRYGWFSNAE---VAFRAPVSSAIPSRHDA  1641
             NL ++Q+W +++TL+AAD+YA+ GSPP+FRLRYGWFS  E   +  +APV+S+   R   
Sbjct  392   NLNNYQRWNQESTLSAADIYAVIGSPPIFRLRYGWFSYTEHGVLNMQAPVASSCMVRQSK  451

Query  1642  NMNIMPESSVGVLQAPSTDPPKEAN-------GCVSMNTVNASRSSDHT------EAVLW  1782
             N     +    ++ +PS   P   N        C +   +N + +S  T      +  ++
Sbjct  452   NGGDSMKDR--IVSSPSLPMPSTNNYSKEHYVDCGTSTNINDALTSTSTYLPNTRDGSIY  509

Query  1783  ENPET--------------------VVTE--AEVDDLQFNKAGTSCVGEWADSLTNISVG  1896
              N  T                     VT    ++D L+         GEWAD+LTNISVG
Sbjct  510   HNTSTEEPCGPTAQISSHGKDATDGAVTRHLEDMDGLKSTNGSGLSAGEWADTLTNISVG  569

Query  1897  DLLSEAPDMEDANCITSSIHSSSNYIHQIPFSCDSFDAAIAAHIKKHQNVTDSQAALPSQ  2076
             DLLS      + NCI   I  +   +HQIPFSCDSFDAAIAAHI KHQ+    Q+ L S 
Sbjct  570   DLLSGVSQDHNDNCIDPLIAENCRSVHQIPFSCDSFDAAIAAHISKHQDKM-GQSTLASH  628

Query  2077  LSSIWGAEDTCDAFAFQRHSL--SEKVQNASKHTSLETCKQI---TLANTTALGASVEDL  2241
             +SSIW AE+T DAF+F++ S+   E     S   SL++ K++   +  N   L    E L
Sbjct  629   MSSIWDAEETRDAFSFKKDSIIRHEDGPCLSLIASLDSDKKVPERSFENLDKLSPEKESL  688

Query  2242  P---GARNPVDGDAATADLESVHYSPTSDVVKDFNGLSDVYWPDSLGPLDLDIPSSRYHS  2412
                    +P+  D   +D ++ ++S      KDF GL+D+YWPDSLGPLDL+IPS++YHS
Sbjct  689   VDDIAQTDPLPMDGCESDADNKYHS-----AKDFTGLADMYWPDSLGPLDLEIPSTKYHS  743

Query  2413  -ELILSDSLGGLTQLIASSLDAFQNCSFFGADKKEPVSTTEAQE  2541
              + ILSDS  GL +LIASSLDAFQNCSFFG DKKE  ST EAQE
Sbjct  744   DDPILSDS--GLNRLIASSLDAFQNCSFFGIDKKETPSTVEAQE  785



>ref|XP_007027387.1| TSL-kinase interacting protein 1, putative isoform 3 [Theobroma 
cacao]
 gb|EOY07889.1| TSL-kinase interacting protein 1, putative isoform 3 [Theobroma 
cacao]
Length=712

 Score =   702 bits (1813),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 404/781 (52%), Positives = 503/781 (64%), Gaps = 130/781 (17%)
 Frame = +1

Query  211   IQMELQLTLGSEADHYLRSSPRKDGDFTFGKVNCVEQQIASSQEHAIPEQAMFSQDHSVT  390
             +Q E Q++L SEA+ +    P + GD       CV    +S+  +A+PEQ          
Sbjct  1     MQTESQVSLASEANCHQEHIPIQIGD------PCV---ASSTPNNAVPEQ----------  41

Query  391   EQLASFEEHSALQQPVKRQTRKWAAWTREEEESFFSALRHVGKNFEKITSRVQSKNKDQV  570
                           P K+ TR+WAAWTR+EEESFF+ALR VGKNFEKIT RVQSKNKDQV
Sbjct  42    --------------PAKKPTRQWAAWTRQEEESFFTALRQVGKNFEKITCRVQSKNKDQV  87

Query  571   RHYYYRLVRRMNKLLGPELCLNAKNSRDTNAAMLRWWSLLEKYSCKASKLHLKPRRFKIF  750
             RHYYYRLVRRMNKLLGP LCL+AKNS+DTNAAMLRWWSLLEKYSC+ASKLHLKPRRFKIF
Sbjct  88    RHYYYRLVRRMNKLLGPGLCLDAKNSKDTNAAMLRWWSLLEKYSCRASKLHLKPRRFKIF  147

Query  751   IETLENQLLKDRKKNVRRCFSQGENTS-TAPISVSNQGRGASGHDGRSVKVVLLDNQDIH  927
             +E LE+QLLKDRKKNVR+  SQGEN+S T+P +V+NQ R ASGHD R+VK+VL+D+Q+I 
Sbjct  148   VEALEHQLLKDRKKNVRKRPSQGENSSPTSPSTVTNQSR-ASGHDARTVKLVLVDSQNIQ  206

Query  928   KFGSGKGSSLKRHINIGANSTSCKADSSLLKTARHRRKIG-ATAAYKRWEKAAIAGVSLV  1104
             K G GKG S KR+ N+G N ++ K +S+ +K AR RRK G ++AAYK+WEKAAIAGVSLV
Sbjct  207   KLGPGKG-SFKRNTNVGVNRSNSKGESNTMKPARQRRKPGSSSAAYKKWEKAAIAGVSLV  265

Query  1105  ADAAEHLERTTTDKEDGHFQDSNVRNVFEHSGKDPHVFPDLLHNSFNETNLQNSGKLKLQ  1284
             ADAAEHLERTTTDKE  H QDS+V                       E+N+ ++GKLKLQ
Sbjct  266   ADAAEHLERTTTDKEAEHDQDSSV-----------------------ESNIHSAGKLKLQ  302

Query  1285  LFPVDDGTRRALELDNHNPYLELTLSTRKKMSSVLEHLNRKWGNSSMACGDLMLFPYHLH  1464
             LFP+DD TRRALE+D HNP+LELTLSTRKK+SSVLEHL RKWGNSS+A G+LMLFPY + 
Sbjct  303   LFPIDDSTRRALEMDKHNPHLELTLSTRKKISSVLEHLTRKWGNSSVASGELMLFPYGVQ  362

Query  1465  KENLVHFQKWTKDTTLTAADVYALTGSPPVFRLRYGWFSNAEVA---FRAPVSSAIPSRH  1635
             +ENL+ +Q+WT+ + ++AADVYA+ GSP VFRLRYGWFS+AEVA   ++APVSS IPS H
Sbjct  363   RENLMGYQRWTQASIVSAADVYAMIGSPQVFRLRYGWFSDAEVASLTWQAPVSSYIPSEH  422

Query  1636  DANMN-----IMPESSVG--------------------------VLQAPSTDPPKE----  1710
             + N+      I  E  V                            LQ P T+ P E    
Sbjct  423   NVNVEGRNGCIAEEVQVSALSTSDQSKKLDDPCNNQPTLRKENHALQPPLTNFPSEISRF  482

Query  1711  ---------ANGCVSMNTVNASRSSDHTEAVLWENPETVVTEAEVDDLQFNKAGTSC-VG  1860
                       +  + +   +A RS     A+L +         +VDD + N    +   G
Sbjct  483   ICAGPKDNLGDSPIPVRHASADRSETCNVAILRQ-------LEDVDDQRLNNNTAALSAG  535

Query  1861  EWADSLTNISVGDLLSEAPDMEDANCITSSIHSSSNYIHQIPFSCDSFDAAIAAHIKKHQ  2040
             EWADSLTNISVGDLL+E P   D NC+   +  SS  + QIPFSCDSFDAAIAAHI +HQ
Sbjct  536   EWADSLTNISVGDLLAEVPHDLDDNCVDHPVAESSQCLQQIPFSCDSFDAAIAAHISRHQ  595

Query  2041  NVTDSQAALPSQLSSIWGAEDTCDAFAFQR-HSLSEKVQNASKHTSLETCKQITLANTTA  2217
             N  +   +L S  SSIW AE+TCDAF+F + H     V   S   +   CKQIT +N+  
Sbjct  596   NKMEV-PSLASHPSSIWDAEETCDAFSFSKNHIPCADVPRLSSAVA-AACKQITRSNSAG  653

Query  2218  LGA----SVEDLPGARNPVDGDAATADLESVHYSPTSDVV-----KDFNGLSDVYWPDSL  2370
              G       ++ P    P++ ++A  DL  V  SP+   +     KDFNGL+D+YW  +L
Sbjct  654   SGTLNKLLPQESPDLEEPME-NSACEDL--VDESPSDPHIMDTTEKDFNGLTDIYWVIAL  710

Query  2371  G  2373
             G
Sbjct  711   G  711



>ref|XP_007208078.1| hypothetical protein PRUPE_ppa001536mg [Prunus persica]
 gb|EMJ09277.1| hypothetical protein PRUPE_ppa001536mg [Prunus persica]
Length=806

 Score =   694 bits (1790),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 405/808 (50%), Positives = 495/808 (61%), Gaps = 91/808 (11%)
 Frame = +1

Query  325   IASSQEHAIPEQAMFSQDHSVTEQLASFEEHSALQQPVKRQTRKWAAWTREEEESFFSAL  504
             I +S+ H  P Q  F           S   H ALQQP           T+  + S     
Sbjct  8     IVNSEAH--PHQGGFFVQDGGPGLAPSTSNHVALQQP----GNGLLGHTKRRKVSLLLYD  61

Query  505   RHVGKNFEKITSRVQSKNKDQVRHYYYRLVRRMNKLLGPELCLNAKNSRDTNAAMLRWWS  684
             +    NFEKIT RVQSKNKDQVRHYYYRLVRRMNKLLGP L L++KNS+DTNAAMLRWWS
Sbjct  62    KLARHNFEKITCRVQSKNKDQVRHYYYRLVRRMNKLLGPGLYLDSKNSKDTNAAMLRWWS  121

Query  685   LLEKYSCKASKLHLKPRRFKIFIETLENQLLKDRKKNVRRCFSQGENT-STAPISVSNQG  861
             LLEKYSCKASKLHLKPRRFKIFIE LE+QLLKDRKK+VR+  SQGEN    AP +VSNQ 
Sbjct  122   LLEKYSCKASKLHLKPRRFKIFIEALEHQLLKDRKKSVRKRPSQGENCPPNAPSTVSNQN  181

Query  862   RGASGHDGRSVKVVLLDNQDIHKFGSGKGSSLKRHINIGANSTSCKADSSLLKTARHRRK  1041
             R  SGHD R+VK+VL+D+ +I K G GK +SLKR++NIG N ++ K DSS +K AR RRK
Sbjct  182   R-PSGHDNRTVKLVLVDSHNIQKLGPGK-ASLKRNVNIGVNRSN-KGDSSTMKPARQRRK  238

Query  1042  IG---ATAAYKRWEKAAIAGVSLVADAAEHLERTTTDKEDGHFQDSNVRNVFEHSGKDPH  1212
                  ++AAYK+WEKAAIAGVSLVADAAEHLER  TDKE    + + V            
Sbjct  239   PAGAISSAAYKKWEKAAIAGVSLVADAAEHLERAITDKEVEQDRSAAVL----------P  288

Query  1213  VFPDLLHNSFNETNLQNSGKLKLQLFPVDDGTRRALELDNHNPYLELTLSTRKKMSSVLE  1392
               P  + N   E+   N  KLKLQLFP+DDGTRRALE D HNPYLELTLSTRKK+SSVL+
Sbjct  289   PMPAFVQNIDAESGTNNCMKLKLQLFPIDDGTRRALENDKHNPYLELTLSTRKKISSVLD  348

Query  1393  HLNRKWGNSSMACGDLMLFPYHLHKENLVHFQKWTKDTTLTAADVYALTGSPPVFRLRYG  1572
             HLNRKWGNS++A G+L LF Y + ++NL+ + +WT+D+ ++AADVYA  G PPVFRLRYG
Sbjct  349   HLNRKWGNSNVASGELTLFHYSVQRDNLMGYPRWTQDSIVSAADVYATIGCPPVFRLRYG  408

Query  1573  WFSNAE---VAFRAPVSSAI-PSRHDAN-----MNIMPESSVGVL---------------  1680
             WFSN E   V  + PV+S      HD N       I+  + V  L               
Sbjct  409   WFSNTELGSVGLQTPVASCSNQGEHDINEEKRKEQIVDSAPVSPLSTDNQSADIHKDHLT  468

Query  1681  ------------------QAPSTDPPK--------------EANGCVSMNTVNASRSSDH  1764
                               Q P    P+              E NG +   + N +   D 
Sbjct  469   STNNSCVLSALAYQHSQPQLPERGKPRYNHSLGLTSDEEPNEINGYICA-SPNDNFVGDP  527

Query  1765  TEAVLWENPE-----TVVTEAEVDDLQFNKAGTSCVGEWADSLTNISVGDLLSEAPDMED  1929
             TE   W   E     T     EVDDL+         G WADSLTNIS+GDLLS      D
Sbjct  528   TEITSWHKKEAGDQNTSRHRGEVDDLRSITGTALSAGVWADSLTNISMGDLLSGVSHDLD  587

Query  1930  ANCITSSIHSSSNYIHQIPFSCDSFDAAIAAHIKKHQNVTDSQAALPSQLSSIWGAEDTC  2109
              NCI   +   S  + QIPFSCDSFDA IAAHI + QN T  Q  +   +SSIW AE+TC
Sbjct  588   TNCIDPPVAEGSQCLQQIPFSCDSFDAVIAAHISR-QNKTGCQPTMECHVSSIWDAEETC  646

Query  2110  DAFAFQRHSL-SEKVQNASKHTSLETCKQITLANTTALGASVEDLPGARNPVDGDAATAD  2286
             DAF+FQ++S+  ++V + S       CKQ  +A++      VE++P    P+D D     
Sbjct  647   DAFSFQKNSVFCQEVSSLSAVAPPGACKQTAVASSAGSDCMVEEIPVVERPID-DPPRGP  705

Query  2287  LESVHYSP--TSDVVKDFNGLSDVYWPDSLGPLDLDIPSSRYHSE-LILSDSLGGLTQLI  2457
             ++     P      VKDFN L+D+YWP+SLGPLDL++PSS+YHSE  +LSDSL GL +LI
Sbjct  706   IDECQSDPRILESSVKDFNALTDIYWPESLGPLDLEMPSSKYHSEDFVLSDSLSGLNRLI  765

Query  2458  ASSLDAFQNCSFFGADKKEPVSTTEAQE  2541
             ASSLDAFQNCSFFGA+K+EP ++ EA+E
Sbjct  766   ASSLDAFQNCSFFGANKREPTASVEARE  793



>ref|XP_010253972.1| PREDICTED: TSL-kinase interacting protein 1-like isoform X2 [Nelumbo 
nucifera]
Length=827

 Score =   691 bits (1783),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 406/778 (52%), Positives = 509/778 (65%), Gaps = 76/778 (10%)
 Frame = +1

Query  421   ALQQPVKRQTRKWAAWTREEEESFFSALRHVGKNFEKITSRVQSKNKDQVRHYYYRLVRR  600
             A QQPVK+QTR+WAAWTR+EEESFF+ALR VGKNFEKIT RVQSKNKDQVRHYYYRLVRR
Sbjct  38    APQQPVKKQTRQWAAWTRQEEESFFNALRQVGKNFEKITCRVQSKNKDQVRHYYYRLVRR  97

Query  601   MNKLLGPELCLNAKNSRDTNAAMLRWWSLLEKYSCKASKLHLKPRRFKIFIETLENQLLK  780
             MNKLL P   L+AKNS+DT AAMLRWWSLLEKYSCKASKLHLKPRR K+F+E LE+QLLK
Sbjct  98    MNKLLSPGFSLDAKNSKDTIAAMLRWWSLLEKYSCKASKLHLKPRRLKLFVEALEHQLLK  157

Query  781   DRKKNVRRCFSQGENTSTA-PISVSNQGRGASGHDGRSVKVVLLDNQDIHKFGSGKGSSL  957
             DRKK++R+  SQGE  S+A P +V  Q + A G D RSVK+V +DNQ I K  SGKGS+L
Sbjct  158   DRKKSIRKRPSQGEYCSSASPTAVLLQNK-APGLDTRSVKLVAVDNQSIQKVVSGKGSAL  216

Query  958   KRHINIGANSTSCKADSSLLKTARHRRKIGAT-AAYKRWEKAAIAGVSLVADAAEHLERT  1134
             KR++N G N ++ K  SS  KT R RRK GA+ AAYKRWEKAA+AGVSLVADAAEHLER+
Sbjct  217   KRNVNTGINRSNNKCHSSTSKTGRQRRKTGASPAAYKRWEKAAMAGVSLVADAAEHLERS  276

Query  1135  TTDKEDGHFQDSNVR-------NVFEHSGKDPHVFPDLLHNS----FNETNLQNSGKLKL  1281
             TT+K+D   + + ++             G    V P L  ++      ++  Q S KLKL
Sbjct  277   TTNKKDCTEEGTLIKPFPGPVDPANAQKGDPVGVRPPLSMSTSVQQLTDSGAQQSLKLKL  336

Query  1282  QLFPVDDGTRRALELDNHNPYLELTLSTRKKMSSVLEHLNRKWGNSSMACGDLMLFPYHL  1461
             QLFP+D+ TRRALE D HNP+LELTLS RKK+SSVLEHLNRKWGNS +A GDL+LFPY +
Sbjct  337   QLFPIDEVTRRALEKDEHNPHLELTLSARKKISSVLEHLNRKWGNSGIASGDLILFPYSV  396

Query  1462  HKENLVHFQKWTKDTTLTAADVYALTGSPPVFRLRYGWFSNA--EVAFRAPVSSAIPSRH  1635
              +ENL+ + +W +DT  +AADVYA+ GSPPVFRLRYGWFS+   E   RA  S  I  +H
Sbjct  397   QRENLMGYPRWKQDTVASAADVYAMIGSPPVFRLRYGWFSSTDLESICRASSSYHIQEQH  456

Query  1636  DA-NMNIMPESSVGVLQAPST-----------------------------DPPKEANGCV  1725
              + N + + ES+   L   ST                             D  ++  GC 
Sbjct  457   TSINRSNIKESTDATLPILSTCHHSEHLLDCFKDRVTLMTESSLILPLHADCCEDVIGCA  516

Query  1726  SMNTVNASRSSDHTEAVLWENPETVVTEA--EVDDLQFNKAGTSCV-GEWADSLTNISVG  1896
                 ++   SS ++  +  E    +V     E+D+L+ +   T+ + GEWAD LTNIS+G
Sbjct  517   EDQEISLPVSSANSSWLKKEIGGGIVKGQWEEMDNLRMSNNSTALLAGEWADGLTNISIG  576

Query  1897  DLLSEAPDMEDANCITSSIHSSSNYIHQIPFSCDSFDAAIAAHIKKHQNVTDSQAALPSQ  2076
             DLLSEA    D NC+      SS Y  QIPFSCDSFDAAIAAHI  HQ   + ++A  S 
Sbjct  577   DLLSEASRAADNNCVDPHSLGSSQYFQQIPFSCDSFDAAIAAHIAAHQEKLNLKSAQVSH  636

Query  2077  LSSIWGAEDTCDAFAFQRH-SLSEKVQNASKHTSLETCKQITLANTTALGASVEDLPGAR  2253
              +S+W AE+T DAF+FQ+  +  ++V++ S+H S  TCKQI+  ++ +L A +E+LP  R
Sbjct  637   ATSLWDAEETRDAFSFQKMPTFDQEVRSPSQHASFGTCKQISCTSSMSLRALIEELPEVR  696

Query  2254  NPVDGDAATA----DLESVHYSPTS-----------------DVVKDFNGLSDVYWPDSL  2370
              P+D  A       D +S  YSP +                 +   DF+ L+D+YWPDSL
Sbjct  697   -PIDDSACEGDSVDDCQSDAYSPDNSPKGLSPENSSKDLSPKNSANDFSELTDIYWPDSL  755

Query  2371  GPLDLDIPSSR-YHSELILSDSL--GGLTQLIASSLDAFQNCSFFGADKKEPVSTTEA  2535
             GPLDLD+PSSR Y  +LI  DS+   GL + +ASSLD FQN S FG DKKE  ST E 
Sbjct  756   GPLDLDVPSSRCYKQDLIFGDSVSFSGLNRFLASSLDTFQN-SLFGFDKKELPSTDEV  812



>ref|XP_010253973.1| PREDICTED: TSL-kinase interacting protein 1-like isoform X3 [Nelumbo 
nucifera]
Length=824

 Score =   687 bits (1773),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 406/779 (52%), Positives = 509/779 (65%), Gaps = 77/779 (10%)
 Frame = +1

Query  421   ALQQPVKRQTRKWAAWTREEEESFFSALRHVGKNFEKITSRVQSKNKDQVRHYYYRLVRR  600
             A QQPVK+QTR+WAAWTR+EEESFF+ALR VGKNFEKIT RVQSKNKDQVRHYYYRLVRR
Sbjct  34    APQQPVKKQTRQWAAWTRQEEESFFNALRQVGKNFEKITCRVQSKNKDQVRHYYYRLVRR  93

Query  601   MNKLLGPELCLNAKNSRDTNAAMLRWWSLLEKYSCKASKLHLKPRRFKIFIETLENQLLK  780
             MNKLL P   L+AKNS+DT AAMLRWWSLLEKYSCKASKLHLKPRR K+F+E LE+QLLK
Sbjct  94    MNKLLSPGFSLDAKNSKDTIAAMLRWWSLLEKYSCKASKLHLKPRRLKLFVEALEHQLLK  153

Query  781   DRKKNVRRCFSQGENTSTA-PISVSNQGRGASGHDGRSVKVVLLDNQDIHKFGSGKGSSL  957
             DRKK++R+  SQGE  S+A P +V  Q + A G D RSVK+V +DNQ I K  SGKGS+L
Sbjct  154   DRKKSIRKRPSQGEYCSSASPTAVLLQNK-APGLDTRSVKLVAVDNQSIQKVVSGKGSAL  212

Query  958   KRHINIGANSTSCKADSSLLKTARHRRKI-GAT-AAYKRWEKAAIAGVSLVADAAEHLER  1131
             KR++N G N ++ K  SS  KT R RRK  GA+ AAYKRWEKAA+AGVSLVADAAEHLER
Sbjct  213   KRNVNTGINRSNNKCHSSTSKTGRQRRKTAGASPAAYKRWEKAAMAGVSLVADAAEHLER  272

Query  1132  TTTDKEDGHFQDSNVR-------NVFEHSGKDPHVFPDLLHNS----FNETNLQNSGKLK  1278
             +TT+K+D   + + ++             G    V P L  ++      ++  Q S KLK
Sbjct  273   STTNKKDCTEEGTLIKPFPGPVDPANAQKGDPVGVRPPLSMSTSVQQLTDSGAQQSLKLK  332

Query  1279  LQLFPVDDGTRRALELDNHNPYLELTLSTRKKMSSVLEHLNRKWGNSSMACGDLMLFPYH  1458
             LQLFP+D+ TRRALE D HNP+LELTLS RKK+SSVLEHLNRKWGNS +A GDL+LFPY 
Sbjct  333   LQLFPIDEVTRRALEKDEHNPHLELTLSARKKISSVLEHLNRKWGNSGIASGDLILFPYS  392

Query  1459  LHKENLVHFQKWTKDTTLTAADVYALTGSPPVFRLRYGWFSNA--EVAFRAPVSSAIPSR  1632
             + +ENL+ + +W +DT  +AADVYA+ GSPPVFRLRYGWFS+   E   RA  S  I  +
Sbjct  393   VQRENLMGYPRWKQDTVASAADVYAMIGSPPVFRLRYGWFSSTDLESICRASSSYHIQEQ  452

Query  1633  HDA-NMNIMPESSVGVLQAPST-----------------------------DPPKEANGC  1722
             H + N + + ES+   L   ST                             D  ++  GC
Sbjct  453   HTSINRSNIKESTDATLPILSTCHHSEHLLDCFKDRVTLMTESSLILPLHADCCEDVIGC  512

Query  1723  VSMNTVNASRSSDHTEAVLWENPETVVTEA--EVDDLQFNKAGTSCV-GEWADSLTNISV  1893
                  ++   SS ++  +  E    +V     E+D+L+ +   T+ + GEWAD LTNIS+
Sbjct  513   AEDQEISLPVSSANSSWLKKEIGGGIVKGQWEEMDNLRMSNNSTALLAGEWADGLTNISI  572

Query  1894  GDLLSEAPDMEDANCITSSIHSSSNYIHQIPFSCDSFDAAIAAHIKKHQNVTDSQAALPS  2073
             GDLLSEA    D NC+      SS Y  QIPFSCDSFDAAIAAHI  HQ   + ++A  S
Sbjct  573   GDLLSEASRAADNNCVDPHSLGSSQYFQQIPFSCDSFDAAIAAHIAAHQEKLNLKSAQVS  632

Query  2074  QLSSIWGAEDTCDAFAFQRH-SLSEKVQNASKHTSLETCKQITLANTTALGASVEDLPGA  2250
               +S+W AE+T DAF+FQ+  +  ++V++ S+H S  TCKQI+  ++ +L A +E+LP  
Sbjct  633   HATSLWDAEETRDAFSFQKMPTFDQEVRSPSQHASFGTCKQISCTSSMSLRALIEELPEV  692

Query  2251  RNPVDGDAATA----DLESVHYSPTS-----------------DVVKDFNGLSDVYWPDS  2367
             R P+D  A       D +S  YSP +                 +   DF+ L+D+YWPDS
Sbjct  693   R-PIDDSACEGDSVDDCQSDAYSPDNSPKGLSPENSSKDLSPKNSANDFSELTDIYWPDS  751

Query  2368  LGPLDLDIPSSR-YHSELILSDSL--GGLTQLIASSLDAFQNCSFFGADKKEPVSTTEA  2535
             LGPLDLD+PSSR Y  +LI  DS+   GL + +ASSLD FQN S FG DKKE  ST E 
Sbjct  752   LGPLDLDVPSSRCYKQDLIFGDSVSFSGLNRFLASSLDTFQN-SLFGFDKKELPSTDEV  809



>ref|XP_010253971.1| PREDICTED: TSL-kinase interacting protein 1-like isoform X1 [Nelumbo 
nucifera]
Length=828

 Score =   687 bits (1772),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 406/779 (52%), Positives = 509/779 (65%), Gaps = 77/779 (10%)
 Frame = +1

Query  421   ALQQPVKRQTRKWAAWTREEEESFFSALRHVGKNFEKITSRVQSKNKDQVRHYYYRLVRR  600
             A QQPVK+QTR+WAAWTR+EEESFF+ALR VGKNFEKIT RVQSKNKDQVRHYYYRLVRR
Sbjct  38    APQQPVKKQTRQWAAWTRQEEESFFNALRQVGKNFEKITCRVQSKNKDQVRHYYYRLVRR  97

Query  601   MNKLLGPELCLNAKNSRDTNAAMLRWWSLLEKYSCKASKLHLKPRRFKIFIETLENQLLK  780
             MNKLL P   L+AKNS+DT AAMLRWWSLLEKYSCKASKLHLKPRR K+F+E LE+QLLK
Sbjct  98    MNKLLSPGFSLDAKNSKDTIAAMLRWWSLLEKYSCKASKLHLKPRRLKLFVEALEHQLLK  157

Query  781   DRKKNVRRCFSQGENTSTA-PISVSNQGRGASGHDGRSVKVVLLDNQDIHKFGSGKGSSL  957
             DRKK++R+  SQGE  S+A P +V  Q + A G D RSVK+V +DNQ I K  SGKGS+L
Sbjct  158   DRKKSIRKRPSQGEYCSSASPTAVLLQNK-APGLDTRSVKLVAVDNQSIQKVVSGKGSAL  216

Query  958   KRHINIGANSTSCKADSSLLKTARHRRKI-GAT-AAYKRWEKAAIAGVSLVADAAEHLER  1131
             KR++N G N ++ K  SS  KT R RRK  GA+ AAYKRWEKAA+AGVSLVADAAEHLER
Sbjct  217   KRNVNTGINRSNNKCHSSTSKTGRQRRKTAGASPAAYKRWEKAAMAGVSLVADAAEHLER  276

Query  1132  TTTDKEDGHFQDSNVR-------NVFEHSGKDPHVFPDLLHNS----FNETNLQNSGKLK  1278
             +TT+K+D   + + ++             G    V P L  ++      ++  Q S KLK
Sbjct  277   STTNKKDCTEEGTLIKPFPGPVDPANAQKGDPVGVRPPLSMSTSVQQLTDSGAQQSLKLK  336

Query  1279  LQLFPVDDGTRRALELDNHNPYLELTLSTRKKMSSVLEHLNRKWGNSSMACGDLMLFPYH  1458
             LQLFP+D+ TRRALE D HNP+LELTLS RKK+SSVLEHLNRKWGNS +A GDL+LFPY 
Sbjct  337   LQLFPIDEVTRRALEKDEHNPHLELTLSARKKISSVLEHLNRKWGNSGIASGDLILFPYS  396

Query  1459  LHKENLVHFQKWTKDTTLTAADVYALTGSPPVFRLRYGWFSNA--EVAFRAPVSSAIPSR  1632
             + +ENL+ + +W +DT  +AADVYA+ GSPPVFRLRYGWFS+   E   RA  S  I  +
Sbjct  397   VQRENLMGYPRWKQDTVASAADVYAMIGSPPVFRLRYGWFSSTDLESICRASSSYHIQEQ  456

Query  1633  HDA-NMNIMPESSVGVLQAPST-----------------------------DPPKEANGC  1722
             H + N + + ES+   L   ST                             D  ++  GC
Sbjct  457   HTSINRSNIKESTDATLPILSTCHHSEHLLDCFKDRVTLMTESSLILPLHADCCEDVIGC  516

Query  1723  VSMNTVNASRSSDHTEAVLWENPETVVTEA--EVDDLQFNKAGTSCV-GEWADSLTNISV  1893
                  ++   SS ++  +  E    +V     E+D+L+ +   T+ + GEWAD LTNIS+
Sbjct  517   AEDQEISLPVSSANSSWLKKEIGGGIVKGQWEEMDNLRMSNNSTALLAGEWADGLTNISI  576

Query  1894  GDLLSEAPDMEDANCITSSIHSSSNYIHQIPFSCDSFDAAIAAHIKKHQNVTDSQAALPS  2073
             GDLLSEA    D NC+      SS Y  QIPFSCDSFDAAIAAHI  HQ   + ++A  S
Sbjct  577   GDLLSEASRAADNNCVDPHSLGSSQYFQQIPFSCDSFDAAIAAHIAAHQEKLNLKSAQVS  636

Query  2074  QLSSIWGAEDTCDAFAFQRH-SLSEKVQNASKHTSLETCKQITLANTTALGASVEDLPGA  2250
               +S+W AE+T DAF+FQ+  +  ++V++ S+H S  TCKQI+  ++ +L A +E+LP  
Sbjct  637   HATSLWDAEETRDAFSFQKMPTFDQEVRSPSQHASFGTCKQISCTSSMSLRALIEELPEV  696

Query  2251  RNPVDGDAATA----DLESVHYSPTS-----------------DVVKDFNGLSDVYWPDS  2367
             R P+D  A       D +S  YSP +                 +   DF+ L+D+YWPDS
Sbjct  697   R-PIDDSACEGDSVDDCQSDAYSPDNSPKGLSPENSSKDLSPKNSANDFSELTDIYWPDS  755

Query  2368  LGPLDLDIPSSR-YHSELILSDSL--GGLTQLIASSLDAFQNCSFFGADKKEPVSTTEA  2535
             LGPLDLD+PSSR Y  +LI  DS+   GL + +ASSLD FQN S FG DKKE  ST E 
Sbjct  756   LGPLDLDVPSSRCYKQDLIFGDSVSFSGLNRFLASSLDTFQN-SLFGFDKKELPSTDEV  813



>ref|XP_006428403.1| hypothetical protein CICLE_v10011099mg [Citrus clementina]
 gb|ESR41643.1| hypothetical protein CICLE_v10011099mg [Citrus clementina]
Length=697

 Score =   671 bits (1730),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 374/696 (54%), Positives = 465/696 (67%), Gaps = 61/696 (9%)
 Frame = +1

Query  601   MNKLLGPELCLNAKNSRDTNAAMLRWWSLLEKYSCKASKLHLKPRRFKIFIETLENQLLK  780
             MNKLLGP LCL+AKNS+DTNAAMLRWWSLLEKYSCKASKLHLKPRRFKIF+E LE+QLLK
Sbjct  1     MNKLLGPGLCLDAKNSKDTNAAMLRWWSLLEKYSCKASKLHLKPRRFKIFVEALEHQLLK  60

Query  781   DRKKNVRRCFSQGENTS-TAPISVSNQGRGASGHDGRSVKVVLLDNQDIHKFGSGKGSSL  957
             DRK++VR+  SQ ++ S TAP  + NQ R  SG D  +VK+VL+D+Q+I K G  KGS L
Sbjct  61    DRKRSVRKRPSQRDSYSPTAPTPIPNQSR-TSGQDTCTVKLVLVDSQNIQKLGPAKGS-L  118

Query  958   KRHINIGANSTSCKADSSLLKTARHRRKIGA--TAAYKRWEKAAIAGVSLVADAAEHLER  1131
             KR++NIG N ++ KADS+ LK  R RRK  +  +AAYK+WEKAAIAGVSLVADAAEHLER
Sbjct  119   KRNVNIGINRSNNKADSATLK-PRQRRKPDSISSAAYKKWEKAAIAGVSLVADAAEHLER  177

Query  1132  TTTDKEDGHFQDSNVRNVFEHSGKDPHVFPDLLHNSFNETNLQNSGKLKLQLFPVDDGTR  1311
             T+TDKE    Q+       E + K     P +    F E N+Q   KLKLQL+P+DDGTR
Sbjct  178   TSTDKEVERQQE---HTALETADKVLPPLPTISPTLFAEGNVQTPVKLKLQLYPIDDGTR  234

Query  1312  RALELDNHNPYLELTLSTRKKMSSVLEHLNRKWGNSSMACGDLMLFPYHLHKENLVHFQK  1491
             +ALE+DNHNP+LELTLSTRKK+SSVLEHLNRKWGN+S+A G+LMLFPY   +ENLV +Q+
Sbjct  235   KALEMDNHNPHLELTLSTRKKISSVLEHLNRKWGNASVASGELMLFPYGAQRENLVGYQR  294

Query  1492  WTKDTTLTAADVYALTGSPPVFRLRYGWFSNAEVAFRAP----VSSAIPSRHDANMNIMP  1659
             WT+D+  +AADVYA+ GSPP+FRLRYGWFS+ E+ + AP     S  +PS H+ N+    
Sbjct  295   WTQDSVFSAADVYAMIGSPPMFRLRYGWFSDTELGYVAPHAPSASGCVPSFHNINVENKK  354

Query  1660  ESSVGVL--QAPST--------DP--------------------PKEANGCVSMNTVNAS  1749
             E  V  +  + PST        DP                    PKE +  +S +  + +
Sbjct  355   EQIVDSVPGRVPSTSDQSENFVDPYKKLTSVKENDTFATSSSSMPKETSSYISTSKCDIA  414

Query  1750  RSSDHTEAVLWENPET----VVTEAE-VDDLQFNKAGTSCVGEWADSLTNISVGDLLSEA  1914
              +SD    V W   ET    +  +AE + D + +       GEWADSLTNISVGDLL+E 
Sbjct  415   DTSDPAANVSWPRKETGNEIITGQAEDMGDERLSSGTALSAGEWADSLTNISVGDLLAEV  474

Query  1915  PDMEDANCITSSIHSSSNYIHQIPFSCDSFDAAIAAHIKKHQNVTDSQAALPSQLSSIWG  2094
             P   DA    + +  SS  + QIPFSCDSFDAAIAAHI +HQN   + + L S  SSIW 
Sbjct  475   PHDLDA----APVAESSQCLQQIPFSCDSFDAAIAAHISRHQNKMGALSTLASHASSIWD  530

Query  2095  AEDTCDAFAFQRHSLSEKVQNASKHTSLET----CKQITLANTTALGASVEDLPGARNPV  2262
             AE+TCDAF+FQ++ +       S+   +      C+QI   N+   G   E+L  A  P 
Sbjct  531   AEETCDAFSFQKNPV--LCNGVSRLPDIAPPAADCEQIARTNSVGSGGFFEELLDAEGPT  588

Query  2263  DGDAATADLESVHYSPTS--DVVKDFNGLSDVYWPDSLGPLDLDIPSSRYHSE-LILSDS  2433
             D  A    ++    +P +  + V DFNGL+D+YWPDSLGPLDLDIPSS+Y  E +ILSDS
Sbjct  589   DYPAHEDPMDDCLRNPHTLDNSVNDFNGLTDIYWPDSLGPLDLDIPSSKYRGEDIILSDS  648

Query  2434  LGGLTQLIASSLDAFQNCSFFGADKKEPVSTTEAQE  2541
             LGGL +LIASSLDAFQNCSFFG DKKEP  T EA E
Sbjct  649   LGGLNRLIASSLDAFQNCSFFGLDKKEPTPTVEAGE  684



>ref|XP_006428405.1| hypothetical protein CICLE_v10011099mg [Citrus clementina]
 gb|ESR41645.1| hypothetical protein CICLE_v10011099mg [Citrus clementina]
Length=689

 Score =   664 bits (1712),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 375/695 (54%), Positives = 463/695 (67%), Gaps = 67/695 (10%)
 Frame = +1

Query  601   MNKLLGPELCLNAKNSRDTNAAMLRWWSLLEKYSCKASKLHLKPRRFKIFIETLENQLLK  780
             MNKLLGP LCL+AKNS+DTNAAMLRWWSLLEKYSCKASKLHLKPRRFKIF+E LE+QLLK
Sbjct  1     MNKLLGPGLCLDAKNSKDTNAAMLRWWSLLEKYSCKASKLHLKPRRFKIFVEALEHQLLK  60

Query  781   DRKKNVRRCFSQGENTS-TAPISVSNQGRGASGHDGRSVKVVLLDNQDIHKFGSGKGSSL  957
             DRK++VR+  SQ ++ S TAP  + NQ R  SG D  +VK+VL+D+Q+I K G  KGS L
Sbjct  61    DRKRSVRKRPSQRDSYSPTAPTPIPNQSR-TSGQDTCTVKLVLVDSQNIQKLGPAKGS-L  118

Query  958   KRHINIGANSTSCKADSSLLKTARHRRKIGA--TAAYKRWEKAAIAGVSLVADAAEHLER  1131
             KR++NIG N ++ KADS+ LK  R RRK  +  +AAYK+WEKAAIAGVSLVADAAEHLER
Sbjct  119   KRNVNIGINRSNNKADSATLK-PRQRRKPDSISSAAYKKWEKAAIAGVSLVADAAEHLER  177

Query  1132  TTTDKEDGHFQDSNVRNVFEHSGKDPHVFPDLLHNSFNETNLQNSGKLKLQLFPVDDGTR  1311
             T+TDKE    Q+       E + K     P +    F E N+Q   KLKLQL+P+DDGTR
Sbjct  178   TSTDKEVERQQE---HTALETADKVLPPLPTISPTLFAEGNVQTPVKLKLQLYPIDDGTR  234

Query  1312  RALELDNHNPYLELTLSTRKKMSSVLEHLNRKWGNSSMACGDLMLFPYHLHKENLVHFQK  1491
             +ALE+DNHNP+LELTLSTRKK+SSVLEHLNRKWGN+S+A G+LMLFPY   +ENLV +Q+
Sbjct  235   KALEMDNHNPHLELTLSTRKKISSVLEHLNRKWGNASVASGELMLFPYGAQRENLVGYQR  294

Query  1492  WTKDTTLTAADVYALTGSPPVFRLRYGWFSNAEVAFRAP----VSSAIPSRHDANMNIMP  1659
             WT+D+  +AADVYA+ GSPP+FRLRYGWFS+ E+ + AP     S  +PS H+ N+    
Sbjct  295   WTQDSVFSAADVYAMIGSPPMFRLRYGWFSDTELGYVAPHAPSASGCVPSFHNINVENKK  354

Query  1660  ESSVGVL--QAPST--------DP--------------------PKEANGCVSMNTVNAS  1749
             E  V  +  + PST        DP                    PKE +  +S +  + +
Sbjct  355   EQIVDSVPGRVPSTSDQSENFVDPYKKLTSVKENDTFATSSSSMPKETSSYISTSKCDIA  414

Query  1750  RSSDHTEAVLWENPET----VVTEAE-VDDLQFNKAGTSCVGEWADSLTNISVGDLLSEA  1914
              +SD    V W   ET    +  +AE + D + +       GEWADSLTNISVGDLL+E 
Sbjct  415   DTSDPAANVSWPRKETGNEIITGQAEDMGDERLSSGTALSAGEWADSLTNISVGDLLAEV  474

Query  1915  PDMEDANCITSSIHSSSNYIHQIPFSCDSFDAAIAAHIKKHQNVTDSQAALPSQLSSIWG  2094
             P   DA    + +  SS  + QIPFSCDSFDAAIAAHI +HQN   + + L S  SSIW 
Sbjct  475   PHDLDA----APVAESSQCLQQIPFSCDSFDAAIAAHISRHQNKMGALSTLASHASSIWD  530

Query  2095  AEDTCDAFAFQRHSLSEKVQNASKHTSLET----CKQITLANTTALGA-SVEDLPGARNP  2259
             AE+TCDAF+FQ++ +       S+   +      C+QI   N+  L A    D P   +P
Sbjct  531   AEETCDAFSFQKNPV--LCNGVSRLPDIAPPAADCEQIARTNSELLDAEGPTDYPAHEDP  588

Query  2260  VDGDAATADLESVHYSPTSDVVKDFNGLSDVYWPDSLGPLDLDIPSSRYHSE-LILSDSL  2436
             +D       L + H    S  V DFNGL+D+YWPDSLGPLDLDIPSS+Y  E +ILSDSL
Sbjct  589   MDD-----CLRNPHTLDNS--VNDFNGLTDIYWPDSLGPLDLDIPSSKYRGEDIILSDSL  641

Query  2437  GGLTQLIASSLDAFQNCSFFGADKKEPVSTTEAQE  2541
             GGL +LIASSLDAFQNCSFFG DKKEP  T EA E
Sbjct  642   GGLNRLIASSLDAFQNCSFFGLDKKEPTPTVEAGE  676



>ref|XP_010529729.1| PREDICTED: TSL-kinase interacting protein 1 isoform X2 [Tarenaya 
hassleriana]
Length=769

 Score =   656 bits (1693),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 388/780 (50%), Positives = 494/780 (63%), Gaps = 68/780 (9%)
 Frame = +1

Query  313   VEQQIASSQEHAIPEQAMFSQDHSVTEQLASFEEHSALQQP-VKRQTRKWAAWTREEEES  489
             VE Q+  +    + +  + +QD + +   A+    + +Q P  K+ TR+WAAWT +EEES
Sbjct  3     VEPQVLLNAASPLDQGPLLNQDGNPS--FAASTATNVVQLPGAKKPTRQWAAWTHQEEES  60

Query  490   FFSALRHVGKNFEKITSRVQSKNKDQVRHYYYRLVRRMNKLLGPELCLNAKNSRDTNAAM  669
             FF+ALR VGKNFEKITSRVQSKNKDQVRHYYYRLVRRMNKLLGPEL L+AKN +DTNAAM
Sbjct  61    FFTALRQVGKNFEKITSRVQSKNKDQVRHYYYRLVRRMNKLLGPELSLDAKNPKDTNAAM  120

Query  670   LRWWSLLEKYSCKASKLHLKPRRFKIFIETLENQLLKDRKKNVRRCFSQGENTSTAPI-S  846
             LRWWSLLEKYSCKASKLHLKPRRFK+FIE+LE+QLLKDRKK++R+   QGEN S A + S
Sbjct  121   LRWWSLLEKYSCKASKLHLKPRRFKLFIESLEHQLLKDRKKSIRKRVCQGENFSAASLGS  180

Query  847   VSNQGRGASGHDGRSVKVVLLDNQDIHKFGSGKGSSLKRHINIGANSTSCKADSSLLKTA  1026
              SNQ R   G D RS+K++L+D+Q+I K G G+ S +    ++G +    K D +  +  
Sbjct  181   FSNQSR-ERGVDNRSLKLILVDSQNIQKLGPGRASIIHSE-SLGISHGDEKEDIAASRGG  238

Query  1027  RHRRKIG--ATAAYKRWEKAAIAGVSLVADAAEHLERTTTDKEDGHFQDSNVRNVFEHS-  1197
             R RRK G  ++ AY+RWEKAAI GVSLVADAAEHLER + DK     +DS      EH  
Sbjct  239   RQRRKQGLSSSPAYRRWEKAAINGVSLVADAAEHLERASIDKNIDCRKDSGPS---EHQS  295

Query  1198  -GKDPHVFPDLLHNSFNETNLQNSGKLKLQLFPVDDGTRRALELDNHNPYLELTLSTRKK  1374
              GK         HN  NETN+Q++ KLKLQLFP+D+ TRRALE   HNP+LELTLS RKK
Sbjct  296   IGKSLLSLGSSDHNPLNETNMQSATKLKLQLFPIDECTRRALETGKHNPHLELTLSNRKK  355

Query  1375  MSSVLEHLNRKWGNSSMACGDLMLFPYHLHKENLVHFQKWTKDTTLTAADVYALTGSPPV  1554
             +SSVLEHLNRKWGNSS A GDLMLFPY   KE ++  Q+WT+D+ L+A DV+++ GSP V
Sbjct  356   ISSVLEHLNRKWGNSSAASGDLMLFPYSARKETVMSHQRWTQDSFLSAGDVHSMVGSPSV  415

Query  1555  FRLRYGWFSNA---EVAFRAPVS-SAIPSRHDANMNI----MPESSVGVLQAP-----ST  1695
             FRLRYGWF  +    +  +AP+S S +    D N++     + ES+   L +      S 
Sbjct  416   FRLRYGWFIRSAWGSLTSQAPISASCLQVEQDMNVDEVIGHVAESAPLSLHSTAEPSRSL  475

Query  1696  DPPKEANGCVSMNTVNASRSSDHTEAVLWENPE--------TVVTEAEVDDLQFNKAGTS  1851
             +P +   G  S    + + S ++ E +    P         +   + + DDL        
Sbjct  476   EPSQSVAGPSSEILAHRAESRENLEQISASGPHNEKETGNMSSSDQIDNDDLHVGNDNAL  535

Query  1852  CVGEWADSLTNISV--------GDLLSEAPDMEDANCITSSIHSSSNYIHQIPFSCDSFD  2007
               GEWADSLTNIS+        GDLLSEAPD  D++C    +  +   +  +PF+ DSFD
Sbjct  536   SAGEWADSLTNISIGDLLSEAPGDLLSEAPDNIDSDCADPQVEDTECLLQDVPFASDSFD  595

Query  2008  AAIAAHIKKHQNVTDSQAALPSQLSSIWGAEDTCDAFAFQRHSLSEKVQNASKHTSLETC  2187
             AAIAAHI +H N   +   LPS    +W  E+T D F+FQ + L+    NAS        
Sbjct  596   AAIAAHILRHHNEIGASLTLPSGSCLLWDDEETRDTFSFQNNRLA----NAS------LS  645

Query  2188  KQITLANTTALGA----SVEDLPGARNPVDGDAATADLES-VHYSPTSDVVKD------F  2334
                +   T+ L A    SVE LP    P    + +ADLE  +  +P      D       
Sbjct  646   AVASPVGTSKLNAEPSHSVEGLPEPDLP----SKSADLEDPMEEAPIEPNTADSPERTTL  701

Query  2335  NGLSDVYWPDSLGPLDLDIPSSRYHSE-LILSDSLGGLTQLIASSLDAFQNCSFFGADKK  2511
              GL+DVYWPDSLGPLDLDI SS+Y +E LILSDSLGGL++LIASSLDAFQNCS FG++ K
Sbjct  702   CGLADVYWPDSLGPLDLDIRSSKYSNEDLILSDSLGGLSRLIASSLDAFQNCSIFGSENK  761



>ref|XP_010529705.1| PREDICTED: TSL-kinase interacting protein 1 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010529713.1| PREDICTED: TSL-kinase interacting protein 1 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010529721.1| PREDICTED: TSL-kinase interacting protein 1 isoform X1 [Tarenaya 
hassleriana]
Length=770

 Score =   655 bits (1689),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 387/781 (50%), Positives = 494/781 (63%), Gaps = 69/781 (9%)
 Frame = +1

Query  313   VEQQIASSQEHAIPEQAMFSQDHSVTEQLASFEEHSALQQP-VKRQTRKWAAWTREEEES  489
             VE Q+  +    + +  + +QD + +   A+    + +Q P  K+ TR+WAAWT +EEES
Sbjct  3     VEPQVLLNAASPLDQGPLLNQDGNPS--FAASTATNVVQLPGAKKPTRQWAAWTHQEEES  60

Query  490   FFSALRHVGKNFEKITSRVQSKNKDQVRHYYYRLVRRMNKLLGPELCLNAKNSRDTNAAM  669
             FF+ALR VGKNFEKITSRVQSKNKDQVRHYYYRLVRRMNKLLGPEL L+AKN +DTNAAM
Sbjct  61    FFTALRQVGKNFEKITSRVQSKNKDQVRHYYYRLVRRMNKLLGPELSLDAKNPKDTNAAM  120

Query  670   LRWWSLLEKYSCKASKLHLKPRRFKIFIETLENQLLKDRKKNVRRCFSQGENTSTAPI-S  846
             LRWWSLLEKYSCKASKLHLKPRRFK+FIE+LE+QLLKDRKK++R+   QGEN S A + S
Sbjct  121   LRWWSLLEKYSCKASKLHLKPRRFKLFIESLEHQLLKDRKKSIRKRVCQGENFSAASLGS  180

Query  847   VSNQGRGASGHDGRSVKVVLLDNQDIHKFGSGKGSSLKRHINIGANSTSCKADSSLLKTA  1026
              SNQ R   G D RS+K++L+D+Q+I K G G+ S +    ++G +    K D +  +  
Sbjct  181   FSNQSR-ERGVDNRSLKLILVDSQNIQKLGPGRASIIHSE-SLGISHGDEKEDIAASRGG  238

Query  1027  RHRRK---IGATAAYKRWEKAAIAGVSLVADAAEHLERTTTDKEDGHFQDSNVRNVFEHS  1197
             R RRK   + ++ AY+RWEKAAI GVSLVADAAEHLER + DK     +DS      EH 
Sbjct  239   RQRRKQAGLSSSPAYRRWEKAAINGVSLVADAAEHLERASIDKNIDCRKDSGPS---EHQ  295

Query  1198  --GKDPHVFPDLLHNSFNETNLQNSGKLKLQLFPVDDGTRRALELDNHNPYLELTLSTRK  1371
               GK         HN  NETN+Q++ KLKLQLFP+D+ TRRALE   HNP+LELTLS RK
Sbjct  296   SIGKSLLSLGSSDHNPLNETNMQSATKLKLQLFPIDECTRRALETGKHNPHLELTLSNRK  355

Query  1372  KMSSVLEHLNRKWGNSSMACGDLMLFPYHLHKENLVHFQKWTKDTTLTAADVYALTGSPP  1551
             K+SSVLEHLNRKWGNSS A GDLMLFPY   KE ++  Q+WT+D+ L+A DV+++ GSP 
Sbjct  356   KISSVLEHLNRKWGNSSAASGDLMLFPYSARKETVMSHQRWTQDSFLSAGDVHSMVGSPS  415

Query  1552  VFRLRYGWFSNA---EVAFRAPVS-SAIPSRHDANMNI----MPESSVGVLQAP-----S  1692
             VFRLRYGWF  +    +  +AP+S S +    D N++     + ES+   L +      S
Sbjct  416   VFRLRYGWFIRSAWGSLTSQAPISASCLQVEQDMNVDEVIGHVAESAPLSLHSTAEPSRS  475

Query  1693  TDPPKEANGCVSMNTVNASRSSDHTEAVLWENPE--------TVVTEAEVDDLQFNKAGT  1848
              +P +   G  S    + + S ++ E +    P         +   + + DDL       
Sbjct  476   LEPSQSVAGPSSEILAHRAESRENLEQISASGPHNEKETGNMSSSDQIDNDDLHVGNDNA  535

Query  1849  SCVGEWADSLTNISV--------GDLLSEAPDMEDANCITSSIHSSSNYIHQIPFSCDSF  2004
                GEWADSLTNIS+        GDLLSEAPD  D++C    +  +   +  +PF+ DSF
Sbjct  536   LSAGEWADSLTNISIGDLLSEAPGDLLSEAPDNIDSDCADPQVEDTECLLQDVPFASDSF  595

Query  2005  DAAIAAHIKKHQNVTDSQAALPSQLSSIWGAEDTCDAFAFQRHSLSEKVQNASKHTSLET  2184
             DAAIAAHI +H N   +   LPS    +W  E+T D F+FQ + L+    NAS       
Sbjct  596   DAAIAAHILRHHNEIGASLTLPSGSCLLWDDEETRDTFSFQNNRLA----NAS------L  645

Query  2185  CKQITLANTTALGA----SVEDLPGARNPVDGDAATADLES-VHYSPTSDVVKD------  2331
                 +   T+ L A    SVE LP    P    + +ADLE  +  +P      D      
Sbjct  646   SAVASPVGTSKLNAEPSHSVEGLPEPDLP----SKSADLEDPMEEAPIEPNTADSPERTT  701

Query  2332  FNGLSDVYWPDSLGPLDLDIPSSRYHSE-LILSDSLGGLTQLIASSLDAFQNCSFFGADK  2508
               GL+DVYWPDSLGPLDLDI SS+Y +E LILSDSLGGL++LIASSLDAFQNCS FG++ 
Sbjct  702   LCGLADVYWPDSLGPLDLDIRSSKYSNEDLILSDSLGGLSRLIASSLDAFQNCSIFGSEN  761

Query  2509  K  2511
             K
Sbjct  762   K  762



>ref|XP_010684064.1| PREDICTED: TSL-kinase interacting protein 1 [Beta vulgaris subsp. 
vulgaris]
 ref|XP_010684065.1| PREDICTED: TSL-kinase interacting protein 1 [Beta vulgaris subsp. 
vulgaris]
Length=793

 Score =   654 bits (1686),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 364/744 (49%), Positives = 476/744 (64%), Gaps = 65/744 (9%)
 Frame = +1

Query  430   QPVKRQTRKWAAWTREEEESFFSALRHVGKNFEKITSRVQSKNKDQVRHYYYRLVRRMNK  609
             QP KR TR+WAAWTREEEESFF+ALR VGKNFEKIT RVQSKNKDQVRHYYYRLVRRMNK
Sbjct  41    QPAKRPTRQWAAWTREEEESFFTALRQVGKNFEKITCRVQSKNKDQVRHYYYRLVRRMNK  100

Query  610   LLGPELCLNAKNSRDTNAAMLRWWSLLEKYSCKASKLHLKPRRFKIFIETLENQLLKDRK  789
             LLGP+L L+AKNS+DTNAAMLRWWSLLEKYSCKASKLHLKPRRFKIFIE LE+QL KDRK
Sbjct  101   LLGPDLSLDAKNSKDTNAAMLRWWSLLEKYSCKASKLHLKPRRFKIFIEALEHQLTKDRK  160

Query  790   KNVRRCFSQGENTSTAPISVSNQGRGASGHDGRSVKVVLLDNQDIHKFGSGKGSSLKRHI  969
             KNV +    GEN S    + ++     SG+D R+VK+V++D+Q++ K G G+GSS +R+ 
Sbjct  161   KNVNKRMPLGENYSPPSSTTTSNQIKLSGNDARAVKIVVVDSQNVQKAGQGRGSSARRNP  220

Query  970   NIGANSTSCKADSSLLKTARHRRKIGA--TAAYKRWEKAAIAGVSLVADAAEHLERTTTD  1143
             N+G   +  K +SS  K  R RRK GA   AA KRWEKAA+AGVSLVADAAEHLERT   
Sbjct  221   NMGVIRSISKGESSHPKPPRQRRKTGAASAAAMKRWEKAAMAGVSLVADAAEHLERTAEQ  280

Query  1144  KEDGHFQDSNVRNVFEHSGKDPHVFPDLLHNSFNETNLQNSGKLKLQLFPVDDGTRRALE  1323
              + G           +  G  P++   +      E NLQ   KLKLQLFP+D+ TR+ALE
Sbjct  281   IDSGP--------SMQVQGNSPNLSKGIAV----EDNLQPILKLKLQLFPIDESTRKALE  328

Query  1324  LDNHNPYLELTLSTRKKMSSVLEHLNRKWGNSSMACGDLMLFPYHLHKENLVHFQKWTKD  1503
             +D HNP+LELTLS+RKK+SS+LEHL+RKWG SS+A G+LMLFP+ + +ENL+ +Q+W+++
Sbjct  329   MDKHNPHLELTLSSRKKISSILEHLDRKWGTSSVASGELMLFPFSIQRENLLGYQRWSRE  388

Query  1504  TTLTAADVYALTGSPPVFRLRYGWFSNAEVAFRAPVSSAIPSRHDANMNIMPESSVGVLQ  1683
             + +TAA+VY++ GSP VFRLRYGW S+ E+   +  + ++ S H +        ++    
Sbjct  389   SVVTAAEVYSMIGSPLVFRLRYGWISSNELQSGSSQTISVASSHYSEQENRRNQTLMEQL  448

Query  1684  APSTDPPKEANGCVSMNTVNASRSSDHTEAVLWENPETVVTEA----EVD------DLQ-  1830
              P T+   +    V  + ++  ++SD   + L E+      EA    ++D      ++Q 
Sbjct  449   CPPTEVEDKLEKLVD-HMLSEHQTSDKQNSSLKESTAATSGEANKNSDIDFHNDAFEMQN  507

Query  1831  -----FNKAGTSCVG-----------------------EWADSLTNISVGDLLSEAPDME  1926
                  F+K   +CV                        EWAD +TN + G   +E  D+ 
Sbjct  508   LVSSVFSKRIEACVDSTLTNMKNVVGQRAIKNPSWSTREWADRVTNATAGKQSTEVSDVM  567

Query  1927  DANCITSSIHSSSNYIHQIPFSCDSFDAAIAAHIKKHQNVTDSQAALPS-QLSSIWGAED  2103
             D +C   +    + ++ +IPF+CDSFDAAIAAHI     +     A PS  LSSIW AE+
Sbjct  568   DVDC-NETHFKDTEHVEEIPFTCDSFDAAIAAHIISQSKIG---FAGPSPHLSSIWDAEE  623

Query  2104  TCDAFAFQRHSLSEKVQNASKHTSLETCK---QITLANTTALGASVEDLPGARNPVDGDA  2274
             TCDAF+FQ   +S +V  ++   +        +  LA T+      +D   A N V  D 
Sbjct  624   TCDAFSFQNRVVSNQVPTSASAAASIAGAGPFRTNLAGTSTKVQDSQDRMMAENDVLVDT  683

Query  2275  ATADLESVHYSPTSDVVKDFNGLSDVYWPDSLGPLDLDIPSSRYHSE-LILSDSLGGLTQ  2451
                     H   +S   KDF+ L+D+YWPDSLGPL+LD+PS +Y+SE LILSDSL GL +
Sbjct  684   INECRSDAHEIESS--AKDFSSLTDIYWPDSLGPLELDVPSCKYYSEDLILSDSLSGLNR  741

Query  2452  LIASSLDAFQNCSFFGADKKEPVS  2523
             L+ASSLDAFQNCSFFG D+K P S
Sbjct  742   LLASSLDAFQNCSFFGLDEKRPPS  765



>ref|NP_850274.1| TSL-kinase interacting protein 1 [Arabidopsis thaliana]
 gb|AEC09327.1| TSL-kinase interacting protein 1 [Arabidopsis thaliana]
Length=741

 Score =   645 bits (1663),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 368/727 (51%), Positives = 471/727 (65%), Gaps = 61/727 (8%)
 Frame = +1

Query  418   SALQQPVKRQTRKWAAWTREEEESFFSALRHVGKNFEKITSRVQSKNKDQVRHYYYRLVR  597
             S  Q P K+ TR+WAAWT +EEESFF+ALR VGKNFEKITSRVQSKNKDQVRHYYYRLVR
Sbjct  42    SITQFPAKKPTRQWAAWTHQEEESFFTALRQVGKNFEKITSRVQSKNKDQVRHYYYRLVR  101

Query  598   RMNKLLGPELCLNAKNSRDTNAAMLRWWSLLEKYSCKASKLHLKPRRFKIFIETLENQLL  777
             RMNKLLGP+L L+AKN +DTNAAMLRWWSLLEKYSCKASKLHLKPRRFK+FIE LE+QLL
Sbjct  102   RMNKLLGPDLSLDAKNPKDTNAAMLRWWSLLEKYSCKASKLHLKPRRFKLFIEALEHQLL  161

Query  778   KDRKKNVRRCFSQGENTSTAPI-SVSNQGRGASGHDGRSVKVVLLDNQDIHKFGSGKGSS  954
             KDR+K++R+   QGEN S+A + ++S+  R   G D R  K++L D Q++ K G G+ S+
Sbjct  162   KDRRKSIRKRTCQGENLSSASLGNISSHSR-ERGLDNRPFKLILSDGQNVKKLGPGRAST  220

Query  955   LKRHINIGANSTSCKADSSLLKTARHRRKIGATAAYKRWEKAAIAGVSLVADAAEHLERT  1134
              K   ++  N    K D++  +  R RRK G    Y++WEKAAI GVSLVADAAEHLERT
Sbjct  221   -KHGESLSVNLGDEKEDTAFGRGGRQRRKQG----YRKWEKAAIDGVSLVADAAEHLERT  275

Query  1135  TTDKEDGHFQDSNVRNVFEHSGKDPHVFPDLLHNSFNETNLQNSGKLKLQLFPVDDGTRR  1314
             + DK+     D         +GK P           ++ N+Q S KLKLQLFP+D+ TRR
Sbjct  276   SIDKD----MDDQTGPTRYLTGKSPLSLCSAGDVPLSDANMQFSAKLKLQLFPIDECTRR  331

Query  1315  ALELDNHNPYLELTLSTRKKMSSVLEHLNRKWGNSSMACGDLMLFPYHLHKENLVHFQKW  1494
             +LE+D HNP+LELTLS RKK+SSVLEHLNRKWG+SS A G+L+LFPY+  KE +   Q+W
Sbjct  332   SLEMDKHNPHLELTLSNRKKISSVLEHLNRKWGSSSCATGELLLFPYNARKETVTCHQRW  391

Query  1495  TKDTTLTAADVYALTGSPPVFRLRYGWF---SNAEVAFRAPVSSAIPSRHDANMNI----  1653
             T D+ L+AA+V+++ GSP VFRLRYGWF   ++  +  + P S   PS  D +MN+    
Sbjct  392   THDSFLSAAEVHSMVGSPSVFRLRYGWFVHDASGSIISQVPTSDPCPSLED-DMNVDRLN  450

Query  1654  ---MPESSVGVLQAPSTD------PPKEANGCVSMNTVNASRSSDHTEAVLWENPETVVT  1806
                M  +  G L   ST        P +   C S      +RS D      +E   T +T
Sbjct  451   EVNMLLTESGPLSVHSTAEQTTSVEPSQGLVCASGVHDRPARSRDD-----YEPASTSIT  505

Query  1807  EAEVDDLQFNKAGTSCVGEWADSLTNISVGDLLSEAPDMEDANCITSSIHSSSNY-IHQI  1983
               E      +       GEWADSLTNIS+GDLLSE PD  D++ +       S+Y +  +
Sbjct  506   PLE----HLSGGNAQSPGEWADSLTNISIGDLLSEVPDDIDSDGVDPPATEGSHYLLRDV  561

Query  1984  PFSCDSFDAAIAAHIKKHQNVTDSQAALPSQLSSIWGAEDTCDAFAFQRHSLSEKVQNAS  2163
             PF+ DSFDAAIAAHI +HQN   +Q  L S  SS+W  E+T DAF+FQ++    +  N++
Sbjct  562   PFTSDSFDAAIAAHILRHQNKPSAQLPLTSGSSSLWDDEETRDAFSFQKN----RFANST  617

Query  2164  KHTSLETCKQITLAN---TTALGASVEDLPGARNPVD-------GDAATADLESVHYSPT  2313
             +  S+ + K +   N   +  + AS  D  G+ NP D       G A    ++S   +P 
Sbjct  618   ELASVASPKGVGRVNGEPSQLVEASSGD-EGSYNPHDDGDPMEEGPADPHTMDSPGKTPC  676

Query  2314  SDVVKDFNGLSDVYWPDSLGPLDLDIPSSRYHSELILSDSLGGLTQLIASSLDAFQNCSF  2493
                     GL+DVYWPDSLGPLDLDI SS+Y  +LILS+SLGGL++LIA+SLDAFQNCS 
Sbjct  677   --------GLADVYWPDSLGPLDLDIRSSKYTDDLILSESLGGLSRLIATSLDAFQNCSL  728

Query  2494  FGADKKE  2514
             FG D K+
Sbjct  729   FGFDNKK  735



>ref|NP_001189693.1| TSL-kinase interacting protein 1 [Arabidopsis thaliana]
 gb|AEC09328.1| TSL-kinase interacting protein 1 [Arabidopsis thaliana]
Length=744

 Score =   645 bits (1663),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 368/727 (51%), Positives = 471/727 (65%), Gaps = 58/727 (8%)
 Frame = +1

Query  418   SALQQPVKRQTRKWAAWTREEEESFFSALRHVGKNFEKITSRVQSKNKDQVRHYYYRLVR  597
             S  Q P K+ TR+WAAWT +EEESFF+ALR VGKNFEKITSRVQSKNKDQVRHYYYRLVR
Sbjct  42    SITQFPAKKPTRQWAAWTHQEEESFFTALRQVGKNFEKITSRVQSKNKDQVRHYYYRLVR  101

Query  598   RMNKLLGPELCLNAKNSRDTNAAMLRWWSLLEKYSCKASKLHLKPRRFKIFIETLENQLL  777
             RMNKLLGP+L L+AKN +DTNAAMLRWWSLLEKYSCKASKLHLKPRRFK+FIE LE+QLL
Sbjct  102   RMNKLLGPDLSLDAKNPKDTNAAMLRWWSLLEKYSCKASKLHLKPRRFKLFIEALEHQLL  161

Query  778   KDRKKNVRRCFSQGENTSTAPI-SVSNQGRGASGHDGRSVKVVLLDNQDIHKFGSGKGSS  954
             KDR+K++R+   QGEN S+A + ++S+  R   G D R  K++L D Q++ K G G+ S+
Sbjct  162   KDRRKSIRKRTCQGENLSSASLGNISSHSR-ERGLDNRPFKLILSDGQNVKKLGPGRAST  220

Query  955   LKRHINIGANSTSCKADSSLLKTARHRRKIGATAAYKRWEKAAIAGVSLVADAAEHLERT  1134
              K   ++  N    K D++  +  R RRK    A Y++WEKAAI GVSLVADAAEHLERT
Sbjct  221   -KHGESLSVNLGDEKEDTAFGRGGRQRRK---QAGYRKWEKAAIDGVSLVADAAEHLERT  276

Query  1135  TTDKEDGHFQDSNVRNVFEHSGKDPHVFPDLLHNSFNETNLQNSGKLKLQLFPVDDGTRR  1314
             + DK+     D         +GK P           ++ N+Q S KLKLQLFP+D+ TRR
Sbjct  277   SIDKDMDDQTDLGPTRYL--TGKSPLSLCSAGDVPLSDANMQFSAKLKLQLFPIDECTRR  334

Query  1315  ALELDNHNPYLELTLSTRKKMSSVLEHLNRKWGNSSMACGDLMLFPYHLHKENLVHFQKW  1494
             +LE+D HNP+LELTLS RKK+SSVLEHLNRKWG+SS A G+L+LFPY+  KE +   Q+W
Sbjct  335   SLEMDKHNPHLELTLSNRKKISSVLEHLNRKWGSSSCATGELLLFPYNARKETVTCHQRW  394

Query  1495  TKDTTLTAADVYALTGSPPVFRLRYGWF---SNAEVAFRAPVSSAIPSRHDANMNI----  1653
             T D+ L+AA+V+++ GSP VFRLRYGWF   ++  +  + P S   PS  D +MN+    
Sbjct  395   THDSFLSAAEVHSMVGSPSVFRLRYGWFVHDASGSIISQVPTSDPCPSLED-DMNVDRLN  453

Query  1654  ---MPESSVGVLQAPSTD------PPKEANGCVSMNTVNASRSSDHTEAVLWENPETVVT  1806
                M  +  G L   ST        P +   C S      +RS D      +E   T +T
Sbjct  454   EVNMLLTESGPLSVHSTAEQTTSVEPSQGLVCASGVHDRPARSRDD-----YEPASTSIT  508

Query  1807  EAEVDDLQFNKAGTSCVGEWADSLTNISVGDLLSEAPDMEDANCITSSIHSSSNY-IHQI  1983
               E      +       GEWADSLTNIS+GDLLSE PD  D++ +       S+Y +  +
Sbjct  509   PLE----HLSGGNAQSPGEWADSLTNISIGDLLSEVPDDIDSDGVDPPATEGSHYLLRDV  564

Query  1984  PFSCDSFDAAIAAHIKKHQNVTDSQAALPSQLSSIWGAEDTCDAFAFQRHSLSEKVQNAS  2163
             PF+ DSFDAAIAAHI +HQN   +Q  L S  SS+W  E+T DAF+FQ++    +  N++
Sbjct  565   PFTSDSFDAAIAAHILRHQNKPSAQLPLTSGSSSLWDDEETRDAFSFQKN----RFANST  620

Query  2164  KHTSLETCKQITLAN---TTALGASVEDLPGARNPVD-------GDAATADLESVHYSPT  2313
             +  S+ + K +   N   +  + AS  D  G+ NP D       G A    ++S   +P 
Sbjct  621   ELASVASPKGVGRVNGEPSQLVEASSGD-EGSYNPHDDGDPMEEGPADPHTMDSPGKTPC  679

Query  2314  SDVVKDFNGLSDVYWPDSLGPLDLDIPSSRYHSELILSDSLGGLTQLIASSLDAFQNCSF  2493
                     GL+DVYWPDSLGPLDLDI SS+Y  +LILS+SLGGL++LIA+SLDAFQNCS 
Sbjct  680   --------GLADVYWPDSLGPLDLDIRSSKYTDDLILSESLGGLSRLIATSLDAFQNCSL  731

Query  2494  FGADKKE  2514
             FG D K+
Sbjct  732   FGFDNKK  738



>gb|AAM94622.1| myb/SANT domain protein [Arabidopsis thaliana]
Length=741

 Score =   645 bits (1663),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 368/727 (51%), Positives = 471/727 (65%), Gaps = 61/727 (8%)
 Frame = +1

Query  418   SALQQPVKRQTRKWAAWTREEEESFFSALRHVGKNFEKITSRVQSKNKDQVRHYYYRLVR  597
             S  Q P K+ TR+WAAWT +EEESFF+ALR VGKNFEKITSRVQSKNKDQVRHYYYRLVR
Sbjct  42    SITQFPAKKPTRQWAAWTHQEEESFFTALRQVGKNFEKITSRVQSKNKDQVRHYYYRLVR  101

Query  598   RMNKLLGPELCLNAKNSRDTNAAMLRWWSLLEKYSCKASKLHLKPRRFKIFIETLENQLL  777
             RMNKLLGP+L L+AKN +DTNAAMLRWWSLLEKYSCKASKLHLKPRRFK+FIE LE+QLL
Sbjct  102   RMNKLLGPDLSLDAKNPKDTNAAMLRWWSLLEKYSCKASKLHLKPRRFKLFIEALEHQLL  161

Query  778   KDRKKNVRRCFSQGENTSTAPI-SVSNQGRGASGHDGRSVKVVLLDNQDIHKFGSGKGSS  954
             KDR+K++R+   QGEN S+A + ++S+  R   G D R  K++L D Q++ K G G+ S+
Sbjct  162   KDRRKSIRKRTCQGENLSSASLGNISSHSR-ERGLDNRPFKLILSDGQNVKKLGPGRAST  220

Query  955   LKRHINIGANSTSCKADSSLLKTARHRRKIGATAAYKRWEKAAIAGVSLVADAAEHLERT  1134
              K   ++  N    K D++  +  R RRK G    Y++WEKAAI GVSLVADAAEHLERT
Sbjct  221   -KHGESLSVNLGDEKEDTAFGRGGRQRRKQG----YRKWEKAAIDGVSLVADAAEHLERT  275

Query  1135  TTDKEDGHFQDSNVRNVFEHSGKDPHVFPDLLHNSFNETNLQNSGKLKLQLFPVDDGTRR  1314
             + DK+     D         +GK P           ++ N+Q S KLKLQLFP+D+ TRR
Sbjct  276   SIDKD----MDDQTGPTRYLTGKSPLSLCSAGDVPLSDANMQFSAKLKLQLFPIDECTRR  331

Query  1315  ALELDNHNPYLELTLSTRKKMSSVLEHLNRKWGNSSMACGDLMLFPYHLHKENLVHFQKW  1494
             +LE+D HNP+LELTLS RKK+SSVLEHLNRKWG+SS A G+L+LFPY+  KE +   Q+W
Sbjct  332   SLEMDKHNPHLELTLSNRKKISSVLEHLNRKWGSSSCATGELLLFPYNARKETVTCHQRW  391

Query  1495  TKDTTLTAADVYALTGSPPVFRLRYGWF---SNAEVAFRAPVSSAIPSRHDANMNI----  1653
             T D+ L+AA+V+++ GSP VFRLRYGWF   ++  +  + P S   PS  D +MN+    
Sbjct  392   THDSFLSAAEVHSMVGSPSVFRLRYGWFVHDASGSIISQVPTSDPCPSLED-DMNVDRLN  450

Query  1654  ---MPESSVGVLQAPSTD------PPKEANGCVSMNTVNASRSSDHTEAVLWENPETVVT  1806
                M  +  G L   ST        P +   C S      +RS D      +E   T +T
Sbjct  451   EVNMLLTESGPLSVHSTAEQTTSVEPSQGLVCASGVHDRPARSRDD-----YEPASTSIT  505

Query  1807  EAEVDDLQFNKAGTSCVGEWADSLTNISVGDLLSEAPDMEDANCITSSIHSSSNY-IHQI  1983
               E      +       GEWADSLTNIS+GDLLSE PD  D++ +       S+Y +  +
Sbjct  506   PLE----HLSGGNAQSPGEWADSLTNISIGDLLSEVPDDIDSDGVDPPATEGSHYLLRDV  561

Query  1984  PFSCDSFDAAIAAHIKKHQNVTDSQAALPSQLSSIWGAEDTCDAFAFQRHSLSEKVQNAS  2163
             PF+ DSFDAAIAAHI +HQN   +Q  L S  SS+W  E+T DAF+FQ++    +  N++
Sbjct  562   PFTSDSFDAAIAAHILRHQNKPSAQLPLTSGSSSLWDDEETRDAFSFQKN----RFANST  617

Query  2164  KHTSLETCKQITLAN---TTALGASVEDLPGARNPVD-------GDAATADLESVHYSPT  2313
             +  S+ + K +   N   +  + AS  D  G+ NP D       G A    ++S   +P 
Sbjct  618   ELASVASPKGVGRVNGEPSQLVEASSGD-EGSYNPHDDGDPMEEGPADPHTMDSPGKTPC  676

Query  2314  SDVVKDFNGLSDVYWPDSLGPLDLDIPSSRYHSELILSDSLGGLTQLIASSLDAFQNCSF  2493
                     GL+DVYWPDSLGPLDLDI SS+Y  +LILS+SLGGL++LIA+SLDAFQNCS 
Sbjct  677   --------GLADVYWPDSLGPLDLDIRSSKYTDDLILSESLGGLSRLIATSLDAFQNCSL  728

Query  2494  FGADKKE  2514
             FG D K+
Sbjct  729   FGFDNKK  735



>ref|NP_850273.1| TSL-kinase interacting protein 1 [Arabidopsis thaliana]
 sp|Q8LJT8.2|TKI1_ARATH RecName: Full=TSL-kinase interacting protein 1; AltName: Full=Myb-related 
protein TKI1 [Arabidopsis thaliana]
 gb|AAL36424.1| unknown protein [Arabidopsis thaliana]
 gb|AAM20017.1| unknown protein [Arabidopsis thaliana]
 gb|AEC09326.1| TSL-kinase interacting protein 1 [Arabidopsis thaliana]
Length=743

 Score =   644 bits (1662),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 368/727 (51%), Positives = 471/727 (65%), Gaps = 59/727 (8%)
 Frame = +1

Query  418   SALQQPVKRQTRKWAAWTREEEESFFSALRHVGKNFEKITSRVQSKNKDQVRHYYYRLVR  597
             S  Q P K+ TR+WAAWT +EEESFF+ALR VGKNFEKITSRVQSKNKDQVRHYYYRLVR
Sbjct  42    SITQFPAKKPTRQWAAWTHQEEESFFTALRQVGKNFEKITSRVQSKNKDQVRHYYYRLVR  101

Query  598   RMNKLLGPELCLNAKNSRDTNAAMLRWWSLLEKYSCKASKLHLKPRRFKIFIETLENQLL  777
             RMNKLLGP+L L+AKN +DTNAAMLRWWSLLEKYSCKASKLHLKPRRFK+FIE LE+QLL
Sbjct  102   RMNKLLGPDLSLDAKNPKDTNAAMLRWWSLLEKYSCKASKLHLKPRRFKLFIEALEHQLL  161

Query  778   KDRKKNVRRCFSQGENTSTAPI-SVSNQGRGASGHDGRSVKVVLLDNQDIHKFGSGKGSS  954
             KDR+K++R+   QGEN S+A + ++S+  R   G D R  K++L D Q++ K G G+ S+
Sbjct  162   KDRRKSIRKRTCQGENLSSASLGNISSHSR-ERGLDNRPFKLILSDGQNVKKLGPGRAST  220

Query  955   LKRHINIGANSTSCKADSSLLKTARHRRKIGATAAYKRWEKAAIAGVSLVADAAEHLERT  1134
              K   ++  N    K D++  +  R RRK G    Y++WEKAAI GVSLVADAAEHLERT
Sbjct  221   -KHGESLSVNLGDEKEDTAFGRGGRQRRKQG----YRKWEKAAIDGVSLVADAAEHLERT  275

Query  1135  TTDKEDGHFQDSNVRNVFEHSGKDPHVFPDLLHNSFNETNLQNSGKLKLQLFPVDDGTRR  1314
             + DK+     D         +GK P           ++ N+Q S KLKLQLFP+D+ TRR
Sbjct  276   SIDKDMDDQTDLGPTRYL--TGKSPLSLCSAGDVPLSDANMQFSAKLKLQLFPIDECTRR  333

Query  1315  ALELDNHNPYLELTLSTRKKMSSVLEHLNRKWGNSSMACGDLMLFPYHLHKENLVHFQKW  1494
             +LE+D HNP+LELTLS RKK+SSVLEHLNRKWG+SS A G+L+LFPY+  KE +   Q+W
Sbjct  334   SLEMDKHNPHLELTLSNRKKISSVLEHLNRKWGSSSCATGELLLFPYNARKETVTCHQRW  393

Query  1495  TKDTTLTAADVYALTGSPPVFRLRYGWF---SNAEVAFRAPVSSAIPSRHDANMNI----  1653
             T D+ L+AA+V+++ GSP VFRLRYGWF   ++  +  + P S   PS  D +MN+    
Sbjct  394   THDSFLSAAEVHSMVGSPSVFRLRYGWFVHDASGSIISQVPTSDPCPSLED-DMNVDRLN  452

Query  1654  ---MPESSVGVLQAPSTD------PPKEANGCVSMNTVNASRSSDHTEAVLWENPETVVT  1806
                M  +  G L   ST        P +   C S      +RS D      +E   T +T
Sbjct  453   EVNMLLTESGPLSVHSTAEQTTSVEPSQGLVCASGVHDRPARSRDD-----YEPASTSIT  507

Query  1807  EAEVDDLQFNKAGTSCVGEWADSLTNISVGDLLSEAPDMEDANCITSSIHSSSNY-IHQI  1983
               E      +       GEWADSLTNIS+GDLLSE PD  D++ +       S+Y +  +
Sbjct  508   PLE----HLSGGNAQSPGEWADSLTNISIGDLLSEVPDDIDSDGVDPPATEGSHYLLRDV  563

Query  1984  PFSCDSFDAAIAAHIKKHQNVTDSQAALPSQLSSIWGAEDTCDAFAFQRHSLSEKVQNAS  2163
             PF+ DSFDAAIAAHI +HQN   +Q  L S  SS+W  E+T DAF+FQ++    +  N++
Sbjct  564   PFTSDSFDAAIAAHILRHQNKPSAQLPLTSGSSSLWDDEETRDAFSFQKN----RFANST  619

Query  2164  KHTSLETCKQITLAN---TTALGASVEDLPGARNPVD-------GDAATADLESVHYSPT  2313
             +  S+ + K +   N   +  + AS  D  G+ NP D       G A    ++S   +P 
Sbjct  620   ELASVASPKGVGRVNGEPSQLVEASSGD-EGSYNPHDDGDPMEEGPADPHTMDSPGKTPC  678

Query  2314  SDVVKDFNGLSDVYWPDSLGPLDLDIPSSRYHSELILSDSLGGLTQLIASSLDAFQNCSF  2493
                     GL+DVYWPDSLGPLDLDI SS+Y  +LILS+SLGGL++LIA+SLDAFQNCS 
Sbjct  679   --------GLADVYWPDSLGPLDLDIRSSKYTDDLILSESLGGLSRLIATSLDAFQNCSL  730

Query  2494  FGADKKE  2514
             FG D K+
Sbjct  731   FGFDNKK  737



>ref|XP_002879635.1| tsl-kinase interacting protein 1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH55894.1| tsl-kinase interacting protein 1 [Arabidopsis lyrata subsp. lyrata]
Length=740

 Score =   641 bits (1654),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 362/718 (50%), Positives = 469/718 (65%), Gaps = 50/718 (7%)
 Frame = +1

Query  427   QQPVKRQTRKWAAWTREEEESFFSALRHVGKNFEKITSRVQSKNKDQVRHYYYRLVRRMN  606
             Q P K+ TR+WAAWT +EEESFF+ALR VGKNFEKITSRVQSKNKDQVRHYYYRLVRRMN
Sbjct  45    QFPAKKPTRQWAAWTHQEEESFFTALRQVGKNFEKITSRVQSKNKDQVRHYYYRLVRRMN  104

Query  607   KLLGPELCLNAKNSRDTNAAMLRWWSLLEKYSCKASKLHLKPRRFKIFIETLENQLLKDR  786
             KLLGPEL L+AKN +DTNAAMLRWWSLLEKYSCKASKLHLKPRRFK+FIE LE+QLLKDR
Sbjct  105   KLLGPELSLDAKNPKDTNAAMLRWWSLLEKYSCKASKLHLKPRRFKLFIEALEHQLLKDR  164

Query  787   KKNVRRCFSQGENTSTAPI-SVSNQGRGASGHDGRSVKVVLLDNQDIHKFGSGKGSSLKR  963
             +K++R+   QGEN S+A + ++S+  R   G D R  K++L D Q++ K G G+ S+ K 
Sbjct  165   RKSIRKRACQGENLSSASLGNISSHSR-ERGLDNRPFKLILSDGQNVKKLGPGRAST-KH  222

Query  964   HINIGANSTSCKADSSLLKTARHRRKIGATAAYKRWEKAAIAGVSLVADAAEHLERTTTD  1143
               ++G      K D++  +  R RRK G    Y++WEKAAI GVSLVADAAEHLERT+ D
Sbjct  223   GESLGVILGEEKEDTAFGRGGRQRRKQG----YRKWEKAAIDGVSLVADAAEHLERTSID  278

Query  1144  KE-DGHFQDSNVRNVFEHSGKDPHVFPDLLHNSFNETNLQNSGKLKLQLFPVDDGTRRAL  1320
             K+ D   +    R +   +GK P           ++TN+Q S KLKLQLFP+D+ TRR+L
Sbjct  279   KDMDDQTELGPSRYL---TGKSPLSLCSSGDILLSDTNMQFSAKLKLQLFPIDECTRRSL  335

Query  1321  ELDNHNPYLELTLSTRKKMSSVLEHLNRKWGNSSMACGDLMLFPYHLHKENLVHFQKWTK  1500
             E+D HNP+LELTLS RKK+SSVLEHLNRKWG++S A G+L+LFPY+  KE +   Q+WT 
Sbjct  336   EMDKHNPHLELTLSNRKKISSVLEHLNRKWGSASCATGELLLFPYNARKETVTCHQRWTH  395

Query  1501  DTTLTAADVYALTGSPPVFRLRYGWF---SNAEVAFRAPVSSAIPSRHDANMNIMPESSV  1671
             D+ L+AA+V+++ GSP VFRLRYGWF   ++  +  + P S   PS  D +MN+   + V
Sbjct  396   DSFLSAAEVHSMVGSPSVFRLRYGWFVHDASGSIISQVPTSDPCPSLED-DMNVDGVNEV  454

Query  1672  GVL--------------QAPSTDPPKEANGCVSMNTVN-ASRSSDHTEAVLWENPETVVT  1806
              +L              QA S + P +   C S    +  + S D  EA       T +T
Sbjct  455   NMLLTESGPLSVHSTAEQATSVE-PSQGLVCASGEIHDHPAESRDDYEAA-----STTIT  508

Query  1807  EAEVDDLQFNKAGTSCVGEWADSLTNISVGDLLSEAPDMEDANCITSSIHSSSNY-IHQI  1983
               E      +       GEWADSLTNIS+GDLLSE PD  D++ +       S+Y +  +
Sbjct  509   PLE----HLSSGNAQSAGEWADSLTNISIGDLLSEVPDDIDSDGVDPPATEGSHYLLRDV  564

Query  1984  PFSCDSFDAAIAAHIKKHQNVTDSQAALPSQLSSIWGAEDTCDAFAFQRHSLSEKVQNAS  2163
             PF+ DSFDAAIAAHI +HQN   +   L S  SS+W  E+T DAF+FQ++ L++  + AS
Sbjct  565   PFASDSFDAAIAAHILRHQNKPSALLPLTSGSSSLWDDEETRDAFSFQKNRLADSTELAS  624

Query  2164  KHTSLETCKQITLANTTALGASVEDLPGARNPV-DGDAATADLESVHYSPTSDVVKDFNG  2340
               +     +   L    +      + P   +P+ +G      ++S   +P         G
Sbjct  625   VASHRVNGEPSQLVEVLSGDEGSCNPPDHGDPMEEGPTDPQTMDSPGKTPC--------G  676

Query  2341  LSDVYWPDSLGPLDLDIPSSRYHSELILSDSLGGLTQLIASSLDAFQNCSFFGADKKE  2514
             L+DVYWPDSLGPLDLDI SS+Y  +LILS+SLGGL++LIA+SLDAFQNCS FG D K+
Sbjct  677   LADVYWPDSLGPLDLDIRSSKYTEDLILSESLGGLSRLIATSLDAFQNCSLFGFDNKK  734



>ref|XP_010923251.1| PREDICTED: TSL-kinase interacting protein 1 isoform X1 [Elaeis 
guineensis]
Length=791

 Score =   641 bits (1654),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 383/766 (50%), Positives = 473/766 (62%), Gaps = 104/766 (14%)
 Frame = +1

Query  421   ALQQPVKRQTRKWAAWTREEEESFFSALRHVGKNFEKITSRVQSKNKDQVRHYYYRLVRR  600
             A Q+P K+ TR+WAAWTR+EEE+FF+ALR VGKNFEKIT RVQSKNKDQVRHYYYRLVRR
Sbjct  41    ATQKPAKKPTRQWAAWTRQEEENFFNALRQVGKNFEKITCRVQSKNKDQVRHYYYRLVRR  100

Query  601   MNKLLGPELCLNAKNSRDTNAAMLRWWSLLEKYSCKASKLHLKPRRFKIFIETLENQLLK  780
             MNKLLGP   L+AKNS+DTNAAMLRWWSLLEKYSC ASKLHLKPRRFKIF+E LENQLLK
Sbjct  101   MNKLLGPGFYLDAKNSKDTNAAMLRWWSLLEKYSCTASKLHLKPRRFKIFVEALENQLLK  160

Query  781   DRKKNVRRCFSQGENTSTAPISVSNQGRGASGHDGRSVKVVLLDNQDIHKFGSGKGSSLK  960
             DR K  RR    G+  S+ P S     R A G+D RS+K++ +D Q  +K G+ KG+S K
Sbjct  161   DRNKTKRR-RPHGDIYSSTP-STQVVSR-APGNDARSLKLLTVDAQTTNKVGATKGASFK  217

Query  961   RHINIGANSTSCKADSSLLKTARHRRKIG--ATAAYKRWEKAAIAGVSLVADAAEHLERT  1134
             R++N  AN    K DSS +KTA+ +R+ G  A+A Y+ WE+AA+AGVSLVADAAE LER 
Sbjct  218   RNVN--ANMNFSKGDSS-MKTAKQKRRTGVVASAEYRSWEEAAMAGVSLVADAAEQLERA  274

Query  1135  TTDKEDGHFQDSNVRNVFEHSGKDPHVFPDLLHNSFN--------ETNLQNSGKLKLQLF  1290
                        +N RN F   G   ++ P  ++NS N        ET +Q   KLKLQLF
Sbjct  275   -----------ANERNGFSDGGT-CNMLPKEMYNSNNEICSHQIKETIMQPHVKLKLQLF  322

Query  1291  PVDDGTRRALELDNHNPYLELTLSTRKKMSSVLEHLNRKWGNSSMACGDLMLFPYHLHKE  1470
             P+D+GTR+ALE D HNP+LELTLS RKK+SSVL+HLNRKWGNSS+A G+LMLFPY++   
Sbjct  323   PIDEGTRKALEKDAHNPHLELTLSARKKISSVLDHLNRKWGNSSIASGELMLFPYNVQLV  382

Query  1471  NLVHFQKWT-KDTTLTAADVYALTGSPPVFRLRYGWFSNAEV---AFRAP----------  1608
              L   ++WT KDT  +AADVYA  GSP VFRLRYGWFS+AE+    F  P          
Sbjct  383   ELASCRRWTIKDTAASAADVYATIGSPAVFRLRYGWFSSAELRSGTFHVPSPDIQSENCM  442

Query  1609  VSSAI---------PSRHDANMNIMP---------------ESSVGVLQAPSTDPPKEAN  1716
             +S  I         P     N +  P               ++SV  L   + DPP+   
Sbjct  443   LSKGILNGNNIMNGPDAKCINADAPPITEFVGQPQQLSEDQQTSVIALATSNIDPPE---  499

Query  1717  GCVSMNTVNASRSSDHTEAVLWENPETVVTEAEVDDLQFN-------KAGTSCV----GE  1863
                 MN VN     D        +P +   E E  DL           AG  CV    GE
Sbjct  500   ---PMNEVNCVEPMDELPENSGRSPFSTSGE-ETKDLSGGPQQEDEVNAGMKCVILSAGE  555

Query  1864  WADSLTNISVGDLLSEAPDMEDANCITSSIHSSSNYIHQIPFSCDSFDAAIAAHIKKHQN  2043
             WADSLTNISVGDLLSEA       C+ S   +S + + QI FSCDSFDAAIAAHI  HQ 
Sbjct  556   WADSLTNISVGDLLSEASKAAKDGCLNSPAGASVSCLQQIQFSCDSFDAAIAAHISGHQL  615

Query  2044  VTDSQAALPSQLSSIWGAEDTCDAFAFQRHSLSEKVQNASKHTSLETCKQITLANTTALG  2223
             +  +  A     +SIW AE+TCD F+F   ++ +     S ++S+E C++IT  ++    
Sbjct  616   LPPTMQA---SHASIWNAEETCDEFSFP--AMQQDGSKPSTNSSVEACREITYPSSLGFQ  670

Query  2224  ASVEDLPGARNPVDGDAATADLESVHYSPTSDVVKDFNG---------LSDVYWPDSLGP  2376
               +++L  +R P D  +     E +   P SD    F+          L D+YWPDSLGP
Sbjct  671   DYLKELAESR-PADDPSQ----ECLTAEPESDKDLSFDDRDNPQKDPCLQDIYWPDSLGP  725

Query  2377  LDLDIPSSRYHSE-LILSDSLGGLTQLIASSLDAFQNCSFFGADKK  2511
             LDLDIPS RYH + L   DSL GL++LIASSLDAFQNCSFF  +K+
Sbjct  726   LDLDIPSPRYHGQDLGFGDSLSGLSRLIASSLDAFQNCSFFSLEKE  771



>ref|XP_010516930.1| PREDICTED: TSL-kinase interacting protein 1-like isoform X3 [Camelina 
sativa]
Length=733

 Score =   635 bits (1637),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 366/727 (50%), Positives = 476/727 (65%), Gaps = 60/727 (8%)
 Frame = +1

Query  418   SALQQPVKRQTRKWAAWTREEEESFFSALRHVGKNFEKITSRVQSKNKDQVRHYYYRLVR  597
             S  Q P K+ TR+WAAWT +EEESFF+ALR VGKNFEKITSRVQSKNKDQVRHYYYRLVR
Sbjct  33    SVSQFPAKKPTRQWAAWTHQEEESFFTALRQVGKNFEKITSRVQSKNKDQVRHYYYRLVR  92

Query  598   RMNKLLGPELCLNAKNSRDTNAAMLRWWSLLEKYSCKASKLHLKPRRFKIFIETLENQLL  777
             RMNKLLGPEL L+AKN +DTNAAMLRWWSLLEKYSCKASKLHLKPRRFK+F+E LE+QLL
Sbjct  93    RMNKLLGPELSLDAKNPKDTNAAMLRWWSLLEKYSCKASKLHLKPRRFKLFLEALEHQLL  152

Query  778   KDRKKNVRRCFSQGENTSTAPI-SVSNQGRGASGHDGRSVKVVLLDNQDIHKFGSGKGSS  954
             KDR+K++R+   QGEN S+A + ++S+Q R   G D R  K++L D Q++ K GSG+ S+
Sbjct  153   KDRRKSIRKRACQGENFSSASLGNISSQSR-ERGLDNRPFKLILSDGQNVKKLGSGRAST  211

Query  955   LKRHINIGANSTSCKADSSLLKTARHRRKIGATAAYKRWEKAAIAGVSLVADAAEHLERT  1134
              K   ++G N    K D++  +  R RRK    A YK+WEKAAI GVSLVADAAEHLERT
Sbjct  212   -KHGESLGVNLGDEKEDTAFGRGGRQRRK---QAGYKKWEKAAIDGVSLVADAAEHLERT  267

Query  1135  TTDKEDGHFQD-SNVRNVFEHSGKDPHVFPDLLHNSFNETNLQNSGKLKLQLFPVDDGTR  1311
             + DK+    +D  + R +   +GK P           ++ N+Q S KLKLQLFP+D+ TR
Sbjct  268   SIDKDMDDQEDLGSTRYI---TGKSPLSLCSSGDVPLSDANMQFSAKLKLQLFPIDECTR  324

Query  1312  RALELDNHNPYLELTLSTRKKMSSVLEHLNRKWGNSSMACGDLMLFPYHLHKENLVHFQK  1491
             R+LE+D HNP+LELTLS RKK+SSVLEHLNRKWG+SS A G+LMLFPY+  KE +   Q+
Sbjct  325   RSLEMDKHNPHLELTLSNRKKISSVLEHLNRKWGSSSCATGELMLFPYNARKETITCHQR  384

Query  1492  WTKDTTLTAADVYALTGSPPVFRLRYGWF-SNAEVAF--RAPVSSAIPSRHDANMNIMPE  1662
             WT D+ L+AA+V+++ GSP VFRLRYGWF  +A  +F  + P S   PS  D +MN+   
Sbjct  385   WTHDSFLSAAEVHSMVGSPSVFRLRYGWFVHDASGSFISQVPTSDLCPSLED-DMNVDGV  443

Query  1663  SSVGVL-------------QAPSTDPPKEANGCVSMNTVNASRSSDHTEAVLWENPETVV  1803
             + V +L             + P++  P     C S  T +  R +++ +   +E     +
Sbjct  444   NEVNMLLTESGPLSVHSTAKQPTSVEPSLGLVCASGETHD--RPAEYRDD--YEPASPTI  499

Query  1804  TEAEVDDLQFNKAGTSCVGEWADSLTNISVGDLLSEAPDMEDANCIT-SSIHSSSNYIHQ  1980
             +  E              GEWADSLTNIS+GDLLS+ PD  D++     +   S   +  
Sbjct  500   SPLE----HLISGNAQSAGEWADSLTNISIGDLLSDVPDDIDSDGGNPPATEGSHCVLRD  555

Query  1981  IPFSCDSFDAAIAAHIKKHQNVTDSQAALPSQLSSIWGAEDTCDAFAFQRHSLSEKVQNA  2160
             + F+ DSFDAAIAAHI +HQN + +   L S  SS+W  E+T DAF+FQ +    +++++
Sbjct  556   VSFASDSFDAAIAAHILRHQNKSSAPLPLTSGSSSLWDDEETRDAFSFQNN----RLEDS  611

Query  2161  SKHTSLETCKQITLAN------TTALGASVEDLPGARNPVD---GDAATADLESVHYSPT  2313
             SK  ++ + + +   N        AL    E LP    P++    D  T D      SP 
Sbjct  612   SKLANVASPRGVGRVNGKPSQLVEALSVD-EKLPDHGEPMEEGPTDPHTMD------SPG  664

Query  2314  SDVVKDFNGLSDVYWPDSLGPLDLDIPSSRYHSELILSDSLGGLTQLIASSLDAFQNCSF  2493
                 K   GL+D+YWPDSLGPLDLDI SS+Y  +LILS+SLGGL++LIA+SLDAFQNCS 
Sbjct  665   ----KTHCGLADIYWPDSLGPLDLDIRSSKYTDDLILSESLGGLSRLIATSLDAFQNCSL  720

Query  2494  FGADKKE  2514
             FG D K+
Sbjct  721   FGLDNKK  727



>ref|XP_010516928.1| PREDICTED: TSL-kinase interacting protein 1-like isoform X1 [Camelina 
sativa]
Length=737

 Score =   635 bits (1637),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 366/728 (50%), Positives = 476/728 (65%), Gaps = 58/728 (8%)
 Frame = +1

Query  418   SALQQPVKRQTRKWAAWTREEEESFFSALRHVGKNFEKITSRVQSKNKDQVRHYYYRLVR  597
             S  Q P K+ TR+WAAWT +EEESFF+ALR VGKNFEKITSRVQSKNKDQVRHYYYRLVR
Sbjct  33    SVSQFPAKKPTRQWAAWTHQEEESFFTALRQVGKNFEKITSRVQSKNKDQVRHYYYRLVR  92

Query  598   RMNKLLGPELCLNAKNSRDTNAAMLRWWSLLEKYSCKASKLHLKPRRFKIFIETLENQLL  777
             RMNKLLGPEL L+AKN +DTNAAMLRWWSLLEKYSCKASKLHLKPRRFK+F+E LE+QLL
Sbjct  93    RMNKLLGPELSLDAKNPKDTNAAMLRWWSLLEKYSCKASKLHLKPRRFKLFLEALEHQLL  152

Query  778   KDRKKNVRRCFSQGENTSTAPI-SVSNQGRGASGHDGRSVKVVLLDNQDIHKFGSGKGSS  954
             KDR+K++R+   QGEN S+A + ++S+Q R   G D R  K++L D Q++ K GSG+ S+
Sbjct  153   KDRRKSIRKRACQGENFSSASLGNISSQSR-ERGLDNRPFKLILSDGQNVKKLGSGRAST  211

Query  955   LKRHINIGANSTSCKADSSLLKTARHRRKIGATAAYKRWEKAAIAGVSLVADAAEHLERT  1134
              K   ++G N    K D++  +  R RRK    A YK+WEKAAI GVSLVADAAEHLERT
Sbjct  212   -KHGESLGVNLGDEKEDTAFGRGGRQRRK---QAGYKKWEKAAIDGVSLVADAAEHLERT  267

Query  1135  TTDK--EDGHFQDSNVRNVFEHSGKDPHVFPDLLHNSFNETNLQNSGKLKLQLFPVDDGT  1308
             + DK  +D     +N+ +    +GK P           ++ N+Q S KLKLQLFP+D+ T
Sbjct  268   SIDKDMDDQEGLLANLGSTRYITGKSPLSLCSSGDVPLSDANMQFSAKLKLQLFPIDECT  327

Query  1309  RRALELDNHNPYLELTLSTRKKMSSVLEHLNRKWGNSSMACGDLMLFPYHLHKENLVHFQ  1488
             RR+LE+D HNP+LELTLS RKK+SSVLEHLNRKWG+SS A G+LMLFPY+  KE +   Q
Sbjct  328   RRSLEMDKHNPHLELTLSNRKKISSVLEHLNRKWGSSSCATGELMLFPYNARKETITCHQ  387

Query  1489  KWTKDTTLTAADVYALTGSPPVFRLRYGWF-SNAEVAF--RAPVSSAIPSRHDANMNIMP  1659
             +WT D+ L+AA+V+++ GSP VFRLRYGWF  +A  +F  + P S   PS  D +MN+  
Sbjct  388   RWTHDSFLSAAEVHSMVGSPSVFRLRYGWFVHDASGSFISQVPTSDLCPSLED-DMNVDG  446

Query  1660  ESSVGVL-------------QAPSTDPPKEANGCVSMNTVNASRSSDHTEAVLWENPETV  1800
              + V +L             + P++  P     C S  T +  R +++ +   +E     
Sbjct  447   VNEVNMLLTESGPLSVHSTAKQPTSVEPSLGLVCASGETHD--RPAEYRDD--YEPASPT  502

Query  1801  VTEAEVDDLQFNKAGTSCVGEWADSLTNISVGDLLSEAPDMEDANCIT-SSIHSSSNYIH  1977
             ++  E              GEWADSLTNIS+GDLLS+ PD  D++     +   S   + 
Sbjct  503   ISPLE----HLISGNAQSAGEWADSLTNISIGDLLSDVPDDIDSDGGNPPATEGSHCVLR  558

Query  1978  QIPFSCDSFDAAIAAHIKKHQNVTDSQAALPSQLSSIWGAEDTCDAFAFQRHSLSEKVQN  2157
              + F+ DSFDAAIAAHI +HQN + +   L S  SS+W  E+T DAF+FQ +    ++++
Sbjct  559   DVSFASDSFDAAIAAHILRHQNKSSAPLPLTSGSSSLWDDEETRDAFSFQNN----RLED  614

Query  2158  ASKHTSLETCKQITLAN------TTALGASVEDLPGARNPVD---GDAATADLESVHYSP  2310
             +SK  ++ + + +   N        AL    E LP    P++    D  T D      SP
Sbjct  615   SSKLANVASPRGVGRVNGKPSQLVEALSVD-EKLPDHGEPMEEGPTDPHTMD------SP  667

Query  2311  TSDVVKDFNGLSDVYWPDSLGPLDLDIPSSRYHSELILSDSLGGLTQLIASSLDAFQNCS  2490
                  K   GL+D+YWPDSLGPLDLDI SS+Y  +LILS+SLGGL++LIA+SLDAFQNCS
Sbjct  668   G----KTHCGLADIYWPDSLGPLDLDIRSSKYTDDLILSESLGGLSRLIATSLDAFQNCS  723

Query  2491  FFGADKKE  2514
              FG D K+
Sbjct  724   LFGLDNKK  731



>ref|XP_010516931.1| PREDICTED: TSL-kinase interacting protein 1-like isoform X4 [Camelina 
sativa]
Length=732

 Score =   634 bits (1636),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 366/727 (50%), Positives = 476/727 (65%), Gaps = 61/727 (8%)
 Frame = +1

Query  418   SALQQPVKRQTRKWAAWTREEEESFFSALRHVGKNFEKITSRVQSKNKDQVRHYYYRLVR  597
             S  Q P K+ TR+WAAWT +EEESFF+ALR VGKNFEKITSRVQSKNKDQVRHYYYRLVR
Sbjct  33    SVSQFPAKKPTRQWAAWTHQEEESFFTALRQVGKNFEKITSRVQSKNKDQVRHYYYRLVR  92

Query  598   RMNKLLGPELCLNAKNSRDTNAAMLRWWSLLEKYSCKASKLHLKPRRFKIFIETLENQLL  777
             RMNKLLGPEL L+AKN +DTNAAMLRWWSLLEKYSCKASKLHLKPRRFK+F+E LE+QLL
Sbjct  93    RMNKLLGPELSLDAKNPKDTNAAMLRWWSLLEKYSCKASKLHLKPRRFKLFLEALEHQLL  152

Query  778   KDRKKNVRRCFSQGENTSTAPI-SVSNQGRGASGHDGRSVKVVLLDNQDIHKFGSGKGSS  954
             KDR+K++R+   QGEN S+A + ++S+Q R   G D R  K++L D Q++ K GSG+ S+
Sbjct  153   KDRRKSIRKRACQGENFSSASLGNISSQSR-ERGLDNRPFKLILSDGQNVKKLGSGRAST  211

Query  955   LKRHINIGANSTSCKADSSLLKTARHRRKIGATAAYKRWEKAAIAGVSLVADAAEHLERT  1134
              K   ++G N    K D++  +  R RRK G    YK+WEKAAI GVSLVADAAEHLERT
Sbjct  212   -KHGESLGVNLGDEKEDTAFGRGGRQRRKQG----YKKWEKAAIDGVSLVADAAEHLERT  266

Query  1135  TTDKEDGHFQD-SNVRNVFEHSGKDPHVFPDLLHNSFNETNLQNSGKLKLQLFPVDDGTR  1311
             + DK+    +D  + R +   +GK P           ++ N+Q S KLKLQLFP+D+ TR
Sbjct  267   SIDKDMDDQEDLGSTRYI---TGKSPLSLCSSGDVPLSDANMQFSAKLKLQLFPIDECTR  323

Query  1312  RALELDNHNPYLELTLSTRKKMSSVLEHLNRKWGNSSMACGDLMLFPYHLHKENLVHFQK  1491
             R+LE+D HNP+LELTLS RKK+SSVLEHLNRKWG+SS A G+LMLFPY+  KE +   Q+
Sbjct  324   RSLEMDKHNPHLELTLSNRKKISSVLEHLNRKWGSSSCATGELMLFPYNARKETITCHQR  383

Query  1492  WTKDTTLTAADVYALTGSPPVFRLRYGWF-SNAEVAF--RAPVSSAIPSRHDANMNIMPE  1662
             WT D+ L+AA+V+++ GSP VFRLRYGWF  +A  +F  + P S   PS  D +MN+   
Sbjct  384   WTHDSFLSAAEVHSMVGSPSVFRLRYGWFVHDASGSFISQVPTSDLCPSLED-DMNVDGV  442

Query  1663  SSVGVL-------------QAPSTDPPKEANGCVSMNTVNASRSSDHTEAVLWENPETVV  1803
             + V +L             + P++  P     C S  T +  R +++ +   +E     +
Sbjct  443   NEVNMLLTESGPLSVHSTAKQPTSVEPSLGLVCASGETHD--RPAEYRDD--YEPASPTI  498

Query  1804  TEAEVDDLQFNKAGTSCVGEWADSLTNISVGDLLSEAPDMEDANCIT-SSIHSSSNYIHQ  1980
             +  E              GEWADSLTNIS+GDLLS+ PD  D++     +   S   +  
Sbjct  499   SPLE----HLISGNAQSAGEWADSLTNISIGDLLSDVPDDIDSDGGNPPATEGSHCVLRD  554

Query  1981  IPFSCDSFDAAIAAHIKKHQNVTDSQAALPSQLSSIWGAEDTCDAFAFQRHSLSEKVQNA  2160
             + F+ DSFDAAIAAHI +HQN + +   L S  SS+W  E+T DAF+FQ +    +++++
Sbjct  555   VSFASDSFDAAIAAHILRHQNKSSAPLPLTSGSSSLWDDEETRDAFSFQNN----RLEDS  610

Query  2161  SKHTSLETCKQITLAN------TTALGASVEDLPGARNPVD---GDAATADLESVHYSPT  2313
             SK  ++ + + +   N        AL    E LP    P++    D  T D      SP 
Sbjct  611   SKLANVASPRGVGRVNGKPSQLVEALSVD-EKLPDHGEPMEEGPTDPHTMD------SPG  663

Query  2314  SDVVKDFNGLSDVYWPDSLGPLDLDIPSSRYHSELILSDSLGGLTQLIASSLDAFQNCSF  2493
                 K   GL+D+YWPDSLGPLDLDI SS+Y  +LILS+SLGGL++LIA+SLDAFQNCS 
Sbjct  664   ----KTHCGLADIYWPDSLGPLDLDIRSSKYTDDLILSESLGGLSRLIATSLDAFQNCSL  719

Query  2494  FGADKKE  2514
             FG D K+
Sbjct  720   FGLDNKK  726



>ref|XP_010516929.1| PREDICTED: TSL-kinase interacting protein 1-like isoform X2 [Camelina 
sativa]
Length=736

 Score =   634 bits (1635),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 366/728 (50%), Positives = 476/728 (65%), Gaps = 59/728 (8%)
 Frame = +1

Query  418   SALQQPVKRQTRKWAAWTREEEESFFSALRHVGKNFEKITSRVQSKNKDQVRHYYYRLVR  597
             S  Q P K+ TR+WAAWT +EEESFF+ALR VGKNFEKITSRVQSKNKDQVRHYYYRLVR
Sbjct  33    SVSQFPAKKPTRQWAAWTHQEEESFFTALRQVGKNFEKITSRVQSKNKDQVRHYYYRLVR  92

Query  598   RMNKLLGPELCLNAKNSRDTNAAMLRWWSLLEKYSCKASKLHLKPRRFKIFIETLENQLL  777
             RMNKLLGPEL L+AKN +DTNAAMLRWWSLLEKYSCKASKLHLKPRRFK+F+E LE+QLL
Sbjct  93    RMNKLLGPELSLDAKNPKDTNAAMLRWWSLLEKYSCKASKLHLKPRRFKLFLEALEHQLL  152

Query  778   KDRKKNVRRCFSQGENTSTAPI-SVSNQGRGASGHDGRSVKVVLLDNQDIHKFGSGKGSS  954
             KDR+K++R+   QGEN S+A + ++S+Q R   G D R  K++L D Q++ K GSG+ S+
Sbjct  153   KDRRKSIRKRACQGENFSSASLGNISSQSR-ERGLDNRPFKLILSDGQNVKKLGSGRAST  211

Query  955   LKRHINIGANSTSCKADSSLLKTARHRRKIGATAAYKRWEKAAIAGVSLVADAAEHLERT  1134
              K   ++G N    K D++  +  R RRK G    YK+WEKAAI GVSLVADAAEHLERT
Sbjct  212   -KHGESLGVNLGDEKEDTAFGRGGRQRRKQG----YKKWEKAAIDGVSLVADAAEHLERT  266

Query  1135  TTDK--EDGHFQDSNVRNVFEHSGKDPHVFPDLLHNSFNETNLQNSGKLKLQLFPVDDGT  1308
             + DK  +D     +N+ +    +GK P           ++ N+Q S KLKLQLFP+D+ T
Sbjct  267   SIDKDMDDQEGLLANLGSTRYITGKSPLSLCSSGDVPLSDANMQFSAKLKLQLFPIDECT  326

Query  1309  RRALELDNHNPYLELTLSTRKKMSSVLEHLNRKWGNSSMACGDLMLFPYHLHKENLVHFQ  1488
             RR+LE+D HNP+LELTLS RKK+SSVLEHLNRKWG+SS A G+LMLFPY+  KE +   Q
Sbjct  327   RRSLEMDKHNPHLELTLSNRKKISSVLEHLNRKWGSSSCATGELMLFPYNARKETITCHQ  386

Query  1489  KWTKDTTLTAADVYALTGSPPVFRLRYGWF-SNAEVAF--RAPVSSAIPSRHDANMNIMP  1659
             +WT D+ L+AA+V+++ GSP VFRLRYGWF  +A  +F  + P S   PS  D +MN+  
Sbjct  387   RWTHDSFLSAAEVHSMVGSPSVFRLRYGWFVHDASGSFISQVPTSDLCPSLED-DMNVDG  445

Query  1660  ESSVGVL-------------QAPSTDPPKEANGCVSMNTVNASRSSDHTEAVLWENPETV  1800
              + V +L             + P++  P     C S  T +  R +++ +   +E     
Sbjct  446   VNEVNMLLTESGPLSVHSTAKQPTSVEPSLGLVCASGETHD--RPAEYRDD--YEPASPT  501

Query  1801  VTEAEVDDLQFNKAGTSCVGEWADSLTNISVGDLLSEAPDMEDANCIT-SSIHSSSNYIH  1977
             ++  E              GEWADSLTNIS+GDLLS+ PD  D++     +   S   + 
Sbjct  502   ISPLE----HLISGNAQSAGEWADSLTNISIGDLLSDVPDDIDSDGGNPPATEGSHCVLR  557

Query  1978  QIPFSCDSFDAAIAAHIKKHQNVTDSQAALPSQLSSIWGAEDTCDAFAFQRHSLSEKVQN  2157
              + F+ DSFDAAIAAHI +HQN + +   L S  SS+W  E+T DAF+FQ +    ++++
Sbjct  558   DVSFASDSFDAAIAAHILRHQNKSSAPLPLTSGSSSLWDDEETRDAFSFQNN----RLED  613

Query  2158  ASKHTSLETCKQITLAN------TTALGASVEDLPGARNPVD---GDAATADLESVHYSP  2310
             +SK  ++ + + +   N        AL    E LP    P++    D  T D      SP
Sbjct  614   SSKLANVASPRGVGRVNGKPSQLVEALSVD-EKLPDHGEPMEEGPTDPHTMD------SP  666

Query  2311  TSDVVKDFNGLSDVYWPDSLGPLDLDIPSSRYHSELILSDSLGGLTQLIASSLDAFQNCS  2490
                  K   GL+D+YWPDSLGPLDLDI SS+Y  +LILS+SLGGL++LIA+SLDAFQNCS
Sbjct  667   G----KTHCGLADIYWPDSLGPLDLDIRSSKYTDDLILSESLGGLSRLIATSLDAFQNCS  722

Query  2491  FFGADKKE  2514
              FG D K+
Sbjct  723   LFGLDNKK  730



>ref|XP_010505244.1| PREDICTED: TSL-kinase interacting protein 1-like isoform X1 [Camelina 
sativa]
Length=732

 Score =   634 bits (1634),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 366/722 (51%), Positives = 466/722 (65%), Gaps = 50/722 (7%)
 Frame = +1

Query  418   SALQQPVKRQTRKWAAWTREEEESFFSALRHVGKNFEKITSRVQSKNKDQVRHYYYRLVR  597
             S  Q PVK+ TR+WAAWT +EEESFF+ALR VGKNFEKITSRVQSKNKDQVRHYYYRLVR
Sbjct  32    SVAQFPVKKPTRQWAAWTHQEEESFFTALRQVGKNFEKITSRVQSKNKDQVRHYYYRLVR  91

Query  598   RMNKLLGPELCLNAKNSRDTNAAMLRWWSLLEKYSCKASKLHLKPRRFKIFIETLENQLL  777
             RMNKLLGPEL L+AKN +DTNAAMLRWWSLLEKYSCKASKLHLKPRRFK+F+E LE+QLL
Sbjct  92    RMNKLLGPELSLDAKNPKDTNAAMLRWWSLLEKYSCKASKLHLKPRRFKLFLEALEHQLL  151

Query  778   KDRKKNVRRCFSQGENTSTAPI-SVSNQGRGASGHDGRSVKVVLLDNQDIHKFGSGKGSS  954
             KDR+K++R+   QGEN S+A + ++S+  R   G D R  K+++ D Q++ K GSG+ S+
Sbjct  152   KDRRKSIRKRACQGENFSSASLGNISSHSR-ERGLDNRPFKLIVSDGQNVKKLGSGRAST  210

Query  955   LKRHINIGANSTSCKADSSLLKTARHRRKIGATAAYKRWEKAAIAGVSLVADAAEHLERT  1134
              K   ++G N    K D++  +  R RRK    A YK+WEKAAI GVSLVADAAEHLERT
Sbjct  211   -KHGESLGVNLGDEKEDTAFGRGGRKRRK---QAGYKKWEKAAIDGVSLVADAAEHLERT  266

Query  1135  TTDKEDGHFQDSNVRNVFEHSGKDPHVFPDLLHNSFNETNLQNSGKLKLQLFPVDDGTRR  1314
             + DK+    +D         +GK P           ++ N+Q S KLKLQLFP+D+ TRR
Sbjct  267   SIDKDMDDQEDLGSTRYL--TGKSPLSLCSSRDVPLSDANMQFSAKLKLQLFPIDECTRR  324

Query  1315  ALELDNHNPYLELTLSTRKKMSSVLEHLNRKWGNSSMACGDLMLFPYHLHKENLVHFQKW  1494
             +LE+D HNP+LELTLS RKK+SSVLEHLNRKWG+SS A G+LMLFPY+  KE +   Q+W
Sbjct  325   SLEMDKHNPHLELTLSNRKKISSVLEHLNRKWGSSSCATGELMLFPYNARKETITCHQRW  384

Query  1495  TKDTTLTAADVYALTGSPPVFRLRYGWF-SNAEVAF--RAPVSSAIPSRHDANMNIMPES  1665
             T D+ L+AA+V+++ GSP VFRLRYGWF  +A  +F  + P S   PS  D +MN+   +
Sbjct  385   THDSFLSAAEVHSMVGSPSVFRLRYGWFVHDASGSFISQVPTSDLCPSLED-DMNVDGVN  443

Query  1666  SVGVL-------------QAPSTDPPKEANGCVSMNTVNASRSSDHTEAVLWENPETVVT  1806
              V VL             + P++  P     C S  T +  R +++ +   +E     ++
Sbjct  444   EVNVLLTESGPLSVHSTAEQPTSVEPSLGLVCASGETHD--RPAEYRDD--YEPASPTIS  499

Query  1807  EAEVDDLQFNKAGTSCVGEWADSLTNISVGDLLSEAPDMEDANCIT-SSIHSSSNYIHQI  1983
               E              GEWADSLTNIS+GDLLS+ PD  D++     +   S   +  +
Sbjct  500   PLE----HLISGNAQSAGEWADSLTNISIGDLLSDVPDDIDSDGGNPPATEGSHCLLRDV  555

Query  1984  PFSCDSFDAAIAAHIKKHQNVTDSQAALPSQLSSIWGAEDTCDAFAFQRHSL--SEKVQN  2157
              F+ DSFDAAIAAHI +HQN   +   L S  SS+W  E+T DAF+FQ + L  S K+ N
Sbjct  556   SFASDSFDAAIAAHILRHQNKPSAPLPLTSGSSSLWDDEETRDAFSFQNNRLADSSKLAN  615

Query  2158  ASKHTSLETCKQITLANTTALGASVEDLPGARNPVD---GDAATADLESVHYSPTSDVVK  2328
              +    +            AL    E LP    P++    D  T D      SP     K
Sbjct  616   VASPRGVGRVNGKPSQLVEALSVD-EKLPDHGEPMEEGPTDPHTMD------SPG----K  664

Query  2329  DFNGLSDVYWPDSLGPLDLDIPSSRYHSELILSDSLGGLTQLIASSLDAFQNCSFFGADK  2508
                GL+D+YWPDSLGPLDLDI SS+Y  +LILS+SLGGL++LIA+SLDAFQNCS FG D 
Sbjct  665   SHCGLADIYWPDSLGPLDLDIRSSKYTEDLILSESLGGLSRLIATSLDAFQNCSLFGFDN  724

Query  2509  KE  2514
             K+
Sbjct  725   KK  726



>ref|XP_010505245.1| PREDICTED: TSL-kinase interacting protein 1-like isoform X2 [Camelina 
sativa]
Length=731

 Score =   633 bits (1633),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 366/722 (51%), Positives = 466/722 (65%), Gaps = 51/722 (7%)
 Frame = +1

Query  418   SALQQPVKRQTRKWAAWTREEEESFFSALRHVGKNFEKITSRVQSKNKDQVRHYYYRLVR  597
             S  Q PVK+ TR+WAAWT +EEESFF+ALR VGKNFEKITSRVQSKNKDQVRHYYYRLVR
Sbjct  32    SVAQFPVKKPTRQWAAWTHQEEESFFTALRQVGKNFEKITSRVQSKNKDQVRHYYYRLVR  91

Query  598   RMNKLLGPELCLNAKNSRDTNAAMLRWWSLLEKYSCKASKLHLKPRRFKIFIETLENQLL  777
             RMNKLLGPEL L+AKN +DTNAAMLRWWSLLEKYSCKASKLHLKPRRFK+F+E LE+QLL
Sbjct  92    RMNKLLGPELSLDAKNPKDTNAAMLRWWSLLEKYSCKASKLHLKPRRFKLFLEALEHQLL  151

Query  778   KDRKKNVRRCFSQGENTSTAPI-SVSNQGRGASGHDGRSVKVVLLDNQDIHKFGSGKGSS  954
             KDR+K++R+   QGEN S+A + ++S+  R   G D R  K+++ D Q++ K GSG+ S+
Sbjct  152   KDRRKSIRKRACQGENFSSASLGNISSHSR-ERGLDNRPFKLIVSDGQNVKKLGSGRAST  210

Query  955   LKRHINIGANSTSCKADSSLLKTARHRRKIGATAAYKRWEKAAIAGVSLVADAAEHLERT  1134
              K   ++G N    K D++  +  R RRK G    YK+WEKAAI GVSLVADAAEHLERT
Sbjct  211   -KHGESLGVNLGDEKEDTAFGRGGRKRRKQG----YKKWEKAAIDGVSLVADAAEHLERT  265

Query  1135  TTDKEDGHFQDSNVRNVFEHSGKDPHVFPDLLHNSFNETNLQNSGKLKLQLFPVDDGTRR  1314
             + DK+    +D         +GK P           ++ N+Q S KLKLQLFP+D+ TRR
Sbjct  266   SIDKDMDDQEDLGSTRYL--TGKSPLSLCSSRDVPLSDANMQFSAKLKLQLFPIDECTRR  323

Query  1315  ALELDNHNPYLELTLSTRKKMSSVLEHLNRKWGNSSMACGDLMLFPYHLHKENLVHFQKW  1494
             +LE+D HNP+LELTLS RKK+SSVLEHLNRKWG+SS A G+LMLFPY+  KE +   Q+W
Sbjct  324   SLEMDKHNPHLELTLSNRKKISSVLEHLNRKWGSSSCATGELMLFPYNARKETITCHQRW  383

Query  1495  TKDTTLTAADVYALTGSPPVFRLRYGWF-SNAEVAF--RAPVSSAIPSRHDANMNIMPES  1665
             T D+ L+AA+V+++ GSP VFRLRYGWF  +A  +F  + P S   PS  D +MN+   +
Sbjct  384   THDSFLSAAEVHSMVGSPSVFRLRYGWFVHDASGSFISQVPTSDLCPSLED-DMNVDGVN  442

Query  1666  SVGVL-------------QAPSTDPPKEANGCVSMNTVNASRSSDHTEAVLWENPETVVT  1806
              V VL             + P++  P     C S  T +  R +++ +   +E     ++
Sbjct  443   EVNVLLTESGPLSVHSTAEQPTSVEPSLGLVCASGETHD--RPAEYRDD--YEPASPTIS  498

Query  1807  EAEVDDLQFNKAGTSCVGEWADSLTNISVGDLLSEAPDMEDANCIT-SSIHSSSNYIHQI  1983
               E              GEWADSLTNIS+GDLLS+ PD  D++     +   S   +  +
Sbjct  499   PLE----HLISGNAQSAGEWADSLTNISIGDLLSDVPDDIDSDGGNPPATEGSHCLLRDV  554

Query  1984  PFSCDSFDAAIAAHIKKHQNVTDSQAALPSQLSSIWGAEDTCDAFAFQRHSL--SEKVQN  2157
              F+ DSFDAAIAAHI +HQN   +   L S  SS+W  E+T DAF+FQ + L  S K+ N
Sbjct  555   SFASDSFDAAIAAHILRHQNKPSAPLPLTSGSSSLWDDEETRDAFSFQNNRLADSSKLAN  614

Query  2158  ASKHTSLETCKQITLANTTALGASVEDLPGARNPVD---GDAATADLESVHYSPTSDVVK  2328
              +    +            AL    E LP    P++    D  T D      SP     K
Sbjct  615   VASPRGVGRVNGKPSQLVEALSVD-EKLPDHGEPMEEGPTDPHTMD------SPG----K  663

Query  2329  DFNGLSDVYWPDSLGPLDLDIPSSRYHSELILSDSLGGLTQLIASSLDAFQNCSFFGADK  2508
                GL+D+YWPDSLGPLDLDI SS+Y  +LILS+SLGGL++LIA+SLDAFQNCS FG D 
Sbjct  664   SHCGLADIYWPDSLGPLDLDIRSSKYTEDLILSESLGGLSRLIATSLDAFQNCSLFGFDN  723

Query  2509  KE  2514
             K+
Sbjct  724   KK  725



>ref|XP_010509410.1| PREDICTED: TSL-kinase interacting protein 1 isoform X1 [Camelina 
sativa]
Length=733

 Score =   627 bits (1618),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 365/718 (51%), Positives = 472/718 (66%), Gaps = 42/718 (6%)
 Frame = +1

Query  418   SALQQPVKRQTRKWAAWTREEEESFFSALRHVGKNFEKITSRVQSKNKDQVRHYYYRLVR  597
             S  Q P K+ TR+WAAWT +EEESFF+ALR VGKNFEKITSRVQSKNKDQVRHYYYRLVR
Sbjct  33    SVAQFPAKKPTRQWAAWTHQEEESFFTALRQVGKNFEKITSRVQSKNKDQVRHYYYRLVR  92

Query  598   RMNKLLGPELCLNAKNSRDTNAAMLRWWSLLEKYSCKASKLHLKPRRFKIFIETLENQLL  777
             RMNKLLGPEL L+AKN +DTNAAMLRWWSLLEKYSCKASKLHLKPRRFK+F+E LE+QLL
Sbjct  93    RMNKLLGPELSLDAKNPKDTNAAMLRWWSLLEKYSCKASKLHLKPRRFKLFLEALEHQLL  152

Query  778   KDRKKNVRRCFSQGENTSTAPI-SVSNQGRGASGHDGRSVKVVLLDNQDIHKFGSGKGSS  954
             KDR+K++R+   QGEN S+A + ++S+  R   G D R  K++L D Q++ K GSG+ S+
Sbjct  153   KDRRKSIRKRACQGENFSSASLGNISSHSRD-RGLDNRPFKLILSDGQNVKKLGSGRAST  211

Query  955   LKRHINIGANSTSCKADSSLLKTARHRRKIGATAAYKRWEKAAIAGVSLVADAAEHLERT  1134
              K   ++G N    K D++  +  R RRK    A YK+WEKAAI GVSLVADAAEHLERT
Sbjct  212   -KHGESLGVNLGDEKEDTAFGRGGRQRRK---QAGYKKWEKAAIDGVSLVADAAEHLERT  267

Query  1135  TTDKEDGHFQDSNVRNVFEHSGKDPHVFPDLLHNSFNETNLQNSGKLKLQLFPVDDGTRR  1314
             + DK+    +D         +GK P           ++ N+Q S KLKLQLFP+D+ TRR
Sbjct  268   SIDKDMDDQEDLGSTRYL--TGKSPLSLCSSGDVPLSDANMQFSAKLKLQLFPIDECTRR  325

Query  1315  ALELDNHNPYLELTLSTRKKMSSVLEHLNRKWGNSSMACGDLMLFPYHLHKENLVHFQKW  1494
             +LE+D HNP+LELTLS RKK+SSVLEHLNRKWG+SS A G+LMLFPY+  KE +   Q W
Sbjct  326   SLEMDKHNPHLELTLSNRKKISSVLEHLNRKWGSSSCATGELMLFPYNARKETITCQQSW  385

Query  1495  TKDTTLTAADVYALTGSPPVFRLRYGWF-SNAEVAF--RAPVSSAIPSRHDANMNIMPES  1665
             T D+ L+AA+V+++ GSP VFRLRYGWF  +A  +F  + P S   PS  D +MN+   +
Sbjct  386   THDSFLSAAEVHSMVGSPSVFRLRYGWFVHDASGSFISQVPTSDLCPSLED-DMNVDGVN  444

Query  1666  SVGVLQAPSTDPPKEANGCVSMNTVNASRSS-DHTEAVLWENPETVVTEAEVDD------  1824
              V +L   S        G +S+++    R+S + +  ++  + ET    AE  D      
Sbjct  445   EVNMLLTES--------GPLSVHSTAEQRTSVEPSLGLVCASGETHDRPAEYRDDYEPAS  496

Query  1825  -----LQFNKAGTS-CVGEWADSLTNISVGDLLSEAPDMEDAN-CITSSIHSSSNYIHQI  1983
                  L+   +G +   GEWADSLTNIS+GDLLS+ PD  D++     +   S   +  +
Sbjct  497   PTISPLEHLISGNAQSAGEWADSLTNISIGDLLSDVPDDIDSDGGDPPATEGSHCLLRDV  556

Query  1984  PFSCDSFDAAIAAHIKKHQNVTDSQAALPSQLSSIWGAEDTCDAFAFQRHSLSEKVQNAS  2163
              F+ DSFDAAIAAHI +HQN   +   L S  SS+W  E+T DAF+FQ + L++  + A+
Sbjct  557   SFASDSFDAAIAAHILRHQNKPSAPLPLTSGSSSLWDDEETRDAFSFQNNRLADSSKLAN  616

Query  2164  KHTSLETCKQITLANTTALGASV-EDLPGARNPVDGDAATADLESVHYSPTSDVVKDFNG  2340
               +     +     +      S+ E LP    P+  +    D  S+  SP     K   G
Sbjct  617   VASPRGGGRVNGEPSQLVEALSIDEKLPDHGEPM--EEGPIDPHSMD-SPG----KTHCG  669

Query  2341  LSDVYWPDSLGPLDLDIPSSRYHSELILSDSLGGLTQLIASSLDAFQNCSFFGADKKE  2514
             L+D+YWPDSLGPLDLDI SS+Y  +LILS+SLGGL++LIA+SLDAFQNCS FG D K+
Sbjct  670   LADIYWPDSLGPLDLDIRSSKYTEDLILSESLGGLSRLIATSLDAFQNCSLFGFDNKK  727



>ref|XP_010509412.1| PREDICTED: TSL-kinase interacting protein 1 isoform X2 [Camelina 
sativa]
Length=732

 Score =   627 bits (1616),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 365/718 (51%), Positives = 472/718 (66%), Gaps = 43/718 (6%)
 Frame = +1

Query  418   SALQQPVKRQTRKWAAWTREEEESFFSALRHVGKNFEKITSRVQSKNKDQVRHYYYRLVR  597
             S  Q P K+ TR+WAAWT +EEESFF+ALR VGKNFEKITSRVQSKNKDQVRHYYYRLVR
Sbjct  33    SVAQFPAKKPTRQWAAWTHQEEESFFTALRQVGKNFEKITSRVQSKNKDQVRHYYYRLVR  92

Query  598   RMNKLLGPELCLNAKNSRDTNAAMLRWWSLLEKYSCKASKLHLKPRRFKIFIETLENQLL  777
             RMNKLLGPEL L+AKN +DTNAAMLRWWSLLEKYSCKASKLHLKPRRFK+F+E LE+QLL
Sbjct  93    RMNKLLGPELSLDAKNPKDTNAAMLRWWSLLEKYSCKASKLHLKPRRFKLFLEALEHQLL  152

Query  778   KDRKKNVRRCFSQGENTSTAPI-SVSNQGRGASGHDGRSVKVVLLDNQDIHKFGSGKGSS  954
             KDR+K++R+   QGEN S+A + ++S+  R   G D R  K++L D Q++ K GSG+ S+
Sbjct  153   KDRRKSIRKRACQGENFSSASLGNISSHSRD-RGLDNRPFKLILSDGQNVKKLGSGRAST  211

Query  955   LKRHINIGANSTSCKADSSLLKTARHRRKIGATAAYKRWEKAAIAGVSLVADAAEHLERT  1134
              K   ++G N    K D++  +  R RRK G    YK+WEKAAI GVSLVADAAEHLERT
Sbjct  212   -KHGESLGVNLGDEKEDTAFGRGGRQRRKQG----YKKWEKAAIDGVSLVADAAEHLERT  266

Query  1135  TTDKEDGHFQDSNVRNVFEHSGKDPHVFPDLLHNSFNETNLQNSGKLKLQLFPVDDGTRR  1314
             + DK+    +D         +GK P           ++ N+Q S KLKLQLFP+D+ TRR
Sbjct  267   SIDKDMDDQEDLGSTRYL--TGKSPLSLCSSGDVPLSDANMQFSAKLKLQLFPIDECTRR  324

Query  1315  ALELDNHNPYLELTLSTRKKMSSVLEHLNRKWGNSSMACGDLMLFPYHLHKENLVHFQKW  1494
             +LE+D HNP+LELTLS RKK+SSVLEHLNRKWG+SS A G+LMLFPY+  KE +   Q W
Sbjct  325   SLEMDKHNPHLELTLSNRKKISSVLEHLNRKWGSSSCATGELMLFPYNARKETITCQQSW  384

Query  1495  TKDTTLTAADVYALTGSPPVFRLRYGWF-SNAEVAF--RAPVSSAIPSRHDANMNIMPES  1665
             T D+ L+AA+V+++ GSP VFRLRYGWF  +A  +F  + P S   PS  D +MN+   +
Sbjct  385   THDSFLSAAEVHSMVGSPSVFRLRYGWFVHDASGSFISQVPTSDLCPSLED-DMNVDGVN  443

Query  1666  SVGVLQAPSTDPPKEANGCVSMNTVNASRSS-DHTEAVLWENPETVVTEAEVDD------  1824
              V +L   S        G +S+++    R+S + +  ++  + ET    AE  D      
Sbjct  444   EVNMLLTES--------GPLSVHSTAEQRTSVEPSLGLVCASGETHDRPAEYRDDYEPAS  495

Query  1825  -----LQFNKAGTS-CVGEWADSLTNISVGDLLSEAPDMEDAN-CITSSIHSSSNYIHQI  1983
                  L+   +G +   GEWADSLTNIS+GDLLS+ PD  D++     +   S   +  +
Sbjct  496   PTISPLEHLISGNAQSAGEWADSLTNISIGDLLSDVPDDIDSDGGDPPATEGSHCLLRDV  555

Query  1984  PFSCDSFDAAIAAHIKKHQNVTDSQAALPSQLSSIWGAEDTCDAFAFQRHSLSEKVQNAS  2163
              F+ DSFDAAIAAHI +HQN   +   L S  SS+W  E+T DAF+FQ + L++  + A+
Sbjct  556   SFASDSFDAAIAAHILRHQNKPSAPLPLTSGSSSLWDDEETRDAFSFQNNRLADSSKLAN  615

Query  2164  KHTSLETCKQITLANTTALGASV-EDLPGARNPVDGDAATADLESVHYSPTSDVVKDFNG  2340
               +     +     +      S+ E LP    P+  +    D  S+  SP     K   G
Sbjct  616   VASPRGGGRVNGEPSQLVEALSIDEKLPDHGEPM--EEGPIDPHSMD-SPG----KTHCG  668

Query  2341  LSDVYWPDSLGPLDLDIPSSRYHSELILSDSLGGLTQLIASSLDAFQNCSFFGADKKE  2514
             L+D+YWPDSLGPLDLDI SS+Y  +LILS+SLGGL++LIA+SLDAFQNCS FG D K+
Sbjct  669   LADIYWPDSLGPLDLDIRSSKYTEDLILSESLGGLSRLIATSLDAFQNCSLFGFDNKK  726



>ref|XP_006410872.1| hypothetical protein EUTSA_v10016298mg [Eutrema salsugineum]
 gb|ESQ52325.1| hypothetical protein EUTSA_v10016298mg [Eutrema salsugineum]
Length=746

 Score =   627 bits (1616),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 363/758 (48%), Positives = 481/758 (63%), Gaps = 55/758 (7%)
 Frame = +1

Query  313   VEQQIASSQEHAIPEQAMFSQDHSVTEQLASFEEHSALQQPVKRQTRKWAAWTREEEESF  492
              E+++  + E  I E  + +Q+ +    +AS    S  Q P K+ TR+WAAWT +EEESF
Sbjct  14    AEKEVLLNTEGPIDEGRITNQNSN--PNIASSASISVAQFPAKKPTRQWAAWTHQEEESF  71

Query  493   FSALRHVGKNFEKITSRVQSKNKDQVRHYYYRLVRRMNKLLGPELCLNAKNSRDTNAAML  672
             F+ALR VGKNFEKITSRVQSKNKDQVRHYYYRLVRRMNKLLGPEL L+AKN +DTNAAML
Sbjct  72    FTALRQVGKNFEKITSRVQSKNKDQVRHYYYRLVRRMNKLLGPELSLDAKNPKDTNAAML  131

Query  673   RWWSLLEKYSCKASKLHLKPRRFKIFIETLENQLLKDRKKNVRRCFSQGENTSTAPISVS  852
             RWWSLLEKYSCKASKLHLKPRRFK+FIE LE+QLLKDR+K++R+   QGE  S++ +   
Sbjct  132   RWWSLLEKYSCKASKLHLKPRRFKLFIEALEHQLLKDRRKSIRKRGCQGETFSSSSLGNI  191

Query  853   NQGRGASGHDGRSVKVVLLDNQDIHKFGSGKGSSLKRHINIGANSTSCKADSSLLKTARH  1032
             +      G D R  K+++ D Q++ K G G+ +  K   ++G +    K D++  +  R 
Sbjct  192   SSNSRDRGLDNRPFKLIICDGQNVKKLGPGR-TFTKHGESLGVSLGDEKEDTAFGRGGRQ  250

Query  1033  RRKIGATAAYKRWEKAAIAGVSLVADAAEHLERTTTDKE-DGHFQDSNVRNVFEHSGKDP  1209
             RRK G    Y++WEKAAI GVSLVADAAEHLERT+ DK+ DG  +     N+   +GK P
Sbjct  251   RRKQG----YRKWEKAAIDGVSLVADAAEHLERTSIDKDMDGQKELGPTSNL---TGKSP  303

Query  1210  HVFPDLLHNSFNETNLQNSGKLKLQLFPVDDGTRRALELDNHNPYLELTLSTRKKMSSVL  1389
                        ++ N+Q SGKLKLQLFP+D+ TRR+LE+D HNP+LELTLS RKK+SSVL
Sbjct  304   LSLCSSGDVPLSDANMQFSGKLKLQLFPIDECTRRSLEMDKHNPHLELTLSNRKKISSVL  363

Query  1390  EHLNRKWGNSSMACGDLMLFPYHLHKENLVHFQKWTKDTTLTAADVYALTGSPPVFRLRY  1569
             EHLNRKWG+SS A G+LMLFPY+  KE +   Q+WT D+ L+AA+V+++ GSP +FRLRY
Sbjct  364   EHLNRKWGSSSCASGELMLFPYNARKETVTCHQRWTHDSFLSAAEVHSMVGSPSIFRLRY  423

Query  1570  GWF---SNAEVAFRAPVSSAIPSRHDANMNI----------MPESSVGVLQAPSTDPPKE  1710
             GWF   ++  +  + P S++ PS  D +MN+          M  +  G L   ST     
Sbjct  424   GWFVHDASGSIISQVPTSASCPSLGD-DMNMDEANEVNEFNMLLTESGPLSVHSTAEQAP  482

Query  1711  ANGCVSMNTVN-ASRSSDHTEAVLWENPETVVTEAEVDDLQFNKAGTSC-VGEWADSLTN  1884
             +  C S    +  + S D+ E  L          A V   +   +G +   GEWADSLTN
Sbjct  483   SVVCASGEIHDRPAESGDNYEPAL----------ATVTPFEHMSSGNALSAGEWADSLTN  532

Query  1885  ISVGDLLSEAPDMEDANCITSSIHSSSN-YIHQIPFSCDSFDAAIAAHIKKHQNVTDSQA  2061
             IS+GDLLSE P+  D++ +   +   S+  +  + F+ DSFDAAIAAHI +HQN   +  
Sbjct  533   ISIGDLLSEVPNDIDSDDVDPPVTEGSHCLLRDVSFASDSFDAAIAAHILRHQNKPSALL  592

Query  2062  ALPSQLSSIWGAEDTCDAFAFQRHSL--SEKVQNASKHTSLETCKQITLANTTALGASVE  2235
              + S  SS+W  E+T DAF+FQ++ L  S K+ N +    +           + +  ++ 
Sbjct  593   PVTSGSSSLWDDEETRDAFSFQKNRLAASPKLANVASPGGVGRVND----EPSHIVKAIS  648

Query  2236  DLPGARNPVDGDAATADLESVHYSPTSDVVKD-----FNGLSDVYWPDSLGPLDLDIPSS  2400
                G  NP D +      + +   PT     D       GL+DVYWPDSLGPLDLDI SS
Sbjct  649   SEEGPCNPPDHE------DPMEEGPTDPHTMDSPGKIHCGLADVYWPDSLGPLDLDIRSS  702

Query  2401  RYHSELILSDSLGGLTQLIASSLDAFQNCSFFGADKKE  2514
             +Y  +LILS+SLGGL++LIA+SLDAFQNCS FG D K+
Sbjct  703   KYTEDLILSESLGGLSRLIATSLDAFQNCSLFGFDSKK  740



>ref|XP_008791201.1| PREDICTED: TSL-kinase interacting protein 1 isoform X2 [Phoenix 
dactylifera]
 ref|XP_008791202.1| PREDICTED: TSL-kinase interacting protein 1 isoform X2 [Phoenix 
dactylifera]
 ref|XP_008791203.1| PREDICTED: TSL-kinase interacting protein 1 isoform X2 [Phoenix 
dactylifera]
Length=790

 Score =   627 bits (1618),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 386/831 (46%), Positives = 485/831 (58%), Gaps = 127/831 (15%)
 Frame = +1

Query  217   MELQLTLGSEADHYLRSSP-----RKDGDFTFGKVNCVEQQIASSQEHAIPEQAMFSQDH  381
             M+L  T+GS+AD  LR+        K+ DF F           SS   A+          
Sbjct  1     MKLCTTMGSQADMELRTPLAENVLMKEADFGF----------PSSSPMAV----------  40

Query  382   SVTEQLASFEEHSALQQPVKRQTRKWAAWTREEEESFFSALRHVGKNFEKITSRVQSKNK  561
                            Q+P K+ TR+WAAWTR+EEE+FF+ALR VGKNFEKIT RVQSKNK
Sbjct  41    -------------VTQKPAKKPTRQWAAWTRQEEENFFNALRQVGKNFEKITCRVQSKNK  87

Query  562   DQVRHYYYRLVRRMNKLLGPELCLNAKNSRDTNAAMLRWWSLLEKYSCKASKLHLKPRRF  741
             DQVRHYYYRLVRRMNKLLGP   L+AKNS+DTNAAMLRWWSLLEKYSC ASKLHLKPRRF
Sbjct  88    DQVRHYYYRLVRRMNKLLGPGFYLDAKNSKDTNAAMLRWWSLLEKYSCTASKLHLKPRRF  147

Query  742   KIFIETLENQLLKDRKKNVRRCFSQGENTSTAPISVSNQGRGASGHDGRSVKVVLLDNQD  921
             KIF+E LENQLLKDR K  RR    G+  S  P S     R   G+D RS+K++ +D Q 
Sbjct  148   KIFVEALENQLLKDRNKTKRR-RPHGDIYSPTP-STQVVSR-VPGNDARSLKLLTVDAQT  204

Query  922   IHKFGSGKGSSLKRHINIGANSTSCKADSSLLKTARHRRKIG--ATAAYKRWEKAAIAGV  1095
              +K G+ KG+S KR++N  AN    K DSS +KTA+ +R+ G  A+A Y+ WE+AA+AGV
Sbjct  205   TNKVGATKGASFKRNVN--ANMNFSKGDSS-MKTAKQKRRTGVVASAEYRSWEEAAMAGV  261

Query  1096  SLVADAAEHLERTTTDKEDGHFQDSNVRNVFEHSGKDPHVFPDLLHNSFN-------ETN  1254
             SLVADAAE LER   D           RN F   G+  ++ P  ++N  N       ET 
Sbjct  262   SLVADAAEQLERAAND-----------RNGFSD-GRTCNMLPKEMYNCNNEICSHQIETI  309

Query  1255  LQNSGKLKLQLFPVDDGTRRALELDNHNPYLELTLSTRKKMSSVLEHLNRKWGNSSMACG  1434
             +Q   KLKLQLFP+D+GTRRALE D HNP+LELTLS RKK+SSVL+HLNRKWGNSS+A G
Sbjct  310   MQPRVKLKLQLFPIDEGTRRALEKDAHNPHLELTLSARKKISSVLDHLNRKWGNSSIASG  369

Query  1435  DLMLFPYHLHKENLVHFQKWT-KDTTLTAADVYALTGSPPVFRLRYGWFSNAEV------  1593
             +LMLFPY +    L   ++W   DT  +AADVYA  GSP +FRLRYGW S+ E+      
Sbjct  370   ELMLFPYDVQLLELASCRRWAITDTAASAADVYATIGSPAIFRLRYGWLSSVELRSGIVH  429

Query  1594  AFRAPVSSA-------------IPSRHDA---NMNIMP---------------ESSVGVL  1680
                 P+ S              I S  DA   N +  P               ++SV  L
Sbjct  430   VPSTPIQSENCMLSEGILNGNNIMSGPDAKCINTDAPPIREFSGQPQQLSEDQQTSVIAL  489

Query  1681  QAPSTDPPKEANGCVSMNTVNASRSSDHTEAVLWENPETVVTEAEVDDLQFNKAGTSCV-  1857
                + DPP+  N    +  ++    +   E       ET    +         AG  CV 
Sbjct  490   ATSNIDPPEPMNEVNCVKPMHELPENSGKEPFSRSGEETKDLSSGPQQEDEGNAGMKCVT  549

Query  1858  ---GEWADSLTNISVGDLLSEAPDMEDANCITSSIHSSSNYIHQIPFSCDSFDAAIAAHI  2028
                GEWADSLTN+SVGDLLSEA      +C+ S   +S++ + QI FSCDSFDAAIAAHI
Sbjct  550   LSAGEWADSLTNVSVGDLLSEASKAAKDSCLDSPAGASASCLQQIHFSCDSFDAAIAAHI  609

Query  2029  KKHQNVTDSQAALPSQLSSIWGAEDTCDAFAFQRHSLSEKVQNASKHTSLETCKQITLAN  2208
               HQ +  +  A     +SIW AE+TCD F+F   ++     N S ++S+   ++IT  +
Sbjct  610   SGHQLLPPTTQAF---QASIWNAEETCDEFSFP--AMKRDGSNPSTNSSIGASREITYPS  664

Query  2209  TTALGASVEDLPGARNPVDGDAATADLESVHYSPTSDVVKDFNG---------LSDVYWP  2361
             +      +++L  +R P D  +     E V   P SD    FN          L D+YWP
Sbjct  665   SLGFQGYLKELAESR-PADDPSN----EYVTAEPESDKDSSFNDRDNPQKDPCLQDIYWP  719

Query  2362  DSLGPLDLDIPSSRYHSE-LILSDSLGGLTQLIASSLDAFQNCSFFGADKK  2511
             DSLGPLDLD+PS RYH + L+  DSL GL++LIASSLDAFQNCSFF  +K+
Sbjct  720   DSLGPLDLDMPSPRYHGQDLVFGDSLSGLSRLIASSLDAFQNCSFFSLEKE  770



>ref|XP_009143542.1| PREDICTED: TSL-kinase interacting protein 1 isoform X1 [Brassica 
rapa]
Length=721

 Score =   616 bits (1588),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 365/750 (49%), Positives = 476/750 (63%), Gaps = 62/750 (8%)
 Frame = +1

Query  316   EQQIASSQEHAIPEQAMFSQDHSVTEQLASFEEHSALQQPVKRQTRKWAAWTREEEESFF  495
             E+++  S + ++ E    +Q+ +    +AS    +  Q P K+ TR+WAAWT +EEESFF
Sbjct  11    EKEVTLSSQGSVEEGREPNQNSN--PNIASSASIAVPQFPAKKPTRQWAAWTHQEEESFF  68

Query  496   SALRHVGKNFEKITSRVQSKNKDQVRHYYYRLVRRMNKLLGPELCLNAKNSRDTNAAMLR  675
             +ALR VGKNF KITSRVQSKNKDQVRHYYYRLVRRMNKLLGPEL L+AKN +DTNAAMLR
Sbjct  69    TALRQVGKNFAKITSRVQSKNKDQVRHYYYRLVRRMNKLLGPELSLDAKNPKDTNAAMLR  128

Query  676   WWSLLEKYSCKASKLHLKPRRFKIFIETLENQLLKDRKKNVRRCFSQGENTSTAPI-SVS  852
             WWSLLEKYSCKASKLHLKPRRFK+F+E LE+QLLKDR+K+ R+    GE+ S+A + ++S
Sbjct  129   WWSLLEKYSCKASKLHLKPRRFKLFLEALEHQLLKDRRKSSRKRACHGESFSSASLGNIS  188

Query  853   NQGRGASGHDGRSVKVVLLDNQDIHKFGSGKGSSLKRHINIGANSTSCKADSSLLKTARH  1032
             +  R   G D    K++L D+Q++     G+ S+ K   ++G      K D++L +  R 
Sbjct  189   SHSR-ERGLDNSPFKLILCDSQNVRP---GRAST-KHGESLGVRLGDEKEDTALGRVGRQ  243

Query  1033  RRKIGATAAYKRWEKAAIAGVSLVADAAEHLERTTTDKEDGHFQDSNVRNVFEHSGKDPH  1212
             RRK    A Y++WEKAAI GVSLVADAAEHLERT+ DK+    +D         +GK P 
Sbjct  244   RRK---QAGYRKWEKAAIDGVSLVADAAEHLERTSIDKDVNGQKDLGPTRYL--TGKSPL  298

Query  1213  VFPDLLHNSFNETNLQNSGKLKLQLFPVDDGTRRALELDNHNPYLELTLSTRKKMSSVLE  1392
               P       ++ N+Q S KLKLQLFP+D+ TRR+LE D HNP+LELTLS RKK+SSVLE
Sbjct  299   SLPSSGEAPLSDANMQFSAKLKLQLFPIDESTRRSLEADKHNPHLELTLSNRKKISSVLE  358

Query  1393  HLNRKWGNSSMACGDLMLFPYHLHKENLVHFQKWTKDTTLTAADVYALTGSPPVFRLRYG  1572
             HLNRKWG+SS ACG+LMLFPY+  KE +   Q+WT D+ L+A +VY++ GSP +FRLRYG
Sbjct  359   HLNRKWGSSSCACGELMLFPYNARKETVALHQRWTSDSFLSAVEVYSMVGSPSLFRLRYG  418

Query  1573  WF-SNAEVAF--RAPVSSAIPSRHDANMNIMPESSVGVLQAPS--------TDPPKEANG  1719
             WF  +A  +F  + P S++ PS  D NMN+   +   +L   S        T  P+ +  
Sbjct  419   WFVQDASGSFISQVPTSASYPSLED-NMNVDAANEDNMLLTESGPLSNKHPTSEPETSVV  477

Query  1720  CVSMNTVNASRSSDHTEAVLWENPETVVTEAEVDDLQFNKAGTSCVGEWADSLTNISVGD  1899
             C +  T    R++       +E     +T  +      +   T   G WADSLTNIS+GD
Sbjct  478   CTAAET----RAN-------YEPASATITPFD----HLSSGNTLSAGAWADSLTNISIGD  522

Query  1900  LLSEAPDMEDANCITSSIHSSSNYIHQIPFSCDSFDAAIAAHIKKHQNVTDSQAALP--S  2073
             LLSEAPD  D      +   S   +  + F+ DSFDAAIAAHI +HQN   S   +P  S
Sbjct  523   LLSEAPDCVDP----PAAEGSHCLLRDVSFASDSFDAAIAAHILRHQN-KPSGGLIPVTS  577

Query  2074  QLSSIWGAEDTCDAFAFQRHSLSEKVQNASKHTSLETCKQIT-LANTTALGASVEDLPGA  2250
               SS+W  EDT DAF+FQ+     +  N SK   + +  + + L   T+      +LP  
Sbjct  578   GSSSLWDDEDTRDAFSFQK----TRRANLSKFADVASNGEPSQLVEATSGDEGPCNLPDQ  633

Query  2251  R-NPVDGDAATADLESVHYSPTSDVV-KDFNGLSDVYWPDSLGPLDLDIPSSRYHSELIL  2424
             + +P++   A          PT D   K   GL+DVYWPDSLGPLDLDI SS+Y  +L L
Sbjct  634   QGDPMEEGPADP--------PTMDSPGKTIYGLADVYWPDSLGPLDLDIRSSKYAEDLNL  685

Query  2425  SDSLGGLTQLIASSLDAFQNCSFFGADKKE  2514
             SDSLGGL++LIA+SLDAFQNCS FG D K+
Sbjct  686   SDSLGGLSRLIATSLDAFQNCSLFGFDSKK  715



>ref|XP_009143543.1| PREDICTED: TSL-kinase interacting protein 1 isoform X2 [Brassica 
rapa]
Length=720

 Score =   615 bits (1587),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 365/750 (49%), Positives = 476/750 (63%), Gaps = 63/750 (8%)
 Frame = +1

Query  316   EQQIASSQEHAIPEQAMFSQDHSVTEQLASFEEHSALQQPVKRQTRKWAAWTREEEESFF  495
             E+++  S + ++ E    +Q+ +    +AS    +  Q P K+ TR+WAAWT +EEESFF
Sbjct  11    EKEVTLSSQGSVEEGREPNQNSN--PNIASSASIAVPQFPAKKPTRQWAAWTHQEEESFF  68

Query  496   SALRHVGKNFEKITSRVQSKNKDQVRHYYYRLVRRMNKLLGPELCLNAKNSRDTNAAMLR  675
             +ALR VGKNF KITSRVQSKNKDQVRHYYYRLVRRMNKLLGPEL L+AKN +DTNAAMLR
Sbjct  69    TALRQVGKNFAKITSRVQSKNKDQVRHYYYRLVRRMNKLLGPELSLDAKNPKDTNAAMLR  128

Query  676   WWSLLEKYSCKASKLHLKPRRFKIFIETLENQLLKDRKKNVRRCFSQGENTSTAPI-SVS  852
             WWSLLEKYSCKASKLHLKPRRFK+F+E LE+QLLKDR+K+ R+    GE+ S+A + ++S
Sbjct  129   WWSLLEKYSCKASKLHLKPRRFKLFLEALEHQLLKDRRKSSRKRACHGESFSSASLGNIS  188

Query  853   NQGRGASGHDGRSVKVVLLDNQDIHKFGSGKGSSLKRHINIGANSTSCKADSSLLKTARH  1032
             +  R   G D    K++L D+Q++     G+ S+ K   ++G      K D++L +  R 
Sbjct  189   SHSR-ERGLDNSPFKLILCDSQNVRP---GRAST-KHGESLGVRLGDEKEDTALGRVGRQ  243

Query  1033  RRKIGATAAYKRWEKAAIAGVSLVADAAEHLERTTTDKEDGHFQDSNVRNVFEHSGKDPH  1212
             RRK G    Y++WEKAAI GVSLVADAAEHLERT+ DK+    +D         +GK P 
Sbjct  244   RRKQG----YRKWEKAAIDGVSLVADAAEHLERTSIDKDVNGQKDLGPTRYL--TGKSPL  297

Query  1213  VFPDLLHNSFNETNLQNSGKLKLQLFPVDDGTRRALELDNHNPYLELTLSTRKKMSSVLE  1392
               P       ++ N+Q S KLKLQLFP+D+ TRR+LE D HNP+LELTLS RKK+SSVLE
Sbjct  298   SLPSSGEAPLSDANMQFSAKLKLQLFPIDESTRRSLEADKHNPHLELTLSNRKKISSVLE  357

Query  1393  HLNRKWGNSSMACGDLMLFPYHLHKENLVHFQKWTKDTTLTAADVYALTGSPPVFRLRYG  1572
             HLNRKWG+SS ACG+LMLFPY+  KE +   Q+WT D+ L+A +VY++ GSP +FRLRYG
Sbjct  358   HLNRKWGSSSCACGELMLFPYNARKETVALHQRWTSDSFLSAVEVYSMVGSPSLFRLRYG  417

Query  1573  WF-SNAEVAF--RAPVSSAIPSRHDANMNIMPESSVGVLQAPS--------TDPPKEANG  1719
             WF  +A  +F  + P S++ PS  D NMN+   +   +L   S        T  P+ +  
Sbjct  418   WFVQDASGSFISQVPTSASYPSLED-NMNVDAANEDNMLLTESGPLSNKHPTSEPETSVV  476

Query  1720  CVSMNTVNASRSSDHTEAVLWENPETVVTEAEVDDLQFNKAGTSCVGEWADSLTNISVGD  1899
             C +  T    R++       +E     +T  +      +   T   G WADSLTNIS+GD
Sbjct  477   CTAAET----RAN-------YEPASATITPFD----HLSSGNTLSAGAWADSLTNISIGD  521

Query  1900  LLSEAPDMEDANCITSSIHSSSNYIHQIPFSCDSFDAAIAAHIKKHQNVTDSQAALP--S  2073
             LLSEAPD  D      +   S   +  + F+ DSFDAAIAAHI +HQN   S   +P  S
Sbjct  522   LLSEAPDCVDP----PAAEGSHCLLRDVSFASDSFDAAIAAHILRHQN-KPSGGLIPVTS  576

Query  2074  QLSSIWGAEDTCDAFAFQRHSLSEKVQNASKHTSLETCKQIT-LANTTALGASVEDLPGA  2250
               SS+W  EDT DAF+FQ+     +  N SK   + +  + + L   T+      +LP  
Sbjct  577   GSSSLWDDEDTRDAFSFQK----TRRANLSKFADVASNGEPSQLVEATSGDEGPCNLPDQ  632

Query  2251  R-NPVDGDAATADLESVHYSPTSDVV-KDFNGLSDVYWPDSLGPLDLDIPSSRYHSELIL  2424
             + +P++   A          PT D   K   GL+DVYWPDSLGPLDLDI SS+Y  +L L
Sbjct  633   QGDPMEEGPADP--------PTMDSPGKTIYGLADVYWPDSLGPLDLDIRSSKYAEDLNL  684

Query  2425  SDSLGGLTQLIASSLDAFQNCSFFGADKKE  2514
             SDSLGGL++LIA+SLDAFQNCS FG D K+
Sbjct  685   SDSLGGLSRLIATSLDAFQNCSLFGFDSKK  714



>emb|CDY33210.1| BnaC04g08290D [Brassica napus]
Length=703

 Score =   614 bits (1584),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 354/730 (48%), Positives = 451/730 (62%), Gaps = 62/730 (8%)
 Frame = +1

Query  352   PEQAMFSQDHSVTEQLASFEEHSALQQPVKRQTRKWAAWTREEEESFFSALRHVGKNFEK  531
             P++     + +    +AS    +  Q P K+ TR+WAAWT +EEESFF+ALR VGKNF K
Sbjct  21    PKEEGRESNQNSNPNIASSASIAVPQFPAKKPTRQWAAWTHQEEESFFTALRQVGKNFAK  80

Query  532   ITSRVQSKNKDQVRHYYYRLVRRMNKLLGPELCLNAKNSRDTNAAMLRWWSLLEKYSCKA  711
             ITSRVQSKNKDQVRHYYYRLVRRMNKLLGPEL L+AKN +DTNAAMLRWWSLLEKYSCKA
Sbjct  81    ITSRVQSKNKDQVRHYYYRLVRRMNKLLGPELSLDAKNPKDTNAAMLRWWSLLEKYSCKA  140

Query  712   SKLHLKPRRFKIFIETLENQLLKDRKKNVRRCFSQGENTSTAPISVSNQGRGASGHDGRS  891
             SKLHLKPRRFK+F+E LE+QLLKDR+K+ R+    GE   ++P                 
Sbjct  141   SKLHLKPRRFKLFLEALEHQLLKDRRKSSRKRACHGERLDSSPF----------------  184

Query  892   VKVVLLDNQDIHKFGSGKGSSLKRHINIGANSTSCKADSSLLKTARHRRKIGATAAYKRW  1071
              K++L D+Q++     G+ S+ K   ++G      K D++L +  R RRK    A Y++W
Sbjct  185   -KLILCDSQNVRP---GRAST-KHGESLGVRLGDEKEDTALGRAGRQRRK---QAGYRKW  236

Query  1072  EKAAIAGVSLVADAAEHLERTTTDKEDGHFQDSNVRNVFEHSGKDPHVFPDLLHNSFNET  1251
             EKAAI GVSLVADAAEHLERT+ DK+    +D         +GK P   P       ++ 
Sbjct  237   EKAAIDGVSLVADAAEHLERTSIDKDVNGQKDLGPTRYL--TGKSPLSLPSSGEAPLSDA  294

Query  1252  NLQNSGKLKLQLFPVDDGTRRALELDNHNPYLELTLSTRKKMSSVLEHLNRKWGNSSMAC  1431
             N+Q S KLKLQLFP+D+ TRR+LE D HNP+LELTLS RKK+SSVLEHLNRKWG+SS AC
Sbjct  295   NMQFSAKLKLQLFPIDESTRRSLEADKHNPHLELTLSNRKKISSVLEHLNRKWGSSSCAC  354

Query  1432  GDLMLFPYHLHKENLVHFQKWTKDTTLTAADVYALTGSPPVFRLRYGWF---SNAEVAFR  1602
             G+LMLFPY+  KE +   Q+WT D+ L+A +VY++ GSP +FRLRYGWF   ++  +  +
Sbjct  355   GELMLFPYNARKETVALHQRWTNDSFLSAVEVYSMVGSPSLFRLRYGWFVQDASGCLISQ  414

Query  1603  APVSSAIPSRHDANMNIMPESSVGVL---QAPSTDPPKEANGCVSMNTVNASRSSDHTEA  1773
              P S++ PS  D NMN+   + V +L     P ++    +    S+    A+ + D+   
Sbjct  415   VPTSASCPSLED-NMNVDDANEVNMLLTESGPLSNKRPTSEQATSV-ACAAAEARDN---  469

Query  1774  VLWENPETVVTEAEVDDLQFNKAGTSCVGEWADSLTNISVGDLLSEAPDMEDANCITSSI  1953
               +E     +T  +      N   T   G WADSLTNIS+GDLLSEAPD  D      + 
Sbjct  470   --YEPASAAITPFD----HLNSGNTLSAGAWADSLTNISIGDLLSEAPDCVDP----PAT  519

Query  1954  HSSSNYIHQIPFSCDSFDAAIAAHIKKHQNVTDSQAALPSQLSSIWGAEDTCDAFAFQRH  2133
               S   +  + F+ DSFDAAIAAHI +HQN       + S  SS+W  EDT DAF+FQ+ 
Sbjct  520   EGSHCLLRDVSFASDSFDAAIAAHILRHQNKPSGLIPVTSGSSSLWDDEDTRDAFSFQK-  578

Query  2134  SLSEKVQNASKHTSLETCKQITLANTTALGASVEDLPGARNPVDGDAATADL--ESVHYS  2307
                 +  N SK           +A+       VE   G   P +      D   E     
Sbjct  579   ---TRRANLSKFAD--------VASNGEPSQVVEATSGDEGPCNLPDQQGDPMEEGPADP  627

Query  2308  PTSDVV-KDFNGLSDVYWPDSLGPLDLDIPSSRYHSELILSDSLGGLTQLIASSLDAFQN  2484
             PT D   K   GL+DVYWPDSLGPLDLDI SS+Y  +L LSDSLGGL++LIA+SLDAFQN
Sbjct  628   PTMDSPGKTIYGLADVYWPDSLGPLDLDIRSSKYAEDLNLSDSLGGLSRLIATSLDAFQN  687

Query  2485  CSFFGADKKE  2514
             CS FG D K+
Sbjct  688   CSLFGFDSKK  697



>ref|XP_008791198.1| PREDICTED: TSL-kinase interacting protein 1 isoform X1 [Phoenix 
dactylifera]
 ref|XP_008791199.1| PREDICTED: TSL-kinase interacting protein 1 isoform X1 [Phoenix 
dactylifera]
 ref|XP_008791200.1| PREDICTED: TSL-kinase interacting protein 1 isoform X1 [Phoenix 
dactylifera]
Length=838

 Score =   618 bits (1593),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 368/753 (49%), Positives = 460/753 (61%), Gaps = 89/753 (12%)
 Frame = +1

Query  436   VKRQTRKWAAWTREEEESFFSALRHVGKNFEKITSRVQSKNKDQVRHYYYRLVRRMNKLL  615
              K+ TR+WAAWTR+EEE+FF+ALR VGKNFEKIT RVQSKNKDQVRHYYYRLVRRMNKLL
Sbjct  94    AKKPTRQWAAWTRQEEENFFNALRQVGKNFEKITCRVQSKNKDQVRHYYYRLVRRMNKLL  153

Query  616   GPELCLNAKNSRDTNAAMLRWWSLLEKYSCKASKLHLKPRRFKIFIETLENQLLKDRKKN  795
             GP   L+AKNS+DTNAAMLRWWSLLEKYSC ASKLHLKPRRFKIF+E LENQLLKDR K 
Sbjct  154   GPGFYLDAKNSKDTNAAMLRWWSLLEKYSCTASKLHLKPRRFKIFVEALENQLLKDRNKT  213

Query  796   VRRCFSQGENTSTAPISVSNQGRGASGHDGRSVKVVLLDNQDIHKFGSGKGSSLKRHINI  975
              RR    G+  S  P S     R   G+D RS+K++ +D Q  +K G+ KG+S KR++N 
Sbjct  214   KRR-RPHGDIYSPTP-STQVVSR-VPGNDARSLKLLTVDAQTTNKVGATKGASFKRNVN-  269

Query  976   GANSTSCKADSSLLKTARHRRKIG--ATAAYKRWEKAAIAGVSLVADAAEHLERTTTDKE  1149
              AN    K DSS +KTA+ +R+ G  A+A Y+ WE+AA+AGVSLVADAAE LER   D  
Sbjct  270   -ANMNFSKGDSS-MKTAKQKRRTGVVASAEYRSWEEAAMAGVSLVADAAEQLERAAND--  325

Query  1150  DGHFQDSNVRNVFEHSGKDPHVFPDLLHNSFN-------ETNLQNSGKLKLQLFPVDDGT  1308
                      RN F   G+  ++ P  ++N  N       ET +Q   KLKLQLFP+D+GT
Sbjct  326   ---------RNGFS-DGRTCNMLPKEMYNCNNEICSHQIETIMQPRVKLKLQLFPIDEGT  375

Query  1309  RRALELDNHNPYLELTLSTRKKMSSVLEHLNRKWGNSSMACGDLMLFPYHLHKENLVHFQ  1488
             RRALE D HNP+LELTLS RKK+SSVL+HLNRKWGNSS+A G+LMLFPY +    L   +
Sbjct  376   RRALEKDAHNPHLELTLSARKKISSVLDHLNRKWGNSSIASGELMLFPYDVQLLELASCR  435

Query  1489  KWT-KDTTLTAADVYALTGSPPVFRLRYGWFSNAEV------AFRAPVSSA---------  1620
             +W   DT  +AADVYA  GSP +FRLRYGW S+ E+          P+ S          
Sbjct  436   RWAITDTAASAADVYATIGSPAIFRLRYGWLSSVELRSGIVHVPSTPIQSENCMLSEGIL  495

Query  1621  ----IPSRHDA---NMNIMP---------------ESSVGVLQAPSTDPPKEANGCVSMN  1734
                 I S  DA   N +  P               ++SV  L   + DPP+  N    + 
Sbjct  496   NGNNIMSGPDAKCINTDAPPIREFSGQPQQLSEDQQTSVIALATSNIDPPEPMNEVNCVK  555

Query  1735  TVNASRSSDHTEAVLWENPETVVTEAEVDDLQFNKAGTSCV----GEWADSLTNISVGDL  1902
              ++    +   E       ET    +         AG  CV    GEWADSLTN+SVGDL
Sbjct  556   PMHELPENSGKEPFSRSGEETKDLSSGPQQEDEGNAGMKCVTLSAGEWADSLTNVSVGDL  615

Query  1903  LSEAPDMEDANCITSSIHSSSNYIHQIPFSCDSFDAAIAAHIKKHQNVTDSQAALPSQLS  2082
             LSEA      +C+ S   +S++ + QI FSCDSFDAAIAAHI  HQ +  +  A     +
Sbjct  616   LSEASKAAKDSCLDSPAGASASCLQQIHFSCDSFDAAIAAHISGHQLLPPTTQAFQ---A  672

Query  2083  SIWGAEDTCDAFAFQRHSLSEKVQNASKHTSLETCKQITLANTTALGASVEDLPGARNPV  2262
             SIW AE+TCD F+F   ++     N S ++S+   ++IT  ++      +++L  +R P 
Sbjct  673   SIWNAEETCDEFSFP--AMKRDGSNPSTNSSIGASREITYPSSLGFQGYLKELAESR-PA  729

Query  2263  DGDAATADLESVHYSPTSDVVKDFNG---------LSDVYWPDSLGPLDLDIPSSRYHSE  2415
             D  +     E V   P SD    FN          L D+YWPDSLGPLDLD+PS RYH +
Sbjct  730   DDPSN----EYVTAEPESDKDSSFNDRDNPQKDPCLQDIYWPDSLGPLDLDMPSPRYHGQ  785

Query  2416  -LILSDSLGGLTQLIASSLDAFQNCSFFGADKK  2511
              L+  DSL GL++LIASSLDAFQNCSFF  +K+
Sbjct  786   DLVFGDSLSGLSRLIASSLDAFQNCSFFSLEKE  818



>emb|CDX75001.1| BnaA05g07470D [Brassica napus]
Length=716

 Score =   612 bits (1579),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 357/712 (50%), Positives = 459/712 (64%), Gaps = 63/712 (9%)
 Frame = +1

Query  427   QQPVKRQTRKWAAWTREEEESFFSALRHVGKNFEKITSRVQSKNKDQVRHYYYRLVRRMN  606
             Q P K+ TR+WAAWT +EEESFF+ALR VGKNF KITSRVQSKNKDQVRHYYYRLVRRMN
Sbjct  46    QFPAKKPTRQWAAWTHQEEESFFTALRQVGKNFAKITSRVQSKNKDQVRHYYYRLVRRMN  105

Query  607   KLLGPELCLNAKNSRDTNAAMLRWWSLLEKYSCKASKLHLKPRRFKIFIETLENQLLKDR  786
             KLLGPEL L+AKN +DTNAAMLRWWSLLEKYSCKASKLHLKPRRFK+F+E LE+QLLKDR
Sbjct  106   KLLGPELSLDAKNPKDTNAAMLRWWSLLEKYSCKASKLHLKPRRFKLFLEALEHQLLKDR  165

Query  787   KKNVRRCFSQGENTSTAPI-SVSNQGRGASGHDGRSVKVVLLDNQDIHKFGSGKGSSLKR  963
             +K+ R+    GE+ S+A + ++S+  R   G D    K++L D+Q++     G+ S+ K 
Sbjct  166   RKSSRKRACHGESFSSASLGNISSHSR-ERGLDNSPFKLILCDSQNVRP---GRAST-KH  220

Query  964   HINIGANSTSCKADSSLLKTARHRRKIGATAAYKRWEKAAIAGVSLVADAAEHLERTTTD  1143
               ++G      K D++L +  R RRK    A Y++WEKAAI GVSLVADAAEHLERT+ D
Sbjct  221   GESLGVRLGDEKEDTALGRVGRQRRK---QAGYRKWEKAAIDGVSLVADAAEHLERTSID  277

Query  1144  KEDGHFQDSNVRNVFEHSGKDPHVFPDLLHNSFNETNLQNSGKLKLQLFPVDDGTRRALE  1323
             K+    +D         +GK P   P       ++ N+Q S KLKLQLFP+D+ TRR+LE
Sbjct  278   KDVNGQKDLGPTRYL--TGKSPLSLPSSGEAPLSDANMQFSAKLKLQLFPIDESTRRSLE  335

Query  1324  LDNHNPYLELTLSTRKKMSSVLEHLNRKWGNSSMACGDLMLFPYHLHKENLVHFQKWTKD  1503
              D HNP+LELTLS RKK+SSVLEHLNRKWG+SS ACG+LMLFPY+  KE +   Q+WT D
Sbjct  336   ADKHNPHLELTLSNRKKISSVLEHLNRKWGSSSCACGELMLFPYNARKETVALHQRWTND  395

Query  1504  TTLTAADVYALTGSPPVFRLRYGWF-SNAEVAFRAPVSSAIPSRHDANMNI---------  1653
             + L+A +VY++ GSP +FRLRYGWF  +A  +F     S +P+  + NMN+         
Sbjct  396   SFLSAVEVYSMVGSPSLFRLRYGWFVQDASGSF----ISQVPTSLEDNMNVDAANEDNML  451

Query  1654  MPESSVGVLQAPSTDPPKEANGCVSMNTVNASRSSDHTEAVLWENPETVVTEAEVDDLQF  1833
             + ES     + P+++P   A   V     +A+ + D+     +E     +T  +      
Sbjct  452   LTESGPLSNKHPTSEP---ATSVV----CDAAEARDN-----YEPASATITPFD----HL  495

Query  1834  NKAGTSCVGEWADSLTNISVGDLLSEAPDMEDANCITSSIHSSSNYIHQIPFSCDSFDAA  2013
             +   T   G WADSLTNIS+GDLLSEAPD  D      +   S   +  + F+ DSFDAA
Sbjct  496   SSVNTLSAGAWADSLTNISIGDLLSEAPDCVDP----PTAEGSHCLLRDVSFASDSFDAA  551

Query  2014  IAAHIKKHQNVTDSQAALP--SQLSSIWGAEDTCDAFAFQRHSLSEKVQNASKHTSLETC  2187
             IAAHI +HQN   S   +P  S  SS+W  EDT DAF+FQ+     +  N SK   + + 
Sbjct  552   IAAHILRHQN-KPSGGLIPVTSGSSSLWDDEDTRDAFSFQK----TRRANLSKFADVASN  606

Query  2188  KQIT-LANTTALGASVEDLPGAR-NPVDGDAATADLESVHYSPTSDVV-KDFNGLSDVYW  2358
              + + L   T+      +LP  + +P++   A          PT D   K   GL+DVYW
Sbjct  607   GEPSQLVEATSGDEGPCNLPDQQGDPMEEGPADP--------PTMDSPGKTIYGLADVYW  658

Query  2359  PDSLGPLDLDIPSSRYHSELILSDSLGGLTQLIASSLDAFQNCSFFGADKKE  2514
             PDSLGPLDLDI SS+Y  +L LSDSLGGL++LIA+SLDAFQNCS FG D K+
Sbjct  659   PDSLGPLDLDIRSSKYAEDLNLSDSLGGLSRLIATSLDAFQNCSLFGFDSKK  710



>ref|XP_010923259.1| PREDICTED: TSL-kinase interacting protein 1 isoform X2 [Elaeis 
guineensis]
Length=775

 Score =   602 bits (1551),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 366/766 (48%), Positives = 457/766 (60%), Gaps = 120/766 (16%)
 Frame = +1

Query  421   ALQQPVKRQTRKWAAWTREEEESFFSALRHVGKNFEKITSRVQSKNKDQVRHYYYRLVRR  600
             A Q+P K+ TR+WAAWTR+EEE+FF+ALR VGK                VRHYYYRLVRR
Sbjct  41    ATQKPAKKPTRQWAAWTRQEEENFFNALRQVGK----------------VRHYYYRLVRR  84

Query  601   MNKLLGPELCLNAKNSRDTNAAMLRWWSLLEKYSCKASKLHLKPRRFKIFIETLENQLLK  780
             MNKLLGP   L+AKNS+DTNAAMLRWWSLLEKYSC ASKLHLKPRRFKIF+E LENQLLK
Sbjct  85    MNKLLGPGFYLDAKNSKDTNAAMLRWWSLLEKYSCTASKLHLKPRRFKIFVEALENQLLK  144

Query  781   DRKKNVRRCFSQGENTSTAPISVSNQGRGASGHDGRSVKVVLLDNQDIHKFGSGKGSSLK  960
             DR K  RR       +ST    V ++   A G+D RS+K++ +D Q  +K G+ KG+S K
Sbjct  145   DRNKTKRRRPHGDIYSSTPSTQVVSR---APGNDARSLKLLTVDAQTTNKVGATKGASFK  201

Query  961   RHINIGANSTSCKADSSLLKTARHRRKIG--ATAAYKRWEKAAIAGVSLVADAAEHLERT  1134
             R++N  AN    K DSS +KTA+ +R+ G  A+A Y+ WE+AA+AGVSLVADAAE LER 
Sbjct  202   RNVN--ANMNFSKGDSS-MKTAKQKRRTGVVASAEYRSWEEAAMAGVSLVADAAEQLERA  258

Query  1135  TTDKEDGHFQDSNVRNVFEHSGKDPHVFPDLLHNSFN--------ETNLQNSGKLKLQLF  1290
                        +N RN F   G   ++ P  ++NS N        ET +Q   KLKLQLF
Sbjct  259   -----------ANERNGFSDGGT-CNMLPKEMYNSNNEICSHQIKETIMQPHVKLKLQLF  306

Query  1291  PVDDGTRRALELDNHNPYLELTLSTRKKMSSVLEHLNRKWGNSSMACGDLMLFPYHLHKE  1470
             P+D+GTR+ALE D HNP+LELTLS RKK+SSVL+HLNRKWGNSS+A G+LMLFPY++   
Sbjct  307   PIDEGTRKALEKDAHNPHLELTLSARKKISSVLDHLNRKWGNSSIASGELMLFPYNVQLV  366

Query  1471  NLVHFQKWT-KDTTLTAADVYALTGSPPVFRLRYGWFSNAEV---AFRAP----------  1608
              L   ++WT KDT  +AADVYA  GSP VFRLRYGWFS+AE+    F  P          
Sbjct  367   ELASCRRWTIKDTAASAADVYATIGSPAVFRLRYGWFSSAELRSGTFHVPSPDIQSENCM  426

Query  1609  VSSAI---------PSRHDANMNIMP---------------ESSVGVLQAPSTDPPKEAN  1716
             +S  I         P     N +  P               ++SV  L   + DPP+   
Sbjct  427   LSKGILNGNNIMNGPDAKCINADAPPITEFVGQPQQLSEDQQTSVIALATSNIDPPE---  483

Query  1717  GCVSMNTVNASRSSDHTEAVLWENPETVVTEAEVDDLQFN-------KAGTSCV----GE  1863
                 MN VN     D        +P +   E E  DL           AG  CV    GE
Sbjct  484   ---PMNEVNCVEPMDELPENSGRSPFSTSGE-ETKDLSGGPQQEDEVNAGMKCVILSAGE  539

Query  1864  WADSLTNISVGDLLSEAPDMEDANCITSSIHSSSNYIHQIPFSCDSFDAAIAAHIKKHQN  2043
             WADSLTNISVGDLLSEA       C+ S   +S + + QI FSCDSFDAAIAAHI  HQ 
Sbjct  540   WADSLTNISVGDLLSEASKAAKDGCLNSPAGASVSCLQQIQFSCDSFDAAIAAHISGHQL  599

Query  2044  VTDSQAALPSQLSSIWGAEDTCDAFAFQRHSLSEKVQNASKHTSLETCKQITLANTTALG  2223
             +  +  A     +SIW AE+TCD F+F   ++ +     S ++S+E C++IT  ++    
Sbjct  600   LPPTMQA---SHASIWNAEETCDEFSFP--AMQQDGSKPSTNSSVEACREITYPSSLGFQ  654

Query  2224  ASVEDLPGARNPVDGDAATADLESVHYSPTSDVVKDFNG---------LSDVYWPDSLGP  2376
               +++L  +R P D  +     E +   P SD    F+          L D+YWPDSLGP
Sbjct  655   DYLKELAESR-PADDPSQ----ECLTAEPESDKDLSFDDRDNPQKDPCLQDIYWPDSLGP  709

Query  2377  LDLDIPSSRYHSE-LILSDSLGGLTQLIASSLDAFQNCSFFGADKK  2511
             LDLDIPS RYH + L   DSL GL++LIASSLDAFQNCSFF  +K+
Sbjct  710   LDLDIPSPRYHGQDLGFGDSLSGLSRLIASSLDAFQNCSFFSLEKE  755



>gb|AAD31581.1| hypothetical protein [Arabidopsis thaliana]
Length=713

 Score =   599 bits (1544),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 354/727 (49%), Positives = 450/727 (62%), Gaps = 83/727 (11%)
 Frame = +1

Query  418   SALQQPVKRQTRKWAAWTREEEESFFSALRHVGKNFEKITSRVQSKNKDQVRHYYYRLVR  597
             S  Q P K+ TR+WAAWT +EEESFF+ALR VGKNFEKITSRVQSKNKDQVRHYYYRLVR
Sbjct  32    SITQFPAKKPTRQWAAWTHQEEESFFTALRQVGKNFEKITSRVQSKNKDQVRHYYYRLVR  91

Query  598   RMNKLLGPELCLNAKNSRDTNAAMLRWWSLLEKYSCKASKLHLKPRRFKIFIETLENQLL  777
             RMNKLLGP+L L+AKN +DTNAAMLRWWSLLEKYSCKASKLHLKPRRFK+FIE LE+QLL
Sbjct  92    RMNKLLGPDLSLDAKNPKDTNAAMLRWWSLLEKYSCKASKLHLKPRRFKLFIEALEHQLL  151

Query  778   KDRKKNVRRCFSQGENTSTAPI-SVSNQGRGASGHDGRSVKVVLLDNQDIHKFGSGKGSS  954
             KDR+K++R+   QGEN S+A + ++S+  R   G D R  K++L D Q++ K G G+ S+
Sbjct  152   KDRRKSIRKRTCQGENLSSASLGNISSHSR-ERGLDNRPFKLILSDGQNVKKLGPGRAST  210

Query  955   LKRHINIGANSTSCKADSSLLKTARHRRKIGATAAYKRWEKAAIAGVSLVADAAEHLERT  1134
              K   ++  N    K D++  +  R RRK    A Y++WEKAAI GVSLVADAAEHLERT
Sbjct  211   -KHGESLSVNLGDEKEDTAFGRGGRQRRK---QAGYRKWEKAAIDGVSLVADAAEHLERT  266

Query  1135  TTDKEDGHFQDSNVRNVFEHSGKDPHVFPDLLHNSFNETNLQNSGKLKLQLFPVDDGTRR  1314
             + DK+     D         +GK P           ++ N+Q S KLKLQLFP+D+ TRR
Sbjct  267   SIDKDMDDQTDLGPTRYL--TGKSPLSLCSAGDVPLSDANMQFSAKLKLQLFPIDECTRR  324

Query  1315  ALELDNHNPYLELTLSTRKKMSSVLEHLNRKWGNSSMACGDLMLFPYHLHKENLVHFQKW  1494
             +LE+D HNP+LELTLS RKK+SSVLEHLNRKWG+SS A G+L+LFPY+  KE +   Q  
Sbjct  325   SLEMDKHNPHLELTLSNRKKISSVLEHLNRKWGSSSCATGELLLFPYNARKETVTCHQ--  382

Query  1495  TKDTTLTAADVYALTGSPPVFRLRYGWF---SNAEVAFRAPVSSAIPSRHDANMNI----  1653
                                    RYGWF   ++  +  + P S   PS  D +MN+    
Sbjct  383   -----------------------RYGWFVHDASGSIISQVPTSDPCPSLED-DMNVDRLN  418

Query  1654  ---MPESSVGVLQAPSTD------PPKEANGCVSMNTVNASRSSDHTEAVLWENPETVVT  1806
                M  +  G L   ST        P +   C S      +RS D      +E   T +T
Sbjct  419   EVNMLLTESGPLSVHSTAEQTTSVEPSQGLVCASGVHDRPARSRDD-----YEPASTSIT  473

Query  1807  EAEVDDLQFNKAGTSCVGEWADSLTNISVGDLLSEAPDMEDANCITSSIHSSSNY-IHQI  1983
               E      +       GEWADSLTNIS+GDLLSE PD  D++ +       S+Y +  +
Sbjct  474   PLE----HLSGGNAQSPGEWADSLTNISIGDLLSEVPDDIDSDGVDPPATEGSHYLLRDV  529

Query  1984  PFSCDSFDAAIAAHIKKHQNVTDSQAALPSQLSSIWGAEDTCDAFAFQRHSLSEKVQNAS  2163
             PF+ DSFDAAIAAHI +HQN   +Q  L S  SS+W  E+T DAF+FQ++    +  N++
Sbjct  530   PFTSDSFDAAIAAHILRHQNKPSAQLPLTSGSSSLWDDEETRDAFSFQKN----RFANST  585

Query  2164  KHTSLETCKQITLAN---TTALGASVEDLPGARNPVD-------GDAATADLESVHYSPT  2313
             +  S+ + K +   N   +  + AS  D  G+ NP D       G A    ++S   +P 
Sbjct  586   ELASVASPKGVGRVNGEPSQLVEASSGD-EGSYNPHDDGDPMEEGPADPHTMDSPGKTPC  644

Query  2314  SDVVKDFNGLSDVYWPDSLGPLDLDIPSSRYHSELILSDSLGGLTQLIASSLDAFQNCSF  2493
                     GL+DVYWPDSLGPLDLDI SS+Y  +LILS+SLGGL++LIA+SLDAFQNCS 
Sbjct  645   --------GLADVYWPDSLGPLDLDIRSSKYTDDLILSESLGGLSRLIATSLDAFQNCSL  696

Query  2494  FGADKKE  2514
             FG D K+
Sbjct  697   FGFDNKK  703



>gb|EPS71953.1| hypothetical protein M569_02804, partial [Genlisea aurea]
Length=657

 Score =   583 bits (1502),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/715 (49%), Positives = 441/715 (62%), Gaps = 80/715 (11%)
 Frame = +1

Query  436   VKRQTRKWAAWTREEEESFFSALRHVGKNFEKITSRVQSKNKDQVRHYYYRLVRRMNKLL  615
             VK+QTR+WAAWTR+EEESFFSALR VGKNF+KIT RVQSKNKDQVRHYYYRL+RRMNKLL
Sbjct  1     VKKQTRRWAAWTRQEEESFFSALRQVGKNFDKITCRVQSKNKDQVRHYYYRLLRRMNKLL  60

Query  616   GPELCLNAKNSRDTNAAMLRWWSLLEKYSCKASKLHLKPRRFKIFIETLENQLLKDRKKN  795
              P+LCLNAKNS+ TN AMLRWWSLLEKYSCKASKLHLKPRRFKIF+E LENQLL+DRKK+
Sbjct  61    DPDLCLNAKNSKYTNTAMLRWWSLLEKYSCKASKLHLKPRRFKIFVENLENQLLRDRKKS  120

Query  796   VRRCFSQGENTSTAPISVSNQGRGASGHDGRSVKVVLLDNQDIHKFGSGKGSSLKRHINI  975
             ++R  S GEN S+     S+    +SGHD R++KVVL      +K G             
Sbjct  121   MKRRVSSGENNSSFHNIPSSDQIKSSGHDCRAIKVVLESQNVNNKVG-------------  167

Query  976   GANSTSCKADSSLLKTARHRRKIG---ATAAYKRWEKAAIAGVSLVADAAEHLERTTTDK  1146
                           KT+  R K G      AYKRWEKAAIAGVSLVADAAEHLER  TDK
Sbjct  168   --------------KTSNRRWKRGDLHTFTAYKRWEKAAIAGVSLVADAAEHLERVDTDK  213

Query  1147  EDGHFQDSNVRNVFEHSGKDPHVFPDLL----HNSFNETNLQNSGKLKLQLFPVDDGTRR  1314
             E        + N  + S   P V P  +    +N F E+ + +  K+KLQLFPVD+ TRR
Sbjct  214   E--------IENSLDGSRHGPAVAPQRVASPPYNIFKES-VHSHAKIKLQLFPVDERTRR  264

Query  1315  ALELDNHNPYLELTLSTRKKMSSVLEHLNRKWGNSSMACGDLMLFPYHLHKENLVHFQKW  1494
              LE++NHNP+LELTLSTRKK+SSVLEHLNRKW N+S    DL+LFP+ +  ENL+ +QKW
Sbjct  265   ILEVENHNPHLELTLSTRKKISSVLEHLNRKWRNTSFQSRDLVLFPFWVQGENLLGYQKW  324

Query  1495  TKDTTLTAADVYALTGSPPVFRLRYGWFSNAEV-AFRAPVSSAIPSRHDANMNIMPESSV  1671
             TK++   AADVY L GSP  FRLRYGWFS  E+ +  A +SS +    +         + 
Sbjct  325   TKESPFCAADVYCLVGSPATFRLRYGWFSRDEMNSGPAQLSSQMDPNDERAKTCSSSEAA  384

Query  1672  GVLQAPSTDPPKEANGCVSMNTVNASRSSDHTEAVLWENPETV-VTEAEVDDLQFNKAGT  1848
               L   ST  P E+         ++   +D T  +   +   + V E   + +    +  
Sbjct  385   NTLILTSTSRPCESLNLPVFEQNSSGGLNDETALIHGRDISHISVVEHNENMVYLAYSFL  444

Query  1849  SCVGEWADSLT-NISVGDLLSEA---PDMED--ANCITSSIHSSSNYIHQ--IPFSCDSF  2004
                GEWA++LT ++++ DLLS +   P+M+   A  I++ +H      HQ  +PFSCDSF
Sbjct  445   LSAGEWANTLTDDVTLRDLLSGSGSLPNMDTDPAPLISNGVH------HQMLLPFSCDSF  498

Query  2005  DAAIAAHIKKHQNVTDSQ--AALPSQLSSIWGAEDTCDAFAFQRHSLSEKVQNASKHTSL  2178
             DAAIAAHI KHQN T        P   SSIW AE+T DAF+FQ+  +     +  K  + 
Sbjct  499   DAAIAAHIYKHQNRTGGSEPGNAPPSSSSIWEAEETRDAFSFQKPVVLRVDDDRDKAAAS  558

Query  2179  ETCKQITLANTTALGASV-EDLPGARNPVDGDAATADLESVHYSPTSDVVKDFNGLSDVY  2355
              T       +T  L A V E+L    + + GD   A              KD  GL+D+Y
Sbjct  559   STS-----YHTGELPADVDENLTRNDDNLFGDHNLA-----------GSTKDLGGLTDIY  602

Query  2356  WPDSLGPLDLDI--PSSRYHSELILSDSLGGLTQLIASSLDAFQNCSFFGADKKE  2514
             WP+SLGPL+LD+   + RY ++LILSDSL G   L+A+SLDAFQN SFFG DKKE
Sbjct  603   WPESLGPLELDVAPAACRYSTDLILSDSLSGFNWLVANSLDAFQNWSFFGFDKKE  657



>ref|XP_006428400.1| hypothetical protein CICLE_v10011099mg [Citrus clementina]
 ref|XP_006428402.1| hypothetical protein CICLE_v10011099mg [Citrus clementina]
 gb|ESR41640.1| hypothetical protein CICLE_v10011099mg [Citrus clementina]
 gb|ESR41642.1| hypothetical protein CICLE_v10011099mg [Citrus clementina]
Length=543

 Score =   558 bits (1439),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/581 (53%), Positives = 388/581 (67%), Gaps = 77/581 (13%)
 Frame = +1

Query  211   IQMELQLTLGSEADHYLRSSPRKDGDFTFGKVNCVEQQIASSQEHAIPEQAMFSQDHSVT  390
             +QME QL++ SE   + R++P +D D          + +ASS           + D+ + 
Sbjct  1     MQMESQLSMNSEVHLHPRNTPVQDED---------PRVVASS-----------TLDNVI-  39

Query  391   EQLASFEEHSALQQPVKRQTRKWAAWTREEEESFFSALRHVGKNFEKITSRVQSKNKDQV  570
                        LQQ  KR TR+WAAWTREEEESFF+ALR VGKNFEKIT RV+SKNKDQV
Sbjct  40    -----------LQQSAKRPTRQWAAWTREEEESFFTALRQVGKNFEKITHRVRSKNKDQV  88

Query  571   RHYYYRLVRRMNKLLGPELCLNAKNSRDTNAAMLRWWSLLEKYSCKASKLHLKPRRFKIF  750
             RHYYYRLVRRMNKLLGP LCL+AKNS+DTNAAMLRWWSLLEKYSCKASKLHLKPRRFKIF
Sbjct  89    RHYYYRLVRRMNKLLGPGLCLDAKNSKDTNAAMLRWWSLLEKYSCKASKLHLKPRRFKIF  148

Query  751   IETLENQLLKDRKKNVRRCFSQGENTS-TAPISVSNQGRGASGHDGRSVKVVLLDNQDIH  927
             +E LE+QLLKDRK++VR+  SQ ++ S TAP  + NQ R  SG D  +VK+VL+D+Q+I 
Sbjct  149   VEALEHQLLKDRKRSVRKRPSQRDSYSPTAPTPIPNQSR-TSGQDTCTVKLVLVDSQNIQ  207

Query  928   KFGSGKGSSLKRHINIGANSTSCKADSSLLKTARHRRKIG--ATAAYKRWEKAAIAGVSL  1101
             K G  KG SLKR++NIG N ++ KADS+ LK  R RRK    ++AAYK+WEKAAIAGVSL
Sbjct  208   KLGPAKG-SLKRNVNIGINRSNNKADSATLK-PRQRRKPDSISSAAYKKWEKAAIAGVSL  265

Query  1102  VADAAEHLERTTTDKEDGHFQDSNVRNVFEHSGKDPHVFPDLLHNSFNETNLQNSGKLKL  1281
             VADAAEHLERT+TDKE    Q+       E + K     P +    F E N+Q   KLKL
Sbjct  266   VADAAEHLERTSTDKEVERQQE---HTALETADKVLPPLPTISPTLFAEGNVQTPVKLKL  322

Query  1282  QLFPVDDGTRRALELDNHNPYLELTLSTRKKMSSVLEHLNRKWGNSSMACGDLMLFPYHL  1461
             QL+P+DDGTR+ALE+DNHNP+LELTLSTRKK+SSVLEHLNRKWGN+S+A G+LMLFPY  
Sbjct  323   QLYPIDDGTRKALEMDNHNPHLELTLSTRKKISSVLEHLNRKWGNASVASGELMLFPYGA  382

Query  1462  HKENLVHFQKWTKDTTLTAADVYALTGSPPVFRLRYGWFSNAEVAFRAP----VSSAIPS  1629
              +ENLV +Q+WT+D+  +AADVYA+ GSPP+FRLRYGWFS+ E+ + AP     S  +PS
Sbjct  383   QRENLVGYQRWTQDSVFSAADVYAMIGSPPMFRLRYGWFSDTELGYVAPHAPSASGCVPS  442

Query  1630  RHDANMNIMPESSVGVL--QAPST--------DP--------------------PKEANG  1719
              H+ N+    E  V  +  + PST        DP                    PKE + 
Sbjct  443   FHNINVENKKEQIVDSVPGRVPSTSDQSENFVDPYKKLTSVKENDTFATSSSSMPKETSS  502

Query  1720  CVSMNTVNASRSSDHTEAVLWENPET--VVTEAEVDDLQFN  1836
              +S +  + + +SD    V W   ET   +   + +D+  N
Sbjct  503   YISTSKCDIADTSDPAANVSWPRKETGNEIITGQAEDMVMN  543



>ref|XP_006649712.1| PREDICTED: TSL-kinase interacting protein 1-like [Oryza brachyantha]
Length=753

 Score =   558 bits (1438),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 343/736 (47%), Positives = 452/736 (61%), Gaps = 55/736 (7%)
 Frame = +1

Query  427   QQPVKRQTRKWAAWTREEEESFFSALRHVGKNFEKITSRVQSKNKDQVRHYYYRLVRRMN  606
             Q+ V++ TR+WAAWTR+EE++FF+ALR VGKNFEKIT RVQSKNKDQVRHYYYRLVRRM 
Sbjct  31    QKTVRKPTRQWAAWTRQEEQNFFNALRQVGKNFEKITLRVQSKNKDQVRHYYYRLVRRMK  90

Query  607   KLLGPELCLNAKNSRDTNAAMLRWWSLLEKYSCKASKLHLKPRRFKIFIETLENQLLKDR  786
             KLLGPE  L+AKNS+DT AAMLRWWSLLEK+SC ASKLHLKPRRFK F+E L NQLLKDR
Sbjct  91    KLLGPEFSLDAKNSKDTIAAMLRWWSLLEKFSCSASKLHLKPRRFKTFVEALGNQLLKDR  150

Query  787   KKNVRRCFSQGENTSTAPISVSNQGRGASGHDGRSVKVVLLDNQDIHKFGSGKGSSLKR-  963
              K  R+C  +G+   ++  SV N+     G++  SVK + +D  +  K  S KG+  K+ 
Sbjct  151   NKTRRKC-PRGDVCLSSSSSVLNR---TPGNESFSVKFLPVDVSNGSKVASSKGAFFKKV  206

Query  964   -HINIGANSTSCKADSSLLKTARHRRKIG---ATAAYKRWEKAAIAGVSLVADAAEHLER  1131
                N    S + K D S  +T + +R+ G   A+AAYK+WE+AA+AGVSLVADAAE LER
Sbjct  207   AESNCNNKSGATKGDLSATRTVKQKRRAGGGVASAAYKKWERAAMAGVSLVADAAEELER  266

Query  1132  TTTDKEDGHFQDSNVRNVFEHSGKDPHVFPDLLHNSFNETNLQNSGKLKLQLFPVDDGTR  1311
              T    D      +  NV      D H+   L  N   E + Q   KLKLQLFP++D TR
Sbjct  267   NTVSV-DARMLSPSSSNV---CTADDHIKEALSQNHIKEADQQAPAKLKLQLFPINDATR  322

Query  1312  RALELDNHNPYLELTLSTRKKMSSVLEHLNRKWGNSSMACGDLMLFPYHLHKENLVHFQK  1491
             +ALE   HNP+LELTLS RKK+SSVLEHLNRKWGNSS+A G+L+LFPY  H+E+L  +Q+
Sbjct  323   KALEKGEHNPHLELTLSARKKISSVLEHLNRKWGNSSIASGELLLFPYCAHQEDLATYQR  382

Query  1492  WTKDTTLTAADVYALTGSPPVFRLRYGWFSNAEVAFRAPVSSAIPSRHDANMNIMPES--  1665
             WT    +  ADV+    SP VFRLRYGWFS AE+   A VS  I   H  N  ++PE   
Sbjct  383   WTTKDNVAVADVFLSVNSPSVFRLRYGWFSLAEL--EAGVSE-ISLTHFENC-LIPEDIH  438

Query  1666  ----SVGVLQAPST---DPPKEANGCVSMNTVNASRSSDHTEAVLWENPE--TVVTEAEV  1818
                 S   +Q   T      +E + C S +      +   +     E PE  T VT +++
Sbjct  439   AKSPSEACVQKDGTSLGSCVREQHPCNSKDQSALLLAMSSSTGKSAEVPEQSTDVTSSQL  498

Query  1819  -----DDLQFNKA-----GTSCV----GEWADSLTNISVGDLLSEAPDMEDANCITSSIH  1956
                  D +  N+      G  C     GEWAD+LT+ISVG LL+EA    + +C  +SI 
Sbjct  499   GRQKHDQVTTNQVFEADPGMDCTAVSEGEWADTLTDISVGYLLTEASRGANTDCPGTSIA  558

Query  1957  SSSNYIHQIPFSCDSFDAAIAAHIKKHQNVTDSQAALPSQLSSIWGAEDTCDAFAFQ-RH  2133
              ++ ++   P S DSFDAA+A H  +++     Q AL S  S+IWGAE+TCD F+F    
Sbjct  559   KNALFLEN-PCSYDSFDAAVALHASRYKAA--EQPALASH-STIWGAEETCDEFSFSVAS  614

Query  2134  SLSEKVQNASKHTSLETCKQITLANTTALGASVEDLPG---ARNPVDGDAATADLESVHY  2304
             S  ++  N S  +S ++   +  +N+      ++DL G   A NP   DA   +      
Sbjct  615   SRKQEGSNNSASSSPDSDCDVHPSNSEGFQGFLQDLAGADVADNPCIDDAKDLEALCAES  674

Query  2305  SPTSD---VVKDFNGLSDVYWPDSLGPLDLDIPSSRYHS-ELILSDSLGGLTQLIASSLD  2472
              P SD    +KD   L+D+YWPDSLGPLDL+IPS+ YH+ +L+L DS     +++A+SLD
Sbjct  675   PPRSDNDSTLKD-QSLADLYWPDSLGPLDLEIPSATYHADDLLLGDSQNSWNRIMANSLD  733

Query  2473  AFQNCSFFGADKKEPV  2520
             AF+N SFF  +K + +
Sbjct  734   AFRNLSFFTTEKNDSI  749



>ref|XP_004985049.1| PREDICTED: TSL-kinase interacting protein 1-like [Setaria italica]
Length=761

 Score =   558 bits (1438),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/750 (45%), Positives = 457/750 (61%), Gaps = 59/750 (8%)
 Frame = +1

Query  391   EQLASFEEHSALQQPVKRQTRKWAAWTREEEESFFSALRHVGKNFEKITSRVQSKNKDQV  570
             ++L S +     ++P K+ TR+WAAWTR+EEE+FF+ALR VGKNFEKIT RVQSKNKDQV
Sbjct  27    QKLDSAQPSDPNRKPAKKPTRQWAAWTRQEEENFFNALRQVGKNFEKITHRVQSKNKDQV  86

Query  571   RHYYYRLVRRMNKLLGPELCLNAKNSRDTNAAMLRWWSLLEKYSCKASKLHLKPRRFKIF  750
             RHYYYRLVRRM KLLGP   L+AKNS+DT AAMLRWWSLLEK+SC ASKLHLKPRRFK F
Sbjct  87    RHYYYRLVRRMKKLLGPGFSLDAKNSKDTIAAMLRWWSLLEKFSCSASKLHLKPRRFKTF  146

Query  751   IETLENQLLKDRKKNVRRCFSQGENTSTAPISVSNQGRGASGHDGRSVKVVLLDNQDIHK  930
             +E L NQLLKDR K+ R+C  + +   ++P  +  +     G++   +K + +D Q+  +
Sbjct  147   VEALGNQLLKDRNKSRRKC-PRVDMCVSSPSPIVGK---TPGNEAFPLKFLPVDAQNGSR  202

Query  931   FGSGKGSSLKRHINIGAN-STSCKADSSLLKTARHRRKIG---ATAAYKRWEKAAIAGVS  1098
               S KG+  KR     ++ S + K D S  +T + +R+ G   A+AAYK+WE+AA+AGVS
Sbjct  203   VASPKGAFFKRMAETNSSKSGATKGDLSATRTVKQKRRAGGVVASAAYKKWERAAMAGVS  262

Query  1099  LVADAAEHLERTTTDKEDGHFQDSNVRNVFEHSGKDPHVFPDLLHNSFNETNLQNSGKLK  1278
             LVADAAE LER T +   G   + + R +   S K   V   +  N   E + Q   KLK
Sbjct  263   LVADAAEELERNTINP--GMLCNVDARTLTSSSDKLSTV-DGISTNHMKEADSQAPAKLK  319

Query  1279  LQLFPVDDGTRRALELDNHNPYLELTLSTRKKMSSVLEHLNRKWGNSSMACGDLMLFPYH  1458
             LQLFP+++ TR+ALE D HNP+LELTLS+RKK+SSVLEHLNRKWGNS++A G+L+LFPY 
Sbjct  320   LQLFPINEATRKALEKDEHNPHLELTLSSRKKISSVLEHLNRKWGNSNIASGELILFPYC  379

Query  1459  LHKENLVHFQKWTKDTTLTAADVYALTGSPPVFRLRYGWFSNAEVAFRAPVSSAIPSRHD  1638
              H+E+L  +Q+WT   T+  ADV+    SP VFRLRYGWFS  E+   A VS  I   H 
Sbjct  380   AHQEDLATYQRWTTRDTVAVADVFLSVNSPSVFRLRYGWFSLVEL--EAGVSE-ISLTHF  436

Query  1639  ANMNIMPESSVGVLQAPSTDPP-------------KEANGCVSMNTVNASRSSDHTEAVL  1779
              N  +MPE     +++PS D                E   C S++       +  +   +
Sbjct  437   ENC-MMPEDI--QVKSPSGDKSCVQKDDALLSSNIHEQYPCSSIDQSALLHITPSSTGKI  493

Query  1780  WENPETV-------------VTEAEVDDLQFNKAGTSCVGEWADSLTNISVGDLLSEAPD  1920
              E PE               VT+A  DD   N A  S  GEWAD+LT+ISVG LL+EA  
Sbjct  494   TELPEQTPSQFGSQKQVRVPVTQAFEDDQGMNCAAIS-EGEWADTLTDISVGYLLTEASK  552

Query  1921  MEDANCI-TSSIHSSSNYIHQIPFSCDSFDAAIAAHIKKHQNVTDSQAALPSQLSSIWGA  2097
                 +CI TSS+ ++   + + P S DSFDAA+A H+ + Q  ++  A  P   S+IWG 
Sbjct  553   GTHLDCIGTSSVKNA--LLLENPCSYDSFDAAVALHVSRFQ-ASEQPAHTPH--STIWGG  607

Query  2098  EDTCDAFAFQ-RHSLSEKVQNASKHTSLETCKQITLANTTALGASVEDLPG----ARNPV  2262
             E+TCD F+F    S  ++  N    +S +T  ++   N+      ++DL G    A NP 
Sbjct  608   EETCDEFSFNLSASRKQEGSNTPSSSSPDTDNEVHPLNSEGFQGFLQDLTGGEAAADNPC  667

Query  2263  DGDAATADLESVHYSPTSDVVKDF--NGLSDVYWPDSLGPLDLDIPSSRYHS-ELILSDS  2433
             + D    +       P +D   D     L+D+YWPDSLGPLDLDIPSSRY + +LI+ DS
Sbjct  668   NDDGKDREEFCAKSPPRNDDTNDLKDQSLADIYWPDSLGPLDLDIPSSRYQADDLIIGDS  727

Query  2434  LGGLTQLIASSLDAFQNCSFFGA-DKKEPV  2520
                  +++A+SLDAF+N SFF + DK + +
Sbjct  728   QNSWNRMMANSLDAFRNLSFFSSVDKNDSI  757



>ref|XP_010228893.1| PREDICTED: TSL-kinase interacting protein 1-like [Brachypodium 
distachyon]
Length=747

 Score =   553 bits (1426),  Expect = 2e-179, Method: Compositional matrix adjust.
 Identities = 335/738 (45%), Positives = 444/738 (60%), Gaps = 65/738 (9%)
 Frame = +1

Query  427   QQPVKRQTRKWAAWTREEEESFFSALRHVGKNFEKITSRVQSKNKDQVRHYYYRLVRRMN  606
             Q+P K+ TR+WAAWT +EEESFF+ALR VGKNFEKIT RVQSKNKDQVRHYYYRLVRRM 
Sbjct  31    QKPAKKPTRQWAAWTHQEEESFFNALRQVGKNFEKITLRVQSKNKDQVRHYYYRLVRRMK  90

Query  607   KLLGPELCLNAKNSRDTNAAMLRWWSLLEKYSCKASKLHLKPRRFKIFIETLENQLLKDR  786
             K+LGPE  L+A+NS+DT AAMLRWWSLLEK+SC ASKLHL+PRR K F+ETL NQLLKDR
Sbjct  91    KILGPEFSLDARNSKDTIAAMLRWWSLLEKFSCSASKLHLRPRRMKTFVETLGNQLLKDR  150

Query  787   KKNVRRCFSQGENTSTAPISVSNQGRGASGHDGRSVKVVLLDNQDIHKFGSGKGSSLKRH  966
             K+  R+C       +++PI     G  +S     SV+++ +D QD       KG+  KR 
Sbjct  151   KRTRRKCPQGDMYLASSPILSKTPGNQSS-----SVELLPMDAQDGSIVAYSKGAFSKRV  205

Query  967   INIGAN-STSCKADSSLLKTARHRRK---IGATAAYKRWEKAAIAGVSLVADAAEHLERT  1134
             +   +N S + K D S  +T + +R+   +GATAAYK+WE+AA+AGVSLVADAAE +ER+
Sbjct  206   VETNSNRSGAIKGDLSATRTVKQKRRAGGVGATAAYKKWERAAMAGVSLVADAAEEIERS  265

Query  1135  TTDKEDGHFQDSNVRNV----FEHSGKDPHVFPDLLHNSFNETNLQNSGKLKLQLFPVDD  1302
                +        N+ NV       S  +      +  N   E + Q   KLKLQLFP+++
Sbjct  266   IVTQ--------NLCNVDARPLASSSNNVATVEAIGTNQIKEADPQAPSKLKLQLFPINE  317

Query  1303  GTRRALELDNHNPYLELTLSTRKKMSSVLEHLNRKWGNSSMACGDLMLFPYHLHKENLVH  1482
              TR+ALE D HNP+LELTLS RKKMSSVLEHLNRKWGNS++ACG+L+LFPY  H+E+L  
Sbjct  318   ATRKALEKDEHNPHLELTLSARKKMSSVLEHLNRKWGNSNIACGELVLFPYCAHQEDLAT  377

Query  1483  FQKWTKDTTLTAADVYALTGSPPVFRLRYGWFSNAEVAFRAPVSSAIPSRHDANMNIMPE  1662
             +Q+WT   T+  ADV+    SP VFRLRYGWFS AE+   A VS  I   H  N  ++PE
Sbjct  378   YQRWTTRDTVAVADVFLSVNSPSVFRLRYGWFSLAEL--EAGVSE-ISLTHFENC-MIPE  433

Query  1663  SSVGVLQAPSTDPPKEANGCVSMNTVNASRSSDHTEAVLWENPETVVTEAE---------  1815
               V V  +      K++       + + S +S+   ++L   P +    AE         
Sbjct  434   -DVQVKSSSEACAQKDSTSLGGFTSEHPSCNSNDQSSLLLGTPSSTDKNAEEEQSTNVSP  492

Query  1816  -----------VDDLQFNKAGTSCVG----EWADSLTNISVGDLLSEAPDMEDANCITSS  1950
                         D       G  CV     EWAD+LT+ISVG LL+EA      +C  +S
Sbjct  493   SQSGSQHQEQVPDQATEVYQGMKCVAMSEVEWADTLTDISVGYLLTEASKGAKLDCPGTS  552

Query  1951  IHSSSNYIHQIPFSCDSFDAAIAAHIKKHQNVTDSQAALPSQLSSIWGAEDTCDAFAFQR  2130
               S  N +     S DSFDAA+A H  ++Q     Q+A  S  S+IWGAE+TCD F+F+ 
Sbjct  553   --SVKNALLDNSCSYDSFDAAVALHTSRYQ--VAEQSAHTSH-SNIWGAEETCDEFSFKS  607

Query  2131  HS-LSEKVQNASKHTSLETCKQITLANTTALGASVEDLPG---ARNPVDGDAATADLESV  2298
              +   ++  N    +  ++  ++   N+      +EDL G   A NP   D    +L ++
Sbjct  608   AAGRKQEGSNTLAGSPPDSDNEVHSPNSEGFRGFLEDLAGGEVADNPCIYDVKDIELCAI  667

Query  2299  HYSPTSDV---VKDFNGLSDVYWPDSLGPLDLDIPSSRYHSE-LILSDSLGGLTQLIASS  2466
                P +D    +KD   L+D+YWPDSLGPLDL+IPS+RY  E   L DS     +++ASS
Sbjct  668   SL-PQNDKDSGLKD-QSLADIYWPDSLGPLDLEIPSTRYQPEDFFLGDSQNSWGRMMASS  725

Query  2467  LDAFQNCSFFGADKKEPV  2520
             LDAF+N SFF +DK + +
Sbjct  726   LDAFRNLSFFTSDKNDSI  743



>ref|XP_006293769.1| hypothetical protein CARUB_v10022743mg [Capsella rubella]
 gb|EOA26667.1| hypothetical protein CARUB_v10022743mg [Capsella rubella]
Length=712

 Score =   548 bits (1412),  Expect = 7e-178, Method: Compositional matrix adjust.
 Identities = 305/594 (51%), Positives = 394/594 (66%), Gaps = 35/594 (6%)
 Frame = +1

Query  418   SALQQPVKRQTRKWAAWTREEEESFFSALRHVGKNFEKITSRVQSKNKDQVRHYYYRLVR  597
             S  Q PVK+ TR+WAAWT +EEESFF+ALR VGKNFEKITSRVQSKNKDQVRHYYYRLVR
Sbjct  42    SVAQFPVKKPTRQWAAWTHQEEESFFTALRQVGKNFEKITSRVQSKNKDQVRHYYYRLVR  101

Query  598   RMNKLLGPELCLNAKNSRDTNAAMLRWWSLLEKYSCKASKLHLKPRRFKIFIETLENQLL  777
             RMNKLLGPELCL+AKN +DTNAAMLRWWSLLEKYSCKASKLHLKPRRFK+FIE LE+QLL
Sbjct  102   RMNKLLGPELCLDAKNPKDTNAAMLRWWSLLEKYSCKASKLHLKPRRFKLFIEALEHQLL  161

Query  778   KDRKKNVRRCFSQGENTSTAPI-SVSNQGRGASGHDGRSVKVVLLDNQDIHKFGSGKGSS  954
             KDR+K++R+   QGEN S+A + ++S+  R   G D R  K++L D+Q++ K GSG+ S+
Sbjct  162   KDRRKSIRKRACQGENFSSASLGNISSHSR-ERGLDNRPFKLILSDSQNVKKLGSGRAST  220

Query  955   LKRHINIGANSTSCKADSSLLKTARHRRKIGATAAYKRWEKAAIAGVSLVADAAEHLERT  1134
              K   ++G N    K DS+  +  R RRK G    Y++WEK AI GVSLVADAAEHLERT
Sbjct  221   -KHGESLGVNLGDEKEDSAFGRGGRQRRKQG----YRKWEKLAIDGVSLVADAAEHLERT  275

Query  1135  TTDKEDGHFQDSNVRNVFEHSGKDPHVFPDLLHNSFNETNLQNSGKLKLQLFPVDDGTRR  1314
             + DK+    +D         +GK P           ++ N+Q S KLKLQLFP+D+ TRR
Sbjct  276   SIDKDMDDQKDLGSPRYL--TGKSPLSLCSSGDVPLSDANMQFSAKLKLQLFPIDECTRR  333

Query  1315  ALELDNHNPYLELTLSTRKKMSSVLEHLNRKWGNSSMACGDLMLFPYHLHKENLVHFQKW  1494
             +LE+D HNP+LELTLS RKK+SSVLEH+NRKWG+SS A G+LMLFPY+  KE +   Q+W
Sbjct  334   SLEMDKHNPHLELTLSNRKKISSVLEHINRKWGSSSCATGELMLFPYNARKETVTCHQRW  393

Query  1495  TKDTTLTAADVYALTGSPPVFRLRYGWF---SNAEVAFRAPVSSAIPSRHDANMNIMPES  1665
             T D+ L+AA+V+++ GSP +FRLRYGWF   S+     + P S   PS H+ +MN+   +
Sbjct  394   THDSFLSAAEVHSMVGSPSIFRLRYGWFVHDSSGSFISQVPTSDLCPS-HEDDMNVDGVN  452

Query  1666  SVGVL-------------QAPSTDPPKEANGCVSMNTVNASRSSDHTEAVLWENPETVVT  1806
              V +L             + P++  P     C S +T +    S       +E     +T
Sbjct  453   EVNMLLTESGPLSVHLTAEQPTSVEPSLGLVCASGDTDDRPTESRDD----YEPASLTIT  508

Query  1807  EAEVDDLQFNKAGTSCVGEWADSLTNISVGDLLSEAPDMEDANCITSSIHSSSNY-IHQI  1983
               E      +       GEWADSLTNIS+GDLLSE PD  D++ +       S+Y +  +
Sbjct  509   PFE----NLSSVNAQSAGEWADSLTNISIGDLLSEVPDDIDSDDVDPPATEGSHYLLRDV  564

Query  1984  PFSCDSFDAAIAAHIKKHQNVTDSQAALPSQLSSIWGAEDTCDAFAFQRHSLSE  2145
              F+ +SFDAAIAAHI +HQN   +     S  SS+W  E+T DAF+FQ++  ++
Sbjct  565   SFASESFDAAIAAHILRHQNKPSTLLPSTSGSSSLWDDEETRDAFSFQKNRFAD  618



>ref|NP_001049513.1| Os03g0241100 [Oryza sativa Japonica Group]
 gb|ABF94893.1| myb family transcription factor, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF11427.1| Os03g0241100 [Oryza sativa Japonica Group]
 dbj|BAG95672.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE58671.1| hypothetical protein OsJ_10091 [Oryza sativa Japonica Group]
Length=719

 Score =   545 bits (1404),  Expect = 1e-176, Method: Compositional matrix adjust.
 Identities = 341/737 (46%), Positives = 449/737 (61%), Gaps = 78/737 (11%)
 Frame = +1

Query  451   RKWAAWTREEEESFFSALRHVGKNFEKITSRVQSKNKDQVRHYYYRLVRRMNKLLGPELC  630
             R+WAAWTR+EE++FF+ALR VGKNFEKIT RVQSK+KDQVRHYYYRLVRRM KLLGPE  
Sbjct  10    RQWAAWTRQEEQNFFNALRQVGKNFEKITLRVQSKSKDQVRHYYYRLVRRMKKLLGPEFS  69

Query  631   LNAKNSRDTNAAMLRWWSLLEKYSCKASKLHLKPRRFKIFIETLENQLLKDRKKNVRRCF  810
             L+AKNS+DT AAML WWSLLEK+SC ASKLHLKPRRFK F+E L NQLLKDR K  ++C 
Sbjct  70    LDAKNSKDTIAAMLCWWSLLEKFSCSASKLHLKPRRFKTFVEALGNQLLKDRNKTRKKC-  128

Query  811   SQGENTSTAPISVSNQGRGASGHDGRSVKVVLLDNQDIHKFGSGKGSSLKR--HINIGAN  984
              +G+   ++  S  N+     G++  SVK++ +D  +  K GS KGS  K+    N    
Sbjct  129   PRGDVCLSSSSSAVNR---TPGNESFSVKLLAVDVSNGSKVGSSKGSFFKKVTEPNCSNK  185

Query  985   STSCKADSSLLKTARHRRKIG---ATAAYKRWEKAAIAGVSLVADAAEHLERTTTDKEDG  1155
             S + K D S  +T + +R+ G   A+AAYK+WE+AA+AGVSLVADAAE LER T + +  
Sbjct  186   SGATKGDLSATRTVKQKRRAGGVVASAAYKKWERAAMAGVSLVADAAEELERNTVNAD--  243

Query  1156  HFQDSNVRNVFEHSGKDPHVFPDLLHNSFNETNLQNSGKLKLQLFPVDDGTRRALELDNH  1335
                      +   S  +      L  N   E + Q   KLKLQLFP+++ TR+ALE D H
Sbjct  244   -------ARMLSPSSSNACTVDGLGTNHIKEADQQAPAKLKLQLFPINEATRKALEKDEH  296

Query  1336  NPYLELTLSTRKKMSSVLEHLNRKWGNSSMACGDLMLFPYHLHKENLVHFQKWTKDTTLT  1515
             NP+LELTLS RKK+SSVLEHLNRKWGNS++A G+L+LFPY  H+E+L  +Q+WT   T+ 
Sbjct  297   NPHLELTLSARKKISSVLEHLNRKWGNSNIASGELLLFPYCAHQEDLATYQRWTTKDTVA  356

Query  1516  AADVYALTGSPPVFRLRYGWFSNAEVAFRAPVSSAIPSRHDANMNIMPESSVGVLQAPST  1695
              ADV+    SP VFRLRYGWFS AE+   A VS  I   H  N  ++PE     + A S 
Sbjct  357   VADVFLSVNSPSVFRLRYGWFSLAEL--EAGVSE-ISLTHFENC-LIPED----IHAKS-  407

Query  1696  DPPKEANGCVSM--NTVNASRSSDH------TEAVLWENPETV-----VTEAEVDDL--Q  1830
               P EA  CV    N++++     H        A+L+  P +      V E  +D L  Q
Sbjct  408   --PLEA--CVQKDGNSLSSCAPEQHPCGSKDQSALLFAMPSSTGKSAQVPEQCIDVLPSQ  463

Query  1831  FNK---------------AGTSCV----GEWADSLTNISVGDLLSEAPDMEDANCITSSI  1953
             F +                G  C     GEWAD+LT+ISVG LL+EA    + +C  +S+
Sbjct  464   FGRQNQDQVTTNQVFEVDQGMDCAAVSEGEWADTLTDISVGYLLTEASRGANTDCPGTSV  523

Query  1954  HSSSNYIHQIPFSCDSFDAAIAAHIKKHQNVTDSQAALPSQLSSIWGAEDTCDAFAFQR-  2130
               ++  +   P S DSFDAA+A H  ++++    Q AL S  S+IWGAE+TCDAF+F   
Sbjct  524   VKNTLLLEN-PCSYDSFDAAVALHASRYKSA--EQPALASH-STIWGAEETCDAFSFNLP  579

Query  2131  HSLSEKVQNASKHTSLETCKQITLANTTALGASVEDLPG---ARNPVDGDAATADLESVH  2301
              S   +  N S  +S ++   +  +N+      ++DL G   A NP   DA   +     
Sbjct  580   ASRKREGSNNSASSSPDSDSDVHPSNSEGFQCFLQDLAGAAVAHNPCIDDAKDVESLCAE  639

Query  2302  YSPTSD---VVKDFNGLSDVYWPDSLGPLDLDIPSSRYHS-ELILSDSLGGLTQLIASSL  2469
               P SD     KD   L+D+YWPDSLGPLDLDIPS+ YH+ +L+L DS     +++A+SL
Sbjct  640   SPPRSDHDSAPKD-QSLADLYWPDSLGPLDLDIPSATYHADDLLLGDSQNSWNRMMANSL  698

Query  2470  DAFQNCSFFGADKKEPV  2520
             DAF+N SFF ADK + +
Sbjct  699   DAFRNLSFFTADKNDSI  715



>gb|AAP68898.1| hypothetical protein [Oryza sativa Japonica Group]
Length=746

 Score =   546 bits (1406),  Expect = 1e-176, Method: Compositional matrix adjust.
 Identities = 337/739 (46%), Positives = 448/739 (61%), Gaps = 73/739 (10%)
 Frame = +1

Query  436   VKRQTRKWAAWTREEEESFFSALRHVGKNFEKITSRVQSKNKDQVRHYYYRLVRRMNKLL  615
              ++ TR+WAAWTR+EE+SFF+ALR  GKNFEKIT RVQSKNKDQVRHYYYRLVRRM KLL
Sbjct  33    AEKPTRQWAAWTRQEEQSFFNALRLEGKNFEKITLRVQSKNKDQVRHYYYRLVRRMKKLL  92

Query  616   GPELCLNAKNSRDTNAAMLRWWSLLEKYSCKASKLHLKPRRFKIFIETLENQLLKDRKKN  795
             GPE  L+AKNS+DT AAMLRWWSLLEK+SC ASKLHLKPRRFK F+E L NQLLKDR K 
Sbjct  93    GPEFSLDAKNSKDTVAAMLRWWSLLEKFSCSASKLHLKPRRFKTFVEALGNQLLKDRNKT  152

Query  796   VRRCFSQGENTSTAPISVSNQGRGASGHDGRSVKVVLLDNQDIHKFGSGKGSSLKRHINI  975
              ++C  +G+   ++   + N+    +G++  SVK++ +D  +  K  S KG+  KR    
Sbjct  153   RKKC-PRGDECLSSSSPILNR---TAGNESSSVKLLPVDVSNGSKVASSKGAVFKRGAEP  208

Query  976   GAN--STSCKADSSLLKTARHRRKIG---ATAAYKRWEKAAIAGVSLVADAAEHLERTTT  1140
              +N  S S K D S   T + +R+ G   A+ AYK+WE+ A+AGVSLVADAAE LER T 
Sbjct  209   NSNNKSGSTKWDLSATITVKQKRRAGGGIASTAYKKWERDAMAGVSLVADAAEELERNTV  268

Query  1141  DKEDGHFQDS--NVRNVFEHSGKDPHVFPDLLHNSFNETNLQNSGKLKLQLFPVDDGTRR  1314
             + +      S  NV  V      DP        N  NE + Q   KLKLQLFP+++ TR+
Sbjct  269   NVDARTLSPSSNNVCTV-----DDPGT------NRMNEADQQAPAKLKLQLFPINEATRK  317

Query  1315  ALELDNHNPYLELTLSTRKKMSSVLEHLNRKWGNSSMACGDLMLFPYHLHKENLVHFQKW  1494
             ALE D HNP+LELT+S RKK+SSVLEHLNRKWG+S++A G+L+LFPY  H+E+L  +Q+W
Sbjct  318   ALEKDEHNPHLELTVSARKKISSVLEHLNRKWGSSNIASGELLLFPYCAHREDLATYQRW  377

Query  1495  TKDTTLTAADVYALTGSPPVFRLRYGWFSNAEVAFRAPVSSAIPSRHDANMNIMPES---  1665
             T   T+  ADV+    SPPVFRLRYGWFS AE+       S I S H  N  +MPE    
Sbjct  378   TTRDTVVVADVFLSVNSPPVFRLRYGWFSLAELE----GGSGISSTHFKNC-MMPEDIHA  432

Query  1666  ---SVGVLQAPST---DPPKEANGCVSMN--------TVNASRSSDHTE-----AVLWEN  1788
                S   +Q   T       E + C S +        T +  +S+   E        W +
Sbjct  433   KSPSDACVQKDGTFLNSCAPEEHLCNSKDRPALFLAMTFSTGKSAKGQEQHSDFPASWFS  492

Query  1789  PETVVTEAEVDDLQFNKAGTSCV----GEWADSLTNISVGDLLSEAPDMEDANCITSSIH  1956
              +    ++    L+ N  G  C     GEWAD+LT+ISVG LL+EA    + +C  ++I 
Sbjct  493   RQKQEKDSTNQVLEAN-LGMDCAIISEGEWADTLTDISVGYLLTEASIGTNTDCPGTAIA  551

Query  1957  SSSNYIHQIPFSCDSFDAAIAAHIKKHQNVTDSQAALPSQLSSIWGAEDTCDAFAFQRHS  2136
              ++ ++   P S DSFDAA+A H  +H+ V   Q AL S  S+IWGAE+TCD F+F   +
Sbjct  552   KNTLFLEN-PCSYDSFDAAVALHASRHKTV--EQPALASH-STIWGAEETCDEFSF---N  604

Query  2137  LSEKVQNASKHTSLETC----KQITLANTTALGASVEDLPGAR---NPVDGDAATADLES  2295
             L+   +  S +TS  +C      +  + +      ++DL GA+   NP   DA   +   
Sbjct  605   LAASRKQESSNTSASSCPGSDSGVLPSTSQGFQGFLQDLAGAKVADNPCMDDAKDMEALC  664

Query  2296  VHYSPTSDV---VKDFNGLSDVYWPDSLGPLDLDIPSSRYHSE-LILSDSLGGLTQLIAS  2463
              +  P S     +KD   L+D+YW DSLGPLDL+IPS RY +E L+L DS     +++ +
Sbjct  665   ANSPPRSKSDSGLKD-QSLADLYWADSLGPLDLEIPSVRYQAEDLLLGDSQNSWNRMMVN  723

Query  2464  SLDAFQNCSFFGADKKEPV  2520
             SLDAF+N SFF ADK + +
Sbjct  724   SLDAFRNLSFFMADKNDSI  742



>ref|XP_008658849.1| PREDICTED: uncharacterized protein LOC100383221 isoform X2 [Zea 
mays]
Length=711

 Score =   544 bits (1402),  Expect = 2e-176, Method: Compositional matrix adjust.
 Identities = 329/716 (46%), Positives = 447/716 (62%), Gaps = 45/716 (6%)
 Frame = +1

Query  427   QQPVKRQTRKWAAWTREEEESFFSALRHVGKNFEKITSRVQSKNKDQVRHYYYRLVRRMN  606
             +QP K+QTR+WAAWT +EEE+FF+ALR VGKNF+KIT RVQSKNKDQVRHYYYRLVRRM 
Sbjct  19    KQPAKKQTRQWAAWTHQEEENFFNALRQVGKNFDKITHRVQSKNKDQVRHYYYRLVRRMK  78

Query  607   KLLGPELCLNAKNSRDTNAAMLRWWSLLEKYSCKASKLHLKPRRFKIFIETLENQLLKDR  786
             KLLGP   L+AKNS+DT AAMLRWWSLLEK+SC ASKLHLKPRRFK F+E L  QLLKDR
Sbjct  79    KLLGPRFSLDAKNSKDTIAAMLRWWSLLEKFSCSASKLHLKPRRFKTFVEALGKQLLKDR  138

Query  787   KKNVRRCFSQGENTSTAPISVSNQGRGASGHDGRSVKVVLLDNQDIHKFGSGKGSSLKRH  966
              K+ R+  S+ +   ++P  V ++   A G +   VK + +D+Q+  +  S KG+  KR 
Sbjct  139   NKS-RKKHSRVDMCISSPSPVISK---APGDETPPVKFLSIDSQNGSRVASPKGTIFKRI  194

Query  967   IN-IGANSTSCKADSSLLKTARHRRKIG---ATAAYKRWEKAAIAGVSLVADAAEHLERT  1134
                I   S + K D S  +T + +RK G   A+AAYK+WE+AA+AGVSLVADAAE LER 
Sbjct  195   AEPISNKSGTTKGDLSATRTVKQKRKAGGAVASAAYKKWERAAMAGVSLVADAAEELERN  254

Query  1135  TTDKEDGHFQDSNVRNVFEHSGKDPHVFPDLLHNSFNETNLQNSGKLKLQLFPVDDGTRR  1314
             T +   G   + + R +   S +       +  N   ET+ Q   KLKLQLFP+++ TR+
Sbjct  255   TINP--GMLCNVDARTLTSSSDR-LSTGDGISTNHMKETDSQAPVKLKLQLFPINEATRK  311

Query  1315  ALELDNHNPYLELTLSTRKKMSSVLEHLNRKWGNSSMACGDLMLFPYHLHKENLVHFQKW  1494
             ALE D+HNP+LELTLS+RKK+SSVLEHLNRKWGNS++A G+L+LFPY  ++E+L  +Q+W
Sbjct  312   ALEKDDHNPHLELTLSSRKKISSVLEHLNRKWGNSNIASGELILFPYCANQEDLATYQRW  371

Query  1495  TKDTTLTAADVYALTGSPPVFRLRYGWFSNAEVAFRAPVSSAIPSRHDANMNIMPESSVG  1674
             T   T+  ADV+    SP VFRLRYGWFS  E+   A VS    +  +  M   PE  V 
Sbjct  372   TTRDTVAVADVFLSVNSPSVFRLRYGWFSLVELG--AGVSDISLTHFEDCMR--PE--VI  425

Query  1675  VLQAPSTDPPKEANGCVSMNTVNASRSSD-----HTEAVLWENPETVVTEAEVDDLQFNK  1839
              +++PS D       CV  +  N+          H+     +  +  VT+A  DD   N 
Sbjct  426   QVKSPSGD-----KACVQKDGKNSELPDQPANVPHSRFGSQKQVQVPVTQAFEDDQGMNC  480

Query  1840  AGTSCVGEWADSLTNISVGDLLSEAPDMEDANCITSSIHSSSNYIHQIPFSCDSFDAAIA  2019
                S V EWAD+LT+ISV  LL+EA   +D +C+ +S+        + P S DSFDA +A
Sbjct  481   VAISEV-EWADTLTDISVEHLLTEA--SKDLDCVGTSVKDP--LFLENPCSYDSFDAVVA  535

Query  2020  AHIKKHQNVTDSQAALPSQLSSIWGAEDTCDAFAFQRHSLSEKVQNASKHTSLETCKQIT  2199
              H  ++Q  ++  A  P   S+IWGAE+TCD F+F   +  ++  + +  +S +T  ++ 
Sbjct  536   LHASRYQ-ASEQPAHAPH--SNIWGAEETCDEFSFNLSASRKQEGSNTSSSSPDTDNEVH  592

Query  2200  LANTTALGASVEDLPG----ARNPVDGDAATADLESVHYSPTSDVVKDFNG--LSDVYWP  2361
              +N+      ++DL G    A NP + DA   +       P +D   +     L+D+YWP
Sbjct  593   PSNSEGFRGFLQDLTGRETDADNPCNDDAKDEEEFYAKSPPRNDKTNELKDQPLADIYWP  652

Query  2362  DSLGPLDLDIPSSRYHSELIL---SDSLGGLTQLIASSLDAFQNCSFFGADKKEPV  2520
             DSLGPLDLDIP+ RY ++ IL   S S     +L+A+SLDAF+N SFF +DK + +
Sbjct  653   DSLGPLDLDIPAVRYQTDDILIGDSQSSWNWNRLMANSLDAFRNLSFF-SDKNDSI  707



>gb|EAY89204.1| hypothetical protein OsI_10700 [Oryza sativa Indica Group]
Length=719

 Score =   544 bits (1401),  Expect = 3e-176, Method: Compositional matrix adjust.
 Identities = 341/737 (46%), Positives = 448/737 (61%), Gaps = 78/737 (11%)
 Frame = +1

Query  451   RKWAAWTREEEESFFSALRHVGKNFEKITSRVQSKNKDQVRHYYYRLVRRMNKLLGPELC  630
             R+WAAWTR+EE++FF+ALR VGKNFEKIT RVQSK+KDQVRHYYYRLVRRM KLLGPE  
Sbjct  10    RQWAAWTRQEEQNFFNALRQVGKNFEKITLRVQSKSKDQVRHYYYRLVRRMKKLLGPEFS  69

Query  631   LNAKNSRDTNAAMLRWWSLLEKYSCKASKLHLKPRRFKIFIETLENQLLKDRKKNVRRCF  810
             L+AKNS+DT AAML WWSLLEK+SC ASKLHLKPRRFK F+E L NQLLKDR K  ++C 
Sbjct  70    LDAKNSKDTIAAMLCWWSLLEKFSCSASKLHLKPRRFKTFVEALGNQLLKDRNKTRKKC-  128

Query  811   SQGENTSTAPISVSNQGRGASGHDGRSVKVVLLDNQDIHKFGSGKGSSLKR--HINIGAN  984
              +G+   ++  S  N+     G++  SVK++ +D  +  K GS KGS  K+    N    
Sbjct  129   PRGDVCLSSSSSAVNR---TPGNESFSVKLLAVDVSNGSKVGSSKGSFFKKVTEPNCSNK  185

Query  985   STSCKADSSLLKTARHRRKIG---ATAAYKRWEKAAIAGVSLVADAAEHLERTTTDKEDG  1155
             S + K D S  +T + +R+ G   A+AAYK+WE+AA+AGVSLVADAAE LER T + +  
Sbjct  186   SGATKGDLSATRTVKQKRRAGGVVASAAYKKWERAAMAGVSLVADAAEELERNTVNAD--  243

Query  1156  HFQDSNVRNVFEHSGKDPHVFPDLLHNSFNETNLQNSGKLKLQLFPVDDGTRRALELDNH  1335
                      +   S  +      L  N   E + Q   KLKLQLFP+++ TR+ALE D H
Sbjct  244   -------ARMLSPSSSNACTVDGLGTNHIKEADQQAPAKLKLQLFPINEATRKALEKDEH  296

Query  1336  NPYLELTLSTRKKMSSVLEHLNRKWGNSSMACGDLMLFPYHLHKENLVHFQKWTKDTTLT  1515
             NP+LELTLS RKK+SSVLEHLNRKWGNS++A G+L+LFPY  H+E+L  +Q+WT   T+ 
Sbjct  297   NPHLELTLSARKKISSVLEHLNRKWGNSNIASGELLLFPYCAHQEDLATYQRWTTKDTVA  356

Query  1516  AADVYALTGSPPVFRLRYGWFSNAEVAFRAPVSSAIPSRHDANMNIMPESSVGVLQAPST  1695
              ADV+    SP VFRLRYGWFS AE+   A VS  I   H  N  ++PE     + A S 
Sbjct  357   VADVFRSVNSPSVFRLRYGWFSLAEL--EAGVSE-ISLTHFENC-LIPED----IHAKS-  407

Query  1696  DPPKEANGCVSM--NTVNASRSSDH------TEAVLWENPETV-----VTEAEVDDL--Q  1830
               P EA  CV    N++++     H        A+L   P +      V E  +D L  Q
Sbjct  408   --PSEA--CVQKDGNSLSSCAPEQHPCGSKDQSALLLAMPSSTGKSAQVPEQCIDVLPSQ  463

Query  1831  FNK---------------AGTSCV----GEWADSLTNISVGDLLSEAPDMEDANCITSSI  1953
             F +                G  C     GEWAD+LT+ISVG LL+EA    + +C  +S+
Sbjct  464   FGRQNQDQVTTNQVFEVDQGMDCAAVSEGEWADTLTDISVGYLLTEASRGANTDCPGTSV  523

Query  1954  HSSSNYIHQIPFSCDSFDAAIAAHIKKHQNVTDSQAALPSQLSSIWGAEDTCDAFAFQR-  2130
               ++  +   P S DSFDAA+A H  ++++    Q AL S  S+IWGAE+TCDAF+F   
Sbjct  524   VKNTLLLEN-PCSYDSFDAAVALHASRYKSA--EQPALASH-STIWGAEETCDAFSFNLP  579

Query  2131  HSLSEKVQNASKHTSLETCKQITLANTTALGASVEDLPG---ARNPVDGDAATADLESVH  2301
              S   +  N S  +S ++   +  +N+      ++DL G   A NP   DA   +     
Sbjct  580   ASRKREGSNNSASSSPDSDSDVHPSNSEGFQCFLQDLAGAAVAHNPCIDDAKDIESLCAE  639

Query  2302  YSPTSD---VVKDFNGLSDVYWPDSLGPLDLDIPSSRYHS-ELILSDSLGGLTQLIASSL  2469
               P SD     KD   L+D+YWPDSLGPLDLDIPS+ YH+ +L+L DS     +++A+SL
Sbjct  640   SPPRSDHDSAPKD-QSLADLYWPDSLGPLDLDIPSATYHADDLLLGDSQNSWNRMMANSL  698

Query  2470  DAFQNCSFFGADKKEPV  2520
             DAF+N SFF ADK + +
Sbjct  699   DAFRNLSFFTADKNDSI  715



>gb|ABF99104.1| ribosomal protein S14p/S29e containing protein, expressed [Oryza 
sativa Japonica Group]
 gb|EEE60012.1| hypothetical protein OsJ_12757 [Oryza sativa Japonica Group]
Length=828

 Score =   545 bits (1403),  Expect = 5e-175, Method: Compositional matrix adjust.
 Identities = 342/772 (44%), Positives = 459/772 (59%), Gaps = 75/772 (10%)
 Frame = +1

Query  337   QEHAIPEQAMFSQDHSVTEQLASFEEHSALQQPVKRQTRKWAAWTREEEESFFSALRHVG  516
             ++  + E   F     +  QL+S  +        ++ TR+WAAWTR+EE+SFF+ALR  G
Sbjct  84    RDAVLIEAICFQDQEKLGVQLSSMPQ--VRPASAEKPTRQWAAWTRQEEQSFFNALRLEG  141

Query  517   KNFEKITSRVQSKNKDQVRHYYYRLVRRMNKLLGPELCLNAKNSRDTNAAMLRWWSLLEK  696
             KNFEKIT RVQSKNKDQVRHYYYRLVRRM KLLGPE  L+AKNS+DT AAMLRWWSLLEK
Sbjct  142   KNFEKITLRVQSKNKDQVRHYYYRLVRRMKKLLGPEFSLDAKNSKDTVAAMLRWWSLLEK  201

Query  697   YSCKASKLHLKPRRFKIFIETLENQLLKDRKKNVRRCFSQGENTSTAPISVSNQGRGASG  876
             +SC ASKLHLKPRRFK F+E L NQLLKDR K  ++C  +G+   ++   + N+    +G
Sbjct  202   FSCSASKLHLKPRRFKTFVEALGNQLLKDRNKTRKKC-PRGDECLSSSSPILNR---TAG  257

Query  877   HDGRSVKVVLLDNQDIHKFGSGKGSSLKRHINIGAN--STSCKADSSLLKTARHRRKIG-  1047
             ++  SVK++ +D  +  K  S KG+  KR     +N  S S K D S   T + +R+ G 
Sbjct  258   NESSSVKLLPVDVSNGSKVASSKGAVFKRGAEPNSNNKSGSTKWDLSATITVKQKRRAGG  317

Query  1048  --ATAAYKRWEKAAIAGVSLVADAAEHLERTTTDKEDGHFQDS--NVRNVFEHSGKDPHV  1215
               A+ AYK+WE+ A+AGVSLVADAAE LER T + +      S  NV  V      DP  
Sbjct  318   GIASTAYKKWERDAMAGVSLVADAAEELERNTVNVDARTLSPSSNNVCTV-----DDPGT  372

Query  1216  FPDLLHNSFNETNLQNSGKLKLQLFPVDDGTRRALELDNHNPYLELTLSTRKKMSSVLEH  1395
                   N  NE + Q   KLKLQLFP+++ TR+ALE D HNP+LELT+S RKK+SSVLEH
Sbjct  373   ------NRMNEADQQAPAKLKLQLFPINEATRKALEKDEHNPHLELTVSARKKISSVLEH  426

Query  1396  LNRKWGNSSMACGDLMLFPYHLHKENLVHFQKWTKDTTLTAADVYALTGSPPVFRLRYGW  1575
             LNRKWG+S++A G+L+LFPY  H+E+L  +Q+WT   T+  ADV+    SPPVFRLRYGW
Sbjct  427   LNRKWGSSNIASGELLLFPYCAHREDLATYQRWTTRDTVVVADVFLSVNSPPVFRLRYGW  486

Query  1576  FSNAEVAFRAPVSSAIPSRHDANMNIMPES------SVGVLQAPST---DPPKEANGCVS  1728
             FS AE+       S I S H  N  +MPE       S   +Q   T       E + C S
Sbjct  487   FSLAELE----GGSGISSTHFKNC-MMPEDIHAKSPSDACVQKDGTFLNSCAPEEHLCNS  541

Query  1729  MN--------TVNASRSSDHTE-----AVLWENPETVVTEAEVDDLQFNKAGTSCV----  1857
              +        T +  +S+   E        W + +    ++    L+ N  G  C     
Sbjct  542   KDRPALFLAMTFSTGKSAKGQEQHSDFPASWFSRQKQEKDSTNQVLEAN-LGMDCAIISE  600

Query  1858  GEWADSLTNISVGDLLSEAPDMEDANCITSSIHSSSNYIHQIPFSCDSFDAAIAAHIKKH  2037
             GEWAD+LT+ISVG LL+EA    + +C  ++I  ++ ++   P S DSFDAA+A H  +H
Sbjct  601   GEWADTLTDISVGYLLTEASIGTNTDCPGTAIAKNTLFLEN-PCSYDSFDAAVALHASRH  659

Query  2038  QNVTDSQAALPSQLSSIWGAEDTCDAFAFQRHSLSEKVQNASKHTSLETC----KQITLA  2205
             + V   Q AL S  S+IWGAE+TCD F+F   +L+   +  S +TS  +C      +  +
Sbjct  660   KTV--EQPALASH-STIWGAEETCDEFSF---NLAASRKQESSNTSASSCPGSDSGVLPS  713

Query  2206  NTTALGASVEDLPGAR---NPVDGDAATADLESVHYSPTSDV---VKDFNGLSDVYWPDS  2367
              +      ++DL GA+   NP   DA   +    +  P S     +KD   L+D+YW DS
Sbjct  714   TSQGFQGFLQDLAGAKVADNPCMDDAKDMEALCANSPPRSKSDSGLKD-QSLADLYWADS  772

Query  2368  LGPLDLDIPSSRYHSE-LILSDSLGGLTQLIASSLDAFQNCSFFGADKKEPV  2520
             LGPLDL+IPS RY +E L+L DS     +++ +SLDAF+N SFF ADK + +
Sbjct  773   LGPLDLEIPSVRYQAEDLLLGDSQNSWNRMMVNSLDAFRNLSFFMADKNDSI  824



>ref|XP_008658848.1| PREDICTED: uncharacterized protein LOC100383221 isoform X1 [Zea 
mays]
 gb|AIB05915.1| MYB-related transcription factor, partial [Zea mays]
Length=737

 Score =   540 bits (1391),  Expect = 2e-174, Method: Compositional matrix adjust.
 Identities = 334/738 (45%), Positives = 453/738 (61%), Gaps = 63/738 (9%)
 Frame = +1

Query  427   QQPVKRQTRKWAAWTREEEESFFSALRHVGKNFEKITSRVQSKNKDQVRHYYYRLVRRMN  606
             +QP K+QTR+WAAWT +EEE+FF+ALR VGKNF+KIT RVQSKNKDQVRHYYYRLVRRM 
Sbjct  19    KQPAKKQTRQWAAWTHQEEENFFNALRQVGKNFDKITHRVQSKNKDQVRHYYYRLVRRMK  78

Query  607   KLLGPELCLNAKNSRDTNAAMLRWWSLLEKYSCKASKLHLKPRRFKIFIETLENQLLKDR  786
             KLLGP   L+AKNS+DT AAMLRWWSLLEK+SC ASKLHLKPRRFK F+E L  QLLKDR
Sbjct  79    KLLGPRFSLDAKNSKDTIAAMLRWWSLLEKFSCSASKLHLKPRRFKTFVEALGKQLLKDR  138

Query  787   KKNVRRCFSQGENTSTAPISVSNQGRGASGHDGRSVKVVLLDNQDIHKFGSGKGSSLKRH  966
              K+ R+  S+ +   ++P  V ++   A G +   VK + +D+Q+  +  S KG+  KR 
Sbjct  139   NKS-RKKHSRVDMCISSPSPVISK---APGDETPPVKFLSIDSQNGSRVASPKGTIFKRI  194

Query  967   IN-IGANSTSCKADSSLLKTARHRRKIG---ATAAYKRWEKAAIAGVSLVADAAEHLERT  1134
                I   S + K D S  +T + +RK G   A+AAYK+WE+AA+AGVSLVADAAE LER 
Sbjct  195   AEPISNKSGTTKGDLSATRTVKQKRKAGGAVASAAYKKWERAAMAGVSLVADAAEELERN  254

Query  1135  TTDKEDGHFQDSNVRNVFEHSGKDPHVFPDLLHNSFNETNLQNSGKLKLQLFPVDDGTRR  1314
             T +   G   + + R +   S +       +  N   ET+ Q   KLKLQLFP+++ TR+
Sbjct  255   TINP--GMLCNVDARTLTSSSDR-LSTGDGISTNHMKETDSQAPVKLKLQLFPINEATRK  311

Query  1315  ALELDNHNPYLELTLSTRKKMSSVLEHLNRKWGNSSMACGDLMLFPYHLHKENLVHFQKW  1494
             ALE D+HNP+LELTLS+RKK+SSVLEHLNRKWGNS++A G+L+LFPY  ++E+L  +Q+W
Sbjct  312   ALEKDDHNPHLELTLSSRKKISSVLEHLNRKWGNSNIASGELILFPYCANQEDLATYQRW  371

Query  1495  TKDTTLTAADVYALTGSPPVFRLRYGWFSNAEVAFRAPVSSAIPSRHDANMNIMPESSVG  1674
             T   T+  ADV+    SP VFRLRYGWFS  E+   A VS    +  +  M   PE  V 
Sbjct  372   TTRDTVAVADVFLSVNSPSVFRLRYGWFSLVELG--AGVSDISLTHFEDCMR--PE--VI  425

Query  1675  VLQAPSTDPP-------------KEANGCVSMNTVNASRSSDHTEAVLWENPETV-----  1800
              +++PS D                E+  C SM  ++ + SS    + L + P  V     
Sbjct  426   QVKSPSGDKACVQKDGTLLSNCTHESYPCSSM-LLHMTPSSTGKNSELPDQPANVPHSRF  484

Query  1801  ---------VTEAEVDDLQFNKAGTSCVGEWADSLTNISVGDLLSEAPDMEDANCITSSI  1953
                      VT+A  DD   N    S V EWAD+LT+ISV  LL+EA   +D +C+ +S+
Sbjct  485   GSQKQVQVPVTQAFEDDQGMNCVAISEV-EWADTLTDISVEHLLTEA--SKDLDCVGTSV  541

Query  1954  HSSSNYIHQIPFSCDSFDAAIAAHIKKHQNVTDSQAALPSQLSSIWGAEDTCDAFAFQRH  2133
                     + P S DSFDA +A H  ++Q  ++  A  P   S+IWGAE+TCD F+F   
Sbjct  542   KDP--LFLENPCSYDSFDAVVALHASRYQ-ASEQPAHAPH--SNIWGAEETCDEFSFNLS  596

Query  2134  SLSEKVQNASKHTSLETCKQITLANTTALGASVEDLPG----ARNPVDGDAATADLESVH  2301
             +  ++  + +  +S +T  ++  +N+      ++DL G    A NP + DA   +     
Sbjct  597   ASRKQEGSNTSSSSPDTDNEVHPSNSEGFRGFLQDLTGRETDADNPCNDDAKDEEEFYAK  656

Query  2302  YSPTSDVVKDFNG--LSDVYWPDSLGPLDLDIPSSRYHSELIL---SDSLGGLTQLIASS  2466
               P +D   +     L+D+YWPDSLGPLDLDIP+ RY ++ IL   S S     +L+A+S
Sbjct  657   SPPRNDKTNELKDQPLADIYWPDSLGPLDLDIPAVRYQTDDILIGDSQSSWNWNRLMANS  716

Query  2467  LDAFQNCSFFGADKKEPV  2520
             LDAF+N SFF +DK + +
Sbjct  717   LDAFRNLSFF-SDKNDSI  733



>gb|EEC76251.1| hypothetical protein OsI_13694 [Oryza sativa Indica Group]
Length=828

 Score =   541 bits (1395),  Expect = 7e-174, Method: Compositional matrix adjust.
 Identities = 340/772 (44%), Positives = 459/772 (59%), Gaps = 69/772 (9%)
 Frame = +1

Query  337   QEHAIPEQAMFSQDHSVTEQLASFEEHSALQQPVKRQTRKWAAWTREEEESFFSALRHVG  516
             ++  + E   F     +  QL+S  +        ++ TR+WAAWTR+EE+SFF+ALR  G
Sbjct  84    RDAVLIEAICFQDQEKLGVQLSSMPQ--VRPASAEKPTRQWAAWTRQEEQSFFNALRLEG  141

Query  517   KNFEKITSRVQSKNKDQVRHYYYRLVRRMNKLLGPELCLNAKNSRDTNAAMLRWWSLLEK  696
             KNFEKIT RVQSKNKDQVRHYYYRLVRRM KLLGPE  L+AKNS+DT AAMLRWWSLLEK
Sbjct  142   KNFEKITLRVQSKNKDQVRHYYYRLVRRMKKLLGPEFSLDAKNSKDTVAAMLRWWSLLEK  201

Query  697   YSCKASKLHLKPRRFKIFIETLENQLLKDRKKNVRRCFSQGENTSTAPISVSNQGRGASG  876
             +SC ASKLHLKPRRFK F+E L NQLLKDR K  ++C  +G+   ++   + N+    +G
Sbjct  202   FSCSASKLHLKPRRFKTFVEALGNQLLKDRNKTRKKC-PRGDECLSSSSPILNR---TAG  257

Query  877   HDGRSVKVVLLDNQDIHKFGSGKGSSLKRHINIGAN--STSCKADSSLLKTARHRRKIG-  1047
             ++  SVK++ +D  +  K  S KG+  KR     +N  S S K D S   T + +R+ G 
Sbjct  258   NESSSVKLLPVDVSNGSKVASSKGAVFKRGAEPNSNNKSGSTKWDLSATITVKQKRRAGG  317

Query  1048  --ATAAYKRWEKAAIAGVSLVADAAEHLERTTTDKEDGHFQDS--NVRNVFEHSGKDPHV  1215
               A+ AYK+WE+ A+AGVSLVADAAE LER T + +      S  NV  V      DP  
Sbjct  318   GIASTAYKKWERDAMAGVSLVADAAEELERNTVNVDARTLSPSSNNVCTV-----DDPGT  372

Query  1216  FPDLLHNSFNETNLQNSGKLKLQLFPVDDGTRRALELDNHNPYLELTLSTRKKMSSVLEH  1395
                   N  NE + Q   KLKLQLFP+++ TR+ALE D HNP+LELT+S RKK+SSVLEH
Sbjct  373   ------NRMNEADQQAPAKLKLQLFPINEATRKALEKDEHNPHLELTVSGRKKISSVLEH  426

Query  1396  LNRKWGNSSMACGDLMLFPYHLHKENLVHFQKWTKDTTLTAADVYALTGSPPVFRLRYGW  1575
             LNRKWG+S++A G+L+LFPY  H+E+L  +Q+WT   T+  ADV+    SPPVFRLRYGW
Sbjct  427   LNRKWGSSNIASGELLLFPYCAHREDLATYQRWTTRDTVVVADVFLSVNSPPVFRLRYGW  486

Query  1576  FSNAEVAFRAPVSSAIPSRHDANMNIMPES------SVGVLQAPST---DPPKEANGCVS  1728
             FS AE+       S I S H  N  +MPE       S   +Q   T       E + C S
Sbjct  487   FSLAELE----GGSGISSTHFKNC-MMPEDIHAKSPSDACVQKDGTFLNSCAPEEHLCNS  541

Query  1729  MN--------TVNASRSSDHTE-----AVLWENPETVVTEAEVDDLQFNKAGTSCV----  1857
              +        T +  +S+   E        W + +    ++    L+ N  G  C     
Sbjct  542   KDRPALFLAMTFSTGKSAKGQEQHSDFPASWFSRQKQEKDSTNQVLEAN-LGMDCAIISE  600

Query  1858  GEWADSLTNISVGDLLSEAPDMEDANCITSSIHSSSNYIHQIPFSCDSFDAAIAAHIKKH  2037
             GEWAD+LT+ISVG LL+EA    + +C  ++I  ++ ++   P S DSFDAA+A H  +H
Sbjct  601   GEWADTLTDISVGYLLTEASIGTNTDCPGTAIAKNTLFLEN-PCSYDSFDAAVALHASRH  659

Query  2038  QNVTDSQAALPSQLSSIWGAEDTCDAFAFQRHSLSEKVQNASKHTSLETCKQITLANTT-  2214
             + V   Q AL S  S+IWGAE+TCD F+F   +  ++  + +  +S      + L +T+ 
Sbjct  660   KTV--EQPALASH-STIWGAEETCDEFSFNLAASRKQESSNTSASSSPGSDSVVLPSTSQ  716

Query  2215  ALGASVEDLPGAR---NPVDGDAATADLESVHYSPTSDV---VKDFNGLSDVYWPDSLGP  2376
                  ++DL GA+   NP   DA   +    +  P S     +KD   L+D+YW DSLGP
Sbjct  717   GFQGFLQDLAGAKVADNPCMDDAKDMEALCANSPPRSKSDSGLKD-QSLADLYWADSLGP  775

Query  2377  LDLDIPSSRYHSE-LILSDSLGGLTQLIASSLDAFQNCSFFGADKKEPVSTT  2529
             LDL+IPS RY +E L+L DS     +++ +SLDAF+N SFF ADK + + + 
Sbjct  776   LDLEIPSVRYQAEDLLLGDSQNSWNRMMVNSLDAFRNLSFFMADKNDSIPSV  827



>gb|AGC14139.1| MYB1 [Leymus chinensis]
Length=751

 Score =   538 bits (1386),  Expect = 2e-173, Method: Compositional matrix adjust.
 Identities = 331/741 (45%), Positives = 438/741 (59%), Gaps = 68/741 (9%)
 Frame = +1

Query  427   QQPVKRQTRKWAAWTREEEESFFSALRHVGKNFEKITSRVQSKNKDQVRHYYYRLVRRMN  606
             Q+P K+ TR+WAAWTR+EEESFF+ALR VGKNFEKIT RVQ KNKDQVRHYYYRLVRRM 
Sbjct  31    QKPAKKATRQWAAWTRQEEESFFNALRQVGKNFEKITLRVQGKNKDQVRHYYYRLVRRMK  90

Query  607   KLLGPELCLNAKNSRDTNAAMLRWWSLLEKYSCKASKLHLKPRRFKIFIETLENQLLKDR  786
             KLLGP   L+A+NS+DT AAMLRWWSLLEK+SC ASKLHLKPRRFK F++ L NQLLKDR
Sbjct  91    KLLGPGFSLDARNSKDTIAAMLRWWSLLEKFSCSASKLHLKPRRFKTFVDALGNQLLKDR  150

Query  787   KKNVRRC-FSQGENTSTAPISVSNQGRGASGHDGRSVKVVLLDNQDIHKFGSGKGSSLKR  963
             K+  R+C       +S++P+          G+   +V ++ +D Q+  K  S KG  +KR
Sbjct  151   KRTRRKCPLGDTRLSSSSPVLSK-----TPGNQSFAVGLLPVDAQNGSKGASSKGVFMKR  205

Query  964   HINIGANSTSCKADSSLLKTARHRRK---IGATAAYKRWEKAAIAGVSLVADAAEHLERT  1134
                  +N +    D S  +T R +R+    GA AAYK+WE+AA+AGVSLVADAAE LER 
Sbjct  206   VAEPNSNKSGVIRDLSATRTVRQKRRAGGAGACAAYKKWERAAMAGVSLVADAAEELERK  265

Query  1135  TTDKEDGHFQDSNVRNVFEHSGKDPHVFPDLLHNSFNETNLQNSGKLKLQLFPVDDGTRR  1314
              T +      D+    V   S  +     D+  N   E + Q   KLKLQLFP+++ TR+
Sbjct  266   MTTQNLSCNADA---TVLVPSPNNVSTVDDMGTNHMKEADTQAPSKLKLQLFPINEATRK  322

Query  1315  ALELDNHNPYLELTLSTRKKMSSVLEHLNRKWGNSSMACGDLMLFPYHLHKENLVHFQKW  1494
             ALE D+HNP+LELTLS+RKKMSSVLEHLNRKWGNS++A G+L+LFPY  H+E+L  +Q+W
Sbjct  323   ALEKDDHNPHLELTLSSRKKMSSVLEHLNRKWGNSNIASGELVLFPYCAHQEDLATYQRW  382

Query  1495  TKDTTLTAADVYALTGSPPVFRLRYGWFSNAEVAFRAPVSSAIPSRHDANMNIMPE----  1662
             T   T+  ADV+    SP +FRLRYGWFS AE+   A +S    +R +  M  +PE    
Sbjct  383   TTQDTVAVADVFLSVNSPSIFRLRYGWFSLAEL--EAGLSEISLTRFENCM--IPEDIQV  438

Query  1663  --SSVGVLQAPSTDPP--------------------------KEANGCVSMNTVNASRSS  1758
               SS   +Q   T P                           K A    S+NT   S+S 
Sbjct  439   RSSSEACVQKDGTLPSDFTSEQSSNNSKDQSALLLGTPSSTGKNAAEEPSINTF-PSQSG  497

Query  1759  DHTEAVLWENPETVVTEAEVDDLQFNKAGTSCVGEWADSLTNISVGDLLSEAPDMEDANC  1938
             DH +  +  N    V      D Q + A  S V +WAD+LT+ISVG LL+EA    + +C
Sbjct  498   DHNQEQVPANQAFEV------DPQMDCAAISEV-DWADTLTDISVGYLLTEASKAANLDC  550

Query  1939  ITSSIHSSSNYIHQIPFSCDSFDAAIAAHIKKHQNVTDSQAALPSQLSSIWGAEDTCDAF  2118
               +SI  ++  +H+ P S DSFDAA+A H  ++Q     Q A  S  S+IWGAE+TCD F
Sbjct  551   EVTSIAKNA-LLHENPCSYDSFDAAVALHASRYQAA--EQPAHTSH-STIWGAEETCDEF  606

Query  2119  AFQRHSLSEKVQNASKHTSLETCKQITLANTTALGASVEDLPGAR---NPVDGDAATADL  2289
             +F   +  ++    S  +  ++  ++  +N+      ++DL G     NP   D    + 
Sbjct  607   SFMLATARKQQGLTSASSPPDSDNEVHSSNSEGFQGFLQDLAGGDTPGNPCADDVKAMEK  666

Query  2290  ESVHYSPTSD---VVKDFNGLSDVYWPDSLGPLDLDIPSSR-YHSELILSDSLGGLTQLI  2457
                   P SD    +KD   L DV+WPDSLGPLDLDIP  R    E IL DS    ++++
Sbjct  667   LCARSPPQSDNYFGLKDL-PLDDVFWPDSLGPLDLDIPPIRSLADEFILGDSQNSWSRMM  725

Query  2458  ASSLDAFQNCSFFGADKKEPV  2520
              +S+D F+N S F +D  + V
Sbjct  726   ENSMDTFRNMSLFASDNNDSV  746



>gb|AFW89044.1| putative MYB DNA-binding domain superfamily protein [Zea mays]
Length=746

 Score =   534 bits (1376),  Expect = 4e-172, Method: Compositional matrix adjust.
 Identities = 332/734 (45%), Positives = 450/734 (61%), Gaps = 63/734 (9%)
 Frame = +1

Query  439   KRQTRKWAAWTREEEESFFSALRHVGKNFEKITSRVQSKNKDQVRHYYYRLVRRMNKLLG  618
             K+QTR+WAAWT +EEE+FF+ALR VGKNF+KIT RVQSKNKDQVRHYYYRLVRRM KLLG
Sbjct  32    KKQTRQWAAWTHQEEENFFNALRQVGKNFDKITHRVQSKNKDQVRHYYYRLVRRMKKLLG  91

Query  619   PELCLNAKNSRDTNAAMLRWWSLLEKYSCKASKLHLKPRRFKIFIETLENQLLKDRKKNV  798
             P   L+AKNS+DT AAMLRWWSLLEK+SC ASKLHLKPRRFK F+E L  QLLKDR K+ 
Sbjct  92    PRFSLDAKNSKDTIAAMLRWWSLLEKFSCSASKLHLKPRRFKTFVEALGKQLLKDRNKS-  150

Query  799   RRCFSQGENTSTAPISVSNQGRGASGHDGRSVKVVLLDNQDIHKFGSGKGSSLKRHIN-I  975
             R+  S+ +   ++P  V ++   A G +   VK + +D+Q+  +  S KG+  KR    I
Sbjct  151   RKKHSRVDMCISSPSPVISK---APGDETPPVKFLSIDSQNGSRVASPKGTIFKRIAEPI  207

Query  976   GANSTSCKADSSLLKTARHRRKIG---ATAAYKRWEKAAIAGVSLVADAAEHLERTTTDK  1146
                S + K D S  +T + +RK G   A+AAYK+WE+AA+AGVSLVADAAE LER T + 
Sbjct  208   SNKSGTTKGDLSATRTVKQKRKAGGAVASAAYKKWERAAMAGVSLVADAAEELERNTINP  267

Query  1147  EDGHFQDSNVRNVFEHSGKDPHVFPDLLHNSFNETNLQNSGKLKLQLFPVDDGTRRALEL  1326
               G   + + R +   S +       +  N   ET+ Q   KLKLQLFP+++ TR+ALE 
Sbjct  268   --GMLCNVDARTLTSSSDR-LSTGDGISTNHMKETDSQAPVKLKLQLFPINEATRKALEK  324

Query  1327  DNHNPYLELTLSTRKKMSSVLEHLNRKWGNSSMACGDLMLFPYHLHKENLVHFQKWTKDT  1506
             D+HNP+LELTLS+RKK+SSVLEHLNRKWGNS++A G+L+LFPY  ++E+L  +Q+WT   
Sbjct  325   DDHNPHLELTLSSRKKISSVLEHLNRKWGNSNIASGELILFPYCANQEDLATYQRWTTRD  384

Query  1507  TLTAADVYALTGSPPVFRLRYGWFSNAEVAFRAPVSSAIPSRHDANMNIMPESSVGVLQA  1686
             T+  ADV+    SP VFRLRYGWFS  E+   A VS    +  +  M   PE  V  +++
Sbjct  385   TVAVADVFLSVNSPSVFRLRYGWFSLVELG--AGVSDISLTHFEDCMR--PE--VIQVKS  438

Query  1687  PSTDPP-------------KEANGCVSMNTVNASRSSDHTEAVLWENPETV---------  1800
             PS D                E+  C SM  ++ + SS    + L + P  V         
Sbjct  439   PSGDKACVQKDGTLLSNCTHESYPCSSM-LLHMTPSSTGKNSELPDQPANVPHSRFGSQK  497

Query  1801  -----VTEAEVDDLQFNKAGTSCVGEWADSLTNISVGDLLSEAPDMEDANCITSSIHSSS  1965
                  VT+A  DD   N    S V EWAD+LT+ISV  LL+EA   +D +C+ +S+    
Sbjct  498   QVQVPVTQAFEDDQGMNCVAISEV-EWADTLTDISVEHLLTEA--SKDLDCVGTSVKDP-  553

Query  1966  NYIHQIPFSCDSFDAAIAAHIKKHQNVTDSQAALPSQLSSIWGAEDTCDAFAFQRHSLSE  2145
                 + P S DSFDA +A H  ++Q  ++  A  P   S+IWGAE+TCD F+F   +  +
Sbjct  554   -LFLENPCSYDSFDAVVALHASRYQ-ASEQPAHAPH--SNIWGAEETCDEFSFNLSASRK  609

Query  2146  KVQNASKHTSLETCKQITLANTTALGASVEDLPG----ARNPVDGDAATADLESVHYSPT  2313
             +  + +  +S +T  ++  +N+      ++DL G    A NP + DA   +       P 
Sbjct  610   QEGSNTSSSSPDTDNEVHPSNSEGFRGFLQDLTGRETDADNPCNDDAKDEEEFYAKSPPR  669

Query  2314  SDVVKDFNG--LSDVYWPDSLGPLDLDIPSSRYHSELIL---SDSLGGLTQLIASSLDAF  2478
             +D   +     L+D+YWPDSLGPLDLDIP+ RY ++ IL   S S     +L+A+SLDAF
Sbjct  670   NDKTNELKDQPLADIYWPDSLGPLDLDIPAVRYQTDDILIGDSQSSWNWNRLMANSLDAF  729

Query  2479  QNCSFFGADKKEPV  2520
             +N SFF +DK + +
Sbjct  730   RNLSFF-SDKNDSI  742



>ref|XP_009391059.1| PREDICTED: TSL-kinase interacting protein 1 isoform X1 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009391060.1| PREDICTED: TSL-kinase interacting protein 1 isoform X1 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009391061.1| PREDICTED: TSL-kinase interacting protein 1 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=726

 Score =   532 bits (1370),  Expect = 2e-171, Method: Compositional matrix adjust.
 Identities = 341/734 (46%), Positives = 445/734 (61%), Gaps = 74/734 (10%)
 Frame = +1

Query  427   QQPVKRQTRKWAAWTREEEESFFSALRHVGKNFEKITSRVQSKNKDQVRHYYYRLVRRMN  606
             Q PVK+ TR+WAAWTR+EEE+FF+ALR VGKNFEKIT RVQSKNKDQVRHYYYRLVRRMN
Sbjct  31    QNPVKKPTRQWAAWTRQEEENFFNALRQVGKNFEKITCRVQSKNKDQVRHYYYRLVRRMN  90

Query  607   KLLGPELCLNAKNSRDTNAAMLRWWSLLEKYSCKASKLHLKPRRFKIFIETLENQLLKDR  786
             KLLGP  C +AKNS+DTNAAMLRWWSLLEK+SC ASKLHLKPRRFKIFIE LENQLLKDR
Sbjct  91    KLLGPGFCFDAKNSKDTNAAMLRWWSLLEKHSCTASKLHLKPRRFKIFIEALENQLLKDR  150

Query  787   KKNVRRCFSQGENTSTAPISVSNQGRGASGHDGRSVKVVLLDNQDIHKFGSGKGSSLKRH  966
              K  R+   +      +P S +   +G  G+D   VK++ +++   +K  + +G+    H
Sbjct  151   NKTRRKRLPED---MYSPTSTTILSKGP-GNDIYPVKLLTVESPSTNKSTASRGTF---H  203

Query  967   INIGANSTSCKADSSLLKTARHRRKIG--ATAAYKRWEKAAIAGVSLVADAAEHLERTTT  1140
              N   ++ +C+ D S ++  R +R+ G  A+A YKRWEKAAIAGVSLVADAAE LER T 
Sbjct  204   KNDMFSNMNCRRDLSSMRPLRPKRRPGVVASAEYKRWEKAAIAGVSLVADAAEELERAT-  262

Query  1141  DKEDGHFQDSNVRNVFEHSGKDPHVFPD-------LLHNSFNETNLQNSGKLKLQLFPVD  1299
                      +N+   F +S +  HV  +       +      +  ++ S KLKLQLFPVD
Sbjct  263   ---------NNIS--FSYSEETYHVLANKICTNTGICSTEMAKAIIEPSLKLKLQLFPVD  311

Query  1300  DGTRRALELDNHNPYLELTLSTRKKMSSVLEHLNRKWGNSSMACGDLMLFPYHLHKENLV  1479
             + T   LE D HNP+LELTLS RK++SSV+EHLNRKWG+SS+A G++MLFP+ + +E+  
Sbjct  312   EQTLNVLEKDGHNPHLELTLSGRKRISSVVEHLNRKWGDSSVAVGEIMLFPFSVKQEDSA  371

Query  1480  HFQKWT-KDTTLTAADVYALTGSPPVFRLRYGWFSNAEVAFRAPVSS--------AIPSR  1632
               ++WT KDT ++AADVYA  GSP +FRLRYGWFS AE        S         + S 
Sbjct  372   SSKRWTSKDTVVSAADVYATVGSPAIFRLRYGWFSTAEAGSEGIEVSHTTLCPDDCLHSE  431

Query  1633  HDANMN---IMPESSVGVLQAPSTDPPKEANGCVSM-----NTVNASRSSDHTEAVLWEN  1788
                N N    + + +  V+  P    P EA+ CV         +  S          W+N
Sbjct  432   DTENENQAVSVKDLATSVVDLPE---PPEAD-CVQCEERFPEPLQPSYGEKARAQSSWKN  487

Query  1789  PETVVTEAEVDDLQFNKAGTSCVGEWADSLTNISVGDLLSEAPDMEDANCITSSIHSSSN  1968
              + V TE E+  L          GEWADSLTNISVGDLL+EA    ++  +      S +
Sbjct  488   KDVVNTE-EICVLM-------SAGEWADSLTNISVGDLLNEASKAANSKHMNFPNQPSVS  539

Query  1969  YIHQIPFSCDSFDAAIAAHIKKHQNVTDSQAALPSQLSSIWGAEDTCDAFAFQRHSLSEK  2148
              + Q  FSCDSFDAAIAAH+  H   + S  A  SQ  SIW AE+TCD F+FQ   LS +
Sbjct  540   CLKQASFSCDSFDAAIAAHMSGHHLSSLSDKA--SQ-PSIWDAEETCDEFSFQM--LSAQ  594

Query  2149  VQNASKHTSLETC----KQITLANTTALGASVEDLPGARNPVDGDAATADLESVHYSPTS  2316
              Q   K  S  TC    +Q +  ++  +   ++D    R+  D     +++E+     +S
Sbjct  595   AQERLKPAS-STCTDGDEQFSSKSSPGIQNFLKDFGEQRSKDDPRCDKSEVETCKDRISS  653

Query  2317  DVV---KDFNGLSDVYWPDSLGPLDLDIPSSRYHSE---LILSDSLGGLTQLIASSLDAF  2478
             D     KD   L+D+YW DSLGPLDLD+P S++  +      S SL  L++L+A+SLD F
Sbjct  654   DGSNHEKD-PCLADIYWSDSLGPLDLDMPPSKFQGQDLIFSDSLSLSSLSRLLANSLDEF  712

Query  2479  QNCSFFGADKKEPV  2520
             QNCS F  D K+P 
Sbjct  713   QNCSLFCLDSKDPA  726



>ref|XP_009391062.1| PREDICTED: TSL-kinase interacting protein 1 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=701

 Score =   516 bits (1329),  Expect = 1e-165, Method: Compositional matrix adjust.
 Identities = 334/734 (46%), Positives = 431/734 (59%), Gaps = 99/734 (13%)
 Frame = +1

Query  427   QQPVKRQTRKWAAWTREEEESFFSALRHVGKNFEKITSRVQSKNKDQVRHYYYRLVRRMN  606
             Q PVK+ TR+WAAWTR+EEE+FF+ALR VGKNFEKIT RVQSKNKDQVRHYYYRLVRRMN
Sbjct  31    QNPVKKPTRQWAAWTRQEEENFFNALRQVGKNFEKITCRVQSKNKDQVRHYYYRLVRRMN  90

Query  607   KLLGPELCLNAKNSRDTNAAMLRWWSLLEKYSCKASKLHLKPRRFKIFIETLENQLLKDR  786
             KLLGP  C +AKNS+DTNAAMLRWWSLLEK+SC ASKLHLKPRRFKIFIE LENQLLKDR
Sbjct  91    KLLGPGFCFDAKNSKDTNAAMLRWWSLLEKHSCTASKLHLKPRRFKIFIEALENQLLKDR  150

Query  787   KKNVRRCFSQGENTSTAPISVSNQGRGASGHDGRSVKVVLLDNQDIHKFGSGKGSSLKRH  966
              K  R+   +   + T+   ++++G                                  H
Sbjct  151   NKTRRKRLPEDMYSPTSTTILTSRGTF--------------------------------H  178

Query  967   INIGANSTSCKADSSLLKTARHRRKIG--ATAAYKRWEKAAIAGVSLVADAAEHLERTTT  1140
              N   ++ +C+ D S ++  R +R+ G  A+A YKRWEKAAIAGVSLVADAAE LER T 
Sbjct  179   KNDMFSNMNCRRDLSSMRPLRPKRRPGVVASAEYKRWEKAAIAGVSLVADAAEELERAT-  237

Query  1141  DKEDGHFQDSNVRNVFEHSGKDPHVFPD-------LLHNSFNETNLQNSGKLKLQLFPVD  1299
                      +N+   F +S +  HV  +       +      +  ++ S KLKLQLFPVD
Sbjct  238   ---------NNIS--FSYSEETYHVLANKICTNTGICSTEMAKAIIEPSLKLKLQLFPVD  286

Query  1300  DGTRRALELDNHNPYLELTLSTRKKMSSVLEHLNRKWGNSSMACGDLMLFPYHLHKENLV  1479
             + T   LE D HNP+LELTLS RK++SSV+EHLNRKWG+SS+A G++MLFP+ + +E+  
Sbjct  287   EQTLNVLEKDGHNPHLELTLSGRKRISSVVEHLNRKWGDSSVAVGEIMLFPFSVKQEDSA  346

Query  1480  HFQKWT-KDTTLTAADVYALTGSPPVFRLRYGWFSNAEVAFRAPVSS--------AIPSR  1632
               ++WT KDT ++AADVYA  GSP +FRLRYGWFS AE        S         + S 
Sbjct  347   SSKRWTSKDTVVSAADVYATVGSPAIFRLRYGWFSTAEAGSEGIEVSHTTLCPDDCLHSE  406

Query  1633  HDANMN---IMPESSVGVLQAPSTDPPKEANGCVSM-----NTVNASRSSDHTEAVLWEN  1788
                N N    + + +  V+  P    P EA+ CV         +  S          W+N
Sbjct  407   DTENENQAVSVKDLATSVVDLPE---PPEAD-CVQCEERFPEPLQPSYGEKARAQSSWKN  462

Query  1789  PETVVTEAEVDDLQFNKAGTSCVGEWADSLTNISVGDLLSEAPDMEDANCITSSIHSSSN  1968
              + V TE E+  L          GEWADSLTNISVGDLL+EA    ++  +      S +
Sbjct  463   KDVVNTE-EICVLM-------SAGEWADSLTNISVGDLLNEASKAANSKHMNFPNQPSVS  514

Query  1969  YIHQIPFSCDSFDAAIAAHIKKHQNVTDSQAALPSQLSSIWGAEDTCDAFAFQRHSLSEK  2148
              + Q  FSCDSFDAAIAAH+  H   + S  A  SQ  SIW AE+TCD F+FQ   LS +
Sbjct  515   CLKQASFSCDSFDAAIAAHMSGHHLSSLSDKA--SQ-PSIWDAEETCDEFSFQM--LSAQ  569

Query  2149  VQNASKHTSLETC----KQITLANTTALGASVEDLPGARNPVDGDAATADLESVHYSPTS  2316
              Q   K  S  TC    +Q +  ++  +   ++D    R+  D     +++E+     +S
Sbjct  570   AQERLKPAS-STCTDGDEQFSSKSSPGIQNFLKDFGEQRSKDDPRCDKSEVETCKDRISS  628

Query  2317  DVV---KDFNGLSDVYWPDSLGPLDLDIPSSRYHSE---LILSDSLGGLTQLIASSLDAF  2478
             D     KD   L+D+YW DSLGPLDLD+P S++  +      S SL  L++L+A+SLD F
Sbjct  629   DGSNHEKD-PCLADIYWSDSLGPLDLDMPPSKFQGQDLIFSDSLSLSSLSRLLANSLDEF  687

Query  2479  QNCSFFGADKKEPV  2520
             QNCS F  D K+P 
Sbjct  688   QNCSLFCLDSKDPA  701



>ref|XP_008653331.1| PREDICTED: TSL-kinase interacting protein 1 [Zea mays]
Length=686

 Score =   506 bits (1304),  Expect = 3e-162, Method: Compositional matrix adjust.
 Identities = 321/729 (44%), Positives = 431/729 (59%), Gaps = 92/729 (13%)
 Frame = +1

Query  427   QQPVKRQTRKWAAWTREEEESFFSALRHVGKNFEKITSRVQSKNKDQVRHYYYRLVRRMN  606
             ++P K+QTR+WAAWT +EEE FF+ALR VGKNF+KIT RVQSKNKDQVRHYYYRLVRRM 
Sbjct  19    RKPAKKQTRQWAAWTHQEEEIFFNALRQVGKNFDKITHRVQSKNKDQVRHYYYRLVRRMK  78

Query  607   KLLGPELCLNAKNSRDTNAAMLRWWSLLEKYSCKASKLHLKPRRFKIFIETLENQLLKD-  783
             KLLGP   L+AKNS+DT AAMLRWWSLLEK+SC ASKLHLKPRRFK F+E L  QLLKD 
Sbjct  79    KLLGPRFSLDAKNSKDTIAAMLRWWSLLEKFSCTASKLHLKPRRFKTFVEALGKQLLKDR  138

Query  784   -----RKKNVRRCFSQGENTSTAPISVSNQGRGASGHDGRSVKVVLLDNQDIHKFGSGKG  948
                  ++  V  C       S +PI +S     A G++   V   +      +K G+ KG
Sbjct  139   NKSRRKRSRVDMCL-----PSPSPI-ISK----APGNENPPVAEPI-----SNKPGTTKG  183

Query  949   SSLKRHINIGANSTSCKADSSLLKTARHRRKIG---ATAAYKRWEKAAIAGVSLVADAAE  1119
                               + S  +T + +RK G   A+AAYK+WE+AA+AGVSLVADAAE
Sbjct  184   ------------------ELSATRTVKQKRKAGGAVASAAYKKWERAAMAGVSLVADAAE  225

Query  1120  HLERTTTDKEDGHFQDSNVRNVFEHSGKDPHVFPDLLHNSFNETNLQNSGKLKLQLFPVD  1299
              LER T +   G F + + R +   S +   +   +  N   E + Q   KLKLQLFP++
Sbjct  226   ELERNTINP--GIFCNVDARTLTSLSERLSSI-DGISTNHMKEADSQAPVKLKLQLFPIN  282

Query  1300  DGTRRALELDNHNPYLELTLSTRKKMSSVLEHLNRKWGNSSMACGDLMLFPYHLHKENLV  1479
             + TR+ALE D+HNP+LELTLS+RKK+SSVLEHLNRKWGNS++A G+L+LFPY  ++E+L 
Sbjct  283   EATRKALEKDDHNPHLELTLSSRKKISSVLEHLNRKWGNSNIASGELILFPYCANQEDLA  342

Query  1480  HFQKWTKDTTLTAADVYALTGSPPVFRLRYGWFSNAEVAFRAPVSSAIPSRHDANMNIMP  1659
              +Q+WT   T+  ADV+    SP VFRLRYGW S  E+   A VS    +  +  M  +P
Sbjct  343   TYQRWTTRDTVAVADVFLSVNSPSVFRLRYGWVSLVELG--AGVSEISLTHFEDCM--IP  398

Query  1660  ESSVGVLQAPSTDPPKEANGCVSMNTVNASRSSDHTEAVLWENPETV-------------  1800
             E  V  +++PS D       CV          SD   + L + P  V             
Sbjct  399   E--VIQVKSPSGD-----KACV---------QSDGKNSELPDEPANVPPSQFGSQKQAHV  442

Query  1801  -VTEAEVDDLQFNKAGTSCVGEWADSLTNISVGDLLSEAPDMEDANCITSSIHSSSNYIH  1977
              +T+A  DD   N    S V EWAD+LTNIS G LL+EA      +C  +S+ +      
Sbjct  443   PITQAFEDDQGMNCVAISAV-EWADTLTNISFGHLLTEASKGTHLDCGGTSVKNP--LFF  499

Query  1978  QIPFSCDSFDAAIAAHIKKHQNVTDSQAALPSQLSSIWGAEDTCDAFAFQRHSLSEKVQN  2157
             + P S DSFDAA+A H  ++Q  ++  A  P   S+IWGAE+TCD F F   +  ++  +
Sbjct  500   ENPCSYDSFDAAVALHASRYQ-ASEQSAHAPH--STIWGAEETCDEFIFNLSASRKQEGS  556

Query  2158  ASKHTSLETCKQITLANTTALGASVEDLPG---ARNPVDGDAATADLESVHYSPTSDVVK  2328
              +  +S +T   +  +N+      +EDL G   A N  + D A  +       P +D   
Sbjct  557   NTLSSSPDTNNGVHPSNSEGFKGFLEDLAGEADADNHYNNDDAKDEEFYAKSPPRNDETN  616

Query  2329  DF--NGLSDVYWPDSLGPLDLDIPSSRYHS-ELILSDSLGGLTQLIASSLDAFQNCSFFG  2499
             +     L+D+YWPDSLGPLDLDIPS RY + ++++ DS     +L+A+SLDAF+N SFF 
Sbjct  617   ELKDQSLADIYWPDSLGPLDLDIPSVRYEADDILIGDSQNSWNRLMANSLDAFRNLSFF-  675

Query  2500  ADKKEPVST  2526
             +DK + + +
Sbjct  676   SDKNDSIPS  684



>ref|XP_008653313.1| PREDICTED: TSL-kinase interacting protein 1-like [Zea mays]
Length=761

 Score =   506 bits (1302),  Expect = 6e-161, Method: Compositional matrix adjust.
 Identities = 321/729 (44%), Positives = 431/729 (59%), Gaps = 92/729 (13%)
 Frame = +1

Query  427   QQPVKRQTRKWAAWTREEEESFFSALRHVGKNFEKITSRVQSKNKDQVRHYYYRLVRRMN  606
             ++P K+QTR+WAAWT +EEE FF+ALR VGKNF+KIT RVQSKNKDQVRHYYYRLVRRM 
Sbjct  94    RKPAKKQTRQWAAWTHQEEEIFFNALRQVGKNFDKITHRVQSKNKDQVRHYYYRLVRRMK  153

Query  607   KLLGPELCLNAKNSRDTNAAMLRWWSLLEKYSCKASKLHLKPRRFKIFIETLENQLLKD-  783
             KLLGP   L+AKNS+DT AAMLRWWSLLEK+SC ASKLHLKPRRFK F+E L  QLLKD 
Sbjct  154   KLLGPRFSLDAKNSKDTIAAMLRWWSLLEKFSCTASKLHLKPRRFKTFVEALGKQLLKDR  213

Query  784   -----RKKNVRRCFSQGENTSTAPISVSNQGRGASGHDGRSVKVVLLDNQDIHKFGSGKG  948
                  ++  V  C       S +PI +S     A G++   V   + +     K G+ KG
Sbjct  214   NKSRRKRSRVDMCLP-----SPSPI-ISK----APGNENPPVAEPISN-----KPGTTKG  258

Query  949   SSLKRHINIGANSTSCKADSSLLKTARHRRKIG---ATAAYKRWEKAAIAGVSLVADAAE  1119
                               + S  +T + +RK G   A+AAYK+WE+AA+AGVSLVADAAE
Sbjct  259   ------------------ELSATRTVKQKRKAGGAVASAAYKKWERAAMAGVSLVADAAE  300

Query  1120  HLERTTTDKEDGHFQDSNVRNVFEHSGKDPHVFPDLLHNSFNETNLQNSGKLKLQLFPVD  1299
              LER T +   G F + + R +   S +   +   +  N   E + Q   KLKLQLFP++
Sbjct  301   ELERNTINP--GIFCNVDARTLTSLSERLSSI-DGISTNHMKEADSQAPVKLKLQLFPIN  357

Query  1300  DGTRRALELDNHNPYLELTLSTRKKMSSVLEHLNRKWGNSSMACGDLMLFPYHLHKENLV  1479
             + TR+ALE D+HNP+LELTLS+RKK+SSVLEHLNRKWGNS++A G+L+LFPY  ++E+L 
Sbjct  358   EATRKALEKDDHNPHLELTLSSRKKISSVLEHLNRKWGNSNIASGELILFPYCANQEDLA  417

Query  1480  HFQKWTKDTTLTAADVYALTGSPPVFRLRYGWFSNAEVAFRAPVSSAIPSRHDANMNIMP  1659
              +Q+WT   T+  ADV+    SP VFRLRYGW S  E+   A VS    +  +  M  +P
Sbjct  418   TYQRWTTRDTVAVADVFLSVNSPSVFRLRYGWVSLVELG--AGVSEISLTHFEDCM--IP  473

Query  1660  ESSVGVLQAPSTDPPKEANGCVSMNTVNASRSSDHTEAVLWENPETV-------------  1800
             E  V  +++PS D       CV          SD   + L + P  V             
Sbjct  474   E--VIQVKSPSGD-----KACV---------QSDGKNSELPDEPANVPPSQFGSQKQAHV  517

Query  1801  -VTEAEVDDLQFNKAGTSCVGEWADSLTNISVGDLLSEAPDMEDANCITSSIHSSSNYIH  1977
              +T+A  DD   N    S V EWAD+LTNIS G LL+EA      +C  +S+ +      
Sbjct  518   PITQAFEDDQGMNCVAISAV-EWADTLTNISFGHLLTEASKGTHLDCGGTSVKNP--LFF  574

Query  1978  QIPFSCDSFDAAIAAHIKKHQNVTDSQAALPSQLSSIWGAEDTCDAFAFQRHSLSEKVQN  2157
             + P S DSFDAA+A H  ++Q  ++  A  P   S+IWGAE+TCD F F   +  ++  +
Sbjct  575   ENPCSYDSFDAAVALHASRYQ-ASEQSAHAPH--STIWGAEETCDEFIFNLSASRKQEGS  631

Query  2158  ASKHTSLETCKQITLANTTALGASVEDLPG---ARNPVDGDAATADLESVHYSPTSDVVK  2328
              +  +S +T   +  +N+      +EDL G   A N  + D A  +       P +D   
Sbjct  632   NTLSSSPDTNNGVHPSNSEGFKGFLEDLAGEADADNHYNNDDAKDEEFYAKSPPRNDETN  691

Query  2329  DF--NGLSDVYWPDSLGPLDLDIPSSRYHS-ELILSDSLGGLTQLIASSLDAFQNCSFFG  2499
             +     L+D+YWPDSLGPLDLDIPS RY + ++++ DS     +L+A+SLDAF+N SFF 
Sbjct  692   ELKDQSLADIYWPDSLGPLDLDIPSVRYEADDILIGDSQNSWNRLMANSLDAFRNLSFF-  750

Query  2500  ADKKEPVST  2526
             +DK + + +
Sbjct  751   SDKNDSIPS  759



>gb|AFW89045.1| putative MYB DNA-binding domain superfamily protein [Zea mays]
Length=716

 Score =   487 bits (1253),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 303/681 (44%), Positives = 412/681 (60%), Gaps = 59/681 (9%)
 Frame = +1

Query  427   QQPVKRQTRKWAAWTREEEESFFSALRHVGKNFEKITSRVQSKNKDQVRHYYYRLVRRMN  606
             +QP K+QTR+WAAWT +EEE+FF+ALR VGKNF+KIT RVQSKNKDQVRHYYYRLVRRM 
Sbjct  19    KQPAKKQTRQWAAWTHQEEENFFNALRQVGKNFDKITHRVQSKNKDQVRHYYYRLVRRMK  78

Query  607   KLLGPELCLNAKNSRDTNAAMLRWWSLLEKYSCKASKLHLKPRRFKIFIETLENQLLKDR  786
             KLLGP   L+AKNS+DT AAMLRWWSLLEK+SC ASKLHLKPRRFK F+E L  QLLKDR
Sbjct  79    KLLGPRFSLDAKNSKDTIAAMLRWWSLLEKFSCSASKLHLKPRRFKTFVEALGKQLLKDR  138

Query  787   KKNVRRCFSQGENTSTAPISVSNQGRGASGHDGRSVKVVLLDNQDIHKFGSGKGSSLKRH  966
              K+ R+  S+ +   ++P  V ++   A G +   VK + +D+Q+  +  S KG+  KR 
Sbjct  139   NKS-RKKHSRVDMCISSPSPVISK---APGDETPPVKFLSIDSQNGSRVASPKGTIFKRI  194

Query  967   IN-IGANSTSCKADSSLLKTARHRRKIG---ATAAYKRWEKAAIAGVSLVADAAEHLERT  1134
                I   S + K D S  +T + +RK G   A+AAYK+WE+AA+AGVSLVADAAE LER 
Sbjct  195   AEPISNKSGTTKGDLSATRTVKQKRKAGGAVASAAYKKWERAAMAGVSLVADAAEELERN  254

Query  1135  TTDKEDGHFQDSNVRNVFEHSGKDPHVFPDLLHNSFNETNLQNSGKLKLQLFPVDDGTRR  1314
             T +   G   + + R +   S +       +  N   ET+ Q   KLKLQLFP+++ TR+
Sbjct  255   TINP--GMLCNVDARTLTSSSDR-LSTGDGISTNHMKETDSQAPVKLKLQLFPINEATRK  311

Query  1315  ALELDNHNPYLELTLSTRKKMSSVLEHLNRKWGNSSMACGDLMLFPYHLHKENLVHFQKW  1494
             ALE D+HNP+LELTLS+RKK+SSVLEHLNRKWGNS++A G+L+LFPY  ++E+L  +Q+W
Sbjct  312   ALEKDDHNPHLELTLSSRKKISSVLEHLNRKWGNSNIASGELILFPYCANQEDLATYQRW  371

Query  1495  TKDTTLTAADVYALTGSPPVFRLRYGWFSNAEVAFRAPVSSAIPSRHDANMNIMPESSVG  1674
             T   T+  ADV+    SP VFRLRYGWFS  E+   A VS    +  +  M   PE  V 
Sbjct  372   TTRDTVAVADVFLSVNSPSVFRLRYGWFSLVELG--AGVSDISLTHFEDCMR--PE--VI  425

Query  1675  VLQAPSTDPP-------------KEANGCVSMNTVNASRSSDHTEAVLWENPETV-----  1800
              +++PS D                E+  C SM  ++ + SS    + L + P  V     
Sbjct  426   QVKSPSGDKACVQKDGTLLSNCTHESYPCSSM-LLHMTPSSTGKNSELPDQPANVPHSRF  484

Query  1801  ---------VTEAEVDDLQFNKAGTSCVGEWADSLTNISVGDLLSEAPDMEDANCITSSI  1953
                      VT+A  DD   N    S V EWAD+LT+ISV  LL+EA   +D +C+ +S+
Sbjct  485   GSQKQVQVPVTQAFEDDQGMNCVAISEV-EWADTLTDISVEHLLTEA--SKDLDCVGTSV  541

Query  1954  HSSSNYIHQIPFSCDSFDAAIAAHIKKHQNVTDSQAALPSQLSSIWGAEDTCDAFAFQRH  2133
                     + P S DSFDA +A H  ++Q  ++  A  P   S+IWGAE+TCD F+F   
Sbjct  542   KDP--LFLENPCSYDSFDAVVALHASRYQ-ASEQPAHAPH--SNIWGAEETCDEFSFNLS  596

Query  2134  SLSEKVQNASKHTSLETCKQITLANTTALGASVEDLPG----ARNPVDGDAATADLESVH  2301
             +  ++  + +  +S +T  ++  +N+      ++DL G    A NP + DA   +     
Sbjct  597   ASRKQEGSNTSSSSPDTDNEVHPSNSEGFRGFLQDLTGRETDADNPCNDDAKDEEEFYAK  656

Query  2302  YSPTSDVVKDFNG--LSDVYW  2358
               P +D   +     L+D+YW
Sbjct  657   SPPRNDKTNELKDQPLADIYW  677



>ref|XP_006854485.1| hypothetical protein AMTR_s00175p00030950 [Amborella trichopoda]
 gb|ERN15952.1| hypothetical protein AMTR_s00175p00030950 [Amborella trichopoda]
Length=759

 Score =   481 bits (1237),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 318/716 (44%), Positives = 419/716 (59%), Gaps = 83/716 (12%)
 Frame = +1

Query  520   NFEKITSRVQSKNKDQVRHYYYRLVRRMNKLLGPELCLNAKNSRDTNAAMLRWWSLLEKY  699
             NFEKITSRVQSKNKDQVRHYYYRL+RRMNKLLGP   L+AKNS+D NAAMLRWWSLLEK 
Sbjct  33    NFEKITSRVQSKNKDQVRHYYYRLIRRMNKLLGPGFTLDAKNSKDANAAMLRWWSLLEKQ  92

Query  700   SCKASKLHLKPRRFKIFIETLENQLLKDRKKNVRRCFSQGENTSTAPISVSNQGRGASGH  879
             SC ASKLHLKPRRFK F+  L +QLLKDRKK  ++  S  + T ++   VS+  +   G+
Sbjct  93    SCSASKLHLKPRRFKTFVTALGDQLLKDRKKTRKQPASVDQGTPSSLTMVSSPTK-VPGN  151

Query  880   DGRSVKVVLLDNQDIHKFGSGKGSSLKRHINIGANSTSCKADSSLLKTARHRRKIGA---  1050
             D R  KV  +D+Q++ K GSGKG+SLKR++ I       K DSS +K ++ RR+  +   
Sbjct  152   DARVAKVSTVDSQNMQKIGSGKGASLKRNMGINCG----KGDSSSVKNSKQRRRTTSNVS  207

Query  1051  TAAYKRWEKAAIAGVSLVADAAEHLERTTTD------------KEDGH------------  1158
             +AAYKRWEKAAIAGVSLVA+AAEHLERT+                D H            
Sbjct  208   SAAYKRWEKAAIAGVSLVAEAAEHLERTSKTPVCDELPHRILTSADDHGNLGLGDNVDRP  267

Query  1159  --FQDSNVRNVFEHSGKDPHVFPDLLHNSFNETNLQNSGKLKLQLFPVDDGTRRALELDN  1332
                 +S  R    H  +  H+ P     +    N+Q   KLKLQLFP+D+ TRR LE D 
Sbjct  268   LPLPESPSRCRQMHVTRTSHL-PTKACPAETGQNVQPFVKLKLQLFPIDESTRRGLETDE  326

Query  1333  HNPYLELTLSTRKKMSSVLEHLNRKWGNSSMACGDLMLFPYHLHKENLVHFQKWT-KDTT  1509
              NP+L+LTL + KK+ SVL+HLNRKWG+SS+A G+LMLFPY   +ENL   Q+WT K+TT
Sbjct  327   INPHLQLTLRSGKKIPSVLDHLNRKWGHSSVASGELMLFPYDAQQENLDSCQRWTMKETT  386

Query  1510  LTAADVYALTGSPPVFRLRYGWFSNAEV------AFRAPVSSAIPSRHDANMNI----MP  1659
             L AAD+YA+ G P +FRLRYGWFS+         +F   + S      D N  I    +P
Sbjct  387   LCAADLYAILGYPELFRLRYGWFSDTGTFGDTSHSFDDCLRSG--DIQDMNDKIDEAQLP  444

Query  1660  -----ESSVGVLQAPSTDPPKEANGCVSMNTVNASRSSD-HTEAVLWENPETV--VTEAE  1815
                  E     +   +T+   E +  VS   +  S  +   T +  W N +++       
Sbjct  445   IASKQEGEGERIHTVTTEQMMEEDAIVSAGKLPESWVNQLETISSYWLNEKSIDGSIRKL  504

Query  1816  VDDLQFNKAGTSCVGEWADSLTNISVGDLLSEAPDMEDANCITSSIHSSSNYIHQIPFSC  1995
             ++D   +K      G+W D+LT ISVGDLLSEA   E A      + S++  +   PF  
Sbjct  505   LEDTDNSKTRPLSAGDWGDNLTTISVGDLLSEASRAEHA------VSSAAPCLP--PFIS  556

Query  1996  DSFDAAIAA-HIKKHQNVTDSQAALPSQLSSIWGAEDTCDAFAFQRHSLSEKVQNASKHT  2172
             +SFDA+ AA H+++ Q+VT +Q A   Q SSIW AE+TCD F F+++ L   + ++SK  
Sbjct  557   NSFDASFAATHMRERQDVTTTQLA---QASSIWDAEETCDGFVFRKNKLP--MVSSSKDA  611

Query  2173  SLETCKQITLANTTALGASVEDLPGARNPVDGDAATADLE---SVHYSPTSDVVKDFNGL  2343
             + ++  Q    N T   +++ +L   R P DG     DL+     H     D V +   +
Sbjct  612   AADS--QDASGNPTVF-SNLAELSEKR-PSDGVVCQEDLKYNMQSHKETIGDGVNNC-AM  666

Query  2344  SDVYWPDSLGPLDLDIPSSRYHSELILSDSLGGLTQLIASSLDAFQNCSFFGADKK  2511
             +D++W DSLG LD+ +P  RY  E   S SL G   LIASSLDA QNCS FG  KK
Sbjct  667   TDLFWADSLGSLDMCMPYPRYQFE--ESASLAG---LIASSLDALQNCSLFGTVKK  717



>ref|XP_008791204.1| PREDICTED: TSL-kinase interacting protein 1 isoform X3 [Phoenix 
dactylifera]
Length=690

 Score =   476 bits (1226),  Expect = 9e-151, Method: Compositional matrix adjust.
 Identities = 305/698 (44%), Positives = 393/698 (56%), Gaps = 89/698 (13%)
 Frame = +1

Query  601   MNKLLGPELCLNAKNSRDTNAAMLRWWSLLEKYSCKASKLHLKPRRFKIFIETLENQLLK  780
             M + LG  L       +      +  WSLLEKYSC ASKLHLKPRRFKIF+E LENQLLK
Sbjct  1     MTRCLGGCLSFVKLTQQHVRTCCISRWSLLEKYSCTASKLHLKPRRFKIFVEALENQLLK  60

Query  781   DRKKNVRRCFSQGENTSTAPISVSNQGRGASGHDGRSVKVVLLDNQDIHKFGSGKGSSLK  960
             DR K  RR    G+  S  P S     R   G+D RS+K++ +D Q  +K G+ KG+S K
Sbjct  61    DRNKTKRR-RPHGDIYSPTP-STQVVSR-VPGNDARSLKLLTVDAQTTNKVGATKGASFK  117

Query  961   RHINIGANSTSCKADSSLLKTARHRRKIG--ATAAYKRWEKAAIAGVSLVADAAEHLERT  1134
             R++N  AN    K DSS+ KTA+ +R+ G  A+A Y+ WE+AA+AGVSLVADAAE LER 
Sbjct  118   RNVN--ANMNFSKGDSSM-KTAKQKRRTGVVASAEYRSWEEAAMAGVSLVADAAEQLERA  174

Query  1135  TTDKEDGHFQDSNVRNVFEHSGKDPHVFPDLLHNSFNE-------TNLQNSGKLKLQLFP  1293
               D           RN F   G+  ++ P  ++N  NE       T +Q   KLKLQLFP
Sbjct  175   AND-----------RNGFSD-GRTCNMLPKEMYNCNNEICSHQIETIMQPRVKLKLQLFP  222

Query  1294  VDDGTRRALELDNHNPYLELTLSTRKKMSSVLEHLNRKWGNSSMACGDLMLFPYHLHKEN  1473
             +D+GTRRALE D HNP+LELTLS RKK+SSVL+HLNRKWGNSS+A G+LMLFPY +    
Sbjct  223   IDEGTRRALEKDAHNPHLELTLSARKKISSVLDHLNRKWGNSSIASGELMLFPYDVQLLE  282

Query  1474  LVHFQKWT-KDTTLTAADVYALTGSPPVFRLRYGWFSNAEV------AFRAPVSSA----  1620
             L   ++W   DT  +AADVYA  GSP +FRLRYGW S+ E+          P+ S     
Sbjct  283   LASCRRWAITDTAASAADVYATIGSPAIFRLRYGWLSSVELRSGIVHVPSTPIQSENCML  342

Query  1621  ---------IPSRHDA---NMNIMP---------------ESSVGVLQAPSTDPPKEANG  1719
                      I S  DA   N +  P               ++SV  L   + DPP+  N 
Sbjct  343   SEGILNGNNIMSGPDAKCINTDAPPIREFSGQPQQLSEDQQTSVIALATSNIDPPEPMNE  402

Query  1720  CVSMNTVNASRSSDHTEAVLWENPETVVTEAEVDDLQFNKAGTSCV----GEWADSLTNI  1887
                +  ++    +   E       ET    +         AG  CV    GEWADSLTN+
Sbjct  403   VNCVKPMHELPENSGKEPFSRSGEETKDLSSGPQQEDEGNAGMKCVTLSAGEWADSLTNV  462

Query  1888  SVGDLLSEAPDMEDANCITSSIHSSSNYIHQIPFSCDSFDAAIAAHIKKHQNVTDSQAAL  2067
             SVGDLLSEA      +C+ S   +S++ + QI FSCDSFDAAIAAHI  HQ +  +  A 
Sbjct  463   SVGDLLSEASKAAKDSCLDSPAGASASCLQQIHFSCDSFDAAIAAHISGHQLLPPTTQAF  522

Query  2068  PSQLSSIWGAEDTCDAFAFQRHSLSEKVQNASKHTSLETCKQITLANTTALGASVEDLPG  2247
                 +SIW AE+TCD F+F   ++     N S ++S+   ++IT  ++      +++L  
Sbjct  523   ---QASIWNAEETCDEFSFP--AMKRDGSNPSTNSSIGASREITYPSSLGFQGYLKELAE  577

Query  2248  ARNPVDGDAATADLESVHYSPTSDVVKDFNG---------LSDVYWPDSLGPLDLDIPSS  2400
             +R P D  +     E V   P SD    FN          L D+YWPDSLGPLDLD+PS 
Sbjct  578   SR-PADDPSN----EYVTAEPESDKDSSFNDRDNPQKDPCLQDIYWPDSLGPLDLDMPSP  632

Query  2401  RYHSE-LILSDSLGGLTQLIASSLDAFQNCSFFGADKK  2511
             RYH + L+  DSL GL++LIASSLDAFQNCSFF  +K+
Sbjct  633   RYHGQDLVFGDSLSGLSRLIASSLDAFQNCSFFSLEKE  670



>gb|AEV91169.1| MYB-related protein [Triticum aestivum]
 gb|EMT26586.1| TSL-kinase interacting protein 1 [Aegilops tauschii]
Length=751

 Score =   476 bits (1224),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 312/755 (41%), Positives = 429/755 (57%), Gaps = 96/755 (13%)
 Frame = +1

Query  427   QQPVKRQTRKWAAWTREEEESFFSALRHVGKNFEKITSRVQSKNKDQVRHYYYRLVRRMN  606
             Q+P K+ TR+WAAWTR+EEESFF+ALR VGKNFEKIT RVQSKNKDQVRHYYYRLVRRM 
Sbjct  31    QKPAKKATRQWAAWTRQEEESFFNALRQVGKNFEKITLRVQSKNKDQVRHYYYRLVRRMK  90

Query  607   KLLGPELCLNAKNSRDTNAAMLRW----WSLLEKY-SCKASKLHLKPRRFKIFIETLE--  765
             KLLGP   L+A+NS+DT AAMLRW    W ++  Y SC             IF    +  
Sbjct  91    KLLGPGFSLDARNSKDTIAAMLRWRLELWIVIVTYKSCG------------IFCSNADYT  138

Query  766   ---NQLLKDRKKNVRRCFSQGEN--TSTAPISVSNQGRGASGHDGRSVKVVLLDNQDIHK  930
                NQL+KDRK+  R+C S G+   +S++P+          G+   +V ++ +D Q+  K
Sbjct  139   SGGNQLIKDRKRTRRKC-SLGDTRLSSSSPVLSK-----TPGNQSFAVGLLPMDAQNGSK  192

Query  931   FGSGKGSSLKRHINIGANSTSC-KADSSLLKTARHRRKIGATAA---YKRWEKAAIAGVS  1098
               S KG+ +KR  +  +N +   + D S  +T R +R+ G   A   YK+WE+AA+AGVS
Sbjct  193   GASSKGAFMKRVADPNSNKSGVIRGDLSATRTVRQKRRAGGAGACAAYKKWERAAMAGVS  252

Query  1099  LVADAAEHLERTTTDKEDGHFQDSNVRNVFEHSGKDPHVFPDLLHNSFNETNLQNSGKLK  1278
             LVADAAE LER  T +      D+ V      S  +     D+  N   E + Q   KLK
Sbjct  253   LVADAAEELERKMTTQNLSCNADATV---LASSPNNVSTVDDMGTNHMKEADPQAPSKLK  309

Query  1279  LQLFPVDDGTRRALELDNHNPYLELTLSTRKKMSSVLEHLNRKWGNSSMACGDLMLFPYH  1458
             LQLFP+++ TR+ALE D+HNP+LELTLS++KKMSSVLEHLNRKWGNS++ACG+L+LFPY 
Sbjct  310   LQLFPINEATRKALEKDDHNPHLELTLSSKKKMSSVLEHLNRKWGNSNIACGELVLFPYC  369

Query  1459  LHKENLVHFQKWTKDTTLTAADVYALTGSPPVFRLRYGWFSNAEVAFRAPVSSAIPSRHD  1638
              H+E+L  +Q+WT   T+  ADV+    SP +FRLRYGWFS AE+   A +S    +R +
Sbjct  370   AHQEDLATYQRWTTQDTVAVADVFFSVNSPSIFRLRYGWFSLAEL--EAGLSEISLTRFE  427

Query  1639  ANMNIMPE------SSVGVLQAPSTDPP--------------------------KEANGC  1722
               M  +PE      SS   +Q   T P                           K A   
Sbjct  428   NCM--IPEDIQVKSSSEACVQKDGTLPSDFTSEQSSNNSKDQSPLLLGTPSSTGKNAAEE  485

Query  1723  VSMNTVNASRSSDHTEAVLWENPETVVTEAEVDDLQFNKAGTSCVGEWADSLTNISVGDL  1902
              S+NT   S+S DH +  +  N +    + ++D L  ++       +WAD+LT+ISVG L
Sbjct  486   PSINTF-PSQSGDHNQEQVPAN-KAFEVDPQMDCLAISEV------DWADTLTDISVGYL  537

Query  1903  LSEAPDMEDANCITSSIHSSSNYIHQIPFSCDSFDAAIAAHIKKHQNVTDSQAALPSQLS  2082
             L+EA    + +C  +SI + +    + P S DSFDAA+A H  ++Q     Q A  S  S
Sbjct  538   LTEASKAANLDCEVTSI-AQNPLFDENPCSYDSFDAAVALHASRYQAA--EQPAHTSN-S  593

Query  2083  SIWGAEDTCDAFAFQRHSL-SEKVQNASKHTSLETCKQITLANTTALGASVEDLPGAR--  2253
             +IWGAE+TCD F+F   +   ++  N S  +  ++  ++  +N+      ++DL G    
Sbjct  594   TIWGAEETCDEFSFMLATARKQQGLNTSASSPPDSDNEVHSSNSEGFQGFLQDLAGGDTP  653

Query  2254  -NPVDGDAATADLESVHYSPTSDVVKDFN----GLSDVYWPDSLGPLDLDIPSSR-YHSE  2415
              NP   D    +       P SD   DF      L DV+WP+SLGPLDLDIP  R    E
Sbjct  654   GNPCADDVKAMEELCARSPPQSD--NDFGLKDQPLDDVFWPESLGPLDLDIPPIRSLADE  711

Query  2416  LILSDSLGGLTQLIASSLDAFQNCSFFGADKKEPV  2520
              IL DS    ++++ +S+DAF+N SFF +D  + V
Sbjct  712   FILGDSQNSWSRMMENSMDAFRNMSFFVSDNNDSV  746



>gb|ACN26933.1| unknown [Zea mays]
Length=608

 Score =   462 bits (1189),  Expect = 3e-146, Method: Compositional matrix adjust.
 Identities = 280/590 (47%), Positives = 363/590 (62%), Gaps = 63/590 (11%)
 Frame = +1

Query  427   QQPVKRQTRKWAAWTREEEESFFSALRHVGKNFEKITSRVQSKNKDQVRHYYYRLVRRMN  606
             ++P K+QTR+WAAWT +EEE FF+ALR VGKNF+KIT RVQSKNKDQVRHYYYRLVRRM 
Sbjct  19    RKPAKKQTRQWAAWTHQEEEIFFNALRQVGKNFDKITHRVQSKNKDQVRHYYYRLVRRMK  78

Query  607   KLLGPELCLNAKNSRDTNAAMLRWWSLLEKYSCKASKLHLKPRRFKIFIETLENQLLKD-  783
             KLLGP   L+AKNS+DT AAMLRWWSLLEK+SC ASKLHLKPRRFK F+E L  QLLKD 
Sbjct  79    KLLGPRFSLDAKNSKDTIAAMLRWWSLLEKFSCTASKLHLKPRRFKTFVEALGKQLLKDR  138

Query  784   -----RKKNVRRCFSQGENTSTAPISVSNQGRGASGHDGRSVKVVLLDNQDIHKFGSGKG  948
                  ++  V  C       S +PI +S     A G++   VK + +D Q+  +  S KG
Sbjct  139   NKSRRKRSRVDMCLP-----SPSPI-ISK----APGNENPPVKFLSVDAQNGSRVASPKG  188

Query  949   SSLKRHIN-IGANSTSCKADSSLLKTARHRRKIG---ATAAYKRWEKAAIAGVSLVADAA  1116
             S  K+    I     + K + S  +T + +RK G   A+AAYK+WE+AA+AGVSLVADAA
Sbjct  189   SIFKQVAEPISNKPGTTKGELSATRTVKQKRKAGGAVASAAYKKWERAAMAGVSLVADAA  248

Query  1117  EHLERTTTDKEDGHFQDSNVRNVFEHSGKDPHVFPDLLHNSFNETNLQNSGKLKLQLFPV  1296
             E LER T +   G F + + R +   S +   +   +  N   E + Q   KLKLQLFP+
Sbjct  249   EELERNTINP--GIFCNVDARTLTSLSERLSSI-DGISTNHMKEADSQAPVKLKLQLFPI  305

Query  1297  DDGTRRALELDNHNPYLELTLSTRKKMSSVLEHLNRKWGNSSMACGDLMLFPYHLHKENL  1476
             ++ TR+ALE D+HNP+LELTLS+RKK+SSVLEHLNRKWGNS++A G+L+LFPY  ++E+L
Sbjct  306   NEATRKALEKDDHNPHLELTLSSRKKISSVLEHLNRKWGNSNIASGELILFPYCANQEDL  365

Query  1477  VHFQKWTKDTTLTAADVYALTGSPPVFRLRYGWFSNAEVAFRAPVSSAIPSRHDANMNIM  1656
               +Q+WT   T+  ADV+    SP VFRLRYGW S  E+   A VS    +  +  M  +
Sbjct  366   ATYQRWTTRDTVAVADVFLSVNSPSVFRLRYGWVSLVELG--AGVSEISLTHFEDCM--I  421

Query  1657  PESSVGVLQAPSTDPPKEANGCVSMNTVNASRSSDHTEAVLWENPETV------------  1800
             PE  V  +++PS D       CV          SD   + L + P  V            
Sbjct  422   PE--VIQVKSPSGD-----KACV---------QSDGKNSELPDEPANVPPSQFGSQKQAH  465

Query  1801  --VTEAEVDDLQFNKAGTSCVGEWADSLTNISVGDLLSEAPDMEDANCITSSIHSSSNYI  1974
               +T+A  DD   N    S V EWAD+LTNIS G LL+EA      +C  +S+ +     
Sbjct  466   VPITQAFEDDQGMNCVAISAV-EWADTLTNISFGHLLTEASKGTHLDCGGTSVKNP--LF  522

Query  1975  HQIPFSCDSFDAAIAAHIKKHQNVTDSQAALPSQLSSIWGAEDTCDAFAF  2124
              + P S DSFDAA+A H  ++Q  ++  A  P   S+IWGAE+TCD F F
Sbjct  523   FENPCSYDSFDAAVALHASRYQ-ASEQSAHAPH--STIWGAEETCDEFIF  569



>ref|XP_008387641.1| PREDICTED: TSL-kinase interacting protein 1, partial [Malus domestica]
Length=555

 Score =   432 bits (1112),  Expect = 8e-136, Method: Compositional matrix adjust.
 Identities = 247/529 (47%), Positives = 326/529 (62%), Gaps = 41/529 (8%)
 Frame = +1

Query  1048  ATAAYKRWEKAAIAGVSLVADAAEHLERTTTDKEDGHFQDSNVRNVFEH--SGKDPHVFP  1221
             ++ AYK+WEKAAIAGVSLVADAAEHLER  TDKE    QD +         +G      P
Sbjct  24    SSVAYKKWEKAAIAGVSLVADAAEHLERAATDKEVQQ-QDRSTEGQSSSVPAGTVLSPMP  82

Query  1222  DLLHNSFNETNLQNSGKLKLQLFPVDDGTRRALELDNHNPYLELTLSTRKKMSSVLEHLN  1401
                   + E N     KLKLQLFP+DD TRRALE+D HNP+LELTLSTRKK+SSVLEHLN
Sbjct  83    TFPQKIYAENNCM---KLKLQLFPIDDVTRRALEIDKHNPHLELTLSTRKKISSVLEHLN  139

Query  1402  RKWGNSSMACGDLMLFPYHLHKENLVHFQKWTKDTTLTAADVYALTGSPPVFRLRYGWFS  1581
             RKWGNS++A G+LMLFPY + +ENL+ + +W +D+ ++AADVY+  GSPPVFRLRYGWFS
Sbjct  140   RKWGNSNVASGELMLFPYSVQRENLMGYPRWAQDSVVSAADVYSTIGSPPVFRLRYGWFS  199

Query  1582  NAE---VAFRAPVSSA--------IPSRHDANMNIMPESSVGV---------LQAPSTDP  1701
               E   V F++P++S         +  R++  ++  P S +           L   STD 
Sbjct  200   XTELRSVEFQSPIASCSIQGEHMNVEKRNEQIVDSTPISHLSTNNQSVDKNSLALTSTDE  259

Query  1702  PKEANGCVSMNTVNASRSSD----HTEAVLWENPETVVTEAEVDDLQFNKAGTSCVGEWA  1869
             P E +GCVS +  N    ++    H +    +N  T     ++D  +     +   G+WA
Sbjct  260   PNEISGCVSSSPNNVGAPTEIRTLHRKEAGDQN--TSGHRGDLDGTRLINGNSLSSGDWA  317

Query  1870  DSLTNISVGDLLSEAPDMEDANCITSSIHSSSNYIHQIPFSCDSFDAAIAAHIKKHQNVT  2049
             DSLTNISVGDLL       D+NCI      +S  + QIPFSCDSFDA IAAHI + Q+  
Sbjct  318   DSLTNISVGDLLLGVSHDLDSNCIDPPAAETSQCLQQIPFSCDSFDAVIAAHIAR-QDKM  376

Query  2050  DSQAALPSQLSSIWGAEDTCDAFAFQRHSL-SEKVQNASKHTSLETCKQITLANTTALGA  2226
               Q+ + S +SSIW AE+TCD F+F ++ +  ++V + S       CKQ    ++     
Sbjct  377   GCQSIMESHVSSIWDAEETCDGFSFPKNPVFCQEVPSLSGVAPQGPCKQTVCTSSAGSDL  436

Query  2227  SVEDLPGARNPV---DGDAATADLESVHYSPTSDVVKDFNGLSDVYWPDSLGPLDLDIPS  2397
              VED+P    P+    GD        +H   +   VKDFN L+D+YWP+SLGPLDL++PS
Sbjct  437   MVEDIPVVDRPIGPPQGDRVDQCQPDLHIESS---VKDFNALADIYWPESLGPLDLEMPS  493

Query  2398  SRYHSE-LILSDSLGGLTQLIASSLDAFQNCSFFGADKKEPVSTTEAQE  2541
             S+Y++E  +LSDSL GL +LIASSLDAFQNCSFFG +KKEP  + E +E
Sbjct  494   SKYNNEDFMLSDSLSGLNRLIASSLDAFQNCSFFGVNKKEPTPSAEGRE  542



>tpg|DAA44324.1| TPA: putative MYB DNA-binding domain superfamily protein, partial 
[Zea mays]
Length=469

 Score =   402 bits (1032),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 216/400 (54%), Positives = 275/400 (69%), Gaps = 23/400 (6%)
 Frame = +1

Query  427   QQPVKRQTRKWAAWTREEEESFFSALRHVGKNFEKITSRVQSKNKDQVRHYYYRLVRRMN  606
             ++P K+QTR+WAAWT +EEE FF+ALR VGKNF+KIT RVQSKNKDQVRHYYYRLVRRM 
Sbjct  19    RKPAKKQTRQWAAWTHQEEEIFFNALRQVGKNFDKITHRVQSKNKDQVRHYYYRLVRRMK  78

Query  607   KLLGPELCLNAKNSRDTNAAMLRWWSLLEKYSCKASKLHLKPRRFKIFIETLENQLLKD-  783
             KLLGP   L+AKNS+DT AAMLRWWSLLEK+SC ASKLHLKPRRFK F+E L  QLLKD 
Sbjct  79    KLLGPRFSLDAKNSKDTIAAMLRWWSLLEKFSCTASKLHLKPRRFKTFVEALGKQLLKDR  138

Query  784   -----RKKNVRRCFSQGENTSTAPISVSNQGRGASGHDGRSVKVVLLDNQDIHKFGSGKG  948
                  ++  V  C       S +PI +S     A G++   VK + +D Q+  +  S KG
Sbjct  139   NKSRRKRSRVDMCLP-----SPSPI-ISK----APGNENPPVKFLSVDAQNGSRVASPKG  188

Query  949   SSLKRHIN-IGANSTSCKADSSLLKTARHRRKIG---ATAAYKRWEKAAIAGVSLVADAA  1116
             S  K+    I     + K + S  +T + +RK G   A+AAYK+WE+AA+AGVSLVADAA
Sbjct  189   SIFKQVAEPISNKPGTTKGELSATRTVKQKRKAGGAVASAAYKKWERAAMAGVSLVADAA  248

Query  1117  EHLERTTTDKEDGHFQDSNVRNVFEHSGKDPHVFPDLLHNSFNETNLQNSGKLKLQLFPV  1296
             E LER T +   G F + + R +   S +   +   +  N   E + Q   KLKLQLFP+
Sbjct  249   EELERNTIN--PGIFCNVDARTLTSLSERLSSI-DGISTNHMKEADSQAPVKLKLQLFPI  305

Query  1297  DDGTRRALELDNHNPYLELTLSTRKKMSSVLEHLNRKWGNSSMACGDLMLFPYHLHKENL  1476
             ++ TR+ALE D+HNP+LELTLS+RKK+SSVLEHLNRKWGNS++A G+L+LFPY  ++E+L
Sbjct  306   NEATRKALEKDDHNPHLELTLSSRKKISSVLEHLNRKWGNSNIASGELILFPYCANQEDL  365

Query  1477  VHFQKWTKDTTLTAADVYALTGSPPVFRLRYGWFSNAEVA  1596
               +Q+WT   T+  ADV+    SP VFRLRYGW S  E+ 
Sbjct  366   ATYQRWTTRDTVAVADVFLSVNSPSVFRLRYGWVSLVELG  405



>ref|XP_002468193.1| hypothetical protein SORBIDRAFT_01g041425 [Sorghum bicolor]
 gb|EER95191.1| hypothetical protein SORBIDRAFT_01g041425 [Sorghum bicolor]
Length=663

 Score =   405 bits (1040),  Expect = 7e-124, Method: Compositional matrix adjust.
 Identities = 220/423 (52%), Positives = 276/423 (65%), Gaps = 47/423 (11%)
 Frame = +1

Query  427   QQPVKRQTRKWAAWTREEEESFFSALRHVGKNFEKITSRVQSKNKDQVRHYYYRLVRRMN  606
             ++P K+QTR+WAAWT +EEE+FF+ALR VGKNF+KIT RVQSKNKDQVRHYYYRLVRRM 
Sbjct  15    KKPAKKQTRQWAAWTHQEEENFFNALRQVGKNFDKITHRVQSKNKDQVRHYYYRLVRRMK  74

Query  607   KLLGPELCLNAKNSRDTNAAMLRWWSLLEKYSCKASKLHLKPRRFKIFIETLENQLLKDR  786
             KLLGP   L+AKNS+DT AAMLRWWSLLEK+SC ASKLHLKPRRFK F+E    QLLKD 
Sbjct  75    KLLGPRFLLDAKNSKDTIAAMLRWWSLLEKFSCSASKLHLKPRRFKTFVEAFGKQLLKDS  134

Query  787   KKNVRR-----CF-SQGENTSTAPISVSNQGRGASGHDGRSVKVVLLDNQDIHKFGSGKG  948
             K   +R     C  S   N S  P           G++   VK++ +D Q+  +  S KG
Sbjct  135   KSRRKRSRVDMCLPSPSPNVSKVP-----------GNE-TPVKLLSVDAQNGSRVASPKG  182

Query  949   SSLKRHIN-IGANSTSCKADSSLLKTARHRRKIGAT---AAYKRWEKAAIAGVSLVADAA  1116
             +  KR    I + S + K D S  +T + +RK G T   AAYK+WE+AA+AGVSLVADAA
Sbjct  183   TIFKRVAEPISSKSGTTKGDLSATRTVKQKRKAGGTVASAAYKKWERAAMAGVSLVADAA  242

Query  1117  EHLERTTTDKEDGHFQDSNVRNVFEHSGK-------------DPHVFPDLLH--------  1233
             E LER T +   G   + + R +   S +                VF +L          
Sbjct  243   EELERNTVNP--GMLCNVDARTLTSSSDRLCTVDGMASSNWISVLVFAELCSTHSLELSI  300

Query  1234  --NSFNETNLQNSGKLKLQLFPVDDGTRRALELDNHNPYLELTLSTRKKMSSVLEHLNRK  1407
               N   E + Q   KLKLQLFP+++ TR+ALE D+HNP+LELTLS+RKK+SSVLEHLNRK
Sbjct  301   STNHMKEADSQAPVKLKLQLFPINEATRKALEKDDHNPHLELTLSSRKKISSVLEHLNRK  360

Query  1408  WGNSSMACGDLMLFPYHLHKENLVHFQKWTKDTTLTAADVYALTGSPPVFRLRYGWFSNA  1587
             WGNS++A G+L+LFPY  ++E+L  +Q+WT   T+  ADV+    SP VFRLRYGWFS  
Sbjct  361   WGNSNIASGELILFPYCANQEDLATYQRWTTRDTVVVADVFLSVNSPSVFRLRYGWFSLV  420

Query  1588  EVA  1596
             E+ 
Sbjct  421   ELG  423


 Score =   142 bits (358),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 88/237 (37%), Positives = 137/237 (58%), Gaps = 17/237 (7%)
 Frame = +1

Query  1843  GTSCVG----EWADSLTNISVGDLLSEAPDMEDANCITSSIHSSSNYIHQIPFSCDSFDA  2010
             G +CV     EWAD+LT+ISVG LL+E       +C+ +S+ +      + P S DSFDA
Sbjct  429   GMNCVAISEVEWADTLTDISVGHLLTETSKDAHLDCVGTSVKNP--LFLENPCSYDSFDA  486

Query  2011  AIAAHIKKHQNVTDSQAALPSQLSSIWGAEDTCDAFAFQRHSLSEKVQNASKHTSLETCK  2190
             A+A H   +Q  ++  A  P   S+IWGAE+TCD F+F   +  ++  + +  +S +T  
Sbjct  487   AVALHASHYQ-ASEKPAHTPH--STIWGAEETCDEFSFNLSASRKQEGSNTPSSSPDTDN  543

Query  2191  QITLANTTALGASVEDLPGAR----NPVDGDAATADLESVHYSPTSDVVKDF--NGLSDV  2352
             ++  +N+      ++DL G      NP + DA   +       P +D   +     L+D+
Sbjct  544   EVHPSNSEGFQGFLQDLIGGEAGGDNPCNDDAKDIEEFYAKSPPRNDETNELKDQALADI  603

Query  2353  YWPDSLGPLDLDIPSSRYHS-ELILSDSLGGLTQLIASSLDAFQNCSFFGADKKEPV  2520
             YWPDSLGPLDLDIPS RY + ++++ DS    ++L+A+SLDAF+N SFF +DK + +
Sbjct  604   YWPDSLGPLDLDIPSVRYQADDILIGDSQNSWSRLMANSLDAFRNLSFF-SDKNDSI  659



>gb|ABE77201.1| unknown [Sorghum bicolor]
Length=669

 Score =   404 bits (1038),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 222/427 (52%), Positives = 278/427 (65%), Gaps = 50/427 (12%)
 Frame = +1

Query  430   QPVKRQTRKWAAWTREEEESFFSALRHVGKNFEKITSRVQSKNKDQVRHYYYRLVRRMNK  609
             +P K+QTR+WAAWT +EEE+FF+ALR VGKNF+KIT RVQSKNKDQVRHYYYRLVRRM K
Sbjct  16    KPAKKQTRQWAAWTHQEEENFFNALRQVGKNFDKITHRVQSKNKDQVRHYYYRLVRRMKK  75

Query  610   LLGPELCLNAKNSRDTNAAMLRWWSLLEKYSCKASKLHLKPRRFKIFIETLENQLLKD--  783
             LLGP   L+AKNS+DT AAMLRWWSLLEK+SC ASKLHLKPRRFK FIE L  QLLKD  
Sbjct  76    LLGPRFSLDAKNSKDTIAAMLRWWSLLEKFSCSASKLHLKPRRFKTFIEALGKQLLKDRN  135

Query  784   ----RKKNVRRCFSQGENTSTAPISVSNQGRGASGHDGRSVKVVLLDNQDIHKFGSGKGS  951
                 ++  V  C       S +PI +S     A G++   VK + +D Q+  +  S KG+
Sbjct  136   KSRRKRSRVDMCLP-----SPSPI-ISK----APGNETPPVKFLPVDAQNGSRVASSKGT  185

Query  952   SLKRHIN-IGANSTSCKADSSLLKTARHRRKIG---ATAAYKRWEKAAIAGVSLVADAAE  1119
               KR    I   S + K D S  +T + +RK G   A+AAYK+WE+AA+AGVSLVADAAE
Sbjct  186   IFKRVAEPISNKSGTTKGDLSATRTVKQKRKAGGAVASAAYKKWERAAMAGVSLVADAAE  245

Query  1120  HLERTTTDKEDGHFQDSNVRNVFEHSGKDPH-------------VFPDLLH---------  1233
              LER T +   G   + + R +   S + P              VF +L           
Sbjct  246   ELERNTINP--GILCNVDARTLTSSSDRLPTADGIASSNWILVLVFAELCSTHSLKLTVA  303

Query  1234  ------NSFNETNLQNSGKLKLQLFPVDDGTRRALELDNHNPYLELTLSTRKKMSSVLEH  1395
                   N   E + Q   KLKLQLFP+++ TR+ALE D+HNP+LELTLS+RKK+SSVLEH
Sbjct  304   DTGISTNHMKEADSQTPVKLKLQLFPINEATRKALEKDDHNPHLELTLSSRKKISSVLEH  363

Query  1396  LNRKWGNSSMACGDLMLFPYHLHKENLVHFQKWTKDTTLTAADVYALTGSPPVFRLRYGW  1575
             LNRKWGNS++A G+L+LFPY  ++E+L  +Q+WT    +  ADV+    SP VFRLRYGW
Sbjct  364   LNRKWGNSNIASGELILFPYCANQEDLATYQRWTTRDAVAVADVFLSVNSPSVFRLRYGW  423

Query  1576  FSNAEVA  1596
             FS  E+ 
Sbjct  424   FSLVELG  430


 Score =   142 bits (358),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 90/236 (38%), Positives = 138/236 (58%), Gaps = 16/236 (7%)
 Frame = +1

Query  1843  GTSCVG----EWADSLTNISVGDLLSEAPDMEDANCITSSIHSSSNYIHQIPFSCDSFDA  2010
             GT+CV     EWAD+LT+ISVG LL+EA      +CI +S+ +      +   S DSFDA
Sbjct  436   GTNCVAISEVEWADTLTDISVGHLLTEASKGAHLDCIGTSVKNP--LFLENTCSYDSFDA  493

Query  2011  AIAAHIKKHQNVTDSQAALPSQLSSIWGAEDTCDAFAFQRHSLSEKVQNASKHTSLETCK  2190
             A+A H  ++Q  ++  A  P   S+IWGAE+TCD F+F   +  ++  + +  +S +T  
Sbjct  494   AVALHASRYQ-ASEQPAHAPH--STIWGAEETCDEFSFNLSASRKQEGSNTPSSSPDTDN  550

Query  2191  QITLANTTALGASVEDLPG---ARNPVDGDAATADLESVHYSPTSDVVKDF--NGLSDVY  2355
             ++  +++       +DL G   A NP + DA   +       P +D   +     L+D+Y
Sbjct  551   EVHPSSSEGFQGFFQDLTGEDDADNPYNDDAKDEEELCAKSPPQNDETNELKDQSLADIY  610

Query  2356  WPDSLGPLDLDIPSSRYHS-ELILSDSLGGLTQLIASSLDAFQNCSFFGADKKEPV  2520
             WPDSLGPLDLDIPS RY + ++++ DS     +L+A+SLDAF+N SFF +DK + +
Sbjct  611   WPDSLGPLDLDIPSVRYQADDILIGDSQNSWNRLMANSLDAFRNLSFF-SDKNDSI  665



>ref|NP_001169354.1| uncharacterized protein LOC100383221 [Zea mays]
 gb|ACN33517.1| unknown [Zea mays]
Length=385

 Score =   385 bits (990),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 205/374 (55%), Positives = 266/374 (71%), Gaps = 11/374 (3%)
 Frame = +1

Query  427   QQPVKRQTRKWAAWTREEEESFFSALRHVGKNFEKITSRVQSKNKDQVRHYYYRLVRRMN  606
             +QP K+QTR+WAAWT +EEE+FF+ALR VGKNF+KIT RVQSKNKDQVRHYYYRLVRRM 
Sbjct  19    KQPAKKQTRQWAAWTHQEEENFFNALRQVGKNFDKITHRVQSKNKDQVRHYYYRLVRRMK  78

Query  607   KLLGPELCLNAKNSRDTNAAMLRWWSLLEKYSCKASKLHLKPRRFKIFIETLENQLLKDR  786
             KLLGP   L+AKNS+DT AAMLRWWSLLEK+SC ASKLHLKPRRFK F+E L  QLLKDR
Sbjct  79    KLLGPRFSLDAKNSKDTIAAMLRWWSLLEKFSCSASKLHLKPRRFKTFVEALGKQLLKDR  138

Query  787   KKNVRRCFSQGENTSTAPISVSNQGRGASGHDGRSVKVVLLDNQDIHKFGSGKGSSLKRH  966
              K+ R+  S+ +   ++P  V ++   A G +   VK + +D+Q+  +  S KG+  KR 
Sbjct  139   NKS-RKKHSRVDMCISSPSPVISK---APGDETPPVKFLSIDSQNGSRVASPKGTIFKRI  194

Query  967   IN-IGANSTSCKADSSLLKTARHRRKIG---ATAAYKRWEKAAIAGVSLVADAAEHLERT  1134
                I   S + K D S  +T + +RK G   A+AAYK+WE+AA+AGVSLVADAAE LER 
Sbjct  195   AEPISNKSGTTKGDLSATRTVKQKRKAGGAVASAAYKKWERAAMAGVSLVADAAEELERN  254

Query  1135  TTDKEDGHFQDSNVRNVFEHSGKDPHVFPDLLHNSFNETNLQNSGKLKLQLFPVDDGTRR  1314
             T +   G   + + R +   S +       +  N   ET+ Q   KLKLQLFP+++ TR+
Sbjct  255   TIN--PGMLCNVDARTLTSSSDR-LSTGDGISTNHMKETDSQAPVKLKLQLFPINEATRK  311

Query  1315  ALELDNHNPYLELTLSTRKKMSSVLEHLNRKWGNSSMACGDLMLFPYHLHKENLVHFQKW  1494
             ALE D+HNP+LELTLS+RKK+SSVLEHLNRKWGNS++A G+L+LFPY  ++E+L  +Q+W
Sbjct  312   ALEKDDHNPHLELTLSSRKKISSVLEHLNRKWGNSNIASGELILFPYCANQEDLATYQRW  371

Query  1495  TKDTTLTAADVYAL  1536
             T +  L +   + L
Sbjct  372   TTEILLQSLMCFFL  385



>ref|XP_008387567.1| PREDICTED: TSL-kinase interacting protein 1-like [Malus domestica]
Length=248

 Score =   311 bits (797),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 164/242 (68%), Positives = 187/242 (77%), Gaps = 6/242 (2%)
 Frame = +1

Query  325   IASSQEHAIPEQAMFSQDHSVTEQLASFEEHSALQQPVKRQTRKWAAWTREEEESFFSAL  504
             I  S+ H  P Q  F           +   H A QQP+K+ TR+WAAWT +EEESFFSAL
Sbjct  8     IMDSEVH--PHQGSFLVQDGGPVVAPTISTHVAQQQPMKKTTRQWAAWTHQEEESFFSAL  65

Query  505   RHVGKNFEKITSRVQSKNKDQVRHYYYRLVRRMNKLLGPELCLNAKNSRDTNAAMLRWWS  684
             R VGKNFEKIT RVQSKNKDQVRHYYYRLVRRMNKLLGPEL L++KNS+DTNAAMLRWWS
Sbjct  66    RQVGKNFEKITRRVQSKNKDQVRHYYYRLVRRMNKLLGPELYLDSKNSKDTNAAMLRWWS  125

Query  685   LLEKYSCKASKLHLKPRRFKIFIETLENQLLKDRKKNVRRCFSQGENT-STAPISVSNQG  861
             LLEKYSCKASKLHLKPRRFKIFIE LE+QLLKDRKK+VR+  SQGEN    AP +VSNQ 
Sbjct  126   LLEKYSCKASKLHLKPRRFKIFIEALEHQLLKDRKKSVRKRPSQGENCPPNAPSTVSNQN  185

Query  862   RGASGHDGRSVKVVLLDNQDIHKFGSGKGSSLKRHINIGANSTSCKADSSLLKTARHRRK  1041
             R  SGHD R+VK+VL+D+ +I K G GK +S+KR++NIG N  S K DSS +K AR RRK
Sbjct  186   R-PSGHDNRTVKLVLVDSHNIQKLGPGK-ASMKRNVNIGVNR-SNKGDSSTMKPARQRRK  242

Query  1042  IG  1047
              G
Sbjct  243   PG  244



>emb|CDY18470.1| BnaA04g21170D [Brassica napus]
Length=256

 Score =   226 bits (576),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 127/239 (53%), Positives = 163/239 (68%), Gaps = 28/239 (12%)
 Frame = +1

Query  439   KRQTRKWAAWTREEEESFFSALRHVGKNFEKITSRVQSKNKDQVRHYYYRLVRRMNKLLG  618
             K+ TR+WAAWT +EEE FF+ALR VGKNF KITS VQSKNKDQV HYY RL         
Sbjct  33    KKPTRQWAAWTHQEEECFFTALRQVGKNFLKITSHVQSKNKDQVGHYYCRL---------  83

Query  619   PELCLNAKNSRDTNAAMLRWWSLLEKYSCKASKLHLKPRRFKIFIETLENQLLKDRKKNV  798
                        DTNAAMLRWWSLLEK+SCKASKLHLKPRRFK+F+E LE+QLLKD +K+ 
Sbjct  84    -----------DTNAAMLRWWSLLEKHSCKASKLHLKPRRFKLFLEALEHQLLKDSRKST  132

Query  799   RRCFSQGENTSTAPI-SVSNQGRGASGHDGRSVKVVLLDNQDIHKFGSGKGSSLKRHINI  975
              +    GE  S+A + ++S+Q R   G D R +K++L D+Q++ K G G+ S+ +     
Sbjct  133   SKRACHGETFSSASLENISSQSR-ERGLDNRPLKMILCDSQNVKKLGPGRSSTKQ-----  186

Query  976   GANSTSCKAD-SSLLKTARHRRKIGATAAYKRWEKAAIAGVSLVADAAEHLERTTTDKE  1149
             G +STS  A    L+     +  + A+A +++WEKAAI GVSLVADAAEHLERT+ +K+
Sbjct  187   GTSSTSFYAVLLRLILWVCVQSVLPASAGFRKWEKAAIDGVSLVADAAEHLERTSINKD  245



>ref|XP_010929796.1| PREDICTED: TSL-kinase interacting protein 1-like isoform X3 [Elaeis 
guineensis]
Length=487

 Score =   231 bits (590),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 171/443 (39%), Positives = 223/443 (50%), Gaps = 70/443 (16%)
 Frame = +1

Query  1258  QNSGKLKLQLFPVDDGTRRALELDNHNPYLELTLSTRKKMSSVLEHLNRKWGNSSMACGD  1437
             Q SGKLKLQLFP+D+ T++ LE D +NPYLEL L TRKK+SSV++HLN KWG+S  A GD
Sbjct  85    QCSGKLKLQLFPIDEVTQKGLEQDKYNPYLELILPTRKKISSVVKHLNVKWGSSKSASGD  144

Query  1438  LMLFPYHLHKENLVHFQKWT-KDTTLTAADVYALTGSPPVFRLRYGWFSNAEVAFRAPVS  1614
             LMLFPY+ H+ NLV +++WT K++   AADVYA  GSP +FRLRYGWFSN      AP +
Sbjct  145   LMLFPYNAHRNNLVSYRRWTIKESDTRAADVYAAVGSPAIFRLRYGWFSNL-----APTT  199

Query  1615  SAIPSRHDANMNIMPESSVGVLQAPSTDPPKEANGCVSMNTVNASRSSDHTEAVLWENPE  1794
                P     + + +      ++ A     P+    C + N  N S       A    +  
Sbjct  200   CERPLASLHSEDCLQIKETQIINAIEEKIPQ----CPASNIENGS-------ACFHNSLN  248

Query  1795  TVVTEAEVDDLQFNKAGTSCVGEWADSLTNISVGDLLSEAPDMEDANCITSSIHSSSNYI  1974
               +    V D          +  WAD L+NIS+G LLSEA   ++++            +
Sbjct  249   QGIGAPPVLDKSVQDQDKFALLSWADCLSNISIGTLLSEAQLAQNSS------------L  296

Query  1975  HQIPFSCDSFDAAIAAHIKKHQNVTDSQAALPSQLSSIWGAEDTCDAFAFQRHSLSEKVQ  2154
              QIP +CDSFDAA+A+ I + Q  T  Q+   S  SSIW AE+TC AFAFQ+ + S    
Sbjct  297   QQIPITCDSFDAAVASIIAREQ--TKYQSTQVSH-SSIWDAEETCHAFAFQKSTSSNNND  353

Query  2155  NA-SKHTSLETCKQ-ITLANTTALGASVEDLPGARN---PVDGDA-------ATADLESV  2298
              A S+      C Q I+          V  LP A N   P+  +A       ATADL+  
Sbjct  354   PASSRDAPPAACTQNISSTLVRPNDMVVHALPAATNLQLPIKNNATPEPTPEATADLQPY  413

Query  2299  HYSPTSDVVK-------------DFNGLSDVYWPDSLGPLDLDIPSSRYHSELILSDSLG  2439
                  S  +K             DF G  D+YWP S G        SR  S        G
Sbjct  414   AEDDASKELKTSAEPLIEDSCNSDF-GRVDIYWPQSSGLSGCITSPSRQMS--------G  464

Query  2440  G----LTQLIASSLDAFQNCSFF  2496
             G    L  L+ +SLDAFQN S F
Sbjct  465   GDRNNLGTLLETSLDAFQNVSIF  487



>ref|XP_010929794.1| PREDICTED: TSL-kinase interacting protein 1-like isoform X1 [Elaeis 
guineensis]
Length=491

 Score =   231 bits (590),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 171/447 (38%), Positives = 225/447 (50%), Gaps = 74/447 (17%)
 Frame = +1

Query  1258  QNSGKLKLQLFPVDDGTRRALELDNHNPYLELTLSTRKKMSSVLEHLNRKWGNSSMACGD  1437
             Q SGKLKLQLFP+D+ T++ LE D +NPYLEL L TRKK+SSV++HLN KWG+S  A GD
Sbjct  85    QCSGKLKLQLFPIDEVTQKGLEQDKYNPYLELILPTRKKISSVVKHLNVKWGSSKSASGD  144

Query  1438  LMLFPYHLHKENLVHFQKWT-KDTTLTAADVYALTGSPPVFRLRYGWFSNAEVAFRAPVS  1614
             LMLFPY+ H+ NLV +++WT K++   AADVYA  GSP +FRLRYGWFSN      AP +
Sbjct  145   LMLFPYNAHRNNLVSYRRWTIKESDTRAADVYAAVGSPAIFRLRYGWFSNL-----APTT  199

Query  1615  SAIPSRHDANMNIMPESSVGVLQAPSTDPPKEANGCVSMNTVNASRSSDHTEAVLWENPE  1794
                P     + + +      ++ A     P+    C + N  N S       A    +  
Sbjct  200   CERPLASLHSEDCLQIKETQIINAIEEKIPQ----CPASNIENGS-------ACFHNSLN  248

Query  1795  TVVTEAEVDDLQFNKAGTSCVGEWADSLTNISVGDLLSEAPDMEDANCITSSIHSSSNYI  1974
               +    V D          +  WAD L+NIS+G LLSEA   ++++            +
Sbjct  249   QGIGAPPVLDKSVQDQDKFALLSWADCLSNISIGTLLSEAQLAQNSS------------L  296

Query  1975  HQIPFSCDSFDAAIAAHIKKHQNVTDSQAALPSQLSSIWGAEDTCDAFAFQRHSLSEKVQ  2154
              QIP +CDSFDAA+A+ I + Q  T  Q+   S  SSIW AE+TC AFAFQ+ + S    
Sbjct  297   QQIPITCDSFDAAVASIIAREQ--TKYQSTQVSH-SSIWDAEETCHAFAFQKSTSSNNND  353

Query  2155  NASKHTSLETCKQITLANTTA-----LGAS-VEDLPGARN---PVDGDA-------ATAD  2286
              AS   +        +++T       LG   V  LP A N   P+  +A       ATAD
Sbjct  354   PASSRDAPPAACTQNISSTLVRPNDMLGTQVVHALPAATNLQLPIKNNATPEPTPEATAD  413

Query  2287  LESVHYSPTSDVVK-------------DFNGLSDVYWPDSLGPLDLDIPSSRYHSELILS  2427
             L+       S  +K             DF G  D+YWP S G        SR  S     
Sbjct  414   LQPYAEDDASKELKTSAEPLIEDSCNSDF-GRVDIYWPQSSGLSGCITSPSRQMS-----  467

Query  2428  DSLGG----LTQLIASSLDAFQNCSFF  2496
                GG    L  L+ +SLDAFQN S F
Sbjct  468   ---GGDRNNLGTLLETSLDAFQNVSIF  491



>ref|XP_010261014.1| PREDICTED: TSL-kinase interacting protein 1-like [Nelumbo nucifera]
 ref|XP_010261015.1| PREDICTED: TSL-kinase interacting protein 1-like [Nelumbo nucifera]
Length=469

 Score =   231 bits (588),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 172/435 (40%), Positives = 228/435 (52%), Gaps = 72/435 (17%)
 Frame = +1

Query  1255  LQNSGKLKLQLFPVDDGTRRALELDNHNPYLELTLSTRKKMSSVLEHLNRKWGNSSMACG  1434
             LQ S K++LQLFP+D+GTR  LE D HNP+LELTL  RKK+ SVL HL+ KWG+SS+A G
Sbjct  91    LQPSAKIRLQLFPIDEGTRTGLEKDGHNPHLELTLRARKKLVSVLNHLHNKWGSSSVAVG  150

Query  1435  DLMLFPYHLHKENLVHFQKWT-KDTTLTAADVYALTGSPPVFRLRYGWFSNAEVAFRAPV  1611
             +LML PY++  ENL  +++WT KD+ ++AADVY   G P +FRLRYGWFS+ E       
Sbjct  151   ELMLLPYNVRLENLAGYRRWTLKDSAISAADVYEAIGKPLIFRLRYGWFSDLE-------  203

Query  1612  SSAIPSRHDANMNIMPESSVGVLQAPSTDPPKEANGCVSMNTVNASRSSDHTEAVLWENP  1791
                                            K  N   + N +  S           EN 
Sbjct  204   ------------------------------SKTHNKSPTSNNIRGSSQFGDIHKSFSENV  233

Query  1792  ETVVTEAEV--DDLQFNKAGTSCVGEWADSLTNISVGDLLSEAPDMEDAN-CITSSIHSS  1962
             E +  + +   D+L+ +   T     WADSLTNIS+G LLSEA    + N C    I  S
Sbjct  234   ECMNGDKQPLEDNLRASNTATPSSLGWADSLTNISMGGLLSEASLQGNVNRCDPMPIGGS  293

Query  1963  SNYIHQIPFSCDSFDAAIAAHIKKHQNVTDSQAALPS---QLSSIWGAEDTCDAFAFQRH  2133
             S  + Q+PFS DSFDAAIAAHI        SQ ++PS     SSI+ AE+TC AF FQ+ 
Sbjct  294   S--LQQLPFSSDSFDAAIAAHIYGR-----SQGSIPSSHVSHSSIFDAEETCHAFPFQKF  346

Query  2134  SLSEKVQNA-------SKHTSLETCKQITLANTTALGASVEDLPGARNPVDGDAATADLE  2292
               S K   A       S+  SL+  K  TL    A   S +D          +   ADL 
Sbjct  347   CSSGKEFVAASRSGACSQDASLKPFKFPTLVEEEAQTGSTQD--------QTEEPKADL-  397

Query  2293  SVHYSPTSDVVKDFNGLSDVYWPDSLGPLDLDIPSSRYHSELILSDSLGGLTQLIASSLD  2472
              +     +D  ++  G+ D+ W DSL   DL + SSR   ++I  DS+   + L++SSLD
Sbjct  398   -LLQRQGADNGENSLGMPDINWSDSLWSPDLSLSSSR---QIISGDSI-NFSSLLSSSLD  452

Query  2473  AFQNCSFFGADKKEP  2517
             AFQ+ SFF  D+K P
Sbjct  453   AFQSRSFFLRDEKVP  467



>ref|XP_010929795.1| PREDICTED: TSL-kinase interacting protein 1-like isoform X2 [Elaeis 
guineensis]
Length=489

 Score =   229 bits (585),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 173/447 (39%), Positives = 229/447 (51%), Gaps = 76/447 (17%)
 Frame = +1

Query  1258  QNSGKLKLQLFPVDDGTRRALELDNHNPYLELTLSTRKKMSSVLEHLNRKWGNSSMACGD  1437
             Q SGKLKLQLFP+D+ T++ LE D +NPYLEL L TRKK+SSV++HLN KWG+S  A GD
Sbjct  85    QCSGKLKLQLFPIDEVTQKGLEQDKYNPYLELILPTRKKISSVVKHLNVKWGSSKSASGD  144

Query  1438  LMLFPYHLHKENLVHFQKWT-KDTTLTAADVYALTGSPPVFRLRYGWFSNAEVAFRAPVS  1614
             LMLFPY+ H+ NLV +++WT K++   AADVYA  GSP +FRLRYGWFSN      AP +
Sbjct  145   LMLFPYNAHRNNLVSYRRWTIKESDTRAADVYAAVGSPAIFRLRYGWFSNL-----APTT  199

Query  1615  SAIPSRHDANMNIMPESSVGVLQAPSTDPPKEANGCVSMNTVNASRSSDHTEAVLWENPE  1794
                P     + + +      ++ A     P+    C + N  N S    ++       P 
Sbjct  200   CERPLASLHSEDCLQIKETQIINAIEEKIPQ----CPASNIENGSACFHNSLNQGIGAPP  255

Query  1795  TVVTEAEVDDLQFNKAGTSCVGEWADSLTNISVGDLLSEAPDMEDANCITSSIHSSSNYI  1974
               V +  V D +F       +  WAD L+NIS+G LLSEA   ++++            +
Sbjct  256   --VLDKSVQD-KF------ALLSWADCLSNISIGTLLSEAQLAQNSS------------L  294

Query  1975  HQIPFSCDSFDAAIAAHIKKHQNVTDSQAALPSQLSSIWGAEDTCDAFAFQRHSLSEKVQ  2154
              QIP +CDSFDAA+A+ I + Q  T  Q+   S  SSIW AE+TC AFAFQ+ + S    
Sbjct  295   QQIPITCDSFDAAVASIIAREQ--TKYQSTQVSH-SSIWDAEETCHAFAFQKSTSSNNND  351

Query  2155  NASKHTSLETCKQITLANTTA-----LGAS-VEDLPGARN---PVDGDA-------ATAD  2286
              AS   +        +++T       LG   V  LP A N   P+  +A       ATAD
Sbjct  352   PASSRDAPPAACTQNISSTLVRPNDMLGTQVVHALPAATNLQLPIKNNATPEPTPEATAD  411

Query  2287  LESVHYSPTSDVVK-------------DFNGLSDVYWPDSLGPLDLDIPSSRYHSELILS  2427
             L+       S  +K             DF G  D+YWP S G        SR  S     
Sbjct  412   LQPYAEDDASKELKTSAEPLIEDSCNSDF-GRVDIYWPQSSGLSGCITSPSRQMS-----  465

Query  2428  DSLGG----LTQLIASSLDAFQNCSFF  2496
                GG    L  L+ +SLDAFQN S F
Sbjct  466   ---GGDRNNLGTLLETSLDAFQNVSIF  489



>ref|XP_010925333.1| PREDICTED: TSL-kinase interacting protein 1 [Elaeis guineensis]
 ref|XP_010925334.1| PREDICTED: TSL-kinase interacting protein 1 [Elaeis guineensis]
 ref|XP_010925335.1| PREDICTED: TSL-kinase interacting protein 1 [Elaeis guineensis]
Length=495

 Score =   228 bits (581),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 160/443 (36%), Positives = 226/443 (51%), Gaps = 51/443 (12%)
 Frame = +1

Query  1255  LQNSGKLKLQLFPVDDGTRRALELDNHNPYLELTLSTRKKMSSVLEHLNRKWGNSSMACG  1434
             LQ   KLK+QLFP+D+ TR+ +E   HNPYLEL L+TRKK+SSV++HLN KWG+S  + G
Sbjct  75    LQCREKLKMQLFPIDEVTRKGVEQGQHNPYLELILTTRKKISSVVKHLNVKWGSSKSSSG  134

Query  1435  DLMLFPYHLHKENLVHFQKWT-KDTTLTAADVYALTGSPPVFRLRYGWFSNAEVAFRAPV  1611
             +LMLFPY+   + L   ++WT KD+ +TAADVYA  G+P +FRLRYGWFSN+E      +
Sbjct  135   ELMLFPYNAQIDTLASHRRWTIKDSDITAADVYASIGNPAIFRLRYGWFSNSEPTTGGIL  194

Query  1612  SSAIPSRHDANMNIMPESSVGVLQAPSTDPPKEANGCVSMNTVNASRSSDHTEAVLWENP  1791
              + + S  +     +P  ++  ++AP        N  V  N    S +    EA++ +  
Sbjct  195   PTPLHSEDNLQTKEIPPMNITDMKAPQCPVSSMENEPVDTNN---SLNQVPGEALVLDK-  250

Query  1792  ETVVTEAEVDDLQFNKAGTSCVGEWADSLTNISVGDLLSEAPDMEDANCITSSIHSSSNY  1971
                 +   VD+L     G S V  WAD L+NIS+G LLSE     D N         ++ 
Sbjct  251   ----SVQAVDNL-----GKSDVLSWADDLSNISIGALLSETSPALDVNFCHPLPAQKNSS  301

Query  1972  IHQIPFSCDSFDAAIAAHIKKHQNVTDSQAALPSQLSSIWGAEDTCDAFAFQRHSLSEKV  2151
             + QIP +CDSFD AIA+ +  HQ    S   L    SSIW AE+TC AF F + S S   
Sbjct  302   LQQIPITCDSFDVAIASLVAHHQTTNQSTQVL---HSSIWDAEETCHAFPFHKISSSNND  358

Query  2152  QNASKHTSLETC--------------------------KQITLANTTALGASVEDLPGAR  2253
               +SK   + TC                          + +T         ++ +L    
Sbjct  359   PASSKDALMTTCVGSNSVGVNDVLGTQVGHASAEHVYQEPVTNLQIQTKSDAIPELAAGL  418

Query  2254  NPVDGDAATADLESVHYSPTSDVVK--DFNGLSDVYWPDSLGPLDLDIPSSRYHSELILS  2427
              P   D A  +L++    P  + ++  DF G  D+YWP+SL  L+     SR   ++   
Sbjct  419   QPNAQDNANKELKT-SSEPQIEALRNSDF-GRVDIYWPESLATLEHVATCSR---QMNGG  473

Query  2428  DSLGGLTQLIASSLDAFQNCSFF  2496
             D+L  L     +SLDAFQN S F
Sbjct  474   DTL-NLGASFETSLDAFQNFSIF  495



>ref|XP_010268735.1| PREDICTED: TSL-kinase interacting protein 1-like [Nelumbo nucifera]
Length=472

 Score =   219 bits (558),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 186/546 (34%), Positives = 258/546 (47%), Gaps = 121/546 (22%)
 Frame = +1

Query  1015  LKTARHRRKIGATAAYKRWEKAAIAGVSLVADAAEHLERT-TTDKEDGHFQDSNVRNVFE  1191
             +KTAR ++K G  +A  +            A A    +RT T+ K  G +Q +  +    
Sbjct  1     MKTARQQKKTGEASAKSK------------ASADLSCKRTKTSAKRTGQWQKATRKTDTS  48

Query  1192  HSGKDPHVFPDLLHNSFNE-----------------------TNLQNSGKLKLQLFPVDD  1302
                KD H  P     +F +                         LQ S K+KLQLFP+D+
Sbjct  49    LHEKDEHPVPSTPQENFQQLPVKEIGHSKASDNMTTVQIELGQMLQPSRKMKLQLFPIDE  108

Query  1303  GTRRALELDNHNPYLELTLSTRKKMSSVLEHLNRKWGNSSMACGDLMLFPYHLHKENLVH  1482
             GTR  LE D HNPYLELTLS+RKK+ SVL+HL+ KW  S++A G+L+LFPY++  ENL  
Sbjct  109   GTRIGLEKDGHNPYLELTLSSRKKVGSVLKHLHNKWDTSTVAMGELVLFPYNVRLENLAG  168

Query  1483  FQKWT-KDTTLTAADVYALTGSPPVFRLRYGWFSNAEVAFRAPVSSAIPSRHDANMNIMP  1659
             +++WT KD   ++ADVY   G P +FRLRYGWFS+ E                +     P
Sbjct  169   YRRWTVKDGDTSSADVYEAIGRPAIFRLRYGWFSDLE----------------SKTLQTP  212

Query  1660  ESSVGVLQAPSTDPPKEANGCVSMNTVNASRSSDHTEAVLWENPETVVTEAEVDDLQFNK  1839
              +S  VLQ  S D  K  +G +   T+N  +                  +   D+L+ + 
Sbjct  213   FTSSDVLQ--SEDVQKHCSGII--GTMNRHK------------------QPSEDNLRTSN  250

Query  1840  AGTSCVGEWADSLTNISVGDLLSEAPDMEDANCITSSIHSSSNYIHQIPFSCDSFDAAIA  2019
                     WADSLTNIS+G LLSEA    + N       ++ + + Q+PFS DSFDAAIA
Sbjct  251   GTMLSSLAWADSLTNISIGGLLSEASLQGNINQCDPVPTANQSSLQQLPFSSDSFDAAIA  310

Query  2020  AHI-KKHQNVTDSQAALPSQL--SSIWGAEDTCDAFAFQRHSLSEK------VQNASKHT  2172
             AHI  +HQ  T      PS L  SSI  AE+TC AF+FQ+ SLS K      +  +S+  
Sbjct  311   AHIYSRHQGPTP-----PSLLSHSSILDAEETCHAFSFQKFSLSGKEIVSSSISGSSRGC  365

Query  2173  SLETC-KQITLANTTALGASVEDLPGARNPVDGDAATADLESVHYSPTSDVVKDFNGLSD  2349
             S + C K     N   +G                  T + +     P +D      G  +
Sbjct  366   SQDACSKSFKFPNFVEVGVK----------------TGNTQDQTQEPKADTRPQTQGADN  409

Query  2350  VYWPDSLGPLDLD--------IPSSRYHSELILSD--SLGGLTQLIASSLDAFQNCSFFG  2499
                 +SLG  D++          S     ++I  D  SLGG   L+++SLDAFQ+ SFF 
Sbjct  410   --GENSLGMSDINRTDSLWSLDLSLSSSRQIIKGDSVSLGG---LLSNSLDAFQSRSFFL  464

Query  2500  ADKKEP  2517
              D+  P
Sbjct  465   RDEMVP  470



>ref|XP_008794942.1| PREDICTED: TSL-kinase interacting protein 1-like [Phoenix dactylifera]
Length=496

 Score =   219 bits (559),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 172/515 (33%), Positives = 242/515 (47%), Gaps = 101/515 (20%)
 Frame = +1

Query  1129  RTTTDKEDGHFQDSNVRNVFEHSGK------DPHVFPDLLHNSFNETNL-----------  1257
             ++ T K     Q +  +N  E +G+       P     L+  +  +T L           
Sbjct  24    KSGTKKTAKKRQKATAKNGMETTGQLLPSRNQPSPLQTLVMQTSGQTKLPGNSMSVSKPY  83

Query  1258  -QNSGKLKLQLFPVDDGTRRALELDNHNPYLELTLSTRKKMSSVLEHLNRKWGNSSMACG  1434
              Q SGKLKLQLFP+D+ T++ LE D HNPYLEL L TRKK+SSV++HL+ KWG+S  A G
Sbjct  84    PQCSGKLKLQLFPIDEVTQKGLEQDKHNPYLELILPTRKKISSVVKHLDVKWGSSEFASG  143

Query  1435  DLMLFPYHLHKENLVHFQKWT-KDTTLTAADVYALTGSPPVFRLRYGWFSNAEVAFRAPV  1611
             +LM+FPY+   +NLV +++WT KD+  +AADVYA  GSP +FRLRYGWFSN E     P 
Sbjct  144   ELMIFPYNACLDNLVSYRRWTIKDSYTSAADVYAAVGSPAIFRLRYGWFSNLE-----PT  198

Query  1612  SSAIPSRHDANMNIMPESSVGVLQAPSTDPPKEANGCVSMNTVNASRSSDHTEAVLWENP  1791
             S   P     +   +      ++       P+    C + +T N S  S ++      +P
Sbjct  199   SCERPLTSLHSEGNLQTKETQIINTTDEKIPQ----CPASSTENGSACSHNSLNQGIGSP  254

Query  1792  ETVVTEAEVDDLQFNKAGTSCVGEWADSLTNISVGDLLSEAPDMEDANCITSSIHSSSNY  1971
              ++       D  F     S    WAD L+N+S+G LLSEA   ++++ +          
Sbjct  255   PSL-------DKSFQAVDKSAFLSWADCLSNVSIGTLLSEALPAQNSSLL----------  297

Query  1972  IHQIPFSCDSFDAAIAAHIKKHQNVTDSQAALPSQLSSIWGAEDTCDAFAFQRHSLSEKV  2151
               QIP + DSFDAA+A+ I  HQ    S  AL    SSIW AE+TC AFAFQ+ +     
Sbjct  298   --QIPITNDSFDAAVASLIACHQTKNQSAQAL---HSSIWDAEETCHAFAFQKTTSPNNN  352

Query  2152  QNA-SKHTSLETCKQITLANT---------------------------------TALGAS  2229
               A S+   +  C     +N+                                  A+  S
Sbjct  353   NPASSRDAPIAACTHNITSNSDRPHDMLVTQLAHALPDGTHQEPAANLQLHIKNDAIPES  412

Query  2230  VEDLPGARNPVDGDAATADLESVHYSPTSDVV--KDFNGLSDVYWPDSLGPLDLDIPSSR  2403
               +      P   D A+ +L++    P  + +  KDF G  D+YW +S GP      SSR
Sbjct  413   TPEATAGLLPHTQDDASKELKT-SAEPQIEALCDKDF-GRVDIYWSESSGPSGCITSSSR  470

Query  2404  YHSELILSDSLGG----LTQLIASSLDAFQNCSFF  2496
                       +GG    L  L  +SLDAFQN S F
Sbjct  471   ---------QIGGDRINLGTLFETSLDAFQNFSIF  496



>ref|XP_008359658.1| PREDICTED: TSL-kinase interacting protein 1-like [Malus domestica]
Length=114

 Score =   206 bits (524),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 96/113 (85%), Positives = 106/113 (94%), Gaps = 0/113 (0%)
 Frame = +1

Query  436  VKRQTRKWAAWTREEEESFFSALRHVGKNFEKITSRVQSKNKDQVRHYYYRLVRRMNKLL  615
            +K+ TR+WAAWT +EEESFFSALR VGKNFEKIT RVQSKNKDQVRHYYYRLVRRMNKLL
Sbjct  1    MKKTTRQWAAWTHQEEESFFSALRQVGKNFEKITRRVQSKNKDQVRHYYYRLVRRMNKLL  60

Query  616  GPELCLNAKNSRDTNAAMLRWWSLLEKYSCKASKLHLKPRRFKIFIETLENQL  774
            GPEL L++KNS+DTNAAMLRWWSLLEKYSCKASKLHLKPRRFKIFIE L +++
Sbjct  61   GPELYLDSKNSKDTNAAMLRWWSLLEKYSCKASKLHLKPRRFKIFIEALVSKI  113



>ref|XP_008786422.1| PREDICTED: TSL-kinase interacting protein 1 isoform X1 [Phoenix 
dactylifera]
 ref|XP_008786431.1| PREDICTED: TSL-kinase interacting protein 1 isoform X1 [Phoenix 
dactylifera]
 ref|XP_008786441.1| PREDICTED: TSL-kinase interacting protein 1 isoform X1 [Phoenix 
dactylifera]
 ref|XP_008786448.1| PREDICTED: TSL-kinase interacting protein 1 isoform X1 [Phoenix 
dactylifera]
Length=442

 Score =   210 bits (534),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 160/445 (36%), Positives = 228/445 (51%), Gaps = 54/445 (12%)
 Frame = +1

Query  1255  LQNSGKLKLQLFPVDDGTRRALELDNHNPYLELTLSTRKKMSSVLEHLNRKWGNSSMACG  1434
             LQ S KLK+QLFP+D+ TR+ +E   HNPYLEL ++TRKK+SSV++HLN KWG+S  A G
Sbjct  21    LQCSEKLKMQLFPIDEVTRKGVEQGQHNPYLELIITTRKKISSVVKHLNVKWGSSKFASG  80

Query  1435  DLMLFPYHLHKENLVHFQKWT-KDTTLTAADVYALTGSPPVFRLRYGWFSNAEVAFRAPV  1611
             +LMLFPY+   + L   ++WT KD+  TAA VYA  G P +FRLRYGWFSN+E     P 
Sbjct  81    ELMLFPYNAQIDTLASHRRWTIKDSDTTAAAVYASIGKPAIFRLRYGWFSNSE-----PT  135

Query  1612  SSAI---PSRHDANMNIMPESSVGVLQAPSTDPPKEANGCVSMNTVNASRSSDHTEAVLW  1782
             +  I   P   + N+       + + +A +  PP   +  +    V+   S +       
Sbjct  136   TGGIHLTPLHSEDNLQTKEILPMNITEAKA--PPYPVSS-MENEPVDTDNSLNQVPVA--  190

Query  1783  ENPETVVTEAEVDDLQFNKAGTSCVGEWADSLTNISVGDLLSEAPDMEDANCITSSIHSS  1962
                  +V +  V  ++ N  G S V  WAD   NISVG LLSEA    DAN         
Sbjct  191   ----ALVLDKSVQAVKEN-LGKSDVLSWADCQCNISVGALLSEASPTSDANFCHPLPAQK  245

Query  1963  SNYIHQIPFSCDSFDAAIAAHIKKHQNVTDSQAALPSQLSSIWGAEDTCDAFAFQRHSLS  2142
             ++ + Q P +CDSFDAA+A+ +  HQ  T+    +P   SSIW AE+T  AF F + + +
Sbjct  246   NSSLQQNPITCDSFDAALASLVACHQ-TTNQSTQVPR--SSIWDAEETRHAFPFHKITPN  302

Query  2143  EKVQNASKHTSLETC-KQITLANTTALGASV----------------------EDLPGAR  2253
                  +SK   + TC    ++     LG  V                      + +P   
Sbjct  303   NNDPASSKDALMPTCIGSNSMGLNDMLGTRVGHASADHVCQEPATNRQIHTNSDAIPEPA  362

Query  2254  NPVDGDAA-TADLESVHYS-PTSDVVK--DFNGLSDVYWPDSLGPLDLDIPSSRYHSELI  2421
               +  +A   A+ ES+  S P  + ++  DF G  D+YWP+SLG L+     SR   ++ 
Sbjct  363   AGLQPNAQDNANKESIKSSEPQIEALRNSDF-GRVDIYWPESLGTLEYIATCSR---QIN  418

Query  2422  LSDSLGGLTQLIASSLDAFQNCSFF  2496
               D+L  L     +SLD+FQN S F
Sbjct  419   SGDTL-NLGASFDTSLDSFQNFSIF  442



>ref|XP_008786456.1| PREDICTED: TSL-kinase interacting protein 1 isoform X2 [Phoenix 
dactylifera]
Length=441

 Score =   209 bits (533),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 159/445 (36%), Positives = 226/445 (51%), Gaps = 55/445 (12%)
 Frame = +1

Query  1255  LQNSGKLKLQLFPVDDGTRRALELDNHNPYLELTLSTRKKMSSVLEHLNRKWGNSSMACG  1434
             LQ S KLK+QLFP+D+ TR+ +E   HNPYLEL ++TRKK+SSV++HLN KWG+S  A G
Sbjct  21    LQCSEKLKMQLFPIDEVTRKGVEQGQHNPYLELIITTRKKISSVVKHLNVKWGSSKFASG  80

Query  1435  DLMLFPYHLHKENLVHFQKWT-KDTTLTAADVYALTGSPPVFRLRYGWFSNAEVAFRAPV  1611
             +LMLFPY+   + L   ++WT KD+  TAA VYA  G P +FRLRYGWFSN+E     P 
Sbjct  81    ELMLFPYNAQIDTLASHRRWTIKDSDTTAAAVYASIGKPAIFRLRYGWFSNSE-----PT  135

Query  1612  SSAI---PSRHDANMNIMPESSVGVLQAPSTDPPKEANGCVSMNTVNASRSSDHTEAVLW  1782
             +  I   P   + N+       + + +A +   P  +     ++T N+         VL 
Sbjct  136   TGGIHLTPLHSEDNLQTKEILPMNITEAKAPPYPVSSMENEPVDTDNSLNQVPVAALVLD  195

Query  1783  ENPETVVTEAEVDDLQFNKAGTSCVGEWADSLTNISVGDLLSEAPDMEDANCITSSIHSS  1962
             ++ + V              G S V  WAD   NISVG LLSEA    DAN         
Sbjct  196   KSVQAV-----------ENLGKSDVLSWADCQCNISVGALLSEASPTSDANFCHPLPAQK  244

Query  1963  SNYIHQIPFSCDSFDAAIAAHIKKHQNVTDSQAALPSQLSSIWGAEDTCDAFAFQRHSLS  2142
             ++ + Q P +CDSFDAA+A+ +  HQ  T+    +P   SSIW AE+T  AF F + + +
Sbjct  245   NSSLQQNPITCDSFDAALASLVACHQ-TTNQSTQVPR--SSIWDAEETRHAFPFHKITPN  301

Query  2143  EKVQNASKHTSLETC-KQITLANTTALGASV----------------------EDLPGAR  2253
                  +SK   + TC    ++     LG  V                      + +P   
Sbjct  302   NNDPASSKDALMPTCIGSNSMGLNDMLGTRVGHASADHVCQEPATNRQIHTNSDAIPEPA  361

Query  2254  NPVDGDAA-TADLESVHYS-PTSDVVK--DFNGLSDVYWPDSLGPLDLDIPSSRYHSELI  2421
               +  +A   A+ ES+  S P  + ++  DF G  D+YWP+SLG L+     SR   ++ 
Sbjct  362   AGLQPNAQDNANKESIKSSEPQIEALRNSDF-GRVDIYWPESLGTLEYIATCSR---QIN  417

Query  2422  LSDSLGGLTQLIASSLDAFQNCSFF  2496
               D+L  L     +SLD+FQN S F
Sbjct  418   SGDTL-NLGASFDTSLDSFQNFSIF  441



>gb|ABR18267.1| unknown [Picea sitchensis]
Length=151

 Score =   199 bits (507),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 91/118 (77%), Positives = 105/118 (89%), Gaps = 0/118 (0%)
 Frame = +1

Query  433  PVKRQTRKWAAWTREEEESFFSALRHVGKNFEKITSRVQSKNKDQVRHYYYRLVRRMNKL  612
            P K+ TR+WAAWTR+EEE+FF ALR VGKNFEKITSRVQSKNK+QVRHYYYRL++RMNKL
Sbjct  34   PGKKPTRQWAAWTRQEEENFFIALRQVGKNFEKITSRVQSKNKNQVRHYYYRLIKRMNKL  93

Query  613  LGPELCLNAKNSRDTNAAMLRWWSLLEKYSCKASKLHLKPRRFKIFIETLENQLLKDR  786
            LGP   ++AKN++D NAAMLRWWSLLEK+SC ASKLHLKPRRFK F+  L +QLLKDR
Sbjct  94   LGPGFVVDAKNTKDANAAMLRWWSLLEKHSCSASKLHLKPRRFKTFVTALGHQLLKDR  151



>emb|CDY66143.1| BnaAnng21650D [Brassica napus]
Length=301

 Score =   195 bits (495),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 103/187 (55%), Positives = 129/187 (69%), Gaps = 23/187 (12%)
 Frame = +1

Query  439  KRQTRKWAAWTREEEESFFSALRHVGKNFEKITSRVQSKNKDQVRHYYYRLVRRMNKLLG  618
            K+ TRKWAAWT +EEE FF+ALRHVGKNF KITSRV SKNKDQVRHYYYRL         
Sbjct  83   KKPTRKWAAWTHQEEECFFTALRHVGKNFLKITSRVLSKNKDQVRHYYYRL---------  133

Query  619  PELCLNAKNSRDTNAAMLRWWSLLEKYSCKASKLHLKPRRFKIFIETLENQLLKDRKKNV  798
                       DTNAAMLRWWSLLEK+SCKASKLHLKPRRFK+F+E LE+QLLKD +K++
Sbjct  134  -----------DTNAAMLRWWSLLEKHSCKASKLHLKPRRFKLFLEALEHQLLKDSRKSI  182

Query  799  RRCFSQGENTSTAPI-SVSNQGRGASGHDGRSVKVVLLDNQDIHKFGSGKGSSLKRHINI  975
             +    GE  S+  + ++S+  R   G D R +K++L D+Q++ K G G+ SS K   ++
Sbjct  183  SKRACHGETFSSVSLENISSHSR-ERGLDNRPLKMILCDSQNVKKLGPGR-SSTKHGDSL  240

Query  976  GANSTSC  996
            G   + C
Sbjct  241  GVIDSEC  247



>ref|NP_001051415.1| Os03g0773100 [Oryza sativa Japonica Group]
 dbj|BAF13329.1| Os03g0773100 [Oryza sativa Japonica Group]
Length=157

 Score =   187 bits (476),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 87/108 (81%), Positives = 97/108 (90%), Gaps = 0/108 (0%)
 Frame = +1

Query  439  KRQTRKWAAWTREEEESFFSALRHVGKNFEKITSRVQSKNKDQVRHYYYRLVRRMNKLLG  618
            ++ TR+WAAWTR+EE+SFF+ALR  GKNFEKIT RVQSKNKDQVRHYYYRLVRRM KLLG
Sbjct  10   EKPTRQWAAWTRQEEQSFFNALRLEGKNFEKITLRVQSKNKDQVRHYYYRLVRRMKKLLG  69

Query  619  PELCLNAKNSRDTNAAMLRWWSLLEKYSCKASKLHLKPRRFKIFIETL  762
            PE  L+AKNS+DT AAMLRWWSLLEK+SC ASKLHLKPRRFK F+E L
Sbjct  70   PEFSLDAKNSKDTVAAMLRWWSLLEKFSCSASKLHLKPRRFKTFVEAL  117



>ref|XP_004968436.1| PREDICTED: TSL-kinase interacting protein 1-like isoform X1 [Setaria 
italica]
Length=451

 Score =   197 bits (501),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 149/414 (36%), Positives = 205/414 (50%), Gaps = 55/414 (13%)
 Frame = +1

Query  1264  SGKLKLQLFPVDDGTRRALELDNHNPYLELTLSTRKKMSSVLEHLNRKWGNSSMACGDLM  1443
             SGK+KLQLFP+D+  ++ ++ + HNPYLEL L+ RKK+SSV++HLN KWGNS  A G+LM
Sbjct  86    SGKIKLQLFPIDENIQKIMQQEKHNPYLELILAPRKKISSVVQHLNTKWGNSQCAKGELM  145

Query  1444  LFPYHLHKENLVHFQKWTKDTTLTAADVYALTGSPPVFRLRYGWFSNAEVAFRAPVSSAI  1623
             LFP     + +    KWT   + TAADV+   GSP  FRLRYGWF               
Sbjct  146   LFPNGTRVDIIASSAKWTLKDSCTAADVHVAVGSPSTFRLRYGWF---------------  190

Query  1624  PSRHDANMNIMPESSVGVLQAPSTDPPKEANGCVSMNTVNASRSSDHTEAVLWENPETVV  1803
                     N+  +SS      PS    + A+  + +   +   + +     L E P   V
Sbjct  191   ------GPNLKQQSS-----GPSLASVQSADKTIGVKAPDLVFTEEKHMTGLSEFPSNFV  239

Query  1804  TEAEVDDL----QFNKAGTSCVGEWADSLTNISVGDLLSEAPDMEDANCITSSIHSSSNY  1971
             T + VD+     Q +         W DS++NIS G LLSEA   +D+      + S +N 
Sbjct  240   TPSIVDNTNAVQQVDNQSKVAPLSWLDSISNISFGALLSEATPSQDSK----QLPSQNNP  295

Query  1972  IHQIPFSCDSFDAAIAAHIKKHQNVTDSQAALPSQLSSIWGAEDTCDAFAFQRHSLSEKV  2151
               QIP +CDSFDAAIA+ I   Q  +  + + P    S+W AEDTC AFAFQ        
Sbjct  296   SIQIPATCDSFDAAIASLIACQQASSQPRVSNP----SLWEAEDTCHAFAFQNQ------  345

Query  2152  QNASKHTSLETCKQITLANTTA-LGASVEDLPGARNPVDGDAATADLESVHYSPTSDVVK  2328
               AS+  S         A T++ LGA    +P      D   +T   E    +  S +  
Sbjct  346   --ASRRASSSIPGNGGAAMTSSVLGA----IPETGTDDDQQCSTNGKEREASTEPSVLGS  399

Query  2329  DFNGLSDVYWPDSLGPLDLDIPSSRYHSELILSDSLGGLTQLIASSLDAFQNCS  2490
             D N   +    +S G  +     S +   LI +DSL GL+ L+A+SLDAFQN S
Sbjct  400   DLNAKPETSVHESTGDPEH---GSSFSGFLIGTDSL-GLSGLLANSLDAFQNFS  449



>ref|XP_003564346.1| PREDICTED: TSL-kinase interacting protein 1 [Brachypodium distachyon]
 ref|XP_010230543.1| PREDICTED: TSL-kinase interacting protein 1 [Brachypodium distachyon]
Length=447

 Score =   195 bits (496),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 157/422 (37%), Positives = 223/422 (53%), Gaps = 72/422 (17%)
 Frame = +1

Query  1264  SGKLKLQLFPVDDGTRRALELDNHNPYLELTLSTRKKMSSVLEHLNRKWGNSSMACGDLM  1443
             SGK+KLQ FP+D+  ++ L+ + HNPYLELTL+ RKKMSS+++HLN KWG+S  A G+LM
Sbjct  83    SGKMKLQFFPIDESIQKVLQQEKHNPYLELTLAPRKKMSSIVQHLNTKWGSSPCAKGELM  142

Query  1444  LFPYHLHKENLVHFQKWTKDTTLTAADVYALTGSPPVFRLRYGWFSNAEVAFR-------  1602
             LFPY+    NL   +KWT + + TAADVYA  GSP  FRLRYGWF   E  F+       
Sbjct  143   LFPYNARLGNLAGSEKWTLNDSCTAADVYAAVGSPTTFRLRYGWF---EPNFKQQSSRSS  199

Query  1603  -APVSSAIPSRHDANMNIM---PESSVGVLQAPSTDPPKEANGCVSMNTVNASRSSDHTE  1770
              A + SA  S  D  ++++    + +VG+ Q P+    K A   V  NT  +        
Sbjct  200   SASLHSAEKSIDDKPLDLVFSEQKQTVGLSQFPT----KFAGPSVECNTEQS--------  247

Query  1771  AVLWENPETVVTEAEVDDLQFNKAGTSCVGEWADSLTNISVGDLLSEAPDMEDANCITSS  1950
                      V  +++V  L            W D ++NIS G LLSEA   +D+     S
Sbjct  248   --------IVDNQSKVTPL-----------SWIDCISNISFGALLSEALPSQDSK--QPS  286

Query  1951  IHSSSNYIHQIPFSCDSFDAAIAAHIKKHQNVTDSQAALPSQLSSIWGAEDTCDAFAFQR  2130
             + ++S  + QIP +CDSFDAAIA+ I + Q  +  +   P    S+W AE+TC AF    
Sbjct  287   VQNNS-ILQQIPATCDSFDAAIASLIARQQVSSQPKVTNP----SLWDAEETCHAFP---  338

Query  2131  HSLSEKVQNASKHTSLETCKQITLANTTALGASVEDLPGARNPVDGDAA-TADLESVHYS  2307
                  + QN+ K TS       T ANT+++  S+ +     +  DGD   +++      S
Sbjct  339   ----SRSQNSVK-TSCSAPGNST-ANTSSVLRSIPE-----SDTDGDQLYSSEGRKEEPS  387

Query  2308  PTSDVVKDFNGLS-DVYWPDSLGPLDLDIPSSRYHSELILSDSLGGLTQLIASSLDAFQN  2484
             P   V+ +   +  DV   +S G L+L     R  S    +DSL GL+ L+A+SLDAF N
Sbjct  388   PQIPVLDNGENMKPDVSMLESNGELELGASCFRLLSG---TDSL-GLSGLLANSLDAFPN  443

Query  2485  CS  2490
              S
Sbjct  444   FS  445



>ref|XP_009388542.1| PREDICTED: TSL-kinase interacting protein 1-like [Musa acuminata 
subsp. malaccensis]
Length=319

 Score =   190 bits (483),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 126/315 (40%), Positives = 181/315 (57%), Gaps = 24/315 (8%)
 Frame = +1

Query  1267  GKLKLQLFPVDDGTRRALELDNHNPYLELTLSTRKKMSSVLEHLNRKWGNSSMACGDLML  1446
             GK+KLQLFP+D+ TR+ALE +NHNPYLELTL+TRK++SSV++HLN KWG+S +A G+LML
Sbjct  25    GKVKLQLFPIDEATRKALEKNNHNPYLELTLTTRKRISSVVKHLNFKWGSSKLASGELML  84

Query  1447  FPYHLHKENLVHFQKWT-KDTTLTAADVYALTGSPPVFRLRYGWFSNAEVAFRAPVSSAI  1623
             FPY+++ +NL +  +WT +D+ +TAADV+A  GSP +FRLRYGWFSN E     P S   
Sbjct  85    FPYNVYLDNLANSIRWTLEDSDVTAADVHASLGSPAMFRLRYGWFSNLEQT-ACPTSMTS  143

Query  1624  PSRHDANMNIMPESSVG-VLQAPSTDPPKEANGCVSMNTVNASRSSDHTEAVLWENPETV  1800
              S  + N +     + G  L   S+    + +G   M+  +++  +  T  +L +  +  
Sbjct  144   HSYEEPNKSFEKHITSGDKLLCKSS----KGHGPCHMD--DSANQAVETHLLLEKTIQNG  197

Query  1801  VTEAEVDDLQFNKAGTSCVGEWADSLTNISVGDLLSEAPDMEDANCITSSIHSSSNYIHQ  1980
             V +             S    W D L+N+S G +LSE  +     C      +SS  + Q
Sbjct  198   VDQ--------KNNSRSVNMSWVDCLSNMSFGAILSEVSETPVNLCHPLPAPNSS--LQQ  247

Query  1981  IPFSCDSFDAAIAAHIKKHQNVTDSQAALPSQLSSIWGAEDTCDAFAFQRHSLSEKVQNA  2160
             IP +CDSFDAAIA+ + +HQ    S   +    SSI  AE+TC AF F + + S     A
Sbjct  248   IPMTCDSFDAAIASVMARHQPSNPSNRLI---HSSILEAEETCHAFPFAKVASSSHNHPA  304

Query  2161  SKH--TSLETCKQIT  2199
             S     + E C  +T
Sbjct  305   STRDPPATENCSDMT  319



>ref|XP_007048175.1| N-terminal nucleophile aminohydrolases superfamily protein isoform 
1 [Theobroma cacao]
 ref|XP_007048176.1| N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily 
protein isoform 1 [Theobroma cacao]
 gb|EOX92332.1| N-terminal nucleophile aminohydrolases superfamily protein isoform 
1 [Theobroma cacao]
 gb|EOX92333.1| N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily 
protein isoform 1 [Theobroma cacao]
Length=479

 Score =   194 bits (493),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 152/403 (38%), Positives = 202/403 (50%), Gaps = 50/403 (12%)
 Frame = +1

Query  1255  LQNSGKLKLQLFPVDDGTRRALELDNHNPYLELTLSTRKKMSSVLEHLNRKWGNSSMACG  1434
             L  S K+KLQLFP+D+ TR  LE D  +PYLELTLS RKK+SSVL+HL+ KWG+SS+A G
Sbjct  90    LHPSAKIKLQLFPIDESTRLGLEKDGFHPYLELTLSARKKISSVLKHLDSKWGSSSIAVG  149

Query  1435  DLMLFPYHLHKENLVHFQKWTK-DTTLTAADVYALTGSPPVFRLRYGWFSNAEVAFRAPV  1611
             + MLFPY++  ENL  + +WTK D  ++A DV+   GSP VFRLRYGW S+ E+      
Sbjct  150   EPMLFPYNI-AENLASY-RWTKNDICISARDVHLTIGSPTVFRLRYGWMSDPEMKTLGQP  207

Query  1612  SSAIP---------SRHDANMNIMPESSVGVLQAPSTDPPKEANGCVSMNTVNASRSSDH  1764
              +  P          + D N N+     +G           E  G  S   V     SD 
Sbjct  208   PALAPFNASSKFEDVQKDCNSNMQKTYGIG--------EKTELRGDESEKPV---IKSDE  256

Query  1765  TEAVLWENPETVVTEAEVDDLQFNKAGTSCVGE----WADSLTNISVGDLLSEAPDMEDA  1932
              +AV+ E    + +   VD +       S +G+    WADSLTNIS+G LLSEA      
Sbjct  257   IDAVVAEK---MPSNGAVDSMDTEVKIDSGIGQSLALWADSLTNISIGGLLSEASLQGRF  313

Query  1933  NCITSSIHSSSNYIHQIPFSCDSFDAAIAAHIKKHQNVTDSQAALPSQL--SSIWGAEDT  2106
             +      + S+  +       DSFDA ++  I   QN        P+Q   SSI  AEDT
Sbjct  314   SNFDPKSNGSNAGLQSSQLISDSFDAFLSGQINPPQNPRP-----PAQASHSSILDAEDT  368

Query  2107  CDAFAFQRHSLSEKVQNAS-----KHTSLETCKQITLANTTALGASVEDLPGARNPVDGD  2271
             C AF+FQ+ S   K   AS      H S +     +  +  A+ A+++    A    D D
Sbjct  369   CHAFSFQKFSSLHKDSIASSGSAYSHASSQETSSKSFKHPNAIEANIQPQGQACQQSDTD  428

Query  2272  AATADLESVHYSPTSDVVKDFNGLSDVYWPDSLGPLDLDIPSS  2400
                  L S  YS  S +     GLS + W DSLGP DL + SS
Sbjct  429   LL---LCSRVYSDESTL-----GLSGIKWTDSLGPFDLGVNSS  463



>gb|KHN34026.1| TSL-kinase interacting protein 1 [Glycine soja]
Length=468

 Score =   192 bits (489),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 153/440 (35%), Positives = 208/440 (47%), Gaps = 29/440 (7%)
 Frame = +1

Query  1138  TDKEDGHFQ-DSNVRNVFEHSGKDPHVFPDLLHNSFNETNLQNSGKLKLQLFPVDDGTRR  1314
             TDKE+ +F    ++R   E S K   +         +   +  S K+KLQLFP+++ TR 
Sbjct  49    TDKENQYFPFKEHMRKCPELSNKCTFLTEKRKAIELHPGQMLTSAKIKLQLFPINEETRI  108

Query  1315  ALELDNHNPYLELTLSTRKKMSSVLEHLNRKWGNSSMACGDLMLFPYHLHKENLVHFQKW  1494
              LE D HNPYLELTL  RKK+SS+L+HL +KWG+SS+A GDL+LFPY++  ENL   ++W
Sbjct  109   GLEKDGHNPYLELTLRGRKKISSILKHLGKKWGSSSIANGDLILFPYNVM-ENLSDCRRW  167

Query  1495  T-KDTTLTAADVYALTGSPPVFRLRYGWFSNAEVAFRAPVSSAIPSRHDANMNIMPESSV  1671
             T  D+  TA+ VYA  G+P +FRL+YGWF   E     P S  IPS       ++P    
Sbjct  168   TINDSDTTASAVYAAVGTPALFRLKYGWFYMHE-----PRSFGIPSTPTPYKLVVPGGDN  222

Query  1672  GVLQAPSTDPPKEANGCVSMNTVNASRSSDHTEAVLWENPETVVTEAEVDDLQFNKAGTS  1851
               L+        E              ++  T A   EN     T+ E    + + +   
Sbjct  223   ANLEETLRGERDEVEISKEYKETEVGNAASETVAQKVENAAVDPTDNE-PRTRISSSLQQ  281

Query  1852  CVGEWADSLTNISVGDLLSEAPDMEDANCITSSIHSSSNYIHQIPFSCDSFDAAIAAHIK  2031
                 W DSL+NIS+G LLSE      A+        S   I     + DS DA IAA   
Sbjct  282   SSSPWVDSLSNISIGGLLSE------ASLFGGLDPKSFAGIQPCDITSDSLDAFIAA--A  333

Query  2032  KHQNVTDSQAALPSQLSSIWGAEDTCDAFAFQRHSLSEKVQNASKHTSLETCKQITLANT  2211
             +  N    +       +SI  AE+TC AF  Q+ S    VQ A +      C Q   +N 
Sbjct  334   QINNCPVPRLPADDLHTSILDAEETCHAFPLQKLSSPTDVQAACRKDYSAVCSQGVFSNL  393

Query  2212  TALGA--SVEDLPGA-RNPVDGDAATADLESVHYSPTSDVVKDFNGLSDVYWPDSLGPLD  2382
               L     V D  GA +NP  G   T  L S  Y     +     GL+ + W DS+GP D
Sbjct  394   LKLSNIDKVNDQDGASQNPPSGKTQTDLLSSRPYDDDRSL-----GLTGINWNDSMGPFD  448

Query  2383  LDIPSSRYHSELILSDSLGG  2442
             L +P+ +    LI  D L G
Sbjct  449   LGMPAQK----LIGGDGLTG  464



>ref|XP_006580315.1| PREDICTED: TSL-kinase interacting protein 1-like isoform X1 [Glycine 
max]
 ref|XP_006580316.1| PREDICTED: TSL-kinase interacting protein 1-like isoform X2 [Glycine 
max]
 ref|XP_006580317.1| PREDICTED: TSL-kinase interacting protein 1-like isoform X3 [Glycine 
max]
Length=468

 Score =   192 bits (489),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 153/440 (35%), Positives = 208/440 (47%), Gaps = 29/440 (7%)
 Frame = +1

Query  1138  TDKEDGHFQ-DSNVRNVFEHSGKDPHVFPDLLHNSFNETNLQNSGKLKLQLFPVDDGTRR  1314
             TDKE+ +F    ++R   E S K   +         +   +  S K+KLQLFP+++ TR 
Sbjct  49    TDKENQYFPFKEHMRKCPELSNKCTFLTEKRKAIELHPGQMLTSAKIKLQLFPINEETRI  108

Query  1315  ALELDNHNPYLELTLSTRKKMSSVLEHLNRKWGNSSMACGDLMLFPYHLHKENLVHFQKW  1494
              LE D HNPYLELTL  RKK+SS+L+HL +KWG+SS+A GDL+LFPY++  ENL   ++W
Sbjct  109   GLEKDGHNPYLELTLRGRKKISSILKHLGKKWGSSSIANGDLILFPYNVM-ENLSDCRRW  167

Query  1495  T-KDTTLTAADVYALTGSPPVFRLRYGWFSNAEVAFRAPVSSAIPSRHDANMNIMPESSV  1671
             T  D+  TA+ VYA  G+P +FRL+YGWF   E     P S  IPS       ++P    
Sbjct  168   TINDSDTTASAVYAAVGTPALFRLKYGWFYMHE-----PGSFGIPSTPTPYKLVVPGGDN  222

Query  1672  GVLQAPSTDPPKEANGCVSMNTVNASRSSDHTEAVLWENPETVVTEAEVDDLQFNKAGTS  1851
               L+        E              ++  T A   EN     T+ E    + + +   
Sbjct  223   ANLEETLRGERDEVEISKEYKETEVGNAASETVAQKVENAAVDPTDNE-PRTRISSSLQQ  281

Query  1852  CVGEWADSLTNISVGDLLSEAPDMEDANCITSSIHSSSNYIHQIPFSCDSFDAAIAAHIK  2031
                 W DSL+NIS+G LLSE      A+        S   I     + DS DA IAA   
Sbjct  282   SSSPWVDSLSNISIGGLLSE------ASLFGGLDPKSFAGIQPCDITSDSLDAFIAA--A  333

Query  2032  KHQNVTDSQAALPSQLSSIWGAEDTCDAFAFQRHSLSEKVQNASKHTSLETCKQITLANT  2211
             +  N    +       +SI  AE+TC AF  Q+ S    VQ A +      C Q   +N 
Sbjct  334   QINNCPVPRLPADDLHTSILDAEETCHAFPLQKLSSPTDVQAACRKDYSAVCSQGVFSNL  393

Query  2212  TALGA--SVEDLPGA-RNPVDGDAATADLESVHYSPTSDVVKDFNGLSDVYWPDSLGPLD  2382
               L     V D  GA +NP  G   T  L S  Y     +     GL+ + W DS+GP D
Sbjct  394   LKLSNIDKVNDQDGASQNPPSGKTQTDLLSSRPYDDDRSL-----GLTGINWNDSMGPFD  448

Query  2383  LDIPSSRYHSELILSDSLGG  2442
             L +P+ +    LI  D L G
Sbjct  449   LGMPAQK----LIGGDGLTG  464



>emb|CDM81780.1| unnamed protein product [Triticum aestivum]
Length=475

 Score =   192 bits (488),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 162/436 (37%), Positives = 227/436 (52%), Gaps = 61/436 (14%)
 Frame = +1

Query  1243  NETNL-----QNSGKLKLQLFPVDDGTRRALELDNHNPYLELTLSTRKKMSSVLEHLNRK  1407
             N TNL       S K+KLQ FP+D+  ++ L+ + HNPYLELTL+ RKKMSS+++HLN K
Sbjct  71    NSTNLPAQPPNYSKKMKLQFFPIDEAIQKVLQQEKHNPYLELTLAPRKKMSSIVQHLNTK  130

Query  1408  WGNSSMACGDLMLFPYHLHKENLVHFQKWTKDTTLTAADVYALTGSPPVFRLRYGWF---  1578
             WG SS A G+LMLFPY    ++LV  +KWT + + TAADVY   GSP  FRLRYGWF   
Sbjct  131   WGRSSCAKGELMLFPYGARPDSLVGSEKWTVNDSCTAADVYVAVGSPSTFRLRYGWFEHN  190

Query  1579  ---SNAEVAFRAPVSSAIPSRHDANMN--IMPESSVGVLQAPST--DP---PKEANGCVS  1728
                 ++E +F AP+ SA  +  D   +  + P       + P+   DP   P + +    
Sbjct  191   LKQQSSEESF-APMHSAEKTIGDKPSDHFVFPNKPSDPFEFPNKPLDPFEFPNKPSDPFE  249

Query  1729  MNTVNASRSSDHTE-AVLWENPETVV-TEAEVDDLQFNKAGTSCVGEWADSLTNISVGDL  1902
             +     ++SSD  E    + +P  V  TE  V D Q      S    W D ++NIS G L
Sbjct  250   L----PNKSSDPFEFPSKFTSPSDVCNTEQTVVDNQTKVTPLS----WIDCISNISFGAL  301

Query  1903  LSEAPDMEDANCITSSIHSSSNYIHQIPFSCDSFDAAIAAHIKKHQNVTDSQAALPSQLS  2082
             LS+A   +D+         +S+ + QIP +CDSFDAAIA+ I   Q     + + P    
Sbjct  302   LSQAVPSQDSK---QPPLQNSSILQQIPATCDSFDAAIASLIAHQQTSNQPKVSNP----  354

Query  2083  SIWGAEDTCDAFAFQRHSLSEKVQNASKHTSLETCKQITLANTTALGASVE-DLPG-ARN  2256
             S+W AE+TC AF   R+  S ++ +++   S      I       LGA  E D  G  R 
Sbjct  355   SVWDAEETCHAFP--RNQTSARMFSSAHGNSSAITPSI-------LGAIPESDTDGNQRC  405

Query  2257  PVDG--DAATADLESVHYSPTSDVVKDFNGLSDVYWPDSLGPLDLDIPSSRYHSELILSD  2430
               +G  + +T  +  +     +D VK      DV  P+S G  +L    SR    L  +D
Sbjct  406   STEGRKEESTPQIPGLG---NNDNVK-----PDVPMPESTGEPELGAFDSRL---LSGTD  454

Query  2431  SLGGLTQLIASSLDAF  2478
             SL GL+ L+A+SLDAF
Sbjct  455   SL-GLSGLLANSLDAF  469



>emb|CDJ26673.1| unnamed protein product [Triticum aestivum]
Length=471

 Score =   189 bits (480),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 157/428 (37%), Positives = 221/428 (52%), Gaps = 49/428 (11%)
 Frame = +1

Query  1243  NETNL-----QNSGKLKLQLFPVDDGTRRALELDNHNPYLELTLSTRKKMSSVLEHLNRK  1407
             N TNL       S K+KLQ FP+D+  ++ L+ + HNPYLELTL+ RKKMSS+++HLN K
Sbjct  71    NSTNLSAQPPNYSKKMKLQFFPIDEAIQKVLQQEKHNPYLELTLAPRKKMSSIVQHLNTK  130

Query  1408  WGNSSMACGDLMLFPYHLHKENLVHFQKWTKDTTLTAADVYALTGSPPVFRLRYGWF--S  1581
             WG SS A G+LMLFPY    ++LV  +KWT + + TAADVY   GSP  FRLRYGWF   
Sbjct  131   WGRSSCAKGELMLFPYGARPDSLVGSEKWTVNDSCTAADVYVAVGSPSTFRLRYGWFEQQ  190

Query  1582  NAEVAFRAPVSSAIPSRHDANMN--IMPESSVGVLQAPST--DPPKEANGCVSMNTVNAS  1749
             ++E +  APV SA  +  D   +  + P       + P+   DP +  N         + 
Sbjct  191   SSEESL-APVHSAEKTIGDKPSDHFVFPNKPSDPFEFPNKPLDPFEFPNKPSDPFEFPSK  249

Query  1750  RSSDHTEAVLWENPETVV-TEAEVDDLQFNKAGTSCVGEWADSLTNISVGDLLSEAPDME  1926
              S        + +P  V  TE  V D Q      S    W D ++NIS G LLS+A   +
Sbjct  250   HSDPFEFPSKFTSPSDVCNTEQTVVDNQSKVTPLS----WIDCISNISFGALLSQAVPSQ  305

Query  1927  DANCITSSIHSSSNYIHQIPFSCDSFDAAIAAHIKKHQNVTDSQAALPSQLSSIWGAEDT  2106
             D+         +S+ + QIP +CDSFDAAIA+ I   Q     + + P    S+W AE+T
Sbjct  306   DSK---QPPLQNSSILQQIPATCDSFDAAIASLIAHQQTSNQPKVSNP----SVWDAEET  358

Query  2107  CDAFAFQRHSLSEKVQNASKHTSLETCKQITLANTTALGASVE-DLPG-ARNPVDG--DA  2274
             C AF   R+  S ++ +++   S       +   ++ LGA  E D  G  R   +G  + 
Sbjct  359   CHAFP--RNQTSARMFSSAHGNS-------SAITSSILGAIPESDTDGNQRCSTEGRKEE  409

Query  2275  ATADLESVHYSPTSDVVKDFNGLSDVYWPDSLGPLDLDIPSSRYHSELILSDSLGGLTQL  2454
             +T  +  +     +D VK      D   P+S G  +L    SR    L  +DSL GL+ L
Sbjct  410   STPQIPGLG---NNDNVK-----PDEPMPESTGEPELGAFDSRL---LSGTDSL-GLSGL  457

Query  2455  IASSLDAF  2478
             +A+SLDAF
Sbjct  458   LANSLDAF  465



>gb|EMS59913.1| hypothetical protein TRIUR3_34375 [Triticum urartu]
Length=565

 Score =   191 bits (484),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 149/415 (36%), Positives = 214/415 (52%), Gaps = 36/415 (9%)
 Frame = +1

Query  1255  LQNSGKLKLQLFPVDDGTRRALELDNHNPYLELTLSTRKKMSSVLEHLNRKWGNSSMACG  1434
             L  S K+KLQ FP+D+  ++ L+ + HNPYLELTL+ RKKMSSV++HLN KWG SS A G
Sbjct  113   LNYSKKMKLQFFPIDEAIQKVLQQEKHNPYLELTLAPRKKMSSVVQHLNTKWGRSSCAKG  172

Query  1435  DLMLFPYHLHKENLVHFQKWTKDTTLTAADVYALTGSPPVFRLRYGWF--SNAEVAFRAP  1608
             +LMLFPY    ++LV  +KWT + + TAADVY   GSP  FRLRYGWF   ++E +  AP
Sbjct  173   ELMLFPYGARPDSLVGSEKWTVNDSCTAADVYVAVGSPSTFRLRYGWFEQQSSEESL-AP  231

Query  1609  VSSAIPSRHD--ANMNIMPESSVGVLQAPST--DPPKEANGCVSMNTVNASRSSDHTEAV  1776
             V SA  +  D  ++  + P       + P+   DP +  N         +  S       
Sbjct  232   VHSAEKTIGDKPSDHFVFPNKPSDPFEFPNKPLDPFEFPNKPSDPFEFPSKHSDPFEFPS  291

Query  1777  LWENPETVV-TEAEVDDLQFNKAGTSCVGEWADSLTNISVGDLLSEAPDMEDANCITSSI  1953
              + +P  V  TE  V D Q      S    W D ++NIS G LLS+A   +D+       
Sbjct  292   KFTSPSDVCNTEQTVVDNQSKVTPLS----WIDCISNISFGALLSQAVPSQDSK---QPP  344

Query  1954  HSSSNYIHQIPFSCDSFDAAIAAHIKKHQNVTDSQAALPSQLSSIWGAEDTCDAFAFQRH  2133
               +S+ + QIP +CDSFDAAIA+ I   Q     + + P    S+W AE+TC AF   R+
Sbjct  345   LQNSSILQQIPATCDSFDAAIASLIAHQQTSNQPKVSNP----SVWDAEETCHAFP--RN  398

Query  2134  SLSEKVQNASKHTSLETCKQITLANTTALGASVEDLPGARNPVDGDAATADLESVHYSPT  2313
               S ++ +++   S       +   ++ LGA    +P +    +   +T   +       
Sbjct  399   QTSARMFSSAHGNS-------SAITSSILGA----IPESDTDGNQRCSTEGRKEESTPQI  447

Query  2314  SDVVKDFNGLSDVYWPDSLGPLDLDIPSSRYHSELILSDSLGGLTQLIASSLDAF  2478
               +  + N   D   P+S G  +L    SR    L  +DSL GL+ L+A+SLDAF
Sbjct  448   PGLGNNDNVKPDEPMPESTGEPELGAFDSRL---LSGTDSL-GLSGLLANSLDAF  498



>ref|XP_002306364.1| hypothetical protein POPTR_0005s08900g [Populus trichocarpa]
 gb|EEE93360.1| hypothetical protein POPTR_0005s08900g [Populus trichocarpa]
Length=383

 Score =   186 bits (471),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 155/417 (37%), Positives = 219/417 (53%), Gaps = 57/417 (14%)
 Frame = +1

Query  1270  KLKLQLFPVDDGTRRALELDNHNPYLELTLSTRKKMSSVLEHLNRKWGNSSMACGDLMLF  1449
             K+KLQLFP+D+ T   LE D ++PYLELTLS RKK+SSVL+HLN KWG+S +A G+ +L+
Sbjct  4     KIKLQLFPIDEATLVGLEKDGYHPYLELTLSARKKVSSVLKHLNDKWGSSKIASGEPVLY  63

Query  1450  PYHLHKENLVHFQKWT-KDTTLTAADVYALTGSPPVFRLRYGWFSNAEVAFRAPVSSAIP  1626
             PY++  E L   +KWT  D  +TA +VYA  G+P VFRLRYGWFS +E+    PV   +P
Sbjct  64    PYNV-AEGLAR-RKWTLSDIDITAGEVYAAIGNPSVFRLRYGWFSKSEI---EPV--GVP  116

Query  1627  SRHDAN------------MNIMPESSVGVLQ--APSTDPPKEANGCVSMNTVNASR-SSD  1761
             S   A+             +I  ES+ G ++    +++  K +    +MN V A + SSD
Sbjct  117   SASTADEACLQPQFVQKVSSINTESTCGEVKRMEETSEEFKPSTSTGAMNAVLADKISSD  176

Query  1762  HTEAVLWENPETVVTEAEVDDLQFNKAGTSCVGEWADSLTNISVGDLLSEAPDMEDANCI  1941
              +       P+   T+ +V   Q +         W D LT+IS+G LLSEA      N  
Sbjct  177   GSIG-----PKGNETKMDVGIGQPSTL-------WNDGLTDISIGGLLSEASLQGLLNSC  224

Query  1942  TSSIHSSSNYIHQIPFSCDSFDAAIAAHIKKHQNVTDSQAALP--SQLSSIWGAEDTCDA  2115
                 + S+  +       DSFDA I A +   Q     +  LP  S  SSI  AEDTC A
Sbjct  225   DPRSNGSNPGLQPSQIISDSFDAFITAQVNGFQ-----EPRLPPHSSSSSILDAEDTCHA  279

Query  2116  FAFQRHSLSEK-VQNASKHTSLETCKQITLANTTALGASVEDLPGARNPVDGDAATADLE  2292
             FA ++ S S K  +  S     +TC Q T + ++    + EDL    +  +       L 
Sbjct  280   FAVKKLSASGKDCRTLSGSAYSQTCSQDTDSKSSMHPTTTEDLGCKESETE-----LSLG  334

Query  2293  SVHYSPTSDVVKDFNGLSDVYWPDSLGPLDLDIPSSRYHSELILSDSLGGLTQLIAS  2463
             S  Y+  + +     GLS + W DSLGP DL + SSR   ++I  DSL  + ++IAS
Sbjct  335   SRMYNHENSL-----GLSGIKWTDSLGPFDLGLSSSR---KIINGDSL-SIGRIIAS  382



>emb|CDP19449.1| unnamed protein product [Coffea canephora]
Length=315

 Score =   183 bits (465),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 113/209 (54%), Positives = 142/209 (68%), Gaps = 7/209 (3%)
 Frame = +1

Query  1855  VGEWADSLTNISVGDLLSEAPDMEDANCITSSIHSSSNYIHQIPFSCDSFDAAIAAHIKK  2034
              GEWADSLTNIS+GDLL+EA    + NCI S+   +S+ + QIPFSCDSFDAAIAAHI K
Sbjct  23    AGEWADSLTNISIGDLLTEASHNGEVNCIDSTELRNSHCLRQIPFSCDSFDAAIAAHIYK  82

Query  2035  HQNVTDSQAALPSQLSSIWGAEDTCDAFAFQRHSL-SEKVQNASKHTSLETCKQITLANT  2211
             HQ+ +  Q  L +  SSIW  E+TCDAF FQ++S+ SE+ QNAS+ +  ET  +IT  ++
Sbjct  83    HQSRSALQPPLHTNTSSIWDGEETCDAFVFQKNSVFSEEFQNASRISPPETSSEITSTSS  142

Query  2212  TALGASVEDLPGARNPVDGDAATADL-ESVHYSPTS--DVVKDFNGLSDVYWPDSLGPLD  2382
              A G + E  P    P+  D    D+ +  H    S  D  +D NGL+D+YWPDSLG LD
Sbjct  143   AASGKAQESDP--EEPLTDDPMHGDIVDKCHSDQHSFDDSQRDLNGLTDIYWPDSLGALD  200

Query  2383  LDIPSSRYHS-ELILSDSLGGLTQLIASS  2466
             LDI S RY S +LILSDSLGGL +LIASS
Sbjct  201   LDISSCRYPSDDLILSDSLGGLNRLIASS  229



>ref|XP_004968437.1| PREDICTED: TSL-kinase interacting protein 1-like isoform X2 [Setaria 
italica]
Length=415

 Score =   186 bits (472),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 114/295 (39%), Positives = 156/295 (53%), Gaps = 38/295 (13%)
 Frame = +1

Query  1264  SGKLKLQLFPVDDGTRRALELDNHNPYLELTLSTRKKMSSVLEHLNRKWGNSSMACGDLM  1443
             SGK+KLQLFP+D+  ++ ++ + HNPYLEL L+ RKK+SSV++HLN KWGNS  A G+LM
Sbjct  86    SGKIKLQLFPIDENIQKIMQQEKHNPYLELILAPRKKISSVVQHLNTKWGNSQCAKGELM  145

Query  1444  LFPYHLHKENLVHFQKWTKDTTLTAADVYALTGSPPVFRLRYGWFSNAEVAFRAPVSSAI  1623
             LFP     + +    KWT   + TAADV+   GSP  FRLRYGWF               
Sbjct  146   LFPNGTRVDIIASSAKWTLKDSCTAADVHVAVGSPSTFRLRYGWF---------------  190

Query  1624  PSRHDANMNIMPESSVGVLQAPSTDPPKEANGCVSMNTVNASRSSDHTEAVLWENPETVV  1803
                     N+  +SS      PS    + A+  + +   +   + +     L E P   V
Sbjct  191   ------GPNLKQQSS-----GPSLASVQSADKTIGVKAPDLVFTEEKHMTGLSEFPSNFV  239

Query  1804  TEAEVDDL----QFNKAGTSCVGEWADSLTNISVGDLLSEAPDMEDANCITSSIHSSSNY  1971
             T + VD+     Q +         W DS++NIS G LLSEA   +D+      + S +N 
Sbjct  240   TPSIVDNTNAVQQVDNQSKVAPLSWLDSISNISFGALLSEATPSQDSK----QLPSQNNP  295

Query  1972  IHQIPFSCDSFDAAIAAHIKKHQNVTDSQAALPSQLSSIWGAEDTCDAFAFQRHS  2136
               QIP +CDSFDAAIA+ I   Q  +  + + P    S+W AEDTC AFAFQ  +
Sbjct  296   SIQIPATCDSFDAAIASLIACQQASSQPRVSNP----SLWEAEDTCHAFAFQNQA  346



>gb|EEC70059.1| hypothetical protein OsI_00661 [Oryza sativa Indica Group]
Length=453

 Score =   187 bits (474),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 150/450 (33%), Positives = 223/450 (50%), Gaps = 63/450 (14%)
 Frame = +1

Query  1201  KDPHVFPDLLHNSFNETNL--QNSGKLKLQLFPVDDGTRRALELDNHNPYLELTLSTRKK  1374
             KD      L H+S N +    ++SGK+ LQLFP+D+  +++L+  NHNPYLELT++ RKK
Sbjct  49    KDGSFMEALFHDSKNVSARPPRHSGKIALQLFPIDEEFQKSLQQKNHNPYLELTVAPRKK  108

Query  1375  MSSVLEHLNRKWGNSSMACGDLMLFPYHLHKENLVHFQKWTKDTTLTAADVYALTGSPPV  1554
             +SSVL+HLN KWGNS  A G+LMLFP     +N+   ++WT+  + TAADV+   GSP  
Sbjct  109   ISSVLQHLNTKWGNSQCARGELMLFPDGTRLDNINGSERWTRSDSCTAADVHVAVGSPST  168

Query  1555  FRLRYGWFSNAEVAFRAPVSSAIPSRHDANMNI---MPESSVGVLQAPSTDP-PKEANGC  1722
             FRLRYGWF               P+  + N  +   +  S+  ++     DP  +E    
Sbjct  169   FRLRYGWFP--------------PNFGEQNSGVSLGLVHSAGNIIDNEPLDPVVREQKQM  214

Query  1723  VSMNTVNASRSSDHTEAVLWENPETVVTEAEVDDLQFNKAGTSCVGEWADSLTNISVGDL  1902
              +++   ++ ++  TEA       TV T  +  D Q  +   S    W D ++NIS G L
Sbjct  215   TALSEFPSNFAAPSTEA------NTVKTMKQ--DNQSKETPLS----WIDCISNISFGAL  262

Query  1903  LSEAPDMEDANCITSSIHSSSNYIHQIPFSCDSFDAAIAAHIKKHQNVTDSQAALPSQLS  2082
             L+EA   +D+  +    +SS     QIP + DSFDAAIA+ I + Q  +  + + P    
Sbjct  263   LAEAAPSQDSKQLLPQNNSS---FQQIPLTADSFDAAIASLIARQQASSQPKVSTP----  315

Query  2083  SIWGAEDTCDAFAFQRHSLSEKVQNASKHTSLETCKQITLANTTALG------------A  2226
             S+W AE+TC AF  Q      ++   +  T+  +C   TL   + LG             
Sbjct  316   SLWDAEETCHAFPSQN-----RISRRTPGTTPSSCGASTL---SVLGTILESGTDGEKQC  367

Query  2227  SVEDLPGARNPVDGDAATADLESVHYSPTSDVVKDFNGLSDVYWPDSLGPLDLDIPSSRY  2406
             S ED     NP     A  D       P S+   +    +  +  +S G  ++    SR 
Sbjct  368   STEDRREEPNPQASLLANDDNNVKPDIPVSESTGEPRLGASCFQSESTGEPEVGASCSRL  427

Query  2407  HSELILSDSLGGLTQLIASSLDAFQNCSFF  2496
                L  +DSL  ++ L+A+SLDAFQ  S F
Sbjct  428   ---LSGTDSL-SVSDLLANSLDAFQKFSVF  453



>ref|NP_001042218.2| Os01g0182400 [Oryza sativa Japonica Group]
 dbj|BAD68050.1| myb/SANT domain protein -like [Oryza sativa Japonica Group]
 dbj|BAG91892.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAF04132.2| Os01g0182400 [Oryza sativa Japonica Group]
Length=467

 Score =   187 bits (474),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 150/450 (33%), Positives = 223/450 (50%), Gaps = 63/450 (14%)
 Frame = +1

Query  1201  KDPHVFPDLLHNSFNETNLQ--NSGKLKLQLFPVDDGTRRALELDNHNPYLELTLSTRKK  1374
             KD      L H+S N +     +SGK+ LQLFP+D+  +++L+  NHNPYLELT++ RKK
Sbjct  63    KDGSFMEALFHDSKNVSARPPCHSGKIALQLFPIDEEFQKSLQQKNHNPYLELTVAPRKK  122

Query  1375  MSSVLEHLNRKWGNSSMACGDLMLFPYHLHKENLVHFQKWTKDTTLTAADVYALTGSPPV  1554
             +SSVL+HLN KWGNS  A G+LMLFP     +N+   ++WT+  + TAADV+   GSP  
Sbjct  123   ISSVLQHLNTKWGNSQCARGELMLFPDGTRLDNINGSERWTRSDSCTAADVHVAVGSPST  182

Query  1555  FRLRYGWFSNAEVAFRAPVSSAIPSRHDANMNI---MPESSVGVLQAPSTDP-PKEANGC  1722
             FRLRYGWF               P+  + N  +   +  S+  ++     DP  +E    
Sbjct  183   FRLRYGWFP--------------PNFGEQNSGVSLGLVHSAGNIIDNEPLDPVVREQKQM  228

Query  1723  VSMNTVNASRSSDHTEAVLWENPETVVTEAEVDDLQFNKAGTSCVGEWADSLTNISVGDL  1902
              +++   ++ ++  TEA       TV T  +  D Q  +   S    W D ++NIS G L
Sbjct  229   TALSEFPSNFAAPSTEA------NTVKTMKQ--DNQSKETPLS----WIDCISNISFGAL  276

Query  1903  LSEAPDMEDANCITSSIHSSSNYIHQIPFSCDSFDAAIAAHIKKHQNVTDSQAALPSQLS  2082
             L+EA   +D+  +    +SS   + QIP + DSFDAAIA+ I + Q  +  + + P    
Sbjct  277   LAEAAPSQDSKQLLPQNNSS---LQQIPLTADSFDAAIASLIARQQASSQPKVSTP----  329

Query  2083  SIWGAEDTCDAFAFQRHSLSEKVQNASKHTSLETCKQITLANTTALG------------A  2226
             S+W AE+TC AF  Q      ++   +  T+  +C   TL   + LG             
Sbjct  330   SLWDAEETCHAFPSQN-----RISRRTPGTTPSSCGASTL---SVLGTILESGTDGEKQC  381

Query  2227  SVEDLPGARNPVDGDAATADLESVHYSPTSDVVKDFNGLSDVYWPDSLGPLDLDIPSSRY  2406
             S ED     NP     A  D       P S+   +    +  +  +S G  ++    SR 
Sbjct  382   STEDRREEPNPQASLLANDDNNVKPDIPVSESTGEPRLGASCFQSESTGEPEVGASCSRL  441

Query  2407  HSELILSDSLGGLTQLIASSLDAFQNCSFF  2496
                L  +DSL  ++ L+A+SLDAFQ  S F
Sbjct  442   ---LSGTDSL-SVSDLLANSLDAFQKFSVF  467



>gb|EEE53998.1| hypothetical protein OsJ_00639 [Oryza sativa Japonica Group]
Length=508

 Score =   186 bits (473),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 152/463 (33%), Positives = 216/463 (47%), Gaps = 89/463 (19%)
 Frame = +1

Query  1201  KDPHVFPDLLHNSFNETNLQ--NSGKLKLQLFPVDDGTRRALELDNHNPYLELTLSTRKK  1374
             KD      L H+S N +     +SGK+ LQLFP+D+  +++L+  NHNPYLELT++ RKK
Sbjct  104   KDGSFMEALFHDSKNVSARPPCHSGKIALQLFPIDEEFQKSLQQKNHNPYLELTVAPRKK  163

Query  1375  MSSVLEHLNRKWGNSSMACGDLMLFPYHLHKENLVHFQKWTKDTTLTAADVYALTGSPPV  1554
             +SSVL+HLN KWGNS  A G+LMLFP     +N+   ++WT+  + TAADV+   GSP  
Sbjct  164   ISSVLQHLNTKWGNSQCARGELMLFPDGTRLDNINGSERWTRSDSCTAADVHVAVGSPST  223

Query  1555  FRLRYGWF-----------------SNAEVAFRAPVSSAIPSRHDANMNIMPESSVGVLQ  1683
             FRLRYGWF                 S   +    P+   +  R    M  + E       
Sbjct  224   FRLRYGWFPPNFGEQNSGVSLGLVHSAGNIIDNEPLDPVV--REQKQMTALSEFPSN-FA  280

Query  1684  APSTDPPKEANGCVSMNTVNASRSSDHTEAVLWENPETVVTEAEVDDLQFNKAGTSCVGE  1863
             APST    EAN   +M   N S+             ET ++                   
Sbjct  281   APST----EANTVKTMKQDNQSK-------------ETPLS-------------------  304

Query  1864  WADSLTNISVGDLLSEAPDMEDANCITSSIHSSSNYIHQIPFSCDSFDAAIAAHIKKHQN  2043
             W D ++NIS G LL+EA   +D+  +    +SS   + QIP + DSFDAAIA+ I + Q 
Sbjct  305   WIDCISNISFGALLAEAAPSQDSKQLLPQNNSS---LQQIPLTADSFDAAIASLIARQQA  361

Query  2044  VTDSQAALPSQLSSIWGAEDTCDAFAFQRHSLSEKVQNASKHTSLETCKQITLANTTALG  2223
              +  + + P    S+W AE+TC AF  Q      ++   +  T+  +C   TL   + LG
Sbjct  362   SSQPKVSTP----SLWDAEETCHAFPSQN-----RISRRTPGTTPSSCGASTL---SVLG  409

Query  2224  ------------ASVEDLPGARNPVDGDAATADLESVHYSPTSDVVKDFNGLSDVYWPDS  2367
                          S ED     NP     A  D       P S+   +    +  +  +S
Sbjct  410   TILESGTDGEKQCSTEDRREEPNPQASLLANDDNNVKPDIPVSESTGEPRLGASCFQSES  469

Query  2368  LGPLDLDIPSSRYHSELILSDSLGGLTQLIASSLDAFQNCSFF  2496
              G  ++    SR    L  +DSL  ++ L+A+SLDAFQ  S F
Sbjct  470   TGEPEVGASCSRL---LSGTDSL-SVSDLLANSLDAFQKFSVF  508



>gb|EMT18634.1| hypothetical protein F775_12182 [Aegilops tauschii]
Length=495

 Score =   186 bits (472),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 123/308 (40%), Positives = 166/308 (54%), Gaps = 28/308 (9%)
 Frame = +1

Query  1243  NETNL-----QNSGKLKLQLFPVDDGTRRALELDNHNPYLELTLSTRKKMSSVLEHLNRK  1407
             N TNL       S K+KLQ FP+D+  ++ L+ + HNPYLELTL+ RKKMSS+++HLN K
Sbjct  71    NSTNLSAQPPNYSKKMKLQFFPIDEAIQKVLQQEKHNPYLELTLAPRKKMSSIVQHLNTK  130

Query  1408  WGNSSMACGDLMLFPYHLHKENLVHFQKWTKDTTLTAADVYALTGSPPVFRLRYGWF---  1578
             WG SS A G+LMLFPY    ++LV  +KWT + + TAADVY   GSP  FRLRYGWF   
Sbjct  131   WGRSSCAKGELMLFPYGARPDSLVGSEKWTVNDSCTAADVYVAVGSPSTFRLRYGWFEHN  190

Query  1579  ---SNAEVAFRAPVSSAIPSRHD--ANMNIMPESSVGVLQAPST--DPPKEANGCVSMNT  1737
                 ++E +  APV SA  +  D  ++  + P       + P+   DP +  N       
Sbjct  191   LKQQSSEESL-APVHSAEKTIGDKPSDHFVFPNKPSDPFEFPNKPLDPFEFPNKPSDPFE  249

Query  1738  VNASRSSDHTEAVLWENPETVV-TEAEVDDLQFNKAGTSCVGEWADSLTNISVGDLLSEA  1914
               +  S        + +P  V  TE  V D Q      S    W D ++NIS G LLS+A
Sbjct  250   FPSKHSDPFEFPSKFTSPSDVCNTEQTVVDNQSKVTPLS----WIDCISNISFGALLSQA  305

Query  1915  PDMEDANCITSSIHSSSNYIHQIPFSCDSFDAAIAAHIKKHQNVTDSQAALPSQLSSIWG  2094
                +D+         SS+ + QIP +CDSFDAAIA+ I   Q     + + P    S+W 
Sbjct  306   VPSQDSK---QPPLQSSSILQQIPATCDSFDAAIASLIAHQQTSNQPKVSNP----SVWD  358

Query  2095  AEDTCDAF  2118
             AE+TC AF
Sbjct  359   AEETCHAF  366



>ref|XP_006643835.1| PREDICTED: TSL-kinase interacting protein 1-like [Oryza brachyantha]
Length=347

 Score =   180 bits (457),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 137/409 (33%), Positives = 196/409 (48%), Gaps = 81/409 (20%)
 Frame = +1

Query  910   DNQDIHKFGSGKGSSLK--RHINIGANSTSCKADSSLLKTARHRRKIGATAAYKRWEKAA  1083
             D   I KFG  K  SLK  ++IN  + + S K          HRR             A 
Sbjct  12    DTGTIAKFGCSKMQSLKPGKYINKSSGNASTK----------HRR-------------AG  48

Query  1084  IAGVSLVADAAEHLERTTTDKEDGHFQDSNVRNVFEHSGKDPHVFPDLLHNSFNETNLQN  1263
             I+   L  +    L+       DG+F ++                    H S +     +
Sbjct  49    ISAPQLCTEKQIALK-------DGNFMEAP------------------FHVSISSRPPTH  83

Query  1264  SGKLKLQLFPVDDGTRRALELDNHNPYLELTLSTRKKMSSVLEHLNRKWGNSSMACGDLM  1443
             SGK+KLQLFP+D+  ++ L+ +N NPYLEL L+ RKK+SSV++HLN KWGNS  A G+LM
Sbjct  84    SGKIKLQLFPIDEEIQKVLQQENRNPYLELILAPRKKISSVVQHLNAKWGNSQCARGELM  143

Query  1444  LFPYHLHKENLVHFQKWTKDTTLTAADVYALTGSPPVFRLRYGWFSNAEVAFRAPVSS-A  1620
             LFP     +N+   +KWT   + TAADV+A  GSP +FRLRYGWF   E  F    S+ +
Sbjct  144   LFPNDAKLDNITVSEKWTHSDSCTAADVHAAVGSPSIFRLRYGWF---ETNFGQRSSAPS  200

Query  1621  IPSRHDANMNIMPESSVGVLQAPSTDPPKEANGCVSMNTVNASRSSDHTEAVLWENPETV  1800
             + S H A   I  E    V +       ++   C+S    N +  S              
Sbjct  201   LGSVHSAGKIIRNEPLDPVFRE------QKQMACLSEFPSNFAAPS--------------  240

Query  1801  VTEAEVDDLQFNKAGTSCVGEWADSLTNISVGDLLSEAPDMEDANCITSSIHSSSNYIHQ  1980
             +  + V+ L+ +         W D ++NIS G LL+E+    D+  + S  +SS   + Q
Sbjct  241   IEASTVNTLKQDNQSKGTPLSWIDCISNISFGALLAESAPSRDSKQLLSQNNSS---LQQ  297

Query  1981  IPFSCDSFDAAIAAHIKKHQNVTDSQAALPSQLSSIWGAEDTCDAFAFQ  2127
             IP + DSFDAAIA+ I + Q  +  + + P    S+W AE+TC AF  Q
Sbjct  298   IPPTADSFDAAIASLIARQQASSQPKVSNP----SLWDAEETCHAFPSQ  342



>ref|XP_002310046.2| hypothetical protein POPTR_0007s06970g [Populus trichocarpa]
 gb|EEE90496.2| hypothetical protein POPTR_0007s06970g [Populus trichocarpa]
Length=403

 Score =   180 bits (457),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 146/406 (36%), Positives = 195/406 (48%), Gaps = 45/406 (11%)
 Frame = +1

Query  1258  QNSGKLKLQLFPVDDGTRRALELDNHNPYLELTLSTRKKMSSVLEHLNRKWGNSSMACGD  1437
             Q   K+KLQLFP+D+GTR  LE D ++PYLELTLS RKK+SSVL+HLN KWG S +ACG+
Sbjct  23    QMPAKIKLQLFPIDEGTRVGLEKDGYHPYLELTLSARKKVSSVLKHLNDKWGGSGIACGE  82

Query  1438  LMLFPYHLHKENLVHFQKWT-KDTTLTAADVYALTGSPPVFRLRYGWFSNAEVAFRAPVS  1614
              +L+PY+  + +    +KWT  D  ++A +VYA  G+P +FRLRYGWFS++        S
Sbjct  83    PVLYPYNTSEASTT--KKWTLSDINISAGEVYAAIGNPSIFRLRYGWFSDSGTE-----S  135

Query  1615  SAIPSRHDANMNIMPESSVGVLQAPSTDPPKEANGCVSMNTVNASRSSDHTEAVLWE-NP  1791
               +PS        M  +    LQ      P+      S++ V+A       E    E  P
Sbjct  136   VGVPS--------MSTTYDACLQ------PQIMQQVCSIDAVSARDEVKWMEETSEEFQP  181

Query  1792  ETVVTEAEV---DDLQFNKAGTSCVGE----WADSLTNISVGDLLSEAPDMEDANCITSS  1950
              T      V   D +   K     +G+    W D  TNIS+G LLSEA      N     
Sbjct  182   STSTGATNVVSADKVNEAKRDVGSIGQPSTLWDDGQTNISIGGLLSEASLQGVLNTFDPK  241

Query  1951  IHSSSNYIHQIPFSCDSFDAAIAAHIKKHQNVTDSQAALPSQLSSIWGAEDTCDAFAFQR  2130
              + S+  +       DS DA IAA +   Q     Q +     SSI  AEDTC  FA ++
Sbjct  242   SNGSNPGLKPSQLISDSLDAFIAAQVNHSQGPRLPQCS----SSSILDAEDTCHEFAIKK  297

Query  2131  HSLSEK-VQNASKHTSLETCKQITLANTTALGASVEDLPGARNPVDGDAATADLES-VHY  2304
              S + K  Q  S     +TC Q    +  +  +    +    N  D        ES    
Sbjct  298   FSAAGKDCQALSGSAYSQTCSQ----DAGSKSSKHPTMTAVNNQSDLQQGHGYEESETGL  353

Query  2305  SPTSDVVKDFN--GLSDVYWPDSLGPLDLDIPSSRYHSELILSDSL  2436
             S  S V    N  GLS + W DSLGP DL + SSR   ++I  DSL
Sbjct  354   SLGSRVYNHENSLGLSGIKWTDSLGPFDLGLSSSR---KIINGDSL  396



>ref|XP_007159787.1| hypothetical protein PHAVU_002G267200g [Phaseolus vulgaris]
 gb|ESW31781.1| hypothetical protein PHAVU_002G267200g [Phaseolus vulgaris]
Length=440

 Score =   181 bits (459),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 159/462 (34%), Positives = 217/462 (47%), Gaps = 87/462 (19%)
 Frame = +1

Query  1126  ERTTTDKEDGHFQDSNVRNVF-EHSGKDPHVFPDLLHNSFNETN----------LQNSGK  1272
             E    DKE+ +F       +F EH G  P +   +  N+F   N          +  S K
Sbjct  46    EEVLNDKENQYF-------LFKEHMGTCPEI---VNKNNFKTENRGAIELHPGEILTSSK  95

Query  1273  LKLQLFPVDDGTRRALELDNHNPYLELTLSTRKKMSSVLEHLNRKWGNSSMACGDLMLFP  1452
             +KLQLFP+++GTR  LE D HNPYLELTL  RKK+SS+L+HL +KWG SS+A G+L+LFP
Sbjct  96    IKLQLFPLNEGTRIGLEKDGHNPYLELTLRGRKKISSILKHLGKKWGTSSIAKGELILFP  155

Query  1453  YHLHKENLVHFQKWT-KDTTLTAADVYALTGSPPVFRLRYGWFSNAEVAFRAPVSSAIPS  1629
             Y++  ENL   ++WT  D+  TA+ VYA  GSP +FRL+YGWF   E     P SS IPS
Sbjct  156   YNI-VENLSDCKRWTINDSDTTASAVYAAVGSPAIFRLKYGWFYIHE-----PRSSGIPS  209

Query  1630  RHDANMNIMPESSVGVLQAPSTDPPKEANGCVSMNTVNASRSSDHTEAVLWENPETVVTE  1809
                                P+   P    G     T NA+              ET+  E
Sbjct  210   ------------------TPTPYKPVVDGG----TTANANLE------------ETLCGE  235

Query  1810  AEV---DDLQFNKAGTSCVGEWADSLTNISVGDLLSEAPDMEDANCITSSIHSSSNYIHQ  1980
               +   ++ + +         W DSL+NIS+G  LSE      A+        S   I  
Sbjct  236   QHMVQDNEPRVSSGLQQSSSPWIDSLSNISIGAFLSE------ASLFGGLDPKSFAGIQP  289

Query  1981  IPFSCDSFDAAIAAHIKKHQNVTDSQAALPSQLSSIWGAEDTCDAFAFQRHSLSEKVQNA  2160
                + DS DA IAA I    N   S+ +      SI  AE+TC AF  Q+ S    V  +
Sbjct  290   CDVTSDSLDAFIAAQI---SNRPVSRLSAEDLRPSILDAEETCHAFPLQKLSSPTDVLTS  346

Query  2161  SKHTSLETCKQITLANTTALGAS--VEDLPG-ARNPVDGDAATADLESVHYSPTSDVVKD  2331
              +      C Q T +N      +  V D  G + NP  G   T  L S    P  D  + 
Sbjct  347   RRKDYSVACSQDTSSNLLKFSNTEKVNDQDGPSPNPPFGKTQTDLLLSSR--PYDD--ER  402

Query  2332  FNGLSDVYWPDSLGPLDLDIPSSRYHSELILSD--SLGGLTQ  2451
               GL+D+ W +S+GP DL +P+ +    +I  D  S+GGL +
Sbjct  403   SLGLTDIKWNESMGPFDLGMPAQK----VIGGDSVSIGGLVK  440



>ref|XP_011021967.1| PREDICTED: TSL-kinase interacting protein 1-like [Populus euphratica]
Length=383

 Score =   179 bits (453),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 154/417 (37%), Positives = 216/417 (52%), Gaps = 57/417 (14%)
 Frame = +1

Query  1270  KLKLQLFPVDDGTRRALELDNHNPYLELTLSTRKKMSSVLEHLNRKWGNSSMACGDLMLF  1449
             K+KLQLFP+D+ T   LE D ++PYLELTLS RKK+SSVL+H N KWG+S +A G+ +L+
Sbjct  4     KIKLQLFPIDEATLVGLEKDGYHPYLELTLSARKKVSSVLKHFNDKWGSSKIASGEPVLY  63

Query  1450  PYHLHKENLVHFQKWT-KDTTLTAADVYALTGSPPVFRLRYGWFSNAEVAFRAPVSSAIP  1626
             PY++  E L   +KWT  D  +TA +V A  G+P VFRLRYGWFS +E+    PV   +P
Sbjct  64    PYNV-AEGLAR-RKWTLSDIDVTAGEVCAAIGNPSVFRLRYGWFSKSEI---EPV--GVP  116

Query  1627  SRHDAN------------MNIMPESSVGVLQ--APSTDPPKEANGCVSMNTVNASR-SSD  1761
             S   A+             +I  ES+ G ++    +++  K +    +MN V A + SSD
Sbjct  117   SASTADEACLQPQFVQKVSSINTESTCGEVKRMEETSEEFKPSTSTGAMNAVLADKLSSD  176

Query  1762  HTEAVLWENPETVVTEAEVDDLQFNKAGTSCVGEWADSLTNISVGDLLSEAPDMEDANCI  1941
              +       P+   T+ +V   Q +         W D LT+IS+G LLSEA      N  
Sbjct  177   GSIG-----PKGNETKMDVGIGQPSTP-------WNDGLTDISIGGLLSEASLQGLLNSC  224

Query  1942  TSSIHSSSNYIHQIPFSCDSFDAAIAAHIKKHQNVTDSQAALP--SQLSSIWGAEDTCDA  2115
                 + S+  +       DSFDA I A +   Q        LP  S  SSI  AEDTC A
Sbjct  225   DPRSNGSNPGLQPSQIISDSFDAFITAQVNCFQG-----PRLPPHSSSSSILDAEDTCHA  279

Query  2116  FAFQRHSLSEK-VQNASKHTSLETCKQITLANTTALGASVEDLPGARNPVDGDAATADLE  2292
             FA ++ S S K  +  S     +TC Q T + ++    + EDL G +           L 
Sbjct  280   FAVKKLSASGKDCRTLSGSAYSQTCSQDTDSKSSMHPTTTEDL-GCKE----SETELSLG  334

Query  2293  SVHYSPTSDVVKDFNGLSDVYWPDSLGPLDLDIPSSRYHSELILSDSLGGLTQLIAS  2463
             S  Y+  + +     GLS + W DSLGP DL + SSR   ++I  DSL  + ++IAS
Sbjct  335   SRMYNHENSL-----GLSGIKWTDSLGPFDLGLSSSR---KIINGDSL-SIGRIIAS  382



>ref|XP_010027744.1| PREDICTED: TSL-kinase interacting protein 1 [Eucalyptus grandis]
 ref|XP_010027745.1| PREDICTED: TSL-kinase interacting protein 1 [Eucalyptus grandis]
Length=458

 Score =   181 bits (458),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 151/401 (38%), Positives = 197/401 (49%), Gaps = 43/401 (11%)
 Frame = +1

Query  1264  SGKLKLQLFPVDDGTRRALELDNHNPYLELTLSTRKKMSSVLEHLNRKWGNSSMACGDLM  1443
             S K+KLQLFPVD+ T   L+ D H+PYLELTL  RK++SSVL+HL  KWG+S+ A G+ +
Sbjct  66    STKIKLQLFPVDEVTCLGLQKDGHHPYLELTLKARKRISSVLKHLQTKWGSSTFATGEPV  125

Query  1444  LFPYHLHKENLVHFQKWT-KDTTLTAADVYALTGSPPVFRLRYGWFSNAEVAFRAPVSSA  1620
             L+PY   +E      +WT  D  + A DV+A  GSP +FRLRYGW SNA        S  
Sbjct  126   LYPYS-KQEAKSCPDRWTLDDKDVRAGDVHAAIGSPALFRLRYGWLSNA-----GSKSLG  179

Query  1621  IPSRHDANMNIMPESSVGVLQAPSTDPPKEANGCVSMNTVNASRSSDHTEAVLWENPETV  1800
               S   +  ++ P S    L   S        GC S N  N    +   E    E  ETV
Sbjct  180   KSSELASAESLSPAS---FLINSSHQHEGMQKGCES-NINNKCEEARKFEQADGEATETV  235

Query  1801  VT----EAEVD-------DLQFNKAGTSCVGE-WADSLTNISVGDLLSEAPDMEDANCIT  1944
             V     E  VD       D   N+ G     E W DSLTNIS+G LLS+A        + 
Sbjct  236   VGVKYHEIMVDNIVDHPEDRMCNEGGLGPSSEIWTDSLTNISIGGLLSDA----SLQGMF  291

Query  1945  SSIHSSSNYIHQI--PFSC--DSFDAAIAAHIKKHQNVTDSQAALPSQLSSIWGAEDTCD  2112
             SS  S +N   Q   P  C  DSFDA I  H+K  Q+   S        SSI  AEDTC 
Sbjct  292   SSFLSKTNGCVQTSHPSQCTSDSFDALITTHVKNSQSNKQSSN---EPCSSILDAEDTCM  348

Query  2113  AFAFQRHSLSEKV--QNASKHTSLETCKQITLANTTALGASVEDLPGARNPVDGDAATAD  2286
             AF F++ S+S+ +   N S +  L +C +I       L A+ +D+     P   DA+   
Sbjct  349   AFPFKKSSMSKDLSTSNGSSNAGL-SCPEI----GARLKAAEDDMQTEIEPNTFDASALQ  403

Query  2287  LESVHYSPTSDVVKDFN--GLSDVYWPDSLGPLDLDIPSSR  2403
                      S V  D +  GL+ + W D+LGP DL +PS +
Sbjct  404   ESETSLQLCSRVYNDESSLGLAGIKWTDTLGPFDLGLPSGK  444



>ref|NP_001060378.1| Os07g0634100 [Oryza sativa Japonica Group]
 dbj|BAC07117.1| putative myb/SANT domain protein [Oryza sativa Japonica Group]
 dbj|BAF22292.1| Os07g0634100 [Oryza sativa Japonica Group]
 gb|EAZ40783.1| hypothetical protein OsJ_25261 [Oryza sativa Japonica Group]
Length=388

 Score =   179 bits (453),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 143/434 (33%), Positives = 200/434 (46%), Gaps = 79/434 (18%)
 Frame = +1

Query  1240  FNETNLQNSGKLKLQLFPVDDGTRRALELDNHNPYLELTLSTRKKMSSVLEHLNRKWGNS  1419
             F+     +SGK+KL+LFP+D   ++ L+ +NHNPYLELTL+ RKK+SSV++HLN KWGNS
Sbjct  19    FSNRQPNHSGKIKLELFPIDKAIQKVLQQENHNPYLELTLAPRKKISSVVQHLNIKWGNS  78

Query  1420  SMACGDLMLFPYHLHKENLVHFQKWTKDTTLTAADVYALTGSPPVFRLRYGWFSNAEVAF  1599
               A G+LMLFPY    +N+    KWT   + TAADV+A  GSP  FRLRYGWF   E  F
Sbjct  79    QCARGELMLFPYDAQLDNIAGSGKWTHSDSCTAADVHAAVGSPLRFRLRYGWF---EPDF  135

Query  1600  RAPVSSAIPSRHDANMNIMPESSVGVLQAPSTDPPKEANGCVSMNTVNASRSSDHTEAVL  1779
                        H  N+                           +++V+    +   + VL
Sbjct  136   EQ-------QSHGPNLQ-------------------------DVHSVDKIIDNKPLDPVL  163

Query  1780  WENPETVVTEAEVDDLQFNKAGTSCVG-----------EWADSLTNISVGDLLSEAPDME  1926
              E  +TV      +D      G + V             W D ++NIS  +LLSEA    
Sbjct  164   MEQKQTVHLSEFPNDFAAQSVGDNAVQTVGNQSKVTPLSWIDCISNISFEELLSEAAPSA  223

Query  1927  DANCITSSIHSSSNYIHQIPFSCDSFDAAIAAHIKKHQNVTDSQAALPSQLSSIWGAEDT  2106
             D   + S  ++S     QIP + DSFDAAIA+ I + Q     + + P    S+W AE+ 
Sbjct  224   DNKQLLSQNNTS---FSQIPINFDSFDAAIASVIGQQQASNQMKVSNP----SLWDAEEA  276

Query  2107  CDAFAFQRHSLSEKVQNASKHTSLETCKQITLANTTALGASVEDLPGARNPVDGDAATA-  2283
             C AF  Q  +      +   H+   T        ++ LG     +P     VD    T  
Sbjct  277   CHAFPLQSQTSIRTFGSGPNHSGAIT--------SSILGT----IPECVTDVDQQCFTEV  324

Query  2284  -DLESVHYSPTS--DVVKDFNGLSDVYWPDSLGPLDLDIPSSRYHSELILSDSLGGLTQL  2454
              + E   + P S  D V  +  L +   P+ LG          Y S L+      GL+ L
Sbjct  325   WEEEPSPHIPLSCKDNVAPYISLPEFGEPE-LG---------AYCSRLLSGTDSLGLSGL  374

Query  2455  IASSLDAFQNCSFF  2496
             +++SLDAFQ  S F
Sbjct  375   LSNSLDAFQKFSVF  388



>dbj|BAK04474.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=464

 Score =   180 bits (457),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 149/418 (36%), Positives = 209/418 (50%), Gaps = 58/418 (14%)
 Frame = +1

Query  1270  KLKLQLFPVDDGTRRALELDNHNPYLELTLSTRKKMSSVLEHLNRKWGNSSMACGDLMLF  1449
             K+KLQ FPVD+  ++ L+ + HNPYLELTL+ RKKMSS+++HLN KWG SS A G+LMLF
Sbjct  84    KMKLQFFPVDEAIQKVLQQEKHNPYLELTLAPRKKMSSIVQHLNTKWGRSSCAKGELMLF  143

Query  1450  PYHLHKENLVHFQKWTKDTTLTAADVYALTGSPPVFRLRYGWF------SNAEVAFRAPV  1611
             PY    +++V  +KWT + + TAADV+   GSP  FRLRYGWF       ++E +  AP+
Sbjct  144   PYGARPDSIVGSEKWTINDSCTAADVHVAVGSPSTFRLRYGWFDHNLKQQSSEESL-APL  202

Query  1612  SSAIPSRHD--ANMNIMPESSVGVLQAPS--TDPPKEANGCVSMNTVNASRSSDHTE-AV  1776
              SA  +  D  ++    P  +      P+  +DP +  N           + SD  E   
Sbjct  203   HSAEKTIGDKPSDHFEFPNKTSDTYDFPNKPSDPFEFPN-----------KPSDPFEFPS  251

Query  1777  LWENPETVV-TEAEVDDLQFNKAGTSCVGEWADSLTNISVGDLLSEAPDMEDANCITSSI  1953
              + +P  V  TE  V D Q      S    W D ++NIS G LLS+A   +D+       
Sbjct  252   KFASPSVVCNTEQTVVDSQSKLTPLS----WIDCISNISFGALLSQAVPSQDSK---QPP  304

Query  1954  HSSSNYIHQIPFSCDSFDAAIAAHIKKHQNVTDSQAALPSQLSSIWGAEDTCDAFAFQRH  2133
               + + + QIP +CDSFDAAIA+ I   Q     + + P    S+W AE+TC AF   + 
Sbjct  305   LQNGSILQQIPATCDSFDAAIASLIAHQQTSNQPKVSNP----SVWDAEETCHAFPRNQT  360

Query  2134  S---LSEKVQNASKHTSLETCKQITLANTTALGASVEDLPGARNPVDGDAATADLESVHY  2304
             S    S    N+S  TS              LGA    +P +    +   +T   +    
Sbjct  361   SARMFSSAHGNSSAITSF------------ILGA----IPESDTDGNQRCSTEGRKEESS  404

Query  2305  SPTSDVVKDFNGLSDVYWPDSLGPLDLDIPSSRYHSELILSDSLGGLTQLIASSLDAF  2478
                S +    N   DV  P+S G  +L    SR    L  +DSL GL+  +A+SLDAF
Sbjct  405   PQISGLGNTDNANPDVPMPESTGEPELGAFDSRL---LSGTDSL-GLSGFLANSLDAF  458



>ref|XP_003532854.1| PREDICTED: TSL-kinase interacting protein 1-like isoform X1 [Glycine 
max]
 ref|XP_006585316.1| PREDICTED: TSL-kinase interacting protein 1-like isoform X2 [Glycine 
max]
Length=468

 Score =   179 bits (455),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 156/452 (35%), Positives = 214/452 (47%), Gaps = 46/452 (10%)
 Frame = +1

Query  1138  TDKEDGHFQ-DSNVRNVFEHSGKDPHVFPDLLHNSFNETNLQNSGKLKLQLFPVDDGTRR  1314
             TDKE+ +F    ++R   E   K   +         +   +  S K+KLQLFP+++GTR 
Sbjct  49    TDKENQYFPFKEHMRKCPELPNKCTFLTEKREAIELHPGQMLTSAKIKLQLFPINEGTRI  108

Query  1315  ALELDNHNPYLELTLSTRKKMSSVLEHLNRKWGNSSMACGDLMLFPYHLHKENLVHFQKW  1494
              LE D HNPYLELTL  RKK+ S+L+HL +KWG+SS+A G+LMLFPY++  ENL   ++W
Sbjct  109   GLEKDGHNPYLELTLRGRKKICSILKHLGKKWGSSSIAKGELMLFPYNIM-ENLSGCRRW  167

Query  1495  T-KDTTLTAADVYALTGSPPVFRLRYGWFSNAEVAFRAPVSSAIPSRHDANMNIMPESSV  1671
             T  D+  TA+ VY   GSP +FRL+YGWF   E       S+  P + D           
Sbjct  168   TINDSDTTASAVYTAVGSPALFRLKYGWFYMLEPGSFGIPSTPTPDKPDV----------  217

Query  1672  GVLQAPSTDPPKEANGCVSMNTVNASRSSDHTEAVLWENPETV---VTEAEVDDL----Q  1830
                 A S +   E   C   + V  S+    TE V     ETV   V  A VD +    +
Sbjct  218   ----AGSGNANLEETLCGERDKVRISKEYKATE-VGNAASETVSQKVENATVDPMDNEPR  272

Query  1831  FNKAGTSCVGEWADSLTNISVGDLLSEAPDMEDANCITSSIHSSSNYIHQIPFSCDSFDA  2010
              + +       W DSL+NIS+G LLSE      A+        S   I     + DS DA
Sbjct  273   ISSSLQQPSSPWIDSLSNISIGGLLSE------ASLFGGLDPKSFAGIQPCDITSDSLDA  326

Query  2011  AIAAHIKKHQNVTDSQAALPSQ--LSSIWGAEDTCDAFAFQRHSLSEKVQNASKHTSLET  2184
              IAA    ++ V      LP+    +SI  AE+TC AF  ++ S    VQ A        
Sbjct  327   FIAAAQINNRPV----PRLPADDLRTSILDAEETCHAFPLRKLSSPTDVQAACGKDYSAV  382

Query  2185  CKQITLANTTALGAS--VEDLPGA-RNPVDGDAATADLESVHYSPTSDVVKDFNGLSDVY  2355
               Q   +N      +  V D  GA +NP  G   T  L S    P  D      GL+ + 
Sbjct  383   RSQDVSSNLLKFSNADKVNDQDGASQNPPSGKTQTDLLLSSR--PYDD--DRSLGLTGIN  438

Query  2356  WPDSLGPLDLDIPSSRYHSELILSDSLGGLTQ  2451
             W DS+GP DL +P+ + +    L  S+GG  +
Sbjct  439   WNDSMGPFDLGMPAQKLNGGDSL--SIGGFVK  468



>gb|EAZ04820.1| hypothetical protein OsI_26998 [Oryza sativa Indica Group]
Length=388

 Score =   176 bits (447),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 141/434 (32%), Positives = 200/434 (46%), Gaps = 79/434 (18%)
 Frame = +1

Query  1240  FNETNLQNSGKLKLQLFPVDDGTRRALELDNHNPYLELTLSTRKKMSSVLEHLNRKWGNS  1419
             F+     +SGK+KL+LFP+D   ++ L+ +N NPYLELTL+ RKK+SSV++HLN KWGNS
Sbjct  19    FSNRQPNHSGKIKLELFPIDKAIQKVLQQENRNPYLELTLAPRKKISSVVQHLNIKWGNS  78

Query  1420  SMACGDLMLFPYHLHKENLVHFQKWTKDTTLTAADVYALTGSPPVFRLRYGWFSNAEVAF  1599
               A G+LMLFPY    +N+    KWT   + TAADV+A  GSP  FRLRYGWF   E  F
Sbjct  79    QCARGELMLFPYDAQLDNIAGSGKWTHSDSCTAADVHAAVGSPLRFRLRYGWF---EPDF  135

Query  1600  RAPVSSAIPSRHDANMNIMPESSVGVLQAPSTDPPKEANGCVSMNTVNASRSSDHTEAVL  1779
                        H+ N+                           +++V+    +   + VL
Sbjct  136   EQ-------QSHEPNLQ-------------------------DVHSVDKIIDNKPLDPVL  163

Query  1780  WENPETVVTEAEVDDLQFNKAGTSCVG-----------EWADSLTNISVGDLLSEAPDME  1926
              E  +T+      +D      G + V             W D ++NIS  +LLSEA    
Sbjct  164   MEQKQTIHLSEFPNDFAAQSVGDNAVQTVGNQSKVTPLSWIDCISNISFEELLSEAAPSA  223

Query  1927  DANCITSSIHSSSNYIHQIPFSCDSFDAAIAAHIKKHQNVTDSQAALPSQLSSIWGAEDT  2106
             D   + S  ++S     QIP + DSFDAAIA+ I + Q     + + P    S+W AE+ 
Sbjct  224   DNKQLLSQNNTS---FSQIPINFDSFDAAIASVIGQQQASNQMKVSNP----SLWDAEEA  276

Query  2107  CDAFAFQRHSLSEKVQNASKHTSLETCKQITLANTTALGASVEDLPGARNPVDGDAATA-  2283
             C AF  Q  +      +   H+   T        ++ LG     +P     VD    T  
Sbjct  277   CHAFPLQSQTSIRTFGSGPNHSGAIT--------SSILGT----IPECVTDVDQQCFTEV  324

Query  2284  -DLESVHYSPTS--DVVKDFNGLSDVYWPDSLGPLDLDIPSSRYHSELILSDSLGGLTQL  2454
              + E   + P S  D V  +  L +   P+ LG          Y S L+      GL+ L
Sbjct  325   WEEEPSPHIPLSCKDNVAPYISLPEFGEPE-LG---------AYCSRLLSGTDSLGLSGL  374

Query  2455  IASSLDAFQNCSFF  2496
             +++SLDAFQ  S F
Sbjct  375   LSNSLDAFQKFSVF  388



>ref|XP_010096476.1| hypothetical protein L484_006723 [Morus notabilis]
 gb|EXB64486.1| hypothetical protein L484_006723 [Morus notabilis]
Length=494

 Score =   178 bits (452),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 148/413 (36%), Positives = 203/413 (49%), Gaps = 47/413 (11%)
 Frame = +1

Query  1270  KLKLQLFPVDDGTRRALELDNHNPYLELTLSTRKKMSSVLEHLNRKWGNSSMACGDLMLF  1449
             K+KLQLFP+D+GTR  LE D H+PYLELTL  +KK+SSVL+ +N KWG+S +A G+ MLF
Sbjct  85    KIKLQLFPIDEGTRIGLEKDGHHPYLELTLRAKKKISSVLKRVNSKWGSSKVALGEPMLF  144

Query  1450  PYHLHKENLVHFQKWT-KDTTLTAADVYALTGSPPVFRLRYGWFSNAEV-AFRAPVSSAI  1623
             PY +H + +   + WT KD+ ++A DVYA  GSP  FRLRYGWFSN+E   F  P +++ 
Sbjct  145   PYDIHGD-ISGCRSWTMKDSDISARDVYASIGSPATFRLRYGWFSNSEPKTFEEPSTTST  203

Query  1624  P---------SRHDAN----------MNIMPESSVGVLQ--APSTDPPKEANGCVS----  1728
                       ++ D N          M I+      ++   A  TD        V+    
Sbjct  204   SCNICLQSGDAKKDCNCDMKKGDNEEMQIVTCEEFKLINDDALRTDSQPGQPQPVAHWLD  263

Query  1729  --MNTVNASRSSDHTEAVLWENPETVVTE----AEVDDLQFNKAGTSCVGEWADSLTNIS  1890
                NT   +  SD +    + + E   TE     + D + FN   +  +  WAD LTNIS
Sbjct  264   DLTNTSIGAFLSDASLQAKFNSCEPKSTENGTCLQPDQINFN---SKLLASWADCLTNIS  320

Query  1891  VGDLLSEAPDMEDANCITSSIHSSSNYIHQIPFSCDSFDAAIAAHIKKHQNVTDSQAALP  2070
             +G LLSE       N    S  S+++ +   P   DS DA  +A     Q        LP
Sbjct  321   IGGLLSEVSLQGKFNNGAKSAGSNAD-LQSTPIISDSLDAFFSAQTGCPQG-----PKLP  374

Query  2071  SQL--SSIWGAEDTCDAFAFQRHSLSEKVQNASKHTSLETCKQITLANTTALGASVEDLP  2244
             + +  SSI  AE+TC AF  QR S S K  +A   +S   C Q   +  +    + E   
Sbjct  375   THMSHSSILDAEETCHAFPVQRLSSSGKRVSAISGSS-GGCSQDAGSKPSRSPKTDEIDS  433

Query  2245  GARNPVDGDAATADLESVHYSPTSDVVKDFNGLSDVYWPDSLGPLDLDIPSSR  2403
              AR   D     A  + V  S T +      GL  + W DSLGP DL +P+SR
Sbjct  434   QARVLEDQACQEAQTDLVLASRTCNDESSL-GLLGIKWNDSLGPFDLGLPASR  485



>ref|XP_002455055.1| hypothetical protein SORBIDRAFT_03g003670 [Sorghum bicolor]
 gb|EES00175.1| hypothetical protein SORBIDRAFT_03g003670 [Sorghum bicolor]
Length=448

 Score =   177 bits (450),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 113/302 (37%), Positives = 159/302 (53%), Gaps = 52/302 (17%)
 Frame = +1

Query  1264  SGKLKLQLFPVDDGTRRALELDNHNPYLELTLSTRKKMSSVLEHLNRKWGNSSMACGDLM  1443
             SGK+KLQLFP+D+  +  ++ + HNPYLELTL+ RKKMSS+++HLN KWG+S  A G+LM
Sbjct  87    SGKIKLQLFPIDETIQEIMQQEKHNPYLELTLAPRKKMSSIVQHLNTKWGSSQCAKGELM  146

Query  1444  LFPYHLHKENLVHFQKWTKDTTLTAADVYALTGSPPVFRLRYGWFSN--AEVAFRAPVSS  1617
             LFP     + +    +WT + + TAADV+   GSP  FRLRYGWF +   + +    +++
Sbjct  147   LFPNDTRLDTICGSARWTLEDSCTAADVHVTVGSPSTFRLRYGWFGSDLKQQSSEPSLAT  206

Query  1618  AIPSRHDANMNIMPESSVGVLQAPSTDPPKEANGCVSMNTVNASRSSDHTEAVLWENPET  1797
             A P+          + S+G      + PP                  +H  A   E P  
Sbjct  207   AHPT----------DKSIG------SKPPDLV-------------FDEHKLAGSGEFPNN  237

Query  1798  VVTEAEVDDLQFNKAGTSCVGE---------WADSLTNISVGDLLSEAPDMEDANCITSS  1950
              VT         NK  TS V +         W DS++NI  G LLSEA   +D+    S 
Sbjct  238   FVTPTVA-----NKTNTSQVVDNPSKVAPLSWLDSISNIRYGALLSEAAPSQDSKQPPS-  291

Query  1951  IHSSSNYIHQIPFSCDSFDAAIAAHIKKHQNVTDSQAALPSQLSSIWGAEDTCDAFAFQR  2130
                ++  + QIP +CDSFDAAIA+ I + Q  +  +   P    S+W AE+TC AFAFQ 
Sbjct  292   --QNNTCLQQIPVTCDSFDAAIASLIARQQPSSQPKVLNP----SLWEAEETCHAFAFQN  345

Query  2131  HS  2136
              +
Sbjct  346   QT  347



>ref|NP_001145214.1| uncharacterized protein LOC100278472 [Zea mays]
 gb|ACG45844.1| hypothetical protein [Zea mays]
Length=447

 Score =   177 bits (448),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 141/411 (34%), Positives = 193/411 (47%), Gaps = 46/411 (11%)
 Frame = +1

Query  1264  SGKLKLQLFPVDDGTRRALELDNHNPYLELTLSTRKKMSSVLEHLNRKWGNSSMACGDLM  1443
             SGK+KLQLFP+ +  +  ++ + HNPYLELTL+ RKKMSS+L HLN KWG+S  A G+LM
Sbjct  83    SGKIKLQLFPLYETIQEIMQQEKHNPYLELTLAPRKKMSSILHHLNTKWGSSQCAKGELM  142

Query  1444  LFPYHLHKENLVHFQKWTKDTTLTAADVYALTGSPPVFRLRYGWFSNAEVAFRAPVSSAI  1623
             LFP     + +    KWT   + TAADV+   G P  FRLRYGWF        +  S A 
Sbjct  143   LFPNDTRLDTIGGSAKWTLKDSCTAADVHVAVGCPSTFRLRYGWFGPDLNQQSSEPSLAS  202

Query  1624  PSRHDANMNIMPESSVGVLQAPSTDPPKEANGCVSMNTVNASRSSDHTEAVLWENPETVV  1803
                 D  +   P   V   Q       + AN  V+ + V+   +S      + ENP  V 
Sbjct  203   AYSEDKIIGSRPPDLVFNEQKHMAGSDEFANHFVTPSIVDKINTSQ-----MAENPSKVA  257

Query  1804  TEAEVDDLQFNKAGTSCVGEWADSLTNISVGDLLSEAPDMEDANCITSSIHSSSNYIHQI  1983
               +                 W DS++NIS G LLSEA   +D     S    +S  + QI
Sbjct  258   QLS-----------------WLDSISNISFGALLSEAAPSQDTKQPPS---QNSICLQQI  297

Query  1984  PFSCDSFDAAIAAHIKKHQNVTDSQAALPSQLSSIWGAEDTCDAFAFQRHSLSEKVQNAS  2163
             P +CDSFDAAIA+ I + Q     +   P    S+W AE+TC AF F         QN +
Sbjct  298   PATCDSFDAAIASLIARQQPSNQPKVLNP----SLWEAEETCHAFPF---------QNQT  344

Query  2164  KHTSLETCKQITLANTTALGASVEDLPGARNPVDGDAATADLESVHYSPTSDVVKDFNGL  2343
              H S         A T+++  ++ +        D   AT   +    S TS      N  
Sbjct  345   PHASSSVPGNSFAAMTSSVLCAIPET----GTDDQQCATDGRKEELNSQTSVEGDGINAK  400

Query  2344  SDVYWPDSLGPLDLDIPSSRYHSELILSDSLGGLTQLIASSLDAFQNCSFF  2496
              ++   +S G  + +    R    L  +DS+ GL+ L+  SLDAFQ  S F
Sbjct  401   PEISMQESAGDPEREASCPRL---LGGTDSI-GLSSLLTDSLDAFQKFSVF  447



>gb|KHG25426.1| TSL-kinase interacting 1 -like protein [Gossypium arboreum]
Length=331

 Score =   173 bits (439),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 123/324 (38%), Positives = 164/324 (51%), Gaps = 59/324 (18%)
 Frame = +1

Query  1246  ETNLQNSGKLKLQLFPVDDGTRRALELDNHNPYLELTLSTRKKMSSVLEHLNRKWGNSSM  1425
             E  L  S K+KLQLFP+D+ TR  LE D  +PYLELTLS RKK+SSVL+HL  KWG+SS+
Sbjct  4     EERLHPSTKIKLQLFPIDESTRLGLEKDGFHPYLELTLSARKKISSVLKHLGSKWGSSSI  63

Query  1426  ACGDLMLFPYHLHKENLVHFQKWTK-DTTLTAADVYALTGSPPVFRLRYGWF--SNAEVA  1596
             A G+ MLFPY    E L  + +WT+ D  ++A+DVYA  GSP VFRLRYGW   SN E  
Sbjct  64    AVGEPMLFPY--VAECLTGY-RWTRNDICISASDVYAAIGSPAVFRLRYGWMSDSNLETK  120

Query  1597  FRAPVSSAIPSRHDANMNIMPESSVGVLQAPSTDPPKEANGCVSMNTVNASRSSDHTEAV  1776
                  S + P +  + +  + +S    +Q                   NA  + +  E  
Sbjct  121   TLGQPSVSAPFKASSKLEDVQKSCHTYMQ-------------------NAYVNGEKAEVT  161

Query  1777  LWENPETVVTEAEVDDLQFNKAGTSCVGE-----------------WADSLTNISVGDLL  1905
               E+ + ++T  E +     KA    VG                  WADSLTNIS+G LL
Sbjct  162   GEESGKPIITSGETNVAVSEKASNGGVGSMENEVTMDGSIEQSLAMWADSLTNISIGGLL  221

Query  1906  SEAPDM-------EDANCITSSIHSSSNYIHQIPFSCDSFDAAIAAHIKKHQNVTDSQAA  2064
             SEA          + +N I+S + SS           DSFDA IA  +   +++   +  
Sbjct  222   SEASLQGRFGNCDKKSNGISSGLQSSQ-------LISDSFDAFIAGQMNPSRSL---RPP  271

Query  2065  LPSQLSSIWGAEDTCDAFAFQRHS  2136
             L    SSI  A+DTC AF FQ+ S
Sbjct  272   LQDSHSSILDADDTCHAFPFQKFS  295



>tpg|DAA53147.1| TPA: hypothetical protein ZEAMMB73_791365 [Zea mays]
Length=447

 Score =   176 bits (445),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 141/411 (34%), Positives = 194/411 (47%), Gaps = 46/411 (11%)
 Frame = +1

Query  1264  SGKLKLQLFPVDDGTRRALELDNHNPYLELTLSTRKKMSSVLEHLNRKWGNSSMACGDLM  1443
             SGK+KLQLFP+ +  +  ++ + HNPYLELTL+ RKKMSS+L+HLN KWG+S  A G+LM
Sbjct  83    SGKIKLQLFPLYETIQEIMQQEKHNPYLELTLAPRKKMSSILQHLNTKWGSSQCAKGELM  142

Query  1444  LFPYHLHKENLVHFQKWTKDTTLTAADVYALTGSPPVFRLRYGWFSNAEVAFRAPVSSAI  1623
             LFP     + +    KWT   + TAADV+   G P  FRLRYGWF        +  S A 
Sbjct  143   LFPNDTRLDTIGGSAKWTLKDSCTAADVHVAVGYPSTFRLRYGWFGPDLNQQSSEPSLAS  202

Query  1624  PSRHDANMNIMPESSVGVLQAPSTDPPKEANGCVSMNTVNASRSSDHTEAVLWENPETVV  1803
                 D  +   P   V   Q       + AN  V+ + V+   +S      + ENP  V 
Sbjct  203   AYSADKIIGSRPPDLVFNEQKHMAGSDEFANHFVTPSIVDEINTSQ-----MAENPSKVA  257

Query  1804  TEAEVDDLQFNKAGTSCVGEWADSLTNISVGDLLSEAPDMEDANCITSSIHSSSNYIHQI  1983
               +                 W DS++NIS G LLSEA   +D     S    +S  + QI
Sbjct  258   QLS-----------------WLDSISNISFGALLSEAAPSQDTKQPPS---QNSICLQQI  297

Query  1984  PFSCDSFDAAIAAHIKKHQNVTDSQAALPSQLSSIWGAEDTCDAFAFQRHSLSEKVQNAS  2163
             P +CDSFDAAIA+ I + Q     +   P    S+W AE+TC AF F         QN +
Sbjct  298   PPTCDSFDAAIASLIARQQPSNQPKVLNP----SLWEAEETCHAFPF---------QNQT  344

Query  2164  KHTSLETCKQITLANTTALGASVEDLPGARNPVDGDAATADLESVHYSPTSDVVKDFNGL  2343
              H S         A T+++  ++ +        D   AT   +    S TS      N  
Sbjct  345   PHASSSVPGNSFAAMTSSVLCAIPET----GTDDQQCATDGRKEELNSQTSVEGDGINAK  400

Query  2344  SDVYWPDSLGPLDLDIPSSRYHSELILSDSLGGLTQLIASSLDAFQNCSFF  2496
              ++   +S G  + +    R    L  +DS+ GL+ L+  SLDAFQ  S F
Sbjct  401   PEISMQESAGDPEREASCPRL---LGGTDSI-GLSSLLTDSLDAFQKFSVF  447



>ref|XP_006427927.1| hypothetical protein CICLE_v10025563mg [Citrus clementina]
 ref|XP_006464527.1| PREDICTED: TSL-kinase interacting protein 1-like isoform X5 [Citrus 
sinensis]
 gb|ESR41167.1| hypothetical protein CICLE_v10025563mg [Citrus clementina]
Length=417

 Score =   174 bits (442),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 144/402 (36%), Positives = 196/402 (49%), Gaps = 64/402 (16%)
 Frame = +1

Query  1270  KLKLQLFPVDDGTRRALELDNHNPYLELTLSTRKKMSSVLEHLNRKWGNSSMACGDLMLF  1449
             K+KLQLFP+D+ TR  LE D  +PYLELTLSTRKK+SSVL+HL  KWG+SS+A G+ M F
Sbjct  51    KIKLQLFPIDEKTRMGLEKDGFHPYLELTLSTRKKISSVLKHLKSKWGSSSIALGEPMFF  110

Query  1450  PYHLHKENLVHFQKWT-KDTTLTAADVYALTGSPPVFRLRYGWFSNAEVAFRAPVSSAIP  1626
             PY+   ENL  + +WT  D  ++A DVYA  G+P VFRLRYGW SN +       +  +P
Sbjct  111   PYNTL-ENLASY-RWTMNDNDISAGDVYAAIGNPTVFRLRYGWSSNLKTE-----TGGVP  163

Query  1627  SRHDANMNIMPESSVGVLQAPSTDPPKEANGCVSMNTVNASRS-------SDHTEAVLWE  1785
             S   +    +       LQ   +   +  NG V    ++A+R        S  T   L  
Sbjct  164   STTTSLEGCLKAQG---LQRSCSTNVENTNGIVKQ--IDATRGELKPFIESGSTNTGL--  216

Query  1786  NPETVVTEAEVDDLQFNKAGTSCVGE----WADSLTNISVGDLLSEAPDMEDANCITSSI  1953
               E +  +  V     +      +G+    W D LTNIS+G LLSEA      N   S +
Sbjct  217   -AEKMSFDRPVGPRDNDVRTDGSIGQPSLLWDDMLTNISIGGLLSEASLQGKFN---SEM  272

Query  1954  HSSSNYIHQIP--FSCDSFDAAIAAHIKKHQNVTDSQAALPSQLSSIWGAEDTCDAFAFQ  2127
              S+ +     P     DSFDA +AA +    +    Q A     SSI  AEDTC AFAFQ
Sbjct  273   KSNGSNADSQPSQLISDSFDAFLAAQM---NHPQGPQPAPQQPRSSILDAEDTCHAFAFQ  329

Query  2128  RHSLSEKVQNASKHTSLETCKQITLANTTALGASVEDLPGARNPVDGDAATADLESVHYS  2307
             + S S K                   +T  LG ++    GA      +   + L+  + S
Sbjct  330   KFSSSGK-------------------DTLGLGGNISCSQGAEAEKFKENIQSGLQQSNTS  370

Query  2308  PTSD--------VVKDFN--GLSDVYWPDSLGPLDLDIPSSR  2403
               S+        ++ D +  GLSD+ W DS+G  DL + SSR
Sbjct  371   KKSETDLLLFSRLLNDESSLGLSDIKWTDSMGTFDLGLSSSR  412



>ref|XP_004503992.1| PREDICTED: TSL-kinase interacting protein 1-like isoform X1 [Cicer 
arietinum]
 ref|XP_004503993.1| PREDICTED: TSL-kinase interacting protein 1-like isoform X2 [Cicer 
arietinum]
 ref|XP_004503994.1| PREDICTED: TSL-kinase interacting protein 1-like isoform X3 [Cicer 
arietinum]
Length=472

 Score =   175 bits (443),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 158/452 (35%), Positives = 216/452 (48%), Gaps = 45/452 (10%)
 Frame = +1

Query  1126  ERTTTDKEDGHFQ-DSNVRNVFEHSGKDPHVFP-----DLLHNSFNETNLQNSGKLKLQL  1287
             E   TDKE+ HF     VR   EH  +D  +       +L H       L +S K+KLQL
Sbjct  46    EELLTDKENQHFLFKEPVRLCPEHPREDTFLMKMREALELEHRPGQ--TLISSAKIKLQL  103

Query  1288  FPVDDGTRRALELDNHNPYLELTLSTRKKMSSVLEHLNRKWGNSSMACGDLMLFPYHLHK  1467
             FPV++  R  LE D HNPYLELTLS +KK+SSVL HL  KWG+SS+A G+ +LFPY    
Sbjct  104   FPVNEEIRTGLEKDGHNPYLELTLSGKKKISSVLRHLETKWGSSSIAKGEPLLFPYS-RM  162

Query  1468  ENLVHFQKWT-KDTTLTAADVYALTGSPPVFRLRYGWFSNAEVAFRAPVSSAIPSRHDAN  1644
              NL   ++WT  D   TAA VY   GSP  FRL+YGWFS  E     P  S++P  +++ 
Sbjct  163   GNLSDCKRWTINDIETTAAAVYTAVGSPATFRLKYGWFSIHEPT--PPGLSSLPIPYESG  220

Query  1645  MNIMPESSVGVLQAPSTDPPK---EANGCVSMNTVNASRSSDHTEAVLWENPETVVTEAE  1815
             +      S G  +  + D      E +   +     A+ S + T  ++ +     +  A 
Sbjct  221   VQ-----SGGKDRGCNNDVESLFDERDKIEATAEYKATCSDNVTSKIVAQK----MDNAP  271

Query  1816  VDDLQFNKAGTSCVGE--WADSLTNISVGDLLSEAPDMEDANCITSSIHSSSNYIHQIPF  1989
              D L  NK   SC  +  W DSL NIS+G  LSE   +   +   S +  S+  I     
Sbjct  272   ADPLD-NKLKQSCSLQQPWIDSLDNISIGGFLSEVSLLGKFD---SKLFGSNATIQTSHL  327

Query  1990  SCDSFDAAIAAHIKKHQNVTDSQAALPSQLSSIWGAEDTCDAFAFQRHSLSEKVQNASKH  2169
               DS DA I + I +    T S  AL    +SI  AE+TC AF  Q+ S    VQ AS  
Sbjct  328   ISDSLDAFITSRISQPPVSTPSAEAL---RTSILDAEETCHAFPLQKLSSRADVQTASGT  384

Query  2170  TSLETCKQITLANTTALGAS--VEDLPGARNPVDGDAATADLESVHYSPTSDVVKDFNGL  2343
              +   C Q    N+  L  +  V D  G       +    DL  +  S   D  +   GL
Sbjct  385   VA---CSQDVSPNSLKLPCTEKVNDPDGLSQSTPSEKTQTDL--LLSSRLYDDERSL-GL  438

Query  2344  SDVYWPDSLGPLDLDIPSSRYHSELILSDSLG  2439
             + + W DS+GP DL + + ++    I  DS+G
Sbjct  439   TGISWNDSMGPFDLGMLAKKH----IGGDSVG  466



>ref|XP_006427928.1| hypothetical protein CICLE_v10025563mg [Citrus clementina]
 ref|XP_006464523.1| PREDICTED: TSL-kinase interacting protein 1-like isoform X1 [Citrus 
sinensis]
 ref|XP_006464524.1| PREDICTED: TSL-kinase interacting protein 1-like isoform X2 [Citrus 
sinensis]
 ref|XP_006464525.1| PREDICTED: TSL-kinase interacting protein 1-like isoform X3 [Citrus 
sinensis]
 ref|XP_006464526.1| PREDICTED: TSL-kinase interacting protein 1-like isoform X4 [Citrus 
sinensis]
 gb|ESR41168.1| hypothetical protein CICLE_v10025563mg [Citrus clementina]
Length=462

 Score =   173 bits (439),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 142/401 (35%), Positives = 194/401 (48%), Gaps = 62/401 (15%)
 Frame = +1

Query  1270  KLKLQLFPVDDGTRRALELDNHNPYLELTLSTRKKMSSVLEHLNRKWGNSSMACGDLMLF  1449
             K+KLQLFP+D+ TR  LE D  +PYLELTLSTRKK+SSVL+HL  KWG+SS+A G+ M F
Sbjct  96    KIKLQLFPIDEKTRMGLEKDGFHPYLELTLSTRKKISSVLKHLKSKWGSSSIALGEPMFF  155

Query  1450  PYHLHKENLVHFQKWTKDTTLTAADVYALTGSPPVFRLRYGWFSNAEVAFRAPVSSAIPS  1629
             PY+   ENL  ++    D  ++A DVYA  G+P VFRLRYGW SN +       +  +PS
Sbjct  156   PYNTL-ENLASYRWTMNDNDISAGDVYAAIGNPTVFRLRYGWSSNLKTE-----TGGVPS  209

Query  1630  RHDANMNIMPESSVGVLQAPSTDPPKEANGCVSMNTVNASRS-------SDHTEAVLWEN  1788
                +    +       LQ   +   +  NG V    ++A+R        S  T   L   
Sbjct  210   TTTSLEGCLKAQG---LQRSCSTNVENTNGIVKQ--IDATRGELKPFIESGSTNTGL---  261

Query  1789  PETVVTEAEVDDLQFNKAGTSCVGE----WADSLTNISVGDLLSEAPDMEDANCITSSIH  1956
              E +  +  V     +      +G+    W D LTNIS+G LLSEA      N   S + 
Sbjct  262   AEKMSFDRPVGPRDNDVRTDGSIGQPSLLWDDMLTNISIGGLLSEASLQGKFN---SEMK  318

Query  1957  SSSNYIHQIP--FSCDSFDAAIAAHIKKHQNVTDSQAALPSQLSSIWGAEDTCDAFAFQR  2130
             S+ +     P     DSFDA +AA +    +    Q A     SSI  AEDTC AFAFQ+
Sbjct  319   SNGSNADSQPSQLISDSFDAFLAAQM---NHPQGPQPAPQQPRSSILDAEDTCHAFAFQK  375

Query  2131  HSLSEKVQNASKHTSLETCKQITLANTTALGASVEDLPGARNPVDGDAATADLESVHYSP  2310
              S S K                   +T  LG ++    GA      +   + L+  + S 
Sbjct  376   FSSSGK-------------------DTLGLGGNISCSQGAEAEKFKENIQSGLQQSNTSK  416

Query  2311  TSD--------VVKDFN--GLSDVYWPDSLGPLDLDIPSSR  2403
              S+        ++ D +  GLSD+ W DS+G  DL + SSR
Sbjct  417   KSETDLLLFSRLLNDESSLGLSDIKWTDSMGTFDLGLSSSR  457



>gb|EMS50457.1| hypothetical protein TRIUR3_05392 [Triticum urartu]
Length=467

 Score =   173 bits (438),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 124/329 (38%), Positives = 169/329 (51%), Gaps = 55/329 (17%)
 Frame = +1

Query  1264  SGKLKLQLFPVDDGTRRALELDNHNPYLELTLSTRKKMSSVLEHLNRKWGNSSMACGDLM  1443
             SGK+KLQ FP+D+  +  L+ + HNPYLELTL+ RKKMSS+++HLN KWG SS A GDLM
Sbjct  135   SGKMKLQFFPIDEAIQNVLQQEKHNPYLELTLAPRKKMSSIVQHLNTKWGRSSCAKGDLM  194

Query  1444  LFPYHLHKENLVHFQKWTKDTTLTAADVYALTGSPPVFRLRYGWF-----SNAEVAFRAP  1608
             LFPY    +++   +KWT + + TAADVY   GSP  FRLRYGWF          A  AP
Sbjct  195   LFPYSARPDSIASSKKWTLNDSCTAADVYVAVGSPSTFRLRYGWFKPNLKQQISEAPLAP  254

Query  1609  VSSAIPSRHDANMNIMPESSVGVLQAPSTDPPKEANGCVSMNTVNASRSSDHTEAVLWEN  1788
             V SA  +  D   +    +S            K A+  V  N          TE  + +N
Sbjct  255   VLSAEKTLGDKPSHHFEFAS------------KFASPSVECN----------TEKTMVDN  292

Query  1789  PETVVTEAEVDDLQFNKAGTSCVGEWADSLTNISVGDLLSEAPDMEDANCITSSIHSSSN  1968
              ++ VT                   W DS++NIS G LLS+A   +D+        +SS 
Sbjct  293   NQSKVTPL----------------SWIDSISNISFGALLSQAVPSQDSK-QPPLQQNSSI  335

Query  1969  YIHQIPFSCDSFDAAIAAHIKKHQNVTDSQAALPSQLSSIWGAEDTCDAFAFQRHSLSEK  2148
                QIP +CDSFDAAIA+ I + Q     + + P    S+W A++TC AF   R+     
Sbjct  336   IQQQIPATCDSFDAAIASLIARQQTSNQPKVSNP----SLWDADETCHAFPPPRN-----  386

Query  2149  VQNASKHTSLETCKQITLANTTALGASVE  2235
              QN ++ ++        + +TT LGA  E
Sbjct  387   -QNLARMSACGPGNNSAITSTT-LGAIAE  413



>ref|XP_008672649.1| PREDICTED: uncharacterized protein LOC100278472 isoform X1 [Zea 
mays]
 gb|ACR35225.1| unknown [Zea mays]
 tpg|DAA53148.1| TPA: hypothetical protein ZEAMMB73_791365 [Zea mays]
Length=446

 Score =   172 bits (436),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 141/411 (34%), Positives = 194/411 (47%), Gaps = 47/411 (11%)
 Frame = +1

Query  1264  SGKLKLQLFPVDDGTRRALELDNHNPYLELTLSTRKKMSSVLEHLNRKWGNSSMACGDLM  1443
             SGK+KLQLFP+ +  +  ++ + HNPYLELTL+ RKKMSS+L+HLN KWG+S  A G+LM
Sbjct  83    SGKIKLQLFPLYETIQEIMQQEKHNPYLELTLAPRKKMSSILQHLNTKWGSSQCAKGELM  142

Query  1444  LFPYHLHKENLVHFQKWTKDTTLTAADVYALTGSPPVFRLRYGWFSNAEVAFRAPVSSAI  1623
             LFP     + +    KWT   + TAADV+   G P  FRLRYGWF        +  S A 
Sbjct  143   LFPNDTRLDTIGGSAKWTLKDSCTAADVHVAVGYPSTFRLRYGWFGPDLNQQSSEPSLAS  202

Query  1624  PSRHDANMNIMPESSVGVLQAPSTDPPKEANGCVSMNTVNASRSSDHTEAVLWENPETVV  1803
                 D  +   P   V   Q       + AN  V+ + V+   +S      + ENP  V 
Sbjct  203   AYSADKIIGSRPPDLVFNEQKHMAGSDEFANHFVTPSIVDEINTSQ-----MAENPSKVA  257

Query  1804  TEAEVDDLQFNKAGTSCVGEWADSLTNISVGDLLSEAPDMEDANCITSSIHSSSNYIHQI  1983
               +                 W DS++NIS G LLSEA   +D     S    +S  + QI
Sbjct  258   QLS-----------------WLDSISNISFGALLSEAAPSQDTKQPPS---QNSICLQQI  297

Query  1984  PFSCDSFDAAIAAHIKKHQNVTDSQAALPSQLSSIWGAEDTCDAFAFQRHSLSEKVQNAS  2163
             P +CDSFDAAIA+ I + Q     +   P    S+W AE+TC AF F         QN +
Sbjct  298   PPTCDSFDAAIASLIARQQPSNQPKVLNP----SLWEAEETCHAFPF---------QNQT  344

Query  2164  KHTSLETCKQITLANTTALGASVEDLPGARNPVDGDAATADLESVHYSPTSDVVKDFNGL  2343
              H S         A T+++  ++ +        D   AT   +    S TS      N  
Sbjct  345   PHASSSVPGNSFAAMTSSVLCAIPET----GTDDQQCATDGRKEELNSQTSVEGDGINAK  400

Query  2344  SDVYWPDSLGPLDLDIPSSRYHSELILSDSLGGLTQLIASSLDAFQNCSFF  2496
              ++   +S G  + +    R    L  +DS+ GL+ L+  SLDAFQ  S F
Sbjct  401   PEISM-ESAGDPEREASCPRL---LGGTDSI-GLSSLLTDSLDAFQKFSVF  446



>gb|AFK47950.1| unknown [Lotus japonicus]
Length=474

 Score =   172 bits (437),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 156/468 (33%), Positives = 217/468 (46%), Gaps = 45/468 (10%)
 Frame = +1

Query  1102  VADAAEHLERTTTDKEDGHFQ-DSNVRNVFEHSGKDPHVFPDLLHNSFN---ETNLQNSG  1269
             V+ A  + E   TDKE+ +F     V    E   KD  +        F+      L +  
Sbjct  34    VSKARGYGEELLTDKENQNFSFKEPVGMCGELHKKDKFIMEKREAIEFDLHPNQALNSCA  93

Query  1270  KLKLQLFPVDDGTRRALELDNHNPYLELTLSTRKKMSSVLEHLNRKWGNSSMACGDLMLF  1449
             K+KLQLFP+++GTR  LE D HNPYLELTL  RKK+SSVL+H+ +KWG+SS   G+ MLF
Sbjct  94    KIKLQLFPINEGTRIGLEKDGHNPYLELTLRGRKKISSVLQHIEKKWGSSSTNKGEPMLF  153

Query  1450  PYHLHKENLVHFQKWTKDTTLTAADVYALTGSPPVFRLRYGWFSNAEVAFRAPVSSAIPS  1629
             PY+   ENL   +    D+  TA+ VYA  GSP +FRLRYGW    E       SS IP 
Sbjct  154   PYN-KMENLPDCRWTINDSDTTASAVYAAIGSPAIFRLRYGWCCTYEPRSFGIPSSPIPH  212

Query  1630  RHDANMNIMPESSVGVLQAPSTDPPKE---ANGCVSMNTVNA-----SRSSDHTEAVLWE  1785
             +   N           ++    +  K+   +  C +++  NA     ++  D+T A   +
Sbjct  213   KPGVNYGGTEGDCNSNMEISRREHDKDEATSEECKAIDMGNATSEIVTQKMDNTSADPLD  272

Query  1786  NPETVVTEAEVDDLQFNKAGTSCVGEWADSLTNISVGDLLSEAPDME--DANCITSSIHS  1959
             N   V +  E             +  W DSLTNIS+G LLSEA  M   D     S+  +
Sbjct  273   NEPRVCSSHE-----------QPLPPWMDSLTNISIGGLLSEASLMSGFDPKSFGSNAAT  321

Query  1960  SSNYIHQIPFSCDSFDAAIAAHIKKHQNVTDSQAALPSQLSSIWGAEDTCDAFAFQRHSL  2139
               + I       DS DA I A   +          L    +SI  AE+TC AF  ++ S 
Sbjct  322   QPSQIVS-----DSLDAFIFARSSRPPVSRPPAEVL---RTSILDAEETCHAFPLRKLSS  373

Query  2140  SEKVQNASKHTSLETCKQITLANTTALGAS--VEDLPG-ARNPVDGDAAT-ADLESVHYS  2307
             S  VQ AS       C Q   +N   L  S  V D     +NP+ G   T + L S  Y 
Sbjct  374   SADVQTASGKGFSVGCSQDVPSNLLKLLNSDKVNDQDSRPQNPLTGKTQTDSSLSSRLYD  433

Query  2308  PTSDVVKDFNGLSDVYWPDSLGPLDLDIPSSRYHSELILSDSLGGLTQ  2451
                 +     GL+ + W DS+GP DL + +++ +     S S+GG  +
Sbjct  434   DERSL-----GLTGIKWNDSMGPFDLGMAATKLNGG--DSASIGGFVK  474



>ref|XP_002970087.1| hypothetical protein SELMODRAFT_410828 [Selaginella moellendorffii]
 gb|EFJ29211.1| hypothetical protein SELMODRAFT_410828 [Selaginella moellendorffii]
Length=549

 Score =   171 bits (432),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 78/119 (66%), Positives = 96/119 (81%), Gaps = 2/119 (2%)
 Frame = +1

Query  427  QQPVK--RQTRKWAAWTREEEESFFSALRHVGKNFEKITSRVQSKNKDQVRHYYYRLVRR  600
            Q+PV+  ++TR+WAAWT EEEE FFSALR VGK+FEKITS+V SKNKDQVRHYYYRL++R
Sbjct  20   QEPVESGKRTRQWAAWTHEEEEKFFSALRQVGKDFEKITSQVVSKNKDQVRHYYYRLIKR  79

Query  601  MNKLLGPELCLNAKNSRDTNAAMLRWWSLLEKYSCKASKLHLKPRRFKIFIETLENQLL  777
            MNK L  +L ++A+NS+D ++AML WWSLLEK+ C +SKLHLKPRR K     LE   L
Sbjct  80   MNKFLRSDLLIDARNSKDVDSAMLCWWSLLEKFKCSSSKLHLKPRRLKAIATALEQHRL  138


 Score =   116 bits (291),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 54/106 (51%), Positives = 69/106 (65%), Gaps = 4/106 (4%)
 Frame = +1

Query  1270  KLKLQLFPVDDGTRRALELDNHNPYLELTLSTRKKMSSVLEHLNRKWGNSSMACGDLMLF  1449
             K+KLQLFP+DD T+ ALE + HNP+LELTL   K +SSVL+HL++KWG  S+A GD+ L+
Sbjct  241   KIKLQLFPIDDKTKTALEQEGHNPHLELTLKASKSISSVLQHLSQKWGRCSVATGDIRLY  300

Query  1450  PYHLHKENLVHFQKWTKDTTLTAADVYALTGSPPVFRLRYGWFSNA  1587
             P+     +      W     + AADVY   G P VFRLRYGW  N 
Sbjct  301   PFIRQPSS----TSWNSKDVVCAADVYDAVGRPSVFRLRYGWCQNV  342



>ref|XP_002985278.1| hypothetical protein SELMODRAFT_424296 [Selaginella moellendorffii]
 gb|EFJ13772.1| hypothetical protein SELMODRAFT_424296 [Selaginella moellendorffii]
Length=564

 Score =   170 bits (431),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 78/119 (66%), Positives = 96/119 (81%), Gaps = 2/119 (2%)
 Frame = +1

Query  427  QQPVK--RQTRKWAAWTREEEESFFSALRHVGKNFEKITSRVQSKNKDQVRHYYYRLVRR  600
            Q+PV+  ++TR+WAAWT EEEE FFSALR VGK+FEKITS+V SKNKDQVRHYYYRL++R
Sbjct  20   QEPVESGKRTRQWAAWTHEEEEKFFSALRQVGKDFEKITSQVVSKNKDQVRHYYYRLIKR  79

Query  601  MNKLLGPELCLNAKNSRDTNAAMLRWWSLLEKYSCKASKLHLKPRRFKIFIETLENQLL  777
            MNK L  +L ++A+NS+D ++AML WWSLLEK+ C +SKLHLKPRR K     LE   L
Sbjct  80   MNKFLRSDLLIDARNSKDVDSAMLCWWSLLEKFKCSSSKLHLKPRRLKAIATALEQHRL  138


 Score =   117 bits (293),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 54/106 (51%), Positives = 70/106 (66%), Gaps = 4/106 (4%)
 Frame = +1

Query  1270  KLKLQLFPVDDGTRRALELDNHNPYLELTLSTRKKMSSVLEHLNRKWGNSSMACGDLMLF  1449
             K+KLQLFP+DD T+ ALE + HNP+LELTL   K +SSVL+HL++KWG  S+A GD+ L+
Sbjct  230   KIKLQLFPIDDKTKTALEQEGHNPHLELTLKASKSISSVLQHLSQKWGRCSVATGDIRLY  289

Query  1450  PYHLHKENLVHFQKWTKDTTLTAADVYALTGSPPVFRLRYGWFSNA  1587
             P+     +      W     + AADVY + G P VFRLRYGW  N 
Sbjct  290   PFIRQPSS----TSWNSKDVVCAADVYDVVGRPSVFRLRYGWCQNV  331



>ref|XP_002275388.2| PREDICTED: TSL-kinase interacting protein 1 isoform X1 [Vitis 
vinifera]
 emb|CBI21543.3| unnamed protein product [Vitis vinifera]
Length=606

 Score =   170 bits (430),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 102/256 (40%), Positives = 144/256 (56%), Gaps = 9/256 (4%)
 Frame = +1

Query  1255  LQNSGKLKLQLFPVDDGTRRALELDNHNPYLELTLSTRKKMSSVLEHLNRKWGNSSMACG  1434
             L  S K+KLQLFP+D+GTR  LE D H+PYLELTL  RKK+SSVL+H+N KWG+SS++ G
Sbjct  92    LDPSSKIKLQLFPIDEGTRIGLERDGHHPYLELTLRARKKISSVLKHINSKWGSSSISLG  151

Query  1435  DLMLFPYHLHKENLVHFQKWT-KDTTLTAADVYALTGSPPVFRLRYGWFSNAEVAFRAPV  1611
             D +LFPYH+  EN+  ++ W+  D  ++A DVYA TGSP VFRL+YGWFS+    F  P 
Sbjct  152   DPILFPYHVALENMSSYRTWSLNDGDISAGDVYAATGSPSVFRLKYGWFSSDPKTFATPS  211

Query  1612  SSAIPSRHDANMNIMPESSVGVLQAPSTDPPKEANGCVSMNTVNASRSSDHTEAVLWENP  1791
             +S        +  +    S  +        P E    ++ N    +  S+       E  
Sbjct  212   TSIASEPCSKSEGVQKGCSSNIENLYGKGKPIE----LTRNKFKTNNISEGANVAAVEKT  267

Query  1792  ETVVTEAEV-DDLQFNKAGTSCVGEWADSLTNISVGDLLSEAP-DMEDANCITSSIHSSS  1965
                V+   V D+++ +   +     WADSLTNIS+G LLSEA    +  NC   S  S S
Sbjct  268   SMDVSVNPVFDEVRVDNGLSQTSDLWADSLTNISIGGLLSEAYLQAKLNNCSQKSDGSKS  327

Query  1966  NYIHQIPFSCDSFDAA  2013
             ++  +IP +   F++ 
Sbjct  328   SF--RIPSTFTPFESC  341


 Score = 63.5 bits (153),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 62/193 (32%), Positives = 84/193 (44%), Gaps = 10/193 (5%)
 Frame = +1

Query  1864  WADSLTNISVGDLLSEAPDMEDANCITSSIHSSSNYIHQIPFSCDSFDAAIAAHIKKHQN  2043
             W D LTNIS+G LLSEA      N  +   + S++ +       DSFDA IA  ++  Q 
Sbjct  415   WDDCLTNISIGGLLSEASLQGKFNNCSPKTNKSNSGLQPSLLISDSFDAFIAGQMQLPQG  474

Query  2044  VTDSQAALPSQL--SSIWGAEDTCDAFAFQRHSLSEKVQNASKHTSLETCKQITLANTTA  2217
                    LPS    SSI  AE+TC AF  Q+ S S K        +   C Q   + +  
Sbjct  475   -----PRLPSHEVHSSILDAEETCHAFPCQKFSSSGKDFLVLGGANSGACSQDAGSKSFK  529

Query  2218  LGASVEDLPGARNPVDGDAATADLESVHYSPTSDVVKDFNGLSDVYWPDSLGPLDLDIPS  2397
             L    E       P D     +  + +  S          GL+ + W DSLGP DL + S
Sbjct  530   LPKFAEVTGQTGLPQDHTCQESKTDPLLCSGGIFADDSSLGLAGIKWNDSLGPFDLGLSS  589

Query  2398  SRYHSELILSDSL  2436
             SR   ++I  DS+
Sbjct  590   SR---KIINGDSI  599



>ref|XP_010652887.1| PREDICTED: TSL-kinase interacting protein 1 isoform X2 [Vitis 
vinifera]
Length=586

 Score =   169 bits (429),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 102/256 (40%), Positives = 144/256 (56%), Gaps = 9/256 (4%)
 Frame = +1

Query  1255  LQNSGKLKLQLFPVDDGTRRALELDNHNPYLELTLSTRKKMSSVLEHLNRKWGNSSMACG  1434
             L  S K+KLQLFP+D+GTR  LE D H+PYLELTL  RKK+SSVL+H+N KWG+SS++ G
Sbjct  72    LDPSSKIKLQLFPIDEGTRIGLERDGHHPYLELTLRARKKISSVLKHINSKWGSSSISLG  131

Query  1435  DLMLFPYHLHKENLVHFQKWT-KDTTLTAADVYALTGSPPVFRLRYGWFSNAEVAFRAPV  1611
             D +LFPYH+  EN+  ++ W+  D  ++A DVYA TGSP VFRL+YGWFS+    F  P 
Sbjct  132   DPILFPYHVALENMSSYRTWSLNDGDISAGDVYAATGSPSVFRLKYGWFSSDPKTFATPS  191

Query  1612  SSAIPSRHDANMNIMPESSVGVLQAPSTDPPKEANGCVSMNTVNASRSSDHTEAVLWENP  1791
             +S        +  +    S  +        P E    ++ N    +  S+       E  
Sbjct  192   TSIASEPCSKSEGVQKGCSSNIENLYGKGKPIE----LTRNKFKTNNISEGANVAAVEKT  247

Query  1792  ETVVTEAEV-DDLQFNKAGTSCVGEWADSLTNISVGDLLSEAP-DMEDANCITSSIHSSS  1965
                V+   V D+++ +   +     WADSLTNIS+G LLSEA    +  NC   S  S S
Sbjct  248   SMDVSVNPVFDEVRVDNGLSQTSDLWADSLTNISIGGLLSEAYLQAKLNNCSQKSDGSKS  307

Query  1966  NYIHQIPFSCDSFDAA  2013
             ++  +IP +   F++ 
Sbjct  308   SF--RIPSTFTPFESC  321


 Score = 63.2 bits (152),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 62/193 (32%), Positives = 84/193 (44%), Gaps = 10/193 (5%)
 Frame = +1

Query  1864  WADSLTNISVGDLLSEAPDMEDANCITSSIHSSSNYIHQIPFSCDSFDAAIAAHIKKHQN  2043
             W D LTNIS+G LLSEA      N  +   + S++ +       DSFDA IA  ++  Q 
Sbjct  395   WDDCLTNISIGGLLSEASLQGKFNNCSPKTNKSNSGLQPSLLISDSFDAFIAGQMQLPQG  454

Query  2044  VTDSQAALPSQL--SSIWGAEDTCDAFAFQRHSLSEKVQNASKHTSLETCKQITLANTTA  2217
                    LPS    SSI  AE+TC AF  Q+ S S K        +   C Q   + +  
Sbjct  455   -----PRLPSHEVHSSILDAEETCHAFPCQKFSSSGKDFLVLGGANSGACSQDAGSKSFK  509

Query  2218  LGASVEDLPGARNPVDGDAATADLESVHYSPTSDVVKDFNGLSDVYWPDSLGPLDLDIPS  2397
             L    E       P D     +  + +  S          GL+ + W DSLGP DL + S
Sbjct  510   LPKFAEVTGQTGLPQDHTCQESKTDPLLCSGGIFADDSSLGLAGIKWNDSLGPFDLGLSS  569

Query  2398  SRYHSELILSDSL  2436
             SR   ++I  DS+
Sbjct  570   SR---KIINGDSI  579



>ref|XP_008440116.1| PREDICTED: TSL-kinase interacting protein 1 isoform X2 [Cucumis 
melo]
Length=452

 Score =   165 bits (417),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 137/383 (36%), Positives = 190/383 (50%), Gaps = 35/383 (9%)
 Frame = +1

Query  1270  KLKLQLFPVDDGTRRALELDNHNPYLELTLSTRKKMSSVLEHLNRKWGNSSMACGDLMLF  1449
             K+KLQLFP+++ TR ALE + ++PYLELTL  RKKMSSVL HL  KWG S++A G+L LF
Sbjct  85    KIKLQLFPINEKTRMALEKEGYHPYLELTLKARKKMSSVLNHLISKWG-SNVARGELTLF  143

Query  1450  PYHLHKENLVHFQKWT-KDTTLTAADVYALTGSPPVFRLRYGWFSNAEVAFRAPVSSAIP  1626
             PY  +  +LV   KWT +D  ++A DVYA  G P +FRLRYGW           VS+++P
Sbjct  144   PYS-NSSSLVSGLKWTLEDCDISAGDVYAAVGGPSIFRLRYGW-----------VSTSVP  191

Query  1627  SRHDANMNIMPESSVGVLQAPSTDPPKEANGCVSMNTVNASRSSDHTEAVLWENPETVVT  1806
               H  +  +    S       ST       G  S  T++  +SS+  E      P+    
Sbjct  192   KFHSFSKGLEKGCS-------STLQIIHGEGKQSARTMDEIKSSNMNEGKNTAAPDKNGN  244

Query  1807  EAEVDDLQFNKAGTSCVGEWADSLTNISVGDLLSEAPDMEDANCITSSIHSSSNYIHQIP  1986
             E  +D  +  ++ + C     DS++NIS+G LLSEA  M   +         +  +    
Sbjct  245   EPPLDSGR--QSSSECGILQFDSISNISMGGLLSEASLMGKFSSWDPKTTGGNASVQPAE  302

Query  1987  FSCDSFDAAIAAHIKKHQNVTDSQAALPSQLSSIWGAEDTCDAFAFQRHSLSEKVQNASK  2166
                DS DA IAA   +   V  S+       SSI  AE TCDAF+ +R      + ++SK
Sbjct  303   VITDSLDACIAAAQMRFSGV--SKQPHNEHHSSILDAEQTCDAFSMKR------LPSSSK  354

Query  2167  HT-SLETCKQITLANTTALGASVEDLPGARNPVDGDAATADLES-VHYSPTSDVVKDFN-  2337
              T SL+   + T  +  +        P A +  D     A  ES    +  S V  D + 
Sbjct  355   DTLSLDASTRGTFQDADSKLFKFPKTPQAHSRSDLSQDPAGKESKTDLTFCSRVYHDESS  414

Query  2338  -GLSDVYWPDSLGPLDLDIPSSR  2403
              GLS + W DSLGP DL +  SR
Sbjct  415   LGLSGINWSDSLGPFDLGLAVSR  437



>emb|CAN64858.1| hypothetical protein VITISV_030493 [Vitis vinifera]
Length=606

 Score =   165 bits (418),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 101/258 (39%), Positives = 145/258 (56%), Gaps = 15/258 (6%)
 Frame = +1

Query  1255  LQNSGKLKLQLFPVDDGTRRALELDNHNPYLELTLSTRKKMSSVLEHLNRKWGNSSMACG  1434
             L  S K+KLQLFP+D+GTR  LE D H+PYLELTL  RKK+SSVL+H+N KWG+SS++ G
Sbjct  92    LDPSSKIKLQLFPIDEGTRIGLERDGHHPYLELTLRARKKISSVLKHINSKWGSSSISLG  151

Query  1435  DLMLFPYHLHKENLVHFQKWT-KDTTLTAADVYALTGSPPVFRLRYGWFSNAEVAFRAPV  1611
             D +LFPYH+  EN+  ++ W+  D  ++A DVYA TGSP VFRL+YGWFS+    F  P 
Sbjct  152   DPILFPYHVALENMSSYRTWSLNDGDISAGDVYAATGSPSVFRLKYGWFSSDPKTFATPS  211

Query  1612  SSAIPSRHDANMNIMPESSVGVLQAPSTDPPKEANGCVSMNTVNASRSSDHTE----AVL  1779
             +S        +  +    S           P E        T N  ++++ +E    A +
Sbjct  212   TSIASEPCSKSEGVQKGCSSNXENLYGKGKPIEL-------TRNKFKTNNISEGANVAAV  264

Query  1780  WENPETVVTEAEVDDLQFNKAGTSCVGEWADSLTNISVGDLLSEAP-DMEDANCITSSIH  1956
              +    V     +D+++ +   +     WADSLTNIS+  LLSEA    +  NC   S  
Sbjct  265   EKTSMDVSVNPVIDEVRVDNGLSQTSDLWADSLTNISIRGLLSEASLQAKLNNCSQKSDG  324

Query  1957  SSSNYIHQIPFSCDSFDA  2010
             S S++  +IP +   F++
Sbjct  325   SKSSF--RIPSTFTPFES  340


 Score = 63.2 bits (152),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 62/193 (32%), Positives = 84/193 (44%), Gaps = 10/193 (5%)
 Frame = +1

Query  1864  WADSLTNISVGDLLSEAPDMEDANCITSSIHSSSNYIHQIPFSCDSFDAAIAAHIKKHQN  2043
             W D LTNIS+G LLSEA      N  +   + S++ +       DSFDA IA  ++  Q 
Sbjct  415   WDDCLTNISIGGLLSEASLQGKFNNCSPKTNKSNSGLQPSLLISDSFDAFIAGQMQLPQG  474

Query  2044  VTDSQAALPSQL--SSIWGAEDTCDAFAFQRHSLSEKVQNASKHTSLETCKQITLANTTA  2217
                    LPS    SSI  AE+TC AF  Q+ S S K        +   C Q   + +  
Sbjct  475   -----PRLPSHEVHSSILDAEETCHAFPCQKFSSSGKDFLVLGGANSGACSQDAGSESFK  529

Query  2218  LGASVEDLPGARNPVDGDAATADLESVHYSPTSDVVKDFNGLSDVYWPDSLGPLDLDIPS  2397
             L    E       P D     +  + +  S          GL+ + W DSLGP DL + S
Sbjct  530   LPKFAEVTGQTGLPQDHTCQESKTDPLLCSGGIFADDSSLGLAGIKWNDSLGPFDLGLSS  589

Query  2398  SRYHSELILSDSL  2436
             SR   ++I  DS+
Sbjct  590   SR---KIINGDSI  599



>ref|XP_011025644.1| PREDICTED: LOW QUALITY PROTEIN: TSL-kinase interacting protein 
1 [Populus euphratica]
Length=388

 Score =   161 bits (407),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 144/405 (36%), Positives = 198/405 (49%), Gaps = 43/405 (11%)
 Frame = +1

Query  1270  KLKLQLFPVDDGTRRALELDNHNPYLELTLSTRKKMSSVLEHLNRKWGNSSMACGDLMLF  1449
             K+KLQLFPVD+GTR  LE D ++PYLELTLS RKK+SSVL+HLN KWG S +ACG+ +L 
Sbjct  4     KIKLQLFPVDEGTRVGLEKDGYHPYLELTLSARKKLSSVLKHLNDKWGGSGIACGEPVL-  62

Query  1450  PYHLHKENLVHFQKWTKDTTLTAADVYALTGSPPVFRLRYGWFSNAEVAFRAPVSSAIPS  1629
              YH +       +KW    TL+  ++ A  G+  +FRLRYG FS++        S  +PS
Sbjct  63    -YHCNTSEASTTKKW----TLSDINISAAIGNASIFRLRYGCFSDSGTE-----SVGVPS  112

Query  1630  R---HDANM--NIMPE-SSVGVLQAPSTDPPKEANGCVSMNTVNASRSSDHTEAVLWENP  1791
                 +DA +   IM +  S+  + A S     E    V       S S+  T AVL +N 
Sbjct  113   MSTTYDACLQPQIMQQVCSIDAVSARSEMKWMEEQXGV---PTKHSTSTGATNAVLADNV  169

Query  1792  ET------VVTEAEVDDLQFNKAGTSCVGEWADSLTNISVGDLLSEAPDMEDANCITSSI  1953
              +      VV EA+ D     +  T     W D L NI +G LLSEA      N      
Sbjct  170   SSNELIGPVVNEAKRDAGSIGQPST----LWDDGLNNIRIGGLLSEASLQGILNTFDPKS  225

Query  1954  HSSSNYIHQIPFSCDSFDAAIAAHIKKHQNV-TDSQAALPSQLSSIWGAEDTCDAFAFQR  2130
             + S+  +       DS DA IAA +   Q      Q +  S L     AEDTC   A ++
Sbjct  226   NGSNPGLKLSQLISDSLDAFIAAQVNHSQGPRRPPQCSCSSNLD----AEDTCHELAIKK  281

Query  2131  HSLSEK-VQNASKHTSLETCKQITLANTTALGASVEDLPGARNPVDGDAATADLESVHYS  2307
              S S K  Q  S     +TC Q    + ++  +++   P  ++ +       + E+   S
Sbjct  282   FSASGKDCQALSGSAYSQTCSQ-DAGSKSSKHSTMTACPWYQSSLQQGHGCEESET-ELS  339

Query  2308  PTSDVVKDFN--GLSDVYWPDSLGPLDLDIPSSRYHSELILSDSL  2436
               S V  + N  GLS + W DSLGP DL + SSR   ++I  DSL
Sbjct  340   LGSRVCNNENSLGLSGIKWTDSLGPFDLXLSSSR---KIINGDSL  381



>ref|XP_008440117.1| PREDICTED: TSL-kinase interacting protein 1 isoform X3 [Cucumis 
melo]
Length=382

 Score =   160 bits (405),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 136/386 (35%), Positives = 187/386 (48%), Gaps = 33/386 (9%)
 Frame = +1

Query  1270  KLKLQLFPVDDGTRRALELDNHNPYLELTLSTRKKMSSVLEHLNRKWGNSSMACGDLMLF  1449
             K+KLQLFP+++ TR ALE + ++PYLELTL  RKKMSSVL HL  KWG S++A G+L LF
Sbjct  7     KIKLQLFPINEKTRMALEKEGYHPYLELTLKARKKMSSVLNHLISKWG-SNVARGELTLF  65

Query  1450  PYHLHKENLVHFQKWT-KDTTLTAADVYALTGSPPVFRLRYGWFSNAEVAFRAPVSSAIP  1626
             PY  +  +LV   KWT +D  ++A DVYA  G P +FRLRYGW S +   F +  S  + 
Sbjct  66    PYS-NSSSLVSGLKWTLEDCDISAGDVYAAVGGPSIFRLRYGWVSTSVPKFHS-FSKGLE  123

Query  1627  SRHDANMNIMPESSVGVLQAPSTDPPKEANGCVSMNTVNASRSSDHTEAVLWENP---ET  1797
                 + + I+     G   A + D  K +N     NT    ++       +   P     
Sbjct  124   KGCSSTLQII--HGEGKQSARTMDEIKSSNMNEGKNTAAPDKNVGCRTNPMGNEPPLDSG  181

Query  1798  VVTEAEVDDLQFNKAGTSCVGEWADSLTNISVGDLLSEAPDMEDANCITSSIHSSSNYIH  1977
               + +E   LQF            DS++NIS+G LLSEA  M   +         +  + 
Sbjct  182   RQSSSECGILQF------------DSISNISMGGLLSEASLMGKFSSWDPKTTGGNASVQ  229

Query  1978  QIPFSCDSFDAAIAAHIKKHQNVTDSQAALPSQLSSIWGAEDTCDAFAFQRHSLSEKVQN  2157
                   DS DA IAA   +   V  S+       SSI  AE TCDAF+ +R      + +
Sbjct  230   PAEVITDSLDACIAAAQMRFSGV--SKQPHNEHHSSILDAEQTCDAFSMKR------LPS  281

Query  2158  ASKHT-SLETCKQITLANTTALGASVEDLPGARNPVDGDAATADLES-VHYSPTSDVVKD  2331
             +SK T SL+   + T  +  +        P A +  D     A  ES    +  S V  D
Sbjct  282   SSKDTLSLDASTRGTFQDADSKLFKFPKTPQAHSRSDLSQDPAGKESKTDLTFCSRVYHD  341

Query  2332  FN--GLSDVYWPDSLGPLDLDIPSSR  2403
              +  GLS + W DSLGP DL +  SR
Sbjct  342   ESSLGLSGINWSDSLGPFDLGLAVSR  367



>ref|XP_008440095.1| PREDICTED: TSL-kinase interacting protein 1 isoform X1 [Cucumis 
melo]
 ref|XP_008440096.1| PREDICTED: TSL-kinase interacting protein 1 isoform X1 [Cucumis 
melo]
 ref|XP_008440097.1| PREDICTED: TSL-kinase interacting protein 1 isoform X1 [Cucumis 
melo]
 ref|XP_008440098.1| PREDICTED: TSL-kinase interacting protein 1 isoform X1 [Cucumis 
melo]
 ref|XP_008440099.1| PREDICTED: TSL-kinase interacting protein 1 isoform X1 [Cucumis 
melo]
 ref|XP_008440100.1| PREDICTED: TSL-kinase interacting protein 1 isoform X1 [Cucumis 
melo]
 ref|XP_008440101.1| PREDICTED: TSL-kinase interacting protein 1 isoform X1 [Cucumis 
melo]
 ref|XP_008440102.1| PREDICTED: TSL-kinase interacting protein 1 isoform X1 [Cucumis 
melo]
 ref|XP_008440103.1| PREDICTED: TSL-kinase interacting protein 1 isoform X1 [Cucumis 
melo]
 ref|XP_008440104.1| PREDICTED: TSL-kinase interacting protein 1 isoform X1 [Cucumis 
melo]
 ref|XP_008440105.1| PREDICTED: TSL-kinase interacting protein 1 isoform X1 [Cucumis 
melo]
 ref|XP_008440106.1| PREDICTED: TSL-kinase interacting protein 1 isoform X1 [Cucumis 
melo]
 ref|XP_008440107.1| PREDICTED: TSL-kinase interacting protein 1 isoform X1 [Cucumis 
melo]
 ref|XP_008440108.1| PREDICTED: TSL-kinase interacting protein 1 isoform X1 [Cucumis 
melo]
 ref|XP_008440110.1| PREDICTED: TSL-kinase interacting protein 1 isoform X1 [Cucumis 
melo]
 ref|XP_008440111.1| PREDICTED: TSL-kinase interacting protein 1 isoform X1 [Cucumis 
melo]
 ref|XP_008440112.1| PREDICTED: TSL-kinase interacting protein 1 isoform X1 [Cucumis 
melo]
 ref|XP_008440113.1| PREDICTED: TSL-kinase interacting protein 1 isoform X1 [Cucumis 
melo]
 ref|XP_008440114.1| PREDICTED: TSL-kinase interacting protein 1 isoform X1 [Cucumis 
melo]
 ref|XP_008440115.1| PREDICTED: TSL-kinase interacting protein 1 isoform X1 [Cucumis 
melo]
Length=460

 Score =   160 bits (405),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 136/386 (35%), Positives = 187/386 (48%), Gaps = 33/386 (9%)
 Frame = +1

Query  1270  KLKLQLFPVDDGTRRALELDNHNPYLELTLSTRKKMSSVLEHLNRKWGNSSMACGDLMLF  1449
             K+KLQLFP+++ TR ALE + ++PYLELTL  RKKMSSVL HL  KWG S++A G+L LF
Sbjct  85    KIKLQLFPINEKTRMALEKEGYHPYLELTLKARKKMSSVLNHLISKWG-SNVARGELTLF  143

Query  1450  PYHLHKENLVHFQKWT-KDTTLTAADVYALTGSPPVFRLRYGWFSNAEVAFRAPVSSAIP  1626
             PY  +  +LV   KWT +D  ++A DVYA  G P +FRLRYGW S +   F +  S  + 
Sbjct  144   PYS-NSSSLVSGLKWTLEDCDISAGDVYAAVGGPSIFRLRYGWVSTSVPKFHS-FSKGLE  201

Query  1627  SRHDANMNIMPESSVGVLQAPSTDPPKEANGCVSMNTVNASRSSDHTEAVLWENP---ET  1797
                 + + I+     G   A + D  K +N     NT    ++       +   P     
Sbjct  202   KGCSSTLQII--HGEGKQSARTMDEIKSSNMNEGKNTAAPDKNVGCRTNPMGNEPPLDSG  259

Query  1798  VVTEAEVDDLQFNKAGTSCVGEWADSLTNISVGDLLSEAPDMEDANCITSSIHSSSNYIH  1977
               + +E   LQF            DS++NIS+G LLSEA  M   +         +  + 
Sbjct  260   RQSSSECGILQF------------DSISNISMGGLLSEASLMGKFSSWDPKTTGGNASVQ  307

Query  1978  QIPFSCDSFDAAIAAHIKKHQNVTDSQAALPSQLSSIWGAEDTCDAFAFQRHSLSEKVQN  2157
                   DS DA IAA   +   V  S+       SSI  AE TCDAF+ +R      + +
Sbjct  308   PAEVITDSLDACIAAAQMRFSGV--SKQPHNEHHSSILDAEQTCDAFSMKR------LPS  359

Query  2158  ASKHT-SLETCKQITLANTTALGASVEDLPGARNPVDGDAATADLES-VHYSPTSDVVKD  2331
             +SK T SL+   + T  +  +        P A +  D     A  ES    +  S V  D
Sbjct  360   SSKDTLSLDASTRGTFQDADSKLFKFPKTPQAHSRSDLSQDPAGKESKTDLTFCSRVYHD  419

Query  2332  FN--GLSDVYWPDSLGPLDLDIPSSR  2403
              +  GLS + W DSLGP DL +  SR
Sbjct  420   ESSLGLSGINWSDSLGPFDLGLAVSR  445



>gb|KCW54332.1| hypothetical protein EUGRSUZ_I00296 [Eucalyptus grandis]
Length=396

 Score =   159 bits (401),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 131/330 (40%), Positives = 167/330 (51%), Gaps = 37/330 (11%)
 Frame = +1

Query  1264  SGKLKLQLFPVDDGTRRALELDNHNPYLELTLSTRKKMSSVLEHLNRKWGNSSMACGDLM  1443
             S K+KLQLFPVD+ T   L+ D H+PYLELTL  RK++SSVL+HL  KWG+S+ A G+ +
Sbjct  45    STKIKLQLFPVDEVTCLGLQKDGHHPYLELTLKARKRISSVLKHLQTKWGSSTFATGEPV  104

Query  1444  LFPYHLHKENLVHFQKWT-KDTTLTAADVYALTGSPPVFRLRYGWFSNAEVAFRAPVSSA  1620
             L+PY   +E      +WT  D  + A DV+A  GSP +FRLRYGW SNA        S  
Sbjct  105   LYPYS-KQEAKSCPDRWTLDDKDVRAGDVHAAIGSPALFRLRYGWLSNA-----GSKSLG  158

Query  1621  IPSRHDANMNIMPESSVGVLQAPSTDPPKEANGCVSMNTVNASRSSDHTEAVLWENPETV  1800
               S   +  ++ P S    L   S        GC S N  N    +   E    E  ETV
Sbjct  159   KSSELASAESLSPAS---FLINSSHQHEGMQKGCES-NINNKCEEARKFEQADGEATETV  214

Query  1801  VT----EAEVD-------DLQFNKAGTSCVGE-WADSLTNISVGDLLSEAPDMEDANCIT  1944
             V     E  VD       D   N+ G     E W DSLTNIS+G LLS+A        + 
Sbjct  215   VGVKYHEIMVDNIVDHPEDRMCNEGGLGPSSEIWTDSLTNISIGGLLSDA----SLQGMF  270

Query  1945  SSIHSSSNYIHQI--PFSC--DSFDAAIAAHIKKHQNVTDSQAALPSQLSSIWGAEDTCD  2112
             SS  S +N   Q   P  C  DSFDA I  H+K  Q+   S        SSI  AEDTC 
Sbjct  271   SSFLSKTNGCVQTSHPSQCTSDSFDALITTHVKNSQSNKQSSN---EPCSSILDAEDTCM  327

Query  2113  AFAFQRHSLSEKV--QNASKHTSLETCKQI  2196
             AF F++ S+S+ +   N S +  L +C +I
Sbjct  328   AFPFKKSSMSKDLSTSNGSSNAGL-SCPEI  356



>ref|XP_003630143.1| TSL-kinase interacting protein [Medicago truncatula]
Length=697

 Score =   160 bits (406),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 142/408 (35%), Positives = 200/408 (49%), Gaps = 48/408 (12%)
 Frame = +1

Query  1240  FNETNLQNSGKLKLQLFPVDDGTRRALE-LDNHNPYLELTLSTRKKMSSVLEHLNRKWGN  1416
             +    L +S K+ LQLFP ++  R+ LE +D HNPYLELTLS RKK+SSVL H+ +KWG+
Sbjct  304   YPRQTLNSSAKITLQLFPANEVIRKGLEKVDGHNPYLELTLSGRKKISSVLRHIKKKWGS  363

Query  1417  SSMACGDLMLFPYHLHKENLVHFQKWT-KDTTLTAADVYALTGSPPVFRLRYGWFSNAEV  1593
             SS A G+ MLFPY+  K NL + ++WT  D+  T A VYA  G+P +FRL+YGWF N + 
Sbjct  364   SSPAKGEPMLFPYNRMK-NLSNCKRWTINDSDTTTAAVYAAVGNPAIFRLKYGWF-NIQK  421

Query  1594  AFRAPVSSAIPSRHDANMNIMPESSVGVLQAPSTDPPKEANGC-VSMNTVNASRSSDHTE  1770
             A    +SS         M I  ES V   Q+  T+      GC  S+ +++  R  D  E
Sbjct  422   ATPIGISS---------MPIPCESGV---QSGRTE-----TGCNASLESLSDDR--DKIE  462

Query  1771  AVLWENPETVV----------TEAEVDDLQFNKAGTSC-----VGEWADSLTNISVGDLL  1905
             A   +    VV          T+ E  D   N+   SC     +  WAD L NIS+G LL
Sbjct  463   ATAVDTATDVVNVISEIVAQKTDNEPADPLDNEPKESCSVQQPLMPWADCLDNISIGGLL  522

Query  1906  SEAPDMEDANCITSSIHSSSNYIHQIPFSCDSFDAAIAAHIKKHQNVTDSQAALPSQLSS  2085
             SEA  +   +      + +S   H I    DS DA I +    H  V+   A     L+S
Sbjct  523   SEASFLGKFDSKLFGSNGTSQTRHLIS---DSLDAFITSR-NSHPPVSTPSAG--PLLTS  576

Query  2086  IWGAEDTCDAFAFQRHSLSEKVQ--NASKHTSLETCKQITLANTTALGASVEDLPGARNP  2259
              + A D C++F  Q  S    VQ  + +K      C Q   +    L  + +    AR  
Sbjct  577   FFDAGDACNSFDLQNLSSPTDVQTDSGTKTGYSVACCQDASSYLFKLPCTDKVNDQARLS  636

Query  2260  VDGDAATADLESVHYSPTSDVVKDFNGLSDVYWPDSLGPLDLDIPSSR  2403
              +  +     +S+  S   D  +   GLS + W DS+GP DL +P+ +
Sbjct  637   QNPSSEETQTDSLLSSCLYDGERSL-GLSGIIWNDSMGPFDLGMPAKK  683



>ref|XP_007207640.1| hypothetical protein PRUPE_ppa020776mg [Prunus persica]
 gb|EMJ08839.1| hypothetical protein PRUPE_ppa020776mg [Prunus persica]
Length=473

 Score =   158 bits (399),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 134/402 (33%), Positives = 184/402 (46%), Gaps = 67/402 (17%)
 Frame = +1

Query  1270  KLKLQLFPVDDGTRRALELDNHNPYLELTLSTRKKMSSVLEHLNRKWGNSSMACGDLMLF  1449
             K+KLQLFPV++ TR  LE D H+PYLEL L  RKK+SSVL+HLN KWG+SS+A G+  LF
Sbjct  100   KIKLQLFPVNEVTRIGLEKDGHHPYLELILRARKKISSVLKHLNGKWGSSSVALGEPALF  159

Query  1450  PYHLHKENLVHFQKWT-KDTTLTAADVYALTGSPPVFRLRYGWFSNAEVAFRAPVSSAIP  1626
             PY + ++++   ++WT  D  ++A  +YA  GSP VFRLRYGWFS        P +SAI 
Sbjct  160   PYKI-QDSMSSNRRWTLNDGDISAGAIYAAIGSPEVFRLRYGWFSTEPKTAAEPSTSAI-  217

Query  1627  SRHDANMNIMPESSVGVLQAPSTD-----------PPKEANGCVSMNTVNASRSSDHTEA  1773
                   +++  E +    +A + +           P K+     +  T+NA      T A
Sbjct  218   ----DKVDLQSEGAQRYSRAATENSYDKVGKHTGLPRKDFRSINASETINADTEKISTGA  273

Query  1774  VLWENPETVVTEAEVDDLQFNKAGTSCVGEWADSLTNISVGDLLSEAPDMEDANCITSSI  1953
             V                    K+ +     WAD   +IS+G LLSEA      N I +  
Sbjct  274   VHL------------------KSDSKSYALWAD-CPSISIGGLLSEASLQGKLNRIDAQS  314

Query  1954  HSSSNYIHQIPFSCDSFDAAIAAHIKKHQNVTDSQAALPSQLSSIWGAEDTCDAFAFQRH  2133
              +S+  +       DS    +A  I   +    S         SI  AE+TC AF FQ+ 
Sbjct  315   TASNAGLPPTHLISDSHQGFVATRINSPRGPGPSTH---DSCLSILDAEETCHAFPFQKF  371

Query  2134  SLSEK------------VQNASKHTSLETCKQITLANTTALGASVEDLPGARNPVDGDAA  2277
             SLS K             QNA+        K     N T +  SV  LP  R   + D  
Sbjct  372   SLSGKDVLGFGGSCGGFSQNAAS-------KAFKSPNATKVN-SVAGLPQDRACQESDTD  423

Query  2278  TADLESVHYSPTSDVVKDFNGLSDVYWPDSLGPLDLDIPSSR  2403
                   V+   +        GLS + W DSLGP DL +P S+
Sbjct  424   IMACSRVNDERSL-------GLSGIKWTDSLGPFDLGLPVSQ  458



>ref|XP_002533886.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF28497.1| conserved hypothetical protein [Ricinus communis]
Length=357

 Score =   154 bits (390),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 135/385 (35%), Positives = 190/385 (49%), Gaps = 54/385 (14%)
 Frame = +1

Query  1324  LDNHNPYLELTLSTRKKMSSVLEHLNRKWGNSSMACGDLMLFPYHLHKENLVHFQKWT-K  1500
             +D ++PYLELTLS RKK+SSVL HLN KWG+SS+A G+  L PY + +   +   +WT  
Sbjct  6     MDGYHPYLELTLSARKKISSVLNHLNHKWGDSSIATGEPFLLPYKIAE--CLSSCRWTLN  63

Query  1501  DTTLTAADVYALTGSPPVFRLRYGWFSNAEVAFRAPVSSAIPS----RHDANMNIMPESS  1668
             D  L+A D+YA  GSP +FRLRYGW ++ E       S+ IPS    RH+          
Sbjct  64    DVGLSAGDIYAAVGSPSIFRLRYGWVTDCENKSSELQSTLIPSEACLRHEG---------  114

Query  1669  VGVLQAPSTDPPKEANGCVSMNTVNASRSSDHTEAVLWENPETVVTEAEVDDLQFNKAGT  1848
                +Q   ++  +  NG          ++ D +E +    P  V    + ++ + +  GT
Sbjct  115   ---IQKVCSNNVENING-------KGKQNEDPSEEL---KPNIVSGATDRNEGKMH-VGT  160

Query  1849  SCVGEWADSLTNISVGDLLSEAP-DMEDANCITSSIHSSSNYIHQIPFSCDSFDAAIAAH  2025
                  W D+LTNIS+G LLSEA      + C   S  S++  +     S DSFDA I + 
Sbjct  161   GQSSLWDDALTNISIGGLLSEASLKGMFSTCEPKSDGSNAGLLPSQLIS-DSFDAFIMSQ  219

Query  2026  IKKHQNVTDSQAALP--SQLSSIWGAEDTCDAFAFQRHSLSEK-----VQNASKHTSLET  2184
             +   Q        LP     SSI  AEDTC AFAFQ  S S K      ++A  HTS + 
Sbjct  220   VNCSQ-----APRLPPHGTSSSILDAEDTCHAFAFQNFSSSGKDALALRESAYGHTSSQD  274

Query  2185  CKQITLANTTALGASVED-LPGARNPVDGDAATADLESVHYSPTSDVVKDFNGLSDVYWP  2361
                 +  N      S++  LP +    + +   + L S  Y+  S +     GLS + W 
Sbjct  275   AVSKSFKNPNISEVSIQSGLPQSHGCQESETDLS-LCSRLYNDESSL-----GLSGIKWT  328

Query  2362  DSLGPLDLDIPSSRYHSELILSDSL  2436
             DSLGP DL + SSR   ++I  DSL
Sbjct  329   DSLGPFDLGLSSSR---KIISGDSL  350



>ref|XP_004503995.1| PREDICTED: TSL-kinase interacting protein 1-like isoform X4 [Cicer 
arietinum]
Length=467

 Score =   155 bits (393),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 153/454 (34%), Positives = 206/454 (45%), Gaps = 54/454 (12%)
 Frame = +1

Query  1126  ERTTTDKEDGHFQ-DSNVRNVFEHSGKDPHVFP-----DLLHNSFNETNLQNSGKLKLQL  1287
             E   TDKE+ HF     VR   EH  +D  +       +L H       L +S K+KLQL
Sbjct  46    EELLTDKENQHFLFKEPVRLCPEHPREDTFLMKMREALELEHRPGQ--TLISSAKIKLQL  103

Query  1288  FPVDDGTRRALELDNHNPYLELTLSTRKKMSSVLEHLNRKWGNSSMACGDLMLFPYHLHK  1467
             FPV++  R  LE D HNPYLELTLS +KK+SSVL HL  KWG+SS+A G+ +LFPY    
Sbjct  104   FPVNEEIRTGLEKDGHNPYLELTLSGKKKISSVLRHLETKWGSSSIAKGEPLLFPYS-RM  162

Query  1468  ENLVHFQKWT-KDTTLTAADVYALTGSPPVFRLRY-----GWFSNAEVAFRAPVSSAIPS  1629
              NL   ++WT  D   TAA VY   GSP  FRL          S+  + + + V S    
Sbjct  163   GNLSDCKRWTINDIETTAAAVYTAVGSPATFRLNIHEPTPPGLSSLPIPYESGVQSG---  219

Query  1630  RHDANMNIMPESSVGVLQAPSTDPPKEANGCVSMNTVNASRSSDHTEAVLWENPETVVTE  1809
               D   N   ES              E +   +     A+ S + T  ++ +     +  
Sbjct  220   GKDRGCNNDVESLF-----------DERDKIEATAEYKATCSDNVTSKIVAQK----MDN  264

Query  1810  AEVDDLQFNKAGTSCVGE--WADSLTNISVGDLLSEAPDMEDANCITSSIHSSSNYIHQI  1983
             A  D L  NK   SC  +  W DSL NIS+G  LSE   +   +   S +  S+  I   
Sbjct  265   APADPLD-NKLKQSCSLQQPWIDSLDNISIGGFLSEVSLLGKFD---SKLFGSNATIQTS  320

Query  1984  PFSCDSFDAAIAAHIKKHQNVTDSQAALPSQLSSIWGAEDTCDAFAFQRHSLSEKVQNAS  2163
                 DS DA I + I +    T S  AL    +SI  AE+TC AF  Q+ S    VQ AS
Sbjct  321   HLISDSLDAFITSRISQPPVSTPSAEAL---RTSILDAEETCHAFPLQKLSSRADVQTAS  377

Query  2164  KHTSLETCKQITLANTTALGAS--VEDLPGARNPVDGDAATADLESVHYSPTSDVVKDFN  2337
                +   C Q    N+  L  +  V D  G       +    DL  +  S   D  +   
Sbjct  378   GTVA---CSQDVSPNSLKLPCTEKVNDPDGLSQSTPSEKTQTDL--LLSSRLYDDERSL-  431

Query  2338  GLSDVYWPDSLGPLDLDIPSSRYHSELILSDSLG  2439
             GL+ + W DS+GP DL + + ++    I  DS+G
Sbjct  432   GLTGISWNDSMGPFDLGMLAKKH----IGGDSVG  461



>gb|KGN48412.1| hypothetical protein Csa_6G486850 [Cucumis sativus]
Length=462

 Score =   154 bits (390),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 142/407 (35%), Positives = 197/407 (48%), Gaps = 42/407 (10%)
 Frame = +1

Query  1270  KLKLQLFPVDDGTRRALELDNHNPYLELTLSTRKKMSSVLEHLNRKWGNSSMACGDLMLF  1449
             K+KLQLFP+++  R A+E + ++PYLELTL  RKK+SSVL HL  KWG S++A G+L LF
Sbjct  85    KIKLQLFPINEKMRMAVEKEGYHPYLELTLKARKKISSVLNHLISKWG-SNVARGELTLF  143

Query  1450  PYHLHKENLVHFQKWT-KDTTLTAADVYALTGSPPVFRLRYGWFSNAEVAFRAPVSSAIP  1626
             PY+    +LV   KWT +D  ++A DVYA  G P VFRLRYGW           VS+++P
Sbjct  144   PYN-KPSSLVSGLKWTLEDYDISAGDVYAAVGGPSVFRLRYGW-----------VSTSVP  191

Query  1627  SRHDANMNIMPESSVGVLQAPSTDPPKEANGCVSMNTVNASRSSDHTEAVLWENPETVV-  1803
               H  +  +    S       ST       G  S  T++  +SS+  E      P+  V 
Sbjct  192   KFHSFSKGLEKGCS-------STLQIIHGEGKQSERTMDEIKSSNMNEMNNTAAPDKTVD  244

Query  1804  --TEAEVDDLQFN---KAGTSCVGEWADSLTNISVGDLLSEAPDMEDANCITSSIHSSSN  1968
               T    ++   N   +  + C     DS++NIS+G LLSEA  M   +     I   + 
Sbjct  245   CPTNPMGNEPPLNSGRQLSSECGILQFDSISNISMGGLLSEASLMGKFSNWDPKITGGTA  304

Query  1969  YIHQIPFSCDSFDAAIAAHIKKHQNVTDSQAALPSQLSSIWGAEDTCDAFAFQRHSLSEK  2148
              +       DS DA IAA   +   V  S+       SSI  AE TCDAF+ +R      
Sbjct  305   SVQPAEVITDSLDACIAAAQMRFSGV--SKQPHNEHHSSILDAEQTCDAFSMKR------  356

Query  2149  VQNASKHT-SLETCKQITLANTTALGASVEDLPGARNPVDGDAATADLES-VHYSPTSDV  2322
             + ++SK T SL+   + T  +  +        P A +  D     A  ES    S  S V
Sbjct  357   LPSSSKDTLSLDATTRGTFQDADS-KFKFPKTPQAHSRSDLSQDPAGKESKTDPSFCSRV  415

Query  2323  VKDFN--GLSDVYWPDSLGPLDLD--IPSSRYHSELILSDSLGGLTQ  2451
               D +  GLS + W DSLGP DL   +P     S   LS+S+ G  +
Sbjct  416   YHDESSLGLSGINWTDSLGPFDLGLAVPRKVSSSGDTLSNSMSGFVR  462



>ref|NP_195648.1| uncharacterized protein [Arabidopsis thaliana]
 emb|CAB44673.1| hypothetical protein [Arabidopsis thaliana]
 emb|CAB80601.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE87064.1| uncharacterized protein AT4G39380 [Arabidopsis thaliana]
Length=518

 Score =   150 bits (379),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 141/444 (32%), Positives = 204/444 (46%), Gaps = 101/444 (23%)
 Frame = +1

Query  1252  NLQNSGKLKLQLFPVDDGTRRALELDNHNPYLELTLSTRKKMSSVLEHLNRKWGNSSMAC  1431
             ++  SGK+KLQLFP+D  TR  LE D  +PYLELTLS+RKK+SSVL+ ++ KWG+S +A 
Sbjct  84    DVPRSGKMKLQLFPLDAHTREGLEKDGFHPYLELTLSSRKKISSVLQRIHSKWGSSEIAR  143

Query  1432  GDLMLFPYHLHKENLVHFQKWTKDTTLTAADVYALTGSPPVFRLRYGWFSNAEVAFRAPV  1611
             GD  L+PY      L    KW  ++ +T  +VY   G+P +FRLRYGW S  E     P 
Sbjct  144   GDPTLYPYDTSV--LASGHKWVANSNITTGNVYEAIGAPFIFRLRYGWSSATENKTNEPP  201

Query  1612  SSAIPSRHDANMNIMPESSVGVLQAPS--TDPPKEAN----GCVSMNTVNASRSSDHTEA  1773
             S + P        +  E+ + +L +P+  TD P   N    G V  +T N          
Sbjct  202   SPSTPG--TGTQMLGSENPLTMLSSPNQVTDTPPLENLPHDGQVE-STENKINDGSGPTL  258

Query  1774  VLWENPET------VVTEAEV-----DDLQFNKAGTSCVGEWADSLTNISVGDLLSEA--  1914
             + W++  T      +++E  +     +  + + AG +    W D+LTNIS+G L SEA  
Sbjct  259   LFWDDGLTSLSIGGLLSEVSLKGNFGNHCKNSNAGNANATLWEDNLTNISIGGLFSEASL  318

Query  1915  -----------PD------------MEDANCITSSIHSSSNY-------IHQ--IPFSCD  1998
                        P             + +A+ +     S  N        I Q  +P   D
Sbjct  319   QDRWHMNNEREPAHNGQSIGSIGGLLSEASILGEGRISDCNKTWETRRAIKQPPLPLISD  378

Query  1999  SFDAAIAAHIKKHQNVTDSQ-----AALP-SQLSSIWGAEDTCDAFAF-QRHSLSEKVQN  2157
             S DA +        N TD++     A LP S  SSI  AEDTC AF+F +R +++ KV +
Sbjct  379   SLDAFLV-------NQTDNRRAPCHAPLPESSHSSILDAEDTCHAFSFRKRTTITPKVHD  431

Query  2158  ASKHTSLETCKQITLANTTA--LGASVEDLPGARNPVDGDAATADLESVHYSPTSDVVKD  2331
                   +E  KQI  +N     LG+SV          + D++                  
Sbjct  432   QVS-GEVEKEKQIDESNPAKPLLGSSV---------FNQDSSL-----------------  464

Query  2332  FNGLSDVYWPDSLGPLDLDIPSSR  2403
               GLS + W +S GP D  + SSR
Sbjct  465   --GLSGIKWAESRGPFDFGLSSSR  486



>ref|XP_010526627.1| PREDICTED: TSL-kinase interacting protein 1 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010526628.1| PREDICTED: TSL-kinase interacting protein 1 isoform X1 [Tarenaya 
hassleriana]
Length=533

 Score =   148 bits (373),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 145/441 (33%), Positives = 202/441 (46%), Gaps = 76/441 (17%)
 Frame = +1

Query  1255  LQNSGKLKLQLFPVDDGTRRALELDNHNPYLELTLSTRKKMSSVLEHLNRKWGNSSMACG  1434
             LQ SGKLKLQLFP DD TR  LE D  +PYLELTLS+RKK+SSVL+HL+ KWG+S +A G
Sbjct  87    LQPSGKLKLQLFPFDDHTREGLEKDGFHPYLELTLSSRKKISSVLKHLHSKWGSSQIAQG  146

Query  1435  DLMLFPYHLHKENLVHFQ--KWTKD-TTLTAADVYALTGSPPVFRLRYGWFSNAE----V  1593
             +  L+PY    + LV F   KWT + ++ TA DVYA  G+P  FRLRYGW S  E     
Sbjct  147   EPRLYPY----DKLVSFAGYKWTTNSSSFTAGDVYAAIGAPTAFRLRYGWTSETEDKTSE  202

Query  1594  AFRAPVSSAIPSRHDANMNIMPESSVGV---------LQAPSTDPPKEANGCVSMNTVN-  1743
             +   P+S       +       + + G          L  PST+  K  N  VS   +  
Sbjct  203   SPSLPISRTTDFLCEGKQKESSDQAEGANEQIGEGDNLSRPSTE-DKATNPTVSERILPD  261

Query  1744  ---ASRSSDHTE------AVLWENPET-----VVTEAEVDDLQFNKAGTSCVGE----WA  1869
                 S+  D T       +  W++        +++EA +     +  G +  GE    W 
Sbjct  262   GQVQSKDKDGTNDYYGPTSFPWDDLTNLSIGGLLSEASLRATNCSTTGKTSNGETTTLWV  321

Query  1870  DSLTNISVGDLLSEA-------------PDMEDANCITSSIHSSSNYIHQIPFSCDSF--  2004
             D+LTNIS+G LLSEA             P+  +   + ++    S         CD    
Sbjct  322   DNLTNISIGGLLSEASLHGRLTSNREQEPNRSNDGLLDNNRLKVSVGGLGRSSDCDKAWS  381

Query  2005  --DAAIAAHIKKHQNVTDSQAALPSQL-SSIWGAEDTCDAFAFQRHSLSE--KVQNASKH  2169
               DA   +  +  +    +  A P +L SSI  AEDTC AF+F  +  S+       S  
Sbjct  382   RSDAGKFSVSRTDKTRGGTCEAAPCELRSSILDAEDTCHAFSFGNNLPSQWKGATTTSTT  441

Query  2170  TSLETCKQITLANTTALGASVEDLPGARNPVDG-DAATADLESVHYSPTSDVVKDFN---  2337
             T  E  + +++            L   R   +G     A  ES     +S ++ D     
Sbjct  442   TGPEGARPVSI------------LDKGRGQDEGVMKQKARSESGKQLLSSSLLFDQERSL  489

Query  2338  GLSDVYWPDSLGPLDLDIPSS  2400
             GLS + W DSLGP D+ + SS
Sbjct  490   GLSGIKWGDSLGPFDMGLSSS  510



>ref|NP_001190966.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AEE87065.1| uncharacterized protein AT4G39380 [Arabidopsis thaliana]
Length=534

 Score =   147 bits (372),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 138/442 (31%), Positives = 204/442 (46%), Gaps = 81/442 (18%)
 Frame = +1

Query  1252  NLQNSGKLKLQLFPVDDGTRRALELDNHNPYLELTLSTRKKMSSVLEHLNRKWGNSSMAC  1431
             ++  SGK+KLQLFP+D  TR  LE D  +PYLELTLS+RKK+SSVL+ ++ KWG+S +A 
Sbjct  84    DVPRSGKMKLQLFPLDAHTREGLEKDGFHPYLELTLSSRKKISSVLQRIHSKWGSSEIAR  143

Query  1432  GDLMLFPYHLHKENLVHFQKWTKDTTLTAADVYALTGSPPVFRLRYGWFSNAEVAFRAPV  1611
             GD  L+PY      L    KW  ++ +T  +VY   G+P +FRLRYGW S  E     P 
Sbjct  144   GDPTLYPYDTSV--LASGHKWVANSNITTGNVYEAIGAPFIFRLRYGWSSATENKTNEPP  201

Query  1612  SSAIPSRHDANMNIMPESSVGVLQAPS--TDPPKEAN----GCVSMNTVNASRSSDHTEA  1773
             S + P        +  E+ + +L +P+  TD P   N    G V  +T N          
Sbjct  202   SPSTPG--TGTQMLGSENPLTMLSSPNQVTDTPPLENLPHDGQVE-STENKINDGSGPTL  258

Query  1774  VLWENPET------VVTEAEV-----DDLQFNKAGTSCVGEWADSLTNISVGDLLSEA--  1914
             + W++  T      +++E  +     +  + + AG +    W D+LTNIS+G L SEA  
Sbjct  259   LFWDDGLTSLSIGGLLSEVSLKGNFGNHCKNSNAGNANATLWEDNLTNISIGGLFSEASL  318

Query  1915  -----------PD------------MEDANCITSSIHSSSNYIHQ---------IPFSCD  1998
                        P             + +A+ +     S  N   +         +P   D
Sbjct  319   QDRWHMNNEREPAHNGQSIGSIGGLLSEASILGEGRISDCNKTWETRRAIKQPPLPLISD  378

Query  1999  SFDAAIAAHIKKHQNVTDSQ-----AALP-SQLSSIWGAEDTCDAFAF-QRHSLSEKVQN  2157
             S DA +        N TD++     A LP S  SSI  AEDTC AF+F +R +++ KV +
Sbjct  379   SLDAFLV-------NQTDNRRAPCHAPLPESSHSSILDAEDTCHAFSFRKRTTITPKVHD  431

Query  2158  ASKHTSLETCKQITLANTTALGASVEDLPGARNPVDGDAATADLESVHYSPTSDVVKDFN  2337
                     TC    L +      S E +   +   + + A   L S  ++  S +     
Sbjct  432   Q----KFRTCNSW-LWDMKIWQVSGE-VEKEKQIDESNPAKPLLGSSVFNQDSSL-----  480

Query  2338  GLSDVYWPDSLGPLDLDIPSSR  2403
             GLS + W +S GP D  + SSR
Sbjct  481   GLSGIKWAESRGPFDFGLSSSR  502



>ref|XP_010526629.1| PREDICTED: TSL-kinase interacting protein 1 isoform X2 [Tarenaya 
hassleriana]
Length=511

 Score =   147 bits (371),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 145/441 (33%), Positives = 202/441 (46%), Gaps = 76/441 (17%)
 Frame = +1

Query  1255  LQNSGKLKLQLFPVDDGTRRALELDNHNPYLELTLSTRKKMSSVLEHLNRKWGNSSMACG  1434
             LQ SGKLKLQLFP DD TR  LE D  +PYLELTLS+RKK+SSVL+HL+ KWG+S +A G
Sbjct  65    LQPSGKLKLQLFPFDDHTREGLEKDGFHPYLELTLSSRKKISSVLKHLHSKWGSSQIAQG  124

Query  1435  DLMLFPYHLHKENLVHFQ--KWTKD-TTLTAADVYALTGSPPVFRLRYGWFSNAE----V  1593
             +  L+PY    + LV F   KWT + ++ TA DVYA  G+P  FRLRYGW S  E     
Sbjct  125   EPRLYPY----DKLVSFAGYKWTTNSSSFTAGDVYAAIGAPTAFRLRYGWTSETEDKTSE  180

Query  1594  AFRAPVSSAIPSRHDANMNIMPESSVGV---------LQAPSTDPPKEANGCVSMNTVN-  1743
             +   P+S       +       + + G          L  PST+  K  N  VS   +  
Sbjct  181   SPSLPISRTTDFLCEGKQKESSDQAEGANEQIGEGDNLSRPSTE-DKATNPTVSERILPD  239

Query  1744  ---ASRSSDHTE------AVLWENPET-----VVTEAEVDDLQFNKAGTSCVGE----WA  1869
                 S+  D T       +  W++        +++EA +     +  G +  GE    W 
Sbjct  240   GQVQSKDKDGTNDYYGPTSFPWDDLTNLSIGGLLSEASLRATNCSTTGKTSNGETTTLWV  299

Query  1870  DSLTNISVGDLLSEA-------------PDMEDANCITSSIHSSSNYIHQIPFSCDSF--  2004
             D+LTNIS+G LLSEA             P+  +   + ++    S         CD    
Sbjct  300   DNLTNISIGGLLSEASLHGRLTSNREQEPNRSNDGLLDNNRLKVSVGGLGRSSDCDKAWS  359

Query  2005  --DAAIAAHIKKHQNVTDSQAALPSQL-SSIWGAEDTCDAFAFQRHSLSE--KVQNASKH  2169
               DA   +  +  +    +  A P +L SSI  AEDTC AF+F  +  S+       S  
Sbjct  360   RSDAGKFSVSRTDKTRGGTCEAAPCELRSSILDAEDTCHAFSFGNNLPSQWKGATTTSTT  419

Query  2170  TSLETCKQITLANTTALGASVEDLPGARNPVDG-DAATADLESVHYSPTSDVVKDFN---  2337
             T  E  + +++            L   R   +G     A  ES     +S ++ D     
Sbjct  420   TGPEGARPVSI------------LDKGRGQDEGVMKQKARSESGKQLLSSSLLFDQERSL  467

Query  2338  GLSDVYWPDSLGPLDLDIPSS  2400
             GLS + W DSLGP D+ + SS
Sbjct  468   GLSGIKWGDSLGPFDMGLSSS  488



>ref|XP_010437057.1| PREDICTED: TSL-kinase interacting protein 1 [Camelina sativa]
 ref|XP_010437058.1| PREDICTED: TSL-kinase interacting protein 1 [Camelina sativa]
Length=539

 Score =   145 bits (367),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 134/458 (29%), Positives = 194/458 (42%), Gaps = 112/458 (24%)
 Frame = +1

Query  1255  LQNSGKLKLQLFPVDDGTRRALELDNHNPYLELTLSTRKKMSSVLEHLNRKWGNSSMACG  1434
             + +SGK+KLQLFP+D  TR  LE D  +PYLELTLS+RKK+SSVL+H++ KWG+S +A G
Sbjct  87    VPSSGKMKLQLFPLDLRTREGLEKDGFHPYLELTLSSRKKISSVLQHIHSKWGSSEIALG  146

Query  1435  DLMLFPYHLHKENLVHFQKWTKDTTLTAADVYALTGSPPVFRLRYGWFSNAEVAFRAPVS  1614
             D  L+PY   K  L    KW  ++ +T   VY   G+PP+FRLRYGW S+ E     P  
Sbjct  147   DPTLYPY--DKPLLASGHKWIANSNITTGAVYEAIGAPPLFRLRYGWSSDIEYKTHEPPC  204

Query  1615  SAIPS--------RH-------------------DANMNIMPESSVGVLQAPSTD-PPKE  1710
              + P         +H                   D    ++P S+      PS + PP E
Sbjct  205   PSTPGIACFQNEEQHNNGNKVEGASFTGKQMLGLDNPFTMLPSSNQVTAMPPSENIPPDE  264

Query  1711  ANGCVSMNTVNASRSSDHTEA----VLWENPET------VVTEAEVDDLQFNKAGTSCVG  1860
                      V +  +  H E+    + W++  T      +++E  +     N   +S   
Sbjct  265   Q--------VESKDNKIHDESGPTLLFWDDGLTSLSIGGLLSEVSLKGNFGNHCKSSSAT  316

Query  1861  EWADSLTNISVGDLLSEA-----------------------------------PDMEDAN  1935
              W D+LTNIS+G L SEA                                   P  E   
Sbjct  317   LWEDNLTNISIGGLFSEASLQDRCNIKYEQEPAHYNNNGQSSGSIRGFLSEASPVGEGRF  376

Query  1936  CITSSIHSSSNYIHQ--IPFSCDSFDAAIAAHIKKHQNVTDSQAALPSQLSSIWGAEDTC  2109
                S    +   I Q  +P   DS +A +       +         PS L SI+ AEDTC
Sbjct  377   SDCSKTGETKRAIKQAPLPLISDSLNAFLENQTDHPREPCSDIPPEPSHL-SIFDAEDTC  435

Query  2110  DAFAFQRHSLSEKVQNASKHTSLETCKQITLANTTALGASVEDLPGARNPVDGDAATADL  2289
              AF+F++ +           TS +  +Q+   N  A     +D        D   A   L
Sbjct  436   HAFSFRKRTT----------TSPKVHEQV---NGKAEKEQQKD--------DSKPAKPLL  474

Query  2290  ESVHYSPTSDVVKDFNGLSDVYWPDSLGPLDLDIPSSR  2403
              S  ++  S +  +F+G   + W +S GP D  + SSR
Sbjct  475   GSTVFNQDSSL--EFSG---IKWAESRGPFDFGLSSSR  507



>tpg|DAA44326.1| TPA: hypothetical protein ZEAMMB73_008667 [Zea mays]
Length=276

 Score =   140 bits (352),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 94/246 (38%), Positives = 139/246 (57%), Gaps = 13/246 (5%)
 Frame = +1

Query  1801  VTEAEVDDLQFNKAGTSCVGEWADSLTNISVGDLLSEAPDMEDANCITSSIHSSSNYIHQ  1980
             +T+A  DD   N    S V EWAD+LTNIS G LL+EA      +C  +S+ +      +
Sbjct  34    ITQAFEDDQGMNCVAISAV-EWADTLTNISFGHLLTEASKGTHLDCGGTSVKNP--LFFE  90

Query  1981  IPFSCDSFDAAIAAHIKKHQNVTDSQAALPSQLSSIWGAEDTCDAFAFQRHSLSEKVQNA  2160
              P S DSFDAA+A H  ++Q  ++  A  P   S+IWGAE+TCD F F   +  ++  + 
Sbjct  91    NPCSYDSFDAAVALHASRYQ-ASEQSAHAPH--STIWGAEETCDEFIFNLSASRKQEGSN  147

Query  2161  SKHTSLETCKQITLANTTALGASVEDLPG---ARNPVDGDAATADLESVHYSPTSDVVKD  2331
             +  +S +T   +  +N+      +EDL G   A N  + D A  +       P +D   +
Sbjct  148   TLSSSPDTNNGVHPSNSEGFKGFLEDLAGEADADNHYNNDDAKDEEFYAKSPPRNDETNE  207

Query  2332  F--NGLSDVYWPDSLGPLDLDIPSSRYHS-ELILSDSLGGLTQLIASSLDAFQNCSFFGA  2502
                  L+D+YWPDSLGPLDLDIPS RY + ++++ DS     +L+A+SLDAF+N SFF +
Sbjct  208   LKDQSLADIYWPDSLGPLDLDIPSVRYEADDILIGDSQNSWNRLMANSLDAFRNLSFF-S  266

Query  2503  DKKEPV  2520
             DK + +
Sbjct  267   DKNDSI  272



>ref|XP_008392022.1| PREDICTED: TSL-kinase interacting protein 1 isoform X2 [Malus 
domestica]
 ref|XP_008351522.1| PREDICTED: TSL-kinase interacting protein 1-like isoform X2 [Malus 
domestica]
Length=476

 Score =   143 bits (361),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 133/433 (31%), Positives = 189/433 (44%), Gaps = 59/433 (14%)
 Frame = +1

Query  1270  KLKLQLFPVDDGTRRALELDNHNPYLELTLSTRKKMSSVLEHLNRKWGNSSMACGDLMLF  1449
             K+KLQLFPV++ TR  LE D H+PYLEL L  +KK++SVL+HLN KWGNSS+A  + +LF
Sbjct  64    KIKLQLFPVNEVTRIRLEKDGHHPYLELILRPQKKITSVLKHLNDKWGNSSVALNEPVLF  123

Query  1450  PYHLHKENLVHFQKWT-KDTTLTAADVYALTGSPPVFRLRYGWFSNAEVAFRAPVSSAIP  1626
             PY +H +++   ++WT  D  ++A  VYA  G P VFRLRYGW S+       P +SA  
Sbjct  124   PYKMH-DSMSSNRRWTLNDGDISAGAVYAAIGCPAVFRLRYGWLSSEPKGADQPSTSAND  182

Query  1627  SRHDANMNIMPESSVGV---LQAPSTDPPKEANGCVSMNTVNASRSSDHTEAVLWENPET  1797
              + +        ++  V   L   +    K+     +  T+NA            EN  T
Sbjct  183   LQSEVEQRCRSAATENVYDELGKHTVLATKDFRSINARETINADT----------ENIST  232

Query  1798  VVTEAEVDDLQFNKAGTSCVGEWADSLTNISVGDLLSEAPDMEDANCITSSIHSSSNYIH  1977
              V + + DD++      +      DS TNIS+G LLSEA      N         +   H
Sbjct  233   GVVDLK-DDIRRXMGNHTQEPLLLDSXTNISIGGLLSEASLQAKCNNSEEKQIGKNEGFH  291

Query  1978  QIPFSCDS-------------------------FDAAIAAHIKKHQNVTDSQAALPS---  2073
                   DS                          D   A  ++ +  +   Q   PS   
Sbjct  292   PTETKNDSKSFALWDCPSISIGGLLSEASMQGKLDQFYAQPVESNAGLPHPQGQRPSTHD  351

Query  2074  QLSSIWGAEDTCDAFAFQRHSLSEKVQNASKHTSLETCKQITLANTTALGASVEDLPGAR  2253
                SI+ AE+TC AF  Q+ SLS K         L         N    G+ +   P A 
Sbjct  352   SCLSIFDAEETCHAFPSQKLSLSGK-------DVLGFGGSRGGFNQNP-GSKLFKFPNAA  403

Query  2254  NPVDGDAATADLESVHYSPTSDVV-KDFN------GLSDVYWPDSLGPLDLDIPSSRYHS  2412
                + D    D  +   S T+ ++    N      GLS + W DSLGP DL +P S+   
Sbjct  404   KSNNVDGLPQDQRACQESNTALMICSRVNNDDRSLGLSGIKWTDSLGPFDLGLPVSQKLI  463

Query  2413  ELILSDSLGGLTQ  2451
                 + S+GG  +
Sbjct  464   TGESTSSIGGFVK  476



>ref|XP_008351519.1| PREDICTED: TSL-kinase interacting protein 1-like isoform X1 [Malus 
domestica]
 ref|XP_008351520.1| PREDICTED: TSL-kinase interacting protein 1-like isoform X1 [Malus 
domestica]
 ref|XP_008351521.1| PREDICTED: TSL-kinase interacting protein 1-like isoform X1 [Malus 
domestica]
Length=497

 Score =   143 bits (361),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 133/433 (31%), Positives = 189/433 (44%), Gaps = 59/433 (14%)
 Frame = +1

Query  1270  KLKLQLFPVDDGTRRALELDNHNPYLELTLSTRKKMSSVLEHLNRKWGNSSMACGDLMLF  1449
             K+KLQLFPV++ TR  LE D H+PYLEL L  +KK++SVL+HLN KWGNSS+A  + +LF
Sbjct  85    KIKLQLFPVNEVTRIRLEKDGHHPYLELILRPQKKITSVLKHLNDKWGNSSVALNEPVLF  144

Query  1450  PYHLHKENLVHFQKWT-KDTTLTAADVYALTGSPPVFRLRYGWFSNAEVAFRAPVSSAIP  1626
             PY +H +++   ++WT  D  ++A  VYA  G P VFRLRYGW S+       P +SA  
Sbjct  145   PYKMH-DSMSSNRRWTLNDGDISAGAVYAAIGCPAVFRLRYGWLSSEPKGADQPSTSAND  203

Query  1627  SRHDANMNIMPESSVGV---LQAPSTDPPKEANGCVSMNTVNASRSSDHTEAVLWENPET  1797
              + +        ++  V   L   +    K+     +  T+NA            EN  T
Sbjct  204   LQSEVEQRCRSAATENVYDELGKHTVLATKDFRSINARETINADT----------ENIST  253

Query  1798  VVTEAEVDDLQFNKAGTSCVGEWADSLTNISVGDLLSEAPDMEDANCITSSIHSSSNYIH  1977
              V + + DD++      +      DS TNIS+G LLSEA      N         +   H
Sbjct  254   GVVDLK-DDIRRXMGNHTQEPLLLDSXTNISIGGLLSEASLQAKCNNSEEKQIGKNEGFH  312

Query  1978  QIPFSCDS-------------------------FDAAIAAHIKKHQNVTDSQAALPS---  2073
                   DS                          D   A  ++ +  +   Q   PS   
Sbjct  313   PTETKNDSKSFALWDCPSISIGGLLSEASMQGKLDQFYAQPVESNAGLPHPQGQRPSTHD  372

Query  2074  QLSSIWGAEDTCDAFAFQRHSLSEKVQNASKHTSLETCKQITLANTTALGASVEDLPGAR  2253
                SI+ AE+TC AF  Q+ SLS K         L         N    G+ +   P A 
Sbjct  373   SCLSIFDAEETCHAFPSQKLSLSGK-------DVLGFGGSRGGFNQNP-GSKLFKFPNAA  424

Query  2254  NPVDGDAATADLESVHYSPTSDVV-KDFN------GLSDVYWPDSLGPLDLDIPSSRYHS  2412
                + D    D  +   S T+ ++    N      GLS + W DSLGP DL +P S+   
Sbjct  425   KSNNVDGLPQDQRACQESNTALMICSRVNNDDRSLGLSGIKWTDSLGPFDLGLPVSQKLI  484

Query  2413  ELILSDSLGGLTQ  2451
                 + S+GG  +
Sbjct  485   TGESTSSIGGFVK  497



>ref|XP_004288089.1| PREDICTED: uncharacterized protein LOC101311903 [Fragaria vesca 
subsp. vesca]
Length=468

 Score =   143 bits (360),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 124/390 (32%), Positives = 186/390 (48%), Gaps = 42/390 (11%)
 Frame = +1

Query  1270  KLKLQLFPVDDGTRRALELDNHNPYLELTLSTRKKMSSVLEHLNRKWGNSSMACGDLMLF  1449
             K+KLQLFPV++G R  L  D  +PYLELTL  RKK+SSVL HL  KWG+SS A G+L+LF
Sbjct  94    KIKLQLFPVNEGIRIGLVKDGFHPYLELTLRARKKISSVLNHLISKWGSSSAALGELVLF  153

Query  1450  PYHLHKENLVHFQKWT-KDTTLTAADVYALTGSPPVFRLRYGWFSNAEVAFRAPVSSAIP  1626
             PY + ++++   ++WT  D  + A DVYA  GSP VFRLRYGWFSN   +   P +S   
Sbjct  154   PYRI-QDSVSSNRRWTLNDGDICAGDVYAAIGSPEVFRLRYGWFSNQHKSSDKPSTSVND  212

Query  1627  SRHDANMNIMPESSVGVLQAPSTDPPKEANGCVSMNTVNASRSSDHTEAVLW--------  1782
                  +  I  ++S     A   D        V     N S     +EA L         
Sbjct  213   KVDLQSKGIKRDTSTPAENAYEVD----GKHVVVDTETNLSIGGLLSEASLQARCNNGNK  268

Query  1783  ENPETVVTEAEVDDLQFNKAGTSCVGEWADSLTNISVGDLLSEAPDMEDANCITSSIHSS  1962
              + E   T   +D     K+ +     W+D   +IS+G +LSE       N         
Sbjct  269   NHREKAKTPHPLD----KKSDSKSFELWSD-CPSISIGGILSEVSLQGKVN---------  314

Query  1963  SNYIHQIPFSCDSFDAAIAAHIKKHQNVTDSQAALPSQLSSIWGAEDTCDAFAFQRHSLS  2142
               ++ Q   S  S     +    K+ +   ++ +      SI  AE+TC AF  Q+ SL 
Sbjct  315   -RFVAQSNVSNPSLQPGHS----KYDSPQGTRQSTHDPCLSILDAEETCHAFPSQKLSLG  369

Query  2143  EKV---QNASKHTSLETCKQITLANTTALGASVEDLPGARNPVDGDAATADLESVHYSPT  2313
             + V     +   +S  +  ++      A    +++LP  ++P   ++ T   E +++S  
Sbjct  370   KDVLGFDGSCGGSSQNSGFKLFKFPLPAKANRLDELP--QDPAQQESNT---ERMNFSYM  424

Query  2314  SDVVKDFNGLSDVYWPDSLGPLDLDIPSSR  2403
             ++  +   GLS + W DSLGP DL +P S+
Sbjct  425   NNDERSL-GLSGIKWTDSLGPFDLGLPVSQ  453



>ref|XP_002868902.1| hypothetical protein ARALYDRAFT_490714 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH45161.1| hypothetical protein ARALYDRAFT_490714 [Arabidopsis lyrata subsp. 
lyrata]
Length=520

 Score =   143 bits (361),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 140/453 (31%), Positives = 200/453 (44%), Gaps = 106/453 (23%)
 Frame = +1

Query  1228  LHNSFNETNLQNSGKLKLQLFPVDDGTRRALELDNHNPYLELTLSTRKKMSSVLEHLNRK  1407
             LH+S     +Q SGK+KLQLFP+D  TR  LE D  +PYLELTLS+RKK+SSVL+ ++ K
Sbjct  81    LHSS---KEVQRSGKMKLQLFPLDAHTREGLEKDGLHPYLELTLSSRKKISSVLQRIHSK  137

Query  1408  WGNSSMACGDLMLFPYHLHKENLVHFQKWTKDTTLTAADVYALTGSPPVFRLRYGWFSNA  1587
             WG+S +A GD  L+PY   K  L    KW  ++ +T  DVY   G+P +FRLRYGW    
Sbjct  138   WGSSEIARGDPTLYPY--DKSVLASGHKWVANSNITTGDVYEAIGAPFLFRLRYGWSFAT  195

Query  1588  EVAFRAPVSSAIPSRHDANMNIMPESSVGVLQAPS--TD-PPKE---ANGCVSMNTVNAS  1749
             E     P S + P           E+ + ++ +P+  TD PP E    +G V  +T N  
Sbjct  196   ENKNNEPPSPSTPGT--GKQMCGSENPLTMMSSPNQVTDTPPLENLPPDGQVE-STENKI  252

Query  1750  RSSDHTEAVLWENPET------VVTEAEVDDLQFN-----KAGTSCVGEWADSLTNISVG  1896
                     + W++  T      +++E  +     N      AG +    W D+LTNIS+G
Sbjct  253   NDGSGPTLLFWDDGLTSLSIGGLLSEVSLKGNFGNHCINSNAGNANATLWEDNLTNISIG  312

Query  1897  DLLSEAP------------------DMEDANCITSSIHSSSNY-----------------  1971
              L SEA                   D + +  I   +  +S+                  
Sbjct  313   GLFSEASLQDRCHMNHEQEPAHNNNDGQTSGSIGGLLSEASSLGEGRFSDCNKTWETRRA  372

Query  1972  IHQIPFSC--DSFDAAIAAHIKKHQNVTDSQAALPSQL-----SSIWGAEDTCDAFAF-Q  2127
             I Q P     DS DA +         V  ++A  P+ L     SSI  A+DTC AF+F +
Sbjct  373   IKQPPLHLISDSLDAFL---------VNQTRAPCPAPLPEPSHSSILDADDTCHAFSFRK  423

Query  2128  RHSLSEKVQN-ASKHTSLETCKQITLANTTALGASVEDLPGARNPVDGDAATADLESVHY  2304
             R ++  KV +  S     E  K  +      LG+SV          + D++         
Sbjct  424   RTTIIPKVHDQVSGEAEKEQQKDESNPAKPLLGSSV---------FNQDSSL--------  466

Query  2305  SPTSDVVKDFNGLSDVYWPDSLGPLDLDIPSSR  2403
                        GLS + W +S GP D  + SSR
Sbjct  467   -----------GLSGIKWAESRGPFDFGLSSSR  488



>ref|XP_008392019.1| PREDICTED: TSL-kinase interacting protein 1 isoform X1 [Malus 
domestica]
 ref|XP_008392020.1| PREDICTED: TSL-kinase interacting protein 1 isoform X1 [Malus 
domestica]
 ref|XP_008392021.1| PREDICTED: TSL-kinase interacting protein 1 isoform X1 [Malus 
domestica]
Length=497

 Score =   143 bits (360),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 133/433 (31%), Positives = 189/433 (44%), Gaps = 59/433 (14%)
 Frame = +1

Query  1270  KLKLQLFPVDDGTRRALELDNHNPYLELTLSTRKKMSSVLEHLNRKWGNSSMACGDLMLF  1449
             K+KLQLFPV++ TR  LE D H+PYLEL L  +KK++SVL+HLN KWGNSS+A  + +LF
Sbjct  85    KIKLQLFPVNEVTRIRLEKDGHHPYLELILRPQKKITSVLKHLNDKWGNSSVALNEPVLF  144

Query  1450  PYHLHKENLVHFQKWT-KDTTLTAADVYALTGSPPVFRLRYGWFSNAEVAFRAPVSSAIP  1626
             PY +H +++   ++WT  D  ++A  VYA  G P VFRLRYGW S+       P +SA  
Sbjct  145   PYKMH-DSMSSNRRWTLNDGDISAGAVYAAIGCPAVFRLRYGWLSSEPKGADQPSTSAND  203

Query  1627  SRHDANMNIMPESSVGV---LQAPSTDPPKEANGCVSMNTVNASRSSDHTEAVLWENPET  1797
              + +        ++  V   L   +    K+     +  T+NA            EN  T
Sbjct  204   LQSEVEQRCRSAATENVYDELGKHTVLATKDFRSINARETINADT----------ENIST  253

Query  1798  VVTEAEVDDLQFNKAGTSCVGEWADSLTNISVGDLLSEAPDMEDANCITSSIHSSSNYIH  1977
              V + + DD++      +      DS TNIS+G LLSEA      N         +   H
Sbjct  254   GVVDLK-DDIRRXMGNHTQEPLLLDSXTNISIGGLLSEASLQAKCNNSEEKQIGKNEGFH  312

Query  1978  QIPFSCDS-------------------------FDAAIAAHIKKHQNVTDSQAALPS---  2073
                   DS                          D   A  ++ +  +   Q   PS   
Sbjct  313   PTETKNDSKSFALWDCPSISIGGLLSEASMQGKLDQFYAQPVESNAGLPHPQGQRPSTHD  372

Query  2074  QLSSIWGAEDTCDAFAFQRHSLSEKVQNASKHTSLETCKQITLANTTALGASVEDLPGAR  2253
                SI+ AE+TC AF  Q+ SLS K         L         N    G+ +   P A 
Sbjct  373   SCLSIFDAEETCHAFPSQKLSLSGK-------DVLGFGGSRGGFNQNP-GSKLFKFPNAA  424

Query  2254  NPVDGDAATADLESVHYSPTSDVV-KDFN------GLSDVYWPDSLGPLDLDIPSSRYHS  2412
                + D    D  +   S T+ ++    N      GLS + W DSLGP DL +P S+   
Sbjct  425   KSNNVDGLPQDQRACQESNTALMICSRVNNDDRSLGLSGIKWTDSLGPFDLGLPVSQKLI  484

Query  2413  ELILSDSLGGLTQ  2451
                 + S+GG  +
Sbjct  485   TGESTSSIGGFVK  497



>ref|XP_010446477.1| PREDICTED: TSL-kinase interacting protein 1-like isoform X2 [Camelina 
sativa]
Length=549

 Score =   143 bits (360),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 131/450 (29%), Positives = 189/450 (42%), Gaps = 96/450 (21%)
 Frame = +1

Query  1255  LQNSGKLKLQLFPVDDGTRRALELDNHNPYLELTLSTRKKMSSVLEHLNRKWGNSSMACG  1434
             + +SGK+KLQLFP+D  TR  LE D  +PYLELTLS+RKK+SSVL+H++ KWG+S +A G
Sbjct  90    VPSSGKMKLQLFPLDLRTREGLEKDGFHPYLELTLSSRKKISSVLQHIHSKWGSSEIALG  149

Query  1435  DLMLFPYHLHKENLVHFQKWTKDTTLTAADVYALTGSPPVFRLRYGWFSNAEVAFRAPVS  1614
             D  L+PY   K  L    KW  ++ +T   VY   G+PP+FRLRYGW S+ E     P  
Sbjct  150   DPTLYPY--DKPLLASGHKWIANSNITTGAVYEAIGAPPLFRLRYGWSSDIEHKTHEPPC  207

Query  1615  SAIPS-------RHDANMNIMPESSVGVLQAPSTDPP----KEANGCVSM---------N  1734
              + P            N N +  +S    Q    D P      +N   +M          
Sbjct  208   PSTPGIACFQNEELHNNGNKVEGASFTGKQMLGLDNPITMLSSSNQVTAMPPSENIPTDE  267

Query  1735  TVNASRSSDHTEA----VLWENPET------VVTEAEVDDLQFNKAGTSCVGEWADSLTN  1884
              V +  +  H E+    + W++  T      +++E  +     N + +S    W D+LTN
Sbjct  268   QVESKDNKIHDESGPTLLFWDDGLTSLSIGGLLSEVSLKGNFGNHSKSSNATLWEDNLTN  327

Query  1885  ISVGDLLSEA-----------------------------------PDMEDANCITSSIHS  1959
             IS+G L SEA                                   P  E      S    
Sbjct  328   ISIGGLFSEASLQDRCNIKHQQEPAHYNNNGQSSGSIGGFLSEASPVGEGKISDCSKTWE  387

Query  1960  SSNYIHQ--IPFSCDSFDAAIAAHIKKHQNVTDSQAALPSQLSSIWGAEDTCDAFAFQRH  2133
             +   I Q  +P   DS +A +     + +         PS L SI+ AEDTC AF+F++ 
Sbjct  388   TKRAIQQAPLPLISDSLNAFLDNQTDRPRIPCSDIPPEPSHL-SIFDAEDTCHAFSFRKR  446

Query  2134  SLSEKVQNASKHTSLETCKQITLANTTALGASVEDLPGARNPVDGDAATADLESVHYSPT  2313
             +           TS +  +Q+   N  A     +D      P+ G        S+     
Sbjct  447   TT----------TSPKVHEQV---NGKAEKEQQKDDSKPAKPLFGSTVFNQDSSL-----  488

Query  2314  SDVVKDFNGLSDVYWPDSLGPLDLDIPSSR  2403
                     G S + W +S GP D  + SSR
Sbjct  489   --------GFSGIKWAESRGPFDFGLSSSR  510



>ref|XP_010446476.1| PREDICTED: TSL-kinase interacting protein 1-like isoform X1 [Camelina 
sativa]
Length=550

 Score =   143 bits (360),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 131/450 (29%), Positives = 189/450 (42%), Gaps = 96/450 (21%)
 Frame = +1

Query  1255  LQNSGKLKLQLFPVDDGTRRALELDNHNPYLELTLSTRKKMSSVLEHLNRKWGNSSMACG  1434
             + +SGK+KLQLFP+D  TR  LE D  +PYLELTLS+RKK+SSVL+H++ KWG+S +A G
Sbjct  91    VPSSGKMKLQLFPLDLRTREGLEKDGFHPYLELTLSSRKKISSVLQHIHSKWGSSEIALG  150

Query  1435  DLMLFPYHLHKENLVHFQKWTKDTTLTAADVYALTGSPPVFRLRYGWFSNAEVAFRAPVS  1614
             D  L+PY   K  L    KW  ++ +T   VY   G+PP+FRLRYGW S+ E     P  
Sbjct  151   DPTLYPY--DKPLLASGHKWIANSNITTGAVYEAIGAPPLFRLRYGWSSDIEHKTHEPPC  208

Query  1615  SAIPS-------RHDANMNIMPESSVGVLQAPSTDPP----KEANGCVSM---------N  1734
              + P            N N +  +S    Q    D P      +N   +M          
Sbjct  209   PSTPGIACFQNEELHNNGNKVEGASFTGKQMLGLDNPITMLSSSNQVTAMPPSENIPTDE  268

Query  1735  TVNASRSSDHTEA----VLWENPET------VVTEAEVDDLQFNKAGTSCVGEWADSLTN  1884
              V +  +  H E+    + W++  T      +++E  +     N + +S    W D+LTN
Sbjct  269   QVESKDNKIHDESGPTLLFWDDGLTSLSIGGLLSEVSLKGNFGNHSKSSNATLWEDNLTN  328

Query  1885  ISVGDLLSEA-----------------------------------PDMEDANCITSSIHS  1959
             IS+G L SEA                                   P  E      S    
Sbjct  329   ISIGGLFSEASLQDRCNIKHQQEPAHYNNNGQSSGSIGGFLSEASPVGEGKISDCSKTWE  388

Query  1960  SSNYIHQ--IPFSCDSFDAAIAAHIKKHQNVTDSQAALPSQLSSIWGAEDTCDAFAFQRH  2133
             +   I Q  +P   DS +A +     + +         PS L SI+ AEDTC AF+F++ 
Sbjct  389   TKRAIQQAPLPLISDSLNAFLDNQTDRPRIPCSDIPPEPSHL-SIFDAEDTCHAFSFRKR  447

Query  2134  SLSEKVQNASKHTSLETCKQITLANTTALGASVEDLPGARNPVDGDAATADLESVHYSPT  2313
             +           TS +  +Q+   N  A     +D      P+ G        S+     
Sbjct  448   TT----------TSPKVHEQV---NGKAEKEQQKDDSKPAKPLFGSTVFNQDSSL-----  489

Query  2314  SDVVKDFNGLSDVYWPDSLGPLDLDIPSSR  2403
                     G S + W +S GP D  + SSR
Sbjct  490   --------GFSGIKWAESRGPFDFGLSSSR  511



>ref|XP_011100920.1| PREDICTED: TSL-kinase interacting protein 1 isoform X2 [Sesamum 
indicum]
Length=470

 Score =   142 bits (358),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 90/226 (40%), Positives = 129/226 (57%), Gaps = 19/226 (8%)
 Frame = +1

Query  1264  SGKLKLQLFPVDDGTRRALELDNHNPYLELTLSTRKKMSSVLEHLNRKWGNSSMACGDLM  1443
             S K+KLQLFP+++ TR  LE D +NP+LELTLS RK++SSV  HLN KWG+SS+A G L+
Sbjct  59    SAKIKLQLFPINEQTRLGLEKDGYNPFLELTLSARKRISSVARHLNTKWGSSSVAIGQLV  118

Query  1444  LFPYHLHKENLVHFQKWT-KDTTLTAADVYALTGSPPVFRLRYGWFSNA--EVAFRAPVS  1614
             LFPY++  E +   ++WT  D  +TA +VY   G P  FRLRY W+SN   E+    P +
Sbjct  119   LFPYNIKLEQVASCRRWTSNDNAITAWEVYVDVGRPSFFRLRYAWYSNLQHEIFHIPPKA  178

Query  1615  SAIPSRHDANMNIMPESSVGVLQAPSTDPPKEANGCVS---MNTVNASRSSDHTEAVL--  1779
             S + +  D+       S+  VL+  S    K    C +   +  VN + +SD  E     
Sbjct  179   SLLEAHTDSEGRRRGCST--VLEISSYQKGKLDVSCETIQQLTNVNEALTSDVNELKPLD  236

Query  1780  --WENPETVVTEAEVDDLQFNKAGTSCVGEWADSLTNISVGDLLSE  1911
               ++ P+  +   +VD +       S V  W D+LTN+S+G LLSE
Sbjct  237   GSYDLPDDAMMRTDVDPI------YSTV-PWDDNLTNLSIGGLLSE  275



>ref|XP_010446478.1| PREDICTED: TSL-kinase interacting protein 1-like isoform X3 [Camelina 
sativa]
 ref|XP_010446479.1| PREDICTED: TSL-kinase interacting protein 1-like isoform X3 [Camelina 
sativa]
Length=546

 Score =   142 bits (359),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 131/450 (29%), Positives = 189/450 (42%), Gaps = 96/450 (21%)
 Frame = +1

Query  1255  LQNSGKLKLQLFPVDDGTRRALELDNHNPYLELTLSTRKKMSSVLEHLNRKWGNSSMACG  1434
             + +SGK+KLQLFP+D  TR  LE D  +PYLELTLS+RKK+SSVL+H++ KWG+S +A G
Sbjct  87    VPSSGKMKLQLFPLDLRTREGLEKDGFHPYLELTLSSRKKISSVLQHIHSKWGSSEIALG  146

Query  1435  DLMLFPYHLHKENLVHFQKWTKDTTLTAADVYALTGSPPVFRLRYGWFSNAEVAFRAPVS  1614
             D  L+PY   K  L    KW  ++ +T   VY   G+PP+FRLRYGW S+ E     P  
Sbjct  147   DPTLYPY--DKPLLASGHKWIANSNITTGAVYEAIGAPPLFRLRYGWSSDIEHKTHEPPC  204

Query  1615  SAIPS-------RHDANMNIMPESSVGVLQAPSTDPP----KEANGCVSM---------N  1734
              + P            N N +  +S    Q    D P      +N   +M          
Sbjct  205   PSTPGIACFQNEELHNNGNKVEGASFTGKQMLGLDNPITMLSSSNQVTAMPPSENIPTDE  264

Query  1735  TVNASRSSDHTEA----VLWENPET------VVTEAEVDDLQFNKAGTSCVGEWADSLTN  1884
              V +  +  H E+    + W++  T      +++E  +     N + +S    W D+LTN
Sbjct  265   QVESKDNKIHDESGPTLLFWDDGLTSLSIGGLLSEVSLKGNFGNHSKSSNATLWEDNLTN  324

Query  1885  ISVGDLLSEA-----------------------------------PDMEDANCITSSIHS  1959
             IS+G L SEA                                   P  E      S    
Sbjct  325   ISIGGLFSEASLQDRCNIKHQQEPAHYNNNGQSSGSIGGFLSEASPVGEGKISDCSKTWE  384

Query  1960  SSNYIHQ--IPFSCDSFDAAIAAHIKKHQNVTDSQAALPSQLSSIWGAEDTCDAFAFQRH  2133
             +   I Q  +P   DS +A +     + +         PS L SI+ AEDTC AF+F++ 
Sbjct  385   TKRAIQQAPLPLISDSLNAFLDNQTDRPRIPCSDIPPEPSHL-SIFDAEDTCHAFSFRKR  443

Query  2134  SLSEKVQNASKHTSLETCKQITLANTTALGASVEDLPGARNPVDGDAATADLESVHYSPT  2313
             +           TS +  +Q+   N  A     +D      P+ G        S+     
Sbjct  444   TT----------TSPKVHEQV---NGKAEKEQQKDDSKPAKPLFGSTVFNQDSSL-----  485

Query  2314  SDVVKDFNGLSDVYWPDSLGPLDLDIPSSR  2403
                     G S + W +S GP D  + SSR
Sbjct  486   --------GFSGIKWAESRGPFDFGLSSSR  507



>ref|XP_011100921.1| PREDICTED: TSL-kinase interacting protein 1 isoform X3 [Sesamum 
indicum]
Length=454

 Score =   141 bits (356),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 90/226 (40%), Positives = 129/226 (57%), Gaps = 19/226 (8%)
 Frame = +1

Query  1264  SGKLKLQLFPVDDGTRRALELDNHNPYLELTLSTRKKMSSVLEHLNRKWGNSSMACGDLM  1443
             S K+KLQLFP+++ TR  LE D +NP+LELTLS RK++SSV  HLN KWG+SS+A G L+
Sbjct  59    SAKIKLQLFPINEQTRLGLEKDGYNPFLELTLSARKRISSVARHLNTKWGSSSVAIGQLV  118

Query  1444  LFPYHLHKENLVHFQKWT-KDTTLTAADVYALTGSPPVFRLRYGWFSNA--EVAFRAPVS  1614
             LFPY++  E +   ++WT  D  +TA +VY   G P  FRLRY W+SN   E+    P +
Sbjct  119   LFPYNIKLEQVASCRRWTSNDNAITAWEVYVDVGRPSFFRLRYAWYSNLQHEIFHIPPKA  178

Query  1615  SAIPSRHDANMNIMPESSVGVLQAPSTDPPKEANGCVS---MNTVNASRSSDHTEAVL--  1779
             S + +  D+       S+  VL+  S    K    C +   +  VN + +SD  E     
Sbjct  179   SLLEAHTDSEGRRRGCST--VLEISSYQKGKLDVSCETIQQLTNVNEALTSDVNELKPLD  236

Query  1780  --WENPETVVTEAEVDDLQFNKAGTSCVGEWADSLTNISVGDLLSE  1911
               ++ P+  +   +VD +       S V  W D+LTN+S+G LLSE
Sbjct  237   GSYDLPDDAMMRTDVDPIY------STV-PWDDNLTNLSIGGLLSE  275



>ref|XP_011100918.1| PREDICTED: TSL-kinase interacting protein 1 isoform X1 [Sesamum 
indicum]
 ref|XP_011100919.1| PREDICTED: TSL-kinase interacting protein 1 isoform X1 [Sesamum 
indicum]
Length=505

 Score =   141 bits (356),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 90/226 (40%), Positives = 129/226 (57%), Gaps = 19/226 (8%)
 Frame = +1

Query  1264  SGKLKLQLFPVDDGTRRALELDNHNPYLELTLSTRKKMSSVLEHLNRKWGNSSMACGDLM  1443
             S K+KLQLFP+++ TR  LE D +NP+LELTLS RK++SSV  HLN KWG+SS+A G L+
Sbjct  59    SAKIKLQLFPINEQTRLGLEKDGYNPFLELTLSARKRISSVARHLNTKWGSSSVAIGQLV  118

Query  1444  LFPYHLHKENLVHFQKWT-KDTTLTAADVYALTGSPPVFRLRYGWFSNA--EVAFRAPVS  1614
             LFPY++  E +   ++WT  D  +TA +VY   G P  FRLRY W+SN   E+    P +
Sbjct  119   LFPYNIKLEQVASCRRWTSNDNAITAWEVYVDVGRPSFFRLRYAWYSNLQHEIFHIPPKA  178

Query  1615  SAIPSRHDANMNIMPESSVGVLQAPSTDPPKEANGCVS---MNTVNASRSSDHTEAVL--  1779
             S + +  D+       S+  VL+  S    K    C +   +  VN + +SD  E     
Sbjct  179   SLLEAHTDSEGRRRGCST--VLEISSYQKGKLDVSCETIQQLTNVNEALTSDVNELKPLD  236

Query  1780  --WENPETVVTEAEVDDLQFNKAGTSCVGEWADSLTNISVGDLLSE  1911
               ++ P+  +   +VD +       S V  W D+LTN+S+G LLSE
Sbjct  237   GSYDLPDDAMMRTDVDPI------YSTV-PWDDNLTNLSIGGLLSE  275



>ref|XP_006357346.1| PREDICTED: uncharacterized protein LOC102603768 isoform X1 [Solanum 
tuberosum]
 ref|XP_006357347.1| PREDICTED: uncharacterized protein LOC102603768 isoform X2 [Solanum 
tuberosum]
 ref|XP_006357348.1| PREDICTED: uncharacterized protein LOC102603768 isoform X3 [Solanum 
tuberosum]
Length=525

 Score =   141 bits (356),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 82/225 (36%), Positives = 125/225 (56%), Gaps = 10/225 (4%)
 Frame = +1

Query  1255  LQNSGKLKLQLFPVDDGTRRALELDNHNPYLELTLSTRKKMSSVLEHLNRKWGNSSMACG  1434
             L +  K+KLQLFP++  TR+ LE D  NP+ ELTLS +KK+SSV++HLN KW ++S+  G
Sbjct  89    LNSCKKIKLQLFPINKSTRQRLEKDGCNPFQELTLSAQKKISSVIKHLNTKWSSTSLGLG  148

Query  1435  DLMLFPYHLHKENLVHFQKW-TKDTTLTAADVYALTGSPPVFRLRYGWFSNAEV-AFRAP  1608
             +L+LFPY  + EN+   ++W +KDT ++A +VYA  GSP +FRLRY WFS+ ++  F  P
Sbjct  149   ELLLFPYDTYTENITSQKRWSSKDTNVSAGEVYAAIGSPAIFRLRYDWFSDLKLKTFEVP  208

Query  1609  VSSAIPSRHDANMNIMPESSVGVLQAPSTDPPKEANGCVSMNTVNASRSSDHTEAVLWEN  1788
              SS       + M+     +  +  A       +  G    N        ++  A + EN
Sbjct  209   DSS-----QPSGMHSQSRGNKRIFAAAMDSANDKVEGAKLKNEELIKPICNNEHANVTEN  263

Query  1789  PE---TVVTEAEVDDLQFNKAGTSCVGEWADSLTNISVGDLLSEA  1914
                   +  +  VD+++     +     W D LTN+S+G L SEA
Sbjct  264   QNMALNIPVDHMVDEVRKQNVLSKMDNPWNDILTNLSIGGLFSEA  308



>tpg|DAA51642.1| TPA: putative MYB DNA-binding domain superfamily protein [Zea 
mays]
Length=309

 Score =   136 bits (342),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 81/165 (49%), Positives = 103/165 (62%), Gaps = 24/165 (15%)
 Frame = +1

Query  427  QQPVKRQTRKWAAWTREEEESFFSALRHVGKNFEKITSRVQSKNKDQVRHYYYRLVRRMN  606
            ++P K QTR+WAAWT +EEE FF+ALR VGKNF+KIT RVQSKNKDQV HYYYRLVRRM 
Sbjct  60   RKPAKNQTRQWAAWTHQEEEIFFNALRQVGKNFDKITHRVQSKNKDQVSHYYYRLVRRMK  119

Query  607  KLLGPELCLNAKNSRDTNAAMLR---WWSLLEKYSCKASKLHLKPRRF-----------K  744
            KLLGP   L+AKNS+DT AAMLR   +W+  E             R+F           +
Sbjct  120  KLLGPRFSLDAKNSKDTIAAMLRCLEYWA-FEMVVPSGISFRSNTRKFSFVSQIVSDAMR  178

Query  745  IFIE-------TLENQLL-KDRKKNVRRCFSQGENTSTAPISVSN  855
            +F+E       + EN++  K  + +VR+ F  G N + A +SV N
Sbjct  179  LFLEDANSPQASHENEIFAKYVEDSVRKAFLHG-NLALADVSVIN  222



>ref|XP_009623564.1| PREDICTED: TSL-kinase interacting protein 1 [Nicotiana tomentosiformis]
 ref|XP_009623565.1| PREDICTED: TSL-kinase interacting protein 1 [Nicotiana tomentosiformis]
 ref|XP_009623566.1| PREDICTED: TSL-kinase interacting protein 1 [Nicotiana tomentosiformis]
 ref|XP_009623567.1| PREDICTED: TSL-kinase interacting protein 1 [Nicotiana tomentosiformis]
Length=597

 Score =   139 bits (349),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 83/217 (38%), Positives = 117/217 (54%), Gaps = 11/217 (5%)
 Frame = +1

Query  1270  KLKLQLFPVDDGTRRALELDNHNPYLELTLSTRKKMSSVLEHLNRKWGNSSMACGDLMLF  1449
             K+KLQLFP++   R+ LE D  NP+ ELTLST KK+SSV++HLN KW +SS+  G+L LF
Sbjct  90    KIKLQLFPINKSIRQRLEKDGCNPFQELTLSTHKKISSVIKHLNTKWNSSSVRLGELFLF  149

Query  1450  PYHLHKENLVHFQKW-TKDTTLTAADVYALTGSPPVFRLRYGWFSNAEV-AFRAPVSSAI  1623
             PY+++ ENL   ++W +KDT + A  VYA   SP +FRLRYGWFS+ ++ A   P  S  
Sbjct  150   PYNINTENLASEKRWSSKDTNVYAGQVYAAIESPAIFRLRYGWFSDVKLKASEVPDISPP  209

Query  1624  PSRHDANMNIMPESSVGVLQAPSTDPPKEANGCVSMNTVNASRSSDHTEAVLWENPETVV  1803
                H  +  I        + A + D   +      +     S+     E  +   P  + 
Sbjct  210   SGTHSQSRGIK------RIFAAAMDIGNDKVEGAKLKNEELSKPICMNEQKM---PLNIP  260

Query  1804  TEAEVDDLQFNKAGTSCVGEWADSLTNISVGDLLSEA  1914
              +  VD  +        V  W D  TN+S+G LLSEA
Sbjct  261   VDNMVDGARKQNVPAKMVSPWDDIFTNLSIGGLLSEA  297



>ref|XP_010431906.1| PREDICTED: TSL-kinase interacting protein 1-like [Camelina sativa]
 ref|XP_010431907.1| PREDICTED: TSL-kinase interacting protein 1-like [Camelina sativa]
Length=538

 Score =   138 bits (347),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 115/367 (31%), Positives = 160/367 (44%), Gaps = 72/367 (20%)
 Frame = +1

Query  1255  LQNSGKLKLQLFPVDDGTRRALELDNHNPYLELTLSTRKKMSSVLEHLNRKWGNSSMACG  1434
             + +SGK+KLQLFP+D  TR  LE D  +PYLELTLS+RKK+SSVL+H++ KWG+S +A G
Sbjct  87    VPSSGKMKLQLFPLDVRTREGLEKDGFHPYLELTLSSRKKISSVLQHIHSKWGSSEIALG  146

Query  1435  DLMLFPYHLHKENLVHFQKWTKDTTLTAADVYALTGSPPVFRLRYGWFSNAEVAFRAPVS  1614
             D  L+PY   K  L    KW  ++ +T   VY   G+PP+FRLRYGW S+ E     P  
Sbjct  147   DPTLYPY--DKPLLASGHKWIANSNITTGAVYEAIGAPPLFRLRYGWSSDIERKTHEPPC  204

Query  1615  SAIPS--------RHDANMNIMPESSVGVLQAPSTDPP----KEANGCVSMNTVNASRSS  1758
              + P          H+ N N +  +S    Q    D P      +N    M       + 
Sbjct  205   PSTPGIACFQNEELHN-NGNKVEGASFTGKQMLGLDNPLTMLSSSNQVTGMPPSENIPTD  263

Query  1759  DHTEA------------VLWENPET------VVTEAEVDDLQFNKAGTSCVGEWADSLTN  1884
             +  E+            + W++  T      +++E  +     N    S    W D+LTN
Sbjct  264   EQVESDNKIHDESGPTLLFWDDGLTSLSIGGLLSEVSLKVNFGNHCKNSNATLWEDNLTN  323

Query  1885  ISVGDLLSEA-----------------------------------PDMEDANCITSSIHS  1959
             IS+G L SEA                                   P  E      S    
Sbjct  324   ISIGGLFSEASLQDRCNIKHQQEPAHYNNNGQSSGSIGGFLSEPSPVGEGRFSDCSKTGE  383

Query  1960  SSNYIHQ--IPFSCDSFDAAIAAHIKKHQNVTDSQAALPSQLSSIWGAEDTCDAFAF-QR  2130
             +   I Q  +P   DS +A +       +         PS L SI+ AEDTC AF+F +R
Sbjct  384   TKRAIKQAPVPLISDSLNAFLENQTDHPREPCSDIPPEPSHL-SIFDAEDTCHAFSFRKR  442

Query  2131  HSLSEKV  2151
              + S KV
Sbjct  443   TTTSPKV  449



>tpg|DAA51643.1| TPA: putative MYB DNA-binding domain superfamily protein [Zea 
mays]
Length=412

 Score =   137 bits (344),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 81/165 (49%), Positives = 103/165 (62%), Gaps = 24/165 (15%)
 Frame = +1

Query  427  QQPVKRQTRKWAAWTREEEESFFSALRHVGKNFEKITSRVQSKNKDQVRHYYYRLVRRMN  606
            ++P K QTR+WAAWT +EEE FF+ALR VGKNF+KIT RVQSKNKDQV HYYYRLVRRM 
Sbjct  163  RKPAKNQTRQWAAWTHQEEEIFFNALRQVGKNFDKITHRVQSKNKDQVSHYYYRLVRRMK  222

Query  607  KLLGPELCLNAKNSRDTNAAMLR---WWSLLEKYSCKASKLHLKPRRF-----------K  744
            KLLGP   L+AKNS+DT AAMLR   +W+  E             R+F           +
Sbjct  223  KLLGPRFSLDAKNSKDTIAAMLRCLEYWA-FEMVVPSGISFRSNTRKFSFVSQIVSDAMR  281

Query  745  IFIE-------TLENQLL-KDRKKNVRRCFSQGENTSTAPISVSN  855
            +F+E       + EN++  K  + +VR+ F  G N + A +SV N
Sbjct  282  LFLEDANSPQASHENEIFAKYVEDSVRKAFLHG-NLALADVSVIN  325


 Score =   136 bits (342),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 68/99 (69%), Positives = 77/99 (78%), Gaps = 3/99 (3%)
 Frame = +1

Query  397  LASFEEHSALQQPVKRQTRKWAAWTREEEESFFSALRHVGKNFEKITSRVQSKNKDQVRH  576
            LA    HS  Q+  K QTR+WAAWT +EEE FF+ALR VGKNF+KIT RVQSKNKDQV H
Sbjct  49   LADLAPHS--QEAAKNQTRQWAAWTHQEEEIFFNALRQVGKNFDKITHRVQSKNKDQVSH  106

Query  577  YYYRLVRRMNKLLGPELCLNAKNSRDTNAAMLR-WWSLL  690
            YYYRLVRRM KLLGP   L+AKNS+DT AAMLR +W  +
Sbjct  107  YYYRLVRRMKKLLGPRFSLDAKNSKDTIAAMLRCYWVYM  145



>ref|XP_009109472.1| PREDICTED: uncharacterized protein LOC103835124 [Brassica rapa]
Length=532

 Score =   137 bits (345),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 85/225 (38%), Positives = 119/225 (53%), Gaps = 25/225 (11%)
 Frame = +1

Query  1255  LQNSGKLKLQLFPVDDGTRRALELDNHNPYLELTLSTRKKMSSVLEHLNRKWGNSSMACG  1434
             ++  GK+KLQLFPVD  TR+ LE D  +PYLELTLS+RKK+ SVL+H++ KWG+S +A G
Sbjct  90    VRRCGKMKLQLFPVDAHTRQGLEKDGFHPYLELTLSSRKKVFSVLQHIHSKWGSSEIARG  149

Query  1435  DLMLFPYHLHKENLVHFQKWTKDTTLTAADVYALTGSPPVFRLRYGWFSNAEVAFRAPVS  1614
             D  L+PY   K  L    KWT D+++T  DVY   G+P +FRLRYGW S        P S
Sbjct  150   DPTLYPY--DKSRLTSGLKWTPDSSITIRDVYVAVGAPSLFRLRYGWSSELCNKTNEPPS  207

Query  1615  SAIPSRHDANMNIMPESSVGVLQAPSTDPP-----KEANGCVSMNTVNASRSSDHTEAVL  1779
              + P               G+   P+ +P      K  NG       N ++ +D   +  
Sbjct  208   PSTP---------------GITCFPNVEPQNIFCDKRENGKQMFGLENLTQVTDPPLSA-  251

Query  1780  WENPETVVTEAEVDDLQFNKAGTSCVGEWADSLTNISVGDLLSEA  1914
                P     E+  +    N +G +   +W D LT++S+G LLSE 
Sbjct  252   -NTPPDGPVESAAEKKINNGSGPTFF-QWDDGLTSLSIGGLLSEV  294



>emb|CDX90330.1| BnaA08g16540D [Brassica napus]
Length=497

 Score =   137 bits (344),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 136/477 (29%), Positives = 202/477 (42%), Gaps = 102/477 (21%)
 Frame = +1

Query  1129  RTTTDKEDGHFQDSNVRNVFEHSGKDPHVFPD--------LLHNSFNETNLQNSGKLKLQ  1284
             +TTT K     +D  + N      K P   PD         LH+   +  ++  GK+KLQ
Sbjct  30    KTTTKKVQ---KDDRLHNSKREKRKSPSDSPDGAQQVPVLALHS---DKEVRRCGKMKLQ  83

Query  1285  LFPVDDGTRRALELDNHNPYLELTLSTRKKMSSVLEHLNRKWGNSSMACGDLMLFPYHLH  1464
             LFPVD  TR+ LE D  +PYLELTLS+RKK+SSVL+H++ KWG+S +A GD  L+P+   
Sbjct  84    LFPVDAHTRQGLEKDGFHPYLELTLSSRKKVSSVLQHIHCKWGSSDIARGDPTLYPFD--  141

Query  1465  KENLVHFQKWTKDTTLTAADVYALTGSPPVFRLRYGWFSNAEVAFRAPVSSAIPSRHDAN  1644
              ++     KWT ++++T  DVY   G+P +FRLRYGW S        P S + P      
Sbjct  142   -QSSSSGPKWTPNSSITIKDVYVAIGAPSLFRLRYGWSSETCNKTDEPPSPSTPKNGKQM  200

Query  1645  MNIMPESSVGVLQAPSTDPP----KEANGCVSMNTVNASRSSDHTEAVLWENPET-----  1797
               +   + V       TDPP       +G V         +        W++  T     
Sbjct  201   FGLDNLTQV-------TDPPLSEHTPPDGPVESAAEKKINNGSGPTFFQWDDGLTSLSIG  253

Query  1798  -VVTEAEVDDLQFNKAGTSCVGE--WADSLTNISVGDLLSEAPDMEDANCITSSIHSSSN  1968
              +++E  +     N +  S      W ++LTNIS+G L SEA  ++      +S H++S 
Sbjct  254   GLLSEVSLKGNFGNGSKNSNANPTLWDENLTNISIGGLFSEA-SLQGRRSKEASTHNNSG  312

Query  1969  ----------YIHQ----------------------IPFSCDSFDAAIAAHIKKHQNVTD  2052
                       ++ +                      +P   DS DA +       Q    
Sbjct  313   NQQPSVSIGAFLSEASSRGEWSNKTWETRGATSQQPLPLISDSLDAFLVNQT-TDQPRGP  371

Query  2053  SQAALPSQL--SSIWGAEDTCDAFAF-QRHSLSEKV-QNASKHTSLETCKQITLANTTAL  2220
               A  P +L  SSI  AEDTC AF+F +R + S KV +  S+ T  +  K  +       
Sbjct  372   CHARPPPELSHSSILDAEDTCHAFSFRKRTTTSPKVLEQVSEETEEQQQKDESKPAKGLF  431

Query  2221  GASVEDLPGARNPVDGDAATADLESVHYSPTSDVVKDFNGLSDVYWPDSLGPLDLDI  2391
             G+ V          + D++                    G S + W DS GP D  +
Sbjct  432   GSGV---------FNQDSSL-------------------GFSGIKWADSRGPFDFGL  460



>ref|XP_008232546.1| PREDICTED: TSL-kinase interacting protein 1-like, partial [Prunus 
mume]
Length=154

 Score =   129 bits (323),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 64/118 (54%), Positives = 83/118 (70%), Gaps = 2/118 (2%)
 Frame = +1

Query  1270  KLKLQLFPVDDGTRRALELDNHNPYLELTLSTRKKMSSVLEHLNRKWGNSSMACGDLMLF  1449
             K+KLQLFPV++GTR  LE D H+PYLEL L  RKK+SSVL+HLN KWG+SS+A G+  LF
Sbjct  35    KIKLQLFPVNEGTRIGLEKDGHHPYLELILRARKKISSVLKHLNGKWGSSSVALGEPALF  94

Query  1450  PYHLHKENLVHFQKWT-KDTTLTAADVYALTGSPPVFRLRYGWFSNAEVAFRAPVSSA  1620
             PY + ++ +   ++WT  D  ++A  +YA  GSP VFRLRYGWFS        P +SA
Sbjct  95    PYKI-QDIMSSNRRWTMNDGDISAGAIYAAIGSPEVFRLRYGWFSTEPKTAAEPSTSA  151



>ref|XP_009785146.1| PREDICTED: uncharacterized protein LOC104233448 [Nicotiana sylvestris]
Length=301

 Score =   132 bits (333),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 62/114 (54%), Positives = 84/114 (74%), Gaps = 3/114 (3%)
 Frame = +1

Query  1270  KLKLQLFPVDDGTRRALELDNHNPYLELTLSTRKKMSSVLEHLNRKWGNSSMACGDLMLF  1449
             K+KLQLFP++  TR+ LE D  NP+ ELTLST KK+SSV++HLN KW +SS+   +L LF
Sbjct  90    KIKLQLFPINKSTRQRLEKDGCNPFQELTLSTHKKISSVIKHLNAKWNSSSVGLAELFLF  149

Query  1450  PYHLHKENLVHFQKW-TKDTTLTAADVYALTGSPPVFRLRYGWFSNAEVAFRAP  1608
             PY+++ ENL   ++W +KDT ++A  VYA   SP +FRLRYGWFS  +V  +AP
Sbjct  150   PYNINTENLASEKRWSSKDTNVSAGQVYAAIESPAIFRLRYGWFS--DVKLKAP  201



>ref|XP_010319799.1| PREDICTED: uncharacterized protein LOC101262510 isoform X2 [Solanum 
lycopersicum]
Length=530

 Score =   136 bits (342),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 88/246 (36%), Positives = 126/246 (51%), Gaps = 52/246 (21%)
 Frame = +1

Query  1255  LQNSGKLKLQLFPVDDGTRRALELDNHNPYLELTLSTRKKMSSVLEHLNRKWGNSSMACG  1434
             L +  K+KLQLFP++  TR+ LE D  NP+ ELTLS +KK+SSV++HLN KW ++S+  G
Sbjct  89    LNSYKKIKLQLFPINRSTRQRLEKDGCNPFQELTLSAQKKISSVIKHLNTKWSSTSLGLG  148

Query  1435  DLMLFPYHLHKENLVHFQKW-TKDTTLTAADVYALTGSPPVFRLRYGWFSNAEV-AFRAP  1608
              L+LFPY  + EN+   ++W +KDT ++A +V+A  GSP +FRLRY WFS+ ++ AF  P
Sbjct  149   VLLLFPYDTNTENITSQKRWSSKDTNVSAGEVHAAIGSPAIFRLRYDWFSDLKLKAFEVP  208

Query  1609  ---VSSAIPSRHDANMNIMPESSVGVLQAPSTDPPKEANGCVSMNTVNASRSSDHTEAVL  1779
                  SA+ S+   N  I                        +M+T N     D  E   
Sbjct  209   DISQPSAMHSQSRGNKRIF---------------------AAAMDTAN-----DRVEGAK  242

Query  1780  WENPETV----------VTEAE-----------VDDLQFNKAGTSCVGEWADSLTNISVG  1896
              +N E            VTE +           VD++      +     W D LTN+S+G
Sbjct  243   LKNEELFEPICKNEHANVTENQNMALNIPVDHMVDEVTKQNVLSKMENPWNDILTNLSIG  302

Query  1897  DLLSEA  1914
              L SEA
Sbjct  303   GLFSEA  308



>emb|CDY12141.1| BnaC03g60570D [Brassica napus]
Length=601

 Score =   136 bits (343),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 125/422 (30%), Positives = 179/422 (42%), Gaps = 85/422 (20%)
 Frame = +1

Query  1267  GKLKLQLFPVDDGTRRALELDNHNPYLELTLSTRKKMSSVLEHLNRKWGNSSMACGDLML  1446
             GK+KLQLFP+D  TR+ LE D  +PYLELTLS+RKK+SSVL+H++ KWG+S +A GD  L
Sbjct  181   GKMKLQLFPLDVHTRQGLEKDGFHPYLELTLSSRKKVSSVLQHIHSKWGSSEIARGDPTL  240

Query  1447  FPYHLHKENLVHFQKWTKDTTLTAADVYALTGSPPVFRLRYGWFSNAEVAFRAPVSSAIP  1626
             +P+   +  L    KWT ++++T  DVY   G+P +FRLRYGW S        P S + P
Sbjct  241   YPF--DQSRLPSAPKWTANSSITIRDVYVAIGAPSLFRLRYGWSSETCNKTDEPPSPSTP  298

Query  1627  SRHDANMNIMPESSVGVLQAPSTDPP----KEANGCVSMNTVNASRSSDHTEAVLWENPE  1794
                     +   + V       TDPP       +G V                  W++  
Sbjct  299   ENGKQMFGLDSLTQV-------TDPPLSEHTPPDGPVESAAEKKMNDGSGPTFFQWDDGL  351

Query  1795  T------VVTEAEVDDLQFNKAGTSCVGE--WADSLTNISVGDLLSEA------------  1914
             T      +++E  +     N +  S      W ++LTNIS+G L SEA            
Sbjct  352   TSLSIGGLLSEVSLKGNFGNGSKNSNANPTLWDENLTNISIGGLFSEASLQGRRGKEEST  411

Query  1915  --------PDMEDANCIT--SSIHSSSNYI---------HQIPFSCDSFDAAIAAHIKKH  2037
                     P +     ++  SS    SN             +P   DS DA +       
Sbjct  412   HNHNGNQQPSVSIGAFLSEASSRGEGSNKTWETRGATSQQPLPLISDSLDAFLVNQT-TD  470

Query  2038  QNVTDSQAALPSQL--SSIWGAEDTCDAFAF-QRHSLSEKV-QNASKHTSLETCKQITLA  2205
             Q      A  P ++  SSI  AEDTC AF+F +R + S KV +  S+ T  +  K  +  
Sbjct  471   QPRGPCHAPPPPEVSHSSILDAEDTCHAFSFRKRTTTSPKVLEQVSEETEEQQQKDESKP  530

Query  2206  NTTALGASVEDLPGARNPVDGDAATADLESVHYSPTSDVVKDFNGLSDVYWPDSLGPLDL  2385
                  G+ V          + D++                    G S + W DS GP D 
Sbjct  531   AKGLFGSGV---------FNQDSSL-------------------GFSGIKWADSRGPFDF  562

Query  2386  DI  2391
              +
Sbjct  563   GL  564



>ref|XP_010680320.1| PREDICTED: TSL-kinase interacting protein 1 [Beta vulgaris subsp. 
vulgaris]
Length=503

 Score =   135 bits (340),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 63/116 (54%), Positives = 83/116 (72%), Gaps = 1/116 (1%)
 Frame = +1

Query  1237  SFNETNLQNSGKLKLQLFPVDDGTRRALELDNHNPYLELTLSTRKKMSSVLEHLNRKWGN  1416
             S +E  L++S K+KLQLFP+D+  R  LE D HNP+LELTLS RKK+SSV+ HL  KWG+
Sbjct  77    SKDEKVLRSSSKIKLQLFPIDEKIRIGLEKDGHNPFLELTLSARKKISSVINHLFNKWGS  136

Query  1417  SSMACGDLMLFPYHLHKENLVHFQKWT-KDTTLTAADVYALTGSPPVFRLRYGWFS  1581
             S +A G+L LFP++   EN+   +KWT  D  + A DV+A+ G P +FRLRYGW S
Sbjct  137   SCVAMGELTLFPFNTAAENVTTCRKWTLSDIGINAGDVHAVLGRPDIFRLRYGWVS  192



>ref|XP_004237480.1| PREDICTED: uncharacterized protein LOC101262510 isoform X1 [Solanum 
lycopersicum]
 ref|XP_010319798.1| PREDICTED: uncharacterized protein LOC101262510 isoform X1 [Solanum 
lycopersicum]
Length=584

 Score =   135 bits (341),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 88/246 (36%), Positives = 126/246 (51%), Gaps = 52/246 (21%)
 Frame = +1

Query  1255  LQNSGKLKLQLFPVDDGTRRALELDNHNPYLELTLSTRKKMSSVLEHLNRKWGNSSMACG  1434
             L +  K+KLQLFP++  TR+ LE D  NP+ ELTLS +KK+SSV++HLN KW ++S+  G
Sbjct  89    LNSYKKIKLQLFPINRSTRQRLEKDGCNPFQELTLSAQKKISSVIKHLNTKWSSTSLGLG  148

Query  1435  DLMLFPYHLHKENLVHFQKW-TKDTTLTAADVYALTGSPPVFRLRYGWFSNAEV-AFRAP  1608
              L+LFPY  + EN+   ++W +KDT ++A +V+A  GSP +FRLRY WFS+ ++ AF  P
Sbjct  149   VLLLFPYDTNTENITSQKRWSSKDTNVSAGEVHAAIGSPAIFRLRYDWFSDLKLKAFEVP  208

Query  1609  ---VSSAIPSRHDANMNIMPESSVGVLQAPSTDPPKEANGCVSMNTVNASRSSDHTEAVL  1779
                  SA+ S+   N  I                        +M+T N     D  E   
Sbjct  209   DISQPSAMHSQSRGNKRIF---------------------AAAMDTAN-----DRVEGAK  242

Query  1780  WENPETV----------VTEAE-----------VDDLQFNKAGTSCVGEWADSLTNISVG  1896
              +N E            VTE +           VD++      +     W D LTN+S+G
Sbjct  243   LKNEELFEPICKNEHANVTENQNMALNIPVDHMVDEVTKQNVLSKMENPWNDILTNLSIG  302

Query  1897  DLLSEA  1914
              L SEA
Sbjct  303   GLFSEA  308



>gb|KDP35287.1| hypothetical protein JCGZ_09446 [Jatropha curcas]
Length=444

 Score =   132 bits (333),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 67/116 (58%), Positives = 84/116 (72%), Gaps = 3/116 (3%)
 Frame = +1

Query  1246  ETNLQNSGKLKLQLFPVDDGTRRALELDNHNPYLELTLSTRKKMSSVLEHLNRKWGNSSM  1425
             E   + S K+KLQLFP+D+ TR  LE D +NPYLELTLS+RKKMSSVL+HLN KWG SS+
Sbjct  91    EPTPKTSAKIKLQLFPLDEVTRMGLEKDGYNPYLELTLSSRKKMSSVLKHLNCKWGGSSI  150

Query  1426  ACGDLMLFPYHLHKENLVHFQKWT-KDTTLTAADVYALTGSPPVFRLRYGWFSNAE  1590
             A G+ +LFP  L  E+L    +WT  D+ LTA DV+   GSP +FRLRYGW S+ +
Sbjct  151   AIGEPILFPNTL-TEDLASC-RWTLNDSNLTARDVHVAIGSPSIFRLRYGWLSDCK  204


 Score = 69.7 bits (169),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 70/206 (34%), Positives = 91/206 (44%), Gaps = 25/206 (12%)
 Frame = +1

Query  1852  CVGE---WADSLTNISVGDLLSEAPDMEDANCITSSIHSSSNYIHQIPFSCDSFDAAIAA  2022
             C G    W DSLTNIS+G LLSEA      N         S  +       DS DA I +
Sbjct  246   CTGNSYPWDDSLTNISIGGLLSEASLQGKFNNCDPKSAGISAALQPSQLISDSLDAFIMS  305

Query  2023  HIKKHQNVTDSQAALPSQLSS--IWGAEDTCDAFAFQR-HSLSEKVQNASKHTSLETCKQ  2193
              +   Q        LPS +SS  I  AEDTC AF FQ+  SL +            TC Q
Sbjct  306   QVNHSQ-----ATRLPSHVSSSSILDAEDTCHAFPFQKVSSLCKDALAVGGSAYSRTCSQ  360

Query  2194  ITLANTTALGASVE-----DLPGARNPVDGDAATADLESVHYSPTSDVVKDFNGLSDVYW  2358
              T++ +T    + E      +P      + +   + L S  Y+  S +     GLS + W
Sbjct  361   DTVSKSTKYPDTSEVNFQSGIPQGHGCQESETDLS-LCSRIYNDESSL-----GLSGIKW  414

Query  2359  PDSLGPLDLDIPSSRYHSELILSDSL  2436
              DSLGP DL + SSR   ++I  DSL
Sbjct  415   TDSLGPFDLGLSSSR---KIISGDSL  437



>gb|EYU24059.1| hypothetical protein MIMGU_mgv1a026856mg, partial [Erythranthe 
guttata]
Length=471

 Score =   132 bits (332),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 95/265 (36%), Positives = 131/265 (49%), Gaps = 32/265 (12%)
 Frame = +1

Query  1264  SGKLKLQLFPVDDGTRRALELDNHNPYLELTLSTRKKMSSVLEHLNRKWGNSSMACGDLM  1443
             S K+KLQLFP+++  R  LE D  NP+LELTLS RKK+SSV+ HL+ KWG+S++A G L 
Sbjct  56    STKIKLQLFPINEQIRLGLEKDGRNPFLELTLSARKKISSVVRHLDTKWGSSNVAKGLLT  115

Query  1444  LFPYHLHKENLVHFQKWT-KDTTLTAADVYALTGSPPVFRLRYGWFSNAEVAFRAPVSSA  1620
             LFPY+   E +   ++WT  DT +TA +VY   GSP VFRLRYGW SN +          
Sbjct  116   LFPYNTKLEQVALCKRWTLNDTAITAWEVYVDVGSPSVFRLRYGWSSNLQQEM-------  168

Query  1621  IPSRHDANMNIMPESSVGVLQAPSTDPPKEANGCVSMNTVNASRSSDHTEAVLWENPETV  1800
                      +I P+SS   L+A  T+      GC     +         E+      +  
Sbjct  169   --------FDIPPKSS--PLEA-HTNSDDRRRGCSRGFEIPTHEEEKIAESRATTEKQIN  217

Query  1801  VTEA---EVDDLQFNKAGTSCVGEWADSLTNISVGDLLSEAP-----DMEDANCITSSIH  1956
             V EA     D+L  +         W D+ TN+S+G LLSE       +  D N +  S+ 
Sbjct  218   VNEALGSNDDELATDVVPVHSTVPWDDNWTNLSIGGLLSEISLQGKINRSDPNSVNKSVM  277

Query  1957  SSSNYIHQIPFSCDSFDAAIAAHIK  2031
                  I +I     S  A +A  +K
Sbjct  278   PQVEPISEI-----SIGAILARDLK  297



>emb|CDP12865.1| unnamed protein product [Coffea canephora]
Length=603

 Score =   133 bits (335),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 85/236 (36%), Positives = 125/236 (53%), Gaps = 7/236 (3%)
 Frame = +1

Query  1264  SGKLKLQLFPVDDGTRRALELDNHNPYLELTLSTRKKMSSVLEHLNRKWGNSSMACGDLM  1443
             S K+KLQLFPV+  TR  LE D HNP+LELTLS +KK+SSV++HLN KWG SS A G+LM
Sbjct  94    SSKIKLQLFPVNSMTRLKLEKDGHNPFLELTLSVQKKVSSVIKHLNTKWGCSSAALGELM  153

Query  1444  LFPYHLHKENLVHFQKWTKDT-TLTAADVYALTGSPPVFRLRYGWFSNAEVAFRAPVSSA  1620
             LFPY +  EN+   + WT D  + TA +++    +P +FRL+YGWF+N  V     VS  
Sbjct  154   LFPYDVRLENIASSRSWTSDCGSFTAGELHEALETPSIFRLKYGWFTNLHVEACG-VSLT  212

Query  1621  IPSRHDANMNIMPESSVGVLQAPSTDPPKEANGCVSMNTVNASRSSDHTEAVLWENPETV  1800
               +  + + +   ++   +    + D  K             +   +   A   + P  +
Sbjct  213   STATEEQSESKHSQNDCSLFSRMTHDQRKTITAASQGIQSPINMHEEEDVARTKQMPTLL  272

Query  1801  VTEAEVDDLQFNKAGTSCVGEWADSLTNISVGDLLSEAPDMEDANCITSSIHSSSN  1968
               +  V+D+    A +     W DS T++S+G LLSEA  +   N  T    + SN
Sbjct  273   SVDHVVNDVPLPPAVS-----WDDSFTSLSIGGLLSEASLLNKINNPTEGSDNKSN  323



>ref|XP_006411741.1| hypothetical protein EUTSA_v10024889mg [Eutrema salsugineum]
 gb|ESQ53194.1| hypothetical protein EUTSA_v10024889mg [Eutrema salsugineum]
Length=531

 Score =   132 bits (333),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 86/234 (37%), Positives = 121/234 (52%), Gaps = 41/234 (18%)
 Frame = +1

Query  1264  SGKLKLQLFPVDDGTRRALELDNHNPYLELTLSTRKKMSSVLEHLNRKWGNSSMACGDLM  1443
             SGK+KLQLFP+D  TR  LE    +PYLELTLS+RKK+SSVL+H++ KWG+S +A GD M
Sbjct  90    SGKMKLQLFPLDAHTREGLEKGGFHPYLELTLSSRKKVSSVLQHIHTKWGSSEIARGDPM  149

Query  1444  LFPYHLHKENLVHFQKWTKDTTLTAADVYALTGSPPVFRLRYGWFSNAEVAFRAPVSSAI  1623
             L+PY   K  L    KWT ++ +T +DVY   G+P +FRLRYGW          P S + 
Sbjct  150   LYPY--DKLVLASGHKWTANSNITISDVYVAVGAPSLFRLRYGWSPATYNKTDEPPSPST  207

Query  1624  PSRHDANMNIMPESSVGVLQAPSTDPPKEANGCVSMNTVNASRSSDHTEAVLWENPETVV  1803
             P               G+    +T P +E    +   T ++S +   T  +   NP T++
Sbjct  208   P---------------GI----TTFPNEEPQNIICNKTESSSFTGKQTFGL--GNPFTML  246

Query  1804  TEA-EVDDL-----------------QFNKAGTSCVGEWADSLTNISVGDLLSE  1911
               + +V DL                 + N      +  W D LT++S+G LLSE
Sbjct  247   PSSNQVTDLPPSESTPPDGQVESAENKINDGSGPTIFSWDDGLTSLSIGGLLSE  300



>ref|XP_006283503.1| hypothetical protein CARUB_v10004555mg [Capsella rubella]
 ref|XP_006283504.1| hypothetical protein CARUB_v10004555mg [Capsella rubella]
 gb|EOA16401.1| hypothetical protein CARUB_v10004555mg [Capsella rubella]
 gb|EOA16402.1| hypothetical protein CARUB_v10004555mg [Capsella rubella]
Length=536

 Score =   129 bits (325),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 88/237 (37%), Positives = 127/237 (54%), Gaps = 25/237 (11%)
 Frame = +1

Query  1228  LHNSFNETNLQNSGKLKLQLFPVDDGTRRALELDNHNPYLELTLSTRKKMSSVLEHLNRK  1407
             LH+S     +++S K+KLQLFP+D  TR  LE D  +PYLELTLS+RKK+SSVL+H++ K
Sbjct  83    LHSS---NKVRSSEKMKLQLFPLDAHTREGLEKDRFHPYLELTLSSRKKISSVLQHIHSK  139

Query  1408  WGNSSMACGDLMLFPYHLHKENLVHFQKWTKDTTLTAADVYALTGSPPVFRLRYGWFSNA  1587
             WG+S +A G+  L+PY   K  L   +KW  ++ +T   VY   G+PP+FRLRYGW S+ 
Sbjct  140   WGSSEIARGEPTLYPY--DKLVLASGRKWIANSNITTGAVYQAIGAPPLFRLRYGWTSDI  197

Query  1588  EVAFRAPVSSAIPS--------RHDANMNIMPESSVGVLQAPSTDPPKEANGCVSMNTVN  1743
             E     P S + P          H+ N N +  +S    Q    D     N    +++ N
Sbjct  198   EHKTHEPPSPSTPGIACFQNEELHN-NGNKVEVASFTGKQMLDLD-----NPFTMLSSSN  251

Query  1744  ASRSSDHTEAVLWENPETVVTEAEVDDLQFNKAGTSCVGEWADSLTNISVGDLLSEA  1914
                +    E +L   P+  V   E  + + N      +  W D LT++S+G LLSE 
Sbjct  252   QVNNMPPLENIL---PDEQV---ESKENKINNGAGPTLLFWDDGLTSLSIGGLLSEV  302



>ref|XP_009772002.1| PREDICTED: TSL-kinase interacting protein 1-like, partial [Nicotiana 
sylvestris]
Length=498

 Score =   127 bits (320),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 77/211 (36%), Positives = 111/211 (53%), Gaps = 11/211 (5%)
 Frame = +1

Query  1288  FPVDDGTRRALELDNHNPYLELTLSTRKKMSSVLEHLNRKWGNSSMACGDLMLFPYHLHK  1467
             FP++  TR+ LE D  NP+ ELTLST KK+SSV++HLN KW +SS+   +L LFPY+++ 
Sbjct  1     FPINKSTRQRLEKDGCNPFQELTLSTHKKISSVIKHLNTKWNSSSVGLAELFLFPYNINT  60

Query  1468  ENLVHFQKW-TKDTTLTAADVYALTGSPPVFRLRYGWFSNAEV-AFRAPVSSAIPSRHDA  1641
             ENL   ++W +KDT ++A  VYA   SP +FRLRYGWFS+ ++ A   P  S     H  
Sbjct  61    ENLASEKRWSSKDTNVSAGQVYAAIESPAIFRLRYGWFSDVKLKASEVPDISPPSGTHSQ  120

Query  1642  NMNIMPESSVGVLQAPSTDPPKEANGCVSMNTVNASRSSDHTEAVLWENPETVVTEAEVD  1821
             +  I        + A + D   +      +     S+     E  +   P  +  +  VD
Sbjct  121   SRGIK------RIFAAAMDIGNDKIEGAKLKNEELSKPICMNEQKM---PLNIPIDNMVD  171

Query  1822  DLQFNKAGTSCVGEWADSLTNISVGDLLSEA  1914
               +           W D  TN+S+G LLSEA
Sbjct  172   GARKQNVPAKMASPWDDIFTNLSIGGLLSEA  202



>ref|XP_004157878.1| PREDICTED: TSL-kinase interacting protein 1-like [Cucumis sativus]
Length=303

 Score =   124 bits (310),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 90/231 (39%), Positives = 124/231 (54%), Gaps = 27/231 (12%)
 Frame = +1

Query  1270  KLKLQLFPVDDGTRRALELDNHNPYLELTLSTRKKMSSVLEHLNRKWGNSSMACGDLMLF  1449
             K+KLQLFP+++  R A+E + ++PYLELTL  RKK+SSVL HL  KWG S++A G+L LF
Sbjct  85    KIKLQLFPINEKMRMAVEKEGYHPYLELTLKARKKISSVLNHLISKWG-SNVARGELTLF  143

Query  1450  PYHLHKENLVHFQKWT-KDTTLTAADVYALTGSPPVFRLRYGWFSNAEVAFRAPVSSAIP  1626
             PY+    +LV   KWT +D  ++A DVYA  G P VFRLRYGW           VS+++P
Sbjct  144   PYN-KPSSLVSGLKWTLEDYDISAGDVYAAVGGPSVFRLRYGW-----------VSTSVP  191

Query  1627  SRHDANMNIMPESSVGVLQAPSTDPPKEANGCVSMNTVNASRSSDHTEAVLWENPETVV-  1803
               H  +  +    S       ST       G  S  T++  +SS+  E      P+  V 
Sbjct  192   KFHSFSKGLEKGCS-------STLQIIHGEGKQSERTMDEIKSSNMNEMNNTAAPDKTVD  244

Query  1804  --TEAEVDDLQFN---KAGTSCVGEWADSLTNISVGDLLSEAPDMEDANCI  1941
               T    ++   N   +  + C     DS++NIS+G LLSEA  M   N I
Sbjct  245   CPTNPMGNEPPLNSGRQLSSECGILQFDSISNISMGGLLSEASLMGKFNEI  295



>ref|XP_010652888.1| PREDICTED: TSL-kinase interacting protein 1 isoform X3 [Vitis 
vinifera]
Length=566

 Score =   115 bits (289),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 86/255 (34%), Positives = 117/255 (46%), Gaps = 47/255 (18%)
 Frame = +1

Query  1255  LQNSGKLKLQLFPVDDGTRRALELDNHNPYLELTLSTRKKMSSVLEHLNRKWGNSSMACG  1434
             L  S K+KLQLFP+D+GTR  LE D H+PYLELTL  RKK+SSVL+H+NR          
Sbjct  92    LDPSSKIKLQLFPIDEGTRIGLERDGHHPYLELTLRARKKISSVLKHINR----------  141

Query  1435  DLMLFPYHLHKENLVHFQKWTKDTTLTAADVYALTGSPPVFRLRYGWFSNAEVAFRAPVS  1614
                                          DVYA TGSP VFRL+YGWFS+    F  P +
Sbjct  142   -----------------------------DVYAATGSPSVFRLKYGWFSSDPKTFATPST  172

Query  1615  SAIPSRHDANMNIMPESSVGVLQAPSTDPPKEANGCVSMNTVNASRSSDHTEAVLWENPE  1794
             S        +  +    S  +        P E    ++ N    +  S+       E   
Sbjct  173   SIASEPCSKSEGVQKGCSSNIENLYGKGKPIE----LTRNKFKTNNISEGANVAAVEKTS  228

Query  1795  TVVTEAEV-DDLQFNKAGTSCVGEWADSLTNISVGDLLSEAP-DMEDANCITSSIHSSSN  1968
               V+   V D+++ +   +     WADSLTNIS+G LLSEA    +  NC   S  S S+
Sbjct  229   MDVSVNPVFDEVRVDNGLSQTSDLWADSLTNISIGGLLSEAYLQAKLNNCSQKSDGSKSS  288

Query  1969  YIHQIPFSCDSFDAA  2013
             +  +IP +   F++ 
Sbjct  289   F--RIPSTFTPFESC  301


 Score = 63.5 bits (153),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 62/193 (32%), Positives = 84/193 (44%), Gaps = 10/193 (5%)
 Frame = +1

Query  1864  WADSLTNISVGDLLSEAPDMEDANCITSSIHSSSNYIHQIPFSCDSFDAAIAAHIKKHQN  2043
             W D LTNIS+G LLSEA      N  +   + S++ +       DSFDA IA  ++  Q 
Sbjct  375   WDDCLTNISIGGLLSEASLQGKFNNCSPKTNKSNSGLQPSLLISDSFDAFIAGQMQLPQG  434

Query  2044  VTDSQAALPSQL--SSIWGAEDTCDAFAFQRHSLSEKVQNASKHTSLETCKQITLANTTA  2217
                    LPS    SSI  AE+TC AF  Q+ S S K        +   C Q   + +  
Sbjct  435   -----PRLPSHEVHSSILDAEETCHAFPCQKFSSSGKDFLVLGGANSGACSQDAGSKSFK  489

Query  2218  LGASVEDLPGARNPVDGDAATADLESVHYSPTSDVVKDFNGLSDVYWPDSLGPLDLDIPS  2397
             L    E       P D     +  + +  S          GL+ + W DSLGP DL + S
Sbjct  490   LPKFAEVTGQTGLPQDHTCQESKTDPLLCSGGIFADDSSLGLAGIKWNDSLGPFDLGLSS  549

Query  2398  SRYHSELILSDSL  2436
             SR   ++I  DS+
Sbjct  550   SR---KIINGDSI  559



>ref|XP_004142043.1| PREDICTED: TSL-kinase interacting protein 1-like [Cucumis sativus]
Length=192

 Score =   104 bits (259),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 55/100 (55%), Positives = 72/100 (72%), Gaps = 3/100 (3%)
 Frame = +1

Query  1270  KLKLQLFPVDDGTRRALELDNHNPYLELTLSTRKKMSSVLEHLNRKWGNSSMACGDLMLF  1449
             K+KLQLFP+++  R A+E + ++PYLELTL  RKK+SSVL HL  KWG S++A G+L LF
Sbjct  85    KIKLQLFPINEKMRMAVEKEGYHPYLELTLKARKKISSVLNHLISKWG-SNVARGELTLF  143

Query  1450  PYHLHKENLVHFQKWT-KDTTLTAADVYALTGSPPVFRLR  1566
             PY+    +LV   KWT +D  ++A DVYA  G P VFRLR
Sbjct  144   PYN-KPSSLVSGLKWTLEDYDISAGDVYAAVGGPSVFRLR  182



>ref|XP_002501770.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO63028.1| predicted protein [Micromonas sp. RCC299]
Length=689

 Score =   107 bits (268),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 110/418 (26%), Positives = 180/418 (43%), Gaps = 90/418 (22%)
 Frame = +1

Query  427   QQPVKRQTRKWAAWTREEEESFFSALRHVGKNFEKITSRVQSKNKDQVRHYYYRLVRRMN  606
             ++P K Q R    WT  EE+ FF+AL+ VG NF+KI   +Q++N+ QVR +Y   V+R+N
Sbjct  19    RKPTKSQDR----WTPWEEKQFFTALKDVGSNFDKIAEIIQTRNRSQVRTFYNTEVKRIN  74

Query  607   KLLGP-ELCLNAKNSRDTNAAMLRWWSLLEKYSCKAS--KLHLKPRRFKIFIETLENQLL  777
              +L P  + ++  ++ + + AM  W S+ +K     S  +L  KP+   +F   L+ +L 
Sbjct  75    TVLAPLGVQVDPSDAEEVHTAMHSWHSMKDKLGPGGSFQELCKKPQNRNLFAWDLKKELD  134

Query  778   KDRKKNVRRCFSQGENTSTAPISVSNQGRGASGHDGRSVKVV-LLDNQDIHKFGSGKGSS  954
             K         ++QG+  +     + + G   +     S KV+ ++  +     G  KGS 
Sbjct  135   KS-------VWAQGKKEA----KLKSLGLLPAVAGDASGKVLGVMPVKTTANRGRPKGSG  183

Query  955   LKRHINIGANSTSCKADSSLLKTARHRRKIGATAAYKRWEKAAIAGVSLVADAAEHLERT  1134
             ++          +CKADS   +T    RK     A +R         S+  +AA      
Sbjct  184   IR-------TKNTCKADSPAGRTKSTGRK-----AARRG--------SVSPNAALRAAAA  223

Query  1135  TTDKEDGHFQDSNVRNVFEHSGKDPHVFPDLLHNSFNETNLQNSGKLKLQLFPVDDGTRR  1314
             T  K+D   ++   R + +       +FP                        +D  TR 
Sbjct  224   TAAKDDSVAKEQKERLMLQ-------LFP------------------------IDTSTRA  252

Query  1315  ALELDNHNPYLELTLSTRKKMSSVLEHLNRKWGNSSMACGDLMLFPYHLHKEN----LVH  1482
             AL     NP+LELT   +K ++ +++HL  KW  +      L   P  L KE     L  
Sbjct  253   ALVAGGFNPHLELTFRAKKSVTGLMQHLITKWAAA------LPHLPAGLDKETAVLQLYP  306

Query  1483  FQ---------KWT-KDTTLTAADVYALTGSPPVFRLRYGWFSNAEVAFRAPVSSAIP  1626
             F+          W  +   +TA D++   G P  FR+RYGW  + E A R  ++   P
Sbjct  307   FEAASASDAKGAWNHRHEGVTATDIFDAIGRPAAFRVRYGWVPSEEAAVRPHLAPPPP  364



>ref|XP_003058530.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH56985.1| predicted protein [Micromonas pusilla CCMP1545]
Length=771

 Score = 75.9 bits (185),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 41/119 (34%), Positives = 59/119 (50%), Gaps = 8/119 (7%)
 Frame = +1

Query  1270  KLKLQLFPVDDGTRRALELDNHNPYLELTLSTRKKMSSVLEHLNRKWGNSS--MACG---  1434
             +L LQLFP+D  TR AL     NP+LELT   +K +  ++ HL  KW  ++  +  G   
Sbjct  294   RLMLQLFPIDASTRAALVAGGFNPHLELTFRAKKSVIGLMNHLKTKWAAATRHLPAGVNG  353

Query  1435  ---DLMLFPYHLHKENLVHFQKWTKDTTLTAADVYALTGSPPVFRLRYGWFSNAEVAFR  1602
                 L L+P+              +   +TA D++   G P  FR+RYGW  +AE A R
Sbjct  354   KDAVLQLYPFEAASATEAVGAWNDRHDGVTATDIFDACGRPAAFRVRYGWVPSAEAASR  412



>gb|KDO57107.1| hypothetical protein CISIN_1g040686mg, partial [Citrus sinensis]
Length=318

 Score = 66.6 bits (161),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 66/184 (36%), Positives = 84/184 (46%), Gaps = 21/184 (11%)
 Frame = +1

Query  1864  WADSLTNISVGDLLSEAPDMEDANCITSSIHSSSNYIHQIP--FSCDSFDAAIAAHIKKH  2037
             W D LTNIS+G LLSEA      N   S + S+ +     P     DSFDA +AA +   
Sbjct  147   WDDMLTNISIGGLLSEASLQGKFN---SEMKSNGSNADSQPSQLISDSFDAFLAAQM---  200

Query  2038  QNVTDSQAALPSQLSSIWGAEDTCDAFAFQRHSLSEKVQNASKHTSLETCKQITLANTTA  2217
              +    Q A     SSI  AEDTC AFAFQ+ SLS K  +A       +C Q        
Sbjct  201   NHPQGPQPAPQQPRSSILDAEDTCHAFAFQKFSLSGK--DALGLGGNISCSQ--------  250

Query  2218  LGASVEDLPGARNPVDGDAATADLESVHYSPTSDVVKDFN--GLSDVYWPDSLGPLDLDI  2391
              GA  E            + T+       S  S ++ D +  GLSD+ W DS+G  DL +
Sbjct  251   -GAEAEKFKENIQSGLQQSNTSKKSETDLSLFSRLLNDESSLGLSDIKWTDSMGTFDLGL  309

Query  2392  PSSR  2403
              SSR
Sbjct  310   SSSR  313



>emb|CEG01572.1| unnamed product [Ostreococcus tauri]
Length=472

 Score = 60.8 bits (146),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 41/113 (36%), Positives = 57/113 (50%), Gaps = 12/113 (11%)
 Frame = +1

Query  1255  LQNSGKLK--LQLFPVDDGTRRALELDNHNPYLELTLSTRKKMSSVLEHLNRKWGNSSMA  1428
             +   GKLK  LQLFP DD T + +    +NP  ELT   +K +  ++ HL+ KW  +S +
Sbjct  168   ITEDGKLKFVLQLFPKDDDTAKRMNKHGYNPLCELTFRHKKSVPGLVLHLSEKWVKASPS  227

Query  1429  CGDLM-LFPYHLHKENLVHFQKWTKDTTL---TAADVYALTGSPPVFRLRYGW  1575
                ++ L P+    +       W  + TL   TA DVY   G P  FRLRY W
Sbjct  228   PSHILQLHPFEADGK----VGPW--NATLENATALDVYNALGEPYCFRLRYCW  274



>ref|XP_003080903.1| unnamed protein product, partial [Ostreococcus tauri]
Length=553

 Score = 60.8 bits (146),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 41/112 (37%), Positives = 58/112 (52%), Gaps = 12/112 (11%)
 Frame = +1

Query  1258  QNSGKLK--LQLFPVDDGTRRALELDNHNPYLELTLSTRKKMSSVLEHLNRKWGNSSMAC  1431
             + +GKLK  LQLFP DD T + +    +NP  ELT   +K +  ++ HL+ KW  +S + 
Sbjct  229   RRTGKLKFVLQLFPKDDDTAKRMNKHGYNPLCELTFRHKKSVPGLVLHLSEKWVKASPSP  288

Query  1432  GDLM-LFPYHLHKENLVHFQKWTKDTTL---TAADVYALTGSPPVFRLRYGW  1575
               ++ L P+    +       W  + TL   TA DVY   G P  FRLRY W
Sbjct  289   SHILQLHPFEADGK----VGPW--NATLENATALDVYNALGEPYCFRLRYCW  334



>gb|AFP49344.1| TSL-kinase interacting protein 1-like protein, partial [Olea 
europaea]
Length=56

 Score = 55.5 bits (132),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 24/37 (65%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +1

Query  2431  SLGGLTQLIASSLDAFQNCSFFGADKKEPVSTTEAQE  2541
             S+GGL + +A+SLDAFQNCSFFG DKKE  S  EA +
Sbjct  9     SIGGLNRFLANSLDAFQNCSFFGLDKKESASAVEAHQ  45



>ref|XP_001631610.1| predicted protein [Nematostella vectensis]
 gb|EDO39547.1| predicted protein [Nematostella vectensis]
Length=1049

 Score = 59.7 bits (143),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 33/96 (34%), Positives = 52/96 (54%), Gaps = 13/96 (14%)
 Frame = +1

Query  373  QDHSVTEQLASFEEHSALQQPVKRQTRKWAAWTREEEESFFSALRHVGKNFEKITSRVQS  552
            +D S T   A  ++ +  +   KR  R+W +W   ++ +FF AL   GK+F+KI S + +
Sbjct  101  KDESSTGSTAQTQKQTPGRVKKKRVKRQWESWVNRDKNAFFKALHDYGKDFDKIQSFIAT  160

Query  553  ------------KNKDQVRHYYYRLVRRMNKLLGPE  624
                        KNKDQVRH+YYR + ++ K + PE
Sbjct  161  KHKRRGDPLNLVKNKDQVRHFYYRTLNKILKYI-PE  195



>ref|XP_010872237.1| PREDICTED: protein cramped-like isoform X2 [Esox lucius]
 ref|XP_010872238.1| PREDICTED: protein cramped-like isoform X2 [Esox lucius]
 ref|XP_010872239.1| PREDICTED: protein cramped-like isoform X2 [Esox lucius]
Length=1204

 Score = 58.2 bits (139),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 45/148 (30%), Positives = 66/148 (45%), Gaps = 31/148 (21%)
 Frame = +1

Query  253  HYLRSS---P----RKD----------GDFTFGKVNCVEQQIASSQEHAIPEQAMFSQDH  381
            H+LRSS   P    RKD          G  + G  N    Q+++ Q  + P     +   
Sbjct  92   HFLRSSVRPPSKRIRKDSIAPTINGHGGAKSKGSENGPSPQVSTGQSGSTPGSTGPTGKA  151

Query  382  SVTEQLASFEEHSALQQPVKRQTRKWAAWTREEEESFFSALRHVGKNFEKITSRV-----  546
            +   Q    +E     Q  KR  R+W +W+ E++ SFF  L   GK+FE I S +     
Sbjct  152  APRGQGPGDKEEPGGSQ--KRARRQWESWSTEDKNSFFEGLYEHGKDFEAIQSNIALKHK  209

Query  547  -------QSKNKDQVRHYYYRLVRRMNK  609
                     KNK+QVRH+YYR   +++K
Sbjct  210  KKGKPASMVKNKEQVRHFYYRTWHKISK  237



>ref|XP_010872236.1| PREDICTED: protein cramped-like isoform X1 [Esox lucius]
Length=1221

 Score = 58.2 bits (139),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 45/148 (30%), Positives = 66/148 (45%), Gaps = 31/148 (21%)
 Frame = +1

Query  253  HYLRSS---P----RKD----------GDFTFGKVNCVEQQIASSQEHAIPEQAMFSQDH  381
            H+LRSS   P    RKD          G  + G  N    Q+++ Q  + P     +   
Sbjct  109  HFLRSSVRPPSKRIRKDSIAPTINGHGGAKSKGSENGPSPQVSTGQSGSTPGSTGPTGKA  168

Query  382  SVTEQLASFEEHSALQQPVKRQTRKWAAWTREEEESFFSALRHVGKNFEKITSRV-----  546
            +   Q    +E     Q  KR  R+W +W+ E++ SFF  L   GK+FE I S +     
Sbjct  169  APRGQGPGDKEEPGGSQ--KRARRQWESWSTEDKNSFFEGLYEHGKDFEAIQSNIALKHK  226

Query  547  -------QSKNKDQVRHYYYRLVRRMNK  609
                     KNK+QVRH+YYR   +++K
Sbjct  227  KKGKPASMVKNKEQVRHFYYRTWHKISK  254



>ref|XP_002112544.1| hypothetical protein TRIADDRAFT_56673 [Trichoplax adhaerens]
 gb|EDV24654.1| hypothetical protein TRIADDRAFT_56673 [Trichoplax adhaerens]
Length=863

 Score = 57.4 bits (137),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 33/108 (31%), Positives = 55/108 (51%), Gaps = 14/108 (13%)
 Frame = +1

Query  436  VKRQTRKWAAWTREEEESFFSALRHVGKNFEKITSRVQS------------KNKDQVRHY  579
            V+ + R+W +W  +++  FF AL   GK+F+KI S + +            KNKDQVRH+
Sbjct  99   VRPKKRQWESWGVDDKRIFFEALNEYGKDFDKIQSYIATKYRRRGDPSDWIKNKDQVRHF  158

Query  580  YYRLVRRMNKLL--GPELCLNAKNSRDTNAAMLRWWSLLEKYSCKASK  717
            YYR   +++K L    ++ +N K        ++ +  L +K    A K
Sbjct  159  YYRTWNKISKYLDRNKDIYINGKKINQELCGLICYGELRKKIKGTAEK  206



>ref|XP_002985276.1| hypothetical protein SELMODRAFT_424293 [Selaginella moellendorffii]
 gb|EFJ13770.1| hypothetical protein SELMODRAFT_424293 [Selaginella moellendorffii]
Length=484

 Score = 55.5 bits (132),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 32/80 (40%), Positives = 45/80 (56%), Gaps = 18/80 (23%)
 Frame = +1

Query  565  QVRHYYYRLVRRMNKLLGPELCLNAKNSRDTNAAMLRWWSLLEKYSCKASKLHLKPRRFK  744
            +VRHYYYRL++RMNK        +A++S+D  A        LEK+ C + KLH +     
Sbjct  185  EVRHYYYRLIKRMNK-------FDARDSKDVVA--------LEKFKCSSFKLHFEA---S  226

Query  745  IFIETLENQLLKDRKKNVRR  804
             F   LE   LKDRKK+ ++
Sbjct  227  TFTTALEQHRLKDRKKDEKK  246



>emb|CDQ66747.1| unnamed protein product [Oncorhynchus mykiss]
Length=1179

 Score = 55.8 bits (133),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 28/76 (37%), Positives = 43/76 (57%), Gaps = 15/76 (20%)
 Frame = +1

Query  427  QQPV---KRQTRKWAAWTREEEESFFSALRHVGKNFEKITSRV------------QSKNK  561
            ++PV   KR  R+W +W+ E++ SFF  L   GK+FE I + +              KNK
Sbjct  162  EEPVGSQKRPRRQWESWSAEDKNSFFEGLYEHGKDFEAIQTNIALKHKKKGKPASMVKNK  221

Query  562  DQVRHYYYRLVRRMNK  609
            +QVRH+YYR   +++K
Sbjct  222  EQVRHFYYRTWHKISK  237



>ref|XP_002734793.1| PREDICTED: protein cramped-like [Saccoglossus kowalevskii]
Length=1170

 Score = 55.8 bits (133),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 33/97 (34%), Positives = 46/97 (47%), Gaps = 13/97 (13%)
 Frame = +1

Query  367  FSQDHSVTEQLASFEEHSALQQPVKRQTRKWAAWTREEEESFFSALRHVGKNFEKITSRV  546
            F +D +         E    Q+P K   ++W AWT +++  FF AL   GK+FE I   +
Sbjct  90   FKKDQTPPPMQPKLPEKPVKQEP-KAVKKRWEAWTVQDKNFFFEALFEHGKDFEAIQKYM  148

Query  547  QS------------KNKDQVRHYYYRLVRRMNKLLGP  621
            +             KNKDQVRH YYR   ++ K L P
Sbjct  149  EVRHKKRGDPPNLIKNKDQVRHLYYRTWHKIFKYLTP  185



>ref|XP_003724342.1| PREDICTED: protein cramped-like [Strongylocentrotus purpuratus]
Length=1256

 Score = 55.8 bits (133),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 32/95 (34%), Positives = 49/95 (52%), Gaps = 22/95 (23%)
 Frame = +1

Query  409  EEHSALQQPVKRQTRKWAAWTREEEESFFSALRHVGKNFEKITSRV------------QS  552
            ++ S  +QP K + ++W AW+ +++  FF A+   GK+FE I   +            Q+
Sbjct  121  DKQSKAEQP-KAERKRWEAWSFQDKNLFFEAVAEHGKDFESIQRYIGQRHKKLGYPPNQN  179

Query  553  KNKDQVRHYYYRLVRRMNKLLGP---------ELC  630
            KNKDQVRH YYR   ++ K + P         ELC
Sbjct  180  KNKDQVRHLYYRTCHKLLKFVKPLPDQPRVNSELC  214



>emb|CDQ72273.1| unnamed protein product [Oncorhynchus mykiss]
Length=535

 Score = 54.7 bits (130),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 28/76 (37%), Positives = 43/76 (57%), Gaps = 15/76 (20%)
 Frame = +1

Query  427  QQPV---KRQTRKWAAWTREEEESFFSALRHVGKNFEKITSRV------------QSKNK  561
            ++PV   KR  R+W +W+ E++ SFF  L   GK+FE I + +              KNK
Sbjct  236  EEPVGCQKRPRRQWESWSAEDKNSFFEGLYEHGKDFEAIQTNIALKHKKKGKPASMVKNK  295

Query  562  DQVRHYYYRLVRRMNK  609
            +QVRH+YYR   +++K
Sbjct  296  EQVRHFYYRTWHKISK  311



>ref|XP_004918071.1| PREDICTED: protein cramped-like isoform X2 [Xenopus (Silurana) 
tropicalis]
Length=1226

 Score = 55.1 bits (131),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 44/154 (29%), Positives = 68/154 (44%), Gaps = 30/154 (19%)
 Frame = +1

Query  229  LTLGSEADHYLRSSPRK-----------DGDFTFGKVNCVEQQIASSQE--HAIPEQAMF  369
            L L  +  H+LRSS R            DG  T  K   ++    SS      +   A  
Sbjct  78   LNLQQDQRHFLRSSVRPHTKRLRKDSCSDGAGTSAKTKGLDSATPSSPSCSTGLAPNAPK  137

Query  370  SQDHSVTEQLASFEEHSALQQPVKRQTRKWAAWTREEEESFFSALRHVGKNFEKITSRV-  546
            +   ++    A  EE S      K+  R+W +W+ E++ +FF AL   GK+FE I + + 
Sbjct  138  ASSRNLAPSGAEKEEGSK-----KKVRRQWESWSTEDKNTFFEALYEHGKDFEAIQNNIA  192

Query  547  -----------QSKNKDQVRHYYYRLVRRMNKLL  615
                         KNK+QVRH+YYR   +++K +
Sbjct  193  LKYKKKAKPASMVKNKEQVRHFYYRTWHKISKYI  226



>ref|XP_004918072.1| PREDICTED: protein cramped-like isoform X3 [Xenopus (Silurana) 
tropicalis]
Length=1210

 Score = 55.1 bits (131),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 44/154 (29%), Positives = 68/154 (44%), Gaps = 30/154 (19%)
 Frame = +1

Query  229  LTLGSEADHYLRSSPRK-----------DGDFTFGKVNCVEQQIASSQE--HAIPEQAMF  369
            L L  +  H+LRSS R            DG  T  K   ++    SS      +   A  
Sbjct  62   LNLQQDQRHFLRSSVRPHTKRLRKDSCSDGAGTSAKTKGLDSATPSSPSCSTGLAPNAPK  121

Query  370  SQDHSVTEQLASFEEHSALQQPVKRQTRKWAAWTREEEESFFSALRHVGKNFEKITSRV-  546
            +   ++    A  EE S      K+  R+W +W+ E++ +FF AL   GK+FE I + + 
Sbjct  122  ASSRNLAPSGAEKEEGSK-----KKVRRQWESWSTEDKNTFFEALYEHGKDFEAIQNNIA  176

Query  547  -----------QSKNKDQVRHYYYRLVRRMNKLL  615
                         KNK+QVRH+YYR   +++K +
Sbjct  177  LKYKKKAKPASMVKNKEQVRHFYYRTWHKISKYI  210



>ref|XP_002932497.2| PREDICTED: protein cramped-like isoform X1 [Xenopus (Silurana) 
tropicalis]
Length=1227

 Score = 55.1 bits (131),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 44/154 (29%), Positives = 68/154 (44%), Gaps = 30/154 (19%)
 Frame = +1

Query  229  LTLGSEADHYLRSSPRK-----------DGDFTFGKVNCVEQQIASSQE--HAIPEQAMF  369
            L L  +  H+LRSS R            DG  T  K   ++    SS      +   A  
Sbjct  79   LNLQQDQRHFLRSSVRPHTKRLRKDSCSDGAGTSAKTKGLDSATPSSPSCSTGLAPNAPK  138

Query  370  SQDHSVTEQLASFEEHSALQQPVKRQTRKWAAWTREEEESFFSALRHVGKNFEKITSRV-  546
            +   ++    A  EE S      K+  R+W +W+ E++ +FF AL   GK+FE I + + 
Sbjct  139  ASSRNLAPSGAEKEEGSK-----KKVRRQWESWSTEDKNTFFEALYEHGKDFEAIQNNIA  193

Query  547  -----------QSKNKDQVRHYYYRLVRRMNKLL  615
                         KNK+QVRH+YYR   +++K +
Sbjct  194  LKYKKKAKPASMVKNKEQVRHFYYRTWHKISKYI  227



>ref|XP_008327995.1| PREDICTED: protein cramped-like isoform X2 [Cynoglossus semilaevis]
Length=1164

 Score = 54.7 bits (130),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 26/69 (38%), Positives = 39/69 (57%), Gaps = 12/69 (17%)
 Frame = +1

Query  439  KRQTRKWAAWTREEEESFFSALRHVGKNFEKITSRV------------QSKNKDQVRHYY  582
            KR  R+W +W+ E++ SFF  L   GK+FE I + +              KNK+QVRH+Y
Sbjct  167  KRARRQWESWSAEDKNSFFEGLYEHGKDFEAIQNNIAMKYKKRGKPANMVKNKEQVRHFY  226

Query  583  YRLVRRMNK  609
            YR   +++K
Sbjct  227  YRTWHKISK  235



>ref|XP_008327994.1| PREDICTED: protein cramped-like isoform X1 [Cynoglossus semilaevis]
Length=1181

 Score = 54.7 bits (130),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 26/69 (38%), Positives = 39/69 (57%), Gaps = 12/69 (17%)
 Frame = +1

Query  439  KRQTRKWAAWTREEEESFFSALRHVGKNFEKITSRV------------QSKNKDQVRHYY  582
            KR  R+W +W+ E++ SFF  L   GK+FE I + +              KNK+QVRH+Y
Sbjct  184  KRARRQWESWSAEDKNSFFEGLYEHGKDFEAIQNNIAMKYKKRGKPANMVKNKEQVRHFY  243

Query  583  YRLVRRMNK  609
            YR   +++K
Sbjct  244  YRTWHKISK  252



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 9990940351080