BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c60019_g1_i1 len=355 path=[1:0-354]

Length=355
                                                                      Score     E

ref|XP_010318090.1|  PREDICTED: LOW QUALITY PROTEIN: crocetin glu...  71.2    8e-12   
ref|XP_006355167.1|  PREDICTED: flavanone 7-O-glucoside 2''-O-bet...  69.3    3e-11   
ref|XP_009608408.1|  PREDICTED: crocetin glucoside glucosyltransf...  64.3    2e-09   
ref|XP_009768067.1|  PREDICTED: crocetin glucoside glucosyltransf...  60.8    3e-08   
gb|AGR44632.1|  UDP-glucosyltransferase 94B1                          60.5    4e-08   
ref|XP_009609569.1|  PREDICTED: crocetin glucoside glucosyltransf...  52.8    3e-06   
gb|AED99884.1|  glycosyltransferase                                   54.3    4e-06   
gb|AFO67248.1|  putative glucosyltransferase                          51.2    7e-06   
ref|XP_004250482.1|  PREDICTED: crocetin glucoside glucosyltransf...  52.8    2e-05   
ref|XP_006436669.1|  hypothetical protein CICLE_v10033610mg           52.4    2e-05   
gb|AHK12770.1|  flavanone-O-glucoside 2''-O-beta-L-rhamnosyltrans...  52.4    2e-05   
ref|XP_009593727.1|  PREDICTED: crocetin glucoside glucosyltransf...  52.0    3e-05   
ref|XP_009629528.1|  PREDICTED: crocetin glucoside glucosyltransf...  50.4    7e-05   
ref|XP_009770958.1|  PREDICTED: crocetin glucoside glucosyltransf...  50.1    1e-04   
ref|XP_009793442.1|  PREDICTED: crocetin glucoside glucosyltransf...  50.1    1e-04   
ref|XP_009593691.1|  PREDICTED: crocetin glucoside glucosyltransf...  49.3    2e-04   
ref|XP_006361439.1|  PREDICTED: cyanidin-3-O-glucoside 2-O-glucur...  49.3    2e-04   
ref|XP_009604940.1|  PREDICTED: crocetin glucoside glucosyltransf...  48.9    2e-04   
ref|XP_002271587.2|  PREDICTED: crocetin glucoside glucosyltransf...  48.9    2e-04   Vitis vinifera
ref|XP_006352206.1|  PREDICTED: cyanidin-3-O-glucoside 2-O-glucur...  48.5    4e-04   
gb|EYU18696.1|  hypothetical protein MIMGU_mgv1a006481mg              48.5    4e-04   
emb|CDO99872.1|  unnamed protein product                              48.1    4e-04   
ref|XP_010110161.1|  Cyanidin-3-O-glucoside 2-O-glucuronosyltrans...  47.8    7e-04   



>ref|XP_010318090.1| PREDICTED: LOW QUALITY PROTEIN: crocetin glucoside glucosyltransferase-like 
[Solanum lycopersicum]
Length=463

 Score = 71.2 bits (173),  Expect = 8e-12, Method: Composition-based stats.
 Identities = 37/59 (63%), Positives = 47/59 (80%), Gaps = 2/59 (3%)
 Frame = -3

Query  353  VVREVVAEKSGQRLRRRAREFSEKIMSERGEEEMDEAVQELTTLCQTKTFRQDSADVNY  177
            VVREVVAEKSGQRLR++ARE+SE IM   G+EE+DE V+EL  LC+  T R+DS ++ Y
Sbjct  407  VVREVVAEKSGQRLRKKAREYSE-IMKGNGDEEIDEVVKELLNLCKPIT-RRDSVEMLY  463



>ref|XP_006355167.1| PREDICTED: flavanone 7-O-glucoside 2''-O-beta-L-rhamnosyltransferase-like 
[Solanum tuberosum]
Length=463

 Score = 69.3 bits (168),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 36/57 (63%), Positives = 44/57 (77%), Gaps = 2/57 (4%)
 Frame = -3

Query  353  VVREVVAEKSGQRLRRRAREFSEKIMSERGEEEMDEAVQELTTLCQTKTFRQDSADV  183
            V+REVVAEKSG RLR++AREFSE IM   GE E+DE V+EL  LC+  T RQDS ++
Sbjct  407  VIREVVAEKSGPRLRKKAREFSE-IMKSNGEREIDEVVKELLNLCKPIT-RQDSVEM  461



>ref|XP_009608408.1| PREDICTED: crocetin glucoside glucosyltransferase-like [Nicotiana 
tomentosiformis]
Length=481

 Score = 64.3 bits (155),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 32/59 (54%), Positives = 46/59 (78%), Gaps = 2/59 (3%)
 Frame = -3

Query  353  VVREVVAEKSGQRLRRRAREFSEKIMSERGEEEMDEAVQELTTLCQTKTFRQDSADVNY  177
            V+R+VVAEK+GQRLR+RARE+SE I+   G +E+D+ V+EL  LC+  T RQ+S ++ Y
Sbjct  425  VIRKVVAEKTGQRLRKRAREYSE-ILKSNGAKEIDQVVEELLKLCRL-TRRQESTELLY  481



>ref|XP_009768067.1| PREDICTED: crocetin glucoside glucosyltransferase-like [Nicotiana 
sylvestris]
Length=459

 Score = 60.8 bits (146),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 32/59 (54%), Positives = 44/59 (75%), Gaps = 2/59 (3%)
 Frame = -3

Query  353  VVREVVAEKSGQRLRRRAREFSEKIMSERGEEEMDEAVQELTTLCQTKTFRQDSADVNY  177
            V+R+VVAEK GQRLR+RARE+SE  +   G +E++E V+EL  LC+  T RQDS ++ Y
Sbjct  403  VIRKVVAEKIGQRLRKRAREYSE-FLESNGAKEINEVVEELLKLCRV-TRRQDSTELLY  459



>gb|AGR44632.1| UDP-glucosyltransferase 94B1 [Panax ginseng]
Length=442

 Score = 60.5 bits (145),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 28/52 (54%), Positives = 40/52 (77%), Gaps = 1/52 (2%)
 Frame = -3

Query  353  VVREVVAEKSGQRLRRRAREFSEKIMSERGEEEMDEAVQELTTLCQTKTFRQ  198
            V+R+VV EKSG+ +RR+ARE SEK M E+GE+E+D A++EL  +C+ K   Q
Sbjct  392  VIRKVVVEKSGEVIRRKARELSEK-MKEKGEQEIDRALEELVQICKKKKDEQ  442



>ref|XP_009609569.1| PREDICTED: crocetin glucoside glucosyltransferase-like [Nicotiana 
tomentosiformis]
Length=199

 Score = 52.8 bits (125),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 25/47 (53%), Positives = 38/47 (81%), Gaps = 1/47 (2%)
 Frame = -3

Query  350  VREVVAEKSGQRLRRRAREFSEKIMSERGEEEMDEAVQELTTLCQTK  210
            +R+VV E+SG+ +R++ARE SEK M+E+G+EE+D  V+EL +LC  K
Sbjct  154  IRKVVMEESGEPVRKKARELSEK-MNEKGDEEIDGVVEELVSLCGNK  199



>gb|AED99884.1| glycosyltransferase [Panax notoginseng]
Length=454

 Score = 54.3 bits (129),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 27/46 (59%), Positives = 37/46 (80%), Gaps = 1/46 (2%)
 Frame = -3

Query  353  VVREVVAEKSGQRLRRRAREFSEKIMSERGEEEMDEAVQELTTLCQ  216
            VV+EVV EKSG  LR++A+E SE+ M  +GEEE+D A++EL TLC+
Sbjct  400  VVKEVVIEKSGVELRKKAKELSEQ-MKAKGEEEVDLAIKELKTLCE  444



>gb|AFO67248.1| putative glucosyltransferase, partial [Aralia elata]
Length=146

 Score = 51.2 bits (121),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 26/48 (54%), Positives = 36/48 (75%), Gaps = 1/48 (2%)
 Frame = -3

Query  353  VVREVVAEKSGQRLRRRAREFSEKIMSERGEEEMDEAVQELTTLCQTK  210
            VV+EVV EKSG  LR++A+E SE+ M  +GEEE+D  ++EL TLC+  
Sbjct  97   VVKEVVIEKSGVELRKKAKELSEQ-MKAKGEEEVDLVIKELKTLCENN  143



>ref|XP_004250482.1| PREDICTED: crocetin glucoside glucosyltransferase-like [Solanum 
lycopersicum]
Length=444

 Score = 52.8 bits (125),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 25/47 (53%), Positives = 35/47 (74%), Gaps = 1/47 (2%)
 Frame = -3

Query  350  VREVVAEKSGQRLRRRAREFSEKIMSERGEEEMDEAVQELTTLCQTK  210
            +REVV E+SG+ LR++A+E SEK M  +G+EE+D  V+EL  LC  K
Sbjct  399  IREVVIEESGEGLRKKAKELSEK-MEMKGDEEIDGVVKELIALCNNK  444



>ref|XP_006436669.1| hypothetical protein CICLE_v10033610mg [Citrus clementina]
 gb|ESR49909.1| hypothetical protein CICLE_v10033610mg [Citrus clementina]
Length=435

 Score = 52.4 bits (124),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 25/44 (57%), Positives = 36/44 (82%), Gaps = 1/44 (2%)
 Frame = -3

Query  353  VVREVVAEKSGQRLRRRAREFSEKIMSERGEEEMDEAVQELTTL  222
            V++EVV EK+G++LRR+ARE SE I  ++G+EE+DE V EL+ L
Sbjct  391  VIKEVVVEKNGEKLRRKAREMSENI-RKKGDEEIDEVVDELSQL  433



>gb|AHK12770.1| flavanone-O-glucoside 2''-O-beta-L-rhamnosyltransferase-like 
protein 4 [Litchi chinensis]
Length=449

 Score = 52.4 bits (124),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 25/44 (57%), Positives = 36/44 (82%), Gaps = 1/44 (2%)
 Frame = -3

Query  353  VVREVVAEKSGQRLRRRAREFSEKIMSERGEEEMDEAVQELTTL  222
            V+REVV +K+G+++RR+ARE SE +M ++GEEE+DE V EL  L
Sbjct  402  VIREVVVDKNGEKIRRKAREMSE-LMKKKGEEEIDEVVNELVQL  444



>ref|XP_009593727.1| PREDICTED: crocetin glucoside glucosyltransferase-like [Nicotiana 
tomentosiformis]
Length=482

 Score = 52.0 bits (123),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 25/47 (53%), Positives = 33/47 (70%), Gaps = 1/47 (2%)
 Frame = -3

Query  353  VVREVVAEKSGQRLRRRAREFSEKIMSERGEEEMDEAVQELTTLCQT  213
            VV+ V+ EK+G+ LR + RE SE +  +R EEEMD AV EL  LC+T
Sbjct  429  VVKSVICEKTGENLRNKVREISENLKKKR-EEEMDAAVGELVQLCKT  474



>ref|XP_009629528.1| PREDICTED: crocetin glucoside glucosyltransferase-like [Nicotiana 
tomentosiformis]
Length=445

 Score = 50.4 bits (119),  Expect = 7e-05, Method: Composition-based stats.
 Identities = 24/48 (50%), Positives = 36/48 (75%), Gaps = 1/48 (2%)
 Frame = -3

Query  353  VVREVVAEKSGQRLRRRAREFSEKIMSERGEEEMDEAVQELTTLCQTK  210
            V+R+VV E+SG+ +R++ RE SEK M+ +G+EE+D  V+EL  LC  K
Sbjct  399  VIRKVVVEESGEDVRKKVRELSEK-MNAKGDEEIDGVVEELVALCNNK  445



>ref|XP_009770958.1| PREDICTED: crocetin glucoside glucosyltransferase-like [Nicotiana 
sylvestris]
Length=443

 Score = 50.1 bits (118),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 24/47 (51%), Positives = 38/47 (81%), Gaps = 1/47 (2%)
 Frame = -3

Query  350  VREVVAEKSGQRLRRRAREFSEKIMSERGEEEMDEAVQELTTLCQTK  210
            +R+VV E+SG+ +R++ARE SE +M+E+G+EE+D  V+EL +LC  K
Sbjct  398  IRKVVMEESGEPVRKKARELSE-MMNEKGDEEIDGVVEELVSLCGNK  443



>ref|XP_009793442.1| PREDICTED: crocetin glucoside glucosyltransferase-like [Nicotiana 
sylvestris]
Length=456

 Score = 50.1 bits (118),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 23/47 (49%), Positives = 33/47 (70%), Gaps = 1/47 (2%)
 Frame = -3

Query  353  VVREVVAEKSGQRLRRRAREFSEKIMSERGEEEMDEAVQELTTLCQT  213
            +V+ ++ EK+G+ LR + RE SE +  ER EEEMD A+ EL  LC+T
Sbjct  403  IVKSIICEKTGENLRNKVREISENLKKER-EEEMDAAIGELVQLCKT  448



>ref|XP_009593691.1| PREDICTED: crocetin glucoside glucosyltransferase-like [Nicotiana 
tomentosiformis]
Length=444

 Score = 49.3 bits (116),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/47 (51%), Positives = 36/47 (77%), Gaps = 1/47 (2%)
 Frame = -3

Query  350  VREVVAEKSGQRLRRRAREFSEKIMSERGEEEMDEAVQELTTLCQTK  210
            +R+VV E+SG+ +R++ARE  EK M+E+G+EE+D  V+EL  LC  K
Sbjct  399  IRKVVMEESGEAVRKKARELREK-MNEKGDEEIDGVVEELVALCGNK  444



>ref|XP_006361439.1| PREDICTED: cyanidin-3-O-glucoside 2-O-glucuronosyltransferase-like 
[Solanum tuberosum]
Length=449

 Score = 49.3 bits (116),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 24/48 (50%), Positives = 36/48 (75%), Gaps = 1/48 (2%)
 Frame = -3

Query  353  VVREVVAEKSGQRLRRRAREFSEKIMSERGEEEMDEAVQELTTLCQTK  210
            V+REVV E+SG+ +R++ +E SEK M+ +G+EE+D  V+EL  LC  K
Sbjct  403  VMREVVIEESGEGVRKKTKELSEK-MNMKGDEEIDGVVEELVALCNNK  449



>ref|XP_009604940.1| PREDICTED: crocetin glucoside glucosyltransferase-like [Nicotiana 
tomentosiformis]
Length=443

 Score = 48.9 bits (115),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 23/48 (48%), Positives = 35/48 (73%), Gaps = 1/48 (2%)
 Frame = -3

Query  353  VVREVVAEKSGQRLRRRAREFSEKIMSERGEEEMDEAVQELTTLCQTK  210
            V+R+VV ++ G+ +R+ ARE SEK M+ +G+EE+D  V+EL  LC  K
Sbjct  397  VIRKVVVDEIGEVVRKNARELSEK-MNAKGDEEIDGVVEELVALCNNK  443



>ref|XP_002271587.2| PREDICTED: crocetin glucoside glucosyltransferase-like [Vitis 
vinifera]
Length=434

 Score = 48.9 bits (115),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 23/45 (51%), Positives = 35/45 (78%), Gaps = 1/45 (2%)
 Frame = -3

Query  353  VVREVVAEKSGQRLRRRAREFSEKIMSERGEEEMDEAVQELTTLC  219
            V++EVV EK+G+ +RR+ARE SE  + ++G+EE+D  V+EL  LC
Sbjct  389  VIKEVVGEKNGENVRRKARELSET-LRKKGDEEIDVVVEELKQLC  432



>ref|XP_006352206.1| PREDICTED: cyanidin-3-O-glucoside 2-O-glucuronosyltransferase-like 
[Solanum tuberosum]
Length=450

 Score = 48.5 bits (114),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 22/47 (47%), Positives = 34/47 (72%), Gaps = 1/47 (2%)
 Frame = -3

Query  350  VREVVAEKSGQRLRRRAREFSEKIMSERGEEEMDEAVQELTTLCQTK  210
            +R+VV EK G+ +R++A+E SE  M+ +G+EE+D  V+EL  LC  K
Sbjct  405  IRKVVVEKGGEAMRKKAKELSE-YMNAKGDEEIDGVVEELLALCNNK  450



>gb|EYU18696.1| hypothetical protein MIMGU_mgv1a006481mg [Erythranthe guttata]
Length=442

 Score = 48.5 bits (114),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 22/45 (49%), Positives = 32/45 (71%), Gaps = 0/45 (0%)
 Frame = -3

Query  353  VVREVVAEKSGQRLRRRAREFSEKIMSERGEEEMDEAVQELTTLC  219
            V+R VV E SG+ +R+RA +   K+  +RG+EE+DE V+EL  LC
Sbjct  396  VIRSVVVESSGKFVRKRAADVGVKLRGKRGDEEIDEVVKELVGLC  440



>emb|CDO99872.1| unnamed protein product [Coffea canephora]
Length=442

 Score = 48.1 bits (113),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 21/46 (46%), Positives = 34/46 (74%), Gaps = 0/46 (0%)
 Frame = -3

Query  353  VVREVVAEKSGQRLRRRAREFSEKIMSERGEEEMDEAVQELTTLCQ  216
            V+R+V+ E+SG+ +RR+A+E SE++     EEE+D  V+E+  LCQ
Sbjct  391  VIRKVLVEESGKNVRRKAKELSEQMEMRGDEEEIDNLVEEVVQLCQ  436



>ref|XP_010110161.1| Cyanidin-3-O-glucoside 2-O-glucuronosyltransferase [Morus notabilis]
 gb|EXC25399.1| Cyanidin-3-O-glucoside 2-O-glucuronosyltransferase [Morus notabilis]
Length=465

 Score = 47.8 bits (112),  Expect = 7e-04, Method: Composition-based stats.
 Identities = 25/44 (57%), Positives = 32/44 (73%), Gaps = 1/44 (2%)
 Frame = -3

Query  350  VREVVAEKSGQRLRRRAREFSEKIMSERGEEEMDEAVQELTTLC  219
            VR+VV EKSG+ +R +A E  EK M  RG+EEM+E V+EL  LC
Sbjct  414  VRKVVLEKSGESVRNKAVEMGEK-MRRRGDEEMEEVVKELVQLC  456



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 534998687751