BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c5_g1_i1 len=1823 path=[1824:0-1612 194:1613-1717 194:1718-1822]

Length=1823
                                                                      Score     E

ref|XP_011093617.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    498   5e-160   
ref|XP_009799518.1|  PREDICTED: uncharacterized protein LOC104245598    491   1e-157   
ref|XP_009611223.1|  PREDICTED: uncharacterized protein LOC104104773    478   1e-152   
ref|XP_006341263.1|  PREDICTED: uncharacterized protein LOC102602783    476   8e-152   
ref|XP_004242929.1|  PREDICTED: uncharacterized protein LOC101245558    462   2e-146   
ref|XP_002280712.1|  PREDICTED: uncharacterized protein LOC100262932    449   2e-140   Vitis vinifera
ref|XP_010249632.1|  PREDICTED: uncharacterized protein LOC104592...    442   6e-139   
ref|XP_010249631.1|  PREDICTED: uncharacterized protein LOC104592...    442   8e-139   
gb|EYU32952.1|  hypothetical protein MIMGU_mgv1a000695mg                439   9e-138   
ref|XP_007013101.1|  Elongation factor Ts isoform 1                     439   3e-137   
ref|XP_007013102.1|  Elongation factor Ts isoform 2                     438   4e-137   
gb|KDO66468.1|  hypothetical protein CISIN_1g005707mg                   426   1e-136   
ref|XP_006475667.1|  PREDICTED: microtubule-associated protein fu...    426   3e-134   
ref|XP_002514263.1|  elongation factor ts, putative                     424   2e-132   Ricinus communis
gb|KHG25312.1|  Elongation factor Ts                                    412   3e-127   
ref|XP_006451571.1|  hypothetical protein CICLE_v10010581mg             408   4e-127   
ref|XP_007203990.1|  hypothetical protein PRUPE_ppa000765mg             410   7e-127   
ref|XP_008242565.1|  PREDICTED: uncharacterized protein LOC103340883    412   8e-127   
ref|XP_010526456.1|  PREDICTED: uncharacterized protein LOC104804019    406   1e-125   
ref|XP_008343990.1|  PREDICTED: probable GPI-anchored adhesin-lik...    395   1e-124   
gb|KCW79949.1|  hypothetical protein EUGRSUZ_C01279                     407   4e-124   
ref|XP_010050572.1|  PREDICTED: uncharacterized protein LOC104439162    407   5e-124   
emb|CDP03297.1|  unnamed protein product                                406   2e-123   
ref|XP_010688265.1|  PREDICTED: uncharacterized protein LOC104902...    399   1e-122   
ref|XP_010688263.1|  PREDICTED: uncharacterized protein LOC104902...    400   2e-122   
ref|XP_010688264.1|  PREDICTED: uncharacterized protein LOC104902...    400   3e-122   
ref|XP_002325009.2|  elongation factor Ts family protein                394   4e-121   Populus trichocarpa [western balsam poplar]
ref|XP_008462748.1|  PREDICTED: probable GPI-anchored adhesin-lik...    396   1e-120   
ref|XP_008462747.1|  PREDICTED: probable GPI-anchored adhesin-lik...    397   1e-120   
ref|XP_011048367.1|  PREDICTED: uncharacterized protein LOC105142434    395   2e-120   
ref|XP_008390553.1|  PREDICTED: probable GPI-anchored adhesin-lik...    391   6e-119   
ref|XP_010107377.1|  Elongation factor Ts                               389   2e-118   
ref|XP_009352505.1|  PREDICTED: uncharacterized protein LOC103943...    387   3e-118   
ref|XP_009352504.1|  PREDICTED: uncharacterized protein LOC103943...    387   5e-118   
ref|XP_004287445.1|  PREDICTED: uncharacterized protein LOC101312281    386   1e-117   
ref|XP_010540967.1|  PREDICTED: uncharacterized protein LOC104814...    382   3e-116   
ref|XP_010540966.1|  PREDICTED: uncharacterized protein LOC104814...    382   4e-116   
ref|XP_004150558.1|  PREDICTED: uncharacterized protein LOC101216355    384   4e-116   
ref|XP_004169613.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    381   4e-115   
gb|AAL09789.1|  AT4g29060/F19B15_90                                     355   3e-112   Arabidopsis thaliana [mouse-ear cress]
gb|KDP33708.1|  hypothetical protein JCGZ_07279                         373   4e-112   
ref|XP_006573450.1|  PREDICTED: enolase-phosphatase E1-like isofo...    367   3e-111   
ref|XP_008783732.1|  PREDICTED: uncharacterized protein LOC103702876    371   4e-111   
ref|XP_006573449.1|  PREDICTED: enolase-phosphatase E1-like isofo...    367   5e-111   
dbj|BAE98916.1|  hypothetical protein                                   358   6e-111   Arabidopsis thaliana [mouse-ear cress]
gb|AAU93601.1|  chloroplast polyprotein of elongation factor Ts p...    358   5e-110   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001031743.1|  elongation factor Ts family protein                358   5e-110   Arabidopsis thaliana [mouse-ear cress]
gb|KHN45619.1|  Elongation factor Ts                                    367   8e-110   
ref|XP_003534213.1|  PREDICTED: enolase-phosphatase E1-like             367   9e-110   
gb|KHN40125.1|  Elongation factor Ts                                    367   1e-109   
ref|XP_010937186.1|  PREDICTED: uncharacterized protein LOC105056625    365   4e-109   
ref|XP_006282541.1|  hypothetical protein CARUB_v10004081mg             359   3e-108   
ref|XP_007152879.1|  hypothetical protein PHAVU_004G168100g             361   1e-107   
ref|NP_567820.1|  elongation factor Ts family protein                   358   1e-107   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010433141.1|  PREDICTED: uncharacterized protein LOC104717292    358   1e-107   
gb|EPS62273.1|  hypothetical protein M569_12515                         357   2e-107   
ref|XP_010447895.1|  PREDICTED: uncharacterized protein LOC104730431    356   5e-107   
ref|XP_010438354.1|  PREDICTED: uncharacterized protein LOC104721969    356   6e-107   
ref|XP_003620654.1|  Elongation factor Ts                               356   2e-106   
ref|XP_009402522.1|  PREDICTED: uncharacterized protein LOC103986289    354   4e-105   
ref|XP_004513015.1|  PREDICTED: enolase-phosphatase E1-like isofo...    351   4e-104   
ref|XP_004513014.1|  PREDICTED: enolase-phosphatase E1-like isofo...    351   4e-104   
ref|XP_006833408.1|  hypothetical protein AMTR_s00109p00129480          345   2e-101   
ref|XP_009109054.1|  PREDICTED: uncharacterized protein LOC103834730    317   1e-97    
emb|CDY14222.1|  BnaA08g13530D                                          316   2e-97    
emb|CDY35248.1|  BnaA01g07830D                                          329   5e-97    
ref|XP_009129019.1|  PREDICTED: altered inheritance of mitochondr...    330   8e-97    
emb|CDY06843.1|  BnaC01g09420D                                          327   2e-96    
ref|XP_006412882.1|  hypothetical protein EUTSA_v10024316mg             328   2e-96    
emb|CBI28033.3|  unnamed protein product                                293   4e-84    
ref|XP_006584819.1|  PREDICTED: rRNA biogenesis protein RRP5-like...    266   2e-80    
ref|NP_001131522.1|  uncharacterized protein LOC100192861               264   2e-76    Zea mays [maize]
gb|EMS52112.1|  Elongation factor Ts                                    273   3e-76    
ref|XP_003570661.1|  PREDICTED: uncharacterized protein LOC100836461    269   3e-75    
ref|XP_004962824.1|  PREDICTED: uncharacterized protein LOC101759704    269   5e-75    
ref|XP_006664084.1|  PREDICTED: mucin-22-like                           270   8e-75    
ref|NP_001066956.1|  Os12g0541500                                       269   1e-74    Oryza sativa Japonica Group [Japonica rice]
ref|XP_002461159.1|  hypothetical protein SORBIDRAFT_02g041940          266   3e-74    Sorghum bicolor [broomcorn]
gb|EMT00261.1|  Elongation factor Ts                                    263   7e-73    
ref|XP_001765237.1|  predicted protein                                  194   2e-49    
ref|XP_001759360.1|  predicted protein                                  193   4e-49    
ref|XP_001765236.1|  predicted protein                                  187   4e-49    
gb|EYU29816.1|  hypothetical protein MIMGU_mgv11b021295mg               182   1e-48    
ref|XP_002961419.1|  hypothetical protein SELMODRAFT_60716              146   2e-33    
ref|XP_002990284.1|  hypothetical protein SELMODRAFT_40704              143   2e-32    
ref|XP_005835743.1|  hypothetical protein GUITHDRAFT_105392             126   1e-28    
ref|XP_003078528.1|  chloroplast polyprotein of elongation factor...    111   2e-23    
ref|XP_003062074.1|  predicted protein                                  115   3e-23    
emb|CEF97398.1|  Translation elongation factor EFTs/EF1B, dimeris...    113   1e-22    
ref|XP_009041734.1|  hypothetical protein AURANDRAFT_72706              108   2e-22    
ref|XP_007513208.1|  elongation factor Ts                               111   4e-22    
ref|XP_002499833.1|  predicted protein                                  107   7e-21    Micromonas commoda
ref|WP_016836946.1|  30S ribosomal protein S1                         99.4    4e-19    
ref|WP_016203025.1|  30S ribosomal protein S1                         97.1    3e-18    
ref|WP_031538293.1|  30S ribosomal protein S1                         95.9    6e-18    
ref|WP_038535886.1|  30S ribosomal protein S1                         95.5    7e-18    
ref|XP_005703273.1|  30S ribosomal protein S1                         94.4    7e-18    
ref|WP_004339407.1|  RNA binding S1 domain-containing protein         97.4    1e-17    
emb|CEG22588.1|  hypothetical protein BN1080_01519                    94.7    1e-17    
ref|WP_039313628.1|  30S ribosomal protein S1                         94.7    1e-17    
ref|WP_031417967.1|  30S ribosomal protein S1                         94.7    2e-17    
ref|WP_021726717.1|  S1 RNA binding domain protein                    94.0    2e-17    
ref|WP_004435313.1|  30S ribosomal protein S1                         93.6    3e-17    
ref|WP_012293606.1|  30S ribosomal protein S1                         93.2    4e-17    
ref|WP_032110940.1|  30S ribosomal protein S1                         93.6    4e-17    
ref|WP_012190631.1|  RNA-binding S1 domain-containing protein         94.4    5e-17    
ref|WP_016427428.1|  30S ribosomal protein S1                         93.2    5e-17    
ref|WP_025746549.1|  hypothetical protein                             95.1    5e-17    
ref|WP_036126780.1|  30S ribosomal protein S1                         92.8    5e-17    
ref|XP_005768711.1|  hypothetical protein EMIHUDRAFT_436544           92.0    6e-17    
ref|WP_009370802.1|  30S ribosomal protein S1                         92.8    6e-17    
ref|WP_023942709.1|  30S ribosomal protein S1                         92.8    6e-17    
ref|WP_019238298.1|  30S ribosomal protein S1                         92.8    7e-17    
ref|WP_004232600.1|  30S ribosomal protein S1                         92.4    7e-17    
ref|WP_004437410.1|  30S ribosomal protein S1                         92.4    7e-17    
ref|WP_004251536.1|  RNA binding S1 domain-containing protein         94.7    7e-17    
ref|WP_016893866.1|  30S ribosomal protein S1                         90.9    7e-17    
ref|WP_016993346.1|  30S ribosomal protein S1                         92.4    7e-17    
ref|WP_008446212.1|  30S ribosomal protein S1                         94.0    8e-17    
ref|WP_036801877.1|  30S ribosomal protein S1                         92.4    8e-17    
ref|WP_001851302.1|  40S ribosomal protein S1                         90.9    9e-17    
ref|WP_028460693.1|  30S ribosomal protein S1                         94.0    9e-17    
ref|WP_024364294.1|  30S ribosomal protein S1                         92.0    9e-17    
gb|AHN21285.1|  30S ribosomal protein S1                              92.0    9e-17    
ref|WP_019921781.1|  30S ribosomal protein S1                         94.0    1e-16    
ref|WP_020924625.1|  Transcription accessory protein (S1 RNA-bind...  94.0    1e-16    
ref|WP_020705490.1|  30S ribosomal protein S1                         93.6    1e-16    
ref|XP_005712094.1|  unnamed protein product                          92.0    1e-16    
ref|WP_018989866.1|  RNA-binding protein                              94.0    1e-16    
ref|WP_034751798.1|  MULTISPECIES: 30S ribosomal protein S1           93.6    1e-16    
ref|WP_011288472.1|  RNA-binding protein                              94.0    1e-16    
gb|AIQ45419.1|  hypothetical protein R70723_05535                     94.0    1e-16    
ref|WP_038495310.1|  30S ribosomal protein S1                         93.2    1e-16    
ref|WP_010395707.1|  30S ribosomal protein S1                         93.2    1e-16    
ref|WP_036750314.1|  transcription accessory protein                  94.0    1e-16    
ref|WP_017876964.1|  30S ribosomal protein S1                         93.2    1e-16    
ref|WP_009277884.1|  30S ribosomal protein S1                         91.7    1e-16    
ref|WP_036600682.1|  hypothetical protein                             90.9    2e-16    
ref|WP_013986473.1|  30S ribosomal protein S1                         92.0    2e-16    
ref|WP_023177725.1|  MULTISPECIES: 30S ribosomal protein S1           92.0    2e-16    
ref|WP_006829852.1|  30S ribosomal protein S1                         91.7    2e-16    
ref|WP_016569798.1|  30S ribosomal protein S1                         91.7    2e-16    
ref|WP_013648727.1|  30S ribosomal protein S1                         93.2    2e-16    
ref|WP_027323807.1|  30S ribosomal protein S1                         91.3    2e-16    
gb|KGY24361.1|  transcription accessory protein                       93.6    2e-16    
ref|WP_033683468.1|  30S ribosomal protein S1                         91.7    2e-16    
ref|WP_001001634.1|  30S ribosomal protein S1                         91.7    2e-16    
ref|WP_039204196.1|  transcription accessory protein                  93.2    2e-16    
ref|WP_025117414.1|  30S ribosomal protein S1                         91.3    2e-16    
ref|WP_005668995.1|  30S ribosomal protein S1                         92.8    2e-16    
emb|CEG28390.1|  phosphorylase or nucleotidyl transferase             87.4    2e-16    
ref|WP_026350008.1|  transcription accessory protein                  93.6    2e-16    
ref|WP_027964476.1|  30S ribosomal protein S1                         91.3    2e-16    
gb|KEQ34714.1|  S1 RNA binding domain protein                         91.7    2e-16    
ref|WP_015875504.1|  RNA-binding protein                              93.2    2e-16    
ref|WP_036252595.1|  30S ribosomal protein S1                         92.8    2e-16    
ref|WP_036183821.1|  30S ribosomal protein S1                         91.3    2e-16    
ref|WP_008180421.1|  30S ribosomal protein S1                         91.3    2e-16    
ref|WP_001001635.1|  MULTISPECIES: 30S ribosomal protein S1           91.3    2e-16    
ref|WP_036124564.1|  MULTISPECIES: 30S ribosomal protein S1           90.9    2e-16    
ref|WP_013392336.1|  RNA-binding protein                              93.2    2e-16    
ref|WP_029215234.1|  hypothetical protein                             92.8    2e-16    
ref|WP_036216105.1|  30S ribosomal protein S1                         92.4    2e-16    
ref|WP_027864827.1|  30S ribosomal protein S1                         92.4    2e-16    
ref|WP_001001630.1|  30S ribosomal protein S1                         91.3    2e-16    
ref|WP_036237328.1|  30S ribosomal protein S1                         92.4    2e-16    
ref|WP_033676925.1|  30S ribosomal protein S1                         91.3    2e-16    
ref|WP_001001633.1|  30S ribosomal protein S1                         91.3    2e-16    
gb|AIQ51037.1|  hypothetical protein R70331_05555                     93.2    2e-16    
ref|WP_001001636.1|  30S ribosomal protein S1                         91.3    2e-16    
ref|WP_039787498.1|  30S ribosomal protein S1                         92.4    2e-16    
ref|WP_001001631.1|  30S ribosomal protein S1                         91.3    2e-16    
ref|WP_001001632.1|  30S ribosomal protein S1                         91.3    2e-16    
ref|WP_026920872.1|  transcription accessory protein                  92.8    2e-16    
ref|WP_008106997.1|  30S ribosomal protein S1                         92.0    2e-16    
gb|KIF82889.1|  30S ribosomal protein S1                              92.4    3e-16    
ref|WP_020652515.1|  30S ribosomal protein S1                         92.4    3e-16    
ref|WP_024534871.1|  30S ribosomal protein S1                         90.9    3e-16    
ref|WP_036736253.1|  hypothetical protein                             85.5    3e-16    
gb|EIJ46026.1|  30s ribosomal protein S1                              92.4    3e-16    
ref|WP_019128600.1|  MULTISPECIES: 30S ribosomal protein S1           90.9    3e-16    
gb|EZI58074.1|  S1 RNA binding domain protein                         90.9    3e-16    
ref|WP_004372223.1|  RNA binding S1 domain-containing protein         92.8    3e-16    
ref|WP_006462118.1|  30S ribosomal protein S1                         92.4    3e-16    
ref|WP_034307708.1|  MULTISPECIES: 30S ribosomal protein S1           92.0    3e-16    
ref|WP_013235629.1|  30S ribosomal protein S1                         92.4    3e-16    
ref|WP_036723070.1|  hypothetical protein                             88.6    3e-16    
ref|WP_034332777.1|  MULTISPECIES: 30S ribosomal protein S1           92.0    3e-16    
ref|WP_008114400.1|  30S ribosomal protein S1                         92.0    3e-16    
ref|WP_011836999.1|  30S ribosomal protein S1                         90.9    3e-16    
ref|WP_028100434.1|  30S ribosomal protein S1                         92.0    3e-16    
ref|WP_006913501.1|  30S ribosomal protein S1                         92.0    3e-16    
ref|WP_034559636.1|  30S ribosomal protein S1                         90.9    3e-16    
ref|WP_001844815.1|  putative 30S ribosomal protein S1                89.4    3e-16    
gb|AHI03327.1|  RNA-binding protein                                   92.8    3e-16    
ref|WP_024068156.1|  Transcription accessory protein (S1 RNA-bind...  92.8    3e-16    
ref|WP_008161788.1|  RNA-binding protein                              92.8    3e-16    
ref|WP_001001627.1|  30S ribosomal protein S1                         90.9    3e-16    
ref|WP_011579664.1|  RNA-binding protein                              92.4    3e-16    
ref|WP_001001626.1|  30S ribosomal protein S1                         90.9    3e-16    
ref|WP_035028356.1|  30S ribosomal protein S1                         90.9    3e-16    
ref|WP_006389393.1|  RNA-binding protein                              92.4    3e-16    
ref|WP_017380368.1|  30S ribosomal protein S1                         90.5    4e-16    
ref|WP_001862393.1|  30S ribosomal protein S1                         90.9    4e-16    
ref|WP_006040783.1|  hypothetical protein                             92.4    4e-16    
ref|WP_029363180.1|  30S ribosomal protein S1                         92.0    4e-16    
ref|WP_013252183.1|  30S ribosomal protein S1                         90.5    4e-16    
ref|WP_033584854.1|  30S ribosomal protein S1                         90.5    4e-16    
ref|WP_034569556.1|  30S ribosomal protein S1                         90.9    4e-16    
gb|AHZ47562.1|  30S ribosomal protein S1                              90.5    4e-16    
ref|WP_016398108.1|  30S ribosomal protein S1                         90.5    4e-16    
ref|WP_001001617.1|  MULTISPECIES: 30S ribosomal protein S1           90.5    4e-16    
ref|WP_011958658.1|  RNA-binding protein S1                           91.7    4e-16    
ref|WP_001001625.1|  30S ribosomal protein S1                         90.5    4e-16    
ref|WP_021735133.1|  S1 RNA binding domain protein                    90.5    4e-16    
ref|WP_001001616.1|  30S ribosomal protein S1                         90.5    4e-16    
ref|WP_036723396.1|  hypothetical protein                             92.4    4e-16    
ref|WP_001001623.1|  30S ribosomal protein S1                         90.5    4e-16    
ref|WP_014191595.1|  RNA-binding protein                              92.0    4e-16    
ref|WP_006223932.1|  RNA-binding protein                              92.4    4e-16    
gb|AIQ11713.1|  hypothetical protein PDUR_06975                       92.0    4e-16    
ref|WP_036165151.1|  30S ribosomal protein S1                         91.7    4e-16    
ref|WP_036697454.1|  hypothetical protein                             92.0    4e-16    
ref|WP_028326338.1|  30S ribosomal protein S1                         91.3    5e-16    
ref|WP_038704164.1|  30S ribosomal protein S1                         90.1    5e-16    
gb|ETT76580.1|  Tex-like protein                                      92.0    5e-16    
ref|WP_017232088.1|  30S ribosomal protein S1                         91.7    5e-16    
ref|WP_001001622.1|  30S ribosomal protein S1                         90.5    5e-16    
ref|WP_001001624.1|  30S ribosomal protein S1                         90.5    5e-16    
ref|WP_014188347.1|  RNA-binding protein                              92.0    5e-16    
ref|WP_025694820.1|  hypothetical protein                             92.0    5e-16    
gb|ETT45609.1|  Tex-like protein                                      92.0    5e-16    
ref|WP_023940981.1|  30S ribosomal protein S1                         90.1    5e-16    
ref|WP_028995476.1|  transcription accessory protein                  92.0    5e-16    
ref|WP_007516923.1|  30S ribosomal protein S1                         90.1    5e-16    
emb|CBA07943.1|  30S ribosomal protein S1                             91.7    5e-16    Neisseria meningitidis alpha275
ref|WP_001001620.1|  MULTISPECIES: 30S ribosomal protein S1           90.1    6e-16    
ref|WP_001001615.1|  MULTISPECIES: 30S ribosomal protein S1           90.1    6e-16    
ref|WP_037616267.1|  30S ribosomal protein S1                         90.1    6e-16    
ref|WP_011798918.1|  30S ribosomal protein S1                         91.3    6e-16    
gb|EFM04762.1|  ribosomal protein S1                                  91.3    6e-16    
ref|WP_003752638.1|  30S ribosomal protein S1                         91.3    6e-16    
ref|WP_029609369.1|  30S ribosomal protein S1                         91.3    6e-16    
ref|WP_034298627.1|  30S ribosomal protein S1                         91.3    6e-16    
ref|WP_007876342.1|  30S ribosomal protein S1                         91.3    6e-16    
gb|AIQ27919.1|  hypothetical protein P40081_06775                     91.7    6e-16    
ref|WP_001001638.1|  30S ribosomal protein S1                         90.1    6e-16    
ref|WP_002223706.1|  30S ribosomal protein S1                         91.3    6e-16    
ref|WP_012119946.1|  RNA-binding protein S1                           90.9    6e-16    
ref|WP_028539684.1|  hypothetical protein                             91.7    7e-16    
ref|WP_002226316.1|  ribosomal protein S1                             90.1    7e-16    
ref|WP_001001637.1|  30S ribosomal protein S1                         89.7    7e-16    
ref|WP_001001621.1|  30S ribosomal protein S1                         89.7    7e-16    
ref|WP_013448999.1|  30S ribosomal protein S1                         91.3    7e-16    
gb|AHV96063.1|  Tex-like protein                                      91.7    7e-16    
ref|WP_008431001.1|  30S ribosomal protein S1                         89.7    7e-16    
ref|WP_004429740.1|  MULTISPECIES: 30S ribosomal protein S1           89.7    7e-16    
ref|WP_025457075.1|  30S ribosomal protein S1                         91.3    7e-16    
ref|WP_002233966.1|  30S ribosomal protein S1                         91.3    7e-16    
ref|WP_002239753.1|  30S ribosomal protein S1                         91.3    7e-16    
ref|WP_002229539.1|  30S ribosomal protein S1                         90.9    7e-16    
ref|WP_001001628.1|  30S ribosomal protein S1                         89.7    7e-16    
ref|WP_033543829.1|  30S ribosomal protein S1                         89.7    7e-16    
gb|EGC51285.1|  ribosomal protein S1                                  90.9    7e-16    
ref|WP_004179476.1|  30S ribosomal protein S1                         91.3    7e-16    
ref|WP_016313113.1|  competence protein ComEA helix-hairpin-helix...  91.7    7e-16    
ref|WP_029278060.1|  30S ribosomal protein S1                         89.7    7e-16    
ref|WP_002237993.1|  30S ribosomal protein S1                         90.9    7e-16    
ref|WP_014575409.1|  30S ribosomal protein S1                         90.9    7e-16    
ref|WP_014582057.1|  30S ribosomal protein S1                         90.9    7e-16    
ref|WP_002224490.1|  30S ribosomal protein S1                         90.9    7e-16    
ref|WP_023269599.1|  30S ribosomal protein S1                         90.5    7e-16    
ref|WP_015076256.1|  30S ribosomal protein S1                         89.7    7e-16    
ref|WP_015815647.1|  30S ribosomal protein S1                         90.9    7e-16    
ref|WP_008497804.1|  30S ribosomal protein S1                         89.4    7e-16    
ref|WP_002909688.1|  MULTISPECIES: 30S ribosomal protein S1           89.7    7e-16    
dbj|GAL14695.1|  transcription accessory protein                      85.5    8e-16    
ref|WP_036668380.1|  hypothetical protein                             91.3    8e-16    
ref|WP_014007724.1|  30S ribosomal protein S1                         90.9    8e-16    
ref|WP_001001629.1|  30S ribosomal protein S1                         89.7    8e-16    
ref|WP_012503703.1|  30S ribosomal protein S1                         90.9    8e-16    
ref|WP_010050134.1|  30S ribosomal protein S1                         89.7    8e-16    
ref|WP_036475077.1|  30S ribosomal protein S1                         90.9    8e-16    
gb|AIY43452.1|  SSU ribosomal protein S1p                             90.9    8e-16    
ref|WP_035980113.1|  transcription accessory protein                  91.3    8e-16    
ref|WP_025041055.1|  30S ribosomal protein S1                         90.9    8e-16    
emb|CCJ90246.1|  Transcription accessory protein (S1 RNA-binding ...  86.3    8e-16    
ref|WP_009666233.1|  30S ribosomal protein S1                         90.9    9e-16    
ref|WP_011859143.1|  30S ribosomal protein S1                         90.5    9e-16    
ref|WP_009226467.1|  hypothetical protein                             91.3    9e-16    
ref|WP_002904540.1|  30S ribosomal protein S1                         89.4    9e-16    
ref|WP_002897515.1|  30S ribosomal protein S1                         89.4    9e-16    
gb|EGC53101.1|  ribosomal protein S1                                  90.9    9e-16    
gb|AIQ39639.1|  hypothetical protein R50912_06000                     91.3    9e-16    
ref|WP_038497114.1|  30S ribosomal protein S1                         90.9    9e-16    
ref|WP_035438700.1|  30S ribosomal protein S1                         89.7    9e-16    
ref|WP_023272084.1|  ribosomal protein S1                             90.5    9e-16    
gb|ERI05768.1|  30S ribosomal protein S1                              90.1    9e-16    
ref|WP_002227273.1|  30S ribosomal protein S1                         90.5    9e-16    
ref|WP_002258245.1|  30S ribosomal protein S1                         90.5    1e-15    
ref|WP_002235859.1|  30S ribosomal protein S1                         90.5    1e-15    
ref|WP_002895434.1|  30S ribosomal protein S1                         89.4    1e-15    
ref|WP_031952218.1|  30S ribosomal protein S1                         90.5    1e-15    
ref|WP_017866895.1|  hypothetical protein                             86.3    1e-15    
ref|WP_002924606.1|  30S ribosomal protein S1                         89.4    1e-15    
ref|WP_002917191.1|  30S ribosomal protein S1                         89.4    1e-15    
ref|WP_031969662.1|  30S ribosomal protein S1                         90.5    1e-15    
ref|WP_003675204.1|  30S ribosomal protein S1                         90.5    1e-15    
ref|WP_005177527.1|  MULTISPECIES: 30S ribosomal protein S1           90.5    1e-15    
ref|WP_019141734.1|  30S ribosomal protein S1                         90.5    1e-15    
ref|WP_004186819.1|  30S ribosomal protein S1                         89.4    1e-15    
ref|WP_019242045.1|  30S ribosomal protein S1                         89.0    1e-15    
ref|WP_011381374.1|  30S ribosomal protein S1                         90.5    1e-15    
ref|WP_034587667.1|  30S ribosomal protein S1                         90.5    1e-15    
ref|WP_003691321.1|  30S ribosomal protein S1                         90.5    1e-15    
ref|WP_039301904.1|  hypothetical protein                             90.9    1e-15    
ref|WP_000140309.1|  MULTISPECIES: 30S ribosomal protein S1           90.5    1e-15    
ref|WP_004792715.1|  MULTISPECIES: 30S ribosomal protein S1           90.5    1e-15    
ref|WP_003688934.1|  30S ribosomal protein S1                         90.5    1e-15    
ref|WP_021298054.1|  30S ribosomal protein S1                         89.0    1e-15    
ref|WP_039787082.1|  hypothetical protein                             90.9    1e-15    
gb|EFF39420.1|  30S ribosomal protein S1                              90.5    1e-15    
gb|EFE04036.1|  30S ribosomal protein S1                              90.5    1e-15    
ref|WP_008941262.1|  MULTISPECIES: 30S ribosomal protein S1           90.5    1e-15    
ref|WP_016167693.1|  30S ribosomal protein S1                         90.5    1e-15    
ref|WP_002121348.1|  MULTISPECIES: 30S ribosomal protein S1           90.5    1e-15    
ref|WP_005041073.1|  30S ribosomal protein S1                         90.5    1e-15    
ref|WP_004860813.1|  30S ribosomal protein S1                         90.5    1e-15    
ref|WP_018679201.1|  30S ribosomal protein S1                         90.5    1e-15    
ref|WP_002921119.1|  30S ribosomal protein S1                         89.0    1e-15    
ref|WP_009387126.1|  30S ribosomal protein S1                         90.5    1e-15    
ref|WP_004783987.1|  MULTISPECIES: 30S ribosomal protein S1           90.5    1e-15    
ref|WP_002050239.1|  MULTISPECIES: 30S ribosomal protein S1           90.5    1e-15    
ref|WP_032062191.1|  30S ribosomal protein S1                         90.5    1e-15    
ref|XP_002989310.1|  hypothetical protein SELMODRAFT_427936           89.4    1e-15    
ref|WP_039047970.1|  30S ribosomal protein S1                         90.5    1e-15    
ref|WP_016539904.1|  30S ribosomal protein S1                         90.1    1e-15    
ref|WP_031951666.1|  30S ribosomal protein S1                         90.1    1e-15    
ref|WP_004639293.1|  MULTISPECIES: 30S ribosomal protein S1           90.1    1e-15    
ref|WP_002128191.1|  30S ribosomal protein S1                         90.1    1e-15    
ref|WP_004815604.1|  MULTISPECIES: 30S ribosomal protein S1           90.1    1e-15    
ref|WP_035500992.1|  transcription accessory protein                  90.9    1e-15    
ref|WP_032003879.1|  30S ribosomal protein S1                         90.1    1e-15    
ref|WP_002246962.1|  30S ribosomal protein S1                         90.1    1e-15    
ref|WP_004752588.1|  30S ribosomal protein S1                         90.1    1e-15    
ref|WP_004901308.1|  30S ribosomal protein S1                         90.1    1e-15    
ref|WP_032040814.1|  30S ribosomal protein S1                         90.1    1e-15    
ref|WP_003651487.1|  30S ribosomal protein S1                         90.1    1e-15    
ref|WP_004911480.1|  30S ribosomal protein S1                         90.1    1e-15    
ref|WP_004806660.1|  MULTISPECIES: 30S ribosomal protein S1           90.1    1e-15    
ref|WP_004772497.1|  MULTISPECIES: 30S ribosomal protein S1           90.1    1e-15    
gb|EXW57475.1|  ribosomal protein S1                                  89.7    1e-15    
ref|WP_011871955.1|  30S ribosomal protein S1                         90.1    1e-15    
ref|WP_029414470.1|  30S ribosomal protein S1                         90.1    1e-15    
ref|WP_036203606.1|  30S ribosomal protein S1                         88.6    1e-15    
ref|WP_005241870.1|  MULTISPECIES: 30S ribosomal protein S1           90.1    1e-15    
ref|WP_004938702.1|  30S ribosomal protein S1                         90.1    1e-15    
ref|WP_004879865.1|  MULTISPECIES: 30S ribosomal protein S1           90.1    1e-15    
ref|WP_031970558.1|  30S ribosomal protein S1                         89.7    1e-15    
ref|WP_012726799.1|  MULTISPECIES: general stress protein             84.7    1e-15    
ref|WP_004662360.1|  30S ribosomal protein S1                         90.1    1e-15    
ref|WP_012080519.1|  30S ribosomal protein S1                         90.1    1e-15    
ref|WP_016856944.1|  transcription accessory protein                  90.5    1e-15    
ref|WP_004954100.1|  30S ribosomal protein S1                         90.1    1e-15    
ref|WP_005589669.1|  30S ribosomal protein S1                         89.0    1e-15    
ref|WP_023390833.1|  putative ribosomal protein S1                    89.0    1e-15    
ref|WP_005159935.1|  MULTISPECIES: 30S ribosomal protein S1           90.1    1e-15    
ref|WP_004928139.1|  MULTISPECIES: 30S ribosomal protein S1           90.1    1e-15    
gb|ETI86898.1|  30S ribosomal protein S1                              89.0    1e-15    
ref|WP_003024424.1|  MULTISPECIES: 30S ribosomal protein S1           89.0    1e-15    
ref|WP_015604624.1|  30S ribosomal protein S1                         89.0    1e-15    
ref|WP_025015758.1|  30S ribosomal protein S1                         89.0    1e-15    
ref|WP_003072767.1|  30S ribosomal protein S1                         89.0    1e-15    
ref|WP_020998664.1|  30S ribosomal protein S1                         89.0    1e-15    
ref|WP_031959824.1|  30S ribosomal protein S1                         90.1    1e-15    
gb|KGO12878.1|  30S ribosomal protein S1                              88.6    1e-15    
ref|WP_003036730.1|  30S ribosomal protein S1                         89.0    1e-15    
ref|WP_003361116.1|  30S ribosomal protein S1                         88.6    1e-15    
dbj|GAL46308.1|  hypothetical protein YhgF                            90.5    1e-15    
ref|WP_039677117.1|  30S ribosomal protein S1                         89.0    2e-15    
ref|WP_036340831.1|  30S ribosomal protein S1                         89.7    2e-15    
ref|WP_004976774.1|  MULTISPECIES: 30S ribosomal protein S1           90.1    2e-15    
ref|WP_011374719.1|  30S ribosomal protein S1                         89.0    2e-15    
ref|WP_012488746.1|  RNA-binding protein                              90.5    2e-15    
ref|WP_036572794.1|  30S ribosomal protein S1                         88.6    2e-15    
ref|WP_003042341.1|  30S ribosomal protein S1                         88.6    2e-15    
ref|WP_033334844.1|  MULTISPECIES: transcription accessory protein    90.5    2e-15    
ref|WP_012720786.1|  30S ribosomal protein S1                         88.6    2e-15    
ref|WP_014713265.1|  30S ribosomal protein S1                         88.6    2e-15    
ref|WP_003069023.1|  MULTISPECIES: 30S ribosomal protein S1           88.6    2e-15    
ref|WP_031988811.1|  30S ribosomal protein S1                         89.7    2e-15    
ref|WP_026573306.1|  30S ribosomal protein S1                         88.6    2e-15    
ref|WP_031974516.1|  30S ribosomal protein S1                         89.7    2e-15    
ref|WP_003007163.1|  30S ribosomal protein S1                         88.6    2e-15    
ref|WP_006218165.1|  RNA-binding protein                              90.5    2e-15    
ref|WP_003011990.1|  30S ribosomal protein S1                         88.6    2e-15    
ref|WP_003003421.1|  30S ribosomal protein S1                         88.6    2e-15    
ref|WP_003029657.1|  MULTISPECIES: 30S ribosomal protein S1           88.6    2e-15    
ref|WP_036653425.1|  hypothetical protein                             90.1    2e-15    
ref|WP_010561521.1|  transcription accessory protein                  90.1    2e-15    
ref|WP_002942263.1|  RNA binding S1 domain-containing protein         90.1    2e-15    
ref|WP_005014687.1|  MULTISPECIES: 30S ribosomal protein S1           89.7    2e-15    
ref|WP_015253920.1|  hypothetical protein                             90.1    2e-15    
ref|WP_031969897.1|  30S ribosomal protein S1                         89.7    2e-15    
ref|WP_026584970.1|  30S ribosomal protein S1                         88.2    2e-15    
ref|WP_022525131.1|  30S ribosomal protein S1                         88.6    2e-15    
ref|WP_038694229.1|  hypothetical protein                             90.1    2e-15    
ref|WP_029430395.1|  30S ribosomal protein S1                         89.4    2e-15    
ref|WP_003019229.1|  30S ribosomal protein S1                         88.6    2e-15    
ref|WP_032007238.1|  30S ribosomal protein S1                         89.7    2e-15    
ref|WP_009730966.1|  30S ribosomal protein S1                         88.6    2e-15    
ref|WP_016265174.1|  30S ribosomal protein S1                         88.6    2e-15    
ref|WP_028783051.1|  30S ribosomal protein S1                         88.2    2e-15    
ref|WP_032872938.1|  30S ribosomal protein S1                         89.7    2e-15    
ref|WP_032066703.1|  30S ribosomal protein S1                         89.7    2e-15    
ref|WP_031951241.1|  30S ribosomal protein S1                         89.7    2e-15    
ref|WP_007541680.1|  30S ribosomal protein S1                         89.4    2e-15    
ref|WP_006596419.1|  MULTISPECIES: 30S ribosomal protein S1           88.2    2e-15    
gb|AIQ56633.1|  hypothetical protein PBOR_06525                       89.7    2e-15    
ref|WP_036789306.1|  transcription accessory protein                  90.1    2e-15    
ref|WP_002927929.1|  RNA binding S1 domain-containing protein         90.1    2e-15    
ref|WP_033855952.1|  30S ribosomal protein S1                         89.4    2e-15    
ref|WP_032013484.1|  30S ribosomal protein S1                         89.4    2e-15    
ref|WP_031950142.1|  30S ribosomal protein S1                         89.4    2e-15    
ref|WP_013710663.1|  30S ribosomal protein S1                         88.2    2e-15    
ref|WP_009332766.1|  MULTISPECIES: 30S ribosomal protein S1           87.8    2e-15    
ref|WP_012949234.1|  30S ribosomal protein S1                         89.0    2e-15    
ref|WP_035757641.1|  30S ribosomal protein S1                         89.0    2e-15    
ref|WP_028391567.1|  30S ribosomal protein S1                         87.8    2e-15    
ref|WP_026845128.1|  30S ribosomal protein S1                         89.0    2e-15    
ref|WP_014741376.1|  30S ribosomal protein S1                         89.0    2e-15    
ref|WP_039409192.1|  30S ribosomal protein S1                         89.4    3e-15    
ref|WP_005053831.1|  MULTISPECIES: 30S ribosomal protein S1           89.4    3e-15    
ref|WP_004648769.1|  30S ribosomal protein S1                         89.4    3e-15    
ref|WP_004679476.1|  MULTISPECIES: 30S ribosomal protein S1           89.4    3e-15    
ref|WP_026855301.1|  30S ribosomal protein S1                         89.0    3e-15    
ref|WP_034760590.1|  30S ribosomal protein S1                         87.8    3e-15    
ref|WP_029018102.1|  30S ribosomal protein S1                         88.6    3e-15    
gb|KHN67599.1|  30S ribosomal protein S1                              89.4    3e-15    
ref|WP_004989421.1|  MULTISPECIES: 30S ribosomal protein S1           89.4    3e-15    
ref|WP_039373879.1|  30S ribosomal protein S1                         89.4    3e-15    
ref|WP_039400075.1|  30S ribosomal protein S1                         89.4    3e-15    
ref|WP_005197163.1|  30S ribosomal protein S1                         89.0    3e-15    
ref|WP_039622658.1|  30S ribosomal protein S1                         89.0    3e-15    
ref|WP_008214715.1|  30S ribosomal protein S1                         88.2    3e-15    
ref|WP_015420791.1|  RNA-binding S1 domain-containing protein         89.7    3e-15    
ref|WP_004671374.1|  30S ribosomal protein S1                         89.0    3e-15    
ref|WP_021656108.1|  30S ribosomal protein S1                         87.8    3e-15    
ref|WP_023597149.1|  MULTISPECIES: 30S ribosomal protein S1           89.0    3e-15    
ref|WP_016138295.1|  30S ribosomal protein S1                         89.0    3e-15    
ref|WP_005009040.1|  30S ribosomal protein S1                         89.0    3e-15    
ref|WP_010115519.1|  30S ribosomal protein S1                         89.0    3e-15    
ref|WP_010804342.1|  30S ribosomal protein S1                         89.0    3e-15    
ref|WP_020991395.1|  30S ribosomal protein S1                         87.8    3e-15    
ref|WP_016656087.1|  30S ribosomal protein S1                         89.0    3e-15    
ref|WP_033170824.1|  30S ribosomal protein S1                         87.0    3e-15    
ref|WP_005097313.1|  MULTISPECIES: 30S ribosomal protein S1           89.0    3e-15    
ref|WP_017838833.1|  30S ribosomal protein S1                         89.0    3e-15    
ref|WP_004278854.1|  MULTISPECIES: 30S ribosomal protein S1           89.0    3e-15    
ref|WP_004645456.1|  MULTISPECIES: 30S ribosomal protein S1           89.0    3e-15    
ref|WP_027160213.1|  transcription accessory protein                  89.4    3e-15    
ref|WP_035264556.1|  30S ribosomal protein S1                         89.0    3e-15    
ref|WP_009443628.1|  30S ribosomal protein S1                         87.8    3e-15    
ref|WP_006722287.1|  30S ribosomal protein S1                         87.4    3e-15    
ref|WP_026253497.1|  transcription accessory protein                  89.4    3e-15    
ref|WP_016539437.1|  30S ribosomal protein S1                         89.0    3e-15    
ref|WP_005252225.1|  30S ribosomal protein S1                         89.0    3e-15    
ref|WP_030453530.1|  transcription accessory protein                  89.4    4e-15    
ref|WP_018934341.1|  30S ribosomal protein S1                         87.4    4e-15    
gb|EXC95065.1|  S1 RNA binding domain protein                         87.0    4e-15    
ref|WP_004821252.1|  MULTISPECIES: 30S ribosomal protein S1           89.0    4e-15    
gb|ELL06029.1|  S1 RNA binding domain protein                         84.0    4e-15    
ref|WP_023957969.1|  RNA-binding protein                              89.4    4e-15    
ref|WP_000140310.1|  30S ribosomal protein S1                         88.6    4e-15    
ref|WP_004696863.1|  MULTISPECIES: 30S ribosomal protein S1           88.6    4e-15    
ref|WP_014148947.1|  30S ribosomal protein S1                         88.6    4e-15    
ref|WP_004830978.1|  MULTISPECIES: 30S ribosomal protein S1           88.6    4e-15    
ref|WP_006720424.1|  30S ribosomal protein S1                         87.4    4e-15    
ref|WP_035522474.1|  30S ribosomal protein S1                         88.6    4e-15    
ref|WP_018393802.1|  MULTISPECIES: 30S ribosomal protein S1           87.4    4e-15    
ref|WP_035022660.1|  30S ribosomal protein S1                         87.4    4e-15    
ref|WP_014376087.1|  30S ribosomal protein S1                         88.6    4e-15    
ref|WP_036409634.1|  transcription accessory protein                  89.0    4e-15    
ref|WP_029339317.1|  30S ribosomal protein S1                         88.2    4e-15    
ref|WP_012188061.1|  30S ribosomal protein S1                         87.8    4e-15    
ref|WP_008809181.1|  30S ribosomal protein S1                         87.4    4e-15    
ref|WP_031972739.1|  30S ribosomal protein S1                         88.6    4e-15    
ref|WP_003490269.1|  30S ribosomal protein S1                         87.0    5e-15    
ref|WP_010750186.1|  S1 RNA-binding protein                           84.0    5e-15    
ref|WP_012000633.1|  30S ribosomal protein S1                         87.4    5e-15    
ref|WP_013709049.1|  30S ribosomal protein S1                         87.4    5e-15    
ref|WP_026825531.1|  general stress protein                           83.2    5e-15    
ref|WP_006303934.1|  30S ribosomal protein S1                         87.0    5e-15    
ref|WP_017774583.1|  30S ribosomal protein S1                         88.2    5e-15    
gb|KHD74679.1|  transcription accessory protein                       89.0    5e-15    
ref|WP_004318243.1|  MULTISPECIES: RNA-binding protein                89.0    5e-15    
ref|WP_002836502.1|  4-hydroxy-3-methylbut-2-enyl diphosphate red...  88.6    5e-15    
ref|WP_003553935.1|  30S ribosomal protein S1                         87.4    5e-15    
gb|EGC99606.1|  30S ribosomal protein S1                              88.2    5e-15    
ref|WP_003560369.1|  MULTISPECIES: 30S ribosomal protein S1           87.4    5e-15    



>ref|XP_011093617.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC105173535 
[Sesamum indicum]
Length=1045

 Score =   498 bits (1281),  Expect = 5e-160, Method: Compositional matrix adjust.
 Identities = 284/488 (58%), Positives = 354/488 (73%), Gaps = 40/488 (8%)
 Frame = +2

Query  248   MAPVIPTTVNSISLTPCNILISRKNNLLTRCSVFQKPGRQTLSAQRYAIPFSTPVRLFPH  427
             MAPVIP++ N++ L+P    I++K+NLL+RCS+ +K  ++ L AQ+Y +P ST +RLFP 
Sbjct  1     MAPVIPSSTNNVPLSPGIAFITKKSNLLSRCSIPRKLNKEALPAQKYILPLSTSIRLFPQ  60

Query  428   LRVGFDIQPKLRTPIVSSAETDVAVEEADSATVDKSPS-----GAPENSPVEsdasptpa  592
              R+G  ++PKLRT I S++ TDVAVEEAD +  D   S      A  +    + +  +  
Sbjct  61    FRIGCILKPKLRTHIASASGTDVAVEEADLSPADNEASVNGTDAAETSGDSSAKSDISSV  120

Query  593   psrrsrparKSEMPPIKNEDLIPGASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNLSNSF  772
              S+RSRP RKSEMPP+KNE+LIPGA+FTGKV+SIQPFGAFVDFGAFTDGLVHVS LS+SF
Sbjct  121   KSKRSRPVRKSEMPPVKNEELIPGATFTGKVRSIQPFGAFVDFGAFTDGLVHVSRLSDSF  180

Query  773   VKDVTSVVSVGQEVTVRLLEANMETGRISLTMRESDETSREKQPKDSPGSSDKSRAPKRT  952
             VKDV SVV+VGQEV VRLLEANMETGRI+L+MRESD++S  KQ +D+PG SDKSR P++T
Sbjct  181   VKDVASVVTVGQEVKVRLLEANMETGRIALSMRESDDSS--KQQRDAPGGSDKSRPPRKT  238

Query  953   PQRNNQRRE-----SKFVKGQDLEGTVKNLTRSGAFISLPEGEEGFLPTSEMADEGLGEI  1117
              QR NQ+RE     SKFVKGQDLEGTVKNLTR+GAFISLPEGEEGFLPTSE ADEG G I
Sbjct  239   NQRFNQKREETKKSSKFVKGQDLEGTVKNLTRAGAFISLPEGEEGFLPTSEEADEGFGNI  298

Query  1118  MGGSSLQVGQEVSVRVLRISRGQATLTMKKEEATEEVNSVLSQGVIHKATNPFALAFRKN  1297
             MGGSSL+VGQEVSVRVLRI+RGQ TLTMKKEEA  E+++ LSQGV+H ATNPF LAFR N
Sbjct  299   MGGSSLEVGQEVSVRVLRITRGQVTLTMKKEEAIGELDAKLSQGVVHTATNPFVLAFRSN  358

Query  1298  KEISAFLDQR--EEEVL--AEKSEKDNNEAGVDISTVDDTLSETAEKDGEVMETINEDTT  1465
             + IS FLD+R  E+EV+  AE+  KD +E    +S  DDTLS    K+ E +ETI + + 
Sbjct  359   QVISEFLDERENEKEVVGKAEEVAKDIDEV---VSRSDDTLSVALAKE-ENVETIPQTSE  414

Query  1466  TTDQ---LSEEPSATE----DDSLPITEDQLAEPEVSTTTTDQLSEEPSAINAAETNAQD  1624
             T D     ++E  A+     DD +P TEDQ+              EEPS   A E   + 
Sbjct  415   TNDDEIGSTKEVEASSVIPGDDGIPPTEDQII-------------EEPSPTEAKENMEES  461

Query  1625  ETAAQLAE  1648
             E + ++A+
Sbjct  462   ELSGEVAD  469



>ref|XP_009799518.1| PREDICTED: uncharacterized protein LOC104245598 [Nicotiana sylvestris]
Length=1040

 Score =   491 bits (1264),  Expect = 1e-157, Method: Compositional matrix adjust.
 Identities = 277/493 (56%), Positives = 355/493 (72%), Gaps = 20/493 (4%)
 Frame = +2

Query  242   FGMAPVIPTTVNSISLTPCNILISRKNNLLTRCSVFQKPGRQTLSAQRYAIPFSTPVRLF  421
               MAP++P   +++S+TP  + I+RKN  L+RC+V +K  +QTL   +Y +P ST V+LF
Sbjct  1     MNMAPMVPIATSNVSVTPGAVFITRKNTCLSRCNVLRKSSKQTLPTPKYNLPLSTSVKLF  60

Query  422   PHLRVGFDIQPKLRTPIVSSAETDVAVEEADSATVDKSPSGAPE-NSPVEsdasptpaps  598
             PH RVG  ++PKLR  IVS+ ETDVAVEE +SA  D     A E +S   + +  T   +
Sbjct  61    PHFRVGCILRPKLRGFIVSATETDVAVEEVESAATDDGSGEASEASSDASNTSEETSVRA  120

Query  599   rrsrparKSEMPPIKNEDLIPGASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNLSNSFVK  778
             +R+RPARKSEMPP+KNEDLIPGA+FTGKV+SIQPFGAFVDFGAFTDGLVHVS LS+SFVK
Sbjct  121   KRTRPARKSEMPPVKNEDLIPGATFTGKVRSIQPFGAFVDFGAFTDGLVHVSRLSDSFVK  180

Query  779   DVTSVVSVGQEVTVRLLEANMETGRISLTMRESDETSREKQPKDSPGSSDKSRAPKRTPQ  958
             DV S+VSVGQEVTVRL+EAN ETGRISLTMRESD+ SR +Q KD+P SSD+ R P++  Q
Sbjct  181   DVGSIVSVGQEVTVRLVEANTETGRISLTMRESDDPSRPQQQKDAPTSSDRPRTPRKNTQ  240

Query  959   RNNQRRE-----SKFVKGQDLEGTVKNLTRSGAFISLPEGEEGFLPTSEMADEGLGEIMG  1123
             RNNQRR+     SKFVKGQDLEGTVKNL RSGAFISLPEGEEGFLP SE ADE  G I  
Sbjct  241   RNNQRRDEVKKVSKFVKGQDLEGTVKNLARSGAFISLPEGEEGFLPASEEADEAFGIIDS  300

Query  1124  GSSLQVGQEVSVRVLRISRGQATLTMKKEEATEEVNSVLSQGVIHKATNPFALAFRKNKE  1303
             GSSLQVGQEVSVRVLRI+RGQ TLTMKKEEA  E++S L+QGV+H ATNPF LAFR N+E
Sbjct  301   GSSLQVGQEVSVRVLRITRGQVTLTMKKEEAASELDSKLNQGVVHLATNPFVLAFRSNEE  360

Query  1304  ISAFLDQREEEVLAEKSEKDNNEAGVDISTVDDTLSETAEKDGEVM--------ETINED  1459
             IS+FLD+RE+E    +  K++ E     +   D L ET   + E +        ETI+++
Sbjct  361   ISSFLDEREKEEELAEQSKEDAEEADVAADKTDVLPETTGNEEESVNAAIDGFPETIDDE  420

Query  1460  TTTTDQLSEEPSATED-DSLPITEDQLAEPEVSTTTTDQLSEEPSAINAAETNAQDETAA  1636
              T  +   E  S +E+ ++ P+ +    EPE  T +++Q++++   I+A+ET A +E   
Sbjct  421   DTKQNIDEEVESVSENAEASPVGD--AVEPEAETGSSEQIADQ---ISASETVAGEEVVE  475

Query  1637  QLAEPEVSTTTID  1675
             +L +  V+   ++
Sbjct  476   KLTDDAVAKNEVE  488



>ref|XP_009611223.1| PREDICTED: uncharacterized protein LOC104104773 [Nicotiana tomentosiformis]
 ref|XP_009611224.1| PREDICTED: uncharacterized protein LOC104104773 [Nicotiana tomentosiformis]
Length=1048

 Score =   478 bits (1231),  Expect = 1e-152, Method: Compositional matrix adjust.
 Identities = 281/519 (54%), Positives = 357/519 (69%), Gaps = 43/519 (8%)
 Frame = +2

Query  257   VIPTTVNSISLTPCNILISRKNNLLTRCSVFQKPGRQTLSAQRYAIPFSTPVRLFPHLRV  436
             ++P   +++S+TP  + I+RKN  L+RC+V +K  +QTL   +Y +P ST V+LFPH RV
Sbjct  1     MVPIATSNVSVTPGAVFITRKNTCLSRCNVLRKSSKQTLPTPKYNLPLSTSVKLFPHFRV  60

Query  437   GFDIQPKLRTPIVSSAETDVAVEEADSATVDKSPSGAPE-NSPVEsdasptpapsrrsrp  613
             G  ++PKLR  IVS+ ETDVAVEE +SA  D     A E +S   + +  T   S+R+RP
Sbjct  61    GCILRPKLRGFIVSATETDVAVEEVESAATDDGSGEASEASSDASNTSEETSVRSKRTRP  120

Query  614   arKSEMPPIKNEDLIPGASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNLSNSFVKDVTSV  793
             ARKSEMPP+KNEDLIPGA+FTGKV+SIQPFGAFVDFGAFTDGLVHVS LS+SFVKDV S+
Sbjct  121   ARKSEMPPVKNEDLIPGATFTGKVRSIQPFGAFVDFGAFTDGLVHVSRLSDSFVKDVGSI  180

Query  794   VSVGQEVTVRLLEANMETGRISLTMRESDETSREKQPKDSPGSSDKSRAPKRTPQRNNQR  973
             VSVGQEVTVRL+EAN ETGRISLTMRESD+ SR +Q KD+P SSD+ R P++  QRNNQR
Sbjct  181   VSVGQEVTVRLVEANTETGRISLTMRESDDPSRPQQQKDAPTSSDRPRTPRKNTQRNNQR  240

Query  974   RE-----SKFVKGQDLEGTVKNLTRSGAFISLPEGEEGFLPTSEMADEGLGEIMGGSSLQ  1138
             R+     SKFVKGQDLEGTVKNL RSGAFISLPEGEEGFLP SE ADE  G I  GSSLQ
Sbjct  241   RDEVKKASKFVKGQDLEGTVKNLARSGAFISLPEGEEGFLPASEEADEAFGIIDSGSSLQ  300

Query  1139  VGQEVSVRVLRISRGQATLTMKKEEATEEVNSVLSQGVIHKATNPFALAFRKNKEISAFL  1318
             VGQEV+VRVLRI+RGQ TLTMKKEEA  E++S L+QGV+H  TNPF LAFR N+EIS+FL
Sbjct  301   VGQEVNVRVLRITRGQVTLTMKKEEAASELDSKLNQGVVHLPTNPFVLAFRSNEEISSFL  360

Query  1319  DQREEEVLAEKSEKDNNEAGVDISTVDDTLSETAEKDGE--------VMETINEDTTTTD  1474
             D+RE+E    +  K++ E     +   D L ET  K+ E        V ETI+++ T  +
Sbjct  361   DEREKEEELAEQSKEDAEEADVAADKTDVLPETTSKEEESVNAAIDGVPETIDDEDTKQN  420

Query  1475  QLSEEPSATED--------------DSLPITEDQLAEPEVSTTTTDQLSEEPSAINAAET  1612
                E  S +E+              ++ P+ +    EPE  T +++Q++++   I+A+ET
Sbjct  421   IDEEVESVSENFTPERSTSTIGQQAEASPVGD--AVEPEAETGSSEQIADQ---ISASET  475

Query  1613  NAQDETAAQLAEPEV----------STTTIDQPSEEPSA  1699
              A +E   +L +  V          S T   + +EEPS 
Sbjct  476   VAGEEVVEKLTDDAVAKNEVETQIASVTEASKETEEPSG  514



>ref|XP_006341263.1| PREDICTED: uncharacterized protein LOC102602783 [Solanum tuberosum]
Length=1050

 Score =   476 bits (1226),  Expect = 8e-152, Method: Compositional matrix adjust.
 Identities = 270/480 (56%), Positives = 340/480 (71%), Gaps = 21/480 (4%)
 Frame = +2

Query  248   MAPVIPTTVNSISLTPCNILISRKNNLLTRCSVFQKPGRQTLSAQRYAIPFSTPVRLFPH  427
             MAP++      +S+TP  +L++R+N  L++ +V +K  +QTL   +Y +P ST ++LFPH
Sbjct  1     MAPMVSIATTIVSVTPGAVLLTRRNQCLSKYNVSRKSSKQTLPTPKYILPLSTSIKLFPH  60

Query  428   LRVGFDIQPKLRTPIVSSAETDVAVEEAD-------SATVDKSPSGAPENSPVEsdaspt  586
              RVG  ++PKLR  +VS+ ETDVAVEE +       S  V ++ S A E S   S +  +
Sbjct  61    FRVGCILRPKLRGLVVSATETDVAVEEVEATATDDGSGEVSEASSDAAETSQESSISDVS  120

Query  587   papsrrsrp--arKSEMPPIKNEDLIPGASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNL  760
             P   +  R   ARKSEMPP+KNE+LIPGA+FTGKV+SIQPFGAF+DFGAFTDGLVHVS L
Sbjct  121   PTSVQSKRSRPARKSEMPPVKNENLIPGATFTGKVRSIQPFGAFIDFGAFTDGLVHVSRL  180

Query  761   SNSFVKDVTSVVSVGQEVTVRLLEANMETGRISLTMRESDETSREKQPKDSPGSSDKSRA  940
             S+SFVKDV S+VSVGQEVTVRL+EAN ETGRISLTMRESD+ SR +Q KD+P SSD+ R 
Sbjct  181   SDSFVKDVGSIVSVGQEVTVRLVEANTETGRISLTMRESDDPSRPQQQKDTPTSSDRPRT  240

Query  941   PKRTPQRNNQRRE---SKFVKGQDLEGTVKNLTRSGAFISLPEGEEGFLPTSEMADEGLG  1111
              +++ QRNNQRR+   SKFVKGQDLEGTVKNLTRSGAFISLPEGEEGFLP SE  DE  G
Sbjct  241   QRKSTQRNNQRRDEKVSKFVKGQDLEGTVKNLTRSGAFISLPEGEEGFLPASEETDEVFG  300

Query  1112  EIMGGSSLQVGQEVSVRVLRISRGQATLTMKKEEATEEVNSVLSQGVIHKATNPFALAFR  1291
              I  GSSLQVGQEV+VRVLRI+RGQ TLTMKKEEA  E++S L+QGV+H ATNPF LAFR
Sbjct  301   IIDSGSSLQVGQEVNVRVLRIARGQVTLTMKKEEAASELDSKLNQGVVHSATNPFLLAFR  360

Query  1292  KNKEISAFLDQRE-EEVLAEKSEKDNNEAGVDISTVDDTLSETAEKDGEVMETINEDTTT  1468
              NKEIS+FLD+RE E+ LAE+S++D  E+ V  + + D L ET  K+ E +   N+    
Sbjct  361   SNKEISSFLDEREKEDELAEQSKEDAQESDVATNKM-DVLPETTSKEEESVNAANDGVPE  419

Query  1469  TDQLSEEPSATEDDSLPITEDQLAEPEVSTTTTDQLSEEPSAINAAETNAQDETAAQLAE  1648
             T          ED    + E+  + PE ST+T  Q +E     +A ET A+  +  Q A+
Sbjct  420   TIN-------GEDTKQNVDEEVESAPEGSTSTIGQQAEVSPVGDAEETEAETGSYEQAAD  472



>ref|XP_004242929.1| PREDICTED: uncharacterized protein LOC101245558 [Solanum lycopersicum]
Length=1048

 Score =   462 bits (1189),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 274/490 (56%), Positives = 339/490 (69%), Gaps = 41/490 (8%)
 Frame = +2

Query  248   MAPVIPTTVNSISLTPCNILISRKNNLLTRCSVFQKPGRQTLSAQRYAIPFSTPVRLFPH  427
             MAP++     ++S+TP  +L++R+N  L++  V +K  +QTL   +Y +P ST ++LFPH
Sbjct  1     MAPMVTIATTNVSVTPGAVLLTRRNQCLSKYDVSRKSSKQTLPTPKYILPLSTSIKLFPH  60

Query  428   LRVGFDIQPKLRTPIVSSAETDVAVEEADSATVDKSPSGAPENSP---------VEsdas  580
              RVG  ++ KLR  +VS+ ETDVAVEE ++   D    G  E S            SD S
Sbjct  61    FRVGCILRHKLRGLVVSATETDVAVEEVEATAADDGSGGVAEASSDAAEISEESSVSDVS  120

Query  581   ptpapsrrsrparKSEMPPIKNEDLIPGASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNL  760
             P    S+RSRPARKSEMPP+KNEDLIPGA+F GKV+SIQPFGAF+DFGAFTDGLVHVS L
Sbjct  121   PRSVQSKRSRPARKSEMPPVKNEDLIPGATFPGKVRSIQPFGAFIDFGAFTDGLVHVSRL  180

Query  761   SNSFVKDVTSVVSVGQEVTVRLLEANMETGRISLTMRESDETSREKQPKDSPGSSDKSRA  940
             S+S+VKDV S+VSVGQEVTVRL+EAN ETGRISLTMRESD+ SR +Q KD+P +SD+ R 
Sbjct  181   SDSYVKDVGSIVSVGQEVTVRLVEANTETGRISLTMRESDDPSRPQQQKDAPTNSDRPRT  240

Query  941   PKRTPQRNNQRRE---SKFVKGQDLEGTVKNLTRSGAFISLPEGEEGFLPTSEMADEGLG  1111
              +++ QRNNQRR+   SKFVKGQDLEGTVKNLTRSGAFISLPEGEEGFLP SE  DE  G
Sbjct  241   QRKSTQRNNQRRDEKVSKFVKGQDLEGTVKNLTRSGAFISLPEGEEGFLPASEETDEVFG  300

Query  1112  EIMGGSSLQVGQEVSVRVLRISRGQATLTMKKEEATEEVNSVLSQGVIHKATNPFALAFR  1291
              I  GSSL VGQEV+VRVLRI+RGQ TLTMKKEEA  E++S L+QGV++ ATNPF LAFR
Sbjct  301   IIDSGSSLTVGQEVNVRVLRIARGQVTLTMKKEEAASELDSKLNQGVVYSATNPFLLAFR  360

Query  1292  KNKEISAFLDQRE-EEVLAEKSEKDNNEAGVDISTVD-DTLSET---------AEKDGEV  1438
              NKEIS+FLD+RE E+  AE+S++D  E+  D +T+  D L ET         A  DG V
Sbjct  361   SNKEISSFLDEREKEDEQAEQSKEDAQES--DAATIKIDVLPETTSIEEESVNAANDG-V  417

Query  1439  METINEDTTTTDQLSEEPSATEDDSLPITEDQLAEPEVSTTTTDQLSEEPSAINAAETNA  1618
              ETIN + T  +   E  SA               PE ST+T  Q +E     +A ET A
Sbjct  418   PETINGEETKQNVDEEVESA---------------PEGSTSTIGQQAEVSPVGDAEETEA  462

Query  1619  QDETAAQLAE  1648
             +  +  Q A+
Sbjct  463   ETGSYEQAAD  472



>ref|XP_002280712.1| PREDICTED: uncharacterized protein LOC100262932 [Vitis vinifera]
Length=1135

 Score =   449 bits (1154),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 236/378 (62%), Positives = 283/378 (75%), Gaps = 15/378 (4%)
 Frame = +2

Query  248   MAPVIPTTVNSISLTPCNILISRKNNLLTRCSVFQKPGRQTLSAQRYAIPFSTPVRLFPH  427
             M PVIP+++++ISL       S KNN LTRC +  K  +QTLS QR+ +P ST VRLFP 
Sbjct  1     MTPVIPSSISNISLISGTAFTSNKNNCLTRCYLLGKSTKQTLSPQRFLLPLSTSVRLFPQ  60

Query  428   LRVGFDIQPKLRTPIVSSAETDVAVEEADSATVDKSPSGAPE---------NSPVEsdas  580
              R G  +  K RT I+S+  TDVAVE++DS   + S SGAPE           P      
Sbjct  61    YRSGCTLHRKSRTHILSATGTDVAVEQSDSPATEDS-SGAPEVPSDSAEASEEPSIKSDG  119

Query  581   ptpapsrrsrparKSEMPPIKNEDLIPGASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNL  760
                +   +    RKSEMPP+KNE+L+PGA+FTGKVKSIQPFGAF+DFGAFTDGLVHVS L
Sbjct  120   GVTSSQPKRARPRKSEMPPVKNEELVPGATFTGKVKSIQPFGAFIDFGAFTDGLVHVSRL  179

Query  761   SNSFVKDVTSVVSVGQEVTVRLLEANMETGRISLTMRESDETSREKQPKDSPGSSDKSRA  940
             S+S+VKDV ++VS+GQEV VRL+EAN ETGRISLTMR+SD+ ++ +Q KD+  SSDK R 
Sbjct  180   SDSYVKDVGNIVSIGQEVKVRLVEANTETGRISLTMRDSDDPTKPQQQKDAASSSDKPRP  239

Query  941   PKRTPQRNNQRRE-----SKFVKGQDLEGTVKNLTRSGAFISLPEGEEGFLPTSEMADEG  1105
              +R  QR+NQRR+     SKFVKGQDLEGTVKNL R+GAFISLPEGEEGFLPTSE ADEG
Sbjct  240   SRRNTQRSNQRRDEVKKTSKFVKGQDLEGTVKNLNRAGAFISLPEGEEGFLPTSEEADEG  299

Query  1106  LGEIMGGSSLQVGQEVSVRVLRISRGQATLTMKKEEATEEVNSVLSQGVIHKATNPFALA  1285
              G +MGGSSLQVGQEVSVRVLRISRGQ TLTMKKEE  E+++  L +GV+H ATNPF LA
Sbjct  300   FGNLMGGSSLQVGQEVSVRVLRISRGQVTLTMKKEEDAEKLDLKLGEGVVHTATNPFVLA  359

Query  1286  FRKNKEISAFLDQREEEV  1339
             FRKNKEI+ FLD+RE+ V
Sbjct  360   FRKNKEIATFLDEREKTV  377



>ref|XP_010249632.1| PREDICTED: uncharacterized protein LOC104592125 isoform X2 [Nelumbo 
nucifera]
Length=1051

 Score =   442 bits (1138),  Expect = 6e-139, Method: Compositional matrix adjust.
 Identities = 249/490 (51%), Positives = 329/490 (67%), Gaps = 36/490 (7%)
 Frame = +2

Query  248   MAPVIPTTVNSISLTPCNILISRKNNLLTRCSVFQKPGRQTLSAQRYAIPFSTPVRLFPH  427
             M  VIP +++S++L P    ISRKNN +TR +  +K   QT  + +  +P S  V LFP 
Sbjct  1     MTFVIPCSISSVALIPATPFISRKNNRITRFNFLRKSSEQTSFSHKLFLPLSRQVSLFPK  60

Query  428   LRVGFDIQPKLRTPIVSSAETDVAVEEADSATVDKSPSGAPE---------NSPVEsdas  580
              R GF      R  I+++A T+VA+EE DS+   +   G  +          +P  +  +
Sbjct  61    FRHGFSAPHGSRCHILAAAGTEVAIEEPDSSIAAEDADGTSDVPSSTVEASEAPSPTTTA  120

Query  581   ptpapsrrsrparKSEMPPIKNEDLIPGASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNL  760
                A S+R+R +RKSEMPP+KNEDL+PGA+FTGKV+SIQPFGAFVDFGAFTDGLVHVS L
Sbjct  121   TPDAQSKRTRSSRKSEMPPVKNEDLVPGATFTGKVRSIQPFGAFVDFGAFTDGLVHVSRL  180

Query  761   SNSFVKDVTSVVSVGQEVTVRLLEANMETGRISLTMRESDETSREKQPKDSPGSSDKSRA  940
             S+SFVKDV   VSVGQEV VRL+EAN+ETGRISLTMR+SD+  + +Q KD P   DK + 
Sbjct  181   SDSFVKDVAKFVSVGQEVKVRLVEANIETGRISLTMRDSDDIDKLQQWKDVPAGGDKQKP  240

Query  941   PKRTP---QRNNQRRESKFVKGQDLEGTVKNLTRSGAFISLPEGEEGFLPTSEMADEGLG  1111
             P+R+    +R+  ++ SKFVKGQDLEGTVKNLTR+GAFISLPEGEEGFLPT+E ADEG G
Sbjct  241   PRRSATKSKRDGVQKTSKFVKGQDLEGTVKNLTRAGAFISLPEGEEGFLPTAEEADEGFG  300

Query  1112  EIMGGSSLQVGQEVSVRVLRISRGQATLTMKKEEATEEVNSVLSQGVIHKATNPFALAFR  1291
              IMGGSSLQVGQEVSVRVLRI++GQ TLTMKKEE  +E+NS LSQGV+H ATNPF LAFR
Sbjct  301   NIMGGSSLQVGQEVSVRVLRITKGQVTLTMKKEEGADELNSKLSQGVVHTATNPFVLAFR  360

Query  1292  KNKEISAFLDQREEEVLAEKSEKDNNEAGVDISTVDDTLSETAEKDGEVMETINEDTTTT  1471
             KNK+I+AFLD+RE+            +  V+ S V DTL  T ++  E      ED +  
Sbjct  361   KNKDIAAFLDEREK-----------VQQSVNTSVVPDTLEGTEKRVYEA-----EDKSDV  404

Query  1472  DQLSEEPSATEDDS--LPITEDQLAEPEVSTTTTDQLSEEPSAINAAETNAQDETAAQLA  1645
              ++ + P++ + D   +P  E+++ E +   T++++  E+   ++     A +E      
Sbjct  405   PEVQDRPTSNDGDQVDVPSVENKVIEED--KTSSEEGDEKEDIVD----QAVEEKTTLEE  458

Query  1646  EPEVSTTTID  1675
             E E + TT+D
Sbjct  459   EVEAAATTVD  468



>ref|XP_010249631.1| PREDICTED: uncharacterized protein LOC104592125 isoform X1 [Nelumbo 
nucifera]
Length=1053

 Score =   442 bits (1138),  Expect = 8e-139, Method: Compositional matrix adjust.
 Identities = 249/490 (51%), Positives = 329/490 (67%), Gaps = 36/490 (7%)
 Frame = +2

Query  248   MAPVIPTTVNSISLTPCNILISRKNNLLTRCSVFQKPGRQTLSAQRYAIPFSTPVRLFPH  427
             M  VIP +++S++L P    ISRKNN +TR +  +K   QT  + +  +P S  V LFP 
Sbjct  1     MTFVIPCSISSVALIPATPFISRKNNRITRFNFLRKSSEQTSFSHKLFLPLSRQVSLFPK  60

Query  428   LRVGFDIQPKLRTPIVSSAETDVAVEEADSATVDKSPSGAPE---------NSPVEsdas  580
              R GF      R  I+++A T+VA+EE DS+   +   G  +          +P  +  +
Sbjct  61    FRHGFSAPHGSRCHILAAAGTEVAIEEPDSSIAAEDADGTSDVPSSTVEASEAPSPTTTA  120

Query  581   ptpapsrrsrparKSEMPPIKNEDLIPGASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNL  760
                A S+R+R +RKSEMPP+KNEDL+PGA+FTGKV+SIQPFGAFVDFGAFTDGLVHVS L
Sbjct  121   TPDAQSKRTRSSRKSEMPPVKNEDLVPGATFTGKVRSIQPFGAFVDFGAFTDGLVHVSRL  180

Query  761   SNSFVKDVTSVVSVGQEVTVRLLEANMETGRISLTMRESDETSREKQPKDSPGSSDKSRA  940
             S+SFVKDV   VSVGQEV VRL+EAN+ETGRISLTMR+SD+  + +Q KD P   DK + 
Sbjct  181   SDSFVKDVAKFVSVGQEVKVRLVEANIETGRISLTMRDSDDIDKLQQWKDVPAGGDKQKP  240

Query  941   PKRTP---QRNNQRRESKFVKGQDLEGTVKNLTRSGAFISLPEGEEGFLPTSEMADEGLG  1111
             P+R+    +R+  ++ SKFVKGQDLEGTVKNLTR+GAFISLPEGEEGFLPT+E ADEG G
Sbjct  241   PRRSATKSKRDGVQKTSKFVKGQDLEGTVKNLTRAGAFISLPEGEEGFLPTAEEADEGFG  300

Query  1112  EIMGGSSLQVGQEVSVRVLRISRGQATLTMKKEEATEEVNSVLSQGVIHKATNPFALAFR  1291
              IMGGSSLQVGQEVSVRVLRI++GQ TLTMKKEE  +E+NS LSQGV+H ATNPF LAFR
Sbjct  301   NIMGGSSLQVGQEVSVRVLRITKGQVTLTMKKEEGADELNSKLSQGVVHTATNPFVLAFR  360

Query  1292  KNKEISAFLDQREEEVLAEKSEKDNNEAGVDISTVDDTLSETAEKDGEVMETINEDTTTT  1471
             KNK+I+AFLD+RE+            +  V+ S V DTL  T ++  E      ED +  
Sbjct  361   KNKDIAAFLDEREK-----------VQQSVNTSVVPDTLEGTEKRVYEA-----EDKSDV  404

Query  1472  DQLSEEPSATEDDS--LPITEDQLAEPEVSTTTTDQLSEEPSAINAAETNAQDETAAQLA  1645
              ++ + P++ + D   +P  E+++ E +   T++++  E+   ++     A +E      
Sbjct  405   PEVQDRPTSNDGDQVDVPSVENKVIEED--KTSSEEGDEKEDIVD----QAVEEKTTLEE  458

Query  1646  EPEVSTTTID  1675
             E E + TT+D
Sbjct  459   EVEAAATTVD  468



>gb|EYU32952.1| hypothetical protein MIMGU_mgv1a000695mg [Erythranthe guttata]
Length=1015

 Score =   439 bits (1128),  Expect = 9e-138, Method: Compositional matrix adjust.
 Identities = 253/456 (55%), Positives = 317/456 (70%), Gaps = 24/456 (5%)
 Frame = +2

Query  248   MAPVIPTTVNSISLTPCNILISRKNNLLTRCSVFQKPGRQTLSAQRYAIPFSTPVRLFPH  427
             MAPVIP + NSIS+TP    I+ K + L++CS  +   +Q L A +Y  P ST VRLFPH
Sbjct  1     MAPVIPNSTNSISITPVITSITNKTSSLSQCSFTKNLNKQKLPASKYTSPLSTSVRLFPH  60

Query  428   LRVGFDI-QPKLRTPIVSSAETDVAVEEADSATVDKSPSGAPENSPVEsdasptpapsrr  604
              R G ++ +PKL+T +V +  TDVAVEE +  +V ++   A E+ PV+S+ASP    S+R
Sbjct  61    FRFGSNLLKPKLQTHLVFATGTDVAVEETN-VSVSETKEDA-ESPPVQSEASPPTTQSKR  118

Query  605   srparKSEMPPIKNEDLIPGASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNLSNSFVKDV  784
              R  RKS+MPP+KNE+LIPGASFTGKVKS+QPFGAFVDFGAFTDGLVHVS LS+ +VKDV
Sbjct  119   PRVVRKSDMPPVKNEELIPGASFTGKVKSVQPFGAFVDFGAFTDGLVHVSKLSDGYVKDV  178

Query  785   TSVVSVGQEVTVRLLEANMETGRISLTMRESDETSREKQPKDSPGSSDKSRAPKRTPQRN  964
             +++VSVGQEV V ++EANMETGRISLTMRESD+ ++ +Q  + P  S +     RT Q+ 
Sbjct  179   STIVSVGQEVKVWVVEANMETGRISLTMRESDDPTKVQQTDEKPRPSPRKSTGPRTNQKR  238

Query  965   NQRRESKFVKGQDLEGTVKNLTRSGAFISLPEGEEGFLPTSEMADEGLGEIMGGSSLQVG  1144
             +  ++SKFVKGQDLEGTVKNL R+GAFISLPEGEEGFLPTSE  DEGLG IMGGSSL+ G
Sbjct  239   DDSKKSKFVKGQDLEGTVKNLVRAGAFISLPEGEEGFLPTSEEIDEGLGHIMGGSSLEAG  298

Query  1145  QEVSVRVLRISRGQATLTMKKEEATEEVNSVLSQGVIHKATNPFALAFRKNKEISAFLD-  1321
             QEVSVRVLRI+RGQ TLTMKKEE + +++S L+ G++H ATNPF LAFR NKEISAFLD 
Sbjct  299   QEVSVRVLRIARGQVTLTMKKEEDSAKLDSKLTGGIVHTATNPFLLAFRGNKEISAFLDE  358

Query  1322  --QREEEVLAEKSEKDNNEAGVDISTVDDTLSETAEKDGEVMETINE----------DTT  1465
               + +E +  +K E    EA   +   DD +    EK+ +V   INE          D T
Sbjct  359   SKKNDESIEDKKEEVQGIEAAASVVVSDDVI----EKEADVA-IINEGEPELAEEVADQT  413

Query  1466  TTDQLSEEPSATEDDSLPITEDQLAEPEVSTTTTDQ  1573
                +  EE    E D   I E    EPE+S    DQ
Sbjct  414   VLSESGEEVVEAEADVAIINE---GEPELSEEVADQ  446



>ref|XP_007013101.1| Elongation factor Ts isoform 1 [Theobroma cacao]
 gb|EOY30720.1| Elongation factor Ts isoform 1 [Theobroma cacao]
Length=1064

 Score =   439 bits (1128),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 244/412 (59%), Positives = 301/412 (73%), Gaps = 20/412 (5%)
 Frame = +2

Query  248   MAPVIPTTVNSISLTPCNILISRKNNLLTRCSVFQKPGRQTLSAQRYAIPFSTPVRLFPH  427
             M PVIP ++++I+L P      RKN  LTRCS+ +K  R  L +QR+ +P ST V LFP 
Sbjct  1     MTPVIPCSISNITLIPGTACTVRKNTCLTRCSLPRKHTRYALPSQRFILPLSTCVTLFPQ  60

Query  428   LRVGFDIQPKLRTPIVSSAETDVAVEEADSATVDKSPSGA---------PENSPVEsdas  580
              R G+ +  K    I S+  TDVAVEE+DS   D S  G+          E S  +SD+S
Sbjct  61    YRTGYALHRKPGVHI-SATGTDVAVEESDSTVTDVSSGGSEIQSDAVETSEKSTSKSDSS  119

Query  581   ptpapsrrsrparKSEMPPIKNEDLIPGASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNL  760
             P P  SR++RP RKSEMPPIKNE+LIPGA FTGKV+SIQPFGAFVDFGAFTDGLVHVS L
Sbjct  120   PAPTQSRQTRPVRKSEMPPIKNEELIPGAMFTGKVRSIQPFGAFVDFGAFTDGLVHVSQL  179

Query  761   SNSFVKDVTSVVSVGQEVTVRLLEANMETGRISLTMRESDETSREKQPKDSPGSSDKSRA  940
             S+SFVKDV S VSVGQEV VRL+E N ++GRISL+MRE+D+ S+ +  KD P ++D++R 
Sbjct  180   SDSFVKDVASFVSVGQEVKVRLVEVNTDSGRISLSMRENDDASKRQPRKDGPAATDRARP  239

Query  941   PKRTPQRNNQRRE----SKFVKGQDLEGTVKNLTRSGAFISLPEGEEGFLPTSEMADEGL  1108
              ++   + +QR+E    SKFVKGQDLEGTVKNLTRSGAFISLPEGEEGFLPTSE +D+GL
Sbjct  240   ARKNASKPSQRKEEVKSSKFVKGQDLEGTVKNLTRSGAFISLPEGEEGFLPTSEESDDGL  299

Query  1109  GEIMGGSSLQVGQEVSVRVLRISRGQATLTMKKEEATEEVNSVLSQGVIHKATNPFALAF  1288
               +MGGSSLQVGQEV+VRVLRISRG+ TLTMKKEE   +++S LSQGV+H ATNPF LAF
Sbjct  300   MSMMGGSSLQVGQEVNVRVLRISRGRVTLTMKKEEDDNKLDSQLSQGVVHTATNPFVLAF  359

Query  1289  RKNKEISAFLDQREEEVLAEKSEKDNNEAGVDISTVDDTLSETAEKDGEVME  1444
             R+NKEI+AFLDQR      EKSE+   +   + +TV    +E  EK+ E+ E
Sbjct  360   RENKEIAAFLDQR------EKSEEIKVQPVEESATVSTAANEIVEKETEIAE  405



>ref|XP_007013102.1| Elongation factor Ts isoform 2 [Theobroma cacao]
 gb|EOY30721.1| Elongation factor Ts isoform 2 [Theobroma cacao]
Length=1063

 Score =   438 bits (1127),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 244/412 (59%), Positives = 301/412 (73%), Gaps = 20/412 (5%)
 Frame = +2

Query  248   MAPVIPTTVNSISLTPCNILISRKNNLLTRCSVFQKPGRQTLSAQRYAIPFSTPVRLFPH  427
             M PVIP ++++I+L P      RKN  LTRCS+ +K  R  L +QR+ +P ST V LFP 
Sbjct  1     MTPVIPCSISNITLIPGTACTVRKNTCLTRCSLPRKHTRYALPSQRFILPLSTCVTLFPQ  60

Query  428   LRVGFDIQPKLRTPIVSSAETDVAVEEADSATVDKSPSGA---------PENSPVEsdas  580
              R G+ +  K    I S+  TDVAVEE+DS   D S  G+          E S  +SD+S
Sbjct  61    YRTGYALHRKPGVHI-SATGTDVAVEESDSTVTDVSSGGSEIQSDAVETSEKSTSKSDSS  119

Query  581   ptpapsrrsrparKSEMPPIKNEDLIPGASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNL  760
             P P  SR++RP RKSEMPPIKNE+LIPGA FTGKV+SIQPFGAFVDFGAFTDGLVHVS L
Sbjct  120   PAPTQSRQTRPVRKSEMPPIKNEELIPGAMFTGKVRSIQPFGAFVDFGAFTDGLVHVSQL  179

Query  761   SNSFVKDVTSVVSVGQEVTVRLLEANMETGRISLTMRESDETSREKQPKDSPGSSDKSRA  940
             S+SFVKDV S VSVGQEV VRL+E N ++GRISL+MRE+D+ S+ +  KD P ++D++R 
Sbjct  180   SDSFVKDVASFVSVGQEVKVRLVEVNTDSGRISLSMRENDDASKRQPRKDGPAATDRARP  239

Query  941   PKRTPQRNNQRRE----SKFVKGQDLEGTVKNLTRSGAFISLPEGEEGFLPTSEMADEGL  1108
              ++   + +QR+E    SKFVKGQDLEGTVKNLTRSGAFISLPEGEEGFLPTSE +D+GL
Sbjct  240   ARKNASKPSQRKEEVKSSKFVKGQDLEGTVKNLTRSGAFISLPEGEEGFLPTSEESDDGL  299

Query  1109  GEIMGGSSLQVGQEVSVRVLRISRGQATLTMKKEEATEEVNSVLSQGVIHKATNPFALAF  1288
               +MGGSSLQVGQEV+VRVLRISRG+ TLTMKKEE   +++S LSQGV+H ATNPF LAF
Sbjct  300   MSMMGGSSLQVGQEVNVRVLRISRGRVTLTMKKEEDDNKLDSQLSQGVVHTATNPFVLAF  359

Query  1289  RKNKEISAFLDQREEEVLAEKSEKDNNEAGVDISTVDDTLSETAEKDGEVME  1444
             R+NKEI+AFLDQR      EKSE+   +   + +TV    +E  EK+ E+ E
Sbjct  360   RENKEIAAFLDQR------EKSEEIKVQPVEESATVSTAANEIVEKETEIAE  405



>gb|KDO66468.1| hypothetical protein CISIN_1g005707mg [Citrus sinensis]
Length=681

 Score =   426 bits (1095),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 238/385 (62%), Positives = 290/385 (75%), Gaps = 15/385 (4%)
 Frame = +2

Query  248   MAPVIPTTVNSISLTPCNILISRKNNLLTRCSVFQKPGRQTLSAQRYAIPFSTPVRLFPH  427
             M PVIP +++SIS  P      +KNN LTR +  +K  +QT+S+QR+ +P  + VR F  
Sbjct  1     MTPVIPCSISSISSIPVTAFTIKKNNCLTRYNSTRKSTKQTISSQRFLLPLPSSVRFFSQ  60

Query  428   LRVGFDIQPKLRTPIVSSAETDVAVEEADSATVDKSPSGAP---------ENSPVEsdas  580
              + G  +Q K    I+S+   +VAVEE+DS   D   +GA          E+S ++S+AS
Sbjct  61    FQSGSALQHKSALHIISATGINVAVEESDSPAADDDSAGASDIPSDVETSESSSIKSEAS  120

Query  581   ptpapsrrsrparKSEMPPIKNEDLIPGASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNL  760
             PT A SRRSR ARKSEMPP+KNEDLIPGA+FTGKV+SIQPFGAF+DFGAFTDGLVHVS L
Sbjct  121   PTLAESRRSRTARKSEMPPVKNEDLIPGATFTGKVRSIQPFGAFIDFGAFTDGLVHVSRL  180

Query  761   SNSFVKDVTSVVSVGQEVTVRLLEANMETGRISLTMRESDETSREKQPKDSPGSSDKSRA  940
             S++FVKDV S+VSVGQEV VRL+EAN ETGRISLTMRESD+ S+ +Q KD+  S DK R 
Sbjct  181   SDNFVKDVGSIVSVGQEVKVRLIEANAETGRISLTMRESDDISKLQQQKDATASGDKVRT  240

Query  941   PKRTPQRNNQRRE----SKFVKGQDLEGTVKNLTRSGAFISLPEGEEGFLPTSEMADEGL  1108
              +R+  +  Q+R+    +KFVKGQDLEGTVKNLTRSGAFISLPEGEEGFLPTSE +D+G 
Sbjct  241   TRRSTSKPGQKRDEMKTTKFVKGQDLEGTVKNLTRSGAFISLPEGEEGFLPTSEESDDGF  300

Query  1109  GEIMGGSSLQVGQEVSVRVLRISRGQATLTMKKEEATEEVNSVLSQGVIHKATNPFALAF  1288
               +MGGSSLQVGQEVSVRVLRISRGQ TLTMKKE+     N  L+QGVIH ATNPF LAF
Sbjct  301   ANMMGGSSLQVGQEVSVRVLRISRGQVTLTMKKEDDVGS-NLQLTQGVIHAATNPFVLAF  359

Query  1289  RKNKEISAFLDQREEEV-LAEKSEK  1360
             R NK+IS+FLD+R++    A+KSEK
Sbjct  360   RSNKDISSFLDERDKSATAAKKSEK  384



>ref|XP_006475667.1| PREDICTED: microtubule-associated protein futsch-like [Citrus 
sinensis]
Length=879

 Score =   426 bits (1095),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 235/381 (62%), Positives = 286/381 (75%), Gaps = 14/381 (4%)
 Frame = +2

Query  248   MAPVIPTTVNSISLTPCNILISRKNNLLTRCSVFQKPGRQTLSAQRYAIPFSTPVRLFPH  427
             M PVIP +++SIS  P      +KNN LTR +  +K  +QT+S+QR+ +P  + VR F  
Sbjct  1     MTPVIPCSISSISSIPVTAFTIKKNNCLTRYNSTRKSTKQTISSQRFLLPLPSSVRFFSQ  60

Query  428   LRVGFDIQPKLRTPIVSSAETDVAVEEADSATVDKSPSGAP---------ENSPVEsdas  580
              + G  +Q K    I+S+   +VAVEE+DS T D   +GA          E+S ++S+AS
Sbjct  61    FQSGSALQHKSALHIISATGINVAVEESDSPTADDDSAGASDIPSDVETSESSSIKSEAS  120

Query  581   ptpapsrrsrparKSEMPPIKNEDLIPGASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNL  760
             PT A SRRSR ARKSEMPP+KNEDLIPGA+FTGKV+SIQPFGAF+DFGAFTDGLVHVS L
Sbjct  121   PTLAESRRSRTARKSEMPPVKNEDLIPGATFTGKVRSIQPFGAFIDFGAFTDGLVHVSRL  180

Query  761   SNSFVKDVTSVVSVGQEVTVRLLEANMETGRISLTMRESDETSREKQPKDSPGSSDKSRA  940
             S++FVKDV S+VSVGQEV VRL+EAN ETGRISLTMRESD+ S+ +Q KD+    DK R 
Sbjct  181   SDNFVKDVGSIVSVGQEVKVRLIEANAETGRISLTMRESDDISKLQQQKDATAGGDKVRT  240

Query  941   PKRTPQRNNQRRE----SKFVKGQDLEGTVKNLTRSGAFISLPEGEEGFLPTSEMADEGL  1108
              +R+  +  Q+R+    +KFVKGQDLEGTVKNLTRSGAFISLPEGEEGFLPTSE +D+G 
Sbjct  241   ARRSTSKPGQKRDEMKTTKFVKGQDLEGTVKNLTRSGAFISLPEGEEGFLPTSEESDDGF  300

Query  1109  GEIMGGSSLQVGQEVSVRVLRISRGQATLTMKKEEATEEVNSVLSQGVIHKATNPFALAF  1288
               +MGGSSLQVGQEVSVRVLRISRGQ TLTMKKE+     N  L+QGVIH ATNPF LAF
Sbjct  301   ANMMGGSSLQVGQEVSVRVLRISRGQVTLTMKKEDDVGS-NLQLTQGVIHAATNPFVLAF  359

Query  1289  RKNKEISAFLDQREEEVLAEK  1351
             R NK+IS+FLD+R++   A K
Sbjct  360   RSNKDISSFLDERDKSATAGK  380



>ref|XP_002514263.1| elongation factor ts, putative [Ricinus communis]
 gb|EEF48217.1| elongation factor ts, putative [Ricinus communis]
Length=972

 Score =   424 bits (1089),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 250/460 (54%), Positives = 317/460 (69%), Gaps = 40/460 (9%)
 Frame = +2

Query  248   MAPVIPTTVNSISLTPCNILISRKNNLLTRCSVFQKPGRQTLSAQRYAIPFSTPVRLFPH  427
             M  V+P + +SISL P      +KNN LTRC++ +K  +  +S+QR+ +P  T V LFPH
Sbjct  1     MTTVVPCSTSSISLIPGTPFRLKKNNNLTRCNLLRKSSKHVISSQRHVLPLLTSVGLFPH  60

Query  428   LRVGFDIQPKLRTPIV-----SSAETDVAVEEADSATVDKSPSGAP----------ENSP  562
              R   +    L   IV     +  +TDV +EE +S   D++  GA           ENS 
Sbjct  61    YRRDCNW---LHRSIVYGVSATGTDTDVVIEEPESPVTDENSGGASDIPADAAETSENSS  117

Query  563   VEsdasptpapsrrsrparKSEMPPIKNEDLIPGASFTGKVKSIQPFGAFVDFGAFTDGL  742
             ++SD++  PA ++RSRP RKSEMPP+ NE+LIPGA+FTGKV+SIQPFGAFVDFGAFTDGL
Sbjct  118   IKSDSNRAPAQTKRSRPGRKSEMPPVTNEELIPGATFTGKVRSIQPFGAFVDFGAFTDGL  177

Query  743   VHVSNLSNSFVKDVTSVVSVGQEVTVRLLEANMETGRISLTMRESDETSREKQPKDSP--  916
             VHVS LS++FVKDV +VVSVGQEVTVRL+EAN ETGRISLTMRESD+T++ +Q +D+P  
Sbjct  178   VHVSRLSDNFVKDVGNVVSVGQEVTVRLVEANTETGRISLTMRESDDTNKSQQQRDAPAT  237

Query  917   GSSDKSRAPKRTPQRNNQRRE----SKFVKGQDLEGTVKNLTRSGAFISLPEGEEGFLPT  1084
              SS K R  +R   ++ QRRE    SKFVKGQ+LEGTVKNLTRSG FISLPEGEEGFLPT
Sbjct  238   ASSGKPRPGRRNAPKSGQRREDNKISKFVKGQELEGTVKNLTRSGTFISLPEGEEGFLPT  297

Query  1085  SEMADEGLGEIMGGSSLQVGQEVSVRVLRISRGQATLTMKKEEATEEVNSVLSQGVIHKA  1264
             SE +D GL  +MGGSSL+VGQEVSVRVLRISRGQ TLTMKKEE   ++N+ L QGV+H A
Sbjct  298   SEESDGGLESMMGGSSLEVGQEVSVRVLRISRGQVTLTMKKEEDN-KLNTELLQGVVHAA  356

Query  1265  TNPFALAFRKNKEISAFLDQREE-----------EVLAEKSEKDNNEAGV-DISTVDDTL  1408
             TNPF LAFRKN++IS+FL++RE+           ++  E  E++     V DI  V    
Sbjct  357   TNPFVLAFRKNRDISSFLEEREKMEKVANQPVEPKIPVEVGEQEKQTETVSDILEVQGQP  416

Query  1409  SETAEKDGEVMETINE---DTTTTDQLSEEPSATEDDSLP  1519
             S + E    V  T+ E   D T+  +++EEPS   DD +P
Sbjct  417   SSSNEGSDSVTSTVAETLVDETSPKEVAEEPSIAGDDEVP  456



>gb|KHG25312.1| Elongation factor Ts [Gossypium arboreum]
Length=1081

 Score =   412 bits (1060),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 241/423 (57%), Positives = 295/423 (70%), Gaps = 19/423 (4%)
 Frame = +2

Query  248   MAPVIPTTVNSISLTPCNILISRKNNLLTRCSVFQKPGRQTLSAQRYAIPFSTPVRLFPH  427
             M PVIP +V++I+  P      RKN  LTRCS  +K  R  L +QR+ +P ST V  F  
Sbjct  1     MTPVIPYSVSNITFIPGAACTVRKNTSLTRCSSSRKHTRYALPSQRFILPLSTSVTSFGK  60

Query  428   LRVGFDIQPKLRTPIVSSAETDVAVEEADSATVDKSPSGAPE--NSPVEsdasptpa---  592
                G+ +  KL    +S+A TDVAVEE+DS +V K  SG  E  +  VE+    T     
Sbjct  61    YGTGYALHGKLGI-CLSTAGTDVAVEESDS-SVTKVSSGGSEIPSDAVETSEDSTSQPDS  118

Query  593   ----psrrsrparKSEMPPIKNEDLIPGASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNL  760
                  S+R+RP RKSEMPP+KNE+LIPGA FTGKV+SIQPFGAFVDFGAFTDGLVHVS L
Sbjct  119   TPPTQSKRARPVRKSEMPPVKNEELIPGAMFTGKVRSIQPFGAFVDFGAFTDGLVHVSRL  178

Query  761   SNSFVKDVTSVVSVGQEVTVRLLEANMETGRISLTMRESDETSREKQPKDSPGSSDKSR-  937
             SNSFVKDV SVVSVGQEV VRL+E N E GRISL+MRE+D+ S+ +  KD P S+DK+R 
Sbjct  179   SNSFVKDVASVVSVGQEVQVRLVEVNTENGRISLSMRENDDASKRQPRKDGPASTDKARP  238

Query  938   --APKRTPQRNNQRRESKFVKGQDLEGTVKNLTRSGAFISLPEGEEGFLPTSEMADEGLG  1111
                           + SKFVKGQ+L+GTVKNLTRSGAFISLPEGEEGFLP SE AD+GL 
Sbjct  239   SRKNASKSSSKKDFKSSKFVKGQELDGTVKNLTRSGAFISLPEGEEGFLPQSEEADDGLM  298

Query  1112  EIMGGSSLQVGQEVSVRVLRISRGQATLTMKKEEATEEVNSVLSQGVIHKATNPFALAFR  1291
              +MG SSLQ+GQEV VRVLRI+RGQ TLTMKKEE  ++++S LSQGV++ ATNPF LAFR
Sbjct  299   SMMGNSSLQIGQEVKVRVLRITRGQVTLTMKKEEDDDKLDSQLSQGVVYTATNPFMLAFR  358

Query  1292  KNKEISAFLDQREEEVLAEKSEKDNNEAGVDISTVDDTLSETAEKDGE-VMETINEDTTT  1468
             KNKEI+AFLDQRE    AEK E     A V+ +TV   + ET  ++ + + E +N+D  T
Sbjct  359   KNKEIAAFLDQRER---AEKVEV-QPAANVETTTVSTEVDETVVQETDTIAEIVNKDEET  414

Query  1469  TDQ  1477
              ++
Sbjct  415   AEK  417



>ref|XP_006451571.1| hypothetical protein CICLE_v10010581mg [Citrus clementina]
 gb|ESR64811.1| hypothetical protein CICLE_v10010581mg [Citrus clementina]
Length=902

 Score =   408 bits (1048),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 229/381 (60%), Positives = 282/381 (74%), Gaps = 14/381 (4%)
 Frame = +2

Query  248   MAPVIPTTVNSISLTPCNILISRKNNLLTRCSVFQKPGRQTLSAQRYAIPFSTPVRLFPH  427
             M PVIP +++SIS  P      +KNN LTR +  +K  +QT+S+QR+ +P  + VR F  
Sbjct  1     MTPVIPCSISSISSIPVTAFTIKKNNCLTRYNSTRKSTKQTISSQRFLLPLPSSVRFFSQ  60

Query  428   LRVGFDIQPKLRTPIVSSAETDVAVEEADSATVDKSPSGAP---------ENSPVEsdas  580
              + G  +Q K    I+S+   +V+VEE+DS T D    GA          E+S ++S+AS
Sbjct  61    FQSGSALQHKFALHIISATGINVSVEESDSPTADDDSVGASDIPSDVETSESSSIKSEAS  120

Query  581   ptpapsrrsrparKSEMPPIKNEDLIPGASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNL  760
             PT   SRRSR +RKSEMPPIKNEDLIPGA+FT KV+SIQPFGAF+DFGAFTDGLVHVS L
Sbjct  121   PTLVESRRSRISRKSEMPPIKNEDLIPGATFTRKVRSIQPFGAFIDFGAFTDGLVHVSRL  180

Query  761   SNSFVKDVTSVVSVGQEVTVRLLEANMETGRISLTMRESDETSREKQPKDSPGSSDKSRA  940
             S++FVKDV S+VSVGQEV VRL+EAN +TGRISLTM ESD+ S  +Q KD+  S DK R 
Sbjct  181   SDNFVKDVGSIVSVGQEVKVRLIEANAKTGRISLTMSESDDISMLQQQKDATASGDKVRT  240

Query  941   PKRTP----QRNNQRRESKFVKGQDLEGTVKNLTRSGAFISLPEGEEGFLPTSEMADEGL  1108
              +R+     Q+ ++ + +KFVKGQDLEGTVKNLTRS AFISLPEGEEGFLPTSE +D+G 
Sbjct  241   ARRSTSKPGQKKDEMKTTKFVKGQDLEGTVKNLTRSSAFISLPEGEEGFLPTSEESDDGF  300

Query  1109  GEIMGGSSLQVGQEVSVRVLRISRGQATLTMKKEEATEEVNSVLSQGVIHKATNPFALAF  1288
               +MGGSSLQVGQEVSVRVLRISRGQ TLTMKKE+    +N  L+QGVIH ATNPF LAF
Sbjct  301   ANMMGGSSLQVGQEVSVRVLRISRGQVTLTMKKEDDV-GLNLQLTQGVIHAATNPFVLAF  359

Query  1289  RKNKEISAFLDQREEEVLAEK  1351
             R NK+IS+FLD+R++   A K
Sbjct  360   RSNKDISSFLDERDKSATAAK  380



>ref|XP_007203990.1| hypothetical protein PRUPE_ppa000765mg [Prunus persica]
 gb|EMJ05189.1| hypothetical protein PRUPE_ppa000765mg [Prunus persica]
Length=1010

 Score =   410 bits (1053),  Expect = 7e-127, Method: Compositional matrix adjust.
 Identities = 258/537 (48%), Positives = 342/537 (64%), Gaps = 68/537 (13%)
 Frame = +2

Query  233   TYSFGMAPVIPTTVNSISLTPCNILISRKNNLLTRCSVFQKPGRQTLSAQRYAIPFSTPV  412
             ++   M PVIP +++++S  P     +RKN+ LT+ S+ +K  R TLS + + +PFST +
Sbjct  9     SFQVNMTPVIPYSISNVSHIPGTAFTARKNDCLTKFSISRKSTRHTLSPKSFLLPFSTSI  68

Query  413   RLFPHLRVGFDIQPKLRTPIVSSAETDVAVEEADSATVDKSPSGAPENSPVEsdasptpa  592
             +L P       +  + R P VS+A TDVAVEEADS   D +   A +NS   SD SP+P+
Sbjct  69    KLHPLYNSRCPVHHRSRIP-VSAAGTDVAVEEADSPVADAASIEALDNS---SDGSPSPS  124

Query  593   psrrsrparKSEMPPIKNEDLIPGASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNLSNSF  772
              SRR++P RKSEMPP+KNE+L+PGASFTGKV+SIQPFGAF+D GAFTDGLVHVS LS+S+
Sbjct  125   QSRRTKPVRKSEMPPVKNEELVPGASFTGKVRSIQPFGAFIDIGAFTDGLVHVSQLSDSY  184

Query  773   VKDVTSVVSVGQEVTVRLLEANMETGRISLTMRESDETSREKQPKDSPGSSDKS-----R  937
             VKDV SVVSVGQEV V L+EAN ETGRISLTMRE D+ S+ +Q KD+  SSD++      
Sbjct  185   VKDVGSVVSVGQEVKVTLVEANTETGRISLTMREGDDGSKPQQRKDASASSDRAGPGRRS  244

Query  938   APKRTPQRNNQRRESKFVKGQDLEGTVKNLTRSGAFISLPEGEEGFLPTSEMADEGLGEI  1117
             +PK+  ++N  R+ +KFVKGQDL GTVKNL R+GAFISLPEGEEGFLPTSE AD+G    
Sbjct  245   SPKKGDRKNEVRKTTKFVKGQDLVGTVKNLVRAGAFISLPEGEEGFLPTSEEADDGFANA  304

Query  1118  MGGSSLQVGQEVSVRVLRISRGQATLTMKKEEATEEVNSVLSQGVIHKATNPFALAFRKN  1297
             +G +SL+VGQEV+VRVLR +RGQ TLTMKKEE   + +S +SQGV+H ATNPF LAFR+N
Sbjct  305   LGETSLEVGQEVNVRVLRTTRGQVTLTMKKEEDALKSDSQISQGVVHTATNPFVLAFREN  364

Query  1298  KEISAFLDQREEEVLAEKS----------EKDNNEAGVDISTVDD--------------T  1405
             K+I++FLD+RE+   A K+          E   NE+  +IS V D               
Sbjct  365   KDIASFLDEREKIEKAAKTIATQKSSEELEGKVNESESNISEVLDEQASSDKGTLGIPSA  424

Query  1406  LSETAEKDGEVMETINEDTTTTDQ-LSEEPSATEDDSLPIT-------------------  1525
             ++ET E DG        D  T D  LS   +  ED   P++                   
Sbjct  425   VNETVENDG-------ADVGTNDNALSISVNNKEDQESPVSGSIETLETTVQTIEKEEVN  477

Query  1526  EDQLAEPEVSTTTTDQLSEEPSAINAAETNAQDETAAQLAEPEVSTTTIDQPSEEPS  1696
              D LA PE S +TT  + +EP + +  E +A  + ++++A   +       PSE P+
Sbjct  478   SDILA-PEGSISTTGSIIKEPPSTDGVENDANADPSSEIANHTL-------PSESPT  526



>ref|XP_008242565.1| PREDICTED: uncharacterized protein LOC103340883 [Prunus mume]
Length=1090

 Score =   412 bits (1058),  Expect = 8e-127, Method: Compositional matrix adjust.
 Identities = 247/524 (47%), Positives = 336/524 (64%), Gaps = 64/524 (12%)
 Frame = +2

Query  233   TYSFGMAPVIPTTVNSISLTPCNILISRKNNLLTRCSVFQKPGRQTLSAQRYAIPFSTPV  412
             ++   M PVIP +++++S  P     +R N+ LT+ S  +K  R TLS + + +PFST +
Sbjct  9     SFQVNMTPVIPYSISNVSHIPGTAFTARTNDCLTKFSFSRKSTRHTLSPKSFLLPFSTSI  68

Query  413   RLFPHLRVGFDIQPKLRTPIVSSAETDVAVEEADSATVDKSPSGAPENSPVEsdasptpa  592
             +L+P       +  + R P VS+  TDVAVEEADS   D + + A +NS   SD SP+P+
Sbjct  69    KLYPLYNSRCLVHHRSRIP-VSATGTDVAVEEADSPVADAASTEALDNS---SDGSPSPS  124

Query  593   psrrsrparKSEMPPIKNEDLIPGASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNLSNSF  772
              SRR++P RKSEMPP+KNE+L+PGASFTGKV+SIQPFGAF+D GAFTDGLVHVS LS+S+
Sbjct  125   QSRRTKPVRKSEMPPVKNEELVPGASFTGKVRSIQPFGAFIDIGAFTDGLVHVSQLSDSY  184

Query  773   VKDVTSVVSVGQEVTVRLLEANMETGRISLTMRESDETSREKQPKDSPGSSDKS-----R  937
             VKDV S+VSVGQEV V L+EAN ETGRISLTMRE D+ S+ +Q KD+  SSD++      
Sbjct  185   VKDVGSIVSVGQEVKVTLVEANTETGRISLTMREGDDGSKPQQRKDASASSDRAGPGRRS  244

Query  938   APKRTPQRNNQRRESKFVKGQDLEGTVKNLTRSGAFISLPEGEEGFLPTSEMADEGLGEI  1117
             +PK+  ++N  R+ +KFVKGQDL GTVKNL R+GAFISLPEGEEGFLPTSE AD+G    
Sbjct  245   SPKKGDRKNEVRKTTKFVKGQDLVGTVKNLVRAGAFISLPEGEEGFLPTSEEADDGFANA  304

Query  1118  MGGSSLQVGQEVSVRVLRISRGQATLTMKKEEATEEVNSVLSQGVIHKATNPFALAFRKN  1297
             +G +SL+VGQEV+VRVLR +RGQ TLTMKKEE   + +S +SQGV+H ATNPF LAFRKN
Sbjct  305   LGETSLEVGQEVNVRVLRTTRGQVTLTMKKEEDALKSDSQISQGVVHTATNPFVLAFRKN  364

Query  1298  KEISAFLDQREE-----------------------------EVLAEKSEKDNNEAGVDIS  1390
             K+I++FLD+RE+                             EVL E++  D    G    
Sbjct  365   KDIASFLDEREKIENAAKTIATQKSSEELEGKVNESESNIIEVLDEQASSDEGTLG----  420

Query  1391  TVDDTLSETAEKDGEVMETINEDTTTTDQLS----------EEPSATEDDSLPIT-----  1525
              +   ++ET E DG ++E +  D  T+D  S          E P +   ++L  T     
Sbjct  421   -IPSAVNETVENDGALLEEV--DVGTSDNASSISVNNKEDQESPVSGSIETLETTVQTIE  477

Query  1526  ----EDQLAEPEVSTTTTDQLSEEPSAINAAETNAQDETAAQLA  1645
                    + +PE S +TT  + +EP + +  E +A  + ++++A
Sbjct  478   KEEVNSDILDPEGSISTTGSIIKEPPSTDGVENDANADPSSEIA  521



>ref|XP_010526456.1| PREDICTED: uncharacterized protein LOC104804019 [Tarenaya hassleriana]
 ref|XP_010526457.1| PREDICTED: uncharacterized protein LOC104804019 [Tarenaya hassleriana]
Length=986

 Score =   406 bits (1043),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 238/460 (52%), Positives = 319/460 (69%), Gaps = 27/460 (6%)
 Frame = +2

Query  254   PVIPTTVNSISLTPCNILISRKNNLLTRCSVFQKPGRQTLSAQRYAIPFSTPVRLFPHLR  433
             P IP+++ ++SL P      + ++   +C + +KPG+Q+LS+ R  +P ST +RLFP   
Sbjct  4     PAIPSSIGNVSLIPRATFSLKTSDCSVKCGISRKPGKQSLSSLRVVLPLSTSLRLFPAYA  63

Query  434   VGFDIQPKLRTPIVSSAETDVAVEEADSATVDKSPSGAP-ENSPVEsdasptpapsrrsr  610
               + + P+ RT   S+  TDV VEE DS+  D++  G P E S    ++  T + SRR+R
Sbjct  64    RQYVLHPRFRT---SATGTDVVVEEQDSSAADENSGGEPVEASEKSEESPATTSQSRRAR  120

Query  611   parKSEMPPIKNEDLIPGASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNLSNSFVKDVTS  790
               RKSEMPP+KNE+L+PG +FTGKV++IQPFGAFVDFGAFTDGLVHVS LS++FVKDV+S
Sbjct  121   MGRKSEMPPVKNEELVPGVTFTGKVRAIQPFGAFVDFGAFTDGLVHVSQLSDNFVKDVSS  180

Query  791   VVSVGQEVTVRLLEANMETGRISLTMRESDETSREKQPKDSPGSSDKSRAPKRTPQRNNQ  970
             VVS+GQEV VRL+EA+ + GRISL+MRE+D+T     PK   G SDK R P++ P + +Q
Sbjct  181   VVSIGQEVKVRLVEADFDAGRISLSMRENDDT-----PKRQSG-SDKPRPPRKNPSKTSQ  234

Query  971   RRE----SKFVKGQDLEGTVKNLTRSGAFISLPEGEEGFLPTSEMADEGLGEIMGGSSLQ  1138
             R+E    SKF+KGQ LEGTVKNLTRSGAFISLPEGEEGFLPT+E AD+GLG +MG SSLQ
Sbjct  235   RKEDLKTSKFMKGQMLEGTVKNLTRSGAFISLPEGEEGFLPTAEEADDGLGSMMGSSSLQ  294

Query  1139  VGQEVSVRVLRISRGQATLTMKKEEATEEVNSVLSQGVIHKATNPFALAFRKNKEISAFL  1318
              GQEVSVRVLRISRGQ TLTMK E+  ++ +  L++GV++ ATNPF LAFRKNK+I++FL
Sbjct  295   AGQEVSVRVLRISRGQVTLTMKSEDG-DKFDETLNEGVVYTATNPFVLAFRKNKDIASFL  353

Query  1319  DQREEEVLAEKSE-------KDNNEAGVDIST---VDDTLSETAEKDGEVMETINEDTTT  1468
             D+R EEV  E +E        +++E   DI T   ++++L+ T E   E+ E+  E   T
Sbjct  354   DKRAEEVEKEAAEKPEETPPNESDEVIKDIITSNEINESLAGTEESTNELSESSEE--IT  411

Query  1469  TDQLSEEPSATEDDSLPITEDQLAEPEVSTTTTDQLSEEP  1588
                LS E    E+      ED L+  EV T  +++L + P
Sbjct  412   EQILSSETPKEEEVVETKAEDDLSAREVQTAESEELEQIP  451



>ref|XP_008343990.1| PREDICTED: probable GPI-anchored adhesin-like protein PGA55 [Malus 
domestica]
Length=669

 Score =   395 bits (1014),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 241/503 (48%), Positives = 320/503 (64%), Gaps = 45/503 (9%)
 Frame = +2

Query  248   MAPVIPTTVNSISLTPCNILISRKNNLLTRCSVFQKPGRQTLSAQRYAIPFSTPVRLFPH  427
             M PVIP +++++S  P     +RKN+ LT+ S  +K  R TLS Q + +PFST ++ FP 
Sbjct  1     MTPVIPYSISNVSHIPGTAFTARKNSCLTKFSFSRKSARHTLSPQSFLLPFSTSIKSFPL  60

Query  428   LRVGFDIQPKLRTPIVSSAETDVAVEEADSATVDKSPSGAP--ENSPVEsdasptpapsr  601
                   +  K R P VS+  TDVAVEEADS   D + S A   E+SP    +    A  +
Sbjct  61    YHSRCPVHHKCRIP-VSATGTDVAVEEADSPVADAASSEAKSXEDSP----SPSQDAQPK  115

Query  602   rsrparKSEMPPIKNEDLIPGASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNLSNSFVKD  781
             R++P RKS MPP+KNE+L+ GA+FTGKV+SIQPFGAF+DFGAFTDGLVHVS LS+ +VKD
Sbjct  116   RTKPVRKSXMPPVKNEELVVGATFTGKVRSIQPFGAFIDFGAFTDGLVHVSQLSDXYVKD  175

Query  782   VTSVVSVGQEVTVRLLEANMETGRISLTMRESDETSREKQPKDSPGSSDKS-----RAPK  946
             V SVVSVGQEV V L+EAN ETGRISLTMRE D+ S+ +Q KD+   SD+        PK
Sbjct  176   VGSVVSVGQEVKVTLVEANAETGRISLTMRERDDGSKPQQRKDASAGSDRGGPGRRSGPK  235

Query  947   RTPQRNNQRRESKFVKGQDLEGTVKNLTRSGAFISLPEGEEGFLPTSEMADEGLGEIMGG  1126
             +  ++N  R+ +KF KG DL GTVKN  R+GAFISLPEG   FLPTSE  D+G   +MG 
Sbjct  236   KGDRKNEVRKTTKFEKGXDLVGTVKNFGRAGAFISLPEGXXXFLPTSEEPDDGFANVMGX  295

Query  1127  SSLQVGQEVSVRVLRISRGQATLTMKKEEATEEVNSVLSQGVIHKATNPFALAFRKNKEI  1306
             +SLQ+GQE++VRVLR +RGQ TLTMKKEE   + +S +SQGVIH ATNPF LAFR+NK+I
Sbjct  296   TSLQLGQEINVRVLRTTRGQVTLTMKKEEDILKSDSQVSQGVIHTATNPFVLAFRQNKDI  355

Query  1307  SAFLDQREE----------------EVLAEKSEKDNNEAGVDIS---TVDDTLSETAEKD  1429
             ++FLD+RE+                EVL EK+  +    GV  +   TV++  + +  ++
Sbjct  356   ASFLDEREKIEKAAKAIPSSESSIPEVLDEKASSEEGTLGVPAAVDETVENGGASSGNQE  415

Query  1430  GEVMETINEDTTTTDQLSEEPSATEDDSLPITEDQLAEPEVSTTTTDQL---SEEPSAIN  1600
               V  TI E   TT+Q  E+   + D         +  PE ST+TTD +   S + S+  
Sbjct  416   SPVSSTI-ETLETTEQTIEKEEVSSD---------ILAPEGSTSTTDGVENASADSSSEI  465

Query  1601  AAETNAQD-ETAAQLAEPEVSTT  1666
             A  T+A +  T  ++ EP+V  T
Sbjct  466   ANHTSASEIPTGEEVIEPQVDDT  488



>gb|KCW79949.1| hypothetical protein EUGRSUZ_C01279 [Eucalyptus grandis]
Length=1201

 Score =   407 bits (1045),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 254/492 (52%), Positives = 338/492 (69%), Gaps = 40/492 (8%)
 Frame = +2

Query  248   MAPVIPTTVNSISLTPCNILISRKNNLLTRCSV-FQKPGRQTLSAQRYAIPFSTPVRLFP  424
             M PVIP++V++I+L P N  + RKNN  T+C +   +P R + S + + +P  + + LFP
Sbjct  1     MTPVIPSSVSNITLIPGNAFLRRKNNRSTQCGISGTRPTRTSFS-RGHNLPLPSSIILFP  59

Query  425   HLRVGFDIQPKLRTPIVSSAETDVAVEEAD----------SATVDKSPSGAPENSPVEsd  574
               R+G+ ++ K R+ I+ +  TDVA EE +          S+    S     E + V+ +
Sbjct  60    --RLGYGLRCKYRSHILFATGTDVATEEQEPPVAEKDSSESSESTPSEVETSEQASVQPE  117

Query  575   asptpapsrrsrparKSEMPPIKNEDLIPGASFTGKVKSIQPFGAFVDFGAFTDGLVHVS  754
             +S  PA +RRS+PARKSEMPPIKNE+L+PGA+FTGKV+SIQPFGAFVDFGAFTDGLVHVS
Sbjct  118   SSSMPAQARRSKPARKSEMPPIKNEELVPGATFTGKVRSIQPFGAFVDFGAFTDGLVHVS  177

Query  755   NLSNSFVKDVTSVVSVGQEVTVRLLEANMETGRISLTMRESDETSREKQPKDSPGSSDKS  934
              LS+ FVKDV S+VSVGQEV VRLLEAN ETGRISL+MRESD+T    Q +D+P S D+ 
Sbjct  178   QLSDRFVKDVGSIVSVGQEVKVRLLEANNETGRISLSMRESDDT---LQRRDAPASGDRP  234

Query  935   RAPKRT---PQRNNQRRESKFVKGQDLEGTVKNLTRSGAFISLPEGEEGFLPTSEMADEG  1105
             R  +++    +R+  R+ SKFVKGQDL+GTVKNLTRSGAFISLPEGEEGFLPTSE +D+G
Sbjct  235   RPSRKSNVAQKRDEARKSSKFVKGQDLKGTVKNLTRSGAFISLPEGEEGFLPTSEESDDG  294

Query  1106  LGEIMGGSSLQVGQEVSVRVLRISRGQATLTMKKEEATEEVNSVLSQGVIHKATNPFALA  1285
                +MGGSSL++GQEV VRVLRISRGQATLTMKKEE  + +++ LSQGV+H ATNPF LA
Sbjct  295   FVSMMGGSSLEIGQEVDVRVLRISRGQATLTMKKEENLKNLDAQLSQGVVHVATNPFVLA  354

Query  1286  FRKNKEISAFLDQRE--EEVLA-EKSEKDNNEAG-VDISTVDDTLSETA---EKDGEVME  1444
             F+ NKEISAFL++RE  E+ +A   S++   +AG  + ++V + LS+ A   E    V  
Sbjct  355   FQNNKEISAFLNEREILEKPMAPTASDEIQGKAGKSETASVTEVLSQPADSSETTATVPS  414

Query  1445  TINEDTTTTDQLSEEPSATEDDSLPITEDQLAEPEVSTTTTDQLSEEPSAINAAETNAQD  1624
             T+N DT  +       SA  D       D  A+ E +++T D    E +A++ +++ A  
Sbjct  415   TVNGDTAAS-------SAGVD-----LGDIKADEESTSSTVDDKESEIAALSLSQS-ADG  461

Query  1625  ETAAQLAEPEVS  1660
              T A + E EVS
Sbjct  462   ATQAAVEEAEVS  473



>ref|XP_010050572.1| PREDICTED: uncharacterized protein LOC104439162 [Eucalyptus grandis]
Length=1230

 Score =   407 bits (1046),  Expect = 5e-124, Method: Compositional matrix adjust.
 Identities = 254/492 (52%), Positives = 338/492 (69%), Gaps = 40/492 (8%)
 Frame = +2

Query  248   MAPVIPTTVNSISLTPCNILISRKNNLLTRCSV-FQKPGRQTLSAQRYAIPFSTPVRLFP  424
             M PVIP++V++I+L P N  + RKNN  T+C +   +P R + S + + +P  + + LFP
Sbjct  1     MTPVIPSSVSNITLIPGNAFLRRKNNRSTQCGISGTRPTRTSFS-RGHNLPLPSSIILFP  59

Query  425   HLRVGFDIQPKLRTPIVSSAETDVAVEEAD----------SATVDKSPSGAPENSPVEsd  574
               R+G+ ++ K R+ I+ +  TDVA EE +          S+    S     E + V+ +
Sbjct  60    --RLGYGLRCKYRSHILFATGTDVATEEQEPPVAEKDSSESSESTPSEVETSEQASVQPE  117

Query  575   asptpapsrrsrparKSEMPPIKNEDLIPGASFTGKVKSIQPFGAFVDFGAFTDGLVHVS  754
             +S  PA +RRS+PARKSEMPPIKNE+L+PGA+FTGKV+SIQPFGAFVDFGAFTDGLVHVS
Sbjct  118   SSSMPAQARRSKPARKSEMPPIKNEELVPGATFTGKVRSIQPFGAFVDFGAFTDGLVHVS  177

Query  755   NLSNSFVKDVTSVVSVGQEVTVRLLEANMETGRISLTMRESDETSREKQPKDSPGSSDKS  934
              LS+ FVKDV S+VSVGQEV VRLLEAN ETGRISL+MRESD+T    Q +D+P S D+ 
Sbjct  178   QLSDRFVKDVGSIVSVGQEVKVRLLEANNETGRISLSMRESDDT---LQRRDAPASGDRP  234

Query  935   RAPKRT---PQRNNQRRESKFVKGQDLEGTVKNLTRSGAFISLPEGEEGFLPTSEMADEG  1105
             R  +++    +R+  R+ SKFVKGQDL+GTVKNLTRSGAFISLPEGEEGFLPTSE +D+G
Sbjct  235   RPSRKSNVAQKRDEARKSSKFVKGQDLKGTVKNLTRSGAFISLPEGEEGFLPTSEESDDG  294

Query  1106  LGEIMGGSSLQVGQEVSVRVLRISRGQATLTMKKEEATEEVNSVLSQGVIHKATNPFALA  1285
                +MGGSSL++GQEV VRVLRISRGQATLTMKKEE  + +++ LSQGV+H ATNPF LA
Sbjct  295   FVSMMGGSSLEIGQEVDVRVLRISRGQATLTMKKEENLKNLDAQLSQGVVHVATNPFVLA  354

Query  1286  FRKNKEISAFLDQRE--EEVLA-EKSEKDNNEAG-VDISTVDDTLSETA---EKDGEVME  1444
             F+ NKEISAFL++RE  E+ +A   S++   +AG  + ++V + LS+ A   E    V  
Sbjct  355   FQNNKEISAFLNEREILEKPMAPTASDEIQGKAGKSETASVTEVLSQPADSSETTATVPS  414

Query  1445  TINEDTTTTDQLSEEPSATEDDSLPITEDQLAEPEVSTTTTDQLSEEPSAINAAETNAQD  1624
             T+N DT  +       SA  D       D  A+ E +++T D    E +A++ +++ A  
Sbjct  415   TVNGDTAAS-------SAGVD-----LGDIKADEESTSSTVDDKESEIAALSLSQS-ADG  461

Query  1625  ETAAQLAEPEVS  1660
              T A + E EVS
Sbjct  462   ATQAAVEEAEVS  473



>emb|CDP03297.1| unnamed protein product [Coffea canephora]
Length=1245

 Score =   406 bits (1043),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 217/365 (59%), Positives = 272/365 (75%), Gaps = 20/365 (5%)
 Frame = +2

Query  248   MAPVIPTTVNSISLTPCNILISRKNNLLTRCSVFQKPGRQTLSAQRYAIPFSTPVRLFPH  427
             M PV+P++ ++  + P + LI+RK+  LTRCS  QK  +Q L +QRY +P ST  RLFP 
Sbjct  1     MTPVLPSSPSNNLVNPADALINRKDTFLTRCSFLQKSRKQGLLSQRYTLPMSTSFRLFPQ  60

Query  428   LRVGFDIQPKLRTPIVSSAETDVAVEEADSATVDKSPSGA---PENSPVEsdasptpaps  598
              R+G            S  ETD+   + D+  V +SP  A    E+S  +SD S T A S
Sbjct  61    FRIG------------SLEETDLPGADKDTGEVSESPLDAIETNEDSSAKSDGSSTTARS  108

Query  599   rrsrparKSEMPPIKNEDLIPGASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNLSNSFVK  778
             +R+RP RKS+MPPI+ EDLIPGA++TGKV+SIQPFGAFVDFGAFTDGLVHVS LS+ FVK
Sbjct  109   KRTRPVRKSDMPPIRTEDLIPGATYTGKVRSIQPFGAFVDFGAFTDGLVHVSRLSDGFVK  168

Query  779   DVTSVVSVGQEVTVRLLEANMETGRISLTMRESDETSREKQPKDSPGSSDKSRAPKRTPQ  958
             DV  VVSVGQEVTVRL+EAN ETGRIS+TMRESD+ S+ ++ +D+P  +  SRAP+++ Q
Sbjct  169   DVGDVVSVGQEVTVRLVEANTETGRISITMRESDDPSKPQKQRDTPAGT--SRAPRKSNQ  226

Query  959   RNNQ-RRESKFVKGQDLEGTVKNLTRSGAFISLPEGEEGFLPTSEMADEGLGEIMGGSSL  1135
             R ++ +R SKFVKGQ+L+GTVKNL R+GAFISLPEGEEGFLPTSE ADEG G   GGSSL
Sbjct  227   RRDEVKRSSKFVKGQELDGTVKNLVRAGAFISLPEGEEGFLPTSEEADEGFGNFTGGSSL  286

Query  1136  QVGQEVSVRVLRISRGQATLTMKKEEATEEVNSVLSQGVIHKATNPFALAFRKNKEISAF  1315
             QVGQEV VRVL I+RG+  LTMKKEE   E +  L QGV+H ATNPF LAF +NK+I+ F
Sbjct  287   QVGQEVKVRVLNINRGKVQLTMKKEETAGEFD--LVQGVVHTATNPFVLAFHRNKDIATF  344

Query  1316  LDQRE  1330
             LD+++
Sbjct  345   LDEQD  349



>ref|XP_010688265.1| PREDICTED: uncharacterized protein LOC104902251 isoform X3 [Beta 
vulgaris subsp. vulgaris]
Length=1034

 Score =   399 bits (1026),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 221/452 (49%), Positives = 296/452 (65%), Gaps = 26/452 (6%)
 Frame = +2

Query  248   MAPVIPTTVNSISLTPCNILISRKNNLLTRCSVFQKPGRQTLSAQRYAIPFSTPVRLFPH  427
             M PVIP +V++IS  P N   +RKN  LTR +  +   R +LS+Q++ I     + +F  
Sbjct  1     MTPVIPCSVSNISFIPGNAFTTRKNRCLTRYNYSENSTRPSLSSQKHFIALPRSITVFQK  60

Query  428   LRVGFDIQPKLRTPIVSSAETDVAVEEADSATVDK-SPSGAPEN-----SPVEsdasptp  589
             LR G       R P +S+  TDV VEE  S+  ++ +P+G P+       P     +   
Sbjct  61    LRNGC-----TRIPRLSATGTDVVVEEQGSSIAEEEAPAGPPQEVETNEEPSTKSDASAA  115

Query  590   apsrrsrparKSEMPPIKNEDLIPGASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNLSNS  769
             A   + R  R+SEMPP+KNEDL+PGA+FTGKV+SIQPFGAFVDFGAFTDGLVHVS LS S
Sbjct  116   ATRAKRRQGRRSEMPPVKNEDLVPGATFTGKVRSIQPFGAFVDFGAFTDGLVHVSRLSES  175

Query  770   FVKDVTSVVSVGQEVTVRLLEANMETGRISLTMRESDETSREKQPKDSPGSSDKSRAPKR  949
             FVKDV  VVS+GQEV VRL+E N ETGRISL+MRE   +S+ +Q  D  G+SDK R+P+R
Sbjct  176   FVKDVNDVVSLGQEVKVRLVEVNTETGRISLSMREETSSSKPQQKTD--GNSDKPRSPRR  233

Query  950   TPQRNNQRRESKFVKGQDLEGTVKNLTRSGAFISLPEGEEGFLPTSEMADEGLGEIMGGS  1129
             +  +    +++KF  GQDL GTVKN  RSGAFISLPEGEEGFLPTSE  D+G G +MG +
Sbjct  234   SAAKREDVKKTKFGLGQDLVGTVKNFARSGAFISLPEGEEGFLPTSEEPDDGFGNVMGNT  293

Query  1130  SLQVGQEVSVRVLRISRGQATLTMKKEEATEEVNSVLSQGVIHKATNPFALAFRKNKEIS  1309
             SL+VGQEV+ RVLRISRG  TLTMKKEE  ++++  L+QGV+H+ATNPF +AFR+NK+I+
Sbjct  294   SLEVGQEVNCRVLRISRGIVTLTMKKEEDVKKLDGKLNQGVVHEATNPFVVAFRRNKDIA  353

Query  1310  AFLDQREE-EVLAEKSEKDNNEAGVDISTVDDTLSETAEKDGEVMETINEDTTTTDQL--  1480
             AFLD RE+ E  A        +A  + +TV+D   ET+ K+   + ++ + + + D    
Sbjct  354   AFLDDREQPEEDASAETTTGEDASTETTTVEDASVETSSKEASEVNSVADTSQSLDAAAV  413

Query  1481  ----------SEEPSATEDDSLPITEDQLAEP  1546
                       S+E + T  D  P+ ED++  P
Sbjct  414   SLGEAVEDPNSKEVATTSQDDGPVAEDEMTTP  445



>ref|XP_010688263.1| PREDICTED: uncharacterized protein LOC104902251 isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=1095

 Score =   400 bits (1028),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 221/452 (49%), Positives = 296/452 (65%), Gaps = 26/452 (6%)
 Frame = +2

Query  248   MAPVIPTTVNSISLTPCNILISRKNNLLTRCSVFQKPGRQTLSAQRYAIPFSTPVRLFPH  427
             M PVIP +V++IS  P N   +RKN  LTR +  +   R +LS+Q++ I     + +F  
Sbjct  1     MTPVIPCSVSNISFIPGNAFTTRKNRCLTRYNYSENSTRPSLSSQKHFIALPRSITVFQK  60

Query  428   LRVGFDIQPKLRTPIVSSAETDVAVEEADSATVDK-SPSGAPEN-----SPVEsdasptp  589
             LR G       R P +S+  TDV VEE  S+  ++ +P+G P+       P     +   
Sbjct  61    LRNGC-----TRIPRLSATGTDVVVEEQGSSIAEEEAPAGPPQEVETNEEPSTKSDASAA  115

Query  590   apsrrsrparKSEMPPIKNEDLIPGASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNLSNS  769
             A   + R  R+SEMPP+KNEDL+PGA+FTGKV+SIQPFGAFVDFGAFTDGLVHVS LS S
Sbjct  116   ATRAKRRQGRRSEMPPVKNEDLVPGATFTGKVRSIQPFGAFVDFGAFTDGLVHVSRLSES  175

Query  770   FVKDVTSVVSVGQEVTVRLLEANMETGRISLTMRESDETSREKQPKDSPGSSDKSRAPKR  949
             FVKDV  VVS+GQEV VRL+E N ETGRISL+MRE   +S+ +Q  D  G+SDK R+P+R
Sbjct  176   FVKDVNDVVSLGQEVKVRLVEVNTETGRISLSMREETSSSKPQQKTD--GNSDKPRSPRR  233

Query  950   TPQRNNQRRESKFVKGQDLEGTVKNLTRSGAFISLPEGEEGFLPTSEMADEGLGEIMGGS  1129
             +  +    +++KF  GQDL GTVKN  RSGAFISLPEGEEGFLPTSE  D+G G +MG +
Sbjct  234   SAAKREDVKKTKFGLGQDLVGTVKNFARSGAFISLPEGEEGFLPTSEEPDDGFGNVMGNT  293

Query  1130  SLQVGQEVSVRVLRISRGQATLTMKKEEATEEVNSVLSQGVIHKATNPFALAFRKNKEIS  1309
             SL+VGQEV+ RVLRISRG  TLTMKKEE  ++++  L+QGV+H+ATNPF +AFR+NK+I+
Sbjct  294   SLEVGQEVNCRVLRISRGIVTLTMKKEEDVKKLDGKLNQGVVHEATNPFVVAFRRNKDIA  353

Query  1310  AFLDQREE-EVLAEKSEKDNNEAGVDISTVDDTLSETAEKDGEVMETINEDTTTTDQL--  1480
             AFLD RE+ E  A        +A  + +TV+D   ET+ K+   + ++ + + + D    
Sbjct  354   AFLDDREQPEEDASAETTTGEDASTETTTVEDASVETSSKEASEVNSVADTSQSLDAAAV  413

Query  1481  ----------SEEPSATEDDSLPITEDQLAEP  1546
                       S+E + T  D  P+ ED++  P
Sbjct  414   SLGEAVEDPNSKEVATTSQDDGPVAEDEMTTP  445



>ref|XP_010688264.1| PREDICTED: uncharacterized protein LOC104902251 isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=1094

 Score =   400 bits (1027),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 221/452 (49%), Positives = 296/452 (65%), Gaps = 26/452 (6%)
 Frame = +2

Query  248   MAPVIPTTVNSISLTPCNILISRKNNLLTRCSVFQKPGRQTLSAQRYAIPFSTPVRLFPH  427
             M PVIP +V++IS  P N   +RKN  LTR +  +   R +LS+Q++ I     + +F  
Sbjct  1     MTPVIPCSVSNISFIPGNAFTTRKNRCLTRYNYSENSTRPSLSSQKHFIALPRSITVFQK  60

Query  428   LRVGFDIQPKLRTPIVSSAETDVAVEEADSATVDK-SPSGAPEN-----SPVEsdasptp  589
             LR G       R P +S+  TDV VEE  S+  ++ +P+G P+       P     +   
Sbjct  61    LRNGC-----TRIPRLSATGTDVVVEEQGSSIAEEEAPAGPPQEVETNEEPSTKSDASAA  115

Query  590   apsrrsrparKSEMPPIKNEDLIPGASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNLSNS  769
             A   + R  R+SEMPP+KNEDL+PGA+FTGKV+SIQPFGAFVDFGAFTDGLVHVS LS S
Sbjct  116   ATRAKRRQGRRSEMPPVKNEDLVPGATFTGKVRSIQPFGAFVDFGAFTDGLVHVSRLSES  175

Query  770   FVKDVTSVVSVGQEVTVRLLEANMETGRISLTMRESDETSREKQPKDSPGSSDKSRAPKR  949
             FVKDV  VVS+GQEV VRL+E N ETGRISL+MRE   +S+ +Q  D  G+SDK R+P+R
Sbjct  176   FVKDVNDVVSLGQEVKVRLVEVNTETGRISLSMREETSSSKPQQKTD--GNSDKPRSPRR  233

Query  950   TPQRNNQRRESKFVKGQDLEGTVKNLTRSGAFISLPEGEEGFLPTSEMADEGLGEIMGGS  1129
             +  +    +++KF  GQDL GTVKN  RSGAFISLPEGEEGFLPTSE  D+G G +MG +
Sbjct  234   SAAKREDVKKTKFGLGQDLVGTVKNFARSGAFISLPEGEEGFLPTSEEPDDGFGNVMGNT  293

Query  1130  SLQVGQEVSVRVLRISRGQATLTMKKEEATEEVNSVLSQGVIHKATNPFALAFRKNKEIS  1309
             SL+VGQEV+ RVLRISRG  TLTMKKEE  ++++  L+QGV+H+ATNPF +AFR+NK+I+
Sbjct  294   SLEVGQEVNCRVLRISRGIVTLTMKKEEDVKKLDGKLNQGVVHEATNPFVVAFRRNKDIA  353

Query  1310  AFLDQREE-EVLAEKSEKDNNEAGVDISTVDDTLSETAEKDGEVMETINEDTTTTDQL--  1480
             AFLD RE+ E  A        +A  + +TV+D   ET+ K+   + ++ + + + D    
Sbjct  354   AFLDDREQPEEDASAETTTGEDASTETTTVEDASVETSSKEASEVNSVADTSQSLDAAAV  413

Query  1481  ----------SEEPSATEDDSLPITEDQLAEP  1546
                       S+E + T  D  P+ ED++  P
Sbjct  414   SLGEAVEDPNSKEVATTSQDDGPVAEDEMTTP  445



>ref|XP_002325009.2| elongation factor Ts family protein [Populus trichocarpa]
 gb|EEF03574.2| elongation factor Ts family protein [Populus trichocarpa]
Length=987

 Score =   394 bits (1013),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 221/375 (59%), Positives = 272/375 (73%), Gaps = 15/375 (4%)
 Frame = +2

Query  248   MAPVIPTTVNSISLTPCNILISRKNNLLTRCSVFQKPGRQTLSAQRYAIPFSTPVRLFPH  427
             M PV+P + ++I L P       KNN L   S+ +K  +   S+QR  +P    V+LFP 
Sbjct  1     MTPVLPCSTSNICLIPGTAFSINKNNSLKNGSLSRKSTKYASSSQRLVLPLPGFVKLFPQ  60

Query  428   LRVGFDIQPKLRTPIVSSAETDVAVEEADSATVDKSPSGAPE---------NSPVEsdas  580
                   +  +     VS+  TDVAVEE DS  VDK   G  E         +S  ++ +S
Sbjct  61    YHRDCAMVHRSVAHTVSATGTDVAVEEPDSPVVDKDSDGVSEIPADAVETIDSSTKAGSS  120

Query  581   ptpapsrrsrparKSEMPPIKNEDLIPGASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNL  760
             P PA S RS+ +RKSEMPP+KNEDL+PGA+FTGKV+SIQPFGAFVDFGAFTDGLVHVS L
Sbjct  121   PAPAQSSRSKGSRKSEMPPVKNEDLVPGATFTGKVRSIQPFGAFVDFGAFTDGLVHVSKL  180

Query  761   SNSFVKDVTSVVSVGQEVTVRLLEANMETGRISLTMRESDETSREKQPKDSPGSSDKSR-  937
             S+SFVKDV SVVSVGQEV VRL+EAN ETGRISLTMRE+D+TS+ +Q  DSP +   +R 
Sbjct  181   SDSFVKDVGSVVSVGQEVKVRLVEANTETGRISLTMRENDDTSKFQQRNDSPATGSSNRQ  240

Query  938   APKRTPQRNNQRRE----SKFVKGQDLEGTVKNLTRSGAFISLPEGEEGFLPTSEMADEG  1105
             A +R   + NQR++    SKFVKGQ+LEGTVKNLTRSGAFISLPEGEEGFLP SE +D+ 
Sbjct  241   AARRNTSKPNQRKDEVKSSKFVKGQNLEGTVKNLTRSGAFISLPEGEEGFLPRSEESDDV  300

Query  1106  LGEIMGGSSLQVGQEVSVRVLRISRGQATLTMKKEEATEEVNSVLSQGVIHKATNPFALA  1285
                +MG SSLQ+GQEVSVRVLRI+RGQ TLTMKKE+A ++ ++ L QG++H ATNPF LA
Sbjct  301   FAGMMGDSSLQIGQEVSVRVLRITRGQVTLTMKKEDA-DKRDTELIQGIVHTATNPFMLA  359

Query  1286  FRKNKEISAFLDQRE  1330
             FRKNK+I+AFLD+RE
Sbjct  360   FRKNKDIAAFLDERE  374



>ref|XP_008462748.1| PREDICTED: probable GPI-anchored adhesin-like protein PGA55 isoform 
X2 [Cucumis melo]
 ref|XP_008462749.1| PREDICTED: probable GPI-anchored adhesin-like protein PGA55 isoform 
X3 [Cucumis melo]
Length=1122

 Score =   396 bits (1017),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 214/371 (58%), Positives = 266/371 (72%), Gaps = 13/371 (4%)
 Frame = +2

Query  248   MAPVIPTTVNSISLTPCNILISRKNNLLTRCSVFQKPGRQTLSAQRYAIPFSTPVRLFPH  427
             M+ + P++++++SL P     S K N  TR S  +KP + T   QR+ +P ST VRLFP+
Sbjct  1     MSVISPSSISNVSLVPIANH-SGKTNSSTRFSFSRKPTKHTFHNQRFLLPLSTSVRLFPN  59

Query  428   LRVGFDIQPKLRTPIVSSAETDVAVEEADSATVDKS-------PSG---APENSPVEsda  577
                        R PI S+A TDVAVEE+DS    +        PSG     E +PV+SDA
Sbjct  60    CTKNLFCSHGRRIPIYSAAGTDVAVEESDSPVSGEESTQNSELPSGEVATNEKTPVKSDA  119

Query  578   sptpapsrrsrparKSEMPPIKNEDLIPGASFTGKVKSIQPFGAFVDFGAFTDGLVHVSN  757
             +PT +   R     KSEMP + NE+LIPGA+FTGKV+SIQPFGAFVDFGAFTDGLVHVS 
Sbjct  120   APTQSKRSRPMR--KSEMPAVNNEELIPGATFTGKVRSIQPFGAFVDFGAFTDGLVHVSR  177

Query  758   LSNSFVKDVTSVVSVGQEVTVRLLEANMETGRISLTMRESDETSREKQPKDSPGSSDKSR  937
             LS+S+VKDV SVVSVGQEV VRL+EAN E GRISL+MRE+DE        D PGSS K+ 
Sbjct  178   LSDSYVKDVASVVSVGQEVKVRLIEANAEAGRISLSMRENDERKESPASNDKPGSSRKNA  237

Query  938   APKRTPQRNNQRRESKFVKGQDLEGTVKNLTRSGAFISLPEGEEGFLPTSEMADEGLGEI  1117
                R P+R+  ++ S FVKGQDL+GTVKN+TRSGAFISLPEGEEGFLP+SE   EG G +
Sbjct  238   PKARGPRRDEVKKSSTFVKGQDLQGTVKNITRSGAFISLPEGEEGFLPSSEETFEGFGNL  297

Query  1118  MGGSSLQVGQEVSVRVLRISRGQATLTMKKEEATEEVNSVLSQGVIHKATNPFALAFRKN  1297
             MGGS+L++GQEV VRVLRI+RG+ TLTMKK+E  E+ +S L+QG ++ ATNPF LAFRKN
Sbjct  298   MGGSTLEIGQEVDVRVLRIARGRVTLTMKKDEDNEKSDSQLNQGKVYAATNPFLLAFRKN  357

Query  1298  KEISAFLDQRE  1330
             K+I+ FLD+RE
Sbjct  358   KDIATFLDERE  368



>ref|XP_008462747.1| PREDICTED: probable GPI-anchored adhesin-like protein PGA55 isoform 
X1 [Cucumis melo]
Length=1171

 Score =   397 bits (1019),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 214/371 (58%), Positives = 266/371 (72%), Gaps = 13/371 (4%)
 Frame = +2

Query  248   MAPVIPTTVNSISLTPCNILISRKNNLLTRCSVFQKPGRQTLSAQRYAIPFSTPVRLFPH  427
             M+ + P++++++SL P     S K N  TR S  +KP + T   QR+ +P ST VRLFP+
Sbjct  1     MSVISPSSISNVSLVPIANH-SGKTNSSTRFSFSRKPTKHTFHNQRFLLPLSTSVRLFPN  59

Query  428   LRVGFDIQPKLRTPIVSSAETDVAVEEADSATVDKS-------PSG---APENSPVEsda  577
                        R PI S+A TDVAVEE+DS    +        PSG     E +PV+SDA
Sbjct  60    CTKNLFCSHGRRIPIYSAAGTDVAVEESDSPVSGEESTQNSELPSGEVATNEKTPVKSDA  119

Query  578   sptpapsrrsrparKSEMPPIKNEDLIPGASFTGKVKSIQPFGAFVDFGAFTDGLVHVSN  757
             +PT +   R     KSEMP + NE+LIPGA+FTGKV+SIQPFGAFVDFGAFTDGLVHVS 
Sbjct  120   APTQSKRSRPMR--KSEMPAVNNEELIPGATFTGKVRSIQPFGAFVDFGAFTDGLVHVSR  177

Query  758   LSNSFVKDVTSVVSVGQEVTVRLLEANMETGRISLTMRESDETSREKQPKDSPGSSDKSR  937
             LS+S+VKDV SVVSVGQEV VRL+EAN E GRISL+MRE+DE        D PGSS K+ 
Sbjct  178   LSDSYVKDVASVVSVGQEVKVRLIEANAEAGRISLSMRENDERKESPASNDKPGSSRKNA  237

Query  938   APKRTPQRNNQRRESKFVKGQDLEGTVKNLTRSGAFISLPEGEEGFLPTSEMADEGLGEI  1117
                R P+R+  ++ S FVKGQDL+GTVKN+TRSGAFISLPEGEEGFLP+SE   EG G +
Sbjct  238   PKARGPRRDEVKKSSTFVKGQDLQGTVKNITRSGAFISLPEGEEGFLPSSEETFEGFGNL  297

Query  1118  MGGSSLQVGQEVSVRVLRISRGQATLTMKKEEATEEVNSVLSQGVIHKATNPFALAFRKN  1297
             MGGS+L++GQEV VRVLRI+RG+ TLTMKK+E  E+ +S L+QG ++ ATNPF LAFRKN
Sbjct  298   MGGSTLEIGQEVDVRVLRIARGRVTLTMKKDEDNEKSDSQLNQGKVYAATNPFLLAFRKN  357

Query  1298  KEISAFLDQRE  1330
             K+I+ FLD+RE
Sbjct  358   KDIATFLDERE  368



>ref|XP_011048367.1| PREDICTED: uncharacterized protein LOC105142434 [Populus euphratica]
 ref|XP_011048368.1| PREDICTED: uncharacterized protein LOC105142434 [Populus euphratica]
Length=1093

 Score =   395 bits (1014),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 221/376 (59%), Positives = 275/376 (73%), Gaps = 17/376 (5%)
 Frame = +2

Query  248   MAPVIPTTVNSISLTPCNILISRKNNLLTRCSVFQKPGRQTLSAQRYAIPFSTPVRLFPH  427
             M PV+P + ++I L P      +KNN L   S+ +K  +   S+QR  +P    V+LFP 
Sbjct  1     MTPVLPCSTSNICLIPGTAFSIKKNNSLKNGSLSRKSTKYASSSQRLVLPLPGFVKLFPQ  60

Query  428   LRVGFDIQPKLRTPIVSSAETDVAVEEADSATVDKSPSGAPE---------NSPVEsdas  580
                   +  +     VS+  TDVAVEE DS  VDK   G  E         +S  ++ +S
Sbjct  61    YHRDCAMVHRSGAHTVSATGTDVAVEEPDSPVVDKDSDGVTEIPADAVETIDSSTKAGSS  120

Query  581   ptpapsrrsrparKSEMPPIKNEDLIPGASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNL  760
             P PA S RS+ +RKSEMPP+KNEDL+PGA+FTGKV+SIQPFGAFVDFGAFTDGLVHVS L
Sbjct  121   PAPAQSSRSKGSRKSEMPPVKNEDLVPGATFTGKVRSIQPFGAFVDFGAFTDGLVHVSKL  180

Query  761   SNSFVKDVTSVVSVGQEVTVRLLEANMETGRISLTMRESDETSREKQPKDSP--GSSDKS  934
             S+SFVKDV SVVSVGQEV VRL+EAN ETGRISLTMRE+D+ ++ +Q  DSP  GSS++ 
Sbjct  181   SDSFVKDVGSVVSVGQEVKVRLVEANTETGRISLTMRENDDMNKFQQRNDSPATGSSNR-  239

Query  935   RAPKRTPQRNNQRRE----SKFVKGQDLEGTVKNLTRSGAFISLPEGEEGFLPTSEMADE  1102
             +A +R   + NQR+E    SKFVKGQ+LEGTVKNLTRSGAFISLPEGEEGFLP SE +D+
Sbjct  240   QAARRNTSKPNQRKEEVKSSKFVKGQNLEGTVKNLTRSGAFISLPEGEEGFLPRSEESDD  299

Query  1103  GLGEIMGGSSLQVGQEVSVRVLRISRGQATLTMKKEEATEEVNSVLSQGVIHKATNPFAL  1282
                 +MG SSLQ+GQEVSVRVLR++RGQ TLTMKKE+A  ++++ L QG++H ATNPF L
Sbjct  300   VFAGMMGDSSLQIGQEVSVRVLRMTRGQVTLTMKKEDAG-KLDTELIQGIVHTATNPFVL  358

Query  1283  AFRKNKEISAFLDQRE  1330
             AFRKNK+I+AFLD+RE
Sbjct  359   AFRKNKDIAAFLDERE  374



>ref|XP_008390553.1| PREDICTED: probable GPI-anchored adhesin-like protein PGA55 [Malus 
domestica]
Length=1121

 Score =   391 bits (1005),  Expect = 6e-119, Method: Compositional matrix adjust.
 Identities = 242/504 (48%), Positives = 317/504 (63%), Gaps = 47/504 (9%)
 Frame = +2

Query  248   MAPVIPTTVNSISLTPCNILISRKNNLLTRCSVFQKPGRQTLSAQRYAIPFSTPVRLFPH  427
             M PVIP +++++S  P     +RKN+ LT+ S  +K  R TLS Q + +PFST ++ FP 
Sbjct  1     MTPVIPYSISNVSHIPGTAFTARKNSCLTKFSFSRKSARHTLSPQSFLLPFSTSIKSFPL  60

Query  428   LRVGFDIQPKLRTPIVSSAETDVAVEEADSATVDKSPSGAP--ENSPVEsdasptpapsr  601
                   +  K R P VS+  TDVAVEEADS   D + S A   E+SP    +    A  +
Sbjct  61    YHSRCPVHHKCRIP-VSATGTDVAVEEADSPVADAASSEAKSXEDSP----SPSQDAQPK  115

Query  602   rsrparKSEMPPIKNEDLIPGASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNLSNSFVKD  781
             R++P RKS MPP+KNE+L+ GA+FTGKV+SIQPFGAF+DFGAFTDGLVHVS LS+ +VKD
Sbjct  116   RTKPVRKSXMPPVKNEELVVGATFTGKVRSIQPFGAFIDFGAFTDGLVHVSQLSDXYVKD  175

Query  782   VTSVVSVGQEVTVRLLEANMETGRISLTMRESDETSREKQPKDSPGSSDKS-----RAPK  946
             V SVVSVGQEV V L+EAN ETGRISLTMRE D+ S+ +Q KD+   SD+        PK
Sbjct  176   VGSVVSVGQEVKVTLVEANAETGRISLTMRERDDGSKPQQRKDASAGSDRGGPGRRSGPK  235

Query  947   RTPQRNNQRRESKFVKGQDLEGTVKNLTRSGAFISLPEGEEGFLPTSEMADEGLGEIMGG  1126
             +  ++N  R+ +KF KG DL GTVKN  R+GAFISLPEG   FLPTSE  D+G   +MG 
Sbjct  236   KGDRKNEVRKTTKFEKGXDLVGTVKNFGRAGAFISLPEGXXXFLPTSEEPDDGFANVMGX  295

Query  1127  SSLQVGQEVSVRVLRISRGQATLTMKKEEATEEVNSVLSQGVIHKATNPFALAFRKNKEI  1306
             +SLQ+GQE++VRVLR +RGQ TLTMKKEE   + +S +SQG IH ATNPF LAFR+NK+I
Sbjct  296   TSLQLGQEINVRVLRTTRGQVTLTMKKEEDILKSDSQVSQGXIHTATNPFVLAFRQNKDI  355

Query  1307  SAFLDQREE----------------EVLAEKSEKDNNEAGVDISTVDDTLSETAEKDGE-  1435
             ++FLD+RE+                EVL EK+  +    GV  + VD+T+       G  
Sbjct  356   ASFLDEREKIEKAAKAIPSSESSIPEVLDEKASSEEGTLGVP-AAVDETVENGGASSGNQ  414

Query  1436  ---VMETINEDTTTTDQLSEEPSATEDDSLPITEDQLAEPEVSTTTTDQL---SEEPSAI  1597
                V  TI E   TT+Q  E+   + D         +  PE ST+TTD +   S + S+ 
Sbjct  415   ESPVSSTI-ETLETTEQTIEKEEVSSD---------ILAPEGSTSTTDGVENASADSSSE  464

Query  1598  NAAETNAQD-ETAAQLAEPEVSTT  1666
              A  T+A +  T  ++ EP+V  T
Sbjct  465   IANHTSASEIPTGEEVIEPQVDDT  488



>ref|XP_010107377.1| Elongation factor Ts [Morus notabilis]
 gb|EXC15866.1| Elongation factor Ts [Morus notabilis]
Length=1060

 Score =   389 bits (999),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 240/496 (48%), Positives = 327/496 (66%), Gaps = 28/496 (6%)
 Frame = +2

Query  248   MAPVIPTTVNSISLTPCNILISRKNNLLTRCSVFQKPGRQTLSAQRYAIPFSTPVRLFPH  427
             M PVIP +++++SL P  +  +RK    TR S+ +K    T S Q + +P S    L   
Sbjct  1     MTPVIPYSISNVSLIPGTVFRTRKTYCSTRFSLSRKSTINTRSPQSFLLPRSASFGLLTP  60

Query  428   LRVGFDIQPKLRTPIVSSAETDVAVEEADSATVDKSPSGAPENSP----VEsdasptpap  595
                G  +  + R  ++S+  TDVAVEE DS    +  +G  E S     V+SD +PTPA 
Sbjct  61    YGRGCSLHNQSRIYLLSATGTDVAVEEPDSPVTGEDSAGDSEVSSDAAEVKSDVTPTPAT  120

Query  596   srrsrparKSEMPPIKNEDLIPGASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNLSNSFV  775
              +RSRP +KSEMPP+KNE+L+PGA+FTGKV+S+QPFGAF+DFGAFTDGLVHVS LS+SFV
Sbjct  121   PKRSRPVKKSEMPPVKNEELVPGATFTGKVRSVQPFGAFIDFGAFTDGLVHVSRLSDSFV  180

Query  776   KDVTSVVSVGQEVTVRLLEANMETGRISLTMRESDETSREKQPKDSPGSSDKS-----RA  940
             KDV SVVSVGQEV VRL+EAN ETGRISL+MRESD+  + +Q KD+  S+D++      A
Sbjct  181   KDVGSVVSVGQEVKVRLVEANTETGRISLSMRESDDVDKAQQRKDTSASNDRAGPGRRNA  240

Query  941   PKRTPQRNNQRRESKFVKGQDLEGTVKNLTRSGAFISLPEGEEGFLPTSEMADEGLGEIM  1120
             PK + ++   ++ SKFV+GQDLEGTVKN+ R+GAFISLPEGEEGFLP +E   +G G +M
Sbjct  241   PKSSQRKAEAKKVSKFVQGQDLEGTVKNMNRAGAFISLPEGEEGFLPIAEELSDGFGNVM  300

Query  1121  GGSSLQVGQEVSVRVLRISRGQATLTMKKEEATEEVNSVLSQGVIHKATNPFALAFRKNK  1300
             G +SL+VGQEVSVRVLRISRGQ TLTMKK E   + +  ++QG++H ATNPF LAFRKNK
Sbjct  301   GETSLEVGQEVSVRVLRISRGQVTLTMKKAEDIPKSDVQITQGILHTATNPFVLAFRKNK  360

Query  1301  EISAFLDQREE-EVLAEK---SEKDNNEAGVDISTVDDTLSETAEKDGEVMETINEDTTT  1468
             +I+AFLD RE  E +AEK    +           TV D L+E         + ++ D TT
Sbjct  361   DIAAFLDDRENIEEVAEKPVTPKVSEEVEKEVSETVADCLTEQD-------QPVSSDETT  413

Query  1469  TDQLSEEPSATEDDSLPITEDQLAEPEVSTTTTDQLSEEPSAINAAETNAQDETAAQLAE  1648
                 S      E      T++  +E   ++   D ++EE S+++ AE+  + +++A+ AE
Sbjct  414   VGVTSAVDEKVE------TDEASSEKAEASALEDPITEEASSVDEAESEEKPDSSAESAE  467

Query  1649  PEVS--TTTIDQPSEE  1690
             P +S  T+T ++ S+E
Sbjct  468   PILSLETSTAEEVSKE  483



>ref|XP_009352505.1| PREDICTED: uncharacterized protein LOC103943869 isoform X2 [Pyrus 
x bretschneideri]
Length=1022

 Score =   387 bits (995),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 217/418 (52%), Positives = 280/418 (67%), Gaps = 29/418 (7%)
 Frame = +2

Query  236   YSFGMAPVIPTTVNSISLTPCNILISRKNNLLTRCSVFQKPGRQTLSAQRYAIPFSTPVR  415
             +   M PVIP +++++S  P +   +RKNN LT+ S  +      LS + + +PFST ++
Sbjct  10    FQVNMTPVIPYSISNVSHIPGSAFTARKNNCLTKFSFSRNSANHALSPRTFLLPFSTSIK  69

Query  416   LFPHLRVGFDIQPKLRTPIVSSAETDVAVEEADSATVDKSPSGAP--ENSPVEsdasptp  589
              F        +  + R   VS+  TDVAVEEADS  VD + S A   ++SP         
Sbjct  70    SFALYHCRCPVHHRFRIH-VSATGTDVAVEEADSPVVDAASSEAKSSDDSP----GPSQD  124

Query  590   apsrrsrparKSEMPPIKNEDLIPGASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNLSNS  769
             +  +RS+P RKSEMPP+KNE+L+ GA+FTGKV+SIQPFGAF+DFGAFTDGLVHVS LS++
Sbjct  125   SQPKRSKPVRKSEMPPVKNEELVVGATFTGKVRSIQPFGAFIDFGAFTDGLVHVSQLSDT  184

Query  770   FVKDVTSVVSVGQEVTVRLLEANMETGRISLTMRESDETSREKQPKDSPGSSDKS-----  934
             +VKDV SVVSVGQEV V L+EAN ETGRISLTMRE D  S+ +Q KD+   SD+      
Sbjct  185   YVKDVGSVVSVGQEVKVTLVEANPETGRISLTMRERDNGSKPQQRKDASAGSDRGGPGRR  244

Query  935   RAPKRTPQRNNQRRESKFVKGQDLEGTVKNLTRSGAFISLPEGEEGFLPTSEMADEGLGE  1114
               PK+  ++N  R+ +KF KGQDL GTVKN  R+GAFISLPEGEEGFLPTSE  D+G   
Sbjct  245   SGPKKGERKNEVRKTTKFEKGQDLVGTVKNFARAGAFISLPEGEEGFLPTSEEPDDGFAN  304

Query  1115  IMGGSSLQVGQEVSVRVLRISRGQATLTMKKEEATEEVNSVLSQGVIHKATNPFALAFRK  1294
             +MG +SLQ+GQE++VRVLR +RGQ TLTMKKEE     +S +SQGVIH ATNPF LAFR+
Sbjct  305   VMGETSLQLGQEINVRVLRTTRGQVTLTMKKEEDILRSDSQVSQGVIHTATNPFLLAFRQ  364

Query  1295  NKEISAFLDQREE----------------EVLAEKSEKDNNEAGVDISTVDDTLSETA  1420
             NK+I++FLD+RE+                EVL E++  D    GV  S VD+T+   A
Sbjct  365   NKDIASFLDEREKIEKAAKAIASSESSIPEVLDEQTTSDEGTLGVP-SAVDETVENGA  421



>ref|XP_009352504.1| PREDICTED: uncharacterized protein LOC103943869 isoform X1 [Pyrus 
x bretschneideri]
Length=1044

 Score =   387 bits (995),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 217/418 (52%), Positives = 280/418 (67%), Gaps = 29/418 (7%)
 Frame = +2

Query  236   YSFGMAPVIPTTVNSISLTPCNILISRKNNLLTRCSVFQKPGRQTLSAQRYAIPFSTPVR  415
             +   M PVIP +++++S  P +   +RKNN LT+ S  +      LS + + +PFST ++
Sbjct  10    FQVNMTPVIPYSISNVSHIPGSAFTARKNNCLTKFSFSRNSANHALSPRTFLLPFSTSIK  69

Query  416   LFPHLRVGFDIQPKLRTPIVSSAETDVAVEEADSATVDKSPSGAP--ENSPVEsdasptp  589
              F        +  + R   VS+  TDVAVEEADS  VD + S A   ++SP         
Sbjct  70    SFALYHCRCPVHHRFRIH-VSATGTDVAVEEADSPVVDAASSEAKSSDDSP----GPSQD  124

Query  590   apsrrsrparKSEMPPIKNEDLIPGASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNLSNS  769
             +  +RS+P RKSEMPP+KNE+L+ GA+FTGKV+SIQPFGAF+DFGAFTDGLVHVS LS++
Sbjct  125   SQPKRSKPVRKSEMPPVKNEELVVGATFTGKVRSIQPFGAFIDFGAFTDGLVHVSQLSDT  184

Query  770   FVKDVTSVVSVGQEVTVRLLEANMETGRISLTMRESDETSREKQPKDSPGSSDKS-----  934
             +VKDV SVVSVGQEV V L+EAN ETGRISLTMRE D  S+ +Q KD+   SD+      
Sbjct  185   YVKDVGSVVSVGQEVKVTLVEANPETGRISLTMRERDNGSKPQQRKDASAGSDRGGPGRR  244

Query  935   RAPKRTPQRNNQRRESKFVKGQDLEGTVKNLTRSGAFISLPEGEEGFLPTSEMADEGLGE  1114
               PK+  ++N  R+ +KF KGQDL GTVKN  R+GAFISLPEGEEGFLPTSE  D+G   
Sbjct  245   SGPKKGERKNEVRKTTKFEKGQDLVGTVKNFARAGAFISLPEGEEGFLPTSEEPDDGFAN  304

Query  1115  IMGGSSLQVGQEVSVRVLRISRGQATLTMKKEEATEEVNSVLSQGVIHKATNPFALAFRK  1294
             +MG +SLQ+GQE++VRVLR +RGQ TLTMKKEE     +S +SQGVIH ATNPF LAFR+
Sbjct  305   VMGETSLQLGQEINVRVLRTTRGQVTLTMKKEEDILRSDSQVSQGVIHTATNPFLLAFRQ  364

Query  1295  NKEISAFLDQREE----------------EVLAEKSEKDNNEAGVDISTVDDTLSETA  1420
             NK+I++FLD+RE+                EVL E++  D    GV  S VD+T+   A
Sbjct  365   NKDIASFLDEREKIEKAAKAIASSESSIPEVLDEQTTSDEGTLGVP-SAVDETVENGA  421



>ref|XP_004287445.1| PREDICTED: uncharacterized protein LOC101312281 [Fragaria vesca 
subsp. vesca]
Length=1023

 Score =   386 bits (991),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 216/432 (50%), Positives = 286/432 (66%), Gaps = 25/432 (6%)
 Frame = +2

Query  248   MAPVIPTTVNSISLTPCNILISRKNNLLTRCSVFQKPGRQTLSAQRYAIPFSTPVRLFPH  427
             M PV+P +++++S+ P     SRK N LT+ +  +   R TLS Q + +PFST +RLFP 
Sbjct  1     MTPVVPYSISNVSVFPGTAFTSRKTNSLTKFNFSRNSARHTLSPQSFLLPFSTSIRLFPL  60

Query  428   LRVGFDIQPKLRTPIVSSAETDVAVEEADSATVDKSPSGAPENSP-----VEsdasptpa  592
                   +    RT ++S+  TDVAVE+ DSAT + + + A +NS      +E  +S   +
Sbjct  61    YNNRCPVHHSSRTYVISATGTDVAVEQPDSATAEAT-TEALDNSSDAAETIEKSSSSDAS  119

Query  593   psrrsrparK----SEMPPIKNEDLIPGASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNL  760
                      +    SEMPP+KNE+L+PGA+FTGKV+SIQPFGAF+DFGAFTDGLVHVS L
Sbjct  120   SGPSQARRARPGRQSEMPPVKNEELVPGATFTGKVRSIQPFGAFIDFGAFTDGLVHVSQL  179

Query  761   SNSFVKDVTSVVSVGQEVTVRLLEANMETGRISLTMRESDETSREKQPKDSPGSSDKSRA  940
             S+++VKDV SVVSVGQEV V L+EANMET RISLTMRE     ++       G SD+   
Sbjct  180   SDTYVKDVGSVVSVGQEVKVTLVEANMETKRISLTMREG----KDASSSSDRGGSDRRGG  235

Query  941   PKRTPQRNNQRRESKFVKGQDLEGTVKNLTRSGAFISLPEGEEGFLPTSEMADEGLGEIM  1120
             PK+  ++N  R+ SKF KGQDL GTVKNL R+GAFISLPEGEEGFLP SE  D+G   +M
Sbjct  236   PKKGERKNEGRKSSKFAKGQDLVGTVKNLVRAGAFISLPEGEEGFLPQSEEVDDGFASMM  295

Query  1121  GGSSLQVGQEVSVRVLRISRGQATLTMKKEEATEEVNSVLSQGVIHKATNPFALAFRKNK  1300
             G +SL+VGQE++VRVLRISRGQ TLTMKKEE   +  S ++QGVIH ATNPF LAFR+NK
Sbjct  296   GETSLEVGQEINVRVLRISRGQVTLTMKKEEDLLKSESQITQGVIHTATNPFLLAFRQNK  355

Query  1301  EISAFLDQRE---EEVLAEKSEKD------NNEAGVDISTVD--DTLSETAEKDGEVMET  1447
             +++AFLD+RE   +E +  KS K+      + +   D+ T+D    + E+ E DG  +E 
Sbjct  356   DVAAFLDEREKTTKETVTPKSTKESTQEVLDKQVNSDMQTLDVPSAVDESIENDGAPLEV  415

Query  1448  INEDTTTTDQLS  1483
              +   +  D  S
Sbjct  416   ADVGASEVDDAS  427



>ref|XP_010540967.1| PREDICTED: uncharacterized protein LOC104814561 isoform X2 [Tarenaya 
hassleriana]
Length=1016

 Score =   382 bits (981),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 204/371 (55%), Positives = 263/371 (71%), Gaps = 18/371 (5%)
 Frame = +2

Query  248   MAPVIPTTVNSISLTPCNILISRKNNLLTRCSVFQKPGRQTLSAQRYAIPFSTPVRLFPH  427
             M  VIP+++ ++SL P      +K+N   +     KPG+  LS+QR+ +P ST +RLFP 
Sbjct  1     MNSVIPSSITNVSLIPGATFSLKKSNCSGKHGFSGKPGKHLLSSQRFVLPLSTSLRLFPA  60

Query  428   L-RVGFDIQPKLRTPIVSSAETDVAVEEAD--SATVDKSPSGAPENSPVEsdasptpaps  598
               R    + P+ R   + + ETD AVEE +  SA  + S   + + + VE++     A  
Sbjct  61    FSRQYVLLLPRDRISALPATETDAAVEEQEDSSAAAENSGGDSDQTNVVEANEKTEAAFV  120

Query  599   rrsrpar----KSEMPPIKNEDLIPGASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNLSN  766
                        KSEMPP+KNE+L+PG++FTGKV++IQPFGAFVDFGAFTDGLVHVS LS+
Sbjct  121   ASQSRRTRPGRKSEMPPVKNEELVPGSTFTGKVRAIQPFGAFVDFGAFTDGLVHVSQLSD  180

Query  767   SFVKDVTSVVSVGQEVTVRLLEANMETGRISLTMRESDETSREKQPKDSPGSSDKSRAPK  946
             +FVKDV+SVVS+GQEV VRL+EAN E GRISL+MRE+D++     PK   G S+K R P+
Sbjct  181   TFVKDVSSVVSIGQEVKVRLVEANFEAGRISLSMRENDDS-----PKRQSG-SEKPRPPR  234

Query  947   RTPQRNNQRRE----SKFVKGQDLEGTVKNLTRSGAFISLPEGEEGFLPTSEMADEGLGE  1114
             +   +  +++E    SKFVKGQ LEGTVKNLTRSGAFISLPEGEEGFLPT+E AD+GLG 
Sbjct  235   KNGSKPMRKKEDVKTSKFVKGQMLEGTVKNLTRSGAFISLPEGEEGFLPTAEEADDGLGS  294

Query  1115  IMGGSSLQVGQEVSVRVLRISRGQATLTMKKEEATEEVNSVLSQGVIHKATNPFALAFRK  1294
             +MG SSLQ GQEVSVRVLRISRGQ TLTMK E   ++ +  LSQGV++ ATNPF +AFRK
Sbjct  295   MMGSSSLQAGQEVSVRVLRISRGQVTLTMKNEN-DDKFDETLSQGVVYTATNPFLVAFRK  353

Query  1295  NKEISAFLDQR  1327
             NK+I+ FLD+R
Sbjct  354   NKDIATFLDKR  364



>ref|XP_010540966.1| PREDICTED: uncharacterized protein LOC104814561 isoform X1 [Tarenaya 
hassleriana]
Length=1035

 Score =   382 bits (981),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 204/371 (55%), Positives = 263/371 (71%), Gaps = 18/371 (5%)
 Frame = +2

Query  248   MAPVIPTTVNSISLTPCNILISRKNNLLTRCSVFQKPGRQTLSAQRYAIPFSTPVRLFPH  427
             M  VIP+++ ++SL P      +K+N   +     KPG+  LS+QR+ +P ST +RLFP 
Sbjct  1     MNSVIPSSITNVSLIPGATFSLKKSNCSGKHGFSGKPGKHLLSSQRFVLPLSTSLRLFPA  60

Query  428   L-RVGFDIQPKLRTPIVSSAETDVAVEEAD--SATVDKSPSGAPENSPVEsdasptpaps  598
               R    + P+ R   + + ETD AVEE +  SA  + S   + + + VE++     A  
Sbjct  61    FSRQYVLLLPRDRISALPATETDAAVEEQEDSSAAAENSGGDSDQTNVVEANEKTEAAFV  120

Query  599   rrsrpar----KSEMPPIKNEDLIPGASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNLSN  766
                        KSEMPP+KNE+L+PG++FTGKV++IQPFGAFVDFGAFTDGLVHVS LS+
Sbjct  121   ASQSRRTRPGRKSEMPPVKNEELVPGSTFTGKVRAIQPFGAFVDFGAFTDGLVHVSQLSD  180

Query  767   SFVKDVTSVVSVGQEVTVRLLEANMETGRISLTMRESDETSREKQPKDSPGSSDKSRAPK  946
             +FVKDV+SVVS+GQEV VRL+EAN E GRISL+MRE+D++     PK   G S+K R P+
Sbjct  181   TFVKDVSSVVSIGQEVKVRLVEANFEAGRISLSMRENDDS-----PKRQSG-SEKPRPPR  234

Query  947   RTPQRNNQRRE----SKFVKGQDLEGTVKNLTRSGAFISLPEGEEGFLPTSEMADEGLGE  1114
             +   +  +++E    SKFVKGQ LEGTVKNLTRSGAFISLPEGEEGFLPT+E AD+GLG 
Sbjct  235   KNGSKPMRKKEDVKTSKFVKGQMLEGTVKNLTRSGAFISLPEGEEGFLPTAEEADDGLGS  294

Query  1115  IMGGSSLQVGQEVSVRVLRISRGQATLTMKKEEATEEVNSVLSQGVIHKATNPFALAFRK  1294
             +MG SSLQ GQEVSVRVLRISRGQ TLTMK E   ++ +  LSQGV++ ATNPF +AFRK
Sbjct  295   MMGSSSLQAGQEVSVRVLRISRGQVTLTMKNEN-DDKFDETLSQGVVYTATNPFLVAFRK  353

Query  1295  NKEISAFLDQR  1327
             NK+I+ FLD+R
Sbjct  354   NKDIATFLDKR  364



>ref|XP_004150558.1| PREDICTED: uncharacterized protein LOC101216355 [Cucumis sativus]
 gb|KGN65093.1| Elongation factor Ts [Cucumis sativus]
Length=1122

 Score =   384 bits (985),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 208/371 (56%), Positives = 259/371 (70%), Gaps = 13/371 (4%)
 Frame = +2

Query  248   MAPVIPTTVNSISLTPCNILISRKNNLLTRCSVFQKPGRQTLSAQRYAIPFSTPVRLFPH  427
             M+ + P++++++SL P       K N  TR S  +KP + T   QR+ +P ST VRLFP+
Sbjct  1     MSVISPSSISNVSLVPIANHTG-KTNSSTRFSFSRKPTKHTFHNQRFLLPLSTSVRLFPN  59

Query  428   LRVGFDIQPKLRTPIVSSAETDVAVEEADSATVDKSP-------SGA---PENSPVEsda  577
                        R  I S+  TDVAVEE+DS    +         SGA    E +PV+SD 
Sbjct  60    CTKNLFCSHGRRIRIFSATGTDVAVEESDSPVSGEESTQNSELTSGAISTNEETPVKSDV  119

Query  578   sptpapsrrsrparKSEMPPIKNEDLIPGASFTGKVKSIQPFGAFVDFGAFTDGLVHVSN  757
             +PT     R     KSEMP + NE+LIPGA+FTGKV+SIQPFGAFVDFGAFTDGLVHVS 
Sbjct  120   APTQTKRSRPVR--KSEMPAVNNEELIPGATFTGKVRSIQPFGAFVDFGAFTDGLVHVSR  177

Query  758   LSNSFVKDVTSVVSVGQEVTVRLLEANMETGRISLTMRESDETSREKQPKDSPGSSDKSR  937
             LS+S+VKDV SVVSVGQEV VRL+EAN E GRISL+MRE+DE        D PGSS KS 
Sbjct  178   LSDSYVKDVASVVSVGQEVKVRLIEANAEAGRISLSMRENDERKESPASNDKPGSSRKSA  237

Query  938   APKRTPQRNNQRRESKFVKGQDLEGTVKNLTRSGAFISLPEGEEGFLPTSEMADEGLGEI  1117
                R P+R+  ++ S FVKGQDL+GTVKN+TRSGAFISLPEGEEGFLP+SE   EG G +
Sbjct  238   PKARGPRRDEVKKSSNFVKGQDLQGTVKNITRSGAFISLPEGEEGFLPSSEETFEGFGNL  297

Query  1118  MGGSSLQVGQEVSVRVLRISRGQATLTMKKEEATEEVNSVLSQGVIHKATNPFALAFRKN  1297
             MGGS+L++GQEV+VRVLRI+RG+ TLTMKK+E  ++ +S   QG ++ ATNPF LAFRKN
Sbjct  298   MGGSTLEIGQEVNVRVLRIARGRVTLTMKKDEDNDKSDSQFIQGKVYAATNPFLLAFRKN  357

Query  1298  KEISAFLDQRE  1330
              +I+ FLD+RE
Sbjct  358   NDIATFLDERE  368



>ref|XP_004169613.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized LOC101216355 
[Cucumis sativus]
Length=1106

 Score =   381 bits (978),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 209/371 (56%), Positives = 261/371 (70%), Gaps = 14/371 (4%)
 Frame = +2

Query  248   MAPVIPTTVNSISLTPCNILISRKNNLLTRCSVFQKPGRQTLSAQRYAIPFSTPVRLFPH  427
             M+ + P++++++SL P       K N  TR S  +KP + T   QR+ +P ST VRLFP+
Sbjct  1     MSVISPSSISNVSLVPIANHTG-KTNSSTRFSFSRKPTKHTFHNQRFLLPLSTSVRLFPN  59

Query  428   LRVGFDIQPKLRTPIVSSAETDVAVEEADSATVDKSP-------SGA---PENSPVEsda  577
                 F    + R  I S+  TDVAVEE+DS    +         SGA    E +PV+SD 
Sbjct  60    HXKPFCSHGR-RIRIFSATGTDVAVEESDSPVSGEESTQNSELTSGAISTNEETPVKSDV  118

Query  578   sptpapsrrsrparKSEMPPIKNEDLIPGASFTGKVKSIQPFGAFVDFGAFTDGLVHVSN  757
             +PT     R     KSEMP + NE+LIPGA+FTGKV+SIQPFGAFVDFGAFTDGLVHVS 
Sbjct  119   APTQTKRSRPVR--KSEMPAVNNEELIPGATFTGKVRSIQPFGAFVDFGAFTDGLVHVSR  176

Query  758   LSNSFVKDVTSVVSVGQEVTVRLLEANMETGRISLTMRESDETSREKQPKDSPGSSDKSR  937
             LS+S+VKDV SVVSVGQEV VRL+EAN E GRISL+MRE+DE        D PGSS KS 
Sbjct  177   LSDSYVKDVASVVSVGQEVKVRLIEANAEAGRISLSMRENDERKESPASNDKPGSSRKSA  236

Query  938   APKRTPQRNNQRRESKFVKGQDLEGTVKNLTRSGAFISLPEGEEGFLPTSEMADEGLGEI  1117
                R P+R+  ++ S FVKGQDL+GTVKN+TRSGAFISLPEGEEGFLP+SE   EG G +
Sbjct  237   PKARGPRRDEVKKSSNFVKGQDLQGTVKNITRSGAFISLPEGEEGFLPSSEETFEGFGNL  296

Query  1118  MGGSSLQVGQEVSVRVLRISRGQATLTMKKEEATEEVNSVLSQGVIHKATNPFALAFRKN  1297
             MGGS+L++GQEV+VRVLRI+RG+ TLTMKK+E  ++ +S   QG ++ ATNPF LAFRKN
Sbjct  297   MGGSTLEIGQEVNVRVLRIARGRVTLTMKKDEDNDKSDSQFIQGKVYAATNPFLLAFRKN  356

Query  1298  KEISAFLDQRE  1330
              +I+ FLD+RE
Sbjct  357   NDIATFLDERE  367



>gb|AAL09789.1| AT4g29060/F19B15_90 [Arabidopsis thaliana]
 gb|AAL66967.1| unknown protein [Arabidopsis thaliana]
 gb|AAM20288.1| unknown protein [Arabidopsis thaliana]
Length=455

 Score =   355 bits (912),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 200/378 (53%), Positives = 261/378 (69%), Gaps = 24/378 (6%)
 Frame = +2

Query  248   MAPVIPTTVNSISLTPCNILISRKNNLLTRCSVFQKPGRQTLSA-QRYAIPFSTPVRLFP  424
             MA + P+++++  L P      +K++   +CS  +K G+Q LS+ QR  +P ST +RLFP
Sbjct  1     MATITPSSISNAWLIPGASFTVKKSDCSIKCSFSRKAGKQILSSTQRLVLPLSTSLRLFP  60

Query  425   HLRVGFDIQPKLR---TPIVSSAE----TDVAVEEADSATVDKSPSGAPENSPVEsdasp  583
                  F + P  R   T +V++ E    T V  E+ ++   +KS + AP +         
Sbjct  61    THGRQFVLHPHRRATGTDVVAAVEEQDSTPVVAEDKETVASEKSDAPAPTSQ--------  112

Query  584   tpapsrrsrparKSEMPPIKNEDLIPGASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNLS  763
                    +RP RKSEMP +KNE+L+PGA+FTGKV++IQPFGAFVDFGAFTDGLVHVS LS
Sbjct  113   ---SRGTARPGRKSEMPAVKNEELVPGATFTGKVRAIQPFGAFVDFGAFTDGLVHVSQLS  169

Query  764   NSFVKDVTSVVSVGQEVTVRLLEANMETGRISLTMRESDE-TSREKQPKDSPGSSDKSRA  940
             ++FVKDV+SVV++GQEV VRL+EA++E+ RISLTMRE+D+   R+    D P S  K   
Sbjct  170   DNFVKDVSSVVTIGQEVKVRLVEADIESKRISLTMRENDDPPKRQSGGSDKPRSGGKRDG  229

Query  941   PKRTPQRNNQRRESKFVKGQDLEGTVKNLTRSGAFISLPEGEEGFLPTSEMADEGLGE-I  1117
              K   QR  +   SKF KGQ L+G VKNLTRSGAFI++ EGEEGFLPT+E AD+G+G  +
Sbjct  230   SKGGGQRKGEGFNSKFAKGQMLDGVVKNLTRSGAFITIGEGEEGFLPTAEEADDGIGSMM  289

Query  1118  MGGSSLQVGQEVSVRVLRISRGQATLTMKKEEATEEVNSVLSQGVIHKATNPFALAFRKN  1297
             MGGSSLQ GQEV VRVLRI+RG+ TLTM KEE   + +   +QGV+H ATNPF LAFRKN
Sbjct  290   MGGSSLQAGQEVKVRVLRIARGRVTLTM-KEEDDGKFDETTTQGVVHTATNPFMLAFRKN  348

Query  1298  KEISAFLDQREEEVLAEK  1351
             +EI+AFLD+REEE  AEK
Sbjct  349   EEIAAFLDKREEE--AEK  364



>gb|KDP33708.1| hypothetical protein JCGZ_07279 [Jatropha curcas]
Length=1121

 Score =   373 bits (958),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 238/459 (52%), Positives = 303/459 (66%), Gaps = 46/459 (10%)
 Frame = +2

Query  248   MAPVIPTTVNSISLTPCNILISRKNNLLTRCSVFQKPGRQTLSAQRYAIPFSTPVRLFPH  427
             M   +P + ++ISLTP  +   +KNN LTRCS+ +K  + TLS+QR  +P  T V LFP 
Sbjct  1     MTTTVPCSTSTISLTPGTVFTIKKNNHLTRCSLPRKSSKHTLSSQRIILPLLTSVGLFPQ  60

Query  428   LR--VGFDIQPKLRTPIVSSAETDVAVEEADSATVDKSPSGAPENS--PVEsdasptp--  589
              R   G+  +  L T   +  +TDV VEE DS   D    G  E S   VE     +   
Sbjct  61    HRKDCGWFHRSLLHTVSATGTDTDVVVEEPDSPVAD---DGTAEISSDAVEKGDKSSNPA  117

Query  590   -apsrrsrparKSEMPPIKNEDLIPGASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNLSN  766
              A +RRSRP+RKSEMPP+KN+DLIPGA+FTGKVKSIQPFGAFVDFGAFTDGLVHVS LS+
Sbjct  118   PAQARRSRPSRKSEMPPVKNDDLIPGATFTGKVKSIQPFGAFVDFGAFTDGLVHVSRLSD  177

Query  767   SFVKDVTSVVSVGQEVTVRLLEANMETGRISLTMRESDETSREKQPKDSP--GSSDKSRA  940
             S+VKDV S+VSVGQEVTVRL+E N E  RISLTMRE D T++ +Q KD+P   SSDK R 
Sbjct  178   SYVKDVGSIVSVGQEVTVRLVEVNTEARRISLTMRERDSTNKLQQQKDAPSTASSDKPRP  237

Query  941   PKRTPQRNNQRRE---SKFVKGQDLEGTVKNLTRSGAFISLPEGEEGFLPTSEMADEGLG  1111
              +R   R +Q+++   SKFVKGQ LEGTVKNLTRSGAFISLPEGEEGFLP SE +D  L 
Sbjct  238   ARRNTPRPSQKKDVKSSKFVKGQVLEGTVKNLTRSGAFISLPEGEEGFLPKSEESD--LV  295

Query  1112  EIMGGSSLQVGQEVSVRVLRISRGQATLTMKKEEATEEVNSVLSQGVIHKATNPFALAFR  1291
              + G S LQVGQEVSV VLRI RGQ TLTMK+EE       V  +GV + ATN F LAFR
Sbjct  296   NMTGESLLQVGQEVSVTVLRIGRGQVTLTMKEEEDN----EVDEEGVDYVATNAFVLAFR  351

Query  1292  KNKEISAFLDQREE--------------------EVLAEKSEKDNNEAGVDISTVDD--T  1405
             KNK+I+AFLD+RE+                    E +++ +E + + +  D  +V D   
Sbjct  352   KNKDIAAFLDEREKVAEPVKPKTLVEVEKQVSQSETVSDVAEVEGHTSSTDEGSVSDPSA  411

Query  1406  LSETAEKDGEVMETINEDTTTTD--QLSEEPSATEDDSL  1516
             + ET E +  V E ++++ T +D  ++  +PS+T+++SL
Sbjct  412   VVETVEGETSV-EQVSQNETVSDVAEIEGQPSSTDEESL  449



>ref|XP_006573450.1| PREDICTED: enolase-phosphatase E1-like isoform X2 [Glycine max]
Length=959

 Score =   367 bits (943),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 234/459 (51%), Positives = 300/459 (65%), Gaps = 43/459 (9%)
 Frame = +2

Query  248   MAPVIPTTVNSISLTPCNILISRKNNLLTRCSVFQ---KPGRQTLSAQRYAIPFSTPVRL  418
             M PVIP ++ ++S+ P  I  +RKNN LTR ++ +   KPG    S+ R+ +P       
Sbjct  1     MNPVIPCSIGNVSIIPVFIYSTRKNNTLTRFNLSRSTVKPGS---SSWRFLLPSFVASGA  57

Query  419   FPHLRVGFDIQPKLRTPIVSSAETDVAVEE------ADSATVDKSPSGAPENSPVEsdas  580
             FP  +       K  T I S+ ETDV VEE       DS  +  +  G  E+S  +SDA+
Sbjct  58    FPQNKGIRSFHKKSSTSI-SATETDVTVEEPSPVADEDSGEITSNEVGISEDSSSKSDAN  116

Query  581   ptpapsrrsrparKSEMPPIKNEDLIPGASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNL  760
             P PA  RRSRPARKSEMPP+KNEDLIPGA+FTGKVKS+QPFGAFVD GAFTDGLVH+S L
Sbjct  117   PDPAKGRRSRPARKSEMPPVKNEDLIPGATFTGKVKSVQPFGAFVDIGAFTDGLVHISML  176

Query  761   SNSFVKDVTSVVSVGQEVTVRLLEANMETGRISLTMRESDETSREKQPKDSPGSSDKSRA  940
             S+S+VKDVTSVVSVGQEV V+L+E N ET RISL+MRE+ +T   KQ KD+P  ++K+  
Sbjct  177   SDSYVKDVTSVVSVGQEVKVKLIEVNTETQRISLSMRENADTG--KQRKDAPVKTEKAGP  234

Query  941   PKR-----TPQRNNQRRESKFVKGQDLEGTVKNLTRSGAFISLPEGEEGFLPTSEMADEG  1105
              KR     + +++N  + +KF  GQ L G+VKNL RSGAFISLPEGEEGFLP SE  D+G
Sbjct  235   GKRNSSKPSSKKDNVTKSTKFAIGQQLVGSVKNLARSGAFISLPEGEEGFLPVSEEPDDG  294

Query  1106  LGEIMGGSSLQVGQEVSVRVLRISRGQATLTMKKEEATEEVNSVLSQGVIHKATNPFALA  1285
                +MG ++L+VGQEV+VRVLRI+RGQ TLTMKKEE T  ++S  + GV+H ATNPF LA
Sbjct  295   FDNVMGNTTLEVGQEVNVRVLRITRGQVTLTMKKEEDTAGLDSTFNHGVVHVATNPFVLA  354

Query  1286  FRKNKEISAFLDQREEEVLAEKSEKDNNEAGVDISTVDDTLSETAEKDGEVMETINEDTT  1465
             FRKNK+I++FLD+R         EK  NE          T + T+E   E+  T+N+  T
Sbjct  355   FRKNKDIASFLDER---------EKTQNEVQ------KPTTASTSE---EIKGTVNQGET  396

Query  1466  TTD----QLSEEPSATEDDSLPITEDQLAEPEVSTTTTD  1570
               D    Q   E S   DD +P  ED ++E  V T+ T+
Sbjct  397   VLDVPDVQGEPESSKLTDDDVPSAEDDISE-NVGTSATN  434



>ref|XP_008783732.1| PREDICTED: uncharacterized protein LOC103702876 [Phoenix dactylifera]
 ref|XP_008783739.1| PREDICTED: uncharacterized protein LOC103702876 [Phoenix dactylifera]
 ref|XP_008783749.1| PREDICTED: uncharacterized protein LOC103702876 [Phoenix dactylifera]
Length=1153

 Score =   371 bits (952),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 220/448 (49%), Positives = 296/448 (66%), Gaps = 35/448 (8%)
 Frame = +2

Query  248   MAPVIPTTVNSISLTPCNILISRKNNLLTRCSVFQKPGRQTLSAQRYAIPFSTPVRLFPH  427
             M PVI  +V +I+L P      RK    TRC V  K  R T  +Q +     T +RLF  
Sbjct  1     MIPVINCSVGNITLLPGTTCGLRKEIQSTRCHVSGKYLRPTPLSQGFLFT-KTSLRLFRR  59

Query  428   LRVGFDIQPKLRTPIVSSAETDVAVEEADSATVDK----------SPSGAPENSPVEsda  577
                G+  +   R  I ++A TDV +EE D A  D+          S +   E++P  + A
Sbjct  60    YYSGYVSKHGSRVRIFAAAGTDVTIEEPDPAVSDEVADETSETAASSAETTEHAPA-NPA  118

Query  578   sptpapsrrsrparKSEMPPIKNEDLIPGASFTGKVKSIQPFGAFVDFGAFTDGLVHVSN  757
              P+ A S+R  P RKSEMPP+K+E+L+PGASF GKV+SIQPFGAF+DFGAFT+GLVHVS 
Sbjct  119   VPSTAKSKRPSPVRKSEMPPVKDEELVPGASFKGKVRSIQPFGAFIDFGAFTNGLVHVSR  178

Query  758   LSNSFVKDVTSVVSVGQEVTVRLLEANMETGRISLTMRESDETSREKQPKDSP--GSSDK  931
             +S+ +VKDV S VSVGQEVTVR++EAN E+GRISLTMR++DE  +++Q +++P  GS++K
Sbjct  179   MSDEYVKDVASFVSVGQEVTVRIVEANKESGRISLTMRDTDEPRKKQQTRETPADGSNNK  238

Query  932   SRAPKRTPQRNNQRRE-----SKFVKGQDLEGTVKNLTRSGAFISLPEGEEGFLPTSEMA  1096
              RA ++   R+NQ+ +     SKFVKGQ+L+GTVKN+TRSGAF+SLPEGEEGFLP SE +
Sbjct  239   PRAVRKNAARSNQKHDAVQKISKFVKGQNLDGTVKNVTRSGAFVSLPEGEEGFLPISEES  298

Query  1097  DEGLGEIMGGSSLQVGQEVSVRVLRISRGQATLTMKKEEATEEVNSVLSQGVIHKATNPF  1276
              EG G I+G SSLQVGQEV VRVLRI+RG+ TLTMKK+E  E++N  L+QGV+H ATNPF
Sbjct  299   -EGFGGILGNSSLQVGQEVKVRVLRITRGRVTLTMKKKEDVEKLNLQLNQGVVHVATNPF  357

Query  1277  ALAFRKNKEISAFLDQREE-----------EVLAEKSEKDNNEAGVDISTVDDTLSETAE  1423
              LAFRKNKEI+AFLD+++            + L +    D N A  D   VD  ++ + E
Sbjct  358   ELAFRKNKEIAAFLDEQDRAQKSSENLSMSKTLEQAGGYDENVASSDTLEVDGLMASSDE  417

Query  1424  KD----GEVMETINEDTTTTDQLSEEPS  1495
                    ++ E + ++  T ++L E+ S
Sbjct  418   NHVVGPSDLSEELEDEKGTVEELQEQAS  445



>ref|XP_006573449.1| PREDICTED: enolase-phosphatase E1-like isoform X1 [Glycine max]
Length=990

 Score =   367 bits (943),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 234/459 (51%), Positives = 300/459 (65%), Gaps = 43/459 (9%)
 Frame = +2

Query  248   MAPVIPTTVNSISLTPCNILISRKNNLLTRCSVFQ---KPGRQTLSAQRYAIPFSTPVRL  418
             M PVIP ++ ++S+ P  I  +RKNN LTR ++ +   KPG    S+ R+ +P       
Sbjct  1     MNPVIPCSIGNVSIIPVFIYSTRKNNTLTRFNLSRSTVKPGS---SSWRFLLPSFVASGA  57

Query  419   FPHLRVGFDIQPKLRTPIVSSAETDVAVEE------ADSATVDKSPSGAPENSPVEsdas  580
             FP  +       K  T I S+ ETDV VEE       DS  +  +  G  E+S  +SDA+
Sbjct  58    FPQNKGIRSFHKKSSTSI-SATETDVTVEEPSPVADEDSGEITSNEVGISEDSSSKSDAN  116

Query  581   ptpapsrrsrparKSEMPPIKNEDLIPGASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNL  760
             P PA  RRSRPARKSEMPP+KNEDLIPGA+FTGKVKS+QPFGAFVD GAFTDGLVH+S L
Sbjct  117   PDPAKGRRSRPARKSEMPPVKNEDLIPGATFTGKVKSVQPFGAFVDIGAFTDGLVHISML  176

Query  761   SNSFVKDVTSVVSVGQEVTVRLLEANMETGRISLTMRESDETSREKQPKDSPGSSDKSRA  940
             S+S+VKDVTSVVSVGQEV V+L+E N ET RISL+MRE+ +T   KQ KD+P  ++K+  
Sbjct  177   SDSYVKDVTSVVSVGQEVKVKLIEVNTETQRISLSMRENADTG--KQRKDAPVKTEKAGP  234

Query  941   PKR-----TPQRNNQRRESKFVKGQDLEGTVKNLTRSGAFISLPEGEEGFLPTSEMADEG  1105
              KR     + +++N  + +KF  GQ L G+VKNL RSGAFISLPEGEEGFLP SE  D+G
Sbjct  235   GKRNSSKPSSKKDNVTKSTKFAIGQQLVGSVKNLARSGAFISLPEGEEGFLPVSEEPDDG  294

Query  1106  LGEIMGGSSLQVGQEVSVRVLRISRGQATLTMKKEEATEEVNSVLSQGVIHKATNPFALA  1285
                +MG ++L+VGQEV+VRVLRI+RGQ TLTMKKEE T  ++S  + GV+H ATNPF LA
Sbjct  295   FDNVMGNTTLEVGQEVNVRVLRITRGQVTLTMKKEEDTAGLDSTFNHGVVHVATNPFVLA  354

Query  1286  FRKNKEISAFLDQREEEVLAEKSEKDNNEAGVDISTVDDTLSETAEKDGEVMETINEDTT  1465
             FRKNK+I++FLD+R         EK  NE          T + T+E   E+  T+N+  T
Sbjct  355   FRKNKDIASFLDER---------EKTQNEVQ------KPTTASTSE---EIKGTVNQGET  396

Query  1466  TTD----QLSEEPSATEDDSLPITEDQLAEPEVSTTTTD  1570
               D    Q   E S   DD +P  ED ++E  V T+ T+
Sbjct  397   VLDVPDVQGEPESSKLTDDDVPSAEDDISE-NVGTSATN  434



>dbj|BAE98916.1| hypothetical protein [Arabidopsis thaliana]
Length=631

 Score =   358 bits (918),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 201/378 (53%), Positives = 261/378 (69%), Gaps = 24/378 (6%)
 Frame = +2

Query  248   MAPVIPTTVNSISLTPCNILISRKNNLLTRCSVFQKPGRQTLSA-QRYAIPFSTPVRLFP  424
             MA + P+++++  L P      +K++   +CS  +K G+Q LS+ QR  +P ST +RLFP
Sbjct  1     MATITPSSISNAWLIPGASFTVKKSDCSIKCSFSRKAGKQILSSTQRLVLPLSTSLRLFP  60

Query  425   HLRVGFDIQPKLR---TPIVSSAE----TDVAVEEADSATVDKSPSGAPENSPVEsdasp  583
                  F + P  R   T +V++ E    T V  E+ ++   +KS + AP           
Sbjct  61    THGRQFVLHPHRRATGTDVVAAVEEQDSTPVVAEDKETVASEKSDAPAP-----------  109

Query  584   tpapsrrsrparKSEMPPIKNEDLIPGASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNLS  763
             T      +RP RKSEMP +KNE+L+PGA+FTGKV++IQPFGAFVDFGAFTDGLVHVS LS
Sbjct  110   TSQSRGTARPGRKSEMPAVKNEELVPGATFTGKVRAIQPFGAFVDFGAFTDGLVHVSQLS  169

Query  764   NSFVKDVTSVVSVGQEVTVRLLEANMETGRISLTMRESDE-TSREKQPKDSPGSSDKSRA  940
             ++FVKDV+SVV++GQEV VRL+EA++E+ RISLTMRE+D+   R+    D P S  K   
Sbjct  170   DNFVKDVSSVVTIGQEVKVRLVEADIESKRISLTMRENDDPPKRQSGGSDKPRSGGKRDG  229

Query  941   PKRTPQRNNQRRESKFVKGQDLEGTVKNLTRSGAFISLPEGEEGFLPTSEMADEGLGE-I  1117
              K   QR  +   SKF KGQ L+G VKNLTRSGAFI++ EGEEGFLPT+E AD+G+G  +
Sbjct  230   SKGGGQRKGEGFNSKFAKGQMLDGVVKNLTRSGAFITIGEGEEGFLPTAEEADDGIGSMM  289

Query  1118  MGGSSLQVGQEVSVRVLRISRGQATLTMKKEEATEEVNSVLSQGVIHKATNPFALAFRKN  1297
             MGGSSLQ GQEV VRVLRI+RG+ TLTM KEE   + +   +QGV+H ATNPF LAFRKN
Sbjct  290   MGGSSLQAGQEVKVRVLRIARGRVTLTM-KEEDDGKFDETTTQGVVHTATNPFMLAFRKN  348

Query  1298  KEISAFLDQREEEVLAEK  1351
             +EI+AFLD+REEE  AEK
Sbjct  349   EEIAAFLDKREEE--AEK  364



>gb|AAU93601.1| chloroplast polyprotein of elongation factor Ts precursor [Arabidopsis 
thaliana]
Length=710

 Score =   358 bits (918),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 201/378 (53%), Positives = 261/378 (69%), Gaps = 24/378 (6%)
 Frame = +2

Query  248   MAPVIPTTVNSISLTPCNILISRKNNLLTRCSVFQKPGRQTLSA-QRYAIPFSTPVRLFP  424
             MA + P+++++  L P      +K++   +CS  +K G+Q LS+ QR  +P ST +RLFP
Sbjct  1     MATITPSSISNAWLIPGASFTVKKSDCSIKCSFSRKAGKQILSSTQRLVLPLSTSLRLFP  60

Query  425   HLRVGFDIQPKLR---TPIVSSAE----TDVAVEEADSATVDKSPSGAPENSPVEsdasp  583
                  F + P  R   T +V++ E    T V  E+ ++   +KS + AP           
Sbjct  61    THGRQFVLHPHRRATGTDVVAAVEEQDSTPVVAEDKETVASEKSDAPAP-----------  109

Query  584   tpapsrrsrparKSEMPPIKNEDLIPGASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNLS  763
             T      +RP RKSEMP +KNE+L+PGA+FTGKV++IQPFGAFVDFGAFTDGLVHVS LS
Sbjct  110   TSQSRGTARPGRKSEMPAVKNEELVPGATFTGKVRAIQPFGAFVDFGAFTDGLVHVSQLS  169

Query  764   NSFVKDVTSVVSVGQEVTVRLLEANMETGRISLTMRESDE-TSREKQPKDSPGSSDKSRA  940
             ++FVKDV+SVV++GQEV VRL+EA++E+ RISLTMRE+D+   R+    D P S  K   
Sbjct  170   DNFVKDVSSVVTIGQEVKVRLVEADIESKRISLTMRENDDPPKRQSGGSDKPRSGGKRDG  229

Query  941   PKRTPQRNNQRRESKFVKGQDLEGTVKNLTRSGAFISLPEGEEGFLPTSEMADEGLGE-I  1117
              K   QR  +   SKF KGQ L+G VKNLTRSGAFI++ EGEEGFLPT+E AD+G+G  +
Sbjct  230   SKGGGQRKGEGFNSKFAKGQMLDGVVKNLTRSGAFITIGEGEEGFLPTAEEADDGIGSMM  289

Query  1118  MGGSSLQVGQEVSVRVLRISRGQATLTMKKEEATEEVNSVLSQGVIHKATNPFALAFRKN  1297
             MGGSSLQ GQEV VRVLRI+RG+ TLTM KEE   + +   +QGV+H ATNPF LAFRKN
Sbjct  290   MGGSSLQAGQEVKVRVLRIARGRVTLTM-KEEDDGKFDETTTQGVVHTATNPFMLAFRKN  348

Query  1298  KEISAFLDQREEEVLAEK  1351
             +EI+AFLD+REEE  AEK
Sbjct  349   EEIAAFLDKREEE--AEK  364



>ref|NP_001031743.1| elongation factor Ts family protein [Arabidopsis thaliana]
 gb|AEE85581.1| elongation factor Ts family protein [Arabidopsis thaliana]
Length=709

 Score =   358 bits (918),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 201/378 (53%), Positives = 261/378 (69%), Gaps = 24/378 (6%)
 Frame = +2

Query  248   MAPVIPTTVNSISLTPCNILISRKNNLLTRCSVFQKPGRQTLSA-QRYAIPFSTPVRLFP  424
             MA + P+++++  L P      +K++   +CS  +K G+Q LS+ QR  +P ST +RLFP
Sbjct  1     MATITPSSISNAWLIPGASFTVKKSDCSIKCSFSRKAGKQILSSTQRLVLPLSTSLRLFP  60

Query  425   HLRVGFDIQPKLR---TPIVSSAE----TDVAVEEADSATVDKSPSGAPENSPVEsdasp  583
                  F + P  R   T +V++ E    T V  E+ ++   +KS + AP           
Sbjct  61    THGRQFVLHPHRRATGTDVVAAVEEQDSTPVVAEDKETVASEKSDAPAP-----------  109

Query  584   tpapsrrsrparKSEMPPIKNEDLIPGASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNLS  763
             T      +RP RKSEMP +KNE+L+PGA+FTGKV++IQPFGAFVDFGAFTDGLVHVS LS
Sbjct  110   TSQSRGTARPGRKSEMPAVKNEELVPGATFTGKVRAIQPFGAFVDFGAFTDGLVHVSQLS  169

Query  764   NSFVKDVTSVVSVGQEVTVRLLEANMETGRISLTMRESDE-TSREKQPKDSPGSSDKSRA  940
             ++FVKDV+SVV++GQEV VRL+EA++E+ RISLTMRE+D+   R+    D P S  K   
Sbjct  170   DNFVKDVSSVVTIGQEVKVRLVEADIESKRISLTMRENDDPPKRQSGGSDKPRSGGKRDG  229

Query  941   PKRTPQRNNQRRESKFVKGQDLEGTVKNLTRSGAFISLPEGEEGFLPTSEMADEGLGE-I  1117
              K   QR  +   SKF KGQ L+G VKNLTRSGAFI++ EGEEGFLPT+E AD+G+G  +
Sbjct  230   SKGGGQRKGEGFNSKFAKGQMLDGVVKNLTRSGAFITIGEGEEGFLPTAEEADDGIGSMM  289

Query  1118  MGGSSLQVGQEVSVRVLRISRGQATLTMKKEEATEEVNSVLSQGVIHKATNPFALAFRKN  1297
             MGGSSLQ GQEV VRVLRI+RG+ TLTM KEE   + +   +QGV+H ATNPF LAFRKN
Sbjct  290   MGGSSLQAGQEVKVRVLRIARGRVTLTM-KEEDDGKFDETTTQGVVHTATNPFMLAFRKN  348

Query  1298  KEISAFLDQREEEVLAEK  1351
             +EI+AFLD+REEE  AEK
Sbjct  349   EEIAAFLDKREEE--AEK  364



>gb|KHN45619.1| Elongation factor Ts [Glycine soja]
Length=1135

 Score =   367 bits (942),  Expect = 8e-110, Method: Compositional matrix adjust.
 Identities = 211/376 (56%), Positives = 270/376 (72%), Gaps = 20/376 (5%)
 Frame = +2

Query  248   MAPVIPTTVNSISLTPCNILISRKNNLLTRCSVFQ---KPGRQTLSAQRYAIPFSTPVRL  418
             M PVIP ++ ++S+ P     +RKNN LTR ++ +   KPG    S+ R+ +P       
Sbjct  1     MNPVIPCSIGNVSIIPGFTYSTRKNNTLTRLNLSRSTVKPGS---SSWRFLLPSFVASGA  57

Query  419   FPHLRVGFDIQPKLRTPIVSSAETDVAVEE------ADSATVDKSPSGAPENSPVEsdas  580
             FP  +       K RT I S+ ETDVAVEE       DS  +  +  G  E+S  +SDA+
Sbjct  58    FPQNKRILSFHKKSRTSI-SATETDVAVEEPGPVADEDSGELPSNEVGVSEDSFTKSDAN  116

Query  581   ptpapsrrsrparKSEMPPIKNEDLIPGASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNL  760
             P PA +RRSRPARKSEMPP+KNEDL+PGA+FTGKVKS+QPFGAFVD GAFTDGLVH+S L
Sbjct  117   PDPAKARRSRPARKSEMPPVKNEDLLPGATFTGKVKSVQPFGAFVDIGAFTDGLVHISML  176

Query  761   SNSFVKDVTSVVSVGQEVTVRLLEANMETGRISLTMRESDETSREKQPKDSPGSSDKSRA  940
             S+S+VKDV SVVSVGQEV V+L+E N ET RISL+MRE+ +T   KQ KD+P  ++K+  
Sbjct  177   SDSYVKDVASVVSVGQEVKVKLIEVNTETQRISLSMRENVDTG--KQRKDAPTKTEKAGP  234

Query  941   PKR-----TPQRNNQRRESKFVKGQDLEGTVKNLTRSGAFISLPEGEEGFLPTSEMADEG  1105
              KR     +P+++N  + +KF  GQ L G+VKNL RSGAFISLPEGEEGFLP SE  D+G
Sbjct  235   GKRNNSKPSPKKDNVTKSTKFAIGQQLVGSVKNLARSGAFISLPEGEEGFLPVSEEPDDG  294

Query  1106  LGEIMGGSSLQVGQEVSVRVLRISRGQATLTMKKEEATEEVNSVLSQGVIHKATNPFALA  1285
                +MG ++L+VGQEV+VRVLRI+RGQ TLTMKKEE T  ++S  +QGV+H ATNPF +A
Sbjct  295   FDNVMGNTTLEVGQEVNVRVLRITRGQVTLTMKKEEDTAGLDSTFNQGVVHVATNPFVVA  354

Query  1286  FRKNKEISAFLDQREE  1333
             FRKNK+I++FLD RE+
Sbjct  355   FRKNKDIASFLDDREK  370



>ref|XP_003534213.1| PREDICTED: enolase-phosphatase E1-like [Glycine max]
Length=1135

 Score =   367 bits (942),  Expect = 9e-110, Method: Compositional matrix adjust.
 Identities = 211/376 (56%), Positives = 270/376 (72%), Gaps = 20/376 (5%)
 Frame = +2

Query  248   MAPVIPTTVNSISLTPCNILISRKNNLLTRCSVFQ---KPGRQTLSAQRYAIPFSTPVRL  418
             M PVIP ++ ++S+ P     +RKNN LTR ++ +   KPG    S+ R+ +P       
Sbjct  1     MNPVIPCSIGNVSIIPGFTYSTRKNNTLTRLNLSRSTVKPGS---SSWRFLLPSFVASGA  57

Query  419   FPHLRVGFDIQPKLRTPIVSSAETDVAVEE------ADSATVDKSPSGAPENSPVEsdas  580
             FP  +       K RT I S+ ETDVAVEE       DS  +  +  G  E+S  +SDA+
Sbjct  58    FPQNKRILSFHKKSRTSI-SATETDVAVEEPGPVADEDSGELPSNEVGVSEDSFTKSDAN  116

Query  581   ptpapsrrsrparKSEMPPIKNEDLIPGASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNL  760
             P PA +RRSRPARKSEMPP+KNEDL+PGA+FTGKVKS+QPFGAFVD GAFTDGLVH+S L
Sbjct  117   PDPAKARRSRPARKSEMPPVKNEDLLPGATFTGKVKSVQPFGAFVDIGAFTDGLVHISML  176

Query  761   SNSFVKDVTSVVSVGQEVTVRLLEANMETGRISLTMRESDETSREKQPKDSPGSSDKSRA  940
             S+S+VKDV SVVSVGQEV V+L+E N ET RISL+MRE+ +T   KQ KD+P  ++K+  
Sbjct  177   SDSYVKDVASVVSVGQEVKVKLIEVNTETQRISLSMRENVDTG--KQRKDAPTKTEKAGP  234

Query  941   PKR-----TPQRNNQRRESKFVKGQDLEGTVKNLTRSGAFISLPEGEEGFLPTSEMADEG  1105
              KR     +P+++N  + +KF  GQ L G+VKNL RSGAFISLPEGEEGFLP SE  D+G
Sbjct  235   GKRNNSKPSPKKDNVTKSTKFAIGQQLVGSVKNLARSGAFISLPEGEEGFLPVSEEPDDG  294

Query  1106  LGEIMGGSSLQVGQEVSVRVLRISRGQATLTMKKEEATEEVNSVLSQGVIHKATNPFALA  1285
                +MG ++L+VGQEV+VRVLRI+RGQ TLTMKKEE T  ++S  +QGV+H ATNPF +A
Sbjct  295   FDNVMGNTTLEVGQEVNVRVLRITRGQVTLTMKKEEDTAGLDSTFNQGVVHVATNPFVVA  354

Query  1286  FRKNKEISAFLDQREE  1333
             FRKNK+I++FLD RE+
Sbjct  355   FRKNKDIASFLDDREK  370



>gb|KHN40125.1| Elongation factor Ts [Glycine soja]
Length=1133

 Score =   367 bits (941),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 234/459 (51%), Positives = 300/459 (65%), Gaps = 43/459 (9%)
 Frame = +2

Query  248   MAPVIPTTVNSISLTPCNILISRKNNLLTRCSVFQ---KPGRQTLSAQRYAIPFSTPVRL  418
             M PVIP ++ ++S+ P  I  +RKNN LTR ++ +   KPG    S+ R+ +P       
Sbjct  1     MNPVIPCSIGNVSIIPVFIYSTRKNNTLTRFNLSRSTVKPGS---SSWRFLLPSFVASGA  57

Query  419   FPHLRVGFDIQPKLRTPIVSSAETDVAVEE------ADSATVDKSPSGAPENSPVEsdas  580
             FP  +       K  T I S+ ETDV VEE       DS  +  +  G  E+S  +SDA+
Sbjct  58    FPQNKGIRSFHKKSSTSI-SATETDVTVEEPSPVADEDSGEITSNEVGISEDSSSKSDAN  116

Query  581   ptpapsrrsrparKSEMPPIKNEDLIPGASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNL  760
             P PA  RRSRPARKSEMPP+KNEDLIPGA+FTGKVKS+QPFGAFVD GAFTDGLVH+S L
Sbjct  117   PDPAKGRRSRPARKSEMPPVKNEDLIPGATFTGKVKSVQPFGAFVDIGAFTDGLVHISML  176

Query  761   SNSFVKDVTSVVSVGQEVTVRLLEANMETGRISLTMRESDETSREKQPKDSPGSSDKSRA  940
             S+S+VKDVTSVVSVGQEV V+L+E N ET RISL+MRE+ +T   KQ KD+P  ++K+  
Sbjct  177   SDSYVKDVTSVVSVGQEVKVKLIEVNTETQRISLSMRENADTG--KQRKDAPVKTEKAGP  234

Query  941   PKR-----TPQRNNQRRESKFVKGQDLEGTVKNLTRSGAFISLPEGEEGFLPTSEMADEG  1105
              KR     + +++N  + +KF  GQ L G+VKNL RSGAFISLPEGEEGFLP SE  D+G
Sbjct  235   GKRNSSKPSSKKDNVTKSTKFAIGQQLVGSVKNLARSGAFISLPEGEEGFLPVSEEPDDG  294

Query  1106  LGEIMGGSSLQVGQEVSVRVLRISRGQATLTMKKEEATEEVNSVLSQGVIHKATNPFALA  1285
                +MG ++L+VGQEV+VRVLRI+RGQ TLTMKKEE T  ++S  + GV+H ATNPF LA
Sbjct  295   FDNVMGNTTLEVGQEVNVRVLRITRGQVTLTMKKEEDTAGLDSTFNHGVVHVATNPFVLA  354

Query  1286  FRKNKEISAFLDQREEEVLAEKSEKDNNEAGVDISTVDDTLSETAEKDGEVMETINEDTT  1465
             FRKNK+I++FLD+R         EK  NE          T + T+E   E+  T+N+  T
Sbjct  355   FRKNKDIASFLDER---------EKTQNEVQ------KPTTASTSE---EIKGTVNQGET  396

Query  1466  TTD----QLSEEPSATEDDSLPITEDQLAEPEVSTTTTD  1570
               D    Q   E S   DD +P  ED ++E  V T+ T+
Sbjct  397   VLDVPDVQGEPESSKLTDDDVPSAEDDISE-NVGTSATN  434



>ref|XP_010937186.1| PREDICTED: uncharacterized protein LOC105056625 [Elaeis guineensis]
Length=1150

 Score =   365 bits (938),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 203/379 (54%), Positives = 259/379 (68%), Gaps = 18/379 (5%)
 Frame = +2

Query  248   MAPVIPTTVNSISLTPCNILISRKNNLLTRCSVFQKPGRQTLSAQRYAIPFSTPVRLFPH  427
             M PVI  +V +I+L P +    RK    TRC V  K  R T  +Q +       +RLF  
Sbjct  1     MVPVINCSVGNITLLPGSTCGLRKEIQSTRCHVSGKYLRPTPLSQGFLFT-KMSLRLFQR  59

Query  428   LRVGFDIQPKLRTPIVSSAETDVAVEEADSATVDK--------SPSGAPENSPVEsdasp  583
                G+  +   R  I ++   D+ +EE D A  D+        + S A  N P  ++ + 
Sbjct  60    NYRGYVSKHGSRVRIFAAVGADITIEEPDPAVSDEVADETSETAASSAETNEPAPANPAV  119

Query  584   tpapsrrsrp-arKSEMPPIKNEDLIPGASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNL  760
             T     +     RKSEMPP+K+E+L+PGASF GKV+SIQPFGAFVDFGAFT+GLVHVS L
Sbjct  120   TSTAKSKRPRPVRKSEMPPVKDEELVPGASFKGKVRSIQPFGAFVDFGAFTNGLVHVSRL  179

Query  761   SNSFVKDVTSVVSVGQEVTVRLLEANMETGRISLTMRESDETSREKQPKDSP--GSSDKS  934
             S+ +VKDV S VSVGQEVTVR++E N E+GRISLTMR++DE  + +Q +D+P  GS++K 
Sbjct  180   SDEYVKDVASFVSVGQEVTVRIVEVNKESGRISLTMRDTDEPRKIQQRRDTPADGSNNKP  239

Query  935   RAPKRTPQRNNQR-----RESKFVKGQDLEGTVKNLTRSGAFISLPEGEEGFLPTSEMAD  1099
             RA ++   R+NQ+     + SKFVKGQ+L GTVKN+TRSGAF+SLP GEEGFLP SE + 
Sbjct  240   RAARKNAARSNQKDGAVQKISKFVKGQNLVGTVKNITRSGAFVSLPAGEEGFLPISEES-  298

Query  1100  EGLGEIMGGSSLQVGQEVSVRVLRISRGQATLTMKKEEATEEVNSVLSQGVIHKATNPFA  1279
             EG G I+G SSLQVGQEV VRVLR++RGQ TLTMKKEE  E +N  L+QGV+H ATNPF 
Sbjct  299   EGFGGILGNSSLQVGQEVKVRVLRVTRGQVTLTMKKEEDVERLNIQLNQGVVHVATNPFE  358

Query  1280  LAFRKNKEISAFLDQREEE  1336
             LAFRKNKEI+AFLD+RE +
Sbjct  359   LAFRKNKEIAAFLDERERD  377



>ref|XP_006282541.1| hypothetical protein CARUB_v10004081mg [Capsella rubella]
 gb|EOA15439.1| hypothetical protein CARUB_v10004081mg [Capsella rubella]
Length=953

 Score =   359 bits (922),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 209/382 (55%), Positives = 265/382 (69%), Gaps = 25/382 (7%)
 Frame = +2

Query  248   MAPVIPTTVNSISLTPCNILISRKNNLLTRCSVFQKPGRQTLSA-QRYAIPFSTPVRLFP  424
             MA + P+++++  L P      +KN+   +CS  +K G+Q LS+ QR  +P ST +RLFP
Sbjct  1     MATITPSSISNAWLIPGAAFSVKKNDCSIKCSFSRKDGKQNLSSTQRLVLPLSTSLRLFP  60

Query  425   HLRVGFDIQPKLRTPIVSSAETDV--AVEEADSATV--DKSPSGAPENSPVEsdasptpa  592
                  F + P  R     + ETDV  AVEE DS  V  D   + A E S      S T  
Sbjct  61    THGRQFVLHPHRR-----ATETDVVAAVEEQDSTPVAADVKETVASEKS---DAPSTTSQ  112

Query  593   psrrsrparKSEMPPIKNEDLIPGASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNLSNSF  772
                 +RP RKSEMP +KNE+L+PGA+FTGKV++IQPFGAFVDFGAFTDGLVHVS LS++F
Sbjct  113   SRGTARPGRKSEMPAVKNEELVPGATFTGKVRAIQPFGAFVDFGAFTDGLVHVSQLSDNF  172

Query  773   VKDVTSVVSVGQEVTVRLLEANMETGRISLTMRESDETSREKQPKDSPGSSDKSRA-PKR  949
             VKDV+SVV++GQEV VRL+EA++ET RISLTMRE+D+      PK   G SDK R+  KR
Sbjct  173   VKDVSSVVTIGQEVKVRLVEADIETKRISLTMRENDDP-----PKRQSGGSDKPRSGGKR  227

Query  950   TPQRNNQRR----ESKFVKGQDLEGTVKNLTRSGAFISLPEGEEGFLPTSEMADEGLGE-  1114
                +   R+     SKF KGQ L+G VKNLTRSGAFI++ EGEEGFLPT+E AD+G+G  
Sbjct  228   DGSKGGPRKGDGFNSKFSKGQMLDGVVKNLTRSGAFITIGEGEEGFLPTAEEADDGIGSM  287

Query  1115  IMGGSSLQVGQEVSVRVLRISRGQATLTMKKEEATEEVNSVLSQGVIHKATNPFALAFRK  1294
             +MGGSSL+ GQEV VRVLRI+RG+ TLTM KEE   + +   +QGV+H ATNPF LAFRK
Sbjct  288   MMGGSSLEAGQEVKVRVLRIARGRVTLTM-KEEDDGKFDETTTQGVVHTATNPFMLAFRK  346

Query  1295  NKEISAFLDQREEEVLAEKSEK  1360
             N+EI+AFLD+REEE   + +EK
Sbjct  347   NEEIAAFLDKREEEAEKQPAEK  368



>ref|XP_007152879.1| hypothetical protein PHAVU_004G168100g [Phaseolus vulgaris]
 gb|ESW24873.1| hypothetical protein PHAVU_004G168100g [Phaseolus vulgaris]
Length=1134

 Score =   361 bits (927),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 209/377 (55%), Positives = 268/377 (71%), Gaps = 20/377 (5%)
 Frame = +2

Query  248   MAPVIPTTVNSISLTPCNILISRKNNLLTRCSVFQ---KPGRQTLSAQRYAIPFSTPVRL  418
             M PVIP ++ ++ + P     SRKNN +TR ++ +   KPG    S+ R+ +P       
Sbjct  1     MNPVIPCSIGNVLIIPGFTYSSRKNNTITRLNLSRSTVKPGS---SSWRFLLPSFVASGT  57

Query  419   FPHLRVGFDIQPKLRTPIVSSAETDVAVEE-------ADSATVDKSPSGAPENSPVEsda  577
             FP  +       K RT I S+ ETDVA+EE        DS  +  +  G  E+S  +SDA
Sbjct  58    FPQSKSIRTFHKKSRTSI-SATETDVALEEPGPPVADEDSGEISSNEIGISEDSSSKSDA  116

Query  578   sptpapsrrsrparKSEMPPIKNEDLIPGASFTGKVKSIQPFGAFVDFGAFTDGLVHVSN  757
             +P  A ++RSRPARKSEMPP+KNEDLIPGASFTGKVKSIQPFGAFVDFGAFTDGLVH+S 
Sbjct  117   NPDTAKAKRSRPARKSEMPPVKNEDLIPGASFTGKVKSIQPFGAFVDFGAFTDGLVHISM  176

Query  758   LSNSFVKDVTSVVSVGQEVTVRLLEANMETGRISLTMRESDETSREKQPKDSPGSSDKSR  937
             LS+++VKD+ S VS+GQEV V+L+E N ET RISL+MRE+ +T   KQ K++P  ++K+ 
Sbjct  177   LSDNYVKDIASFVSIGQEVKVKLIEVNNETRRISLSMRENADTG-SKQRKEAPVKTEKTG  235

Query  938   APKRTPQRNNQRRE-----SKFVKGQDLEGTVKNLTRSGAFISLPEGEEGFLPTSEMADE  1102
             + KR+  + + R++     +KFV GQ L G+VKNL RSGAFISLPEGEEGFLP SE  D+
Sbjct  236   SGKRSTSKPSSRKDNVVKSTKFVLGQLLVGSVKNLARSGAFISLPEGEEGFLPVSEEPDD  295

Query  1103  GLGEIMGGSSLQVGQEVSVRVLRISRGQATLTMKKEEATEEVNSVLSQGVIHKATNPFAL  1282
             G   +MG + L+VGQEV+VRVLRI+RGQATLTMK EE T +  S  +QGVIH ATNPF L
Sbjct  296   GFDNVMGNTRLEVGQEVNVRVLRINRGQATLTMKTEEDTTDSASTFNQGVIHTATNPFML  355

Query  1283  AFRKNKEISAFLDQREE  1333
             AFRKNK+IS+FLD+RE+
Sbjct  356   AFRKNKDISSFLDEREK  372



>ref|NP_567820.1| elongation factor Ts family protein [Arabidopsis thaliana]
 emb|CAB43920.1| putative protein [Arabidopsis thaliana]
 emb|CAB79664.1| putative protein [Arabidopsis thaliana]
 gb|AAL10483.1| AT4g29060/F19B15_90 [Arabidopsis thaliana]
 gb|AEE85580.1| elongation factor Ts family protein [Arabidopsis thaliana]
Length=953

 Score =   358 bits (918),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 200/378 (53%), Positives = 261/378 (69%), Gaps = 24/378 (6%)
 Frame = +2

Query  248   MAPVIPTTVNSISLTPCNILISRKNNLLTRCSVFQKPGRQTLSA-QRYAIPFSTPVRLFP  424
             MA + P+++++  L P      +K++   +CS  +K G+Q LS+ QR  +P ST +RLFP
Sbjct  1     MATITPSSISNAWLIPGASFTVKKSDCSIKCSFSRKAGKQILSSTQRLVLPLSTSLRLFP  60

Query  425   HLRVGFDIQPKLR---TPIVSSAE----TDVAVEEADSATVDKSPSGAPENSPVEsdasp  583
                  F + P  R   T +V++ E    T V  E+ ++   +KS + AP +         
Sbjct  61    THGRQFVLHPHRRATGTDVVAAVEEQDSTPVVAEDKETVASEKSDAPAPTSQ--------  112

Query  584   tpapsrrsrparKSEMPPIKNEDLIPGASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNLS  763
                    +RP RKSEMP +KNE+L+PGA+FTGKV++IQPFGAFVDFGAFTDGLVHVS LS
Sbjct  113   ---SRGTARPGRKSEMPAVKNEELVPGATFTGKVRAIQPFGAFVDFGAFTDGLVHVSQLS  169

Query  764   NSFVKDVTSVVSVGQEVTVRLLEANMETGRISLTMRESDE-TSREKQPKDSPGSSDKSRA  940
             ++FVKDV+SVV++GQEV VRL+EA++E+ RISLTMRE+D+   R+    D P S  K   
Sbjct  170   DNFVKDVSSVVTIGQEVKVRLVEADIESKRISLTMRENDDPPKRQSGGSDKPRSGGKRDG  229

Query  941   PKRTPQRNNQRRESKFVKGQDLEGTVKNLTRSGAFISLPEGEEGFLPTSEMADEGLGE-I  1117
              K   QR  +   SKF KGQ L+G VKNLTRSGAFI++ EGEEGFLPT+E AD+G+G  +
Sbjct  230   SKGGGQRKGEGFNSKFAKGQMLDGVVKNLTRSGAFITIGEGEEGFLPTAEEADDGIGSMM  289

Query  1118  MGGSSLQVGQEVSVRVLRISRGQATLTMKKEEATEEVNSVLSQGVIHKATNPFALAFRKN  1297
             MGGSSLQ GQEV VRVLRI+RG+ TLTM KEE   + +   +QGV+H ATNPF LAFRKN
Sbjct  290   MGGSSLQAGQEVKVRVLRIARGRVTLTM-KEEDDGKFDETTTQGVVHTATNPFMLAFRKN  348

Query  1298  KEISAFLDQREEEVLAEK  1351
             +EI+AFLD+REEE  AEK
Sbjct  349   EEIAAFLDKREEE--AEK  364



>ref|XP_010433141.1| PREDICTED: uncharacterized protein LOC104717292 [Camelina sativa]
Length=980

 Score =   358 bits (919),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 214/409 (52%), Positives = 276/409 (67%), Gaps = 31/409 (8%)
 Frame = +2

Query  248   MAPVIPTTVNSISLTPCNIL-ISRKNNLLTRCSVFQKPGRQTLSA-QRYAIPFSTPVRLF  421
             MA + P+++++  L P     + +KN+   +CS   K G+Q LS+ QR  +P ST +RLF
Sbjct  1     MATITPSSISNAWLIPGAAFSVKKKNDCSIKCSFSGKAGKQILSSTQRLVLPLSTSLRLF  60

Query  422   PHLRVGFDIQPKLRTPIVSSAETDV--AVEEADSAT----VDKSPSGAPENSPVEsdasp  583
             P     F + P  R     +  TDV  AVEE DS T     D+  + A E S      + 
Sbjct  61    PTHGRQFVLHPHRR-----ATGTDVVAAVEEQDSTTPVVAADEKKTVASEKS---DAPAT  112

Query  584   tpapsrrsrparKSEMPPIKNEDLIPGASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNLS  763
             T  P   +RP RKSEMP +KNE+L+PGA+FTGKV++IQPFGAFVDFGAFTDGLVHVS LS
Sbjct  113   TSQPRGAARPGRKSEMPAVKNEELVPGATFTGKVRAIQPFGAFVDFGAFTDGLVHVSQLS  172

Query  764   NSFVKDVTSVVSVGQEVTVRLLEANMETGRISLTMRESDETSREKQPKDSPGSSDKSRA-  940
             ++FVKDV SVV++GQEV VRL+EA++ET RISL+MRE+D+      PK   G  DK R+ 
Sbjct  173   DTFVKDVASVVTIGQEVKVRLVEADIETKRISLSMRENDDP-----PKRQSGGGDKPRSG  227

Query  941   PKRTPQRNNQRR----ESKFVKGQDLEGTVKNLTRSGAFISLPEGEEGFLPTSEMADEGL  1108
              KR   +  QR+     SKF KGQ L+G VKNLTRSGAFI++ EGEEGFLPT+E AD+G+
Sbjct  228   GKRDGSKGGQRKGDGFNSKFAKGQMLDGVVKNLTRSGAFITIGEGEEGFLPTAEEADDGI  287

Query  1109  GE-IMGGSSLQVGQEVSVRVLRISRGQATLTMKKEEATEEVNSVLSQGVIHKATNPFALA  1285
             G  +MGGSSL+ GQEV VRVLRI+RG+ TLTM KEE   + +   +QGV+H ATNPF LA
Sbjct  288   GSMMMGGSSLEAGQEVKVRVLRIARGRVTLTM-KEENDGKFDETTTQGVVHTATNPFMLA  346

Query  1286  FRKNKEISAFLDQREEEVLAEKSEK---DNNEAGVDISTVDDTLSETAE  1423
             FRKN+EI+AFLD+REEE   + +EK      EA V    V+++ S +AE
Sbjct  347   FRKNEEIAAFLDKREEEAEKQPAEKPVEPEAEASVTTGEVEESSSASAE  395



>gb|EPS62273.1| hypothetical protein M569_12515, partial [Genlisea aurea]
Length=932

 Score =   357 bits (915),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 212/435 (49%), Positives = 285/435 (66%), Gaps = 44/435 (10%)
 Frame = +2

Query  308   ISRKNNLLTRCSVFQKPGRQTLSAQRYAIPFSTPVRLFPHLRVGFDIQPKLRTPIVSSAE  487
             + +KNN L +  + +KP    L +++  +P    ++ FP  R+ F +  +L+     ++E
Sbjct  6     LVKKNNFLVQYRLKRKP----LLSEKRMVPLPDALKSFP--RIQFRL-CRLQPLEAFASE  58

Query  488   TDVAVEEADSATVDKSPSGAPENSPVEsdasptpapsrrsrparKSEMPPIKNEDLIPGA  667
             TD+AVEE+  A + +S S +PE  P ES    T A  R      KSEMP +KNE+L+PG+
Sbjct  59    TDIAVEESSDADILQS-SVSPEKKPGESSEKQTRAKQRSR----KSEMPAVKNEELLPGS  113

Query  668   SFTGKVKSIQPFGAFVDFGAFTDGLVHVSNLSNSFVKDVTSVVSVGQEVTVRLLEANMET  847
             +F GKV+SIQPFGAFVDFGAFTDGLVHVS LS+SFVKDV SVVSVGQEV VRL+E NMET
Sbjct  114   TFIGKVRSIQPFGAFVDFGAFTDGLVHVSQLSDSFVKDVASVVSVGQEVKVRLVEVNMET  173

Query  848   GRISLTMRESDETS-REKQPKDSPGSSDKSRAPKR--TPQRNNQRRESKFVKGQDLEGTV  1018
              RISL+MRE+D+   +E+Q K+   + D+S  P+R   P+++  ++ SKF+KGQDL GTV
Sbjct  174   RRISLSMRENDDAGKKEQQQKEGSVNGDRSGPPRRRNAPRKDESKKTSKFLKGQDLVGTV  233

Query  1019  KNLTRSGAFISLPEGEEGFLPTSEMADEGLGEIMGG--SSLQVGQEVSVRVLRISRGQAT  1192
             KNL R+GAFISLP+GEEGFLPTSE  DEG   +MGG  SSL+V QEV+VRVLRISRG+ T
Sbjct  234   KNLVRAGAFISLPDGEEGFLPTSEQPDEGFVSMMGGGSSSLEVDQEVNVRVLRISRGKVT  293

Query  1193  LTMKKEEATEEVNSVLSQGVIHKATNPFALAFRKNKEISAFLDQREEEVLAEKSEKDNNE  1372
             LTMKKEE   E++S L+QGV+HKATNPF LAFR+++EIS+FLD R ++V  ++ + D   
Sbjct  294   LTMKKEEDGGELDSKLNQGVVHKATNPFVLAFRRSEEISSFLDGRRKDVEQQQQQAD---  350

Query  1373  AGVDISTVDDTLSETAEKDGEVMETINEDTTTTDQLSEEPSATEDDSLPITEDQLAEPEV  1552
                          E  E  G +   I+ ++  TD+ +EE    +D S           E+
Sbjct  351   -------------EYPELSGTIDSEISGESLMTDEPAEEAKEADDGS-----------EI  386

Query  1553  STTTTDQLSEEPSAI  1597
             S    D L   P  +
Sbjct  387   SGIAIDGLDSTPDIV  401



>ref|XP_010447895.1| PREDICTED: uncharacterized protein LOC104730431 [Camelina sativa]
Length=972

 Score =   356 bits (914),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 226/446 (51%), Positives = 293/446 (66%), Gaps = 35/446 (8%)
 Frame = +2

Query  248   MAPVIPTTVNSISLTPCNILISRKNNLLTRCSVFQKPGRQTLSA-QRYAIPFSTPVRLFP  424
             MA + P+++++  L P      +KN+   +CS   K G+Q LS+ QR  +P ST +RLFP
Sbjct  1     MATITPSSISNAWLIPGAAFSVKKNDCSIKCSFSGKAGKQILSSTQRLVLPLSTSLRLFP  60

Query  425   HLRVGFDIQPKLRTPIVSSAETDV--AVEEADSAT----VDKSPSGAPENSPVEsdaspt  586
                  F + P  R     +  TDV  AVEE DS T     D+  + A E S      + T
Sbjct  61    THGRHFVLHPHRR-----ATGTDVVAAVEEQDSTTPVVAADEKQTVASEKS---DAPATT  112

Query  587   papsrrsrparKSEMPPIKNEDLIPGASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNLSN  766
               P   +RP RKSEMP +KNE+L+PGA+FTGKV++IQPFGAFVDFGAFTDGLVHVS LS+
Sbjct  113   SQPRGGARPGRKSEMPAVKNEELVPGATFTGKVRAIQPFGAFVDFGAFTDGLVHVSQLSD  172

Query  767   SFVKDVTSVVSVGQEVTVRLLEANMETGRISLTMRESDETSREKQPKDSPGSSDKSRA-P  943
             +FVKDV SVV++GQEV VRL+EA++ET RISLTMRE+D+      PK   G  DK R+  
Sbjct  173   TFVKDVASVVTIGQEVKVRLVEADIETKRISLTMRENDDP-----PKRQSGGGDKPRSGG  227

Query  944   KRTPQRNNQRR----ESKFVKGQDLEGTVKNLTRSGAFISLPEGEEGFLPTSEMADEGLG  1111
             KR   +   R+     SKF KGQ L+G VKNLTRSGAFI++ EGEEGFLPT+E AD+G+G
Sbjct  228   KRDGSKGGPRKGDGFNSKFAKGQMLDGVVKNLTRSGAFITIGEGEEGFLPTAEEADDGIG  287

Query  1112  E-IMGGSSLQVGQEVSVRVLRISRGQATLTMKKEEATEEVNSVLSQGVIHKATNPFALAF  1288
               +MGGSSL+ GQEV VRVLRI+RG+ TLTM KEE   + +   +QGV+H ATNPF LAF
Sbjct  288   SMMMGGSSLEAGQEVKVRVLRIARGRVTLTM-KEENDGKFDETTTQGVVHTATNPFMLAF  346

Query  1289  RKNKEISAFLDQREEEVLAEKSEK---DNNEAGVDISTVDDTLSETAEKDGEVMETINED  1459
             RKN+EI+AFLD+REEE   + +EK      EA V    V+++ S +AE   E  E  + +
Sbjct  347   RKNEEIAAFLDKREEEAEKQPAEKPVEPEAEASVTTCVVEESPSVSAEVTSE--EVPSSE  404

Query  1460  TTTTDQLSEEPSATE-DDSLPITEDQ  1534
             T   ++  EE  AT+ +D LP  E+Q
Sbjct  405   TPKVEE--EEVIATKAEDELPEKEEQ  428



>ref|XP_010438354.1| PREDICTED: uncharacterized protein LOC104721969 [Camelina sativa]
Length=957

 Score =   356 bits (913),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 206/385 (54%), Positives = 265/385 (69%), Gaps = 28/385 (7%)
 Frame = +2

Query  248   MAPVIPTTVNSISLTPCNIL-ISRKNNLLTRCSVFQKPGRQTLSA-QRYAIPFSTPVRLF  421
             MA + P+++++  L P     + +KN+   +CS   + G+Q LS+ QR  +P ST +RLF
Sbjct  1     MATITPSSISNAWLIPGAAFNVKKKNDCSIKCSFSGRAGKQNLSSTQRLVLPLSTSLRLF  60

Query  422   PHLRVGFDIQPKLRTPIVSSAETDV--AVEEADSAT----VDKSPSGAPENSPVEsdasp  583
             P     F + P  R     +  TDV  AVEE DS T     D+  + A E S      + 
Sbjct  61    PTHGRQFVLHPHRR-----ATGTDVVAAVEEQDSTTPVVAADEKKTVASEKS---DAPAT  112

Query  584   tpapsrrsrparKSEMPPIKNEDLIPGASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNLS  763
             T  P   +RP RKSEMP +KNE+L+PGA+FTGKV++IQPFGAFVDFGAFTDGLVHVS LS
Sbjct  113   TSQPRGAARPGRKSEMPAVKNEELVPGATFTGKVRAIQPFGAFVDFGAFTDGLVHVSQLS  172

Query  764   NSFVKDVTSVVSVGQEVTVRLLEANMETGRISLTMRESDETSREKQPKDSPGSSDKSRA-  940
             ++FVKDV SVV++GQEV VRL+EA++ET RISL+MRE+D+      PK   G  DK R+ 
Sbjct  173   DTFVKDVASVVTIGQEVKVRLVEADIETKRISLSMRENDDP-----PKRQSGGGDKPRSG  227

Query  941   PKRTPQRNNQRR----ESKFVKGQDLEGTVKNLTRSGAFISLPEGEEGFLPTSEMADEGL  1108
              KR   +  QR+     SKF KGQ L+G VKNLTRSGAFI++ EGEEGFLPT+E AD+G+
Sbjct  228   GKRDGSKGGQRKGDGFNSKFAKGQMLDGVVKNLTRSGAFITIGEGEEGFLPTAEEADDGI  287

Query  1109  GE-IMGGSSLQVGQEVSVRVLRISRGQATLTMKKEEATEEVNSVLSQGVIHKATNPFALA  1285
             G  +MGGSSL+ GQEV VRVLRI+RG+ TLTM KEE   + +   +QGV+H ATNPF LA
Sbjct  288   GSMMMGGSSLEAGQEVKVRVLRIARGRVTLTM-KEENDGKFDETTTQGVVHTATNPFMLA  346

Query  1286  FRKNKEISAFLDQREEEVLAEKSEK  1360
             FRKN+EI+AFLD+REEE   + +EK
Sbjct  347   FRKNEEIAAFLDKREEEAEKQPAEK  371



>ref|XP_003620654.1| Elongation factor Ts [Medicago truncatula]
 gb|AES76872.1| elongation factor Ts protein [Medicago truncatula]
Length=1054

 Score =   356 bits (914),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 201/372 (54%), Positives = 266/372 (72%), Gaps = 15/372 (4%)
 Frame = +2

Query  248   MAPVIPTTVNSISLTPCNILISRKNNLLTRCSVFQKPGRQTLSAQRYAIPFSTPVRLFPH  427
             M P+I  +V + S+ P    ++RKNN LTR +  +   R   S +R+  P      +FP 
Sbjct  1     MNPIISCSVGNSSVIPGVAYLTRKNNSLTRLNFSRSSLRHGSSTRRFLFPSFVVNGVFPQ  60

Query  428   LRVGFDIQPKLRTPIVSSAETDVAVEEADSATVDK----SPS---GAPENSPVEsdaspt  586
              +  +  + K RT  +S+ ET+V+VE  DS   D+    SPS   G   +S  +SDA+  
Sbjct  61    NKRIYSYRKKSRT-FISATETEVSVEVQDSPVADEVSGESPSNEVGTSGDSSPKSDANTG  119

Query  587   papsrrsrparKSEMPPIKNEDLIPGASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNLSN  766
              A ++RSR ARKSEMPP+KNEDL+PGA+FTGKVKSIQPFGAFVDFGAFTDGLVH+S LS+
Sbjct  120   SAKAKRSRRARKSEMPPVKNEDLVPGAAFTGKVKSIQPFGAFVDFGAFTDGLVHISMLSD  179

Query  767   SFVKDVTSVVSVGQEVTVRLLEANMETGRISLTMRESDETSREKQPKDSPGSSDKSRAPK  946
             SFVKDV+SVVS+GQEVTV+++E N ET RISL+MRE+ +T +    +++P + +KS   +
Sbjct  180   SFVKDVSSVVSLGQEVTVKVIEVNAETKRISLSMRENTDTGK----RNAPNNDEKSGYGR  235

Query  947   RTPQRNNQRRE---SKFVKGQDLEGTVKNLTRSGAFISLPEGEEGFLPTSEMADEGLGEI  1117
             R   ++  R++   +KFV GQ+L+GTVKN+TRSG FISLPEGEEGFLP +E  D G G+I
Sbjct  236   RDSSKSGPRKDMKKTKFVVGQELQGTVKNMTRSGTFISLPEGEEGFLPLAEEDDGGFGKI  295

Query  1118  MGGSSLQVGQEVSVRVLRISRGQATLTMKKEEATEEVNSVLSQGVIHKATNPFALAFRKN  1297
             MG SSL++G+EVSVRVLRI+RGQATLTMKKE A  E++   +Q     ATNPF LAFR+N
Sbjct  296   MGKSSLEIGREVSVRVLRITRGQATLTMKKEGAAAELDIAYAQVGDDVATNPFVLAFRRN  355

Query  1298  KEISAFLDQREE  1333
             K+I+ FLDQRE+
Sbjct  356   KDIAKFLDQREK  367



>ref|XP_009402522.1| PREDICTED: uncharacterized protein LOC103986289 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009402523.1| PREDICTED: uncharacterized protein LOC103986289 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009402524.1| PREDICTED: uncharacterized protein LOC103986289 [Musa acuminata 
subsp. malaccensis]
Length=1117

 Score =   354 bits (909),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 225/480 (47%), Positives = 308/480 (64%), Gaps = 41/480 (9%)
 Frame = +2

Query  248   MAPVIPTTVNSISLTPCNILISRKNNLLTRCSVFQKPGRQTLSAQRYAIPFSTPVRLFPH  427
             M PVI  T+ +I+L P  +   RK   LTRC   +K  R   S+QR+ +P S+ +RL   
Sbjct  1     MTPVIHCTIGNITLVPRIVFSPRKEIHLTRCDTSEKDTRLK-SSQRFLLPHSS-LRLI-Q  57

Query  428   LRVGFDIQPKLRTPIVSSAETDVAVEEADSATVDKSPSGAPENSPVEsd---------as  580
             L      Q  +RT  V+   TD+ VEE +         G+ E      +          +
Sbjct  58    LHTSRFCQG-IRT--VADVGTDLTVEEPNPTVSGNVADGSSEAPSSSDESSEPGPPNPTT  114

Query  581   ptpapsrrsrparKSEMPPIKNEDLIPGASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNL  760
              + + ++R+RP RKSEMPP+K+E+++ GASF GKV+SIQPFG FVDFGA+TDGLVHVS +
Sbjct  115   TSSSKTKRTRPVRKSEMPPVKDEEIVTGASFIGKVRSIQPFGCFVDFGAYTDGLVHVSRM  174

Query  761   SNSFVKDVTSVVSVGQEVTVRLLEANMETGRISLTMRESDETSREKQPKDSPG-SSDKSR  937
             S+S+VKDV +VVS+GQEV VR++EAN ET RISLTMR++D+T++ +Q K+S   SS+K R
Sbjct  175   SDSYVKDVAAVVSIGQEVKVRIVEANKETRRISLTMRDTDDTAKIQQKKESTYESSEKPR  234

Query  938   APKRTPQRNNQRRE-----SKFVKGQDLEGTVKNLTRSGAFISLPEGEEGFLPTSEMADE  1102
               ++   R+NQ+RE     SKFVKGQ L+GTVKNLTRSGAF+SLP+GEEGFLP +E + E
Sbjct  235   PVRKNTSRSNQKREEKQKSSKFVKGQILDGTVKNLTRSGAFVSLPDGEEGFLPVAEES-E  293

Query  1103  GLGEIMGGSSLQVGQEVSVRVLRISRGQATLTMKKEEATEEVNSVLSQGVIHKATNPFAL  1282
             G G I+G SSLQVGQEV+VRVLRI+RGQ TLTMKKEE  E +N  L++GV+H ATNPF L
Sbjct  294   GFGGILGSSSLQVGQEVNVRVLRINRGQVTLTMKKEEDVEGLNMKLNKGVLHVATNPFEL  353

Query  1283  AFRKNKEISAFLDQRE----------------EEVL--AEKSEKDNNEAGVDISTVDDTL  1408
             AFRKNKEI++FLD+RE                +E+L  +  S  DN+ +  D   +D + 
Sbjct  354   AFRKNKEIASFLDERERTQKSLETMEQTVGEVDEILESSNTSVVDNSASSDDTQLIDSSD  413

Query  1409  SET-AEKDGEVMETINEDTTTTDQLSEEPSATEDDSLPITEDQLAEPEVSTTTTDQLSEE  1585
             S T A+ +  V E ++E+T   D +S     T ++   I +    E E S+   +Q S++
Sbjct  414   STTEADNEKSVAEVLHEETLPVDPVSNNLENTTEELSQIADIVAQEDEKSSKILNQSSQD  473



>ref|XP_004513015.1| PREDICTED: enolase-phosphatase E1-like isoform X2 [Cicer arietinum]
Length=1079

 Score =   351 bits (900),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 212/415 (51%), Positives = 281/415 (68%), Gaps = 25/415 (6%)
 Frame = +2

Query  248   MAPVIPTTVNSISLTPCNILISRKNNLLTRCSVFQKPGRQTLSAQRYAIPFSTPVRLFPH  427
             M P+I  +V + S+ P     +RKNN LTR +  +   +   S +R+ +P      +FP 
Sbjct  1     MNPIISCSVGNASIIPGVAYSTRKNNTLTRFNFSRSSLKHGSSTRRFLLPPFVVSGVFPQ  60

Query  428   LRVGFDIQPKLRTPIVSSAETDVAVEEADSATVDKSPSGAP--------ENSPVEsdasp  583
              +     +   RT  VS+ + +V VEE+ S   D+ PS +P        ++SP     + 
Sbjct  61    NKTICSYRKISRTS-VSATKIEVPVEESGSPVADEVPSESPSDEVGTSEDSSPKSDANTS  119

Query  584   tpapsrrsrparKSEMPPIKNEDLIPGASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNLS  763
             +    +RSRP RKS+MPP+KNEDLIPGA+FTGKV+SIQPFGAFVDFGAFTDGLVH+S LS
Sbjct  120   STKAVKRSRPPRKSDMPPVKNEDLIPGAAFTGKVRSIQPFGAFVDFGAFTDGLVHISMLS  179

Query  764   NSFVKDVTSVVSVGQEVTVRLLEANMETGRISLTMRESDETSREKQP------KDSPGSS  925
             +S+VKDV+SVVSVGQEV V+L+E N ET RISL+MRE+ +T ++++       K SPG  
Sbjct  180   DSYVKDVSSVVSVGQEVKVKLIEVNAETQRISLSMRENTDTGKQRKDGPINAEKASPGRR  239

Query  926   DKSRAPKRTPQRNNQRRESKFVKGQDLEGTVKNLTRSGAFISLPEGEEGFLPTSEMADEG  1105
             D S   K  P+R+  ++ +KFV GQ+L+GTVKN+TRSG FISLPEGEEGFLP SE  D+G
Sbjct  240   DSS---KSGPKRDGMKKNTKFVVGQELQGTVKNMTRSGTFISLPEGEEGFLPLSEEDDDG  296

Query  1106  LGEIMGGSSLQVGQEVSVRVLRISRGQATLTMKKEEATEEVNSVLS-QGVIHKATNPFAL  1282
              G IMG SSL+ GQE+SVRVLRI+RGQATLTMKKE A  E++  L+ QG +  ATNPF L
Sbjct  297   FGNIMGKSSLETGQEISVRVLRITRGQATLTMKKEGAVVELDKALAQQGGVDVATNPFVL  356

Query  1283  AFRKNKEISAFLDQREE---EVLAEKSEKDNNEAGVDISTVDDT---LSETAEKD  1429
             AFRKNK+ISAFLD+RE+   EV    + + + E+  D+   DD    L+++AE D
Sbjct  357   AFRKNKDISAFLDEREKIQSEVKKSSTTETSEESKGDVELTDDVSSALTDSAEVD  411



>ref|XP_004513014.1| PREDICTED: enolase-phosphatase E1-like isoform X1 [Cicer arietinum]
Length=1080

 Score =   351 bits (900),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 212/415 (51%), Positives = 281/415 (68%), Gaps = 25/415 (6%)
 Frame = +2

Query  248   MAPVIPTTVNSISLTPCNILISRKNNLLTRCSVFQKPGRQTLSAQRYAIPFSTPVRLFPH  427
             M P+I  +V + S+ P     +RKNN LTR +  +   +   S +R+ +P      +FP 
Sbjct  1     MNPIISCSVGNASIIPGVAYSTRKNNTLTRFNFSRSSLKHGSSTRRFLLPPFVVSGVFPQ  60

Query  428   LRVGFDIQPKLRTPIVSSAETDVAVEEADSATVDKSPSGAP--------ENSPVEsdasp  583
              +     +   RT  VS+ + +V VEE+ S   D+ PS +P        ++SP     + 
Sbjct  61    NKTICSYRKISRTS-VSATKIEVPVEESGSPVADEVPSESPSDEVGTSEDSSPKSDANTS  119

Query  584   tpapsrrsrparKSEMPPIKNEDLIPGASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNLS  763
             +    +RSRP RKS+MPP+KNEDLIPGA+FTGKV+SIQPFGAFVDFGAFTDGLVH+S LS
Sbjct  120   STKAVKRSRPPRKSDMPPVKNEDLIPGAAFTGKVRSIQPFGAFVDFGAFTDGLVHISMLS  179

Query  764   NSFVKDVTSVVSVGQEVTVRLLEANMETGRISLTMRESDETSREKQP------KDSPGSS  925
             +S+VKDV+SVVSVGQEV V+L+E N ET RISL+MRE+ +T ++++       K SPG  
Sbjct  180   DSYVKDVSSVVSVGQEVKVKLIEVNAETQRISLSMRENTDTGKQRKDGPINAEKASPGRR  239

Query  926   DKSRAPKRTPQRNNQRRESKFVKGQDLEGTVKNLTRSGAFISLPEGEEGFLPTSEMADEG  1105
             D S   K  P+R+  ++ +KFV GQ+L+GTVKN+TRSG FISLPEGEEGFLP SE  D+G
Sbjct  240   DSS---KSGPKRDGMKKNTKFVVGQELQGTVKNMTRSGTFISLPEGEEGFLPLSEEDDDG  296

Query  1106  LGEIMGGSSLQVGQEVSVRVLRISRGQATLTMKKEEATEEVNSVLS-QGVIHKATNPFAL  1282
              G IMG SSL+ GQE+SVRVLRI+RGQATLTMKKE A  E++  L+ QG +  ATNPF L
Sbjct  297   FGNIMGKSSLETGQEISVRVLRITRGQATLTMKKEGAVVELDKALAQQGGVDVATNPFVL  356

Query  1283  AFRKNKEISAFLDQREE---EVLAEKSEKDNNEAGVDISTVDDT---LSETAEKD  1429
             AFRKNK+ISAFLD+RE+   EV    + + + E+  D+   DD    L+++AE D
Sbjct  357   AFRKNKDISAFLDEREKIQSEVKKSSTTETSEESKGDVELTDDVSSALTDSAEVD  411



>ref|XP_006833408.1| hypothetical protein AMTR_s00109p00129480 [Amborella trichopoda]
 gb|ERM98686.1| hypothetical protein AMTR_s00109p00129480 [Amborella trichopoda]
Length=1164

 Score =   345 bits (885),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 209/388 (54%), Positives = 270/388 (70%), Gaps = 17/388 (4%)
 Frame = +2

Query  248   MAPVIPTTVNSISLTPCNILISRKNNLLTRCSVFQKPGRQTLSAQRY--AIPFSTPVRLF  421
             MAPV+P  + SI L P  +    +   L + +  Q     TL +QR+  + P S+  +LF
Sbjct  1     MAPVVPCPIGSIYLFPGAVFPLCREAHLRKSTSPQINRGATLLSQRFLNSKPISS--KLF  58

Query  422   PHLRVGFDIQPKLRTPIVSSAETDVAVEEADSATVDKSPSGAPENSP-VEsdasptpaps  598
                R G  ++   R  I ++  TDVAVEE +SA+  +  +    +   V  +     A +
Sbjct  59    HIERRGISLKQSSRLQISATTSTDVAVEEPNSASTSEDSTETSSSEASVTVEPPGPEAQT  118

Query  599   rrsrparKSEMPPIKNEDLIPGASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNLSNSFVK  778
             +R+RP RKSEMPP+K E+L PGA+FTGKV+SIQPFGAFVDFGAFTDGLVHVS LS+S+VK
Sbjct  119   KRTRPVRKSEMPPVKTEELTPGATFTGKVRSIQPFGAFVDFGAFTDGLVHVSRLSDSYVK  178

Query  779   DVTSVVSVGQEVTVRLLEANMETGRISLTMRESDETSREKQPKD--SPGSSDKSRAPKRT  952
             DV   V+VGQEV VR++EANMETGRISLTMRESD+T++ +Q +D  S  +SDK R  +R 
Sbjct  179   DVNGFVAVGQEVKVRIVEANMETGRISLTMRESDDTTKSQQMRDSSSSSTSDKPRPTRRN  238

Query  953   PQRNNQRRE-----SKFVKGQDLEGTVKNLTRSGAFISLPEGEEGFLPTSEMADEGLGEI  1117
             P ++NQRRE     SKF  GQ L+GTVKNL R+GAFISLPEGEEGFLPTSE ++     +
Sbjct  239   P-KSNQRRENAQKTSKFQTGQVLDGTVKNLNRAGAFISLPEGEEGFLPTSEESE--WFAV  295

Query  1118  MGGSSLQVGQEVSVRVLRISRGQATLTMKKEEAT-EEVNSVLSQGVIHKATNPFALAFRK  1294
             +G S +Q+GQEV VRVLRI+RGQ TLTMKKEE   +E N  L+QGV++ ATNPF LAFRK
Sbjct  296   LGSSEMQIGQEVKVRVLRITRGQVTLTMKKEEENMDEANLKLNQGVVYGATNPFELAFRK  355

Query  1295  NKEISAFLDQREE-EVLAEKSEKDNNEA  1375
             NK ISAFL++RE+ + L E+S+    EA
Sbjct  356   NKAISAFLEEREKAQSLVEESKSGPTEA  383



>ref|XP_009109054.1| PREDICTED: uncharacterized protein LOC103834730 [Brassica rapa]
Length=441

 Score =   317 bits (813),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 189/369 (51%), Positives = 244/369 (66%), Gaps = 25/369 (7%)
 Frame = +2

Query  248   MAPVIPTTVNSISLTPCNILISRKNNLLTRCSVFQKPGRQTL---SAQRYAIPFSTPVRL  418
             MA V P++++   L P      +KN+   +C  ++K G++     S+Q   +P ST ++L
Sbjct  1     MATVSPSSISKAGLIPGAAFTVKKNDYSFKCCFWRKAGQKHYIPSSSQTLVLPLSTSLKL  60

Query  419   FPHLRVGFDIQPKLRTPIVSSAETDVAVEEADSATVDKSPSGAPENSPVEsdasptpaps  598
             FP       + P  R+   +  +    VEE DS      P  A + +P            
Sbjct  61    FPTHGRQLVLNPH-RSRAATGTDVVATVEEQDSP----PPPVANDAAPT-----TISQSR  110

Query  599   rrsrparKSEMPPIKNEDLIPGASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNLSNSFVK  778
               SRP RKSEMP IKNE+L+ GA+FTGKV++IQPFGAFVDFGAFTDGLVHVS LS++FVK
Sbjct  111   GTSRPGRKSEMPSIKNEELVAGATFTGKVRAIQPFGAFVDFGAFTDGLVHVSQLSDTFVK  170

Query  779   DVTSVVSVGQEVTVRLLEANMETGRISLTMRESDETSREKQPKDSPGSSDKSRAPKRTPQ  958
             DV SVV++GQEV VRL+E ++E+ RISLTMRE+D+      PK  PG    S +  R   
Sbjct  171   DVASVVTIGQEVKVRLVEVDIESKRISLTMRENDD-----PPKRQPGGGGGSDSKPRGGG  225

Query  959   RNNQRRE----SKFVKGQDLEGTVKNLTRSGAFISLPEGEEGFLPTSEMADEGL--GEIM  1120
             + N  +E    SK+VKGQ L+GTVKNLTRSGAFI++ EGEEGFLPT+E AD+G+    + 
Sbjct  226   KRNASKEDGFSSKYVKGQMLDGTVKNLTRSGAFITIGEGEEGFLPTNEEADDGIGSMMMG  285

Query  1121  GGSSLQVGQEVSVRVLRISRGQATLTMKKEEATEEVNSVLSQGVIHKATNPFALAFRKNK  1300
             GGSSLQ GQEV VRVLRI+RG+ TLTM KEE   + +  LSQGV+H ATNPF LAFRKN+
Sbjct  286   GGSSLQAGQEVKVRVLRIARGRVTLTM-KEEDDGKFDETLSQGVVHTATNPFVLAFRKNE  344

Query  1301  EISAFLDQR  1327
             EI+AFLD+R
Sbjct  345   EIAAFLDKR  353



>emb|CDY14222.1| BnaA08g13530D [Brassica napus]
Length=443

 Score =   316 bits (810),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 190/368 (52%), Positives = 245/368 (67%), Gaps = 21/368 (6%)
 Frame = +2

Query  248   MAPVIPTTVNSISLTPCNILISRKNNLLTRCSVFQKPGRQTL--SAQRYAIPFSTPVRLF  421
             MA V  ++++   L P      +KN+   +C  ++  G++    SAQR  +P ST ++LF
Sbjct  1     MATVSLSSISKAWLIPGASFNVKKNDCSIKCCFWRNAGQKQTPSSAQRLVLPLSTSLKLF  60

Query  422   PHLRVGFDIQPKLRTPIVSSAETDVAVEEADSATVDKSPSGAPENSPVEsdasptpapsr  601
             P     F + P  R+   +  +    VEE DS     +   AP  +      + T     
Sbjct  61    PTHGKQFVLHPH-RSRAATGTDVVATVEEQDSPPPPVADDAAPTTT------TTTSQSRG  113

Query  602   rsrparKSEMPPIKNEDLIPGASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNLSNSFVKD  781
              SRP RKSEMP +KNE+L+ GA+FTGKV++IQPFGAFVDFGAFTDGLVHVS LS++FVKD
Sbjct  114   TSRPGRKSEMPSVKNEELVAGATFTGKVRAIQPFGAFVDFGAFTDGLVHVSQLSDTFVKD  173

Query  782   VTSVVSVGQEVTVRLLEANMETGRISLTMRESDETSREKQPKDSPGSSDKSRAPKRTPQR  961
             V SVV++GQEV VRL+E ++E+ RISLTMRE+D       PK  PG S  S +  R   +
Sbjct  174   VASVVTIGQEVKVRLVEVDIESKRISLTMREND-----GPPKRQPGGSGGSDSKPRGGGK  228

Query  962   NNQRRE----SKFVKGQDLEGTVKNLTRSGAFISLPEGEEGFLPTSEMADEGL--GEIMG  1123
              N  +E    SK+VKGQ L+GTVKNLTRSGAFI++ EGEEGFLPT+E AD+G+    + G
Sbjct  229   RNASKEDGFSSKYVKGQMLDGTVKNLTRSGAFITIGEGEEGFLPTNEEADDGIGSMMMGG  288

Query  1124  GSSLQVGQEVSVRVLRISRGQATLTMKKEEATEEVNSVLSQGVIHKATNPFALAFRKNKE  1303
             GSSLQ GQEV VRVLRI+RG+ TLTM KEE   + +  LSQGV+H ATNPF LAFRKN+E
Sbjct  289   GSSLQAGQEVKVRVLRIARGRVTLTM-KEEDDGKFDETLSQGVVHTATNPFVLAFRKNEE  347

Query  1304  ISAFLDQR  1327
             I+AFLD+R
Sbjct  348   IAAFLDKR  355



>emb|CDY35248.1| BnaA01g07830D [Brassica napus]
Length=956

 Score =   329 bits (844),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 199/376 (53%), Positives = 252/376 (67%), Gaps = 26/376 (7%)
 Frame = +2

Query  248   MAPVIPTTVNSISLTPCNILISRKNNLLTRCSVFQKPGRQTL-SAQRYAIPFSTPVRLFP  424
             MA V P++++   L P      +KN+   +C   +K G+Q   S QR  +P ST ++LFP
Sbjct  1     MATVTPSSISKPWLVPGAAFTVKKNDCSIKCCFSRKAGKQIPPSTQRLVLPLSTSLKLFP  60

Query  425   HLRVGFDIQPKLRTPIVSSAETDV---AVEEADSATV------DKSPSGAPENSPVEsda  577
                  F + P  RT   ++ ETDV   AVE  DS  V      DKS   AP  +P +S  
Sbjct  61    THGRHFVLHPH-RTR--ATTETDVVAAAVEGQDSPPVAETDANDKSEEAAP-AAPTQSRG  116

Query  578   sptpapsrrsrparKSEMPPIKNEDLIPGASFTGKVKSIQPFGAFVDFGAFTDGLVHVSN  757
             +  P          KSEMP +KNE+L+ GA+FTGKV++IQPFGAF+DFGAFTDGLVHVS 
Sbjct  117   TARPGR--------KSEMPAVKNEELVAGATFTGKVRAIQPFGAFIDFGAFTDGLVHVSQ  168

Query  758   LSNSFVKDVTSVVSVGQEVTVRLLEANMETGRISLTMRESDETSREKQPKDSPGSSDKSR  937
             LS++FVKDV SVVSVGQEV VRL+EA++E+ RISLTMR +D+  + +      G   K R
Sbjct  169   LSDTFVKDVASVVSVGQEVKVRLVEADIESKRISLTMRSNDDPPKRQSGGGGGGGDSKPR  228

Query  938   -APKRTPQRNNQRRESKFVKGQDLEGTVKNLTRSGAFISLPEGEEGFLPTSEMADEGL--  1108
                KR  Q+      SK+VKGQ L+GTVKN+TRSGAFI++ EGEEGFLPT+E AD+G+  
Sbjct  229   PGGKRGGQKKEDGFSSKYVKGQMLDGTVKNVTRSGAFITIGEGEEGFLPTNEEADDGIGS  288

Query  1109  GEIMGGSSLQVGQEVSVRVLRISRGQATLTMKKEEATEEVNSVLSQGVIHKATNPFALAF  1288
               + GGSSLQ GQEV VRVLRI+RG+ TLTM KEE   + +  LSQGV+H ATNPF LAF
Sbjct  289   MMMGGGSSLQAGQEVKVRVLRIARGRVTLTM-KEEDDGKFDETLSQGVVHTATNPFVLAF  347

Query  1289  RKNKEISAFLDQREEE  1336
             RKN+EI+AFLD+REEE
Sbjct  348   RKNEEIAAFLDKREEE  363



>ref|XP_009129019.1| PREDICTED: altered inheritance of mitochondria protein 21 [Brassica 
rapa]
Length=1009

 Score =   330 bits (845),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 204/396 (52%), Positives = 261/396 (66%), Gaps = 16/396 (4%)
 Frame = +2

Query  248   MAPVIPTTVNSISLTPCNILISRKNNLLTRCSVFQKPGRQTL-SAQRYAIPFSTPVRLFP  424
             MA V P++++   L P      +KN+   +C   +K G+Q   S QR  +P ST ++LFP
Sbjct  1     MATVTPSSISKPWLVPGAAFTVKKNDCSIKCCFSRKAGKQIPPSTQRLVLPLSTSLKLFP  60

Query  425   HLRVGFDIQPKLRTPIVSSAETDV---AVEEADSATVDKSPSGAPENSPVEsdasptpap  595
                  F + P  RT   ++ ETDV   AVE  DS  V    +G   N   E  A   P  
Sbjct  61    THGRHFVLHPH-RTR--ATTETDVVAAAVEGQDSPPV----AGTDANDKSEEAALAAPTT  113

Query  596   srrsrp-arKSEMPPIKNEDLIPGASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNLSNSF  772
             SR +    RKSEMP +KNE+L+ GA+FTGKV++IQPFGAF+DFGAFTDGLVHVS LS++F
Sbjct  114   SRGTARPGRKSEMPAVKNEELVAGATFTGKVRAIQPFGAFIDFGAFTDGLVHVSQLSDTF  173

Query  773   VKDVTSVVSVGQEVTVRLLEANMETGRISLTMRESDETSREKQPKDSPGSSDKSR-APKR  949
             VKDV SVVS+GQEV VRL+EA++E+ RISLTMR +D+  + +      G  +K R   KR
Sbjct  174   VKDVASVVSIGQEVKVRLVEADIESKRISLTMRSNDDPPKRQSGGGGGGGDNKPRPGGKR  233

Query  950   TPQRNNQRRESKFVKGQDLEGTVKNLTRSGAFISLPEGEEGFLPTSEMADEGL--GEIMG  1123
               Q+      SK+VKGQ L+GTVKNLTRSGAFI++ EGEEGFLPT+E AD+G+    + G
Sbjct  234   GGQKKEDGFSSKYVKGQMLDGTVKNLTRSGAFITIGEGEEGFLPTNEEADDGIGSMMMGG  293

Query  1124  GSSLQVGQEVSVRVLRISRGQATLTMKKEEATEEVNSVLSQGVIHKATNPFALAFRKNKE  1303
             GSSLQ GQEV VRVLRI+RG+ TLTM KEE   + +  LSQGV+H ATNPF LAFRKN+E
Sbjct  294   GSSLQAGQEVKVRVLRIARGRVTLTM-KEEDDGKFDETLSQGVVHTATNPFVLAFRKNEE  352

Query  1304  ISAFLDQREEEVLAEKSEKDNNEAGVDISTVDDTLS  1411
             I+AFLD+REEE          +E  +    VD++LS
Sbjct  353   IAAFLDKREEEAEKPVEPVKESEEAITSEKVDESLS  388



>emb|CDY06843.1| BnaC01g09420D [Brassica napus]
Length=947

 Score =   327 bits (839),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 204/404 (50%), Positives = 260/404 (64%), Gaps = 36/404 (9%)
 Frame = +2

Query  248   MAPVIPTTVNSISLTPCNILISRKNNLLTRCSVFQKPGRQTL-SAQRYAIPFSTPVRLFP  424
             MA V P++++   L P      +KN+   +C   +K G+    S QR  +P ST ++LFP
Sbjct  1     MATVTPSSISKPWLVPGAAFTVKKNDCSIKCCFSRKAGKHIPPSTQRLVLPLSTSLKLFP  60

Query  425   HLRVGFDIQPKLRTPIVSSAETDV---AVEEADSATV------DKSPSGAPENSPVEsda  577
                  F + P  RT   ++ ETD+   AVE  DS  V      DKS   AP  +P     
Sbjct  61    THGRHFVLHPH-RTR--ATTETDLVAAAVEGQDSPPVPETDANDKSDDSAPPAAPT----  113

Query  578   sptpapsrrsrparKSEMPPIKNEDLIPGASFTGKVKSIQPFGAFVDFGAFTDGLVHVSN  757
                      +RP RKSEMP +KNE+L+ GA+FTGKV++IQPFGAF+DFGAFTDGLVHVS 
Sbjct  114   -----SRGTARPGRKSEMPAVKNEELVAGATFTGKVRAIQPFGAFIDFGAFTDGLVHVSQ  168

Query  758   LSNSFVKDVTSVVSVGQEVTVRLLEANMETGRISLTMRESDETSREKQPKDSPGSSDKSR  937
             LS++FVKDV SVVS+GQEV VRL+EA++E  RISLTMR +D+      PK   G  D   
Sbjct  169   LSDTFVKDVASVVSIGQEVKVRLVEADIEAKRISLTMRSNDDP-----PKRQSGGGDNK-  222

Query  938   APKRTPQRNNQRRE----SKFVKGQDLEGTVKNLTRSGAFISLPEGEEGFLPTSEMADEG  1105
              P+   +R  Q++E    SK+VKGQ L+GTVKNLTRSGAFI++ EGEEGFLPT+E AD+G
Sbjct  223   -PRPGGKRGGQKKEDGFSSKYVKGQMLDGTVKNLTRSGAFITIGEGEEGFLPTNEEADDG  281

Query  1106  L--GEIMGGSSLQVGQEVSVRVLRISRGQATLTMKKEEATEEVNSVLSQGVIHKATNPFA  1279
             +    + GGSSLQ  QEV VRVLRI+RG+ TLTM KEE   + +  LSQGV+H ATNPF 
Sbjct  282   IGSMMMGGGSSLQAEQEVKVRVLRIARGRVTLTM-KEEDDGKFDETLSQGVVHTATNPFV  340

Query  1280  LAFRKNKEISAFLDQREEEVLAEKSEKDNNEAGVDISTVDDTLS  1411
             LAFRKN EI+AFLD+REEE          +E  +    VD++LS
Sbjct  341   LAFRKNVEIAAFLDKREEEAEKPVEPVKESEEAITSEKVDESLS  384



>ref|XP_006412882.1| hypothetical protein EUTSA_v10024316mg [Eutrema salsugineum]
 ref|XP_006412883.1| hypothetical protein EUTSA_v10024316mg [Eutrema salsugineum]
 ref|XP_006412884.1| hypothetical protein EUTSA_v10024316mg [Eutrema salsugineum]
 gb|ESQ54335.1| hypothetical protein EUTSA_v10024316mg [Eutrema salsugineum]
 gb|ESQ54336.1| hypothetical protein EUTSA_v10024316mg [Eutrema salsugineum]
 gb|ESQ54337.1| hypothetical protein EUTSA_v10024316mg [Eutrema salsugineum]
Length=979

 Score =   328 bits (840),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 200/384 (52%), Positives = 254/384 (66%), Gaps = 23/384 (6%)
 Frame = +2

Query  248   MAPVIPTTVNSISLTPCNILISRKNNLLTRCSVFQKPGRQTLSA-QRYAIPFSTPVRLFP  424
             MA +  ++++   L P      +KN+   +C   +K  +Q  S+ QR  +P ST + LFP
Sbjct  1     MATITSSSISKAWLIPGAAFTVKKNDCSIKCCFSRKACKQIPSSTQRLVLPLSTSLGLFP  60

Query  425   HLRVGFDIQPKLRTPIVSSAETDV-AVEEADSATV----DKSPSGAPENSPVEsdasptp  589
                  F + P        +  TDV AVEE DS  V     K  + A + S      + T 
Sbjct  61    THGRQFVLHPHRS----RATGTDVVAVEEQDSPPVADENSKGATDANDKSDAAPATTTTS  116

Query  590   apsrrsrparKSEMPPIKNEDLIPGASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNLSNS  769
                   RP RKSEMP +KNE+L+ GA+FTGKV++IQPFGAFVDFGAFTDGLVHVS LS++
Sbjct  117   QSRGAPRPGRKSEMPAVKNEELVAGATFTGKVRAIQPFGAFVDFGAFTDGLVHVSQLSDN  176

Query  770   FVKDVTSVVSVGQEVTVRLLEANMETGRISLTMRESDETSREKQPKDSPGSSDKSRA-PK  946
             FVKDV SVVSVGQEV VRL+EA++E  RISL+MRE+D+      PK + G  DK RA  K
Sbjct  177   FVKDVASVVSVGQEVKVRLVEADIEGKRISLSMRENDDP-----PKRNSGGGDKPRAGGK  231

Query  947   RTPQRNNQRRE----SKFVKGQDLEGTVKNLTRSGAFISLPEGEEGFLPTSEMADEGL--  1108
             R   +  Q++E    SKF KGQ L+GTVKNLTRSGAFI++ EGEEGFLPT+E AD+G+  
Sbjct  232   RNALKGGQKKEDGFSSKFAKGQMLDGTVKNLTRSGAFITIGEGEEGFLPTNEEADDGIGS  291

Query  1109  GEIMGGSSLQVGQEVSVRVLRISRGQATLTMKKEEATEEVNSVLSQGVIHKATNPFALAF  1288
               + GGSSL  GQEV VRVLRI+RG+ TLTM KEE   + +  L+QGV+H ATNPF LAF
Sbjct  292   MMMGGGSSLTAGQEVKVRVLRIARGRVTLTM-KEEDDGKFDETLTQGVVHTATNPFMLAF  350

Query  1289  RKNKEISAFLDQREEEVLAEKSEK  1360
             RKN+EI+AFLD+REEE   + +EK
Sbjct  351   RKNEEIAAFLDKREEEAEKQTAEK  374



>emb|CBI28033.3| unnamed protein product [Vitis vinifera]
Length=917

 Score =   293 bits (751),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 208/496 (42%), Positives = 260/496 (52%), Gaps = 122/496 (25%)
 Frame = +2

Query  248   MAPVIPTTVNSISLTPCNILISRKNNLLTRCSVFQKPGRQTLSAQRYAIPFSTPVRLFPH  427
             M PVIP+++++ISL       S KNN LTRC +  K  +QTLS QR+ +P ST VRLFP 
Sbjct  1     MTPVIPSSISNISLISGTAFTSNKNNCLTRCYLLGKSTKQTLSPQRFLLPLSTSVRLFPQ  60

Query  428   LRVGFDIQPKLRTPIVSSAETDVAVEEADSATVDKSPSGAPENSPVEsdasptpapsrrs  607
              R G  + P     I                   KS  G   + P             + 
Sbjct  61    YRSGCTLHPSEEPSI-------------------KSDGGVTSSQP-------------KR  88

Query  608   rparKSEMPPIKNEDLIPGASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNLSNSFVKDVT  787
                RKSEMPP+KNE+L+PGA+FTGKVKSIQPFGAF+DFGAFTDGLVHVS LS+S+VKDV 
Sbjct  89    ARPRKSEMPPVKNEELVPGATFTGKVKSIQPFGAFIDFGAFTDGLVHVSRLSDSYVKDVG  148

Query  788   SVVSVGQEVTVRLLEANMETGRISLTMRESDETSREKQPKDSPGSSDKSRAPKRTPQRNN  967
             ++VS+GQEV VRL+EAN ETGRISLTM E  +T                           
Sbjct  149   NIVSIGQEVKVRLVEANTETGRISLTMHEVKKT---------------------------  181

Query  968   QRRESKFVKGQDLEGTVKNLTRSGAFISLPEGEEGFLPTSEMADEGLGEIMGGSSLQVGQ  1147
                 SKFVKGQDLEGTVKNL R+GAFISLPEGEEGFLPTSE ADEG G +MGGSSLQV  
Sbjct  182   ----SKFVKGQDLEGTVKNLNRAGAFISLPEGEEGFLPTSEEADEGFGNLMGGSSLQV--  235

Query  1148  EVSVRVLRISRGQATLTMKKEEATEEVNSVLSQGVIHKATNPFALAF-------RKNKEI  1306
                                               V+H ATNPF LAF       + ++EI
Sbjct  236   ----------------------------------VVHTATNPFVLAFPEIPAIPKTSEEI  261

Query  1307  SAFLDQREE-----EVLAEKSEKDNNEAGVDISTVD--DTLSETAEKDGEVMETINEDTT  1465
                ++Q E      EV  + +  D     V  ++ D   T+ E A    EV+ +     +
Sbjct  262   EGKVNQAETVTDILEVQDQPASSDEKSVSVPSASGDAVQTIEEKAVVSSEVLAS-ERSIS  320

Query  1466  TTDQLSEEPSATEDDSLPITEDQLAEPEVSTTTTDQ-LSEEPSAINAAETNAQDETAAQL  1642
             T  Q+ EE SAT +    +  D  ++P  ST   DQ LS E       E +  D+T A++
Sbjct  321   TASQIIEEASATHE----VGSDAKSDP--STAIADQILSSESLVGKEVEESQSDDTIAKV  374

Query  1643  AEPEVSTTTIDQPSEE  1690
              E ++ T  I +P EE
Sbjct  375   -EVQIETPPIVEPVEE  389



>ref|XP_006584819.1| PREDICTED: rRNA biogenesis protein RRP5-like isoform X1 [Glycine 
max]
 ref|XP_006584820.1| PREDICTED: rRNA biogenesis protein RRP5-like isoform X2 [Glycine 
max]
 gb|KHN16619.1| 30S ribosomal protein S1 like [Glycine soja]
Length=263

 Score =   266 bits (680),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 144/232 (62%), Positives = 180/232 (78%), Gaps = 18/232 (8%)
 Frame = +2

Query  629   MPPIKNEDLIPGASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNLSNSFVKDVTSVVSVGQ  808
             M P+KNEDLIPGA+FTGKVKSIQ FGAF+DFG FTDGLVHVS LS+ +VKDV SVVSVGQ
Sbjct  1     MAPVKNEDLIPGATFTGKVKSIQLFGAFIDFGGFTDGLVHVSQLSDGYVKDVASVVSVGQ  60

Query  809   EVTVRLLEANMETGRISLTMRESDETSREKQPKDSPGSSDKSRAPKRTPQRNNQRRESKF  988
             EV V+L+E N ET RISL+MRE++  + +      PG           P+++  ++ +KF
Sbjct  61    EVKVKLIEVNTETQRISLSMRENNNDTVK------PG-----------PRKDEVKKNTKF  103

Query  989   VKGQDLEGTVKNLTRSGAFISLPEGEEGFLPTSEMADEGLGEIMGGSSLQVGQEVSVRVL  1168
             V+GQDL+GT+KNL RSG+FISLP+GEE FLP SE +DEG     G SSLQVGQ+VSV+VL
Sbjct  104   VEGQDLKGTLKNLARSGSFISLPDGEEEFLPISEESDEGFENFTGISSLQVGQQVSVQVL  163

Query  1169  RISRGQATLTMKKEEATEEVNSVLSQGVIHKATNPFALAFRKNKEISAFLDQ  1324
             RI+RGQ TLTMKKE+    ++S + QGV+H ATNPFALAFRKNK+I+ FL++
Sbjct  164   RINRGQLTLTMKKEDVA-ALDSEIGQGVVHVATNPFALAFRKNKDIATFLEE  214



>ref|NP_001131522.1| uncharacterized protein LOC100192861 [Zea mays]
Length=541

 Score =   264 bits (675),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 164/390 (42%), Positives = 234/390 (60%), Gaps = 39/390 (10%)
 Frame = +2

Query  248   MAPVIPTTVNSISLTPCNILISRKNNLLTRCSVFQKPGRQTLSAQRYAIPFSTPVRLFP-  424
             M P+   +V ++SL       + +   + R   FQ   R +    R A P  +P RL   
Sbjct  1     MTPLSHCSVGNVSLFHIGSYRTTREIQIRR---FQGSARYS----RVASP--SPRRLLQP  51

Query  425   ----HL-----RVGFDIQPKLRTPIVSSAETDVAVEEADSATVDKSPSGAPENSP-----  562
                 HL     R  +    + RT   ++  TDV VE+ + +  +++  G  E +P     
Sbjct  52    QTAFHLISIYKRRSWSSPQRPRTLSAATVGTDVTVEDLNPSPSEEASDGNSEAAPDAVDA  111

Query  563   ---VEsdasptpapsrrsrparKSEMPPIKNEDLIPGASFTGKVKSIQPFGAFVDFGAFT  733
                 E+      +  +  R  RKSEMPP+  EDL+PGASFTGKV SI+PFG FVD GAFT
Sbjct  112   SEQAEASTGQASSARKLGRNIRKSEMPPLNEEDLVPGASFTGKVMSIKPFGVFVDIGAFT  171

Query  734   DGLVHVSNLSNSFVKDVTSVVSVGQEVTVRLLEANMETGRISLTMRESDETSR--EKQPK  907
             +GLVH+S +S+ FVKD++S+ +VGQEV+VRLLEAN ET RISLTMRE D+  +  ++ PK
Sbjct  172   EGLVHISRVSDGFVKDISSLFTVGQEVSVRLLEANKETKRISLTMREGDDYVKPQKEMPK  231

Query  908   DSPGSSDKSRAPKRTPQRNNQRR------ESKFVKGQDLEGTVKNLTRSGAFISLPEGEE  1069
              + G    +  PK +P++  +R+      ESK+V GQ L GTVK+ TR+G F++LP+G E
Sbjct  232   AANGGRSATATPKSSPRQTRERQELKETLESKYVPGQSLNGTVKSTTRAGTFVTLPDGSE  291

Query  1070  GFLPTSEMADEGLGEIMGGSSLQVGQEVSVRVLRISRGQATLTMKKEEATEEVNSVLSQG  1249
             GFLP  E A   L  ++G S++++G+++ V+VL +++GQATLTMK  E  E+    L+  
Sbjct  292   GFLPREEEA-LALFTLIGQSAMEIGKQIRVKVLNVAQGQATLTMKGVEDDEDDLKTLNME  350

Query  1250  V---IHKATNPFALAFRKNKEISAFLDQRE  1330
             +     + TN F LAFR+NKEISAFLDQRE
Sbjct  351   LKRDWSRGTNAFELAFRRNKEISAFLDQRE  380



>gb|EMS52112.1| Elongation factor Ts [Triticum urartu]
Length=987

 Score =   273 bits (697),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 190/476 (40%), Positives = 286/476 (60%), Gaps = 27/476 (6%)
 Frame = +2

Query  248   MAPVIPTTVNSISLTPCNILISRKNNLLTRCSVFQKPGRQTLSAQRYAIPFSTPVRLFPH  427
             M PV+  +V +ISL         +   + R    ++  R T  ++   +   TP  L   
Sbjct  1     MTPVVHCSVGTISLFHIGSFRPSREIQIRRFRGSERYSRVTSPSRHGLLQPQTPFHLISM  60

Query  428   LRVGFD-IQPKLRTPIVSSAETDVAVEEADS---ATVDKSPSGAPENSPVEsdasptpap  595
              +  +     +LRT   ++  TDV VE + S    T D  P+ A       +  SP  +P
Sbjct  61    YKRSWSSANNRLRTLSAAAVGTDVTVEGSSSPAGETSDPPPAAAETTGQAVASKSPASSP  120

Query  596   srrsrparKSEMPPIKNEDLIPGASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNLSNSFV  775
              +  R  RKSEMPP+K+ DL+PGASFTGKV+SI+PFG FVD GAFT+GLVH+S +S+ FV
Sbjct  121   PKLGRNPRKSEMPPLKDGDLVPGASFTGKVRSIKPFGVFVDIGAFTEGLVHISRVSDGFV  180

Query  776   KDVTSVVSVGQEVTVRLLEANMETGRISLTMRESDETSREKQPKDSPGSSDKSRAPKRTP  955
             +D++++ +VGQEV+V+L+E N ET RISLTMR   +  +E     S G S  + AP+ +P
Sbjct  181   EDISTLFTVGQEVSVKLVEVNKETRRISLTMRTGGDYVKEAPTAPSGGRSPTAAAPRSSP  240

Query  956   QRNNQRR---ESKFVKGQDLEGTVKNLTRSGAFISLPEGEEGFLPTSEMADEGLGEIMGG  1126
             ++    +   E+K+ +GQ L GTVKN TR+G+F++LP+GEEGFLP  E A   L  ++G 
Sbjct  241   RQTKDFKKIDEAKYTRGQSLTGTVKNSTRTGSFVTLPDGEEGFLPREEEA-AALFTLIGH  299

Query  1127  SSLQVGQEVSVRVLRISRGQATLTMKKEEATEE----VNSVLSQGVIHKATNPFALAFRK  1294
             S+L+VGQEV+V+VL ++RGQ TLTMK  E  ++    +N+ L QG   + TN F LAFR+
Sbjct  300   SALEVGQEVTVKVLNVARGQVTLTMKGGEDDDDELSSLNTNLKQG-WSRGTNAFELAFRR  358

Query  1295  NKEISAFLDQREE----EVLAE-KSEKDNNEAGVDISTVDDTLSETAEKDGEVMETINED  1459
             +KEISAFLDQRE+    EV  E ++E   + +GV+ STVDD L E   +    +E+  ED
Sbjct  359   SKEISAFLDQREKVTAPEVKTEVETETSVSTSGVE-STVDDKLVEPPTE----IES-KED  412

Query  1460  TTTTDQLSEEPSATEDDSLPITEDQLAEPEVSTTTTDQLSEEPSAINAAETNAQDE  1627
             ++ T+ ++      E  ++ +TE +  E + ++T     + EP  ++A E  +++E
Sbjct  413   SSLTEAVT---GVVEPPTVSVTEVESKEEDSASTEAVTGAVEPPTVSATEVESKEE  465



>ref|XP_003570661.1| PREDICTED: uncharacterized protein LOC100836461 [Brachypodium 
distachyon]
Length=962

 Score =   269 bits (688),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 193/504 (38%), Positives = 286/504 (57%), Gaps = 52/504 (10%)
 Frame = +2

Query  248   MAPVIPTTVNSISLTPCNILISRKNNLLTRCSVFQKPGRQTLSAQRYAIPFSTPVRLFPH  427
             M PV+  +V SISL       S + +  TR   F+   R + +  R   P +    +  H
Sbjct  1     MTPVVHCSVGSISLFHIG---SFRPSRETR---FRASQRYSRAHHRLLQPHTAFNLISIH  54

Query  428   LRVGFDIQPKLRTPIVSSAETDVAVEEADSATVDKSPSGAPENSPVEsdasptpapsrrs  607
              R  +    +LRT   ++ ETDVAVE +  +   ++  G+ E +   + +  + AP    
Sbjct  55    KR-SWSSANRLRTLSAAAVETDVAVEGSSPSLSGETSDGSSEAAA-PATSPASSAPKPGR  112

Query  608   rparKSEMPPIKNEDLIPGASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNLSNSFVKDVT  787
                RKSEMPP+K++DL+PGASFTGKV+SI+PFG FVD GA+T+GLVH+S +S+ FV+D++
Sbjct  113   GGTRKSEMPPLKDDDLVPGASFTGKVRSIKPFGVFVDIGAYTEGLVHISRVSDGFVEDIS  172

Query  788   SVVSVGQEVTVRLLEANMETGRISLTMRESDETSREKQPKDSPGSSDKSRAPKRTPQRNN  967
             ++ +VGQEV+V+L+EAN +T RISLTMR   +  +E     S G +  + AP+ +P++  
Sbjct  173   TLFTVGQEVSVKLVEANKQTRRISLTMRTGGDYVKEAPKAASSGGNPTAAAPRSSPRQKK  232

Query  968   QRR---ESKFVKGQDLEGTVKNLTRSGAFISLPEGEEGFLPTSEMADEGLGEIMGGSSLQ  1138
               +   E+K+ +GQ L GTVKN TR+G+F++LP+G+EGFLP  E A   L  ++G S+L+
Sbjct  233   DFKKIDEAKYARGQSLTGTVKNTTRTGSFVTLPDGDEGFLPREEEA-AALFTLIGHSALE  291

Query  1139  VGQEVSVRVLRISRGQATLTMKKEEATEE----VNSVLSQGVIHKATNPFALAFRKNKEI  1306
             VGQ+V V+VL +SRGQ  LTMK  E  E+    +N+ L +G   + TN F LAFR++KEI
Sbjct  292   VGQQVEVKVLNVSRGQVNLTMKGGEDDEDELVSLNTDLKRG-WSRGTNAFELAFRRSKEI  350

Query  1307  SAFLDQREEEVLAEKSEKDNNEAGVDISTVDDTLSETAEKDGEVMETINEDTTTTDQLSE  1486
             SAFLDQRE   + E             +TVD  +      D E   +  E   T   +  
Sbjct  351   SAFLDQRETITVPEAQ-----------TTVDTGVESEQSLDKETEASKAESVETESSV--  397

Query  1487  EPSATEDDSLPITEDQLAEPEVSTTTTDQLSEEPSAINAAETNAQD------ETAAQL--  1642
                 +EDDS  I +D+L EP +S T      E+ S+  A     +D      ET A+L  
Sbjct  398   --VTSEDDS--IVDDKLIEP-LSATEVKSKEEDSSSTEAVTGTIEDITPVDEETGAELSS  452

Query  1643  -AEPEVSTTT--------IDQPSE  1687
              A  EV++ +        +D+P E
Sbjct  453   NAAAEVTSVSSVPEAEVKLDEPQE  476



>ref|XP_004962824.1| PREDICTED: uncharacterized protein LOC101759704 [Setaria italica]
Length=988

 Score =   269 bits (688),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 173/414 (42%), Positives = 243/414 (59%), Gaps = 43/414 (10%)
 Frame = +2

Query  248   MAPVIPTTVNSISLTPCNILISRKNNLLTRCSVFQKPGRQTLSAQRYAIPFSTPVRLFP-  424
             M PVI  +V +ISL     + + +   + R   FQ     +    R A P  +P RL   
Sbjct  1     MTPVIHCSVGNISLFHIGSIRTSREIQIRR---FQG----STGYSRVASP--SPRRLLQP  51

Query  425   ----HL-----RVGFDIQPKLRTPIVSSAETDVAVE--------EADSATVDKSPSGAPE  553
                 HL     R  +    + RT   ++  TDV VE        EA     + +P     
Sbjct  52    QTAFHLISIYKRRSWSSAQRPRTLSAATVGTDVTVEDQNPSPSGEASDEASEAAPDAVEA  111

Query  554   NSPVEsdasptpapsrrsrparKSEMPPIKNEDLIPGASFTGKVKSIQPFGAFVDFGAFT  733
             +   E+      +  +  R  RKSEMPP+ +EDL+PGASFTGKV+SI+PFG FVD GAFT
Sbjct  112   SEQGEASTDQASSARKSGRNIRKSEMPPLTDEDLVPGASFTGKVRSIKPFGVFVDIGAFT  171

Query  734   DGLVHVSNLSNSFVKDVTSVVSVGQEVTVRLLEANMETGRISLTMRESDETSREKQ--PK  907
             +GLVH+S +S+ FVKD++S+ +VGQEV+VRLLEAN ETGRISLTMRE D+  + K+  PK
Sbjct  172   EGLVHISRVSDGFVKDISSLFTVGQEVSVRLLEANKETGRISLTMREGDDYVKPKKEAPK  231

Query  908   DSPGSSDKSRAPKRTPQRNNQRR------ESKFVKGQDLEGTVKNLTRSGAFISLPEGEE  1069
                     +  P+ +P++  +R+      ESK+  GQ L+GTVK+ TR+G F++LP+G E
Sbjct  232   AESNGRSATATPRSSPRQTKERQEAKATGESKYAPGQSLKGTVKSTTRAGTFVTLPDGSE  291

Query  1070  GFLPTSEMADEGLGEIMGGSSLQVGQEVSVRVLRISRGQATLTMKKEEATEEVNSVLSQG  1249
             GFLP  E A   L  ++G S+++VG+++ V+VL +++GQATLTMK  E  E+    L+  
Sbjct  292   GFLPREEEA-VALFTLIGQSAMEVGKQIRVKVLNVAQGQATLTMKDLEDDEDDLQTLNME  350

Query  1250  V---IHKATNPFALAFRKNKEISAFLDQREEEVLAEKSEKDNNEAGVDISTVDD  1402
             +     + TN F LAFR+NKEISAFLDQRE+  + E     +  AGV + TV D
Sbjct  351   LKRDWSRGTNAFELAFRRNKEISAFLDQREKTKVPEV----HAAAGVAVDTVVD  400



>ref|XP_006664084.1| PREDICTED: mucin-22-like [Oryza brachyantha]
Length=1140

 Score =   270 bits (689),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 165/384 (43%), Positives = 243/384 (63%), Gaps = 29/384 (8%)
 Frame = +2

Query  248   MAPVIPTTVNSISL------TPCNILISRKNNLLTRCSVFQKPGRQTLSAQRYAIPFSTP  409
             M PV+  +V +ISL       P + +  R+ +   R S    P R+ L   + A      
Sbjct  1     MTPVVHCSVGNISLFHIGSFRPSHEIQIRRFHSTERYSRVPSPSRRRLLQPQRAFNL---  57

Query  410   VRLFPHLRVGFDIQPKLRTPIVSSAETDVAVEEADSATVDKSPSGAPENSPV-----Esd  574
               +  + R  +    + RT   ++  TDVAVE+ +     ++   + E++P      E  
Sbjct  58    --ISIYKRSSWSSARRPRTLSAATVGTDVAVEDPNPPPSGETSEESSEDAPATTEASEQA  115

Query  575   asptpapsrrsrparKSEMPPIKNEDLIPGASFTGKVKSIQPFGAFVDFGAFTDGLVHVS  754
              + T +  +  R  RKSEMP + +EDL+PGASFTGKV+SI+PFG FVD GAFT+GLVH+S
Sbjct  116   EASTSSTPKAGRNIRKSEMPALNDEDLVPGASFTGKVRSIKPFGVFVDIGAFTEGLVHIS  175

Query  755   NLSNSFVKDVTSVVSVGQEVTVRLLEANMETGRISLTMRESDETSREK--QPKDSPG---  919
              +S+ FVKD++++ ++GQEV+VRL+EAN ETGRISLTMR   +  + K   PK + G   
Sbjct  176   RVSDGFVKDISTLFTIGQEVSVRLVEANKETGRISLTMRTGGDYVKPKTEAPKAASGGRN  235

Query  920   -SSDKSR-APKRTPQRNNQRRESKFVKGQDLEGTVKNLTRSGAFISLPEGEEGFLPTSEM  1093
              ++  SR +P++T +R++ + E+ +V+GQ L GTVK+ TRSG+F++LP+G EGFLP  E 
Sbjct  236   TTATASRGSPRQTRERDDAKSETNYVQGQFLNGTVKSTTRSGSFVTLPDGSEGFLPREEE  295

Query  1094  ADEGLGEIMGGSSLQVGQEVSVRVLRISRGQATLTMKKEEATEE----VNSVLSQGVIHK  1261
             A   L  ++G S+L+VGQ+V V+VL ++RGQ TLTMK+ E  E+    +N+ L QG   +
Sbjct  296   A-VALFTLIGHSALEVGQQVRVKVLNVARGQVTLTMKEGEDDEDDLSSLNTELKQG-WSR  353

Query  1262  ATNPFALAFRKNKEISAFLDQREE  1333
              TN F LAFR+NKEIS+FLDQRE+
Sbjct  354   GTNAFELAFRRNKEISSFLDQREK  377



>ref|NP_001066956.1| Os12g0541500 [Oryza sativa Japonica Group]
 gb|ABA99456.1| Elongation factor TS family protein, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF29975.1| Os12g0541500 [Oryza sativa Japonica Group]
 gb|EAY83405.1| hypothetical protein OsI_38621 [Oryza sativa Indica Group]
 gb|EAZ20768.1| hypothetical protein OsJ_36392 [Oryza sativa Japonica Group]
Length=1123

 Score =   269 bits (688),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 224/606 (37%), Positives = 325/606 (54%), Gaps = 101/606 (17%)
 Frame = +2

Query  248   MAPVIPTTVNSISL------TPCNILISRKNNLLTRCSVFQKPGRQTLSAQRYAIPFSTP  409
             M PV+  +V +ISL       P + +  R+     R S  + P R+ L  QR     S  
Sbjct  1     MTPVVHCSVGNISLFHIGSFRPSHEIQIRRFRSTERYS--RVPSRRLLQPQRAFNLISI-  57

Query  410   VRLFPHLRVGFDIQPKLRTPIVSSAETDVAVEEAD---------SATVDKSPSGAPENSP  562
                  + R  +    + RT   ++  TDV VE+ +          ++ D +P  A  +  
Sbjct  58    -----YKRSSWSSARRPRTLSAATVGTDVTVEDPNPPPSGETSEESSEDTAPDTAEAS--  110

Query  563   VEsdasptpapsrrsrparKSEMPPIKNEDLIPGASFTGKVKSIQPFGAFVDFGAFTDGL  742
              E   + T +  +  R  RKSEMPP+ +EDL+PGASFTGKV+SI+PFG FVD GAFT+GL
Sbjct  111   -EQAEASTSSIPKAGRNIRKSEMPPLNDEDLVPGASFTGKVRSIKPFGVFVDIGAFTEGL  169

Query  743   VHVSNLSNSFVKDVTSVVSVGQEVTVRLLEANMETGRISLTMRESDETSREK--QPKDSP  916
             VH+S +S+ FVKD++S+ +VGQEV+VRL+EAN ETGRISLTMR   +  + K   PK + 
Sbjct  170   VHISRVSDGFVKDISSLFTVGQEVSVRLVEANKETGRISLTMRTGGDYVKPKTETPKAAS  229

Query  917   GSSDKSRAPKR-TPQRNNQRRESK------FVKGQDLEGTVKNLTRSGAFISLPEGEEGF  1075
             G  + +    R +P++  +R E+K      +V+GQ L+G VKN TR+G+F++LP+G EGF
Sbjct  230   GGRNTTATTSRGSPRQTRERDEAKSMGETNYVQGQFLDGVVKNSTRAGSFVTLPDGSEGF  289

Query  1076  LPTSEMADEGLGEIMGGSSLQVGQEVSVRVLRISRGQATLTMKKEEATEE----VNSVLS  1243
             LP  E A   L  ++G S+L+VGQ+V V+VL + RGQ TLTMK+ E  EE    +N+ L 
Sbjct  290   LPREEEA-VALFTLIGHSALEVGQQVRVKVLNVVRGQVTLTMKEGEDDEEDLASLNTQLK  348

Query  1244  QGVIHKATNPFALAFRKNKEISAFLDQRE--------EEVLAEKSEKDNNEAGVDIS---  1390
             QG   + TN F LAFR+NKEISAFLDQRE        E  +A    + + E G++ S   
Sbjct  349   QG-WSRGTNAFELAFRRNKEISAFLDQREKIIVPDVQEAAVASVGTELDAEVGIEQSPGK  407

Query  1391  ----------TVDDTLSET--------AEKDGEVMET----------INEDTTTTDQLSE  1486
                        +D +++E          EKD E+ +T          I+ED +T D    
Sbjct  408   EPETGNAESVAIDSSITEVKETDSIAAVEKDSEISKTESVETASSVVISEDDSTVDGKLV  467

Query  1487  EP----SATEDDSLPITEDQLAEPEVSTTTTDQLSEE----------PSAINAAETNAQD  1624
             EP    SATE +   I ED  +E  V+T  T+  S E          P+A ++ ET+  D
Sbjct  468   EPTASVSATETE---IKEDS-SEGSVTTEPTEAASTEFVTAVVEESAPTA-SSVETSEDD  522

Query  1625  ETA-AQLAEPEVSTTTIDQPSEEPSAINaaetdaqdetaaqLAEPEVSTTTIDQPSEEPS  1801
              T   +L EP  S +  +  S+E S+  +  +        + + P VS+  I+ P+ E S
Sbjct  523   STVDDKLVEPTASVSATEAESKEDSSEGSVASTESVTAVVEESAP-VSSVAIEVPAPEAS  581

Query  1802  AINAAE  1819
               +A E
Sbjct  582   EASAQE  587



>ref|XP_002461159.1| hypothetical protein SORBIDRAFT_02g041940 [Sorghum bicolor]
 gb|EER97680.1| hypothetical protein SORBIDRAFT_02g041940 [Sorghum bicolor]
Length=937

 Score =   266 bits (681),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 168/386 (44%), Positives = 236/386 (61%), Gaps = 37/386 (10%)
 Frame = +2

Query  248   MAPVIPTTVNSISLTPCNILISRKNNLLTRCSVFQKPGRQTLSAQRYAIPFSTPVRLFPH  427
             M PV   +V SISL       + +   + R   FQ   R +    R A P  +P RL   
Sbjct  1     MTPVSHCSVGSISLFHIGSFRTSREIQVRR---FQGTARYS----RVASP--SPRRLL-Q  50

Query  428   LRVGFDIQPKLRTPIVSSAE-----------TDVAVEEADSATVDKSPSGAPE----NSP  562
              +  F +    +    SSAE           TDV VE+ +  T D++   AP+    +  
Sbjct  51    PQAAFHLISIYKRRSWSSAERPTTLSAATVGTDVTVEDQNPETSDENSEAAPDAVEASEQ  110

Query  563   VEsdasptpapsrrsrparKSEMPPIKNEDLIPGASFTGKVKSIQPFGAFVDFGAFTDGL  742
              E+      +P +  R  RKSEMPP+  EDL+PGASFTGKV SI+PFG FVD GA+T+GL
Sbjct  111   AEASTGQASSPRKLGRNIRKSEMPPLNEEDLVPGASFTGKVMSIKPFGVFVDIGAYTEGL  170

Query  743   VHVSNLSNSFVKDVTSVVSVGQEVTVRLLEANMETGRISLTMRESDETSREKQPKDSPGS  922
             VH+S +S+ FVKD++S+ +VGQEV+VRLLEAN ET RISLTMRE D+  + K  K++P +
Sbjct  171   VHISRVSDGFVKDISSLFTVGQEVSVRLLEANKETKRISLTMREGDDYVKPK--KETPKA  228

Query  923   SDKSRAPKRTPQRNNQRR------ESKFVKGQDLEGTVKNLTRSGAFISLPEGEEGFLPT  1084
             ++  R+   TP++  +R+      ESK+V GQ L GTVK+ TR+G F++LP+G EGFLP 
Sbjct  229   ANGGRSATATPRQTRERQEAKETVESKYVPGQSLNGTVKSTTRAGTFVTLPDGSEGFLPR  288

Query  1085  SEMADEGLGEIMGGSSLQVGQEVSVRVLRISRGQATLTMKKEEATEEVNSVLSQGV---I  1255
              E A   L  ++G S+++VG+++ V+VL +++GQATLTMK  E  E+    L+  +    
Sbjct  289   EEEA-LALFTLIGQSAMEVGKQIRVKVLNVAQGQATLTMKGVEDDEDDLKTLNMELKRDW  347

Query  1256  HKATNPFALAFRKNKEISAFLDQREE  1333
              + TN F LAFR+NKEISAFLDQR++
Sbjct  348   SRGTNAFELAFRRNKEISAFLDQRQK  373



>gb|EMT00261.1| Elongation factor Ts [Aegilops tauschii]
Length=937

 Score =   263 bits (671),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 143/277 (52%), Positives = 199/277 (72%), Gaps = 15/277 (5%)
 Frame = +2

Query  620   KSEMPPIKNEDLIPGASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNLSNSFVKDVTSVVS  799
             KSEMPP+K+ DL+PGASFTGKV+SI+PFG FVD GAFT+GLVH+S +S+ FV+D++++ +
Sbjct  94    KSEMPPLKDGDLVPGASFTGKVRSIKPFGVFVDIGAFTEGLVHISRVSDGFVEDISTLFT  153

Query  800   VGQEVTVRLLEANMETGRISLTMRESDETSREKQPKDSPGSSDKSRAPKRTPQRNNQRR-  976
             VGQEV+V+L+E N ET RISLTMR   +  +E     S G S  + AP+ +P++    + 
Sbjct  154   VGQEVSVKLVEVNKETRRISLTMRTGGDYVKEAPTAPSGGRSPTAAAPRSSPRQTKDFKK  213

Query  977   --ESKFVKGQDLEGTVKNLTRSGAFISLPEGEEGFLPTSEMADEGLGEIMGGSSLQVGQE  1150
               E+K+ +GQ L GTVKN TR+G+F++LP+GEEGFLP  E A   L  ++G S+L+VGQE
Sbjct  214   IDEAKYTRGQSLTGTVKNTTRTGSFVTLPDGEEGFLPREEEA-AALFTLIGHSALEVGQE  272

Query  1151  VSVRVLRISRGQATLTMKKEEATEE----VNSVLSQGVIHKATNPFALAFRKNKEISAFL  1318
             V+V+VL ++RGQ TLTMK  E  ++    +N+ L QG   + TN F LAFR++KEISAFL
Sbjct  273   VTVKVLNVARGQVTLTMKGGEDDDDELSSLNTNLKQG-WSRGTNAFELAFRRSKEISAFL  331

Query  1319  DQREE----EVLAE-KSEKDNNEAGVDISTVDDTLSE  1414
             DQRE+    EV  E ++E   + +GV+ S +DD L E
Sbjct  332   DQREKVTAPEVKTEVETETSVSTSGVE-SAIDDKLVE  367



>ref|XP_001765237.1| predicted protein [Physcomitrella patens]
 gb|EDQ69965.1| predicted protein [Physcomitrella patens]
Length=899

 Score =   194 bits (494),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 105/219 (48%), Positives = 142/219 (65%), Gaps = 7/219 (3%)
 Frame = +2

Query  638   IKNEDLIPGASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNLSNSFVKDVTSVVSVGQEVT  817
             ++ + ++ GA FTGKV+S+Q +GAFVD GAFTDGLVH+S L+  FVK+VT VVS+GQEVT
Sbjct  57    VQKDQIVAGAVFTGKVRSVQSYGAFVDIGAFTDGLVHISELAPKFVKEVTDVVSIGQEVT  116

Query  818   VRLLEANMETGRISLTMRESDETSREKQPKDSPGSSDKSRAPKRTPQRNNQRRESKFVKG  997
             VR+LE N + GRI+LTMR+     RE + ++         +           R +K  KG
Sbjct  117   VRVLELNEKAGRIALTMRD-----RENEEEEQSSRPGSESSAGSGSGGEESGRPTKLKKG  171

Query  998   QDLEGTVKNLTRSGAFISLPE-GEEGFLPTSEMADEGLGEIMGGSSLQVGQEVSVRVLRI  1174
             ++L+GTVKN+ R+GAFI   E GEE FL  SE+ + G    M  + L VGQEV+VRVL++
Sbjct  172   EELKGTVKNIIRNGAFIEFAEQGEEAFLRGSEVTEGGENVPM-ENLLTVGQEVTVRVLKV  230

Query  1175  SRGQATLTMKKEEATEEVNSVLSQGVIHKATNPFALAFR  1291
              RG+A LTMK +     VN  ++ GV+  A NPFA  FR
Sbjct  231   ERGKAYLTMKPQVDMTSVNQSINSGVVGSAANPFATFFR  269



>ref|XP_001759360.1| predicted protein [Physcomitrella patens]
 gb|EDQ75662.1| predicted protein [Physcomitrella patens]
Length=854

 Score =   193 bits (490),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 111/225 (49%), Positives = 149/225 (66%), Gaps = 10/225 (4%)
 Frame = +2

Query  638   IKNEDLIPGASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNLSNSFVKDVTSVVSVGQEVT  817
             ++ + ++PGA FTG+V+ +QP+GAFVD GAFT+GLVHVS L+  +VKDV+  V VGQEVT
Sbjct  28    VQKDQIVPGAVFTGRVRFVQPYGAFVDIGAFTNGLVHVSELAPGYVKDVSDFVKVGQEVT  87

Query  818   VRLLEANMETGRISLTMRESDETSREKQPKDSPGS-SDKSRAPKR--TPQRNNQR---RE  979
             V +LE N ++ RI+LTMR  D  S    P D  G  +++ +   R     R+N +   R+
Sbjct  88    VTVLEMNEKSKRIALTMR--DRESEAAVPGDGSGKPTNQGKIAGRGNGGSRSNLKPKLRQ  145

Query  980   SKFVKGQDLEGTVKNLTRSGAFISLPE-GEEGFLPTSEMADEGLGEIMGGSSLQVGQEVS  1156
             SK  KG+ L+GTVKN+ R+GAFI  PE GEE FL  SE+  EG   +   + L VGQEV+
Sbjct  146   SKAKKGEVLKGTVKNIIRNGAFIEFPEQGEEAFLRGSEVT-EGGENVPIENLLTVGQEVT  204

Query  1157  VRVLRISRGQATLTMKKEEATEEVNSVLSQGVIHKATNPFALAFR  1291
             VRVL+I RG+A LTMK +     VN  ++ GV+  ATNPFA  FR
Sbjct  205   VRVLKIERGKAYLTMKPQIDMTAVNDSINSGVVGGATNPFATFFR  249



>ref|XP_001765236.1| predicted protein [Physcomitrella patens]
 gb|EDQ69964.1| predicted protein [Physcomitrella patens]
Length=421

 Score =   187 bits (475),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 115/260 (44%), Positives = 153/260 (59%), Gaps = 44/260 (17%)
 Frame = +2

Query  638   IKNEDLIPGASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNLSNSFVKDVTSVVSVGQEVT  817
             ++ + ++ GA FTGKV+S+Q +GAFVD GAFTDGLVH+S L+  FVK+VT VVS+GQEVT
Sbjct  129   VQKDQIVAGAVFTGKVRSVQSYGAFVDIGAFTDGLVHISELAPKFVKEVTDVVSIGQEVT  188

Query  818   VRLLEANMETGRISLTM--RESDETSREKQP--------------------------KDS  913
             VR+LE N + GRI+LTM  RE++E  +  +P                          + S
Sbjct  189   VRVLELNEKAGRIALTMRDRENEEEEQSSRPGSESSAGSGSGGEESGRPVNRGKIAGRGS  248

Query  914   PGSSDKSRA--PK------------RTPQRNNQRRESKFVKGQDLEGTVKNLTRSGAFIS  1051
              GS   SRA  PK            R+  R  Q   +K  KG++L+GTVKN+ R+GAFI 
Sbjct  249   GGSRSNSRASEPKVRRSGVEGDGRNRSDGRGLQVGWTKLKKGEELKGTVKNIIRNGAFIE  308

Query  1052  LPE-GEEGFLPTSEMADEGLGEIMGGSSLQVGQEVSVRVLRISRGQATLTMKKEEATEEV  1228
               E GEE FL  SE+ + G    M  + L VGQEV+VRVL++ RG+A LTMK +     V
Sbjct  309   FAEQGEEAFLRGSEVTEGGENVPM-ENLLTVGQEVTVRVLKVERGKAYLTMKPQVDMTSV  367

Query  1229  NSVLSQGVIHKATNPFALAF  1288
             N  ++ GV+  A NPFA  F
Sbjct  368   NQSINSGVVGSAANPFATFF  387



>gb|EYU29816.1| hypothetical protein MIMGU_mgv11b021295mg [Erythranthe guttata]
Length=305

 Score =   182 bits (463),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 112/213 (53%), Positives = 135/213 (63%), Gaps = 36/213 (17%)
 Frame = +2

Query  248  MAPVIP-TTVNSISLTP-CNILISRKNN-LLTRCSVFQKPGRQTLSAQRYAIPFSTPVRL  418
            MAP+IP TT NSIS T      I+R++N  L+R ++  K  RQTL AQ+Y +P S  V L
Sbjct  1    MAPLIPCTTTNSISPTSGVAFTINRRSNCYLSRFNITIKLNRQTLQAQKYTLPLSKSVGL  60

Query  419  --FPHLRVGFDIQPKLRTPIVSSAETDVAVEEADSATVDKSPSGAPENSPVEsdasptpa  592
              F  +R+G                +   V    +AT  +  SG                
Sbjct  61   QTFSQIRIG----------------SVFYVHSVGAATDAEGTSGG---------------  89

Query  593  psrrsrparKSEMPPIKNEDLIPGASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNLSNSF  772
              +RSR  RKSEMPP+ NEDLIPGA+FTGKV+SIQPFGAF+DFG+FTDGLVHVSNLSN F
Sbjct  90   SFKRSRYVRKSEMPPVNNEDLIPGATFTGKVRSIQPFGAFIDFGSFTDGLVHVSNLSNEF  149

Query  773  VKDVTSVVSVGQEVTVRLLEANMETGRISLTMR  871
            VKDV S+VSVGQEV VRL+EANMET RISL+MR
Sbjct  150  VKDVGSIVSVGQEVVVRLIEANMETRRISLSMR  182


 Score = 82.0 bits (201),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 53/151 (35%), Positives = 82/151 (54%), Gaps = 15/151 (10%)
 Frame = +2

Query  911   SPGSSDKSRAPKRT--PQRNNQRRESKFVKGQDLEGTVKNLTRSGAFISLPEGEEGFLPT  1084
             S GS  +SR  +++  P  NN+      + G    G V+++   GAFI      +G +  
Sbjct  87    SGGSFKRSRYVRKSEMPPVNNE----DLIPGATFTGKVRSIQPFGAFIDFGSFTDGLVHV  142

Query  1085  SEMADEGLGEIMGGSSLQVGQEVSVRVL-------RISRGQATLTMKKEEATEEVNSVLS  1243
             S +++E + ++  GS + VGQEV VR++       RIS     +     +  +   +++ 
Sbjct  143   SNLSNEFVKDV--GSIVSVGQEVVVRLIEANMETRRISLSMRNVMTSANDEEDFDENLIQ  200

Query  1244  QGVIHKATNPFALAFRKNKEISAFLDQREEE  1336
             QGV+H ATNPF LAFR NK ISAFLD+ E+E
Sbjct  201   QGVVHTATNPFVLAFRTNKVISAFLDELEKE  231



>ref|XP_002961419.1| hypothetical protein SELMODRAFT_60716, partial [Selaginella moellendorffii]
 gb|EFJ36679.1| hypothetical protein SELMODRAFT_60716, partial [Selaginella moellendorffii]
Length=877

 Score =   146 bits (368),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 104/252 (41%), Positives = 142/252 (56%), Gaps = 32/252 (13%)
 Frame = +2

Query  635   PIKNEDLIPGASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNLSNSFVKDVTSVVSVGQEV  814
             P+++EDL+     TG++KSI  FGAFVD GA  DGL+H+S L   FVK V  VV VGQEV
Sbjct  25    PVQDEDLVADKVLTGRIKSIMTFGAFVDLGARVDGLLHISKLGEGFVKAVEDVVQVGQEV  84

Query  815   TVRLLEANMETGRISLTMRESDETSREKQPKDSPGSSDKSRAPK---RTPQRN-------  964
              V++LEA+++  R+ L +   D T     PK  P  +  S AP    R   R        
Sbjct  85    QVQILEADLQNRRVKLKL--YDPT-----PKPEPTRAPSSGAPATGGREAFRGKIAGRGA  137

Query  965   ------NQR------RESKFVKGQDLEGTVKNLTRSGAFISLPEGEEGFLPTSEMADEGL  1108
                   N+R      + S + KGQ   G VKNLTR G F+ LP GEEGF+  +E++  G 
Sbjct  138   PGAAGQNRRAATDKPKTSNYQKGQAATGVVKNLTRRGCFVELPGGEEGFMHANEISVAG-  196

Query  1109  GEIMGGSSLQVGQEVSVRVLRISRGQATLTMKKEEATEEVNSVLSQGVIHKATNPFALAF  1288
               +   + ++VGQEV V+VLRI  G+  LTMK+E   ++VN   +  +   ATN F LAF
Sbjct  197   ENVPIETLVKVGQEVKVKVLRIIEGRINLTMKEELDLKKVNEEFNGSMT--ATNAFELAF  254

Query  1289  RKNKEISAFLDQ  1324
             RKN  I  +L++
Sbjct  255   RKNAAIRKYLEE  266



>ref|XP_002990284.1| hypothetical protein SELMODRAFT_40704, partial [Selaginella moellendorffii]
 gb|EFJ08699.1| hypothetical protein SELMODRAFT_40704, partial [Selaginella moellendorffii]
Length=863

 Score =   143 bits (360),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 103/251 (41%), Positives = 141/251 (56%), Gaps = 32/251 (13%)
 Frame = +2

Query  638   IKNEDLIPGASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNLSNSFVKDVTSVVSVGQEVT  817
             +++EDL+     TG++KSI  FGAFVD GA  DGL+H+S L   FVK V  VV VGQEV 
Sbjct  26    VQDEDLVADKVLTGRIKSIMTFGAFVDLGARVDGLLHISKLGEGFVKAVEDVVQVGQEVQ  85

Query  818   VRLLEANMETGRISLTMRESDETSREKQPKDSPGSSDKSRAPK---RTPQRN--------  964
             V++LEA+++  R+ L +   D T     PK  P  +  S AP    R   R         
Sbjct  86    VQILEADLQNRRVKLKL--YDPT-----PKPEPTRAPSSGAPATGGREAFRGKIAGRGAP  138

Query  965   -----NQR------RESKFVKGQDLEGTVKNLTRSGAFISLPEGEEGFLPTSEMADEGLG  1111
                  N+R      + S + KGQ   G VKNLTR G F+ LP GEEGF+  +E++  G  
Sbjct  139   GAAGQNRRPATDKPKTSNYQKGQAATGVVKNLTRRGCFVELPGGEEGFMHANEISVAG-E  197

Query  1112  EIMGGSSLQVGQEVSVRVLRISRGQATLTMKKEEATEEVNSVLSQGVIHKATNPFALAFR  1291
              +   + ++VGQEV V+VLRI  G+  LTMK+E   ++VN   +  +   ATN F LAFR
Sbjct  198   NVPIETLVKVGQEVKVKVLRIIEGRINLTMKEELDLKKVNEEFNGSMT--ATNAFELAFR  255

Query  1292  KNKEISAFLDQ  1324
             KN  I  +L++
Sbjct  256   KNAAIRKYLEE  266



>ref|XP_005835743.1| hypothetical protein GUITHDRAFT_105392 [Guillardia theta CCMP2712]
 gb|EKX48763.1| hypothetical protein GUITHDRAFT_105392 [Guillardia theta CCMP2712]
Length=312

 Score =   126 bits (316),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 76/200 (38%), Positives = 118/200 (59%), Gaps = 15/200 (8%)
 Frame = +2

Query  635   PIKNE----DLIPGASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNLSNSFVKDVTSVVSV  802
             P KN+    D   G++  GKV SI P+GAFVD GA TDGLVHVS L++ FV D+ SVV V
Sbjct  86    PSKNKKPLSDYEVGSTVPGKVVSIMPYGAFVDIGATTDGLVHVSQLADEFVSDIESVVKV  145

Query  803   GQEVTVRLLEANMETGRISLTMRESDETSREKQPKDSPGSSDKSRAPKRTPQRNNQRRES  982
             G EV VR+ E N +  ++SL+MR  +  SR ++ +   G   +S  P++    +++    
Sbjct  146   GDEVQVRITEINADINKVSLSMRSENAPSRGERNERRSGGGGRSELPEKFKNFDDK----  201

Query  983   KFVKGQDLEGTVKNLTRSGAFISLPEGEEGFLPTSEMADEGLGEIMGGSSLQVGQEVSVR  1162
             +F+K     GTV +L   GAF+++ EG +G +  S++++E   +I     L VGQEV+VR
Sbjct  202   EFIK-----GTVASLMEYGAFVTIGEGVDGLVHISQISEERDTKI--DKVLTVGQEVNVR  254

Query  1163  VLRISRGQATLTMKKEEATE  1222
             ++   + +  L++   E  E
Sbjct  255   IINFDQKRKRLSLSMREWRE  274


 Score = 62.8 bits (151),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 36/89 (40%), Positives = 51/89 (57%), Gaps = 3/89 (3%)
 Frame = +2

Query  620  KSEMP-PIKNEDLIPGASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNLSNSFVKDVTSVV  796
            +SE+P   KN D        G V S+  +GAFV  G   DGLVH+S +S      +  V+
Sbjct  188  RSELPEKFKNFD--DKEFIKGTVASLMEYGAFVTIGEGVDGLVHISQISEERDTKIDKVL  245

Query  797  SVGQEVTVRLLEANMETGRISLTMRESDE  883
            +VGQEV VR++  + +  R+SL+MRE  E
Sbjct  246  TVGQEVNVRIINFDQKRKRLSLSMREWRE  274



>ref|XP_003078528.1| chloroplast polyprotein of elongation factor Ts precursor (ISS) 
[Ostreococcus tauri]
Length=294

 Score =   111 bits (277),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 77/225 (34%), Positives = 123/225 (55%), Gaps = 6/225 (3%)
 Frame = +2

Query  638   IKNEDLIPGASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNLSNSFVKDVTSVVSVGQEVT  817
             +++  ++ GA F+GKVK IQ +G FVDFGA  DGLVH+S L + FV+ V  VVS  Q+V 
Sbjct  65    VEDSAVVVGAEFSGKVKRIQDYGCFVDFGAKQDGLVHISELKDGFVESVAEVVSQDQDVQ  124

Query  818   VRLLEANMETGRISLTMRESDETSREKQPKDSPGSSDKSRAPKRTPQRNNQRRESKFVKG  997
             V + E  ++ G+ISLTM++          K    +   +R   +  Q    +      KG
Sbjct  125   VWVKE--IKDGKISLTMKKPKSEEELAAIKSEQEAKFLARQEYKKQQDAKVQAVKGLKKG  182

Query  998   QDLEGTVKNLTRSGAFISLPEGEEGFLPTSEMADEGLGEIMGGSSLQVGQEVSVRVLRIS  1177
             + +EG VK++   GAF+ + EG EG L  +E++D+    +     ++VG +V+V ++ I 
Sbjct  183   EKVEGEVKSIQPFGAFVEVAEGCEGLLHVTELSDD--FNVKVEDFVKVGDKVTVTIVGIE  240

Query  1178  RGQATLTMKKEEATEEVNSVLSQGVIHKATNPFALAFRKNKEISA  1312
               +  L+MK++    E+N+  S  V   A +    A +K K ISA
Sbjct  241   GAKVKLSMKEKLNLNEMNAEASAAV-EGAVSAMEYALKK-KGISA  283



>ref|XP_003062074.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH53786.1| predicted protein [Micromonas pusilla CCMP1545]
Length=844

 Score =   115 bits (287),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 70/200 (35%), Positives = 107/200 (54%), Gaps = 21/200 (11%)
 Frame = +2

Query  638   IKNEDLIPGASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNLSNSFVKDVTSVVSVGQEVT  817
             + +E ++ GA F G VK +Q +G FVDFGA +DGLVH+S L + FV++V  VVS  QEV 
Sbjct  63    VTDEQVVVGAEFKGVVKRVQEYGCFVDFGAKSDGLVHISELKDGFVENVADVVSENQEVQ  122

Query  818   VRLLEANMETGRISLTMR-----------ESDETSREKQPKDSPGSSDKSRAPKRTPQRN  964
             V +   + E GRISLTM+            + E  RE + ++        R  K+     
Sbjct  123   VFIKSIDAEKGRISLTMKPPPSAAELETILAKEAEREAKFQE--------RKAKKAASEE  174

Query  965   NQRRESKFVKGQDLEGTVKNLTRSGAFISLPEGEEGFLPTSEMADEGLGEIMGGSSLQVG  1144
             + +      KG  +EG VK++   GAF+ + EG EG +  +EM+++    +     + VG
Sbjct  175   SMKAVRAIKKGTTVEGVVKSIQAFGAFVEIAEGVEGLVHVTEMSED--YNVKPEDFVTVG  232

Query  1145  QEVSVRVLRISRGQATLTMK  1204
             + V VRVL +   +  L+MK
Sbjct  233   ETVKVRVLGVDGQKVKLSMK  252



>emb|CEF97398.1| Translation elongation factor EFTs/EF1B, dimerisation [Ostreococcus 
tauri]
Length=787

 Score =   113 bits (282),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 77/225 (34%), Positives = 123/225 (55%), Gaps = 6/225 (3%)
 Frame = +2

Query  638   IKNEDLIPGASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNLSNSFVKDVTSVVSVGQEVT  817
             +++  ++ GA F+GKVK IQ +G FVDFGA  DGLVH+S L + FV+ V  VVS  Q+V 
Sbjct  65    VEDSAVVVGAEFSGKVKRIQDYGCFVDFGAKQDGLVHISELKDGFVESVAEVVSQDQDVQ  124

Query  818   VRLLEANMETGRISLTMRESDETSREKQPKDSPGSSDKSRAPKRTPQRNNQRRESKFVKG  997
             V + E  ++ G+ISLTM++          K    +   +R   +  Q    +      KG
Sbjct  125   VWVKE--IKDGKISLTMKKPKSEEELAAIKSEQEAKFLARQEYKKQQDAKVQAVKGLKKG  182

Query  998   QDLEGTVKNLTRSGAFISLPEGEEGFLPTSEMADEGLGEIMGGSSLQVGQEVSVRVLRIS  1177
             + +EG VK++   GAF+ + EG EG L  +E++D+    +     ++VG +V+V ++ I 
Sbjct  183   EKVEGEVKSIQPFGAFVEVAEGCEGLLHVTELSDD--FNVKVEDFVKVGDKVTVTIVGIE  240

Query  1178  RGQATLTMKKEEATEEVNSVLSQGVIHKATNPFALAFRKNKEISA  1312
               +  L+MK++    E+N+  S  V   A +    A +K K ISA
Sbjct  241   GAKVKLSMKEKLNLNEMNAEASAAV-EGAVSAMEYALKK-KGISA  283



>ref|XP_009041734.1| hypothetical protein AURANDRAFT_72706 [Aureococcus anophagefferens]
 gb|EGB03584.1| hypothetical protein AURANDRAFT_72706 [Aureococcus anophagefferens]
Length=328

 Score =   108 bits (270),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 65/194 (34%), Positives = 108/194 (56%), Gaps = 12/194 (6%)
 Frame = +2

Query  620   KSEMPPIKNEDLIPGASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNLSNSFVKDVTSVVS  799
             KS+  P+   DL+ G  + GK+  +  +GAFVD GA +DGLVH+S LS S+V DV SVV 
Sbjct  56    KSKATPLA--DLVEGNEYAGKITGLAAYGAFVDIGAQSDGLVHISELSASYVDDVASVVK  113

Query  800   VGQEVTVRLLEANMETGRISLTMRESDETSREKQPKDSPGSSDKSRAPKRTPQRNNQRRE  979
              G +VTVR+L+ +    ++SL+M+       E  PK   G   + +A     ++      
Sbjct  114   EGDDVTVRILKIDSGKKQLSLSMKPE---GAEAPPKKRGGGGRQKKAGAEELRKYQDADP  170

Query  980   SKFVKGQDLEGTVKNLTRSGAFISLPEGEEGFLPTSEMADEGLGEIMGGSSLQVGQEVSV  1159
             ++F+      GTV+ +   GAF+++  G +G +  S ++D  + ++   + L VG EV V
Sbjct  171   AEFI-----SGTVRTVLEWGAFVNIAPGVDGLVHISRVSDSRVEDLQ--AELSVGDEVKV  223

Query  1160  RVLRISRGQATLTM  1201
             R++ +   +ATL +
Sbjct  224   RIIDVDLDKATLGL  237


 Score = 65.5 bits (158),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 38/125 (30%), Positives = 66/125 (53%), Gaps = 3/125 (2%)
 Frame = +2

Query  641   KNEDLIPGASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNLSNSFVKDVTSVVSVGQEVTV  820
             K +D  P    +G V+++  +GAFV+     DGLVH+S +S+S V+D+ + +SVG EV V
Sbjct  164   KYQDADPAEFISGTVRTVLEWGAFVNIAPGVDGLVHISRVSDSRVEDLQAELSVGDEVKV  223

Query  821   RLLEANMETGRISLTMR-ESDETSREKQPKDSPGSSDKSRAPKRTPQR--NNQRRESKFV  991
             R+++ +++   + L M    D T+  +  +D  G    +    R P      QR+  +  
Sbjct  224   RIIDVDLDKATLGLAMNTYRDPTAPPRPGRDDAGGESAAARRARNPDAAGGGQRKPRRMD  283

Query  992   KGQDL  1006
              G D+
Sbjct  284   PGDDI  288



>ref|XP_007513208.1| elongation factor Ts [Bathycoccus prasinos]
 emb|CCO16766.1| elongation factor Ts [Bathycoccus prasinos]
Length=831

 Score =   111 bits (277),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 73/196 (37%), Positives = 109/196 (56%), Gaps = 5/196 (3%)
 Frame = +2

Query  650   DLIPGASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNLSNSFVKDVTSVVSVGQEVTVRLL  829
             DL  G  FTGKVKS   +GAFVDFGA  DGLVH+S L + FV++V  VV+V QEV + + 
Sbjct  85    DLEVGKEFTGKVKSTTVYGAFVDFGAKNDGLVHISELQSGFVENVGDVVAVDQEVKIWI-  143

Query  830   EANMETGRISLTMRESDETSREKQPKDSPGSSDKSRAPKRTPQRNNQRRESKFVKGQDLE  1009
               ++E GRISLTM++    +   Q      +  ++R   +  +           KG  LE
Sbjct  144   -KSIEKGRISLTMKQPPTEAEVAQQAADQQAKFEARQAFKLQKEKQSEIAGNLKKGAVLE  202

Query  1010  GT-VKNLTRSGAFISLPEGEEGFLPTSEMADEGLGEIMGGSSLQVGQEVSVRVLRISRGQ  1186
             G  VK++   G F+ + EG EG +  SE++D+  G +       VG +V+VRVL +   +
Sbjct  203   GCEVKSIQNYGIFVEIAEGVEGLVHISELSDD-FG-VEAKDIANVGDKVTVRVLGVDGSK  260

Query  1187  ATLTMKKEEATEEVNS  1234
               L+MK++   +E+ S
Sbjct  261   VKLSMKEKLDLDEMAS  276



>ref|XP_002499833.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO61091.1| predicted protein [Micromonas sp. RCC299]
Length=876

 Score =   107 bits (267),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 67/176 (38%), Positives = 98/176 (56%), Gaps = 5/176 (3%)
 Frame = +2

Query  686   KSIQPFGAFVDFGAFTDGLVHVSNLSNSFVKDVTSVVSVGQEVTVRLLEANMETGRISLT  865
             K +Q +G FVDFGA  DGLVH+S L + FV++VT VVS  Q VTV +   + E GRISLT
Sbjct  152   KRVQEYGCFVDFGAKNDGLVHISELKDGFVENVTDVVSADQAVTVWVKSIDAEKGRISLT  211

Query  866   MR---ESDETSREKQPKDSPGSSDKSRAPKRTPQRNNQRRESKFVKGQDLEGTVKNLTRS  1036
             M+    +DE    K  +    +   +R  ++   R    +     KG   EG VK++   
Sbjct  212   MKPPPTADELEAIKAKEAEREAKFAARKAQQAEARAAAEKVKAIKKGTAFEGEVKSVQPF  271

Query  1037  GAFISLPEGEEGFLPTSEMADEGLGEIMGGSSLQVGQEVSVRVLRISRGQATLTMK  1204
             GAF+ + EG EG +  +EM+D+   ++      +VG +VSV+VL +   +  LTMK
Sbjct  272   GAFVEIMEGVEGLVHVTEMSDDYNVDV--ADFCKVGDKVSVKVLDVDGAKVKLTMK  325


 Score = 65.9 bits (159),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 30/76 (39%), Positives = 51/76 (67%), Gaps = 2/76 (3%)
 Frame = +2

Query  662  GASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNLSNSFVKDVTSVVSVGQEVTVRLLEANM  841
            G +F G+VKS+QPFGAFV+     +GLVHV+ +S+ +  DV     VG +V+V++L  ++
Sbjct  258  GTAFEGEVKSVQPFGAFVEIMEGVEGLVHVTEMSDDYNVDVADFCKVGDKVSVKVL--DV  315

Query  842  ETGRISLTMRESDETS  889
            +  ++ LTM++  + S
Sbjct  316  DGAKVKLTMKDKVDIS  331



>ref|WP_016836946.1| 30S ribosomal protein S1 [Ureibacillus thermosphaericus]
Length=381

 Score = 99.4 bits (246),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 70/195 (36%), Positives = 103/195 (53%), Gaps = 34/195 (17%)
 Frame = +2

Query  647   EDLIPGASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNLSNSFVKDVTSVVSVGQEVTVRL  826
             E L PG    GKV+ + PFGAFVD G   DGLVH+S +++  V D+ +V+  GQEV V++
Sbjct  183   ESLKPGDVLNGKVQRLAPFGAFVDIGG-VDGLVHISQVAHEHVDDINTVLQEGQEVKVKV  241

Query  827   LEANMETGRISLTMRESDETSREKQPKDSPGSSDKSRAPKRTPQRNNQRRESKFVKGQDL  1006
             L  + E  RISL+++E+            PG           P  N   R S   KGQ L
Sbjct  242   LSVDPENERISLSIKET-----------LPG-----------PWANIAERVS---KGQVL  276

Query  1007  EGTVKNLTRSGAFISLPEGEEGFLPTSEMADEGLG---EIMGGSSLQVGQEVSVRVLRIS  1177
              GTVK L   GAF+ +  G EG +  S+++ + +    E+     L+ GQEV V+VL ++
Sbjct  277   TGTVKRLVSFGAFVEVFPGVEGLVHISQISHKHINTPHEV-----LKEGQEVQVKVLDVN  331

Query  1178  RGQATLTMKKEEATE  1222
               +  L++  +E  E
Sbjct  332   EQEKRLSLSMKELEE  346


 Score = 60.5 bits (145),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 31/83 (37%), Positives = 50/83 (60%), Gaps = 0/83 (0%)
 Frame = +2

Query  662  GASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNLSNSFVKDVTSVVSVGQEVTVRLLEANM  841
            G   TG VK +  FGAFV+     +GLVH+S +S+  +     V+  GQEV V++L+ N 
Sbjct  273  GQVLTGTVKRLVSFGAFVEVFPGVEGLVHISQISHKHINTPHEVLKEGQEVQVKVLDVNE  332

Query  842  ETGRISLTMRESDETSREKQPKD  910
            +  R+SL+M+E +E  + ++  D
Sbjct  333  QEKRLSLSMKELEENPKHQEEFD  355



>ref|WP_016203025.1| 30S ribosomal protein S1 [Bacillus nealsonii]
 gb|EOR23595.1| 30S ribosomal protein S1 [Bacillus nealsonii AAU1]
Length=379

 Score = 97.1 bits (240),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 68/191 (36%), Positives = 100/191 (52%), Gaps = 34/191 (18%)
 Frame = +2

Query  662   GASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNLSNSFVKDVTSVVSVGQEVTVRLLEANM  841
             G + TG V+ I  FGAFVD G   DGLVH+S LS   +   T VV  GQEV V++L  + 
Sbjct  188   GQTLTGTVQRITDFGAFVDLGGI-DGLVHISQLSYDHISSPTDVVQEGQEVKVKVLSVDR  246

Query  842   ETGRISLTMRESDETSREKQPKDSPGSSDKSRAPKRTPQRNNQRRESKFVKGQDLEGTVK  1021
                RISL+++E+       QP   P ++   RA                 KG  L+GTVK
Sbjct  247   NNDRISLSIKET-------QP--GPWANIAERAE----------------KGSVLDGTVK  281

Query  1022  NLTRSGAFISLPEGEEGFLPTSEMADEGLG---EIMGGSSLQVGQEVSVRVLRISRGQAT  1192
              +   GAF+ +  G EG +  S++A + +G   E+     L+ GQEV V+VL ++  +  
Sbjct  282   RIVSYGAFVEVFPGVEGLVHISQIAHKHIGTPHEV-----LKEGQEVQVKVLDVNEAEQR  336

Query  1193  LTMKKEEATEE  1225
             L++  +E TE+
Sbjct  337   LSLSIKELTEK  347



>ref|WP_031538293.1| 30S ribosomal protein S1 [Bacillus sp. MB2021]
Length=379

 Score = 95.9 bits (237),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 68/192 (35%), Positives = 100/192 (52%), Gaps = 34/192 (18%)
 Frame = +2

Query  659   PGASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNLSNSFVKDVTSVVSVGQEVTVRLLEAN  838
              G + TG V+ I  FGAFVD G   DGLVH+S LS+  +   T VV  GQEV V++L  +
Sbjct  187   AGQTLTGTVQRITDFGAFVDLGGI-DGLVHISQLSHEHISSPTDVVQEGQEVNVKVLSVD  245

Query  839   METGRISLTMRESDETSREKQPKDSPGSSDKSRAPKRTPQRNNQRRESKFVKGQDLEGTV  1018
                 RISL+++E+       QP   P ++   RA                 KG  L+GTV
Sbjct  246   RNNDRISLSIKET-------QP--GPWANIADRAE----------------KGSVLDGTV  280

Query  1019  KNLTRSGAFISLPEGEEGFLPTSEMADEGLG---EIMGGSSLQVGQEVSVRVLRISRGQA  1189
             K +   GAF+ +  G EG +  S++A + +G   E+     L+ GQEV V+VL ++    
Sbjct  281   KRIVSYGAFVEVFPGVEGLVHISQIAHKHIGTPHEV-----LKEGQEVQVKVLDVNEEDQ  335

Query  1190  TLTMKKEEATEE  1225
              L++  +E TE+
Sbjct  336   RLSLSIKELTEK  347



>ref|WP_038535886.1| 30S ribosomal protein S1 [Bacillus sp. X1(2014)]
 gb|AIM15457.1| 30S ribosomal protein S1 [Bacillus sp. X1(2014)]
Length=379

 Score = 95.5 bits (236),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 68/188 (36%), Positives = 100/188 (53%), Gaps = 34/188 (18%)
 Frame = +2

Query  647   EDLIPGASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNLSNSFVKDVTSVVSVGQEVTVRL  826
             E+L PG    G V+ I  FGAFVD G   DGLVH+S LS+  V   T VV  GQ+V V++
Sbjct  183   EELKPGQIIEGTVQRITDFGAFVDIGGI-DGLVHISQLSHEHVNKPTDVVHEGQKVQVKV  241

Query  827   LEANMETGRISLTMRESDETSREKQPKDSPGSSDKSRAPKRTPQRNNQRRESKFVKGQDL  1006
             L  + +  RISL+++E+        P   P S+   +AP                KG  L
Sbjct  242   LSVDRDNERISLSIKET-------LP--GPWSNISEKAP----------------KGSVL  276

Query  1007  EGTVKNLTRSGAFISLPEGEEGFLPTSEMADEGLG---EIMGGSSLQVGQEVSVRVLRIS  1177
             +GTVK L   GAF+ +  G EG +  S++A + +G   E+     L+ GQEV+V+VL ++
Sbjct  277   KGTVKRLVSYGAFVEVFPGVEGLVHISQIAHKHIGTPHEV-----LKEGQEVNVKVLDVN  331

Query  1178  RGQATLTM  1201
               +  L++
Sbjct  332   EAEQRLSL  339


 Score = 52.0 bits (123),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 43/71 (61%), Gaps = 0/71 (0%)
 Frame = +2

Query  662  GASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNLSNSFVKDVTSVVSVGQEVTVRLLEANM  841
            G+   G VK +  +GAFV+     +GLVH+S +++  +     V+  GQEV V++L+ N 
Sbjct  273  GSVLKGTVKRLVSYGAFVEVFPGVEGLVHISQIAHKHIGTPHEVLKEGQEVNVKVLDVNE  332

Query  842  ETGRISLTMRE  874
               R+SL+++E
Sbjct  333  AEQRLSLSIKE  343



>ref|XP_005703273.1| 30S ribosomal protein S1 [Galdieria sulphuraria]
 gb|EME26753.1| 30S ribosomal protein S1 [Galdieria sulphuraria]
Length=275

 Score = 94.4 bits (233),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 68/202 (34%), Positives = 106/202 (52%), Gaps = 25/202 (12%)
 Frame = +2

Query  632   PPIKNEDLIPGASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNLSNSFVKDVTSVVSVGQE  811
             P +   DL+ G ++TG VK++  +GAFVD GA   GL+H+S +SN FV     VVS+G +
Sbjct  91    PQLSVSDLVIGETYTGIVKNVTNYGAFVDIGANKLGLLHISQMSNRFVNHPNEVVSIGSQ  150

Query  812   VTVRLLEANMETGRISLTMRESDETSREKQPKDSPGSSDKSRAPKRTPQRNNQRRESKFV  991
             VTVR+ + ++E  + SLTM+  +   R     ++   + +S A         Q    +F 
Sbjct  151   VTVRVYKIDVEKDQFSLTMKTQEPRRRRNDEPENVVEALRSFA--------EQVDRHEFR  202

Query  992   KGQDLEGTVKNLTRSGAFISLPEGEEGFLPTSEMADEGLGEIMGGSSLQVGQEVSVRVLR  1171
             KG+     V N+T  GAF+ +   ++G +  ++M D+          L+V  E+ VRV +
Sbjct  203   KGR-----VVNVTDFGAFVDIDGPKDGLVFRADMTDD----------LEVDDEIQVRVKK  247

Query  1172  I--SRGQATLTMKKEEATEEVN  1231
             I  SR   TL+MK     EE N
Sbjct  248   IDLSRKFITLSMKPITEYEEEN  269



>ref|WP_004339407.1| RNA binding S1 domain-containing protein [Thauera linaloolentis]
 gb|ENO86918.1| RNA binding S1 domain-containing protein [Thauera linaloolentis 
47Lol = DSM 12138]
Length=782

 Score = 97.4 bits (241),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 57/123 (46%), Positives = 74/123 (60%), Gaps = 8/123 (7%)
 Frame = +2

Query  647   EDLIPGASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNLSNSFVKDVTSVVSVGQEVTVRL  826
             +DL PG    G V ++  FGAFVD G   DGLVH+S LSN+FVKD  SVV  GQ V V++
Sbjct  645   KDLQPGMQLEGVVTNVTNFGAFVDIGVHQDGLVHISALSNTFVKDPHSVVKAGQVVKVKV  704

Query  827   LEANMETGRISLTMRESDETSREKQPK-DSPGSSDKSRAPKRTPQR---NNQRRESKFVK  994
             LE ++   RI+LTMR SDE +    PK +  GS   +R  +R+ +R    N R  S   +
Sbjct  705   LEVDIPRHRIALTMRLSDEAA----PKRNDHGSRGDARGDRRSDERRSGGNARAASSARQ  760

Query  995   GQD  1003
             GQD
Sbjct  761   GQD  763



>emb|CEG22588.1| hypothetical protein BN1080_01519 [Planomicrobium sp. ES2]
Length=381

 Score = 94.7 bits (234),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 68/195 (35%), Positives = 103/195 (53%), Gaps = 34/195 (17%)
 Frame = +2

Query  647   EDLIPGASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNLSNSFVKDVTSVVSVGQEVTVRL  826
             E +  G   TGKV+ I  FGAFVD G   DGLVH+S LS+  V+ V+ VV+ GQEV V++
Sbjct  183   ETIHAGDVLTGKVQRIASFGAFVDIGG-VDGLVHISQLSHEHVEKVSDVVTEGQEVQVKV  241

Query  827   LEANMETGRISLTMRESDETSREKQPKDSPGSSDKSRAPKRTPQRNNQRRESKFVKGQDL  1006
             L  + ++ RISL+++++        P   P  S + +AP                KG   
Sbjct  242   LSVDRDSERISLSIKDT-------LP--GPWDSIEDKAP----------------KGSVH  276

Query  1007  EGTVKNLTRSGAFISLPEGEEGFLPTSEMADEGLG---EIMGGSSLQVGQEVSVRVLRIS  1177
             +G VK L   GAF+ +  G EG +  S++A + +G   E+     L  GQEV V+VL ++
Sbjct  277   DGKVKRLVSYGAFVEVLPGVEGLVHISQIAHKHIGTPHEV-----LSEGQEVQVKVLDVN  331

Query  1178  RGQATLTMKKEEATE  1222
             +    L++  +E  E
Sbjct  332   KEDKRLSLSIKELQE  346


 Score = 62.4 bits (150),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 38/100 (38%), Positives = 59/100 (59%), Gaps = 7/100 (7%)
 Frame = +2

Query  647  EDLIP-GASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNLSNSFVKDVTSVVSVGQEVTVR  823
            ED  P G+   GKVK +  +GAFV+     +GLVH+S +++  +     V+S GQEV V+
Sbjct  267  EDKAPKGSVHDGKVKRLVSYGAFVEVLPGVEGLVHISQIAHKHIGTPHEVLSEGQEVQVK  326

Query  824  LLEANMETGRISLTMRESDETSREK------QPKDSPGSS  925
            +L+ N E  R+SL+++E  E  RE+       P++S G S
Sbjct  327  VLDVNKEDKRLSLSIKELQEKEREQDFSNYEMPEESSGFS  366



>ref|WP_039313628.1| 30S ribosomal protein S1 [Clostridium baratii]
 gb|AIY85005.1| S1 RNA binding domain protein [Clostridium baratii str. Sullivan]
Length=378

 Score = 94.7 bits (234),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 64/192 (33%), Positives = 99/192 (52%), Gaps = 34/192 (18%)
 Frame = +2

Query  659   PGASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNLSNSFVKDVTSVVSVGQEVTVRLLEAN  838
             PG    G VK++  FGAFVD G    GLVH+++L+   VK VT VV++G EV V +   +
Sbjct  193   PGEKRKGVVKNVVKFGAFVDIGG-VQGLVHINDLAWERVKKVTDVVNIGDEVEVYVGNVD  251

Query  839   METGRISLTMRESDETSREKQPKDSPGSSDKSRAPKRTPQRNNQRRESKFVKGQDLEGTV  1018
              E  ++SL +++++     K+P    G S K                     G  LEGTV
Sbjct  252   KENRKLSLILKDNN-----KEPWAVHGDSMKV--------------------GDTLEGTV  286

Query  1019  KNLTRSGAFISLPEGEEGFLPTSEMADEGLG---EIMGGSSLQVGQEVSVRVLRISRGQA  1189
               LT  GAF+ + +G EG +  SE+ DE +    E+     L++GQ+V V+VL + +   
Sbjct  287   VRLTSFGAFVEVFKGIEGLVHISEITDENIAKPEEV-----LKIGQKVKVKVLNVDKASK  341

Query  1190  TLTMKKEEATEE  1225
              L +  ++A E+
Sbjct  342   KLALSIKDAAEK  353



>ref|WP_031417967.1| 30S ribosomal protein S1 [Lysinibacillus sphaericus]
Length=378

 Score = 94.7 bits (234),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 67/187 (36%), Positives = 98/187 (52%), Gaps = 28/187 (15%)
 Frame = +2

Query  662   GASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNLSNSFVKDVTSVVSVGQEVTVRLLEANM  841
             G    GKV+ +  FGAF+D G   DGLVH+S +S+  V DV+ V+S GQ VTV++L  + 
Sbjct  187   GDVLDGKVQRLASFGAFIDLGG-IDGLVHISQVSHEHVSDVSEVLSEGQGVTVKVLSVDP  245

Query  842   ETGRISLTMRESDETSREKQPKDSPGSSDKSRAPKRTPQRNNQRRESKFVKGQDLEGTVK  1021
             E  RISL+++E+            PG           P  N + R +   KG  LEG VK
Sbjct  246   ENERISLSIKET-----------IPG-----------PWSNIEERAA---KGTILEGKVK  280

Query  1022  NLTRSGAFISLPEGEEGFLPTSEMADEGLGEIMGGSSLQVGQEVSVRVLRISRGQATLTM  1201
              LT  GAF+ +  G EG +  S++A + +       +L+ GQEV V+VL ++     L +
Sbjct  281   RLTSFGAFVEVFPGVEGLVHISQIAHKHIN--TPHEALKEGQEVQVKVLDVNAEDGRLAL  338

Query  1202  KKEEATE  1222
               +E  E
Sbjct  339   SIKELLE  345



>ref|WP_021726717.1| S1 RNA binding domain protein [Olsenella profusa]
 gb|ERL06978.1| S1 RNA binding domain protein [Olsenella profusa F0195]
Length=388

 Score = 94.0 bits (232),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 67/186 (36%), Positives = 96/186 (52%), Gaps = 30/186 (16%)
 Frame = +2

Query  653   LIPGASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNLSNSFVKDVTSVVSVGQEVTVRLLE  832
             L PG    G V SI  FGAFVD G   DGL+H+S LS + V   + VV VGQEV V++L+
Sbjct  204   LQPGMRLKGTVSSIVDFGAFVDLGGI-DGLIHISELSWNHVNHPSEVVKVGQEVEVQVLD  262

Query  833   ANMETGRISLTMRESDETSREKQPKDSPGSSDKSRAPKRTPQRNNQRRESKFVKGQDLEG  1012
              ++   RISL ++++ E                   P RT  +       K+  G  +EG
Sbjct  263   VDLNRERISLGLKQTTED------------------PWRTLVK-------KYPVGAIVEG  297

Query  1013  TVKNLTRSGAFISLPEGEEGFLPTSEMADEGLGEIMGGSSLQVGQEVSVRVLRI--SRGQ  1186
             TV  L   GAF+ L +G EG +  SEMA++ + +        VG +V V+V+ I   R +
Sbjct  298   TVTKLVTFGAFVDLGDGVEGLVHISEMANKHVDQ--PSQVCSVGDKVQVKVMEIDLDRRR  355

Query  1187  ATLTMK  1204
              +L+MK
Sbjct  356   ISLSMK  361


 Score = 65.5 bits (158),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 32/75 (43%), Positives = 48/75 (64%), Gaps = 0/75 (0%)
 Frame = +2

Query  662  GASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNLSNSFVKDVTSVVSVGQEVTVRLLEANM  841
            GA   G V  +  FGAFVD G   +GLVH+S ++N  V   + V SVG +V V+++E ++
Sbjct  292  GAIVEGTVTKLVTFGAFVDLGDGVEGLVHISEMANKHVDQPSQVCSVGDKVQVKVMEIDL  351

Query  842  ETGRISLTMRESDET  886
            +  RISL+M+ + ET
Sbjct  352  DRRRISLSMKSAAET  366



>ref|WP_004435313.1| 30S ribosomal protein S1 [Bacillus methanolicus]
 gb|EIJ83321.1| 30S ribosomal protein S1 [Bacillus methanolicus MGA3]
 gb|AIE60565.1| 30S ribosomal protein S1 [Bacillus methanolicus MGA3]
Length=379

 Score = 93.6 bits (231),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 65/192 (34%), Positives = 100/192 (52%), Gaps = 28/192 (15%)
 Frame = +2

Query  647   EDLIPGASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNLSNSFVKDVTSVVSVGQEVTVRL  826
             E L PG    G ++ I  FGAFVD G   DGLVH+S LS+  V+  + VV  GQ+V V++
Sbjct  183   ESLQPGQVLEGTIQRITDFGAFVDIGG-VDGLVHISQLSHQHVEKPSDVVEEGQKVNVKV  241

Query  827   LEANMETGRISLTMRESDETSREKQPKDSPGSSDKSRAPKRTPQRNNQRRESKFVKGQDL  1006
             L  + +  RISL+++E+        P   P ++   +AP                KG  L
Sbjct  242   LSVDRDNNRISLSIKET-------LP--GPWTNISEKAP----------------KGSVL  276

Query  1007  EGTVKNLTRSGAFISLPEGEEGFLPTSEMADEGLGEIMGGSSLQVGQEVSVRVLRISRGQ  1186
             EGTVK +   GAF+ +  G EG +  S+++ + +G       L+ GQ+V V+VL ++  Q
Sbjct  277   EGTVKRIVSYGAFVEVFSGVEGLVHISQISHKHIG--TPHEVLKEGQKVQVKVLDVNEEQ  334

Query  1187  ATLTMKKEEATE  1222
               L++  +E  E
Sbjct  335   QRLSLSIKELQE  346



>ref|WP_012293606.1| 30S ribosomal protein S1 [Lysinibacillus sphaericus]
 ref|YP_001697640.1| 30S ribosomal protein S1 [Lysinibacillus sphaericus C3-41]
 gb|ACA39510.1| 30S ribosomal protein S1-like protein [Lysinibacillus sphaericus 
C3-41]
 gb|EWH33612.1| 30S ribosomal protein S1 [Lysinibacillus sphaericus CBAM5]
Length=378

 Score = 93.2 bits (230),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 66/187 (35%), Positives = 98/187 (52%), Gaps = 28/187 (15%)
 Frame = +2

Query  662   GASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNLSNSFVKDVTSVVSVGQEVTVRLLEANM  841
             G    GKV+ +  FGAF+D G   DGLVH+S +S+  V DV+ V+S GQ VTV++L  + 
Sbjct  187   GDVLDGKVQRLASFGAFIDLGG-IDGLVHISQVSHEHVSDVSEVLSEGQGVTVKVLSVDP  245

Query  842   ETGRISLTMRESDETSREKQPKDSPGSSDKSRAPKRTPQRNNQRRESKFVKGQDLEGTVK  1021
             E  RISL+++E+            PG           P  N + R +   KG  LEG VK
Sbjct  246   ENERISLSIKET-----------IPG-----------PWSNIEERAA---KGTILEGKVK  280

Query  1022  NLTRSGAFISLPEGEEGFLPTSEMADEGLGEIMGGSSLQVGQEVSVRVLRISRGQATLTM  1201
              LT  GAF+ +  G EG +  S++A + +       +L+ GQ+V V+VL ++     L +
Sbjct  281   RLTSFGAFVEVFPGVEGLVHISQIAHKHIN--TPHEALKEGQDVQVKVLDVNAEDGRLAL  338

Query  1202  KKEEATE  1222
               +E  E
Sbjct  339   SIKELLE  345



>ref|WP_032110940.1| 30S ribosomal protein S1 [bacterium OL-1]
Length=398

 Score = 93.6 bits (231),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 69/186 (37%), Positives = 92/186 (49%), Gaps = 30/186 (16%)
 Frame = +2

Query  653   LIPGASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNLSNSFVKDVTSVVSVGQEVTVRLLE  832
             L PG    G V SI  FGAFVD G   DGLVH+S LS + V   + VV VGQEV V++L+
Sbjct  204   LKPGMRLKGTVSSIVDFGAFVDLGGI-DGLVHISELSWNHVNHPSEVVKVGQEVEVQVLD  262

Query  833   ANMETGRISLTMRESDETSREKQPKDSPGSSDKSRAPKRTPQRNNQRRESKFVKGQDLEG  1012
              ++   RISL ++++ E                   P RT  +       K+  G  +EG
Sbjct  263   VDLNRERISLGLKQTTED------------------PWRTLVK-------KYPVGAIVEG  297

Query  1013  TVKNLTRSGAFISLPEGEEGFLPTSEMADEGLGEIMGGSSLQVGQEVSVRVLRI--SRGQ  1186
              V  L   GAF+ L EG EG +  SEMA   +         QVG  V V+V+ I   R +
Sbjct  298   KVTKLVTFGAFVDLGEGVEGLVHISEMAKSHVD--APSQVCQVGDTVQVKVMEIDLDRRR  355

Query  1187  ATLTMK  1204
              +L+MK
Sbjct  356   ISLSMK  361


 Score = 64.3 bits (155),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 32/75 (43%), Positives = 47/75 (63%), Gaps = 0/75 (0%)
 Frame = +2

Query  662  GASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNLSNSFVKDVTSVVSVGQEVTVRLLEANM  841
            GA   GKV  +  FGAFVD G   +GLVH+S ++ S V   + V  VG  V V+++E ++
Sbjct  292  GAIVEGKVTKLVTFGAFVDLGEGVEGLVHISEMAKSHVDAPSQVCQVGDTVQVKVMEIDL  351

Query  842  ETGRISLTMRESDET  886
            +  RISL+M+ + ET
Sbjct  352  DRRRISLSMKAAAET  366



>ref|WP_012190631.1| RNA-binding S1 domain-containing protein [Herpetosiphon aurantiacus]
 ref|YP_001545861.1| RNA-binding S1 domain-containing protein [Herpetosiphon aurantiacus 
DSM 785]
 gb|ABX05733.1| RNA binding S1 domain protein [Herpetosiphon aurantiacus DSM 
785]
Length=501

 Score = 94.4 bits (233),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 64/197 (32%), Positives = 100/197 (51%), Gaps = 17/197 (9%)
 Frame = +2

Query  635   PIKNEDLIPGASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNLSNSFVKDVTSVVSVGQEV  814
             P +  DL  G    GKV S   +G FVD G   DGLVH+S +S+  ++  T VV +G  V
Sbjct  96    PRRLADLHAGMELDGKVTSTALYGVFVDIGVGRDGLVHISEMSDQRIESPTDVVQIGDIV  155

Query  815   TVRLLEANMETGRISLTMRESDETSREKQPKDSPGSSDKSRAPKRTPQRNNQRRESKFVK  994
              VR+   + +  RISLTMR             SP S  + RAPKR P+ NN +   +   
Sbjct  156   KVRVKSVDPDARRISLTMR-------------SPRSEGRRRAPKR-PEVNNDKL-GELKP  200

Query  995   GQDLEGTVKNLTRSGAFISLPEGEEGFLPTSEMADEGLGEIMGGSSLQVGQEVSVRVLRI  1174
             G  ++GTV  +   G F+ +  G++G +  SE+++  + +     ++ VGQ  + RVL +
Sbjct  201   GDLVDGTVNGIAPFGVFVDIGVGKDGLVHISELSENRVEKAE--DAVTVGQSYTFRVLEV  258

Query  1175  SRGQATLTMKKEEATEE  1225
               G   +++    A E+
Sbjct  259   DTGAQRISLSLRRAKED  275


 Score = 86.3 bits (212),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 78/223 (35%), Positives = 110/223 (49%), Gaps = 30/223 (13%)
 Frame = +2

Query  632   PPIKNE---DLIPGASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNLSNSFVKDVTSVVSV  802
             P + N+   +L PG    G V  I PFG FVD G   DGLVH+S LS + V+     V+V
Sbjct  188   PEVNNDKLGELKPGDLVDGTVNGIAPFGVFVDIGVGKDGLVHISELSENRVEKAEDAVTV  247

Query  803   GQEVTVRLLEANMETGRISLTMRESDETSREKQPKDSPGSSDKSRAPKRTPQRNNQRRES  982
             GQ  T R+LE +    RISL++R + E  +E+ PK          AP+        RRE 
Sbjct  248   GQSYTFRVLEVDTGAQRISLSLRRAKEDFQER-PK----------APR--------RREV  288

Query  983   KF---VKGQDLEGTVKNLTRSGAFISLPEGEEGFLPTSEMADEGLGEIMGGSSLQVGQEV  1153
                    G  L+G V  +   GAF+ L  G +G +  SE++ EG         ++VG  V
Sbjct  289   NLDVIAPGTVLDGKVSGIAPFGAFVDLGVGRDGLVHISELS-EGR-VGKVDDVVKVGDPV  346

Query  1154  SVRVLRI--SRGQATLTMKKEEA-TEEVNSVLSQGVIHKATNP  1273
              VRVL +     + +LTM+ EEA T  +++  S  +    TNP
Sbjct  347   KVRVLEVDPDSKRISLTMRVEEAPTTPISTSGSSRLDRDWTNP  389



>ref|WP_016427428.1| 30S ribosomal protein S1 [Paenisporosarcina sp. HGH0030]
 gb|EPD53187.1| ribosomal protein S1 [Paenisporosarcina sp. HGH0030]
Length=379

 Score = 93.2 bits (230),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 66/192 (34%), Positives = 100/192 (52%), Gaps = 34/192 (18%)
 Frame = +2

Query  659   PGASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNLSNSFVKDVTSVVSVGQEVTVRLLEAN  838
             PG   TG V+ I  FGAFVD G   DGLVH+S LS+  V+ V+ V+  GQEV V++L  +
Sbjct  187   PGDELTGTVQRIAAFGAFVDLGG-VDGLVHISQLSHEHVEQVSDVIQEGQEVKVKVLSVD  245

Query  839   METGRISLTMRESDETSREKQPKDSPGSSDKSRAPKRTPQRNNQRRESKFVKGQDLEGTV  1018
              ++ RISL+++++        P    G  DK  AP+ +                   GTV
Sbjct  246   RDSERISLSIKDT-------LPGPWEGIEDK--APRGSVHT----------------GTV  280

Query  1019  KNLTRSGAFISLPEGEEGFLPTSEMADEGLG---EIMGGSSLQVGQEVSVRVLRISRGQA  1189
             K L   GAFI +  G EG +  S++A   +G   E+     L+ GQEV V+VL +++   
Sbjct  281   KRLVSYGAFIEVFPGIEGLVHISQIAHSHIGTPHEV-----LKDGQEVQVKVLDVNKQDK  335

Query  1190  TLTMKKEEATEE  1225
              L++  ++  E+
Sbjct  336   RLSLSIKDLLEK  347


 Score = 53.5 bits (127),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 28/77 (36%), Positives = 49/77 (64%), Gaps = 1/77 (1%)
 Frame = +2

Query  647  EDLIP-GASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNLSNSFVKDVTSVVSVGQEVTVR  823
            ED  P G+  TG VK +  +GAF++     +GLVH+S +++S +     V+  GQEV V+
Sbjct  267  EDKAPRGSVHTGTVKRLVSYGAFIEVFPGIEGLVHISQIAHSHIGTPHEVLKDGQEVQVK  326

Query  824  LLEANMETGRISLTMRE  874
            +L+ N +  R+SL++++
Sbjct  327  VLDVNKQDKRLSLSIKD  343



>ref|WP_025746549.1| hypothetical protein [Caldicoprobacter oshimai]
Length=727

 Score = 95.1 bits (235),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 65/188 (35%), Positives = 91/188 (48%), Gaps = 28/188 (15%)
 Frame = +2

Query  662   GASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNLSNSFVKDVTSVVSVGQEVTVRLLEANM  841
             G   TG VK +  FGAFVD G   DGLVH+S+LS   +     VV   Q +TVR+L  + 
Sbjct  531   GQVITGTVKRLTDFGAFVDIGG-VDGLVHISDLSWGHIGHPREVVQENQTITVRVLSVDR  589

Query  842   ETGRISLTMRESDETSREKQPKDSPGSSDKSRAPKRTPQRNNQRRESKFVKGQDLEGTVK  1021
             E GRI+L  +++       QP D+ G                     K+  G  + G V 
Sbjct  590   ERGRIALGYKQT-----LPQPWDNVG--------------------EKYHIGDVVTGKVV  624

Query  1022  NLTRSGAFISLPEGEEGFLPTSEMADEGLGEIMGGSSLQVGQEVSVRVLRISRGQATLTM  1201
              LT  GAF+ L  G +G +  SE+AD  +  +     LQVGQ VSV++L +   Q  +++
Sbjct  625   RLTHFGAFVELEPGVDGLVHISEVADRHVNRV--ADVLQVGQMVSVKILDVKPEQRRISL  682

Query  1202  KKEEATEE  1225
                EA  E
Sbjct  683   SIREALRE  690


 Score = 65.5 bits (158),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 34/80 (43%), Positives = 49/80 (61%), Gaps = 0/80 (0%)
 Frame = +2

Query  662  GASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNLSNSFVKDVTSVVSVGQEVTVRLLEANM  841
            G   TGKV  +  FGAFV+     DGLVH+S +++  V  V  V+ VGQ V+V++L+   
Sbjct  616  GDVVTGKVVRLTHFGAFVELEPGVDGLVHISEVADRHVNRVADVLQVGQMVSVKILDVKP  675

Query  842  ETGRISLTMRESDETSREKQ  901
            E  RISL++RE+     EK+
Sbjct  676  EQRRISLSIREALREQEEKE  695



>ref|WP_036126780.1| 30S ribosomal protein S1 [Lysinibacillus sphaericus]
Length=378

 Score = 92.8 bits (229),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 65/187 (35%), Positives = 99/187 (53%), Gaps = 28/187 (15%)
 Frame = +2

Query  662   GASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNLSNSFVKDVTSVVSVGQEVTVRLLEANM  841
             G    GKV+ +  FGAF+D G   DGLVH+S +S+  V DV+ V++ GQ+V V++L  + 
Sbjct  187   GEVLDGKVQRLASFGAFIDLGG-IDGLVHISQVSHEHVNDVSEVLAEGQDVKVKVLSVDP  245

Query  842   ETGRISLTMRESDETSREKQPKDSPGSSDKSRAPKRTPQRNNQRRESKFVKGQDLEGTVK  1021
             E  RISL+++E+        P   P SS + RA                 KG  L+G VK
Sbjct  246   ENERISLSIKET-------MP--GPWSSIEERAA----------------KGTILDGRVK  280

Query  1022  NLTRSGAFISLPEGEEGFLPTSEMADEGLGEIMGGSSLQVGQEVSVRVLRISRGQATLTM  1201
              LT  GAF+ +  G EG +  S++A + +       +L+ GQEV V+VL ++  +  L +
Sbjct  281   RLTSFGAFVEVFPGVEGLVHISQIAHKHIN--TPHEALKEGQEVQVKVLDVNAEEGRLAL  338

Query  1202  KKEEATE  1222
               +E  E
Sbjct  339   SIKELLE  345



>ref|XP_005768711.1| hypothetical protein EMIHUDRAFT_436544 [Emiliania huxleyi CCMP1516]
 gb|EOD16282.1| hypothetical protein EMIHUDRAFT_436544 [Emiliania huxleyi CCMP1516]
Length=327

 Score = 92.0 bits (227),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 60/185 (32%), Positives = 100/185 (54%), Gaps = 23/185 (12%)
 Frame = +2

Query  662   GASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNLSNSFVKDVTSVVSVGQEVTVRLLEANM  841
             G++  G V+S+Q +GAFVD G  +DGL+HVS ++++FVKD   + +VG  VTVR+   ++
Sbjct  82    GSTVEGTVRSVQQYGAFVDIGFASDGLLHVSEMADTFVKDANDMFAVGDAVTVRVKSVDL  141

Query  842   ETGRISLTMRESDETSREKQPKDSPGSSDKSRAPKRTPQRNNQRRESKFVKGQDLE---G  1012
               G+++L+          K P         +  P    Q+      S+F    + E   G
Sbjct  142   AKGQVALS---------NKDP--------NAPPPPPRRQKREAADLSEFASADEKEFRTG  184

Query  1013  TVKNLTRSGAFISLPEGEEGFLPTSEMADEGLGEIMGGSSLQVGQEVSVRVLRI-SRGQA  1189
             TV+++   GAF++L +G +G L  SE+ + G+  +   + L  GQEV VRV+    + + 
Sbjct  185   TVRSIQSFGAFVNLKDGVDGLLHISEIKEGGVESV--AAELSEGQEVQVRVVSFDDKRRI  242

Query  1190  TLTMK  1204
              L+MK
Sbjct  243   GLSMK  247



>ref|WP_009370802.1| 30S ribosomal protein S1 [Lysinibacillus fusiformis]
 gb|EKU43963.1| 30S ribosomal protein S1-like protein [Lysinibacillus fusiformis 
ZB2]
Length=378

 Score = 92.8 bits (229),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 64/187 (34%), Positives = 99/187 (53%), Gaps = 28/187 (15%)
 Frame = +2

Query  662   GASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNLSNSFVKDVTSVVSVGQEVTVRLLEANM  841
             G    GKV+ +  FGAF+D G   DGLVH+S +S+  V DV+ V++ GQ+V V++L  + 
Sbjct  187   GDVLDGKVQRLASFGAFIDLGG-IDGLVHISQVSHEHVSDVSEVLAEGQDVKVKVLSVDP  245

Query  842   ETGRISLTMRESDETSREKQPKDSPGSSDKSRAPKRTPQRNNQRRESKFVKGQDLEGTVK  1021
             E  RISL+++E+            PG           P  N + R +   KG  L+G VK
Sbjct  246   ENERISLSIKET-----------IPG-----------PWSNIEERAA---KGTILDGRVK  280

Query  1022  NLTRSGAFISLPEGEEGFLPTSEMADEGLGEIMGGSSLQVGQEVSVRVLRISRGQATLTM  1201
              LT  GAF+ +  G EG +  S++A + +       +L+ GQEV V+VL ++  +  L +
Sbjct  281   RLTSFGAFVEVFPGVEGLVHISQIAHKHIN--TPHEALKEGQEVQVKVLDVNADEGRLAL  338

Query  1202  KKEEATE  1222
               +E  E
Sbjct  339   SIKELLE  345



>ref|WP_023942709.1| 30S ribosomal protein S1 [Streptococcus mitis]
 gb|ETD97237.1| 30S ribosomal protein S1 [Streptococcus mitis 21/39]
Length=400

 Score = 92.8 bits (229),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 64/177 (36%), Positives = 98/177 (55%), Gaps = 32/177 (18%)
 Frame = +2

Query  653   LIPGASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNLSNSFVKDVT--SVVSVGQEVTVRL  826
             L  G   TGKV  I  FGAF+D G   DGLVH++ LS+   ++V+  SVV+VG+E+ V++
Sbjct  191   LAVGDVVTGKVARITSFGAFIDLGG-VDGLVHLTELSHE--RNVSPKSVVTVGEEIEVKI  247

Query  827   LEANMETGRISLTMRESDETSREKQPKDSPGSSDKSRAPKRTPQRNNQRRESKFVKGQDL  1006
             L+ N E GR+SL+++ +           +PG  D                E K  KG  +
Sbjct  248   LDLNEEEGRVSLSLKAT-----------TPGPWDGV--------------EQKLAKGDVV  282

Query  1007  EGTVKNLTRSGAFISLPEGEEGFLPTSEMADEGLGEIMGGSSLQVGQEVSVRVLRIS  1177
             EGTVK LT  GAF+ +  G +G +  S+++ + +       +L+VGQEV V+VL ++
Sbjct  283   EGTVKRLTDFGAFVEVLPGIDGLVHVSQISHKRIEN--AKEALKVGQEVKVKVLEVN  337


 Score = 59.3 bits (142),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 31/77 (40%), Positives = 47/77 (61%), Gaps = 0/77 (0%)
 Frame = +2

Query  653  LIPGASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNLSNSFVKDVTSVVSVGQEVTVRLLE  832
            L  G    G VK +  FGAFV+     DGLVHVS +S+  +++    + VGQEV V++LE
Sbjct  276  LAKGDVVEGTVKRLTDFGAFVEVLPGIDGLVHVSQISHKRIENAKEALKVGQEVKVKVLE  335

Query  833  ANMETGRISLTMRESDE  883
             N +  R+SL+++  +E
Sbjct  336  VNADAERVSLSIKALEE  352



>ref|WP_019238298.1| 30S ribosomal protein S1 [Collinsella sp. GD3]
Length=388

 Score = 92.8 bits (229),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 66/186 (35%), Positives = 91/186 (49%), Gaps = 30/186 (16%)
 Frame = +2

Query  653   LIPGASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNLSNSFVKDVTSVVSVGQEVTVRLLE  832
             L PG    G V SI  FGAFVD G   DGLVH+S LS + V   + VV VGQE+ V +L+
Sbjct  205   LKPGMRLRGTVSSIVDFGAFVDLGGI-DGLVHISELSWNHVNHPSEVVKVGQEIEVEVLD  263

Query  833   ANMETGRISLTMRESDETSREKQPKDSPGSSDKSRAPKRTPQRNNQRRESKFVKGQDLEG  1012
              ++   RISL ++++ E       K  P                          G  +EG
Sbjct  264   VDLNRERISLGLKQTTEDPWHALVKKYP-------------------------VGAIVEG  298

Query  1013  TVKNLTRSGAFISLPEGEEGFLPTSEMADEGLGEIMGGSSLQVGQEVSVRVLRI--SRGQ  1186
             TV  L   GAF+ L EG EG +  SEMA++ + +        VG +V V+V+ I   R +
Sbjct  299   TVTKLVPFGAFVDLGEGIEGLVHISEMANKHVDQ--PSQVTHVGAKVQVKVMEIELDRRR  356

Query  1187  ATLTMK  1204
              +L+MK
Sbjct  357   ISLSMK  362


 Score = 67.0 bits (162),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 36/88 (41%), Positives = 51/88 (58%), Gaps = 3/88 (3%)
 Frame = +2

Query  662  GASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNLSNSFVKDVTSVVSVGQEVTVRLLEANM  841
            GA   G V  + PFGAFVD G   +GLVH+S ++N  V   + V  VG +V V+++E  +
Sbjct  293  GAIVEGTVTKLVPFGAFVDLGEGIEGLVHISEMANKHVDQPSQVTHVGAKVQVKVMEIEL  352

Query  842  ETGRISLTMRESDET---SREKQPKDSP  916
            +  RISL+M+ + ET     E  P D P
Sbjct  353  DRRRISLSMKSAAETLGVEIEVAPLDKP  380



>ref|WP_004232600.1| 30S ribosomal protein S1 [Lysinibacillus fusiformis]
 gb|EFI66731.1| 30S ribosomal protein S1-like protein [Lysinibacillus fusiformis 
ZC1]
Length=378

 Score = 92.4 bits (228),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 64/187 (34%), Positives = 99/187 (53%), Gaps = 28/187 (15%)
 Frame = +2

Query  662   GASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNLSNSFVKDVTSVVSVGQEVTVRLLEANM  841
             G    GKV+ +  FGAF+D G   DGLVH+S +S+  V DV+ V++ GQ+V V++L  + 
Sbjct  187   GDVLDGKVQRLASFGAFIDLGG-IDGLVHISQVSHEHVSDVSEVLAEGQDVKVKVLSVDP  245

Query  842   ETGRISLTMRESDETSREKQPKDSPGSSDKSRAPKRTPQRNNQRRESKFVKGQDLEGTVK  1021
             E  RISL+++E+            PG           P  N + R +   KG  L+G VK
Sbjct  246   ENERISLSIKET-----------IPG-----------PWSNIEERAA---KGTILDGRVK  280

Query  1022  NLTRSGAFISLPEGEEGFLPTSEMADEGLGEIMGGSSLQVGQEVSVRVLRISRGQATLTM  1201
              LT  GAF+ +  G EG +  S++A + +       +L+ GQEV V+VL ++  +  L +
Sbjct  281   RLTSFGAFVEVFPGVEGLVHISQIAHKHIN--TPHEALKEGQEVQVKVLDVNADEGRLAL  338

Query  1202  KKEEATE  1222
               +E  E
Sbjct  339   SIKELLE  345



>ref|WP_004437410.1| 30S ribosomal protein S1 [Bacillus methanolicus]
 gb|EIJ78699.1| 30S ribosomal protein S1 [Bacillus methanolicus PB1]
Length=379

 Score = 92.4 bits (228),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 66/192 (34%), Positives = 99/192 (52%), Gaps = 28/192 (15%)
 Frame = +2

Query  647   EDLIPGASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNLSNSFVKDVTSVVSVGQEVTVRL  826
             E L PG    G ++ I  FGAFVD G   DGLVH+S LS+  V+  + VV  GQ+V V++
Sbjct  183   ESLQPGQVLEGTIQRITDFGAFVDIGGI-DGLVHISQLSHQHVEKPSDVVEEGQKVNVKV  241

Query  827   LEANMETGRISLTMRESDETSREKQPKDSPGSSDKSRAPKRTPQRNNQRRESKFVKGQDL  1006
             L  + +  RISL+++E+        P   P ++   +AP                KG  L
Sbjct  242   LSVDRDKDRISLSIKET-------LP--GPWTNISEKAP----------------KGSIL  276

Query  1007  EGTVKNLTRSGAFISLPEGEEGFLPTSEMADEGLGEIMGGSSLQVGQEVSVRVLRISRGQ  1186
             EGTVK L   GAF+ +  G EG +  S+++ + +G       L+ GQ V V+VL ++  Q
Sbjct  277   EGTVKRLISYGAFVEVFPGVEGLVHISQISHKHIG--TPHEVLKEGQTVQVKVLDVNEEQ  334

Query  1187  ATLTMKKEEATE  1222
               L++  +E  E
Sbjct  335   QRLSLSIKELQE  346



>ref|WP_004251536.1| RNA binding S1 domain-containing protein [Thauera sp. 63]
 gb|ENO80271.1| RNA binding S1 domain-containing protein [Thauera sp. 63]
Length=784

 Score = 94.7 bits (234),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 53/122 (43%), Positives = 72/122 (59%), Gaps = 11/122 (9%)
 Frame = +2

Query  647  EDLIPGASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNLSNSFVKDVTSVVSVGQEVTVRL  826
            +DL PG    G V ++  FGAFVD G   DGLVH+S LSN+FVKD  SVV  GQ V V++
Sbjct  645  KDLQPGMLLEGVVTNVTNFGAFVDIGVHQDGLVHISALSNTFVKDPHSVVKAGQVVKVKV  704

Query  827  LEANMETGRISLTMRESDE-TSREKQP----------KDSPGSSDKSRAPKRTPQRNNQR  973
            LE ++   RI+LTMR SDE  +R  +P          +D  G+S + R+  + P+R    
Sbjct  705  LEVDIPRNRIALTMRMSDEPAARRAEPGGRSARSGDSQDRGGNSARPRSAAQAPRREQND  764

Query  974  RE  979
            R+
Sbjct  765  RQ  766



>ref|WP_016893866.1| 30S ribosomal protein S1, partial [Streptococcus sp. GMD5S]
Length=242

 Score = 90.9 bits (224),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 63/175 (36%), Positives = 94/175 (54%), Gaps = 28/175 (16%)
 Frame = +2

Query  653   LIPGASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNLSNSFVKDVTSVVSVGQEVTVRLLE  832
             L  G   TGKV  I  FGAF+D G   DGLVH++ LS+       SVV+VG+E+ V++L+
Sbjct  33    LAVGDVVTGKVARITSFGAFIDLGG-VDGLVHLTELSHERNVSPKSVVTVGEEIEVKILD  91

Query  833   ANMETGRISLTMRESDETSREKQPKDSPGSSDKSRAPKRTPQRNNQRRESKFVKGQDLEG  1012
              N E GR+SL+++ +           +PG  D                E K  KG  +EG
Sbjct  92    LNEEEGRVSLSLKAT-----------TPGPWDGV--------------EQKLAKGDVVEG  126

Query  1013  TVKNLTRSGAFISLPEGEEGFLPTSEMADEGLGEIMGGSSLQVGQEVSVRVLRIS  1177
             TVK LT  GAF+ +  G +G +  S+++ + +       +L VGQEV+V+VL ++
Sbjct  127   TVKRLTDFGAFVEVLPGIDGLVHVSQISHKRIENPK--EALTVGQEVTVKVLDVN  179


 Score = 60.1 bits (144),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 31/77 (40%), Positives = 49/77 (64%), Gaps = 0/77 (0%)
 Frame = +2

Query  653  LIPGASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNLSNSFVKDVTSVVSVGQEVTVRLLE  832
            L  G    G VK +  FGAFV+     DGLVHVS +S+  +++    ++VGQEVTV++L+
Sbjct  118  LAKGDVVEGTVKRLTDFGAFVEVLPGIDGLVHVSQISHKRIENPKEALTVGQEVTVKVLD  177

Query  833  ANMETGRISLTMRESDE  883
             N +  R+SL+++  +E
Sbjct  178  VNADAERVSLSIKALEE  194



>ref|WP_016993346.1| 30S ribosomal protein S1 [Lysinibacillus boronitolerans]
 gb|KGR81095.1| 30S ribosomal protein S1 [Lysinibacillus boronitolerans JCM 21713 
= 10a = NBRC 103108]
Length=378

 Score = 92.4 bits (228),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 64/187 (34%), Positives = 99/187 (53%), Gaps = 28/187 (15%)
 Frame = +2

Query  662   GASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNLSNSFVKDVTSVVSVGQEVTVRLLEANM  841
             G    GKV+ +  FGAF+D G   DGLVH+S +S+  V DV+ V++ GQ+V V++L  + 
Sbjct  187   GDVLDGKVQRLASFGAFIDLGG-IDGLVHISQVSHEHVSDVSEVLAEGQDVKVKVLSVDP  245

Query  842   ETGRISLTMRESDETSREKQPKDSPGSSDKSRAPKRTPQRNNQRRESKFVKGQDLEGTVK  1021
             E  RISL+++E+            PG           P  N + R +   KG  L+G VK
Sbjct  246   ENERISLSIKET-----------IPG-----------PWSNIEERAA---KGTILDGRVK  280

Query  1022  NLTRSGAFISLPEGEEGFLPTSEMADEGLGEIMGGSSLQVGQEVSVRVLRISRGQATLTM  1201
              LT  GAF+ +  G EG +  S++A + +       +L+ GQEV V+VL ++  +  L +
Sbjct  281   RLTSFGAFVEVFPGVEGLVHISQIAHKHIN--TPHEALKEGQEVQVKVLDVNAEEGRLAL  338

Query  1202  KKEEATE  1222
               +E  E
Sbjct  339   SIKELLE  345



>ref|WP_008446212.1| 30S ribosomal protein S1 [Janthinobacterium sp. HH01]
 gb|ELX13188.1| 30S ribosomal protein S1 [Janthinobacterium sp. HH01]
Length=562

 Score = 94.0 bits (232),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 75/226 (33%), Positives = 110/226 (49%), Gaps = 33/226 (15%)
 Frame = +2

Query  647   EDLIPGASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNLSNSFVKDVTSVVSVGQEVTVRL  826
             E L  G   TG VK+I  +GAFVD G   DGL+H+++L+   V+  + V++VGQE+T ++
Sbjct  189   ETLKEGTVVTGVVKNITDYGAFVDLGGI-DGLLHITDLAWRRVRHPSEVLTVGQEITAKV  247

Query  827   LEANMETGRISLTMRESDETSREKQPKDSPGSSDKSRAPKRTPQRNNQRRESKFVKGQDL  1006
             L+ + E  R+SL +         KQ  D P +       +R PQ            G  L
Sbjct  248   LKYDQEKNRVSLGV---------KQLGDDPWTG----LSRRYPQ------------GTRL  282

Query  1007  EGTVKNLTRSGAFISLPEGEEGFLPTSEMADEGLGEIMGGSSLQVGQEVSVRVLRIS--R  1180
              G V NLT  GAF+ + +G EG +  SEM D     +     +Q+G EV V VL I   R
Sbjct  283   FGKVTNLTDYGAFVEVEQGIEGLVHVSEM-DWTNKNVAPNKVVQLGDEVEVMVLEIDEER  341

Query  1181  GQATLTMKKEEATEEVNSVLSQGVIHKATNPFALAFRKNKEISAFL  1318
              + +L MK+ +A    N     GV HK  +    A +   +   F+
Sbjct  342   RRISLGMKQCKA----NPWDDFGVTHKKGDKVRGAIKSITDFGVFI  383



>ref|WP_036801877.1| 30S ribosomal protein S1 [Planomicrobium glaciei]
 gb|ETP70681.1| 30S ribosomal protein S1 [Planomicrobium glaciei CHR43]
Length=381

 Score = 92.4 bits (228),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 65/192 (34%), Positives = 100/192 (52%), Gaps = 38/192 (20%)
 Frame = +2

Query  662   GASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNLSNSFVKDVTSVVSVGQEVTVRLLEANM  841
             G    GKV+ I  FGAFVD G   DGLVH+S LS+  V+ V+ VV+ GQEVTV++L  + 
Sbjct  188   GDVLKGKVQRIASFGAFVDIGG-VDGLVHISQLSHEHVEKVSDVVTEGQEVTVKVLSVDR  246

Query  842   ETGRISLTMRESDETSREKQPKDSPGSSD--KSRAPKRTPQRNNQRRESKFVKGQDLEGT  1015
             ++ RISL+++++            PG  D  + +AP                KG   +G 
Sbjct  247   DSERISLSIKDT-----------LPGPWDAIEEKAP----------------KGSVHDGK  279

Query  1016  VKNLTRSGAFISLPEGEEGFLPTSEMADEGLG---EIMGGSSLQVGQEVSVRVLRISRGQ  1186
             VK +   GAF+ +  G EG +  S++A + +    E+     L  GQEV V+VL +++  
Sbjct  280   VKRIVSYGAFVEVLPGVEGLVHISQIAHKHIATPNEV-----LSEGQEVQVKVLEVNKAD  334

Query  1187  ATLTMKKEEATE  1222
               L++  +E  E
Sbjct  335   KRLSLSIKELQE  346


 Score = 61.6 bits (148),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 35/94 (37%), Positives = 55/94 (59%), Gaps = 6/94 (6%)
 Frame = +2

Query  662  GASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNLSNSFVKDVTSVVSVGQEVTVRLLEANM  841
            G+   GKVK I  +GAFV+     +GLVH+S +++  +     V+S GQEV V++LE N 
Sbjct  273  GSVHDGKVKRIVSYGAFVEVLPGVEGLVHISQIAHKHIATPNEVLSEGQEVQVKVLEVNK  332

Query  842  ETGRISLTMRESDETSREK------QPKDSPGSS  925
               R+SL+++E  E  +E+       P++S G S
Sbjct  333  ADKRLSLSIKELQEKEKEQDYSNYEMPEESSGFS  366



>ref|WP_001851302.1| 40S ribosomal protein S1 [Streptococcus pneumoniae]
 gb|EJG45242.1| 40S ribosomal protein S1 [Streptococcus pneumoniae 2070335]
Length=264

 Score = 90.9 bits (224),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 64/175 (37%), Positives = 93/175 (53%), Gaps = 28/175 (16%)
 Frame = +2

Query  653   LIPGASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNLSNSFVKDVTSVVSVGQEVTVRLLE  832
             L  G   TGKV  I  FGAFVD G   DGLVH++ LS+       SVV+VG+E+ V++L+
Sbjct  55    LAVGDVVTGKVARITSFGAFVDLGG-VDGLVHLTELSHERNVSPKSVVTVGEEIEVKILD  113

Query  833   ANMETGRISLTMRESDETSREKQPKDSPGSSDKSRAPKRTPQRNNQRRESKFVKGQDLEG  1012
              N E GR+SL+++ +            PG  D                E K  KG  +EG
Sbjct  114   LNEEEGRVSLSLKAT-----------VPGPWDGV--------------EQKLAKGDVVEG  148

Query  1013  TVKNLTRSGAFISLPEGEEGFLPTSEMADEGLGEIMGGSSLQVGQEVSVRVLRIS  1177
             TVK LT  GAF+ +  G +G +  S+++ + +       +L+VGQEV V+VL ++
Sbjct  149   TVKRLTDFGAFVEVLPGIDGLVHVSQISHKRIENPK--EALKVGQEVQVKVLEVN  201


 Score = 58.2 bits (139),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 31/79 (39%), Positives = 48/79 (61%), Gaps = 0/79 (0%)
 Frame = +2

Query  647  EDLIPGASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNLSNSFVKDVTSVVSVGQEVTVRL  826
            + L  G    G VK +  FGAFV+     DGLVHVS +S+  +++    + VGQEV V++
Sbjct  138  QKLAKGDVVEGTVKRLTDFGAFVEVLPGIDGLVHVSQISHKRIENPKEALKVGQEVQVKV  197

Query  827  LEANMETGRISLTMRESDE  883
            LE N +  R+SL+++  +E
Sbjct  198  LEVNADAERVSLSIKALEE  216



>ref|WP_028460693.1| 30S ribosomal protein S1 [Nitrosomonas cryotolerans]
Length=571

 Score = 94.0 bits (232),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 66/184 (36%), Positives = 93/184 (51%), Gaps = 29/184 (16%)
 Frame = +2

Query  662   GASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNLSNSFVKDVTSVVSVGQEVTVRLLEANM  841
             GA   G VK+I  +GAFVD G   DGL+H+++L+   VK  + VV++G EVT ++L+ + 
Sbjct  201   GAVVNGIVKNITDYGAFVDLGGI-DGLLHITDLAWRRVKHPSEVVNIGDEVTAKVLKFDQ  259

Query  842   ETGRISLTMRESDETSREKQPKDSPGSSDKSRAPKRTPQRNNQRRESKFVKGQDLEGTVK  1021
             E  R+SL M         KQ  + P      R P+RT                 L G V 
Sbjct  260   EKNRVSLGM---------KQLSEDPWVGLARRYPQRTR----------------LFGKVT  294

Query  1022  NLTRSGAFISLPEGEEGFLPTSEMADEGLGEIMGGSSLQVGQEVSVRVLRIS--RGQATL  1195
             NLT  GAFI + +G EG +  SEM D     +     +Q+G EV V +L I   R + +L
Sbjct  295   NLTDYGAFIEIEQGIEGLVHVSEM-DWTNKNVYPSKIVQLGDEVEVMILEIDEERRRISL  353

Query  1196  TMKK  1207
              MK+
Sbjct  354   GMKQ  357


 Score = 57.8 bits (138),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 54/195 (28%), Positives = 92/195 (47%), Gaps = 30/195 (15%)
 Frame = +2

Query  662   GASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNLSNSF-VKDVTSVVSVGQEVTVRLLEAN  838
             G    G++KSI  FG F+      DGLVH+S+LS S   ++       G EV   +L  +
Sbjct  373   GDKIQGQIKSITDFGVFIGLPGNIDGLVHLSDLSWSHPGEEAVCNYKKGDEVEALILSID  432

Query  839   METGRISLTMRESDETSREKQPKDSPGSSDKSRAPKRTPQRNNQRRESKFVKGQDLEGTV  1018
             +E  RISL +         KQ +  P +S  S   K +                 ++GTV
Sbjct  433   VERERISLGI---------KQLEGDPFNSFVSEHDKNSI----------------IQGTV  467

Query  1019  KNLTRSGAFISLPEGEEGFLPTSEMADEGLGEIMGGSSLQVGQEVSVRVLRISRGQ--AT  1192
             K +   GA I+L +  EG+L  SE++ + + +I   + L+ G  V   ++ I R      
Sbjct  468   KTIDAKGAVIALTDDIEGYLRASEVSRDRVEDIR--THLKEGDPVETMIINIDRKNRAIN  525

Query  1193  LTMKKEEATEEVNSV  1237
             L++K ++ ++E +++
Sbjct  526   LSIKAKDKSDEASAM  540



>ref|WP_024364294.1| 30S ribosomal protein S1 [Lysinibacillus sphaericus]
Length=378

 Score = 92.0 bits (227),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 66/183 (36%), Positives = 96/183 (52%), Gaps = 30/183 (16%)
 Frame = +2

Query  662   GASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNLSNSFVKDVTSVVSVGQEVTVRLLEANM  841
             G    GKV+ I  FGAF+D G   DGLVH+S +S+  V DV+ V+S GQEV V++L  + 
Sbjct  187   GDVLDGKVQRIASFGAFIDLGG-IDGLVHISQVSHEHVSDVSEVLSEGQEVKVKVLSVDP  245

Query  842   ETGRISLTMRESDETSREKQPKDSPGSSDKSRAPKRTPQRNNQRRESKFVKGQDLEGTVK  1021
             E  RISL+++E+            PG           P  N + R +   KG  L G VK
Sbjct  246   ENERISLSIKET-----------IPG-----------PWSNIEERAA---KGTILVGKVK  280

Query  1022  NLTRSGAFISLPEGEEGFLPTSEMADEGLGEIMGGSSLQVGQEVSVRVL--RISRGQATL  1195
              LT  GAF+ +  G EG +  S++A + +       +L+  QEV V+VL   +  G+  L
Sbjct  281   RLTSFGAFVEVFPGVEGLVHISQIAHKHIN--TPHEALKEAQEVQVKVLDVNVDEGRLAL  338

Query  1196  TMK  1204
             ++K
Sbjct  339   SIK  341


 Score = 55.1 bits (131),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 29/94 (31%), Positives = 54/94 (57%), Gaps = 6/94 (6%)
 Frame = +2

Query  662  GASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNLSNSFVKDVTSVVSVGQEVTVRLLEANM  841
            G    GKVK +  FGAFV+     +GLVH+S +++  +      +   QEV V++L+ N+
Sbjct  272  GTILVGKVKRLTSFGAFVEVFPGVEGLVHISQIAHKHINTPHEALKEAQEVQVKVLDVNV  331

Query  842  ETGRISLTMR------ESDETSREKQPKDSPGSS  925
            + GR++L+++      E++E    + P+++ G S
Sbjct  332  DEGRLALSIKDLLENPEAEEVIDYELPEENTGFS  365



>gb|AHN21285.1| 30S ribosomal protein S1 [Lysinibacillus varians]
Length=378

 Score = 92.0 bits (227),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 66/183 (36%), Positives = 96/183 (52%), Gaps = 30/183 (16%)
 Frame = +2

Query  662   GASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNLSNSFVKDVTSVVSVGQEVTVRLLEANM  841
             G    GKV+ I  FGAF+D G   DGLVH+S +S+  V DV+ V+S GQEV V++L  + 
Sbjct  187   GDVLDGKVQRIASFGAFIDLGG-IDGLVHISQVSHEHVSDVSEVLSEGQEVKVKVLSVDP  245

Query  842   ETGRISLTMRESDETSREKQPKDSPGSSDKSRAPKRTPQRNNQRRESKFVKGQDLEGTVK  1021
             E  RISL+++E+            PG           P  N + R +   KG  L G VK
Sbjct  246   ENERISLSIKET-----------IPG-----------PWSNIEERAA---KGTILVGKVK  280

Query  1022  NLTRSGAFISLPEGEEGFLPTSEMADEGLGEIMGGSSLQVGQEVSVRVL--RISRGQATL  1195
              LT  GAF+ +  G EG +  S++A + +       +L+  QEV V+VL   +  G+  L
Sbjct  281   RLTSFGAFVEVFPGVEGLVHISQIAHKHIN--TPHEALKEAQEVQVKVLDVNVDEGRLAL  338

Query  1196  TMK  1204
             ++K
Sbjct  339   SIK  341


 Score = 55.1 bits (131),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 29/94 (31%), Positives = 54/94 (57%), Gaps = 6/94 (6%)
 Frame = +2

Query  662  GASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNLSNSFVKDVTSVVSVGQEVTVRLLEANM  841
            G    GKVK +  FGAFV+     +GLVH+S +++  +      +   QEV V++L+ N+
Sbjct  272  GTILVGKVKRLTSFGAFVEVFPGVEGLVHISQIAHKHINTPHEALKEAQEVQVKVLDVNV  331

Query  842  ETGRISLTMR------ESDETSREKQPKDSPGSS  925
            + GR++L+++      E++E    + P+++ G S
Sbjct  332  DEGRLALSIKDLLENPEAEEVIDYELPEENTGFS  365



>ref|WP_019921781.1| 30S ribosomal protein S1 [Duganella zoogloeoides]
Length=558

 Score = 94.0 bits (232),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 75/226 (33%), Positives = 110/226 (49%), Gaps = 33/226 (15%)
 Frame = +2

Query  647   EDLIPGASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNLSNSFVKDVTSVVSVGQEVTVRL  826
             E L  G   TG VK+I  +GAFVD G   DGL+H+++L+   V+  + V++VGQE+T ++
Sbjct  186   ETLKEGTVVTGVVKNITDYGAFVDLGGI-DGLLHITDLAWRRVRHPSEVLTVGQEITAKV  244

Query  827   LEANMETGRISLTMRESDETSREKQPKDSPGSSDKSRAPKRTPQRNNQRRESKFVKGQDL  1006
             L+ + E  R+SL +         KQ  D P +       +R PQ            G  L
Sbjct  245   LKYDQEKNRVSLGV---------KQLGDDPWTG----LSRRYPQ------------GTRL  279

Query  1007  EGTVKNLTRSGAFISLPEGEEGFLPTSEMADEGLGEIMGGSSLQVGQEVSVRVLRIS--R  1180
              G V NLT  GAF+ + +G EG +  SEM D     +     +Q+G EV V VL I   R
Sbjct  280   FGKVTNLTDYGAFVEVEQGIEGLVHVSEM-DWTNKNVAPNKVVQLGDEVEVMVLEIDEER  338

Query  1181  GQATLTMKKEEATEEVNSVLSQGVIHKATNPFALAFRKNKEISAFL  1318
              + +L MK+ +A    N     GV HK  +    A +   +   F+
Sbjct  339   RRISLGMKQCKA----NPWDDFGVTHKKGDKVRGAIKSITDFGVFI  380



>ref|WP_020924625.1| Transcription accessory protein (S1 RNA-binding domain [Achromobacter 
xylosoxidans]
 ref|YP_008027526.1| Transcription accessory protein (S1 RNA-binding domain [Achromobacter 
xylosoxidans NH44784-1996]
 emb|CCH04404.1| Transcription accessory protein (S1 RNA-binding domain [Achromobacter 
xylosoxidans NH44784-1996]
Length=791

 Score = 94.0 bits (232),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 47/103 (46%), Positives = 64/103 (62%), Gaps = 3/103 (3%)
 Frame = +2

Query  650  DLIPGASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNLSNSFVKDVTSVVSVGQEVTVRLL  829
            DL PG    G V ++  FGAFVD G   DGLVH+S L+  FVKD   VV VGQ V+V++L
Sbjct  666  DLYPGMVLEGVVTNVANFGAFVDIGVHQDGLVHISALAEKFVKDPRDVVRVGQTVSVKVL  725

Query  830  EANMETGRISLTMRESDETSREKQPKDSPGSSDKSRAPKRTPQ  958
            E ++   R++LTMR +D  +  ++  D+P S D+   P R PQ
Sbjct  726  EVDVARKRVALTMRLNDTAAPARRGADAPKSGDR---PGRRPQ  765



>ref|WP_020705490.1| 30S ribosomal protein S1 [Oxalobacteraceae bacterium AB_14]
Length=559

 Score = 93.6 bits (231),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 74/226 (33%), Positives = 109/226 (48%), Gaps = 33/226 (15%)
 Frame = +2

Query  647   EDLIPGASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNLSNSFVKDVTSVVSVGQEVTVRL  826
             E L  G   TG VK+I  +GAFVD G   DGL+H+++L+   V+  + V++VGQE+T ++
Sbjct  186   ETLKEGTVVTGVVKNITDYGAFVDLGGI-DGLLHITDLAWRRVRHPSEVLTVGQEITAKV  244

Query  827   LEANMETGRISLTMRESDETSREKQPKDSPGSSDKSRAPKRTPQRNNQRRESKFVKGQDL  1006
             L+ + E  R+SL +         KQ  D P +    R P+ T                 L
Sbjct  245   LKYDQEKNRVSLGV---------KQLGDDPWTGLSRRYPQSTR----------------L  279

Query  1007  EGTVKNLTRSGAFISLPEGEEGFLPTSEMADEGLGEIMGGSSLQVGQEVSVRVLRIS--R  1180
              G V NLT  GAF+ + +G EG +  SEM D     +     +Q+G EV V VL I   R
Sbjct  280   FGKVTNLTDYGAFVEVEQGIEGLVHVSEM-DWTNKNVAPNKVVQLGDEVEVMVLEIDEER  338

Query  1181  GQATLTMKKEEATEEVNSVLSQGVIHKATNPFALAFRKNKEISAFL  1318
              + +L MK+ +A    N     GV HK  +    A +   +   F+
Sbjct  339   RRISLGMKQCKA----NPWDDFGVTHKKGDKVRGAIKSITDFGVFI  380



>ref|XP_005712094.1| unnamed protein product [Chondrus crispus]
 emb|CDF32429.1| unnamed protein product [Chondrus crispus]
Length=390

 Score = 92.0 bits (227),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 64/205 (31%), Positives = 103/205 (50%), Gaps = 18/205 (9%)
 Frame = +2

Query  647   EDLIPGASFTGKVKSIQPFGAFV-DFGAFTDGLVHVSNLSNSFVKDVTSVVSVGQEVTVR  823
             ED++ G    G VKS+  +GAFV D G  TDGL+HVS L+  FV+ VT +V+VG +VTVR
Sbjct  157   EDIVVGQELEGVVKSVTDYGAFVGDMGTPTDGLLHVSQLAAGFVEKVTDIVNVGDKVTVR  216

Query  824   LLEANMETGRISLTMRESDETSREKQPKDSPGSSDKSRAPKRTPQRNNQRRESKFVKGQD  1003
             ++  +   G  SLTM+ + E    +          + R   R   +  +  + KF + + 
Sbjct  217   VMGVDTVKGNFSLTMKTAQEMEERRS------GGGEGRGKGRREDQKEKWDQFKFDQTEY  270

Query  1004  LEGTVKNLTRSGAFISLPEGE---------EGFLPTSEMADEGLGEIMGGSSLQVGQEVS  1156
             ++  V ++T  GAF      +         EG +  SE++   +  +     L VGQ V 
Sbjct  271   VDAKVTSVTDFGAFCQFMNADGQPLQSAPTEGLIHISEISQNRVNNV--SDVLSVGQNVK  328

Query  1157  VRVLRISRGQATLTMKKEEATEEVN  1231
             VRVL   R +  ++M  +E +E+ +
Sbjct  329   VRVLATDRKRNRISMSLKEYSEDAD  353



>ref|WP_018989866.1| RNA-binding protein [Azoarcus toluclasticus]
Length=778

 Score = 94.0 bits (232),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 52/117 (44%), Positives = 64/117 (55%), Gaps = 8/117 (7%)
 Frame = +2

Query  647  EDLIPGASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNLSNSFVKDVTSVVSVGQEVTVRL  826
            +DL PG    G V ++  FGAFVD G   DGLVH+S LS  FVKD  SVV  GQ V V++
Sbjct  645  KDLAPGMMLEGVVTNVTNFGAFVDIGVHQDGLVHISALSERFVKDPHSVVKAGQVVKVKV  704

Query  827  LEANMETGRISLTMRESDE--------TSREKQPKDSPGSSDKSRAPKRTPQRNNQR  973
            LE ++   RI+LTMR SDE         +R+  P+         R   RTP R N R
Sbjct  705  LEVDLPRNRIALTMRMSDEPAATRPAGGARDNAPRGRSDGPRPDRNAPRTPSRGNDR  761



>ref|WP_034751798.1| MULTISPECIES: 30S ribosomal protein S1 [Janthinobacterium]
 gb|EZP39699.1| 30S ribosomal protein S1 [Janthinobacterium lividum]
 gb|KHA79016.1| 30S ribosomal protein S1 [Janthinobacterium lividum]
Length=559

 Score = 93.6 bits (231),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 74/226 (33%), Positives = 109/226 (48%), Gaps = 33/226 (15%)
 Frame = +2

Query  647   EDLIPGASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNLSNSFVKDVTSVVSVGQEVTVRL  826
             E L  G   TG VK+I  +GAFVD G   DGL+H+++L+   V+  + V++VGQE+T ++
Sbjct  186   ETLKEGTVVTGVVKNITDYGAFVDLGGI-DGLLHITDLAWRRVRHPSEVLTVGQEITAKV  244

Query  827   LEANMETGRISLTMRESDETSREKQPKDSPGSSDKSRAPKRTPQRNNQRRESKFVKGQDL  1006
             L+ + E  R+SL +         KQ  D P +    R P+ T                 L
Sbjct  245   LKYDQEKNRVSLGV---------KQLGDDPWTGLSRRYPQSTR----------------L  279

Query  1007  EGTVKNLTRSGAFISLPEGEEGFLPTSEMADEGLGEIMGGSSLQVGQEVSVRVLRIS--R  1180
              G V NLT  GAF+ + +G EG +  SEM D     +     +Q+G EV V VL I   R
Sbjct  280   FGKVTNLTDYGAFVEVEQGIEGLVHVSEM-DWTNKNVAPNKVVQLGDEVEVMVLEIDEER  338

Query  1181  GQATLTMKKEEATEEVNSVLSQGVIHKATNPFALAFRKNKEISAFL  1318
              + +L MK+ +A    N     GV HK  +    A +   +   F+
Sbjct  339   RRISLGMKQCKA----NPWDDFGVTHKKGDKVRGAIKSITDFGVFI  380



>ref|WP_011288472.1| RNA-binding protein [Dechloromonas aromatica]
 ref|YP_285944.1| RNA binding S1 [Dechloromonas aromatica RCB]
 gb|AAZ47474.1| RNA binding S1 [Dechloromonas aromatica RCB]
Length=772

 Score = 94.0 bits (232),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 49/106 (46%), Positives = 69/106 (65%), Gaps = 2/106 (2%)
 Frame = +2

Query  641  KNEDLIPGASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNLSNSFVKDVTSVVSVGQEVTV  820
            K  DL PG    G V ++  FGAFVD G   DGLVHVS LSN+FVKD   VV  GQ V V
Sbjct  648  KVSDLRPGMILEGVVTNVAAFGAFVDIGVHQDGLVHVSALSNTFVKDPHDVVKAGQVVKV  707

Query  821  RLLEANMETGRISLTMRESDETSREKQPKDSPGS--SDKSRAPKRT  952
            ++LE +++  RI+LTMR  DE ++ K+  ++P +  +++SR  +R+
Sbjct  708  KVLEVDLQRQRIALTMRMGDEPTQGKRHDNAPANRGNNQSRPAQRS  753



>gb|AIQ45419.1| hypothetical protein R70723_05535 [Paenibacillus sp. FSL R7-0273]
Length=757

 Score = 94.0 bits (232),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 45/84 (54%), Positives = 58/84 (69%), Gaps = 0/84 (0%)
 Frame = +2

Query  638  IKNEDLIPGASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNLSNSFVKDVTSVVSVGQEVT  817
            +K EDL+PG    G V+++  FGAFVD G   DGLVH+S LS SFVK    VVSVG  VT
Sbjct  670  LKIEDLVPGMEMQGTVRNVIDFGAFVDIGIKNDGLVHISQLSGSFVKHPMDVVSVGDNVT  729

Query  818  VRLLEANMETGRISLTMRESDETS  889
            V +L  +++ GR+SLTMR+  ET+
Sbjct  730  VWVLGVDLKKGRVSLTMRQPRETA  753



>ref|WP_038495310.1| 30S ribosomal protein S1 [Janthinobacterium agaricidamnosum]
 emb|CDG84697.1| ribosomal protein S1 [Janthinobacterium agaricidamnosum NBRC 
102515 = DSM 9628]
Length=559

 Score = 93.2 bits (230),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 74/226 (33%), Positives = 109/226 (48%), Gaps = 33/226 (15%)
 Frame = +2

Query  647   EDLIPGASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNLSNSFVKDVTSVVSVGQEVTVRL  826
             E L  G   TG VK+I  +GAFVD G   DGL+H+++L+   V+  + V++VGQE+T ++
Sbjct  186   ETLKEGTVVTGVVKNITDYGAFVDLGGI-DGLLHITDLAWRRVRHPSEVLTVGQEITAKV  244

Query  827   LEANMETGRISLTMRESDETSREKQPKDSPGSSDKSRAPKRTPQRNNQRRESKFVKGQDL  1006
             L+ + E  R+SL +         KQ  D P +    R P+ T                 L
Sbjct  245   LKYDQEKNRVSLGV---------KQLGDDPWTGLSRRYPQSTR----------------L  279

Query  1007  EGTVKNLTRSGAFISLPEGEEGFLPTSEMADEGLGEIMGGSSLQVGQEVSVRVLRIS--R  1180
              G V NLT  GAF+ + +G EG +  SEM D     +     +Q+G EV V VL I   R
Sbjct  280   FGKVTNLTDYGAFVEVEQGIEGLVHVSEM-DWTNKNVAPNKVVQLGDEVEVMVLEIDEER  338

Query  1181  GQATLTMKKEEATEEVNSVLSQGVIHKATNPFALAFRKNKEISAFL  1318
              + +L MK+ +A    N     GV HK  +    A +   +   F+
Sbjct  339   RRISLGMKQCKA----NPWDDFGVTHKKGDKVRGAIKSITDFGVFI  380



>ref|WP_010395707.1| 30S ribosomal protein S1 [Janthinobacterium lividum]
Length=559

 Score = 93.2 bits (230),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 74/226 (33%), Positives = 109/226 (48%), Gaps = 33/226 (15%)
 Frame = +2

Query  647   EDLIPGASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNLSNSFVKDVTSVVSVGQEVTVRL  826
             E L  G   TG VK+I  +GAFVD G   DGL+H+++L+   V+  + V++VGQE+T ++
Sbjct  186   ETLKEGTVVTGVVKNITDYGAFVDLGGI-DGLLHITDLAWRRVRHPSEVLTVGQEITAKV  244

Query  827   LEANMETGRISLTMRESDETSREKQPKDSPGSSDKSRAPKRTPQRNNQRRESKFVKGQDL  1006
             L+ + E  R+SL +         KQ  D P +    R P+ T                 L
Sbjct  245   LKYDQEKNRVSLGV---------KQLGDDPWTGLSRRYPQSTR----------------L  279

Query  1007  EGTVKNLTRSGAFISLPEGEEGFLPTSEMADEGLGEIMGGSSLQVGQEVSVRVLRIS--R  1180
              G V NLT  GAF+ + +G EG +  SEM D     +     +Q+G EV V VL I   R
Sbjct  280   FGKVTNLTDYGAFVEVEQGIEGLVHVSEM-DWTNKNVAPNKVVQLGDEVEVMVLEIDEER  338

Query  1181  GQATLTMKKEEATEEVNSVLSQGVIHKATNPFALAFRKNKEISAFL  1318
              + +L MK+ +A    N     GV HK  +    A +   +   F+
Sbjct  339   RRISLGMKQCKA----NPWDDFGVTHKKGDKVRGAIKSITDFGVFI  380



>ref|WP_036750314.1| transcription accessory protein [Photobacterium halotolerans]
 gb|KDM92326.1| transcription accessory protein [Photobacterium halotolerans]
Length=772

 Score = 94.0 bits (232),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 47/110 (43%), Positives = 70/110 (64%), Gaps = 4/110 (4%)
 Frame = +2

Query  647  EDLIPGASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNLSNSFVKDVTSVVSVGQEVTVRL  826
            +DL+PG    G + ++  FGAFVD G   DGLVH+S LS+ FV D   VV  G  V V++
Sbjct  646  KDLVPGMVLEGVITNVTNFGAFVDVGVHQDGLVHISALSDKFVSDPREVVKAGDVVKVKV  705

Query  827  LEANMETGRISLTMRESDETSR--EKQPKDSPGSSDKSRAPKRTPQRNNQ  970
            +E +++  RI ++MR SDE  +  E++PK     +D+ RAP++  QR+NQ
Sbjct  706  MEVDLQRKRIGMSMRLSDEPGQEAERKPKGGQRQNDQRRAPRQ--QRDNQ  753



>ref|WP_017876964.1| 30S ribosomal protein S1 [Janthinobacterium sp. CG3]
Length=559

 Score = 93.2 bits (230),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 74/226 (33%), Positives = 109/226 (48%), Gaps = 33/226 (15%)
 Frame = +2

Query  647   EDLIPGASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNLSNSFVKDVTSVVSVGQEVTVRL  826
             E L  G   TG VK+I  +GAFVD G   DGL+H+++L+   V+  + V++VGQE+T ++
Sbjct  186   ETLKEGTVVTGVVKNITDYGAFVDLGGI-DGLLHITDLAWRRVRHPSEVLTVGQEITAKV  244

Query  827   LEANMETGRISLTMRESDETSREKQPKDSPGSSDKSRAPKRTPQRNNQRRESKFVKGQDL  1006
             L+ + E  R+SL +         KQ  D P +    R P+ T                 L
Sbjct  245   LKYDQEKNRVSLGV---------KQLGDDPWTGLSRRYPQSTR----------------L  279

Query  1007  EGTVKNLTRSGAFISLPEGEEGFLPTSEMADEGLGEIMGGSSLQVGQEVSVRVLRIS--R  1180
              G V NLT  GAF+ + +G EG +  SEM D     +     +Q+G EV V VL I   R
Sbjct  280   FGKVTNLTDYGAFVEVEQGIEGLVHVSEM-DWTNKNVAPNKVVQLGDEVEVMVLEIDEER  338

Query  1181  GQATLTMKKEEATEEVNSVLSQGVIHKATNPFALAFRKNKEISAFL  1318
              + +L MK+ +A    N     GV HK  +    A +   +   F+
Sbjct  339   RRISLGMKQCKA----NPWDDFGVTHKKGDKVRGAIKSITDFGVFI  380



>ref|WP_009277884.1| 30S ribosomal protein S1 [Olsenella sp. oral taxon 809]
 gb|EHF03053.1| hypothetical protein HMPREF1008_00094 [Olsenella sp. oral taxon 
809 str. F0356]
Length=390

 Score = 91.7 bits (226),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 67/186 (36%), Positives = 92/186 (49%), Gaps = 30/186 (16%)
 Frame = +2

Query  653   LIPGASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNLSNSFVKDVTSVVSVGQEVTVRLLE  832
             L PG    G V SI  FGAFVD G   DGL+H+S LS + V   + VV VGQEV V++L+
Sbjct  204   LQPGMRLKGSVSSIVDFGAFVDLGGI-DGLIHISELSWNHVNHPSEVVKVGQEVEVQVLD  262

Query  833   ANMETGRISLTMRESDETSREKQPKDSPGSSDKSRAPKRTPQRNNQRRESKFVKGQDLEG  1012
              ++   RISL ++++ E                   P RT  +       K+  G  +EG
Sbjct  263   VDLNRERISLGLKQTTED------------------PWRTLVK-------KYPVGAIVEG  297

Query  1013  TVKNLTRSGAFISLPEGEEGFLPTSEMADEGLGEIMGGSSLQVGQEVSVRVLRI--SRGQ  1186
             TV  L   GAF+ L  G EG +  SEMA + +          VG  V V+V+ I   R +
Sbjct  298   TVTKLVTFGAFVDLGNGVEGLVHISEMAKQHVD--APAQVCAVGDTVQVKVMEIDLDRRR  355

Query  1187  ATLTMK  1204
              +L+MK
Sbjct  356   ISLSMK  361


 Score = 62.8 bits (151),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 37/97 (38%), Positives = 54/97 (56%), Gaps = 4/97 (4%)
 Frame = +2

Query  662  GASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNLSNSFVKDVTSVVSVGQEVTVRLLEANM  841
            GA   G V  +  FGAFVD G   +GLVH+S ++   V     V +VG  V V+++E ++
Sbjct  292  GAIVEGTVTKLVTFGAFVDLGNGVEGLVHISEMAKQHVDAPAQVCAVGDTVQVKVMEIDL  351

Query  842  ETGRISLTMRESDET---SREKQPKDSPGSSDKSRAP  943
            +  RISL+M+ + ET     E +P D P   D+  AP
Sbjct  352  DRRRISLSMKSAAETLGVEVEVKPLDKP-EDDEEEAP  387



>ref|WP_036600682.1| hypothetical protein, partial [Paenibacillus sophorae]
Length=333

 Score = 90.9 bits (224),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 46/91 (51%), Positives = 59/91 (65%), Gaps = 7/91 (8%)
 Frame = +2

Query  620  KSEMPP-------IKNEDLIPGASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNLSNSFVK  778
            + E+PP       +K EDL PG    G V+++  FGAFVD G   DGLVH+S LS+SFVK
Sbjct  238  REELPPPIFRTDVLKIEDLAPGMELQGTVRNVIDFGAFVDIGIKNDGLVHISQLSSSFVK  297

Query  779  DVTSVVSVGQEVTVRLLEANMETGRISLTMR  871
                VVSVG  VTV +L  +++ GR+SLTMR
Sbjct  298  HPMDVVSVGDNVTVWVLSVDLKKGRVSLTMR  328



>ref|WP_013986473.1| 30S ribosomal protein S1 [Sulfobacillus acidophilus]
 ref|YP_004719479.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Sulfobacillus 
acidophilus TPY]
 ref|YP_005256921.1| RNA binding S1 domain-containing protein [Sulfobacillus acidophilus 
DSM 10332]
 gb|AEJ39736.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase/S1 RNA-binding 
domain protein [Sulfobacillus acidophilus TPY]
 gb|AEW05249.1| RNA binding S1 domain protein [Sulfobacillus acidophilus DSM 
10332]
Length=416

 Score = 92.0 bits (227),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 59/188 (31%), Positives = 96/188 (51%), Gaps = 28/188 (15%)
 Frame = +2

Query  662   GASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNLSNSFVKDVTSVVSVGQEVTVRLLEANM  841
             G  + G VKS+  FGAF+D G   DGL+H+S +S   +   + ++ VGQ+V V++L  N 
Sbjct  212   GQIWEGTVKSLTEFGAFIDLGG-VDGLLHISEMSWHRINHPSEILEVGQKVRVKVLRLNP  270

Query  842   ETGRISLTMRESDETSREKQPKDSPGSSDKSRAPKRTPQRNNQRRESKFVKGQDLEGTVK  1021
             E G+ISL +R+      E  P D+                       ++++G+   GTV 
Sbjct  271   EKGKISLGLRQV-----EGNPWDTVA--------------------ERYLEGRIYRGTVV  305

Query  1022  NLTRSGAFISLPEGEEGFLPTSEMADEGLGEIMGGSSLQVGQEVSVRVLRISRGQATLTM  1201
              L   G F+ L  G +G +  S++AD  +GE      +QVG E++V+VL +   +  +++
Sbjct  306   RLASFGVFVQLEPGVDGLVHISQLADYRVGE--PSEVVQVGDEIAVKVLYVDPERKRISL  363

Query  1202  KKEEATEE  1225
              K EA  E
Sbjct  364   SKREADAE  371


 Score = 59.7 bits (143),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 31/78 (40%), Positives = 45/78 (58%), Gaps = 0/78 (0%)
 Frame = +2

Query  647  EDLIPGASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNLSNSFVKDVTSVVSVGQEVTVRL  826
            E  + G  + G V  +  FG FV      DGLVH+S L++  V + + VV VG E+ V++
Sbjct  292  ERYLEGRIYRGTVVRLASFGVFVQLEPGVDGLVHISQLADYRVGEPSEVVQVGDEIAVKV  351

Query  827  LEANMETGRISLTMRESD  880
            L  + E  RISL+ RE+D
Sbjct  352  LYVDPERKRISLSKREAD  369


 Score = 56.6 bits (135),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 56/233 (24%), Positives = 106/233 (45%), Gaps = 44/233 (19%)
 Frame = +2

Query  647   EDLIPGASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNLSNSFVKDVTSVVSVGQEVTVRL  826
             ED  PG    GKV  I   G  VD GA ++G++H+ +LS   V+    VV +G  ++V +
Sbjct  34    EDARPGDILQGKVVHISNDGVLVDVGAKSEGIIHLRDLSYRRVERPEEVVHLGDVISVYV  93

Query  827   LEANMETGRISLTMRESDETSREKQPKDSPGSSDKSRAPKRTPQRNNQRRESKFVKGQDL  1006
             +    E G + L+ +++DE    ++ +++              QRN          G+ L
Sbjct  94    VGYEGEEGTLKLSKKKADERVAWERLEEA--------------QRN----------GEIL  129

Query  1007  EGTVKNLTRSGAFISLPEGEEGFLPTSEMADEGLGEIMGGSSLQVGQEVSVRVLRISRGQ  1186
             E  V  + + G  + +  G  GF+P S +A   + ++    +  +GQ + V+V+ + R +
Sbjct  130   EAPVVEVVKGGLVVDV--GLRGFVPASLVAPGFISDL----TPFLGQTLRVKVVELDRNK  183

Query  1187  ATLTMKKEEAT--------EEVNSVLSQGVIHKATNPFALAFRKNKEISAFLD  1321
                 + +++          EE+ S +++G I + T       +   E  AF+D
Sbjct  184   RRAILSRKDVVEQESKAKQEEIWSKIAEGQIWEGT------VKSLTEFGAFID  230


 Score = 55.8 bits (133),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 59/196 (30%), Positives = 96/196 (49%), Gaps = 40/196 (20%)
 Frame = +2

Query  704   GAFVDFGAFTDGLVHVSNLSNSFVKDVTSVVSVGQEVTVRLLEANMETGRISLTMRES-D  880
             G  VD G    G V  S ++  F+ D+T  +  GQ + V+++E +    R  L+ ++  +
Sbjct  140   GLVVDVG--LRGFVPASLVAPGFISDLTPFL--GQTLRVKVVELDRNKRRAILSRKDVVE  195

Query  881   ETSREKQPKDSPGSSDKSRAPKRTPQRNNQRRESKFVKGQDLEGTVKNLTRSGAFISLPE  1060
             + S+ KQ                      +   SK  +GQ  EGTVK+LT  GAFI L  
Sbjct  196   QESKAKQ----------------------EEIWSKIAEGQIWEGTVKSLTEFGAFIDLG-  232

Query  1061  GEEGFLPTSEMADEGLG---EIMGGSSLQVGQEVSVRVLRIS--RGQATLTMKKEEA--T  1219
             G +G L  SEM+   +    EI     L+VGQ+V V+VLR++  +G+ +L +++ E    
Sbjct  233   GVDGLLHISEMSWHRINHPSEI-----LEVGQKVRVKVLRLNPEKGKISLGLRQVEGNPW  287

Query  1220  EEVNSVLSQGVIHKAT  1267
             + V     +G I++ T
Sbjct  288   DTVAERYLEGRIYRGT  303



>ref|WP_023177725.1| MULTISPECIES: 30S ribosomal protein S1 [Carnobacterium]
 ref|YP_008718271.1| 30S ribosomal protein S1 [Carnobacterium sp. WN1359]
 gb|AGY81582.1| 30S ribosomal protein S1 [Carnobacterium sp. WN1359]
Length=406

 Score = 92.0 bits (227),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 61/175 (35%), Positives = 90/175 (51%), Gaps = 28/175 (16%)
 Frame = +2

Query  653   LIPGASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNLSNSFVKDVTSVVSVGQEVTVRLLE  832
             L+ G +  GKV  +  FGAF+D G   DGLVH+S L+   VKD   V++VG+EV V++L 
Sbjct  203   LVEGDTVKGKVARLTNFGAFIDLGG-VDGLVHISQLAYEHVKDPADVLTVGEEVNVKVLS  261

Query  833   ANMETGRISLTMRESDETSREKQPKDSPGSSDKSRAPKRTPQRNNQRRESKFVKGQDLEG  1012
              N E GRISL+++E+            PG           P  N + R +    G  L+G
Sbjct  262   VNEEEGRISLSIKET-----------LPG-----------PWDNIEERAA---AGSVLDG  296

Query  1013  TVKNLTRSGAFISLPEGEEGFLPTSEMADEGLGEIMGGSSLQVGQEVSVRVLRIS  1177
              VK LT  GAF+ +  G EG +  S+++   +        L  G E+ V+VL ++
Sbjct  297   LVKRLTSFGAFVEVFPGVEGLVHISQISHNHIA--TPHEVLSEGDEIKVKVLEVN  349


 Score = 54.3 bits (129),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 30/83 (36%), Positives = 50/83 (60%), Gaps = 2/83 (2%)
 Frame = +2

Query  662  GASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNLSNSFVKDVTSVVSVGQEVTVRLLEANM  841
            G+   G VK +  FGAFV+     +GLVH+S +S++ +     V+S G E+ V++LE N 
Sbjct  291  GSVLDGLVKRLTSFGAFVEVFPGVEGLVHISQISHNHIATPHEVLSEGDEIKVKVLEVNP  350

Query  842  ETGRISLTMRESDETSREKQPKD  910
               R+SL+++  +E  +  QPK+
Sbjct  351  TDQRLSLSIKALEE--KPNQPKE  371



>ref|WP_006829852.1| 30S ribosomal protein S1 [Planococcus antarcticus]
 gb|EIM06741.1| 30S ribosomal protein S1 [Planococcus antarcticus DSM 14505]
Length=381

 Score = 91.7 bits (226),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 65/196 (33%), Positives = 101/196 (52%), Gaps = 34/196 (17%)
 Frame = +2

Query  647   EDLIPGASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNLSNSFVKDVTSVVSVGQEVTVRL  826
             E +  G    GKV+ I  FGAFVD G   DGLVH+S LS+  V+ V+ VV+ GQEVTV++
Sbjct  183   EKIHAGDELKGKVQRIASFGAFVDIGG-VDGLVHISQLSHEHVEKVSDVVTEGQEVTVKV  241

Query  827   LEANMETGRISLTMRESDETSREKQPKDSPGSSDKSRAPKRTPQRNNQRRESKFVKGQDL  1006
             L  + ++ RISL+++++        P   P  S   +APK +                  
Sbjct  242   LSVDRDSERISLSIKDT-------LP--GPWDSIDEKAPKGSVHT---------------  277

Query  1007  EGTVKNLTRSGAFISLPEGEEGFLPTSEMADEGLG---EIMGGSSLQVGQEVSVRVLRIS  1177
              G VK L   GAF+ +  G EG +  S++A + +    E+     L  G+EV V+VL ++
Sbjct  278   -GMVKRLVSYGAFVEVLSGVEGLVHISQIAHKHIATPNEV-----LTEGEEVQVKVLEVN  331

Query  1178  RGQATLTMKKEEATEE  1225
             +    L++  +E  E+
Sbjct  332   KTDKRLSLSIKELKEK  347


 Score = 55.8 bits (133),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 32/94 (34%), Positives = 54/94 (57%), Gaps = 6/94 (6%)
 Frame = +2

Query  662  GASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNLSNSFVKDVTSVVSVGQEVTVRLLEANM  841
            G+  TG VK +  +GAFV+  +  +GLVH+S +++  +     V++ G+EV V++LE N 
Sbjct  273  GSVHTGMVKRLVSYGAFVEVLSGVEGLVHISQIAHKHIATPNEVLTEGEEVQVKVLEVNK  332

Query  842  ETGRISLTMRESDET------SREKQPKDSPGSS  925
               R+SL+++E  E       S    P++S G S
Sbjct  333  TDKRLSLSIKELKEKEGDQDFSNYNMPEESTGFS  366



>ref|WP_016569798.1| 30S ribosomal protein S1 [Streptococcus pneumoniae]
 gb|EPF48421.1| 30S ribosomal protein S1 [Streptococcus pneumoniae MNZ85]
 gb|KGI29978.1| SSU ribosomal protein S1p [Streptococcus pneumoniae]
Length=400

 Score = 91.7 bits (226),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 64/175 (37%), Positives = 93/175 (53%), Gaps = 28/175 (16%)
 Frame = +2

Query  653   LIPGASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNLSNSFVKDVTSVVSVGQEVTVRLLE  832
             L  G   TGKV  I  FGAF+D G   DGLVH++ LS+       SVV+VG+E+ V++L+
Sbjct  191   LAVGDVVTGKVARITSFGAFIDLGG-VDGLVHLTELSHERNVSPKSVVTVGEEIEVKILD  249

Query  833   ANMETGRISLTMRESDETSREKQPKDSPGSSDKSRAPKRTPQRNNQRRESKFVKGQDLEG  1012
              N E GR+SL+++ +            PG  D                E K  KG  +EG
Sbjct  250   LNEEEGRVSLSLKAT-----------VPGPWDGV--------------EQKLAKGDVVEG  284

Query  1013  TVKNLTRSGAFISLPEGEEGFLPTSEMADEGLGEIMGGSSLQVGQEVSVRVLRIS  1177
             TVK LT  GAF+ +  G EG +  S+++ + +       +L+VGQEV V+VL ++
Sbjct  285   TVKRLTDFGAFVEVLPGIEGLVHVSQISHKRIENPK--EALKVGQEVQVKVLEVN  337


 Score = 55.8 bits (133),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 30/77 (39%), Positives = 47/77 (61%), Gaps = 0/77 (0%)
 Frame = +2

Query  653  LIPGASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNLSNSFVKDVTSVVSVGQEVTVRLLE  832
            L  G    G VK +  FGAFV+     +GLVHVS +S+  +++    + VGQEV V++LE
Sbjct  276  LAKGDVVEGTVKRLTDFGAFVEVLPGIEGLVHVSQISHKRIENPKEALKVGQEVQVKVLE  335

Query  833  ANMETGRISLTMRESDE  883
             N +  R+SL+++  +E
Sbjct  336  VNADAERVSLSIKALEE  352



>ref|WP_013648727.1| 30S ribosomal protein S1 [Nitrosomonas sp. AL212]
 ref|YP_004295943.1| 30S ribosomal protein S1 [Nitrosomonas sp. AL212]
 gb|ADZ27781.1| ribosomal protein S1 [Nitrosomonas sp. AL212]
Length=570

 Score = 93.2 bits (230),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 67/188 (36%), Positives = 94/188 (50%), Gaps = 29/188 (15%)
 Frame = +2

Query  650   DLIPGASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNLSNSFVKDVTSVVSVGQEVTVRLL  829
             +L  GA   G VK+I  +GAFVD G   DGL+H+++L+   VK  + VV++G EVT ++L
Sbjct  198   NLQEGAVVQGVVKNITDYGAFVDLGGI-DGLLHITDLAWRRVKHPSEVVNIGDEVTAKVL  256

Query  830   EANMETGRISLTMRESDETSREKQPKDSPGSSDKSRAPKRTPQRNNQRRESKFVKGQDLE  1009
             + + E  R+SL M         KQ  + P      R P RT                 L 
Sbjct  257   KFDQEKNRVSLGM---------KQLSEDPWVGLSRRYPARTR----------------LF  291

Query  1010  GTVKNLTRSGAFISLPEGEEGFLPTSEMADEGLGEIMGGSSLQVGQEVSVRVLRIS--RG  1183
             G V NLT  GAFI + +G EG +  SEM D     +     +Q+G EV V +L I   R 
Sbjct  292   GKVTNLTDYGAFIEIEQGIEGLVHVSEM-DWTNKNVYPSKIVQLGDEVEVMILEIDEERR  350

Query  1184  QATLTMKK  1207
             + +L MK+
Sbjct  351   RISLGMKQ  358



>ref|WP_027323807.1| 30S ribosomal protein S1 [Bacillus sp. URHB0009]
Length=379

 Score = 91.3 bits (225),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 68/194 (35%), Positives = 100/194 (52%), Gaps = 34/194 (18%)
 Frame = +2

Query  653   LIPGASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNLSNSFVKDVTSVVSVGQEVTVRLLE  832
             L PG    G V+ I  FGAFVD G   DGLVH+S LS   V+  + VV+ GQ+V V++L 
Sbjct  185   LQPGQVLEGTVQRITDFGAFVDIGG-IDGLVHISQLSYEHVEKPSDVVAEGQKVQVKVLN  243

Query  833   ANMETGRISLTMRESDETSREKQPKDSPGSSDKSRAPKRTPQRNNQRRESKFVKGQDLEG  1012
              + +  RISL+++E+        P   P  S   +AP                KG  L+G
Sbjct  244   VDRDNERISLSIKET-------LP--GPWESISDKAP----------------KGSMLDG  278

Query  1013  TVKNLTRSGAFISLPEGEEGFLPTSEMADEGLG---EIMGGSSLQVGQEVSVRVLRISRG  1183
             TVK L   GAF+ +  G EG +  S++A + +G   E+     L+ GQEV V+VL ++  
Sbjct  279   TVKRLVSYGAFVEVFPGVEGLVHISQIAHKHIGTPHEV-----LKEGQEVKVKVLDVNEK  333

Query  1184  QATLTMKKEEATEE  1225
                L++  +E  E+
Sbjct  334   DQRLSLSIKELLEK  347



>gb|KGY24361.1| transcription accessory protein [Achromobacter xylosoxidans]
Length=789

 Score = 93.6 bits (231),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 44/99 (44%), Positives = 63/99 (64%), Gaps = 0/99 (0%)
 Frame = +2

Query  650  DLIPGASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNLSNSFVKDVTSVVSVGQEVTVRLL  829
            DL PG    G V ++  FGAFVD G   DGLVH+S L+  FVKD   VV VGQ V+V++L
Sbjct  666  DLYPGMVLEGVVTNVANFGAFVDIGVHQDGLVHISALAEKFVKDPRDVVRVGQTVSVKVL  725

Query  830  EANMETGRISLTMRESDETSREKQPKDSPGSSDKSRAPK  946
            E ++   R++LTMR +D  +  ++  D+P   D++R P+
Sbjct  726  EVDVARKRVALTMRLNDTAAPARRSGDAPKGGDRNRRPQ  764



>ref|WP_033683468.1| 30S ribosomal protein S1 [Streptococcus mitis]
 gb|KEQ40550.1| S1 RNA binding domain protein [Streptococcus mitis]
Length=400

 Score = 91.7 bits (226),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 63/175 (36%), Positives = 94/175 (54%), Gaps = 28/175 (16%)
 Frame = +2

Query  653   LIPGASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNLSNSFVKDVTSVVSVGQEVTVRLLE  832
             L  G   TGKV  I  FGAF+D G   DGLVH++ LS+       SVV+VG+E+ V++L+
Sbjct  191   LAVGDVVTGKVARITSFGAFIDLGG-VDGLVHLTELSHERNVSPKSVVTVGEEIEVKILD  249

Query  833   ANMETGRISLTMRESDETSREKQPKDSPGSSDKSRAPKRTPQRNNQRRESKFVKGQDLEG  1012
              N E GR+SL+++ +           +PG  D                E K  KG  +EG
Sbjct  250   LNEEEGRVSLSLKAT-----------TPGPWDGV--------------EQKLAKGDVVEG  284

Query  1013  TVKNLTRSGAFISLPEGEEGFLPTSEMADEGLGEIMGGSSLQVGQEVSVRVLRIS  1177
             TVK LT  GAF+ +  G +G +  S+++ + +       +L+VGQEV V+VL ++
Sbjct  285   TVKRLTDFGAFVEVLPGIDGLVHVSQISHKRIENPK--EALKVGQEVQVKVLEVN  337


 Score = 57.8 bits (138),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 31/77 (40%), Positives = 47/77 (61%), Gaps = 0/77 (0%)
 Frame = +2

Query  653  LIPGASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNLSNSFVKDVTSVVSVGQEVTVRLLE  832
            L  G    G VK +  FGAFV+     DGLVHVS +S+  +++    + VGQEV V++LE
Sbjct  276  LAKGDVVEGTVKRLTDFGAFVEVLPGIDGLVHVSQISHKRIENPKEALKVGQEVQVKVLE  335

Query  833  ANMETGRISLTMRESDE  883
             N +  R+SL+++  +E
Sbjct  336  VNADAERVSLSIKALEE  352



>ref|WP_001001634.1| 30S ribosomal protein S1 [Streptococcus mitis]
 gb|EGP69824.1| 30S ribosomal protein S1 [Streptococcus mitis SK1080]
Length=400

 Score = 91.7 bits (226),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 63/175 (36%), Positives = 94/175 (54%), Gaps = 28/175 (16%)
 Frame = +2

Query  653   LIPGASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNLSNSFVKDVTSVVSVGQEVTVRLLE  832
             L  G   TGKV  I  FGAF+D G   DGLVH++ LS+       SVV+VG+E+ V++L+
Sbjct  191   LAVGDVVTGKVARITSFGAFIDLGG-VDGLVHLTELSHERNVSPKSVVTVGEEIEVKILD  249

Query  833   ANMETGRISLTMRESDETSREKQPKDSPGSSDKSRAPKRTPQRNNQRRESKFVKGQDLEG  1012
              N E GR+SL+++ +           +PG  D                E K  KG  +EG
Sbjct  250   LNEEEGRVSLSLKAT-----------TPGPWDGV--------------EQKLAKGDVVEG  284

Query  1013  TVKNLTRSGAFISLPEGEEGFLPTSEMADEGLGEIMGGSSLQVGQEVSVRVLRIS  1177
             TVK LT  GAF+ +  G +G +  S+++ + +       +L+VGQEV V+VL ++
Sbjct  285   TVKRLTDFGAFVEVLPGIDGLVHVSQISHKRIENPK--EALKVGQEVQVKVLEVN  337


 Score = 57.8 bits (138),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 31/77 (40%), Positives = 47/77 (61%), Gaps = 0/77 (0%)
 Frame = +2

Query  653  LIPGASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNLSNSFVKDVTSVVSVGQEVTVRLLE  832
            L  G    G VK +  FGAFV+     DGLVHVS +S+  +++    + VGQEV V++LE
Sbjct  276  LAKGDVVEGTVKRLTDFGAFVEVLPGIDGLVHVSQISHKRIENPKEALKVGQEVQVKVLE  335

Query  833  ANMETGRISLTMRESDE  883
             N +  R+SL+++  +E
Sbjct  336  VNADAERVSLSIKALEE  352



>ref|WP_039204196.1| transcription accessory protein, partial [Burkholderia glumae]
 gb|KHJ60536.1| transcription accessory protein, partial [Burkholderia glumae]
Length=628

 Score = 93.2 bits (230),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 50/113 (44%), Positives = 65/113 (58%), Gaps = 1/113 (1%)
 Frame = +2

Query  641  KNEDLIPGASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNLSNSFVKDVTSVVSVGQEVTV  820
            K  DL+PG    G V ++  FGAFVD G   DGLVHVS +S  F+KD   VV  GQ V V
Sbjct  501  KVSDLLPGMVLEGVVTNVAAFGAFVDIGVHQDGLVHVSAMSTKFIKDPHEVVKAGQVVKV  560

Query  821  RLLEANMETGRISLTMRESDETSREKQPKDSPGSSDKSRAPKRTPQRNNQRRE  979
            ++LE +++  RI+LTMR +DE      P  +PGS     AP+    R  + RE
Sbjct  561  KVLEVDVKRQRIALTMRLADEAG-AAGPGRAPGSGADRGAPRGGAGRPQRSRE  612



>ref|WP_025117414.1| 30S ribosomal protein S1 [Lysinibacillus fusiformis]
Length=378

 Score = 91.3 bits (225),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 65/187 (35%), Positives = 97/187 (52%), Gaps = 28/187 (15%)
 Frame = +2

Query  662   GASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNLSNSFVKDVTSVVSVGQEVTVRLLEANM  841
             G    GKV+ +  FGAF+D G   DGLVH+S +S+  V DV+ V+S GQ VTV++L  + 
Sbjct  187   GDVLDGKVQRLASFGAFIDLGG-IDGLVHISQVSHKHVSDVSEVLSEGQGVTVKVLSVDP  245

Query  842   ETGRISLTMRESDETSREKQPKDSPGSSDKSRAPKRTPQRNNQRRESKFVKGQDLEGTVK  1021
                RISL+++E+            PG           P  N + R +   KG  L+G VK
Sbjct  246   ANERISLSIKET-----------IPG-----------PWSNIEERAA---KGAILDGKVK  280

Query  1022  NLTRSGAFISLPEGEEGFLPTSEMADEGLGEIMGGSSLQVGQEVSVRVLRISRGQATLTM  1201
              LT  GAF+ +  G EG +  S++A + +       +L+ GQEV V+VL ++     L +
Sbjct  281   RLTSFGAFVEVFPGVEGLVHISQIAHKHIN--TPHEALKEGQEVQVKVLDVNAEDGRLAL  338

Query  1202  KKEEATE  1222
               +E  E
Sbjct  339   SIKELLE  345



>ref|WP_005668995.1| 30S ribosomal protein S1 [Massilia timonae]
 gb|EKU80886.1| 30S ribosomal protein S1 [Massilia timonae CCUG 45783]
Length=558

 Score = 92.8 bits (229),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 69/192 (36%), Positives = 99/192 (52%), Gaps = 29/192 (15%)
 Frame = +2

Query  647   EDLIPGASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNLSNSFVKDVTSVVSVGQEVTVRL  826
             E L  G   TG VK+I  +GAFVD G   DGL+H+++L+   V+  + V+SVGQE+T ++
Sbjct  186   ETLKEGTVVTGVVKNITDYGAFVDLGGI-DGLLHITDLAWRRVRHPSEVLSVGQEITAKV  244

Query  827   LEANMETGRISLTMRESDETSREKQPKDSPGSSDKSRAPKRTPQRNNQRRESKFVKGQDL  1006
             L+ + E  R+SL +         KQ  D P +       +R PQ            G  L
Sbjct  245   LKYDQEKNRVSLGV---------KQLGDDPWTG----LSRRYPQ------------GTRL  279

Query  1007  EGTVKNLTRSGAFISLPEGEEGFLPTSEMADEGLGEIMGGSSLQVGQEVSVRVLRIS--R  1180
              G V NLT  GAF+ + +G EG +  SEM D     +     +Q+G EV V VL I   R
Sbjct  280   FGKVTNLTDYGAFVEVEQGIEGLVHVSEM-DWTNKNVAPNKVVQLGDEVEVMVLEIDEER  338

Query  1181  GQATLTMKKEEA  1216
              + +L MK+ +A
Sbjct  339   RRISLGMKQCKA  350


 Score = 53.9 bits (128),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 50/174 (29%), Positives = 82/174 (47%), Gaps = 28/174 (16%)
 Frame = +2

Query  662   GASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNLSNSFV-KDVTSVVSVGQEVTVRLLEAN  838
             G    G +KSI  FG F+      DGLVH+S+LS +   ++       G E+   +L  +
Sbjct  363   GDKVKGSIKSITDFGVFIGLPGNIDGLVHLSDLSWTEAGEEAVRRFKKGDELEAVVLAID  422

Query  839   METGRISLTMRESDETSREKQPKDSPGSSDKSRAPKRTPQRNNQRRESKFVKGQDLEGTV  1018
             +E  R+SL +++      E  P ++  S +                     KG  + GTV
Sbjct  423   VERERVSLGVKQ-----LEGDPFNTYSSLND--------------------KGSLVTGTV  457

Query  1019  KNLTRSGAFISLPEGEEGFLPTSEMADEGLGEIMGGSSLQVGQEVSVRVLRISR  1180
             K++   GA ISL +  EG+L  SE++ + + +   G+ L+VG +V   V+ I R
Sbjct  458   KSVEPKGAVISLSDEVEGYLRASEISRDRVED--AGTHLKVGDKVEALVINIDR  509



>emb|CEG28390.1| phosphorylase or nucleotidyl transferase [Bacillus sp. B-jedd]
Length=133

 Score = 87.4 bits (215),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 38/88 (43%), Positives = 58/88 (66%), Gaps = 0/88 (0%)
 Frame = +2

Query  644  NEDLIPGASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNLSNSFVKDVTSVVSVGQEVTVR  823
             E + PG+   GKV  IQP+GAFV     T GLVH+S +++ +VKDV   + VG EV V+
Sbjct  2    QEKIEPGSVLAGKVTGIQPYGAFVALDGNTQGLVHISEITHGYVKDVNEFLKVGDEVKVK  61

Query  824  LLEANMETGRISLTMRESDETSREKQPK  907
            +L  + E G++SL++R ++E   ++QPK
Sbjct  62   VLSVDEEAGKVSLSIRATEEVPAQQQPK  89



>ref|WP_026350008.1| transcription accessory protein [Bordetella sp. FB-8]
Length=788

 Score = 93.6 bits (231),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 52/111 (47%), Positives = 68/111 (61%), Gaps = 5/111 (5%)
 Frame = +2

Query  647  EDLIPGASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNLSNSFVKDVTSVVSVGQEVTVRL  826
            +DL+PG    G V ++  FGAFVD G   DGLVH+S LS  FVKD   VV VGQ VTV++
Sbjct  664  KDLVPGMVLEGVVTNVANFGAFVDVGVHQDGLVHISALSEKFVKDPRDVVRVGQTVTVKV  723

Query  827  LEANMETGRISLTMRESD--ETSREKQPKDSPGSSDKSRAPKRTPQRNNQR  973
            LE ++   R++LTMR +D  E +R  Q   SP S   +R  +R PQ +  R
Sbjct  724  LEVDVARQRVALTMRLNDAAEPARRGQDGGSPAS---TRGGQRRPQVDAGR  771



>ref|WP_027964476.1| 30S ribosomal protein S1 [Halalkalibacillus halophilus]
Length=379

 Score = 91.3 bits (225),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 63/195 (32%), Positives = 99/195 (51%), Gaps = 30/195 (15%)
 Frame = +2

Query  647   EDLIPGASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNLSNSFVKDVTSVVSVGQEVTVRL  826
             ++L  G    G V+ I  FG FVD G   DGL+H+S LS+  +     VV + Q++TV++
Sbjct  181   QNLEAGQEIEGVVRRIASFGVFVDIGGI-DGLIHISQLSHQHIASAEEVVELSQKITVKI  239

Query  827   LEANMETGRISLTMRESDETSREKQPKDSPGSSDKSRAPKRTPQRNNQRRESKFVKGQDL  1006
             +  + +T RI L+++E             PG           P  N    +SK   GQ +
Sbjct  240   ITVDRDTERIGLSLKEM-----------IPG-----------PWEN---VDSKLQYGQII  274

Query  1007  EGTVKNLTRSGAFISLPEGEEGFLPTSEMADEGLGEIMGGSSLQVGQEVSVRVLRISRGQ  1186
             EGTVK +   GAF+ +    EG +  S+++ E +G      +L VGQ+V V+VL ++  Q
Sbjct  275   EGTVKRIVNFGAFVEVLPQVEGLVHISQISTEHIGN--PNEALHVGQKVKVKVLEVNEKQ  332

Query  1187  --ATLTMKKEEATEE  1225
                 L++K+ E  EE
Sbjct  333   RRIALSIKEVEKAEE  347


 Score = 55.5 bits (132),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 48/82 (59%), Gaps = 2/82 (2%)
 Frame = +2

Query  635  PIKNED--LIPGASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNLSNSFVKDVTSVVSVGQ  808
            P +N D  L  G    G VK I  FGAFV+     +GLVH+S +S   + +    + VGQ
Sbjct  260  PWENVDSKLQYGQIIEGTVKRIVNFGAFVEVLPQVEGLVHISQISTEHIGNPNEALHVGQ  319

Query  809  EVTVRLLEANMETGRISLTMRE  874
            +V V++LE N +  RI+L+++E
Sbjct  320  KVKVKVLEVNEKQRRIALSIKE  341



>gb|KEQ34714.1| S1 RNA binding domain protein [Streptococcus mitis]
Length=400

 Score = 91.7 bits (226),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 63/175 (36%), Positives = 94/175 (54%), Gaps = 28/175 (16%)
 Frame = +2

Query  653   LIPGASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNLSNSFVKDVTSVVSVGQEVTVRLLE  832
             L  G   TGKV  I  FGAF+D G   DGLVH++ LS+       SVV+VG+E+ V++L+
Sbjct  191   LAVGDVVTGKVARITSFGAFIDLGG-VDGLVHLTELSHERNVSPKSVVTVGEEIEVKILD  249

Query  833   ANMETGRISLTMRESDETSREKQPKDSPGSSDKSRAPKRTPQRNNQRRESKFVKGQDLEG  1012
              N E GR+SL+++ +           +PG  D                E K  KG  +EG
Sbjct  250   LNEEEGRVSLSLKAT-----------TPGPWDGV--------------EQKLAKGDVVEG  284

Query  1013  TVKNLTRSGAFISLPEGEEGFLPTSEMADEGLGEIMGGSSLQVGQEVSVRVLRIS  1177
             TVK LT  GAF+ +  G +G +  S+++ + +       +L+VGQEV V+VL ++
Sbjct  285   TVKRLTDFGAFVEVLPGIDGLVHVSQISHKRIENPK--EALKVGQEVKVKVLEVN  337


 Score = 57.8 bits (138),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 31/77 (40%), Positives = 47/77 (61%), Gaps = 0/77 (0%)
 Frame = +2

Query  653  LIPGASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNLSNSFVKDVTSVVSVGQEVTVRLLE  832
            L  G    G VK +  FGAFV+     DGLVHVS +S+  +++    + VGQEV V++LE
Sbjct  276  LAKGDVVEGTVKRLTDFGAFVEVLPGIDGLVHVSQISHKRIENPKEALKVGQEVKVKVLE  335

Query  833  ANMETGRISLTMRESDE  883
             N +  R+SL+++  +E
Sbjct  336  VNADAERVSLSIKALEE  352



>ref|WP_015875504.1| RNA-binding protein [Burkholderia glumae]
 ref|YP_002911316.1| RNA binding S1 [Burkholderia glumae BGR1]
 gb|ACR28612.1| RNA binding S1 [Burkholderia glumae BGR1]
Length=776

 Score = 93.2 bits (230),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 50/113 (44%), Positives = 65/113 (58%), Gaps = 1/113 (1%)
 Frame = +2

Query  641  KNEDLIPGASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNLSNSFVKDVTSVVSVGQEVTV  820
            K  DL+PG    G V ++  FGAFVD G   DGLVHVS +S  F+KD   VV  GQ V V
Sbjct  649  KVSDLLPGMVLEGVVTNVAAFGAFVDIGVHQDGLVHVSAMSTKFIKDPHEVVKAGQVVKV  708

Query  821  RLLEANMETGRISLTMRESDETSREKQPKDSPGSSDKSRAPKRTPQRNNQRRE  979
            ++LE +++  RI+LTMR +DE      P  +PGS     AP+    R  + RE
Sbjct  709  KVLEVDVKRQRIALTMRLADEAG-AAGPGRAPGSGADRGAPRGGAGRPQRSRE  760



>ref|WP_036252595.1| 30S ribosomal protein S1 [Massilia sp. BSC265]
 gb|KFI05519.1| 30S ribosomal protein S1 [Massilia sp. BSC265]
Length=558

 Score = 92.8 bits (229),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 74/226 (33%), Positives = 110/226 (49%), Gaps = 33/226 (15%)
 Frame = +2

Query  647   EDLIPGASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNLSNSFVKDVTSVVSVGQEVTVRL  826
             E L  G   TG VK+I  +GAFVD G   DGL+H+++L+   V+  + V+SVGQE+T ++
Sbjct  186   ETLKEGTVVTGVVKNITDYGAFVDLGGI-DGLLHITDLAWRRVRHPSEVLSVGQEITAKV  244

Query  827   LEANMETGRISLTMRESDETSREKQPKDSPGSSDKSRAPKRTPQRNNQRRESKFVKGQDL  1006
             L+ + E  R+SL +         KQ  D P +       +R PQ            G  L
Sbjct  245   LKYDQEKNRVSLGV---------KQLGDDPWTG----LSRRYPQ------------GTRL  279

Query  1007  EGTVKNLTRSGAFISLPEGEEGFLPTSEMADEGLGEIMGGSSLQVGQEVSVRVLRIS--R  1180
              G V NLT  GAF+ + +G EG +  SEM D     +     +Q+G EV V VL I   R
Sbjct  280   FGKVTNLTDYGAFVEVEQGIEGLVHVSEM-DWTNKNVAPNKVVQLGDEVEVMVLEIDEER  338

Query  1181  GQATLTMKKEEATEEVNSVLSQGVIHKATNPFALAFRKNKEISAFL  1318
              + +L MK+ +A    N     G+ HK  +    + +   +   F+
Sbjct  339   RRISLGMKQCKA----NPWDDFGMTHKKGDKVKGSIKSITDFGVFI  380



>ref|WP_036183821.1| 30S ribosomal protein S1 [Lysinibacillus manganicus]
 gb|KGR79567.1| 30S ribosomal protein S1 [Lysinibacillus manganicus DSM 26584]
Length=379

 Score = 91.3 bits (225),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 66/190 (35%), Positives = 101/190 (53%), Gaps = 34/190 (18%)
 Frame = +2

Query  662   GASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNLSNSFVKDVTSVVSVGQEVTVRLLEANM  841
             G    G V+ I PFGAFVD G   DGLVH+S +S+  V+DV SV++ GQ V V++L  + 
Sbjct  188   GDVLDGTVQRIAPFGAFVDIGG-IDGLVHISQVSHDHVEDVNSVLTKGQAVKVKVLSVDP  246

Query  842   ETGRISLTMRESDETSREKQPKDSPGSSDKSRAPKRTPQRNNQRRESKFVKGQDLEGTVK  1021
             E+ RISL+++++            PG           P  N + R +   KG  L GTVK
Sbjct  247   ESERISLSIKDT-----------LPG-----------PWSNIEERVT---KGSVLTGTVK  281

Query  1022  NLTRSGAFISLPEGEEGFLPTSEMADEGLG---EIMGGSSLQVGQEVSVRVLRISRGQAT  1192
              L   GAF+ +  G EG +  S+++ + +    E+     L+ GQEV V+VL ++  +  
Sbjct  282   RLVSFGAFVEVFPGIEGLVHISQISHKHINTPHEV-----LKDGQEVQVKVLDVNGAEKR  336

Query  1193  LTMKKEEATE  1222
             L++  +E  E
Sbjct  337   LSLTIKELLE  346


 Score = 56.2 bits (134),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 30/76 (39%), Positives = 46/76 (61%), Gaps = 0/76 (0%)
 Frame = +2

Query  647  EDLIPGASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNLSNSFVKDVTSVVSVGQEVTVRL  826
            E +  G+  TG VK +  FGAFV+     +GLVH+S +S+  +     V+  GQEV V++
Sbjct  268  ERVTKGSVLTGTVKRLVSFGAFVEVFPGIEGLVHISQISHKHINTPHEVLKDGQEVQVKV  327

Query  827  LEANMETGRISLTMRE  874
            L+ N    R+SLT++E
Sbjct  328  LDVNGAEKRLSLTIKE  343



>ref|WP_008180421.1| 30S ribosomal protein S1 [Bacillus sp. B14905]
 gb|EAZ84020.1| ribosomal protein S1, putative [Bacillus sp. B14905]
Length=378

 Score = 91.3 bits (225),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 65/187 (35%), Positives = 97/187 (52%), Gaps = 28/187 (15%)
 Frame = +2

Query  662   GASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNLSNSFVKDVTSVVSVGQEVTVRLLEANM  841
             G    GKV+ +  FGAF+D G   DGLVH+S +S+  V DV+ V+S GQ VTV++L  + 
Sbjct  187   GDVLDGKVQRLASFGAFIDLGG-IDGLVHISQVSHEHVSDVSEVLSEGQGVTVKVLSVDP  245

Query  842   ETGRISLTMRESDETSREKQPKDSPGSSDKSRAPKRTPQRNNQRRESKFVKGQDLEGTVK  1021
                RISL+++E+            PG           P  N + R +   KG  L+G VK
Sbjct  246   ANERISLSIKET-----------IPG-----------PWSNIEERAA---KGAILDGKVK  280

Query  1022  NLTRSGAFISLPEGEEGFLPTSEMADEGLGEIMGGSSLQVGQEVSVRVLRISRGQATLTM  1201
              LT  GAF+ +  G EG +  S++A + +       +L+ GQEV V+VL ++     L +
Sbjct  281   RLTSFGAFVEVFPGVEGLVHISQIAHKHIN--TPHEALKEGQEVQVKVLDVNAEDGRLAL  338

Query  1202  KKEEATE  1222
               +E  E
Sbjct  339   SIKELLE  345



>ref|WP_001001635.1| MULTISPECIES: 30S ribosomal protein S1 [Streptococcus]
 gb|EFX59228.1| putative ribosomal protein S1 [Streptococcus sp. M334]
 gb|KEQ36586.1| S1 RNA binding domain protein [Streptococcus mitis]
Length=400

 Score = 91.3 bits (225),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 63/175 (36%), Positives = 94/175 (54%), Gaps = 28/175 (16%)
 Frame = +2

Query  653   LIPGASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNLSNSFVKDVTSVVSVGQEVTVRLLE  832
             L  G   TGKV  I  FGAF+D G   DGLVH++ LS+       SVV+VG+E+ V++L+
Sbjct  191   LAVGDVVTGKVARITSFGAFIDLGG-VDGLVHLTELSHERNVSPKSVVTVGEEIEVKILD  249

Query  833   ANMETGRISLTMRESDETSREKQPKDSPGSSDKSRAPKRTPQRNNQRRESKFVKGQDLEG  1012
              N E GR+SL+++ +           +PG  D                E K  KG  +EG
Sbjct  250   LNEEEGRVSLSLKAT-----------TPGPWDGV--------------EQKLAKGDVVEG  284

Query  1013  TVKNLTRSGAFISLPEGEEGFLPTSEMADEGLGEIMGGSSLQVGQEVSVRVLRIS  1177
             TVK LT  GAF+ +  G +G +  S+++ + +       +L+VGQEV V+VL ++
Sbjct  285   TVKRLTDFGAFVEVLPGIDGLVHVSQISHKRIENPK--EALKVGQEVQVKVLEVN  337


 Score = 57.8 bits (138),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 31/77 (40%), Positives = 47/77 (61%), Gaps = 0/77 (0%)
 Frame = +2

Query  653  LIPGASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNLSNSFVKDVTSVVSVGQEVTVRLLE  832
            L  G    G VK +  FGAFV+     DGLVHVS +S+  +++    + VGQEV V++LE
Sbjct  276  LAKGDVVEGTVKRLTDFGAFVEVLPGIDGLVHVSQISHKRIENPKEALKVGQEVQVKVLE  335

Query  833  ANMETGRISLTMRESDE  883
             N +  R+SL+++  +E
Sbjct  336  VNADAERVSLSIKALEE  352



>ref|WP_036124564.1| MULTISPECIES: 30S ribosomal protein S1 [Lysinibacillus]
 gb|KEK09991.1| 30S ribosomal protein S1 [Lysinibacillus sphaericus]
 gb|KER44649.1| 30S ribosomal protein S1 [Lysinibacillus fusiformis]
 gb|KGA83156.1| 30S ribosomal protein S1 [Lysinibacillus fusiformis]
 gb|KHK55197.1| 30S ribosomal protein S1 [Lysinibacillus sp. A1]
Length=378

 Score = 90.9 bits (224),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 65/187 (35%), Positives = 97/187 (52%), Gaps = 28/187 (15%)
 Frame = +2

Query  662   GASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNLSNSFVKDVTSVVSVGQEVTVRLLEANM  841
             G    GKV+ +  FGAF+D G   DGLVH+S +S+  V DV+ V+S GQ VTV++L  + 
Sbjct  187   GDVLDGKVQRLASFGAFIDLGG-IDGLVHISQVSHEHVSDVSEVLSEGQGVTVKVLSVDP  245

Query  842   ETGRISLTMRESDETSREKQPKDSPGSSDKSRAPKRTPQRNNQRRESKFVKGQDLEGTVK  1021
                RISL+++E+            PG           P  N + R +   KG  L+G VK
Sbjct  246   ANERISLSIKET-----------IPG-----------PWSNIEERAA---KGAILDGKVK  280

Query  1022  NLTRSGAFISLPEGEEGFLPTSEMADEGLGEIMGGSSLQVGQEVSVRVLRISRGQATLTM  1201
              LT  GAF+ +  G EG +  S++A + +       +L+ GQEV V+VL ++     L +
Sbjct  281   RLTSFGAFVEVFPGVEGLVHISQIAHKHIN--TPHEALKEGQEVQVKVLDVNAEDGRLAL  338

Query  1202  KKEEATE  1222
               +E  E
Sbjct  339   SIKELLE  345



>ref|WP_013392336.1| RNA-binding protein [Achromobacter xylosoxidans]
 ref|YP_003977711.1| protein tex [Achromobacter xylosoxidans A8]
 gb|ADP14996.1| protein tex [Achromobacter xylosoxidans A8]
Length=791

 Score = 93.2 bits (230),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 44/99 (44%), Positives = 62/99 (63%), Gaps = 0/99 (0%)
 Frame = +2

Query  650  DLIPGASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNLSNSFVKDVTSVVSVGQEVTVRLL  829
            DL PG    G V ++  FGAFVD G   DGLVH+S L+  FVKD   VV VGQ V+V++L
Sbjct  666  DLYPGMVLEGVVTNVANFGAFVDIGVHQDGLVHISALAEKFVKDPRDVVRVGQTVSVKVL  725

Query  830  EANMETGRISLTMRESDETSREKQPKDSPGSSDKSRAPK  946
            E +    R++LTMR +D  +  ++  D+P   D++R P+
Sbjct  726  EVDAARKRVALTMRLNDTAAPARRSADAPKGGDRNRRPQ  764



>ref|WP_029215234.1| hypothetical protein [bacterium JKG1]
Length=602

 Score = 92.8 bits (229),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 61/181 (34%), Positives = 98/181 (54%), Gaps = 21/181 (12%)
 Frame = +2

Query  635   PIKNEDLIPGASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNLSNSFVKDVTSVVSVGQEV  814
             P + +D+ PG    G+V SI  +G FVD G   DGLVH+S +S++ V+  T +V +G  V
Sbjct  196   PRRFKDVQPGMQLEGRVTSIALYGVFVDVGVGRDGLVHISEMSDTRVESPTDLVQIGDPV  255

Query  815   TVRLLEANMETGRISLTMRESD--ETSREKQPKDSPGSSDKSRAPKRTPQRNNQRRESKF  988
             TV +   + E  RISLTMR+ +  +  RE++P+      +K R               + 
Sbjct  256   TVWVKSVDPEARRISLTMRDPNRPKPQRERRPRKPEVDLEKLR---------------QL  300

Query  989   VKGQDLEGTVKNLTRSGAFISLPEGEEGFLPTSEMADEGLGEI-MGGSSLQVGQEVSVRV  1165
               G  +EGTV +L+  GAF+ +  G++G +  SE+++   G I     ++QVG+  + RV
Sbjct  301   KPGDTVEGTVSSLSPFGAFVDIGVGKDGLVHISELSE---GRIEKPEDAVQVGERYTFRV  357

Query  1166  L  1168
             L
Sbjct  358   L  358


 Score = 92.4 bits (228),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 63/193 (33%), Positives = 94/193 (49%), Gaps = 32/193 (17%)
 Frame = +2

Query  641   KNEDLIPGASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNLSNSFVKDVTSVVSVGQEVTV  820
             K   L PG +  G V S+ PFGAFVD G   DGLVH+S LS   ++     V VG+  T 
Sbjct  296   KLRQLKPGDTVEGTVSSLSPFGAFVDIGVGKDGLVHISELSEGRIEKPEDAVQVGERYTF  355

Query  821   RLLEANMETGRISLTMRESDETSREKQPKDSPGSSDKSRAPKRTPQRNNQRRESKFVKGQ  1000
             R+LEA+ E  RISL++R +  + R +Q                               G 
Sbjct  356   RVLEADPEGKRISLSLRRALRSQRLQQ----------------------------LEPGT  387

Query  1001  DLEGTVKNLTRSGAFISLPEGEEGFLPTSEMADEGLGEIMGGSSLQVGQEVSVRVLRI--  1174
              LEGTV  L   GAF+ +  G +G +  SE+A   +  +     ++VG +V V+V+ +  
Sbjct  388   ILEGTVSGLAPFGAFVDIGVGRDGLVHISELAAYRVATVE--EVVRVGDKVQVKVIEVDP  445

Query  1175  SRGQATLTMKKEE  1213
             +  + +LTM+ +E
Sbjct  446   NSKRISLTMRVDE  458



>ref|WP_036216105.1| 30S ribosomal protein S1 [Massilia sp. LC238]
 gb|KFC63042.1| 30S ribosomal protein S1 [Massilia sp. LC238]
Length=558

 Score = 92.4 bits (228),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 69/192 (36%), Positives = 99/192 (52%), Gaps = 29/192 (15%)
 Frame = +2

Query  647   EDLIPGASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNLSNSFVKDVTSVVSVGQEVTVRL  826
             E L  G   TG VK+I  +GAFVD G   DGL+H+++L+   V+  + V+SVGQE+T ++
Sbjct  186   ETLKEGTVVTGVVKNITDYGAFVDLGGI-DGLLHITDLAWRRVRHPSEVLSVGQEITAKV  244

Query  827   LEANMETGRISLTMRESDETSREKQPKDSPGSSDKSRAPKRTPQRNNQRRESKFVKGQDL  1006
             L+ + E  R+SL +         KQ  D P +       +R PQ            G  L
Sbjct  245   LKYDQEKNRVSLGV---------KQLGDDPWTG----LSRRYPQ------------GTRL  279

Query  1007  EGTVKNLTRSGAFISLPEGEEGFLPTSEMADEGLGEIMGGSSLQVGQEVSVRVLRIS--R  1180
              G V NLT  GAF+ + +G EG +  SEM D     +     +Q+G EV V VL I   R
Sbjct  280   FGKVTNLTDYGAFVEVEQGIEGLVHVSEM-DWTNKNVAPNKVVQLGDEVEVMVLEIDEER  338

Query  1181  GQATLTMKKEEA  1216
              + +L MK+ +A
Sbjct  339   RRISLGMKQCKA  350



>ref|WP_027864827.1| 30S ribosomal protein S1 [Massilia alkalitolerans]
Length=558

 Score = 92.4 bits (228),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 69/192 (36%), Positives = 99/192 (52%), Gaps = 29/192 (15%)
 Frame = +2

Query  647   EDLIPGASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNLSNSFVKDVTSVVSVGQEVTVRL  826
             E L  G   TG VK+I  +GAFVD G   DGL+H+++L+   V+  + V+SVGQE+T ++
Sbjct  186   ETLKEGTVVTGVVKNITDYGAFVDLGGI-DGLLHITDLAWRRVRHPSEVLSVGQEITAKV  244

Query  827   LEANMETGRISLTMRESDETSREKQPKDSPGSSDKSRAPKRTPQRNNQRRESKFVKGQDL  1006
             L+ + E  R+SL +         KQ  D P +       +R PQ            G  L
Sbjct  245   LKYDQEKNRVSLGV---------KQLGDDPWTG----LSRRYPQ------------GTRL  279

Query  1007  EGTVKNLTRSGAFISLPEGEEGFLPTSEMADEGLGEIMGGSSLQVGQEVSVRVLRIS--R  1180
              G V NLT  GAF+ + +G EG +  SEM D     +     +Q+G EV V VL I   R
Sbjct  280   FGKVTNLTDYGAFVEVEQGIEGLVHVSEM-DWTNKNVAPNKVVQLGDEVEVMVLEIDEER  338

Query  1181  GQATLTMKKEEA  1216
              + +L MK+ +A
Sbjct  339   RRISLGMKQCKA  350


 Score = 52.8 bits (125),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 50/174 (29%), Positives = 82/174 (47%), Gaps = 28/174 (16%)
 Frame = +2

Query  662   GASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNLSNSFV-KDVTSVVSVGQEVTVRLLEAN  838
             G    G +KSI  FG F+      DGLVH+S+LS +   ++       G E+   +L  +
Sbjct  363   GDKVKGSIKSITDFGVFIGLPGNIDGLVHLSDLSWTEAGEEAVRKFKKGDELEAVVLAID  422

Query  839   METGRISLTMRESDETSREKQPKDSPGSSDKSRAPKRTPQRNNQRRESKFVKGQDLEGTV  1018
             +E  R+SL +++      E  P ++  S +                     KG  + GTV
Sbjct  423   VERERVSLGVKQ-----LEGDPFNNFASLND--------------------KGTLVTGTV  457

Query  1019  KNLTRSGAFISLPEGEEGFLPTSEMADEGLGEIMGGSSLQVGQEVSVRVLRISR  1180
             K++   GA I+L E  EG+L  SE++ + + +   G+ L+VG +V   V+ I R
Sbjct  458   KSVEPKGAVIALNEEVEGYLRASEISRDRVED--AGTHLKVGDKVEALVINIDR  509



>ref|WP_001001630.1| 30S ribosomal protein S1 [Streptococcus mitis]
 gb|EFN94675.1| S1 RNA binding domain protein [Streptococcus mitis NCTC 12261]
 gb|EFN97355.1| 40S ribosomal protein S1 [Streptococcus mitis SK321]
 gb|EFO00810.1| 40S ribosomal protein S1 [Streptococcus mitis SK597]
 gb|EGU69644.1| 30S ribosomal protein S1 [Streptococcus mitis SK569]
 gb|EID24327.1| 30S ribosomal protein S1 [Streptococcus mitis SK616]
 gb|EID27637.1| 30S ribosomal protein S1 [Streptococcus mitis SK575]
 gb|EID32110.1| 30S ribosomal protein S1 [Streptococcus mitis SK579]
 gb|EOB23048.1| 30S ribosomal protein S1 [Streptococcus mitis 11/5]
 gb|EPR95995.1| 30S ribosomal protein S1 [Streptococcus mitis 29/42]
 gb|EPR96505.1| 30S ribosomal protein S1 [Streptococcus mitis 18/56]
 gb|ETD97907.1| 30S ribosomal protein S1 [Streptococcus mitis 27/7]
 gb|KEQ38277.1| 40S ribosomal protein S1 [Streptococcus mitis]
 gb|KEQ42409.1| S1 RNA binding domain protein [Streptococcus mitis]
 gb|KER08585.1| S1 RNA binding domain protein [Streptococcus mitis]
Length=400

 Score = 91.3 bits (225),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 63/175 (36%), Positives = 94/175 (54%), Gaps = 28/175 (16%)
 Frame = +2

Query  653   LIPGASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNLSNSFVKDVTSVVSVGQEVTVRLLE  832
             L  G   TGKV  I  FGAF+D G   DGLVH++ LS+       SVV+VG+E+ V++L+
Sbjct  191   LAVGDVVTGKVARITSFGAFIDLGG-VDGLVHLTELSHERNVSPKSVVTVGEEIEVKILD  249

Query  833   ANMETGRISLTMRESDETSREKQPKDSPGSSDKSRAPKRTPQRNNQRRESKFVKGQDLEG  1012
              N E GR+SL+++ +           +PG  D                E K  KG  +EG
Sbjct  250   LNEEEGRVSLSLKAT-----------TPGPWDGV--------------EQKLAKGDVVEG  284

Query  1013  TVKNLTRSGAFISLPEGEEGFLPTSEMADEGLGEIMGGSSLQVGQEVSVRVLRIS  1177
             TVK LT  GAF+ +  G +G +  S+++ + +       +L+VGQEV V+VL ++
Sbjct  285   TVKRLTDFGAFVEVLPGIDGLVHVSQISHKRIENPK--EALKVGQEVKVKVLEVN  337


 Score = 57.8 bits (138),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 31/77 (40%), Positives = 47/77 (61%), Gaps = 0/77 (0%)
 Frame = +2

Query  653  LIPGASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNLSNSFVKDVTSVVSVGQEVTVRLLE  832
            L  G    G VK +  FGAFV+     DGLVHVS +S+  +++    + VGQEV V++LE
Sbjct  276  LAKGDVVEGTVKRLTDFGAFVEVLPGIDGLVHVSQISHKRIENPKEALKVGQEVKVKVLE  335

Query  833  ANMETGRISLTMRESDE  883
             N +  R+SL+++  +E
Sbjct  336  VNADAERVSLSIKALEE  352



>ref|WP_036237328.1| 30S ribosomal protein S1 [Massilia sp. JS1662]
 gb|KGF79884.1| 30S ribosomal protein S1 [Massilia sp. JS1662]
Length=558

 Score = 92.4 bits (228),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 69/192 (36%), Positives = 99/192 (52%), Gaps = 29/192 (15%)
 Frame = +2

Query  647   EDLIPGASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNLSNSFVKDVTSVVSVGQEVTVRL  826
             E L  G   TG VK+I  +GAFVD G   DGL+H+++L+   V+  + V+SVGQE+T ++
Sbjct  186   ETLKEGTVVTGVVKNITDYGAFVDLGGI-DGLLHITDLAWRRVRHPSEVLSVGQEITAKV  244

Query  827   LEANMETGRISLTMRESDETSREKQPKDSPGSSDKSRAPKRTPQRNNQRRESKFVKGQDL  1006
             L+ + E  R+SL +         KQ  D P +       +R PQ            G  L
Sbjct  245   LKYDQEKNRVSLGV---------KQLGDDPWTG----LSRRYPQ------------GTRL  279

Query  1007  EGTVKNLTRSGAFISLPEGEEGFLPTSEMADEGLGEIMGGSSLQVGQEVSVRVLRIS--R  1180
              G V NLT  GAF+ + +G EG +  SEM D     +     +Q+G EV V VL I   R
Sbjct  280   FGKVTNLTDYGAFVEVEQGIEGLVHVSEM-DWTNKNVAPNKVVQLGDEVEVMVLEIDEER  338

Query  1181  GQATLTMKKEEA  1216
              + +L MK+ +A
Sbjct  339   RRISLGMKQCKA  350



>ref|WP_033676925.1| 30S ribosomal protein S1 [Streptococcus mitis]
 gb|KEQ47836.1| S1 RNA binding domain protein [Streptococcus mitis]
Length=400

 Score = 91.3 bits (225),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 63/175 (36%), Positives = 94/175 (54%), Gaps = 28/175 (16%)
 Frame = +2

Query  653   LIPGASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNLSNSFVKDVTSVVSVGQEVTVRLLE  832
             L  G   TGKV  I  FGAF+D G   DGLVH++ LS+       SVV+VG+E+ V++L+
Sbjct  191   LAVGDVVTGKVARITSFGAFIDLGG-VDGLVHLTELSHERNVSPKSVVTVGEEIEVKILD  249

Query  833   ANMETGRISLTMRESDETSREKQPKDSPGSSDKSRAPKRTPQRNNQRRESKFVKGQDLEG  1012
              N E GR+SL+++ +           +PG  D                E K  KG  +EG
Sbjct  250   LNEEEGRVSLSLKAT-----------TPGPWDGV--------------EQKLAKGDVVEG  284

Query  1013  TVKNLTRSGAFISLPEGEEGFLPTSEMADEGLGEIMGGSSLQVGQEVSVRVLRIS  1177
             TVK LT  GAF+ +  G +G +  S+++ + +       +L+VGQEV V+VL ++
Sbjct  285   TVKRLTDFGAFVEVLPGIDGLVHVSQISHKRIENPK--EALKVGQEVKVKVLEVN  337


 Score = 57.8 bits (138),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 31/77 (40%), Positives = 47/77 (61%), Gaps = 0/77 (0%)
 Frame = +2

Query  653  LIPGASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNLSNSFVKDVTSVVSVGQEVTVRLLE  832
            L  G    G VK +  FGAFV+     DGLVHVS +S+  +++    + VGQEV V++LE
Sbjct  276  LAKGDVVEGTVKRLTDFGAFVEVLPGIDGLVHVSQISHKRIENPKEALKVGQEVKVKVLE  335

Query  833  ANMETGRISLTMRESDE  883
             N +  R+SL+++  +E
Sbjct  336  VNADAERVSLSIKALEE  352



>ref|WP_001001633.1| 30S ribosomal protein S1 [Streptococcus pseudopneumoniae]
 gb|EID23968.1| 30S ribosomal protein S1 [Streptococcus pseudopneumoniae ATCC 
BAA-960]
Length=400

 Score = 91.3 bits (225),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 64/177 (36%), Positives = 98/177 (55%), Gaps = 32/177 (18%)
 Frame = +2

Query  653   LIPGASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNLSNSFVKDVT--SVVSVGQEVTVRL  826
             L  G   TGKV  I  FGAF+D G   DGLVH++ LS+   ++V+  SVV+VG+E+ V++
Sbjct  191   LAVGDVVTGKVARITSFGAFIDLGG-VDGLVHLTELSHE--RNVSPKSVVTVGEEIEVKI  247

Query  827   LEANMETGRISLTMRESDETSREKQPKDSPGSSDKSRAPKRTPQRNNQRRESKFVKGQDL  1006
             L+ N E GR+SL+++ +           +PG  D                E K  KG  +
Sbjct  248   LDLNEEEGRVSLSLKAT-----------TPGPWDGV--------------EQKLAKGDVV  282

Query  1007  EGTVKNLTRSGAFISLPEGEEGFLPTSEMADEGLGEIMGGSSLQVGQEVSVRVLRIS  1177
             EGTVK LT  GAF+ +  G +G +  S+++ + +       +L+VGQEV V+VL ++
Sbjct  283   EGTVKRLTDFGAFVEVLPGIDGLVHVSQISHKRIENPK--EALKVGQEVQVKVLEVN  337


 Score = 57.8 bits (138),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 31/77 (40%), Positives = 47/77 (61%), Gaps = 0/77 (0%)
 Frame = +2

Query  653  LIPGASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNLSNSFVKDVTSVVSVGQEVTVRLLE  832
            L  G    G VK +  FGAFV+     DGLVHVS +S+  +++    + VGQEV V++LE
Sbjct  276  LAKGDVVEGTVKRLTDFGAFVEVLPGIDGLVHVSQISHKRIENPKEALKVGQEVQVKVLE  335

Query  833  ANMETGRISLTMRESDE  883
             N +  R+SL+++  +E
Sbjct  336  VNADAERVSLSIKALEE  352



>gb|AIQ51037.1| hypothetical protein R70331_05555 [Paenibacillus sp. FSL R7-0331]
Length=742

 Score = 93.2 bits (230),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 47/95 (49%), Positives = 61/95 (64%), Gaps = 9/95 (9%)
 Frame = +2

Query  638  IKNEDLIPGASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNLSNSFVKDVTSVVSVGQEVT  817
            +K EDL+PG    G V+++  FGAFVD G   DGLVH+S LS SFVK    VVSVG  VT
Sbjct  655  LKIEDLVPGMEMQGTVRNVIDFGAFVDIGIKNDGLVHISQLSGSFVKHPMDVVSVGDNVT  714

Query  818  VRLLEANMETGRISLTMRESDETSREKQPKDSPGS  922
            V +L  +++ GR+SLTMR         QP+++ GS
Sbjct  715  VWVLGVDLKKGRVSLTMR---------QPREAAGS  740



>ref|WP_001001636.1| 30S ribosomal protein S1 [Streptococcus sp. SK643]
 gb|EIF39315.1| S1 RNA binding domain protein [Streptococcus sp. SK643]
Length=400

 Score = 91.3 bits (225),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 63/175 (36%), Positives = 94/175 (54%), Gaps = 28/175 (16%)
 Frame = +2

Query  653   LIPGASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNLSNSFVKDVTSVVSVGQEVTVRLLE  832
             L  G   TGKV  I  FGAF+D G   DGLVH++ LS+       SVV+VG+E+ V++L+
Sbjct  191   LAVGDVVTGKVARITSFGAFIDLGG-VDGLVHLTELSHERNVSPKSVVTVGEEIEVKILD  249

Query  833   ANMETGRISLTMRESDETSREKQPKDSPGSSDKSRAPKRTPQRNNQRRESKFVKGQDLEG  1012
              N E GR+SL+++ +           +PG  D                E K  KG  +EG
Sbjct  250   LNEEEGRVSLSLKAT-----------TPGPWDGV--------------EQKLAKGDVVEG  284

Query  1013  TVKNLTRSGAFISLPEGEEGFLPTSEMADEGLGEIMGGSSLQVGQEVSVRVLRIS  1177
             TVK LT  GAF+ +  G +G +  S+++ + +       +L+VGQEV V+VL ++
Sbjct  285   TVKRLTDFGAFVEVLPGIDGLVHVSQISHKRIENPK--EALKVGQEVQVKVLEVN  337


 Score = 57.8 bits (138),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 31/77 (40%), Positives = 47/77 (61%), Gaps = 0/77 (0%)
 Frame = +2

Query  653  LIPGASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNLSNSFVKDVTSVVSVGQEVTVRLLE  832
            L  G    G VK +  FGAFV+     DGLVHVS +S+  +++    + VGQEV V++LE
Sbjct  276  LAKGDVVEGTVKRLTDFGAFVEVLPGIDGLVHVSQISHKRIENPKEALKVGQEVQVKVLE  335

Query  833  ANMETGRISLTMRESDE  883
             N +  R+SL+++  +E
Sbjct  336  VNADAERVSLSIKALEE  352



>ref|WP_039787498.1| 30S ribosomal protein S1 [Herbaspirillum huttiense]
Length=542

 Score = 92.4 bits (228),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 68/189 (36%), Positives = 97/189 (51%), Gaps = 29/189 (15%)
 Frame = +2

Query  647   EDLIPGASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNLSNSFVKDVTSVVSVGQEVTVRL  826
             E L  G   TG VK+I  +GAFVD G   DGL+H+++L+   V+  + V+SVGQE+T ++
Sbjct  170   ETLKEGTVVTGIVKNITDYGAFVDLGGI-DGLLHITDLAWRRVRHPSEVLSVGQEITAKV  228

Query  827   LEANMETGRISLTMRESDETSREKQPKDSPGSSDKSRAPKRTPQRNNQRRESKFVKGQDL  1006
             L+ + E  R+SL +         KQ  D P +       +R PQ            G  L
Sbjct  229   LKYDQEKNRVSLGV---------KQLGDDPWTG----LSRRYPQ------------GTRL  263

Query  1007  EGTVKNLTRSGAFISLPEGEEGFLPTSEMADEGLGEIMGGSSLQVGQEVSVRVLRIS--R  1180
              G V NLT  GAF+ + +G EG +  SEM D     +     +Q+G EV V VL I   R
Sbjct  264   FGKVTNLTDYGAFVEVEQGIEGLVHVSEM-DWTNKNVAPNKVVQLGDEVEVMVLEIDEER  322

Query  1181  GQATLTMKK  1207
              + +L MK+
Sbjct  323   RRISLGMKQ  331



>ref|WP_001001631.1| 30S ribosomal protein S1 [Streptococcus mitis]
 ref|YP_003446023.1| 30S ribosomal protein S1 [Streptococcus mitis B6]
 emb|CBJ22158.1| 30S ribosomal protein S1 [Streptococcus mitis B6]
 gb|EGP68451.1| 30S ribosomal protein S1 [Streptococcus mitis SK1073]
 gb|EOB32699.1| 30S ribosomal protein S1 [Streptococcus mitis 13/39]
 gb|EPR92031.1| 30S ribosomal protein S1 [Streptococcus mitis 17/34]
 gb|KEQ33326.1| S1 RNA binding domain protein [Streptococcus mitis]
 gb|KEQ45375.1| S1 RNA binding domain protein [Streptococcus mitis]
Length=400

 Score = 91.3 bits (225),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 63/175 (36%), Positives = 94/175 (54%), Gaps = 28/175 (16%)
 Frame = +2

Query  653   LIPGASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNLSNSFVKDVTSVVSVGQEVTVRLLE  832
             L  G   TGKV  I  FGAF+D G   DGLVH++ LS+       SVV+VG+E+ V++L+
Sbjct  191   LAVGDVVTGKVARITSFGAFIDLGG-VDGLVHLTELSHERNVSPKSVVTVGEEIEVKILD  249

Query  833   ANMETGRISLTMRESDETSREKQPKDSPGSSDKSRAPKRTPQRNNQRRESKFVKGQDLEG  1012
              N E GR+SL+++ +           +PG  D                E K  KG  +EG
Sbjct  250   LNEEEGRVSLSLKAT-----------TPGPWDGV--------------EQKLAKGDVVEG  284

Query  1013  TVKNLTRSGAFISLPEGEEGFLPTSEMADEGLGEIMGGSSLQVGQEVSVRVLRIS  1177
             TVK LT  GAF+ +  G +G +  S+++ + +       +L+VGQEV V+VL ++
Sbjct  285   TVKRLTDFGAFVEVLPGIDGLVHVSQISHKRIENPK--EALKVGQEVQVKVLEVN  337


 Score = 57.8 bits (138),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 31/77 (40%), Positives = 47/77 (61%), Gaps = 0/77 (0%)
 Frame = +2

Query  653  LIPGASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNLSNSFVKDVTSVVSVGQEVTVRLLE  832
            L  G    G VK +  FGAFV+     DGLVHVS +S+  +++    + VGQEV V++LE
Sbjct  276  LAKGDVVEGTVKRLTDFGAFVEVLPGIDGLVHVSQISHKRIENPKEALKVGQEVQVKVLE  335

Query  833  ANMETGRISLTMRESDE  883
             N +  R+SL+++  +E
Sbjct  336  VNADAERVSLSIKALEE  352



>ref|WP_001001632.1| 30S ribosomal protein S1 [Streptococcus mitis]
 gb|EFN99262.1| 40S ribosomal protein S1 [Streptococcus mitis SK564]
Length=400

 Score = 91.3 bits (225),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 63/175 (36%), Positives = 94/175 (54%), Gaps = 28/175 (16%)
 Frame = +2

Query  653   LIPGASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNLSNSFVKDVTSVVSVGQEVTVRLLE  832
             L  G   TGKV  I  FGAF+D G   DGLVH++ LS+       SVV+VG+E+ V++L+
Sbjct  191   LAVGDVVTGKVARITSFGAFIDLGG-VDGLVHLTELSHERNVSPKSVVTVGEEIEVKILD  249

Query  833   ANMETGRISLTMRESDETSREKQPKDSPGSSDKSRAPKRTPQRNNQRRESKFVKGQDLEG  1012
              N E GR+SL+++ +           +PG  D                E K  KG  +EG
Sbjct  250   LNEEEGRVSLSLKAT-----------TPGPWDGV--------------EQKLAKGDVVEG  284

Query  1013  TVKNLTRSGAFISLPEGEEGFLPTSEMADEGLGEIMGGSSLQVGQEVSVRVLRIS  1177
             TVK LT  GAF+ +  G +G +  S+++ + +       +L+VGQEV V+VL ++
Sbjct  285   TVKRLTDFGAFVEVLPGIDGLVHVSQISHKRIENPK--EALKVGQEVQVKVLEVN  337


 Score = 57.8 bits (138),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 31/77 (40%), Positives = 47/77 (61%), Gaps = 0/77 (0%)
 Frame = +2

Query  653  LIPGASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNLSNSFVKDVTSVVSVGQEVTVRLLE  832
            L  G    G VK +  FGAFV+     DGLVHVS +S+  +++    + VGQEV V++LE
Sbjct  276  LAKGDVVEGTVKRLTDFGAFVEVLPGIDGLVHVSQISHKRIENPKEALKVGQEVQVKVLE  335

Query  833  ANMETGRISLTMRESDE  883
             N +  R+SL+++  +E
Sbjct  336  VNADAERVSLSIKALEE  352



>ref|WP_026920872.1| transcription accessory protein [Glomeribacter sp. 1016415]
Length=767

 Score = 92.8 bits (229),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 51/112 (46%), Positives = 66/112 (59%), Gaps = 12/112 (11%)
 Frame = +2

Query  650  DLIPGASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNLSNSFVKDVTSVVSVGQEVTVRLL  829
            DL PG    G V ++  FGAF+D G   DGLVHVS +SN F+KD   ++ VGQ V V++L
Sbjct  652  DLAPGMVLEGVVTNVAAFGAFIDIGVHQDGLVHVSAMSNRFIKDPHEILKVGQIVRVKVL  711

Query  830  EANMETGRISLTMRESDETSREKQPKDSPGSSDKSRAPKRTPQRNNQRRESK  985
            E + +  RI LTMR SDE+   K       S+ ++ AP     RN QRRE K
Sbjct  712  EVDAKRQRIGLTMRLSDESQSAK-------SAPQAEAP-----RNPQRRERK  751



>ref|WP_008106997.1| 30S ribosomal protein S1 [Methylophilales bacterium HTCC2181]
 gb|EAV47102.1| 30S ribosomal protein S1 [Methylophilales bacterium HTCC2181]
Length=503

 Score = 92.0 bits (227),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 63/192 (33%), Positives = 98/192 (51%), Gaps = 29/192 (15%)
 Frame = +2

Query  647   EDLIPGASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNLSNSFVKDVTSVVSVGQEVTVRL  826
             E ++ GA+  G +K+I  +GAFVD G   DGL+H+++L+   +K  + +++VG E+  R+
Sbjct  197   ESIVEGANVKGIIKNITDYGAFVDLGGI-DGLLHITDLAWKRIKHPSEILNVGDEIEARV  255

Query  827   LEANMETGRISLTMRESDETSREKQPKDSPGSSDKSRAPKRTPQRNNQRRESKFVKGQDL  1006
             L+ + E  R+SL +++ DE          P      R P +T                 L
Sbjct  256   LKFDQEKNRVSLGLKQLDE---------DPWVGLGRRYPVKTK----------------L  290

Query  1007  EGTVKNLTRSGAFISLPEGEEGFLPTSEMADEGLGEIMGGSSLQVGQEVSVRVLRI--SR  1180
              G V NLT  GAFI +  G EG +  SEM D     I    ++Q+G EV V +L I   R
Sbjct  291   FGKVSNLTDYGAFIEIETGIEGLVHVSEM-DWTNKNIHPTKAVQLGDEVEVMILEIDEDR  349

Query  1181  GQATLTMKKEEA  1216
              + +L MK+ +A
Sbjct  350   RRLSLGMKQCQA  361



>gb|KIF82889.1| 30S ribosomal protein S1 [Herbaspirillum sp. TSA66]
Length=558

 Score = 92.4 bits (228),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 68/189 (36%), Positives = 97/189 (51%), Gaps = 29/189 (15%)
 Frame = +2

Query  647   EDLIPGASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNLSNSFVKDVTSVVSVGQEVTVRL  826
             E L  G   TG VK+I  +GAFVD G   DGL+H+++L+   V+  + V+SVGQE+T ++
Sbjct  186   ETLKEGTVVTGIVKNITDYGAFVDLGGI-DGLLHITDLAWRRVRHPSEVLSVGQEITAKV  244

Query  827   LEANMETGRISLTMRESDETSREKQPKDSPGSSDKSRAPKRTPQRNNQRRESKFVKGQDL  1006
             L+ + E  R+SL +         KQ  D P +       +R PQ            G  L
Sbjct  245   LKYDQEKNRVSLGV---------KQLGDDPWTG----LSRRYPQ------------GTRL  279

Query  1007  EGTVKNLTRSGAFISLPEGEEGFLPTSEMADEGLGEIMGGSSLQVGQEVSVRVLRIS--R  1180
              G V NLT  GAF+ + +G EG +  SEM D     +     +Q+G EV V VL I   R
Sbjct  280   FGKVTNLTDYGAFVEVEQGIEGLVHVSEM-DWTNKNVAPNKVVQLGDEVEVMVLEIDEER  338

Query  1181  GQATLTMKK  1207
              + +L MK+
Sbjct  339   RRISLGMKQ  347


 Score = 53.1 bits (126),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 52/178 (29%), Positives = 82/178 (46%), Gaps = 36/178 (20%)
 Frame = +2

Query  662   GASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNLSNSFV-KDVTSVVSVGQEVTVRLLEAN  838
             G    G +KSI  FG F+      DGLVH+S+LS +   ++       G E+   +L  +
Sbjct  363   GDKVKGAIKSITDFGVFIGLSGNIDGLVHLSDLSWTEAGEEAVRKFKKGDELEAVVLAID  422

Query  839   METGRISLTMRESDETSREKQPKDSPGSSDKSRAPKRTPQRNNQRRESKFV----KGQDL  1006
             +E  R+SL +         KQ +  P               NN      FV    KG  +
Sbjct  423   VERERVSLGV---------KQLEGDP--------------FNN------FVALNDKGAIV  453

Query  1007  EGTVKNLTRSGAFISLPEGEEGFLPTSEMADEGLGEIMGGSSLQVGQEVSVRVLRISR  1180
              GTVK++   GA I+L +  EG+L  SE++ + + +   G+ L+VG +V   V+ + R
Sbjct  454   SGTVKSVEPKGAVIALNDEVEGYLRASEISRDRVED--AGTHLKVGDKVEAMVINVDR  509



>ref|WP_020652515.1| 30S ribosomal protein S1 [Massilia niastensis]
Length=558

 Score = 92.4 bits (228),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 69/192 (36%), Positives = 99/192 (52%), Gaps = 29/192 (15%)
 Frame = +2

Query  647   EDLIPGASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNLSNSFVKDVTSVVSVGQEVTVRL  826
             E L  G   TG VK+I  +GAFVD G   DGL+H+++L+   V+  + V+SVGQE+T ++
Sbjct  186   ETLKEGTVVTGVVKNITDYGAFVDLGGI-DGLLHITDLAWRRVRHPSEVLSVGQEITAKV  244

Query  827   LEANMETGRISLTMRESDETSREKQPKDSPGSSDKSRAPKRTPQRNNQRRESKFVKGQDL  1006
             L+ + E  R+SL +         KQ  D P +       +R PQ            G  L
Sbjct  245   LKYDQEKNRVSLGV---------KQLGDDPWTG----LSRRYPQ------------GTRL  279

Query  1007  EGTVKNLTRSGAFISLPEGEEGFLPTSEMADEGLGEIMGGSSLQVGQEVSVRVLRIS--R  1180
              G V NLT  GAF+ + +G EG +  SEM D     +     +Q+G EV V VL I   R
Sbjct  280   FGKVTNLTDYGAFVEVEQGIEGLVHVSEM-DWTNKNVAPNKVVQLGDEVEVMVLEIDEER  338

Query  1181  GQATLTMKKEEA  1216
              + +L MK+ +A
Sbjct  339   RRISLGMKQCKA  350


 Score = 53.1 bits (126),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 50/174 (29%), Positives = 81/174 (47%), Gaps = 28/174 (16%)
 Frame = +2

Query  662   GASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNLSNSFV-KDVTSVVSVGQEVTVRLLEAN  838
             G    G +KSI  FG F+      DGLVH+S+LS +   ++       G E+   +L  +
Sbjct  363   GDKVKGSIKSITDFGVFIGLPGNIDGLVHLSDLSWTEAGEEAVRRFKKGDELEAVVLAID  422

Query  839   METGRISLTMRESDETSREKQPKDSPGSSDKSRAPKRTPQRNNQRRESKFVKGQDLEGTV  1018
             +E  R+SL +++      E  P ++  S +                     KG  + GTV
Sbjct  423   VERERVSLGVKQ-----LEGDPFNTFASLND--------------------KGSLVTGTV  457

Query  1019  KNLTRSGAFISLPEGEEGFLPTSEMADEGLGEIMGGSSLQVGQEVSVRVLRISR  1180
             K++   GA I L E  EG+L  SE++ + + +   G+ L+VG +V   V+ I R
Sbjct  458   KSVEPKGAVIGLTEEVEGYLRASEISRDRVED--AGTHLKVGDKVEALVINIDR  509



>ref|WP_024534871.1| 30S ribosomal protein S1 [Sporosarcina sp. EUR3 2.2.2]
Length=379

 Score = 90.9 bits (224),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 64/191 (34%), Positives = 100/191 (52%), Gaps = 34/191 (18%)
 Frame = +2

Query  662   GASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNLSNSFVKDVTSVVSVGQEVTVRLLEANM  841
             G   TG V+ I  FGAFVD G   DGLVH+S LS+  V+ V+ V+  GQEV V++L  + 
Sbjct  188   GDVLTGTVQRIAAFGAFVDLGG-VDGLVHISQLSHEHVEQVSDVIHEGQEVQVKVLSVDR  246

Query  842   ETGRISLTMRESDETSREKQPKDSPGSSDKSRAPKRTPQRNNQRRESKFVKGQDLEGTVK  1021
             ++ RISL+++++        P    G  DK  AP+ + Q                 GT+K
Sbjct  247   DSERISLSIKDT-------LPGPWEGIEDK--APRGSVQT----------------GTIK  281

Query  1022  NLTRSGAFISLPEGEEGFLPTSEMADEGLG---EIMGGSSLQVGQEVSVRVLRISRGQAT  1192
              L   GAF+ +  G EG +  S++A   +G   E+     L+ GQEV V+VL +++    
Sbjct  282   RLVSYGAFVEVFPGIEGLVHISQIAHSHIGTPHEV-----LKEGQEVQVKVLDVNKKDKR  336

Query  1193  LTMKKEEATEE  1225
             L++  ++  E+
Sbjct  337   LSLSIKDLLEK  347



>ref|WP_036736253.1| hypothetical protein, partial [Paenibacillus zanthoxyli]
Length=80

 Score = 85.5 bits (210),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 42/75 (56%), Positives = 52/75 (69%), Gaps = 0/75 (0%)
 Frame = +2

Query  647  EDLIPGASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNLSNSFVKDVTSVVSVGQEVTVRL  826
            EDL PG    G V+++  FGAFVD G   DGLVH+S LS+SFVK    VVSVG  VTV +
Sbjct  1    EDLAPGMELQGTVRNVIDFGAFVDIGIKNDGLVHISQLSSSFVKHPMDVVSVGDNVTVWV  60

Query  827  LEANMETGRISLTMR  871
            L  +++ GR+SLTMR
Sbjct  61   LSVDLKKGRVSLTMR  75



>gb|EIJ46026.1| 30s ribosomal protein S1 [Herbaspirillum sp. GW103]
Length=571

 Score = 92.4 bits (228),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 68/189 (36%), Positives = 97/189 (51%), Gaps = 29/189 (15%)
 Frame = +2

Query  647   EDLIPGASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNLSNSFVKDVTSVVSVGQEVTVRL  826
             E L  G   TG VK+I  +GAFVD G   DGL+H+++L+   V+  + V+SVGQE+T ++
Sbjct  199   ETLKEGTVVTGIVKNITDYGAFVDLGGI-DGLLHITDLAWRRVRHPSEVLSVGQEITAKV  257

Query  827   LEANMETGRISLTMRESDETSREKQPKDSPGSSDKSRAPKRTPQRNNQRRESKFVKGQDL  1006
             L+ + E  R+SL +         KQ  D P +       +R PQ            G  L
Sbjct  258   LKYDQEKNRVSLGV---------KQLGDDPWTG----LSRRYPQ------------GTRL  292

Query  1007  EGTVKNLTRSGAFISLPEGEEGFLPTSEMADEGLGEIMGGSSLQVGQEVSVRVLRIS--R  1180
              G V NLT  GAF+ + +G EG +  SEM D     +     +Q+G EV V VL I   R
Sbjct  293   FGKVTNLTDYGAFVEVEQGIEGLVHVSEM-DWTNKNVAPNKVVQLGDEVEVMVLEIDEER  351

Query  1181  GQATLTMKK  1207
              + +L MK+
Sbjct  352   RRISLGMKQ  360



>ref|WP_019128600.1| MULTISPECIES: 30S ribosomal protein S1 [Coriobacteriaceae]
 emb|CDD43088.1| 30S ribosomal protein S1 [Collinsella sp. CAG:398]
Length=387

 Score = 90.9 bits (224),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 67/186 (36%), Positives = 94/186 (51%), Gaps = 30/186 (16%)
 Frame = +2

Query  653   LIPGASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNLSNSFVKDVTSVVSVGQEVTVRLLE  832
             L PG    G V SI  FGAFVD G   DGLVH+S LS + V   + VV VGQE+ V +L+
Sbjct  204   LKPGMRLKGTVSSIVDFGAFVDLGGI-DGLVHISELSWNHVNHPSEVVKVGQEIEVEVLD  262

Query  833   ANMETGRISLTMRESDETSREKQPKDSPGSSDKSRAPKRTPQRNNQRRESKFVKGQDLEG  1012
              ++   RISL ++++ E              D  RA  +           K+  G  +EG
Sbjct  263   VDLNRERISLGLKQTTE--------------DPWRALVK-----------KYPTGAVVEG  297

Query  1013  TVKNLTRSGAFISLPEGEEGFLPTSEMADEGLGEIMGGSSLQVGQEVSVRVLRIS--RGQ  1186
             TV  L   GAF+ L +G EG +  SEMA + + +        VG +V V+V+ I   R +
Sbjct  298   TVTKLVPFGAFVDLGDGIEGLVHISEMAHKHVDQ--PSQVTHVGAKVQVKVMDIDLERRR  355

Query  1187  ATLTMK  1204
              +L+MK
Sbjct  356   ISLSMK  361


 Score = 65.1 bits (157),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 31/75 (41%), Positives = 48/75 (64%), Gaps = 0/75 (0%)
 Frame = +2

Query  662  GASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNLSNSFVKDVTSVVSVGQEVTVRLLEANM  841
            GA   G V  + PFGAFVD G   +GLVH+S +++  V   + V  VG +V V++++ ++
Sbjct  292  GAVVEGTVTKLVPFGAFVDLGDGIEGLVHISEMAHKHVDQPSQVTHVGAKVQVKVMDIDL  351

Query  842  ETGRISLTMRESDET  886
            E  RISL+M+ + ET
Sbjct  352  ERRRISLSMKSAAET  366



>gb|EZI58074.1| S1 RNA binding domain protein [Acinetobacter baumannii 25442_7]
Length=384

 Score = 90.9 bits (224),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 63/187 (34%), Positives = 95/187 (51%), Gaps = 29/187 (16%)
 Frame = +2

Query  662   GASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNLSNSFVKDVTSVVSVGQEVTVRLLEANM  841
             G + TG +K++  +GAFVD G   DGL+H+++++   +K  + VV VGQEVTV++L+ + 
Sbjct  19    GQTVTGTIKNLTDYGAFVDLGGI-DGLLHITDMAWKRIKHPSEVVEVGQEVTVKVLKFDR  77

Query  842   ETGRISLTMRESDETSREKQPKDSPGSSDKSRAPKRTPQRNNQRRESKFVKGQDLEGTVK  1021
             E  R+SL +         KQ  + P  +  SR P                KG  ++  V 
Sbjct  78    ERNRVSLGL---------KQLGEDPWLAIMSRYP----------------KGSIVKARVT  112

Query  1022  NLTRSGAFISLPEGEEGFLPTSEMADEGLGEIMGGSSLQVGQEVSVRVLRIS--RGQATL  1195
             NLT  G F  + EG EG +  SEM D     I     +Q+G EV V VL +   R + +L
Sbjct  113   NLTDYGCFAEIAEGVEGLVHVSEM-DHTNKNIHPSKVVQIGDEVDVMVLEVDEERRRISL  171

Query  1196  TMKKEEA  1216
              +K+  A
Sbjct  172   GIKQTRA  178


 Score = 54.7 bits (130),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 41/154 (27%), Positives = 72/154 (47%), Gaps = 28/154 (18%)
 Frame = +2

Query  659   PGASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNLSNSFVKDV--TSVVSVGQEVTVRLLE  832
              G+    +V ++  +G F +     +GLVHVS + ++  K++  + VV +G EV V +LE
Sbjct  103   KGSIVKARVTNLTDYGCFAEIAEGVEGLVHVSEMDHTN-KNIHPSKVVQIGDEVDVMVLE  161

Query  833   ANMETGRISLTMRESDETSREKQPKDSPGSSDKSRAPKRTPQRNNQRRESKFVKGQDLEG  1012
              + E  RISL ++++     E+  K                            KG+ + G
Sbjct  162   VDEERRRISLGIKQTRANPWEEFAKSHE-------------------------KGEKVSG  196

Query  1013  TVKNLTRSGAFISLPEGEEGFLPTSEMADEGLGE  1114
             T+K++T  G FI L  G +G +  S+++    GE
Sbjct  197   TIKSITDFGIFIGLNGGIDGLVHLSDISWNEQGE  230



>ref|WP_004372223.1| RNA binding S1 domain-containing protein, partial [Thauera phenylacetica]
 gb|ENO95678.1| RNA binding S1 domain-containing protein, partial [Thauera phenylacetica 
B4P]
Length=768

 Score = 92.8 bits (229),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 49/107 (46%), Positives = 65/107 (61%), Gaps = 0/107 (0%)
 Frame = +2

Query  647  EDLIPGASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNLSNSFVKDVTSVVSVGQEVTVRL  826
            +DL PG    G V ++  FGAFVD G   DGLVH+S LSN+FVKD  SVV  GQ V V++
Sbjct  645  KDLEPGMLLEGVVTNVTNFGAFVDIGVHQDGLVHISALSNTFVKDPHSVVKAGQVVKVKV  704

Query  827  LEANMETGRISLTMRESDETSREKQPKDSPGSSDKSRAPKRTPQRNN  967
            LE ++   RI+LTMR  DE + ++    +      +R  K TPQR+ 
Sbjct  705  LEVDIPRHRIALTMRLGDEVTAKRGEPGARRDEGAARRDKGTPQRDR  751



>ref|WP_006462118.1| 30S ribosomal protein S1 [Herbaspirillum frisingense]
 gb|EOA06134.1| 30S ribosomal protein S1 [Herbaspirillum frisingense GSF30]
Length=542

 Score = 92.4 bits (228),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 68/189 (36%), Positives = 97/189 (51%), Gaps = 29/189 (15%)
 Frame = +2

Query  647   EDLIPGASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNLSNSFVKDVTSVVSVGQEVTVRL  826
             E L  G   TG VK+I  +GAFVD G   DGL+H+++L+   V+  + V+SVGQE+T ++
Sbjct  170   ETLKEGTVVTGIVKNITDYGAFVDLGGI-DGLLHITDLAWRRVRHPSEVLSVGQEITAKV  228

Query  827   LEANMETGRISLTMRESDETSREKQPKDSPGSSDKSRAPKRTPQRNNQRRESKFVKGQDL  1006
             L+ + E  R+SL +         KQ  D P +       +R PQ            G  L
Sbjct  229   LKYDQEKNRVSLGV---------KQLGDDPWTG----LSRRYPQ------------GTRL  263

Query  1007  EGTVKNLTRSGAFISLPEGEEGFLPTSEMADEGLGEIMGGSSLQVGQEVSVRVLRIS--R  1180
              G V NLT  GAF+ + +G EG +  SEM D     +     +Q+G EV V VL I   R
Sbjct  264   FGKVTNLTDYGAFVEVEQGIEGLVHVSEM-DWTNKNVAPNKVVQLGDEVEVMVLEIDEER  322

Query  1181  GQATLTMKK  1207
              + +L MK+
Sbjct  323   RRISLGMKQ  331



>ref|WP_034307708.1| MULTISPECIES: 30S ribosomal protein S1 [Herbaspirillum]
Length=542

 Score = 92.0 bits (227),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 68/189 (36%), Positives = 97/189 (51%), Gaps = 29/189 (15%)
 Frame = +2

Query  647   EDLIPGASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNLSNSFVKDVTSVVSVGQEVTVRL  826
             E L  G   TG VK+I  +GAFVD G   DGL+H+++L+   V+  + V+SVGQE+T ++
Sbjct  170   ETLKEGTVVTGIVKNITDYGAFVDLGGI-DGLLHITDLAWRRVRHPSEVLSVGQEITAKV  228

Query  827   LEANMETGRISLTMRESDETSREKQPKDSPGSSDKSRAPKRTPQRNNQRRESKFVKGQDL  1006
             L+ + E  R+SL +         KQ  D P +       +R PQ            G  L
Sbjct  229   LKYDQEKNRVSLGV---------KQLGDDPWTG----LSRRYPQ------------GTRL  263

Query  1007  EGTVKNLTRSGAFISLPEGEEGFLPTSEMADEGLGEIMGGSSLQVGQEVSVRVLRIS--R  1180
              G V NLT  GAF+ + +G EG +  SEM D     +     +Q+G EV V VL I   R
Sbjct  264   FGKVTNLTDYGAFVEVEQGIEGLVHVSEM-DWTNKNVAPNKVVQLGDEVEVMVLEIDEER  322

Query  1181  GQATLTMKK  1207
              + +L MK+
Sbjct  323   RRISLGMKQ  331



>ref|WP_013235629.1| 30S ribosomal protein S1 [Herbaspirillum seropedicae]
 ref|YP_003777075.1| 30s ribosomal protein S1 [Herbaspirillum seropedicae SmR1]
 emb|CAM32585.1| 30s ribosomal subunit protein S1 [Herbaspirillum seropedicae]
 gb|ADJ65167.1| 30s ribosomal subunit S1 protein [Herbaspirillum seropedicae 
SmR1]
Length=585

 Score = 92.4 bits (228),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 68/189 (36%), Positives = 97/189 (51%), Gaps = 29/189 (15%)
 Frame = +2

Query  647   EDLIPGASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNLSNSFVKDVTSVVSVGQEVTVRL  826
             E L  G   TG VK+I  +GAFVD G   DGL+H+++L+   V+  + V+SVGQE+T ++
Sbjct  213   ETLKEGTVVTGIVKNITDYGAFVDLGGI-DGLLHITDLAWRRVRHPSEVLSVGQEITAKV  271

Query  827   LEANMETGRISLTMRESDETSREKQPKDSPGSSDKSRAPKRTPQRNNQRRESKFVKGQDL  1006
             L+ + E  R+SL +         KQ  D P +       +R PQ            G  L
Sbjct  272   LKYDQEKNRVSLGV---------KQLGDDPWTG----LSRRYPQ------------GTRL  306

Query  1007  EGTVKNLTRSGAFISLPEGEEGFLPTSEMADEGLGEIMGGSSLQVGQEVSVRVLRIS--R  1180
              G V NLT  GAF+ + +G EG +  SEM D     +     +Q+G EV V VL I   R
Sbjct  307   FGKVTNLTDYGAFVEVEQGIEGLVHVSEM-DWTNKNVAPNKVVQLGDEVEVMVLEIDEER  365

Query  1181  GQATLTMKK  1207
              + +L MK+
Sbjct  366   RRISLGMKQ  374



>ref|WP_036723070.1| hypothetical protein [Paenibacillus forsythiae]
Length=220

 Score = 88.6 bits (218),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 45/91 (49%), Positives = 58/91 (64%), Gaps = 7/91 (8%)
 Frame = +2

Query  620  KSEMPP-------IKNEDLIPGASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNLSNSFVK  778
            + E+PP       +K EDL PG    G V+++  FGAFVD G   DGLVH+S LS+SFVK
Sbjct  125  REELPPPIFRTDVLKIEDLTPGMELQGTVRNVIDFGAFVDIGIKNDGLVHISQLSSSFVK  184

Query  779  DVTSVVSVGQEVTVRLLEANMETGRISLTMR  871
                VVSVG  VTV +L  +++ GR+ LTMR
Sbjct  185  HPMDVVSVGDNVTVWVLSVDLKKGRVGLTMR  215



>ref|WP_034332777.1| MULTISPECIES: 30S ribosomal protein S1 [Herbaspirillum]
Length=542

 Score = 92.0 bits (227),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 68/189 (36%), Positives = 97/189 (51%), Gaps = 29/189 (15%)
 Frame = +2

Query  647   EDLIPGASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNLSNSFVKDVTSVVSVGQEVTVRL  826
             E L  G   TG VK+I  +GAFVD G   DGL+H+++L+   V+  + V+SVGQE+T ++
Sbjct  170   ETLKEGTVVTGIVKNITDYGAFVDLGGI-DGLLHITDLAWRRVRHPSEVLSVGQEITAKV  228

Query  827   LEANMETGRISLTMRESDETSREKQPKDSPGSSDKSRAPKRTPQRNNQRRESKFVKGQDL  1006
             L+ + E  R+SL +         KQ  D P +       +R PQ            G  L
Sbjct  229   LKYDQEKNRVSLGV---------KQLGDDPWTG----LSRRYPQ------------GTRL  263

Query  1007  EGTVKNLTRSGAFISLPEGEEGFLPTSEMADEGLGEIMGGSSLQVGQEVSVRVLRIS--R  1180
              G V NLT  GAF+ + +G EG +  SEM D     +     +Q+G EV V VL I   R
Sbjct  264   FGKVTNLTDYGAFVEVEQGIEGLVHVSEM-DWTNKNVAPNKVVQLGDEVEVMVLEIDEER  322

Query  1181  GQATLTMKK  1207
              + +L MK+
Sbjct  323   RRISLGMKQ  331



>ref|WP_008114400.1| 30S ribosomal protein S1 [Herbaspirillum sp. YR522]
 gb|EJN07307.1| ribosomal protein S1 [Herbaspirillum sp. YR522]
Length=542

 Score = 92.0 bits (227),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 68/189 (36%), Positives = 97/189 (51%), Gaps = 29/189 (15%)
 Frame = +2

Query  647   EDLIPGASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNLSNSFVKDVTSVVSVGQEVTVRL  826
             E L  G   TG VK+I  +GAFVD G   DGL+H+++L+   V+  + V+SVGQE+T ++
Sbjct  170   ETLKEGTVVTGIVKNITDYGAFVDLGGI-DGLLHITDLAWRRVRHPSEVLSVGQEITAKV  228

Query  827   LEANMETGRISLTMRESDETSREKQPKDSPGSSDKSRAPKRTPQRNNQRRESKFVKGQDL  1006
             L+ + E  R+SL +         KQ  D P +       +R PQ            G  L
Sbjct  229   LKYDQEKNRVSLGV---------KQLGDDPWTG----LSRRYPQ------------GTRL  263

Query  1007  EGTVKNLTRSGAFISLPEGEEGFLPTSEMADEGLGEIMGGSSLQVGQEVSVRVLRIS--R  1180
              G V NLT  GAF+ + +G EG +  SEM D     +     +Q+G EV V VL I   R
Sbjct  264   FGKVTNLTDYGAFVEVEQGIEGLVHVSEM-DWTNKNVAPNKVVQLGDEVEVMVLEIDEER  322

Query  1181  GQATLTMKK  1207
              + +L MK+
Sbjct  323   RRISLGMKQ  331


 Score = 53.9 bits (128),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 49/174 (28%), Positives = 81/174 (47%), Gaps = 28/174 (16%)
 Frame = +2

Query  662   GASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNLSNSFV-KDVTSVVSVGQEVTVRLLEAN  838
             G    G +KSI  FG F+      DGLVH+S+LS +   ++       G E+   +L  +
Sbjct  347   GDKVRGSIKSITDFGVFIGLSGNIDGLVHLSDLSWTEAGEEAVRKFKKGDELEAVVLAID  406

Query  839   METGRISLTMRESDETSREKQPKDSPGSSDKSRAPKRTPQRNNQRRESKFVKGQDLEGTV  1018
             +E  R+SL +++      E  P ++  + +                     KG  + GTV
Sbjct  407   VERERVSLGVKQ-----LEGDPFNNFAALND--------------------KGALVTGTV  441

Query  1019  KNLTRSGAFISLPEGEEGFLPTSEMADEGLGEIMGGSSLQVGQEVSVRVLRISR  1180
             K++   GA I+L E  EG+L  SE++ + + +   G+ L+VG  V   V+ I R
Sbjct  442   KSVEAKGAVIALNEEVEGYLRASEISRDRVED--AGTHLKVGDSVEALVINIDR  493



>ref|WP_011836999.1| 30S ribosomal protein S1 [Streptococcus sanguinis]
 ref|YP_001035177.1| 30S ribosomal protein S1 [Streptococcus sanguinis SK36]
 gb|ABN44627.1| 30S ribosomal protein S1, putative [Streptococcus sanguinis SK36]
Length=401

 Score = 90.9 bits (224),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 78/230 (34%), Positives = 115/230 (50%), Gaps = 42/230 (18%)
 Frame = +2

Query  662   GASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNLSNSFVKDVTSVVSVGQEVTVRLLEANM  841
             G   TGKV  I  FGAF+D G   DGLVH++ LS+       SVVSVG E+ V++L+ N 
Sbjct  194   GDIVTGKVARITSFGAFIDLGG-VDGLVHLTELSHERNVSPKSVVSVGDEIEVKVLDLNE  252

Query  842   ETGRISLTMRESDETSREKQPKDSPGSSDKSRAPKRTPQRNNQRRESKFVKGQDLEGTVK  1021
             E GR+SL+++ +           +PG  D                E K   G  +EGTVK
Sbjct  253   EEGRVSLSLKAT-----------TPGPWDGV--------------EQKLAAGDVIEGTVK  287

Query  1022  NLTRSGAFISLPEGEEGFLPTSEMADEGLGEIMGGSSLQVGQEVSVRVLRISRG--QATL  1195
              LT  GAF+ +  G +G +  S+++ + +       +L+VGQEV+V+VL ++    + +L
Sbjct  288   RLTDFGAFVEVLPGIDGLVHISQISHKRVES--PKDALKVGQEVTVKVLEVNAADERVSL  345

Query  1196  TMKKEE---ATEE------VNSVLSQGVIHKATNPFALAFRKNKEISAFL  1318
             ++K  E   A EE       N VL   V+        L F+K K  S +L
Sbjct  346   SIKALEERPAQEEGKKMRNANHVL---VVQNVKKNVTLNFQKLKLDSQWL  392


 Score = 58.5 bits (140),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 33/87 (38%), Positives = 51/87 (59%), Gaps = 0/87 (0%)
 Frame = +2

Query  647  EDLIPGASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNLSNSFVKDVTSVVSVGQEVTVRL  826
            + L  G    G VK +  FGAFV+     DGLVH+S +S+  V+     + VGQEVTV++
Sbjct  274  QKLAAGDVIEGTVKRLTDFGAFVEVLPGIDGLVHISQISHKRVESPKDALKVGQEVTVKV  333

Query  827  LEANMETGRISLTMRESDETSREKQPK  907
            LE N    R+SL+++  +E   +++ K
Sbjct  334  LEVNAADERVSLSIKALEERPAQEEGK  360



>ref|WP_028100434.1| 30S ribosomal protein S1 [Pseudoduganella violaceinigra]
Length=558

 Score = 92.0 bits (227),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 74/226 (33%), Positives = 110/226 (49%), Gaps = 33/226 (15%)
 Frame = +2

Query  647   EDLIPGASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNLSNSFVKDVTSVVSVGQEVTVRL  826
             E L  G   TG VK+I  +GAFVD G   DGL+H+++L+   V+  + V++VGQE+T ++
Sbjct  186   ETLKEGTVVTGVVKNITDYGAFVDLGGI-DGLLHITDLAWRRVRHPSEVLTVGQEITAKV  244

Query  827   LEANMETGRISLTMRESDETSREKQPKDSPGSSDKSRAPKRTPQRNNQRRESKFVKGQDL  1006
             L+ + E  R+SL +         KQ  D P +       +R PQ            G  L
Sbjct  245   LKYDQEKNRVSLGV---------KQLGDDPWTG----LSRRYPQ------------GTRL  279

Query  1007  EGTVKNLTRSGAFISLPEGEEGFLPTSEMADEGLGEIMGGSSLQVGQEVSVRVLRIS--R  1180
              G V NLT  GAF+ + +G EG +  SEM D     +     +Q+G EV V VL I   R
Sbjct  280   FGKVTNLTDYGAFVEVEQGIEGLVHVSEM-DWTNKNVAPNKVVQLGDEVEVMVLEIDEER  338

Query  1181  GQATLTMKKEEATEEVNSVLSQGVIHKATNPFALAFRKNKEISAFL  1318
              + +L MK+ +A    N     G+ HK  +    A +   +   F+
Sbjct  339   RRISLGMKQCKA----NPWDDFGMSHKKGDKVKGAIKSITDFGVFI  380



>ref|WP_006913501.1| 30S ribosomal protein S1 [Salinisphaera shabanensis]
 gb|ERJ18708.1| 30S ribosomal protein S1 [Salinisphaera shabanensis E1L3A]
Length=561

 Score = 92.0 bits (227),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 65/184 (35%), Positives = 93/184 (51%), Gaps = 29/184 (16%)
 Frame = +2

Query  662   GASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNLSNSFVKDVTSVVSVGQEVTVRLLEANM  841
             G    G VK++  +GAFVD G   DGL+H++++S   +KD T VV+VG+E+ V++L+ + 
Sbjct  192   GIVLKGIVKNLVDYGAFVDLGGI-DGLLHITDMSWKRIKDPTDVVNVGEEIEVKVLKFDR  250

Query  842   ETGRISLTMRESDETSREKQPKDSPGSSDKSRAPKRTPQRNNQRRESKFVKGQDLEGTVK  1021
             E  R+SL +         KQ  D P      R P+ T                 L G V 
Sbjct  251   ERTRVSLGL---------KQLGDDPWVDIARRYPESTR----------------LFGNVT  285

Query  1022  NLTRSGAFISLPEGEEGFLPTSEMADEGLGEIMGGSSLQVGQEVSVRVLRIS--RGQATL  1195
             N+T  GAF+ + EG EG +  SEM D     +  G  + VG EV V VL I   R + +L
Sbjct  286   NITDYGAFVEIEEGVEGLVHVSEM-DWTNKNVNPGQIVDVGDEVEVMVLEIDEERRRISL  344

Query  1196  TMKK  1207
              MK+
Sbjct  345   GMKQ  348



>ref|WP_034559636.1| 30S ribosomal protein S1 [Carnobacterium gallinarum]
Length=408

 Score = 90.9 bits (224),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 61/175 (35%), Positives = 91/175 (52%), Gaps = 28/175 (16%)
 Frame = +2

Query  653   LIPGASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNLSNSFVKDVTSVVSVGQEVTVRLLE  832
             L+ G + TGKV  +  FGAF+D G   DGLVH+S +S + VK  + V++V QEV V++L 
Sbjct  203   LVEGDTVTGKVARLTNFGAFIDLGG-VDGLVHISQISYNHVKAPSDVLAVDQEVQVKILS  261

Query  833   ANMETGRISLTMRESDETSREKQPKDSPGSSDKSRAPKRTPQRNNQRRESKFVKGQDLEG  1012
              N ETGRISL+++++            PG           P  N + R +    G  L G
Sbjct  262   INEETGRISLSIKDT-----------QPG-----------PWENIEERAA---VGAVLTG  296

Query  1013  TVKNLTRSGAFISLPEGEEGFLPTSEMADEGLGEIMGGSSLQVGQEVSVRVLRIS  1177
             TVK LT  GAF+ +  G EG +  S+++   +        L    E+ V+VL ++
Sbjct  297   TVKRLTSFGAFVEVYPGVEGLVHISQISHNHIA--TPHEVLHENDEIKVKVLEVN  349



>ref|WP_001844815.1| putative 30S ribosomal protein S1, partial [Streptococcus pneumoniae]
 gb|ELU59803.1| putative 30S ribosomal protein S1, partial [Streptococcus pneumoniae 
PCS125219]
Length=288

 Score = 89.4 bits (220),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 63/175 (36%), Positives = 93/175 (53%), Gaps = 28/175 (16%)
 Frame = +2

Query  653   LIPGASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNLSNSFVKDVTSVVSVGQEVTVRLLE  832
             L  G   TGKV  I  FGAF+D G   DGLVH++ LS+       SVV+VG+E+ V++L+
Sbjct  79    LAVGDVVTGKVARITSFGAFIDLGG-VDGLVHLTELSHERNVSPKSVVTVGEEIEVKILD  137

Query  833   ANMETGRISLTMRESDETSREKQPKDSPGSSDKSRAPKRTPQRNNQRRESKFVKGQDLEG  1012
              N E GR+SL+++ +            PG  D                E K  KG  +EG
Sbjct  138   LNEEEGRVSLSLKAT-----------VPGPWDGV--------------EQKLAKGDVVEG  172

Query  1013  TVKNLTRSGAFISLPEGEEGFLPTSEMADEGLGEIMGGSSLQVGQEVSVRVLRIS  1177
             TVK LT  GAF+ +  G +G +  S+++ + +       +L+VGQEV V+VL ++
Sbjct  173   TVKRLTDFGAFVEVLPGIDGLVHVSQISHKRIENPK--EALKVGQEVQVKVLEVN  225


 Score = 57.8 bits (138),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 31/79 (39%), Positives = 48/79 (61%), Gaps = 0/79 (0%)
 Frame = +2

Query  647  EDLIPGASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNLSNSFVKDVTSVVSVGQEVTVRL  826
            + L  G    G VK +  FGAFV+     DGLVHVS +S+  +++    + VGQEV V++
Sbjct  162  QKLAKGDVVEGTVKRLTDFGAFVEVLPGIDGLVHVSQISHKRIENPKEALKVGQEVQVKV  221

Query  827  LEANMETGRISLTMRESDE  883
            LE N +  R+SL+++  +E
Sbjct  222  LEVNADAERVSLSIKALEE  240



>gb|AHI03327.1| RNA-binding protein [Corynebacterium falsenii DSM 44353]
Length=797

 Score = 92.8 bits (229),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 60/155 (39%), Positives = 78/155 (50%), Gaps = 18/155 (12%)
 Frame = +2

Query  647   EDLIPGASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNLSNSFVKDVTSVVSVGQEVTVRL  826
             +DL PG    G V ++  FGAFVD G   DGLVHVS +S+ FVKD   VVS GQ V V++
Sbjct  648   KDLAPGMVLEGTVTNVAAFGAFVDIGVHQDGLVHVSAMSDRFVKDPHEVVSSGQVVKVKV  707

Query  827   LEANMETGRISLTMRESDETSREKQPKDSPGSSDKSRAPKRTPQRNNQRRESKFVKGQDL  1006
             +E ++   RISL++R SDE          PGSSD  R   RT       + S+  +    
Sbjct  708   MEVDVTRNRISLSLRLSDE----------PGSSDSRRPTGRTAPATGAGKSSRGAR----  753

Query  1007  EGTVKNLT----RSGAFISLPEGEEGFLPTSEMAD  1099
              G  KN      R G  +   +G  G  P   MA+
Sbjct  754   RGVDKNTNPKGQRRGHGLQGSQGSRGAGPAGSMAE  788



>ref|WP_024068156.1| Transcription accessory protein (S1 RNA-binding domain) [Achromobacter 
xylosoxidans]
 ref|YP_008923331.1| Transcription accessory protein (S1 RNA-binding domain) [Achromobacter 
xylosoxidans NBRC 15126 = ATCC 27061]
Length=791

 Score = 92.8 bits (229),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 46/103 (45%), Positives = 63/103 (61%), Gaps = 3/103 (3%)
 Frame = +2

Query  650  DLIPGASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNLSNSFVKDVTSVVSVGQEVTVRLL  829
            DL PG    G V ++  FGAFVD G   DGLVH+S L+  FVKD   VV VGQ V+V++L
Sbjct  666  DLYPGMVLEGVVTNVANFGAFVDIGVHQDGLVHISALAEKFVKDPRDVVRVGQTVSVKVL  725

Query  830  EANMETGRISLTMRESDETSREKQPKDSPGSSDKSRAPKRTPQ  958
            E ++   R++LTMR +D  +  ++  D+P   D+   P R PQ
Sbjct  726  EVDVARKRVALTMRLNDTAAPARRGADAPKGGDR---PGRRPQ  765



>ref|WP_008161788.1| RNA-binding protein [Achromobacter arsenitoxydans]
 gb|EHK66211.1| transcription accessory protein [Achromobacter arsenitoxydans 
SY8]
Length=791

 Score = 92.8 bits (229),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 44/99 (44%), Positives = 62/99 (63%), Gaps = 0/99 (0%)
 Frame = +2

Query  650  DLIPGASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNLSNSFVKDVTSVVSVGQEVTVRLL  829
            DL PG    G V ++  FGAFVD G   DGLVH+S L+  FVKD   VV VGQ V+V++L
Sbjct  666  DLYPGMVLEGVVTNVANFGAFVDIGVHQDGLVHISALAEKFVKDPRDVVRVGQTVSVKVL  725

Query  830  EANMETGRISLTMRESDETSREKQPKDSPGSSDKSRAPK  946
            E ++   R++LTMR +D  +  ++  D+P   D+ R P+
Sbjct  726  EVDVARKRVALTMRLNDTAAPARRSGDAPKGGDRPRRPQ  764



>ref|WP_001001627.1| 30S ribosomal protein S1 [Streptococcus pneumoniae]
 gb|EHE36197.1| S1 RNA binding domain protein [Streptococcus pneumoniae GA47373]
 gb|EJG37626.1| 40S ribosomal protein S1 [Streptococcus pneumoniae 2090008]
 gb|EJG57045.1| 40S ribosomal protein S1 [Streptococcus pneumoniae 2061376]
 gb|EJH04929.1| ribosomal protein S1 [Streptococcus pneumoniae GA56348]
 gb|EJH23042.1| ribosomal protein S1 [Streptococcus pneumoniae GA58981]
Length=400

 Score = 90.9 bits (224),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 64/175 (37%), Positives = 93/175 (53%), Gaps = 28/175 (16%)
 Frame = +2

Query  653   LIPGASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNLSNSFVKDVTSVVSVGQEVTVRLLE  832
             L  G   TGKV  I  FGAFVD G   DGLVH++ LS+       SVV+VG+E+ V++L+
Sbjct  191   LAVGDVVTGKVARITSFGAFVDLGG-VDGLVHLTELSHERNVSPKSVVTVGEEIEVKILD  249

Query  833   ANMETGRISLTMRESDETSREKQPKDSPGSSDKSRAPKRTPQRNNQRRESKFVKGQDLEG  1012
              N E GR+SL+++ +            PG  D                E K  KG  +EG
Sbjct  250   LNEEEGRVSLSLKAT-----------VPGPWDGV--------------EQKLAKGDVVEG  284

Query  1013  TVKNLTRSGAFISLPEGEEGFLPTSEMADEGLGEIMGGSSLQVGQEVSVRVLRIS  1177
             TVK LT  GAF+ +  G +G +  S+++ + +       +L+VGQEV V+VL ++
Sbjct  285   TVKRLTDFGAFVEVLPGIDGLVHVSQISHKRIENPK--EALKVGQEVQVKVLEVN  337


 Score = 60.5 bits (145),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 36/109 (33%), Positives = 60/109 (55%), Gaps = 5/109 (5%)
 Frame = +2

Query  653  LIPGASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNLSNSFVKDVTSVVSVGQEVTVRLLE  832
            L  G    G VK +  FGAFV+     DGLVHVS +S+  +++    + VGQEV V++LE
Sbjct  276  LAKGDVVEGTVKRLTDFGAFVEVLPGIDGLVHVSQISHKRIENPKEALKVGQEVQVKVLE  335

Query  833  ANMETGRISLTMRESDETSREKQPKDSPGSSDKSRAPKRTPQRNNQRRE  979
             N +  R+SL+++     + E++P    G  ++ R  +    R  ++R+
Sbjct  336  VNADAERVSLSIK-----ALEERPAQEEGQKEEKRVARPRRPRRQEKRD  379



>ref|WP_011579664.1| RNA-binding protein [Chelativorans sp. BNC1]
 ref|YP_672886.1| RNA binding S1 [Chelativorans sp. BNC1]
 gb|ABG61721.1| RNA binding S1 [Chelativorans sp. BNC1]
Length=772

 Score = 92.4 bits (228),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 51/110 (46%), Positives = 64/110 (58%), Gaps = 8/110 (7%)
 Frame = +2

Query  647  EDLIPGASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNLSNSFVKDVTSVVSVGQEVTVRL  826
            +DL PG    G V ++  FGAFVD G   DGLVHVS L+N FVKD   VV  G  V VR+
Sbjct  645  KDLKPGMMLEGTVTNVAAFGAFVDIGVHQDGLVHVSQLANRFVKDAHEVVKAGDVVKVRV  704

Query  827  LEANMETGRISLTMR-ESDETSREKQPKDSPGSSDKSRAPKRTPQRNNQR  973
            LE +++  RISL+MR + D  SR +QP++S         P R  Q  N R
Sbjct  705  LEVDIKRNRISLSMRSDGDAGSRPQQPRESG-------KPLRNSQPGNDR  747



>ref|WP_001001626.1| 30S ribosomal protein S1 [Streptococcus pneumoniae]
 ref|NP_345350.1| 30S ribosomal protein S1 [Streptococcus pneumoniae TIGR4]
 gb|AAK74990.1| ribosomal protein S1 [Streptococcus pneumoniae TIGR4]
 gb|EDK64982.1| 30S ribosomal protein S1 [Streptococcus pneumoniae SP14-BS69]
 gb|EDT50144.1| putative 30S ribosomal protein S1 homolog [Streptococcus pneumoniae 
CDC1873-00]
 gb|EDT98991.1| putative ribosomal protein S1 [Streptococcus pneumoniae MLV-016]
 gb|EGJ16787.1| hypothetical protein SPAR69_0831 [Streptococcus pneumoniae GA41317]
 gb|EGJ18083.1| S1 RNA binding domain protein [Streptococcus pneumoniae GA47368]
 gb|EHD31623.1| hypothetical protein SPAR19_0783 [Streptococcus pneumoniae GA11184]
 gb|EHD39442.1| S1 RNA binding domain protein [Streptococcus pneumoniae GA47033]
 gb|EHD45927.1| S1 RNA binding domain protein [Streptococcus pneumoniae GA44452]
 gb|EHD60652.1| S1 RNA binding domain protein [Streptococcus pneumoniae GA41410]
 gb|EHD64215.1| S1 RNA binding domain protein [Streptococcus pneumoniae GA49447]
 gb|EHD83610.1| S1 RNA binding domain protein [Streptococcus pneumoniae GA07643]
 gb|EHD89673.1| hypothetical protein SPAR31_0856 [Streptococcus pneumoniae GA13494]
 gb|EHD95100.1| hypothetical protein SPAR32_0852 [Streptococcus pneumoniae GA13637]
 gb|EHE09161.1| hypothetical protein SPAR49_0898 [Streptococcus pneumoniae GA17328]
 gb|EHE15884.1| hypothetical protein SPAR56_1046 [Streptococcus pneumoniae GA19077]
 gb|EHE22284.1| hypothetical protein SPAR71_0904 [Streptococcus pneumoniae GA41437]
 gb|EHE32682.1| S1 RNA binding domain protein [Streptococcus pneumoniae GA47360]
 gb|EHE47826.1| hypothetical protein SPAR115_0849 [Streptococcus pneumoniae GA52306]
 gb|EHE53222.1| hypothetical protein SPAR147_0821 [Streptococcus pneumoniae Netherlands15B-37]
 gb|EHE55107.1| S1 RNA binding domain protein [Streptococcus pneumoniae NP127]
 gb|EHE57493.1| S1 RNA binding domain protein [Streptococcus pneumoniae GA47751]
 gb|EHE69552.1| S1 RNA binding domain protein [Streptococcus pneumoniae EU-NP01]
 gb|EHE73926.1| S1 RNA binding domain protein [Streptococcus pneumoniae NorthCarolina6A-23]
 gb|EHY97945.1| S1 RNA binding domain protein [Streptococcus pneumoniae GA02254]
 gb|EHY97958.1| S1 RNA binding domain protein [Streptococcus pneumoniae GA02270]
 gb|EHY98408.1| S1 RNA binding domain protein [Streptococcus pneumoniae GA02714]
 gb|EHZ24110.1| S1 RNA binding domain protein [Streptococcus pneumoniae GA14373]
 gb|EHZ31895.1| S1 RNA binding domain protein [Streptococcus pneumoniae GA18068]
 gb|EHZ45643.1| S1 RNA binding domain protein [Streptococcus pneumoniae GA40563]
 gb|EHZ53146.1| S1 RNA binding domain protein [Streptococcus pneumoniae GA44386]
 gb|EHZ54583.1| S1 RNA binding domain protein [Streptococcus pneumoniae GA43264]
 gb|EHZ60070.1| S1 RNA binding domain protein [Streptococcus pneumoniae GA47461]
 gb|EHZ72458.1| S1 RNA binding domain protein [Streptococcus pneumoniae GA49194]
 gb|EHZ94313.1| S1 RNA binding domain protein [Streptococcus pneumoniae EU-NP04]
 gb|EJG49192.1| 40S ribosomal protein S1 [Streptococcus pneumoniae 2070531]
 gb|EJG49503.1| 40S ribosomal protein S1 [Streptococcus pneumoniae 2070425]
 gb|EJG62892.1| 40S ribosomal protein S1 [Streptococcus pneumoniae 2061617]
 gb|EJG71670.1| 40S ribosomal protein S1 [Streptococcus pneumoniae 2081074]
 gb|EJG74773.1| 40S ribosomal protein S1 [Streptococcus pneumoniae 2082170]
 gb|EJG82046.1| S1 RNA binding domain protein [Streptococcus pneumoniae SPAR48]
 gb|EJG87824.1| S1 RNA binding domain protein [Streptococcus pneumoniae SPAR55]
 gb|EJG98193.1| ribosomal protein S1 [Streptococcus pneumoniae GA60190]
 gb|EJH12642.1| ribosomal protein S1 [Streptococcus pneumoniae GA17484]
 gb|EOB25712.1| 30S ribosomal protein S1 [Streptococcus pneumoniae 3051]
 gb|ESP65911.1| 30S ribosomal protein S1 [Streptococcus pneumoniae BHN418]
 gb|ESP67254.1| 30S ribosomal protein S1 [Streptococcus pneumoniae BHN237]
 gb|ESP68341.1| 30S ribosomal protein S1 [Streptococcus pneumoniae BHN191]
 gb|ESP71192.1| 30S ribosomal protein S1 [Streptococcus pneumoniae BHN427]
Length=400

 Score = 90.9 bits (224),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 64/175 (37%), Positives = 93/175 (53%), Gaps = 28/175 (16%)
 Frame = +2

Query  653   LIPGASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNLSNSFVKDVTSVVSVGQEVTVRLLE  832
             L  G   TGKV  I  FGAFVD G   DGLVH++ LS+       SVV+VG+E+ V++L+
Sbjct  191   LAVGDVVTGKVARITSFGAFVDLGG-VDGLVHLTELSHERNVSPKSVVTVGEEIEVKILD  249

Query  833   ANMETGRISLTMRESDETSREKQPKDSPGSSDKSRAPKRTPQRNNQRRESKFVKGQDLEG  1012
              N E GR+SL+++ +            PG  D                E K  KG  +EG
Sbjct  250   LNEEEGRVSLSLKAT-----------VPGPWDGV--------------EQKLAKGDVVEG  284

Query  1013  TVKNLTRSGAFISLPEGEEGFLPTSEMADEGLGEIMGGSSLQVGQEVSVRVLRIS  1177
             TVK LT  GAF+ +  G +G +  S+++ + +       +L+VGQEV V+VL ++
Sbjct  285   TVKRLTDFGAFVEVLPGIDGLVHVSQISHKRIENPK--EALKVGQEVQVKVLEVN  337


 Score = 57.8 bits (138),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 31/77 (40%), Positives = 47/77 (61%), Gaps = 0/77 (0%)
 Frame = +2

Query  653  LIPGASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNLSNSFVKDVTSVVSVGQEVTVRLLE  832
            L  G    G VK +  FGAFV+     DGLVHVS +S+  +++    + VGQEV V++LE
Sbjct  276  LAKGDVVEGTVKRLTDFGAFVEVLPGIDGLVHVSQISHKRIENPKEALKVGQEVQVKVLE  335

Query  833  ANMETGRISLTMRESDE  883
             N +  R+SL+++  +E
Sbjct  336  VNADAERVSLSIKALEE  352



>ref|WP_035028356.1| 30S ribosomal protein S1 [Carnobacterium mobile]
Length=410

 Score = 90.9 bits (224),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 62/185 (34%), Positives = 96/185 (52%), Gaps = 28/185 (15%)
 Frame = +2

Query  647   EDLIPGASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNLSNSFVKDVTSVVSVGQEVTVRL  826
             ++L  G +  GKV  +  FGAF+D G   DGLVH+S +S   VK+   V+ VG+EV V++
Sbjct  201   QNLTEGETVKGKVARLTNFGAFIDLGG-VDGLVHISQISYEHVKNPADVLKVGEEVDVKV  259

Query  827   LEANMETGRISLTMRESDETSREKQPKDSPGSSDKSRAPKRTPQRNNQRRESKFVKGQDL  1006
             L  + ETGRISL+++++            PG           P  N + R +    G  L
Sbjct  260   LSVDEETGRISLSIKDT-----------LPG-----------PWDNIEERAA---VGSVL  294

Query  1007  EGTVKNLTRSGAFISLPEGEEGFLPTSEMADEGLGEIMGGSSLQVGQEVSVRVLRISRGQ  1186
             +GTVK LT  GAF+ +  G EG +  S+++   +        L  GQE+ V+VL ++   
Sbjct  295   DGTVKRLTSFGAFVEVFPGVEGLVHISQISHNHIA--TPHEVLSEGQEIKVKVLDVNPND  352

Query  1187  ATLTM  1201
               L++
Sbjct  353   QRLSL  357


 Score = 54.3 bits (129),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 27/74 (36%), Positives = 46/74 (62%), Gaps = 0/74 (0%)
 Frame = +2

Query  662  GASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNLSNSFVKDVTSVVSVGQEVTVRLLEANM  841
            G+   G VK +  FGAFV+     +GLVH+S +S++ +     V+S GQE+ V++L+ N 
Sbjct  291  GSVLDGTVKRLTSFGAFVEVFPGVEGLVHISQISHNHIATPHEVLSEGQEIKVKVLDVNP  350

Query  842  ETGRISLTMRESDE  883
               R+SL+++  +E
Sbjct  351  NDQRLSLSIKALEE  364



>ref|WP_006389393.1| RNA-binding protein [Achromobacter xylosoxidans]
 gb|EFV82404.1| tex protein [Achromobacter xylosoxidans C54]
 gb|AIR50534.1| transcription accessory protein [Achromobacter xylosoxidans C54]
Length=791

 Score = 92.4 bits (228),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 46/103 (45%), Positives = 63/103 (61%), Gaps = 3/103 (3%)
 Frame = +2

Query  650  DLIPGASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNLSNSFVKDVTSVVSVGQEVTVRLL  829
            DL PG    G V ++  FGAFVD G   DGLVH+S L+  FVKD   VV VGQ V+V++L
Sbjct  666  DLYPGMVLEGVVTNVANFGAFVDIGVHQDGLVHISALAEKFVKDPRDVVRVGQTVSVKVL  725

Query  830  EANMETGRISLTMRESDETSREKQPKDSPGSSDKSRAPKRTPQ  958
            E ++   R++LTMR +D  +  ++  D+P   D+   P R PQ
Sbjct  726  EVDVARKRVALTMRLNDTAAPARRGADAPKGGDR---PGRRPQ  765



>ref|WP_017380368.1| 30S ribosomal protein S1 [Paenisporosarcina sp. TG-14]
Length=379

 Score = 90.5 bits (223),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 63/193 (33%), Positives = 101/193 (52%), Gaps = 34/193 (18%)
 Frame = +2

Query  662   GASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNLSNSFVKDVTSVVSVGQEVTVRLLEANM  841
             G   TG V+ I  FGAFVD G   DGLVH+S LS+  V+ V+ V+  GQ++ V++L  + 
Sbjct  188   GDELTGTVQRIASFGAFVDLGG-VDGLVHISQLSHEHVEQVSDVIQEGQQIKVKVLSVDR  246

Query  842   ETGRISLTMRESDETSREKQPKDSPGSSDKSRAPKRTPQRNNQRRESKFVKGQDLEGTVK  1021
             ++ RISL+++++        P    G  DK  AP+ + Q                 GT+K
Sbjct  247   DSERISLSIKDT-------LPGPWEGIEDK--APRGSVQT----------------GTIK  281

Query  1022  NLTRSGAFISLPEGEEGFLPTSEMADEGLG---EIMGGSSLQVGQEVSVRVLRISRGQAT  1192
              L   GAF+ +  G EG +  S++A   +G   E+     L+ GQEV V+VL +++    
Sbjct  282   RLVSYGAFVEVFPGIEGLVHISQIAHSHIGTPHEV-----LKEGQEVQVKVLEVNKQDKR  336

Query  1193  LTMKKEEATEEVN  1231
             L++  ++  E+ N
Sbjct  337   LSLSIKDLLEKEN  349


 Score = 54.7 bits (130),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 32/89 (36%), Positives = 52/89 (58%), Gaps = 1/89 (1%)
 Frame = +2

Query  647  EDLIP-GASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNLSNSFVKDVTSVVSVGQEVTVR  823
            ED  P G+  TG +K +  +GAFV+     +GLVH+S +++S +     V+  GQEV V+
Sbjct  267  EDKAPRGSVQTGTIKRLVSYGAFVEVFPGIEGLVHISQIAHSHIGTPHEVLKEGQEVQVK  326

Query  824  LLEANMETGRISLTMRESDETSREKQPKD  910
            +LE N +  R+SL++++  E   E    D
Sbjct  327  VLEVNKQDKRLSLSIKDLLEKENEYSGSD  355



>ref|WP_001862393.1| 30S ribosomal protein S1 [Streptococcus pneumoniae]
 gb|EOB16213.1| 30S ribosomal protein S1 [Streptococcus pneumoniae 2009]
Length=400

 Score = 90.9 bits (224),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 64/175 (37%), Positives = 93/175 (53%), Gaps = 28/175 (16%)
 Frame = +2

Query  653   LIPGASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNLSNSFVKDVTSVVSVGQEVTVRLLE  832
             L  G   TGKV  I  FGAFVD G   DGLVH++ LS+       SVV+VG+E+ V++L+
Sbjct  191   LAVGDVVTGKVARITSFGAFVDLGG-VDGLVHLTELSHERNVSPKSVVTVGEEIEVKILD  249

Query  833   ANMETGRISLTMRESDETSREKQPKDSPGSSDKSRAPKRTPQRNNQRRESKFVKGQDLEG  1012
              N E GR+SL+++ +            PG  D                E K  KG  +EG
Sbjct  250   LNEEEGRVSLSLKAT-----------VPGPWDGV--------------EQKLAKGDVVEG  284

Query  1013  TVKNLTRSGAFISLPEGEEGFLPTSEMADEGLGEIMGGSSLQVGQEVSVRVLRIS  1177
             TVK LT  GAF+ +  G +G +  S+++ + +       +L+VGQEV V+VL ++
Sbjct  285   TVKRLTDFGAFVEVLPGIDGLVHVSQISHKRIENPK--EALKVGQEVQVKVLEVN  337


 Score = 57.8 bits (138),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 31/77 (40%), Positives = 47/77 (61%), Gaps = 0/77 (0%)
 Frame = +2

Query  653  LIPGASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNLSNSFVKDVTSVVSVGQEVTVRLLE  832
            L  G    G VK +  FGAFV+     DGLVHVS +S+  +++    + VGQEV V++LE
Sbjct  276  LAKGDVVEGTVKRLTDFGAFVEVLPGIDGLVHVSQISHKRIENPKEALKVGQEVQVKVLE  335

Query  833  ANMETGRISLTMRESDE  883
             N +  R+SL+++  +E
Sbjct  336  VNADAERVSLSIKALEE  352



>ref|WP_006040783.1| hypothetical protein [Paenibacillus curdlanolyticus]
 gb|EFM08392.1| Tex-like protein [Paenibacillus curdlanolyticus YK9]
Length=742

 Score = 92.4 bits (228),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 47/94 (50%), Positives = 61/94 (65%), Gaps = 7/94 (7%)
 Frame = +2

Query  620  KSEMPP-------IKNEDLIPGASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNLSNSFVK  778
            + E+PP       ++ EDL PG    G V+++  FGAFVD G   DGLVH+S LS  FVK
Sbjct  649  REELPPPAFRTDVLQIEDLKPGMELQGTVRNVIDFGAFVDIGIKNDGLVHISRLSTKFVK  708

Query  779  DVTSVVSVGQEVTVRLLEANMETGRISLTMRESD  880
              T VVSVG  VTV +LEA+++ GR+SLTM + D
Sbjct  709  HPTDVVSVGDAVTVWVLEADLKKGRVSLTMVKPD  742



>ref|WP_029363180.1| 30S ribosomal protein S1 [Herbaspirillum lusitanum]
Length=552

 Score = 92.0 bits (227),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 68/192 (35%), Positives = 99/192 (52%), Gaps = 29/192 (15%)
 Frame = +2

Query  647   EDLIPGASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNLSNSFVKDVTSVVSVGQEVTVRL  826
             E L  G   TG VK+I  +GAFVD G   DGL+H+++L+   V+  + V++VGQE+T ++
Sbjct  180   ETLKEGTVVTGVVKNITDYGAFVDLGGI-DGLLHITDLAWRRVRHPSEVLTVGQEITAKV  238

Query  827   LEANMETGRISLTMRESDETSREKQPKDSPGSSDKSRAPKRTPQRNNQRRESKFVKGQDL  1006
             L+ + E  R+SL +         KQ  D P +       +R PQ            G  L
Sbjct  239   LKYDQEKNRVSLGV---------KQLGDDPWTG----LSRRYPQ------------GTRL  273

Query  1007  EGTVKNLTRSGAFISLPEGEEGFLPTSEMADEGLGEIMGGSSLQVGQEVSVRVLRIS--R  1180
              G V NLT  GAF+ + +G EG +  SEM D     +     +Q+G EV V VL I   R
Sbjct  274   FGKVTNLTDYGAFVEVEQGIEGLVHVSEM-DWTNKNVAPNKVVQLGDEVEVMVLEIDEER  332

Query  1181  GQATLTMKKEEA  1216
              + +L MK+ +A
Sbjct  333   RRISLGMKQCKA  344



>ref|WP_013252183.1| 30S ribosomal protein S1 [Olsenella uli]
 ref|YP_003801311.1| SSU ribosomal protein S1P [Olsenella uli DSM 7084]
 gb|ADK68431.1| SSU ribosomal protein S1P [Olsenella uli DSM 7084]
 gb|EUB32286.1| S1 RNA binding domain protein [Olsenella uli MSTE5]
Length=392

 Score = 90.5 bits (223),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 66/186 (35%), Positives = 93/186 (50%), Gaps = 30/186 (16%)
 Frame = +2

Query  653   LIPGASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNLSNSFVKDVTSVVSVGQEVTVRLLE  832
             L PG    G V SI  FGAFVD G   DGL+H+S LS + V   + VV VGQEV V++L+
Sbjct  204   LQPGMRLKGTVSSIVDFGAFVDLGGI-DGLIHISELSWNHVNHPSEVVKVGQEVEVQVLD  262

Query  833   ANMETGRISLTMRESDETSREKQPKDSPGSSDKSRAPKRTPQRNNQRRESKFVKGQDLEG  1012
              ++   RISL ++++ E                   P RT  +       K+  G  +EG
Sbjct  263   VDLNRERISLGLKQTTED------------------PWRTLVK-------KYPVGAIVEG  297

Query  1013  TVKNLTRSGAFISLPEGEEGFLPTSEMADEGLGEIMGGSSLQVGQEVSVRVLRI--SRGQ  1186
             +V  L   GAF+ L +G EG +  SEMA + +          VG  V V+V+ I   R +
Sbjct  298   SVTKLVTFGAFVDLGDGVEGLVHISEMAKQHVDA--PAQVCAVGDTVQVKVMEIDLDRRR  355

Query  1187  ATLTMK  1204
              +L+MK
Sbjct  356   ISLSMK  361


 Score = 61.6 bits (148),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 34/88 (39%), Positives = 50/88 (57%), Gaps = 3/88 (3%)
 Frame = +2

Query  662  GASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNLSNSFVKDVTSVVSVGQEVTVRLLEANM  841
            GA   G V  +  FGAFVD G   +GLVH+S ++   V     V +VG  V V+++E ++
Sbjct  292  GAIVEGSVTKLVTFGAFVDLGDGVEGLVHISEMAKQHVDAPAQVCAVGDTVQVKVMEIDL  351

Query  842  ETGRISLTMRESDET---SREKQPKDSP  916
            +  RISL+M+ + ET     E +P D P
Sbjct  352  DRRRISLSMKAAAETLGVEVEVKPLDKP  379



>ref|WP_033584854.1| 30S ribosomal protein S1 [Streptococcus sp. SR1]
 gb|EUC79695.1| S1 RNA binding domain protein [Streptococcus sp. SR1]
Length=400

 Score = 90.5 bits (223),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 63/175 (36%), Positives = 94/175 (54%), Gaps = 28/175 (16%)
 Frame = +2

Query  653   LIPGASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNLSNSFVKDVTSVVSVGQEVTVRLLE  832
             L  G   TGKV  I  FGAF+D G   DGLVH++ LS+       SVV+VG+E+ V++L+
Sbjct  191   LAVGDVVTGKVARITSFGAFIDLGG-VDGLVHLTELSHERNVSPKSVVTVGEEIEVKILD  249

Query  833   ANMETGRISLTMRESDETSREKQPKDSPGSSDKSRAPKRTPQRNNQRRESKFVKGQDLEG  1012
              N E GR+SL+++ +           +PG  D                E K  KG  +EG
Sbjct  250   LNEEEGRVSLSLKAT-----------TPGPWDGV--------------EQKLAKGDVVEG  284

Query  1013  TVKNLTRSGAFISLPEGEEGFLPTSEMADEGLGEIMGGSSLQVGQEVSVRVLRIS  1177
             TVK LT  GAF+ +  G +G +  S+++ + +       +L VGQEV+V+VL ++
Sbjct  285   TVKRLTDFGAFVEVLPGIDGLVHVSQISHKRIENPK--EALTVGQEVTVKVLDVN  337


 Score = 59.3 bits (142),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 31/77 (40%), Positives = 49/77 (64%), Gaps = 0/77 (0%)
 Frame = +2

Query  653  LIPGASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNLSNSFVKDVTSVVSVGQEVTVRLLE  832
            L  G    G VK +  FGAFV+     DGLVHVS +S+  +++    ++VGQEVTV++L+
Sbjct  276  LAKGDVVEGTVKRLTDFGAFVEVLPGIDGLVHVSQISHKRIENPKEALTVGQEVTVKVLD  335

Query  833  ANMETGRISLTMRESDE  883
             N +  R+SL+++  +E
Sbjct  336  VNADAERVSLSIKALEE  352



>ref|WP_034569556.1| 30S ribosomal protein S1 [Carnobacterium divergens]
Length=406

 Score = 90.9 bits (224),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 61/183 (33%), Positives = 93/183 (51%), Gaps = 28/183 (15%)
 Frame = +2

Query  653   LIPGASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNLSNSFVKDVTSVVSVGQEVTVRLLE  832
             L+ G + TG V  +  FGAF+D G   DGLVH+S +S   VK+   V++VG  V V++L 
Sbjct  203   LVEGDTVTGTVARLTNFGAFIDLGG-VDGLVHISQISYDHVKNPADVLTVGDSVEVKILS  261

Query  833   ANMETGRISLTMRESDETSREKQPKDSPGSSDKSRAPKRTPQRNNQRRESKFVKGQDLEG  1012
              + ETGRISL+++++            PG           P  N + R +    G  L G
Sbjct  262   IDTETGRISLSIKDT-----------QPG-----------PWDNIEERAA---VGTTLTG  296

Query  1013  TVKNLTRSGAFISLPEGEEGFLPTSEMADEGLGEIMGGSSLQVGQEVSVRVLRISRGQAT  1192
             TVK LT  GAF+ +  G EG +  S+++   +        L  G E+ V+VL ++ G   
Sbjct  297   TVKRLTSFGAFVEVYPGVEGLVHISQISHNHIA--TPHEVLHEGDEIKVKVLDVNPGDQR  354

Query  1193  LTM  1201
             L++
Sbjct  355   LSL  357



>gb|AHZ47562.1| 30S ribosomal protein S1 [Streptococcus sp. VT 162]
Length=400

 Score = 90.5 bits (223),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 63/175 (36%), Positives = 94/175 (54%), Gaps = 28/175 (16%)
 Frame = +2

Query  653   LIPGASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNLSNSFVKDVTSVVSVGQEVTVRLLE  832
             L  G   TGKV  I  FGAF+D G   DGLVH++ LS+       SVV+VG+E+ V++L+
Sbjct  191   LAVGDVVTGKVARITSFGAFIDLGG-VDGLVHLTELSHERNVSPKSVVTVGEEIEVKILD  249

Query  833   ANMETGRISLTMRESDETSREKQPKDSPGSSDKSRAPKRTPQRNNQRRESKFVKGQDLEG  1012
              N E GR+SL+++ +           +PG  D                E K  KG  +EG
Sbjct  250   LNEEEGRVSLSLKAT-----------TPGPWDGV--------------EQKLAKGDVVEG  284

Query  1013  TVKNLTRSGAFISLPEGEEGFLPTSEMADEGLGEIMGGSSLQVGQEVSVRVLRIS  1177
             TVK LT  GAF+ +  G +G +  S+++ + +       +L VGQEV+V+VL ++
Sbjct  285   TVKRLTDFGAFVEVLPGIDGLVHVSQISHKRIENPK--EALTVGQEVTVKVLDVN  337


 Score = 59.3 bits (142),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 31/77 (40%), Positives = 49/77 (64%), Gaps = 0/77 (0%)
 Frame = +2

Query  653  LIPGASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNLSNSFVKDVTSVVSVGQEVTVRLLE  832
            L  G    G VK +  FGAFV+     DGLVHVS +S+  +++    ++VGQEVTV++L+
Sbjct  276  LAKGDVVEGTVKRLTDFGAFVEVLPGIDGLVHVSQISHKRIENPKEALTVGQEVTVKVLD  335

Query  833  ANMETGRISLTMRESDE  883
             N +  R+SL+++  +E
Sbjct  336  VNADAERVSLSIKALEE  352



>ref|WP_016398108.1| 30S ribosomal protein S1 [Streptococcus pneumoniae]
 gb|EPD18672.1| 30S ribosomal protein S1 [Streptococcus pneumoniae MNZ14]
 gb|KGI25795.1| SSU ribosomal protein S1p [Streptococcus pneumoniae]
 gb|KGI34586.1| SSU ribosomal protein S1p [Streptococcus pneumoniae ECC_3510]
Length=400

 Score = 90.5 bits (223),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 63/175 (36%), Positives = 93/175 (53%), Gaps = 28/175 (16%)
 Frame = +2

Query  653   LIPGASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNLSNSFVKDVTSVVSVGQEVTVRLLE  832
             L  G   TGKV  I  FGAF+D G   DGLVH++ LS+       SVV+VG+E+ V++L+
Sbjct  191   LAVGDVVTGKVARITSFGAFIDLGG-VDGLVHLTELSHERNVSPKSVVTVGEEIEVKILD  249

Query  833   ANMETGRISLTMRESDETSREKQPKDSPGSSDKSRAPKRTPQRNNQRRESKFVKGQDLEG  1012
              N E GR+SL+++ +            PG  D                E K  KG  +EG
Sbjct  250   LNEEEGRVSLSLKAT-----------VPGPWDGV--------------EQKLAKGDVVEG  284

Query  1013  TVKNLTRSGAFISLPEGEEGFLPTSEMADEGLGEIMGGSSLQVGQEVSVRVLRIS  1177
             TVK LT  GAF+ +  G +G +  S+++ + +       +L+VGQEV V+VL ++
Sbjct  285   TVKRLTDFGAFVEVLPGIDGLVHVSQISHKRIENPK--EALKVGQEVQVKVLEVN  337


 Score = 57.8 bits (138),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 31/77 (40%), Positives = 47/77 (61%), Gaps = 0/77 (0%)
 Frame = +2

Query  653  LIPGASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNLSNSFVKDVTSVVSVGQEVTVRLLE  832
            L  G    G VK +  FGAFV+     DGLVHVS +S+  +++    + VGQEV V++LE
Sbjct  276  LAKGDVVEGTVKRLTDFGAFVEVLPGIDGLVHVSQISHKRIENPKEALKVGQEVQVKVLE  335

Query  833  ANMETGRISLTMRESDE  883
             N +  R+SL+++  +E
Sbjct  336  VNADAERVSLSIKALEE  352



>ref|WP_001001617.1| MULTISPECIES: 30S ribosomal protein S1 [Streptococcus]
 ref|YP_004325832.1| 30S ribosomal protein S1 [Streptococcus oralis Uo5]
 gb|EFA24401.1| putative ribosomal protein S1 [Streptococcus sp. M143]
 gb|EFE56422.1| putative ribosomal protein S1 [Streptococcus oralis ATCC 35037]
 gb|EFO01961.1| 40S ribosomal protein S1 [Streptococcus oralis ATCC 35037]
 gb|EFU62603.1| putative ribosomal protein S1 [Streptococcus oralis ATCC 49296]
 gb|EFX56699.1| putative ribosomal protein S1 [Streptococcus sp. C300]
 emb|CBZ00491.1| 30S ribosomal protein S1 [Streptococcus oralis Uo5]
 gb|EGU69929.1| 30S ribosomal protein S1 [Streptococcus mitis bv. 2 str. SK95]
 gb|EHI76327.1| putative ribosomal protein S1 [Streptococcus sp. oral taxon 058 
str. F0407]
 gb|EIC75942.1| S1 RNA binding domain protein [Streptococcus oralis SK610]
 gb|EIC78046.1| S1 RNA binding domain protein [Streptococcus oralis SK100]
 gb|EIC78689.1| S1 RNA binding domain protein [Streptococcus oralis SK10]
 gb|EKA06525.1| 30S ribosomal protein S1 [Streptococcus sp. GMD6S]
 gb|EKA16732.1| 30S ribosomal protein S1 [Streptococcus sp. GMD2S]
 gb|EKA18516.1| 30S ribosomal protein S1 [Streptococcus sp. GMD1S]
 gb|KEQ46181.1| S1 RNA binding domain protein [Streptococcus oralis]
 gb|KEQ50390.1| S1 RNA binding domain protein [Streptococcus oralis]
Length=400

 Score = 90.5 bits (223),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 63/175 (36%), Positives = 94/175 (54%), Gaps = 28/175 (16%)
 Frame = +2

Query  653   LIPGASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNLSNSFVKDVTSVVSVGQEVTVRLLE  832
             L  G   TGKV  I  FGAF+D G   DGLVH++ LS+       SVV+VG+E+ V++L+
Sbjct  191   LAVGDVVTGKVARITSFGAFIDLGG-VDGLVHLTELSHERNVSPKSVVTVGEEIEVKILD  249

Query  833   ANMETGRISLTMRESDETSREKQPKDSPGSSDKSRAPKRTPQRNNQRRESKFVKGQDLEG  1012
              N E GR+SL+++ +           +PG  D                E K  KG  +EG
Sbjct  250   LNEEEGRVSLSLKAT-----------TPGPWDGV--------------EQKLAKGDVVEG  284

Query  1013  TVKNLTRSGAFISLPEGEEGFLPTSEMADEGLGEIMGGSSLQVGQEVSVRVLRIS  1177
             TVK LT  GAF+ +  G +G +  S+++ + +       +L VGQEV+V+VL ++
Sbjct  285   TVKRLTDFGAFVEVLPGIDGLVHVSQISHKRIENPK--EALTVGQEVTVKVLDVN  337


 Score = 59.3 bits (142),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 31/77 (40%), Positives = 49/77 (64%), Gaps = 0/77 (0%)
 Frame = +2

Query  653  LIPGASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNLSNSFVKDVTSVVSVGQEVTVRLLE  832
            L  G    G VK +  FGAFV+     DGLVHVS +S+  +++    ++VGQEVTV++L+
Sbjct  276  LAKGDVVEGTVKRLTDFGAFVEVLPGIDGLVHVSQISHKRIENPKEALTVGQEVTVKVLD  335

Query  833  ANMETGRISLTMRESDE  883
             N +  R+SL+++  +E
Sbjct  336  VNADAERVSLSIKALEE  352



>ref|WP_011958658.1| RNA-binding protein S1 [Roseiflexus sp. RS-1]
 ref|YP_001278268.1| RNA-binding S1 domain-containing protein [Roseiflexus sp. RS-1]
 gb|ABQ92318.1| RNA binding S1 domain protein [Roseiflexus sp. RS-1]
Length=514

 Score = 91.7 bits (226),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 70/224 (31%), Positives = 118/224 (53%), Gaps = 22/224 (10%)
 Frame = +2

Query  635   PIKNEDLIPGASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNLSNSFVKDVTSVVSVGQEV  814
             P + +DL PG    G+V SI  +G FVD G   DGLVH+S +S++ ++  + +V +G  V
Sbjct  133   PRRVKDLAPGMELEGRVTSIALYGIFVDIGVGRDGLVHISEMSDTRIESPSDLVKIGDTV  192

Query  815   TVRLLEANMETGRISLTMRESDETSREKQPKDSPGSSDKSRAPKRTPQRNNQRRESKFVK  994
              VR+     +  RISLTMR  +   R  +P+   G        K+ P+ + ++  +  V 
Sbjct  193   KVRVKSVEPDGRRISLTMRTKE---RSAEPRSGRG--------KKKPEVDYEKLAALRV-  240

Query  995   GQDLEGTVKNLTRSGAFISLPEGEEGFLPTSEMADEGLGEIMGGSSLQVGQEVSVRVLRI  1174
             G ++EGTV  +   G F+ +  G++G +  SE+A EG  E      +QVGQ  + +VL +
Sbjct  241   GDNVEGTVTGMAPFGVFVDIGVGKDGLVHVSELA-EGRVE-KAEDVVQVGQTYTFKVLEV  298

Query  1175  SRGQA--TLTMKKEEATEEVNSVLSQGVIHKAT----NPFALAF  1288
                 A  +L++++ +  +++   L +G I + T     PF  AF
Sbjct  299   DAAGARISLSLRRAQRGQKLQQ-LEKGQILEGTISGLAPFG-AF  340


 Score = 87.4 bits (215),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 55/171 (32%), Positives = 80/171 (47%), Gaps = 30/171 (18%)
 Frame = +2

Query  662   GASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNLSNSFVKDVTSVVSVGQEVTVRLLEANM  841
             G +  G V  + PFG FVD G   DGLVHVS L+   V+    VV VGQ  T ++LE + 
Sbjct  241   GDNVEGTVTGMAPFGVFVDIGVGKDGLVHVSELAEGRVEKAEDVVQVGQTYTFKVLEVDA  300

Query  842   ETGRISLTMRESDETSREKQPKDSPGSSDKSRAPKRTPQRNNQRRESKFVKGQDLEGTVK  1021
                RISL++R +    + +Q                              KGQ LEGT+ 
Sbjct  301   AGARISLSLRRAQRGQKLQQ----------------------------LEKGQILEGTIS  332

Query  1022  NLTRSGAFISLPEGEEGFLPTSEMADEGLGEIMGGSSLQVGQEVSVRVLRI  1174
              L   GAF+ +  G +G +  SE+++  +  +     ++VG  V VRVL +
Sbjct  333   GLAPFGAFVDIGVGRDGLVHISELSNTHVARVE--DVVKVGDRVQVRVLDV  381


 Score = 74.7 bits (182),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 37/80 (46%), Positives = 49/80 (61%), Gaps = 0/80 (0%)
 Frame = +2

Query  641  KNEDLIPGASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNLSNSFVKDVTSVVSVGQEVTV  820
            K + L  G    G +  + PFGAFVD G   DGLVH+S LSN+ V  V  VV VG  V V
Sbjct  317  KLQQLEKGQILEGTISGLAPFGAFVDIGVGRDGLVHISELSNTHVARVEDVVKVGDRVQV  376

Query  821  RLLEANMETGRISLTMRESD  880
            R+L+ + ++ RISL++R  D
Sbjct  377  RVLDVDPQSKRISLSLRLED  396



>ref|WP_001001625.1| 30S ribosomal protein S1 [Streptococcus pneumoniae]
 ref|YP_006701601.1| 30S ribosomal protein S1 [Streptococcus pneumoniae SPNA45]
 emb|CCM08456.1| putative 30S ribosomal protein S1 [Streptococcus pneumoniae SPNA45]
Length=400

 Score = 90.5 bits (223),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 64/175 (37%), Positives = 93/175 (53%), Gaps = 28/175 (16%)
 Frame = +2

Query  653   LIPGASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNLSNSFVKDVTSVVSVGQEVTVRLLE  832
             L  G   TGKV  I  FGAFVD G   DGLVH++ LS+       SVV+VG+E+ V++L+
Sbjct  191   LAVGDVVTGKVARITSFGAFVDLGG-VDGLVHLTELSHERNVSPKSVVTVGEEIEVKILD  249

Query  833   ANMETGRISLTMRESDETSREKQPKDSPGSSDKSRAPKRTPQRNNQRRESKFVKGQDLEG  1012
              N E GR+SL+++ +            PG  D                E K  KG  +EG
Sbjct  250   LNEEEGRLSLSLKAT-----------VPGPWDGV--------------EQKLAKGDVVEG  284

Query  1013  TVKNLTRSGAFISLPEGEEGFLPTSEMADEGLGEIMGGSSLQVGQEVSVRVLRIS  1177
             TVK LT  GAF+ +  G +G +  S+++ + +       +L+VGQEV V+VL ++
Sbjct  285   TVKRLTDFGAFVEVLPGIDGLVHVSQISHKRIENPK--EALKVGQEVQVKVLEVN  337


 Score = 57.8 bits (138),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 31/77 (40%), Positives = 47/77 (61%), Gaps = 0/77 (0%)
 Frame = +2

Query  653  LIPGASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNLSNSFVKDVTSVVSVGQEVTVRLLE  832
            L  G    G VK +  FGAFV+     DGLVHVS +S+  +++    + VGQEV V++LE
Sbjct  276  LAKGDVVEGTVKRLTDFGAFVEVLPGIDGLVHVSQISHKRIENPKEALKVGQEVQVKVLE  335

Query  833  ANMETGRISLTMRESDE  883
             N +  R+SL+++  +E
Sbjct  336  VNADAERVSLSIKALEE  352



>ref|WP_021735133.1| S1 RNA binding domain protein [Coriobacteriaceae bacterium BV3Ac1]
 gb|ERL12344.1| S1 RNA binding domain protein [Coriobacteriaceae bacterium BV3AC1]
Length=403

 Score = 90.5 bits (223),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 65/186 (35%), Positives = 94/186 (51%), Gaps = 30/186 (16%)
 Frame = +2

Query  653   LIPGASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNLSNSFVKDVTSVVSVGQEVTVRLLE  832
             L PG    G+V SI  FGAFVD G   DGLVH+S LS + V   + VV VGQE+ V++L+
Sbjct  204   LKPGMHLKGQVSSIVDFGAFVDLGGI-DGLVHISELSWNHVNHPSEVVKVGQEIEVQVLD  262

Query  833   ANMETGRISLTMRESDETSREKQPKDSPGSSDKSRAPKRTPQRNNQRRESKFVKGQDLEG  1012
              ++   RISL ++++ E                   P R   +       K+  G  +EG
Sbjct  263   VDLNRERISLGLKQTTED------------------PWRVLVK-------KYPVGAIVEG  297

Query  1013  TVKNLTRSGAFISLPEGEEGFLPTSEMADEGLGEIMGGSSLQVGQEVSVRVLRI--SRGQ  1186
              V  L   GAF+ L +G EG +  SEMA + + +        VG +V V+V+ I   R +
Sbjct  298   VVTKLVSFGAFVDLGDGVEGLVHISEMARQHVEQ--PSQVCSVGTKVQVKVMEIDLDRRR  355

Query  1187  ATLTMK  1204
              +L+MK
Sbjct  356   ISLSMK  361


 Score = 62.4 bits (150),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 31/75 (41%), Positives = 48/75 (64%), Gaps = 0/75 (0%)
 Frame = +2

Query  662  GASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNLSNSFVKDVTSVVSVGQEVTVRLLEANM  841
            GA   G V  +  FGAFVD G   +GLVH+S ++   V+  + V SVG +V V+++E ++
Sbjct  292  GAIVEGVVTKLVSFGAFVDLGDGVEGLVHISEMARQHVEQPSQVCSVGTKVQVKVMEIDL  351

Query  842  ETGRISLTMRESDET  886
            +  RISL+M+ + ET
Sbjct  352  DRRRISLSMKSAAET  366



>ref|WP_001001616.1| 30S ribosomal protein S1 [Streptococcus mitis]
 gb|EFM31838.1| 30S ribosomal protein S1 [Streptococcus mitis ATCC 6249]
 gb|EGR93131.1| 30S ribosomal protein S1 [Streptococcus mitis bv. 2 str. F0392]
Length=400

 Score = 90.5 bits (223),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 63/175 (36%), Positives = 94/175 (54%), Gaps = 28/175 (16%)
 Frame = +2

Query  653   LIPGASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNLSNSFVKDVTSVVSVGQEVTVRLLE  832
             L  G   TGKV  I  FGAF+D G   DGLVH++ LS+       SVV+VG+E+ V++L+
Sbjct  191   LAVGDVVTGKVARITSFGAFIDLGG-VDGLVHLTELSHERNVSPKSVVTVGEEIEVKILD  249

Query  833   ANMETGRISLTMRESDETSREKQPKDSPGSSDKSRAPKRTPQRNNQRRESKFVKGQDLEG  1012
              N E GR+SL+++ +           +PG  D                E K  KG  +EG
Sbjct  250   LNEEEGRVSLSLKAT-----------TPGPWDGV--------------EQKLAKGDVVEG  284

Query  1013  TVKNLTRSGAFISLPEGEEGFLPTSEMADEGLGEIMGGSSLQVGQEVSVRVLRIS  1177
             TVK LT  GAF+ +  G +G +  S+++ + +       +L VGQEV+V+VL ++
Sbjct  285   TVKRLTDFGAFVEVLPGIDGLVHVSQISHKRIENPK--EALTVGQEVTVKVLDVN  337


 Score = 58.9 bits (141),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 31/77 (40%), Positives = 49/77 (64%), Gaps = 0/77 (0%)
 Frame = +2

Query  653  LIPGASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNLSNSFVKDVTSVVSVGQEVTVRLLE  832
            L  G    G VK +  FGAFV+     DGLVHVS +S+  +++    ++VGQEVTV++L+
Sbjct  276  LAKGDVVEGTVKRLTDFGAFVEVLPGIDGLVHVSQISHKRIENPKEALTVGQEVTVKVLD  335

Query  833  ANMETGRISLTMRESDE  883
             N +  R+SL+++  +E
Sbjct  336  VNADAERVSLSIKALEE  352



>ref|WP_036723396.1| hypothetical protein [Paenibacillus sp. FSL R7-277]
Length=759

 Score = 92.4 bits (228),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 46/97 (47%), Positives = 62/97 (64%), Gaps = 9/97 (9%)
 Frame = +2

Query  638  IKNEDLIPGASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNLSNSFVKDVTSVVSVGQEVT  817
            +K EDL+PG    G V+++  FGAFVD G   DGLVH+S LS S+VK    VVSVG  VT
Sbjct  672  LKMEDLLPGMEMQGTVRNVIDFGAFVDIGIKNDGLVHISQLSGSYVKHPMDVVSVGDNVT  731

Query  818  VRLLEANMETGRISLTMRESDETSREKQPKDSPGSSD  928
            V +L  +++ GR+SLTMR         QP+++ GS +
Sbjct  732  VWVLGVDVKKGRVSLTMR---------QPREAAGSGE  759



>ref|WP_001001623.1| 30S ribosomal protein S1 [Streptococcus pneumoniae]
 ref|NP_358358.1| 30S ribosomal protein S1 [Streptococcus pneumoniae R6]
 ref|YP_816245.1| 30S ribosomal protein S1 [Streptococcus pneumoniae D39]
 ref|YP_001694315.1| 30S ribosomal protein S1 [Streptococcus pneumoniae Hungary19A-6]
 ref|YP_001835523.1| 30S ribosomal protein S1 [Streptococcus pneumoniae CGSP14]
 ref|YP_002037497.1| 30S ribosomal protein S1 [Streptococcus pneumoniae G54]
 ref|YP_002510795.1| 30S ribosomal protein S1 [Streptococcus pneumoniae ATCC 700669]
 ref|YP_002735880.1| 30S ribosomal protein S1 [Streptococcus pneumoniae JJA]
 ref|YP_002738040.1| 30S ribosomal protein S1 [Streptococcus pneumoniae P1031]
 ref|YP_002740171.1| 30S ribosomal protein S1 [Streptococcus pneumoniae 70585]
 ref|YP_002742753.1| 30S ribosomal protein S1 [Streptococcus pneumoniae Taiwan19F-14]
 ref|YP_003725071.1| 30S ribosomal protein S1 [Streptococcus pneumoniae TCH8431/19A]
 ref|YP_003876425.1| hypothetical protein SPAP_0832 [Streptococcus pneumoniae AP200]
 ref|YP_006062388.1| putative 30S ribosomal protein S1 [Streptococcus pneumoniae INV104]
 ref|YP_006064246.1| putative 30S ribosomal protein S1 [Streptococcus pneumoniae OXC141]
 ref|YP_006253529.1| 30S ribosomal protein S1 [Streptococcus pneumoniae ST556]
 ref|YP_006743061.1| 30S ribosomal protein S1 [Streptococcus pneumoniae gamPNI0373]
 ref|YP_007763254.1| putative 30S ribosomal protein S1 [Streptococcus pneumoniae SPN994039]
 ref|YP_007766051.1| putative 30S ribosomal protein S1 [Streptococcus pneumoniae SPN034156]
 ref|YP_007812580.1| putative 30S ribosomal protein S1 [Streptococcus pneumoniae SPN994038]
 ref|YP_007814404.1| putative 30S ribosomal protein S1 [Streptococcus pneumoniae SPN034183]
 ref|YP_008730534.1| 30S ribosomal protein S1 [Streptococcus pneumoniae A026]
 sp|Q8CWR9.1|RS1_STRR6 RecName: Full=30S Ribosomal protein S1 [Streptococcus pneumoniae 
R6]
 gb|AAK99568.1| 30S Ribosomal protein S1 [Streptococcus pneumoniae R6]
 gb|ABJ53821.1| ribosomal protein S1 [Streptococcus pneumoniae D39]
 gb|EDK63802.1| ribosomal protein S1 [Streptococcus pneumoniae SP11-BS70]
 gb|EDK68199.1| ribosomal protein S1 [Streptococcus pneumoniae SP18-BS74]
 gb|EDK74098.1| ribosomal protein S1 [Streptococcus pneumoniae SP3-BS71]
 gb|EDK77036.1| ribosomal protein S1 [Streptococcus pneumoniae SP6-BS73]
 gb|EDK78777.1| ribosomal protein S1 [Streptococcus pneumoniae SP9-BS68]
 gb|EDK81176.1| 30S ribosomal protein S1 [Streptococcus pneumoniae SP23-BS72]
 gb|ACA35766.1| putative 30S ribosomal protein S1 homolog [Streptococcus pneumoniae 
Hungary19A-6]
 gb|ACB90058.1| 30S ribosomal protein S1 [Streptococcus pneumoniae CGSP14]
 gb|EDT91545.1| putative 30S ribosomal protein S1 homolog [Streptococcus pneumoniae 
CDC1087-00]
 gb|EDT91883.1| putative 30S ribosomal protein S1 homolog [Streptococcus pneumoniae 
SP195]
 gb|EDT95163.1| putative 30S ribosomal protein S1 homolog [Streptococcus pneumoniae 
CDC0288-04]
 gb|EDT97522.1| putative 30S ribosomal protein S1 homolog [Streptococcus pneumoniae 
CDC3059-06]
 gb|ACF55522.1| 30S ribosomal protein S1 [Streptococcus pneumoniae G54]
 emb|CAR68621.1| putative 30S ribosomal protein S1 [Streptococcus pneumoniae ATCC 
700669]
 gb|ACO16997.1| putative 30S ribosomal protein S1 homolog [Streptococcus pneumoniae 
70585]
 gb|ACO19241.1| putative 30S ribosomal protein S1 homolog [Streptococcus pneumoniae 
JJA]
 gb|ACO21436.1| putative 30S ribosomal protein S1 homolog [Streptococcus pneumoniae 
P1031]
 gb|ACO24102.1| putative 30S ribosomal protein S1 homolog [Streptococcus pneumoniae 
Taiwan19F-14]
 gb|ADI69857.1| 30S ribosomal protein S1 [Streptococcus pneumoniae TCH8431/19A]
 emb|CBW36396.1| putative 30S ribosomal protein S1 [Streptococcus pneumoniae INV104]
 emb|CBW32430.1| putative 30S ribosomal protein S1 [Streptococcus pneumoniae OXC141]
 gb|ADM84423.1| hypothetical protein SPAP_0832 [Streptococcus pneumoniae AP200]
 gb|EGE88556.1| hypothetical protein SPAR5_0822 [Streptococcus pneumoniae GA04375]
 gb|EGI83670.1| 30S ribosomal protein S1 [Streptococcus pneumoniae GA17570]
 gb|EGJ18932.1| hypothetical protein SPAR120_0834 [Streptococcus pneumoniae GA47901]
 gb|EHD28197.1| S1 RNA binding domain protein [Streptococcus pneumoniae 4027-06]
 gb|EHD34532.1| S1 RNA binding domain protein [Streptococcus pneumoniae 6735-05]
 gb|EHD37300.1| S1 RNA binding domain protein [Streptococcus pneumoniae GA44288]
 gb|EHD39217.1| S1 RNA binding domain protein [Streptococcus pneumoniae GA47281]
 gb|EHD42503.1| S1 RNA binding domain protein [Streptococcus pneumoniae GA43265]
 gb|EHD46111.1| S1 RNA binding domain protein [Streptococcus pneumoniae GA49138]
 gb|EHD50105.1| S1 RNA binding domain protein [Streptococcus pneumoniae 6901-05]
 gb|EHD51462.1| S1 RNA binding domain protein [Streptococcus pneumoniae GA16531]
 gb|EHD53134.1| S1 RNA binding domain protein [Streptococcus pneumoniae 7286-06]
 gb|EHD57218.1| S1 RNA binding domain protein [Streptococcus pneumoniae NP070]
 gb|EHD59809.1| S1 RNA binding domain protein [Streptococcus pneumoniae GA44500]
 gb|EHD68051.1| S1 RNA binding domain protein [Streptococcus pneumoniae 5787-06]
 gb|EHD70809.1| S1 RNA binding domain protein [Streptococcus pneumoniae 6963-05]
 gb|EHD71179.1| S1 RNA binding domain protein [Streptococcus pneumoniae GA18523]
 gb|EHD74116.1| S1 RNA binding domain protein [Streptococcus pneumoniae GA44194]
 gb|EHD78929.1| S1 RNA binding domain protein [Streptococcus pneumoniae GA44378]
 gb|EHD79139.1| S1 RNA binding domain protein [Streptococcus pneumoniae GA44511]
 gb|EHD80488.1| S1 RNA binding domain protein [Streptococcus pneumoniae NP170]
 gb|EHD85977.1| hypothetical protein SPAR30_0833 [Streptococcus pneumoniae GA13455]
 gb|EHD93193.1| hypothetical protein SPAR34_0775 [Streptococcus pneumoniae GA13856]
 gb|EHD96304.1| hypothetical protein SPAR37_0734 [Streptococcus pneumoniae GA14798]
 gb|EHD99437.1| hypothetical protein SPAR38_0833 [Streptococcus pneumoniae GA16121]
 gb|EHE04302.1| hypothetical protein SPAR41_1459 [Streptococcus pneumoniae GA16833]
 gb|EHE10199.1| hypothetical protein SPAR52_0893 [Streptococcus pneumoniae GA17971]
 gb|EHE12639.1| hypothetical protein SPAR45_0831 [Streptococcus pneumoniae GA17371]
 gb|EHE15371.1| hypothetical protein SPAR58_1320 [Streptococcus pneumoniae GA19451]
 gb|EHE20002.1| hypothetical protein SPAR67_0832 [Streptococcus pneumoniae GA41277]
 gb|EHE24703.1| hypothetical protein SPAR73_0814 [Streptococcus pneumoniae GA41565]
 gb|EHE28121.1| hypothetical protein SPAR78_1527 [Streptococcus pneumoniae GA43380]
 gb|EHE31215.1| hypothetical protein SPAR91_0873 [Streptococcus pneumoniae GA47283]
 gb|EHE37272.1| S1 RNA binding domain protein [Streptococcus pneumoniae GA47388]
 gb|EHE40160.1| S1 RNA binding domain protein [Streptococcus pneumoniae GA47439]
 gb|EHE41285.1| hypothetical protein SPAR103_1091 [Streptococcus pneumoniae GA47688]
 gb|EHE44353.1| hypothetical protein SPAR106_0774 [Streptococcus pneumoniae GA47778]
 gb|EHE51185.1| S1 RNA binding domain protein [Streptococcus pneumoniae GA54644]
 gb|EHE58233.1| S1 RNA binding domain protein [Streptococcus pneumoniae 5185-06]
 gb|EHE62855.1| S1 RNA binding domain protein [Streptococcus pneumoniae 3063-00]
 gb|EHE68006.1| S1 RNA binding domain protein [Streptococcus pneumoniae GA07228]
 gb|EHE69262.1| S1 RNA binding domain protein [Streptococcus pneumoniae GA08780]
 gb|EHE72347.1| S1 RNA binding domain protein [Streptococcus pneumoniae GA19690]
 gb|EHE77683.1| S1 RNA binding domain protein [Streptococcus pneumoniae GA11426]
 gb|EHE78343.1| hypothetical protein SPAR24_0784 [Streptococcus pneumoniae GA11663]
 gb|AFC94994.1| 30S ribosomal protein S1 [Streptococcus pneumoniae ST556]
 gb|EHZ04561.1| S1 RNA binding domain protein [Streptococcus pneumoniae GA04175]
 gb|EHZ04951.1| S1 RNA binding domain protein [Streptococcus pneumoniae GA13499]
 gb|EHZ10669.1| S1 RNA binding domain protein [Streptococcus pneumoniae GA07914]
 gb|EHZ11969.1| S1 RNA binding domain protein [Streptococcus pneumoniae GA06083]
 gb|EHZ14886.1| S1 RNA binding domain protein [Streptococcus pneumoniae GA11856]
 gb|EHZ17513.1| S1 RNA binding domain protein [Streptococcus pneumoniae GA13430]
 gb|EHZ19391.1| S1 RNA binding domain protein [Streptococcus pneumoniae GA13224]
 gb|EHZ26607.1| S1 RNA binding domain protein [Streptococcus pneumoniae GA14688]
 gb|EHZ30886.1| S1 RNA binding domain protein [Streptococcus pneumoniae GA17719]
 gb|EHZ32337.1| S1 RNA binding domain protein [Streptococcus pneumoniae GA17457]
 gb|EHZ37566.1| S1 RNA binding domain protein [Streptococcus pneumoniae GA19923]
 gb|EHZ38298.1| S1 RNA binding domain protein [Streptococcus pneumoniae GA19101]
 gb|EHZ38407.1| S1 RNA binding domain protein [Streptococcus pneumoniae GA40028]
 gb|EHZ41608.1| S1 RNA binding domain protein [Streptococcus pneumoniae GA40183]
 gb|EHZ45575.1| S1 RNA binding domain protein [Streptococcus pneumoniae GA40410]
 gb|EHZ48663.1| S1 RNA binding domain protein [Streptococcus pneumoniae GA43257]
 gb|EHZ52868.1| S1 RNA binding domain protein [Streptococcus pneumoniae GA44128]
 gb|EHZ59169.1| S1 RNA binding domain protein [Streptococcus pneumoniae GA47179]
 gb|EHZ59849.1| S1 RNA binding domain protein [Streptococcus pneumoniae GA47210]
 gb|EHZ66326.1| S1 RNA binding domain protein [Streptococcus pneumoniae GA47522]
 gb|EHZ66727.1| S1 RNA binding domain protein [Streptococcus pneumoniae GA47628]
 gb|EHZ67207.1| S1 RNA binding domain protein [Streptococcus pneumoniae GA47597]
 gb|EHZ73589.1| S1 RNA binding domain protein [Streptococcus pneumoniae GA47794]
 gb|EHZ74002.1| S1 RNA binding domain protein [Streptococcus pneumoniae GA47760]
 gb|EHZ77486.1| S1 RNA binding domain protein [Streptococcus pneumoniae GA49542]
 gb|EHZ79310.1| S1 RNA binding domain protein [Streptococcus pneumoniae 7879-04]
 gb|EHZ80966.1| S1 RNA binding domain protein [Streptococcus pneumoniae 8190-05]
 gb|EHZ82342.1| S1 RNA binding domain protein [Streptococcus pneumoniae 5652-06]
 gb|EHZ84876.1| S1 RNA binding domain protein [Streptococcus pneumoniae 7533-05]
 gb|EHZ87543.1| S1 RNA binding domain protein [Streptococcus pneumoniae EU-NP02]
 gb|EHZ88194.1| S1 RNA binding domain protein [Streptococcus pneumoniae 4075-00]
 gb|EHZ97077.1| S1 RNA binding domain protein [Streptococcus pneumoniae EU-NP05]
 gb|EHZ98250.1| S1 RNA binding domain protein [Streptococcus pneumoniae NP141]
 gb|EIA06171.1| S1 RNA binding domain protein [Streptococcus pneumoniae GA08825]
 gb|EIC50477.1| 40S ribosomal protein S1 [Streptococcus pneumoniae SV36]
 gb|EIC58284.1| 40S ribosomal protein S1 [Streptococcus pneumoniae SV35]
 gb|EIC59193.1| 40S ribosomal protein S1 [Streptococcus pneumoniae 459-5]
 gb|EJG34776.1| 40S ribosomal protein S1 [Streptococcus pneumoniae 2070035]
 gb|EJG36206.1| 40S ribosomal protein S1 [Streptococcus pneumoniae 2070005]
 gb|EJG41115.1| 40S ribosomal protein S1 [Streptococcus pneumoniae 2070108]
 gb|EJG42279.1| 40S ribosomal protein S1 [Streptococcus pneumoniae 2070109]
 gb|EJG50814.1| 40S ribosomal protein S1 [Streptococcus pneumoniae 2070768]
 gb|EJG56935.1| 40S ribosomal protein S1 [Streptococcus pneumoniae 2080076]
 gb|EJG56990.1| 40S ribosomal protein S1 [Streptococcus pneumoniae 2072047]
 gb|EJG63216.1| 40S ribosomal protein S1 [Streptococcus pneumoniae 2071247]
 gb|EJG65063.1| 40S ribosomal protein S1 [Streptococcus pneumoniae 2071004]
 gb|EJG69093.1| 40S ribosomal protein S1 [Streptococcus pneumoniae 2080913]
 gb|EJG70418.1| 40S ribosomal protein S1 [Streptococcus pneumoniae 2081685]
 gb|EJG75802.1| 40S ribosomal protein S1 [Streptococcus pneumoniae 2082239]
 gb|EJG79738.1| S1 RNA binding domain protein [Streptococcus pneumoniae SPAR27]
 gb|EJG86571.1| S1 RNA binding domain protein [Streptococcus pneumoniae GA52612]
 gb|EJG93044.1| S1 RNA binding domain protein [Streptococcus pneumoniae GA17301]
 gb|EJG95243.1| 30S Ribosomal protein S1 [Streptococcus pneumoniae GA04672]
 gb|EJG99205.1| 30S Ribosomal protein S1 [Streptococcus pneumoniae GA58771]
 gb|EJH01765.1| 30S Ribosomal protein S1 [Streptococcus pneumoniae GA54354]
 gb|EJH05293.1| 30S Ribosomal protein S1 [Streptococcus pneumoniae GA56113]
 gb|EJH11074.1| 30S Ribosomal protein S1 [Streptococcus pneumoniae GA19998]
 gb|EJH13222.1| 30S Ribosomal protein S1 [Streptococcus pneumoniae GA60080]
 gb|EJH16386.1| 30S Ribosomal protein S1 [Streptococcus pneumoniae GA62331]
 gb|EJH19881.1| 30S Ribosomal protein S1 [Streptococcus pneumoniae GA60132]
 gb|EJH22271.1| 30S Ribosomal protein S1 [Streptococcus pneumoniae GA62681]
 gb|EJH25371.1| 30S Ribosomal protein S1 [Streptococcus pneumoniae GA47562]
 gb|AFS42937.1| 30S ribosomal protein S1 [Streptococcus pneumoniae gamPNI0373]
 emb|CCP37490.1| putative 30S ribosomal protein S1 [Streptococcus pneumoniae SPN034156]
 emb|CCP32483.1| putative 30S ribosomal protein S1 [Streptococcus pneumoniae SPN034183]
 emb|CCP34457.1| putative 30S ribosomal protein S1 [Streptococcus pneumoniae SPN994039]
 emb|CCP30498.1| putative 30S ribosomal protein S1 [Streptococcus pneumoniae SPN994038]
 gb|ELU55871.1| putative ribosomal protein S1 [Streptococcus pneumoniae PCS8203]
 gb|ELU57712.1| putative ribosomal protein S1 [Streptococcus pneumoniae PCS8106]
 gb|ELU62816.1| putative ribosomal protein S1 [Streptococcus pneumoniae PCS70012]
 gb|ELU66274.1| putative ribosomal protein S1 [Streptococcus pneumoniae PNI0006]
 gb|ELU67726.1| putative ribosomal protein S1 [Streptococcus pneumoniae PNI0002]
 gb|ELU70607.1| putative ribosomal protein S1 [Streptococcus pneumoniae PNI0008]
 gb|ELU71384.1| putative ribosomal protein S1 [Streptococcus pneumoniae PCS81218]
 gb|ELU73486.1| putative ribosomal protein S1 [Streptococcus pneumoniae PNI0007]
 gb|ELU74250.1| putative ribosomal protein S1 [Streptococcus pneumoniae PNI0009]
 gb|ELU75530.1| putative ribosomal protein S1 [Streptococcus pneumoniae PNI0010]
 gb|ELU80753.1| putative ribosomal protein S1 [Streptococcus pneumoniae PNI0153]
 gb|ELU81366.1| putative ribosomal protein S1 [Streptococcus pneumoniae PNI0076]
 gb|ELU83396.1| putative ribosomal protein S1 [Streptococcus pneumoniae PNI0199]
 gb|ELU88328.1| putative ribosomal protein S1 [Streptococcus pneumoniae PNI0427]
 gb|ELU89969.1| putative ribosomal protein S1 [Streptococcus pneumoniae PNI0360]
 gb|ELU92404.1| putative ribosomal protein S1 [Streptococcus pneumoniae PNI0446]
 gb|EMQ92159.1| putative ribosomal protein S1 [Streptococcus pneumoniae PCS8235]
 gb|EMY84312.1| putative ribosomal protein S1 [Streptococcus pneumoniae PNI0159]
 gb|EMY86044.1| putative ribosomal protein S1 [Streptococcus pneumoniae PNI0164]
 gb|EMY87808.1| putative ribosomal protein S1 [Streptococcus pneumoniae PNI0212]
 gb|EMY91316.1| putative ribosomal protein S1 [Streptococcus pneumoniae PNI0197]
 gb|EOB16493.1| 30S ribosomal protein S1 [Streptococcus pneumoniae 801]
 gb|EOB21492.1| 30S ribosomal protein S1 [Streptococcus pneumoniae 1488]
 gb|EOB25914.1| 30S ribosomal protein S1 [Streptococcus pneumoniae 357]
 gb|EOB26972.1| 30S ribosomal protein S1 [Streptococcus pneumoniae 1542]
 gb|EOB31109.1| 30S ribosomal protein S1 [Streptococcus pneumoniae 845]
 gb|EPD14925.1| 30S ribosomal protein S1 [Streptococcus pneumoniae MNZ11b]
 gb|EPD16756.1| 30S ribosomal protein S1 [Streptococcus pneumoniae MNZ41]
 gb|EPD17416.1| 30S ribosomal protein S1 [Streptococcus pneumoniae MNZ37]
 gb|EPR91755.1| 30S ribosomal protein S1 [Streptococcus pneumoniae 1779n23_04]
 gb|AGZ47978.1| 30S ribosomal protein S1 [Streptococcus pneumoniae A026]
 gb|ETE00370.1| 30S ribosomal protein S1 [Streptococcus pneumoniae 27]
 gb|ETE13289.1| 30S ribosomal protein S1 [Streptococcus pneumoniae 13856]
 gb|ETE23037.1| 30S ribosomal protein S1 [Streptococcus pneumoniae 1719]
 gb|KAA01309.1| 30S ribosomal protein S1 [Streptococcus pneumoniae DAR831]
 gb|KAA04162.1| 30S ribosomal protein S1 [Streptococcus pneumoniae DAR3264]
 gb|KDA39831.1| 30S ribosomal protein S1 [Streptococcus pneumoniae]
 gb|KDE92504.1| 30S ribosomal protein S1 [Streptococcus pneumoniae]
 gb|KGI23317.1| SSU ribosomal protein S1p [Streptococcus pneumoniae]
 gb|KGI27751.1| SSU ribosomal protein S1p [Streptococcus pneumoniae]
 gb|KGI31710.1| SSU ribosomal protein S1p [Streptococcus pneumoniae]
 gb|AJD72384.1| 30S Ribosomal protein S1 [Streptococcus pneumoniae]
Length=400

 Score = 90.5 bits (223),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 63/175 (36%), Positives = 93/175 (53%), Gaps = 28/175 (16%)
 Frame = +2

Query  653   LIPGASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNLSNSFVKDVTSVVSVGQEVTVRLLE  832
             L  G   TGKV  I  FGAF+D G   DGLVH++ LS+       SVV+VG+E+ V++L+
Sbjct  191   LAVGDVVTGKVARITSFGAFIDLGG-VDGLVHLTELSHERNVSPKSVVTVGEEIEVKILD  249

Query  833   ANMETGRISLTMRESDETSREKQPKDSPGSSDKSRAPKRTPQRNNQRRESKFVKGQDLEG  1012
              N E GR+SL+++ +            PG  D                E K  KG  +EG
Sbjct  250   LNEEEGRVSLSLKAT-----------VPGPWDGV--------------EQKLAKGDVVEG  284

Query  1013  TVKNLTRSGAFISLPEGEEGFLPTSEMADEGLGEIMGGSSLQVGQEVSVRVLRIS  1177
             TVK LT  GAF+ +  G +G +  S+++ + +       +L+VGQEV V+VL ++
Sbjct  285   TVKRLTDFGAFVEVLPGIDGLVHVSQISHKRIENPK--EALKVGQEVQVKVLEVN  337


 Score = 57.8 bits (138),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 31/77 (40%), Positives = 47/77 (61%), Gaps = 0/77 (0%)
 Frame = +2

Query  653  LIPGASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNLSNSFVKDVTSVVSVGQEVTVRLLE  832
            L  G    G VK +  FGAFV+     DGLVHVS +S+  +++    + VGQEV V++LE
Sbjct  276  LAKGDVVEGTVKRLTDFGAFVEVLPGIDGLVHVSQISHKRIENPKEALKVGQEVQVKVLE  335

Query  833  ANMETGRISLTMRESDE  883
             N +  R+SL+++  +E
Sbjct  336  VNADAERVSLSIKALEE  352



>ref|WP_014191595.1| RNA-binding protein [Burkholderia sp. YI23]
 ref|YP_004977347.1| S1 RNA-binding domain-containing protein [Burkholderia sp. YI23]
 gb|AET89370.1| S1 RNA-binding domain-containing protein [Burkholderia sp. YI23]
 dbj|BAO86635.1| S1 RNA-binding domain-containing protein [Burkholderia sp. RPE67]
Length=775

 Score = 92.0 bits (227),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 53/119 (45%), Positives = 66/119 (55%), Gaps = 14/119 (12%)
 Frame = +2

Query  641  KNEDLIPGASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNLSNSFVKDVTSVVSVGQEVTV  820
            K  DL+PG    G V ++  FGAFVD G   DGLVHVS LS  F+KD   VV  GQ V V
Sbjct  649  KISDLVPGMILEGVVTNVAAFGAFVDIGVHQDGLVHVSALSTKFIKDPHEVVKAGQVVKV  708

Query  821  RLLEANMETGRISLTMRESDETSREKQPKDSPGSSDKSRAP------KRTPQRNNQRRE  979
            ++LE +++  RISLTMR  D+         +P SS+    P      +R   R NQRRE
Sbjct  709  KVLETDVKRQRISLTMRLDDDL--------APASSNAGSQPRGASQDRRRDARPNQRRE  759



>ref|WP_006223932.1| RNA-binding protein [Achromobacter piechaudii]
 gb|EJO32188.1| transcription accessory protein [Achromobacter piechaudii HLE]
Length=791

 Score = 92.4 bits (228),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 44/99 (44%), Positives = 61/99 (62%), Gaps = 0/99 (0%)
 Frame = +2

Query  650  DLIPGASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNLSNSFVKDVTSVVSVGQEVTVRLL  829
            DL PG    G V ++  FGAFVD G   DGLVH+S L+  FVKD   VV VGQ V+V++L
Sbjct  666  DLYPGMVLEGVVTNVANFGAFVDIGVHQDGLVHISALAEKFVKDPRDVVRVGQTVSVKVL  725

Query  830  EANMETGRISLTMRESDETSREKQPKDSPGSSDKSRAPK  946
            E +    R++LTMR +D  +  ++  D+P   D+ R P+
Sbjct  726  EVDAARKRVALTMRLNDTAAPARRSGDAPKGGDRPRRPQ  764



>gb|AIQ11713.1| hypothetical protein PDUR_06975 [Paenibacillus durus]
Length=747

 Score = 92.0 bits (227),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 46/91 (51%), Positives = 59/91 (65%), Gaps = 7/91 (8%)
 Frame = +2

Query  620  KSEMPP-------IKNEDLIPGASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNLSNSFVK  778
            + E+PP       +K EDL PG    G V+++  FGAFVD G   DGLVH+S LS+SFVK
Sbjct  653  REELPPPIFRTDVLKIEDLAPGMELQGTVRNVIDFGAFVDIGIKNDGLVHISQLSSSFVK  712

Query  779  DVTSVVSVGQEVTVRLLEANMETGRISLTMR  871
                VVSVG  VTV +L  +++ GR+SLTMR
Sbjct  713  HPMDVVSVGDNVTVWVLSVDLKKGRVSLTMR  743



>ref|WP_036165151.1| 30S ribosomal protein S1 [Massilia sp. 9096]
Length=557

 Score = 91.7 bits (226),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 68/192 (35%), Positives = 99/192 (52%), Gaps = 29/192 (15%)
 Frame = +2

Query  647   EDLIPGASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNLSNSFVKDVTSVVSVGQEVTVRL  826
             E L  G   TG VK+I  +GAFVD G   DGL+H+++L+   V+  + V++VGQE+T ++
Sbjct  186   ETLKEGTVVTGVVKNITDYGAFVDLGGI-DGLLHITDLAWRRVRHPSEVLTVGQEITAKV  244

Query  827   LEANMETGRISLTMRESDETSREKQPKDSPGSSDKSRAPKRTPQRNNQRRESKFVKGQDL  1006
             L+ + E  R+SL +         KQ  D P +       +R PQ            G  L
Sbjct  245   LKYDQEKNRVSLGV---------KQLGDDPWTG----LSRRYPQ------------GTRL  279

Query  1007  EGTVKNLTRSGAFISLPEGEEGFLPTSEMADEGLGEIMGGSSLQVGQEVSVRVLRIS--R  1180
              G V NLT  GAF+ + +G EG +  SEM D     +     +Q+G EV V VL I   R
Sbjct  280   FGKVTNLTDYGAFVEVEQGIEGLVHVSEM-DWTNKNVAPNKVVQLGDEVEVMVLEIDEER  338

Query  1181  GQATLTMKKEEA  1216
              + +L MK+ +A
Sbjct  339   RRISLGMKQCKA  350


 Score = 53.5 bits (127),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 50/174 (29%), Positives = 82/174 (47%), Gaps = 28/174 (16%)
 Frame = +2

Query  662   GASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNLSNSFV-KDVTSVVSVGQEVTVRLLEAN  838
             G    G +KSI  FG F+      DGLVH+S+LS +   ++       G E+   +L  +
Sbjct  363   GDKVKGSIKSITDFGVFIGLPGNIDGLVHLSDLSWTEAGEEAVRRFKKGDELEAVVLAID  422

Query  839   METGRISLTMRESDETSREKQPKDSPGSSDKSRAPKRTPQRNNQRRESKFVKGQDLEGTV  1018
             +E  R+SL +++      E  P ++  S +                     KG  + GTV
Sbjct  423   VERERVSLGVKQ-----LEGDPFNNFASLND--------------------KGTLVTGTV  457

Query  1019  KNLTRSGAFISLPEGEEGFLPTSEMADEGLGEIMGGSSLQVGQEVSVRVLRISR  1180
             K++   GA I+L E  EG+L  SE++ + + +   G+ L+VG +V   V+ I R
Sbjct  458   KSVEPKGAVIALSEEVEGYLRASEISRDRVED--AGTHLKVGDKVEALVINIDR  509



>ref|WP_036697454.1| hypothetical protein [Paenibacillus sp. FSL R7-269]
Length=734

 Score = 92.0 bits (227),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 46/97 (47%), Positives = 62/97 (64%), Gaps = 9/97 (9%)
 Frame = +2

Query  638  IKNEDLIPGASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNLSNSFVKDVTSVVSVGQEVT  817
            +K EDL+PG    G V+++  FGAFVD G   DGLVH+S LS S+VK    VVSVG  VT
Sbjct  647  LKMEDLLPGMEMQGTVRNVIDFGAFVDIGIKNDGLVHISQLSGSYVKHPMDVVSVGDNVT  706

Query  818  VRLLEANMETGRISLTMRESDETSREKQPKDSPGSSD  928
            V +L  +++ GR+SLTMR         QP+++ GS +
Sbjct  707  VWVLGVDVKKGRVSLTMR---------QPREAAGSGE  734



>ref|WP_028326338.1| 30S ribosomal protein S1 [Dermatophilus congolensis]
Length=484

 Score = 91.3 bits (225),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 66/189 (35%), Positives = 99/189 (52%), Gaps = 30/189 (16%)
 Frame = +2

Query  647   EDLIPGASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNLSNSFVKDVTSVVSVGQEVTVRL  826
              DL  G   +G+V SI  FGAFVD G   DGLVHVS LS   +   + VV VGQEVTV +
Sbjct  200   HDLQRGQVRSGQVSSIVNFGAFVDLGG-VDGLVHVSELSWKHIDHPSEVVEVGQEVTVEV  258

Query  827   LEANMETGRISLTMRESDETSREKQPKDSPGSSDKSRAPKRTPQRNNQRRESKFVKGQDL  1006
             L+ +M+  R+SL+++ + E                   P +T  R +         GQ +
Sbjct  259   LDVDMDRERVSLSLKATQED------------------PWQTFARTH-------AIGQIV  293

Query  1007  EGTVKNLTRSGAFISLPEGEEGFLPTSEMADEGLGEIMGGSSLQVGQEVSVRVLRI--SR  1180
              G V  L   GAF+ + +G EG +  SE+A+  +   +    +QVGQE+ V+V+ I   R
Sbjct  294   PGKVTKLVPFGAFVRVEDGIEGLVHISELAERHVE--LPEQVVQVGQEIFVKVIDIDLDR  351

Query  1181  GQATLTMKK  1207
              + +L++K+
Sbjct  352   RRISLSLKQ  360


 Score = 58.2 bits (139),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 27/71 (38%), Positives = 48/71 (68%), Gaps = 0/71 (0%)
 Frame = +2

Query  677  GKVKSIQPFGAFVDFGAFTDGLVHVSNLSNSFVKDVTSVVSVGQEVTVRLLEANMETGRI  856
            GKV  + PFGAFV      +GLVH+S L+   V+    VV VGQE+ V++++ +++  RI
Sbjct  295  GKVTKLVPFGAFVRVEDGIEGLVHISELAERHVELPEQVVQVGQEIFVKVIDIDLDRRRI  354

Query  857  SLTMRESDETS  889
            SL+++++++ +
Sbjct  355  SLSLKQANDIA  365



>ref|WP_038704164.1| 30S ribosomal protein S1 [Planococcus sp. PAMC 21323]
 gb|AIY05762.1| 30S ribosomal protein S1-like protein [Planococcus sp. PAMC 21323]
Length=381

 Score = 90.1 bits (222),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 64/198 (32%), Positives = 103/198 (52%), Gaps = 38/198 (19%)
 Frame = +2

Query  647   EDLIPGASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNLSNSFVKDVTSVVSVGQEVTVRL  826
             +++  G    GKV+ I  FGAFVD G   DGLVH+S LS+  V+ V+ VV+ GQEVTV++
Sbjct  183   DNIHAGDELKGKVQRIASFGAFVDIGG-VDGLVHISQLSHEHVEKVSDVVTEGQEVTVKV  241

Query  827   LEANMETGRISLTMRESDETSREKQPKDSPGSSD--KSRAPKRTPQRNNQRRESKFVKGQ  1000
             L  + ++ RISL+++++            PG  D    +APK +                
Sbjct  242   LSVDRDSERISLSIKDT-----------LPGPWDAIDEKAPKGSVHT-------------  277

Query  1001  DLEGTVKNLTRSGAFISLPEGEEGFLPTSEMADEGLG---EIMGGSSLQVGQEVSVRVLR  1171
                GTVK L   GAF+ +  G EG +  S++A + +    E+     L  G++V V+VL 
Sbjct  278   ---GTVKRLVSYGAFVEVLPGVEGLVHISQIAHKHIATPNEV-----LTEGEKVEVKVLE  329

Query  1172  ISRGQATLTMKKEEATEE  1225
             +++    L++  +E  E+
Sbjct  330   VNKADKRLSLSIKELQEK  347


 Score = 53.5 bits (127),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 31/94 (33%), Positives = 54/94 (57%), Gaps = 6/94 (6%)
 Frame = +2

Query  662  GASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNLSNSFVKDVTSVVSVGQEVTVRLLEANM  841
            G+  TG VK +  +GAFV+     +GLVH+S +++  +     V++ G++V V++LE N 
Sbjct  273  GSVHTGTVKRLVSYGAFVEVLPGVEGLVHISQIAHKHIATPNEVLTEGEKVEVKVLEVNK  332

Query  842  ETGRISLTMRESDETSREK------QPKDSPGSS  925
               R+SL+++E  E   E+       P++S G S
Sbjct  333  ADKRLSLSIKELQEKQGEQDFSNYDMPEESSGFS  366



>gb|ETT76580.1| Tex-like protein [Paenibacillus sp. FSL R7-277]
Length=742

 Score = 92.0 bits (227),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 46/97 (47%), Positives = 62/97 (64%), Gaps = 9/97 (9%)
 Frame = +2

Query  638  IKNEDLIPGASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNLSNSFVKDVTSVVSVGQEVT  817
            +K EDL+PG    G V+++  FGAFVD G   DGLVH+S LS S+VK    VVSVG  VT
Sbjct  655  LKMEDLLPGMEMQGTVRNVIDFGAFVDIGIKNDGLVHISQLSGSYVKHPMDVVSVGDNVT  714

Query  818  VRLLEANMETGRISLTMRESDETSREKQPKDSPGSSD  928
            V +L  +++ GR+SLTMR         QP+++ GS +
Sbjct  715  VWVLGVDVKKGRVSLTMR---------QPREAAGSGE  742



>ref|WP_017232088.1| 30S ribosomal protein S1 [Pandoraea sp. B-6]
Length=567

 Score = 91.7 bits (226),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 69/192 (36%), Positives = 98/192 (51%), Gaps = 29/192 (15%)
 Frame = +2

Query  647   EDLIPGASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNLSNSFVKDVTSVVSVGQEVTVRL  826
             E L  GA   G VK+I  +GAFVD G   DGL+H+++++   V+  + V+SVGQEVT ++
Sbjct  194   ETLKEGAIVKGVVKNITDYGAFVDLGGI-DGLLHITDIAWRRVRHPSEVLSVGQEVTAKI  252

Query  827   LEANMETGRISLTMRESDETSREKQPKDSPGSSDKSRAPKRTPQRNNQRRESKFVKGQDL  1006
             L+ + E GR+SL +         KQ  D P         +R PQ            G  L
Sbjct  253   LKFDQEKGRVSLGV---------KQLGDDPWEG----IARRYPQ------------GTRL  287

Query  1007  EGTVKNLTRSGAFISLPEGEEGFLPTSEMADEGLGEIMGGSSLQVGQEVSVRVLRI--SR  1180
              G V N+T  GAF+ +  G EG +  SEM D     +     +Q+G EV V VL I   R
Sbjct  288   FGKVTNITDYGAFVEVESGIEGLVHVSEM-DWTNKNVAPTKVVQLGDEVEVMVLEIDEDR  346

Query  1181  GQATLTMKKEEA  1216
              + +L MK+ +A
Sbjct  347   RRISLGMKQCKA  358


 Score = 55.1 bits (131),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 56/195 (29%), Positives = 90/195 (46%), Gaps = 38/195 (19%)
 Frame = +2

Query  662   GASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNLSNSFV-KDVTSVVSVGQEVTVRLLEAN  838
             G    G +KSI  FG F+      DGLVH+S+LS S   +D       G EV   +L  +
Sbjct  371   GDKIKGGIKSITDFGVFIGLPGGIDGLVHLSDLSWSETGEDAVRKYKKGDEVEAVVLGID  430

Query  839   METGRISLTMRESDETSREKQPKDSPGSSDKSRAPKRTPQRNNQRRESKFV----KGQDL  1006
             +E  RISL +         KQ +  P +S                    FV    KG  +
Sbjct  431   VEKERISLGI---------KQLEGDPFNS--------------------FVAIHDKGSIV  461

Query  1007  EGTVKNLTRSGAFISLPEGEEGFLPTSEMADEGLGEIMGGSSLQVGQEVSVRVLRISRG-  1183
             +GT+K +   GA +SL E  EG+L  SE++ + + +    + L+ G+ V+  ++ I R  
Sbjct  462   DGTIKAVDPKGAVVSLGEDVEGYLRASEISHDRVEDAR--NVLKEGEAVNAMIVNIDRKS  519

Query  1184  -QATLTMKKEEATEE  1225
                 L++K +++ E+
Sbjct  520   RNINLSIKAKDSAEQ  534



>ref|WP_001001622.1| 30S ribosomal protein S1 [Streptococcus pneumoniae]
Length=400

 Score = 90.5 bits (223),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 63/175 (36%), Positives = 93/175 (53%), Gaps = 28/175 (16%)
 Frame = +2

Query  653   LIPGASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNLSNSFVKDVTSVVSVGQEVTVRLLE  832
             L  G   TGKV  I  FGAF+D G   DGLVH++ LS+       SVV+VG+E+ V++L+
Sbjct  191   LAVGDVVTGKVARITSFGAFIDLGG-VDGLVHLTELSHERNVSPKSVVTVGEEIEVKILD  249

Query  833   ANMETGRISLTMRESDETSREKQPKDSPGSSDKSRAPKRTPQRNNQRRESKFVKGQDLEG  1012
              N E GR+SL+++ +            PG  D                E K  KG  +EG
Sbjct  250   LNEEEGRVSLSLKAT-----------VPGPWDGV--------------EQKLAKGDVVEG  284

Query  1013  TVKNLTRSGAFISLPEGEEGFLPTSEMADEGLGEIMGGSSLQVGQEVSVRVLRIS  1177
             TVK LT  GAF+ +  G +G +  S+++ + +       +L+VGQEV V+VL ++
Sbjct  285   TVKRLTDFGAFVEVLPGIDGLVHVSQISHKRIENPK--EALKVGQEVQVKVLEVN  337


 Score = 57.8 bits (138),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 31/77 (40%), Positives = 47/77 (61%), Gaps = 0/77 (0%)
 Frame = +2

Query  653  LIPGASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNLSNSFVKDVTSVVSVGQEVTVRLLE  832
            L  G    G VK +  FGAFV+     DGLVHVS +S+  +++    + VGQEV V++LE
Sbjct  276  LAKGDVVEGTVKRLTDFGAFVEVLPGIDGLVHVSQISHKRIENPKEALKVGQEVQVKVLE  335

Query  833  ANMETGRISLTMRESDE  883
             N +  R+SL+++  +E
Sbjct  336  VNADAERVSLSIKALEE  352



>ref|WP_001001624.1| 30S ribosomal protein S1 [Streptococcus pneumoniae]
 gb|EGI86606.1| hypothetical protein SPAR68_0864 [Streptococcus pneumoniae GA41301]
 gb|EHE04807.1| hypothetical protein SPAR43_0821 [Streptococcus pneumoniae GA17227]
 gb|EHZ05871.1| S1 RNA binding domain protein [Streptococcus pneumoniae GA05245]
Length=400

 Score = 90.5 bits (223),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 63/175 (36%), Positives = 93/175 (53%), Gaps = 28/175 (16%)
 Frame = +2

Query  653   LIPGASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNLSNSFVKDVTSVVSVGQEVTVRLLE  832
             L  G   TGKV  I  FGAF+D G   DGLVH++ LS+       SVV+VG+E+ V++L+
Sbjct  191   LAVGDVVTGKVARITSFGAFIDLGG-VDGLVHLTELSHERNVSPKSVVTVGEEIEVKILD  249

Query  833   ANMETGRISLTMRESDETSREKQPKDSPGSSDKSRAPKRTPQRNNQRRESKFVKGQDLEG  1012
              N E GR+SL+++ +            PG  D                E K  KG  +EG
Sbjct  250   LNEEEGRVSLSLKAT-----------VPGPWDGV--------------EQKLAKGDVVEG  284

Query  1013  TVKNLTRSGAFISLPEGEEGFLPTSEMADEGLGEIMGGSSLQVGQEVSVRVLRIS  1177
             TVK LT  GAF+ +  G +G +  S+++ + +       +L+VGQEV V+VL ++
Sbjct  285   TVKRLTDFGAFVEVLPGIDGLVHVSQISHKRIENPK--EALKVGQEVQVKVLEVN  337


 Score = 60.5 bits (145),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 36/109 (33%), Positives = 60/109 (55%), Gaps = 5/109 (5%)
 Frame = +2

Query  653  LIPGASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNLSNSFVKDVTSVVSVGQEVTVRLLE  832
            L  G    G VK +  FGAFV+     DGLVHVS +S+  +++    + VGQEV V++LE
Sbjct  276  LAKGDVVEGTVKRLTDFGAFVEVLPGIDGLVHVSQISHKRIENPKEALKVGQEVQVKVLE  335

Query  833  ANMETGRISLTMRESDETSREKQPKDSPGSSDKSRAPKRTPQRNNQRRE  979
             N +  R+SL+++     + E++P    G  ++ R  +    R  ++R+
Sbjct  336  VNADAERVSLSIK-----ALEERPAQEEGQKEEKRVARPRRPRRQEKRD  379



>ref|WP_014188347.1| RNA-binding protein [Azospirillum lipoferum]
 ref|YP_004974068.1| Transcriptional accessory protein with RNA-binding S1 domain 
[Azospirillum lipoferum 4B]
 emb|CBS88893.1| Transcriptional accessory protein with RNA-binding S1 domain 
[Azospirillum lipoferum 4B]
Length=780

 Score = 92.0 bits (227),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 47/107 (44%), Positives = 63/107 (59%), Gaps = 7/107 (7%)
 Frame = +2

Query  653  LIPGASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNLSNSFVKDVTSVVSVGQEVTVRLLE  832
            L PG    G V ++  FGAFVD G   DGLVH+S L+NSFVKD  +VV  G  V V++LE
Sbjct  645  LQPGMMLEGVVTNVTAFGAFVDIGVHQDGLVHISQLANSFVKDPHTVVKAGDVVKVKVLE  704

Query  833  ANMETGRISLTMRESDETSREKQPKDSPGSSDKSRAPKRTPQRNNQR  973
             ++   RI+LTMR  +E  R       P   ++ R P R PQ+ ++R
Sbjct  705  VDIPRKRIALTMRMGEEAPR-------PARREEQRGPARPPQQQDRR  744



>ref|WP_025694820.1| hypothetical protein [Paenibacillus durus]
Length=729

 Score = 92.0 bits (227),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 46/91 (51%), Positives = 59/91 (65%), Gaps = 7/91 (8%)
 Frame = +2

Query  620  KSEMPP-------IKNEDLIPGASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNLSNSFVK  778
            + E+PP       +K EDL PG    G V+++  FGAFVD G   DGLVH+S LS+SFVK
Sbjct  634  REELPPPIFRTDVLKIEDLAPGMELQGTVRNVIDFGAFVDIGIKNDGLVHISQLSSSFVK  693

Query  779  DVTSVVSVGQEVTVRLLEANMETGRISLTMR  871
                VVSVG  VTV +L  +++ GR+SLTMR
Sbjct  694  HPMDVVSVGDNVTVWVLSVDLKKGRVSLTMR  724



>gb|ETT45609.1| Tex-like protein [Paenibacillus sp. FSL R7-269]
Length=742

 Score = 92.0 bits (227),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 46/97 (47%), Positives = 62/97 (64%), Gaps = 9/97 (9%)
 Frame = +2

Query  638  IKNEDLIPGASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNLSNSFVKDVTSVVSVGQEVT  817
            +K EDL+PG    G V+++  FGAFVD G   DGLVH+S LS S+VK    VVSVG  VT
Sbjct  655  LKMEDLLPGMEMQGTVRNVIDFGAFVDIGIKNDGLVHISQLSGSYVKHPMDVVSVGDNVT  714

Query  818  VRLLEANMETGRISLTMRESDETSREKQPKDSPGSSD  928
            V +L  +++ GR+SLTMR         QP+++ GS +
Sbjct  715  VWVLGVDVKKGRVSLTMR---------QPREAAGSGE  742



>ref|WP_023940981.1| 30S ribosomal protein S1 [Streptococcus pseudopneumoniae]
 gb|ETE00136.1| 30S ribosomal protein S1 [Streptococcus pseudopneumoniae 5247]
Length=400

 Score = 90.1 bits (222),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 62/172 (36%), Positives = 92/172 (53%), Gaps = 28/172 (16%)
 Frame = +2

Query  662   GASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNLSNSFVKDVTSVVSVGQEVTVRLLEANM  841
             G   TGKV  I  FGAF+D G   DGLVH++ LS+       SVV+VG+E+ V++L+ N 
Sbjct  194   GDVVTGKVARITSFGAFIDLGG-VDGLVHLTELSHERNVSPKSVVTVGEEIEVKILDLNE  252

Query  842   ETGRISLTMRESDETSREKQPKDSPGSSDKSRAPKRTPQRNNQRRESKFVKGQDLEGTVK  1021
             E GR+SL+++ +            PG  D                E K  KG  +EGTVK
Sbjct  253   EEGRVSLSLKAT-----------VPGPWDGV--------------EQKLAKGDVVEGTVK  287

Query  1022  NLTRSGAFISLPEGEEGFLPTSEMADEGLGEIMGGSSLQVGQEVSVRVLRIS  1177
              LT  GAF+ +  G +G +  S+++ + +       +L+VGQEV V+VL ++
Sbjct  288   RLTDFGAFVEVLPGIDGLVHVSQISHKRIDNPK--EALKVGQEVQVKVLEVN  337


 Score = 57.0 bits (136),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 31/77 (40%), Positives = 46/77 (60%), Gaps = 0/77 (0%)
 Frame = +2

Query  653  LIPGASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNLSNSFVKDVTSVVSVGQEVTVRLLE  832
            L  G    G VK +  FGAFV+     DGLVHVS +S+  + +    + VGQEV V++LE
Sbjct  276  LAKGDVVEGTVKRLTDFGAFVEVLPGIDGLVHVSQISHKRIDNPKEALKVGQEVQVKVLE  335

Query  833  ANMETGRISLTMRESDE  883
             N +  R+SL+++  +E
Sbjct  336  VNADAERVSLSIKALEE  352



>ref|WP_028995476.1| transcription accessory protein [Azonexus hydrophilus]
Length=768

 Score = 92.0 bits (227),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 50/107 (47%), Positives = 62/107 (58%), Gaps = 6/107 (6%)
 Frame = +2

Query  647  EDLIPGASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNLSNSFVKDVTSVVSVGQEVTVRL  826
            +DL PG    G V ++  FGAFVD G   DGLVHVS LSN+FVKD   VV  GQ V V++
Sbjct  650  KDLRPGMILEGVVTNVAAFGAFVDIGVHQDGLVHVSALSNTFVKDPHDVVKAGQVVKVKV  709

Query  827  LEANMETGRISLTMRESDETSREKQPKDSPGSSDKSRAPKRTPQRNN  967
            LE ++   RI+LTMR SDE      PK   G S +     +   R+N
Sbjct  710  LEVDLARQRIALTMRMSDE------PKKHDGGSQRGAPLSKQQARHN  750



>ref|WP_007516923.1| 30S ribosomal protein S1 [Streptococcus tigurinus]
 gb|EMG33788.1| 30S ribosomal protein S1 [Streptococcus tigurinus AZ_3a]
Length=400

 Score = 90.1 bits (222),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 63/175 (36%), Positives = 94/175 (54%), Gaps = 28/175 (16%)
 Frame = +2

Query  653   LIPGASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNLSNSFVKDVTSVVSVGQEVTVRLLE  832
             L  G   TGKV  I  FGAF+D G   DGLVH++ LS+       SVV+VG+E+ V++L+
Sbjct  191   LAVGDVVTGKVARITSFGAFIDLGG-VDGLVHLTELSHERNVSPKSVVTVGEEIEVKVLD  249

Query  833   ANMETGRISLTMRESDETSREKQPKDSPGSSDKSRAPKRTPQRNNQRRESKFVKGQDLEG  1012
              N E GR+SL+++ +           +PG  D                E K  KG  +EG
Sbjct  250   LNEEEGRVSLSLKAT-----------TPGPWDGV--------------EQKLAKGDVVEG  284

Query  1013  TVKNLTRSGAFISLPEGEEGFLPTSEMADEGLGEIMGGSSLQVGQEVSVRVLRIS  1177
             TVK LT  GAF+ +  G +G +  S+++ + +       +L VGQEV+V+VL ++
Sbjct  285   TVKRLTDFGAFVEVLPGIDGLVHVSQISHKRIENPK--EALTVGQEVTVKVLDVN  337


 Score = 59.3 bits (142),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 31/77 (40%), Positives = 49/77 (64%), Gaps = 0/77 (0%)
 Frame = +2

Query  653  LIPGASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNLSNSFVKDVTSVVSVGQEVTVRLLE  832
            L  G    G VK +  FGAFV+     DGLVHVS +S+  +++    ++VGQEVTV++L+
Sbjct  276  LAKGDVVEGTVKRLTDFGAFVEVLPGIDGLVHVSQISHKRIENPKEALTVGQEVTVKVLD  335

Query  833  ANMETGRISLTMRESDE  883
             N +  R+SL+++  +E
Sbjct  336  VNADAERVSLSIKALEE  352



>emb|CBA07943.1| 30S ribosomal protein S1 [Neisseria meningitidis alpha275]
 gb|EFV63077.1| ribosomal protein S1 [Neisseria meningitidis H44/76]
 gb|EGC55191.1| ribosomal protein S1 [Neisseria meningitidis M6190]
 gb|EGC62995.1| ribosomal protein S1 [Neisseria meningitidis CU385]
Length=589

 Score = 91.7 bits (226),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 68/192 (35%), Positives = 98/192 (51%), Gaps = 29/192 (15%)
 Frame = +2

Query  647   EDLIPGASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNLSNSFVKDVTSVVSVGQEVTVRL  826
             E+L  G+   G VK+I  +GAFVD G   DGL+H+++L+   VK  + V+ VGQEV  ++
Sbjct  216   ENLQEGSVIKGIVKNITDYGAFVDLGGI-DGLLHITDLAWRRVKHPSEVLEVGQEVEAKV  274

Query  827   LEANMETGRISLTMRESDETSREKQPKDSPGSSDKSRAPKRTPQRNNQRRESKFVKGQDL  1006
             L+ + E  R+SL M         KQ  + P S       +R PQ            G  L
Sbjct  275   LKFDQEKQRVSLGM---------KQLGEDPWSG----LTRRYPQ------------GTRL  309

Query  1007  EGTVKNLTRSGAFISLPEGEEGFLPTSEMADEGLGEIMGGSSLQVGQEVSVRVLRISRG-  1183
              G V NLT  GAF+ + +G EG +  SEM D     +     +Q+G EV V +L I  G 
Sbjct  310   FGKVSNLTDYGAFVEIEQGIEGLVHVSEM-DWTNKNVHPSKVVQLGDEVEVMILEIDEGR  368

Query  1184  -QATLTMKKEEA  1216
              + +L MK+ +A
Sbjct  369   RRISLGMKQCQA  380


 Score = 57.0 bits (136),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 57/198 (29%), Positives = 93/198 (47%), Gaps = 33/198 (17%)
 Frame = +2

Query  662   GASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNLSNS-FVKDVTSVVSVGQEVTVRLLEAN  838
             G   +G VKSI  FG FV      DGLVH+S+LS +   ++       G+EV   +L  +
Sbjct  393   GDKISGAVKSITDFGVFVGLPGGIDGLVHLSDLSWTESGEEAVRKYKKGEEVEAVVLAID  452

Query  839   METGRISLTMRESDETSREKQPKDSPGSSDKSRAPKRTPQRNNQRRESKFVKGQDLEGTV  1018
             +E  RISL +         KQ +  P  +  S                   KG  ++G+V
Sbjct  453   VEKERISLGI---------KQLEGDPFGNFISVND----------------KGSLVKGSV  487

Query  1019  KNLTRSGAFISLPEGEEGFLPTSEMADEGLGEIMGGSSLQVGQEVSVRVLRISRGQATLT  1198
             K++   GA I+L +  EG+LP SE A + + ++   + L+ G EV   ++ + R   ++ 
Sbjct  488   KSVDAKGAVIALSDEVEGYLPASEFAADRVEDLT--TKLKEGDEVEAVIVTVDRKNRSIK  545

Query  1199  MK-----KEEATEEVNSV  1237
             +       +E+ E +NSV
Sbjct  546   LSVKAKDAKESREALNSV  563



>ref|WP_001001620.1| MULTISPECIES: 30S ribosomal protein S1 [Streptococcus]
 gb|EFM35473.1| putative ribosomal protein S1 [Streptococcus sp. oral taxon 071 
str. 73H25AP]
 gb|EGL86667.1| 30S ribosomal protein S1 [Streptococcus oralis SK255]
 gb|EID25184.1| 30S ribosomal protein S1 [Streptococcus oralis SK1074]
 gb|EJO21654.1| S1 RNA binding domain protein [Streptococcus sp. BS35b]
 gb|EJP21369.1| S1 RNA binding domain protein [Streptococcus oralis SK304]
 gb|EKS19140.1| ribosomal protein S1 [Streptococcus sp. F0441]
 gb|EMG34828.1| 30S ribosomal protein S1 [Streptococcus tigurinus 1366]
 gb|EPX88502.1| 30S ribosomal protein S1 [Streptococcus tigurinus 2426]
 gb|EPX89280.1| 30S ribosomal protein S1 [Streptococcus tigurinus 2425]
 gb|ETS89250.1| S1 RNA binding domain protein [Streptococcus sp. BS29a]
 gb|EUB29964.1| S1 RNA binding domain protein [Streptococcus sp. BS21]
Length=400

 Score = 90.1 bits (222),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 63/175 (36%), Positives = 94/175 (54%), Gaps = 28/175 (16%)
 Frame = +2

Query  653   LIPGASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNLSNSFVKDVTSVVSVGQEVTVRLLE  832
             L  G   TGKV  I  FGAF+D G   DGLVH++ LS+       SVV+VG+E+ V++L+
Sbjct  191   LAVGDVVTGKVARITSFGAFIDLGG-VDGLVHLTELSHERNVSPKSVVTVGEEIEVKVLD  249

Query  833   ANMETGRISLTMRESDETSREKQPKDSPGSSDKSRAPKRTPQRNNQRRESKFVKGQDLEG  1012
              N E GR+SL+++ +           +PG  D                E K  KG  +EG
Sbjct  250   LNEEEGRVSLSLKAT-----------TPGPWDGV--------------EQKLAKGDVVEG  284

Query  1013  TVKNLTRSGAFISLPEGEEGFLPTSEMADEGLGEIMGGSSLQVGQEVSVRVLRIS  1177
             TVK LT  GAF+ +  G +G +  S+++ + +       +L VGQEV+V+VL ++
Sbjct  285   TVKRLTDFGAFVEVLPGIDGLVHVSQISHKRIENPK--EALTVGQEVTVKVLDVN  337


 Score = 59.3 bits (142),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 31/77 (40%), Positives = 49/77 (64%), Gaps = 0/77 (0%)
 Frame = +2

Query  653  LIPGASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNLSNSFVKDVTSVVSVGQEVTVRLLE  832
            L  G    G VK +  FGAFV+     DGLVHVS +S+  +++    ++VGQEVTV++L+
Sbjct  276  LAKGDVVEGTVKRLTDFGAFVEVLPGIDGLVHVSQISHKRIENPKEALTVGQEVTVKVLD  335

Query  833  ANMETGRISLTMRESDE  883
             N +  R+SL+++  +E
Sbjct  336  VNADAERVSLSIKALEE  352



>ref|WP_001001615.1| MULTISPECIES: 30S ribosomal protein S1 [Streptococcus]
 gb|EGV01135.1| 30S ribosomal protein S1 [Streptococcus oralis SK313]
 gb|EUC81105.1| S1 RNA binding domain protein [Streptococcus sp. CM6]
Length=400

 Score = 90.1 bits (222),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 63/175 (36%), Positives = 94/175 (54%), Gaps = 28/175 (16%)
 Frame = +2

Query  653   LIPGASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNLSNSFVKDVTSVVSVGQEVTVRLLE  832
             L  G   TGKV  I  FGAF+D G   DGLVH++ LS+       SVV+VG+E+ V++L+
Sbjct  191   LAVGDVVTGKVARITSFGAFIDLGG-VDGLVHLTELSHERNVSPKSVVTVGEEIEVKVLD  249

Query  833   ANMETGRISLTMRESDETSREKQPKDSPGSSDKSRAPKRTPQRNNQRRESKFVKGQDLEG  1012
              N E GR+SL+++ +           +PG  D                E K  KG  +EG
Sbjct  250   LNEEEGRVSLSLKAT-----------TPGPWDGV--------------EQKLAKGDVVEG  284

Query  1013  TVKNLTRSGAFISLPEGEEGFLPTSEMADEGLGEIMGGSSLQVGQEVSVRVLRIS  1177
             TVK LT  GAF+ +  G +G +  S+++ + +       +L VGQEV+V+VL ++
Sbjct  285   TVKRLTDFGAFVEVLPGIDGLVHVSQISHKRIENPK--EALTVGQEVTVKVLDVN  337


 Score = 59.3 bits (142),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 31/77 (40%), Positives = 49/77 (64%), Gaps = 0/77 (0%)
 Frame = +2

Query  653  LIPGASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNLSNSFVKDVTSVVSVGQEVTVRLLE  832
            L  G    G VK +  FGAFV+     DGLVHVS +S+  +++    ++VGQEVTV++L+
Sbjct  276  LAKGDVVEGTVKRLTDFGAFVEVLPGIDGLVHVSQISHKRIENPKEALTVGQEVTVKVLD  335

Query  833  ANMETGRISLTMRESDE  883
             N +  R+SL+++  +E
Sbjct  336  VNADAERVSLSIKALEE  352



>ref|WP_037616267.1| 30S ribosomal protein S1 [Streptococcus sinensis]
 gb|KGM37299.1| SSU ribosomal protein S1p [Streptococcus sinensis]
Length=400

 Score = 90.1 bits (222),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 62/172 (36%), Positives = 93/172 (54%), Gaps = 28/172 (16%)
 Frame = +2

Query  662   GASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNLSNSFVKDVTSVVSVGQEVTVRLLEANM  841
             G   TGKV  I  FGAF+D G   DGLVH++ LS+       SVVSVG+E+ V++L+ N 
Sbjct  194   GDVVTGKVARITSFGAFIDLGG-VDGLVHLTELSHERNVSPKSVVSVGEEIEVKVLDLNE  252

Query  842   ETGRISLTMRESDETSREKQPKDSPGSSDKSRAPKRTPQRNNQRRESKFVKGQDLEGTVK  1021
             E GR+SL+++ +           +PG  D                E K   G  +EGTVK
Sbjct  253   EEGRVSLSLKAT-----------TPGPWDGV--------------EQKLAAGDVIEGTVK  287

Query  1022  NLTRSGAFISLPEGEEGFLPTSEMADEGLGEIMGGSSLQVGQEVSVRVLRIS  1177
              LT  GAF+ +  G +G +  S+++ + +       +L+VGQEV+V+VL ++
Sbjct  288   RLTDFGAFVEVLPGIDGLVHISQISHKRVENPK--DALKVGQEVTVKVLEVN  337


 Score = 59.7 bits (143),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 32/77 (42%), Positives = 47/77 (61%), Gaps = 0/77 (0%)
 Frame = +2

Query  653  LIPGASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNLSNSFVKDVTSVVSVGQEVTVRLLE  832
            L  G    G VK +  FGAFV+     DGLVH+S +S+  V++    + VGQEVTV++LE
Sbjct  276  LAAGDVIEGTVKRLTDFGAFVEVLPGIDGLVHISQISHKRVENPKDALKVGQEVTVKVLE  335

Query  833  ANMETGRISLTMRESDE  883
             N    R+SL+++  +E
Sbjct  336  VNAAAERVSLSIKALEE  352



>ref|WP_011798918.1| 30S ribosomal protein S1 [Neisseria meningitidis]
 ref|YP_975258.1| 30S ribosomal protein S1 [Neisseria meningitidis FAM18]
 emb|CAM10472.1| 30S ribosomal protein S1 [Neisseria meningitidis FAM18]
Length=570

 Score = 91.3 bits (225),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 68/192 (35%), Positives = 98/192 (51%), Gaps = 29/192 (15%)
 Frame = +2

Query  647   EDLIPGASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNLSNSFVKDVTSVVSVGQEVTVRL  826
             E+L  G+   G VK+I  +GAFVD G   DGL+H+++L+   VK  + V+ VGQEV  ++
Sbjct  197   ENLQEGSVIKGIVKNITDYGAFVDLGGI-DGLLHITDLAWRRVKHPSEVLEVGQEVEAKV  255

Query  827   LEANMETGRISLTMRESDETSREKQPKDSPGSSDKSRAPKRTPQRNNQRRESKFVKGQDL  1006
             L+ + E  R+SL M         KQ  + P S       +R PQ            G  L
Sbjct  256   LKFDQEKQRVSLGM---------KQLGEDPWSG----LTRRYPQ------------GTRL  290

Query  1007  EGTVKNLTRSGAFISLPEGEEGFLPTSEMADEGLGEIMGGSSLQVGQEVSVRVLRISRG-  1183
              G V NLT  GAF+ + +G EG +  SEM D     +     +Q+G EV V +L I  G 
Sbjct  291   FGKVSNLTDYGAFVEIEQGIEGLVHVSEM-DWTNKNVHPSKVVQLGDEVEVMILEIDEGR  349

Query  1184  -QATLTMKKEEA  1216
              + +L MK+ +A
Sbjct  350   RRISLGMKQCQA  361


 Score = 56.2 bits (134),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 57/199 (29%), Positives = 93/199 (47%), Gaps = 33/199 (17%)
 Frame = +2

Query  659   PGASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNLSNS-FVKDVTSVVSVGQEVTVRLLEA  835
              G   +G VKSI  FG FV      DGLVH+S+LS +   ++       G+EV   +L  
Sbjct  373   KGDKISGAVKSITDFGVFVGLPGGIDGLVHLSDLSWTESGEEAVRKYKKGEEVEAVVLAI  432

Query  836   NMETGRISLTMRESDETSREKQPKDSPGSSDKSRAPKRTPQRNNQRRESKFVKGQDLEGT  1015
             ++E  RISL +         KQ +  P  +  S                   KG  ++G+
Sbjct  433   DVEKERISLGI---------KQLEGDPFGNFISVND----------------KGSLVKGS  467

Query  1016  VKNLTRSGAFISLPEGEEGFLPTSEMADEGLGEIMGGSSLQVGQEVSVRVLRISRGQATL  1195
             VK++   GA I+L +  EG+LP SE A + + ++   + L+ G EV   ++ + R   ++
Sbjct  468   VKSVDAKGAVIALSDEVEGYLPASEFAADRVEDLT--TKLKEGDEVEAVIVTVDRKNRSI  525

Query  1196  TMK-----KEEATEEVNSV  1237
              +       +E+ E +NSV
Sbjct  526   KLSVKAKDAKESREALNSV  544



>gb|EFM04762.1| ribosomal protein S1 [Neisseria meningitidis ATCC 13091]
Length=589

 Score = 91.3 bits (225),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 68/192 (35%), Positives = 98/192 (51%), Gaps = 29/192 (15%)
 Frame = +2

Query  647   EDLIPGASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNLSNSFVKDVTSVVSVGQEVTVRL  826
             E+L  G+   G VK+I  +GAFVD G   DGL+H+++L+   VK  + V+ VGQEV  ++
Sbjct  216   ENLQEGSVIKGIVKNITDYGAFVDLGGI-DGLLHITDLAWRRVKHPSEVLEVGQEVEAKV  274

Query  827   LEANMETGRISLTMRESDETSREKQPKDSPGSSDKSRAPKRTPQRNNQRRESKFVKGQDL  1006
             L+ + E  R+SL M         KQ  + P S       +R PQ            G  L
Sbjct  275   LKFDQEKQRVSLGM---------KQLGEDPWSG----LTRRYPQ------------GTRL  309

Query  1007  EGTVKNLTRSGAFISLPEGEEGFLPTSEMADEGLGEIMGGSSLQVGQEVSVRVLRISRG-  1183
              G V NLT  GAF+ + +G EG +  SEM D     +     +Q+G EV V +L I  G 
Sbjct  310   FGKVSNLTDYGAFVEIEQGIEGLVHVSEM-DWTNKNVHPSKVVQLGDEVEVMILEIDEGR  368

Query  1184  -QATLTMKKEEA  1216
              + +L MK+ +A
Sbjct  369   RRISLGMKQCQA  380


 Score = 56.6 bits (135),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 57/198 (29%), Positives = 93/198 (47%), Gaps = 33/198 (17%)
 Frame = +2

Query  662   GASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNLSNS-FVKDVTSVVSVGQEVTVRLLEAN  838
             G   +G VKSI  FG FV      DGLVH+S+LS +   ++       G+EV   +L  +
Sbjct  393   GDKISGAVKSITDFGVFVGLPGGIDGLVHLSDLSWTESGEEAVRKYKKGEEVEAVVLAID  452

Query  839   METGRISLTMRESDETSREKQPKDSPGSSDKSRAPKRTPQRNNQRRESKFVKGQDLEGTV  1018
             +E  RISL +         KQ +  P  +  S                   KG  ++G+V
Sbjct  453   VEKERISLGI---------KQLEGDPFGNFISVND----------------KGSLVKGSV  487

Query  1019  KNLTRSGAFISLPEGEEGFLPTSEMADEGLGEIMGGSSLQVGQEVSVRVLRISRGQATLT  1198
             K++   GA I+L +  EG+LP SE A + + ++   + L+ G EV   ++ + R   ++ 
Sbjct  488   KSVDAKGAVIALSDEVEGYLPASEFAADRVEDLT--TKLKEGDEVEAVIVTVDRKNRSIK  545

Query  1199  MK-----KEEATEEVNSV  1237
             +       +E+ E +NSV
Sbjct  546   LSVKAKDAKESREALNSV  563



>ref|WP_003752638.1| 30S ribosomal protein S1 [Neisseria polysaccharea]
 gb|EFH22760.1| ribosomal protein S1 [Neisseria polysaccharea ATCC 43768]
Length=561

 Score = 91.3 bits (225),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 68/192 (35%), Positives = 98/192 (51%), Gaps = 29/192 (15%)
 Frame = +2

Query  647   EDLIPGASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNLSNSFVKDVTSVVSVGQEVTVRL  826
             E+L  G+   G VK+I  +GAFVD G   DGL+H+++L+   VK  + V+ VGQEV  ++
Sbjct  188   ENLQEGSVIKGIVKNITDYGAFVDLGGI-DGLLHITDLAWRRVKHPSEVLEVGQEVEAKV  246

Query  827   LEANMETGRISLTMRESDETSREKQPKDSPGSSDKSRAPKRTPQRNNQRRESKFVKGQDL  1006
             L+ + E  R+SL M         KQ  + P S       +R PQ            G  L
Sbjct  247   LKFDQEKQRVSLGM---------KQLGEDPWSG----LTRRYPQ------------GTRL  281

Query  1007  EGTVKNLTRSGAFISLPEGEEGFLPTSEMADEGLGEIMGGSSLQVGQEVSVRVLRISRG-  1183
              G V NLT  GAF+ + +G EG +  SEM D     +     +Q+G EV V +L I  G 
Sbjct  282   FGKVSNLTDYGAFVGIEQGIEGLVHVSEM-DWTNKNVHPSKVVQLGDEVEVMILEIDEGR  340

Query  1184  -QATLTMKKEEA  1216
              + +L MK+ +A
Sbjct  341   RRISLGMKQCQA  352


 Score = 55.1 bits (131),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 56/198 (28%), Positives = 93/198 (47%), Gaps = 33/198 (17%)
 Frame = +2

Query  662   GASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNLSNS-FVKDVTSVVSVGQEVTVRLLEAN  838
             G   +G VKSI  FG FV      DGLVH+S+LS +   ++       G+EV   +L  +
Sbjct  365   GDKISGAVKSITDFGVFVGLPGGIDGLVHLSDLSWTESGEEAVRKYKKGEEVEAVVLAID  424

Query  839   METGRISLTMRESDETSREKQPKDSPGSSDKSRAPKRTPQRNNQRRESKFVKGQDLEGTV  1018
             +E  RISL +         KQ +  P  +  S                   KG  ++G+V
Sbjct  425   VEKERISLGI---------KQLEGDPFGNFISVND----------------KGSLVKGSV  459

Query  1019  KNLTRSGAFISLPEGEEGFLPTSEMADEGLGEIMGGSSLQVGQEVSVRVLRISRGQATLT  1198
             K++   GA ++L +  EG+LP SE A + + ++   + L+ G EV   ++ + R   ++ 
Sbjct  460   KSVDAKGAVVALSDEVEGYLPASEFAADRVEDLT--TKLKEGDEVEAVIVTVDRKNRSIK  517

Query  1199  MK-----KEEATEEVNSV  1237
             +       +E+ E +NSV
Sbjct  518   LSVKAKDAKESREALNSV  535



>ref|WP_029609369.1| 30S ribosomal protein S1 [Neisseria lactamica]
Length=561

 Score = 91.3 bits (225),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 69/192 (36%), Positives = 98/192 (51%), Gaps = 29/192 (15%)
 Frame = +2

Query  647   EDLIPGASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNLSNSFVKDVTSVVSVGQEVTVRL  826
             E+L  GA   G VK+I  +GAFVD G   DGL+H+++L+   VK  + V+ VGQEV  ++
Sbjct  188   ENLQEGAIIKGVVKNITDYGAFVDLGGI-DGLLHITDLAWRRVKHPSEVLEVGQEVEAKV  246

Query  827   LEANMETGRISLTMRESDETSREKQPKDSPGSSDKSRAPKRTPQRNNQRRESKFVKGQDL  1006
             L+ + E  R+SL M         KQ  + P S       +R PQ            G  L
Sbjct  247   LKFDQEKQRVSLGM---------KQLGEDPWSG----LTRRYPQ------------GTRL  281

Query  1007  EGTVKNLTRSGAFISLPEGEEGFLPTSEMADEGLGEIMGGSSLQVGQEVSVRVLRI--SR  1180
              G V NLT  GAF+ + +G EG +  SEM D     +     +Q+G EV V +L I  +R
Sbjct  282   FGKVSNLTDYGAFVEIEQGIEGLVHVSEM-DWTNKNVHPSKVVQLGDEVEVMILEIDENR  340

Query  1181  GQATLTMKKEEA  1216
              + +L MK+  A
Sbjct  341   RRISLGMKQCRA  352


 Score = 59.7 bits (143),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 59/199 (30%), Positives = 94/199 (47%), Gaps = 33/199 (17%)
 Frame = +2

Query  659   PGASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNLSNSFV-KDVTSVVSVGQEVTVRLLEA  835
              G   +G VKSI  FG FV      DGLVH+S+LS +   ++       G+EV   +L  
Sbjct  364   KGDKISGAVKSITDFGIFVGLPGGIDGLVHLSDLSWTEAGEEAVRKYKKGEEVEAVVLAI  423

Query  836   NMETGRISLTMRESDETSREKQPKDSPGSSDKSRAPKRTPQRNNQRRESKFVKGQDLEGT  1015
             ++E  RISL +         KQ +  P  +  S                   KG  ++GT
Sbjct  424   DVEKERISLGI---------KQLEGDPFGNFISVND----------------KGSLVKGT  458

Query  1016  VKNLTRSGAFISLPEGEEGFLPTSEMADEGLGEIMGGSSLQVGQEVSVRVLRISRGQATL  1195
             VK++   GA ++L +  EG+LP SE A + + ++   + L+ G+EV   VL + R   ++
Sbjct  459   VKSVDAKGAVVALSDEVEGYLPASEFAADRVEDL--STKLKEGEEVEAVVLTVDRKNRSI  516

Query  1196  TMK-----KEEATEEVNSV  1237
              +       +E+ E +NSV
Sbjct  517   KLSVKAKDAKESREALNSV  535



>ref|WP_034298627.1| 30S ribosomal protein S1 [Herbaspirillum sp. RV1423]
Length=542

 Score = 91.3 bits (225),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 67/189 (35%), Positives = 97/189 (51%), Gaps = 29/189 (15%)
 Frame = +2

Query  647   EDLIPGASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNLSNSFVKDVTSVVSVGQEVTVRL  826
             E L  G   TG VK+I  +GAFVD G   DGL+H+++L+   V+  + V++VGQE+T ++
Sbjct  170   ETLKEGTVVTGVVKNITDYGAFVDLGGI-DGLLHITDLAWRRVRHPSEVLTVGQEITAKV  228

Query  827   LEANMETGRISLTMRESDETSREKQPKDSPGSSDKSRAPKRTPQRNNQRRESKFVKGQDL  1006
             L+ + E  R+SL +         KQ  D P +       +R PQ            G  L
Sbjct  229   LKYDQEKNRVSLGV---------KQLGDDPWTG----LSRRYPQ------------GTRL  263

Query  1007  EGTVKNLTRSGAFISLPEGEEGFLPTSEMADEGLGEIMGGSSLQVGQEVSVRVLRIS--R  1180
              G V NLT  GAF+ + +G EG +  SEM D     +     +Q+G EV V VL I   R
Sbjct  264   FGKVTNLTDYGAFVEVEQGIEGLVHVSEM-DWTNKNVAPNKVVQLGDEVEVMVLEIDEER  322

Query  1181  GQATLTMKK  1207
              + +L MK+
Sbjct  323   RRISLGMKQ  331



>ref|WP_007876342.1| 30S ribosomal protein S1 [Herbaspirillum sp. CF444]
 gb|EJL93330.1| ribosomal protein S1 [Herbaspirillum sp. CF444]
Length=542

 Score = 91.3 bits (225),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 67/189 (35%), Positives = 97/189 (51%), Gaps = 29/189 (15%)
 Frame = +2

Query  647   EDLIPGASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNLSNSFVKDVTSVVSVGQEVTVRL  826
             E L  G   TG VK+I  +GAFVD G   DGL+H+++L+   V+  + V++VGQE+T ++
Sbjct  170   ETLKEGTVVTGVVKNITDYGAFVDLGGI-DGLLHITDLAWRRVRHPSEVLTVGQEITAKV  228

Query  827   LEANMETGRISLTMRESDETSREKQPKDSPGSSDKSRAPKRTPQRNNQRRESKFVKGQDL  1006
             L+ + E  R+SL +         KQ  D P +       +R PQ            G  L
Sbjct  229   LKYDQEKNRVSLGV---------KQLGDDPWTG----LSRRYPQ------------GTRL  263

Query  1007  EGTVKNLTRSGAFISLPEGEEGFLPTSEMADEGLGEIMGGSSLQVGQEVSVRVLRIS--R  1180
              G V NLT  GAF+ + +G EG +  SEM D     +     +Q+G EV V VL I   R
Sbjct  264   FGKVTNLTDYGAFVEVEQGIEGLVHVSEM-DWTNKNVAPNKVVQLGDEVEVMVLEIDEER  322

Query  1181  GQATLTMKK  1207
              + +L MK+
Sbjct  323   RRISLGMKQ  331



>gb|AIQ27919.1| hypothetical protein P40081_06775 [Paenibacillus sp. FSL P4-0081]
Length=742

 Score = 91.7 bits (226),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 46/95 (48%), Positives = 61/95 (64%), Gaps = 9/95 (9%)
 Frame = +2

Query  638  IKNEDLIPGASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNLSNSFVKDVTSVVSVGQEVT  817
            +K EDL+PG    G V+++  FGAFVD G   DGLVH+S LS SFVK    VVSVG  VT
Sbjct  655  LKIEDLVPGMEMQGTVRNVIDFGAFVDIGIKNDGLVHISQLSGSFVKHPMDVVSVGDNVT  714

Query  818  VRLLEANMETGRISLTMRESDETSREKQPKDSPGS  922
            V ++  +++ GR+SLTMR         QP+++ GS
Sbjct  715  VWVMGVDLKKGRVSLTMR---------QPREAGGS  740



>ref|WP_001001638.1| 30S ribosomal protein S1 [Streptococcus pneumoniae]
 gb|EDK71918.1| ribosomal protein S1 [Streptococcus pneumoniae SP19-BS75]
Length=400

 Score = 90.1 bits (222),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 63/175 (36%), Positives = 93/175 (53%), Gaps = 28/175 (16%)
 Frame = +2

Query  653   LIPGASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNLSNSFVKDVTSVVSVGQEVTVRLLE  832
             L  G   TGKV  I  FGAF+D G   DGLVH++ LS+       SVV+VG+E+ V++L+
Sbjct  191   LAVGDVVTGKVARITSFGAFIDLGG-VDGLVHLTELSHERNVSPKSVVTVGEEIEVKILD  249

Query  833   ANMETGRISLTMRESDETSREKQPKDSPGSSDKSRAPKRTPQRNNQRRESKFVKGQDLEG  1012
              N E GR+SL+++ +            PG  D                E K  KG  +EG
Sbjct  250   LNEEEGRVSLSIKAT-----------VPGPWDGV--------------EQKLAKGDVVEG  284

Query  1013  TVKNLTRSGAFISLPEGEEGFLPTSEMADEGLGEIMGGSSLQVGQEVSVRVLRIS  1177
             TVK LT  GAF+ +  G +G +  S+++ + +       +L+VGQEV V+VL ++
Sbjct  285   TVKRLTDFGAFVEVLPGIDGLVHVSQISHKRIENPK--EALKVGQEVQVKVLEVN  337


 Score = 60.5 bits (145),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 36/109 (33%), Positives = 60/109 (55%), Gaps = 5/109 (5%)
 Frame = +2

Query  653  LIPGASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNLSNSFVKDVTSVVSVGQEVTVRLLE  832
            L  G    G VK +  FGAFV+     DGLVHVS +S+  +++    + VGQEV V++LE
Sbjct  276  LAKGDVVEGTVKRLTDFGAFVEVLPGIDGLVHVSQISHKRIENPKEALKVGQEVQVKVLE  335

Query  833  ANMETGRISLTMRESDETSREKQPKDSPGSSDKSRAPKRTPQRNNQRRE  979
             N +  R+SL+++     + E++P    G  ++ R  +    R  ++R+
Sbjct  336  VNADAERVSLSIK-----ALEERPAQEEGQKEEKRVARPRRPRRQEKRD  379



>ref|WP_002223706.1| 30S ribosomal protein S1 [Neisseria meningitidis]
 gb|EGC58803.1| ribosomal protein S1 [Neisseria meningitidis M0579]
Length=561

 Score = 91.3 bits (225),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 68/192 (35%), Positives = 98/192 (51%), Gaps = 29/192 (15%)
 Frame = +2

Query  647   EDLIPGASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNLSNSFVKDVTSVVSVGQEVTVRL  826
             E+L  G+   G VK+I  +GAFVD G   DGL+H+++L+   VK  + V+ VGQEV  ++
Sbjct  188   ENLQEGSVIKGIVKNITDYGAFVDLGGI-DGLLHITDLAWRRVKHPSEVLEVGQEVEAKV  246

Query  827   LEANMETGRISLTMRESDETSREKQPKDSPGSSDKSRAPKRTPQRNNQRRESKFVKGQDL  1006
             L+ + E  R+SL M         KQ  + P S       +R PQ            G  L
Sbjct  247   LKFDQEKQRVSLGM---------KQLGEDPWSG----LTRRYPQ------------GTRL  281

Query  1007  EGTVKNLTRSGAFISLPEGEEGFLPTSEMADEGLGEIMGGSSLQVGQEVSVRVLRISRG-  1183
              G V NLT  GAF+ + +G EG +  SEM D     +     +Q+G EV V +L I  G 
Sbjct  282   FGKVSNLTDYGAFVEIEQGIEGLVHVSEM-DWTNKNVHPSKVVQLGDEVEVMILEIDEGR  340

Query  1184  -QATLTMKKEEA  1216
              + +L MK+ +A
Sbjct  341   RRISLGMKQCQA  352


 Score = 56.2 bits (134),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 57/198 (29%), Positives = 93/198 (47%), Gaps = 33/198 (17%)
 Frame = +2

Query  662   GASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNLSNS-FVKDVTSVVSVGQEVTVRLLEAN  838
             G   +G VKSI  FG FV      DGLVH+S+LS +   ++       G+EV   +L  +
Sbjct  365   GDKISGAVKSITDFGVFVGLPGGIDGLVHLSDLSWTESSEEAVRKYKKGEEVEAVVLAID  424

Query  839   METGRISLTMRESDETSREKQPKDSPGSSDKSRAPKRTPQRNNQRRESKFVKGQDLEGTV  1018
             +E  RISL +         KQ +  P  +  S                   KG  ++G+V
Sbjct  425   VEKERISLGI---------KQLEGDPFGNFISVND----------------KGSLVKGSV  459

Query  1019  KNLTRSGAFISLPEGEEGFLPTSEMADEGLGEIMGGSSLQVGQEVSVRVLRISRGQATLT  1198
             K++   GA I+L +  EG+LP SE A + + ++   + L+ G EV   ++ + R   ++ 
Sbjct  460   KSVDAKGAVIALSDEVEGYLPASEFAADRVEDLT--TKLKEGDEVEAVIVTVDRKNRSIK  517

Query  1199  MK-----KEEATEEVNSV  1237
             +       +E+ E +NSV
Sbjct  518   LSVKAKDAKESREALNSV  535



>ref|WP_012119946.1| RNA-binding protein S1 [Roseiflexus castenholzii]
 ref|YP_001431535.1| RNA-binding S1 domain-containing protein [Roseiflexus castenholzii 
DSM 13941]
 gb|ABU57517.1| RNA binding S1 domain protein [Roseiflexus castenholzii DSM 13941]
Length=503

 Score = 90.9 bits (224),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 56/171 (33%), Positives = 83/171 (49%), Gaps = 30/171 (18%)
 Frame = +2

Query  662   GASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNLSNSFVKDVTSVVSVGQEVTVRLLEANM  841
             G +  G V  + PFG FVD G   DGLVHVS L+   V+    VV VGQ  T ++LE + 
Sbjct  238   GDNVEGTVTGLAPFGVFVDIGVGKDGLVHVSELAEGRVEKAEDVVQVGQTYTFKVLEVDA  297

Query  842   ETGRISLTMRESDETSREKQPKDSPGSSDKSRAPKRTPQRNNQRRESKFVKGQDLEGTVK  1021
             E  RISL++R +    + +Q                              KGQ LEGT+ 
Sbjct  298   EGARISLSLRRAQRGQKLQQ----------------------------LEKGQILEGTIS  329

Query  1022  NLTRSGAFISLPEGEEGFLPTSEMADEGLGEIMGGSSLQVGQEVSVRVLRI  1174
              L   GAF+ +  G +G +  SE+++  +  +    +++VG +V VRVL +
Sbjct  330   GLAPFGAFVDIGVGRDGLVHISELSNARVARVE--DAVKVGDKVQVRVLDV  378


 Score = 90.5 bits (223),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 66/213 (31%), Positives = 113/213 (53%), Gaps = 17/213 (8%)
 Frame = +2

Query  635   PIKNEDLIPGASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNLSNSFVKDVTSVVSVGQEV  814
             P + +DL PG    G+V SI  +G FVD G   DGLVH+S +S++ ++  + +V +G  V
Sbjct  130   PRRVKDLAPGMELEGRVTSIALYGIFVDIGVGRDGLVHISEMSDTRIESPSDLVKIGDTV  189

Query  815   TVRLLEANMETGRISLTMRESDETSREKQPKDSPGSSDKSRAPKRTPQRNNQRRESKFVK  994
              VR+     +  RISLTMR  +   R  +P+   G        K+ P+ +  +  +  V 
Sbjct  190   KVRVKSVEPDGRRISLTMRMKE---RGAEPRSGRG--------KKKPEVDYDKLAALRV-  237

Query  995   GQDLEGTVKNLTRSGAFISLPEGEEGFLPTSEMADEGLGEIMGGSSLQVGQEVSVRVLRI  1174
             G ++EGTV  L   G F+ +  G++G +  SE+A EG  E      +QVGQ  + +VL +
Sbjct  238   GDNVEGTVTGLAPFGVFVDIGVGKDGLVHVSELA-EGRVE-KAEDVVQVGQTYTFKVLEV  295

Query  1175  SR--GQATLTMKKEEATEEVNSVLSQGVIHKAT  1267
                  + +L++++ +  +++   L +G I + T
Sbjct  296   DAEGARISLSLRRAQRGQKLQQ-LEKGQILEGT  327


 Score = 72.0 bits (175),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 36/80 (45%), Positives = 49/80 (61%), Gaps = 0/80 (0%)
 Frame = +2

Query  641  KNEDLIPGASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNLSNSFVKDVTSVVSVGQEVTV  820
            K + L  G    G +  + PFGAFVD G   DGLVH+S LSN+ V  V   V VG +V V
Sbjct  314  KLQQLEKGQILEGTISGLAPFGAFVDIGVGRDGLVHISELSNARVARVEDAVKVGDKVQV  373

Query  821  RLLEANMETGRISLTMRESD  880
            R+L+ + ++ RISL++R  D
Sbjct  374  RVLDVDPQSKRISLSLRLED  393



>ref|WP_028539684.1| hypothetical protein [Paenibacillus sp. J14]
Length=744

 Score = 91.7 bits (226),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 44/91 (48%), Positives = 58/91 (64%), Gaps = 7/91 (8%)
 Frame = +2

Query  620  KSEMPP-------IKNEDLIPGASFTGKVKSIQPFGAFVDFGAFTDGLVHVSNLSNSFVK  778
            + E+PP       +K EDL+PG    G V+++  FGAFVD G   DGLVH+S LSN +VK
Sbjct  646  REELPPPIFRTDVLKIEDLVPGMELQGTVRNVIDFGAFVDIGIKNDGLVHISQLSNGYVK  705

Query  779  DVTSVVSVGQEVTVRLLEANMETGRISLTMR  871
                VVSVG  VTV +L  +++ GR+ LTMR
Sbjct  706  HPMDVVSVGDNVTVWVLNVDVKKGRVGLTMR  736



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 5321438819768