BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c59978_g1_i1 len=124 path=[1:0-123]

Length=124
                                                                      Score     E

ref|XP_009600486.1|  PREDICTED: pentatricopeptide repeat-containi...  79.7    7e-16   
ref|XP_009797119.1|  PREDICTED: pentatricopeptide repeat-containi...  76.6    7e-15   
ref|XP_010316223.1|  PREDICTED: pentatricopeptide repeat-containi...  72.4    2e-13   
ref|XP_006338375.1|  PREDICTED: pentatricopeptide repeat-containi...  71.6    4e-13   
gb|EYU39274.1|  hypothetical protein MIMGU_mgv1a004625mg              68.9    4e-12   
gb|EYU25996.1|  hypothetical protein MIMGU_mgv1a024459mg              68.6    5e-12   
ref|XP_010098470.1|  hypothetical protein L484_025905                 67.8    1e-11   
ref|XP_011089232.1|  PREDICTED: uncharacterized protein LOC105170258  66.2    6e-11   
ref|XP_008235707.1|  PREDICTED: pentatricopeptide repeat-containi...  64.3    2e-10   
ref|XP_010669712.1|  PREDICTED: pentatricopeptide repeat-containi...  63.5    3e-10   
gb|KDP26556.1|  hypothetical protein JCGZ_17714                       63.2    4e-10   
emb|CDP04124.1|  unnamed protein product                              62.4    9e-10   
ref|XP_007200721.1|  hypothetical protein PRUPE_ppa025321mg           62.0    1e-09   
ref|XP_009118553.1|  PREDICTED: pentatricopeptide repeat-containi...  61.6    2e-09   
ref|XP_002301860.2|  pentatricopeptide repeat-containing family p...  61.6    2e-09   Populus trichocarpa [western balsam poplar]
ref|XP_009354972.1|  PREDICTED: pentatricopeptide repeat-containi...  60.8    3e-09   
ref|XP_006493995.1|  PREDICTED: pentatricopeptide repeat-containi...  59.7    7e-09   
ref|XP_006420414.1|  hypothetical protein CICLE_v10006642mg           59.3    9e-09   
gb|KDO55742.1|  hypothetical protein CISIN_1g043124mg                 57.8    2e-08   
ref|XP_010542740.1|  PREDICTED: transcription factor bHLH155          57.0    9e-08   
emb|CDY10177.1|  BnaC05g04200D                                        56.6    1e-07   
ref|XP_009367773.1|  PREDICTED: pentatricopeptide repeat-containi...  55.1    1e-07   
gb|KCW76194.1|  hypothetical protein EUGRSUZ_D00581                   55.8    1e-07   
ref|XP_010052252.1|  PREDICTED: pentatricopeptide repeat-containi...  55.8    1e-07   
ref|XP_007050341.1|  Basic helix-loop-helix DNA-binding superfami...  55.8    1e-07   
ref|XP_010274819.1|  PREDICTED: pentatricopeptide repeat-containi...  55.5    2e-07   
emb|CDY09986.1|  BnaC08g44650D                                        55.5    2e-07   
emb|CBI20254.3|  unnamed protein product                              54.3    5e-07   
ref|XP_002282675.3|  PREDICTED: pentatricopeptide repeat-containi...  54.3    6e-07   Vitis vinifera
ref|XP_009369523.1|  PREDICTED: pentatricopeptide repeat-containi...  53.1    6e-07   
ref|XP_004292199.1|  PREDICTED: pentatricopeptide repeat-containi...  53.5    1e-06   
emb|CDY47719.1|  BnaA10g04080D                                        50.4    1e-06   
gb|KHN10981.1|  Pentatricopeptide repeat-containing protein           52.4    2e-06   
ref|XP_003530855.2|  PREDICTED: pentatricopeptide repeat-containi...  52.4    2e-06   
ref|XP_004511192.1|  PREDICTED: pentatricopeptide repeat-containi...  52.8    2e-06   
ref|XP_009400644.1|  PREDICTED: pentatricopeptide repeat-containi...  52.0    3e-06   
ref|XP_008447444.1|  PREDICTED: pentatricopeptide repeat-containi...  51.2    6e-06   
ref|XP_008783512.1|  PREDICTED: pentatricopeptide repeat-containi...  50.8    1e-05   
ref|XP_004165913.1|  PREDICTED: pentatricopeptide repeat-containi...  50.1    2e-05   
gb|KGN57932.1|  hypothetical protein Csa_3G395920                     49.7    2e-05   
ref|XP_007134299.1|  hypothetical protein PHAVU_010G035600g           49.7    2e-05   
ref|XP_006430161.1|  hypothetical protein CICLE_v10013825mg           49.7    2e-05   
ref|XP_004152039.1|  PREDICTED: pentatricopeptide repeat-containi...  49.7    2e-05   
gb|KDP28762.1|  hypothetical protein JCGZ_14533                       49.7    3e-05   
gb|KEH22613.1|  basic helix loop helix protein, putative              49.3    3e-05   
gb|AFG65800.1|  hypothetical protein 2_9455_01                        47.0    3e-05   
gb|KDO70478.1|  hypothetical protein CISIN_1g0374141mg                48.9    3e-05   
ref|XP_008382915.1|  PREDICTED: LOW QUALITY PROTEIN: pentatricope...  48.5    3e-05   
ref|XP_004491724.1|  PREDICTED: pentatricopeptide repeat-containi...  48.9    4e-05   
emb|CDO98371.1|  unnamed protein product                              49.3    4e-05   
gb|ACE80776.1|  pentatricopeptide repeat protein                      46.6    4e-05   Scapania nemorea
gb|AFG65806.1|  hypothetical protein 2_9455_01                        46.6    4e-05   
gb|AEW08424.1|  hypothetical protein 2_9455_01                        46.6    4e-05   
gb|AFG65804.1|  hypothetical protein 2_9455_01                        46.6    4e-05   
gb|AFG65809.1|  hypothetical protein 2_9455_01                        46.6    4e-05   
gb|AFG65812.1|  hypothetical protein 2_9455_01                        46.2    5e-05   
gb|KHN35639.1|  Pentatricopeptide repeat-containing protein, chlo...  48.1    7e-05   
ref|XP_010935756.1|  PREDICTED: pentatricopeptide repeat-containi...  48.1    8e-05   
ref|XP_008787391.1|  PREDICTED: pentatricopeptide repeat-containi...  48.1    8e-05   
ref|XP_006409153.1|  hypothetical protein EUTSA_v10022616mg           48.1    8e-05   
ref|XP_008438168.1|  PREDICTED: pentatricopeptide repeat-containi...  48.1    8e-05   
ref|XP_004133915.1|  PREDICTED: pentatricopeptide repeat-containi...  48.1    9e-05   
gb|EPS65029.1|  tetratricopeptide-like helical                        48.1    9e-05   
ref|XP_004955088.1|  PREDICTED: pentatricopeptide repeat-containi...  47.8    1e-04   
gb|EAY92839.1|  hypothetical protein OsI_14639                        47.8    1e-04   Oryza sativa Indica Group [Indian rice]
ref|XP_007200964.1|  hypothetical protein PRUPE_ppa004156mg           47.4    1e-04   
ref|XP_008232533.1|  PREDICTED: pentatricopeptide repeat-containi...  47.4    1e-04   
ref|NP_001052059.2|  Os04g0118700                                     47.8    1e-04   Oryza sativa Japonica Group [Japonica rice]
emb|CAE01289.2|  OSJNBa0020P07.6                                      47.8    1e-04   Oryza sativa Japonica Group [Japonica rice]
emb|CAH66009.1|  H0613H07.7                                           47.8    1e-04   Oryza sativa [red rice]
ref|XP_003624159.1|  Pentatricopeptide repeat-containing protein      47.8    1e-04   
ref|XP_010911842.1|  PREDICTED: putative pentatricopeptide repeat...  47.8    1e-04   
ref|XP_006344596.1|  PREDICTED: pentatricopeptide repeat-containi...  47.4    1e-04   
gb|ACE80722.1|  pentatricopeptide repeat protein                      45.1    1e-04   Anastrophyllum minutum
ref|XP_010920030.1|  PREDICTED: pentatricopeptide repeat-containi...  47.4    2e-04   
gb|KDO42941.1|  hypothetical protein CISIN_1g009663mg                 47.4    2e-04   
ref|XP_006441856.1|  hypothetical protein CICLE_v10019688mg           47.4    2e-04   
gb|ACE80853.1|  pentatricopeptide repeat protein                      45.1    2e-04   Lepidogyna hodgsoniae
gb|ACE80735.1|  pentatricopeptide repeat protein                      45.1    2e-04   Diplophyllum albicans
ref|XP_006478286.1|  PREDICTED: pentatricopeptide repeat-containi...  47.0    2e-04   
ref|XP_003619586.1|  hypothetical protein MTR_6g059820                47.0    2e-04   
ref|XP_008791010.1|  PREDICTED: pentatricopeptide repeat-containi...  47.0    2e-04   
gb|AFB33718.1|  hypothetical protein 2_9455_01                        44.7    2e-04   
ref|XP_008791356.1|  PREDICTED: pentatricopeptide repeat-containi...  47.0    2e-04   
ref|XP_010920279.1|  PREDICTED: pentatricopeptide repeat-containi...  47.0    2e-04   
ref|XP_010679228.1|  PREDICTED: pentatricopeptide repeat-containi...  47.0    2e-04   
gb|AEX12062.1|  hypothetical protein 0_18789_01                       44.7    2e-04   
gb|AEX12049.1|  hypothetical protein 0_18789_01                       44.7    2e-04   
gb|AEX12054.1|  hypothetical protein 0_18789_01                       44.7    2e-04   
dbj|BAJ91522.1|  predicted protein                                    47.0    2e-04   
ref|XP_010478758.1|  PREDICTED: pentatricopeptide repeat-containi...  47.0    2e-04   
ref|XP_004158080.1|  PREDICTED: pentatricopeptide repeat-containi...  47.0    2e-04   
gb|KGN65963.1|  hypothetical protein Csa_1G553510                     47.0    2e-04   
ref|XP_004135750.1|  PREDICTED: pentatricopeptide repeat-containi...  47.0    2e-04   
gb|AEX12061.1|  hypothetical protein 0_18789_01                       44.7    2e-04   
emb|CDP11100.1|  unnamed protein product                              46.6    2e-04   
ref|XP_004984893.1|  PREDICTED: pentatricopeptide repeat-containi...  47.0    2e-04   
gb|AEX12050.1|  hypothetical protein 0_18789_01                       44.7    2e-04   
ref|XP_010690456.1|  PREDICTED: pentatricopeptide repeat-containi...  47.0    2e-04   
ref|XP_004984890.1|  PREDICTED: pentatricopeptide repeat-containi...  47.0    3e-04   
ref|XP_004492833.1|  PREDICTED: pentatricopeptide repeat-containi...  46.6    3e-04   
ref|XP_009381414.1|  PREDICTED: pentatricopeptide repeat-containi...  46.6    3e-04   
ref|XP_007155354.1|  hypothetical protein PHAVU_003G194000g           46.6    3e-04   
ref|XP_007031405.1|  Pentatricopeptide repeat (PPR) superfamily p...  46.2    3e-04   
ref|XP_002980702.1|  hypothetical protein SELMODRAFT_113181           46.6    3e-04   
ref|XP_007052071.1|  Pentatricopeptide repeat (PPR) superfamily p...  46.2    3e-04   
gb|AEW08425.1|  hypothetical protein 2_9455_01                        43.9    3e-04   
ref|XP_010090507.1|  hypothetical protein L484_017129                 46.2    3e-04   
ref|XP_010922662.1|  PREDICTED: putative pentatricopeptide repeat...  46.2    4e-04   
ref|XP_008801268.1|  PREDICTED: pentatricopeptide repeat-containi...  46.2    4e-04   
ref|XP_010241799.1|  PREDICTED: pentatricopeptide repeat-containi...  46.2    4e-04   
ref|XP_006393385.1|  hypothetical protein EUTSA_v10011302mg           46.2    4e-04   
ref|XP_006299039.1|  hypothetical protein CARUB_v10015176mg           46.2    4e-04   
ref|XP_010533968.1|  PREDICTED: pentatricopeptide repeat-containi...  46.2    4e-04   
gb|ACE80848.1|  pentatricopeptide repeat protein                      43.9    4e-04   Lepidogyna hodgsoniae
ref|XP_010430241.1|  PREDICTED: pentatricopeptide repeat-containi...  46.2    4e-04   
ref|XP_004959110.1|  PREDICTED: putative pentatricopeptide repeat...  46.2    4e-04   
gb|ACE80767.1|  pentatricopeptide repeat protein                      43.5    4e-04   Ptilidium pulcherrimum [naugehyde liverwort]
ref|XP_010654106.1|  PREDICTED: pentatricopeptide repeat-containi...  45.8    4e-04   
ref|XP_006306508.1|  hypothetical protein CARUB_v10012498mg           45.8    5e-04   
ref|XP_004512654.1|  PREDICTED: pentatricopeptide repeat-containi...  45.8    5e-04   
gb|KFK36081.1|  hypothetical protein AALP_AA4G075000                  45.8    5e-04   
ref|XP_010553384.1|  PREDICTED: pentatricopeptide repeat-containi...  45.8    5e-04   
ref|XP_010246114.1|  PREDICTED: pentatricopeptide repeat-containi...  45.8    5e-04   
ref|XP_003628686.1|  Pentatricopeptide repeat protein                 45.8    5e-04   
gb|AEU08424.1|  pentatricopeptide repeat protein                      43.5    5e-04   
ref|XP_010654107.1|  PREDICTED: pentatricopeptide repeat-containi...  45.8    5e-04   
gb|KHN19434.1|  Putative pentatricopeptide repeat-containing protein  45.8    5e-04   
emb|CBI30318.3|  unnamed protein product                              45.8    5e-04   
ref|XP_002458168.1|  hypothetical protein SORBIDRAFT_03g028130        45.8    5e-04   Sorghum bicolor [broomcorn]
ref|XP_007133846.1|  hypothetical protein PHAVU_011G213900g           45.8    5e-04   
ref|XP_010690022.1|  PREDICTED: pentatricopeptide repeat-containi...  45.8    5e-04   
ref|XP_006587808.1|  PREDICTED: pentatricopeptide repeat-containi...  45.8    5e-04   
ref|XP_003575376.1|  PREDICTED: pentatricopeptide repeat-containi...  45.8    5e-04   
ref|XP_002884698.1|  pentatricopeptide repeat-containing protein      45.8    5e-04   
ref|XP_010943831.1|  PREDICTED: LOW QUALITY PROTEIN: pentatricope...  45.8    5e-04   
ref|XP_006647529.1|  PREDICTED: pentatricopeptide repeat-containi...  45.4    5e-04   
ref|XP_002976962.1|  hypothetical protein SELMODRAFT_106096           45.8    5e-04   
ref|XP_003539649.2|  PREDICTED: putative pentatricopeptide repeat...  45.8    6e-04   
ref|XP_008776306.1|  PREDICTED: pentatricopeptide repeat-containi...  45.8    6e-04   
gb|KHN29274.1|  Putative pentatricopeptide repeat-containing protein  45.8    6e-04   
ref|XP_007011666.1|  Pentatricopeptide repeat-containing protein,...  45.8    6e-04   
ref|XP_008386694.1|  PREDICTED: pentatricopeptide repeat-containi...  43.5    6e-04   
emb|CAN68552.1|  hypothetical protein VITISV_014227                   45.8    6e-04   Vitis vinifera
ref|NP_187494.1|  pentatricopeptide repeat-containing protein         45.8    6e-04   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010665484.1|  PREDICTED: pentatricopeptide repeat-containi...  45.4    6e-04   
ref|XP_004509852.1|  PREDICTED: putative pentatricopeptide repeat...  45.8    6e-04   
ref|XP_002533783.1|  pentatricopeptide repeat-containing protein,...  45.4    6e-04   Ricinus communis
ref|XP_006602844.1|  PREDICTED: putative pentatricopeptide repeat...  45.8    6e-04   
ref|XP_002265522.1|  PREDICTED: putative pentatricopeptide repeat...  45.4    6e-04   Vitis vinifera
ref|XP_006290208.1|  hypothetical protein CARUB_v10003899mg           45.4    6e-04   
ref|XP_009146978.1|  PREDICTED: putative pentatricopeptide repeat...  45.4    6e-04   
gb|AHB18411.1|  pentatricopeptide repeat-containing protein           45.4    6e-04   
gb|KHN40468.1|  Putative pentatricopeptide repeat-containing protein  45.4    6e-04   
gb|KDP37792.1|  hypothetical protein JCGZ_06694                       45.4    6e-04   
ref|XP_006420415.1|  hypothetical protein CICLE_v10006446mg           45.1    7e-04   
ref|XP_010232231.1|  PREDICTED: pentatricopeptide repeat-containi...  45.4    7e-04   
gb|AEU08415.1|  pentatricopeptide repeat protein                      43.1    7e-04   
ref|XP_010912878.1|  PREDICTED: pentatricopeptide repeat-containi...  45.4    7e-04   
gb|AEU08426.1|  pentatricopeptide repeat protein                      43.1    7e-04   
emb|CBI18084.3|  unnamed protein product                              45.4    7e-04   
ref|XP_006415097.1|  hypothetical protein EUTSA_v10009638mg           45.4    7e-04   
gb|ACE80732.1|  pentatricopeptide repeat protein                      43.1    7e-04   Diplophyllum albicans
ref|XP_008799870.1|  PREDICTED: putative pentatricopeptide repeat...  45.4    8e-04   
ref|XP_010927665.1|  PREDICTED: pentatricopeptide repeat-containi...  45.4    8e-04   
ref|XP_008805213.1|  PREDICTED: pentatricopeptide repeat-containi...  44.7    8e-04   
ref|XP_006653119.1|  PREDICTED: pentatricopeptide repeat-containi...  45.1    8e-04   
ref|XP_010464495.1|  PREDICTED: putative pentatricopeptide repeat...  45.1    9e-04   
gb|EMT21227.1|  hypothetical protein F775_14950                       45.1    9e-04   
ref|XP_004137118.1|  PREDICTED: pentatricopeptide repeat-containi...  45.1    9e-04   
ref|XP_010486427.1|  PREDICTED: putative pentatricopeptide repeat...  45.1    9e-04   
ref|XP_009402221.1|  PREDICTED: putative pentatricopeptide repeat...  45.1    9e-04   
ref|XP_007203303.1|  hypothetical protein PRUPE_ppa025850mg           45.1    9e-04   
ref|XP_010461159.1|  PREDICTED: pentatricopeptide repeat-containi...  45.1    0.001   
ref|XP_010529708.1|  PREDICTED: pentatricopeptide repeat-containi...  45.1    0.001   
ref|XP_010261461.1|  PREDICTED: putative pentatricopeptide repeat...  45.1    0.001   
ref|NP_193861.1|  pentatricopeptide repeat-containing protein         45.1    0.001   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002272240.1|  PREDICTED: pentatricopeptide repeat-containi...  45.1    0.001   Vitis vinifera



>ref|XP_009600486.1| PREDICTED: pentatricopeptide repeat-containing protein At1g06145-like 
[Nicotiana tomentosiformis]
Length=560

 Score = 79.7 bits (195),  Expect = 7e-16, Method: Composition-based stats.
 Identities = 34/41 (83%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    EKECPGSSWIELEKAIHQFSACDNYHPASHEIYSLLDGLFG  123
            EKECPGSSWIE+EK IHQF+ACDNYH +S EIYSLLDGL G
Sbjct  505  EKECPGSSWIEIEKKIHQFAACDNYHHSSQEIYSLLDGLDG  545



>ref|XP_009797119.1| PREDICTED: pentatricopeptide repeat-containing protein At1g06145-like 
[Nicotiana sylvestris]
 ref|XP_009797120.1| PREDICTED: pentatricopeptide repeat-containing protein At1g06145-like 
[Nicotiana sylvestris]
 ref|XP_009797121.1| PREDICTED: pentatricopeptide repeat-containing protein At1g06145-like 
[Nicotiana sylvestris]
 ref|XP_009797122.1| PREDICTED: pentatricopeptide repeat-containing protein At1g06145-like 
[Nicotiana sylvestris]
Length=560

 Score = 76.6 bits (187),  Expect = 7e-15, Method: Composition-based stats.
 Identities = 32/41 (78%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    EKECPGSSWIELEKAIHQFSACDNYHPASHEIYSLLDGLFG  123
            EKECPGSSWIE+EK IHQF+ACDNYH +S EI+SLLDG  G
Sbjct  505  EKECPGSSWIEIEKKIHQFAACDNYHHSSQEIFSLLDGFDG  545



>ref|XP_010316223.1| PREDICTED: pentatricopeptide repeat-containing protein At1g06145-like 
[Solanum lycopersicum]
 ref|XP_010316224.1| PREDICTED: pentatricopeptide repeat-containing protein At1g06145-like 
[Solanum lycopersicum]
Length=558

 Score = 72.4 bits (176),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 32/40 (80%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = +1

Query  4    KECPGSSWIELEKAIHQFSACDNYHPASHEIYSLLDGLFG  123
            KE PGSSWIEL+K IHQF+ACDNYH +S EIYSLLDGL G
Sbjct  504  KEQPGSSWIELKKKIHQFAACDNYHHSSQEIYSLLDGLDG  543



>ref|XP_006338375.1| PREDICTED: pentatricopeptide repeat-containing protein At1g06145-like 
isoform X1 [Solanum tuberosum]
 ref|XP_006338376.1| PREDICTED: pentatricopeptide repeat-containing protein At1g06145-like 
isoform X2 [Solanum tuberosum]
Length=558

 Score = 71.6 bits (174),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 32/40 (80%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = +1

Query  4    KECPGSSWIELEKAIHQFSACDNYHPASHEIYSLLDGLFG  123
            KE PG SWIELEK IHQF+ACDNYH +S EIYSLLDGL G
Sbjct  504  KEQPGFSWIELEKKIHQFAACDNYHHSSQEIYSLLDGLDG  543



>gb|EYU39274.1| hypothetical protein MIMGU_mgv1a004625mg [Erythranthe guttata]
Length=517

 Score = 68.9 bits (167),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 29/39 (74%), Positives = 33/39 (85%), Gaps = 0/39 (0%)
 Frame = +1

Query  1    EKECPGSSWIELEKAIHQFSACDNYHPASHEIYSLLDGL  117
            EK  PGSSWIE+EK +HQF+ACDNYHPAS EIY +LD L
Sbjct  462  EKILPGSSWIEVEKKMHQFAACDNYHPASQEIYLVLDVL  500



>gb|EYU25996.1| hypothetical protein MIMGU_mgv1a024459mg, partial [Erythranthe 
guttata]
Length=526

 Score = 68.6 bits (166),  Expect = 5e-12, Method: Composition-based stats.
 Identities = 29/39 (74%), Positives = 33/39 (85%), Gaps = 0/39 (0%)
 Frame = +1

Query  1    EKECPGSSWIELEKAIHQFSACDNYHPASHEIYSLLDGL  117
            EK  PGSSWIE+EK +HQF+ACDNYHPAS EIY +LD L
Sbjct  471  EKILPGSSWIEVEKKMHQFAACDNYHPASQEIYLVLDVL  509



>ref|XP_010098470.1| hypothetical protein L484_025905 [Morus notabilis]
 gb|EXB75130.1| hypothetical protein L484_025905 [Morus notabilis]
Length=554

 Score = 67.8 bits (164),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 29/41 (71%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    EKECPGSSWIELEKAIHQFSACDNYHPASHEIYSLLDGLFG  123
            EK+CPG+SWIE+E++IHQF+A DN HPAS EIYSLL  L G
Sbjct  502  EKKCPGASWIEMERSIHQFAASDNSHPASAEIYSLLAWLNG  542



>ref|XP_011089232.1| PREDICTED: uncharacterized protein LOC105170258 [Sesamum indicum]
Length=1475

 Score = 66.2 bits (160),  Expect = 6e-11, Method: Composition-based stats.
 Identities = 27/35 (77%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = +1

Query  13    PGSSWIELEKAIHQFSACDNYHPASHEIYSLLDGL  117
             PGSSWIE++K +HQF+ACDNYHPAS EIYS+LD L
Sbjct  1424  PGSSWIEVKKKMHQFAACDNYHPASEEIYSVLDVL  1458



>ref|XP_008235707.1| PREDICTED: pentatricopeptide repeat-containing protein At1g06145-like 
[Prunus mume]
Length=583

 Score = 64.3 bits (155),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 27/41 (66%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    EKECPGSSWIELEKAIHQFSACDNYHPASHEIYSLLDGLFG  123
            EK CPGSSWIE+E+ +HQF+A D  HPAS EIY LL  L+G
Sbjct  528  EKGCPGSSWIEMERKVHQFAASDKSHPASSEIYLLLAELYG  568



>ref|XP_010669712.1| PREDICTED: pentatricopeptide repeat-containing protein At1g06145-like 
[Beta vulgaris subsp. vulgaris]
Length=551

 Score = 63.5 bits (153),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 27/41 (66%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    EKECPGSSWIELEKAIHQFSACDNYHPASHEIYSLLDGLFG  123
            EK CPGSSWIEL+K +HQF A D  HPAS +I+ LLD L+G
Sbjct  502  EKRCPGSSWIELDKELHQFVAADKSHPASGDIHVLLDELYG  542



>gb|KDP26556.1| hypothetical protein JCGZ_17714 [Jatropha curcas]
Length=579

 Score = 63.2 bits (152),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 28/41 (68%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    EKECPGSSWIELEKAIHQFSACDNYHPASHEIYSLLDGLFG  123
            EK CPGSSWIEL+  +HQF+A D  HPAS+EIYSLL  L G
Sbjct  524  EKRCPGSSWIELKNKVHQFAASDKSHPASNEIYSLLIELDG  564



>emb|CDP04124.1| unnamed protein product [Coffea canephora]
Length=578

 Score = 62.4 bits (150),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 29/41 (71%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    EKECPGSSWIELEKAIHQFSACDNYHPASHEIYSLLDGLFG  123
            EK  PGSSWIE+EK I QF++CDN HPAS EIY LLD L G
Sbjct  523  EKRYPGSSWIEVEKNIFQFASCDNCHPASEEIYLLLDELVG  563



>ref|XP_007200721.1| hypothetical protein PRUPE_ppa025321mg [Prunus persica]
 gb|EMJ01920.1| hypothetical protein PRUPE_ppa025321mg [Prunus persica]
Length=529

 Score = 62.0 bits (149),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 26/40 (65%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = +1

Query  1    EKECPGSSWIELEKAIHQFSACDNYHPASHEIYSLLDGLF  120
            EK CPGSSWIE+E+ +HQF+A D  HPAS EIY LL  L+
Sbjct  474  EKGCPGSSWIEMERKVHQFAASDKSHPASSEIYLLLAELY  513



>ref|XP_009118553.1| PREDICTED: pentatricopeptide repeat-containing protein At1g06145-like 
[Brassica rapa]
Length=571

 Score = 61.6 bits (148),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 25/40 (63%), Positives = 32/40 (80%), Gaps = 0/40 (0%)
 Frame = +1

Query  1    EKECPGSSWIELEKAIHQFSACDNYHPASHEIYSLLDGLF  120
            EK CPG+SWIEL+K +H F+A D  H AS+E+YSLLD +F
Sbjct  516  EKLCPGTSWIELDKRVHMFAAADKSHSASNEVYSLLDEVF  555



>ref|XP_002301860.2| pentatricopeptide repeat-containing family protein [Populus trichocarpa]
 gb|EEE81133.2| pentatricopeptide repeat-containing family protein [Populus trichocarpa]
Length=933

 Score = 61.6 bits (148),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 27/41 (66%), Positives = 30/41 (73%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    EKECPGSSWIELEKAIHQFSACDNYHPASHEIYSLLDGLFG  123
            EK CPGSSWIE+E  +HQF+A D  H AS EIYSLL  L G
Sbjct  478  EKRCPGSSWIEMESQVHQFAASDKSHAASDEIYSLLAELDG  518



>ref|XP_009354972.1| PREDICTED: pentatricopeptide repeat-containing protein At1g06145-like 
[Pyrus x bretschneideri]
Length=579

 Score = 60.8 bits (146),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 26/40 (65%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = +1

Query  1    EKECPGSSWIELEKAIHQFSACDNYHPASHEIYSLLDGLF  120
            EK CPGSSWIE+E+ +HQF+A D  H AS EIYSLL  L+
Sbjct  524  EKGCPGSSWIEMERKVHQFAASDESHSASAEIYSLLAELY  563



>ref|XP_006493995.1| PREDICTED: pentatricopeptide repeat-containing protein At1g06145-like 
[Citrus sinensis]
Length=578

 Score = 59.7 bits (143),  Expect = 7e-09, Method: Composition-based stats.
 Identities = 25/39 (64%), Positives = 30/39 (77%), Gaps = 0/39 (0%)
 Frame = +1

Query  1    EKECPGSSWIELEKAIHQFSACDNYHPASHEIYSLLDGL  117
            EK CPGSSWIE+E+ ++QF+A D  HPAS EIYS L  L
Sbjct  523  EKRCPGSSWIEMERKVYQFAASDKSHPASDEIYSSLSKL  561



>ref|XP_006420414.1| hypothetical protein CICLE_v10006642mg [Citrus clementina]
 gb|ESR33654.1| hypothetical protein CICLE_v10006642mg [Citrus clementina]
Length=530

 Score = 59.3 bits (142),  Expect = 9e-09, Method: Composition-based stats.
 Identities = 25/39 (64%), Positives = 30/39 (77%), Gaps = 0/39 (0%)
 Frame = +1

Query  1    EKECPGSSWIELEKAIHQFSACDNYHPASHEIYSLLDGL  117
            EK CPGSSWIE+E+ ++QF+A D  HPAS EIYS L  L
Sbjct  475  EKRCPGSSWIEMERKVYQFAASDKSHPASDEIYSSLSKL  513



>gb|KDO55742.1| hypothetical protein CISIN_1g043124mg [Citrus sinensis]
Length=331

 Score = 57.8 bits (138),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 25/39 (64%), Positives = 30/39 (77%), Gaps = 0/39 (0%)
 Frame = +1

Query  1    EKECPGSSWIELEKAIHQFSACDNYHPASHEIYSLLDGL  117
            EK CPGSSWIE+E+ ++QF+A D  HPAS EIYS L  L
Sbjct  276  EKRCPGSSWIEMERKVYQFAASDKSHPASDEIYSSLSKL  314



>ref|XP_010542740.1| PREDICTED: transcription factor bHLH155 [Tarenaya hassleriana]
Length=1332

 Score = 57.0 bits (136),  Expect = 9e-08, Method: Composition-based stats.
 Identities = 22/40 (55%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = +1

Query  1     EKECPGSSWIELEKAIHQFSACDNYHPASHEIYSLLDGLF  120
             EK CPG+SW+E+++ +HQF+A D  H AS EIY LLD ++
Sbjct  1278  EKRCPGTSWVEIDRRVHQFAASDKSHKASDEIYLLLDFMY  1317



>emb|CDY10177.1| BnaC05g04200D [Brassica napus]
Length=616

 Score = 56.6 bits (135),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 23/40 (58%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = +1

Query  1    EKECPGSSWIELEKAIHQFSACDNYHPASHEIYSLLDGLF  120
            EK CPG+SWIEL+K +H F+A D  H AS E+Y LLD ++
Sbjct  564  EKICPGASWIELDKRVHLFAAADRSHSASDEVYLLLDAIY  603



>ref|XP_009367773.1| PREDICTED: pentatricopeptide repeat-containing protein At1g06145-like 
[Pyrus x bretschneideri]
Length=290

 Score = 55.1 bits (131),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 24/36 (67%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    EKECPGSSWIELEKAIHQFSACDNYHPASHEIYSLL  108
            EK CPGSSWIE E+ +HQ +A D  H AS EIYSLL
Sbjct  235  EKGCPGSSWIETERKVHQLAASDESHSASDEIYSLL  270



>gb|KCW76194.1| hypothetical protein EUGRSUZ_D00581 [Eucalyptus grandis]
Length=550

 Score = 55.8 bits (133),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 26/41 (63%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    EKECPGSSWIELEKAIHQFSACDNYHPASHEIYSLLDGLFG  123
            EK+CPG+S IE+E  IHQF+A D  HP S+EIY LLD L G
Sbjct  493  EKDCPGASSIEMEGEIHQFAASDKNHPDSNEIYLLLDELDG  533



>ref|XP_010052252.1| PREDICTED: pentatricopeptide repeat-containing protein At1g06145-like 
[Eucalyptus grandis]
Length=565

 Score = 55.8 bits (133),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 26/41 (63%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    EKECPGSSWIELEKAIHQFSACDNYHPASHEIYSLLDGLFG  123
            EK+CPG+S IE+E  IHQF+A D  HP S+EIY LLD L G
Sbjct  508  EKDCPGASSIEMEGEIHQFAASDKNHPDSNEIYLLLDELDG  548



>ref|XP_007050341.1| Basic helix-loop-helix DNA-binding superfamily protein [Theobroma 
cacao]
 gb|EOX94498.1| Basic helix-loop-helix DNA-binding superfamily protein [Theobroma 
cacao]
Length=600

 Score = 55.8 bits (133),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 24/36 (67%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    EKECPGSSWIELEKAIHQFSACDNYHPASHEIYSLL  108
            +K CPGSSWIE+E  IHQF+A D  H AS EIYS+L
Sbjct  544  KKGCPGSSWIEMESEIHQFAASDKSHLASDEIYSIL  579



>ref|XP_010274819.1| PREDICTED: pentatricopeptide repeat-containing protein At1g06145-like 
[Nelumbo nucifera]
Length=556

 Score = 55.5 bits (132),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 23/41 (56%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    EKECPGSSWIELEKAIHQFSACDNYHPASHEIYSLLDGLFG  123
            +K+ PGSSWIE+E  +H+F A D+ HPAS +IY LL  L+G
Sbjct  501  QKKSPGSSWIEIEGKVHEFVASDSSHPASSDIYRLLIELYG  541



>emb|CDY09986.1| BnaC08g44650D [Brassica napus]
Length=569

 Score = 55.5 bits (132),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 23/40 (58%), Positives = 29/40 (73%), Gaps = 0/40 (0%)
 Frame = +1

Query  1    EKECPGSSWIELEKAIHQFSACDNYHPASHEIYSLLDGLF  120
            EK CPG+SWIEL K +H F+A D  H AS E+Y LLD ++
Sbjct  514  EKICPGTSWIELGKRVHMFAAADKSHSASDEVYLLLDEVY  553



>emb|CBI20254.3| unnamed protein product [Vitis vinifera]
Length=494

 Score = 54.3 bits (129),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 25/41 (61%), Positives = 30/41 (73%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    EKECPGSSWIELEKAIHQFSACDNYHPASHEIYSLLDGLFG  123
            EK  PGSSWIE+++ IHQF+A D  H AS EIY+LL  L G
Sbjct  438  EKTSPGSSWIEMDRKIHQFAASDKSHLASDEIYTLLVELDG  478



>ref|XP_002282675.3| PREDICTED: pentatricopeptide repeat-containing protein At1g06145-like 
[Vitis vinifera]
Length=564

 Score = 54.3 bits (129),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 25/41 (61%), Positives = 30/41 (73%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    EKECPGSSWIELEKAIHQFSACDNYHPASHEIYSLLDGLFG  123
            EK  PGSSWIE+++ IHQF+A D  H AS EIY+LL  L G
Sbjct  508  EKTSPGSSWIEMDRKIHQFAASDKSHLASDEIYTLLVELDG  548



>ref|XP_009369523.1| PREDICTED: pentatricopeptide repeat-containing protein At1g06145-like 
[Pyrus x bretschneideri]
Length=290

 Score = 53.1 bits (126),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 24/36 (67%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    EKECPGSSWIELEKAIHQFSACDNYHPASHEIYSLL  108
            EK CPGSSWIE E+ +HQ +A D  H AS EIYSLL
Sbjct  235  EKGCPGSSWIETERKVHQLAASDESHSASDEIYSLL  270



>ref|XP_004292199.1| PREDICTED: pentatricopeptide repeat-containing protein At1g06145-like 
[Fragaria vesca subsp. vesca]
Length=532

 Score = 53.5 bits (127),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 23/41 (56%), Positives = 29/41 (71%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    EKECPGSSWIELEKAIHQFSACDNYHPASHEIYSLLDGLFG  123
            +K  PGSSWIE+E+ IH F+A D  H AS EI+S L  L+G
Sbjct  477  QKTSPGSSWIEIERKIHTFAASDKSHAASGEIHSFLAELYG  517



>emb|CDY47719.1| BnaA10g04080D [Brassica napus]
Length=111

 Score = 50.4 bits (119),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 20/40 (50%), Positives = 29/40 (73%), Gaps = 0/40 (0%)
 Frame = +1

Query  1    EKECPGSSWIELEKAIHQFSACDNYHPASHEIYSLLDGLF  120
            EK CPG+SWI+L++ +H F+A D  H  S E+Y LLD ++
Sbjct  56   EKICPGASWIQLDERVHLFAAADTSHSTSDEVYLLLDEIY  95



>gb|KHN10981.1| Pentatricopeptide repeat-containing protein [Glycine soja]
Length=529

 Score = 52.4 bits (124),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 19/36 (53%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    EKECPGSSWIELEKAIHQFSACDNYHPASHEIYSLL  108
            EK CPGSSW+E+ K +H F+A D YHP+  +++ LL
Sbjct  474  EKRCPGSSWVEINKTVHLFAASDTYHPSYSQLHLLL  509



>ref|XP_003530855.2| PREDICTED: pentatricopeptide repeat-containing protein At1g06145-like 
[Glycine max]
Length=585

 Score = 52.4 bits (124),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 19/36 (53%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    EKECPGSSWIELEKAIHQFSACDNYHPASHEIYSLL  108
            EK CPGSSW+E+ K +H F+A D YHP+  +++ LL
Sbjct  530  EKRCPGSSWVEINKTVHLFAASDTYHPSYSQLHLLL  565



>ref|XP_004511192.1| PREDICTED: pentatricopeptide repeat-containing protein At1g06145-like 
[Cicer arietinum]
Length=1049

 Score = 52.8 bits (125),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 21/36 (58%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = +1

Query  1     EKECPGSSWIELEKAIHQFSACDNYHPASHEIYSLL  108
             EK CPGSSWIEL K IH F+A D +HP+  +++ LL
Sbjct  993   EKRCPGSSWIELNKEIHVFAASDKFHPSYGQVHLLL  1028



>ref|XP_009400644.1| PREDICTED: pentatricopeptide repeat-containing protein At1g33350 
[Musa acuminata subsp. malaccensis]
Length=524

 Score = 52.0 bits (123),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 22/40 (55%), Positives = 27/40 (68%), Gaps = 0/40 (0%)
 Frame = +1

Query  4    KECPGSSWIELEKAIHQFSACDNYHPASHEIYSLLDGLFG  123
            K+ PG SWIE+EK +HQF + D  HP   +IY LLD L G
Sbjct  481  KKLPGCSWIEVEKKVHQFYSGDTVHPEVEQIYELLDELAG  520



>ref|XP_008447444.1| PREDICTED: pentatricopeptide repeat-containing protein At1g06145-like 
[Cucumis melo]
Length=599

 Score = 51.2 bits (121),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 25/41 (61%), Positives = 29/41 (71%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    EKECPGSSWIELEKAIHQFSACDNYHPASHEIYSLLDGLFG  123
            EK+ PGSSWIELE  IHQFSA  + HP S +IY +L  L G
Sbjct  535  EKKYPGSSWIELEGTIHQFSASADSHPDSDKIYFVLTELDG  575



>ref|XP_008783512.1| PREDICTED: pentatricopeptide repeat-containing protein At2g33680-like 
[Phoenix dactylifera]
Length=861

 Score = 50.8 bits (120),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 23/39 (59%), Positives = 26/39 (67%), Gaps = 0/39 (0%)
 Frame = +1

Query  4    KECPGSSWIELEKAIHQFSACDNYHPASHEIYSLLDGLF  120
            K+ PG SWIEL  AIH+F A D  HP + EIY  L GLF
Sbjct  800  KKEPGKSWIELHNAIHEFMAGDRLHPQADEIYMNLRGLF  838



>ref|XP_004165913.1| PREDICTED: pentatricopeptide repeat-containing protein At1g06145-like 
[Cucumis sativus]
Length=600

 Score = 50.1 bits (118),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/41 (61%), Positives = 29/41 (71%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    EKECPGSSWIELEKAIHQFSACDNYHPASHEIYSLLDGLFG  123
            EK+ PGSSWIELE  IHQFSA  + HP S +IY +L  L G
Sbjct  536  EKKYPGSSWIELEGTIHQFSASADSHPDSDKIYFILTELDG  576



>gb|KGN57932.1| hypothetical protein Csa_3G395920 [Cucumis sativus]
Length=600

 Score = 49.7 bits (117),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/41 (61%), Positives = 29/41 (71%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    EKECPGSSWIELEKAIHQFSACDNYHPASHEIYSLLDGLFG  123
            EK+ PGSSWIELE  IHQFSA  + HP S +IY +L  L G
Sbjct  536  EKKYPGSSWIELEGTIHQFSASADSHPDSDKIYFVLTELDG  576



>ref|XP_007134299.1| hypothetical protein PHAVU_010G035600g [Phaseolus vulgaris]
 gb|ESW06293.1| hypothetical protein PHAVU_010G035600g [Phaseolus vulgaris]
Length=558

 Score = 49.7 bits (117),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 18/36 (50%), Positives = 26/36 (72%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    EKECPGSSWIELEKAIHQFSACDNYHPASHEIYSLL  108
            EK CPG+SW+E+ K +H F+A D YHP+  + + LL
Sbjct  503  EKRCPGASWVEINKRVHVFAASDTYHPSYSQFHLLL  538



>ref|XP_006430161.1| hypothetical protein CICLE_v10013825mg [Citrus clementina]
 gb|ESR43401.1| hypothetical protein CICLE_v10013825mg [Citrus clementina]
Length=586

 Score = 49.7 bits (117),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 20/35 (57%), Positives = 25/35 (71%), Gaps = 0/35 (0%)
 Frame = +1

Query  4    KECPGSSWIELEKAIHQFSACDNYHPASHEIYSLL  108
            K+ PG +WIE+E  IHQFS  D+ HP S EIY +L
Sbjct  449  KKIPGWTWIEVENKIHQFSVGDSTHPQSEEIYRML  483



>ref|XP_004152039.1| PREDICTED: pentatricopeptide repeat-containing protein At1g06145-like 
[Cucumis sativus]
Length=697

 Score = 49.7 bits (117),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/41 (61%), Positives = 29/41 (71%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    EKECPGSSWIELEKAIHQFSACDNYHPASHEIYSLLDGLFG  123
            EK+ PGSSWIELE  IHQFSA  + HP S +IY +L  L G
Sbjct  633  EKKYPGSSWIELEGTIHQFSASADSHPDSDKIYFVLTELDG  673



>gb|KDP28762.1| hypothetical protein JCGZ_14533 [Jatropha curcas]
Length=627

 Score = 49.7 bits (117),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 21/38 (55%), Positives = 26/38 (68%), Gaps = 0/38 (0%)
 Frame = +1

Query  4    KECPGSSWIELEKAIHQFSACDNYHPASHEIYSLLDGL  117
            K+ PG SWIELE  +H+FS  D  HP   EIYSLL+ +
Sbjct  587  KKIPGCSWIELEGNVHEFSVQDKSHPQVKEIYSLLNSV  624



>gb|KEH22613.1| basic helix loop helix protein, putative [Medicago truncatula]
Length=534

 Score = 49.3 bits (116),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 20/36 (56%), Positives = 26/36 (72%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    EKECPGSSWIELEKAIHQFSACDNYHPASHEIYSLL  108
            EK CPGSSWIE+ K IH F+A D  HP+  +++ LL
Sbjct  478  EKRCPGSSWIEINKEIHVFAASDKCHPSYGQVHLLL  513



>gb|AFG65800.1| hypothetical protein 2_9455_01, partial [Pinus taeda]
 gb|AFG65802.1| hypothetical protein 2_9455_01, partial [Pinus taeda]
Length=156

 Score = 47.0 bits (110),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 20/40 (50%), Positives = 25/40 (63%), Gaps = 0/40 (0%)
 Frame = +1

Query  4    KECPGSSWIELEKAIHQFSACDNYHPASHEIYSLLDGLFG  123
            K+ PG SWIE+   +H F   D  HP + EIY+LLD L G
Sbjct  19   KKQPGCSWIEVNNKMHSFVVGDTSHPQTEEIYTLLDALAG  58



>gb|KDO70478.1| hypothetical protein CISIN_1g0374141mg, partial [Citrus sinensis]
Length=344

 Score = 48.9 bits (115),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 20/35 (57%), Positives = 25/35 (71%), Gaps = 0/35 (0%)
 Frame = +1

Query  4    KECPGSSWIELEKAIHQFSACDNYHPASHEIYSLL  108
            K+ PG +WIE+E  IHQFS  D+ HP S EIY +L
Sbjct  207  KKIPGWTWIEVENKIHQFSVGDSTHPQSEEIYRML  241



>ref|XP_008382915.1| PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing 
protein At1g06145-like [Malus domestica]
Length=295

 Score = 48.5 bits (114),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 22/40 (55%), Positives = 27/40 (68%), Gaps = 0/40 (0%)
 Frame = +1

Query  1    EKECPGSSWIELEKAIHQFSACDNYHPASHEIYSLLDGLF  120
            EK CP SSWIE+E+ +HQ +A D  H AS  IY LL  L+
Sbjct  235  EKGCPVSSWIEMERKVHQLAASDESHSASDVIYLLLVELY  274



>ref|XP_004491724.1| PREDICTED: pentatricopeptide repeat-containing protein At1g06145-like 
[Cicer arietinum]
Length=423

 Score = 48.9 bits (115),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 20/36 (56%), Positives = 26/36 (72%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    EKECPGSSWIELEKAIHQFSACDNYHPASHEIYSLL  108
            EK CPGSSWIEL K IH F+A D +H +  +++ LL
Sbjct  367  EKRCPGSSWIELNKEIHVFAASDKFHSSYGQVHLLL  402



>emb|CDO98371.1| unnamed protein product [Coffea canephora]
Length=777

 Score = 49.3 bits (116),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 19/38 (50%), Positives = 26/38 (68%), Gaps = 0/38 (0%)
 Frame = +1

Query  4    KECPGSSWIELEKAIHQFSACDNYHPASHEIYSLLDGL  117
            K+ PG SW+E++  IH FS  D+ HP SH IY+ L+ L
Sbjct  640  KKVPGYSWVEVQNKIHTFSVGDSTHPESHRIYAFLEEL  677



>gb|ACE80776.1| pentatricopeptide repeat protein, partial [Scapania nemorea]
Length=152

 Score = 46.6 bits (109),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 18/35 (51%), Positives = 26/35 (74%), Gaps = 0/35 (0%)
 Frame = +1

Query  13   PGSSWIELEKAIHQFSACDNYHPASHEIYSLLDGL  117
            PG SWIE++K IH+F+  D  HP + EIY++L+ L
Sbjct  25   PGRSWIEVDKKIHKFAVGDRSHPEAKEIYTMLNKL  59



>gb|AFG65806.1| hypothetical protein 2_9455_01, partial [Pinus taeda]
 gb|AFG65807.1| hypothetical protein 2_9455_01, partial [Pinus taeda]
Length=156

 Score = 46.6 bits (109),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 20/40 (50%), Positives = 25/40 (63%), Gaps = 0/40 (0%)
 Frame = +1

Query  4    KECPGSSWIELEKAIHQFSACDNYHPASHEIYSLLDGLFG  123
            K+ PG SWIE+   +H F   D  HP + EIY+LLD L G
Sbjct  19   KKQPGCSWIEVNNKMHSFVVGDTSHPQTEEIYTLLDALAG  58



>gb|AEW08424.1| hypothetical protein 2_9455_01, partial [Pinus radiata]
 gb|AFG65801.1| hypothetical protein 2_9455_01, partial [Pinus taeda]
 gb|AFG65803.1| hypothetical protein 2_9455_01, partial [Pinus taeda]
 gb|AFG65808.1| hypothetical protein 2_9455_01, partial [Pinus taeda]
 gb|AFG65810.1| hypothetical protein 2_9455_01, partial [Pinus taeda]
 gb|AFG65811.1| hypothetical protein 2_9455_01, partial [Pinus taeda]
Length=156

 Score = 46.6 bits (109),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 20/40 (50%), Positives = 25/40 (63%), Gaps = 0/40 (0%)
 Frame = +1

Query  4    KECPGSSWIELEKAIHQFSACDNYHPASHEIYSLLDGLFG  123
            K+ PG SWIE+   +H F   D  HP + EIY+LLD L G
Sbjct  19   KKQPGCSWIEVNNKMHSFVVGDTSHPQTEEIYTLLDALAG  58



>gb|AFG65804.1| hypothetical protein 2_9455_01, partial [Pinus taeda]
 gb|AFG65805.1| hypothetical protein 2_9455_01, partial [Pinus taeda]
 gb|AFG65814.1| hypothetical protein 2_9455_01, partial [Pinus taeda]
Length=156

 Score = 46.6 bits (109),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 20/40 (50%), Positives = 25/40 (63%), Gaps = 0/40 (0%)
 Frame = +1

Query  4    KECPGSSWIELEKAIHQFSACDNYHPASHEIYSLLDGLFG  123
            K+ PG SWIE+   +H F   D  HP + EIY+LLD L G
Sbjct  19   KKQPGCSWIEVNNKMHSFVVGDTSHPQTEEIYTLLDALAG  58



>gb|AFG65809.1| hypothetical protein 2_9455_01, partial [Pinus taeda]
Length=156

 Score = 46.6 bits (109),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 20/40 (50%), Positives = 25/40 (63%), Gaps = 0/40 (0%)
 Frame = +1

Query  4    KECPGSSWIELEKAIHQFSACDNYHPASHEIYSLLDGLFG  123
            K+ PG SWIE+   +H F   D  HP + EIY+LLD L G
Sbjct  19   KKQPGCSWIEVNNKMHSFVVGDTSHPQTEEIYTLLDALAG  58



>gb|AFG65812.1| hypothetical protein 2_9455_01, partial [Pinus taeda]
 gb|AFG65813.1| hypothetical protein 2_9455_01, partial [Pinus taeda]
Length=156

 Score = 46.2 bits (108),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 20/40 (50%), Positives = 25/40 (63%), Gaps = 0/40 (0%)
 Frame = +1

Query  4    KECPGSSWIELEKAIHQFSACDNYHPASHEIYSLLDGLFG  123
            K+ PG SWIE+   +H F   D  HP + EIY+LLD L G
Sbjct  19   KKQPGCSWIEVNNKMHSFVVGDTSHPQTEEIYTLLDALAG  58



>gb|KHN35639.1| Pentatricopeptide repeat-containing protein, chloroplastic [Glycine 
soja]
Length=622

 Score = 48.1 bits (113),  Expect = 7e-05, Method: Composition-based stats.
 Identities = 22/38 (58%), Positives = 24/38 (63%), Gaps = 0/38 (0%)
 Frame = +1

Query  4    KECPGSSWIELEKAIHQFSACDNYHPASHEIYSLLDGL  117
            K+ PG SWIEL   +HQFS  D  HP   EIYSLL  L
Sbjct  585  KKIPGCSWIELGGIVHQFSVQDRTHPQVTEIYSLLSSL  622



>ref|XP_010935756.1| PREDICTED: pentatricopeptide repeat-containing protein At1g06145-like 
[Elaeis guineensis]
Length=584

 Score = 48.1 bits (113),  Expect = 8e-05, Method: Composition-based stats.
 Identities = 20/41 (49%), Positives = 30/41 (73%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    EKECPGSSWIELEKAIHQFSACDNYHPASHEIYSLLDGLFG  123
            +K  PG SWIE++  +H+F+A + +HP+S+EI  LL GL G
Sbjct  527  QKRGPGCSWIEMDGVVHEFAASEMFHPSSNEICLLLFGLDG  567



>ref|XP_008787391.1| PREDICTED: pentatricopeptide repeat-containing protein At1g06145-like 
[Phoenix dactylifera]
Length=584

 Score = 48.1 bits (113),  Expect = 8e-05, Method: Composition-based stats.
 Identities = 19/41 (46%), Positives = 30/41 (73%), Gaps = 0/41 (0%)
 Frame = +1

Query  1    EKECPGSSWIELEKAIHQFSACDNYHPASHEIYSLLDGLFG  123
            +K  PG SWIE++  +H+F+A D +HP+S+++  LL GL G
Sbjct  527  QKRGPGCSWIEMDGVVHEFAASDMFHPSSNKVCLLLVGLDG  567



>ref|XP_006409153.1| hypothetical protein EUTSA_v10022616mg [Eutrema salsugineum]
 gb|ESQ50606.1| hypothetical protein EUTSA_v10022616mg [Eutrema salsugineum]
Length=578

 Score = 48.1 bits (113),  Expect = 8e-05, Method: Composition-based stats.
 Identities = 19/40 (48%), Positives = 29/40 (73%), Gaps = 0/40 (0%)
 Frame = +1

Query  1    EKECPGSSWIELEKAIHQFSACDNYHPASHEIYSLLDGLF  120
            EK CPG+S+IE++K +H F+  D  H AS ++Y LLD ++
Sbjct  524  EKICPGTSFIEIDKRVHMFAIADKSHSASDKVYILLDEIY  563



>ref|XP_008438168.1| PREDICTED: pentatricopeptide repeat-containing protein At2g45350, 
chloroplastic [Cucumis melo]
Length=638

 Score = 48.1 bits (113),  Expect = 8e-05, Method: Composition-based stats.
 Identities = 22/37 (59%), Positives = 25/37 (68%), Gaps = 1/37 (3%)
 Frame = +1

Query  13   PGSSWIELEKAIHQFSACDNYHPASHEIYSLLDGLFG  123
            PG SWIELE  +H+F   D  HP   EIYS+LDG FG
Sbjct  592  PGCSWIELEGVVHEFLVRDKSHPYVSEIYSVLDG-FG  627



>ref|XP_004133915.1| PREDICTED: pentatricopeptide repeat-containing protein At2g45350, 
chloroplastic-like [Cucumis sativus]
 ref|XP_004155790.1| PREDICTED: pentatricopeptide repeat-containing protein At2g45350, 
chloroplastic-like [Cucumis sativus]
 gb|KGN56603.1| hypothetical protein Csa_3G126180 [Cucumis sativus]
Length=638

 Score = 48.1 bits (113),  Expect = 9e-05, Method: Composition-based stats.
 Identities = 22/37 (59%), Positives = 25/37 (68%), Gaps = 1/37 (3%)
 Frame = +1

Query  13   PGSSWIELEKAIHQFSACDNYHPASHEIYSLLDGLFG  123
            PG SWIELE  +H+F   D  HP   EIYS+LDG FG
Sbjct  592  PGCSWIELEGVVHEFLVRDKSHPYVSEIYSVLDG-FG  627



>gb|EPS65029.1| tetratricopeptide-like helical [Genlisea aurea]
Length=759

 Score = 48.1 bits (113),  Expect = 9e-05, Method: Composition-based stats.
 Identities = 20/35 (57%), Positives = 22/35 (63%), Gaps = 0/35 (0%)
 Frame = +1

Query  13   PGSSWIELEKAIHQFSACDNYHPASHEIYSLLDGL  117
            PG SWIE+E  IH FS  D+ HP    IY  LDGL
Sbjct  625  PGYSWIEVENRIHTFSVGDSMHPERERIYEFLDGL  659



>ref|XP_004955088.1| PREDICTED: pentatricopeptide repeat-containing protein At1g33350-like 
[Setaria italica]
Length=530

 Score = 47.8 bits (112),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 19/38 (50%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = +1

Query  4    KECPGSSWIELEKAIHQFSACDNYHPASHEIYSLLDGL  117
            K+ PG SWIE+++ IH+F + D+ HP S +IY  LD L
Sbjct  487  KKLPGCSWIEVDRKIHRFYSGDDAHPQSEDIYDTLDDL  524



>gb|EAY92839.1| hypothetical protein OsI_14639 [Oryza sativa Indica Group]
Length=702

 Score = 47.8 bits (112),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 18/37 (49%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +1

Query  13   PGSSWIELEKAIHQFSACDNYHPASHEIYSLLDGLFG  123
            PG SWIE++ AIH+F A ++ HPAS E+++ ++ L+G
Sbjct  568  PGCSWIEVDGAIHRFMAGESAHPASEEVHAHMEALWG  604



>ref|XP_007200964.1| hypothetical protein PRUPE_ppa004156mg [Prunus persica]
 gb|EMJ02163.1| hypothetical protein PRUPE_ppa004156mg [Prunus persica]
Length=526

 Score = 47.4 bits (111),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 18/37 (49%), Positives = 25/37 (68%), Gaps = 0/37 (0%)
 Frame = +1

Query  13   PGSSWIELEKAIHQFSACDNYHPASHEIYSLLDGLFG  123
            PG SWIE++  ++QF + D  HP + EIY +LD L G
Sbjct  481  PGCSWIEVDNQVYQFYSVDKSHPRTEEIYQILDTLVG  517



>ref|XP_008232533.1| PREDICTED: pentatricopeptide repeat-containing protein At1g33350 
[Prunus mume]
Length=526

 Score = 47.4 bits (111),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 18/37 (49%), Positives = 25/37 (68%), Gaps = 0/37 (0%)
 Frame = +1

Query  13   PGSSWIELEKAIHQFSACDNYHPASHEIYSLLDGLFG  123
            PG SWIE++  ++QF + D  HP + EIY +LD L G
Sbjct  481  PGCSWIEVDNQVYQFYSVDKSHPRTEEIYQILDTLVG  517



>ref|NP_001052059.2| Os04g0118700 [Oryza sativa Japonica Group]
 gb|EEE60404.1| hypothetical protein OsJ_13579 [Oryza sativa Japonica Group]
 dbj|BAF13973.2| Os04g0118700 [Oryza sativa Japonica Group]
Length=856

 Score = 47.8 bits (112),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 18/37 (49%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +1

Query  13   PGSSWIELEKAIHQFSACDNYHPASHEIYSLLDGLFG  123
            PG SWIE++ AIH+F A ++ HPAS E+++ ++ L+G
Sbjct  722  PGCSWIEVDGAIHRFMAGESAHPASEEVHAHMEALWG  758



>emb|CAE01289.2| OSJNBa0020P07.6 [Oryza sativa Japonica Group]
Length=854

 Score = 47.8 bits (112),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 18/37 (49%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +1

Query  13   PGSSWIELEKAIHQFSACDNYHPASHEIYSLLDGLFG  123
            PG SWIE++ AIH+F A ++ HPAS E+++ ++ L+G
Sbjct  720  PGCSWIEVDGAIHRFMAGESAHPASEEVHAHMEALWG  756



>emb|CAH66009.1| H0613H07.7 [Oryza sativa Indica Group]
 emb|CAH65944.1| H0716A07.2 [Oryza sativa Indica Group]
Length=854

 Score = 47.8 bits (112),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 18/37 (49%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +1

Query  13   PGSSWIELEKAIHQFSACDNYHPASHEIYSLLDGLFG  123
            PG SWIE++ AIH+F A ++ HPAS E+++ ++ L+G
Sbjct  720  PGCSWIEVDGAIHRFMAGESAHPASEEVHAHMEALWG  756



>ref|XP_003624159.1| Pentatricopeptide repeat-containing protein [Medicago truncatula]
 gb|ABD28372.1| Tetratricopeptide-like helical [Medicago truncatula]
 gb|AES80377.1| pentatricopeptide (PPR) repeat protein [Medicago truncatula]
Length=755

 Score = 47.8 bits (112),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 20/40 (50%), Positives = 25/40 (63%), Gaps = 0/40 (0%)
 Frame = +1

Query  4    KECPGSSWIELEKAIHQFSACDNYHPASHEIYSLLDGLFG  123
            K+ PG SW++L+  IH F+  D  HP   EIYS LD L G
Sbjct  618  KKQPGQSWVQLKDQIHSFTVGDRSHPQDKEIYSYLDSLIG  657



>ref|XP_010911842.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At3g47840 [Elaeis guineensis]
Length=854

 Score = 47.8 bits (112),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 21/39 (54%), Positives = 25/39 (64%), Gaps = 0/39 (0%)
 Frame = +1

Query  4    KECPGSSWIELEKAIHQFSACDNYHPASHEIYSLLDGLF  120
            K+ PG SWIEL   IH+F A D  HP + +IY  L GLF
Sbjct  793  KKEPGKSWIELHNTIHEFMAGDRLHPQADQIYLNLRGLF  831



>ref|XP_006344596.1| PREDICTED: pentatricopeptide repeat-containing protein At1g33350-like 
[Solanum tuberosum]
Length=528

 Score = 47.4 bits (111),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 20/38 (53%), Positives = 26/38 (68%), Gaps = 0/38 (0%)
 Frame = +1

Query  7    ECPGSSWIELEKAIHQFSACDNYHPASHEIYSLLDGLF  120
            + PG SWIEL+  +HQF + D  HP   EIYS+L+ LF
Sbjct  486  KAPGCSWIELDSQVHQFYSVDKSHPRMEEIYSILECLF  523



>gb|ACE80722.1| pentatricopeptide repeat protein, partial [Anastrophyllum minutum]
Length=152

 Score = 45.1 bits (105),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 19/35 (54%), Positives = 23/35 (66%), Gaps = 0/35 (0%)
 Frame = +1

Query  13   PGSSWIELEKAIHQFSACDNYHPASHEIYSLLDGL  117
            PG SWIE++  IH+F A D YHP    IYS L+ L
Sbjct  25   PGRSWIEVDDKIHEFVAGDTYHPERKAIYSELNKL  59



>ref|XP_010920030.1| PREDICTED: pentatricopeptide repeat-containing protein At5g27110 
[Elaeis guineensis]
Length=696

 Score = 47.4 bits (111),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 21/38 (55%), Positives = 26/38 (68%), Gaps = 0/38 (0%)
 Frame = +1

Query  4    KECPGSSWIELEKAIHQFSACDNYHPASHEIYSLLDGL  117
            K+ PG SWIE+EK IHQF   D+ HP +  IY+LL  L
Sbjct  645  KKKPGCSWIEIEKRIHQFFVNDDSHPQAEFIYALLGSL  682



>gb|KDO42941.1| hypothetical protein CISIN_1g009663mg [Citrus sinensis]
Length=529

 Score = 47.4 bits (111),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 17/35 (49%), Positives = 24/35 (69%), Gaps = 0/35 (0%)
 Frame = +1

Query  13   PGSSWIELEKAIHQFSACDNYHPASHEIYSLLDGL  117
            PG SWIE++K +HQF + D  HP + EIY  L+ +
Sbjct  491  PGCSWIEVDKQVHQFHSLDKTHPRTEEIYDALESM  525



>ref|XP_006441856.1| hypothetical protein CICLE_v10019688mg [Citrus clementina]
 gb|ESR55096.1| hypothetical protein CICLE_v10019688mg [Citrus clementina]
Length=529

 Score = 47.4 bits (111),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 17/35 (49%), Positives = 24/35 (69%), Gaps = 0/35 (0%)
 Frame = +1

Query  13   PGSSWIELEKAIHQFSACDNYHPASHEIYSLLDGL  117
            PG SWIE++K +HQF + D  HP + EIY  L+ +
Sbjct  491  PGCSWIEVDKQVHQFHSLDKTHPRTEEIYDALESM  525



>gb|ACE80853.1| pentatricopeptide repeat protein, partial [Lepidogyna hodgsoniae]
Length=152

 Score = 45.1 bits (105),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 17/38 (45%), Positives = 25/38 (66%), Gaps = 0/38 (0%)
 Frame = +1

Query  4    KECPGSSWIELEKAIHQFSACDNYHPASHEIYSLLDGL  117
            ++ PG SWIE++  IH+F   D  HP + EIY++L  L
Sbjct  22   RKVPGRSWIEVDNKIHEFVVADTSHPEAAEIYTVLKKL  59



>gb|ACE80735.1| pentatricopeptide repeat protein, partial [Diplophyllum albicans]
Length=152

 Score = 45.1 bits (105),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 19/35 (54%), Positives = 23/35 (66%), Gaps = 0/35 (0%)
 Frame = +1

Query  13   PGSSWIELEKAIHQFSACDNYHPASHEIYSLLDGL  117
            PG SWIE++  IH+F A D YHP    IYS L+ L
Sbjct  25   PGRSWIEVDNKIHEFVAGDTYHPERKAIYSELNKL  59



>ref|XP_006478286.1| PREDICTED: pentatricopeptide repeat-containing protein At1g33350-like 
[Citrus sinensis]
Length=529

 Score = 47.0 bits (110),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 17/35 (49%), Positives = 24/35 (69%), Gaps = 0/35 (0%)
 Frame = +1

Query  13   PGSSWIELEKAIHQFSACDNYHPASHEIYSLLDGL  117
            PG SWIE++K +HQF + D  HP + EIY  L+ +
Sbjct  491  PGCSWIEVDKQVHQFHSLDKTHPRTEEIYDALESM  525



>ref|XP_003619586.1| hypothetical protein MTR_6g059820 [Medicago truncatula]
 gb|AES75804.1| PPR containing plant-like protein [Medicago truncatula]
Length=528

 Score = 47.0 bits (110),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 17/37 (46%), Positives = 27/37 (73%), Gaps = 0/37 (0%)
 Frame = +1

Query  13   PGSSWIELEKAIHQFSACDNYHPASHEIYSLLDGLFG  123
            PG SWIE++  +HQF + D  +P + E+Y++L+ LFG
Sbjct  483  PGCSWIEVDDKVHQFFSLDQSNPKTEELYNILESLFG  519



>ref|XP_008791010.1| PREDICTED: pentatricopeptide repeat-containing protein At5g27110 
[Phoenix dactylifera]
Length=696

 Score = 47.0 bits (110),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 21/38 (55%), Positives = 26/38 (68%), Gaps = 0/38 (0%)
 Frame = +1

Query  4    KECPGSSWIELEKAIHQFSACDNYHPASHEIYSLLDGL  117
            K+ PG SWIE+EK IHQF   D+ HP +  IY+LL  L
Sbjct  645  KKNPGCSWIEIEKRIHQFFVNDDSHPQAEFIYALLGSL  682



>gb|AFB33718.1| hypothetical protein 2_9455_01, partial [Pinus cembra]
Length=156

 Score = 44.7 bits (104),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 19/40 (48%), Positives = 25/40 (63%), Gaps = 0/40 (0%)
 Frame = +1

Query  4    KECPGSSWIELEKAIHQFSACDNYHPASHEIYSLLDGLFG  123
            K+ PG SWIE+   ++ F   D  HP + EIY+LLD L G
Sbjct  19   KKQPGCSWIEVNNKMYSFVVGDTSHPQTEEIYALLDALAG  58



>ref|XP_008791356.1| PREDICTED: pentatricopeptide repeat-containing protein At2g45350, 
chloroplastic [Phoenix dactylifera]
Length=627

 Score = 47.0 bits (110),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 19/38 (50%), Positives = 26/38 (68%), Gaps = 0/38 (0%)
 Frame = +1

Query  4    KECPGSSWIELEKAIHQFSACDNYHPASHEIYSLLDGL  117
            ++ PG SWIEL+  +H+F   DN H  +  IYSLL+GL
Sbjct  579  RKVPGCSWIELDGVVHEFVVGDNSHSEAKGIYSLLEGL  616



>ref|XP_010920279.1| PREDICTED: pentatricopeptide repeat-containing protein At1g33350 
[Elaeis guineensis]
Length=522

 Score = 47.0 bits (110),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 18/40 (45%), Positives = 28/40 (70%), Gaps = 0/40 (0%)
 Frame = +1

Query  4    KECPGSSWIELEKAIHQFSACDNYHPASHEIYSLLDGLFG  123
            K+ PG SWIE++  +H+F + D +HP + EIY +L+ L G
Sbjct  479  KKLPGCSWIEVDSKVHRFYSGDKFHPEAEEIYKVLEVLLG  518



>ref|XP_010679228.1| PREDICTED: pentatricopeptide repeat-containing protein At1g33350 
[Beta vulgaris subsp. vulgaris]
Length=541

 Score = 47.0 bits (110),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 17/39 (44%), Positives = 28/39 (72%), Gaps = 0/39 (0%)
 Frame = +1

Query  4    KECPGSSWIELEKAIHQFSACDNYHPASHEIYSLLDGLF  120
            ++ PG SWIE++  +HQF + D+ HP + E+Y++L  LF
Sbjct  484  QKIPGCSWIEVDCRVHQFHSADDTHPRAEEMYNMLGSLF  522



>gb|AEX12062.1| hypothetical protein 0_18789_01 [Pinus taeda]
Length=161

 Score = 44.7 bits (104),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 18/40 (45%), Positives = 26/40 (65%), Gaps = 0/40 (0%)
 Frame = +1

Query  4    KECPGSSWIELEKAIHQFSACDNYHPASHEIYSLLDGLFG  123
            ++ PGSSWIE+   ++ F   D  HP S +IY +L+ LFG
Sbjct  65   QKMPGSSWIEVNGKVYAFLVGDKSHPQSEKIYDMLEKLFG  104



>gb|AEX12049.1| hypothetical protein 0_18789_01 [Pinus taeda]
 gb|AEX12052.1| hypothetical protein 0_18789_01 [Pinus taeda]
 gb|AEX12056.1| hypothetical protein 0_18789_01 [Pinus taeda]
 gb|AEX12057.1| hypothetical protein 0_18789_01 [Pinus taeda]
 gb|AEX12058.1| hypothetical protein 0_18789_01 [Pinus taeda]
 gb|AEX12065.1| hypothetical protein 0_18789_01 [Pinus radiata]
Length=161

 Score = 44.7 bits (104),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 18/40 (45%), Positives = 26/40 (65%), Gaps = 0/40 (0%)
 Frame = +1

Query  4    KECPGSSWIELEKAIHQFSACDNYHPASHEIYSLLDGLFG  123
            ++ PGSSWIE+   ++ F   D  HP S +IY +L+ LFG
Sbjct  65   QKMPGSSWIEVNGKVYAFLVGDKSHPQSEKIYDMLEKLFG  104



>gb|AEX12054.1| hypothetical protein 0_18789_01 [Pinus taeda]
Length=161

 Score = 44.7 bits (104),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 18/40 (45%), Positives = 26/40 (65%), Gaps = 0/40 (0%)
 Frame = +1

Query  4    KECPGSSWIELEKAIHQFSACDNYHPASHEIYSLLDGLFG  123
            ++ PGSSWIE+   ++ F   D  HP S +IY +L+ LFG
Sbjct  65   QKMPGSSWIEVNGKVYAFLVGDKSHPQSEKIYDMLEKLFG  104



>dbj|BAJ91522.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=878

 Score = 47.0 bits (110),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 19/36 (53%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = +1

Query  13   PGSSWIELEKAIHQFSACDNYHPASHEIYSLLDGLF  120
            PG SWIEL+ AIH+F A ++ HPAS E+++ +D L+
Sbjct  744  PGCSWIELDGAIHRFMAGESSHPASAEVHAHMDALW  779



>ref|XP_010478758.1| PREDICTED: pentatricopeptide repeat-containing protein At1g33350 
[Camelina sativa]
Length=540

 Score = 47.0 bits (110),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 19/37 (51%), Positives = 26/37 (70%), Gaps = 0/37 (0%)
 Frame = +1

Query  7    ECPGSSWIELEKAIHQFSACDNYHPASHEIYSLLDGL  117
            + PG SWIE+++ +HQF + D  HP S EIY +LD L
Sbjct  501  KTPGCSWIEIDEVVHQFYSLDKSHPKSIEIYMILDSL  537



>ref|XP_004158080.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21300-like 
[Cucumis sativus]
Length=762

 Score = 47.0 bits (110),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 19/39 (49%), Positives = 25/39 (64%), Gaps = 0/39 (0%)
 Frame = +1

Query  4    KECPGSSWIELEKAIHQFSACDNYHPASHEIYSLLDGLF  120
            ++ PG SWIE+  A H F A D  HP + +IYS+LD L 
Sbjct  697  RKVPGYSWIEVNNATHMFVAADGSHPLTAQIYSVLDSLL  735



>gb|KGN65963.1| hypothetical protein Csa_1G553510 [Cucumis sativus]
Length=848

 Score = 47.0 bits (110),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 19/39 (49%), Positives = 25/39 (64%), Gaps = 0/39 (0%)
 Frame = +1

Query  4    KECPGSSWIELEKAIHQFSACDNYHPASHEIYSLLDGLF  120
            ++ PG SWIE+  A H F A D  HP + +IYS+LD L 
Sbjct  783  RKVPGYSWIEVNNATHMFVAADGSHPLTAQIYSVLDSLL  821



>ref|XP_004135750.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21300-like 
[Cucumis sativus]
Length=762

 Score = 47.0 bits (110),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 19/39 (49%), Positives = 25/39 (64%), Gaps = 0/39 (0%)
 Frame = +1

Query  4    KECPGSSWIELEKAIHQFSACDNYHPASHEIYSLLDGLF  120
            ++ PG SWIE+  A H F A D  HP + +IYS+LD L 
Sbjct  697  RKVPGYSWIEVNNATHMFVAADGSHPLTAQIYSVLDSLL  735



>gb|AEX12061.1| hypothetical protein 0_18789_01 [Pinus taeda]
Length=161

 Score = 44.7 bits (104),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 18/40 (45%), Positives = 26/40 (65%), Gaps = 0/40 (0%)
 Frame = +1

Query  4    KECPGSSWIELEKAIHQFSACDNYHPASHEIYSLLDGLFG  123
            ++ PGSSWIE+   ++ F   D  HP S +IY +L+ LFG
Sbjct  65   QKMPGSSWIEVNGKVYAFLVGDKSHPQSEKIYDMLEKLFG  104



>emb|CDP11100.1| unnamed protein product [Coffea canephora]
Length=524

 Score = 46.6 bits (109),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 18/35 (51%), Positives = 25/35 (71%), Gaps = 0/35 (0%)
 Frame = +1

Query  13   PGSSWIELEKAIHQFSACDNYHPASHEIYSLLDGL  117
            PG SWIEL+  +HQF + D  HP + EIY++L+ L
Sbjct  486  PGCSWIELDNQVHQFYSVDKSHPRTEEIYAVLECL  520



>ref|XP_004984893.1| PREDICTED: pentatricopeptide repeat-containing protein At4g13650-like 
isoform X4 [Setaria italica]
Length=889

 Score = 47.0 bits (110),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 21/40 (53%), Positives = 27/40 (68%), Gaps = 0/40 (0%)
 Frame = +1

Query  4    KECPGSSWIELEKAIHQFSACDNYHPASHEIYSLLDGLFG  123
            K+ PGSSWIE++ A+H F A D  HP + +IYS L  L G
Sbjct  752  KKEPGSSWIEVKSAVHAFYAGDRLHPLADQIYSFLADLNG  791



>gb|AEX12050.1| hypothetical protein 0_18789_01 [Pinus taeda]
 gb|AEX12051.1| hypothetical protein 0_18789_01 [Pinus taeda]
 gb|AEX12053.1| hypothetical protein 0_18789_01 [Pinus taeda]
 gb|AEX12055.1| hypothetical protein 0_18789_01 [Pinus taeda]
 gb|AEX12059.1| hypothetical protein 0_18789_01 [Pinus taeda]
 gb|AEX12060.1| hypothetical protein 0_18789_01 [Pinus taeda]
 gb|AEX12063.1| hypothetical protein 0_18789_01 [Pinus taeda]
 gb|AEX12064.1| hypothetical protein 0_18789_01 [Pinus taeda]
Length=161

 Score = 44.7 bits (104),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 18/40 (45%), Positives = 26/40 (65%), Gaps = 0/40 (0%)
 Frame = +1

Query  4    KECPGSSWIELEKAIHQFSACDNYHPASHEIYSLLDGLFG  123
            ++ PGSSWIE+   ++ F   D  HP S +IY +L+ LFG
Sbjct  65   QKMPGSSWIEVNGKVYAFLVGDKSHPQSEKIYDMLEKLFG  104



>ref|XP_010690456.1| PREDICTED: pentatricopeptide repeat-containing protein At1g11290-like 
[Beta vulgaris subsp. vulgaris]
Length=730

 Score = 47.0 bits (110),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 18/35 (51%), Positives = 24/35 (69%), Gaps = 0/35 (0%)
 Frame = +1

Query  4    KECPGSSWIELEKAIHQFSACDNYHPASHEIYSLL  108
            K+ PG SW+E+   +H+F   D  HP SHEIYS+L
Sbjct  670  KKTPGCSWLEVNGKVHEFRVADKSHPRSHEIYSIL  704



>ref|XP_004984890.1| PREDICTED: pentatricopeptide repeat-containing protein At4g13650-like 
isoform X1 [Setaria italica]
 ref|XP_004984891.1| PREDICTED: pentatricopeptide repeat-containing protein At4g13650-like 
isoform X2 [Setaria italica]
 ref|XP_004984892.1| PREDICTED: pentatricopeptide repeat-containing protein At4g13650-like 
isoform X3 [Setaria italica]
Length=920

 Score = 47.0 bits (110),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 21/40 (53%), Positives = 27/40 (68%), Gaps = 0/40 (0%)
 Frame = +1

Query  4    KECPGSSWIELEKAIHQFSACDNYHPASHEIYSLLDGLFG  123
            K+ PGSSWIE++ A+H F A D  HP + +IYS L  L G
Sbjct  783  KKEPGSSWIEVKSAVHAFYAGDRLHPLADQIYSFLADLNG  822



>ref|XP_004492833.1| PREDICTED: pentatricopeptide repeat-containing protein At2g22070-like 
[Cicer arietinum]
Length=755

 Score = 46.6 bits (109),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 21/40 (53%), Positives = 24/40 (60%), Gaps = 0/40 (0%)
 Frame = +1

Query  4    KECPGSSWIELEKAIHQFSACDNYHPASHEIYSLLDGLFG  123
            K+ PG SWI+L+  IH F   D  HP   EIYS LD L G
Sbjct  618  KKQPGQSWIQLKDRIHTFIVGDRSHPQDKEIYSYLDSLIG  657



>ref|XP_009381414.1| PREDICTED: pentatricopeptide repeat-containing protein At1g62260, 
mitochondrial [Musa acuminata subsp. malaccensis]
Length=687

 Score = 46.6 bits (109),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 17/33 (52%), Positives = 24/33 (73%), Gaps = 0/33 (0%)
 Frame = +1

Query  13   PGSSWIELEKAIHQFSACDNYHPASHEIYSLLD  111
            PG SWIE+   +H F + D  HP+SHEI+SL++
Sbjct  643  PGYSWIEMHNKVHIFVSGDTSHPSSHEIFSLIE  675



>ref|XP_007155354.1| hypothetical protein PHAVU_003G194000g [Phaseolus vulgaris]
 gb|ESW27348.1| hypothetical protein PHAVU_003G194000g [Phaseolus vulgaris]
Length=618

 Score = 46.6 bits (109),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 21/38 (55%), Positives = 23/38 (61%), Gaps = 0/38 (0%)
 Frame = +1

Query  4    KECPGSSWIELEKAIHQFSACDNYHPASHEIYSLLDGL  117
            K+ PG SWIEL   +H FS  D  HP   EIYSLL  L
Sbjct  581  KKIPGCSWIELGGTVHHFSVKDRTHPQVTEIYSLLSSL  618



>ref|XP_007031405.1| Pentatricopeptide repeat (PPR) superfamily protein [Theobroma 
cacao]
 gb|EOY02331.1| Pentatricopeptide repeat (PPR) superfamily protein [Theobroma 
cacao]
Length=527

 Score = 46.2 bits (108),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 17/37 (46%), Positives = 26/37 (70%), Gaps = 0/37 (0%)
 Frame = +1

Query  13   PGSSWIELEKAIHQFSACDNYHPASHEIYSLLDGLFG  123
            PG SWIE++  +HQF + D  HP + EIY++L+ + G
Sbjct  489  PGCSWIEVDSQVHQFYSVDKTHPRTDEIYNILESVVG  525



>ref|XP_002980702.1| hypothetical protein SELMODRAFT_113181 [Selaginella moellendorffii]
 gb|EFJ18353.1| hypothetical protein SELMODRAFT_113181 [Selaginella moellendorffii]
Length=1108

 Score = 46.6 bits (109),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 19/38 (50%), Positives = 25/38 (66%), Gaps = 0/38 (0%)
 Frame = +1

Query  4     KECPGSSWIELEKAIHQFSACDNYHPASHEIYSLLDGL  117
             K  PG SW+E+ K +H+F A D  HP + EIY +LD L
Sbjct  974   KNAPGMSWLEIGKQVHEFVAGDRSHPQTDEIYVVLDKL  1011



>ref|XP_007052071.1| Pentatricopeptide repeat (PPR) superfamily protein, putative 
[Theobroma cacao]
 gb|EOX96228.1| Pentatricopeptide repeat (PPR) superfamily protein, putative 
[Theobroma cacao]
Length=637

 Score = 46.2 bits (108),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 20/35 (57%), Positives = 23/35 (66%), Gaps = 0/35 (0%)
 Frame = +1

Query  4    KECPGSSWIELEKAIHQFSACDNYHPASHEIYSLL  108
            K+ PG SWIELE  +H+F   D  HP   EIYSLL
Sbjct  586  KKIPGCSWIELEGTVHEFFVQDKSHPQVMEIYSLL  620



>gb|AEW08425.1| hypothetical protein 2_9455_01, partial [Pinus lambertiana]
Length=156

 Score = 43.9 bits (102),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 19/40 (48%), Positives = 25/40 (63%), Gaps = 0/40 (0%)
 Frame = +1

Query  4    KECPGSSWIELEKAIHQFSACDNYHPASHEIYSLLDGLFG  123
            K+ PG SWIE+   ++ F   D  HP + EIY+LLD L G
Sbjct  19   KKKPGCSWIEVNNKMYSFVVGDTSHPQTEEIYALLDALAG  58



>ref|XP_010090507.1| hypothetical protein L484_017129 [Morus notabilis]
 gb|EXB39656.1| hypothetical protein L484_017129 [Morus notabilis]
Length=628

 Score = 46.2 bits (108),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 19/38 (50%), Positives = 26/38 (68%), Gaps = 0/38 (0%)
 Frame = +1

Query  4    KECPGSSWIELEKAIHQFSACDNYHPASHEIYSLLDGL  117
            K+ PG +WIE++  I+QFS+ D  HP S EIY +L  L
Sbjct  491  KKFPGWTWIEVDNKIYQFSSGDETHPRSKEIYGMLKNL  528



>ref|XP_010922662.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At3g08820 [Elaeis guineensis]
Length=692

 Score = 46.2 bits (108),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 19/38 (50%), Positives = 25/38 (66%), Gaps = 0/38 (0%)
 Frame = +1

Query  4    KECPGSSWIELEKAIHQFSACDNYHPASHEIYSLLDGL  117
            ++ PG SWIEL+  +H+F   D  HP S +IYS LD L
Sbjct  555  QKTPGRSWIELKGVVHEFHVGDKSHPLSKQIYSKLDEL  592



>ref|XP_008801268.1| PREDICTED: pentatricopeptide repeat-containing protein At1g33350 
[Phoenix dactylifera]
 ref|XP_008801269.1| PREDICTED: pentatricopeptide repeat-containing protein At1g33350 
[Phoenix dactylifera]
 ref|XP_008801270.1| PREDICTED: pentatricopeptide repeat-containing protein At1g33350 
[Phoenix dactylifera]
 ref|XP_008801271.1| PREDICTED: pentatricopeptide repeat-containing protein At1g33350 
[Phoenix dactylifera]
Length=526

 Score = 46.2 bits (108),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 18/40 (45%), Positives = 27/40 (68%), Gaps = 0/40 (0%)
 Frame = +1

Query  4    KECPGSSWIELEKAIHQFSACDNYHPASHEIYSLLDGLFG  123
            K+ PG SWIE++  +H+F + D  HP + EIY +L+ L G
Sbjct  483  KKLPGCSWIEVDSKVHRFYSGDKLHPEAEEIYKVLELLVG  522



>ref|XP_010241799.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like 
[Nelumbo nucifera]
Length=619

 Score = 46.2 bits (108),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 20/38 (53%), Positives = 24/38 (63%), Gaps = 0/38 (0%)
 Frame = +1

Query  4    KECPGSSWIELEKAIHQFSACDNYHPASHEIYSLLDGL  117
            K+ PG SWIE+   +HQF A D  HP S +IY  LD L
Sbjct  482  KKTPGRSWIEINNIVHQFFAGDKSHPLSDKIYMKLDEL  519



>ref|XP_006393385.1| hypothetical protein EUTSA_v10011302mg [Eutrema salsugineum]
 gb|ESQ30671.1| hypothetical protein EUTSA_v10011302mg [Eutrema salsugineum]
Length=650

 Score = 46.2 bits (108),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 18/38 (47%), Positives = 24/38 (63%), Gaps = 0/38 (0%)
 Frame = +1

Query  4    KECPGSSWIELEKAIHQFSACDNYHPASHEIYSLLDGL  117
            K+ PG SWIE++   H FS  D +HP   EIY+ L+ L
Sbjct  513  KKVPGYSWIEIQNKTHTFSVGDEFHPEKDEIYAFLEDL  550



>ref|XP_006299039.1| hypothetical protein CARUB_v10015176mg [Capsella rubella]
 gb|EOA31937.1| hypothetical protein CARUB_v10015176mg [Capsella rubella]
Length=685

 Score = 46.2 bits (108),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 20/38 (53%), Positives = 26/38 (68%), Gaps = 0/38 (0%)
 Frame = +1

Query  4    KECPGSSWIELEKAIHQFSACDNYHPASHEIYSLLDGL  117
            K+ PG SWIELE  +H+F A D  HP S +IY+ L+ L
Sbjct  548  KKIPGYSWIELEGTVHEFLADDKSHPLSDKIYAKLEDL  585



>ref|XP_010533968.1| PREDICTED: pentatricopeptide repeat-containing protein At4g02750 
[Tarenaya hassleriana]
Length=774

 Score = 46.2 bits (108),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 18/38 (47%), Positives = 25/38 (66%), Gaps = 0/38 (0%)
 Frame = +1

Query  4    KECPGSSWIELEKAIHQFSACDNYHPASHEIYSLLDGL  117
            K+ PG SWIE++  IH FS  D  HP  +EIY+ ++ L
Sbjct  637  KKIPGFSWIEIQNKIHTFSVGDELHPERNEIYAFMEDL  674



>gb|ACE80848.1| pentatricopeptide repeat protein, partial [Lepidogyna hodgsoniae]
Length=152

 Score = 43.9 bits (102),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 17/35 (49%), Positives = 23/35 (66%), Gaps = 0/35 (0%)
 Frame = +1

Query  13   PGSSWIELEKAIHQFSACDNYHPASHEIYSLLDGL  117
            PG SWIE++  IH+F   D  HP + EIY++L  L
Sbjct  25   PGRSWIEVDNKIHEFVVADTSHPEAAEIYTVLKKL  59



>ref|XP_010430241.1| PREDICTED: pentatricopeptide repeat-containing protein At4g02750-like 
[Camelina sativa]
Length=775

 Score = 46.2 bits (108),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 18/39 (46%), Positives = 24/39 (62%), Gaps = 0/39 (0%)
 Frame = +1

Query  1    EKECPGSSWIELEKAIHQFSACDNYHPASHEIYSLLDGL  117
            +K+ PG SWIE++   H FS  D +HP   EIY  L+ L
Sbjct  637  KKKVPGYSWIEIQNKTHTFSVGDEFHPEKEEIYVFLEDL  675



>ref|XP_004959110.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At1g68930-like [Setaria italica]
Length=727

 Score = 46.2 bits (108),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 21/38 (55%), Positives = 25/38 (66%), Gaps = 0/38 (0%)
 Frame = +1

Query  4    KECPGSSWIELEKAIHQFSACDNYHPASHEIYSLLDGL  117
            K+ PG SWI L+ A+H F A D  HP S EIY+ LD L
Sbjct  590  KKQPGQSWIHLKNAVHTFVAGDVSHPRSAEIYAYLDKL  627



>gb|ACE80767.1| pentatricopeptide repeat protein, partial [Ptilidium pulcherrimum]
Length=152

 Score = 43.5 bits (101),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 17/37 (46%), Positives = 24/37 (65%), Gaps = 0/37 (0%)
 Frame = +1

Query  13   PGSSWIELEKAIHQFSACDNYHPASHEIYSLLDGLFG  123
            PG +WIE+   +H F+A DN HP   EI+  LD ++G
Sbjct  25   PGLTWIEVNNQVHSFTAGDNQHPQIMEIHQELDRVYG  61



>ref|XP_010654106.1| PREDICTED: pentatricopeptide repeat-containing protein At2g33760-like 
[Vitis vinifera]
Length=633

 Score = 45.8 bits (107),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 19/38 (50%), Positives = 24/38 (63%), Gaps = 0/38 (0%)
 Frame = +1

Query  4    KECPGSSWIELEKAIHQFSACDNYHPASHEIYSLLDGL  117
            K+ PG +WIE++   HQFS  D  HP S EIY +L  L
Sbjct  496  KKIPGWTWIEVDNKSHQFSVGDTTHPRSKEIYEMLKSL  533



>ref|XP_006306508.1| hypothetical protein CARUB_v10012498mg [Capsella rubella]
 gb|EOA39406.1| hypothetical protein CARUB_v10012498mg [Capsella rubella]
Length=538

 Score = 45.8 bits (107),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 18/35 (51%), Positives = 24/35 (69%), Gaps = 0/35 (0%)
 Frame = +1

Query  13   PGSSWIELEKAIHQFSACDNYHPASHEIYSLLDGL  117
            PG SWIE++  +HQF + D  HP + EIY +LD L
Sbjct  501  PGCSWIEIDNEVHQFYSLDKSHPKNIEIYEILDSL  535



>ref|XP_004512654.1| PREDICTED: pentatricopeptide repeat-containing protein At1g33350-like 
[Cicer arietinum]
Length=433

 Score = 45.8 bits (107),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 17/37 (46%), Positives = 26/37 (70%), Gaps = 0/37 (0%)
 Frame = +1

Query  13   PGSSWIELEKAIHQFSACDNYHPASHEIYSLLDGLFG  123
            PG SWIE++  +HQF + D  +P + E+YS+L+ L G
Sbjct  388  PGCSWIEVDDQVHQFYSLDQSNPKTEELYSVLESLIG  424



>gb|KFK36081.1| hypothetical protein AALP_AA4G075000 [Arabis alpina]
Length=773

 Score = 45.8 bits (107),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 18/38 (47%), Positives = 24/38 (63%), Gaps = 0/38 (0%)
 Frame = +1

Query  4    KECPGSSWIELEKAIHQFSACDNYHPASHEIYSLLDGL  117
            K+ PG SWIE++   H FS  D +HP   EIY+ L+ L
Sbjct  636  KKVPGYSWIEIQNNTHTFSVGDKFHPEKDEIYAFLEDL  673



>ref|XP_010553384.1| PREDICTED: pentatricopeptide repeat-containing protein At1g08070-like 
[Tarenaya hassleriana]
 ref|XP_010553385.1| PREDICTED: pentatricopeptide repeat-containing protein At1g08070-like 
[Tarenaya hassleriana]
 ref|XP_010553386.1| PREDICTED: pentatricopeptide repeat-containing protein At1g08070-like 
[Tarenaya hassleriana]
Length=627

 Score = 45.8 bits (107),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 20/38 (53%), Positives = 24/38 (63%), Gaps = 0/38 (0%)
 Frame = +1

Query  4    KECPGSSWIELEKAIHQFSACDNYHPASHEIYSLLDGL  117
            K+ PG +WIE +K IH+FS  D  HP S EIY  L  L
Sbjct  490  KKIPGYTWIEADKIIHRFSVGDRTHPRSKEIYDKLGNL  527



>ref|XP_010246114.1| PREDICTED: pentatricopeptide repeat-containing protein At4g19191, 
mitochondrial-like [Nelumbo nucifera]
Length=719

 Score = 45.8 bits (107),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 18/38 (47%), Positives = 25/38 (66%), Gaps = 0/38 (0%)
 Frame = +1

Query  4    KECPGSSWIELEKAIHQFSACDNYHPASHEIYSLLDGL  117
            K+ PGSSW+E+   +H+F   D  HP S EIY++L  L
Sbjct  666  KKTPGSSWLEINGNVHEFRVADRSHPKSEEIYNILRNL  703



>ref|XP_003628686.1| Pentatricopeptide repeat protein [Medicago truncatula]
 gb|AET03162.1| PPR containing plant-like protein [Medicago truncatula]
Length=699

 Score = 45.8 bits (107),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 19/35 (54%), Positives = 25/35 (71%), Gaps = 0/35 (0%)
 Frame = +1

Query  4    KECPGSSWIELEKAIHQFSACDNYHPASHEIYSLL  108
            K+ PG SWIE++  +H F+A D+ HP S EIY LL
Sbjct  630  KKVPGWSWIEVKNKVHAFNAEDHSHPQSKEIYELL  664



>gb|AEU08424.1| pentatricopeptide repeat protein [Physcomitrium pyriforme]
Length=151

 Score = 43.5 bits (101),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 18/35 (51%), Positives = 22/35 (63%), Gaps = 0/35 (0%)
 Frame = +1

Query  13   PGSSWIELEKAIHQFSACDNYHPASHEIYSLLDGL  117
            PG SWIE++  IH F   D  HP S EIY+ L+ L
Sbjct  25   PGRSWIEVDNRIHSFVVGDTSHPESKEIYAQLNDL  59



>ref|XP_010654107.1| PREDICTED: pentatricopeptide repeat-containing protein At2g33760-like 
[Vitis vinifera]
 ref|XP_010654108.1| PREDICTED: pentatricopeptide repeat-containing protein At2g33760-like 
[Vitis vinifera]
Length=633

 Score = 45.8 bits (107),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 19/38 (50%), Positives = 24/38 (63%), Gaps = 0/38 (0%)
 Frame = +1

Query  4    KECPGSSWIELEKAIHQFSACDNYHPASHEIYSLLDGL  117
            K+ PG +WIE++   HQFS  D  HP S EIY +L  L
Sbjct  496  KKTPGWTWIEVDNKSHQFSVGDTTHPRSKEIYEMLKSL  533



>gb|KHN19434.1| Putative pentatricopeptide repeat-containing protein [Glycine 
soja]
Length=480

 Score = 45.8 bits (107),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 17/39 (44%), Positives = 26/39 (67%), Gaps = 0/39 (0%)
 Frame = +1

Query  4    KECPGSSWIELEKAIHQFSACDNYHPASHEIYSLLDGLF  120
            ++ PG SW+E++  +H+F   D  HP SH+IY  L+ LF
Sbjct  343  QKLPGCSWVEVDGVVHEFLVGDTSHPLSHKIYEKLESLF  381



>emb|CBI30318.3| unnamed protein product [Vitis vinifera]
Length=861

 Score = 45.8 bits (107),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 19/38 (50%), Positives = 24/38 (63%), Gaps = 0/38 (0%)
 Frame = +1

Query  4    KECPGSSWIELEKAIHQFSACDNYHPASHEIYSLLDGL  117
            K+ PG +WIE++   HQFS  D  HP S EIY +L  L
Sbjct  724  KKIPGWTWIEVDNKSHQFSVGDTTHPRSKEIYEMLKSL  761



>ref|XP_002458168.1| hypothetical protein SORBIDRAFT_03g028130 [Sorghum bicolor]
 gb|EES03288.1| hypothetical protein SORBIDRAFT_03g028130 [Sorghum bicolor]
Length=694

 Score = 45.8 bits (107),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 19/39 (49%), Positives = 26/39 (67%), Gaps = 1/39 (3%)
 Frame = +1

Query  4    KECPGSSWIEL-EKAIHQFSACDNYHPASHEIYSLLDGL  117
            K+CPG SWIE+ +  +H+F   D  H  SH+IY +L GL
Sbjct  635  KKCPGYSWIEVGDSEVHRFLTADKLHTQSHQIYRVLGGL  673



>ref|XP_007133846.1| hypothetical protein PHAVU_011G213900g [Phaseolus vulgaris]
 gb|ESW05840.1| hypothetical protein PHAVU_011G213900g [Phaseolus vulgaris]
Length=690

 Score = 45.8 bits (107),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 16/39 (41%), Positives = 26/39 (67%), Gaps = 0/39 (0%)
 Frame = +1

Query  4    KECPGSSWIELEKAIHQFSACDNYHPASHEIYSLLDGLF  120
            ++ PG SW+E++  +H+F   D  HP +H+IY  L+ LF
Sbjct  553  QKLPGCSWVEVDGVVHEFRVGDTSHPLTHKIYEKLESLF  591



>ref|XP_010690022.1| PREDICTED: pentatricopeptide repeat-containing protein At4g13650 
[Beta vulgaris subsp. vulgaris]
Length=1060

 Score = 45.8 bits (107),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 20/38 (53%), Positives = 26/38 (68%), Gaps = 0/38 (0%)
 Frame = +1

Query  4    KECPGSSWIELEKAIHQFSACDNYHPASHEIYSLLDGL  117
            K+ PG SWIE++  IH F A DN HP + +IY+ LD L
Sbjct  926  KKEPGRSWIEVKNCIHAFYAGDNLHPLADKIYNFLDDL  963



>ref|XP_006587808.1| PREDICTED: pentatricopeptide repeat-containing protein At2g22070-like 
[Glycine max]
Length=771

 Score = 45.8 bits (107),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 21/40 (53%), Positives = 24/40 (60%), Gaps = 0/40 (0%)
 Frame = +1

Query  4    KECPGSSWIELEKAIHQFSACDNYHPASHEIYSLLDGLFG  123
            K+ PG SWI+L+  IH F   D  HP   EIYS LD L G
Sbjct  634  KKQPGQSWIQLKDQIHTFIMGDRSHPQDEEIYSYLDILIG  673



>ref|XP_003575376.1| PREDICTED: pentatricopeptide repeat-containing protein At1g33350 
[Brachypodium distachyon]
Length=523

 Score = 45.8 bits (107),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 18/38 (47%), Positives = 26/38 (68%), Gaps = 0/38 (0%)
 Frame = +1

Query  4    KECPGSSWIELEKAIHQFSACDNYHPASHEIYSLLDGL  117
            K+ PG SWIE+++  H+F + D+ HP S +IY  LD L
Sbjct  480  KKLPGCSWIEVDRKTHRFYSGDDAHPESEDIYDTLDEL  517



>ref|XP_002884698.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH60957.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata 
subsp. lyrata]
Length=685

 Score = 45.8 bits (107),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 20/38 (53%), Positives = 26/38 (68%), Gaps = 0/38 (0%)
 Frame = +1

Query  4    KECPGSSWIELEKAIHQFSACDNYHPASHEIYSLLDGL  117
            K+ PG SWIELE  +H+F A D  HP S +IY+ L+ L
Sbjct  548  KKIPGYSWIELEGTVHEFLADDKSHPLSDKIYAKLEDL  585



>ref|XP_010943831.1| PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing 
protein At4g21065-like [Elaeis guineensis]
Length=803

 Score = 45.8 bits (107),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 18/38 (47%), Positives = 22/38 (58%), Gaps = 0/38 (0%)
 Frame = +1

Query  4    KECPGSSWIELEKAIHQFSACDNYHPASHEIYSLLDGL  117
            K+ PG +WIE+    HQF   D  HP S EIY +L  L
Sbjct  496  KKTPGGTWIEINNKTHQFRVGDKSHPQSKEIYEMLKAL  533



>ref|XP_006647529.1| PREDICTED: pentatricopeptide repeat-containing protein At1g33350-like 
[Oryza brachyantha]
Length=530

 Score = 45.4 bits (106),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 19/38 (50%), Positives = 26/38 (68%), Gaps = 0/38 (0%)
 Frame = +1

Query  4    KECPGSSWIELEKAIHQFSACDNYHPASHEIYSLLDGL  117
            K+ PG SWIE+ +  H+F + D+ HP S +IYS LD L
Sbjct  482  KKLPGCSWIEVNRRTHRFYSGDDGHPESEDIYSTLDEL  519



>ref|XP_002976962.1| hypothetical protein SELMODRAFT_106096 [Selaginella moellendorffii]
 gb|EFJ22072.1| hypothetical protein SELMODRAFT_106096 [Selaginella moellendorffii]
Length=1108

 Score = 45.8 bits (107),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 19/38 (50%), Positives = 24/38 (63%), Gaps = 0/38 (0%)
 Frame = +1

Query  4     KECPGSSWIELEKAIHQFSACDNYHPASHEIYSLLDGL  117
             K  PG SW E+ K +H+F A D  HP + EIY +LD L
Sbjct  974   KNAPGMSWFEIGKQVHEFVAGDRSHPKTDEIYVVLDKL  1011



>ref|XP_003539649.2| PREDICTED: putative pentatricopeptide repeat-containing protein 
At3g08820-like isoform X1 [Glycine max]
 ref|XP_006592973.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At3g08820-like isoform X2 [Glycine max]
Length=681

 Score = 45.8 bits (107),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 17/39 (44%), Positives = 26/39 (67%), Gaps = 0/39 (0%)
 Frame = +1

Query  4    KECPGSSWIELEKAIHQFSACDNYHPASHEIYSLLDGLF  120
            ++ PG SW+E++  +H+F   D  HP SH+IY  L+ LF
Sbjct  544  QKLPGCSWVEVDGVVHEFLVGDTSHPLSHKIYEKLESLF  582



>ref|XP_008776306.1| PREDICTED: pentatricopeptide repeat-containing protein At1g08070-like 
[Phoenix dactylifera]
Length=622

 Score = 45.8 bits (107),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 19/32 (59%), Positives = 23/32 (72%), Gaps = 0/32 (0%)
 Frame = +1

Query  22   SWIELEKAIHQFSACDNYHPASHEIYSLLDGL  117
            SWIELE  +H+F   D  HP S EIYS++DGL
Sbjct  570  SWIELEGMVHKFLVEDTTHPKSDEIYSIVDGL  601



>gb|KHN29274.1| Putative pentatricopeptide repeat-containing protein [Glycine 
soja]
Length=672

 Score = 45.8 bits (107),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 21/40 (53%), Positives = 24/40 (60%), Gaps = 0/40 (0%)
 Frame = +1

Query  4    KECPGSSWIELEKAIHQFSACDNYHPASHEIYSLLDGLFG  123
            K+ PG SWI+L+  IH F   D  HP   EIYS LD L G
Sbjct  535  KKQPGQSWIQLKDQIHTFIMGDRSHPQDEEIYSYLDILIG  574



>ref|XP_007011666.1| Pentatricopeptide repeat-containing protein, putative [Theobroma 
cacao]
 gb|EOY29285.1| Pentatricopeptide repeat-containing protein, putative [Theobroma 
cacao]
Length=716

 Score = 45.8 bits (107),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 19/38 (50%), Positives = 25/38 (66%), Gaps = 0/38 (0%)
 Frame = +1

Query  4    KECPGSSWIELEKAIHQFSACDNYHPASHEIYSLLDGL  117
            K+ PG SWIE++  +H F+A D  HP   EIY +L GL
Sbjct  642  KKVPGWSWIEIKNQVHAFNAEDQSHPHCKEIYQMLGGL  679



>ref|XP_008386694.1| PREDICTED: pentatricopeptide repeat-containing protein At3g62890-like 
[Malus domestica]
Length=157

 Score = 43.5 bits (101),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 17/36 (47%), Positives = 25/36 (69%), Gaps = 0/36 (0%)
 Frame = +1

Query  4    KECPGSSWIELEKAIHQFSACDNYHPASHEIYSLLD  111
            K+ PG S +E+   +H+F ACD+ HP + EIY +LD
Sbjct  20   KKVPGCSLVEVGGVLHEFFACDDSHPETREIYMMLD  55



>emb|CAN68552.1| hypothetical protein VITISV_014227 [Vitis vinifera]
Length=1309

 Score = 45.8 bits (107),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 19/38 (50%), Positives = 24/38 (63%), Gaps = 0/38 (0%)
 Frame = +1

Query  4    KECPGSSWIELEKAIHQFSACDNYHPASHEIYSLLDGL  117
            K+ PG +WIE++   HQFS  D  HP S EIY +L  L
Sbjct  496  KKTPGWTWIEVDNKSHQFSVGDTTHPRSKEIYEMLKSL  533


 Score = 45.8 bits (107),  Expect = 7e-04, Method: Composition-based stats.
 Identities = 19/38 (50%), Positives = 24/38 (63%), Gaps = 0/38 (0%)
 Frame = +1

Query  4     KECPGSSWIELEKAIHQFSACDNYHPASHEIYSLLDGL  117
             K+ PG +WIE++   HQFS  D  HP S EIY +L  L
Sbjct  1172  KKIPGWTWIEVDNKSHQFSVGDTTHPRSKEIYEMLKSL  1209



>ref|NP_187494.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana]
 sp|Q9SR82.1|PP219_ARATH RecName: Full=Putative pentatricopeptide repeat-containing protein 
At3g08820 [Arabidopsis thaliana]
 gb|AAF07847.1|AC010871_23 unknown protein [Arabidopsis thaliana]
 gb|AAG51349.1|AC012562_10 unknown protein; 90102-88045 [Arabidopsis thaliana]
 gb|AEE74683.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana]
Length=685

 Score = 45.8 bits (107),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 20/38 (53%), Positives = 26/38 (68%), Gaps = 0/38 (0%)
 Frame = +1

Query  4    KECPGSSWIELEKAIHQFSACDNYHPASHEIYSLLDGL  117
            K+ PG SWIELE  +H+F A D  HP S +IY+ L+ L
Sbjct  548  KKIPGYSWIELEGKVHEFLADDKSHPLSDKIYAKLEDL  585



>ref|XP_010665484.1| PREDICTED: pentatricopeptide repeat-containing protein At1g33350 
[Vitis vinifera]
 ref|XP_010665485.1| PREDICTED: pentatricopeptide repeat-containing protein At1g33350 
[Vitis vinifera]
Length=529

 Score = 45.4 bits (106),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 17/35 (49%), Positives = 24/35 (69%), Gaps = 0/35 (0%)
 Frame = +1

Query  13   PGSSWIELEKAIHQFSACDNYHPASHEIYSLLDGL  117
            PG SWIE++  +HQF + D  HP + EIY+ L+ L
Sbjct  491  PGCSWIEIDNQVHQFYSVDKTHPRTEEIYNTLESL  525



>ref|XP_004509852.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At3g25970-like [Cicer arietinum]
Length=692

 Score = 45.8 bits (107),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 20/38 (53%), Positives = 26/38 (68%), Gaps = 0/38 (0%)
 Frame = +1

Query  4    KECPGSSWIELEKAIHQFSACDNYHPASHEIYSLLDGL  117
            K+ PG SWIE++  +H F+A D+ HP S EIY LL  L
Sbjct  641  KKVPGWSWIEVKNKVHAFNAEDHSHPQSEEIYVLLQHL  678



>ref|XP_002533783.1| pentatricopeptide repeat-containing protein, putative [Ricinus 
communis]
 gb|EEF28596.1| pentatricopeptide repeat-containing protein, putative [Ricinus 
communis]
Length=672

 Score = 45.4 bits (106),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 19/39 (49%), Positives = 25/39 (64%), Gaps = 0/39 (0%)
 Frame = +1

Query  4    KECPGSSWIELEKAIHQFSACDNYHPASHEIYSLLDGLF  120
            ++ PG SWIE+ K  H F A D  HP S +IYS+L+ L 
Sbjct  611  QKVPGYSWIEVNKTTHMFVAADGSHPESAQIYSVLNNLL  649



>ref|XP_006602844.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At3g23330-like [Glycine max]
Length=756

 Score = 45.8 bits (107),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 21/40 (53%), Positives = 24/40 (60%), Gaps = 0/40 (0%)
 Frame = +1

Query  4    KECPGSSWIELEKAIHQFSACDNYHPASHEIYSLLDGLFG  123
            K+ PG SWI+L+  IH F   D  HP   EIYS LD L G
Sbjct  619  KKQPGQSWIQLKDQIHTFVMGDRSHPQDDEIYSYLDILIG  658



>ref|XP_002265522.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At3g08820 [Vitis vinifera]
Length=686

 Score = 45.4 bits (106),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 18/35 (51%), Positives = 24/35 (69%), Gaps = 0/35 (0%)
 Frame = +1

Query  13   PGSSWIELEKAIHQFSACDNYHPASHEIYSLLDGL  117
            PG SWIE++  +H+F   D YHP S +IY+ LD L
Sbjct  552  PGCSWIEVDGIVHEFLVGDKYHPLSEKIYAKLDEL  586



>ref|XP_006290208.1| hypothetical protein CARUB_v10003899mg [Capsella rubella]
 gb|EOA23106.1| hypothetical protein CARUB_v10003899mg [Capsella rubella]
Length=756

 Score = 45.4 bits (106),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 17/38 (45%), Positives = 24/38 (63%), Gaps = 0/38 (0%)
 Frame = +1

Query  4    KECPGSSWIELEKAIHQFSACDNYHPASHEIYSLLDGL  117
            K+ PG SWIE++   H FS  D +HP   +IY+ L+ L
Sbjct  619  KKVPGYSWIEIQNKTHTFSVADEFHPEKDKIYAFLEDL  656



>ref|XP_009146978.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At3g08820 [Brassica rapa]
 emb|CDY36010.1| BnaA05g29400D [Brassica napus]
Length=684

 Score = 45.4 bits (106),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 20/38 (53%), Positives = 26/38 (68%), Gaps = 0/38 (0%)
 Frame = +1

Query  4    KECPGSSWIELEKAIHQFSACDNYHPASHEIYSLLDGL  117
            K+ PG SWIELE  +H+F A D  HP S +IY+ L+ L
Sbjct  547  KKLPGWSWIELEGTVHEFLADDKSHPLSDKIYAKLEDL  584



>gb|AHB18411.1| pentatricopeptide repeat-containing protein [Gossypium hirsutum]
Length=637

 Score = 45.4 bits (106),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 21/39 (54%), Positives = 24/39 (62%), Gaps = 0/39 (0%)
 Frame = +1

Query  4    KECPGSSWIELEKAIHQFSACDNYHPASHEIYSLLDGLF  120
            K+ PG S IELE  +H+F   D  HP   EIYSLLD L 
Sbjct  586  KKIPGCSRIELEGTVHEFFVQDKSHPQVMEIYSLLDSLL  624



>gb|KHN40468.1| Putative pentatricopeptide repeat-containing protein [Glycine 
soja]
Length=756

 Score = 45.4 bits (106),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 21/40 (53%), Positives = 24/40 (60%), Gaps = 0/40 (0%)
 Frame = +1

Query  4    KECPGSSWIELEKAIHQFSACDNYHPASHEIYSLLDGLFG  123
            K+ PG SWI+L+  IH F   D  HP   EIYS LD L G
Sbjct  619  KKQPGQSWIQLKDQIHTFVMGDRSHPQDDEIYSYLDILIG  658



>gb|KDP37792.1| hypothetical protein JCGZ_06694 [Jatropha curcas]
Length=523

 Score = 45.4 bits (106),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 18/35 (51%), Positives = 25/35 (71%), Gaps = 0/35 (0%)
 Frame = +1

Query  13   PGSSWIELEKAIHQFSACDNYHPASHEIYSLLDGL  117
            PG SWIE++  ++QF + D  HP S EIYS+L+ L
Sbjct  487  PGCSWIEVDNEVYQFYSVDKTHPRSEEIYSVLETL  521



>ref|XP_006420415.1| hypothetical protein CICLE_v10006446mg [Citrus clementina]
 gb|ESR33655.1| hypothetical protein CICLE_v10006446mg [Citrus clementina]
Length=315

 Score = 45.1 bits (105),  Expect = 7e-04, Method: Composition-based stats.
 Identities = 17/29 (59%), Positives = 22/29 (76%), Gaps = 0/29 (0%)
 Frame = +1

Query  1    EKECPGSSWIELEKAIHQFSACDNYHPAS  87
            EK CP SSWIE+E+ ++ F+A D  HPAS
Sbjct  287  EKRCPDSSWIEMERTVYLFTASDKSHPAS  315



>ref|XP_010232231.1| PREDICTED: pentatricopeptide repeat-containing protein At1g08070-like 
[Brachypodium distachyon]
Length=591

 Score = 45.4 bits (106),  Expect = 7e-04, Method: Composition-based stats.
 Identities = 18/32 (56%), Positives = 23/32 (72%), Gaps = 0/32 (0%)
 Frame = +1

Query  22   SWIELEKAIHQFSACDNYHPASHEIYSLLDGL  117
            SWIEL+  +H+F   D YHP S EIY ++DGL
Sbjct  544  SWIELDGEVHKFLVQDTYHPKSAEIYDVVDGL  575



>gb|AEU08415.1| pentatricopeptide repeat protein [Fissidens cristatus]
Length=152

 Score = 43.1 bits (100),  Expect = 7e-04, Method: Composition-based stats.
 Identities = 17/35 (49%), Positives = 23/35 (66%), Gaps = 0/35 (0%)
 Frame = +1

Query  13   PGSSWIELEKAIHQFSACDNYHPASHEIYSLLDGL  117
            PG SWIE++  IH F   D +HP + EIY+ L+ L
Sbjct  25   PGRSWIEVDNKIHHFDVGDRFHPEAKEIYAELNRL  59



>ref|XP_010912878.1| PREDICTED: pentatricopeptide repeat-containing protein At1g08070-like 
[Elaeis guineensis]
Length=622

 Score = 45.4 bits (106),  Expect = 7e-04, Method: Composition-based stats.
 Identities = 19/32 (59%), Positives = 23/32 (72%), Gaps = 0/32 (0%)
 Frame = +1

Query  22   SWIELEKAIHQFSACDNYHPASHEIYSLLDGL  117
            SWIELE  +H+F   D  HP S EIYS++DGL
Sbjct  570  SWIELEGIVHKFLVEDTTHPKSDEIYSIVDGL  601



>gb|AEU08426.1| pentatricopeptide repeat protein [Timmia megapolitana subsp. 
bavarica]
Length=152

 Score = 43.1 bits (100),  Expect = 7e-04, Method: Composition-based stats.
 Identities = 18/35 (51%), Positives = 23/35 (66%), Gaps = 0/35 (0%)
 Frame = +1

Query  13   PGSSWIELEKAIHQFSACDNYHPASHEIYSLLDGL  117
            PG SWIE++K IH F   D  HP + EIY+ L+ L
Sbjct  25   PGRSWIEVDKKIHDFVVGDTSHPDTEEIYAELNRL  59



>emb|CBI18084.3| unnamed protein product [Vitis vinifera]
Length=496

 Score = 45.4 bits (106),  Expect = 7e-04, Method: Composition-based stats.
 Identities = 18/35 (51%), Positives = 24/35 (69%), Gaps = 0/35 (0%)
 Frame = +1

Query  13   PGSSWIELEKAIHQFSACDNYHPASHEIYSLLDGL  117
            PG SWIE++  +H+F   D YHP S +IY+ LD L
Sbjct  362  PGCSWIEVDGIVHEFLVGDKYHPLSEKIYAKLDEL  396



>ref|XP_006415097.1| hypothetical protein EUTSA_v10009638mg [Eutrema salsugineum]
 gb|ESQ33450.1| hypothetical protein EUTSA_v10009638mg [Eutrema salsugineum]
Length=521

 Score = 45.4 bits (106),  Expect = 7e-04, Method: Composition-based stats.
 Identities = 18/35 (51%), Positives = 23/35 (66%), Gaps = 0/35 (0%)
 Frame = +1

Query  13   PGSSWIELEKAIHQFSACDNYHPASHEIYSLLDGL  117
            PG SWIE++  +HQF + D  HP   EIY +LD L
Sbjct  484  PGCSWIEIDSEVHQFYSLDKTHPKIEEIYIVLDNL  518



>gb|ACE80732.1| pentatricopeptide repeat protein, partial [Diplophyllum albicans]
Length=152

 Score = 43.1 bits (100),  Expect = 7e-04, Method: Composition-based stats.
 Identities = 18/35 (51%), Positives = 24/35 (69%), Gaps = 0/35 (0%)
 Frame = +1

Query  13   PGSSWIELEKAIHQFSACDNYHPASHEIYSLLDGL  117
            PG SWIE++K IH+F A D  HP +  IY+ L+ L
Sbjct  25   PGRSWIEVDKKIHEFVAGDTSHPEAKAIYNELNNL  59



>ref|XP_008799870.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At3g08820 [Phoenix dactylifera]
Length=702

 Score = 45.4 bits (106),  Expect = 8e-04, Method: Composition-based stats.
 Identities = 18/38 (47%), Positives = 25/38 (66%), Gaps = 0/38 (0%)
 Frame = +1

Query  4    KECPGSSWIELEKAIHQFSACDNYHPASHEIYSLLDGL  117
            ++ PG SW+EL+  +H+F   D  HP S +IYS LD L
Sbjct  565  QKTPGRSWVELKGVVHEFHVGDKSHPLSKQIYSKLDEL  602



>ref|XP_010927665.1| PREDICTED: pentatricopeptide repeat-containing protein At5g04780-like 
[Elaeis guineensis]
Length=778

 Score = 45.4 bits (106),  Expect = 8e-04, Method: Composition-based stats.
 Identities = 19/37 (51%), Positives = 24/37 (65%), Gaps = 0/37 (0%)
 Frame = +1

Query  13   PGSSWIELEKAIHQFSACDNYHPASHEIYSLLDGLFG  123
            PG SWI+L+  IH F A D  HP + E+YS L+ L G
Sbjct  644  PGRSWIQLKNKIHTFVAGDRSHPQADEVYSYLECLIG  680



>ref|XP_008805213.1| PREDICTED: pentatricopeptide repeat-containing protein At5g15340, 
mitochondrial [Phoenix dactylifera]
Length=341

 Score = 44.7 bits (104),  Expect = 8e-04, Method: Composition-based stats.
 Identities = 17/36 (47%), Positives = 26/36 (72%), Gaps = 0/36 (0%)
 Frame = +1

Query  4    KECPGSSWIELEKAIHQFSACDNYHPASHEIYSLLD  111
            K+ PG S+IE+   +H+FSA D  HP + E+Y++LD
Sbjct  201  KKAPGISFIEVNGQVHRFSAGDKSHPQAREVYAMLD  236



>ref|XP_006653119.1| PREDICTED: pentatricopeptide repeat-containing protein At3g57430, 
chloroplastic-like [Oryza brachyantha]
Length=703

 Score = 45.1 bits (105),  Expect = 8e-04, Method: Composition-based stats.
 Identities = 18/36 (50%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = +1

Query  13   PGSSWIELEKAIHQFSACDNYHPASHEIYSLLDGLF  120
            PG SWIEL+ AIH+F+A ++ HPAS E++  +  L+
Sbjct  569  PGCSWIELDGAIHRFTAGESAHPASAEVHERMGALW  604



>ref|XP_010464495.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At3g08820 [Camelina sativa]
Length=684

 Score = 45.1 bits (105),  Expect = 9e-04, Method: Composition-based stats.
 Identities = 20/38 (53%), Positives = 25/38 (66%), Gaps = 0/38 (0%)
 Frame = +1

Query  4    KECPGSSWIELEKAIHQFSACDNYHPASHEIYSLLDGL  117
            K+ PG SWIELE  +H+F A D  HP S +IY  L+ L
Sbjct  547  KKIPGYSWIELEGTVHEFLADDKSHPLSDKIYGKLEEL  584



>gb|EMT21227.1| hypothetical protein F775_14950 [Aegilops tauschii]
Length=663

 Score = 45.1 bits (105),  Expect = 9e-04, Method: Composition-based stats.
 Identities = 17/38 (45%), Positives = 24/38 (63%), Gaps = 0/38 (0%)
 Frame = +1

Query  4    KECPGSSWIELEKAIHQFSACDNYHPASHEIYSLLDGL  117
            KE PG SW++ +  +H+F   DN+HP   +IY  LD L
Sbjct  534  KEVPGYSWVDFDGKVHKFHVGDNWHPLMDQIYKKLDEL  571



>ref|XP_004137118.1| PREDICTED: pentatricopeptide repeat-containing protein At3g02330-like 
[Cucumis sativus]
 ref|XP_004171015.1| PREDICTED: pentatricopeptide repeat-containing protein At3g02330-like 
[Cucumis sativus]
 gb|KGN43953.1| hypothetical protein Csa_7G074860 [Cucumis sativus]
Length=868

 Score = 45.1 bits (105),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 20/39 (51%), Positives = 24/39 (62%), Gaps = 0/39 (0%)
 Frame = +1

Query  4    KECPGSSWIELEKAIHQFSACDNYHPASHEIYSLLDGLF  120
            K+ PG SWIE++  +H F  CD  HP    IYSLLD L 
Sbjct  796  KKEPGCSWIEVKDEVHTFLVCDKAHPKCEMIYSLLDLLI  834



>ref|XP_010486427.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At3g08820 [Camelina sativa]
Length=683

 Score = 45.1 bits (105),  Expect = 9e-04, Method: Composition-based stats.
 Identities = 20/38 (53%), Positives = 25/38 (66%), Gaps = 0/38 (0%)
 Frame = +1

Query  4    KECPGSSWIELEKAIHQFSACDNYHPASHEIYSLLDGL  117
            K+ PG SWIELE  +H+F A D  HP S +IY  L+ L
Sbjct  546  KKIPGYSWIELEGTVHEFLADDKSHPLSDKIYGKLEEL  583



>ref|XP_009402221.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At3g08820 [Musa acuminata subsp. malaccensis]
Length=696

 Score = 45.1 bits (105),  Expect = 9e-04, Method: Composition-based stats.
 Identities = 19/38 (50%), Positives = 26/38 (68%), Gaps = 0/38 (0%)
 Frame = +1

Query  4    KECPGSSWIELEKAIHQFSACDNYHPASHEIYSLLDGL  117
            ++ PG SW+EL+  +H+F   D  HP S+EIYS LD L
Sbjct  559  QKTPGCSWVELKGVVHEFHVGDISHPLSNEIYSKLDEL  596



>ref|XP_007203303.1| hypothetical protein PRUPE_ppa025850mg, partial [Prunus persica]
 gb|EMJ04502.1| hypothetical protein PRUPE_ppa025850mg, partial [Prunus persica]
Length=554

 Score = 45.1 bits (105),  Expect = 9e-04, Method: Composition-based stats.
 Identities = 17/38 (45%), Positives = 26/38 (68%), Gaps = 0/38 (0%)
 Frame = +1

Query  4    KECPGSSWIELEKAIHQFSACDNYHPASHEIYSLLDGL  117
            K+ PG +WIE++   +QFS  D  HP S +IY++L+ L
Sbjct  417  KKVPGLTWIEVDNKTYQFSTGDRIHPQSEKIYAMLESL  454



>ref|XP_010461159.1| PREDICTED: pentatricopeptide repeat-containing protein At1g33350-like 
[Camelina sativa]
 ref|XP_010461160.1| PREDICTED: pentatricopeptide repeat-containing protein At1g33350-like 
[Camelina sativa]
 ref|XP_010461161.1| PREDICTED: pentatricopeptide repeat-containing protein At1g33350-like 
[Camelina sativa]
Length=540

 Score = 45.1 bits (105),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 18/37 (49%), Positives = 26/37 (70%), Gaps = 0/37 (0%)
 Frame = +1

Query  7    ECPGSSWIELEKAIHQFSACDNYHPASHEIYSLLDGL  117
            + PG SWIE+++ +HQF + D  HP + EIY +LD L
Sbjct  501  KTPGCSWIEIDEEVHQFYSLDKSHPKNIEIYMMLDSL  537



>ref|XP_010529708.1| PREDICTED: pentatricopeptide repeat-containing protein At1g33350 
[Tarenaya hassleriana]
Length=557

 Score = 45.1 bits (105),  Expect = 0.001, Method: Composition-based stats.
 Identities = 17/35 (49%), Positives = 24/35 (69%), Gaps = 0/35 (0%)
 Frame = +1

Query  13   PGSSWIELEKAIHQFSACDNYHPASHEIYSLLDGL  117
            PG SWIE++  +HQF + D  HP + EIY +L+ L
Sbjct  514  PGCSWIEIDNRVHQFYSLDKSHPKTEEIYFILESL  548



>ref|XP_010261461.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At3g49142 [Nelumbo nucifera]
Length=680

 Score = 45.1 bits (105),  Expect = 0.001, Method: Composition-based stats.
 Identities = 21/40 (53%), Positives = 25/40 (63%), Gaps = 0/40 (0%)
 Frame = +1

Query  4    KECPGSSWIELEKAIHQFSACDNYHPASHEIYSLLDGLFG  123
            K+ PG S +EL   +H F A DN HP S EIY+ LD L G
Sbjct  543  KKLPGCSNVELSDRVHTFLAGDNSHPQSKEIYAELDVLLG  582



>ref|NP_193861.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana]
 sp|Q9STE1.1|PP333_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At4g21300 
[Arabidopsis thaliana]
 emb|CAA20195.1| putative protein [Arabidopsis thaliana]
 emb|CAB79129.1| putative protein [Arabidopsis thaliana]
 gb|AEE84437.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana]
Length=857

 Score = 45.1 bits (105),  Expect = 0.001, Method: Composition-based stats.
 Identities = 20/40 (50%), Positives = 25/40 (63%), Gaps = 0/40 (0%)
 Frame = +1

Query  4    KECPGSSWIELEKAIHQFSACDNYHPASHEIYSLLDGLFG  123
            ++ PG SWIE+ K  H F + D  HP S  IYSLL+ L G
Sbjct  778  QKIPGYSWIEINKRTHLFVSGDVNHPESSHIYSLLNSLLG  817



>ref|XP_002272240.1| PREDICTED: pentatricopeptide repeat-containing protein At3g14730 
[Vitis vinifera]
Length=629

 Score = 45.1 bits (105),  Expect = 0.001, Method: Composition-based stats.
 Identities = 17/38 (45%), Positives = 25/38 (66%), Gaps = 0/38 (0%)
 Frame = +1

Query  4    KECPGSSWIELEKAIHQFSACDNYHPASHEIYSLLDGL  117
            ++ PG SWIEL+  +H F + D  HP +H IY+ L+ L
Sbjct  579  RKTPGCSWIELKNGVHVFVSADRAHPEAHSIYAGLNSL  616



Lambda      K        H        a         alpha
   0.317    0.136    0.444    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 516678285084