BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c59854_g1_i1 len=133 path=[111:0-132]

Length=133
                                                                      Score     E

ref|WP_035800933.1|  hypothetical protein                             54.3    7e-08   
ref|WP_029550481.1|  hypothetical protein                             51.6    7e-07   
ref|WP_031904853.1|  hypothetical protein                             51.2    8e-07   
ref|WP_040839527.1|  hypothetical protein                             50.8    8e-07   
gb|KAK63114.1|  hypothetical protein AZ22_5162                        49.7    1e-06   
gb|KAK59965.1|  hypothetical protein AZ22_5144                        50.1    2e-06   
ref|WP_026060796.1|  hypothetical protein                             49.3    2e-06   
gb|EAZ87917.1|  hypothetical protein CY0110_00940                     48.5    6e-06   Cyanothece sp. CCY0110
ref|WP_029550482.1|  hypothetical protein                             48.9    6e-06   
ref|WP_029550601.1|  hypothetical protein                             48.5    9e-06   
ref|WP_029550480.1|  hypothetical protein                             47.8    2e-05   
gb|KAK63108.1|  hypothetical protein AZ22_5165                        47.0    2e-05   
ref|WP_001846539.1|  hypothetical protein                             47.0    3e-05   
gb|ERK45529.1|  hypothetical protein HMPREF0495_00278                 46.2    3e-05   
ref|WP_029264640.1|  hypothetical protein                             46.6    3e-05   
gb|EGV91139.1|  hypothetical protein I79_026279                       45.8    4e-05   
gb|KAK63118.1|  hypothetical protein AZ22_5166                        46.2    4e-05   
ref|WP_032635473.1|  hypothetical protein                             45.8    5e-05   
ref|WP_029550600.1|  hypothetical protein                             45.4    6e-05   
ref|WP_029264639.1|  hypothetical protein                             45.4    6e-05   
ref|WP_004195543.1|  hypothetical protein                             45.8    7e-05   
ref|WP_021664619.1|  hypothetical protein                             45.4    8e-05   
ref|WP_026017095.1|  hypothetical protein                             45.4    9e-05   
gb|ERJ77556.1|  hypothetical protein HMPREF1557_00734                 44.3    1e-04   
gb|KAK63113.1|  hypothetical protein AZ22_5161                        44.3    1e-04   
ref|WP_021665556.1|  hypothetical protein                             43.9    2e-04   
gb|EMP35162.1|  hypothetical protein UY3_07672                        44.3    3e-04   
ref|WP_029401717.1|  hypothetical protein                             43.1    6e-04   
gb|KAK63107.1|  hypothetical protein AZ22_5158                        42.4    7e-04   
gb|KAK63112.1|  hypothetical protein AZ22_5169                        42.0    9e-04   
gb|KAK63110.1|  hypothetical protein AZ22_5164                        42.0    0.001   



>ref|WP_035800933.1| hypothetical protein [Cyanothece sp. CCY0110]
Length=119

 Score = 54.3 bits (129),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 27/41 (66%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = -1

Query  133  IKWTLMESSSIGIEWNH*MDSNGIITKYNQKKSSNGFE*NH  11
            IKWT MESSS GI+WNH MD+N II ++N+ +SSNG E NH
Sbjct  52   IKWTRMESSSSGIKWNHRMDTNQIIVEWNRMESSNGLEGNH  92


 Score = 50.4 bits (119),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 29/44 (66%), Positives = 35/44 (80%), Gaps = 1/44 (2%)
 Frame = -2

Query  132  LNGL*WNHHRLE*NGIIEWTPMESSPNIIKRNHQMDSNRII-EW  4
            LNGL  NH R+E NGII+WT MESS + IK NH+MD+N+II EW
Sbjct  36   LNGLKRNHRRMELNGIIKWTRMESSSSGIKWNHRMDTNQIIVEW  79


 Score = 46.2 bits (108),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 25/41 (61%), Positives = 33/41 (80%), Gaps = 1/41 (2%)
 Frame = -3

Query  128  MDSNGIIIDWNRMESLNGLQWNHHQI*SKE-IIKWIRIESS  9
            MD+N II++WNRMES NGL+ NH+Q+   E II+W R+ESS
Sbjct  70   MDTNQIIVEWNRMESSNGLEGNHYQMELNEIIIEWSRMESS  110


 Score = 45.4 bits (106),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/40 (58%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = -3

Query  128  MDSNGIIIDWNRMESLNGLQWNHHQI*SKEIIKWIRIESS  9
            + SNG+II WNR+E+LNGL+ NH ++    IIKW R+ESS
Sbjct  21   ISSNGVIIIWNRVEALNGLKRNHRRMELNGIIKWTRMESS  60



>ref|WP_029550481.1| hypothetical protein [Staphylococcus aureus]
Length=127

 Score = 51.6 bits (122),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 30/44 (68%), Positives = 35/44 (80%), Gaps = 2/44 (5%)
 Frame = -2

Query  129  NGL*WNHHRLE*NGI-IEWTPMESSPNIIKRNHQMDSNRIIEWT  1
            NG  WNH R+E NGI IEWT MES+ N IKRN++M+S RIIEWT
Sbjct  22   NGKEWNH-RIESNGINIEWTRMESTSNGIKRNYRMESKRIIEWT  64



>ref|WP_031904853.1| hypothetical protein, partial [Staphylococcus aureus]
Length=126

 Score = 51.2 bits (121),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 30/44 (68%), Positives = 36/44 (82%), Gaps = 2/44 (5%)
 Frame = -2

Query  129  NGL*WNHHRLE*NGII-EWTPMESSPNIIKRNHQMDSNRIIEWT  1
            NG+ WNH R+E NGII EWT MES+ N IKRN++M+S RIIEWT
Sbjct  22   NGMEWNH-RIESNGIIIEWTRMESTSNGIKRNYRMESKRIIEWT  64


 Score = 42.7 bits (99),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 25/43 (58%), Positives = 35/43 (81%), Gaps = 2/43 (5%)
 Frame = -3

Query  128  MDSNGIIIDWNRMESL-NGLQWNHHQI*SKEIIKWIRIESSNG  3
            ++SNGIII+W RMES  NG++ N +++ SK II+W R+ESSNG
Sbjct  30   IESNGIIIEWTRMESTSNGIKRN-YRMESKRIIEWTRMESSNG  71



>ref|WP_040839527.1| hypothetical protein, partial [Nocardia brevicatena]
Length=94

 Score = 50.8 bits (120),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 29/44 (66%), Positives = 35/44 (80%), Gaps = 2/44 (5%)
 Frame = -2

Query  129  NGL*WNHHRLE*NGII-EWTPMESSPNIIKRNHQMDSNRIIEWT  1
            NG+ WNH R+E NGII EW  MES+PN  KRN++M+S RIIEWT
Sbjct  22   NGMEWNH-RIESNGIIIEWNRMESTPNGKKRNYRMESKRIIEWT  64


 Score = 45.8 bits (107),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 24/45 (53%), Positives = 37/45 (82%), Gaps = 1/45 (2%)
 Frame = -1

Query  133  IKWTLMESSSIGIEWNH*MDSNGIITKYNQKKSS-NGFE*NHRMD  2
            I+W+ MESSS G+EWNH ++SNGII ++N+ +S+ NG + N+RM+
Sbjct  12   IEWSRMESSSNGMEWNHRIESNGIIIEWNRMESTPNGKKRNYRME  56


 Score = 45.4 bits (106),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 23/42 (55%), Positives = 33/42 (79%), Gaps = 0/42 (0%)
 Frame = -3

Query  128  MDSNGIIIDWNRMESLNGLQWNHHQI*SKEIIKWIRIESSNG  3
            ++SNGIII+WNRMES    +  ++++ SK II+W R+ESSNG
Sbjct  30   IESNGIIIEWNRMESTPNGKKRNYRMESKRIIEWTRMESSNG  71



>gb|KAK63114.1| hypothetical protein AZ22_5162 [Bordetella bronchiseptica 980-2]
Length=48

 Score = 49.7 bits (117),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 28/43 (65%), Positives = 34/43 (79%), Gaps = 1/43 (2%)
 Frame = -2

Query  129  NGL*WNHHRLE*NGIIEWTPMESSPNIIKRNHQMDSNR-IIEW  4
            NGL WNHH++E NGIIEWT ++SS N I+ NH+MDS   IIEW
Sbjct  5    NGLEWNHHQVESNGIIEWTRIKSSLNGIEWNHRMDSKGIIIEW  47



>gb|KAK59965.1| hypothetical protein AZ22_5144 [Bordetella bronchiseptica 980-2]
Length=95

 Score = 50.1 bits (118),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 27/41 (66%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = -1

Query  133  IKWTLMESSSIGIEWNH*MDSNGIITKYNQKKSSNGFE*NH  11
            I+WT MESSS GI+WNH MDSN II K N+ +S NG E NH
Sbjct  20   IEWTRMESSSNGIKWNHQMDSNEIIIKRNRMESLNGMEWNH  60


 Score = 47.8 bits (112),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = -3

Query  128  MDSNGIIIDWNRMESLNGLQWNHHQI*SKEIIKWIRIESS  9
            MDSN III  NRMESLNG++WNHH + +  I +W R+ SS
Sbjct  38   MDSNEIIIKRNRMESLNGMEWNHHGMETNGITEWTRMGSS  77


 Score = 46.2 bits (108),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 22/23 (96%), Positives = 22/23 (96%), Gaps = 0/23 (0%)
 Frame = -2

Query  69  MESSPNIIKRNHQMDSNRIIEWT  1
           MESSPNIIK NHQMDSNRIIEWT
Sbjct  1   MESSPNIIKSNHQMDSNRIIEWT  23


 Score = 43.1 bits (100),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 24/41 (59%), Positives = 28/41 (68%), Gaps = 0/41 (0%)
 Frame = -2

Query  132  LNGL*WNHHRLE*NGIIEWTPMESSPNIIKRNHQMDSNRII  10
            LNG+ WNHH +E NGI EWT M SS N I+ NH M+   II
Sbjct  53   LNGMEWNHHGMETNGITEWTRMGSSSNGIEWNHLMNLKGII  93


 Score = 43.1 bits (100),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 23/33 (70%), Positives = 26/33 (79%), Gaps = 0/33 (0%)
 Frame = -2

Query  108  HRLE*NGIIEWTPMESSPNIIKRNHQMDSNRII  10
            H+++ N IIEWT MESS N IK NHQMDSN II
Sbjct  12   HQMDSNRIIEWTRMESSSNGIKWNHQMDSNEII  44



>ref|WP_026060796.1| hypothetical protein, partial [Vibrio vulnificus]
Length=68

 Score = 49.3 bits (116),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 28/44 (64%), Positives = 34/44 (77%), Gaps = 2/44 (5%)
 Frame = -2

Query  129  NGL*WNHHRLE*NGII-EWTPMESSPNIIKRNHQMDSNRIIEWT  1
            NG+ WNH R+E NGII EW  MES+ N  KRN++M+S RIIEWT
Sbjct  22   NGMEWNH-RIESNGIIIEWNRMESTSNGKKRNYRMESKRIIEWT  64


 Score = 47.0 bits (110),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/45 (56%), Positives = 37/45 (82%), Gaps = 1/45 (2%)
 Frame = -1

Query  133  IKWTLMESSSIGIEWNH*MDSNGIITKYNQKKS-SNGFE*NHRMD  2
            I+W+ MESSS G+EWNH ++SNGII ++N+ +S SNG + N+RM+
Sbjct  12   IEWSRMESSSNGMEWNHRIESNGIIIEWNRMESTSNGKKRNYRME  56



>gb|EAZ87917.1| hypothetical protein CY0110_00940 [Cyanothece sp. CCY0110]
Length=82

 Score = 48.5 bits (114),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 27/41 (66%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = -1

Query  133  IKWTLMESSSIGIEWNH*MDSNGIITKYNQKKSSNGFE*NH  11
            I+WT MESSS GI+WNH MDSN II K N+ +S NG E NH
Sbjct  7    IEWTRMESSSNGIKWNHQMDSNEIIIKRNRMESLNGKEWNH  47


 Score = 44.7 bits (104),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 28/40 (70%), Gaps = 0/40 (0%)
 Frame = -3

Query  128  MDSNGIIIDWNRMESLNGLQWNHHQI*SKEIIKWIRIESS  9
            MDSN III  NRMESLNG +WNHH +    I +W R+ SS
Sbjct  25   MDSNEIIIKRNRMESLNGKEWNHHGMEMNGITEWTRMGSS  64



>ref|WP_029550482.1| hypothetical protein, partial [Staphylococcus aureus]
Length=126

 Score = 48.9 bits (115),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 27/43 (63%), Positives = 34/43 (79%), Gaps = 1/43 (2%)
 Frame = -1

Query  127  WTLMESSSIGIEWNH*MDSNGIITKYNQ-KKSSNGFE*NHRMD  2
            WT M+SSS GIEWNH MDSNGII + N+ + SS+G E NH+M+
Sbjct  78   WTRMQSSSNGIEWNHRMDSNGIIIERNRMESSSDGNEWNHQME  120


 Score = 46.6 bits (109),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 25/45 (56%), Positives = 37/45 (82%), Gaps = 1/45 (2%)
 Frame = -1

Query  133  IKWTLMESSSIGIEWNH*MDSNGIITKYNQKKS-SNGFE*NHRMD  2
            I+W+ MESSS G+EWNH ++SNGII ++N+ +S SNG + N+RM+
Sbjct  12   IEWSRMESSSNGMEWNHRIESNGIIIEWNRMESTSNGKKRNYRME  56


 Score = 43.9 bits (102),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 27/44 (61%), Positives = 33/44 (75%), Gaps = 2/44 (5%)
 Frame = -2

Query  129  NGL*WNHHRLE*NGII-EWTPMESSPNIIKRNHQMDSNRIIEWT  1
            NG+ WNH R+E NGII EW  MES+ N  KRN++M+S RIIE T
Sbjct  22   NGMEWNH-RIESNGIIIEWNRMESTSNGKKRNYRMESKRIIERT  64



>ref|WP_029550601.1| hypothetical protein, partial [Staphylococcus aureus]
Length=125

 Score = 48.5 bits (114),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 28/44 (64%), Positives = 34/44 (77%), Gaps = 2/44 (5%)
 Frame = -2

Query  129  NGL*WNHHRLE*NGII-EWTPMESSPNIIKRNHQMDSNRIIEWT  1
            NG+ WNH R+E NGII EW  MES+ N  KRN++M+S RIIEWT
Sbjct  22   NGMEWNH-RIESNGIIIEWNRMESTSNGKKRNYRMESKRIIEWT  64


 Score = 46.2 bits (108),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 25/45 (56%), Positives = 37/45 (82%), Gaps = 1/45 (2%)
 Frame = -1

Query  133  IKWTLMESSSIGIEWNH*MDSNGIITKYNQKKS-SNGFE*NHRMD  2
            I+W+ MESSS G+EWNH ++SNGII ++N+ +S SNG + N+RM+
Sbjct  12   IEWSRMESSSNGMEWNHRIESNGIIIEWNRMESTSNGKKRNYRME  56


 Score = 45.8 bits (107),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 28/44 (64%), Positives = 34/44 (77%), Gaps = 2/44 (5%)
 Frame = -1

Query  127  WTLMESSSIGIEWNH*MDSNGIITKYNQ-KKSSNGFE*N-HRMD  2
            WT M+SSS GIEWNH MDSNGII + N+ + SS+G E N HRM+
Sbjct  78   WTRMQSSSNGIEWNHRMDSNGIIIERNRMESSSDGNEWNHHRME  121


 Score = 45.8 bits (107),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 23/42 (55%), Positives = 34/42 (81%), Gaps = 0/42 (0%)
 Frame = -3

Query  128  MDSNGIIIDWNRMESLNGLQWNHHQI*SKEIIKWIRIESSNG  3
            ++SNGIII+WNRMES +  +  ++++ SK II+W R+ESSNG
Sbjct  30   IESNGIIIEWNRMESTSNGKKRNYRMESKRIIEWTRMESSNG  71



>ref|WP_029550480.1| hypothetical protein, partial [Staphylococcus aureus]
Length=155

 Score = 47.8 bits (112),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/42 (60%), Positives = 33/42 (79%), Gaps = 1/42 (2%)
 Frame = -3

Query  128  MDSNGIIIDWNRMESLNGLQWNHHQI*SKEIIKWIRIESSNG  3
            MDSNGII+ WNRME  N ++WN +++ S  II+W R+ESSNG
Sbjct  109  MDSNGIILKWNRMELSNAIEWN-YRMQSNRIIEWTRMESSNG  149


 Score = 45.4 bits (106),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 28/45 (62%), Positives = 34/45 (76%), Gaps = 2/45 (4%)
 Frame = -2

Query  132  LNGL*WNHHRLE*NGI-IEWTPMESSPNIIKRNHQMDSNRIIEWT  1
            LNG+ WNHH++E NGI IEW  M+ S N I+ NH+MD N IIEWT
Sbjct  26   LNGIEWNHHQMEMNGIVIEWNRMD-SLNGIRWNHRMDWNGIIEWT  69



>gb|KAK63108.1| hypothetical protein AZ22_5165 [Bordetella bronchiseptica 980-2]
Length=87

 Score = 47.0 bits (110),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 27/44 (61%), Positives = 33/44 (75%), Gaps = 1/44 (2%)
 Frame = -1

Query  133  IKWTLMESSSIGIEWNH*MDSNGIITKYNQKKSSNGFE*NHRMD  2
            I+WT ME SS GIEWN+ M SNGII + N+ +SS G E NHRM+
Sbjct  32   IEWTQMELSSNGIEWNYRMQSNGII-ECNRIESSKGLEWNHRME  74


 Score = 44.3 bits (103),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/45 (53%), Positives = 33/45 (73%), Gaps = 1/45 (2%)
 Frame = -1

Query  133  IKWTLMESSSIGIEWNH*MDSNGIITKYNQKK-SSNGFE*NHRMD  2
            I+W+ +ES S GIEWNH ++SNG I ++ Q + SSNG E N+RM 
Sbjct  7    IEWSRLESLSNGIEWNHRIESNGTIIEWTQMELSSNGIEWNYRMQ  51



>ref|WP_001846539.1| hypothetical protein [Streptococcus pneumoniae]
 gb|ELU74445.1| hypothetical protein PNI0010_02364 [Streptococcus pneumoniae 
PNI0010]
Length=127

 Score = 47.0 bits (110),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 28/44 (64%), Positives = 33/44 (75%), Gaps = 2/44 (5%)
 Frame = -2

Query  129  NGL*WNHHRLE*NGII-EWTPMESSPNIIKRNHQMDSNRIIEWT  1
            NG+ WNH R E NGII EW  MES+ N  KRN++M+S RIIEWT
Sbjct  22   NGMEWNH-RKESNGIIIEWNRMESTSNGKKRNYRMESKRIIEWT  64


 Score = 45.4 bits (106),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 23/41 (56%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = -3

Query  125  DSNGIIIDWNRMESLNGLQWNHHQI*SKEIIKWIRIESSNG  3
            +SNGIII+WNRMES +  +  ++++ SK II+W R+ESSNG
Sbjct  31   ESNGIIIEWNRMESTSNGKKRNYRMESKRIIEWTRMESSNG  71


 Score = 43.9 bits (102),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 27/44 (61%), Positives = 34/44 (77%), Gaps = 2/44 (5%)
 Frame = -1

Query  127  WTLMESSSIGIEWNH*MDSNGIITKYNQKKSS-NGFE*N-HRMD  2
            WT M+SSS GIEWNH +DSNGII + N+ +SS +G E N HRM+
Sbjct  78   WTRMQSSSNGIEWNHRIDSNGIIIERNRMESSLDGNEWNHHRME  121


 Score = 43.9 bits (102),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 24/45 (53%), Positives = 36/45 (80%), Gaps = 1/45 (2%)
 Frame = -1

Query  133  IKWTLMESSSIGIEWNH*MDSNGIITKYNQKKS-SNGFE*NHRMD  2
            I+W+ +ESSS G+EWNH  +SNGII ++N+ +S SNG + N+RM+
Sbjct  12   IEWSRIESSSNGMEWNHRKESNGIIIEWNRMESTSNGKKRNYRME  56



>gb|ERK45529.1| hypothetical protein HMPREF0495_00278 [Lactobacillus brevis ATCC 
14869 = DSM 20054]
Length=60

 Score = 46.2 bits (108),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 25/40 (63%), Positives = 30/40 (75%), Gaps = 1/40 (3%)
 Frame = -3

Query  128  MDSNGIIIDWNRMESLNGLQWNHHQI*SKEIIKWIRIESS  9
            MDS+ II  WN+MES NGL+WNH    S EII+W R+ESS
Sbjct  1    MDSSRIIFKWNQMESSNGLEWNHWMY-SNEIIEWTRMESS  39



>ref|WP_029264640.1| hypothetical protein [Staphylococcus aureus]
 gb|ETO03479.1| hypothetical protein RFI_33928 [Reticulomyxa filosa]
Length=127

 Score = 46.6 bits (109),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 28/44 (64%), Positives = 33/44 (75%), Gaps = 2/44 (5%)
 Frame = -2

Query  129  NGL*WNHHRLE*NGII-EWTPMESSPNIIKRNHQMDSNRIIEWT  1
            NG  WNH R+E NGII EW  MES+ N  KRN++M+S RIIEWT
Sbjct  22   NGKEWNH-RIESNGIIIEWNRMESTSNGKKRNYRMESKRIIEWT  64


 Score = 45.8 bits (107),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 28/44 (64%), Positives = 34/44 (77%), Gaps = 2/44 (5%)
 Frame = -1

Query  127  WTLMESSSIGIEWNH*MDSNGIITKYNQ-KKSSNGFE*N-HRMD  2
            WT M+SSS GIEWNH MDSNGII + N+ + SS+G E N HRM+
Sbjct  78   WTRMQSSSNGIEWNHRMDSNGIIIERNRMESSSDGNEWNHHRME  121


 Score = 45.8 bits (107),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 23/42 (55%), Positives = 34/42 (81%), Gaps = 0/42 (0%)
 Frame = -3

Query  128  MDSNGIIIDWNRMESLNGLQWNHHQI*SKEIIKWIRIESSNG  3
            ++SNGIII+WNRMES +  +  ++++ SK II+W R+ESSNG
Sbjct  30   IESNGIIIEWNRMESTSNGKKRNYRMESKRIIEWTRMESSNG  71


 Score = 44.7 bits (104),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/45 (56%), Positives = 36/45 (80%), Gaps = 1/45 (2%)
 Frame = -1

Query  133  IKWTLMESSSIGIEWNH*MDSNGIITKYNQKKS-SNGFE*NHRMD  2
            I+W+ MESSS G EWNH ++SNGII ++N+ +S SNG + N+RM+
Sbjct  12   IEWSRMESSSNGKEWNHRIESNGIIIEWNRMESTSNGKKRNYRME  56



>gb|EGV91139.1| hypothetical protein I79_026279 [Cricetulus griseus]
Length=62

 Score = 45.8 bits (107),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 26/41 (63%), Positives = 31/41 (76%), Gaps = 1/41 (2%)
 Frame = -1

Query  130  KWTLMESSSIGIEWNH*MDSNGIITKYNQ-KKSSNGFE*NH  11
             WT M+SSS GIEWNH MDSNGII + N+ + SS+G E NH
Sbjct  12   PWTRMQSSSNGIEWNHRMDSNGIIIERNRMESSSDGNEWNH  52



>gb|KAK63118.1| hypothetical protein AZ22_5166 [Bordetella bronchiseptica 980-2]
Length=81

 Score = 46.2 bits (108),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 28/45 (62%), Positives = 34/45 (76%), Gaps = 2/45 (4%)
 Frame = -2

Query  132  LNGL*WNHHRLE*NGI-IEWTPMESSPNIIKRNHQMDSNRIIEWT  1
            LNG+ WNHH++E NGI IEW  M+ S N I+ NH+MD N IIEWT
Sbjct  34   LNGIEWNHHQMEMNGIVIEWNRMD-SLNGIRWNHRMDWNGIIEWT  77


 Score = 42.7 bits (99),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 23/38 (61%), Positives = 30/38 (79%), Gaps = 1/38 (3%)
 Frame = -3

Query  113  IIIDWNRMESLNGLQWNHHQI*SKEI-IKWIRIESSNG  3
            III+WNRM SLNG++WNHHQ+    I I+W R++S NG
Sbjct  24   IIIEWNRMVSLNGIEWNHHQMEMNGIVIEWNRMDSLNG  61



>ref|WP_032635473.1| hypothetical protein, partial [Pseudomonas syringae]
Length=67

 Score = 45.8 bits (107),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 26/41 (63%), Positives = 31/41 (76%), Gaps = 1/41 (2%)
 Frame = -1

Query  130  KWTLMESSSIGIEWNH*MDSNGIITKYNQ-KKSSNGFE*NH  11
             WT M+SSS GIEWNH MDSNGII + N+ + SS+G E NH
Sbjct  17   PWTRMQSSSNGIEWNHRMDSNGIIIERNRMESSSDGNEWNH  57



>ref|WP_029550600.1| hypothetical protein, partial [Staphylococcus aureus]
Length=66

 Score = 45.4 bits (106),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 28/45 (62%), Positives = 34/45 (76%), Gaps = 2/45 (4%)
 Frame = -1

Query  130  KWTLMESSSIGIEWNH*MDSNGIITKYNQ-KKSSNGFE*N-HRMD  2
             WT M+SSS GIEWNH MDSNGII + N+ + SS+G E N HRM+
Sbjct  16   PWTRMQSSSNGIEWNHRMDSNGIIIERNRMESSSDGNEWNHHRME  60



>ref|WP_029264639.1| hypothetical protein, partial [Staphylococcus aureus]
Length=70

 Score = 45.4 bits (106),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 28/45 (62%), Positives = 34/45 (76%), Gaps = 2/45 (4%)
 Frame = -1

Query  130  KWTLMESSSIGIEWNH*MDSNGIITKYNQ-KKSSNGFE*N-HRMD  2
             WT M+SSS GIEWNH MDSNGII + N+ + SS+G E N HRM+
Sbjct  20   PWTRMQSSSNGIEWNHRMDSNGIIIERNRMESSSDGNEWNHHRME  64



>ref|WP_004195543.1| hypothetical protein [Klebsiella pneumoniae]
 gb|EMH93478.1| hypothetical protein MTE1_5898 [Klebsiella pneumoniae JHCK1]
Length=127

 Score = 45.8 bits (107),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 28/44 (64%), Positives = 34/44 (77%), Gaps = 2/44 (5%)
 Frame = -1

Query  127  WTLMESSSIGIEWNH*MDSNGIITKYNQ-KKSSNGFE*N-HRMD  2
            WT M+SSS GIEWNH MDSNGII + N+ + SS+G E N HRM+
Sbjct  78   WTRMQSSSNGIEWNHRMDSNGIIIERNRMESSSDGNEWNHHRME  121


 Score = 43.9 bits (102),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 27/44 (61%), Positives = 32/44 (73%), Gaps = 2/44 (5%)
 Frame = -2

Query  129  NGL*WNHHRLE*NGII-EWTPMESSPNIIKRNHQMDSNRIIEWT  1
            NG  WNH R+E NGII EW  M S+ N  KRN++M+S RIIEWT
Sbjct  22   NGKEWNH-RIESNGIIIEWNRMVSTSNGKKRNYRMESKRIIEWT  64


 Score = 43.5 bits (101),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 25/45 (56%), Positives = 35/45 (78%), Gaps = 1/45 (2%)
 Frame = -1

Query  133  IKWTLMESSSIGIEWNH*MDSNGIITKYNQKKS-SNGFE*NHRMD  2
            I+W+ MESSS G EWNH ++SNGII ++N+  S SNG + N+RM+
Sbjct  12   IEWSRMESSSNGKEWNHRIESNGIIIEWNRMVSTSNGKKRNYRME  56


 Score = 42.7 bits (99),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 22/42 (52%), Positives = 33/42 (79%), Gaps = 0/42 (0%)
 Frame = -3

Query  128  MDSNGIIIDWNRMESLNGLQWNHHQI*SKEIIKWIRIESSNG  3
            ++SNGIII+WNRM S +  +  ++++ SK II+W R+ESSNG
Sbjct  30   IESNGIIIEWNRMVSTSNGKKRNYRMESKRIIEWTRMESSNG  71



>ref|WP_021664619.1| hypothetical protein, partial [Porphyromonas gingivalis]
 gb|ERJ71642.1| hypothetical protein HMPREF1554_00035, partial [Porphyromonas 
gingivalis F0569]
Length=103

 Score = 45.4 bits (106),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 28/44 (64%), Positives = 34/44 (77%), Gaps = 2/44 (5%)
 Frame = -1

Query  127  WTLMESSSIGIEWNH*MDSNGIITKYNQ-KKSSNGFE*N-HRMD  2
            WT M+SSS GIEWNH MDSNGII + N+ + SS+G E N HRM+
Sbjct  54   WTRMQSSSNGIEWNHRMDSNGIIIERNRMESSSDGNEWNHHRME  97


 Score = 45.4 bits (106),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 23/42 (55%), Positives = 34/42 (81%), Gaps = 0/42 (0%)
 Frame = -3

Query  128  MDSNGIIIDWNRMESLNGLQWNHHQI*SKEIIKWIRIESSNG  3
            ++SNGIII+WNRMES +  +  ++++ SK II+W R+ESSNG
Sbjct  6    IESNGIIIEWNRMESTSNGKKRNYRMESKRIIEWTRMESSNG  47


 Score = 44.3 bits (103),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 26/40 (65%), Positives = 31/40 (78%), Gaps = 2/40 (5%)
 Frame = -2

Query  117  WNHHRLE*NGII-EWTPMESSPNIIKRNHQMDSNRIIEWT  1
            WNH R+E NGII EW  MES+ N  KRN++M+S RIIEWT
Sbjct  2    WNH-RIESNGIIIEWNRMESTSNGKKRNYRMESKRIIEWT  40



>ref|WP_026017095.1| hypothetical protein, partial [Lactobacillus rossiae]
Length=131

 Score = 45.4 bits (106),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 28/45 (62%), Positives = 34/45 (76%), Gaps = 2/45 (4%)
 Frame = -2

Query  132  LNGL*WNHHRLE*NGI-IEWTPMESSPNIIKRNHQMDSNRIIEWT  1
            LNG+ WNHH++E NGI IEW  M+ S N I+ NH+MD N IIEWT
Sbjct  34   LNGIEWNHHQMEMNGIVIEWNRMD-SLNGIRWNHRMDWNGIIEWT  77



>gb|ERJ77556.1| hypothetical protein HMPREF1557_00734 [Streptococcus sobrinus 
W1703]
Length=46

 Score = 44.3 bits (103),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 24/41 (59%), Positives = 28/41 (68%), Gaps = 0/41 (0%)
 Frame = -2

Query  132  LNGL*WNHHRLE*NGIIEWTPMESSPNIIKRNHQMDSNRII  10
            LNG+ WNHH +E NGI EWT M SS N I+ NH M+   II
Sbjct  4    LNGMEWNHHGMETNGITEWTRMGSSSNGIEWNHLMNLKGII  44



>gb|KAK63113.1| hypothetical protein AZ22_5161 [Bordetella bronchiseptica 980-2]
Length=49

 Score = 44.3 bits (103),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/42 (55%), Positives = 31/42 (74%), Gaps = 1/42 (2%)
 Frame = -3

Query  128  MDSNGIIIDWNRMESLNGLQWNHHQI*SKEIIKWIRIESSNG  3
            M SNG+I +WNR+ES NG + N H++ S  II+W R+ESSN 
Sbjct  1    MGSNGVI-EWNRVESSNGFEQNQHRMESNGIIEWTRMESSNA  41



>ref|WP_021665556.1| hypothetical protein [Porphyromonas gingivalis]
 gb|ERJ68953.1| hypothetical protein HMPREF1555_00133 [Porphyromonas gingivalis 
F0570]
Length=50

 Score = 43.9 bits (102),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 22/32 (69%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = -1

Query  127  WTLMESSSIGIEWNH*MDSNGIITKYNQKKSS  32
            WT M+SSS GIEWNH MDSNGII + N+ +SS
Sbjct  7    WTRMQSSSNGIEWNHRMDSNGIIIERNRMESS  38



>gb|EMP35162.1| hypothetical protein UY3_07672 [Chelonia mydas]
Length=131

 Score = 44.3 bits (103),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = -2

Query  117  WNHHRLE*NGIIEWTPMESSPNIIKRNHQMDSNRIIEW  4
            + + +++ NGIIE TPMES+ N   RN QMDSN IIEW
Sbjct  93   YRNDQMDSNGIIECTPMESTSNGPYRNDQMDSNGIIEW  130



>ref|WP_029401717.1| hypothetical protein [Mycobacterium tuberculosis]
Length=82

 Score = 43.1 bits (100),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 24/44 (55%), Positives = 32/44 (73%), Gaps = 1/44 (2%)
 Frame = -1

Query  133  IKWTLMESSSIGIEWNH*MDSNGIITKYNQKKSSNGFE*NHRMD  2
            I+W  MESS+ G+EWNH M SNGII + N+  SSNG + N+ M+
Sbjct  8    IEWNRMESSN-GLEWNHLMHSNGIIIECNRMDSSNGIKWNNEME  50


 Score = 42.7 bits (99),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 24/42 (57%), Positives = 31/42 (74%), Gaps = 0/42 (0%)
 Frame = -3

Query  128  MDSNGIIIDWNRMESLNGLQWNHHQI*SKEIIKWIRIESSNG  3
            M SNGIII+ NRM+S NG++WN+    +  IIKW R+ES NG
Sbjct  25   MHSNGIIIECNRMDSSNGIKWNNEMESNGIIIKWNRMESLNG  66



>gb|KAK63107.1| hypothetical protein AZ22_5158 [Bordetella bronchiseptica 980-2]
Length=48

 Score = 42.4 bits (98),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 22/41 (54%), Positives = 29/41 (71%), Gaps = 0/41 (0%)
 Frame = -1

Query  133  IKWTLMESSSIGIEWNH*MDSNGIITKYNQKKSSNGFE*NH  11
             +W  +ESSS G+E N+ MD NGII ++N  +SSNG E NH
Sbjct  7    FEWIRLESSSNGLELNYRMDLNGIIIEWNPMESSNGIEWNH  47



>gb|KAK63112.1| hypothetical protein AZ22_5169 [Bordetella bronchiseptica 980-2]
Length=38

 Score = 42.0 bits (97),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 22/35 (63%), Positives = 29/35 (83%), Gaps = 1/35 (3%)
 Frame = -3

Query  128  MDSNGIIIDWNRMESLNGLQWNHHQI*SKE-IIKW  27
            M+SNGIII+WNRMES +G++WN+ Q+ S   IIKW
Sbjct  1    MNSNGIIIEWNRMESSSGIEWNYDQMESNVIIIKW  35



>gb|KAK63110.1| hypothetical protein AZ22_5164 [Bordetella bronchiseptica 980-2]
Length=38

 Score = 42.0 bits (97),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 23/31 (74%), Positives = 25/31 (81%), Gaps = 1/31 (3%)
 Frame = -2

Query  93  NGIIEWTPMESSPNIIKRNHQMDSNR-IIEW  4
           NGIIEWT MESS N I+ NHQM+SN  IIEW
Sbjct  4   NGIIEWTRMESSSNEIECNHQMESNGIIIEW  34



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 525112096184