BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c59528_g1_i1 len=113 path=[1:0-112]

Length=113
                                                                      Score     E

ref|XP_006354435.1|  PREDICTED: U-box domain-containing protein 7...  63.9    2e-10   
ref|XP_004247768.1|  PREDICTED: U-box domain-containing protein 72    63.9    2e-10   
ref|XP_011091239.1|  PREDICTED: pre-mRNA-processing factor 19-like    63.2    3e-10   
ref|XP_009759669.1|  PREDICTED: U-box domain-containing protein 7...  62.8    4e-10   
ref|XP_009759668.1|  PREDICTED: U-box domain-containing protein 7...  62.8    4e-10   
ref|XP_009775901.1|  PREDICTED: pre-mRNA-processing factor 19 hom...  63.2    4e-10   
ref|XP_009759666.1|  PREDICTED: U-box domain-containing protein 7...  63.2    4e-10   
ref|XP_009759667.1|  PREDICTED: U-box domain-containing protein 7...  63.2    4e-10   
ref|XP_009598907.1|  PREDICTED: U-box domain-containing protein 7...  62.8    4e-10   
gb|EYU43746.1|  hypothetical protein MIMGU_mgv1a004422mg              62.8    5e-10   
ref|XP_009594705.1|  PREDICTED: U-box domain-containing protein 7...  59.7    5e-09   
ref|XP_009594697.1|  PREDICTED: U-box domain-containing protein 7...  59.7    5e-09   
ref|XP_009594689.1|  PREDICTED: pre-mRNA-processing factor 19 hom...  59.7    5e-09   
ref|XP_002311694.1|  transducin family protein                        59.7    6e-09   Populus trichocarpa [western balsam poplar]
gb|KDP33313.1|  hypothetical protein JCGZ_12862                       59.7    7e-09   
ref|XP_002528359.1|  Pre-mRNA-splicing factor, putative               58.5    2e-08   Ricinus communis
gb|KDO43336.1|  hypothetical protein CISIN_1g009763mg                 58.2    2e-08   
ref|XP_006420336.1|  hypothetical protein CICLE_v10004724mg           58.2    2e-08   
gb|KDO43335.1|  hypothetical protein CISIN_1g009763mg                 58.2    2e-08   
gb|KHN24878.1|  U-box domain-containing protein 72                    58.2    2e-08   
ref|XP_003555746.1|  PREDICTED: U-box domain-containing protein 72    58.2    2e-08   
ref|XP_011029750.1|  PREDICTED: pre-mRNA-processing factor 19 hom...  57.8    3e-08   
gb|KCW60228.1|  hypothetical protein EUGRSUZ_H02940                   57.0    3e-08   
gb|AFK34753.1|  unknown                                               57.4    3e-08   
ref|XP_011013445.1|  PREDICTED: pre-mRNA-processing factor 19-like    57.0    4e-08   
gb|EPS73033.1|  hypothetical protein M569_01722                       57.0    5e-08   
ref|XP_010023847.1|  PREDICTED: pre-mRNA-processing factor 19 hom...  57.0    5e-08   
ref|XP_011041438.1|  PREDICTED: pre-mRNA-processing factor 19 hom...  57.0    5e-08   
ref|XP_003535988.1|  PREDICTED: U-box domain-containing protein 7...  57.0    5e-08   
emb|CDO99306.1|  unnamed protein product                              57.0    6e-08   
ref|XP_004959003.1|  PREDICTED: uncharacterized protein LOC101786798  57.0    6e-08   
ref|XP_010276202.1|  PREDICTED: U-box domain-containing protein 7...  56.2    1e-07   
ref|XP_002285452.1|  PREDICTED: pre-mRNA-processing factor 19         56.2    1e-07   Vitis vinifera
ref|XP_003574025.1|  PREDICTED: U-box domain-containing protein 72    56.2    1e-07   
ref|XP_002314503.2|  transducin family protein                        55.8    1e-07   Populus trichocarpa [western balsam poplar]
gb|AFK41051.1|  unknown                                               55.5    2e-07   
ref|XP_009411388.1|  PREDICTED: U-box domain-containing protein 72    55.5    2e-07   
ref|XP_003590128.1|  Pre-mRNA-processing factor-like protein          55.5    2e-07   
ref|XP_010542962.1|  PREDICTED: pre-mRNA-processing factor 19 hom...  55.5    2e-07   
ref|XP_007145817.1|  hypothetical protein PHAVU_007G270500g           55.1    2e-07   
ref|XP_009382203.1|  PREDICTED: U-box domain-containing protein 7...  55.1    2e-07   
ref|XP_007035246.1|  MOS4-associated complex 3A                       55.1    2e-07   
gb|KHG28464.1|  Pre-mRNA-processing factor 19 -like protein           55.1    3e-07   
ref|XP_006342411.1|  PREDICTED: LOW QUALITY PROTEIN: pre-mRNA-pro...  54.7    3e-07   
ref|XP_006854430.1|  hypothetical protein AMTR_s00039p00212570        54.7    3e-07   
gb|KHG10431.1|  Pre-mRNA-processing factor 19 -like protein           54.3    5e-07   
gb|ADE76270.1|  unknown                                               53.9    6e-07   
gb|ADE75987.1|  unknown                                               53.9    6e-07   
ref|XP_009334193.1|  PREDICTED: U-box domain-containing protein 7...  53.9    6e-07   
ref|XP_008362339.1|  PREDICTED: U-box domain-containing protein 7...  53.9    6e-07   
gb|EMS65878.1|  U-box domain-containing protein 72                    53.5    9e-07   
ref|XP_001754673.1|  predicted protein                                53.5    1e-06   
ref|XP_001763879.1|  predicted protein                                53.1    1e-06   
ref|XP_008340660.1|  PREDICTED: U-box domain-containing protein 7...  53.1    1e-06   
ref|XP_009357977.1|  PREDICTED: U-box domain-containing protein 7...  52.8    1e-06   
ref|XP_010089218.1|  U-box domain-containing protein 72               53.1    1e-06   
ref|XP_008353197.1|  PREDICTED: LOW QUALITY PROTEIN: U-box domain...  52.8    1e-06   
ref|XP_004296409.1|  PREDICTED: U-box domain-containing protein 7...  52.4    2e-06   
ref|XP_006661845.1|  PREDICTED: U-box domain-containing protein 7...  52.0    3e-06   
ref|XP_004172951.1|  PREDICTED: U-box domain-containing protein 7...  50.8    4e-06   
ref|XP_008801251.1|  PREDICTED: U-box domain-containing protein 7...  51.2    5e-06   
ref|XP_010469491.1|  PREDICTED: pre-mRNA-processing factor 19 hom...  51.2    5e-06   
ref|XP_009143870.1|  PREDICTED: pre-mRNA-processing factor 19 hom...  51.2    5e-06   
ref|XP_010469490.1|  PREDICTED: pre-mRNA-processing factor 19 hom...  51.2    5e-06   
ref|XP_010509903.1|  PREDICTED: pre-mRNA-processing factor 19 hom...  51.2    5e-06   
ref|XP_010413887.1|  PREDICTED: pre-mRNA-processing factor 19 hom...  51.2    6e-06   
ref|XP_006294009.1|  hypothetical protein CARUB_v10022997mg           51.2    6e-06   
ref|XP_010413886.1|  PREDICTED: pre-mRNA-processing factor 19 hom...  51.2    6e-06   
emb|CDY19484.1|  BnaC04g11150D                                        51.2    6e-06   
gb|AAL92025.1|AF484839_1  PRP-like protein                            49.7    6e-06   Marsilea vestita
ref|XP_010934240.1|  PREDICTED: pre-mRNA-processing factor 19-like    50.8    6e-06   
ref|XP_004134043.1|  PREDICTED: U-box domain-containing protein 7...  50.8    7e-06   
ref|XP_009141306.1|  PREDICTED: pre-mRNA-processing factor 19 hom...  50.8    7e-06   
ref|XP_008438467.1|  PREDICTED: U-box domain-containing protein 72    50.8    7e-06   
emb|CDY37731.1|  BnaA04g19370D                                        50.8    7e-06   
ref|XP_007221798.1|  hypothetical protein PRUPE_ppa003451mg           50.8    7e-06   
ref|NP_850206.4|  U-box protein MAC3B                                 50.8    7e-06   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001031471.1|  U-box protein MAC3B                              50.8    7e-06   Arabidopsis thaliana [mouse-ear cress]
emb|CDY23752.1|  BnaC04g43700D                                        50.8    8e-06   
ref|XP_003558846.1|  PREDICTED: U-box domain-containing protein 7...  50.8    8e-06   
ref|NP_001064804.1|  Os10g0466300                                     50.4    9e-06   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010522453.1|  PREDICTED: pre-mRNA-processing factor 19 hom...  50.4    9e-06   
ref|XP_010670940.1|  PREDICTED: pre-mRNA-processing factor 19         50.4    1e-05   
ref|XP_002881277.1|  transducin family protein                        50.4    1e-05   
ref|XP_006410472.1|  hypothetical protein EUTSA_v10016510mg           50.4    1e-05   
ref|XP_008245266.1|  PREDICTED: U-box domain-containing protein 7...  50.4    1e-05   
ref|XP_006410473.1|  hypothetical protein EUTSA_v10016510mg           50.4    1e-05   
ref|XP_002961116.1|  ubiquitin-protein ligase, PUB59                  50.1    1e-05   
ref|XP_002966895.1|  ubiquitin-protein ligase, PUB59                  50.1    1e-05   
gb|EMS55665.1|  U-box domain-containing protein 72                    50.1    1e-05   
ref|XP_010920296.1|  PREDICTED: pre-mRNA-processing factor 19-like    49.3    2e-05   
ref|XP_010457499.1|  PREDICTED: pre-mRNA-processing factor 19 hom...  49.3    3e-05   
ref|XP_010483893.1|  PREDICTED: pre-mRNA-processing factor 19 hom...  49.3    3e-05   
ref|XP_008785160.1|  PREDICTED: U-box domain-containing protein 7...  49.3    3e-05   
ref|XP_010475111.1|  PREDICTED: pre-mRNA-processing factor 19 hom...  48.9    3e-05   
ref|XP_006307243.1|  hypothetical protein CARUB_v10008852mg           48.9    3e-05   
ref|XP_004497808.1|  PREDICTED: pre-mRNA-processing factor 19 hom...  48.9    3e-05   
gb|AGH13207.1|  PUB1                                                  48.5    4e-05   
dbj|BAD94465.1|  putative pre-mRNA splicing factor PRP19              48.1    5e-05   Arabidopsis thaliana [mouse-ear cress]
gb|EMT10525.1|  DEAD-box ATP-dependent RNA helicase 29                48.5    5e-05   
ref|NP_563708.1|  MOS4-associated complex 3A                          48.1    6e-05   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002464506.1|  hypothetical protein SORBIDRAFT_01g019790        48.1    6e-05   Sorghum bicolor [broomcorn]
ref|NP_001150622.1|  pre-mRNA-splicing factor 19                      48.1    6e-05   Zea mays [maize]
ref|XP_006418122.1|  hypothetical protein EUTSA_v10007366mg           48.1    6e-05   
ref|XP_002889510.1|  transducin family protein                        48.1    6e-05   
ref|NP_001030958.1|  MOS4-associated complex 3A                       48.1    6e-05   Arabidopsis thaliana [mouse-ear cress]
emb|CDY15510.1|  BnaA08g27940D                                        48.1    6e-05   
gb|AFW68634.1|  hypothetical protein ZEAMMB73_254634                  48.1    6e-05   
emb|CDX86629.1|  BnaC08g00740D                                        48.1    6e-05   
emb|CDY18239.1|  BnaC05g02620D                                        48.1    6e-05   
ref|XP_009111097.1|  PREDICTED: LOW QUALITY PROTEIN: pre-mRNA-pro...  48.1    7e-05   
ref|XP_009119290.1|  PREDICTED: pre-mRNA-processing factor 19 hom...  48.1    7e-05   
emb|CDX89818.1|  BnaA10g02640D                                        48.1    7e-05   
ref|NP_001130751.1|  uncharacterized protein LOC100191855             48.1    7e-05   Zea mays [maize]
emb|CBJ28011.1|  conserved unknown protein                            47.8    9e-05   
gb|KFK42789.1|  hypothetical protein AALP_AA1G039400                  47.4    1e-04   
gb|KFK42788.1|  hypothetical protein AALP_AA1G039400                  47.4    1e-04   
ref|XP_004982929.1|  PREDICTED: U-box domain-containing protein 7...  46.2    3e-04   
gb|ETO14092.1|  hypothetical protein RFI_23277                        46.2    3e-04   
gb|ETO23622.1|  hypothetical protein RFI_13557                        45.4    3e-04   
ref|XP_002109371.1|  conserved hypothetical protein                   45.4    4e-04   Trichoplax adhaerens
gb|ETO07197.1|  G-protein beta WD-40 repeats containing protein       46.2    4e-04   
gb|EJW79081.1|  WD repeat protein 5                                   44.7    4e-04   
ref|XP_002500695.1|  COMPASS/Set1C complex protein                    45.4    6e-04   Micromonas commoda
gb|ETO30665.1|  WD repeat-containing protein                          45.1    6e-04   
ref|WP_028978428.1|  hypothetical protein                             45.4    7e-04   
emb|CCG82860.1|  Ribosome biogenesis protein Sqt1                     45.1    7e-04   
ref|WP_017747107.1|  hypothetical protein                             45.4    7e-04   
gb|ETO36626.1|  Pfs, NACHT and WD domain protein                      45.1    7e-04   
dbj|GAL86316.1|  peptidase C14, caspase catalytic subunit p20, pu...  45.1    8e-04   
ref|XP_001897052.1|  Will die slowly protein                          44.3    0.001   Brugia malayi [agent of lymphatic filariasis]



>ref|XP_006354435.1| PREDICTED: U-box domain-containing protein 72-like [Solanum tuberosum]
Length=521

 Score = 63.9 bits (154),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 30/36 (83%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = -2

Query  112  ISTLSGHSKRVTNVKFAVEGEVVVTSSADETVRVWQ  5
            ISTLSGHSKRVT+VKFA EGE+VV+ SAD+TVRVWQ
Sbjct  257  ISTLSGHSKRVTSVKFAAEGELVVSGSADKTVRVWQ  292



>ref|XP_004247768.1| PREDICTED: U-box domain-containing protein 72 [Solanum lycopersicum]
Length=521

 Score = 63.9 bits (154),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 30/36 (83%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = -2

Query  112  ISTLSGHSKRVTNVKFAVEGEVVVTSSADETVRVWQ  5
            ISTLSGHSKRVT+VKFA EGE+VV+ SAD+TVRVWQ
Sbjct  257  ISTLSGHSKRVTSVKFAAEGELVVSGSADKTVRVWQ  292



>ref|XP_011091239.1| PREDICTED: pre-mRNA-processing factor 19-like [Sesamum indicum]
Length=525

 Score = 63.2 bits (152),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 29/37 (78%), Positives = 35/37 (95%), Gaps = 0/37 (0%)
 Frame = -2

Query  112  ISTLSGHSKRVTNVKFAVEGEVVVTSSADETVRVWQG  2
            +STLSGHSK+VT+VKFA EGE+VVT SAD+TVRVW+G
Sbjct  259  VSTLSGHSKKVTSVKFAAEGELVVTGSADKTVRVWRG  295



>ref|XP_009759669.1| PREDICTED: U-box domain-containing protein 72-like isoform X4 
[Nicotiana sylvestris]
Length=452

 Score = 62.8 bits (151),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 28/36 (78%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = -2

Query  112  ISTLSGHSKRVTNVKFAVEGEVVVTSSADETVRVWQ  5
            +STLSGHSKRVT+++FA EGE+VVT SAD+TVRVWQ
Sbjct  188  VSTLSGHSKRVTSIRFAAEGELVVTGSADKTVRVWQ  223



>ref|XP_009759668.1| PREDICTED: U-box domain-containing protein 72-like isoform X3 
[Nicotiana sylvestris]
Length=486

 Score = 62.8 bits (151),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 28/36 (78%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = -2

Query  112  ISTLSGHSKRVTNVKFAVEGEVVVTSSADETVRVWQ  5
            +STLSGHSKRVT+++FA EGE+VVT SAD+TVRVWQ
Sbjct  222  VSTLSGHSKRVTSIRFAAEGELVVTGSADKTVRVWQ  257



>ref|XP_009775901.1| PREDICTED: pre-mRNA-processing factor 19 homolog 1-like [Nicotiana 
sylvestris]
Length=521

 Score = 63.2 bits (152),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 30/36 (83%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = -2

Query  112  ISTLSGHSKRVTNVKFAVEGEVVVTSSADETVRVWQ  5
            ISTLSGHSKRVT+VKFA EGE+VV+ SAD+TVRVWQ
Sbjct  257  ISTLSGHSKRVTSVKFASEGELVVSGSADKTVRVWQ  292



>ref|XP_009759666.1| PREDICTED: U-box domain-containing protein 72-like isoform X1 
[Nicotiana sylvestris]
Length=523

 Score = 63.2 bits (152),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 28/36 (78%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = -2

Query  112  ISTLSGHSKRVTNVKFAVEGEVVVTSSADETVRVWQ  5
            +STLSGHSKRVT+++FA EGE+VVT SAD+TVRVWQ
Sbjct  259  VSTLSGHSKRVTSIRFAAEGELVVTGSADKTVRVWQ  294



>ref|XP_009759667.1| PREDICTED: U-box domain-containing protein 72-like isoform X2 
[Nicotiana sylvestris]
Length=521

 Score = 63.2 bits (152),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 28/36 (78%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = -2

Query  112  ISTLSGHSKRVTNVKFAVEGEVVVTSSADETVRVWQ  5
            +STLSGHSKRVT+++FA EGE+VVT SAD+TVRVWQ
Sbjct  257  VSTLSGHSKRVTSIRFAAEGELVVTGSADKTVRVWQ  292



>ref|XP_009598907.1| PREDICTED: U-box domain-containing protein 72-like, partial [Nicotiana 
tomentosiformis]
Length=453

 Score = 62.8 bits (151),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 30/36 (83%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = -2

Query  112  ISTLSGHSKRVTNVKFAVEGEVVVTSSADETVRVWQ  5
            ISTLSGHSKRVT+VKFA EGE+VV+ SAD+TVRVWQ
Sbjct  189  ISTLSGHSKRVTSVKFASEGELVVSGSADKTVRVWQ  224



>gb|EYU43746.1| hypothetical protein MIMGU_mgv1a004422mg [Erythranthe guttata]
Length=528

 Score = 62.8 bits (151),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 28/37 (76%), Positives = 35/37 (95%), Gaps = 0/37 (0%)
 Frame = -2

Query  112  ISTLSGHSKRVTNVKFAVEGEVVVTSSADETVRVWQG  2
            +STLSGHSK+VT++KFA EGEVVVT SAD+TVR+W+G
Sbjct  259  VSTLSGHSKKVTSIKFAAEGEVVVTGSADKTVRLWRG  295



>ref|XP_009594705.1| PREDICTED: U-box domain-containing protein 72-like isoform X3 
[Nicotiana tomentosiformis]
Length=451

 Score = 59.7 bits (143),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 28/36 (78%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = -2

Query  112  ISTLSGHSKRVTNVKFAVEGEVVVTSSADETVRVWQ  5
            +STLSGHSKRVT+V+FA EGE+VVT SAD+TV VWQ
Sbjct  187  VSTLSGHSKRVTSVRFAAEGELVVTGSADKTVCVWQ  222



>ref|XP_009594697.1| PREDICTED: U-box domain-containing protein 72-like isoform X2 
[Nicotiana tomentosiformis]
Length=485

 Score = 59.7 bits (143),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 28/36 (78%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = -2

Query  112  ISTLSGHSKRVTNVKFAVEGEVVVTSSADETVRVWQ  5
            +STLSGHSKRVT+V+FA EGE+VVT SAD+TV VWQ
Sbjct  221  VSTLSGHSKRVTSVRFAAEGELVVTGSADKTVCVWQ  256



>ref|XP_009594689.1| PREDICTED: pre-mRNA-processing factor 19 homolog 1-like isoform 
X1 [Nicotiana tomentosiformis]
Length=522

 Score = 59.7 bits (143),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 28/36 (78%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = -2

Query  112  ISTLSGHSKRVTNVKFAVEGEVVVTSSADETVRVWQ  5
            +STLSGHSKRVT+V+FA EGE+VVT SAD+TV VWQ
Sbjct  258  VSTLSGHSKRVTSVRFAAEGELVVTGSADKTVCVWQ  293



>ref|XP_002311694.1| transducin family protein [Populus trichocarpa]
 gb|EEE89061.1| transducin family protein [Populus trichocarpa]
Length=524

 Score = 59.7 bits (143),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 26/37 (70%), Positives = 32/37 (86%), Gaps = 0/37 (0%)
 Frame = -2

Query  112  ISTLSGHSKRVTNVKFAVEGEVVVTSSADETVRVWQG  2
            +STLSGHSK+VT+VKF  EGE  +T SAD+T+RVWQG
Sbjct  259  VSTLSGHSKKVTSVKFVAEGEFFLTGSADKTIRVWQG  295



>gb|KDP33313.1| hypothetical protein JCGZ_12862 [Jatropha curcas]
Length=529

 Score = 59.7 bits (143),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 26/37 (70%), Positives = 33/37 (89%), Gaps = 0/37 (0%)
 Frame = -2

Query  112  ISTLSGHSKRVTNVKFAVEGEVVVTSSADETVRVWQG  2
            +STLSGHSK+VT+VKF  EG++ +T SAD+TVRVWQG
Sbjct  259  VSTLSGHSKKVTSVKFVAEGDLFLTGSADKTVRVWQG  295



>ref|XP_002528359.1| Pre-mRNA-splicing factor, putative [Ricinus communis]
 gb|EEF34031.1| Pre-mRNA-splicing factor, putative [Ricinus communis]
Length=531

 Score = 58.5 bits (140),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 25/37 (68%), Positives = 33/37 (89%), Gaps = 0/37 (0%)
 Frame = -2

Query  112  ISTLSGHSKRVTNVKFAVEGEVVVTSSADETVRVWQG  2
            +STLSGHSK+VT+V+F  EG++ +T SAD+TVRVWQG
Sbjct  259  LSTLSGHSKKVTSVRFVAEGDLFLTGSADKTVRVWQG  295



>gb|KDO43336.1| hypothetical protein CISIN_1g009763mg [Citrus sinensis]
Length=504

 Score = 58.2 bits (139),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 25/37 (68%), Positives = 33/37 (89%), Gaps = 0/37 (0%)
 Frame = -2

Query  112  ISTLSGHSKRVTNVKFAVEGEVVVTSSADETVRVWQG  2
            ++TLSGHSK+VT+VKF  EG++ +T SAD+TVRVWQG
Sbjct  258  VTTLSGHSKKVTSVKFVTEGDLFLTGSADKTVRVWQG  294



>ref|XP_006420336.1| hypothetical protein CICLE_v10004724mg [Citrus clementina]
 ref|XP_006489640.1| PREDICTED: pre-mRNA-processing factor 19 homolog 2-like [Citrus 
sinensis]
 gb|ESR33576.1| hypothetical protein CICLE_v10004724mg [Citrus clementina]
 gb|KDO43334.1| hypothetical protein CISIN_1g009763mg [Citrus sinensis]
Length=526

 Score = 58.2 bits (139),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 25/37 (68%), Positives = 33/37 (89%), Gaps = 0/37 (0%)
 Frame = -2

Query  112  ISTLSGHSKRVTNVKFAVEGEVVVTSSADETVRVWQG  2
            ++TLSGHSK+VT+VKF  EG++ +T SAD+TVRVWQG
Sbjct  258  VTTLSGHSKKVTSVKFVTEGDLFLTGSADKTVRVWQG  294



>gb|KDO43335.1| hypothetical protein CISIN_1g009763mg [Citrus sinensis]
Length=490

 Score = 58.2 bits (139),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 25/37 (68%), Positives = 33/37 (89%), Gaps = 0/37 (0%)
 Frame = -2

Query  112  ISTLSGHSKRVTNVKFAVEGEVVVTSSADETVRVWQG  2
            ++TLSGHSK+VT+VKF  EG++ +T SAD+TVRVWQG
Sbjct  222  VTTLSGHSKKVTSVKFVTEGDLFLTGSADKTVRVWQG  258



>gb|KHN24878.1| U-box domain-containing protein 72 [Glycine soja]
Length=525

 Score = 58.2 bits (139),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 25/37 (68%), Positives = 33/37 (89%), Gaps = 0/37 (0%)
 Frame = -2

Query  112  ISTLSGHSKRVTNVKFAVEGEVVVTSSADETVRVWQG  2
            +STLSGHSK+VT+VKF  +GE  +T+SAD+TVR+WQG
Sbjct  259  LSTLSGHSKKVTSVKFVAQGESFLTASADKTVRLWQG  295



>ref|XP_003555746.1| PREDICTED: U-box domain-containing protein 72 [Glycine max]
Length=525

 Score = 58.2 bits (139),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 25/37 (68%), Positives = 33/37 (89%), Gaps = 0/37 (0%)
 Frame = -2

Query  112  ISTLSGHSKRVTNVKFAVEGEVVVTSSADETVRVWQG  2
            +STLSGHSK+VT+VKF  +GE  +T+SAD+TVR+WQG
Sbjct  259  LSTLSGHSKKVTSVKFVAQGESFLTASADKTVRLWQG  295



>ref|XP_011029750.1| PREDICTED: pre-mRNA-processing factor 19 homolog 2-like isoform 
X1 [Populus euphratica]
 ref|XP_011029751.1| PREDICTED: pre-mRNA-processing factor 19 homolog 2-like isoform 
X2 [Populus euphratica]
Length=524

 Score = 57.8 bits (138),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 26/37 (70%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = -2

Query  112  ISTLSGHSKRVTNVKFAVEGEVVVTSSADETVRVWQG  2
            +STLSGHSK+VT+VKF  EGE  +T S D+TVRVWQG
Sbjct  259  VSTLSGHSKKVTSVKFVAEGEFFLTGSVDKTVRVWQG  295



>gb|KCW60228.1| hypothetical protein EUGRSUZ_H02940 [Eucalyptus grandis]
Length=382

 Score = 57.0 bits (136),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 24/37 (65%), Positives = 33/37 (89%), Gaps = 0/37 (0%)
 Frame = -2

Query  112  ISTLSGHSKRVTNVKFAVEGEVVVTSSADETVRVWQG  2
            +STLSGHSK+VT+V F  +G++V+T SAD+TVR+WQG
Sbjct  117  MSTLSGHSKKVTSVNFDAQGDMVLTGSADKTVRIWQG  153



>gb|AFK34753.1| unknown [Lotus japonicus]
Length=453

 Score = 57.4 bits (137),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 24/37 (65%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = -2

Query  112  ISTLSGHSKRVTNVKFAVEGEVVVTSSADETVRVWQG  2
            ++TLSGHSK+VT+VKF  +G+ ++TSSAD+TVR+WQG
Sbjct  186  LATLSGHSKKVTSVKFVAQGDSLLTSSADKTVRLWQG  222



>ref|XP_011013445.1| PREDICTED: pre-mRNA-processing factor 19-like [Populus euphratica]
Length=432

 Score = 57.0 bits (136),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 26/36 (72%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = -2

Query  109  STLSGHSKRVTNVKFAVEGEVVVTSSADETVRVWQG  2
            S LSGHSK+VT+VKF  EGE  +T SAD+TVRVWQG
Sbjct  219  SALSGHSKKVTSVKFVAEGEFFLTGSADKTVRVWQG  254



>gb|EPS73033.1| hypothetical protein M569_01722, partial [Genlisea aurea]
Length=457

 Score = 57.0 bits (136),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 26/37 (70%), Positives = 32/37 (86%), Gaps = 0/37 (0%)
 Frame = -2

Query  112  ISTLSGHSKRVTNVKFAVEGEVVVTSSADETVRVWQG  2
            +STLSGHSK+VT+VKF  + E+VVT SAD+TVRVWQ 
Sbjct  271  VSTLSGHSKKVTSVKFVADSELVVTGSADKTVRVWQA  307



>ref|XP_010023847.1| PREDICTED: pre-mRNA-processing factor 19 homolog 1-like [Eucalyptus 
grandis]
 gb|KCW60227.1| hypothetical protein EUGRSUZ_H02940 [Eucalyptus grandis]
Length=524

 Score = 57.0 bits (136),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 24/37 (65%), Positives = 33/37 (89%), Gaps = 0/37 (0%)
 Frame = -2

Query  112  ISTLSGHSKRVTNVKFAVEGEVVVTSSADETVRVWQG  2
            +STLSGHSK+VT+V F  +G++V+T SAD+TVR+WQG
Sbjct  259  MSTLSGHSKKVTSVNFDAQGDMVLTGSADKTVRIWQG  295



>ref|XP_011041438.1| PREDICTED: pre-mRNA-processing factor 19 homolog 2-like [Populus 
euphratica]
Length=524

 Score = 57.0 bits (136),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 26/36 (72%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = -2

Query  109  STLSGHSKRVTNVKFAVEGEVVVTSSADETVRVWQG  2
            S LSGHSK+VT+VKF  EGE  +T SAD+TVRVWQG
Sbjct  260  SALSGHSKKVTSVKFVAEGEFFLTGSADKTVRVWQG  295



>ref|XP_003535988.1| PREDICTED: U-box domain-containing protein 72-like [Glycine max]
 gb|KHN41538.1| U-box domain-containing protein 72 [Glycine soja]
Length=525

 Score = 57.0 bits (136),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 24/37 (65%), Positives = 33/37 (89%), Gaps = 0/37 (0%)
 Frame = -2

Query  112  ISTLSGHSKRVTNVKFAVEGEVVVTSSADETVRVWQG  2
            ++TLSGHSK+VT+VKF  +GE  +T+SAD+TVR+WQG
Sbjct  259  LATLSGHSKKVTSVKFVAQGESFLTASADKTVRLWQG  295



>emb|CDO99306.1| unnamed protein product [Coffea canephora]
Length=531

 Score = 57.0 bits (136),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 23/37 (62%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = -2

Query  112  ISTLSGHSKRVTNVKFAVEGEVVVTSSADETVRVWQG  2
            +STLSGHS++VT+VKF  +GE++++ SAD+TVR+WQG
Sbjct  261  LSTLSGHSRKVTSVKFVADGELLLSGSADKTVRLWQG  297



>ref|XP_004959003.1| PREDICTED: uncharacterized protein LOC101786798 [Setaria italica]
Length=725

 Score = 57.0 bits (136),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 23/37 (62%), Positives = 33/37 (89%), Gaps = 0/37 (0%)
 Frame = -2

Query  112  ISTLSGHSKRVTNVKFAVEGEVVVTSSADETVRVWQG  2
            + TL+GHSK++T++KFA  GE++VT SAD+TVR+WQG
Sbjct  454  LCTLTGHSKKITSLKFANRGELIVTGSADKTVRIWQG  490



>ref|XP_010276202.1| PREDICTED: U-box domain-containing protein 72-like [Nelumbo nucifera]
Length=522

 Score = 56.2 bits (134),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 26/37 (70%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = -2

Query  112  ISTLSGHSKRVTNVKFAVEGEVVVTSSADETVRVWQG  2
            +STLSGHSK+VT+VKF    E+ VT SAD+TVRVWQG
Sbjct  258  LSTLSGHSKKVTSVKFVPRDELFVTGSADKTVRVWQG  294



>ref|XP_002285452.1| PREDICTED: pre-mRNA-processing factor 19 [Vitis vinifera]
 emb|CBI23714.3| unnamed protein product [Vitis vinifera]
Length=524

 Score = 56.2 bits (134),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 24/37 (65%), Positives = 33/37 (89%), Gaps = 0/37 (0%)
 Frame = -2

Query  112  ISTLSGHSKRVTNVKFAVEGEVVVTSSADETVRVWQG  2
            +STLSGHSK+VT+VKF  + ++ +T+SAD+TVRVWQG
Sbjct  259  LSTLSGHSKKVTSVKFVTQDDLFLTASADKTVRVWQG  295



>ref|XP_003574025.1| PREDICTED: U-box domain-containing protein 72 [Brachypodium distachyon]
Length=527

 Score = 56.2 bits (134),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 24/37 (65%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = -2

Query  112  ISTLSGHSKRVTNVKFAVEGEVVVTSSADETVRVWQG  2
            +STLSGHSK++T +KF    E+VVT SAD+TVR+WQG
Sbjct  256  LSTLSGHSKKITTLKFVPRDELVVTGSADKTVRIWQG  292



>ref|XP_002314503.2| transducin family protein [Populus trichocarpa]
 gb|EEF00674.2| transducin family protein [Populus trichocarpa]
Length=524

 Score = 55.8 bits (133),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 26/36 (72%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = -2

Query  109  STLSGHSKRVTNVKFAVEGEVVVTSSADETVRVWQG  2
            S LSGHSK+VT+VKF  EGE  +T SAD+TVRVWQG
Sbjct  260  SALSGHSKKVTSVKFVGEGEFFLTGSADKTVRVWQG  295



>gb|AFK41051.1| unknown [Medicago truncatula]
Length=521

 Score = 55.5 bits (132),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 23/37 (62%), Positives = 33/37 (89%), Gaps = 0/37 (0%)
 Frame = -2

Query  112  ISTLSGHSKRVTNVKFAVEGEVVVTSSADETVRVWQG  2
            ++TL+GHSK+VT+VKF  +GE ++T SAD+TVR+WQG
Sbjct  259  LATLTGHSKKVTSVKFVGQGESIITGSADKTVRLWQG  295



>ref|XP_009411388.1| PREDICTED: U-box domain-containing protein 72 [Musa acuminata 
subsp. malaccensis]
Length=526

 Score = 55.5 bits (132),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 25/37 (68%), Positives = 32/37 (86%), Gaps = 0/37 (0%)
 Frame = -2

Query  112  ISTLSGHSKRVTNVKFAVEGEVVVTSSADETVRVWQG  2
            +STLSGHSK+VT+VKF    E++VT S+D+TVRVWQG
Sbjct  257  LSTLSGHSKKVTSVKFVPGNELIVTGSSDKTVRVWQG  293



>ref|XP_003590128.1| Pre-mRNA-processing factor-like protein [Medicago truncatula]
 gb|AES60379.1| Pre-mRNA-processing factor [Medicago truncatula]
Length=519

 Score = 55.5 bits (132),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 23/37 (62%), Positives = 33/37 (89%), Gaps = 0/37 (0%)
 Frame = -2

Query  112  ISTLSGHSKRVTNVKFAVEGEVVVTSSADETVRVWQG  2
            ++TL+GHSK+VT+VKF  +GE ++T SAD+TVR+WQG
Sbjct  257  LATLTGHSKKVTSVKFVGQGESIITGSADKTVRLWQG  293



>ref|XP_010542962.1| PREDICTED: pre-mRNA-processing factor 19 homolog 1-like [Tarenaya 
hassleriana]
Length=522

 Score = 55.5 bits (132),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 24/37 (65%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = -2

Query  112  ISTLSGHSKRVTNVKFAVEGEVVVTSSADETVRVWQG  2
            +STLSGHSK+VT+VKF  + ++V+T+SAD+TVRVW+G
Sbjct  256  LSTLSGHSKKVTSVKFVADTDLVLTASADKTVRVWRG  292



>ref|XP_007145817.1| hypothetical protein PHAVU_007G270500g [Phaseolus vulgaris]
 gb|ESW17811.1| hypothetical protein PHAVU_007G270500g [Phaseolus vulgaris]
Length=525

 Score = 55.1 bits (131),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 24/36 (67%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = -2

Query  112  ISTLSGHSKRVTNVKFAVEGEVVVTSSADETVRVWQ  5
            +STLSGHSK+VT+VKF  +GE V+T S+D+TVR+WQ
Sbjct  259  LSTLSGHSKKVTSVKFVAQGESVLTGSSDKTVRLWQ  294



>ref|XP_009382203.1| PREDICTED: U-box domain-containing protein 72-like [Musa acuminata 
subsp. malaccensis]
Length=526

 Score = 55.1 bits (131),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 25/37 (68%), Positives = 32/37 (86%), Gaps = 0/37 (0%)
 Frame = -2

Query  112  ISTLSGHSKRVTNVKFAVEGEVVVTSSADETVRVWQG  2
            +STL+GHSK+VT+VKF    EV+VT S+D+TVRVWQG
Sbjct  257  LSTLAGHSKKVTSVKFVPGSEVIVTGSSDKTVRVWQG  293



>ref|XP_007035246.1| MOS4-associated complex 3A [Theobroma cacao]
 gb|EOY06172.1| MOS4-associated complex 3A [Theobroma cacao]
Length=523

 Score = 55.1 bits (131),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 23/37 (62%), Positives = 32/37 (86%), Gaps = 0/37 (0%)
 Frame = -2

Query  112  ISTLSGHSKRVTNVKFAVEGEVVVTSSADETVRVWQG  2
            +STLSGHSK+VT+VKF  + +V ++ SAD+TVR+WQG
Sbjct  258  LSTLSGHSKKVTSVKFVAQNDVFLSGSADKTVRIWQG  294



>gb|KHG28464.1| Pre-mRNA-processing factor 19 -like protein [Gossypium arboreum]
Length=524

 Score = 55.1 bits (131),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 23/37 (62%), Positives = 32/37 (86%), Gaps = 0/37 (0%)
 Frame = -2

Query  112  ISTLSGHSKRVTNVKFAVEGEVVVTSSADETVRVWQG  2
            +STLSGHSK+VT+VKF  + +V ++ SAD+TVR+WQG
Sbjct  258  LSTLSGHSKKVTSVKFVAQNDVFLSGSADKTVRIWQG  294



>ref|XP_006342411.1| PREDICTED: LOW QUALITY PROTEIN: pre-mRNA-processing factor 19 
homolog 1-like [Solanum tuberosum]
Length=521

 Score = 54.7 bits (130),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 27/36 (75%), Positives = 33/36 (92%), Gaps = 1/36 (3%)
 Frame = -2

Query  112  ISTLSGHSKRVTNVKFAVEGEVVVTSSADETVRVWQ  5
            +STLS HSK+VT+V+FA EGE+VVT SAD+TVRVWQ
Sbjct  258  VSTLS-HSKKVTSVRFAAEGELVVTGSADKTVRVWQ  292



>ref|XP_006854430.1| hypothetical protein AMTR_s00039p00212570 [Amborella trichopoda]
 gb|ERN15897.1| hypothetical protein AMTR_s00039p00212570 [Amborella trichopoda]
Length=534

 Score = 54.7 bits (130),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 25/37 (68%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = -2

Query  112  ISTLSGHSKRVTNVKFAVEGEVVVTSSADETVRVWQG  2
            +STLSGHSK+VT+VKF    E  V++SAD+TVRVWQG
Sbjct  259  LSTLSGHSKKVTSVKFVPRDEFFVSASADKTVRVWQG  295



>gb|KHG10431.1| Pre-mRNA-processing factor 19 -like protein [Gossypium arboreum]
Length=519

 Score = 54.3 bits (129),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 23/37 (62%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = -2

Query  112  ISTLSGHSKRVTNVKFAVEGEVVVTSSADETVRVWQG  2
            +STLSGHSK+VT+VKF    +V ++ SAD+TVR+WQG
Sbjct  254  LSTLSGHSKKVTSVKFVAHNDVFLSGSADKTVRIWQG  290



>gb|ADE76270.1| unknown [Picea sitchensis]
Length=523

 Score = 53.9 bits (128),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 23/37 (62%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = -2

Query  112  ISTLSGHSKRVTNVKFAVEGEVVVTSSADETVRVWQG  2
            ISTLSGH+KRVT+VKF    ++++T SAD+TVR+WQ 
Sbjct  260  ISTLSGHTKRVTSVKFVARDDLLLTGSADKTVRIWQA  296



>gb|ADE75987.1| unknown [Picea sitchensis]
Length=523

 Score = 53.9 bits (128),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 23/37 (62%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = -2

Query  112  ISTLSGHSKRVTNVKFAVEGEVVVTSSADETVRVWQG  2
            ISTLSGH+KRVT+VKF    ++++T SAD+TVR+WQ 
Sbjct  260  ISTLSGHTKRVTSVKFVARDDLLLTGSADKTVRIWQA  296



>ref|XP_009334193.1| PREDICTED: U-box domain-containing protein 72-like [Pyrus x bretschneideri]
 ref|XP_009334204.1| PREDICTED: U-box domain-containing protein 72-like [Pyrus x bretschneideri]
Length=520

 Score = 53.9 bits (128),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 23/37 (62%), Positives = 32/37 (86%), Gaps = 0/37 (0%)
 Frame = -2

Query  112  ISTLSGHSKRVTNVKFAVEGEVVVTSSADETVRVWQG  2
            ISTLSGHSK+VT+VKF  + ++ ++ SAD+TVR+WQG
Sbjct  256  ISTLSGHSKKVTSVKFVGQDDLFISGSADKTVRIWQG  292



>ref|XP_008362339.1| PREDICTED: U-box domain-containing protein 72-like [Malus domestica]
Length=521

 Score = 53.9 bits (128),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 23/37 (62%), Positives = 32/37 (86%), Gaps = 0/37 (0%)
 Frame = -2

Query  112  ISTLSGHSKRVTNVKFAVEGEVVVTSSADETVRVWQG  2
            ISTLSGHSK+VT+VKF  + ++ ++ SAD+TVR+WQG
Sbjct  256  ISTLSGHSKKVTSVKFVGQDDLFISGSADKTVRIWQG  292



>gb|EMS65878.1| U-box domain-containing protein 72 [Triticum urartu]
Length=619

 Score = 53.5 bits (127),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 22/37 (59%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = -2

Query  112  ISTLSGHSKRVTNVKFAVEGEVVVTSSADETVRVWQG  2
            + TL+GHSK++T +KF    E+VVT SAD+TVR+WQG
Sbjct  348  LCTLAGHSKKITTLKFVPRDELVVTGSADKTVRIWQG  384



>ref|XP_001754673.1| predicted protein [Physcomitrella patens]
 gb|EDQ80643.1| predicted protein [Physcomitrella patens]
Length=522

 Score = 53.5 bits (127),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 23/37 (62%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = -2

Query  112  ISTLSGHSKRVTNVKFAVEGEVVVTSSADETVRVWQG  2
            +STLSGHSKRVT+VKF  + E  +T S D+TV++WQG
Sbjct  259  VSTLSGHSKRVTSVKFVAKDECALTGSVDKTVKIWQG  295



>ref|XP_001763879.1| predicted protein [Physcomitrella patens]
 gb|EDQ71283.1| predicted protein [Physcomitrella patens]
Length=522

 Score = 53.1 bits (126),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 23/37 (62%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = -2

Query  112  ISTLSGHSKRVTNVKFAVEGEVVVTSSADETVRVWQG  2
            +STLSGH+KRVT+VKF  + E V+T S D+TV++WQG
Sbjct  259  VSTLSGHTKRVTSVKFVAKDEYVLTGSIDKTVKIWQG  295



>ref|XP_008340660.1| PREDICTED: U-box domain-containing protein 72 isoform X1 [Malus 
domestica]
Length=521

 Score = 53.1 bits (126),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 23/37 (62%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = -2

Query  112  ISTLSGHSKRVTNVKFAVEGEVVVTSSADETVRVWQG  2
            ISTLSGHSK+VT+VKF    ++ ++ SAD+TVR+WQG
Sbjct  257  ISTLSGHSKKVTSVKFVGRDDMFISGSADKTVRIWQG  293



>ref|XP_009357977.1| PREDICTED: U-box domain-containing protein 72-like isoform X1 
[Pyrus x bretschneideri]
Length=521

 Score = 52.8 bits (125),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 23/37 (62%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = -2

Query  112  ISTLSGHSKRVTNVKFAVEGEVVVTSSADETVRVWQG  2
            ISTLSGHSK+VT+VKF    ++ ++ SAD+TVR+WQG
Sbjct  257  ISTLSGHSKKVTSVKFVGRDDMFISGSADKTVRIWQG  293



>ref|XP_010089218.1| U-box domain-containing protein 72 [Morus notabilis]
 gb|EXB37496.1| U-box domain-containing protein 72 [Morus notabilis]
Length=572

 Score = 53.1 bits (126),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 22/37 (59%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = -2

Query  112  ISTLSGHSKRVTNVKFAVEGEVVVTSSADETVRVWQG  2
            +STL+GHSK+VT+VKF    ++ +T SAD+TVR+WQG
Sbjct  307  LSTLNGHSKKVTSVKFVAPDDLFLTGSADKTVRIWQG  343



>ref|XP_008353197.1| PREDICTED: LOW QUALITY PROTEIN: U-box domain-containing protein 
72-like [Malus domestica]
Length=472

 Score = 52.8 bits (125),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 23/37 (62%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = -2

Query  112  ISTLSGHSKRVTNVKFAVEGEVVVTSSADETVRVWQG  2
            ISTLSGHSK+VT+VKF    ++ ++ SAD+TVR+WQG
Sbjct  208  ISTLSGHSKKVTSVKFVGRDDMFISGSADKTVRIWQG  244



>ref|XP_004296409.1| PREDICTED: U-box domain-containing protein 72-like [Fragaria 
vesca subsp. vesca]
Length=523

 Score = 52.4 bits (124),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 23/37 (62%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = -2

Query  112  ISTLSGHSKRVTNVKFAVEGEVVVTSSADETVRVWQG  2
            +STL GHSK+VT+VKF     +V+T SAD+TVR+WQG
Sbjct  258  LSTLGGHSKKVTSVKFVGRDNLVITGSADKTVRIWQG  294



>ref|XP_006661845.1| PREDICTED: U-box domain-containing protein 72-like [Oryza brachyantha]
Length=481

 Score = 52.0 bits (123),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 21/37 (57%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = -2

Query  112  ISTLSGHSKRVTNVKFAVEGEVVVTSSADETVRVWQG  2
            + TL+GHSK++T++KF    E+ VT SAD+TVR+WQG
Sbjct  210  LCTLTGHSKKITSLKFVPRDELFVTGSADKTVRIWQG  246



>ref|XP_004172951.1| PREDICTED: U-box domain-containing protein 72-like [Cucumis sativus]
Length=299

 Score = 50.8 bits (120),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 23/36 (64%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = -2

Query  112  ISTLSGHSKRVTNVKFAVEGEVVVTSSADETVRVWQ  5
            +STLSGHSK+VT+VKF    ++ +T SAD+TVRVWQ
Sbjct  34   LSTLSGHSKKVTSVKFVGRDDLFLTGSADKTVRVWQ  69



>ref|XP_008801251.1| PREDICTED: U-box domain-containing protein 72-like [Phoenix dactylifera]
Length=526

 Score = 51.2 bits (121),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 22/37 (59%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = -2

Query  112  ISTLSGHSKRVTNVKFAVEGEVVVTSSADETVRVWQG  2
            I TL+GHSK+VT+VKF    E+ ++ S D+TVRVWQG
Sbjct  257  ICTLTGHSKKVTSVKFVPRDELFISGSGDKTVRVWQG  293



>ref|XP_010469491.1| PREDICTED: pre-mRNA-processing factor 19 homolog 2-like isoform 
X2 [Camelina sativa]
Length=525

 Score = 51.2 bits (121),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 21/36 (58%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = -2

Query  112  ISTLSGHSKRVTNVKFAVEGEVVVTSSADETVRVWQ  5
            +STL+GHSK+VT+VKF  + ++V+T+SAD+TVR+W+
Sbjct  255  LSTLTGHSKKVTSVKFVGDADLVLTASADKTVRIWR  290



>ref|XP_009143870.1| PREDICTED: pre-mRNA-processing factor 19 homolog 2-like [Brassica 
rapa]
 emb|CDY17165.1| BnaA05g10230D [Brassica napus]
Length=525

 Score = 51.2 bits (121),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 22/36 (61%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = -2

Query  112  ISTLSGHSKRVTNVKFAVEGEVVVTSSADETVRVWQ  5
            +STL+GHSK+VT+VKF  + ++V+T+SAD+TVRVW+
Sbjct  257  LSTLTGHSKKVTSVKFVGDSDLVLTASADKTVRVWR  292



>ref|XP_010469490.1| PREDICTED: pre-mRNA-processing factor 19 homolog 2-like isoform 
X1 [Camelina sativa]
Length=527

 Score = 51.2 bits (121),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 21/36 (58%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = -2

Query  112  ISTLSGHSKRVTNVKFAVEGEVVVTSSADETVRVWQ  5
            +STL+GHSK+VT+VKF  + ++V+T+SAD+TVR+W+
Sbjct  257  LSTLTGHSKKVTSVKFVGDADLVLTASADKTVRIWR  292



>ref|XP_010509903.1| PREDICTED: pre-mRNA-processing factor 19 homolog 2 [Camelina 
sativa]
Length=527

 Score = 51.2 bits (121),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 21/36 (58%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = -2

Query  112  ISTLSGHSKRVTNVKFAVEGEVVVTSSADETVRVWQ  5
            +STL+GHSK+VT+VKF  + ++V+T+SAD+TVR+W+
Sbjct  257  LSTLTGHSKKVTSVKFVGDADLVLTASADKTVRIWR  292



>ref|XP_010413887.1| PREDICTED: pre-mRNA-processing factor 19 homolog 2-like isoform 
X2 [Camelina sativa]
Length=525

 Score = 51.2 bits (121),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 21/36 (58%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = -2

Query  112  ISTLSGHSKRVTNVKFAVEGEVVVTSSADETVRVWQ  5
            +STL+GHSK+VT+VKF  + ++V+T+SAD+TVR+W+
Sbjct  255  LSTLTGHSKKVTSVKFVGDADLVLTASADKTVRIWR  290



>ref|XP_006294009.1| hypothetical protein CARUB_v10022997mg [Capsella rubella]
 gb|EOA26907.1| hypothetical protein CARUB_v10022997mg [Capsella rubella]
Length=525

 Score = 51.2 bits (121),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 21/36 (58%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = -2

Query  112  ISTLSGHSKRVTNVKFAVEGEVVVTSSADETVRVWQ  5
            +STL+GHSK+VT+VKF  + ++V+T+SAD+TVR+W+
Sbjct  257  LSTLTGHSKKVTSVKFVGDADLVLTASADKTVRIWR  292



>ref|XP_010413886.1| PREDICTED: pre-mRNA-processing factor 19 homolog 2-like isoform 
X1 [Camelina sativa]
Length=527

 Score = 51.2 bits (121),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 21/36 (58%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = -2

Query  112  ISTLSGHSKRVTNVKFAVEGEVVVTSSADETVRVWQ  5
            +STL+GHSK+VT+VKF  + ++V+T+SAD+TVR+W+
Sbjct  257  LSTLTGHSKKVTSVKFVGDADLVLTASADKTVRIWR  292



>emb|CDY19484.1| BnaC04g11150D [Brassica napus]
Length=609

 Score = 51.2 bits (121),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 22/36 (61%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = -2

Query  112  ISTLSGHSKRVTNVKFAVEGEVVVTSSADETVRVWQ  5
            +STL+GHSK+VT+VKF  + ++V+T+SAD+TVRVW+
Sbjct  341  LSTLTGHSKKVTSVKFVGDSDLVLTASADKTVRVWR  376



>gb|AAL92025.1|AF484839_1 PRP-like protein, partial [Marsilea vestita]
Length=215

 Score = 49.7 bits (117),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 22/36 (61%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = -2

Query  112  ISTLSGHSKRVTNVKFAVEGEVVVTSSADETVRVWQ  5
            +STL+GHSKRV +VKF  E   V+T SAD+TV++WQ
Sbjct  69   VSTLNGHSKRVNSVKFVPENGYVLTGSADKTVKIWQ  104



>ref|XP_010934240.1| PREDICTED: pre-mRNA-processing factor 19-like [Elaeis guineensis]
Length=509

 Score = 50.8 bits (120),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 21/37 (57%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = -2

Query  112  ISTLSGHSKRVTNVKFAVEGEVVVTSSADETVRVWQG  2
            I TL+GHSK+VT+VKF    E++++ S D+TVR+WQG
Sbjct  257  ICTLTGHSKKVTSVKFVPRDELLISGSGDKTVRIWQG  293



>ref|XP_004134043.1| PREDICTED: U-box domain-containing protein 72-like [Cucumis sativus]
 gb|KGN56819.1| hypothetical protein Csa_3G134680 [Cucumis sativus]
Length=522

 Score = 50.8 bits (120),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 23/36 (64%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = -2

Query  112  ISTLSGHSKRVTNVKFAVEGEVVVTSSADETVRVWQ  5
            +STLSGHSK+VT+VKF    ++ +T SAD+TVRVWQ
Sbjct  257  LSTLSGHSKKVTSVKFVGRDDLFLTGSADKTVRVWQ  292



>ref|XP_009141306.1| PREDICTED: pre-mRNA-processing factor 19 homolog 2 [Brassica 
rapa]
Length=525

 Score = 50.8 bits (120),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 21/36 (58%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = -2

Query  112  ISTLSGHSKRVTNVKFAVEGEVVVTSSADETVRVWQ  5
            +STL+GHSK+VT+VKF  + ++V+T+SAD+TVR+W+
Sbjct  257  LSTLTGHSKKVTSVKFVGDSDLVLTASADKTVRIWR  292



>ref|XP_008438467.1| PREDICTED: U-box domain-containing protein 72 [Cucumis melo]
Length=522

 Score = 50.8 bits (120),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 23/36 (64%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = -2

Query  112  ISTLSGHSKRVTNVKFAVEGEVVVTSSADETVRVWQ  5
            +STLSGHSK+VT+VKF    ++ +T SAD+TVRVWQ
Sbjct  257  LSTLSGHSKKVTSVKFVGRDDLFLTGSADKTVRVWQ  292



>emb|CDY37731.1| BnaA04g19370D [Brassica napus]
Length=525

 Score = 50.8 bits (120),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 21/36 (58%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = -2

Query  112  ISTLSGHSKRVTNVKFAVEGEVVVTSSADETVRVWQ  5
            +STL+GHSK+VT+VKF  + ++V+T+SAD+TVR+W+
Sbjct  257  LSTLTGHSKKVTSVKFVGDSDLVLTASADKTVRIWR  292



>ref|XP_007221798.1| hypothetical protein PRUPE_ppa003451mg [Prunus persica]
 gb|EMJ22997.1| hypothetical protein PRUPE_ppa003451mg [Prunus persica]
Length=573

 Score = 50.8 bits (120),  Expect = 7e-06, Method: Composition-based stats.
 Identities = 22/37 (59%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = -2

Query  112  ISTLSGHSKRVTNVKFAVEGEVVVTSSADETVRVWQG  2
            ISTLSGHSK+V +VK     ++++T SAD+TVR+WQG
Sbjct  308  ISTLSGHSKKVNSVKIVPRDDLLITGSADKTVRIWQG  344



>ref|NP_850206.4| U-box protein MAC3B [Arabidopsis thaliana]
 ref|NP_850207.4| U-box protein MAC3B [Arabidopsis thaliana]
 sp|O22785.3|PR19B_ARATH RecName: Full=Pre-mRNA-processing factor 19 homolog 2; AltName: 
Full=MOS4-associated complex protein 3B; Short=MAC protein 
3B; AltName: Full=Plant U-box protein 60; AltName: Full=U-box 
domain-containing protein 60 [Arabidopsis thaliana]
 gb|ACO38702.1| truncated MOS4-associated complex protein 3B [Arabidopsis thaliana]
 gb|AEC08817.1| U-box protein MAC3B [Arabidopsis thaliana]
 gb|AEC08818.1| U-box protein MAC3B [Arabidopsis thaliana]
Length=525

 Score = 50.8 bits (120),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 21/36 (58%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = -2

Query  112  ISTLSGHSKRVTNVKFAVEGEVVVTSSADETVRVWQ  5
            +STL+GHSK+VT+VKF  + ++V+T+SAD+TVR+W+
Sbjct  257  LSTLTGHSKKVTSVKFVGDSDLVLTASADKTVRIWR  292



>ref|NP_001031471.1| U-box protein MAC3B [Arabidopsis thaliana]
 gb|AEC08819.1| U-box protein MAC3B [Arabidopsis thaliana]
Length=485

 Score = 50.8 bits (120),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 21/36 (58%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = -2

Query  112  ISTLSGHSKRVTNVKFAVEGEVVVTSSADETVRVWQ  5
            +STL+GHSK+VT+VKF  + ++V+T+SAD+TVR+W+
Sbjct  257  LSTLTGHSKKVTSVKFVGDSDLVLTASADKTVRIWR  292



>emb|CDY23752.1| BnaC04g43700D [Brassica napus]
Length=525

 Score = 50.8 bits (120),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 21/36 (58%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = -2

Query  112  ISTLSGHSKRVTNVKFAVEGEVVVTSSADETVRVWQ  5
            +STL+GHSK+VT+VKF  + ++V+T+SAD+TVR+W+
Sbjct  257  LSTLTGHSKKVTSVKFVGDSDLVLTASADKTVRIWR  292



>ref|XP_003558846.1| PREDICTED: U-box domain-containing protein 72-like [Brachypodium 
distachyon]
Length=527

 Score = 50.8 bits (120),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 20/37 (54%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = -2

Query  112  ISTLSGHSKRVTNVKFAVEGEVVVTSSADETVRVWQG  2
            + TL+GHSK++T++KF    E+++T SAD+TVR+WQG
Sbjct  256  LCTLTGHSKKITSLKFVPWDELLITGSADKTVRIWQG  292



>ref|NP_001064804.1| Os10g0466300 [Oryza sativa Japonica Group]
 sp|Q9AV81.1|PRP19_ORYSJ RecName: Full=Pre-mRNA-processing factor 19; AltName: Full=Plant 
U-box protein 72; Short=OsPUB72; AltName: Full=U-box domain-containing 
protein 72 [Oryza sativa Japonica Group]
 gb|AAK27816.1|AC022457_19 putative WD-repeat containing protein [Oryza sativa Japonica 
Group]
 gb|AAP54192.1| PRP19/PSO4, putative, expressed [Oryza sativa Japonica Group]
 gb|ABG66129.1| PRP19/PSO4, putative, expressed [Oryza sativa Japonica Group]
 dbj|BAF26718.1| Os10g0466300 [Oryza sativa Japonica Group]
 dbj|BAG89200.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE51104.1| hypothetical protein OsJ_31829 [Oryza sativa Japonica Group]
Length=527

 Score = 50.4 bits (119),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 20/37 (54%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = -2

Query  112  ISTLSGHSKRVTNVKFAVEGEVVVTSSADETVRVWQG  2
            + TL+GHSK++T++KF    E+ VT SAD+TV++WQG
Sbjct  256  LCTLTGHSKKITSLKFVPRDELFVTGSADKTVKIWQG  292



>ref|XP_010522453.1| PREDICTED: pre-mRNA-processing factor 19 homolog 2-like [Tarenaya 
hassleriana]
Length=526

 Score = 50.4 bits (119),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 23/37 (62%), Positives = 33/37 (89%), Gaps = 0/37 (0%)
 Frame = -2

Query  112  ISTLSGHSKRVTNVKFAVEGEVVVTSSADETVRVWQG  2
            +STLSGHSK+VT+VKF  + ++V+T+SAD+TV VW+G
Sbjct  257  LSTLSGHSKKVTSVKFVGDTDLVLTASADKTVCVWRG  293



>ref|XP_010670940.1| PREDICTED: pre-mRNA-processing factor 19 [Beta vulgaris subsp. 
vulgaris]
Length=525

 Score = 50.4 bits (119),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 23/38 (61%), Positives = 32/38 (84%), Gaps = 1/38 (3%)
 Frame = -2

Query  112  ISTLSGHSKRVTNVKFAVEGE-VVVTSSADETVRVWQG  2
            +STLSGHSK+VT++K   + E +V+T SAD+TVR+WQG
Sbjct  259  VSTLSGHSKKVTSIKIVPQDESLVITGSADKTVRIWQG  296



>ref|XP_002881277.1| transducin family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH57536.1| transducin family protein [Arabidopsis lyrata subsp. lyrata]
Length=552

 Score = 50.4 bits (119),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 21/36 (58%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = -2

Query  112  ISTLSGHSKRVTNVKFAVEGEVVVTSSADETVRVWQ  5
            +STL+GHSK+VT+VKF  + ++V+T+SAD+TVR+W+
Sbjct  257  LSTLTGHSKKVTSVKFVGDTDLVLTASADKTVRIWR  292



>ref|XP_006410472.1| hypothetical protein EUTSA_v10016510mg [Eutrema salsugineum]
 gb|ESQ51925.1| hypothetical protein EUTSA_v10016510mg [Eutrema salsugineum]
Length=522

 Score = 50.4 bits (119),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 21/36 (58%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = -2

Query  112  ISTLSGHSKRVTNVKFAVEGEVVVTSSADETVRVWQ  5
            +STL+GHSK+VT+VKF  + ++V+T+SAD+TVR+W+
Sbjct  254  LSTLTGHSKKVTSVKFVGDTDLVLTASADKTVRIWR  289



>ref|XP_008245266.1| PREDICTED: U-box domain-containing protein 72-like [Prunus mume]
Length=523

 Score = 50.4 bits (119),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 22/37 (59%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = -2

Query  112  ISTLSGHSKRVTNVKFAVEGEVVVTSSADETVRVWQG  2
            ISTLSGHSK+V +VK     ++++T SAD+TVR+WQG
Sbjct  258  ISTLSGHSKKVNSVKIVPRDDLLITGSADKTVRIWQG  294



>ref|XP_006410473.1| hypothetical protein EUTSA_v10016510mg [Eutrema salsugineum]
 gb|ESQ51926.1| hypothetical protein EUTSA_v10016510mg [Eutrema salsugineum]
Length=525

 Score = 50.4 bits (119),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 21/36 (58%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = -2

Query  112  ISTLSGHSKRVTNVKFAVEGEVVVTSSADETVRVWQ  5
            +STL+GHSK+VT+VKF  + ++V+T+SAD+TVR+W+
Sbjct  257  LSTLTGHSKKVTSVKFVGDTDLVLTASADKTVRIWR  292



>ref|XP_002961116.1| ubiquitin-protein ligase, PUB59 [Selaginella moellendorffii]
 gb|EFJ38655.1| ubiquitin-protein ligase, PUB59 [Selaginella moellendorffii]
Length=517

 Score = 50.1 bits (118),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 20/37 (54%), Positives = 32/37 (86%), Gaps = 0/37 (0%)
 Frame = -2

Query  112  ISTLSGHSKRVTNVKFAVEGEVVVTSSADETVRVWQG  2
            +++L GHSK+VT+VKF    ++V+T+SAD+TV++WQG
Sbjct  254  VASLVGHSKKVTSVKFVARDDLVLTASADKTVKIWQG  290



>ref|XP_002966895.1| ubiquitin-protein ligase, PUB59 [Selaginella moellendorffii]
 gb|EFJ31494.1| ubiquitin-protein ligase, PUB59 [Selaginella moellendorffii]
Length=520

 Score = 50.1 bits (118),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 20/37 (54%), Positives = 32/37 (86%), Gaps = 0/37 (0%)
 Frame = -2

Query  112  ISTLSGHSKRVTNVKFAVEGEVVVTSSADETVRVWQG  2
            +++L GHSK+VT+VKF    ++V+T+SAD+TV++WQG
Sbjct  254  VASLVGHSKKVTSVKFVARDDLVLTASADKTVKIWQG  290



>gb|EMS55665.1| U-box domain-containing protein 72 [Triticum urartu]
Length=588

 Score = 50.1 bits (118),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 20/37 (54%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = -2

Query  112  ISTLSGHSKRVTNVKFAVEGEVVVTSSADETVRVWQG  2
            + TL+ HSK++T++KF    E+++T SAD+TVRVWQG
Sbjct  313  LCTLTDHSKKITSLKFVPRDELLITGSADKTVRVWQG  349



>ref|XP_010920296.1| PREDICTED: pre-mRNA-processing factor 19-like [Elaeis guineensis]
Length=526

 Score = 49.3 bits (116),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 21/37 (57%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = -2

Query  112  ISTLSGHSKRVTNVKFAVEGEVVVTSSADETVRVWQG  2
            I TL+GHSK+VT+VKF    ++ ++ S D+TVRVWQG
Sbjct  257  ICTLTGHSKKVTSVKFVPRDDLFISGSGDKTVRVWQG  293



>ref|XP_010457499.1| PREDICTED: pre-mRNA-processing factor 19 homolog 1-like [Camelina 
sativa]
Length=522

 Score = 49.3 bits (116),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 19/35 (54%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = -2

Query  112  ISTLSGHSKRVTNVKFAVEGEVVVTSSADETVRVW  8
            +STL+GHSK+VT++KF  + ++V+T+S+D+TVR+W
Sbjct  257  LSTLTGHSKKVTSIKFVGDADLVLTASSDKTVRIW  291



>ref|XP_010483893.1| PREDICTED: pre-mRNA-processing factor 19 homolog 1 [Camelina 
sativa]
Length=522

 Score = 49.3 bits (116),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 19/35 (54%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = -2

Query  112  ISTLSGHSKRVTNVKFAVEGEVVVTSSADETVRVW  8
            +STL+GHSK+VT++KF  + ++V+T+S+D+TVR+W
Sbjct  257  LSTLTGHSKKVTSIKFVGDADLVLTASSDKTVRIW  291



>ref|XP_008785160.1| PREDICTED: U-box domain-containing protein 72-like [Phoenix dactylifera]
Length=526

 Score = 49.3 bits (116),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 21/37 (57%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = -2

Query  112  ISTLSGHSKRVTNVKFAVEGEVVVTSSADETVRVWQG  2
            I TL+GHSK+VT+VKF    E+ V+ S D+TVR+W G
Sbjct  257  ICTLTGHSKKVTSVKFVPRDELFVSGSGDKTVRIWHG  293



>ref|XP_010475111.1| PREDICTED: pre-mRNA-processing factor 19 homolog 1-like [Camelina 
sativa]
Length=522

 Score = 48.9 bits (115),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 19/35 (54%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = -2

Query  112  ISTLSGHSKRVTNVKFAVEGEVVVTSSADETVRVW  8
            +STL+GHSK+VT++KF  + ++V+T+S+D+TVR+W
Sbjct  257  LSTLTGHSKKVTSIKFVGDADLVLTASSDKTVRIW  291



>ref|XP_006307243.1| hypothetical protein CARUB_v10008852mg [Capsella rubella]
 gb|EOA40141.1| hypothetical protein CARUB_v10008852mg [Capsella rubella]
Length=522

 Score = 48.9 bits (115),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 19/35 (54%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = -2

Query  112  ISTLSGHSKRVTNVKFAVEGEVVVTSSADETVRVW  8
            +STL+GHSK+VT++KF  + ++V+T+S+D+TVR+W
Sbjct  257  LSTLTGHSKKVTSIKFVGDADLVLTASSDKTVRIW  291



>ref|XP_004497808.1| PREDICTED: pre-mRNA-processing factor 19 homolog 2-like [Cicer 
arietinum]
Length=535

 Score = 48.9 bits (115),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 21/36 (58%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = -2

Query  112  ISTLSGHSKRVTNVKFAVEGEVVVTSSADETVRVWQ  5
            ++ L GHSK+VT+VKF  EGE  +T S+D+TVR+WQ
Sbjct  259  LAILPGHSKKVTSVKFVGEGESFLTGSSDKTVRLWQ  294



>gb|AGH13207.1| PUB1 [Triticum aestivum]
Length=531

 Score = 48.5 bits (114),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 19/37 (51%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = -2

Query  112  ISTLSGHSKRVTNVKFAVEGEVVVTSSADETVRVWQG  2
            + TL+ HSK++T++KF    E+++T SAD+T RVWQG
Sbjct  256  LCTLTDHSKKITSLKFVPRDELLITGSADKTARVWQG  292



>dbj|BAD94465.1| putative pre-mRNA splicing factor PRP19 [Arabidopsis thaliana]
Length=421

 Score = 48.1 bits (113),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 19/35 (54%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = -2

Query  112  ISTLSGHSKRVTNVKFAVEGEVVVTSSADETVRVW  8
            +STL+GHSK+VT++KF  + ++V+T+S+D+TVR+W
Sbjct  155  LSTLTGHSKKVTSIKFVGDTDLVLTASSDKTVRIW  189



>gb|EMT10525.1| DEAD-box ATP-dependent RNA helicase 29 [Aegilops tauschii]
Length=1295

 Score = 48.5 bits (114),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 20/37 (54%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = -2

Query  112   ISTLSGHSKRVTNVKFAVEGEVVVTSSADETVRVWQG  2
             + TL+ HSK++T++KF    E+++T SAD+TVRVWQG
Sbjct  1020  LCTLTDHSKKITSLKFVPRDELLITGSADKTVRVWQG  1056



>ref|NP_563708.1| MOS4-associated complex 3A [Arabidopsis thaliana]
 sp|Q94BR4.1|PR19A_ARATH RecName: Full=Pre-mRNA-processing factor 19 homolog 1; AltName: 
Full=MOS4-associated complex protein 3A; Short=MAC protein 
3A; AltName: Full=Plant U-box protein 59; AltName: Full=U-box 
domain-containing protein 59 [Arabidopsis thaliana]
 gb|AAK64044.1| putative pre-mRNA splicing factor PRP19 [Arabidopsis thaliana]
 gb|AAN13133.1| putative pre-mRNA splicing factor PRP19 [Arabidopsis thaliana]
 gb|AEE27707.1| MOS4-associated complex 3A [Arabidopsis thaliana]
Length=523

 Score = 48.1 bits (113),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 19/35 (54%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = -2

Query  112  ISTLSGHSKRVTNVKFAVEGEVVVTSSADETVRVW  8
            +STL+GHSK+VT++KF  + ++V+T+S+D+TVR+W
Sbjct  257  LSTLTGHSKKVTSIKFVGDTDLVLTASSDKTVRIW  291



>ref|XP_002464506.1| hypothetical protein SORBIDRAFT_01g019790 [Sorghum bicolor]
 gb|EER91504.1| hypothetical protein SORBIDRAFT_01g019790 [Sorghum bicolor]
Length=535

 Score = 48.1 bits (113),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 19/36 (53%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = -2

Query  112  ISTLSGHSKRVTNVKFAVEGEVVVTSSADETVRVWQ  5
            + TL+GHSK++T +KF    ++ VT SAD+TVR+WQ
Sbjct  265  LCTLTGHSKKITTLKFVPRDQLFVTGSADKTVRIWQ  300



>ref|NP_001150622.1| pre-mRNA-splicing factor 19 [Zea mays]
 ref|XP_008678422.1| PREDICTED: pre-mRNA-splicing factor 19 isoform X1 [Zea mays]
 gb|ACG39790.1| pre-mRNA-splicing factor 19 [Zea mays]
 gb|ACN34262.1| unknown [Zea mays]
 tpg|DAA49697.1| TPA: pre-mRNA-splicing factor 19 isoform 1 [Zea mays]
 tpg|DAA49698.1| TPA: pre-mRNA-splicing factor 19 isoform 2 [Zea mays]
Length=526

 Score = 48.1 bits (113),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 19/36 (53%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = -2

Query  112  ISTLSGHSKRVTNVKFAVEGEVVVTSSADETVRVWQ  5
            + TL+GHSK++T +KF    ++ VT SAD+TVR+WQ
Sbjct  256  LCTLTGHSKKITTLKFVPRDQLFVTGSADKTVRIWQ  291



>ref|XP_006418122.1| hypothetical protein EUTSA_v10007366mg [Eutrema salsugineum]
 gb|ESQ36475.1| hypothetical protein EUTSA_v10007366mg [Eutrema salsugineum]
Length=522

 Score = 48.1 bits (113),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 19/35 (54%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = -2

Query  112  ISTLSGHSKRVTNVKFAVEGEVVVTSSADETVRVW  8
            +STL+GHSK+VT++KF  + ++V+T+S+D+TVR+W
Sbjct  257  LSTLTGHSKKVTSIKFVGDTDLVLTASSDKTVRIW  291



>ref|XP_002889510.1| transducin family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH65769.1| transducin family protein [Arabidopsis lyrata subsp. lyrata]
Length=522

 Score = 48.1 bits (113),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 19/35 (54%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = -2

Query  112  ISTLSGHSKRVTNVKFAVEGEVVVTSSADETVRVW  8
            +STL+GHSK+VT++KF  + ++V+T+S+D+TVR+W
Sbjct  257  LSTLTGHSKKVTSIKFVGDTDLVLTASSDKTVRIW  291



>ref|NP_001030958.1| MOS4-associated complex 3A [Arabidopsis thaliana]
 gb|AEE27708.1| MOS4-associated complex 3A [Arabidopsis thaliana]
Length=523

 Score = 48.1 bits (113),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 19/35 (54%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = -2

Query  112  ISTLSGHSKRVTNVKFAVEGEVVVTSSADETVRVW  8
            +STL+GHSK+VT++KF  + ++V+T+S+D+TVR+W
Sbjct  257  LSTLTGHSKKVTSIKFVGDTDLVLTASSDKTVRIW  291



>emb|CDY15510.1| BnaA08g27940D [Brassica napus]
Length=550

 Score = 48.1 bits (113),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 19/35 (54%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = -2

Query  112  ISTLSGHSKRVTNVKFAVEGEVVVTSSADETVRVW  8
            +STL+GHSK+VT++KF  + ++V+T+S+D+TVR+W
Sbjct  285  LSTLTGHSKKVTSIKFVGDTDLVLTASSDKTVRIW  319



>gb|AFW68634.1| hypothetical protein ZEAMMB73_254634 [Zea mays]
Length=431

 Score = 48.1 bits (113),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 19/36 (53%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = -2

Query  112  ISTLSGHSKRVTNVKFAVEGEVVVTSSADETVRVWQ  5
            + TL+GHSK++T +KF    ++ VT SAD+TVR+WQ
Sbjct  210  LCTLAGHSKKITTLKFIPRDQLFVTGSADKTVRIWQ  245



>emb|CDX86629.1| BnaC08g00740D [Brassica napus]
Length=529

 Score = 48.1 bits (113),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 19/35 (54%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = -2

Query  112  ISTLSGHSKRVTNVKFAVEGEVVVTSSADETVRVW  8
            +STL+GHSK+VT++KF  + ++V+T+S+D+TVR+W
Sbjct  248  LSTLTGHSKKVTSIKFVGDTDLVLTASSDKTVRIW  282



>emb|CDY18239.1| BnaC05g02620D [Brassica napus]
Length=551

 Score = 48.1 bits (113),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 19/35 (54%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = -2

Query  112  ISTLSGHSKRVTNVKFAVEGEVVVTSSADETVRVW  8
            +STL+GHSK+VT++KF  + ++V+T+S+D+TVR+W
Sbjct  286  LSTLTGHSKKVTSIKFVGDTDLVLTASSDKTVRIW  320



>ref|XP_009111097.1| PREDICTED: LOW QUALITY PROTEIN: pre-mRNA-processing factor 19 
homolog 1-like [Brassica rapa]
Length=523

 Score = 48.1 bits (113),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 19/35 (54%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = -2

Query  112  ISTLSGHSKRVTNVKFAVEGEVVVTSSADETVRVW  8
            +STL+GHSK+VT++KF  + ++V+T+S+D+TVR+W
Sbjct  258  LSTLTGHSKKVTSIKFVGDTDLVLTASSDKTVRIW  292



>ref|XP_009119290.1| PREDICTED: pre-mRNA-processing factor 19 homolog 1 [Brassica 
rapa]
Length=522

 Score = 48.1 bits (113),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 19/35 (54%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = -2

Query  112  ISTLSGHSKRVTNVKFAVEGEVVVTSSADETVRVW  8
            +STL+GHSK+VT++KF  + ++V+T+S+D+TVR+W
Sbjct  257  LSTLTGHSKKVTSIKFVGDTDLVLTASSDKTVRIW  291



>emb|CDX89818.1| BnaA10g02640D [Brassica napus]
Length=522

 Score = 48.1 bits (113),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 19/35 (54%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = -2

Query  112  ISTLSGHSKRVTNVKFAVEGEVVVTSSADETVRVW  8
            +STL+GHSK+VT++KF  + ++V+T+S+D+TVR+W
Sbjct  257  LSTLTGHSKKVTSIKFVGDTDLVLTASSDKTVRIW  291



>ref|NP_001130751.1| uncharacterized protein LOC100191855 [Zea mays]
 gb|ACF79093.1| unknown [Zea mays]
 gb|AFW68633.1| hypothetical protein ZEAMMB73_254634 [Zea mays]
Length=526

 Score = 48.1 bits (113),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 19/36 (53%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = -2

Query  112  ISTLSGHSKRVTNVKFAVEGEVVVTSSADETVRVWQ  5
            + TL+GHSK++T +KF    ++ VT SAD+TVR+WQ
Sbjct  256  LCTLAGHSKKITTLKFIPRDQLFVTGSADKTVRIWQ  291



>emb|CBJ28011.1| conserved unknown protein [Ectocarpus siliculosus]
Length=509

 Score = 47.8 bits (112),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 20/36 (56%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = -2

Query  112  ISTLSGHSKRVTNVKFAVEGEVVVTSSADETVRVWQ  5
            ++TLSGH+KR+T+  F    E+++TSSAD+T RVWQ
Sbjct  255  VATLSGHTKRITDACFHPTRELLLTSSADKTARVWQ  290



>gb|KFK42789.1| hypothetical protein AALP_AA1G039400 [Arabis alpina]
Length=522

 Score = 47.4 bits (111),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 19/35 (54%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = -2

Query  112  ISTLSGHSKRVTNVKFAVEGEVVVTSSADETVRVW  8
            +STL+GHSK+VT++KF  +  +V+T+S+D+TVR+W
Sbjct  257  LSTLTGHSKKVTSIKFVGDTNLVLTASSDKTVRIW  291



>gb|KFK42788.1| hypothetical protein AALP_AA1G039400 [Arabis alpina]
Length=523

 Score = 47.4 bits (111),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 19/35 (54%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = -2

Query  112  ISTLSGHSKRVTNVKFAVEGEVVVTSSADETVRVW  8
            +STL+GHSK+VT++KF  +  +V+T+S+D+TVR+W
Sbjct  258  LSTLTGHSKKVTSIKFVGDTNLVLTASSDKTVRIW  292



>ref|XP_004982929.1| PREDICTED: U-box domain-containing protein 72-like [Setaria italica]
Length=526

 Score = 46.2 bits (108),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 19/36 (53%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = -2

Query  112  ISTLSGHSKRVTNVKFAVEGEVVVTSSADETVRVWQ  5
            + TL+GHSK++T +KF     + VT SAD+TVR+WQ
Sbjct  256  LCTLTGHSKKITTLKFVPRDGLFVTGSADKTVRIWQ  291



>gb|ETO14092.1| hypothetical protein RFI_23277 [Reticulomyxa filosa]
Length=392

 Score = 46.2 bits (108),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 18/35 (51%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = -2

Query  112  ISTLSGHSKRVTNVKFAVEGEVVVTSSADETVRVW  8
            + TL GHS RV +VKF+ +G+V+V+ S D T+R+W
Sbjct  315  VQTLEGHSARVRDVKFSADGQVIVSCSNDHTIRLW  349



>gb|ETO23622.1| hypothetical protein RFI_13557 [Reticulomyxa filosa]
Length=258

 Score = 45.4 bits (106),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 20/35 (57%), Positives = 26/35 (74%), Gaps = 0/35 (0%)
 Frame = -2

Query  112  ISTLSGHSKRVTNVKFAVEGEVVVTSSADETVRVW  8
            I T+ GH KR+T V F+ +G  VV+SS D+TVRVW
Sbjct  147  IQTMKGHLKRITGVHFSPDGRCVVSSSEDKTVRVW  181



>ref|XP_002109371.1| conserved hypothetical protein [Trichoplax adhaerens]
 gb|EDV27537.1| conserved hypothetical protein [Trichoplax adhaerens]
Length=336

 Score = 45.4 bits (106),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 19/35 (54%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = -2

Query  106  TLSGHSKRVTNVKFAVEGEVVVTSSADETVRVWQG  2
            TL+GHSK V++VKF+ +G+ V +SSAD T+R+W  
Sbjct  29   TLTGHSKAVSSVKFSADGDWVASSSADGTIRIWNA  63



>gb|ETO07197.1| G-protein beta WD-40 repeats containing protein [Reticulomyxa 
filosa]
Length=1453

 Score = 46.2 bits (108),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 17/35 (49%), Positives = 26/35 (74%), Gaps = 0/35 (0%)
 Frame = -2

Query  112   ISTLSGHSKRVTNVKFAVEGEVVVTSSADETVRVW  8
             I  L GH +RVTN +F+ +G  +V+ SAD+T+R+W
Sbjct  1222  IIKLEGHEERVTNARFSPDGSTIVSGSADKTIRIW  1256



>gb|EJW79081.1| WD repeat protein 5 [Wuchereria bancrofti]
Length=225

 Score = 44.7 bits (104),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 17/33 (52%), Positives = 28/33 (85%), Gaps = 0/33 (0%)
 Frame = -2

Query  103  LSGHSKRVTNVKFAVEGEVVVTSSADETVRVWQ  5
            LSGH+K V++VKF+ +G ++ +SSAD+T++VW 
Sbjct  85   LSGHTKAVSSVKFSADGSLLASSSADKTIKVWN  117



>ref|XP_002500695.1| COMPASS/Set1C complex protein [Micromonas sp. RCC299]
 gb|ACO61953.1| COMPASS/Set1C complex protein [Micromonas sp. RCC299]
Length=487

 Score = 45.4 bits (106),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 20/34 (59%), Positives = 27/34 (79%), Gaps = 0/34 (0%)
 Frame = -2

Query  106  TLSGHSKRVTNVKFAVEGEVVVTSSADETVRVWQ  5
            TL GHSK V  VKF+ +G VV ++SAD+TVR+W+
Sbjct  11   TLEGHSKSVAAVKFSPDGSVVASASADKTVRLWR  44



>gb|ETO30665.1| WD repeat-containing protein [Reticulomyxa filosa]
Length=367

 Score = 45.1 bits (105),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 16/35 (46%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = -2

Query  112  ISTLSGHSKRVTNVKFAVEGEVVVTSSADETVRVW  8
            +  L GH   +TNVKF+ +G ++V++SAD+T+R+W
Sbjct  79   LRILEGHEDEITNVKFSTDGRMLVSTSADQTIRIW  113



>ref|WP_028978428.1| hypothetical protein [Sporocytophaga myxococcoides]
Length=1010

 Score = 45.4 bits (106),  Expect = 7e-04, Method: Composition-based stats.
 Identities = 17/35 (49%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = -2

Query  112  ISTLSGHSKRVTNVKFAVEGEVVVTSSADETVRVW  8
            ++TLSGH+ R+ N++F+ +GE + T S D+TVR+W
Sbjct  886  LATLSGHTARINNIRFSNDGEKLATGSFDKTVRIW  920



>emb|CCG82860.1| Ribosome biogenesis protein Sqt1 [Taphrina deformans PYCC 5710]
Length=412

 Score = 45.1 bits (105),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 16/35 (46%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = -2

Query  112  ISTLSGHSKRVTNVKFAVEGEVVVTSSADETVRVW  8
            +STLSGHS  +T+++F+ +G+++ T+S D T+R+W
Sbjct  112  LSTLSGHSDSITSIEFSFDGQLLATASMDGTIRIW  146



>ref|WP_017747107.1| hypothetical protein [Scytonema hofmanni]
Length=1746

 Score = 45.4 bits (106),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 16/36 (44%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = -2

Query  112   ISTLSGHSKRVTNVKFAVEGEVVVTSSADETVRVWQ  5
             I TL+GH KRVT++ F+ + E++ + SAD+T+++W+
Sbjct  1509  IKTLTGHEKRVTSISFSPDNEIIASGSADKTIKLWR  1544



>gb|ETO36626.1| Pfs, NACHT and WD domain protein, partial [Reticulomyxa filosa]
Length=509

 Score = 45.1 bits (105),  Expect = 7e-04, Method: Composition-based stats.
 Identities = 18/36 (50%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = -2

Query  112  ISTLSGHSKRVTNVKFAVEGEVVVTSSADETVRVWQ  5
            I TL GHSK +T +  + +G ++V+SS DET+R+WQ
Sbjct  460  IQTLIGHSKYITEIDISPDGNMIVSSSYDETIRLWQ  495



>dbj|GAL86316.1| peptidase C14, caspase catalytic subunit p20, putative [Sporocytophaga 
myxococcoides]
Length=1028

 Score = 45.1 bits (105),  Expect = 8e-04, Method: Composition-based stats.
 Identities = 17/35 (49%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = -2

Query  112  ISTLSGHSKRVTNVKFAVEGEVVVTSSADETVRVW  8
            ++TLSGH+ R+ N++F+ +GE + T S D+TVR+W
Sbjct  904  LATLSGHTARINNIRFSNDGEKLATGSFDKTVRIW  938



>ref|XP_001897052.1| Will die slowly protein [Brugia malayi]
Length=326

 Score = 44.3 bits (103),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 17/33 (52%), Positives = 28/33 (85%), Gaps = 0/33 (0%)
 Frame = -2

Query  103  LSGHSKRVTNVKFAVEGEVVVTSSADETVRVWQ  5
            LSGH+K V++VKF+ +G ++ +SSAD+T++VW 
Sbjct  86   LSGHTKAVSSVKFSADGSLLASSSADKTIKVWN  118



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 522694794284