BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c5800_g1_i1 len=2203 path=[643:0-749 23:750-1047 321:1048-2202]

Length=2203
                                                                      Score     E

ref|XP_009784694.1|  PREDICTED: GDP-L-galactose phosphorylase 2-like    503   5e-168   
ref|XP_011099472.1|  PREDICTED: GDP-L-galactose phosphorylase 2-like    499   1e-166   
ref|XP_009628804.1|  PREDICTED: GDP-L-galactose phosphorylase 2-like    496   2e-165   
ref|XP_003633703.2|  PREDICTED: GDP-L-galactose phosphorylase 1-l...    492   6e-164   
ref|XP_010274722.1|  PREDICTED: GDP-L-galactose phosphorylase 1-like    491   3e-163   
ref|XP_004231986.1|  PREDICTED: GDP-L-galactose phosphorylase 2-like    488   2e-162   
ref|XP_010263564.1|  PREDICTED: GDP-L-galactose phosphorylase 1-like    487   8e-162   
ref|NP_001275193.1|  GDP-L-galactose phosphorylase 1-like               484   6e-161   
ref|XP_006383317.1|  hypothetical protein POPTR_0005s14440g             483   2e-160   
emb|CDP02699.1|  unnamed protein product                                483   6e-160   
ref|XP_007033043.1|  Mannose-1-phosphate guanylyltransferases,GDP...    478   4e-158   
ref|XP_011021405.1|  PREDICTED: GDP-L-galactose phosphorylase 1-like    477   8e-158   
ref|XP_010693970.1|  PREDICTED: GDP-L-galactose phosphorylase 2-like    468   4e-154   
ref|XP_010911669.1|  PREDICTED: GDP-L-galactose phosphorylase 1-like    466   7e-154   
ref|XP_008803683.1|  PREDICTED: GDP-L-galactose phosphorylase 1-like    461   5e-152   
ref|XP_008795238.1|  PREDICTED: GDP-L-galactose phosphorylase 1-like    459   7e-151   
ref|XP_006430623.1|  hypothetical protein CICLE_v10013649mg             456   5e-150   
ref|XP_010910502.1|  PREDICTED: GDP-L-galactose phosphorylase 2-l...    456   6e-150   
ref|XP_011095440.1|  PREDICTED: GDP-L-galactose phosphorylase 2-like    455   2e-149   
ref|XP_009421168.1|  PREDICTED: GDP-L-galactose phosphorylase 1-like    455   2e-149   
gb|KDO63082.1|  hypothetical protein CISIN_1g040147mg                   454   2e-149   
ref|XP_006482136.1|  PREDICTED: GDP-L-galactose phosphorylase 1-like    454   9e-149   
ref|XP_008781038.1|  PREDICTED: GDP-L-galactose phosphorylase 2-like    452   3e-148   
gb|KHG19846.1|  GDP-L-galactose phosphorylase 1 -like protein           452   3e-148   
ref|XP_010910501.1|  PREDICTED: GDP-L-galactose phosphorylase 2-l...    451   4e-148   
ref|XP_007142307.1|  hypothetical protein PHAVU_008G269600g             451   6e-148   
ref|XP_010912623.1|  PREDICTED: GDP-L-galactose phosphorylase 1-like    451   9e-148   
ref|XP_008226982.1|  PREDICTED: GDP-L-galactose phosphorylase 1         451   1e-147   
ref|XP_003617599.1|  hypothetical protein MTR_5g093390                  449   5e-147   
ref|NP_001240984.1|  uncharacterized protein LOC100806541               448   7e-147   
gb|AGO32051.1|  GDP-L-galactose phosphorylase                           448   1e-146   
ref|XP_009361034.1|  PREDICTED: GDP-L-galactose phosphorylase 2         448   1e-146   
ref|XP_009350144.1|  PREDICTED: GDP-L-galactose phosphorylase 1-like    447   2e-146   
gb|ABP65665.1|  VTC2-like protein                                       448   2e-146   Actinidia chinensis
gb|ADB85572.1|  GDP-L-galactose phosphorylase                           448   2e-146   Actinidia deliciosa [Chinese gooseberry]
ref|XP_008808494.1|  PREDICTED: GDP-L-galactose phosphorylase 2-like    447   2e-146   
ref|XP_002532458.1|  conserved hypothetical protein                     448   2e-146   Ricinus communis
gb|AGO32052.1|  GDP-L-galactose phosphorylase                           447   2e-146   
dbj|BAP75925.1|  GDP-L-galactose phosphorylase                          447   2e-146   
emb|CDY14296.1|  BnaA08g14270D                                          447   4e-146   
ref|XP_007020730.1|  Galactose-1-phosphate guanylyltransferases,G...    447   5e-146   
gb|KHG00569.1|  GDP-L-galactose phosphorylase 1 -like protein           446   7e-146   
emb|CDX97369.1|  BnaC08g12340D                                          445   1e-145   
ref|XP_003551872.1|  PREDICTED: GDP-L-galactose phosphorylase 1-like    445   2e-145   
gb|KCW52134.1|  hypothetical protein EUGRSUZ_J01575                     443   2e-145   
ref|XP_004491414.1|  PREDICTED: GDP-L-galactose phosphorylase 1-like    445   2e-145   
ref|XP_010096115.1|  hypothetical protein L484_012470                   445   2e-145   
ref|XP_009109165.1|  PREDICTED: GDP-L-galactose phosphorylase 1-like    444   6e-145   
ref|XP_008349897.1|  PREDICTED: GDP-L-galactose phosphorylase 1-like    444   7e-145   
emb|CDP13797.1|  unnamed protein product                                443   8e-145   
ref|XP_008363580.1|  PREDICTED: GDP-L-galactose phosphorylase 2-like    443   1e-144   
gb|AII99836.1|  GDP-L-galactose phosphorylase                           442   1e-144   
ref|XP_010252494.1|  PREDICTED: GDP-L-galactose phosphorylase 2         442   2e-144   
ref|XP_009404316.1|  PREDICTED: GDP-L-galactose phosphorylase 2-like    442   2e-144   
ref|NP_001280814.1|  GDP-L-galactose phosphorylase 1-like               442   2e-144   
gb|KDP33162.1|  hypothetical protein JCGZ_13427                         441   2e-144   
ref|XP_004139797.1|  PREDICTED: GDP-L-galactose phosphorylase 1-like    442   2e-144   
ref|XP_009142887.1|  PREDICTED: GDP-L-galactose phosphorylase 1         441   4e-144   
ref|XP_006413133.1|  hypothetical protein EUTSA_v10025206mg             441   4e-144   
ref|XP_006843814.1|  hypothetical protein AMTR_s00007p00255940          441   5e-144   
ref|XP_009588390.1|  PREDICTED: GDP-L-galactose phosphorylase 1-like    441   5e-144   
ref|XP_009772775.1|  PREDICTED: GDP-L-galactose phosphorylase 1-like    441   7e-144   
gb|EYU33662.1|  hypothetical protein MIMGU_mgv1a006529mg                440   1e-143   
ref|XP_011097847.1|  PREDICTED: GDP-L-galactose phosphorylase 2-like    440   1e-143   
emb|CBI26680.3|  unnamed protein product                                440   1e-143   
ref|XP_010060290.1|  PREDICTED: GDP-L-galactose phosphorylase 2-like    440   1e-143   
gb|KHF98732.1|  GDP-L-galactose phosphorylase 1 -like protein           440   2e-143   
gb|EMT04185.1|  hypothetical protein F775_27680                         439   2e-143   
dbj|BAJ86561.1|  predicted protein                                      439   2e-143   
emb|CDY29254.1|  BnaC01g19060D                                          439   2e-143   
ref|XP_004294401.1|  PREDICTED: GDP-L-galactose phosphorylase 1-like    440   2e-143   
ref|NP_001266145.1|  GDP-L-galactose phosphorylase                      439   2e-143   
ref|XP_011046712.1|  PREDICTED: GDP-L-galactose phosphorylase 1         440   3e-143   
ref|XP_003519588.1|  PREDICTED: GDP-L-galactose phosphorylase 1-like    439   3e-143   
ref|XP_010536681.1|  PREDICTED: GDP-L-galactose phosphorylase 1-like    439   4e-143   
gb|AGI78464.1|  GDP-L-galactose phosphorylase                           439   4e-143   
ref|XP_002278339.1|  PREDICTED: GDP-L-galactose phosphorylase 2         439   5e-143   Vitis vinifera
ref|XP_002442954.1|  hypothetical protein SORBIDRAFT_08g005410          438   6e-143   Sorghum bicolor [broomcorn]
ref|XP_002530359.1|  conserved hypothetical protein                     439   7e-143   Ricinus communis
gb|AEN69451.1|  VTC                                                     439   7e-143   
ref|XP_010238642.1|  PREDICTED: GDP-L-galactose phosphorylase 2-like    437   1e-142   
ref|NP_001275300.1|  GDP-L-galactose phosphorylase 1-like               437   1e-142   
gb|KCW52117.1|  hypothetical protein EUGRSUZ_J01552                     437   2e-142   
ref|XP_007146508.1|  hypothetical protein PHAVU_006G046700g             437   2e-142   
gb|KEH33865.1|  GDP-L-galactose phosphorylase                           436   2e-142   
gb|ABK96203.1|  unknown                                                 437   3e-142   Populus trichocarpa [western balsam poplar]
gb|EYU27365.1|  hypothetical protein MIMGU_mgv1a006489mg                437   3e-142   
gb|ABR16423.1|  unknown                                                 436   4e-142   Picea sitchensis
ref|XP_009349354.1|  PREDICTED: GDP-L-galactose phosphorylase 1-like    437   4e-142   
gb|KFK29192.1|  hypothetical protein AALP_AA7G101600                    437   4e-142   
ref|XP_008447718.1|  PREDICTED: GDP-L-galactose phosphorylase 1         436   7e-142   
ref|XP_006283739.1|  hypothetical protein CARUB_v10004813mg             436   9e-142   
ref|XP_002298816.2|  VITAMIN C DEFECTIVE 2 family protein               436   1e-141   Populus trichocarpa [western balsam poplar]
gb|EPS59998.1|  hypothetical protein M569_14805                         434   1e-141   
emb|CAN70988.1|  hypothetical protein VITISV_043185                     437   2e-141   Vitis vinifera
ref|XP_010244129.1|  PREDICTED: GDP-L-galactose phosphorylase 2-like    434   3e-141   
gb|KDP39175.1|  hypothetical protein JCGZ_00932                         434   5e-141   
ref|XP_010448203.1|  PREDICTED: GDP-L-galactose phosphorylase 1         433   6e-141   
gb|AAL07213.1|  unknown protein                                         433   6e-141   Arabidopsis thaliana [mouse-ear cress]
ref|NP_567759.1|  GDP-L-galactose phosphorylase 1                       433   6e-141   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009403710.1|  PREDICTED: GDP-L-galactose phosphorylase 2-like    432   8e-141   
ref|XP_002867538.1|  hypothetical protein ARALYDRAFT_492115             433   1e-140   
ref|XP_010063041.1|  PREDICTED: GDP-L-galactose phosphorylase 2-like    432   2e-140   
ref|XP_007211628.1|  hypothetical protein PRUPE_ppa005736mg             432   2e-140   
ref|NP_001066338.1|  Os12g0190000                                       432   2e-140   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010433431.1|  PREDICTED: GDP-L-galactose phosphorylase 1-like    432   2e-140   
gb|ACN28924.1|  unknown                                                 431   4e-140   Zea mays [maize]
ref|NP_001150222.1|  VTC2                                               431   4e-140   Zea mays [maize]
ref|XP_004977174.1|  PREDICTED: GDP-L-galactose phosphorylase 2-like    431   4e-140   
gb|KHN12517.1|  GDP-L-galactose phosphorylase 1                         431   5e-140   
gb|ADM16545.1|  GDP-L-galactose guanyltransferase                       430   1e-139   
ref|XP_006663878.1|  PREDICTED: GDP-L-galactose phosphorylase 2-like    430   1e-139   
ref|XP_010438688.1|  PREDICTED: GDP-L-galactose phosphorylase 1-like    429   2e-139   
gb|KCW70214.1|  hypothetical protein EUGRSUZ_F03491                     429   2e-139   
gb|EEC68977.1|  hypothetical protein OsI_37726                          429   2e-139   Oryza sativa Indica Group [Indian rice]
dbj|BAJ89242.1|  predicted protein                                      428   4e-139   
ref|XP_003577725.1|  PREDICTED: GDP-L-galactose phosphorylase 2-like    428   4e-139   
ref|XP_002316755.1|  VITAMIN C DEFECTIVE 2 family protein               429   5e-139   Populus trichocarpa [western balsam poplar]
ref|XP_004514559.1|  PREDICTED: GDP-L-galactose phosphorylase 1-like    428   6e-139   
ref|XP_011042805.1|  PREDICTED: GDP-L-galactose phosphorylase 2-like    427   2e-138   
ref|XP_006452438.1|  hypothetical protein CICLE_v10008255mg             426   4e-138   
gb|KFK27113.1|  hypothetical protein AALP_AA8G336300                    424   1e-137   
gb|AGV54231.1|  vitamin C defective 2                                   424   2e-137   
ref|XP_010443119.1|  PREDICTED: GDP-L-galactose phosphorylase 2-like    423   3e-137   
gb|EMS60286.1|  hypothetical protein TRIUR3_28618                       424   4e-137   
ref|XP_010449106.1|  PREDICTED: GDP-L-galactose phosphorylase 2         423   4e-137   
ref|XP_010482932.1|  PREDICTED: GDP-L-galactose phosphorylase 2-like    421   1e-136   
ref|XP_002864375.1|  hypothetical protein ARALYDRAFT_918651             421   2e-136   
ref|NP_200323.1|  GDP-L-galactose phosphorylase                         421   3e-136   Arabidopsis thaliana [mouse-ear cress]
gb|ACG75920.1|  GDP-L-galactose phosphorylase                           421   5e-136   Malpighia glabra [acerola]
ref|XP_006401493.1|  hypothetical protein EUTSA_v10013622mg             419   1e-135   
emb|CAB36531.1|  putative protein                                       419   5e-135   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006280501.1|  hypothetical protein CARUB_v10026439mg             417   8e-135   
gb|EMT17985.1|  hypothetical protein F775_32461                         418   1e-134   
ref|XP_010675741.1|  PREDICTED: GDP-L-galactose phosphorylase 1         417   2e-134   
gb|EMS57447.1|  hypothetical protein TRIUR3_28682                       419   5e-134   
gb|AAM34266.1|AF508793_1  VTC2                                          416   6e-134   Arabidopsis thaliana [mouse-ear cress]
gb|ABR16684.1|  unknown                                                 413   3e-133   Picea sitchensis
ref|XP_010539307.1|  PREDICTED: GDP-L-galactose phosphorylase 1-like    413   6e-133   
gb|ABR16521.1|  unknown                                                 411   2e-132   Picea sitchensis
emb|CDX92792.1|  BnaC07g40500D                                          409   3e-132   
emb|CDY46677.1|  BnaA03g48310D                                          407   2e-131   
ref|XP_009127029.1|  PREDICTED: GDP-L-galactose phosphorylase 2         396   4e-127   
gb|KCW52128.1|  hypothetical protein EUGRSUZ_J015682                    392   8e-127   
ref|XP_002529463.1|  conserved hypothetical protein                     394   5e-126   Ricinus communis
ref|XP_001769469.1|  predicted protein                                  394   2e-125   
gb|KCW52138.1|  hypothetical protein EUGRSUZ_J01579                     389   1e-124   
gb|KCW70216.1|  hypothetical protein EUGRSUZ_F03491                     388   8e-124   
ref|XP_002973386.1|  hypothetical protein SELMODRAFT_99090              388   9e-124   
ref|XP_002976520.1|  hypothetical protein SELMODRAFT_105410             387   3e-123   
ref|XP_010660319.1|  PREDICTED: GDP-L-galactose phosphorylase 1-l...    383   7e-123   
gb|KDO62102.1|  hypothetical protein CISIN_1g012827mg                   384   1e-122   
ref|XP_001774558.1|  predicted protein                                  380   3e-121   
ref|XP_001753398.1|  predicted protein                                  380   4e-121   
emb|CDY20787.1|  BnaA02g09270D                                          386   6e-121   
gb|ABR16416.1|  unknown                                                 375   3e-120   Picea sitchensis
gb|EEE52889.1|  hypothetical protein OsJ_35472                          378   2e-119   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008647912.1|  PREDICTED: VTC2 isoform X2                         371   4e-117   
ref|XP_008647911.1|  PREDICTED: VTC2 isoform X1                         371   5e-117   
ref|XP_006413132.1|  hypothetical protein EUTSA_v10025206mg             367   1e-116   
gb|KCW52131.1|  hypothetical protein EUGRSUZ_J01570                     363   1e-115   
gb|KCW70217.1|  hypothetical protein EUGRSUZ_F03491                     358   4e-113   
gb|KHM99535.1|  GDP-L-galactose phosphorylase 1                         355   2e-112   
ref|XP_010926167.1|  PREDICTED: GDP-L-galactose phosphorylase 2-l...    357   4e-111   
gb|AGO64470.1|  GDP-L-galactose phosphorylase                           346   6e-110   
emb|CAN80482.1|  hypothetical protein VITISV_017519                     346   1e-107   Vitis vinifera
ref|XP_008780932.1|  PREDICTED: GDP-L-galactose phosphorylase 1-like    345   1e-107   
ref|XP_003617600.1|  hypothetical protein MTR_5g093390                  341   1e-107   
ref|XP_010916132.1|  PREDICTED: GDP-L-galactose phosphorylase 2-like    342   1e-105   
ref|XP_010926168.1|  PREDICTED: GDP-L-galactose phosphorylase 1-l...    340   4e-105   
dbj|BAH03300.1|  GDP-L-galactose:hexose-1-phosphate guanylyltrans...    330   1e-103   Prunus persica
ref|XP_010034477.1|  PREDICTED: GDP-L-galactose phosphorylase 1-like    325   6e-102   
gb|AFW74694.1|  hypothetical protein ZEAMMB73_918708                    323   2e-101   
ref|XP_002988631.1|  hypothetical protein SELMODRAFT_427287             315   2e-96    
ref|XP_009404393.1|  PREDICTED: GDP-L-galactose phosphorylase 1-like    315   6e-96    
gb|AAT45011.1|  unknown                                                 311   3e-95    Xerophyta humilis
gb|KCW52136.1|  hypothetical protein EUGRSUZ_J01577                     307   5e-94    
ref|XP_002979321.1|  hypothetical protein SELMODRAFT_110588             306   6e-93    
gb|EEC71974.1|  hypothetical protein OsI_04811                          305   1e-92    Oryza sativa Indica Group [Indian rice]
gb|EMS49953.1|  hypothetical protein TRIUR3_21856                       301   3e-91    
ref|XP_002967093.1|  hypothetical protein SELMODRAFT_439945             302   4e-91    
gb|EEE55829.1|  hypothetical protein OsJ_04435                          300   1e-90    Oryza sativa Japonica Group [Japonica rice]
ref|XP_004970941.1|  PREDICTED: GDP-L-galactose phosphorylase 1-l...    300   1e-90    
ref|XP_002960918.1|  hypothetical protein SELMODRAFT_139516             300   2e-90    
ref|XP_004970940.1|  PREDICTED: GDP-L-galactose phosphorylase 1-l...    300   3e-90    
tpg|DAA56303.1|  TPA: VTC2                                              300   2e-89    
ref|NP_001140486.1|  uncharacterized protein LOC100272546               295   5e-89    Zea mays [maize]
ref|XP_008672350.1|  PREDICTED: uncharacterized protein LOC100272...    294   8e-89    
gb|ACG33623.1|  VTC2                                                    293   2e-88    Zea mays [maize]
ref|XP_008672348.1|  PREDICTED: uncharacterized protein LOC100272...    295   2e-88    
ref|XP_006421135.1|  hypothetical protein CICLE_v10006850mg             289   2e-87    
ref|XP_006646570.1|  PREDICTED: GDP-L-galactose phosphorylase 2-like    290   4e-87    
ref|XP_002506606.1|  hypothetical protein MICPUN_64582                  293   1e-86    Micromonas commoda
ref|XP_010232701.1|  PREDICTED: GDP-L-galactose phosphorylase 1-l...    288   3e-86    
ref|XP_003567366.2|  PREDICTED: GDP-L-galactose phosphorylase 1-l...    288   9e-86    
ref|XP_003063182.1|  predicted protein                                  291   2e-84    
gb|KDO36138.1|  hypothetical protein CISIN_1g045630mg                   274   2e-82    
ref|XP_005850444.1|  hypothetical protein CHLNCDRAFT_57139              280   9e-82    
ref|XP_005649851.1|  hypothetical protein COCSUDRAFT_13851              271   6e-80    
dbj|BAB90526.1|  B1065G12.8                                             265   1e-77    Oryza sativa Japonica Group [Japonica rice]
ref|XP_001420569.1|  predicted protein                                  261   1e-76    Ostreococcus lucimarinus CCE9901
ref|XP_002948819.1|  hypothetical protein VOLCADRAFT_58668              235   4e-66    
ref|XP_007508728.1|  predicted protein                                  234   9e-64    
gb|KFM25983.1|  GDP-L-galactose phosphorylase 1                         223   3e-61    
ref|XP_001693879.1|  predicted protein                                  217   9e-60    Chlamydomonas reinhardtii
ref|XP_010034466.1|  PREDICTED: GDP-L-galactose phosphorylase 2-like    216   1e-59    
gb|AEZ51834.1|  GDP-galactose:glucose-1-phosphate guanyltransferase     220   1e-58    
dbj|BAM76580.1|  VTC2                                                   201   2e-56    
dbj|BAJ91935.1|  predicted protein                                      203   4e-56    
ref|NP_001045110.1|  Os01g0901300                                       193   7e-53    Oryza sativa Japonica Group [Japonica rice]
gb|AJC01343.1|  GDP-L-galactose-phosphorylase                           181   3e-50    
ref|XP_010245347.1|  PREDICTED: GDP-L-galactose phosphorylase 1-like    174   1e-44    
dbj|BAJ34309.1|  unnamed protein product                                167   1e-43    
ref|XP_006845994.1|  hypothetical protein AMTR_s00155p00050480          167   6e-42    
ref|XP_008804719.1|  PREDICTED: GDP-L-galactose phosphorylase 1-like    164   5e-41    
ref|XP_002263657.1|  PREDICTED: GDP-L-galactose phosphorylase 1-l...    162   2e-40    Vitis vinifera
ref|XP_010923696.1|  PREDICTED: GDP-L-galactose phosphorylase 1-l...    162   3e-40    
ref|XP_010655755.1|  PREDICTED: GDP-L-galactose phosphorylase 1-l...    161   4e-40    
ref|XP_001631502.1|  predicted protein                                  161   4e-40    Nematostella vectensis
ref|XP_010655757.1|  PREDICTED: GDP-L-galactose phosphorylase 1-l...    158   2e-39    
ref|XP_004070140.1|  PREDICTED: GDP-D-glucose phosphorylase 1-like      159   2e-39    
gb|AIW66501.1|  VTC2 protein                                            151   2e-39    
ref|XP_009362225.1|  PREDICTED: GDP-L-galactose phosphorylase 2-l...    159   2e-39    
emb|CEF97775.1|  unnamed product                                        155   5e-39    
ref|XP_008372237.1|  PREDICTED: GDP-L-galactose phosphorylase 2-like    158   6e-39    
ref|XP_010906479.1|  PREDICTED: GDP-L-galactose phosphorylase 1-l...    155   6e-38    
ref|XP_007906745.1|  PREDICTED: GDP-D-glucose phosphorylase 1           155   2e-37    
ref|XP_010923694.1|  PREDICTED: GDP-L-galactose phosphorylase 1-l...    154   2e-37    
ref|XP_008383397.1|  PREDICTED: GDP-L-galactose phosphorylase 2-like    154   2e-37    
ref|XP_008225604.1|  PREDICTED: GDP-L-galactose phosphorylase 1-l...    153   3e-37    
ref|XP_007526351.1|  PREDICTED: GDP-D-glucose phosphorylase 1           153   4e-37    
ref|XP_008794437.1|  PREDICTED: GDP-L-galactose phosphorylase 1-l...    153   4e-37    
ref|XP_009344416.1|  PREDICTED: GDP-L-galactose phosphorylase 2-l...    152   7e-37    
ref|XP_003514267.1|  PREDICTED: GDP-D-glucose phosphorylase 1           152   7e-37    
ref|XP_009344415.1|  PREDICTED: GDP-L-galactose phosphorylase 2-l...    152   1e-36    
ref|XP_008225603.1|  PREDICTED: GDP-L-galactose phosphorylase 1-l...    151   1e-36    
ref|XP_007022928.1|  Mannose-1-phosphate guanylyltransferase, put...    151   2e-36    
ref|XP_007022929.1|  Mannose-1-phosphate guanylyltransferase, put...    151   2e-36    
dbj|BAG94528.1|  unnamed protein product                                145   3e-36    Oryza sativa Japonica Group [Japonica rice]
ref|XP_003641882.1|  PREDICTED: GDP-D-glucose phosphorylase 1           150   4e-36    
ref|XP_004370690.1|  PREDICTED: GDP-D-glucose phosphorylase 1           150   5e-36    
ref|XP_006905337.1|  PREDICTED: GDP-D-glucose phosphorylase 1 iso...    150   6e-36    
ref|XP_006885279.1|  PREDICTED: GDP-D-glucose phosphorylase 1           150   6e-36    
ref|XP_001168711.1|  PREDICTED: GDP-D-glucose phosphorylase 1 iso...    149   7e-36    Pan troglodytes
gb|ABG81448.1|  hypothetical protein LOC390637                          149   8e-36    Bos taurus [bovine]
gb|AAH37479.1|  D330012F22Rik protein                                   149   8e-36    Mus musculus [mouse]
ref|XP_003440556.1|  PREDICTED: GDP-D-glucose phosphorylase 1-like      149   8e-36    
ref|NP_001015629.1|  GDP-D-glucose phosphorylase 1                      149   9e-36    Bos taurus [bovine]
ref|XP_009428103.1|  PREDICTED: GDP-D-glucose phosphorylase 1 iso...    150   1e-35    
dbj|BAE38719.1|  unnamed protein product                                149   1e-35    Mus musculus [mouse]
ref|XP_004293983.1|  PREDICTED: GDP-L-galactose phosphorylase 1-like    149   1e-35    
ref|NP_848867.2|  GDP-D-glucose phosphorylase 1                         149   1e-35    Mus musculus [mouse]
dbj|BAE25508.1|  unnamed protein product                                149   1e-35    Mus musculus [mouse]
dbj|BAC85370.1|  unnamed protein product                                149   1e-35    Homo sapiens [man]
ref|XP_008958116.1|  PREDICTED: GDP-D-glucose phosphorylase 1           149   1e-35    
ref|XP_006106744.1|  PREDICTED: GDP-D-glucose phosphorylase 1           149   1e-35    
ref|XP_004432012.1|  PREDICTED: GDP-D-glucose phosphorylase 1           149   2e-35    
ref|NP_001013679.2|  GDP-D-glucose phosphorylase 1                      148   2e-35    Homo sapiens [man]
ref|XP_006970068.1|  PREDICTED: GDP-D-glucose phosphorylase 1 iso...    148   2e-35    
ref|XP_010716004.1|  PREDICTED: GDP-D-glucose phosphorylase 1           145   2e-35    
ref|XP_008274095.1|  PREDICTED: GDP-D-glucose phosphorylase 1           148   2e-35    
ref|XP_001498916.2|  PREDICTED: GDP-D-glucose phosphorylase 1           148   3e-35    Equus caballus [domestic horse]
ref|XP_004563487.1|  PREDICTED: GDP-D-glucose phosphorylase 1-lik...    147   3e-35    
ref|XP_004056807.1|  PREDICTED: GDP-D-glucose phosphorylase 1 iso...    147   4e-35    
gb|ELR56806.1|  hypothetical protein M91_16071                          147   4e-35    
ref|XP_010839347.1|  PREDICTED: GDP-D-glucose phosphorylase 1           147   4e-35    
ref|XP_007228362.1|  PREDICTED: GDP-D-glucose phosphorylase 1-like      147   5e-35    
ref|XP_004017802.1|  PREDICTED: GDP-D-glucose phosphorylase 1           147   5e-35    
ref|XP_004658249.1|  PREDICTED: GDP-D-glucose phosphorylase 1           147   5e-35    
ref|XP_010985062.1|  PREDICTED: GDP-D-glucose phosphorylase 1           147   6e-35    
ref|XP_007108418.1|  PREDICTED: GDP-D-glucose phosphorylase 1           147   6e-35    
gb|ELT93039.1|  hypothetical protein CAPTEDRAFT_105623                  145   6e-35    
ref|XP_218822.2|  PREDICTED: GDP-D-glucose phosphorylase 1              147   7e-35    Rattus norvegicus [brown rat]
ref|XP_004321513.1|  PREDICTED: GDP-D-glucose phosphorylase 1           147   7e-35    
ref|XP_006198508.1|  PREDICTED: GDP-D-glucose phosphorylase 1           147   7e-35    
ref|XP_005895216.1|  PREDICTED: GDP-D-glucose phosphorylase 1           147   7e-35    
ref|XP_008529974.1|  PREDICTED: LOW QUALITY PROTEIN: GDP-D-glucos...    147   7e-35    
ref|XP_005381585.1|  PREDICTED: GDP-D-glucose phosphorylase 1           147   7e-35    
ref|XP_010953384.1|  PREDICTED: GDP-D-glucose phosphorylase 1           147   8e-35    
ref|XP_008562207.1|  PREDICTED: GDP-D-glucose phosphorylase 1           147   8e-35    
gb|EAX02093.1|  hCG2044041                                              144   9e-35    
ref|XP_006192645.1|  PREDICTED: GDP-D-glucose phosphorylase 1           146   9e-35    
ref|XP_006058300.1|  PREDICTED: GDP-D-glucose phosphorylase 1 iso...    146   9e-35    
emb|CDY06610.1|  BnaC02g13340D                                          144   9e-35    
ref|XP_005695038.1|  PREDICTED: GDP-D-glucose phosphorylase 1           146   9e-35    
ref|XP_004278313.1|  PREDICTED: GDP-D-glucose phosphorylase 1 iso...    146   1e-34    
ref|XP_005357879.1|  PREDICTED: GDP-D-glucose phosphorylase 1           147   1e-34    
ref|XP_003413934.1|  PREDICTED: GDP-D-glucose phosphorylase 1           146   1e-34    
ref|XP_007022931.1|  Mannose-1-phosphate guanylyltransferase, put...    146   1e-34    
ref|XP_006058299.1|  PREDICTED: GDP-D-glucose phosphorylase 1 iso...    146   1e-34    
ref|XP_004623525.1|  PREDICTED: GDP-D-glucose phosphorylase 1           146   2e-34    
ref|XP_006058298.1|  PREDICTED: GDP-D-glucose phosphorylase 1 iso...    146   2e-34    
ref|XP_005077931.1|  PREDICTED: GDP-D-glucose phosphorylase 1           145   2e-34    
ref|XP_005977231.1|  PREDICTED: LOW QUALITY PROTEIN: GDP-D-glucos...    145   2e-34    
ref|XP_002749151.1|  PREDICTED: GDP-D-glucose phosphorylase 1           145   2e-34    
ref|XP_004468951.1|  PREDICTED: GDP-D-glucose phosphorylase 1 iso...    145   2e-34    
ref|XP_006058293.1|  PREDICTED: GDP-D-glucose phosphorylase 1 iso...    146   2e-34    
ref|XP_005560569.1|  PREDICTED: GDP-D-glucose phosphorylase 1 iso...    145   2e-34    
ref|XP_004577982.1|  PREDICTED: GDP-D-glucose phosphorylase 1           145   3e-34    
ref|XP_007470596.1|  PREDICTED: GDP-D-glucose phosphorylase 1           145   3e-34    
ref|XP_001369200.1|  PREDICTED: GDP-D-glucose phosphorylase 1 iso...    145   3e-34    
ref|XP_010737166.1|  PREDICTED: GDP-D-glucose phosphorylase 1           144   3e-34    
ref|XP_007194388.1|  PREDICTED: GDP-D-glucose phosphorylase 1 iso...    145   3e-34    
ref|XP_009209204.1|  PREDICTED: GDP-D-glucose phosphorylase 1           145   3e-34    
ref|XP_007194387.1|  PREDICTED: GDP-D-glucose phosphorylase 1 iso...    145   3e-34    
ref|XP_005560570.1|  PREDICTED: GDP-D-glucose phosphorylase 1 iso...    145   3e-34    
gb|EHH27594.1|  hypothetical protein EGK_17831                          145   3e-34    
ref|NP_001180975.1|  GDP-D-glucose phosphorylase C15orf58               145   3e-34    
ref|XP_010767779.1|  PREDICTED: GDP-D-glucose phosphorylase 1           144   3e-34    
ref|XP_010376912.1|  PREDICTED: GDP-D-glucose phosphorylase 1           145   4e-34    
ref|XP_007988598.1|  PREDICTED: GDP-D-glucose phosphorylase 1           144   4e-34    
ref|XP_002919825.1|  PREDICTED: UPF0580 protein C15orf58 homolog        144   4e-34    
ref|XP_005942883.1|  PREDICTED: GDP-D-glucose phosphorylase 1-lik...    144   5e-34    
gb|EHB18469.1|  hypothetical protein GW7_08833                          144   6e-34    
ref|XP_005320208.1|  PREDICTED: GDP-D-glucose phosphorylase 1           144   6e-34    
ref|XP_007479378.1|  PREDICTED: GDP-D-glucose phosphorylase 1 iso...    145   6e-34    
sp|Q8HXE4.1|GDPP1_MACFA  RecName: Full=GDP-D-glucose phosphorylase 1    144   6e-34    
gb|KFM76272.1|  hypothetical protein X975_20518                         140   7e-34    
ref|XP_003268546.1|  PREDICTED: GDP-D-glucose phosphorylase 1           144   7e-34    
ref|NP_001071021.1|  GDP-D-glucose phosphorylase 1                      143   8e-34    
ref|XP_008159484.1|  PREDICTED: GDP-D-glucose phosphorylase 1           144   8e-34    
ref|XP_004398350.1|  PREDICTED: GDP-D-glucose phosphorylase 1           143   1e-33    
ref|NP_001072398.1|  GDP-D-glucose phosphorylase 1                      144   1e-33    
ref|XP_003967466.1|  PREDICTED: GDP-D-glucose phosphorylase 1-like      142   1e-33    
ref|XP_006867195.1|  PREDICTED: GDP-D-glucose phosphorylase 1           143   2e-33    
ref|XP_006152884.1|  PREDICTED: GDP-D-glucose phosphorylase 1           143   2e-33    
ref|XP_004763779.1|  PREDICTED: GDP-D-glucose phosphorylase 1 iso...    143   2e-33    
ref|XP_004763778.1|  PREDICTED: GDP-D-glucose phosphorylase 1 iso...    143   2e-33    
ref|XP_004763777.1|  PREDICTED: GDP-D-glucose phosphorylase 1 iso...    143   2e-33    
ref|XP_008851018.1|  PREDICTED: GDP-D-glucose phosphorylase 1           143   2e-33    
ref|XP_009047709.1|  hypothetical protein LOTGIDRAFT_225290             142   2e-33    
ref|XP_004763776.1|  PREDICTED: GDP-D-glucose phosphorylase 1 iso...    143   2e-33    
ref|XP_010619383.1|  PREDICTED: GDP-D-glucose phosphorylase 1 iso...    142   3e-33    
ref|XP_003482284.1|  PREDICTED: GDP-D-glucose phosphorylase 1-like      142   3e-33    
ref|XP_004708159.1|  PREDICTED: GDP-D-glucose phosphorylase 1           142   3e-33    
ref|XP_003755569.1|  PREDICTED: GDP-D-glucose phosphorylase C15or...    142   4e-33    
ref|XP_010619381.1|  PREDICTED: GDP-D-glucose phosphorylase 1 iso...    142   5e-33    
emb|CDY06609.1|  BnaC02g13330D                                          132   5e-33    
ref|XP_007545566.1|  PREDICTED: GDP-D-glucose phosphorylase 1           141   5e-33    
ref|XP_005989860.1|  PREDICTED: GDP-D-glucose phosphorylase 1           142   5e-33    
ref|XP_004693059.1|  PREDICTED: GDP-D-glucose phosphorylase 1           141   6e-33    
ref|XP_005737703.1|  PREDICTED: ammonium transporter Rh type C 1-...    145   7e-33    
ref|XP_007943352.1|  PREDICTED: GDP-D-glucose phosphorylase 1           141   7e-33    
ref|XP_003986853.1|  PREDICTED: GDP-D-glucose phosphorylase 1 iso...    141   8e-33    
ref|XP_003967467.1|  PREDICTED: GDP-D-glucose phosphorylase 1-like      142   8e-33    
ref|XP_005521865.1|  PREDICTED: GDP-D-glucose phosphorylase 1           140   9e-33    
ref|XP_007433686.1|  PREDICTED: GDP-D-glucose phosphorylase 1           140   1e-32    
ref|XP_006745418.1|  PREDICTED: GDP-D-glucose phosphorylase 1           140   1e-32    
ref|XP_005618423.1|  PREDICTED: GDP-D-glucose phosphorylase 1 iso...    139   3e-32    
ref|XP_008047066.1|  PREDICTED: GDP-D-glucose phosphorylase 1           139   3e-32    
ref|XP_005618422.1|  PREDICTED: GDP-D-glucose phosphorylase 1 iso...    139   3e-32    
ref|XP_536194.2|  PREDICTED: GDP-D-glucose phosphorylase 1 isofor...    139   3e-32    
ref|XP_004852848.1|  PREDICTED: LOW QUALITY PROTEIN: tubulin poly...    144   3e-32    
ref|XP_008409710.1|  PREDICTED: GDP-D-glucose phosphorylase 1           139   3e-32    
ref|XP_004909235.1|  PREDICTED: LOW QUALITY PROTEIN: tubulin poly...    144   3e-32    
ref|XP_003803120.1|  PREDICTED: GDP-D-glucose phosphorylase 1           139   4e-32    
ref|XP_002129263.1|  PREDICTED: GDP-D-glucose phosphorylase 1           138   4e-32    
ref|XP_003921661.1|  PREDICTED: GDP-D-glucose phosphorylase 1           139   4e-32    
ref|XP_006128680.1|  PREDICTED: GDP-D-glucose phosphorylase 1-like      139   4e-32    
ref|XP_005802333.1|  PREDICTED: GDP-D-glucose phosphorylase 1-like      138   4e-32    
ref|XP_006273511.1|  PREDICTED: GDP-D-glucose phosphorylase 1           139   4e-32    
ref|XP_003475536.1|  PREDICTED: GDP-D-glucose phosphorylase 1 iso...    139   5e-32    
ref|XP_005006334.1|  PREDICTED: GDP-D-glucose phosphorylase 1 iso...    139   5e-32    
ref|XP_002735196.1|  PREDICTED: GDP-D-glucose phosphorylase 1-like      138   6e-32    
ref|NP_001104198.1|  GDP-D-glucose phosphorylase 1                      138   9e-32    
ref|XP_006030863.1|  PREDICTED: GDP-D-glucose phosphorylase 1           137   1e-31    
gb|EPY75017.1|  hypothetical protein CB1_001815028                      136   1e-31    
ref|XP_004963236.1|  PREDICTED: GDP-L-galactose phosphorylase 1-l...    137   2e-31    
ref|XP_002613324.1|  hypothetical protein BRAFLDRAFT_118724             136   2e-31    
gb|KFV64948.1|  GDP-D-glucose phosphorylase 1                           136   2e-31    
ref|XP_004617641.1|  PREDICTED: GDP-D-glucose phosphorylase 1           136   3e-31    
ref|XP_786940.3|  PREDICTED: GDP-D-glucose phosphorylase C15orf58...    136   3e-31    
ref|XP_009895642.1|  PREDICTED: GDP-D-glucose phosphorylase 1           136   3e-31    
ref|XP_002721536.1|  PREDICTED: GDP-D-glucose phosphorylase 1           136   4e-31    
ref|XP_006448886.1|  hypothetical protein CICLE_v10017717mg             135   4e-31    
ref|XP_006468321.1|  PREDICTED: GDP-L-galactose phosphorylase 1-like    135   4e-31    
ref|XP_008310755.1|  PREDICTED: GDP-D-glucose phosphorylase 1           135   7e-31    
ref|XP_010570632.1|  PREDICTED: LOW QUALITY PROTEIN: GDP-D-glucos...    140   9e-31    
ref|XP_008686011.1|  PREDICTED: LOW QUALITY PROTEIN: GDP-D-glucos...    135   1e-30    
gb|EKC20071.1|  UPF0580 protein C15orf58-like protein                   131   1e-30    
gb|EMS59556.1|  hypothetical protein TRIUR3_01198                       134   1e-30    
ref|NP_001156693.1|  uncharacterized protein LOC100165161               133   2e-30    
ref|XP_010882064.1|  PREDICTED: GDP-D-glucose phosphorylase 1           132   3e-30    
gb|AEW08439.1|  hypothetical protein 2_9822_02                          126   5e-30    
ref|XP_002109047.1|  hypothetical protein TRIADDRAFT_52681              132   6e-30    
dbj|BAJ89803.1|  predicted protein                                      132   7e-30    
ref|XP_009397387.1|  PREDICTED: GDP-L-galactose phosphorylase 1-like    132   8e-30    
ref|XP_005300797.1|  PREDICTED: GDP-D-glucose phosphorylase 1           131   9e-30    
ref|XP_007059618.1|  PREDICTED: GDP-D-glucose phosphorylase 1           130   1e-29    
gb|AFG67790.1|  hypothetical protein 2_9822_02                          124   2e-29    
gb|AFG67785.1|  hypothetical protein 2_9822_02                          124   2e-29    
gb|AEW08438.1|  hypothetical protein 2_9822_02                          124   2e-29    
ref|XP_006629148.1|  PREDICTED: GDP-D-glucose phosphorylase 1-like      130   2e-29    
gb|EFX83789.1|  hypothetical protein DAPPUDRAFT_100309                  130   2e-29    
emb|CAG03444.1|  unnamed protein product                                127   7e-29    
ref|XP_009030631.1|  hypothetical protein HELRODRAFT_90313              126   1e-28    
ref|NP_001067256.1|  Os12g0612100                                       128   2e-28    
gb|AFW74693.1|  hypothetical protein ZEAMMB73_918708                    120   3e-28    
emb|CDQ63227.1|  unnamed protein product                                125   5e-28    
ref|XP_002415731.1|  conserved hypothetical protein                     125   9e-28    
ref|XP_001512648.2|  PREDICTED: GDP-D-glucose phosphorylase 1           124   1e-27    
ref|XP_008546662.1|  PREDICTED: GDP-D-glucose phosphorylase 1           124   3e-27    
gb|EMP36059.1|  GDP-D-glucose phosphorylase C15orf58 like protein       124   3e-27    
gb|KDO75243.1|  hypothetical protein CISIN_1g018301mg                   123   3e-27    
ref|XP_006664186.1|  PREDICTED: GDP-L-galactose phosphorylase 2-like    123   9e-27    
gb|EEC69664.1|  hypothetical protein OsI_39091                          125   3e-26    
ref|XP_006811068.1|  PREDICTED: GDP-D-glucose phosphorylase 1-like      118   2e-25    
gb|EZA59551.1|  hypothetical protein X777_00394                         118   2e-25    
ref|XP_003425937.1|  PREDICTED: GDP-D-glucose phosphorylase 1           117   4e-25    
ref|XP_003493962.1|  PREDICTED: GDP-D-glucose phosphorylase C15or...    114   4e-25    
gb|EWS71121.1|  GDP-L-galactose phosphorylase, putative                 118   4e-25    
gb|EHJ78476.1|  hypothetical protein KGM_14476                          115   1e-24    
ref|XP_009362226.1|  PREDICTED: GDP-L-galactose phosphorylase 2-l...    115   2e-24    
ref|XP_006562068.1|  PREDICTED: GDP-D-glucose phosphorylase 1-lik...    111   5e-24    
gb|EMT07467.1|  hypothetical protein F775_31606                         115   5e-24    
ref|XP_006562067.1|  PREDICTED: GDP-D-glucose phosphorylase 1-lik...    111   6e-24    
ref|XP_010098558.1|  hypothetical protein L484_026000                   113   1e-23    
ref|XP_006610300.1|  PREDICTED: GDP-D-glucose phosphorylase 1-like      112   1e-23    
gb|ELK25763.1|  hypothetical protein MDA_GLEAN10006761                  113   2e-23    
gb|AGU28438.1|  mannose-1-phosphate guanylyltransferase GDP             107   7e-23    
ref|XP_006769649.1|  PREDICTED: GDP-D-glucose phosphorylase 1           110   1e-22    
ref|XP_003577487.1|  PREDICTED: GDP-L-galactose phosphorylase 1-like    110   1e-22    
gb|ERE79871.1|  tubulin polyglutamylase TTLL13                          113   2e-22    
gb|ERE79870.1|  tubulin polyglutamylase TTLL13                          113   2e-22    
gb|KDD74865.1|  hypothetical protein H632_c1024p0                       112   2e-22    
ref|XP_007211868.1|  hypothetical protein PRUPE_ppa010097mg             107   5e-22    
ref|XP_003780367.1|  PREDICTED: LOW QUALITY PROTEIN: GDP-D-glucos...    108   5e-22    
gb|ETN64930.1|  hypothetical protein AND_003315                         107   9e-22    
ref|XP_002862180.1|  predicted protein                                  101   1e-21    
ref|XP_005104165.1|  PREDICTED: GDP-D-glucose phosphorylase 1-lik...    107   1e-21    
ref|XP_005878571.1|  PREDICTED: GDP-D-glucose phosphorylase 1           107   2e-21    
ref|XP_006789714.1|  PREDICTED: GDP-D-glucose phosphorylase 1-like      103   2e-21    
gb|ABA99380.1|  VTC2, putative, expressed                               105   4e-21    
ref|XP_002523185.1|  conserved hypothetical protein                     104   5e-21    
gb|AAX46570.1|  similar to RIKEN cDNA D330012F22 gene                   102   9e-21    
emb|CDY06608.1|  BnaC02g13320D                                          100   2e-20    
ref|XP_005104167.1|  PREDICTED: GDP-D-glucose phosphorylase 1-lik...    103   2e-20    
ref|XP_005104166.1|  PREDICTED: GDP-D-glucose phosphorylase 1-lik...    103   3e-20    
ref|XP_005104164.1|  PREDICTED: GDP-D-glucose phosphorylase 1-lik...    103   4e-20    
gb|EFN81306.1|  UPF0580 protein C15orf58                                102   5e-20    
ref|XP_008911014.1|  hypothetical protein PPTG_15980                    102   5e-20    
gb|ETK79320.1|  hypothetical protein L915_14804                         102   6e-20    
dbj|BAC39476.1|  unnamed protein product                                100   9e-20    
gb|ETP37053.1|  hypothetical protein F442_15100                         101   9e-20    
gb|ETO67860.1|  hypothetical protein F444_15250                         101   9e-20    
gb|ETI39111.1|  hypothetical protein F443_15262                         101   1e-19    
gb|EFN65130.1|  UPF0580 protein C15orf58-like protein                 99.0    2e-19    
gb|ERG82410.1|  gdp-d-glucose phosphorylase                             100   4e-19    
gb|EFZ15821.1|  hypothetical protein SINV_10863                       98.2    9e-19    
emb|CDQ03562.1|  Protein BM-MCP-1, isoform b                          99.4    1e-18    
emb|CDJ93744.1|  Unknown                                              99.8    1e-18    
gb|EJW89046.1|  hypothetical protein WUBG_00039                       99.0    1e-18    
ref|XP_011050121.1|  PREDICTED: GDP-D-glucose phosphorylase 1         97.4    2e-18    
dbj|BAC39622.1|  unnamed protein product                              96.3    2e-18    
ref|XP_001896382.1|  D330012F22Rik protein                            97.8    3e-18    
ref|XP_002029880.1|  GM25151                                          97.1    4e-18    
gb|KHN76270.1|  GDP-D-glucose phosphorylase 1                         98.2    5e-18    
ref|XP_002165277.2|  PREDICTED: GDP-D-glucose phosphorylase 1-like    95.1    6e-18    
gb|EPQ15313.1|  GDP-D-glucose phosphorylase like protein              95.1    9e-18    
gb|EJD74278.1|  hypothetical protein LOAG_18387                       96.3    1e-17    
ref|XP_002093303.1|  GE20843                                          95.5    1e-17    
gb|AAL90017.1|  AT07815p                                              95.1    2e-17    
emb|CAN61883.1|  hypothetical protein VITISV_001208                   93.6    2e-17    
gb|EYC06588.1|  hypothetical protein Y032_0075g973                    95.5    3e-17    
gb|EYC06587.1|  hypothetical protein Y032_0075g973                    95.1    3e-17    
ref|XP_008225607.1|  PREDICTED: GDP-L-galactose phosphorylase 1-l...  93.2    3e-17    
ref|XP_008225605.1|  PREDICTED: GDP-L-galactose phosphorylase 1-l...  92.8    4e-17    
gb|EMT20737.1|  hypothetical protein F775_19319                       92.4    5e-17    
ref|NP_648319.1|  CG3552, isoform A                                   93.6    6e-17    
gb|EFX88397.1|  hypothetical protein DAPPUDRAFT_42599                 89.7    2e-16    
ref|XP_001352613.2|  GA17516                                          90.5    4e-16    
ref|XP_004922840.1|  PREDICTED: GDP-D-glucose phosphorylase 1-like    90.1    4e-16    
emb|CBY21855.1|  unnamed protein product                              91.7    7e-16    
emb|CBY38295.1|  unnamed protein product                              91.7    7e-16    
gb|EDL07026.1|  mCG131044                                             88.6    8e-16    
ref|XP_005184763.1|  PREDICTED: GDP-D-glucose phosphorylase 1-like    89.0    8e-16    
ref|XP_002024859.1|  GL17880                                          88.6    1e-15    
ref|XP_004338258.1|  carboxylesterase superfamily protein             91.3    1e-15    
gb|EGT46989.1|  hypothetical protein CAEBREN_26078                    90.1    1e-15    
ref|XP_001984023.1|  GH15238                                          88.2    2e-15    
gb|AAI27822.1|  C15orf58 protein                                      85.9    2e-15    
ref|XP_002636829.1|  Hypothetical protein CBG09277                    89.7    2e-15    
emb|CAP29281.2|  Protein CBR-MCP-1                                    89.7    2e-15    
ref|XP_001956298.1|  GF25136                                          89.0    2e-15    
ref|NP_001023638.1|  Protein MCP-1, isoform a                         89.4    2e-15    
ref|XP_002008199.1|  GI11948                                          87.4    3e-15    
ref|NP_001023639.1|  Protein MCP-1, isoform b                         89.0    3e-15    
ref|XP_008794439.1|  PREDICTED: GDP-L-galactose phosphorylase 1-l...  87.0    4e-15    
ref|XP_002131802.1|  PREDICTED: GDP-D-glucose phosphorylase 1-like    87.4    4e-15    
ref|XP_007078346.1|  PREDICTED: LOW QUALITY PROTEIN: GDP-D-glucos...  85.1    1e-14    
emb|CBY23445.1|  unnamed protein product                              86.7    2e-14    
ref|XP_311278.4|  AGAP000740-PA                                       84.3    3e-14    
ref|XP_003079064.1|  Predicted hydrolase (HIT family) (ISS)           82.0    4e-14    
ref|XP_001972174.1|  GG15380                                          84.3    5e-14    
ref|XP_008485433.1|  PREDICTED: GDP-D-glucose phosphorylase 1         79.7    2e-13    
ref|XP_003112406.1|  hypothetical protein CRE_30836                   82.0    5e-13    
ref|XP_001749638.1|  hypothetical protein                             81.3    6e-13    
ref|XP_002068503.1|  GK20384                                          80.1    1e-12    
gb|AEW08839.1|  hypothetical protein CL1894Contig1_03                 73.6    4e-12    
ref|XP_001661616.1|  hypothetical protein AaeL_AAEL011367             76.6    1e-11    



>ref|XP_009784694.1| PREDICTED: GDP-L-galactose phosphorylase 2-like [Nicotiana sylvestris]
 gb|ACD92981.1| VTC2-like protein [Nicotiana tabacum]
Length=443

 Score =   503 bits (1295),  Expect = 5e-168, Method: Compositional matrix adjust.
 Identities = 247/337 (73%), Positives = 283/337 (84%), Gaps = 6/337 (2%)
 Frame = -1

Query  2041  MLTIKRVPTVVSNYQDDAPEDSKPESLGCGRNCLGQCCLPVSCLPLFAFKNDEHK-CDGD  1865
             MLTIKRVPT+VSNYQ+D PE +    +GCGRNCLG CCLPVS LPL+AFKND+++  + +
Sbjct  1     MLTIKRVPTLVSNYQEDVPESNN--VVGCGRNCLGFCCLPVSRLPLYAFKNDDNEPIENN  58

Query  1864  WNYLSYGECPISFLSDLLLGQWEERMSRGLFRYDVTSCETKIIPGTFGFIAQLNEGRHLK  1685
              + L   +C ISFL+DLLLG WEERMS+GLFRYDVT+CETK+IPG +GFIAQLNEGRHLK
Sbjct  59    IDTLPGEDCQISFLNDLLLGLWEERMSQGLFRYDVTTCETKVIPGRYGFIAQLNEGRHLK  118

Query  1684  KRPTEFRVDQVLQPFDENKFNFTKIGQEEVLFRFEPSNDCKSHYLPSGLVDARSGSPTVL  1505
             KRPTEFR+DQVLQPFDENKFNFTK+GQ+EVLFRFEPS D K+ Y     VD    SP+++
Sbjct  119   KRPTEFRIDQVLQPFDENKFNFTKVGQDEVLFRFEPSTDYKARYFSGVGVDV-GISPSIV  177

Query  1504  AINVSPIEYGHVLLIPRVLDCLPQRIDHDSFFVAMHLAKEAADPFFRVGYNSLGAFATIN  1325
             AINVSPIEYGHVLLIPRVLD LPQRID DSF VA+H A+E ADPFFRVGYNSLGAFATIN
Sbjct  178   AINVSPIEYGHVLLIPRVLDYLPQRIDRDSFTVALHFARELADPFFRVGYNSLGAFATIN  237

Query  1324  HLHFQAYYLQVPFPVEKTPTREIMRGREQGDGGIVVSQLLNYPARALLFEG--GSTVRDL  1151
             HLHFQAYYL VPFPVEK P R IMRG+  GD G++VS+LLNYP R   FEG  GSTVRDL
Sbjct  238   HLHFQAYYLSVPFPVEKAPMRRIMRGKGLGDAGVIVSKLLNYPVRGFSFEGGNGSTVRDL  297

Query  1150  SDAVANSCISLQNNNIPFNLLISERGNKVFLFPQVHS  1040
             SDAV NSCISLQN NIPFN+LI++ G K+FLFPQ ++
Sbjct  298   SDAVVNSCISLQNKNIPFNILIAQCGKKIFLFPQCYA  334


 Score =   136 bits (342),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 63/77 (82%), Positives = 71/77 (92%), Gaps = 0/77 (0%)
 Frame = -2

Query  759  FSKCYAEKQACGKIDQEILDTWVNPAVWEISGHMVLKRREDYDDASEDYAWRLLSEVSLS  580
            F +CYAEKQA G +DQE+LDT VNPAVWEISGHMVLKRR+DY+DASE+YAW+LLSEVSLS
Sbjct  329  FPQCYAEKQALGVVDQELLDTQVNPAVWEISGHMVLKRRKDYNDASEEYAWKLLSEVSLS  388

Query  579  EERFEEVKAYVSRAADL  529
            EERFEEVK Y+S AADL
Sbjct  389  EERFEEVKGYISEAADL  405



>ref|XP_011099472.1| PREDICTED: GDP-L-galactose phosphorylase 2-like [Sesamum indicum]
Length=447

 Score =   499 bits (1286),  Expect = 1e-166, Method: Compositional matrix adjust.
 Identities = 243/339 (72%), Positives = 278/339 (82%), Gaps = 2/339 (1%)
 Frame = -1

Query  2041  MLTIKRVPTVVSNYQDD-APEDSKPESLGCGRNCLGQCCLPVSCLPLFAFKNDEHKCDGD  1865
             MLTIKRVPTVVSNYQ+  + ED K  + GCGRNCLG CCLPVS LPL+AFKNDEH+   D
Sbjct  7     MLTIKRVPTVVSNYQESGSSEDLKSRAEGCGRNCLGDCCLPVSKLPLYAFKNDEHERVED  66

Query  1864  WNYLSYGECPI-SFLSDLLLGQWEERMSRGLFRYDVTSCETKIIPGTFGFIAQLNEGRHL  1688
              +    G CP  S L++LLLGQWE RM+RGLFRYDVTSCETK+IPG +GFIAQLNEGRHL
Sbjct  67    IHGSCNGRCPQRSSLNNLLLGQWENRMNRGLFRYDVTSCETKVIPGKYGFIAQLNEGRHL  126

Query  1687  KKRPTEFRVDQVLQPFDENKFNFTKIGQEEVLFRFEPSNDCKSHYLPSGLVDARSGSPTV  1508
             KKRPTEFR+D+VLQPFDENKFNFTK+GQEEVLFRFEP+    S Y PS L D+   SP+V
Sbjct  127   KKRPTEFRIDKVLQPFDENKFNFTKVGQEEVLFRFEPNKGKTSFYFPSSLADSEKDSPSV  186

Query  1507  LAINVSPIEYGHVLLIPRVLDCLPQRIDHDSFFVAMHLAKEAADPFFRVGYNSLGAFATI  1328
             +AINVSPIEYGHVLLIPRVLD LPQRID DS  +A HLAKEA+DPFFRVGYNSLGAFATI
Sbjct  187   VAINVSPIEYGHVLLIPRVLDQLPQRIDRDSLLLAFHLAKEASDPFFRVGYNSLGAFATI  246

Query  1327  NHLHFQAYYLQVPFPVEKTPTREIMRGREQGDGGIVVSQLLNYPARALLFEGGSTVRDLS  1148
             NHLHFQAYYL VPFP+EK PT   M  +   + G+VVS+LL+YP R L+FEGG  + DL 
Sbjct  247   NHLHFQAYYLSVPFPIEKAPTCRTMSSKGSYETGVVVSKLLDYPVRGLVFEGGCQLHDLC  306

Query  1147  DAVANSCISLQNNNIPFNLLISERGNKVFLFPQVHSNSV  1031
             DAVA+SCISLQNNNIPFNLLIS+RG ++FL PQ ++  +
Sbjct  307   DAVASSCISLQNNNIPFNLLISDRGKRIFLLPQCYAEKL  345


 Score =   122 bits (307),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 62/105 (59%), Positives = 76/105 (72%), Gaps = 2/105 (2%)
 Frame = -2

Query  759  FSKCYAEKQACGKIDQEILDTWVNPAVWEISGHMVLKRREDYDDASEDYAWRLLSEVSLS  580
              +CYAEK ACG+++QE+LDT VNPA WEISGHMVLK R+DYD+ASE YAWRLL+EVSLS
Sbjct  337  LPQCYAEKLACGEVNQELLDTQVNPAAWEISGHMVLKHRKDYDEASEQYAWRLLAEVSLS  396

Query  579  EERFEEVKAYVSRAADLLLDSECSNGGSQPWETYPEASWTATNEL  445
            EERF++VK  V  AA+L  + E ++   QP   Y   S   T  L
Sbjct  397  EERFQDVKQLVCEAANLQPEDEYNS--IQPEARYDSTSPQVTTHL  439



>ref|XP_009628804.1| PREDICTED: GDP-L-galactose phosphorylase 2-like [Nicotiana tomentosiformis]
Length=441

 Score =   496 bits (1277),  Expect = 2e-165, Method: Compositional matrix adjust.
 Identities = 242/337 (72%), Positives = 281/337 (83%), Gaps = 6/337 (2%)
 Frame = -1

Query  2041  MLTIKRVPTVVSNYQDDAPEDSKPESLGCGRNCLGQCCLPVSCLPLFAFKNDEHK-CDGD  1865
             MLTIKRVPT+VSNYQ+D PE +    +GCGRNCLG+CCLP S LPL+AFKND+++  + D
Sbjct  1     MLTIKRVPTLVSNYQEDVPESNN--VVGCGRNCLGKCCLPASRLPLYAFKNDDNEPIEND  58

Query  1864  WNYLSYGECPISFLSDLLLGQWEERMSRGLFRYDVTSCETKIIPGTFGFIAQLNEGRHLK  1685
              + L   +C ISFL+DLLLG WEERMS+GLFRYDVT+CETK+IPG  GFIAQLNEGRHLK
Sbjct  59    IDTLPGEDCQISFLNDLLLGLWEERMSQGLFRYDVTTCETKVIPGRCGFIAQLNEGRHLK  118

Query  1684  KRPTEFRVDQVLQPFDENKFNFTKIGQEEVLFRFEPSNDCKSHYLPSGLVDARSGSPTVL  1505
             KRPTEFR+DQVLQPFDENKFNFTK+GQ+EVLFRFEP+ D K+HY     VDA   SP+++
Sbjct  119   KRPTEFRIDQVLQPFDENKFNFTKVGQDEVLFRFEPTTDYKAHYFSGVGVDA-GISPSIV  177

Query  1504  AINVSPIEYGHVLLIPRVLDCLPQRIDHDSFFVAMHLAKEAADPFFRVGYNSLGAFATIN  1325
             AINVSPIEYGHVLLIPRVLD LPQRID DSF  A+H A+E ADPFFRVGYNSLGAFATIN
Sbjct  178   AINVSPIEYGHVLLIPRVLDYLPQRIDRDSFTAALHFARELADPFFRVGYNSLGAFATIN  237

Query  1324  HLHFQAYYLQVPFPVEKTPTREIMRGREQGDGGIVVSQLLNYPARALLFEG--GSTVRDL  1151
             HLHFQAYYL VPFPVEK P R+I+  +  GD G++VS+LLNYP R   FEG  GSTVRDL
Sbjct  238   HLHFQAYYLSVPFPVEKAPMRKILIRKGLGDTGVIVSKLLNYPVRGFAFEGGNGSTVRDL  297

Query  1150  SDAVANSCISLQNNNIPFNLLISERGNKVFLFPQVHS  1040
             SDAV NSC+SLQN  IPFN+LI++ G K+FLFPQ ++
Sbjct  298   SDAVVNSCVSLQNKYIPFNILIAQSGKKIFLFPQYYA  334


 Score =   132 bits (331),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 66/92 (72%), Positives = 75/92 (82%), Gaps = 1/92 (1%)
 Frame = -2

Query  804  LNSLRIKEGTHSFGEFSKCYAEKQACGKIDQEILDTWVNPAVWEISGHMVLKRREDYDDA  625
             N L  + G   F  F + YAEKQA G +DQE+LDT VNPAVWEISGHMVLKRR+DY+DA
Sbjct  315  FNILIAQSGKKIF-LFPQYYAEKQALGVVDQELLDTQVNPAVWEISGHMVLKRRKDYNDA  373

Query  624  SEDYAWRLLSEVSLSEERFEEVKAYVSRAADL  529
            SE+YAW+LLSEVSLSEERFEEVK Y+S AADL
Sbjct  374  SEEYAWKLLSEVSLSEERFEEVKGYISEAADL  405



>ref|XP_003633703.2| PREDICTED: GDP-L-galactose phosphorylase 1-like isoform X1 [Vitis 
vinifera]
 emb|CBI33528.3| unnamed protein product [Vitis vinifera]
Length=433

 Score =   492 bits (1267),  Expect = 6e-164, Method: Compositional matrix adjust.
 Identities = 236/332 (71%), Positives = 275/332 (83%), Gaps = 6/332 (2%)
 Frame = -1

Query  2041  MLTIKRVPTVVSNYQDDAPEDSKPESLGCGRNCLGQCCLPVSCLPLFAFK-NDEHKCDGD  1865
             MLTIKRVPTVVSNYQ++A E     SLGCGRNCLG CCLPVS LPL+ FK N +   +  
Sbjct  1     MLTIKRVPTVVSNYQEEASE-----SLGCGRNCLGHCCLPVSKLPLYTFKKNVKDSSEAR  55

Query  1864  WNYLSYGECPISFLSDLLLGQWEERMSRGLFRYDVTSCETKIIPGTFGFIAQLNEGRHLK  1685
                 S G+ P +FL +LLLGQWE+RMS+GLFRYDVT CET+I+PG +GFIAQLNEGRH+K
Sbjct  56    VEVSSEGQPPAAFLDNLLLGQWEDRMSQGLFRYDVTLCETRIMPGNYGFIAQLNEGRHMK  115

Query  1684  KRPTEFRVDQVLQPFDENKFNFTKIGQEEVLFRFEPSNDCKSHYLPSGLVDARSGSPTVL  1505
             KRPTEFRVDQVLQPFDENKFNFTKIGQEEVLFRFE SND  +HY P   V A S S +V+
Sbjct  116   KRPTEFRVDQVLQPFDENKFNFTKIGQEEVLFRFEQSNDNNAHYFPVSPVTADSNSSSVV  175

Query  1504  AINVSPIEYGHVLLIPRVLDCLPQRIDHDSFFVAMHLAKEAADPFFRVGYNSLGAFATIN  1325
             AINVSPIEYGHVLLIP VLDCLPQRIDHDSF +A+H+AKEAADPFFR+GYNSLGAFATIN
Sbjct  176   AINVSPIEYGHVLLIPHVLDCLPQRIDHDSFLLALHMAKEAADPFFRLGYNSLGAFATIN  235

Query  1324  HLHFQAYYLQVPFPVEKTPTREIMRGREQGDGGIVVSQLLNYPARALLFEGGSTVRDLSD  1145
             HLHFQAYYL  PFPVEK PT  I+R  +  + G+++S++LNYP +  +FEGG+ ++DLSD
Sbjct  236   HLHFQAYYLMAPFPVEKAPTERIIRRGKLPNSGVMISKMLNYPVQGFVFEGGNLMQDLSD  295

Query  1144  AVANSCISLQNNNIPFNLLISERGNKVFLFPQ  1049
              VANSCI LQNNNIP+N+LIS+ G ++FLFPQ
Sbjct  296   TVANSCIFLQNNNIPYNVLISDCGGRIFLFPQ  327


 Score =   127 bits (320),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 58/77 (75%), Positives = 69/77 (90%), Gaps = 0/77 (0%)
 Frame = -2

Query  759  FSKCYAEKQACGKIDQEILDTWVNPAVWEISGHMVLKRREDYDDASEDYAWRLLSEVSLS  580
            F +C+AEKQA G++ QE+LDT VNPAVWEISGHMVLKRREDY++ASE+YAWRLL+EVSLS
Sbjct  325  FPQCFAEKQALGEVSQELLDTLVNPAVWEISGHMVLKRREDYENASEEYAWRLLAEVSLS  384

Query  579  EERFEEVKAYVSRAADL  529
            EERF+EVK YV  A+ L
Sbjct  385  EERFQEVKGYVLEASGL  401



>ref|XP_010274722.1| PREDICTED: GDP-L-galactose phosphorylase 1-like [Nelumbo nucifera]
Length=440

 Score =   491 bits (1263),  Expect = 3e-163, Method: Compositional matrix adjust.
 Identities = 235/340 (69%), Positives = 281/340 (83%), Gaps = 6/340 (2%)
 Frame = -1

Query  2041  MLTIKRVPTVVSNYQDDAPEDSKPESLGCGRNCLGQCCLPVSCLPLFAFKND-EHKCDGD  1865
             MLTIKRVPTVVSN+Q+++PE     +LGCGRNCLG+CC+PVS LPL+AFK D      G+
Sbjct  1     MLTIKRVPTVVSNFQEESPE-----ALGCGRNCLGKCCVPVSKLPLYAFKRDGSDSIKGE  55

Query  1864  WNYLSYGECPISFLSDLLLGQWEERMSRGLFRYDVTSCETKIIPGTFGFIAQLNEGRHLK  1685
                 S     + FL+DLLLGQWE RMS+GLFRYDVT+CETK+IPG +GFIAQLNEGRHLK
Sbjct  56    GAVQSEESNQVCFLNDLLLGQWENRMSQGLFRYDVTTCETKVIPGDYGFIAQLNEGRHLK  115

Query  1684  KRPTEFRVDQVLQPFDENKFNFTKIGQEEVLFRFEPSNDCKSHYLPSGLVDARSGSPTVL  1505
             KRPTEFRVD+VLQPFDE KFNFTK+GQEEVLFRFE   D ++ Y P+  V   S SP+V+
Sbjct  116   KRPTEFRVDRVLQPFDEKKFNFTKVGQEEVLFRFEEGEDDETKYFPNAPVGQNSKSPSVI  175

Query  1504  AINVSPIEYGHVLLIPRVLDCLPQRIDHDSFFVAMHLAKEAADPFFRVGYNSLGAFATIN  1325
             AINVSPIEYGHVLLIPRVLDCLPQRIDH+SF +A+H+A EAA+PFFR+GYNSLGAFATIN
Sbjct  176   AINVSPIEYGHVLLIPRVLDCLPQRIDHESFLLALHMADEAANPFFRLGYNSLGAFATIN  235

Query  1324  HLHFQAYYLQVPFPVEKTPTREIMRGREQGDGGIVVSQLLNYPARALLFEGGSTVRDLSD  1145
             HLHFQAYYL VPFPVEK PT++I+  +   D G++VS+LLNYP R L+FEGG T++DLSD
Sbjct  236   HLHFQAYYLSVPFPVEKVPTQKIITVKNVPDNGVIVSKLLNYPVRGLVFEGGKTMKDLSD  295

Query  1144  AVANSCISLQNNNIPFNLLISERGNKVFLFPQVHSNSVFL  1025
             AVA+SCI LQ+NNIP+N+LIS+ G +VFLFPQ ++    L
Sbjct  296   AVASSCICLQDNNIPYNILISDCGKRVFLFPQCYAEKQAL  335


 Score =   132 bits (332),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 61/77 (79%), Positives = 71/77 (92%), Gaps = 0/77 (0%)
 Frame = -2

Query  759  FSKCYAEKQACGKIDQEILDTWVNPAVWEISGHMVLKRREDYDDASEDYAWRLLSEVSLS  580
            F +CYAEKQA G+++QE+LDT VNPAVWEISGHMVLKRR+DY+DASEDYAWRLL+EVSLS
Sbjct  325  FPQCYAEKQALGEVNQELLDTQVNPAVWEISGHMVLKRRKDYEDASEDYAWRLLAEVSLS  384

Query  579  EERFEEVKAYVSRAADL  529
            +ERFEEVKAY+  AA L
Sbjct  385  KERFEEVKAYILEAAGL  401



>ref|XP_004231986.1| PREDICTED: GDP-L-galactose phosphorylase 2-like [Solanum lycopersicum]
Length=438

 Score =   488 bits (1257),  Expect = 2e-162, Method: Compositional matrix adjust.
 Identities = 237/337 (70%), Positives = 278/337 (82%), Gaps = 7/337 (2%)
 Frame = -1

Query  2041  MLTIKRVPTVVSNYQDDAPEDSKPESLGCGRNCLGQCCLPVSCLPLFAFKNDEHK-CDGD  1865
             MLT+KRVPT+VSNYQ+D  E +    +GCGR CLG+CC+PVS LPL+AFKND+++  + D
Sbjct  1     MLTVKRVPTLVSNYQEDVLEGN---VMGCGRKCLGKCCMPVSVLPLYAFKNDDNEPIEND  57

Query  1864  WNYLSYGECPISFLSDLLLGQWEERMSRGLFRYDVTSCETKIIPGTFGFIAQLNEGRHLK  1685
                L   EC +SFL+DLLLG WEERMS+GLFRYDVT+CETK+IPG  GFIAQLNEGRHLK
Sbjct  58    VQTLPEEECQMSFLNDLLLGLWEERMSQGLFRYDVTTCETKVIPGRCGFIAQLNEGRHLK  117

Query  1684  KRPTEFRVDQVLQPFDENKFNFTKIGQEEVLFRFEPSNDCKSHYLPSGLVDARSGSPTVL  1505
             KRPTEF +D+VLQPFDENKFNFTK+GQEEVLFRFEPS D K+HY  SG+      SP+++
Sbjct  118   KRPTEFCIDKVLQPFDENKFNFTKVGQEEVLFRFEPSTDYKAHYF-SGMRVNSGISPSIV  176

Query  1504  AINVSPIEYGHVLLIPRVLDCLPQRIDHDSFFVAMHLAKEAADPFFRVGYNSLGAFATIN  1325
             AINVSPIEYGHVLLIPRVLDCLPQRID DSF +A+H A+E ADPFFRVGYNSLGAFATIN
Sbjct  177   AINVSPIEYGHVLLIPRVLDCLPQRIDRDSFAIALHFAREVADPFFRVGYNSLGAFATIN  236

Query  1324  HLHFQAYYLQVPFPVEKTPTREIMRGREQGDGGIVVSQLLNYPARALLFEG--GSTVRDL  1151
             HLHFQAYYL VPFPVEK P ++I+  +  G  G++VS+LLNYP R   FEG  GST RDL
Sbjct  237   HLHFQAYYLSVPFPVEKAPIQKILARKGLGGAGVIVSKLLNYPVRGFAFEGGNGSTARDL  296

Query  1150  SDAVANSCISLQNNNIPFNLLISERGNKVFLFPQVHS  1040
             SDAV NSCISLQN NIPFN+LI++ G K+FL PQ ++
Sbjct  297   SDAVVNSCISLQNKNIPFNILIAQCGKKIFLLPQCYA  333


 Score =   129 bits (324),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 60/82 (73%), Positives = 71/82 (87%), Gaps = 0/82 (0%)
 Frame = -2

Query  759  FSKCYAEKQACGKIDQEILDTWVNPAVWEISGHMVLKRREDYDDASEDYAWRLLSEVSLS  580
              +CYAEKQA G +DQE+LDT VNPAVWEISGH+VLKR +DY+DASE+YAW+LLSEVS+S
Sbjct  328  LPQCYAEKQALGVVDQELLDTQVNPAVWEISGHIVLKRTKDYNDASEEYAWKLLSEVSIS  387

Query  579  EERFEEVKAYVSRAADLLLDSE  514
            EERFEEVK Y+S AADL  D +
Sbjct  388  EERFEEVKGYISEAADLQADED  409



>ref|XP_010263564.1| PREDICTED: GDP-L-galactose phosphorylase 1-like [Nelumbo nucifera]
Length=440

 Score =   487 bits (1253),  Expect = 8e-162, Method: Compositional matrix adjust.
 Identities = 234/340 (69%), Positives = 275/340 (81%), Gaps = 6/340 (2%)
 Frame = -1

Query  2041  MLTIKRVPTVVSNYQDDAPEDSKPESLGCGRNCLGQCCLPVSCLPLFAFKNDEHKCDGDW  1862
             MLTIKRVPTVVSN+Q+D P      +LGCGRNCLG+CCLPVS LPL+AFK D        
Sbjct  1     MLTIKRVPTVVSNFQEDTPG-----ALGCGRNCLGKCCLPVSKLPLYAFKRDGSDLIKGG  55

Query  1861  NYLSYGECP-ISFLSDLLLGQWEERMSRGLFRYDVTSCETKIIPGTFGFIAQLNEGRHLK  1685
               +  G+ P +SFL++LLL QWE+RMSRGLFRYDVT+CETK+IPG +GFIAQLNEGRHLK
Sbjct  56    AAIEPGDNPKVSFLNELLLAQWEDRMSRGLFRYDVTTCETKVIPGDYGFIAQLNEGRHLK  115

Query  1684  KRPTEFRVDQVLQPFDENKFNFTKIGQEEVLFRFEPSNDCKSHYLPSGLVDARSGSPTVL  1505
             KRPTEFRVD+VLQPFDE KFNFTK+GQEE LFRFE S D  +HY P+  +   S SP  +
Sbjct  116   KRPTEFRVDRVLQPFDEKKFNFTKVGQEEALFRFEQSEDNGTHYFPNAPIGDSSKSPNAV  175

Query  1504  AINVSPIEYGHVLLIPRVLDCLPQRIDHDSFFVAMHLAKEAADPFFRVGYNSLGAFATIN  1325
             AINVSPIEYGHVLLIPRVLDCLPQRIDH+SF +A+H+A EAADPFFR+GYNSLGAFATIN
Sbjct  176   AINVSPIEYGHVLLIPRVLDCLPQRIDHESFLLALHMASEAADPFFRLGYNSLGAFATIN  235

Query  1324  HLHFQAYYLQVPFPVEKTPTREIMRGREQGDGGIVVSQLLNYPARALLFEGGSTVRDLSD  1145
             HLHFQAYYL +PFPVEKTPT ++   +   D G+ VS+LLNYP R L+FEGG T++ LSD
Sbjct  236   HLHFQAYYLSMPFPVEKTPTEKLNTVKNVPDNGVTVSKLLNYPVRGLVFEGGKTMKHLSD  295

Query  1144  AVANSCISLQNNNIPFNLLISERGNKVFLFPQVHSNSVFL  1025
             AVANSCI LQ NNIP+N+LIS+ G +VF+FPQ ++    L
Sbjct  296   AVANSCICLQENNIPYNVLISDCGKRVFIFPQCYAEKQAL  335


 Score =   125 bits (315),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 58/75 (77%), Positives = 68/75 (91%), Gaps = 0/75 (0%)
 Frame = -2

Query  759  FSKCYAEKQACGKIDQEILDTWVNPAVWEISGHMVLKRREDYDDASEDYAWRLLSEVSLS  580
            F +CYAEKQA G++ QE+LDT VNPAVWEISGH+VLKR++DY +ASEDYAWRLL+EVSLS
Sbjct  325  FPQCYAEKQALGEVSQELLDTQVNPAVWEISGHIVLKRKDDYREASEDYAWRLLAEVSLS  384

Query  579  EERFEEVKAYVSRAA  535
            EERFEEVKAY+  AA
Sbjct  385  EERFEEVKAYILEAA  399



>ref|NP_001275193.1| GDP-L-galactose phosphorylase 1-like [Solanum tuberosum]
 gb|AEQ64270.1| VTC2-like protein B [Solanum tuberosum]
Length=438

 Score =   484 bits (1247),  Expect = 6e-161, Method: Compositional matrix adjust.
 Identities = 237/337 (70%), Positives = 277/337 (82%), Gaps = 7/337 (2%)
 Frame = -1

Query  2041  MLTIKRVPTVVSNYQDDAPEDSKPESLGCGRNCLGQCCLPVSCLPLFAFKNDEHK-CDGD  1865
             MLTIKRVPT+VSNYQ+D  E +    +GCGR CLG+CC+PVS LPL+AFKND+++  + D
Sbjct  1     MLTIKRVPTLVSNYQEDVLEGN---VMGCGRKCLGKCCMPVSVLPLYAFKNDDNEPIEND  57

Query  1864  WNYLSYGECPISFLSDLLLGQWEERMSRGLFRYDVTSCETKIIPGTFGFIAQLNEGRHLK  1685
                L   EC +SFL++LLLG WEERMS+GLFRYDVT+CETK+IPG  GFIAQLNEGRHLK
Sbjct  58    IQTLPEEECQMSFLNNLLLGLWEERMSQGLFRYDVTTCETKVIPGRCGFIAQLNEGRHLK  117

Query  1684  KRPTEFRVDQVLQPFDENKFNFTKIGQEEVLFRFEPSNDCKSHYLPSGLVDARSGSPTVL  1505
             KRPTEF +D+VLQPFDENKFNFTK+GQEEVLFRFEPS D K HY  SG+      SP+++
Sbjct  118   KRPTEFCIDKVLQPFDENKFNFTKVGQEEVLFRFEPSTDYKPHYF-SGMRVNGGISPSIV  176

Query  1504  AINVSPIEYGHVLLIPRVLDCLPQRIDHDSFFVAMHLAKEAADPFFRVGYNSLGAFATIN  1325
             AINVSPIEYGHVLLIPRVLDCLPQRID DSF +A+H A+E ADPFFRVGYNSLGAFATIN
Sbjct  177   AINVSPIEYGHVLLIPRVLDCLPQRIDRDSFAIALHFAREVADPFFRVGYNSLGAFATIN  236

Query  1324  HLHFQAYYLQVPFPVEKTPTREIMRGREQGDGGIVVSQLLNYPARALLFEG--GSTVRDL  1151
             HLHFQAYYL VPFPVEK P ++I+  +  G  G++VS+LLNYP R   FEG  GST RDL
Sbjct  237   HLHFQAYYLSVPFPVEKAPIQKILARKGLGGAGVIVSKLLNYPVRGFAFEGGNGSTARDL  296

Query  1150  SDAVANSCISLQNNNIPFNLLISERGNKVFLFPQVHS  1040
             SDAV NSCISLQN NIPFN+LI++ G K+FL PQ ++
Sbjct  297   SDAVVNSCISLQNKNIPFNILIAQCGKKIFLLPQCYA  333


 Score =   124 bits (312),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 58/77 (75%), Positives = 67/77 (87%), Gaps = 0/77 (0%)
 Frame = -2

Query  759  FSKCYAEKQACGKIDQEILDTWVNPAVWEISGHMVLKRREDYDDASEDYAWRLLSEVSLS  580
              +CYAEKQA G +DQE+LDT VNPAVWEISGH+VLKR +DY+DASE+YAW+LLSEVSLS
Sbjct  328  LPQCYAEKQALGVVDQELLDTQVNPAVWEISGHIVLKRTKDYNDASEEYAWKLLSEVSLS  387

Query  579  EERFEEVKAYVSRAADL  529
            EERFEEVK Y+S A  L
Sbjct  388  EERFEEVKGYISEADGL  404



>ref|XP_006383317.1| hypothetical protein POPTR_0005s14440g [Populus trichocarpa]
 gb|ERP61114.1| hypothetical protein POPTR_0005s14440g [Populus trichocarpa]
Length=441

 Score =   483 bits (1244),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 238/337 (71%), Positives = 279/337 (83%), Gaps = 5/337 (1%)
 Frame = -1

Query  2044  LMLTIKRVPTVVSNYQDDAPEDSKPESLGCGRNCLGQCCLPVSCLPLFAFKNDEHKCDGD  1865
             ++LTIK+VPTVVSNYQ+   E+S+    GCGRNCLG+CCLPVS LPL+AFK D     G+
Sbjct  1     MVLTIKKVPTVVSNYQE---ENSEKGFEGCGRNCLGKCCLPVSKLPLYAFKEDNSNLIGN  57

Query  1864  WNYLSYGECP-ISFLSDLLLGQWEERMSRGLFRYDVTSCETKIIPGTFGFIAQLNEGRHL  1688
                 S  E P + FL +LLLGQWE+RMSRGLFRYDVT+C+TKIIPG +GFIAQLN+GRHL
Sbjct  58    SVEKSSEEQPHMCFLHNLLLGQWEDRMSRGLFRYDVTACDTKIIPGRYGFIAQLNKGRHL  117

Query  1687  KKRPTEFRVDQVLQPFDENKFNFTKIGQEEVLFRFEPSNDCKSHYLPSGL-VDARSGSPT  1511
             KKRPTEFRVD+VLQ FDE KFNFTK+GQEEVLFRFE S D   H+ PS   + A S S +
Sbjct  118   KKRPTEFRVDKVLQDFDETKFNFTKVGQEEVLFRFEKSIDHNRHFFPSAPPITADSNSSS  177

Query  1510  VLAINVSPIEYGHVLLIPRVLDCLPQRIDHDSFFVAMHLAKEAADPFFRVGYNSLGAFAT  1331
             V+AINVSPIEYGHVLLIP+VL+CLPQRIDH SF +A+H+AKEAADPFFRVGYNSLGAFAT
Sbjct  178   VVAINVSPIEYGHVLLIPQVLNCLPQRIDHGSFLLALHMAKEAADPFFRVGYNSLGAFAT  237

Query  1330  INHLHFQAYYLQVPFPVEKTPTREIMRGREQGDGGIVVSQLLNYPARALLFEGGSTVRDL  1151
             INHLHFQAYYL  PFPVEK PTR IM  +   D G++VSQLLNYP R L+FEGGSTV+DL
Sbjct  238   INHLHFQAYYLAAPFPVEKAPTRRIMTMKSPQDEGVIVSQLLNYPVRGLVFEGGSTVQDL  297

Query  1150  SDAVANSCISLQNNNIPFNLLISERGNKVFLFPQVHS  1040
             SD+VA+SCI LQNNNIPFN+LI++ G ++FLFPQ ++
Sbjct  298   SDSVASSCIFLQNNNIPFNVLITDCGRRIFLFPQCYA  334


 Score =   119 bits (298),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 61/105 (58%), Positives = 75/105 (71%), Gaps = 0/105 (0%)
 Frame = -2

Query  759  FSKCYAEKQACGKIDQEILDTWVNPAVWEISGHMVLKRREDYDDASEDYAWRLLSEVSLS  580
            F +CYAEKQA G+  QE+LDT VNPAVWEISGH+VLKR+ED+DDASE YAWRLL+EVSLS
Sbjct  329  FPQCYAEKQARGEASQELLDTQVNPAVWEISGHIVLKRQEDFDDASETYAWRLLAEVSLS  388

Query  579  EERFEEVKAYVSRAADLLLDSECSNGGSQPWETYPEASWTATNEL  445
             +RF +VKAY+  AA    + E +N   +    Y + S  A   L
Sbjct  389  NKRFHQVKAYLLEAAGFQTEIEENNRDLEREPIYEQPSPEAVAHL  433



>emb|CDP02699.1| unnamed protein product [Coffea canephora]
Length=452

 Score =   483 bits (1242),  Expect = 6e-160, Method: Compositional matrix adjust.
 Identities = 236/364 (65%), Positives = 284/364 (78%), Gaps = 12/364 (3%)
 Frame = -1

Query  2041  MLTIKRVPTVVSNYQDDAPED-----------SKPESLGCGRNCLGQCCLPVSCLPLFAF  1895
             MLTIK+VPTVVSNYQ+D  ++           ++ ++ GC RNCLG+CCLPVS LPL+AF
Sbjct  1     MLTIKKVPTVVSNYQEDGDDNNNAAGIRTEDATQSQARGCARNCLGKCCLPVSKLPLYAF  60

Query  1894  KNDEHKCDGDWNYLSY-GECPISFLSDLLLGQWEERMSRGLFRYDVTSCETKIIPGTFGF  1718
             K +++    +  + S  G  PISFL++LLL QWE+RM RGLFRYDVTSCETK+IPG +GF
Sbjct  61    KKNDYPSKNNAVFPSDDGVSPISFLNNLLLAQWEDRMRRGLFRYDVTSCETKVIPGRYGF  120

Query  1717  IAQLNEGRHLKKRPTEFRVDQVLQPFDENKFNFTKIGQEEVLFRFEPSNDCKSHYLPSGL  1538
             IAQLNEGRHLKKRPTEFR+DQVLQPFDENKFNFTK+GQEEVLFRFE ++D KS +  S  
Sbjct  121   IAQLNEGRHLKKRPTEFRIDQVLQPFDENKFNFTKVGQEEVLFRFESNDDDKSRFFSSYA  180

Query  1537  VDARSGSPTVLAINVSPIEYGHVLLIPRVLDCLPQRIDHDSFFVAMHLAKEAADPFFRVG  1358
             VD  S SP+V+AINVSPIEYGHVLLIPRVLDCLPQRIDH+SF +A++ AKEAADPF RVG
Sbjct  181   VDICSISPSVVAINVSPIEYGHVLLIPRVLDCLPQRIDHESFLLALYFAKEAADPFLRVG  240

Query  1357  YNSLGAFATINHLHFQAYYLQVPFPVEKTPTREIMRGREQGDGGIVVSQLLNYPARALLF  1178
             YNSLGAFATINHLHFQAYYL V FP+EK PTR IM  +      +VVS+LL+YP R L+F
Sbjct  241   YNSLGAFATINHLHFQAYYLSVTFPIEKAPTRRIMTRKGLQGADLVVSELLDYPVRGLVF  300

Query  1177  EGGSTVRDLSDAVANSCISLQNNNIPFNLLISERGNKVFLFPQVHSNSVFLSSREFSIYV  998
             EGG  +RDLSDAVA+SCI LQ NNIPFN+LI++ G K+FL PQ ++    L      +  
Sbjct  301   EGGCVLRDLSDAVASSCIYLQQNNIPFNVLIADCGRKIFLLPQCYAEKQALGEVSLEVLE  360

Query  997   SR*N  986
             ++ N
Sbjct  361   TQVN  364


 Score =   118 bits (296),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 58/85 (68%), Positives = 68/85 (80%), Gaps = 0/85 (0%)
 Frame = -2

Query  759  FSKCYAEKQACGKIDQEILDTWVNPAVWEISGHMVLKRREDYDDASEDYAWRLLSEVSLS  580
              +CYAEKQA G++  E+L+T VNPAVWEISGHMVLKRR+DYDDASEDYAW+LLSEVSLS
Sbjct  341  LPQCYAEKQALGEVSLEVLETQVNPAVWEISGHMVLKRRKDYDDASEDYAWKLLSEVSLS  400

Query  579  EERFEEVKAYVSRAADLLLDSECSN  505
              RFE VKA VS A  L ++ +  N
Sbjct  401  GVRFESVKACVSEATGLQVEVDTYN  425



>ref|XP_007033043.1| Mannose-1-phosphate guanylyltransferases,GDP-galactose:mannose-1-phosphate 
guanylyltransferases,GDP-galactose:glucose-1-phosphate 
guanylyltransferases,GDP-galactose:myoinositol-1-phosphate 
guanylyltransferases,glucose-1-phosphate guanylyltransferase 
[Theobroma cacao]
 gb|EOY03969.1| Mannose-1-phosphate guanylyltransferases,GDP-galactose:mannose-1-phosphate 
guanylyltransferases,GDP-galactose:glucose-1-phosphate 
guanylyltransferases,GDP-galactose:myoinositol-1-phosphate 
guanylyltransferases,glucose-1-phosphate guanylyltransferase 
[Theobroma cacao]
Length=448

 Score =   478 bits (1230),  Expect = 4e-158, Method: Compositional matrix adjust.
 Identities = 235/337 (70%), Positives = 274/337 (81%), Gaps = 8/337 (2%)
 Frame = -1

Query  2041  MLTIKRVPTVVSNYQDDAPEDSKPESLGCGRNCLGQCCLPVSCLPLFAFKNDEHKCDGDW  1862
             MLTIKRV TV+SNYQ+DA E    + +GCGRNCLG CC+P S LPL+AF+  E    G++
Sbjct  1     MLTIKRVATVLSNYQEDAYEK---QEVGCGRNCLGNCCIPASTLPLYAFQK-EQDDSGEY  56

Query  1861  N--YLSYGECPISFLSDLLLGQWEERMSRGLFRYDVTSCETKIIPGTFGFIAQLNEGRHL  1688
                Y S  +   SFL +LLL QW +RM RGLFRYDVT+C+TKIIPG +GFIAQLNEGRHL
Sbjct  57    GELYPSEEQPQPSFL-NLLLEQWGDRMRRGLFRYDVTNCKTKIIPGKYGFIAQLNEGRHL  115

Query  1687  KKRPTEFRVDQVLQPFDENKFNFTKIGQEEVLFRFEPSNDCKSHYLPSGLVDARSG-SPT  1511
             KKRPTEFR+DQVLQPFD++KFNFTK+GQEEVLFRFE SNDCKSH+L S  V A+   SP 
Sbjct  116   KKRPTEFRIDQVLQPFDDSKFNFTKVGQEEVLFRFEQSNDCKSHFLASAPVTAKPNYSPN  175

Query  1510  VLAINVSPIEYGHVLLIPRVLDCLPQRIDHDSFFVAMHLAKEAADPFFRVGYNSLGAFAT  1331
             V+AINVSPIEYGHVLLIP VLDCLPQRIDHDSF +A+HLA+EAADPFFRVGYNSLGAFAT
Sbjct  176   VIAINVSPIEYGHVLLIPHVLDCLPQRIDHDSFLLAIHLAREAADPFFRVGYNSLGAFAT  235

Query  1330  INHLHFQAYYLQVPFPVEKTPTREIMRGREQGDGGIVVSQLLNYPARALLFEGGSTVRDL  1151
             INHLHFQAYYL+VPFP+EK P + I       D G++VSQLLNYP R L+F+GG + +DL
Sbjct  236   INHLHFQAYYLEVPFPIEKAPIQRISTKEGLQDTGVIVSQLLNYPVRGLVFKGGKSAQDL  295

Query  1150  SDAVANSCISLQNNNIPFNLLISERGNKVFLFPQVHS  1040
             SD VANSCI LQ NNIPFN+LIS+ G +VFL PQ ++
Sbjct  296   SDVVANSCIFLQTNNIPFNVLISDCGKRVFLLPQCYA  332


 Score =   119 bits (298),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 56/77 (73%), Positives = 64/77 (83%), Gaps = 0/77 (0%)
 Frame = -2

Query  759  FSKCYAEKQACGKIDQEILDTWVNPAVWEISGHMVLKRREDYDDASEDYAWRLLSEVSLS  580
              +CYAEKQA G++  E+L T VNPAVWEI GHMVLKRREDY+D SE YAWRLL+EVSLS
Sbjct  327  LPQCYAEKQAIGEVSLELLHTQVNPAVWEIGGHMVLKRREDYEDTSEAYAWRLLAEVSLS  386

Query  579  EERFEEVKAYVSRAADL  529
            EERF+EVKAY+  AA L
Sbjct  387  EERFQEVKAYILEAAAL  403



>ref|XP_011021405.1| PREDICTED: GDP-L-galactose phosphorylase 1-like [Populus euphratica]
Length=441

 Score =   477 bits (1227),  Expect = 8e-158, Method: Compositional matrix adjust.
 Identities = 236/337 (70%), Positives = 276/337 (82%), Gaps = 5/337 (1%)
 Frame = -1

Query  2044  LMLTIKRVPTVVSNYQDDAPEDSKPESLGCGRNCLGQCCLPVSCLPLFAFKNDEHKCDGD  1865
             +MLTIK+VPTVVSNYQ+   E+S+    GCGRNCLG+CCLPVS LPL+AFK D     G+
Sbjct  1     MMLTIKKVPTVVSNYQE---ENSEKGFEGCGRNCLGKCCLPVSKLPLYAFKEDNSNLIGN  57

Query  1864  WNYLSYGECP-ISFLSDLLLGQWEERMSRGLFRYDVTSCETKIIPGTFGFIAQLNEGRHL  1688
                 S  E P I FL +LLLGQWE+RMSRGLFRYDVT+C+TKIIPG +GFIAQLN+GRHL
Sbjct  58    SVEKSSEEQPHICFLHNLLLGQWEDRMSRGLFRYDVTACDTKIIPGRYGFIAQLNKGRHL  117

Query  1687  KKRPTEFRVDQVLQPFDENKFNFTKIGQEEVLFRFEPSNDCKSHYLPSGL-VDARSGSPT  1511
             KKRPTEFRVD+VLQ FDE KFNFTK+GQEEVLFRFE S D   H+ P      A S + +
Sbjct  118   KKRPTEFRVDKVLQDFDETKFNFTKVGQEEVLFRFEKSIDHNRHFFPCAPPTTADSNNSS  177

Query  1510  VLAINVSPIEYGHVLLIPRVLDCLPQRIDHDSFFVAMHLAKEAADPFFRVGYNSLGAFAT  1331
             V+AINVSPIEYGHVLLIP+VL+CLPQRIDH SF +A+H+AKEAADPFFRVGYNSLGAFAT
Sbjct  178   VVAINVSPIEYGHVLLIPQVLNCLPQRIDHGSFLLALHMAKEAADPFFRVGYNSLGAFAT  237

Query  1330  INHLHFQAYYLQVPFPVEKTPTREIMRGREQGDGGIVVSQLLNYPARALLFEGGSTVRDL  1151
             INHLHFQAYYL  PFPVEK PTR IM  +   D G++VSQLLNYP R L+FEGG+TV+DL
Sbjct  238   INHLHFQAYYLAAPFPVEKAPTRRIMIMKSPQDKGVIVSQLLNYPVRGLVFEGGNTVQDL  297

Query  1150  SDAVANSCISLQNNNIPFNLLISERGNKVFLFPQVHS  1040
             SD+VA+SCI LQNNNIPFN+LI++ G ++FLF Q ++
Sbjct  298   SDSVASSCIFLQNNNIPFNVLIADCGRRIFLFTQCYA  334


 Score =   123 bits (309),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 63/105 (60%), Positives = 76/105 (72%), Gaps = 0/105 (0%)
 Frame = -2

Query  759  FSKCYAEKQACGKIDQEILDTWVNPAVWEISGHMVLKRREDYDDASEDYAWRLLSEVSLS  580
            F++CYAEKQA G+  QE+LDT VNPAVWEISGH+VLKR+ED+DDASE YAWRLL+EVSLS
Sbjct  329  FTQCYAEKQARGEASQELLDTQVNPAVWEISGHIVLKRQEDFDDASETYAWRLLAEVSLS  388

Query  579  EERFEEVKAYVSRAADLLLDSECSNGGSQPWETYPEASWTATNEL  445
             +RF EVKAY+  AA    D E +N   +    Y + S  A   L
Sbjct  389  NKRFHEVKAYILEAAGFQTDIEENNRDLEREPIYEQRSPEALTHL  433



>ref|XP_010693970.1| PREDICTED: GDP-L-galactose phosphorylase 2-like [Beta vulgaris 
subsp. vulgaris]
Length=450

 Score =   468 bits (1203),  Expect = 4e-154, Method: Compositional matrix adjust.
 Identities = 233/336 (69%), Positives = 267/336 (79%), Gaps = 11/336 (3%)
 Frame = -1

Query  2038  LTIKRVPTVVSNYQDDAPEDSKPESLGCGRNCLGQCCLPVSCLPLFAFKNDEHKCDGDWN  1859
             LTIKRVPTV+SNYQ++       E+LGCGRNCLG+CCL V+ LPL+ +K +    DGD N
Sbjct  8     LTIKRVPTVLSNYQEEDG-GGGVENLGCGRNCLGKCCLLVAKLPLYVYKEE----DGDMN  62

Query  1858  ----YLSYGEC--PISFLSDLLLGQWEERMSRGLFRYDVTSCETKIIPGTFGFIAQLNEG  1697
                   + G+   P+SFL DLLLGQWE+RM RGLFRYDVT CETKIIPG +GFIAQLNEG
Sbjct  63    ENVIMANSGDQLPPVSFLHDLLLGQWEDRMRRGLFRYDVTQCETKIIPGRYGFIAQLNEG  122

Query  1696  RHLKKRPTEFRVDQVLQPFDENKFNFTKIGQEEVLFRFEPSNDCKSHYLPSGLVDARSGS  1517
             RHLKKRPTEFRVDQVLQPFD NKFNFTK+GQEE LFRFEPS D  +HY PS  V +   S
Sbjct  123   RHLKKRPTEFRVDQVLQPFDGNKFNFTKVGQEEALFRFEPSKDHMTHYCPSAPVTSELDS  182

Query  1516  PTVLAINVSPIEYGHVLLIPRVLDCLPQRIDHDSFFVAMHLAKEAADPFFRVGYNSLGAF  1337
             P ++AINVSPIEYGHVLLIPR+ DCLPQ IDH SF  A+H AKEAADPFFRVGYNSLGAF
Sbjct  183   PNMVAINVSPIEYGHVLLIPRIFDCLPQMIDHASFLAALHFAKEAADPFFRVGYNSLGAF  242

Query  1336  ATINHLHFQAYYLQVPFPVEKTPTREIMRGREQGDGGIVVSQLLNYPARALLFEGGSTVR  1157
             ATINHLHFQAYYLQVPFP EK PT+ I   +      +V+S+LL YP R L+FEGG+T+ 
Sbjct  243   ATINHLHFQAYYLQVPFPAEKAPTQVISEVKVIPPNCVVISRLLKYPVRGLVFEGGNTID  302

Query  1156  DLSDAVANSCISLQNNNIPFNLLISERGNKVFLFPQ  1049
             DLSDAVA+SCI LQ+ NIPFN+LIS+ G +VFLFPQ
Sbjct  303   DLSDAVASSCIRLQSANIPFNILISDCGKRVFLFPQ  338


 Score =   124 bits (311),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 58/77 (75%), Positives = 67/77 (87%), Gaps = 0/77 (0%)
 Frame = -2

Query  759  FSKCYAEKQACGKIDQEILDTWVNPAVWEISGHMVLKRREDYDDASEDYAWRLLSEVSLS  580
            F +C+AEKQA G++  E+LDT VNPAVWEISGHMVLKRRED+D ASE+YAWRLL+EVSLS
Sbjct  336  FPQCFAEKQALGQVSSEVLDTQVNPAVWEISGHMVLKRREDFDKASEEYAWRLLAEVSLS  395

Query  579  EERFEEVKAYVSRAADL  529
            EERFEEVKA V  A+ L
Sbjct  396  EERFEEVKAIVLEASGL  412



>ref|XP_010911669.1| PREDICTED: GDP-L-galactose phosphorylase 1-like [Elaeis guineensis]
Length=432

 Score =   466 bits (1200),  Expect = 7e-154, Method: Compositional matrix adjust.
 Identities = 230/336 (68%), Positives = 266/336 (79%), Gaps = 11/336 (3%)
 Frame = -1

Query  2041  MLTIKRVPTVVSNYQDDAPEDSKPESLGCGRNCLGQCCLPVSCLPLFAFKNDEHKCDGDW  1862
             MLTIKRVPTVVSNYQ+D  E      LGCGRNCLG CCLPVS LPL+AFK D    +G  
Sbjct  1     MLTIKRVPTVVSNYQEDVCE-----PLGCGRNCLGHCCLPVSKLPLYAFKRDATSPNGSS  55

Query  1861  NYLSYGECPIS--FLSDLLLGQWEERMSRGLFRYDVTSCETKIIPGTFGFIAQLNEGRHL  1688
                S  E P S  FL  L+LG+WE+RMSRGLFRYDVT+CET++IPG +GFIAQ NEGRHL
Sbjct  56    ---STAEDPSSGFFLHFLILGEWEDRMSRGLFRYDVTACETRVIPGEYGFIAQFNEGRHL  112

Query  1687  KKRPTEFRVDQVLQPFDENKFNFTKIGQEEVLFRFEPSNDCKSHYLPSGLVDARSGSPTV  1508
             KKRPTEFRVD+VLQPFD  KFNFTK+GQEEVLFRFE   D +S +  S  V + +  P V
Sbjct  113   KKRPTEFRVDRVLQPFDHGKFNFTKVGQEEVLFRFEAGGDSRSQFFESAPVSS-TNPPNV  171

Query  1507  LAINVSPIEYGHVLLIPRVLDCLPQRIDHDSFFVAMHLAKEAADPFFRVGYNSLGAFATI  1328
             +AINVSPIEYGHVLLIPRVL+CLPQRID +SF VA+H+A EAA P+FR+GYNSLGAFATI
Sbjct  172   VAINVSPIEYGHVLLIPRVLECLPQRIDPESFLVALHMAAEAASPYFRLGYNSLGAFATI  231

Query  1327  NHLHFQAYYLQVPFPVEKTPTREIMRGREQGDGGIVVSQLLNYPARALLFEGGSTVRDLS  1148
             NHLHFQAYYL +PFPVEK PT  I   +   D G+ +SQLLNYP R L+FEGG+T+RDLS
Sbjct  232   NHLHFQAYYLAMPFPVEKAPTERITITKSLSDRGVKISQLLNYPVRGLVFEGGNTLRDLS  291

Query  1147  DAVANSCISLQNNNIPFNLLISERGNKVFLFPQVHS  1040
             D VA+SC+ LQ NNIPFNLLIS+ G +VFLFPQ ++
Sbjct  292   DVVASSCMCLQGNNIPFNLLISDSGRRVFLFPQCYA  327


 Score =   122 bits (305),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 56/77 (73%), Positives = 67/77 (87%), Gaps = 0/77 (0%)
 Frame = -2

Query  759  FSKCYAEKQACGKIDQEILDTWVNPAVWEISGHMVLKRREDYDDASEDYAWRLLSEVSLS  580
            F +CYAEKQA G++ QE+LDT VNPA WEISGHMVLKR +D+++ASE YAWRLLSEVSLS
Sbjct  322  FPQCYAEKQALGEVSQELLDTQVNPAAWEISGHMVLKRNKDFEEASEAYAWRLLSEVSLS  381

Query  579  EERFEEVKAYVSRAADL  529
            +ERF+EVKAY+S A  L
Sbjct  382  KERFQEVKAYISDATRL  398



>ref|XP_008803683.1| PREDICTED: GDP-L-galactose phosphorylase 1-like [Phoenix dactylifera]
Length=431

 Score =   461 bits (1187),  Expect = 5e-152, Method: Compositional matrix adjust.
 Identities = 240/410 (59%), Positives = 299/410 (73%), Gaps = 15/410 (4%)
 Frame = -1

Query  2041  MLTIKRVPTVVSNYQDDAPEDSKPESLGCGRNCLGQCCLPVSCLPLFAFKNDEHKCDGDW  1862
             MLTIKRVPTV+SNYQ+   ED++P  LGCGRNCLG CCLPVS LPL+AFK D     G  
Sbjct  1     MLTIKRVPTVLSNYQE---EDAEP--LGCGRNCLGNCCLPVSKLPLYAFKRDSTSASGSS  55

Query  1861  NYLSYGECPISFLSDLLLGQWEERMSRGLFRYDVTSCETKIIPGTFGFIAQLNEGRHLKK  1682
             +       P  FL  L+L +WE+RMS+GLFRYDVT+CETK+IPG  GFIAQLNEGRHLKK
Sbjct  56    SNSE-DPSPNFFLQSLVLREWEDRMSQGLFRYDVTACETKVIPGELGFIAQLNEGRHLKK  114

Query  1681  RPTEFRVDQVLQPFDENKFNFTKIGQEEVLFRFEPSNDCKSHYLPSGLVDARSGSPTVLA  1502
             RPTEFRVD+VLQPFD NKFNFTK+GQEEVLFRFE   D +SH+  S  V A +  P V+A
Sbjct  115   RPTEFRVDRVLQPFDSNKFNFTKVGQEEVLFRFEAGGDTRSHFFESAPVGA-TEPPNVVA  173

Query  1501  INVSPIEYGHVLLIPRVLDCLPQRIDHDSFFVAMHLAKEAADPFFRVGYNSLGAFATINH  1322
             INVSPIEYGHVLLIPRVL+CLPQR DH+SF +A+++A EA  P+FR+GYNSLGAFATINH
Sbjct  174   INVSPIEYGHVLLIPRVLECLPQRNDHESFLLALNMAAEAGSPYFRLGYNSLGAFATINH  233

Query  1321  LHFQAYYLQVPFPVEKTPTREI-MRGREQGDGGIVVSQLLNYPARALLFEGGSTVRDLSD  1145
             LHFQAYYL +PFPVEK PTR I ++GR   + G+ VS+LLNYP R L+F+GG+T++DLSD
Sbjct  234   LHFQAYYLAMPFPVEKAPTRRIPIKGR--SESGVKVSELLNYPVRGLVFKGGNTLKDLSD  291

Query  1144  AVANSCISLQNNNIPFNLLISERGNKVFLFPQVHSNSVFLSSREFSIYVSR*NVHFSSVK  965
              VA+SCISL+ NNIPFN+LIS+ G ++FLFPQ ++    L      +  ++ N     + 
Sbjct  292   VVASSCISLEENNIPFNVLISDSGRRIFLFPQCYAEKQALGQVSQELLDTQVNPAVWEIS  351

Query  964   F*KYGNMVCLIACSFEVV*SLHGFR*LSVAFINDMLNFRSMEGDIYNQFS  815
                 G+MV      FE     + +R LS   +++   FR ++  I++  S
Sbjct  352   ----GHMVLKRKKDFEEASEAYAWRLLSEVSLSEE-RFRRVKAYIFDAIS  396


 Score =   123 bits (309),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 63/103 (61%), Positives = 79/103 (77%), Gaps = 1/103 (1%)
 Frame = -2

Query  759  FSKCYAEKQACGKIDQEILDTWVNPAVWEISGHMVLKRREDYDDASEDYAWRLLSEVSLS  580
            F +CYAEKQA G++ QE+LDT VNPAVWEISGHMVLKR++D+++ASE YAWRLLSEVSLS
Sbjct  321  FPQCYAEKQALGQVSQELLDTQVNPAVWEISGHMVLKRKKDFEEASEAYAWRLLSEVSLS  380

Query  579  EERFEEVKAYVSRAADLLLDSECSNGGSQPWETYPEASWTATN  451
            EERF  VKAY+  A   L++SE     ++   T  +AS  AT+
Sbjct  381  EERFRRVKAYIFDAIS-LVESEEEIDANENKGTLLQASLLATH  422



>ref|XP_008795238.1| PREDICTED: GDP-L-galactose phosphorylase 1-like [Phoenix dactylifera]
Length=436

 Score =   459 bits (1180),  Expect = 7e-151, Method: Compositional matrix adjust.
 Identities = 223/336 (66%), Positives = 267/336 (79%), Gaps = 11/336 (3%)
 Frame = -1

Query  2041  MLTIKRVPTVVSNYQDDAPEDSKPESLGCGRNCLGQCCLPVSCLPLFAFKNDEHKCDGDW  1862
             MLTIKRVPTV+SNYQ+DA E       GCGRNCLG+CCLPVS LPL+ FK+     D   
Sbjct  3     MLTIKRVPTVLSNYQEDAAEPR-----GCGRNCLGKCCLPVSKLPLYVFKSAAELPDSPS  57

Query  1861  NYLSYGECPIS--FLSDLLLGQWEERMSRGLFRYDVTSCETKIIPGTFGFIAQLNEGRHL  1688
                   E P++  FL+ LLLGQWE+RMS+GLFRYDVT+CETK+IPG  GFIAQLNEGRHL
Sbjct  58    GAT---EKPLADFFLNSLLLGQWEDRMSKGLFRYDVTTCETKVIPGEQGFIAQLNEGRHL  114

Query  1687  KKRPTEFRVDQVLQPFDENKFNFTKIGQEEVLFRFEPSNDCKSHYLPSGLVDARSGSPTV  1508
             KKRPTEFR+D+VLQPFD  KFNFTK+GQEEVLFRFE     K+H+  S  VD  + SPTV
Sbjct  115   KKRPTEFRIDRVLQPFDPAKFNFTKVGQEEVLFRFEAGGGNKAHFFESAPVDGAT-SPTV  173

Query  1507  LAINVSPIEYGHVLLIPRVLDCLPQRIDHDSFFVAMHLAKEAADPFFRVGYNSLGAFATI  1328
             +AINVSPIEYGHVLLIPR+LDCLPQRID +SF +A H+A EA +P+FR+GYNSLGAFATI
Sbjct  174   VAINVSPIEYGHVLLIPRLLDCLPQRIDAESFLLAFHMAAEAGNPYFRLGYNSLGAFATI  233

Query  1327  NHLHFQAYYLQVPFPVEKTPTREIMRGREQGDGGIVVSQLLNYPARALLFEGGSTVRDLS  1148
             NHLHFQAYYL +PFPVEK PT +I   +   + G+ VS L+NYP R L++EGG+T++DL+
Sbjct  234   NHLHFQAYYLSLPFPVEKAPTEKIPMAKGLANSGLKVSLLMNYPVRGLVYEGGNTLKDLA  293

Query  1147  DAVANSCISLQNNNIPFNLLISERGNKVFLFPQVHS  1040
             D VANSCI LQ NNIPFN+LIS+ G ++FLFPQ ++
Sbjct  294   DVVANSCICLQENNIPFNVLISDSGRRIFLFPQCYA  329


 Score =   124 bits (312),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 57/78 (73%), Positives = 69/78 (88%), Gaps = 0/78 (0%)
 Frame = -2

Query  759  FSKCYAEKQACGKIDQEILDTWVNPAVWEISGHMVLKRREDYDDASEDYAWRLLSEVSLS  580
            F +CYAEKQA G++ QEILDT VNPAVWEISGH+VLKR++DY++ASEDYAW LL+EVSLS
Sbjct  324  FPQCYAEKQALGEVSQEILDTQVNPAVWEISGHIVLKRKKDYEEASEDYAWSLLAEVSLS  383

Query  579  EERFEEVKAYVSRAADLL  526
            EERF+EVKAY+  A  L+
Sbjct  384  EERFQEVKAYIFEAIGLV  401



>ref|XP_006430623.1| hypothetical protein CICLE_v10013649mg [Citrus clementina]
 gb|ESR43863.1| hypothetical protein CICLE_v10013649mg [Citrus clementina]
Length=411

 Score =   456 bits (1172),  Expect = 5e-150, Method: Compositional matrix adjust.
 Identities = 226/340 (66%), Positives = 263/340 (77%), Gaps = 22/340 (6%)
 Frame = -1

Query  2041  MLTIKRVPTVVSNYQDDAPEDSKPESLGCGRNCLGQCCLPVSCLPLFAFKNDEHKCDGDW  1862
             MLTIKRVPTVVSNYQD     S+    GCG NCLG C LPVS LPL+    D+     D 
Sbjct  1     MLTIKRVPTVVSNYQDQEETASENSEAGCGSNCLGNCSLPVSKLPLYQITKDK----VDL  56

Query  1861  NYLSYGECP-ISFLSDLLLGQWEERMSRGLFRYDVTSCETKIIPGTFGFIAQLNEGRHLK  1685
                + GE P +SFL DLLLGQWE+RM+RGLFRYDVTSCETKIIPG +GF+AQLNEGRHLK
Sbjct  57    TEEASGEEPRMSFLHDLLLGQWEDRMNRGLFRYDVTSCETKIIPGEYGFVAQLNEGRHLK  116

Query  1684  KRPTEFRVDQVLQPFDENKFNFTKIGQEEVLFRFEPSNDCKSHYLPSGLVDARSGSPTVL  1505
             KRPTEFR+DQVLQPFDENKFNFTKIGQEE+LFR + S                  SP+V+
Sbjct  117   KRPTEFRIDQVLQPFDENKFNFTKIGQEEMLFRLDDSK-----------------SPSVV  159

Query  1504  AINVSPIEYGHVLLIPRVLDCLPQRIDHDSFFVAMHLAKEAADPFFRVGYNSLGAFATIN  1325
             AINVSPIEYGHVLLIPRVLDCLPQRIDH+SF +A+++AKEAADPFFR+GYNSLGAFATIN
Sbjct  160   AINVSPIEYGHVLLIPRVLDCLPQRIDHESFLLALYVAKEAADPFFRLGYNSLGAFATIN  219

Query  1324  HLHFQAYYLQVPFPVEKTPTREIMRGREQGDGGIVVSQLLNYPARALLFEGGSTVRDLSD  1145
             HLHFQAYYL +PFPVEK P   I+  +   D  +++SQLLNYP R L+FE G ++RDLSD
Sbjct  220   HLHFQAYYLPLPFPVEKAPISRIVTVKGYQDTEVIISQLLNYPVRGLVFEVGKSLRDLSD  279

Query  1144  AVANSCISLQNNNIPFNLLISERGNKVFLFPQVHSNSVFL  1025
             AVA+SCI LQ+NNIPFN+LIS+ G ++ LFPQ ++    L
Sbjct  280   AVASSCICLQDNNIPFNVLISDCGRRIILFPQCYAEKQAL  319


 Score = 99.4 bits (246),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 47/77 (61%), Positives = 58/77 (75%), Gaps = 10/77 (13%)
 Frame = -2

Query  759  FSKCYAEKQACGKIDQEILDTWVNPAVWEISGHMVLKRREDYDDASEDYAWRLLSEVSLS  580
            F +CYAEKQA G++ QE+LDT VNPA WEISGH+VLKRR+D+++ASE+YAWR        
Sbjct  309  FPQCYAEKQALGEVSQELLDTQVNPAAWEISGHIVLKRRKDFEEASEEYAWR--------  360

Query  579  EERFEEVKAYVSRAADL  529
              RF+EVKAYV  A  L
Sbjct  361  --RFQEVKAYVLEAVGL  375



>ref|XP_010910502.1| PREDICTED: GDP-L-galactose phosphorylase 2-like isoform X2 [Elaeis 
guineensis]
Length=433

 Score =   456 bits (1173),  Expect = 6e-150, Method: Compositional matrix adjust.
 Identities = 228/351 (65%), Positives = 268/351 (76%), Gaps = 31/351 (9%)
 Frame = -1

Query  2041  MLTIKRVPTVVSNYQDDAPEDSKPESLGCGRNCLGQCCLPVSCLPLFAFKNDEHKCDGDW  1862
             MLTIKRVPTV+SNYQ+DA E     S GCGRNCLG+CCLPVS LPL+AFK+D  +     
Sbjct  1     MLTIKRVPTVLSNYQEDASE-----SRGCGRNCLGKCCLPVSKLPLYAFKSDSKR-----  50

Query  1861  NYLSYGECPIS------------FLSDLLLGQWEERMSRGLFRYDVTSCETKIIPGTFGF  1718
                     PIS            FL+ LLLGQWE+R++RGLFRYDVT+CETK+IPG  GF
Sbjct  51    --------PISPSGATDDPPADFFLNSLLLGQWEDRLNRGLFRYDVTACETKVIPGEQGF  102

Query  1717  IAQLNEGRHLKKRPTEFRVDQVLQPFDENKFNFTKIGQEEVLFRFEPSNDCKSHYLPSGL  1538
             IAQLNEGRHLKKRPTEFRVD+VLQPFD  KFNFTK+GQEEVLFRFE      S +  S  
Sbjct  103   IAQLNEGRHLKKRPTEFRVDRVLQPFDPAKFNFTKVGQEEVLFRFEDGGGHTSLFFDSAS  162

Query  1537  VDARSGSPTVLAINVSPIEYGHVLLIPRVLDCLPQRIDHDSFFVAMHLAKEAADPFFRVG  1358
             VD  +  P+V+AINVSPIEYGHVLLIPRVLDCLPQRID +SF +A+H+A EA +P FR+G
Sbjct  163   VD-EANPPSVVAINVSPIEYGHVLLIPRVLDCLPQRIDAESFLLALHMAAEAGNPCFRLG  221

Query  1357  YNSLGAFATINHLHFQAYYLQVPFPVEKTPTREIMRGREQGDGGIVVSQLLNYPARALLF  1178
             YNSLGAFATINHLHFQAYYL VPFPVEK PTREI   +   D G+ +S L+NYP R L++
Sbjct  222   YNSLGAFATINHLHFQAYYLSVPFPVEKAPTREIPIAKGLADSGVKISLLMNYPVRGLVY  281

Query  1177  EGGSTVRDLSDAVANSCISLQNNNIPFNLLISERGNKVFLFPQVHSNSVFL  1025
             EGG+T++DL+D VANSCI LQ NNIPFN+LIS+ G ++FLFPQ ++    L
Sbjct  282   EGGNTLKDLADVVANSCIWLQENNIPFNVLISDSGRRIFLFPQCYAEKQAL  332


 Score =   128 bits (321),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 62/96 (65%), Positives = 76/96 (79%), Gaps = 6/96 (6%)
 Frame = -2

Query  759  FSKCYAEKQACGKIDQEILDTWVNPAVWEISGHMVLKRREDYDDASEDYAWRLLSEVSLS  580
            F +CYAEKQA G++ QE+LDT VNPAVWEISGHMVLKRR+DY++A+EDYAWRLL+EVSLS
Sbjct  322  FPQCYAEKQALGEVPQELLDTQVNPAVWEISGHMVLKRRKDYEEATEDYAWRLLAEVSLS  381

Query  579  EERFEEVKAYVSRAADLL------LDSECSNGGSQP  490
            EERF+EVKAY+  A  L+       D+  + G  QP
Sbjct  382  EERFQEVKAYIFEATGLVEAEVEDTDANENKGTYQP  417



>ref|XP_011095440.1| PREDICTED: GDP-L-galactose phosphorylase 2-like [Sesamum indicum]
Length=441

 Score =   455 bits (1171),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 213/341 (62%), Positives = 270/341 (79%), Gaps = 6/341 (2%)
 Frame = -1

Query  2044  LMLTIKRVPTVVSNYQDDAPEDSKPESLGCGRNCLGQCCLPVSCLPLFAF-KNDEHKCDG  1868
             +ML IKRVPTVVSNYQ +  E+    + GCGRNCL  CCLP + LPL+AF K  +  C+ 
Sbjct  1     MMLRIKRVPTVVSNYQKEEAEEGASHAAGCGRNCLRSCCLPGAKLPLYAFNKTSKVVCEK  60

Query  1867  DWNYLSYGECPISFLSDLLLGQWEERMSRGLFRYDVTSCETKIIPGTFGFIAQLNEGRHL  1688
             D       E P+ FL  LLL +WE+RM RGLFRYDVT+CETK+IPG +GFIAQLNEGRHL
Sbjct  61    DSVGSENDEPPVDFLDSLLLAEWEDRMQRGLFRYDVTACETKVIPGKYGFIAQLNEGRHL  120

Query  1687  KKRPTEFRVDQVLQPFDENKFNFTKIGQEEVLFRFEPSNDCKSHYLPSGLVDARSGSPTV  1508
             KKRPTEFRVD+VLQPFDENKFNFTK+GQEE+LF+FEPS D    ++P   +DA + SP+V
Sbjct  121   KKRPTEFRVDKVLQPFDENKFNFTKVGQEELLFQFEPSKDNVVKFIPKAPIDAEN-SPSV  179

Query  1507  LAINVSPIEYGHVLLIPRVLDCLPQRIDHDSFFVAMHLAKEAADPFFRVGYNSLGAFATI  1328
             +AINVSPIEYGHVLLIPR+L+CLPQRID +SF +A+++A EA +P+FR+GYNSLGAFATI
Sbjct  180   VAINVSPIEYGHVLLIPRILECLPQRIDRESFLLALYMAVEAGNPYFRLGYNSLGAFATI  239

Query  1327  NHLHFQAYYLQVPFPVEKTPTREIMRGREQGDGGIVVSQLLNYPARALLFEGGSTVRDLS  1148
             NHLHFQAYYL  PFP+E+ P+++I+      +GG+ +S +LNYP R L+FEGG+T+ DLS
Sbjct  240   NHLHFQAYYLATPFPIERAPSKKII----TTNGGVKISDILNYPVRGLVFEGGNTLEDLS  295

Query  1147  DAVANSCISLQNNNIPFNLLISERGNKVFLFPQVHSNSVFL  1025
             + V++SCI LQ NNIP+N+LI++ G +VFLFPQ ++    L
Sbjct  296   NVVSDSCICLQENNIPYNVLIADTGKRVFLFPQCYAEKQAL  336


 Score =   111 bits (277),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 53/85 (62%), Positives = 67/85 (79%), Gaps = 7/85 (8%)
 Frame = -2

Query  759  FSKCYAEKQACGKIDQEILDTWVNPAVWEISGHMVLKRREDYDDASEDYAWRLLSEVSLS  580
            F +CYAEKQA G++  E+LDT VNPAVWEISGHMVLKR+EDY++ASE+ AWRLL+EVSLS
Sbjct  326  FPQCYAEKQALGEVSSELLDTQVNPAVWEISGHMVLKRKEDYEEASEENAWRLLAEVSLS  385

Query  579  EERFEEVKAYVSRAADLLLDSECSN  505
            E R +EVK       +L+ ++ C N
Sbjct  386  EARLQEVK-------ELIFETICCN  403



>ref|XP_009421168.1| PREDICTED: GDP-L-galactose phosphorylase 1-like [Musa acuminata 
subsp. malaccensis]
Length=434

 Score =   455 bits (1170),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 223/335 (67%), Positives = 267/335 (80%), Gaps = 10/335 (3%)
 Frame = -1

Query  2041  MLTIKRVPTVVSNYQDDAPEDSKPESLGCGRNCLGQCCLPVSCLPLFAFKNDEHKCDGDW  1862
             MLTIKRVPTV+SNYQ+D+ E     S GCGRNCLG+CCLPVS LPL+AFK+D      + 
Sbjct  1     MLTIKRVPTVLSNYQEDSGE-----SRGCGRNCLGKCCLPVSKLPLYAFKSDARP---EI  52

Query  1861  NYLSYGECPISF-LSDLLLGQWEERMSRGLFRYDVTSCETKIIPGTFGFIAQLNEGRHLK  1685
             +     E P  F L+ LLLG WE+RMSRGLFRYDVT+CETK+IPG +GF+AQLNEGRHLK
Sbjct  53    SSSGVDEPPSDFFLNSLLLGGWEDRMSRGLFRYDVTACETKVIPGEYGFVAQLNEGRHLK  112

Query  1684  KRPTEFRVDQVLQPFDENKFNFTKIGQEEVLFRFEPSNDCKSHYLPSGLVDARSGSPTVL  1505
             KRPTEFRVD+VLQPFD  KFNFTK+GQEEVLFRFE     K+ +L S  V   + +P+V+
Sbjct  113   KRPTEFRVDRVLQPFDPAKFNFTKVGQEEVLFRFEAGEGDKARFLESAAV-GETNTPSVV  171

Query  1504  AINVSPIEYGHVLLIPRVLDCLPQRIDHDSFFVAMHLAKEAADPFFRVGYNSLGAFATIN  1325
             AINVSPIEYGHVLLIPRVLDCLPQRID DSF +A+H+A EA  P+FR+GYNSLGAFATIN
Sbjct  172   AINVSPIEYGHVLLIPRVLDCLPQRIDPDSFLLALHMAAEAGSPYFRLGYNSLGAFATIN  231

Query  1324  HLHFQAYYLQVPFPVEKTPTREIMRGREQGDGGIVVSQLLNYPARALLFEGGSTVRDLSD  1145
             HLHFQAY+L +PFPVEK PT+ I   +      + VS+LLNYP R L++EGG+T++DLSD
Sbjct  232   HLHFQAYFLTMPFPVEKAPTQRIPVVKGLSQSKVKVSKLLNYPVRGLVYEGGNTLKDLSD  291

Query  1144  AVANSCISLQNNNIPFNLLISERGNKVFLFPQVHS  1040
              VANSCI LQ NNIPFN+LIS+ G ++FLFPQ ++
Sbjct  292   VVANSCICLQENNIPFNVLISDSGRRIFLFPQCYA  326


 Score =   125 bits (315),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 58/77 (75%), Positives = 68/77 (88%), Gaps = 0/77 (0%)
 Frame = -2

Query  759  FSKCYAEKQACGKIDQEILDTWVNPAVWEISGHMVLKRREDYDDASEDYAWRLLSEVSLS  580
            F +CYAEKQA G++ QEILDT VNPAVWEISGHMVLKR++DY++ASE+YAWRLL+EVSLS
Sbjct  321  FPQCYAEKQALGEVSQEILDTQVNPAVWEISGHMVLKRKKDYEEASEEYAWRLLAEVSLS  380

Query  579  EERFEEVKAYVSRAADL  529
            E RFEEVKAY+  A  L
Sbjct  381  EARFEEVKAYIFEATGL  397



>gb|KDO63082.1| hypothetical protein CISIN_1g040147mg, partial [Citrus sinensis]
Length=412

 Score =   454 bits (1167),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 226/340 (66%), Positives = 261/340 (77%), Gaps = 22/340 (6%)
 Frame = -1

Query  2041  MLTIKRVPTVVSNYQDDAPEDSKPESLGCGRNCLGQCCLPVSCLPLFAFKNDEHKCDGDW  1862
             MLTIKRVPTVVSNYQD     S+    GCG NCLG C LPVS LPL+    D+     D 
Sbjct  1     MLTIKRVPTVVSNYQDQEETASENSEAGCGSNCLGNCSLPVSKLPLYQITKDK----VDL  56

Query  1861  NYLSYGECP-ISFLSDLLLGQWEERMSRGLFRYDVTSCETKIIPGTFGFIAQLNEGRHLK  1685
                + GE P +SFL DLLLGQWE+RM+RGLFRYDVTSCETKIIPG +GFIAQLNEGRHLK
Sbjct  57    TEEASGEEPRMSFLHDLLLGQWEDRMNRGLFRYDVTSCETKIIPGEYGFIAQLNEGRHLK  116

Query  1684  KRPTEFRVDQVLQPFDENKFNFTKIGQEEVLFRFEPSNDCKSHYLPSGLVDARSGSPTVL  1505
             KR TEFR+DQVLQ FDENKFNFTKIGQEE+LFR + S                  SP+V+
Sbjct  117   KRATEFRIDQVLQSFDENKFNFTKIGQEEMLFRLDDSK-----------------SPSVV  159

Query  1504  AINVSPIEYGHVLLIPRVLDCLPQRIDHDSFFVAMHLAKEAADPFFRVGYNSLGAFATIN  1325
             AINVSPIEYGHVLLIPRVLDCLPQRIDH+SF +A+++AKEAADPFFR+GYNSLGAFATIN
Sbjct  160   AINVSPIEYGHVLLIPRVLDCLPQRIDHESFLLALYVAKEAADPFFRLGYNSLGAFATIN  219

Query  1324  HLHFQAYYLQVPFPVEKTPTREIMRGREQGDGGIVVSQLLNYPARALLFEGGSTVRDLSD  1145
             HLHFQAYYL +PFPVEK PT  I+  +   D  +++SQLLNYP R L+FE G ++RDLS 
Sbjct  220   HLHFQAYYLPLPFPVEKAPTSRIVTVKGHQDTQVIISQLLNYPVRGLVFEVGKSLRDLSH  279

Query  1144  AVANSCISLQNNNIPFNLLISERGNKVFLFPQVHSNSVFL  1025
             AVA+SCI LQNNNIPFN+LIS+ G ++ LFPQ ++    L
Sbjct  280   AVASSCICLQNNNIPFNVLISDCGRRIILFPQCYAEKQAL  319


 Score =   122 bits (306),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 56/77 (73%), Positives = 68/77 (88%), Gaps = 0/77 (0%)
 Frame = -2

Query  759  FSKCYAEKQACGKIDQEILDTWVNPAVWEISGHMVLKRREDYDDASEDYAWRLLSEVSLS  580
            F +CYAEKQA G++ QE+LDT VNPA WEISGH+VLKRR+D+++ASE+YAWR+LSEVSLS
Sbjct  309  FPQCYAEKQALGEVSQELLDTQVNPAAWEISGHIVLKRRKDFEEASEEYAWRVLSEVSLS  368

Query  579  EERFEEVKAYVSRAADL  529
            EERF+EVKAYV  A  L
Sbjct  369  EERFQEVKAYVLEAVGL  385



>ref|XP_006482136.1| PREDICTED: GDP-L-galactose phosphorylase 1-like [Citrus sinensis]
Length=446

 Score =   454 bits (1167),  Expect = 9e-149, Method: Compositional matrix adjust.
 Identities = 225/336 (67%), Positives = 260/336 (77%), Gaps = 22/336 (7%)
 Frame = -1

Query  2041  MLTIKRVPTVVSNYQDDAPEDSKPESLGCGRNCLGQCCLPVSCLPLFAFKNDEHKCDGDW  1862
             MLTIKRVPTVVSNYQD     S+    GCG NCLG C LPVS LPL+    D+     D 
Sbjct  1     MLTIKRVPTVVSNYQDQEETTSENSEAGCGSNCLGNCSLPVSKLPLYQITKDK----VDL  56

Query  1861  NYLSYGECP-ISFLSDLLLGQWEERMSRGLFRYDVTSCETKIIPGTFGFIAQLNEGRHLK  1685
                + GE P +SFL DLLLGQWE+RM+RGLFRYDVTSCETKIIPG +GFIAQLNEGRHLK
Sbjct  57    TEEASGEEPRMSFLHDLLLGQWEDRMNRGLFRYDVTSCETKIIPGEYGFIAQLNEGRHLK  116

Query  1684  KRPTEFRVDQVLQPFDENKFNFTKIGQEEVLFRFEPSNDCKSHYLPSGLVDARSGSPTVL  1505
             KR TEFR+DQVLQ FDENKFNFTKIGQEE+LFR + S                  SP+V+
Sbjct  117   KRATEFRIDQVLQSFDENKFNFTKIGQEEMLFRLDDSK-----------------SPSVV  159

Query  1504  AINVSPIEYGHVLLIPRVLDCLPQRIDHDSFFVAMHLAKEAADPFFRVGYNSLGAFATIN  1325
             AINVSPIEYGHVLLIPRVLDCLPQRIDH+SF +A+++AKEAADPFFR+GYNSLGAFATIN
Sbjct  160   AINVSPIEYGHVLLIPRVLDCLPQRIDHESFLLALYVAKEAADPFFRLGYNSLGAFATIN  219

Query  1324  HLHFQAYYLQVPFPVEKTPTREIMRGREQGDGGIVVSQLLNYPARALLFEGGSTVRDLSD  1145
             HLHFQAYYL +PFPVEK PT  I+  +   D  +++SQLLNYP R L+FE G ++RDLS 
Sbjct  220   HLHFQAYYLPLPFPVEKAPTSRIVTVKGHQDTQVIISQLLNYPVRGLVFEVGKSLRDLSH  279

Query  1144  AVANSCISLQNNNIPFNLLISERGNKVFLFPQVHSN  1037
             AVA+SCI LQNNNIPFN+LIS+ G ++ LFPQ ++ 
Sbjct  280   AVASSCICLQNNNIPFNVLISDCGRRIILFPQCYAE  315


 Score =   119 bits (298),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 54/75 (72%), Positives = 66/75 (88%), Gaps = 0/75 (0%)
 Frame = -2

Query  759  FSKCYAEKQACGKIDQEILDTWVNPAVWEISGHMVLKRREDYDDASEDYAWRLLSEVSLS  580
            F +CYAEKQA G++ QE+LDT VNPA WEISGH+VLKRR+D+++A E+YAWR+LSEVSLS
Sbjct  309  FPQCYAEKQALGEVSQELLDTQVNPAAWEISGHIVLKRRKDFEEAPEEYAWRVLSEVSLS  368

Query  579  EERFEEVKAYVSRAA  535
            EERF+EVKAYV  A 
Sbjct  369  EERFQEVKAYVLEAV  383



>ref|XP_008781038.1| PREDICTED: GDP-L-galactose phosphorylase 2-like [Phoenix dactylifera]
Length=452

 Score =   452 bits (1164),  Expect = 3e-148, Method: Compositional matrix adjust.
 Identities = 223/341 (65%), Positives = 260/341 (76%), Gaps = 11/341 (3%)
 Frame = -1

Query  2041  MLTIKRVPTVVSNYQDDAPEDSKPESLGCGRNCLGQCCLPVSCLPLFAFKNDEHKCDGDW  1862
             MLTIKRVPTVVSNYQ+D  E      LGCGRNCLG CCLPVS LPL+AFK D    +   
Sbjct  1     MLTIKRVPTVVSNYQEDVSE-----PLGCGRNCLGHCCLPVSKLPLYAFKRDSKSPN---  52

Query  1861  NYLSYGECPIS--FLSDLLLGQWEERMSRGLFRYDVTSCETKIIPGTFGFIAQLNEGRHL  1688
                S  E P +  FL  L+LG+WE+RMSRGLFRYDVT+CETK+IPG  GFIAQLNEGRHL
Sbjct  53    ESSSTAEDPSTGFFLHSLILGEWEDRMSRGLFRYDVTACETKVIPGEHGFIAQLNEGRHL  112

Query  1687  KKRPTEFRVDQVLQPFDENKFNFTKIGQEEVLFRFEPSNDCKSHYLPSGLVDARSGSPTV  1508
             KKRPTEFRVD+VLQPFD NKFNFTK+GQEEVLFRFE   D +S +  S    A +  P V
Sbjct  113   KKRPTEFRVDRVLQPFDRNKFNFTKVGQEEVLFRFEAGGDSRSQFFESAPAGA-THPPNV  171

Query  1507  LAINVSPIEYGHVLLIPRVLDCLPQRIDHDSFFVAMHLAKEAADPFFRVGYNSLGAFATI  1328
             +AINVSPIEYGHVLLIP VL+CLPQRID +SF VA+H+A EA  P+FR+GYNSLGAFATI
Sbjct  172   VAINVSPIEYGHVLLIPHVLECLPQRIDPESFLVALHMAAEAGSPYFRLGYNSLGAFATI  231

Query  1327  NHLHFQAYYLQVPFPVEKTPTREIMRGREQGDGGIVVSQLLNYPARALLFEGGSTVRDLS  1148
             NHLHFQAYYL +PFPVEK P   I   +   + G+  SQLLNYP R L+FEGG+T++DLS
Sbjct  232   NHLHFQAYYLSMPFPVEKAPAEMISVAKGLSERGVKTSQLLNYPVRGLVFEGGNTLKDLS  291

Query  1147  DAVANSCISLQNNNIPFNLLISERGNKVFLFPQVHSNSVFL  1025
                A+SC+ LQ NNIPFN+LIS+ G ++FLFPQ ++    L
Sbjct  292   VVAASSCMCLQGNNIPFNVLISDSGRRIFLFPQCYAEKQAL  332


 Score =   123 bits (308),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 57/77 (74%), Positives = 69/77 (90%), Gaps = 0/77 (0%)
 Frame = -2

Query  759  FSKCYAEKQACGKIDQEILDTWVNPAVWEISGHMVLKRREDYDDASEDYAWRLLSEVSLS  580
            F +CYAEKQA G++ QE+LDT VNPAVWEISGHMVLKR++D+++ASE YAW+LLSEVSLS
Sbjct  322  FPQCYAEKQALGEVSQELLDTQVNPAVWEISGHMVLKRKKDFEEASEAYAWKLLSEVSLS  381

Query  579  EERFEEVKAYVSRAADL  529
            EERF+EVKA +S AA L
Sbjct  382  EERFQEVKACISDAATL  398



>gb|KHG19846.1| GDP-L-galactose phosphorylase 1 -like protein [Gossypium arboreum]
Length=445

 Score =   452 bits (1163),  Expect = 3e-148, Method: Compositional matrix adjust.
 Identities = 210/340 (62%), Positives = 269/340 (79%), Gaps = 5/340 (1%)
 Frame = -1

Query  2044  LMLTIKRVPTVVSNYQDDAPEDSKPESLGCGRNCLGQCCLPVSCLPLFAFKNDEHKCDGD  1865
             +ML IKRVPTVVSNYQ D  +D+   S GCG+NCL  CC+P + LPL+AFK    + + D
Sbjct  1     MMLRIKRVPTVVSNYQKDEADDTARRSAGCGKNCLKSCCIPGAKLPLYAFKKVSMEREED  60

Query  1864  WNYLSYGECPISFLSDLLLGQWEERMSRGLFRYDVTSCETKIIPGTFGFIAQLNEGRHLK  1685
                +   E P++FL  L+LG+WE+RM RGLFRYDVT+CETK+IPG +GFIAQLNEGRHLK
Sbjct  61    VLKMENTEPPVAFLDSLVLGEWEDRMQRGLFRYDVTACETKVIPGEYGFIAQLNEGRHLK  120

Query  1684  KRPTEFRVDQVLQPFDENKFNFTKIGQEEVLFRFEPSNDCKSHYLPSGLVDARSGSPTVL  1505
             KRPTEFRVD+VLQPFD NKFNFTK+GQEEVLF+FE S D +  + P+  +D  + SP+V+
Sbjct  121   KRPTEFRVDKVLQPFDGNKFNFTKVGQEEVLFQFEASEDGEVQFYPTAPIDVEN-SPSVV  179

Query  1504  AINVSPIEYGHVLLIPRVLDCLPQRIDHDSFFVAMHLAKEAADPFFRVGYNSLGAFATIN  1325
             AINVSPIEYGHVLLIPR+ +CLPQRID +SF +A+H+A EA +P FR+GYNSLGAFATIN
Sbjct  180   AINVSPIEYGHVLLIPRIFECLPQRIDRESFLLALHMAAEAGNPHFRLGYNSLGAFATIN  239

Query  1324  HLHFQAYYLQVPFPVEKTPTREIMRGREQGDGGIVVSQLLNYPARALLFEGGSTVRDLSD  1145
             HLHFQAYYL VPFP+EK PT+E+    +    G++VS+LL YP + L+FEGG+T+ DLS+
Sbjct  240   HLHFQAYYLAVPFPIEKAPTKELTTLSD----GVIVSELLKYPVKGLVFEGGNTLLDLSN  295

Query  1144  AVANSCISLQNNNIPFNLLISERGNKVFLFPQVHSNSVFL  1025
              V+++CI LQ+NNIP+N+LIS+ G ++FL PQ ++    L
Sbjct  296   TVSDACICLQDNNIPYNVLISDCGKRIFLLPQCYAEKQAL  335


 Score =   111 bits (278),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 52/74 (70%), Positives = 61/74 (82%), Gaps = 0/74 (0%)
 Frame = -2

Query  759  FSKCYAEKQACGKIDQEILDTWVNPAVWEISGHMVLKRREDYDDASEDYAWRLLSEVSLS  580
              +CYAEKQA G++  E+LDT VNPAVWEISGHMVLKRR+DYD+ASE  AWRLL+EVSLS
Sbjct  325  LPQCYAEKQALGEVSPELLDTQVNPAVWEISGHMVLKRRKDYDEASEGNAWRLLAEVSLS  384

Query  579  EERFEEVKAYVSRA  538
            +ERF EV A +  A
Sbjct  385  DERFREVNALIFEA  398



>ref|XP_010910501.1| PREDICTED: GDP-L-galactose phosphorylase 2-like isoform X1 [Elaeis 
guineensis]
Length=434

 Score =   451 bits (1161),  Expect = 4e-148, Method: Compositional matrix adjust.
 Identities = 228/352 (65%), Positives = 268/352 (76%), Gaps = 32/352 (9%)
 Frame = -1

Query  2041  MLTIKRVPTVVSNYQDDAPEDSKPESLGCGRNCLGQCCLP-VSCLPLFAFKNDEHKCDGD  1865
             MLTIKRVPTV+SNYQ+DA E     S GCGRNCLG+CCLP VS LPL+AFK+D  +    
Sbjct  1     MLTIKRVPTVLSNYQEDASE-----SRGCGRNCLGKCCLPAVSKLPLYAFKSDSKR----  51

Query  1864  WNYLSYGECPIS------------FLSDLLLGQWEERMSRGLFRYDVTSCETKIIPGTFG  1721
                      PIS            FL+ LLLGQWE+R++RGLFRYDVT+CETK+IPG  G
Sbjct  52    ---------PISPSGATDDPPADFFLNSLLLGQWEDRLNRGLFRYDVTACETKVIPGEQG  102

Query  1720  FIAQLNEGRHLKKRPTEFRVDQVLQPFDENKFNFTKIGQEEVLFRFEPSNDCKSHYLPSG  1541
             FIAQLNEGRHLKKRPTEFRVD+VLQPFD  KFNFTK+GQEEVLFRFE      S +  S 
Sbjct  103   FIAQLNEGRHLKKRPTEFRVDRVLQPFDPAKFNFTKVGQEEVLFRFEDGGGHTSLFFDSA  162

Query  1540  LVDARSGSPTVLAINVSPIEYGHVLLIPRVLDCLPQRIDHDSFFVAMHLAKEAADPFFRV  1361
              VD  +  P+V+AINVSPIEYGHVLLIPRVLDCLPQRID +SF +A+H+A EA +P FR+
Sbjct  163   SVD-EANPPSVVAINVSPIEYGHVLLIPRVLDCLPQRIDAESFLLALHMAAEAGNPCFRL  221

Query  1360  GYNSLGAFATINHLHFQAYYLQVPFPVEKTPTREIMRGREQGDGGIVVSQLLNYPARALL  1181
             GYNSLGAFATINHLHFQAYYL VPFPVEK PTREI   +   D G+ +S L+NYP R L+
Sbjct  222   GYNSLGAFATINHLHFQAYYLSVPFPVEKAPTREIPIAKGLADSGVKISLLMNYPVRGLV  281

Query  1180  FEGGSTVRDLSDAVANSCISLQNNNIPFNLLISERGNKVFLFPQVHSNSVFL  1025
             +EGG+T++DL+D VANSCI LQ NNIPFN+LIS+ G ++FLFPQ ++    L
Sbjct  282   YEGGNTLKDLADVVANSCIWLQENNIPFNVLISDSGRRIFLFPQCYAEKQAL  333


 Score =   128 bits (321),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 62/96 (65%), Positives = 76/96 (79%), Gaps = 6/96 (6%)
 Frame = -2

Query  759  FSKCYAEKQACGKIDQEILDTWVNPAVWEISGHMVLKRREDYDDASEDYAWRLLSEVSLS  580
            F +CYAEKQA G++ QE+LDT VNPAVWEISGHMVLKRR+DY++A+EDYAWRLL+EVSLS
Sbjct  323  FPQCYAEKQALGEVPQELLDTQVNPAVWEISGHMVLKRRKDYEEATEDYAWRLLAEVSLS  382

Query  579  EERFEEVKAYVSRAADLL------LDSECSNGGSQP  490
            EERF+EVKAY+  A  L+       D+  + G  QP
Sbjct  383  EERFQEVKAYIFEATGLVEAEVEDTDANENKGTYQP  418



>ref|XP_007142307.1| hypothetical protein PHAVU_008G269600g [Phaseolus vulgaris]
 gb|ESW14301.1| hypothetical protein PHAVU_008G269600g [Phaseolus vulgaris]
Length=433

 Score =   451 bits (1160),  Expect = 6e-148, Method: Compositional matrix adjust.
 Identities = 214/335 (64%), Positives = 266/335 (79%), Gaps = 7/335 (2%)
 Frame = -1

Query  2044  LMLTIKRVPTVVSNYQDDAPEDSKPESLGCGRNCLGQCCLPVSCLPLFAFKNDEHKCDGD  1865
             +ML IKRVPTVVSNYQ D   D+     GCGRNCL  CCLP + LPL+AFK   +  + D
Sbjct  1     MMLKIKRVPTVVSNYQKDGAADTSRPVGGCGRNCLKACCLPDAKLPLYAFKKVVN--EKD  58

Query  1864  WNYLSYGECPISFLSDLLLGQWEERMSRGLFRYDVTSCETKIIPGTFGFIAQLNEGRHLK  1685
                   GE P++FL  LLLG+WE+RM +GLFRYDVT+CETK+IPG +GF+AQLNEGRHLK
Sbjct  59    LALQECGEPPVAFLDSLLLGEWEDRMQKGLFRYDVTACETKVIPGEYGFVAQLNEGRHLK  118

Query  1684  KRPTEFRVDQVLQPFDENKFNFTKIGQEEVLFRFEPSNDCKSHYLPSGLVDARSGSPTVL  1505
             KRPTEFRVD+VLQPFDE+KFNFTK+GQEEVLF+FE S+D +  + P+  VD    SP+ +
Sbjct  119   KRPTEFRVDKVLQPFDESKFNFTKVGQEEVLFQFEASDDGQIQFFPNAPVDV-DNSPSFV  177

Query  1504  AINVSPIEYGHVLLIPRVLDCLPQRIDHDSFFVAMHLAKEAADPFFRVGYNSLGAFATIN  1325
             AINVSPIEYGHVLLIPR+ +CLPQRID +SF +A+H+A EA +P+FR+GYNSLGAFATIN
Sbjct  178   AINVSPIEYGHVLLIPRIFECLPQRIDRESFLLALHMAVEADNPYFRLGYNSLGAFATIN  237

Query  1324  HLHFQAYYLQVPFPVEKTPTREIMRGREQGDGGIVVSQLLNYPARALLFEGGSTVRDLSD  1145
             HLHFQAYYL +PFP+EK PT++I       +GG+ +S+LL YP R L+FEGG TV DLS+
Sbjct  238   HLHFQAYYLALPFPIEKAPTKKIA----NLNGGVKISELLKYPVRGLVFEGGDTVEDLSN  293

Query  1144  AVANSCISLQNNNIPFNLLISERGNKVFLFPQVHS  1040
              V+++CI LQNNNIPFN+LIS+ G +VFL PQ ++
Sbjct  294   VVSDACICLQNNNIPFNVLISDCGKQVFLLPQCYA  328


 Score =   114 bits (284),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 53/76 (70%), Positives = 63/76 (83%), Gaps = 0/76 (0%)
 Frame = -2

Query  759  FSKCYAEKQACGKIDQEILDTWVNPAVWEISGHMVLKRREDYDDASEDYAWRLLSEVSLS  580
              +CYAEKQA G++D E+LDT VNPAVWEISGHMVLKR++DYD+ASE  AWRLL+EVSLS
Sbjct  323  LPQCYAEKQALGEVDAELLDTQVNPAVWEISGHMVLKRKKDYDEASEGNAWRLLAEVSLS  382

Query  579  EERFEEVKAYVSRAAD  532
            EERF+EV   +  A D
Sbjct  383  EERFQEVNDLIFEAID  398



>ref|XP_010912623.1| PREDICTED: GDP-L-galactose phosphorylase 1-like [Elaeis guineensis]
Length=436

 Score =   451 bits (1159),  Expect = 9e-148, Method: Compositional matrix adjust.
 Identities = 221/351 (63%), Positives = 265/351 (75%), Gaps = 31/351 (9%)
 Frame = -1

Query  2041  MLTIKRVPTVVSNYQDDAPEDSKPESLGCGRNCLGQCCLPVSCLPLFAFKNDEHKCDGDW  1862
             MLTIKRVPTV+SNYQ+DA E       GCGRNCLG+CCLP S LPL+ FK+D        
Sbjct  3     MLTIKRVPTVLSNYQEDAAEPR-----GCGRNCLGECCLPFSKLPLYVFKSD--------  49

Query  1861  NYLSYGECPIS------------FLSDLLLGQWEERMSRGLFRYDVTSCETKIIPGTFGF  1718
                   E P+S            FL+ LLLGQWE+RMSRGLFRYDVT+CETK+IPG  GF
Sbjct  50    -----AELPVSPSDATEEPPADFFLNSLLLGQWEDRMSRGLFRYDVTTCETKVIPGEQGF  104

Query  1717  IAQLNEGRHLKKRPTEFRVDQVLQPFDENKFNFTKIGQEEVLFRFEPSNDCKSHYLPSGL  1538
             IAQLNEGRHLKKRPTEFRVD+VLQPFD  KFNFTK+GQEE LFRFE     K+ +  S  
Sbjct  105   IAQLNEGRHLKKRPTEFRVDRVLQPFDPTKFNFTKVGQEEALFRFEAGEGNKARFFESAP  164

Query  1537  VDARSGSPTVLAINVSPIEYGHVLLIPRVLDCLPQRIDHDSFFVAMHLAKEAADPFFRVG  1358
             VD  S SP+V+ INVSPIEYGHVLLIPR+LDCLPQRID + F +A+H+A EA +P+FR+G
Sbjct  165   VDGAS-SPSVVVINVSPIEYGHVLLIPRLLDCLPQRIDAECFLLALHMAAEAGNPYFRLG  223

Query  1357  YNSLGAFATINHLHFQAYYLQVPFPVEKTPTREIMRGREQGDGGIVVSQLLNYPARALLF  1178
             YNSLGAFATINHLHFQAYYL +PFPVEK PT++I   +   + G+ VS L+NYP R L++
Sbjct  224   YNSLGAFATINHLHFQAYYLSLPFPVEKAPTKKIPMAKGLANSGLKVSLLMNYPVRGLVY  283

Query  1177  EGGSTVRDLSDAVANSCISLQNNNIPFNLLISERGNKVFLFPQVHSNSVFL  1025
             EGG+T++DL+D VANSCI LQ +NIPFN+LIS+ G ++FLFPQ ++    L
Sbjct  284   EGGNTLKDLADVVANSCICLQKSNIPFNVLISDSGRRIFLFPQCYAEKQAL  334


 Score =   123 bits (309),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 56/78 (72%), Positives = 69/78 (88%), Gaps = 0/78 (0%)
 Frame = -2

Query  759  FSKCYAEKQACGKIDQEILDTWVNPAVWEISGHMVLKRREDYDDASEDYAWRLLSEVSLS  580
            F +CYAEKQA G++ QE+LDT VNPAVWEISGHMVLKR++DY++ASEDYAW LL+EVSLS
Sbjct  324  FPQCYAEKQALGEVSQELLDTQVNPAVWEISGHMVLKRKKDYEEASEDYAWSLLAEVSLS  383

Query  579  EERFEEVKAYVSRAADLL  526
            EERF+EVKA++  A  L+
Sbjct  384  EERFQEVKAHILEATGLV  401



>ref|XP_008226982.1| PREDICTED: GDP-L-galactose phosphorylase 1 [Prunus mume]
Length=446

 Score =   451 bits (1159),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 218/344 (63%), Positives = 268/344 (78%), Gaps = 8/344 (2%)
 Frame = -1

Query  2044  LMLTIKRVPTVVSNYQDDAPEDSKPESLGCGRNCLGQCCLPVSCLPLFAFKNDEHKCDGD  1865
             +ML IKRVPTVVSNYQ D  E+      GCGRNCL QCC+P + LPL+AFK   +K DG 
Sbjct  1     MMLRIKRVPTVVSNYQKDEAEEGARRVGGCGRNCLNQCCIPGAKLPLYAFKK-LNKIDGG  59

Query  1864  WNY--LSYGECPISFLSDLLLGQWEERMSRGLFRYDVTSCETKIIPGTFGFIAQLNEGRH  1691
                      E P+ FL  LLLG+WE+RM RGLFRYDVT+CETK+IPG FGFIAQLNEGRH
Sbjct  60    KELPGSEKREPPVDFLDSLLLGEWEDRMQRGLFRYDVTACETKVIPGQFGFIAQLNEGRH  119

Query  1690  LKKRPTEFRVDQVLQPFDENKFNFTKIGQEEVLFRFEPSNDCKSHYLPSGLVDARSGSPT  1511
             LKKRPTEFRVD+VLQPFD NKFNFTK+GQEEVLF+FE S D +  ++PS  V+  + SP+
Sbjct  120   LKKRPTEFRVDKVLQPFDGNKFNFTKVGQEEVLFQFEASEDGEVQFIPSAPVEPEN-SPS  178

Query  1510  VLAINVSPIEYGHVLLIPRVLDCLPQRIDHDSFFVAMHLAKEAADPFFRVGYNSLGAFAT  1331
             V+AINVSPIEYGHVLLIPR+L+ LPQRIDH+SF +A+H+A EA +P+FR+GYNSLGAFAT
Sbjct  179   VVAINVSPIEYGHVLLIPRILERLPQRIDHESFLLALHMAAEAGNPYFRLGYNSLGAFAT  238

Query  1330  INHLHFQAYYLQVPFPVEKTPTREIMRGREQGDGGIVVSQLLNYPARALLFEGGSTVRDL  1151
             INHLHFQAYYL V FP+EK PT++I         G+ VS+LLNYP R L+FEGG+T++DL
Sbjct  239   INHLHFQAYYLAVTFPIEKAPTKKIT----VSGAGVKVSELLNYPVRGLVFEGGNTLQDL  294

Query  1150  SDAVANSCISLQNNNIPFNLLISERGNKVFLFPQVHSNSVFLSS  1019
             S+ V+++CI LQ NNIP+N+LIS+ G ++FL PQ ++    L  
Sbjct  295   SNTVSDACICLQENNIPYNVLISDCGKRIFLLPQCYAEKQALGE  338


 Score =   108 bits (270),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 49/74 (66%), Positives = 63/74 (85%), Gaps = 0/74 (0%)
 Frame = -2

Query  759  FSKCYAEKQACGKIDQEILDTWVNPAVWEISGHMVLKRREDYDDASEDYAWRLLSEVSLS  580
              +CYAEKQA G++  E+LDT VNPAVWEISGHMVLKR++DY++AS++ AW+LL+EVSLS
Sbjct  326  LPQCYAEKQALGEVRAELLDTQVNPAVWEISGHMVLKRKKDYEEASDENAWKLLAEVSLS  385

Query  579  EERFEEVKAYVSRA  538
            EERF+EV A +  A
Sbjct  386  EERFQEVNALIFEA  399



>ref|XP_003617599.1| hypothetical protein MTR_5g093390 [Medicago truncatula]
 gb|AET00558.1| GDP-L-galactose phosphorylase [Medicago truncatula]
 gb|AFK40896.1| unknown [Medicago truncatula]
Length=439

 Score =   449 bits (1154),  Expect = 5e-147, Method: Compositional matrix adjust.
 Identities = 215/345 (62%), Positives = 270/345 (78%), Gaps = 13/345 (4%)
 Frame = -1

Query  2044  LMLTIKRVPTVVSNYQDDAPEDSKPESLG-CGRNCLGQCCLPVSCLPLFAFKNDEHKCDG  1868
             +ML IKRVPTVVSNYQ +   ++ P ++G CGRNCL  CC+  + LPL+AFK  +   + 
Sbjct  1     MMLKIKRVPTVVSNYQKEEVGEAAPRTVGGCGRNCLKSCCIQDAKLPLYAFKKIDKVTEK  60

Query  1867  DWNYLSYGEC----PISFLSDLLLGQWEERMSRGLFRYDVTSCETKIIPGTFGFIAQLNE  1700
             D   L+  EC    P++FL  L+LG+WE+RM RGLFRYDVT+CETK+IPG  GFIAQLNE
Sbjct  61    D---LAIHECQEELPMAFLDSLVLGEWEDRMQRGLFRYDVTACETKVIPGECGFIAQLNE  117

Query  1699  GRHLKKRPTEFRVDQVLQPFDENKFNFTKIGQEEVLFRFEPSNDCKSHYLPSGLVDARSG  1520
             GRHLKKRPTEFRVD+VLQPFDENKFNFTK+GQEEVLF+FE S D +  + P+  +D    
Sbjct  118   GRHLKKRPTEFRVDKVLQPFDENKFNFTKVGQEEVLFQFEASEDGEVQFYPNAPIDV-DN  176

Query  1519  SPTVLAINVSPIEYGHVLLIPRVLDCLPQRIDHDSFFVAMHLAKEAADPFFRVGYNSLGA  1340
              P+ +AINVSPIEYGHVLLIPR+ +CLPQRIDH+SF +A+H+A EAA+P+FR+GYNSLGA
Sbjct  177   YPSFVAINVSPIEYGHVLLIPRIFECLPQRIDHESFLLALHMAAEAANPYFRLGYNSLGA  236

Query  1339  FATINHLHFQAYYLQVPFPVEKTPTREIMRGREQGDGGIVVSQLLNYPARALLFEGGSTV  1160
             FATINHLHFQAYYL +PFP+EK PT++I       +GG+ VS+LL YP R L+FEGG T+
Sbjct  237   FATINHLHFQAYYLAMPFPIEKAPTKKIAT----SNGGVKVSELLKYPVRGLVFEGGDTL  292

Query  1159  RDLSDAVANSCISLQNNNIPFNLLISERGNKVFLFPQVHSNSVFL  1025
              DLS  V+++CISLQNNNIP+N+LIS+ G +VFL PQ ++    L
Sbjct  293   EDLSKIVSDACISLQNNNIPYNVLISDCGTQVFLLPQCYAEKQAL  337


 Score =   115 bits (287),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 56/84 (67%), Positives = 67/84 (80%), Gaps = 1/84 (1%)
 Frame = -2

Query  780  GTHSFGEFSKCYAEKQACGKIDQEILDTWVNPAVWEISGHMVLKRREDYDDASEDYAWRL  601
            GT  F    +CYAEKQA G++D E+LDT VNPAVWEISGHMVLKR++D+D+ASE  AWRL
Sbjct  321  GTQVF-LLPQCYAEKQALGEVDAELLDTQVNPAVWEISGHMVLKRKKDFDEASEANAWRL  379

Query  600  LSEVSLSEERFEEVKAYVSRAADL  529
            L+EVSLSEERF+EV A +  A  L
Sbjct  380  LAEVSLSEERFQEVNAIIFEAIAL  403



>ref|NP_001240984.1| uncharacterized protein LOC100806541 [Glycine max]
 gb|AEO21431.1| GDP-L-galactose phosphorylase [Glycine max]
 gb|KHN11905.1| GDP-L-galactose phosphorylase 1 [Glycine soja]
Length=436

 Score =   448 bits (1153),  Expect = 7e-147, Method: Compositional matrix adjust.
 Identities = 217/337 (64%), Positives = 266/337 (79%), Gaps = 11/337 (3%)
 Frame = -1

Query  2044  LMLTIKRVPTVVSNYQDDAPEDSKPESLGCGRNCLGQCCLPVSCLPLFAFKNDEHKCDGD  1865
             +ML IKRVPTVVSNYQ D   DS     GCGRNCL  CCLP + LPL+AFK    K +G 
Sbjct  1     MMLRIKRVPTVVSNYQKDDAADSPRPVGGCGRNCLKACCLPDAKLPLYAFK----KANGK  56

Query  1864  WNYLSY--GECPISFLSDLLLGQWEERMSRGLFRYDVTSCETKIIPGTFGFIAQLNEGRH  1691
                L    GE P++FL  LLLG+WE+RM RGLFRYDVT+CETK+IPG +GF+AQLNEGRH
Sbjct  57    DLALHACAGEPPLTFLDSLLLGEWEDRMQRGLFRYDVTACETKVIPGEYGFVAQLNEGRH  116

Query  1690  LKKRPTEFRVDQVLQPFDENKFNFTKIGQEEVLFRFEPSNDCKSHYLPSGLVDARSGSPT  1511
             LKKRPTEFRVD+VLQPFDENKFNFTK+GQEEVLF+FE S D +  + P+  VD    SP+
Sbjct  117   LKKRPTEFRVDKVLQPFDENKFNFTKVGQEEVLFQFEASEDGQVQFFPNAPVDV-DNSPS  175

Query  1510  VLAINVSPIEYGHVLLIPRVLDCLPQRIDHDSFFVAMHLAKEAADPFFRVGYNSLGAFAT  1331
              +AINVSPIEYGHVLLIPR+ +CLPQRID +SF +A+H+A EA +P+FR+GYNSLGAFAT
Sbjct  176   FVAINVSPIEYGHVLLIPRIFECLPQRIDRESFLLALHMAVEADNPYFRLGYNSLGAFAT  235

Query  1330  INHLHFQAYYLQVPFPVEKTPTREIMRGREQGDGGIVVSQLLNYPARALLFEGGSTVRDL  1151
             INHLHFQAYYL +PFP+EK PT++I       +GG+ +S+LL YP R L+FEGG T+ DL
Sbjct  236   INHLHFQAYYLALPFPIEKAPTKKIA----SLNGGVKISELLKYPVRGLVFEGGDTLEDL  291

Query  1150  SDAVANSCISLQNNNIPFNLLISERGNKVFLFPQVHS  1040
             S+ V+++CI LQNNNIPFN+LIS+ G +V+L PQ ++
Sbjct  292   SNVVSDACICLQNNNIPFNVLISDCGKQVYLLPQCYA  328


 Score =   111 bits (277),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 51/74 (69%), Positives = 62/74 (84%), Gaps = 0/74 (0%)
 Frame = -2

Query  759  FSKCYAEKQACGKIDQEILDTWVNPAVWEISGHMVLKRREDYDDASEDYAWRLLSEVSLS  580
              +CYAEKQA G++D E+LDT VNPAVWEISGHMVLKR++DYD+ASE  AWRLL+EVSLS
Sbjct  323  LPQCYAEKQALGEVDAELLDTQVNPAVWEISGHMVLKRKKDYDEASEGNAWRLLAEVSLS  382

Query  579  EERFEEVKAYVSRA  538
            +ERF+EV   +  A
Sbjct  383  QERFQEVNDLIFEA  396



>gb|AGO32051.1| GDP-L-galactose phosphorylase [Actinidia rufa]
Length=450

 Score =   448 bits (1153),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 213/340 (63%), Positives = 269/340 (79%), Gaps = 6/340 (2%)
 Frame = -1

Query  2041  MLTIKRVPTVVSNYQDDAPEDSKPESLGCGRNCLGQCCLPVSCLPLFAFKN-DEHKCDGD  1865
             ML IKRVPTVVSN+Q D  +D      GCGRNCL +CC+  + LPL+AFK  +E   +  
Sbjct  1     MLKIKRVPTVVSNFQKDEADDGARSGGGCGRNCLQKCCIQGAKLPLYAFKRVNEVVGEKG  60

Query  1864  WNYLSYGECPISFLSDLLLGQWEERMSRGLFRYDVTSCETKIIPGTFGFIAQLNEGRHLK  1685
                L   E P++FL  LLLG+WE+R+ RGLFRYDVT+CETK+IPG +GFIAQLNEGRHLK
Sbjct  61    VLALDNEEAPVAFLDSLLLGEWEDRVQRGLFRYDVTACETKVIPGEYGFIAQLNEGRHLK  120

Query  1684  KRPTEFRVDQVLQPFDENKFNFTKIGQEEVLFRFEPSNDCKSHYLPSGLVDARSGSPTVL  1505
             KRPTEFRVD+VLQPFDE+KFNFTK+GQEEVLF+FE S+D +  + P+  VD  + SP+V+
Sbjct  121   KRPTEFRVDKVLQPFDESKFNFTKVGQEEVLFQFEASDDNEVQFFPNAPVDVEN-SPSVV  179

Query  1504  AINVSPIEYGHVLLIPRVLDCLPQRIDHDSFFVAMHLAKEAADPFFRVGYNSLGAFATIN  1325
             AINVSPIEYGHVLLIPR+L+CLPQRID +SF +A+H+A EA +P+FR+GYNSLGAFATIN
Sbjct  180   AINVSPIEYGHVLLIPRILECLPQRIDRESFLLALHMAAEAGNPYFRLGYNSLGAFATIN  239

Query  1324  HLHFQAYYLQVPFPVEKTPTREIMRGREQGDGGIVVSQLLNYPARALLFEGGSTVRDLSD  1145
             HLHFQAYYL VPFP+EK PTR+I       +GG+ +S LLNYP R L+FEGG+++ DLS+
Sbjct  240   HLHFQAYYLAVPFPIEKAPTRKIT----TLNGGVKISDLLNYPVRGLVFEGGNSLEDLSN  295

Query  1144  AVANSCISLQNNNIPFNLLISERGNKVFLFPQVHSNSVFL  1025
             A+++S I LQ NNIP+N+LIS+ G ++FL PQ ++    L
Sbjct  296   AISDSSICLQGNNIPYNVLISDSGKRIFLLPQCYAEKQAL  335


 Score =   113 bits (282),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 53/74 (72%), Positives = 62/74 (84%), Gaps = 0/74 (0%)
 Frame = -2

Query  759  FSKCYAEKQACGKIDQEILDTWVNPAVWEISGHMVLKRREDYDDASEDYAWRLLSEVSLS  580
              +CYAEKQA G++  ++LDT VNPAVWEISGHMVLKR+EDY +ASE  AWRLL+EVSLS
Sbjct  325  LPQCYAEKQALGEVSPDLLDTQVNPAVWEISGHMVLKRKEDYQEASEGNAWRLLAEVSLS  384

Query  579  EERFEEVKAYVSRA  538
            EERFEEVKA +  A
Sbjct  385  EERFEEVKALIFEA  398



>ref|XP_009361034.1| PREDICTED: GDP-L-galactose phosphorylase 2 [Pyrus x bretschneideri]
Length=448

 Score =   448 bits (1153),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 216/337 (64%), Positives = 268/337 (80%), Gaps = 8/337 (2%)
 Frame = -1

Query  2044  LMLTIKRVPTVVSNYQDDAPEDSKPESLGCGRNCLGQCCLPVSCLPLFAFKNDEHKCDGD  1865
             + L IKRVPTVVSNYQ D  E+      GCGRNCL QCC+P + LPL+AFK   +  DGD
Sbjct  3     MTLRIKRVPTVVSNYQKDEAEEGARRVGGCGRNCLNQCCIPGAKLPLYAFKK-LNVNDGD  61

Query  1864  WNYLSYG--ECPISFLSDLLLGQWEERMSRGLFRYDVTSCETKIIPGTFGFIAQLNEGRH  1691
              + L +   E P++FL  LLLG+WE+RM RGLFRYDVT+CETK+IPG FGFIAQLNEGRH
Sbjct  62    TSLLGHEKREPPVAFLDSLLLGEWEDRMQRGLFRYDVTACETKVIPGQFGFIAQLNEGRH  121

Query  1690  LKKRPTEFRVDQVLQPFDENKFNFTKIGQEEVLFRFEPSNDCKSHYLPSGLVDARSGSPT  1511
             LKKRPTEFRVD+VLQPFD +KFNFTK+GQEEVLF+FE S D +  + PS  +D  S SP+
Sbjct  122   LKKRPTEFRVDKVLQPFDCSKFNFTKVGQEEVLFQFEASEDGEVQFFPSAPIDVES-SPS  180

Query  1510  VLAINVSPIEYGHVLLIPRVLDCLPQRIDHDSFFVAMHLAKEAADPFFRVGYNSLGAFAT  1331
             V+AINVSPIEYGHVLLIPR+LD LPQRID +SF +A+H+A EA +P+FR+GYNSLGAFAT
Sbjct  181   VVAINVSPIEYGHVLLIPRILDRLPQRIDRESFLLALHMAAEAGNPYFRLGYNSLGAFAT  240

Query  1330  INHLHFQAYYLQVPFPVEKTPTREIMRGREQGDGGIVVSQLLNYPARALLFEGGSTVRDL  1151
             INHLHFQAYYL V FP+EK PT++I       +  + VS+LLNYP R L+FEGG+T++DL
Sbjct  241   INHLHFQAYYLAVTFPIEKAPTKKIA----TLNAEVKVSELLNYPVRGLVFEGGNTLQDL  296

Query  1150  SDAVANSCISLQNNNIPFNLLISERGNKVFLFPQVHS  1040
             S+ V+++CI LQ NNIP+N+LIS+ G ++FL PQ ++
Sbjct  297   SNTVSDACICLQENNIPYNVLISDSGKRIFLMPQCYA  333


 Score =   110 bits (276),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 50/71 (70%), Positives = 62/71 (87%), Gaps = 0/71 (0%)
 Frame = -2

Query  759  FSKCYAEKQACGKIDQEILDTWVNPAVWEISGHMVLKRREDYDDASEDYAWRLLSEVSLS  580
              +CYAEKQA G++  EILDT VNPAVWEISGHMVLKR++DYD+AS++ AW+LL+EVSLS
Sbjct  328  MPQCYAEKQALGEVRAEILDTQVNPAVWEISGHMVLKRKKDYDEASDENAWKLLAEVSLS  387

Query  579  EERFEEVKAYV  547
            EERF+EV A +
Sbjct  388  EERFQEVNALI  398



>ref|XP_009350144.1| PREDICTED: GDP-L-galactose phosphorylase 1-like [Pyrus x bretschneideri]
Length=437

 Score =   447 bits (1151),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 215/337 (64%), Positives = 269/337 (80%), Gaps = 8/337 (2%)
 Frame = -1

Query  2044  LMLTIKRVPTVVSNYQDDAPEDSKPESLGCGRNCLGQCCLPVSCLPLFAFKNDEHKCDGD  1865
             + L IKRVPTVVSNYQ D  E+      GCGRNCL QCC+P + LPL+AFK   +  DGD
Sbjct  3     MTLRIKRVPTVVSNYQKDEAEEGARRVGGCGRNCLNQCCIPGAKLPLYAFKK-LNVNDGD  61

Query  1864  WNYLSYG--ECPISFLSDLLLGQWEERMSRGLFRYDVTSCETKIIPGTFGFIAQLNEGRH  1691
              + L +   E P++FL  LLLG+WE+RM RGLFRYDVT+CETK+IPG FGFIAQLNEGRH
Sbjct  62    TSLLGHEKREPPVAFLDSLLLGEWEDRMQRGLFRYDVTACETKVIPGQFGFIAQLNEGRH  121

Query  1690  LKKRPTEFRVDQVLQPFDENKFNFTKIGQEEVLFRFEPSNDCKSHYLPSGLVDARSGSPT  1511
             LKKRPTEFRVD+VLQPFD +KFNFTK+GQEEVLF+FE S D +  + PS  +D  S SP+
Sbjct  122   LKKRPTEFRVDKVLQPFDCSKFNFTKVGQEEVLFQFEASEDGEVQFFPSAPIDVES-SPS  180

Query  1510  VLAINVSPIEYGHVLLIPRVLDCLPQRIDHDSFFVAMHLAKEAADPFFRVGYNSLGAFAT  1331
             V+AINVSPIEYGHVLLIPR+L+ LPQRID +SF +A+H+A EA +P+FR+GYNSLGAFAT
Sbjct  181   VVAINVSPIEYGHVLLIPRILERLPQRIDRESFLLALHMAAEAGNPYFRLGYNSLGAFAT  240

Query  1330  INHLHFQAYYLQVPFPVEKTPTREIMRGREQGDGGIVVSQLLNYPARALLFEGGSTVRDL  1151
             INHLHFQAYYL V FP+EK PT++I    ++    + VS+LLNYP R L+FEGG+T++DL
Sbjct  241   INHLHFQAYYLAVTFPIEKAPTKKIATLNDE----VKVSELLNYPVRGLVFEGGNTLQDL  296

Query  1150  SDAVANSCISLQNNNIPFNLLISERGNKVFLFPQVHS  1040
             S+ V+++CI LQ NNIP+N+LIS+ G ++FL PQ ++
Sbjct  297   SNTVSDACICLQENNIPYNVLISDSGKRIFLMPQCYA  333


 Score =   110 bits (276),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 50/71 (70%), Positives = 62/71 (87%), Gaps = 0/71 (0%)
 Frame = -2

Query  759  FSKCYAEKQACGKIDQEILDTWVNPAVWEISGHMVLKRREDYDDASEDYAWRLLSEVSLS  580
              +CYAEKQA G++  EILDT VNPAVWEISGHMVLKR++DYD+AS++ AW+LL+EVSLS
Sbjct  328  MPQCYAEKQALGEVRAEILDTQVNPAVWEISGHMVLKRKKDYDEASDENAWKLLAEVSLS  387

Query  579  EERFEEVKAYV  547
            EERF+EV A +
Sbjct  388  EERFQEVNALI  398



>gb|ABP65665.1| VTC2-like protein [Actinidia chinensis]
Length=450

 Score =   448 bits (1152),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 215/341 (63%), Positives = 269/341 (79%), Gaps = 8/341 (2%)
 Frame = -1

Query  2041  MLTIKRVPTVVSNYQDDAPEDSKPESLGCGRNCLGQCCLPVSCLPLFAFKNDEHKCDGDW  1862
             ML IKRVPTVVSN+Q D  ED      GCGRNCL +CC+  + LPL+AFK  +    G+ 
Sbjct  1     MLKIKRVPTVVSNFQKDEAEDGARSGGGCGRNCLQKCCIQGAKLPLYAFKRVKEVV-GEK  59

Query  1861  NYLSYG--ECPISFLSDLLLGQWEERMSRGLFRYDVTSCETKIIPGTFGFIAQLNEGRHL  1688
               L+    E P++FL  LLLG+WE+R+ RGLFRYDVT+CETK+IPG +GFIAQLNEGRHL
Sbjct  60    GLLAVDDEEAPVAFLDSLLLGEWEDRVQRGLFRYDVTACETKVIPGEYGFIAQLNEGRHL  119

Query  1687  KKRPTEFRVDQVLQPFDENKFNFTKIGQEEVLFRFEPSNDCKSHYLPSGLVDARSGSPTV  1508
             KKRPTEFRVD+VLQPFDE+KFNFTK+GQEEVLF+FE S+D +  + P+  VD  + SP+V
Sbjct  120   KKRPTEFRVDKVLQPFDESKFNFTKVGQEEVLFQFEASDDNEVQFFPNAPVDVEN-SPSV  178

Query  1507  LAINVSPIEYGHVLLIPRVLDCLPQRIDHDSFFVAMHLAKEAADPFFRVGYNSLGAFATI  1328
             +AINVSPIEYGHVLLIPR+L+CLPQRID +SF +A+H+A EA +P+FR+GYNSLGAFATI
Sbjct  179   VAINVSPIEYGHVLLIPRILECLPQRIDRESFLLALHMAAEAGNPYFRLGYNSLGAFATI  238

Query  1327  NHLHFQAYYLQVPFPVEKTPTREIMRGREQGDGGIVVSQLLNYPARALLFEGGSTVRDLS  1148
             NHLHFQAYYL VPFP+EK PTR+I       +GG+ +S LLNYP R L+FEGG+++ DLS
Sbjct  239   NHLHFQAYYLAVPFPIEKAPTRKIT----TLNGGVKISDLLNYPVRGLVFEGGNSLEDLS  294

Query  1147  DAVANSCISLQNNNIPFNLLISERGNKVFLFPQVHSNSVFL  1025
             +AV++S I LQ NNIP+N+LIS+ G  +FL PQ ++    L
Sbjct  295   NAVSDSSICLQGNNIPYNVLISDSGKCIFLLPQCYAEKQAL  335


 Score =   113 bits (283),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 53/74 (72%), Positives = 63/74 (85%), Gaps = 0/74 (0%)
 Frame = -2

Query  759  FSKCYAEKQACGKIDQEILDTWVNPAVWEISGHMVLKRREDYDDASEDYAWRLLSEVSLS  580
              +CYAEKQA G++  ++LDT VNPAVWEISGHMVLKR+EDY++ASE  AWRLL+EVSLS
Sbjct  325  LPQCYAEKQALGEVSSDLLDTQVNPAVWEISGHMVLKRKEDYEEASEGNAWRLLAEVSLS  384

Query  579  EERFEEVKAYVSRA  538
            EERFEEVKA +  A
Sbjct  385  EERFEEVKALIFEA  398



>gb|ADB85572.1| GDP-L-galactose phosphorylase [Actinidia deliciosa]
Length=450

 Score =   448 bits (1152),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 214/341 (63%), Positives = 270/341 (79%), Gaps = 8/341 (2%)
 Frame = -1

Query  2041  MLTIKRVPTVVSNYQDDAPEDSKPESLGCGRNCLGQCCLPVSCLPLFAFKNDEHKCDGDW  1862
             ML IKRVPTVVSN+Q D  ED      GCGRNCL +CC+  + LPL+AFK  +    G+ 
Sbjct  1     MLKIKRVPTVVSNFQKDEAEDGARSGGGCGRNCLQKCCIQGAKLPLYAFKRVKEVV-GEK  59

Query  1861  NYLSYG--ECPISFLSDLLLGQWEERMSRGLFRYDVTSCETKIIPGTFGFIAQLNEGRHL  1688
               L+    E P++FL  LLLG+WE+R+ RGLFRYDVT+CETK+IPG +GFIAQLNEGRHL
Sbjct  60    GLLAVDDEEAPVAFLDSLLLGEWEDRVQRGLFRYDVTACETKVIPGEYGFIAQLNEGRHL  119

Query  1687  KKRPTEFRVDQVLQPFDENKFNFTKIGQEEVLFRFEPSNDCKSHYLPSGLVDARSGSPTV  1508
             KKRPTEFRVD+VLQPFDE+KFNFTK+GQEEVLF+FE S+D +  + P+  VD  + SP+V
Sbjct  120   KKRPTEFRVDKVLQPFDESKFNFTKVGQEEVLFQFEASDDNEVQFFPNAPVDVEN-SPSV  178

Query  1507  LAINVSPIEYGHVLLIPRVLDCLPQRIDHDSFFVAMHLAKEAADPFFRVGYNSLGAFATI  1328
             +AINVSPIEYGHVLLIP +L+CLP+RID +SF +A+H+A EA +P+FR+GYNSLGAFATI
Sbjct  179   VAINVSPIEYGHVLLIPSILECLPRRIDRESFLLALHMAAEAGNPYFRLGYNSLGAFATI  238

Query  1327  NHLHFQAYYLQVPFPVEKTPTREIMRGREQGDGGIVVSQLLNYPARALLFEGGSTVRDLS  1148
             NHLHFQAYYL VPFP+EK PTR+I       +GG+ +S+LLNYP R L+FEGG+T+ DLS
Sbjct  239   NHLHFQAYYLXVPFPIEKVPTRKIT----TLNGGVKISELLNYPVRGLVFEGGNTLEDLS  294

Query  1147  DAVANSCISLQNNNIPFNLLISERGNKVFLFPQVHSNSVFL  1025
             +AV++S I LQ NNIP+N+LIS+ G ++FL PQ ++    L
Sbjct  295   NAVSDSSICLQGNNIPYNVLISDSGKRIFLLPQCYAEKQAL  335


 Score =   115 bits (287),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 57/88 (65%), Positives = 68/88 (77%), Gaps = 6/88 (7%)
 Frame = -2

Query  759  FSKCYAEKQACGKIDQEILDTWVNPAVWEISGHMVLKRREDYDDASEDYAWRLLSEVSLS  580
              +CYAEKQA G++  E+LDT VNPAVWEISGHMVLKR+EDY++ASE  AWRLL+EVSLS
Sbjct  325  LPQCYAEKQALGEVSSELLDTQVNPAVWEISGHMVLKRKEDYEEASEGNAWRLLAEVSLS  384

Query  579  EERFEEVKAYVSRAADLLLDSECSNGGS  496
            EERFEEVKA +  A        C++ GS
Sbjct  385  EERFEEVKALIFEAIS------CADDGS  406



>ref|XP_008808494.1| PREDICTED: GDP-L-galactose phosphorylase 2-like [Phoenix dactylifera]
Length=443

 Score =   447 bits (1151),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 223/335 (67%), Positives = 264/335 (79%), Gaps = 11/335 (3%)
 Frame = -1

Query  2041  MLTIKRVPTVVSNYQDDAPEDSKPESLGCGRNCLGQCCLPVSCLPLFAFKNDEHKCDGDW  1862
             MLTIKRVPTV SNYQ+DA E       GCGRNCLG+CCLPVS LPL+AFK+D        
Sbjct  1     MLTIKRVPTVFSNYQEDAAEPR-----GCGRNCLGKCCLPVSKLPLYAFKSDSKP---PV  52

Query  1861  NYLSYGECPIS--FLSDLLLGQWEERMSRGLFRYDVTSCETKIIPGTFGFIAQLNEGRHL  1688
             +     E P +  FL+ LLLGQWE+RMSRGLFRYDVT+CETK+IPG  GFIAQLNEGRHL
Sbjct  53    SPSGATEDPPADFFLNALLLGQWEDRMSRGLFRYDVTACETKVIPGEQGFIAQLNEGRHL  112

Query  1687  KKRPTEFRVDQVLQPFDENKFNFTKIGQEEVLFRFEPSNDCKSHYLPSGLVDARSGSPTV  1508
             KKRP EFRVD+VLQPFD  KFNFTK+GQEEVLFRFE     KS +  S  VD  +  P+V
Sbjct  113   KKRPAEFRVDRVLQPFDPAKFNFTKVGQEEVLFRFEAGGADKSRFFESASVD-EANPPSV  171

Query  1507  LAINVSPIEYGHVLLIPRVLDCLPQRIDHDSFFVAMHLAKEAADPFFRVGYNSLGAFATI  1328
             +AINVSPIEYGHVLLIPRVLDCLPQRID +SF +A+H+A EA +P+FR+GYNSLGAFATI
Sbjct  172   VAINVSPIEYGHVLLIPRVLDCLPQRIDTESFLLALHMAAEAGNPYFRLGYNSLGAFATI  231

Query  1327  NHLHFQAYYLQVPFPVEKTPTREIMRGREQGDGGIVVSQLLNYPARALLFEGGSTVRDLS  1148
             NHLHFQ Y L VPFPVEK  T++I   +   DGG+ +S L+NYP R L++EGG+T++DL+
Sbjct  232   NHLHFQVYCLSVPFPVEKATTKKIPIAKGLADGGVKISLLMNYPVRGLVYEGGNTLKDLA  291

Query  1147  DAVANSCISLQNNNIPFNLLISERGNKVFLFPQVH  1043
             D VANSCI LQ +NIPFN+LIS+ G ++FLFPQV+
Sbjct  292   DVVANSCICLQESNIPFNVLISDSGRRIFLFPQVN  326


 Score = 99.0 bits (245),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 46/62 (74%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = -2

Query  711  EILDTWVNPAVWEISGHMVLKRREDYDDASEDYAWRLLSEVSLSEERFEEVKAYVSRAAD  532
            E+LDT VNPAVWEISGHMVLK+++DY++ASEDYAWRLL+EVSLSEERF+EVKA +  A  
Sbjct  348  ELLDTQVNPAVWEISGHMVLKQKKDYEEASEDYAWRLLAEVSLSEERFQEVKACIFEATG  407

Query  531  LL  526
            L+
Sbjct  408  LV  409



>ref|XP_002532458.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF29914.1| conserved hypothetical protein [Ricinus communis]
Length=453

 Score =   448 bits (1152),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 223/335 (67%), Positives = 266/335 (79%), Gaps = 6/335 (2%)
 Frame = -1

Query  2041  MLTIKRVPTVVSNYQDDAPEDSKPESLGCGRNCLGQCCLPVSCLPLFAFKNDEHKC--DG  1868
             MLTIK+VPTVVSNYQ+D   D+  E  GCGR+CLG CCLP S LPL++FK D      +G
Sbjct  1     MLTIKKVPTVVSNYQEDDSSDTSFE--GCGRDCLGNCCLPGSNLPLYSFKKDGENLLQNG  58

Query  1867  DWNYLSYGECPISFLSDLLLGQWEERMSRGLFRYDVTSCETKIIPGTFGFIAQLNEGRHL  1688
             +  + S  +  I FL +LLLGQWE+RM RGL RYDVT+CET+IIPG +GFIAQLNEGRHL
Sbjct  59    EMKF-SKEQPQICFLHNLLLGQWEDRMCRGLLRYDVTACETRIIPGKYGFIAQLNEGRHL  117

Query  1687  KKRPTEFRVDQVLQPFDENKFNFTKIGQEEVLFRFEPSNDCKSHYLPSGLVDARSGSPT-  1511
             KKRPTEFRVD VLQ FD++KFNFT+IGQEEVLFRFE   +  SH+ P+    A   S   
Sbjct  118   KKRPTEFRVDNVLQSFDDSKFNFTRIGQEEVLFRFEQGQENMSHFFPNPPPSADDSSSPS  177

Query  1510  VLAINVSPIEYGHVLLIPRVLDCLPQRIDHDSFFVAMHLAKEAADPFFRVGYNSLGAFAT  1331
             ++AINVSPIE+GHVLLIPRVLDC PQRID DSF +A+HLAKEA+DPFFRVGYNSLGAFAT
Sbjct  178   IVAINVSPIEFGHVLLIPRVLDCFPQRIDLDSFLLAVHLAKEASDPFFRVGYNSLGAFAT  237

Query  1330  INHLHFQAYYLQVPFPVEKTPTREIMRGREQGDGGIVVSQLLNYPARALLFEGGSTVRDL  1151
             INHLHFQAYYL   F VEK P+++IM        G++VSQLLNYP R L+FEGG+T++DL
Sbjct  238   INHLHFQAYYLAATFLVEKAPSKKIMIVEGSEGRGVIVSQLLNYPVRGLVFEGGNTMQDL  297

Query  1150  SDAVANSCISLQNNNIPFNLLISERGNKVFLFPQV  1046
             SD+VA+SCI LQNNN+ FN+LI+E G +VFLFPQ+
Sbjct  298   SDSVASSCIYLQNNNVAFNVLIAECGRRVFLFPQI  332


 Score =   112 bits (281),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 53/73 (73%), Positives = 64/73 (88%), Gaps = 0/73 (0%)
 Frame = -2

Query  753  KCYAEKQACGKIDQEILDTWVNPAVWEISGHMVLKRREDYDDASEDYAWRLLSEVSLSEE  574
            +CYAEKQA G++ QE+LD  VNPAVWEISGH+VLKRR+D++DASE  AWRLL+EVSLSEE
Sbjct  341  QCYAEKQALGEVSQELLDIQVNPAVWEISGHIVLKRRKDFEDASEISAWRLLAEVSLSEE  400

Query  573  RFEEVKAYVSRAA  535
            RF+EVKA +  AA
Sbjct  401  RFKEVKACILEAA  413



>gb|AGO32052.1| GDP-L-galactose phosphorylase [Actinidia eriantha]
Length=450

 Score =   447 bits (1151),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 214/340 (63%), Positives = 269/340 (79%), Gaps = 6/340 (2%)
 Frame = -1

Query  2041  MLTIKRVPTVVSNYQDDAPEDSKPESLGCGRNCLGQCCLPVSCLPLFAFKN-DEHKCDGD  1865
             ML IKRVPTVVSN+Q D  +D      GCGRNCL +CC+  + LPL+AFK  +E   +  
Sbjct  1     MLKIKRVPTVVSNFQKDEADDGARSGGGCGRNCLQKCCIQGAKLPLYAFKRVNEVVGEKG  60

Query  1864  WNYLSYGECPISFLSDLLLGQWEERMSRGLFRYDVTSCETKIIPGTFGFIAQLNEGRHLK  1685
                L   E P++FL  LLLG+WE+R+ RGLFRYDVT+CETK+IPG +GFIAQLNEGRHLK
Sbjct  61    VLALDNEEAPVAFLDSLLLGEWEDRVQRGLFRYDVTACETKVIPGEYGFIAQLNEGRHLK  120

Query  1684  KRPTEFRVDQVLQPFDENKFNFTKIGQEEVLFRFEPSNDCKSHYLPSGLVDARSGSPTVL  1505
             KRPTEFRVD+VLQPFDE+KFNFTK+GQEEVLF+FE S D +  + P+  VD  + SP+V+
Sbjct  121   KRPTEFRVDKVLQPFDESKFNFTKVGQEEVLFQFEASVDNEVQFFPNAPVDVEN-SPSVV  179

Query  1504  AINVSPIEYGHVLLIPRVLDCLPQRIDHDSFFVAMHLAKEAADPFFRVGYNSLGAFATIN  1325
             AINVSPIEYGHVLLIPR+L+CLPQRID +SF +A+H+A EA +P+FR+GYNSLGAFATIN
Sbjct  180   AINVSPIEYGHVLLIPRILECLPQRIDRESFLLALHMAAEAGNPYFRLGYNSLGAFATIN  239

Query  1324  HLHFQAYYLQVPFPVEKTPTREIMRGREQGDGGIVVSQLLNYPARALLFEGGSTVRDLSD  1145
             HLHFQAYYL VPFP+EK PTR+I       +GG+ +S+LLNYP R L+FEGG+++ DLS+
Sbjct  240   HLHFQAYYLAVPFPIEKAPTRKIT----TLNGGVKISELLNYPVRGLVFEGGNSLEDLSN  295

Query  1144  AVANSCISLQNNNIPFNLLISERGNKVFLFPQVHSNSVFL  1025
             AV++S I LQ NNIP+N+LIS+ G ++FL PQ ++    L
Sbjct  296   AVSDSSICLQCNNIPYNVLISDSGKRIFLLPQCYAEKQAL  335


 Score =   115 bits (287),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 54/74 (73%), Positives = 62/74 (84%), Gaps = 0/74 (0%)
 Frame = -2

Query  759  FSKCYAEKQACGKIDQEILDTWVNPAVWEISGHMVLKRREDYDDASEDYAWRLLSEVSLS  580
              +CYAEKQA G++  E+LDT VNPAVWEISGHMVLKR+EDY +ASE  AWRLL+EVSLS
Sbjct  325  LPQCYAEKQALGEVSSELLDTQVNPAVWEISGHMVLKRKEDYQEASEGNAWRLLAEVSLS  384

Query  579  EERFEEVKAYVSRA  538
            EERFEEVKA +  A
Sbjct  385  EERFEEVKALIFEA  398



>dbj|BAP75925.1| GDP-L-galactose phosphorylase [Moringa oleifera]
 dbj|BAP76192.1| GDP-L-galactose phosphorylase [Moringa oleifera]
Length=440

 Score =   447 bits (1150),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 216/336 (64%), Positives = 270/336 (80%), Gaps = 8/336 (2%)
 Frame = -1

Query  2041  MLTIKRVPTVVSNYQDDAPEDSKPESLGCGRNCLGQCCLPVSCLPLFAFKNDEHKCDGDW  1862
             ML IKRVPTVVSNYQ +  E+      GCGRNCL +CC+  + +PL+ FK   +K  G  
Sbjct  1     MLRIKRVPTVVSNYQKEEGEEGARREGGCGRNCLNKCCIQGAKIPLYVFKG-LNKTGGSK  59

Query  1861  NYLSY--GECPISFLSDLLLGQWEERMSRGLFRYDVTSCETKIIPGTFGFIAQLNEGRHL  1688
               L +  GE P++FL  LLLG+WE+R  RGLFRYDVT+CETK+IPG +GFIAQLNEGRHL
Sbjct  60    GVLGHENGEPPVAFLESLLLGEWEDRSERGLFRYDVTACETKVIPGDYGFIAQLNEGRHL  119

Query  1687  KKRPTEFRVDQVLQPFDENKFNFTKIGQEEVLFRFEPSNDCKSHYLPSGLVDARSGSPTV  1508
             KKRPTEFRVD+VLQPFD NKFNFTK+GQEEVLF+FE S D +  + PS  +D  + SP+V
Sbjct  120   KKRPTEFRVDKVLQPFDGNKFNFTKVGQEEVLFQFEASEDGEVQFFPSAPIDVEN-SPSV  178

Query  1507  LAINVSPIEYGHVLLIPRVLDCLPQRIDHDSFFVAMHLAKEAADPFFRVGYNSLGAFATI  1328
             +AINVSPIEYGHVLLIPRVL+CLPQRID DSF +A+H+A EA +P+FR+GYNSLGAFATI
Sbjct  179   VAINVSPIEYGHVLLIPRVLECLPQRIDRDSFLLALHMAAEAGNPYFRLGYNSLGAFATI  238

Query  1327  NHLHFQAYYLQVPFPVEKTPTREIMRGREQGDGGIVVSQLLNYPARALLFEGGSTVRDLS  1148
             NHLHFQAYYL +PFPVEK PT++I       DGG+ +S+LLNYP R+L+FE G TV+DLS
Sbjct  239   NHLHFQAYYLAMPFPVEKAPTKKIT----TTDGGVRISELLNYPVRSLVFEDGETVQDLS  294

Query  1147  DAVANSCISLQNNNIPFNLLISERGNKVFLFPQVHS  1040
             + V+++CI LQN+NIP+N+LI++ GN+VF+FPQ ++
Sbjct  295   NTVSDACICLQNSNIPYNVLIADCGNRVFVFPQCYA  330


 Score =   114 bits (285),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 55/85 (65%), Positives = 67/85 (79%), Gaps = 0/85 (0%)
 Frame = -2

Query  759  FSKCYAEKQACGKIDQEILDTWVNPAVWEISGHMVLKRREDYDDASEDYAWRLLSEVSLS  580
            F +CYAEKQA G++  E+LDT VNPAVWEISGHMVLKR++DY++ASE+ AWRLL+EVSLS
Sbjct  325  FPQCYAEKQALGEVSPELLDTQVNPAVWEISGHMVLKRKKDYEEASEENAWRLLAEVSLS  384

Query  579  EERFEEVKAYVSRAADLLLDSECSN  505
            EERF EV A +  A     + E SN
Sbjct  385  EERFREVSALIFEAIACSENGEASN  409



>emb|CDY14296.1| BnaA08g14270D [Brassica napus]
Length=441

 Score =   447 bits (1149),  Expect = 4e-146, Method: Compositional matrix adjust.
 Identities = 211/336 (63%), Positives = 269/336 (80%), Gaps = 10/336 (3%)
 Frame = -1

Query  2041  MLTIKRVPTVVSNYQDDAPEDSKPESLGCGRNCLGQCCLPVSCLPLFAFKNDEHKCDGDW  1862
             ML IKRVPTVVSNYQ D   D   ES+GCGRNCLG CCL  + LPL++ K  E+   G+ 
Sbjct  1     MLKIKRVPTVVSNYQKDEASD---ESVGCGRNCLGACCLNGARLPLYSCKKLENSGTGEK  57

Query  1861  NYLSYG--ECPISFLSDLLLGQWEERMSRGLFRYDVTSCETKIIPGTFGFIAQLNEGRHL  1688
               +S+   E P++FL  L+LG+WE+R  RGLFRYDVT+CETK+IPG +GF+AQLNEGRHL
Sbjct  58    LVISHEAREPPVAFLESLVLGEWEDRFQRGLFRYDVTACETKVIPGKYGFVAQLNEGRHL  117

Query  1687  KKRPTEFRVDQVLQPFDENKFNFTKIGQEEVLFRFEPSNDCKSHYLPSGLVDARSGSPTV  1508
             KKRPTEFRVD+VLQ FD NKFNFTK+GQEE+LF+FE   DC   + P   +DA + SP+V
Sbjct  118   KKRPTEFRVDKVLQSFDGNKFNFTKVGQEELLFQFEAGEDCDVQFFPCMPLDAEN-SPSV  176

Query  1507  LAINVSPIEYGHVLLIPRVLDCLPQRIDHDSFFVAMHLAKEAADPFFRVGYNSLGAFATI  1328
             +AINVSPIEYGHVLLIPRVLDCLPQRIDH S  +A+H+A EAA+P+FR+GYNSLGAFATI
Sbjct  177   VAINVSPIEYGHVLLIPRVLDCLPQRIDHKSLLLALHMAAEAANPYFRLGYNSLGAFATI  236

Query  1327  NHLHFQAYYLQVPFPVEKTPTREIMRGREQGDGGIVVSQLLNYPARALLFEGGSTVRDLS  1148
             NHLHFQAYYL +PFP+EK P+++++        G+ +S+L+NYP R+LLFEGG++++DLS
Sbjct  237   NHLHFQAYYLAMPFPLEKAPSKKMITTV----SGVKISELVNYPVRSLLFEGGTSMQDLS  292

Query  1147  DAVANSCISLQNNNIPFNLLISERGNKVFLFPQVHS  1040
             D V+++C+ LQ NNIPFN+LIS+ G ++FL PQ ++
Sbjct  293   DTVSDACVCLQENNIPFNILISDSGRQIFLMPQCYA  328


 Score =   108 bits (269),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 59/125 (47%), Positives = 76/125 (61%), Gaps = 8/125 (6%)
 Frame = -2

Query  759  FSKCYAEKQACGKIDQEILDTWVNPAVWEISGHMVLKRREDYDDASEDYAWRLLSEVSLS  580
              +CYAEKQA G++  E+L+T VNPAVWEISGHMVLKR+EDY+ ASE+ AWRLL+E SLS
Sbjct  323  MPQCYAEKQALGEVSPELLETQVNPAVWEISGHMVLKRKEDYEGASEENAWRLLAEASLS  382

Query  579  EERFEEVKAYVSRAADLLLDSECSNGGS--QPWETYPEASWTATNELSFTSRLSGATLKF  406
            EERF+EV A +  A        CSN     +     P  S   T   +    ++  T   
Sbjct  383  EERFKEVNALIFDAIG------CSNQEEELEGILVQPSGSVNQTGNRTLGGPITNGTASE  436

Query  405  C*ILK  391
            C +L+
Sbjct  437  CLVLQ  441



>ref|XP_007020730.1| Galactose-1-phosphate guanylyltransferases,GDP-D-glucose phosphorylases,quercetin 
4\'-O-glucosyltransferases [Theobroma cacao]
 gb|EOY12255.1| Galactose-1-phosphate guanylyltransferases,GDP-D-glucose phosphorylases,quercetin 
4\'-O-glucosyltransferases [Theobroma cacao]
Length=446

 Score =   447 bits (1149),  Expect = 5e-146, Method: Compositional matrix adjust.
 Identities = 212/345 (61%), Positives = 269/345 (78%), Gaps = 14/345 (4%)
 Frame = -1

Query  2044  LMLTIKRVPTVVSNYQDDAPEDSKPESLGCGRNCLGQCCLPVSCLPLFAFKN-----DEH  1880
             +ML IKRVPTV+SNYQ D  E++   S GCG+NCL  CC+P + LPL+AFK       E 
Sbjct  1     MMLRIKRVPTVLSNYQKDEAEETARRSGGCGKNCLRSCCIPGAKLPLYAFKKVTNTQSEK  60

Query  1879  KCDGDWNYLSYGECPISFLSDLLLGQWEERMSRGLFRYDVTSCETKIIPGTFGFIAQLNE  1700
                G+ N     E P++FL  L+LG+WE+RM RGLFRYDVT+CETK+IPG +GFIAQLNE
Sbjct  61    GVRGNEN----KEPPVAFLDSLVLGEWEDRMQRGLFRYDVTACETKVIPGEYGFIAQLNE  116

Query  1699  GRHLKKRPTEFRVDQVLQPFDENKFNFTKIGQEEVLFRFEPSNDCKSHYLPSGLVDARSG  1520
             GRHLKKRPTEFRVD+VLQPFD NKFNFTK+GQEEVLF+F  S D +  + P+  +D  + 
Sbjct  117   GRHLKKRPTEFRVDKVLQPFDGNKFNFTKVGQEEVLFQFAASEDGEVQFFPNAPIDVEN-  175

Query  1519  SPTVLAINVSPIEYGHVLLIPRVLDCLPQRIDHDSFFVAMHLAKEAADPFFRVGYNSLGA  1340
             SP+V+AINVSPIEYGHVLLIPR+L+CLPQRID  SF +A+ +A EA +P+FR+GYNSLGA
Sbjct  176   SPSVVAINVSPIEYGHVLLIPRILECLPQRIDRQSFLLALCMAAEAGNPYFRLGYNSLGA  235

Query  1339  FATINHLHFQAYYLQVPFPVEKTPTREIMRGREQGDGGIVVSQLLNYPARALLFEGGSTV  1160
             FATINHLHFQAYYL VPFP+EK PTR+I    +    G+++S+LL YP R L+FEGG+T+
Sbjct  236   FATINHLHFQAYYLAVPFPIEKAPTRKITTLSD----GVIISELLKYPVRGLVFEGGNTI  291

Query  1159  RDLSDAVANSCISLQNNNIPFNLLISERGNKVFLFPQVHSNSVFL  1025
             +DLSD V+++CI LQ+NNIP+N+LIS+ G ++FL PQ ++    L
Sbjct  292   QDLSDTVSDACICLQDNNIPYNVLISDCGKRIFLLPQCYAEKQAL  336


 Score =   112 bits (281),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 56/87 (64%), Positives = 67/87 (77%), Gaps = 7/87 (8%)
 Frame = -2

Query  759  FSKCYAEKQACGKIDQEILDTWVNPAVWEISGHMVLKRREDYDDASEDYAWRLLSEVSLS  580
              +CYAEKQA G++  E+LDT VNPAVWEISGHMVLKRR+DYD+AS++ AWRLL+EVSLS
Sbjct  326  LPQCYAEKQALGEVSPELLDTQVNPAVWEISGHMVLKRRKDYDEASDENAWRLLAEVSLS  385

Query  579  EERFEEVKAYVSRA-------ADLLLD  520
            EERF EV A +  A       A+ LLD
Sbjct  386  EERFREVNALIFEAIAIGETIAETLLD  412



>gb|KHG00569.1| GDP-L-galactose phosphorylase 1 -like protein [Gossypium arboreum]
Length=450

 Score =   446 bits (1148),  Expect = 7e-146, Method: Compositional matrix adjust.
 Identities = 208/341 (61%), Positives = 272/341 (80%), Gaps = 6/341 (2%)
 Frame = -1

Query  2044  LMLTIKRVPTVVSNYQDDAPEDSKPESLGCGRNCLGQCCLPVSCLPLFAFKN-DEHKCDG  1868
             +ML IKRVPTVVSNYQ D  E++   S GCG+NCL  CC+P + LPL+AF+  +  + + 
Sbjct  1     MMLRIKRVPTVVSNYQKDETEETARRSSGCGKNCLRSCCIPGAKLPLYAFRKLNNIESEK  60

Query  1867  DWNYLSYGECPISFLSDLLLGQWEERMSRGLFRYDVTSCETKIIPGTFGFIAQLNEGRHL  1688
                 +   E P++FL  L+LG+WE+R+ RGLFRYDVT+CETK+IPG +GF+AQLNEGRHL
Sbjct  61    VVLGIENKEPPVAFLDSLILGEWEDRLQRGLFRYDVTACETKVIPGEYGFVAQLNEGRHL  120

Query  1687  KKRPTEFRVDQVLQPFDENKFNFTKIGQEEVLFRFEPSNDCKSHYLPSGLVDARSGSPTV  1508
             KKRPTEFRVD+VLQPFD NKFNFTK+GQEEVLF+FE S D +  + PS  +DA + SP+V
Sbjct  121   KKRPTEFRVDKVLQPFDGNKFNFTKVGQEEVLFQFEASEDGEVQFYPSAPIDAEN-SPSV  179

Query  1507  LAINVSPIEYGHVLLIPRVLDCLPQRIDHDSFFVAMHLAKEAADPFFRVGYNSLGAFATI  1328
             +AINVSPIEYGHVLLIPR+L+CLPQRID +SF +A+++A EA +P+FR+GYNSLGAFATI
Sbjct  180   VAINVSPIEYGHVLLIPRILECLPQRIDRESFLLALYMAAEAGNPYFRLGYNSLGAFATI  239

Query  1327  NHLHFQAYYLQVPFPVEKTPTREIMRGREQGDGGIVVSQLLNYPARALLFEGGSTVRDLS  1148
             NHLHFQAYYL VPFP+EK PT++I    ++    +++S+LLNYP R L+FEGG+T++ LS
Sbjct  240   NHLHFQAYYLAVPFPIEKAPTKKITTLNDE----VIISELLNYPVRGLVFEGGNTLQALS  295

Query  1147  DAVANSCISLQNNNIPFNLLISERGNKVFLFPQVHSNSVFL  1025
             D V+++CI LQ NNIP+N+LIS+ G ++FL PQ ++    L
Sbjct  296   DTVSDACICLQENNIPYNVLISDCGKRIFLLPQCYAEKQAL  336


 Score =   112 bits (279),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 57/100 (57%), Positives = 70/100 (70%), Gaps = 0/100 (0%)
 Frame = -2

Query  759  FSKCYAEKQACGKIDQEILDTWVNPAVWEISGHMVLKRREDYDDASEDYAWRLLSEVSLS  580
              +CYAEKQA G++  E+LDT VNPAVWEISGHMVLKRR+DYD+AS++ AWRLL+EVSLS
Sbjct  326  LPQCYAEKQALGEVSPELLDTQVNPAVWEISGHMVLKRRKDYDEASDENAWRLLAEVSLS  385

Query  579  EERFEEVKAYVSRAADLLLDSECSNGGSQPWETYPEASWT  460
            +ERF EV A +        D    +  S P E  P+A  T
Sbjct  386  DERFREVNALIFEVIASGEDGIEHDAKSLPKEPDPKAEST  425



>emb|CDX97369.1| BnaC08g12340D [Brassica napus]
Length=432

 Score =   445 bits (1145),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 210/334 (63%), Positives = 266/334 (80%), Gaps = 15/334 (4%)
 Frame = -1

Query  2041  MLTIKRVPTVVSNYQDDAPEDSKPESLGCGRNCLGQCCLPVSCLPLFAFKNDEHKCDGDW  1862
             ML IKRVPTVVSNYQ D   D   ES+GCGRNCLG CCL  + LPL+A    E    G+ 
Sbjct  1     MLKIKRVPTVVSNYQKDEASD---ESVGCGRNCLGACCLNGARLPLYACNKLEKSGTGE-  56

Query  1861  NYLSYGECPISFLSDLLLGQWEERMSRGLFRYDVTSCETKIIPGTFGFIAQLNEGRHLKK  1682
                   + P++FL  L+L +WE+R  RGLFRYDVT+CETK+IPG +GF+AQLNEGRHLKK
Sbjct  57    ------KPPVAFLESLVLEEWEDRFQRGLFRYDVTACETKVIPGKYGFVAQLNEGRHLKK  110

Query  1681  RPTEFRVDQVLQPFDENKFNFTKIGQEEVLFRFEPSNDCKSHYLPSGLVDARSGSPTVLA  1502
             RPTEFRVD+VLQ FD NKFNFTK+GQEE+LF+FE   DC++ + P   VDA + SP+V+A
Sbjct  111   RPTEFRVDKVLQSFDGNKFNFTKVGQEELLFQFEAGEDCEAQFFPCMPVDAEN-SPSVVA  169

Query  1501  INVSPIEYGHVLLIPRVLDCLPQRIDHDSFFVAMHLAKEAADPFFRVGYNSLGAFATINH  1322
             INVSPIEYGHVLLIPRVLDCLPQRIDH S  +A+H+A EAA+P+FR+GYNSLGAFATINH
Sbjct  170   INVSPIEYGHVLLIPRVLDCLPQRIDHKSLLLALHMAAEAANPYFRLGYNSLGAFATINH  229

Query  1321  LHFQAYYLQVPFPVEKTPTREIMRGREQGDGGIVVSQLLNYPARALLFEGGSTVRDLSDA  1142
             LHFQAYYL +PFP+EK P+++++        G+ +S+L+NYP R+LLFEGG++++DLSD 
Sbjct  230   LHFQAYYLAMPFPLEKAPSKKMITTV----SGVKISELVNYPVRSLLFEGGTSMQDLSDT  285

Query  1141  VANSCISLQNNNIPFNLLISERGNKVFLFPQVHS  1040
             V+++C+ LQNNNIPFN+LIS+ G ++FL PQ ++
Sbjct  286   VSDACVCLQNNNIPFNILISDSGRQIFLMPQCYA  319


 Score =   108 bits (271),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 59/125 (47%), Positives = 76/125 (61%), Gaps = 8/125 (6%)
 Frame = -2

Query  759  FSKCYAEKQACGKIDQEILDTWVNPAVWEISGHMVLKRREDYDDASEDYAWRLLSEVSLS  580
              +CYAEKQA G++  E+L+T VNPAVWEISGHMVLKR+EDY+ ASE+ AWRLL+E SLS
Sbjct  314  MPQCYAEKQALGEVSPELLETQVNPAVWEISGHMVLKRKEDYEGASEENAWRLLAEASLS  373

Query  579  EERFEEVKAYVSRAADLLLDSECSNGGS--QPWETYPEASWTATNELSFTSRLSGATLKF  406
            EERF+EV A +  A        CSN     +     P  S   T   +    ++  T   
Sbjct  374  EERFKEVNALIFEAIG------CSNQEEELEGILVQPSGSVNQTGNRTLGGPITNGTASE  427

Query  405  C*ILK  391
            C +L+
Sbjct  428  CLVLQ  432



>ref|XP_003551872.1| PREDICTED: GDP-L-galactose phosphorylase 1-like [Glycine max]
Length=435

 Score =   445 bits (1144),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 209/335 (62%), Positives = 267/335 (80%), Gaps = 8/335 (2%)
 Frame = -1

Query  2041  MLTIKRVPTVVSNYQDDAPEDSKPESLGCGRNCLGQCCLPVSCLPLFAFKNDEHKCDGDW  1862
             ML+IKRVPTVVSNYQ +  E  +  + GCGRNCL  CC+  + LPL+AFK  +  C  + 
Sbjct  1     MLSIKRVPTVVSNYQKE--ETGEAAAGGCGRNCLKSCCIQGARLPLYAFKKVDKVCGNEL  58

Query  1861  NYLSYGEC-PISFLSDLLLGQWEERMSRGLFRYDVTSCETKIIPGTFGFIAQLNEGRHLK  1685
               L   E  P++FL  L+LG+WE+RM RGLFRYDVT+CETK+IPG +GFIAQLNEGRHLK
Sbjct  59    PLLGCKEQHPVAFLDSLVLGEWEDRMQRGLFRYDVTACETKVIPGEYGFIAQLNEGRHLK  118

Query  1684  KRPTEFRVDQVLQPFDENKFNFTKIGQEEVLFRFEPSNDCKSHYLPSGLVDARSGSPTVL  1505
             KRPTEFRVD+VLQPFDENKFNFTK+GQEEVLF+ E SND +  + P+  +D  + SP+ +
Sbjct  119   KRPTEFRVDKVLQPFDENKFNFTKVGQEEVLFQLEASNDGEVQFFPNAPIDVEN-SPSFV  177

Query  1504  AINVSPIEYGHVLLIPRVLDCLPQRIDHDSFFVAMHLAKEAADPFFRVGYNSLGAFATIN  1325
             AINVSPIEYGHVLLIPR+ +CLPQRIDH SF +A+ +A EA +P+FR+GYNSLGAFATIN
Sbjct  178   AINVSPIEYGHVLLIPRIFECLPQRIDHASFLLALQMAVEARNPYFRLGYNSLGAFATIN  237

Query  1324  HLHFQAYYLQVPFPVEKTPTREIMRGREQGDGGIVVSQLLNYPARALLFEGGSTVRDLSD  1145
             HLHFQAYYL +PFP+EK PT++I +      GG+++S+LLNYP R L+FEGG T+ DL++
Sbjct  238   HLHFQAYYLALPFPIEKAPTKKIAK----LSGGVIISKLLNYPVRGLVFEGGHTLEDLAN  293

Query  1144  AVANSCISLQNNNIPFNLLISERGNKVFLFPQVHS  1040
             AV+ +CI LQ+NNIP+N+LIS+ G ++FL PQ ++
Sbjct  294   AVSEACICLQHNNIPYNVLISDCGRQIFLLPQCYA  328


 Score =   105 bits (263),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 50/74 (68%), Positives = 61/74 (82%), Gaps = 0/74 (0%)
 Frame = -2

Query  759  FSKCYAEKQACGKIDQEILDTWVNPAVWEISGHMVLKRREDYDDASEDYAWRLLSEVSLS  580
              +CYAEKQA G++  E+L+T VNPAVWEISGHMVLKR++DY++ASE  AWRLL+EVSLS
Sbjct  323  LPQCYAEKQALGEVSPELLETQVNPAVWEISGHMVLKRKKDYEEASEANAWRLLAEVSLS  382

Query  579  EERFEEVKAYVSRA  538
            EER  EV A V +A
Sbjct  383  EERLLEVTALVFQA  396



>gb|KCW52134.1| hypothetical protein EUGRSUZ_J01575 [Eucalyptus grandis]
Length=388

 Score =   443 bits (1139),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 222/338 (66%), Positives = 260/338 (77%), Gaps = 13/338 (4%)
 Frame = -1

Query  2041  MLTIKRVPTVVSNYQDDAPEDSKPESLGCGRNCLGQCCLPVSCLPLFAFKNDEHKCDGDW  1862
             MLTIKR  TVVSNYQ++  E     + GCGRNCLG+CCLP   LPL+ FK +    D   
Sbjct  1     MLTIKRAATVVSNYQEEGGE-----AKGCGRNCLGKCCLPD--LPLYTFKGE----DCAE  49

Query  1861  NYLSYGECP-ISFLSDLLLGQWEERMSRGLFRYDVTSCETKIIPGTFGFIAQLNEGRHLK  1685
               + Y + P  SFL +LLLGQW+ RM+RGLFRYDVT+C+TK+IP  +GFI QLNEGRHLK
Sbjct  50    ESIFYQKPPETSFLLNLLLGQWKNRMNRGLFRYDVTTCKTKVIPSDYGFIVQLNEGRHLK  109

Query  1684  KRPTEFRVDQVLQPFDENKFNFTKIGQEEVLFRFEPSNDCKSHYLPSGLVDARSGSPTVL  1505
             KRPTEFRVDQVLQ FDE KFNFTK+G EEVLF FE S+DC SH+ PS     +  SP V+
Sbjct  110   KRPTEFRVDQVLQDFDEKKFNFTKVGHEEVLFMFEQSDDCYSHFFPSAPAIFKPTSPNVV  169

Query  1504  AINVSP-IEYGHVLLIPRVLDCLPQRIDHDSFFVAMHLAKEAADPFFRVGYNSLGAFATI  1328
             AINVSP I+YGH+LLIPRVLDCLPQRIDH SFF+A+ LAKEAADPFFRVGYNSLG FATI
Sbjct  170   AINVSPSIQYGHILLIPRVLDCLPQRIDHMSFFLALSLAKEAADPFFRVGYNSLGTFATI  229

Query  1327  NHLHFQAYYLQVPFPVEKTPTREIMRGREQGDGGIVVSQLLNYPARALLFEGGSTVRDLS  1148
             NHLHFQAYYL  PFPVEK PT  +M        G+VVSQLL +P R+L+FEG  T+ DLS
Sbjct  230   NHLHFQAYYLASPFPVEKVPTLRVMTSTSMQRNGVVVSQLLKFPVRSLVFEGRDTLWDLS  289

Query  1147  DAVANSCISLQNNNIPFNLLISERGNKVFLFPQVHSNS  1034
              A+ANSCI LQ+NNIPFN+LI++ G +VFLFPQ ++  
Sbjct  290   SAIANSCIRLQHNNIPFNVLIADCGKRVFLFPQCYAKK  327


 Score =   108 bits (269),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 47/69 (68%), Positives = 62/69 (90%), Gaps = 0/69 (0%)
 Frame = -2

Query  759  FSKCYAEKQACGKIDQEILDTWVNPAVWEISGHMVLKRREDYDDASEDYAWRLLSEVSLS  580
            F +CYA+KQA G++ QE+L+T VNPA+WEI GH+VLKRR+++++A+EDYAWRLL+EVSLS
Sbjct  320  FPQCYAKKQARGEVSQELLETQVNPAIWEIGGHIVLKRRKNFENATEDYAWRLLAEVSLS  379

Query  579  EERFEEVKA  553
            EE F EVKA
Sbjct  380  EESFREVKA  388



>ref|XP_004491414.1| PREDICTED: GDP-L-galactose phosphorylase 1-like [Cicer arietinum]
Length=441

 Score =   445 bits (1144),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 212/339 (63%), Positives = 265/339 (78%), Gaps = 12/339 (4%)
 Frame = -1

Query  2044  LMLTIKRVPTVVSNYQDDAPEDSKPESLGCGRNCLGQCCLPVSCLPLFAFKNDEHKCDGD  1865
             +ML IKRVPTVVSNYQ +   ++     GCGRNCL  CC+  + LPL+AFK        D
Sbjct  1     MMLKIKRVPTVVSNYQKEEVGEAPRSVGGCGRNCLKACCIQDAKLPLYAFKKINKVTGKD  60

Query  1864  WNYLSYGEC----PISFLSDLLLGQWEERMSRGLFRYDVTSCETKIIPGTFGFIAQLNEG  1697
                L   EC    P++FL  L+LG+WE+RM RGLFRYDVT+CETK+IPG +GFIAQLNEG
Sbjct  61    ---LVINECQEELPVAFLDSLVLGEWEDRMQRGLFRYDVTACETKVIPGEYGFIAQLNEG  117

Query  1696  RHLKKRPTEFRVDQVLQPFDENKFNFTKIGQEEVLFRFEPSNDCKSHYLPSGLVDARSGS  1517
             RHLKKRPTEFRVD+VLQPFDENKFNFTK+GQEEVLF+FE S + +  + P+  +D    S
Sbjct  118   RHLKKRPTEFRVDKVLQPFDENKFNFTKVGQEEVLFQFEASENGEVQFFPNAPIDV-DNS  176

Query  1516  PTVLAINVSPIEYGHVLLIPRVLDCLPQRIDHDSFFVAMHLAKEAADPFFRVGYNSLGAF  1337
             P+ +AINVSPIEYGHVLLIPR+ +CLPQRIDH+SF +A+H+A EAA+P+FR+GYNSLGAF
Sbjct  177   PSFVAINVSPIEYGHVLLIPRIFECLPQRIDHESFLLALHMAAEAANPYFRLGYNSLGAF  236

Query  1336  ATINHLHFQAYYLQVPFPVEKTPTREIMRGREQGDGGIVVSQLLNYPARALLFEGGSTVR  1157
             ATINHLHFQAYYL + FP+EK PT++I   +    GG+ VS+LL YP R L+FEGG T+ 
Sbjct  237   ATINHLHFQAYYLAMQFPIEKAPTKKIATLK----GGVKVSELLKYPVRGLVFEGGDTLE  292

Query  1156  DLSDAVANSCISLQNNNIPFNLLISERGNKVFLFPQVHS  1040
             DLS+ V+ +CISLQNNNIP+N+LIS+ G++VFL PQ ++
Sbjct  293   DLSNIVSEACISLQNNNIPYNVLISDCGSQVFLLPQCYA  331


 Score =   114 bits (284),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 59/106 (56%), Positives = 73/106 (69%), Gaps = 10/106 (9%)
 Frame = -2

Query  759  FSKCYAEKQACGKIDQEILDTWVNPAVWEISGHMVLKRREDYDDASEDYAWRLLSEVSLS  580
              +CYAEKQA G++D E+LDT VNPAVWEISGHMVLKR++D+D+ASE  AW+LL+EVSLS
Sbjct  326  LPQCYAEKQALGEVDAELLDTQVNPAVWEISGHMVLKRKKDFDEASEGNAWKLLAEVSLS  385

Query  579  EERFEEVKAYVSRAADLLLDSECSNGGSQPWE---------TYPEA  469
            EERF+EV A +  A  + L+ E  N   Q            TYP A
Sbjct  386  EERFQEVNALIFEAIGIGLN-ELDNNNLQSLSEDNDAVNSTTYPTA  430



>ref|XP_010096115.1| hypothetical protein L484_012470 [Morus notabilis]
 gb|EXB63280.1| hypothetical protein L484_012470 [Morus notabilis]
Length=443

 Score =   445 bits (1144),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 215/343 (63%), Positives = 271/343 (79%), Gaps = 11/343 (3%)
 Frame = -1

Query  2044  LMLTIKRVPTVVSNYQDDAPEDSKPESLGCGRNCLGQCCLPVSCLPLFAFKNDEHKCDGD  1865
             +ML IKRVPTVVSNYQ +  ++++    GCGRNCL  CCLP + LPL+AFK  E K   D
Sbjct  1     MMLRIKRVPTVVSNYQKEEADEAR--VAGCGRNCLRNCCLPGAKLPLYAFKRLE-KLVSD  57

Query  1864  WNYLSYGEC---PISFLSDLLLGQWEERMSRGLFRYDVTSCETKIIPGTFGFIAQLNEGR  1694
                 ++GE    P++FL  L+LG+WE+R+ RGLFRYDVT+CETK+IPG +GFIAQLNEGR
Sbjct  58    KGLPAHGENGEPPVAFLDSLVLGEWEDRVQRGLFRYDVTACETKVIPGQYGFIAQLNEGR  117

Query  1693  HLKKRPTEFRVDQVLQPFDENKFNFTKIGQEEVLFRFEPSNDCKSHYLPSGLVDARSGSP  1514
             HLKKRPTEFRVD+VLQPFDE+KFNFTK+GQEEVLF+FE S D +  + PS  +D  + SP
Sbjct  118   HLKKRPTEFRVDKVLQPFDESKFNFTKVGQEEVLFQFEASEDGEVQFFPSAPIDVEN-SP  176

Query  1513  TVLAINVSPIEYGHVLLIPRVLDCLPQRIDHDSFFVAMHLAKEAADPFFRVGYNSLGAFA  1334
             +V+AINVSPIEYGHVLLIPR+LDCLPQRID  SF +A+H+A EA +P+FR+GYNSLGAFA
Sbjct  177   SVVAINVSPIEYGHVLLIPRILDCLPQRIDRGSFLLALHMAAEAGNPYFRLGYNSLGAFA  236

Query  1333  TINHLHFQAYYLQVPFPVEKTPTREIMRGREQGDGGIVVSQLLNYPARALLFEGGSTVRD  1154
             TINHLHFQAYYL VPFP+EK  T++I        G + +S+LLNYP R L+FEGG+TV  
Sbjct  237   TINHLHFQAYYLAVPFPIEKATTKKITTLV----GDVKISELLNYPVRGLVFEGGNTVEY  292

Query  1153  LSDAVANSCISLQNNNIPFNLLISERGNKVFLFPQVHSNSVFL  1025
             LS+AV+++CI LQ+NNIP+N+LIS+ G ++FL PQ ++    L
Sbjct  293   LSNAVSDACICLQDNNIPYNVLISDCGKRIFLLPQCYAEKQAL  335


 Score =   109 bits (272),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 55/97 (57%), Positives = 70/97 (72%), Gaps = 2/97 (2%)
 Frame = -2

Query  759  FSKCYAEKQACGKIDQEILDTWVNPAVWEISGHMVLKRREDYDDASEDYAWRLLSEVSLS  580
              +CYAEKQA G++  E+LDT VNPAVWEISGHMVLKR++DY++ASE+ AWRLL+ VSLS
Sbjct  325  LPQCYAEKQALGEVSAELLDTQVNPAVWEISGHMVLKRKKDYEEASEENAWRLLAVVSLS  384

Query  579  EERFEEVKAYVSRAADLLLDSECSNGGSQPWETYPEA  469
            EERF+EV A +  A    +D   S   +   E  P+A
Sbjct  385  EERFQEVNALIFEAIASGVD--VSENATAELEAKPQA  419



>ref|XP_009109165.1| PREDICTED: GDP-L-galactose phosphorylase 1-like [Brassica rapa]
Length=441

 Score =   444 bits (1141),  Expect = 6e-145, Method: Compositional matrix adjust.
 Identities = 210/336 (63%), Positives = 268/336 (80%), Gaps = 10/336 (3%)
 Frame = -1

Query  2041  MLTIKRVPTVVSNYQDDAPEDSKPESLGCGRNCLGQCCLPVSCLPLFAFKNDEHKCDGDW  1862
             ML IKRVPTVVSNYQ D   D   ES+GCGRNCLG CCL  + LPL++ K  E+   G+ 
Sbjct  1     MLKIKRVPTVVSNYQKDEASD---ESVGCGRNCLGACCLNGARLPLYSCKKLENSGTGEK  57

Query  1861  NYLSY--GECPISFLSDLLLGQWEERMSRGLFRYDVTSCETKIIPGTFGFIAQLNEGRHL  1688
               +S+   E P++FL  L+LG+WE+R  RGLFRYDVT+CETK+IPG +GF+AQLNEGRHL
Sbjct  58    VVISHEAKEPPVAFLESLVLGEWEDRFQRGLFRYDVTACETKVIPGKYGFVAQLNEGRHL  117

Query  1687  KKRPTEFRVDQVLQPFDENKFNFTKIGQEEVLFRFEPSNDCKSHYLPSGLVDARSGSPTV  1508
             KKRPTEFRVD+VLQ FD NKFNFTK+GQEE+LF+FE   DC   + P   +DA + SP+V
Sbjct  118   KKRPTEFRVDKVLQSFDGNKFNFTKVGQEELLFQFEAGEDCDVQFFPCMPLDAEN-SPSV  176

Query  1507  LAINVSPIEYGHVLLIPRVLDCLPQRIDHDSFFVAMHLAKEAADPFFRVGYNSLGAFATI  1328
             +AINVSPIEYGHVLLIPRVLDCLPQRIDH S  +A+H+A EAA+P+FR+GYNSLGAFATI
Sbjct  177   VAINVSPIEYGHVLLIPRVLDCLPQRIDHKSLLLALHMAAEAANPYFRLGYNSLGAFATI  236

Query  1327  NHLHFQAYYLQVPFPVEKTPTREIMRGREQGDGGIVVSQLLNYPARALLFEGGSTVRDLS  1148
             NHLHFQAYYL +PFP+EK  +++++        G+ +S+L+NYP R+LLFEGG++++DLS
Sbjct  237   NHLHFQAYYLAMPFPLEKALSKKMITTV----SGVKISELVNYPVRSLLFEGGNSMQDLS  292

Query  1147  DAVANSCISLQNNNIPFNLLISERGNKVFLFPQVHS  1040
             D V+++C+ LQ NNIPFN+LIS+ G ++FL PQ ++
Sbjct  293   DTVSDACVCLQENNIPFNILISDSGRQIFLMPQCYA  328


 Score =   105 bits (262),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 58/125 (46%), Positives = 74/125 (59%), Gaps = 8/125 (6%)
 Frame = -2

Query  759  FSKCYAEKQACGKIDQEILDTWVNPAVWEISGHMVLKRREDYDDASEDYAWRLLSEVSLS  580
              +CYAEKQA G++  E+L+T VNPAVWEISGHMVLKR+EDY+ ASE  AWRLL+E SLS
Sbjct  323  MPQCYAEKQALGEVSPELLETQVNPAVWEISGHMVLKRKEDYEGASEKNAWRLLAEASLS  382

Query  579  EERFEEVKAYVSRAADLLLDSECSNGGS--QPWETYPEASWTATNELSFTSRLSGATLKF  406
             ERF+EV A +  A        CSN     +     P  S   T   +    ++  T   
Sbjct  383  GERFKEVNALIFEAIG------CSNQEEELEGILVQPSGSVNQTGNRTLGGPIANGTASE  436

Query  405  C*ILK  391
            C +L+
Sbjct  437  CLVLQ  441



>ref|XP_008349897.1| PREDICTED: GDP-L-galactose phosphorylase 1-like [Malus domestica]
Length=447

 Score =   444 bits (1141),  Expect = 7e-145, Method: Compositional matrix adjust.
 Identities = 213/342 (62%), Positives = 265/342 (77%), Gaps = 8/342 (2%)
 Frame = -1

Query  2044  LMLTIKRVPTVVSNYQDDAPEDSKPESLGCGRNCLGQCCLPVSCLPLFAFKNDEHKCDGD  1865
             +ML IKRVPTVVSNYQ D  E+      GCGRNCL QCC+P + LPL+AFK   +  +GD
Sbjct  1     MMLRIKRVPTVVSNYQKDEAEEGARRVEGCGRNCLNQCCIPGAKLPLYAFKK-RNVNNGD  59

Query  1864  WNYLSYG--ECPISFLSDLLLGQWEERMSRGLFRYDVTSCETKIIPGTFGFIAQLNEGRH  1691
                  +   E P++FL  LLLG+WE+RM RGLFRYDVT+CETK+IPG +GFIAQLNEGRH
Sbjct  60    TGVPGHDKREPPVAFLDSLLLGEWEDRMQRGLFRYDVTACETKVIPGQYGFIAQLNEGRH  119

Query  1690  LKKRPTEFRVDQVLQPFDENKFNFTKIGQEEVLFRFEPSNDCKSHYLPSGLVDARSGSPT  1511
             LKKRPTEFRVD+VLQPFD +KFNFTK+GQEEVLFRFE S D + H+ PS  +D  + SP+
Sbjct  120   LKKRPTEFRVDKVLQPFDSSKFNFTKVGQEEVLFRFEASEDGEVHFFPSAPIDVEN-SPS  178

Query  1510  VLAINVSPIEYGHVLLIPRVLDCLPQRIDHDSFFVAMHLAKEAADPFFRVGYNSLGAFAT  1331
             V+AINVSPIEYGHVLLIPR+ + LPQRID +SF +A+H+A EA  P+FR+GYNSLGAFAT
Sbjct  179   VVAINVSPIEYGHVLLIPRIFERLPQRIDRESFLLALHMAAEAGSPYFRLGYNSLGAFAT  238

Query  1330  INHLHFQAYYLQVPFPVEKTPTREIMRGREQGDGGIVVSQLLNYPARALLFEGGSTVRDL  1151
             INHLHFQAYYL V FP+EK PT++I       +  + VS+LLNYP R L+FEGG+T+ DL
Sbjct  239   INHLHFQAYYLAVTFPIEKAPTKKI----STLNAEVKVSELLNYPVRGLVFEGGNTLEDL  294

Query  1150  SDAVANSCISLQNNNIPFNLLISERGNKVFLFPQVHSNSVFL  1025
             S  V+++CI LQ NN+P+N+LIS+ G ++FL PQ ++    L
Sbjct  295   SYTVSDACICLQENNVPYNVLISDCGKRIFLLPQCYAEKQAL  336


 Score =   110 bits (275),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 49/71 (69%), Positives = 62/71 (87%), Gaps = 0/71 (0%)
 Frame = -2

Query  759  FSKCYAEKQACGKIDQEILDTWVNPAVWEISGHMVLKRREDYDDASEDYAWRLLSEVSLS  580
              +CYAEKQA G++  E+LDT VNPAVWEISGHMVLKR++DYD+AS++ AW+LL+EVSLS
Sbjct  326  LPQCYAEKQALGEVSAEVLDTQVNPAVWEISGHMVLKRKKDYDEASDENAWKLLAEVSLS  385

Query  579  EERFEEVKAYV  547
            EERF+EV A +
Sbjct  386  EERFQEVNALI  396



>emb|CDP13797.1| unnamed protein product [Coffea canephora]
Length=440

 Score =   443 bits (1140),  Expect = 8e-145, Method: Compositional matrix adjust.
 Identities = 213/341 (62%), Positives = 268/341 (79%), Gaps = 9/341 (3%)
 Frame = -1

Query  2041  MLTIKRVPTVVSNYQ-DDAPEDSKPESLGCGRNCLGQCCLPVSCLPLFAFKN-DEHKCDG  1868
             ML IKRVPTVVSNYQ ++A E +  +  GCGRNCL  CCLP + LPL+ FK  +E   + 
Sbjct  1     MLRIKRVPTVVSNYQKEEAEEGAARQGGGCGRNCLRNCCLPGAKLPLYRFKRLNEVANEK  60

Query  1867  DWNYLSYGECPISFLSDLLLGQWEERMSRGLFRYDVTSCETKIIPGTFGFIAQLNEGRHL  1688
                     E P+ FL  LLLG+WE RM RGLFRYDVT+CETK+IPG +GFIAQLNEGRHL
Sbjct  61    VGLSCENKEPPVPFLESLLLGEWEGRMQRGLFRYDVTACETKVIPGEYGFIAQLNEGRHL  120

Query  1687  KKRPTEFRVDQVLQPFDENKFNFTKIGQEEVLFRFEPSNDCKSHYLPSGLVDARSGSPTV  1508
             KKRPTEFRVD+VLQPFDE KFNFTK+GQEE+LF+FEP ++ +  +LPS L+D  + SP+V
Sbjct  121   KKRPTEFRVDKVLQPFDETKFNFTKVGQEEILFQFEPGDEVQ--FLPSALIDTEN-SPSV  177

Query  1507  LAINVSPIEYGHVLLIPRVLDCLPQRIDHDSFFVAMHLAKEAADPFFRVGYNSLGAFATI  1328
             +AINVSPIEYGHVLLIP++L+CLPQ IDHDS  +A+++A EA  P+FR+GYNSLGAFATI
Sbjct  178   VAINVSPIEYGHVLLIPQILNCLPQSIDHDSLLLALYMAAEARSPYFRLGYNSLGAFATI  237

Query  1327  NHLHFQAYYLQVPFPVEKTPTREIMRGREQGDGGIVVSQLLNYPARALLFEGGSTVRDLS  1148
             NHLHFQAYYL VPFP+EK P+++I   +    GG+ +S+LL YP R L+FEGG+T++DLS
Sbjct  238   NHLHFQAYYLAVPFPIEKAPSKKITTTK----GGVQISELLKYPVRGLVFEGGNTLKDLS  293

Query  1147  DAVANSCISLQNNNIPFNLLISERGNKVFLFPQVHSNSVFL  1025
             + VA+SCI LQ  NIP+N+LIS+ G ++FLFPQ ++    L
Sbjct  294   NVVADSCICLQETNIPYNVLISDSGKRIFLFPQCYAEKQAL  334


 Score =   114 bits (285),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 52/74 (70%), Positives = 65/74 (88%), Gaps = 0/74 (0%)
 Frame = -2

Query  759  FSKCYAEKQACGKIDQEILDTWVNPAVWEISGHMVLKRREDYDDASEDYAWRLLSEVSLS  580
            F +CYAEKQA G++  E+LDT VNPAVWEISGHMVLK+++DY++ASE+ AWRLL+EVSLS
Sbjct  324  FPQCYAEKQALGEVSAELLDTQVNPAVWEISGHMVLKQKKDYEEASEENAWRLLAEVSLS  383

Query  579  EERFEEVKAYVSRA  538
            EERF+EVKA +  A
Sbjct  384  EERFQEVKALIFEA  397



>ref|XP_008363580.1| PREDICTED: GDP-L-galactose phosphorylase 2-like [Malus domestica]
Length=448

 Score =   443 bits (1140),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 214/337 (64%), Positives = 265/337 (79%), Gaps = 8/337 (2%)
 Frame = -1

Query  2044  LMLTIKRVPTVVSNYQDDAPEDSKPESLGCGRNCLGQCCLPVSCLPLFAFKNDEHKCDGD  1865
             + L IKRVPTVVSNYQ D  E+      GCGRNCL QCC+P + LPL+AFK   +  DGD
Sbjct  3     MTLRIKRVPTVVSNYQKDEAEEGARRVGGCGRNCLNQCCIPGAKLPLYAFKK-LNVNDGD  61

Query  1864  WNYLSYG--ECPISFLSDLLLGQWEERMSRGLFRYDVTSCETKIIPGTFGFIAQLNEGRH  1691
                L     E P++FL  LLLG+WE+RM RGLFRYDVT+CETK+IPG FGFIAQLNEGRH
Sbjct  62    TGLLGREKREPPVAFLDSLLLGEWEDRMQRGLFRYDVTACETKVIPGQFGFIAQLNEGRH  121

Query  1690  LKKRPTEFRVDQVLQPFDENKFNFTKIGQEEVLFRFEPSNDCKSHYLPSGLVDARSGSPT  1511
             LKKRPTEFRVD+VLQPFD +KFNFTK+GQEEVLF+FE S D +  + PS  +D  S SP+
Sbjct  122   LKKRPTEFRVDKVLQPFDGSKFNFTKVGQEEVLFQFEASKDGEVQFFPSAPIDVES-SPS  180

Query  1510  VLAINVSPIEYGHVLLIPRVLDCLPQRIDHDSFFVAMHLAKEAADPFFRVGYNSLGAFAT  1331
             V+AINVSPIEYGHVLLIP +L+ LPQRID +SF +A+H+A EA +P+FR+GYNSLGAFAT
Sbjct  181   VVAINVSPIEYGHVLLIPHILERLPQRIDRESFLLALHMAAEAGNPYFRLGYNSLGAFAT  240

Query  1330  INHLHFQAYYLQVPFPVEKTPTREIMRGREQGDGGIVVSQLLNYPARALLFEGGSTVRDL  1151
             INHLHFQAYYL V FP+EK PT++I       +  + VS+LLNYP R L+FEGG+T++DL
Sbjct  241   INHLHFQAYYLAVTFPIEKAPTKKI----STLNAEVKVSELLNYPVRGLVFEGGNTLQDL  296

Query  1150  SDAVANSCISLQNNNIPFNLLISERGNKVFLFPQVHS  1040
             S+ V+++CI LQ NNIP+N+LIS+ G ++FL PQ ++
Sbjct  297   SNTVSDACICLQENNIPYNVLISDXGKRIFLVPQCYA  333


 Score =   109 bits (272),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 50/69 (72%), Positives = 61/69 (88%), Gaps = 0/69 (0%)
 Frame = -2

Query  753  KCYAEKQACGKIDQEILDTWVNPAVWEISGHMVLKRREDYDDASEDYAWRLLSEVSLSEE  574
            +CYAEKQA G++  EILDT VNPAVWEISGHMVLKR++DYD+AS++ AW+LL+EVSLSEE
Sbjct  330  QCYAEKQALGEVRAEILDTQVNPAVWEISGHMVLKRKKDYDEASDENAWKLLAEVSLSEE  389

Query  573  RFEEVKAYV  547
            RF EV A +
Sbjct  390  RFLEVNALI  398



>gb|AII99836.1| GDP-L-galactose phosphorylase [Nicotiana tabacum]
Length=436

 Score =   442 bits (1138),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 209/341 (61%), Positives = 263/341 (77%), Gaps = 10/341 (3%)
 Frame = -1

Query  2044  LMLTIKRVPTVVSNYQDDAPEDSKPESLGCGRNCLGQCCLPVSCLPLFAFKN-DEHKCDG  1868
             +ML IKRVPT+VSN+Q +  E++     GCGRNCL  CCLP S LPL+A KN  + K   
Sbjct  1     MMLKIKRVPTLVSNFQKEEAEETLARGAGCGRNCLRYCCLPGSKLPLYASKNLRKGKSVA  60

Query  1867  DWNYLSYGECPISFLSDLLLGQWEERMSRGLFRYDVTSCETKIIPGTFGFIAQLNEGRHL  1688
             D       E P+ FL  LLLG+WE+R  +GLFRYDVT+CETK+IPG +GFIAQLNEGRHL
Sbjct  61    D----ETKEPPVDFLESLLLGEWEDRQQKGLFRYDVTACETKVIPGEYGFIAQLNEGRHL  116

Query  1687  KKRPTEFRVDQVLQPFDENKFNFTKIGQEEVLFRFEPSNDCKSHYLPSGLVDARSGSPTV  1508
             KKRPTEFRVD+VLQPFD +KFNFTK+GQEE+LF+FE S D    + P+  +DA   SP+V
Sbjct  117   KKRPTEFRVDKVLQPFDGSKFNFTKVGQEELLFQFEASEDNDVQFFPNAPIDAEK-SPSV  175

Query  1507  LAINVSPIEYGHVLLIPRVLDCLPQRIDHDSFFVAMHLAKEAADPFFRVGYNSLGAFATI  1328
             +AINVSPIEYGHVLLIP+VL+CLPQRID DS  +A+H+A EAA+P+FR+GYNSLGAFATI
Sbjct  176   VAINVSPIEYGHVLLIPKVLECLPQRIDRDSLLLALHMAAEAANPYFRLGYNSLGAFATI  235

Query  1327  NHLHFQAYYLQVPFPVEKTPTREIMRGREQGDGGIVVSQLLNYPARALLFEGGSTVRDLS  1148
             NHLHFQAYYL VPFP+EK PTR+I       D G+ +S++LNYP R L+FEGG+T+ DL+
Sbjct  236   NHLHFQAYYLAVPFPIEKAPTRKITF----ADAGVKISEMLNYPVRGLVFEGGNTLEDLA  291

Query  1147  DAVANSCISLQNNNIPFNLLISERGNKVFLFPQVHSNSVFL  1025
             + V+ SC+ LQ NNIP+N+LI++   ++FL PQ ++    L
Sbjct  292   NVVSGSCVCLQENNIPYNVLIADSAKRIFLLPQCYAEKQAL  332


 Score =   110 bits (275),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 51/76 (67%), Positives = 61/76 (80%), Gaps = 0/76 (0%)
 Frame = -2

Query  759  FSKCYAEKQACGKIDQEILDTWVNPAVWEISGHMVLKRREDYDDASEDYAWRLLSEVSLS  580
              +CYAEKQA G++  E+LDT VNPAVWEISGHMVLKR+EDY+ A+E  AWRLL+EVSLS
Sbjct  322  LPQCYAEKQALGEVSSELLDTQVNPAVWEISGHMVLKRKEDYEGATEANAWRLLAEVSLS  381

Query  579  EERFEEVKAYVSRAAD  532
            E RF+EV A +  A D
Sbjct  382  EARFQEVTALIFEAID  397



>ref|XP_010252494.1| PREDICTED: GDP-L-galactose phosphorylase 2 [Nelumbo nucifera]
Length=439

 Score =   442 bits (1137),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 208/342 (61%), Positives = 264/342 (77%), Gaps = 5/342 (1%)
 Frame = -1

Query  2044  LMLTIKRVPTVVSNYQDDAPEDSKPESLGCGRNCLGQCCLPVSCLPLFAFKNDEHKCDGD  1865
             +ML+IK+VPT+VSN+Q +  E+S+    GCGRNCL +CC+  + LPL+ F     K    
Sbjct  1     MMLSIKKVPTLVSNHQKEEGEESRLNGGGCGRNCLNKCCIQGANLPLYTFNRMNKKVQEK  60

Query  1864  WNYLSYGECPISFLSDLLLGQWEERMSRGLFRYDVTSCETKIIPGTFGFIAQLNEGRHLK  1685
                    E P++FL  L+LG+WE+RM +GLFRYDVT+CETK+IPG +GFIAQLNEGRHLK
Sbjct  61    GLVDDEKEPPVAFLESLILGEWEDRMQKGLFRYDVTACETKVIPGKYGFIAQLNEGRHLK  120

Query  1684  KRPTEFRVDQVLQPFDENKFNFTKIGQEEVLFRFEPSNDCKSHYLPSGLVDARSGSPTVL  1505
             KRPTEFRVD+VLQPFD NKFNFTK+GQEEVLF+F  S D ++++ P   +D    SP+V+
Sbjct  121   KRPTEFRVDKVLQPFDGNKFNFTKVGQEEVLFQFGASEDDETNFFPFAPIDV-DDSPSVV  179

Query  1504  AINVSPIEYGHVLLIPRVLDCLPQRIDHDSFFVAMHLAKEAADPFFRVGYNSLGAFATIN  1325
             AINVSPIEYGHVLLIPR+LDCLPQRID +SF +A+H+A EA +P+FR+GYNSLGAFATIN
Sbjct  180   AINVSPIEYGHVLLIPRILDCLPQRIDRESFLLALHMAAEAGNPYFRLGYNSLGAFATIN  239

Query  1324  HLHFQAYYLQVPFPVEKTPTREIMRGREQGDGGIVVSQLLNYPARALLFEGGSTVRDLSD  1145
             HLHFQAY+L VPFP+EK PTR I       DGG+ +S+L NYP R L+FEGG+T+ DLS+
Sbjct  240   HLHFQAYFLAVPFPIEKAPTRRIT----TTDGGVKISELSNYPVRGLVFEGGNTLIDLSN  295

Query  1144  AVANSCISLQNNNIPFNLLISERGNKVFLFPQVHSNSVFLSS  1019
             AV+ SCI LQ+NNIP+N LIS+ G ++FL PQ ++    L  
Sbjct  296   AVSESCICLQDNNIPYNALISDYGKRIFLLPQCYAEKQALGE  337


 Score =   108 bits (271),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 50/81 (62%), Positives = 65/81 (80%), Gaps = 0/81 (0%)
 Frame = -2

Query  759  FSKCYAEKQACGKIDQEILDTWVNPAVWEISGHMVLKRREDYDDASEDYAWRLLSEVSLS  580
              +CYAEKQA G+++ E+LDT VNPAVWEISGHMVLKR+ DY++A+E+ AWRLL+EVSLS
Sbjct  325  LPQCYAEKQALGEVNPELLDTQVNPAVWEISGHMVLKRKHDYEEATEENAWRLLAEVSLS  384

Query  579  EERFEEVKAYVSRAADLLLDS  517
            E RF+EV A +  A    +D+
Sbjct  385  EGRFQEVMAMIFEAIACNVDA  405



>ref|XP_009404316.1| PREDICTED: GDP-L-galactose phosphorylase 2-like [Musa acuminata 
subsp. malaccensis]
Length=435

 Score =   442 bits (1137),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 221/342 (65%), Positives = 265/342 (77%), Gaps = 13/342 (4%)
 Frame = -1

Query  2041  MLTIKRVPTVVSNYQDDAPEDSKPESLGCGRNCLGQCCLPVSCLPLFAFKNDEHKCDGDW  1862
             ML+IKRVPTV+SNYQ    E++  E LGCGR+CLG+CCLP S LP++AFKND        
Sbjct  1     MLSIKRVPTVLSNYQ----EENAGEPLGCGRSCLGKCCLPASKLPVYAFKNDPRP---KA  53

Query  1861  NYLSYGECPISF-LSDLLLGQWEERMSRGLFRYDVTSCETKIIPGTFGFIAQLNEGRHLK  1685
             + +   E P  F L+ LLLGQWE+RM+RGLFRYDVT+CETK+IPG  GFIAQLNEGRHLK
Sbjct  54    SSVGTDELPPDFFLNTLLLGQWEDRMNRGLFRYDVTACETKVIPGDHGFIAQLNEGRHLK  113

Query  1684  KRPTEFRVDQVLQPFDENKFNFTKIGQEEVLFRFEPSNDCKSHYLPSGLVDARSG--SPT  1511
             KRPTEFRVD+VLQ FD  KFNFTK+GQEEVLFRFE +   ++H   S   D   G  SP+
Sbjct  114   KRPTEFRVDRVLQAFDPAKFNFTKVGQEEVLFRFEAAGGDEAHLFES---DGNEGTKSPS  170

Query  1510  VLAINVSPIEYGHVLLIPRVLDCLPQRIDHDSFFVAMHLAKEAADPFFRVGYNSLGAFAT  1331
             V+AINVSPIEYGHVLLIPRVLD LPQRID +SF +A+ +A EA  P+FR+GYNSLGAFAT
Sbjct  171   VVAINVSPIEYGHVLLIPRVLDSLPQRIDQESFLLALRMASEAGSPYFRLGYNSLGAFAT  230

Query  1330  INHLHFQAYYLQVPFPVEKTPTREIMRGREQGDGGIVVSQLLNYPARALLFEGGSTVRDL  1151
             INHLHFQAYYL VPFPVEK PT +I   + +   G+ VS+LLNYP R L++EGG  ++DL
Sbjct  231   INHLHFQAYYLSVPFPVEKAPTAKIPTNQGRSKSGVTVSRLLNYPVRGLVYEGGKHLKDL  290

Query  1150  SDAVANSCISLQNNNIPFNLLISERGNKVFLFPQVHSNSVFL  1025
             +D VANSCI LQ+NNIPFN+LIS+ G +VFLFPQ ++    L
Sbjct  291   ADMVANSCIWLQSNNIPFNVLISDSGRRVFLFPQCYAEKQAL  332


 Score =   125 bits (313),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 57/78 (73%), Positives = 68/78 (87%), Gaps = 0/78 (0%)
 Frame = -2

Query  759  FSKCYAEKQACGKIDQEILDTWVNPAVWEISGHMVLKRREDYDDASEDYAWRLLSEVSLS  580
            F +CYAEKQA G++ QE+LDT VNPAVWEISGHMVLKR++DY++ASEDYAWRLL+EVSLS
Sbjct  322  FPQCYAEKQALGEVGQELLDTQVNPAVWEISGHMVLKRKKDYEEASEDYAWRLLAEVSLS  381

Query  579  EERFEEVKAYVSRAADLL  526
            EERF EVK Y+  A  L+
Sbjct  382  EERFHEVKTYIFEAIGLV  399



>ref|NP_001280814.1| GDP-L-galactose phosphorylase 1-like [Malus domestica]
 gb|ACN88681.1| VTC2-like protein [Malus domestica]
Length=446

 Score =   442 bits (1138),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 213/341 (62%), Positives = 264/341 (77%), Gaps = 8/341 (2%)
 Frame = -1

Query  2041  MLTIKRVPTVVSNYQDDAPEDSKPESLGCGRNCLGQCCLPVSCLPLFAFKNDEHKCDGDW  1862
             ML IKRVPTVVSNYQ D  E+      GCGRNCL QCC+P + LPL+AFK   +  +GD 
Sbjct  1     MLRIKRVPTVVSNYQKDEAEEGARRVEGCGRNCLNQCCIPGAKLPLYAFKK-RNVNNGDT  59

Query  1861  NYLSYG--ECPISFLSDLLLGQWEERMSRGLFRYDVTSCETKIIPGTFGFIAQLNEGRHL  1688
                 +   E P++FL  LLLG+WE+RM RGLFRYDVT+CETK+IPG +GFIAQLNEGRHL
Sbjct  60    GVPGHDKREPPVAFLDSLLLGEWEDRMQRGLFRYDVTACETKVIPGQYGFIAQLNEGRHL  119

Query  1687  KKRPTEFRVDQVLQPFDENKFNFTKIGQEEVLFRFEPSNDCKSHYLPSGLVDARSGSPTV  1508
             KKRPTEFRVD+VLQPFD +KFNFTK+GQEEVLFRFE S D + H+ PS  +D  + SP+V
Sbjct  120   KKRPTEFRVDKVLQPFDSSKFNFTKVGQEEVLFRFEASEDGEVHFFPSAPIDVEN-SPSV  178

Query  1507  LAINVSPIEYGHVLLIPRVLDCLPQRIDHDSFFVAMHLAKEAADPFFRVGYNSLGAFATI  1328
             +AINVSPIEYGHVLLIPR+ + LPQRID +SF +A+H+A EA  P+FR+GYNSLGAFATI
Sbjct  179   VAINVSPIEYGHVLLIPRIFERLPQRIDRESFLLALHMAAEAGSPYFRLGYNSLGAFATI  238

Query  1327  NHLHFQAYYLQVPFPVEKTPTREIMRGREQGDGGIVVSQLLNYPARALLFEGGSTVRDLS  1148
             NHLHFQAYYL V FP+EK PT++I       +  + VS+LLNYP R L+FEGG+T+ DLS
Sbjct  239   NHLHFQAYYLAVTFPIEKAPTKKI----STLNAEVKVSELLNYPVRGLVFEGGNTLEDLS  294

Query  1147  DAVANSCISLQNNNIPFNLLISERGNKVFLFPQVHSNSVFL  1025
               V+++CI LQ NN+P+N+LIS+ G ++FL PQ ++    L
Sbjct  295   YTVSDACICLQENNVPYNVLISDCGKRIFLLPQCYAEKQAL  335


 Score =   110 bits (275),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 49/71 (69%), Positives = 62/71 (87%), Gaps = 0/71 (0%)
 Frame = -2

Query  759  FSKCYAEKQACGKIDQEILDTWVNPAVWEISGHMVLKRREDYDDASEDYAWRLLSEVSLS  580
              +CYAEKQA G++  E+LDT VNPAVWEISGHMVLKR++DYD+AS++ AW+LL+EVSLS
Sbjct  325  LPQCYAEKQALGEVSAEVLDTQVNPAVWEISGHMVLKRKKDYDEASDENAWKLLAEVSLS  384

Query  579  EERFEEVKAYV  547
            EERF+EV A +
Sbjct  385  EERFQEVNALI  395



>gb|KDP33162.1| hypothetical protein JCGZ_13427 [Jatropha curcas]
Length=424

 Score =   441 bits (1135),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 220/336 (65%), Positives = 268/336 (80%), Gaps = 15/336 (4%)
 Frame = -1

Query  2041  MLTIKRVPTVVSNYQDDAPEDSKPESLGCGRNCLGQCCLPVSCLPLFAFKNDEHKCDGDW  1862
             MLTIK+VPTVVSNYQ+   E+S+    GCGRNCLG CCLP +     + +N   +   D 
Sbjct  1     MLTIKKVPTVVSNYQE---ENSERNLEGCGRNCLGNCCLPDTEK---SIENGMVRSSQDR  54

Query  1861  NYLSYGECPISFLSDLLLGQWEERMSRGLFRYDVTSCETKIIPGTFGFIAQLNEGRHLKK  1682
                   +  I FL +LLLGQWE+RM+RGLFRYDVT+C++ IIPG +GFIAQLNEGRHLKK
Sbjct  55    Q-----QAQICFLHNLLLGQWEDRMTRGLFRYDVTTCQSTIIPGRYGFIAQLNEGRHLKK  109

Query  1681  RPTEFRVDQVLQPFDENKFNFTKIGQEEVLFRFEPS-NDCKSHYLPSGLVDARSGSPTVL  1505
             RPTEFRVD+VLQ FDE+KFNF KIGQEEVLFRFE   +D KS + P+      S SP V+
Sbjct  110   RPTEFRVDKVLQDFDESKFNFNKIGQEEVLFRFEHGLDDKKSEFFPTAPASVDSNSPNVV  169

Query  1504  AINVSPIEYGHVLLIPRVLDCLPQRIDHDSFFVAMHLAKEAADPFFRVGYNSLGAFATIN  1325
             AINVSPIEYGHVLLIPR+LDCLPQRID +SF +A++LAKEA+DPFFRVGYNSLGAFATIN
Sbjct  170   AINVSPIEYGHVLLIPRILDCLPQRIDSESFLLAVYLAKEASDPFFRVGYNSLGAFATIN  229

Query  1324  HLHFQAYYLQVPFPVEKTPTREI-MRGREQGDGGIVVSQLLNYPARALLFEGGSTVRDLS  1148
             HLHFQAYYL V FPVEK PT+ I ++G    D G+VVS+LLNYP + L+FEGG+T+ DLS
Sbjct  230   HLHFQAYYLAVSFPVEKAPTKRITLKGTR--DKGVVVSRLLNYPVKGLVFEGGNTIEDLS  287

Query  1147  DAVANSCISLQNNNIPFNLLISERGNKVFLFPQVHS  1040
             D+V++SCI LQNNN+PFN+LI++ GN++FLFPQ ++
Sbjct  288   DSVSSSCIYLQNNNVPFNVLIADCGNRIFLFPQCYA  323


 Score =   112 bits (281),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 51/75 (68%), Positives = 64/75 (85%), Gaps = 0/75 (0%)
 Frame = -2

Query  759  FSKCYAEKQACGKIDQEILDTWVNPAVWEISGHMVLKRREDYDDASEDYAWRLLSEVSLS  580
            F +CYAEKQA G++ QE+L+T VNPAVWE+SGH+VLKRR+D++DASE Y WRLL+EVS+S
Sbjct  318  FPQCYAEKQALGEVSQELLNTQVNPAVWEVSGHIVLKRRKDFEDASEAYIWRLLAEVSVS  377

Query  579  EERFEEVKAYVSRAA  535
            EERF+EV   V  AA
Sbjct  378  EERFQEVTTRVLEAA  392



>ref|XP_004139797.1| PREDICTED: GDP-L-galactose phosphorylase 1-like [Cucumis sativus]
 ref|XP_004163034.1| PREDICTED: GDP-L-galactose phosphorylase 1-like [Cucumis sativus]
 gb|KGN44184.1| hypothetical protein Csa_7G219200 [Cucumis sativus]
Length=445

 Score =   442 bits (1137),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 211/342 (62%), Positives = 272/342 (80%), Gaps = 20/342 (6%)
 Frame = -1

Query  2041  MLTIKRVPTVVSNYQDDAPEDSKPESLGCGRNCLGQCCLPVSCLPLFAFKNDEHKCDGDW  1862
             ML IKRVPTVVSNYQ+D  E+    S GCGRNCL +CC+  + +PL+AFK   +K  G  
Sbjct  1     MLRIKRVPTVVSNYQEDETENVS-RSTGCGRNCLNKCCIEGAKIPLYAFKK-LNKISG--  56

Query  1861  NYLSYGEC--------PISFLSDLLLGQWEERMSRGLFRYDVTSCETKIIPGTFGFIAQL  1706
                S G C        P++FL  LLLG+WE+RM RGLFRYDVT+CETK+IPG +GFIAQL
Sbjct  57    ---SKGLCCEYENSVPPVAFLDSLLLGEWEDRMQRGLFRYDVTACETKVIPGKYGFIAQL  113

Query  1705  NEGRHLKKRPTEFRVDQVLQPFDENKFNFTKIGQEEVLFRFEPSNDCKSHYLPSGLVDAR  1526
             NEGRHLKKRPTEFRVD+VLQPFD NKFNFTK+GQEEVLFRFE + +  + ++P+  +D  
Sbjct  114   NEGRHLKKRPTEFRVDKVLQPFDGNKFNFTKVGQEEVLFRFEANENGNTQFIPNDAIDLE  173

Query  1525  SGSPTVLAINVSPIEYGHVLLIPRVLDCLPQRIDHDSFFVAMHLAKEAADPFFRVGYNSL  1346
             + SP+V+AINVSPIEYGHVLLIPR+LDCLPQRID +SF +A+H+A EA + +FR+GYNSL
Sbjct  174   N-SPSVVAINVSPIEYGHVLLIPRILDCLPQRIDRESFLLALHMATEAGNTYFRLGYNSL  232

Query  1345  GAFATINHLHFQAYYLQVPFPVEKTPTREIMRGREQGDGGIVVSQLLNYPARALLFEGGS  1166
             GAFATINHLHFQAYYL VPFP+EK PT++IM  ++    G+++S+LL YP R L+FEGG+
Sbjct  233   GAFATINHLHFQAYYLGVPFPIEKAPTKKIMTLKD----GVIISELLKYPVRGLVFEGGN  288

Query  1165  TVRDLSDAVANSCISLQNNNIPFNLLISERGNKVFLFPQVHS  1040
             T++ LS++V+++CI LQ NNIP+N+LI++ G ++FL PQ ++
Sbjct  289   TLQSLSNSVSDACICLQENNIPYNILIADCGQRIFLLPQCYA  330


 Score =   110 bits (276),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 57/110 (52%), Positives = 76/110 (69%), Gaps = 1/110 (1%)
 Frame = -2

Query  759  FSKCYAEKQACGKIDQEILDTWVNPAVWEISGHMVLKRREDYDDASEDYAWRLLSEVSLS  580
              +CYAEKQA G++  E+LDT VNPAVWEISGHMVLKR++DY++ASE+ AWRLL+ VSLS
Sbjct  325  LPQCYAEKQALGEVSAELLDTQVNPAVWEISGHMVLKRKKDYEEASEENAWRLLAVVSLS  384

Query  579  EERFEEVKAYVSRAADLLLDSECSNGGSQPWETYPEASWTATNELSFTSR  430
            EERF+EV A +    D  +D+E + G S   E + +         + T+R
Sbjct  385  EERFQEVCALIFEVID-TVDAENTEGSSSMPEEHDDGCLKEVEARNNTTR  433



>ref|XP_009142887.1| PREDICTED: GDP-L-galactose phosphorylase 1 [Brassica rapa]
 gb|AET14214.1| GDP-L-galactose phosphorylase [Brassica rapa subsp. chinensis]
 emb|CDX89298.1| BnaA01g15950D [Brassica napus]
Length=434

 Score =   441 bits (1135),  Expect = 4e-144, Method: Compositional matrix adjust.
 Identities = 212/339 (63%), Positives = 268/339 (79%), Gaps = 16/339 (5%)
 Frame = -1

Query  2041  MLTIKRVPTVVSNYQDDAPEDSKPESLGCGRNCLGQCCLPVSCLPLFAFKNDEHKCDGDW  1862
             ML IKRVPTVVSNYQ D   +S  ES+GCGRNCLG CC+  + LPL+A K    K D   
Sbjct  1     MLKIKRVPTVVSNYQKD---ESADESVGCGRNCLGACCINGARLPLYACK----KLDKS-  52

Query  1861  NYLSYGECPISFLSDLLLGQWEERMSRGLFRYDVTSCETKIIPGTFGFIAQLNEGRHLKK  1682
                  GE P++FL  L+LG+WE+R  RGLFRYDVT+CETK+IPG +GF+AQLNEGRHLKK
Sbjct  53    ---GAGEKPVAFLESLVLGEWEDRFQRGLFRYDVTACETKVIPGKYGFVAQLNEGRHLKK  109

Query  1681  RPTEFRVDQVLQPFDENKFNFTKIGQEEVLFRFEPSNDCKSHYLPSGLVDARSGSPTVLA  1502
             RPTEFRVD+VLQ FD NKFNFTK+GQEE+LF+FE   D +  + P   +DA + SP+V+A
Sbjct  110   RPTEFRVDKVLQSFDGNKFNFTKVGQEELLFQFEAGEDGEVQFFPCMPLDAEN-SPSVVA  168

Query  1501  INVSPIEYGHVLLIPRVLDCLPQRIDHDSFFVAMHLAKEAADPFFRVGYNSLGAFATINH  1322
             INVSPIEYGHVLLIPRVLDCLPQRIDH S  +A+H+A EAA+P+FR+GYNSLGAFATINH
Sbjct  169   INVSPIEYGHVLLIPRVLDCLPQRIDHKSLLLALHMAAEAANPYFRLGYNSLGAFATINH  228

Query  1321  LHFQAYYLQVPFPVEKTPTREIMRGREQGDGGIVVSQLLNYPARALLFEGGSTVRDLSDA  1142
             LHFQAYYL +PFP+EK P+++++        G+ +S+LL+YP R+LLFEGGS+++DLSD 
Sbjct  229   LHFQAYYLAMPFPLEKAPSKKMVTTA----SGVKISELLSYPVRSLLFEGGSSMQDLSDT  284

Query  1141  VANSCISLQNNNIPFNLLISERGNKVFLFPQVHSNSVFL  1025
             V+++C+ LQNNNIPFN+LI++ G ++FL PQ ++    L
Sbjct  285   VSDACVCLQNNNIPFNILIADCGRQIFLMPQCYAEKQAL  323


 Score =   108 bits (270),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 50/74 (68%), Positives = 61/74 (82%), Gaps = 0/74 (0%)
 Frame = -2

Query  759  FSKCYAEKQACGKIDQEILDTWVNPAVWEISGHMVLKRREDYDDASEDYAWRLLSEVSLS  580
              +CYAEKQA G++  E+L+T VNPAVWEISGHMVLKR+EDY+ ASE+ AWRLL+E SLS
Sbjct  313  MPQCYAEKQALGEVSPEVLETQVNPAVWEISGHMVLKRKEDYEGASEENAWRLLAEASLS  372

Query  579  EERFEEVKAYVSRA  538
            EERF+EV A +  A
Sbjct  373  EERFKEVNALIFEA  386



>ref|XP_006413133.1| hypothetical protein EUTSA_v10025206mg [Eutrema salsugineum]
 dbj|BAJ34159.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ54586.1| hypothetical protein EUTSA_v10025206mg [Eutrema salsugineum]
Length=444

 Score =   441 bits (1135),  Expect = 4e-144, Method: Compositional matrix adjust.
 Identities = 212/341 (62%), Positives = 270/341 (79%), Gaps = 10/341 (3%)
 Frame = -1

Query  2041  MLTIKRVPTVVSNYQDDAPEDSKPESLGCGRNCLGQCCLPVSCLPLFAFKNDEHKCDGDW  1862
             ML+IKRVPTVVSNYQ D   D   ES+GCGRNCLG CC+  + LPL+A K  E    G+ 
Sbjct  1     MLSIKRVPTVVSNYQKDEAAD---ESVGCGRNCLGACCINGARLPLYACKKLEKSGAGEK  57

Query  1861  NYLSYG--ECPISFLSDLLLGQWEERMSRGLFRYDVTSCETKIIPGTFGFIAQLNEGRHL  1688
               +S+   E P++FL  L+LG+WE+R  RGLFRYDVT+CETK+IPG +GF+AQLNEGRHL
Sbjct  58    LVISHEAREPPVAFLESLVLGEWEDRFQRGLFRYDVTACETKVIPGKYGFVAQLNEGRHL  117

Query  1687  KKRPTEFRVDQVLQPFDENKFNFTKIGQEEVLFRFEPSNDCKSHYLPSGLVDARSGSPTV  1508
             KKRPTEFRVD+VLQ FD NKFNFTK+GQEE+LF+FE   D +  + P   +DA + SP+V
Sbjct  118   KKRPTEFRVDKVLQSFDGNKFNFTKVGQEELLFQFEAGEDGEVQFFPCMPLDAEN-SPSV  176

Query  1507  LAINVSPIEYGHVLLIPRVLDCLPQRIDHDSFFVAMHLAKEAADPFFRVGYNSLGAFATI  1328
             +AINVSPIEYGHVLLIPRVLDCLPQRIDH S  +A+H+A EAA+P+FR+GYNSLGAFATI
Sbjct  177   VAINVSPIEYGHVLLIPRVLDCLPQRIDHKSLLLAVHMAAEAANPYFRLGYNSLGAFATI  236

Query  1327  NHLHFQAYYLQVPFPVEKTPTREIMRGREQGDGGIVVSQLLNYPARALLFEGGSTVRDLS  1148
             NHLHFQAYYL +PFP+EK  +++++        G+ +S+LLNYP R+LLFEGG++++DLS
Sbjct  237   NHLHFQAYYLAMPFPLEKALSKKMITTV----SGVKISELLNYPVRSLLFEGGNSMQDLS  292

Query  1147  DAVANSCISLQNNNIPFNLLISERGNKVFLFPQVHSNSVFL  1025
             D V+++C+ LQNNNIPFN+LIS+ G ++FL PQ ++    L
Sbjct  293   DTVSDACVCLQNNNIPFNILISDCGRQIFLMPQCYAEKQAL  333


 Score =   107 bits (266),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 59/129 (46%), Positives = 80/129 (62%), Gaps = 13/129 (10%)
 Frame = -2

Query  759  FSKCYAEKQACGKIDQEILDTWVNPAVWEISGHMVLKRREDYDDASEDYAWRLLSEVSLS  580
              +CYAEKQA G++  E+L+T VNPAVWEISGHMVLKR+EDY+ ASE+ AWRLL+E SLS
Sbjct  323  MPQCYAEKQALGEVSPEVLETQVNPAVWEISGHMVLKRKEDYEGASEENAWRLLAEASLS  382

Query  579  EERFEEVKAYVSRAADLLLDS-ECSNG-----GSQPWETYPEASWTATNELSFTSRLSGA  418
            EERF+EV        DL+ ++  CSN      G+   +  P  S    +  +    ++  
Sbjct  383  EERFKEVN-------DLIFEAIGCSNQEEELEGTIVHQQSPSGSVNQKSNRTHGGPITNG  435

Query  417  TLKFC*ILK  391
            T   C +L+
Sbjct  436  TASECLVLQ  444



>ref|XP_006843814.1| hypothetical protein AMTR_s00007p00255940 [Amborella trichopoda]
 gb|ERN05489.1| hypothetical protein AMTR_s00007p00255940 [Amborella trichopoda]
Length=432

 Score =   441 bits (1134),  Expect = 5e-144, Method: Compositional matrix adjust.
 Identities = 220/334 (66%), Positives = 261/334 (78%), Gaps = 13/334 (4%)
 Frame = -1

Query  2041  MLTIKRVPTVVSNYQDDAPEDSKPESLGCGRNCLGQCCLPVSCLPLFAFKNDEHKCDGDW  1862
             MLTIKRVPTVVSNYQ++       E+LGCGRNCLG CCLPVS LPL+AF        G  
Sbjct  1     MLTIKRVPTVVSNYQEEL------ENLGCGRNCLGNCCLPVSKLPLYAFNKKRGLAGGKD  54

Query  1861  NYLSYGECPISFLSDLLLGQWEERMSRGLFRYDVTSCETKIIPGTFGFIAQLNEGRHLKK  1682
                S  E   SFL  LLLGQWE+RMSRGLFRYDVT+CETK+IPG +GFIAQLNEGRHLKK
Sbjct  55    EKESESEPEKSFLDTLLLGQWEDRMSRGLFRYDVTACETKVIPGNYGFIAQLNEGRHLKK  114

Query  1681  RPTEFRVDQVLQPFDENKFNFTKIGQEEVLFRFEPSNDCKSHYLPSGLVDARSGSPTVLA  1502
             RPTEFRVD+VLQPFD+ KFNFTK+GQEEVLFRFE SN  ++ +       A S  P+V+A
Sbjct  115   RPTEFRVDKVLQPFDDKKFNFTKVGQEEVLFRFEESNHDETFFFEKA---AASSCPSVVA  171

Query  1501  INVSPIEYGHVLLIPRVLDCLPQRIDHDSFFVAMHLAKEAADPFFRVGYNSLGAFATINH  1322
             INVSPIEYGHVLLIPRVLDCLPQRID +SF +A+H+A EAA+PFFR+GYNSLGAFATINH
Sbjct  172   INVSPIEYGHVLLIPRVLDCLPQRIDSESFLLALHMAAEAANPFFRLGYNSLGAFATINH  231

Query  1321  LHFQAYYLQVPFPVEKTPTREIMRGREQGDGGIVVSQLLNYPARALLFEGGSTVRDLSDA  1142
             LHFQAYY+ +PFPVEK  T+ I    +    G+ +S+L +YP   L+FEGG  + DLS+A
Sbjct  232   LHFQAYYMSMPFPVEKARTKRIAIMSK----GVKMSELCDYPVCGLVFEGGKQLEDLSEA  287

Query  1141  VANSCISLQNNNIPFNLLISERGNKVFLFPQVHS  1040
             V+ SCI LQNNNIP+N+LIS+ G ++FLFPQ ++
Sbjct  288   VSLSCICLQNNNIPYNVLISDSGRRIFLFPQCYA  321


 Score =   124 bits (310),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 57/74 (77%), Positives = 67/74 (91%), Gaps = 0/74 (0%)
 Frame = -2

Query  759  FSKCYAEKQACGKIDQEILDTWVNPAVWEISGHMVLKRREDYDDASEDYAWRLLSEVSLS  580
            F +CYAEKQA G++ QE+LDT VNPAVWEISGHMVLKRR+DY++ASEDYAWRLL+EVSLS
Sbjct  316  FPQCYAEKQALGEVSQELLDTQVNPAVWEISGHMVLKRRKDYEEASEDYAWRLLAEVSLS  375

Query  579  EERFEEVKAYVSRA  538
            +ER EEVKAY+  A
Sbjct  376  KERLEEVKAYILEA  389



>ref|XP_009588390.1| PREDICTED: GDP-L-galactose phosphorylase 1-like [Nicotiana tomentosiformis]
Length=436

 Score =   441 bits (1134),  Expect = 5e-144, Method: Compositional matrix adjust.
 Identities = 209/341 (61%), Positives = 263/341 (77%), Gaps = 10/341 (3%)
 Frame = -1

Query  2044  LMLTIKRVPTVVSNYQDDAPEDSKPESLGCGRNCLGQCCLPVSCLPLFAFKN-DEHKCDG  1868
             +ML IKRVPT+VSN+Q +  E++     GCGRNCL  CCLP S LPL+A KN  + K   
Sbjct  1     MMLKIKRVPTLVSNFQKEEAEETLARGAGCGRNCLRNCCLPGSKLPLYASKNLRKGKSVA  60

Query  1867  DWNYLSYGECPISFLSDLLLGQWEERMSRGLFRYDVTSCETKIIPGTFGFIAQLNEGRHL  1688
             D       E P+ FL  LLLG+WE+R  +GLFRYDVT+CETK+IPG  GFIAQLNEGRHL
Sbjct  61    D----ETKEPPVDFLESLLLGEWEDRQLKGLFRYDVTACETKVIPGEHGFIAQLNEGRHL  116

Query  1687  KKRPTEFRVDQVLQPFDENKFNFTKIGQEEVLFRFEPSNDCKSHYLPSGLVDARSGSPTV  1508
             KKRPTEFRVD+VLQPFD +KFNFTK+GQEE+LF+FE S D +  + P+  +DA   SP+V
Sbjct  117   KKRPTEFRVDKVLQPFDGSKFNFTKVGQEELLFQFEASEDNEVQFFPNAPIDAEK-SPSV  175

Query  1507  LAINVSPIEYGHVLLIPRVLDCLPQRIDHDSFFVAMHLAKEAADPFFRVGYNSLGAFATI  1328
             +AINVSPIEYGHVLLIP+VL+CLPQRID DS  +A+H+A EAA+P+FR+GYNSLGAFATI
Sbjct  176   VAINVSPIEYGHVLLIPKVLECLPQRIDRDSLLLALHMAAEAANPYFRLGYNSLGAFATI  235

Query  1327  NHLHFQAYYLQVPFPVEKTPTREIMRGREQGDGGIVVSQLLNYPARALLFEGGSTVRDLS  1148
             NHLHFQAYYL VPFP+EK PTR+I       D G+ +S++LNYP R L+FEGG+T+ DL+
Sbjct  236   NHLHFQAYYLAVPFPIEKAPTRKITF----ADAGVKISEMLNYPVRGLVFEGGNTLEDLA  291

Query  1147  DAVANSCISLQNNNIPFNLLISERGNKVFLFPQVHSNSVFL  1025
             + V+ SC+ LQ NNIP+N+LI++   ++FL PQ ++    L
Sbjct  292   NVVSGSCVCLQENNIPYNVLIADSAKRIFLLPQCYAEKQAL  332


 Score =   110 bits (276),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 51/76 (67%), Positives = 61/76 (80%), Gaps = 0/76 (0%)
 Frame = -2

Query  759  FSKCYAEKQACGKIDQEILDTWVNPAVWEISGHMVLKRREDYDDASEDYAWRLLSEVSLS  580
              +CYAEKQA G++  E+LDT VNPAVWEISGHMVLKR+EDY+ A+E  AWRLL+EVSLS
Sbjct  322  LPQCYAEKQALGEVSSELLDTQVNPAVWEISGHMVLKRKEDYEGATEANAWRLLAEVSLS  381

Query  579  EERFEEVKAYVSRAAD  532
            E RF+EV A +  A D
Sbjct  382  EARFQEVTALIFEAID  397



>ref|XP_009772775.1| PREDICTED: GDP-L-galactose phosphorylase 1-like [Nicotiana sylvestris]
Length=436

 Score =   441 bits (1133),  Expect = 7e-144, Method: Compositional matrix adjust.
 Identities = 210/341 (62%), Positives = 262/341 (77%), Gaps = 10/341 (3%)
 Frame = -1

Query  2044  LMLTIKRVPTVVSNYQDDAPEDSKPESLGCGRNCLGQCCLPVSCLPLFAFKN-DEHKCDG  1868
             +ML IKRVPT+VSN+Q +  E++     GCGRNCL  CCLP S LPL+A KN  + K   
Sbjct  1     MMLKIKRVPTLVSNFQKEEAEETLARGAGCGRNCLRYCCLPGSKLPLYASKNLRKGKSVA  60

Query  1867  DWNYLSYGECPISFLSDLLLGQWEERMSRGLFRYDVTSCETKIIPGTFGFIAQLNEGRHL  1688
             D       E P+ FL  LLLG+WE+R  +GLFRYDVT+CETK+IPG +GFIAQLNEGRHL
Sbjct  61    D----ETKEPPVDFLESLLLGEWEDRQQKGLFRYDVTACETKVIPGEYGFIAQLNEGRHL  116

Query  1687  KKRPTEFRVDQVLQPFDENKFNFTKIGQEEVLFRFEPSNDCKSHYLPSGLVDARSGSPTV  1508
             KKRPTEFRVD+VLQPFD +KFNFTK+GQEE+LF+FE S D    + P+  +DA   SP+V
Sbjct  117   KKRPTEFRVDKVLQPFDGSKFNFTKVGQEELLFQFEASEDNDVQFFPNAPIDAEK-SPSV  175

Query  1507  LAINVSPIEYGHVLLIPRVLDCLPQRIDHDSFFVAMHLAKEAADPFFRVGYNSLGAFATI  1328
             +AINVSPIEYGHVLLIP+VL+CLPQRID DS  +A+ +A EAA+P+FR+GYNSLGAFATI
Sbjct  176   VAINVSPIEYGHVLLIPKVLECLPQRIDRDSLLLALQMAAEAANPYFRLGYNSLGAFATI  235

Query  1327  NHLHFQAYYLQVPFPVEKTPTREIMRGREQGDGGIVVSQLLNYPARALLFEGGSTVRDLS  1148
             NHLHFQAYYL VPFP+EK PTR+I       D G+ +S++LNYP R L+FEGG+T+ DL+
Sbjct  236   NHLHFQAYYLAVPFPMEKAPTRKITF----ADAGVKISEMLNYPVRGLVFEGGNTLEDLA  291

Query  1147  DAVANSCISLQNNNIPFNLLISERGNKVFLFPQVHSNSVFL  1025
             + V+ SC+ LQ NNIP+N+LIS+   +VFL PQ ++    L
Sbjct  292   NVVSGSCVFLQENNIPYNVLISDSAKRVFLLPQCYAEKQAL  332


 Score =   110 bits (275),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 51/76 (67%), Positives = 61/76 (80%), Gaps = 0/76 (0%)
 Frame = -2

Query  759  FSKCYAEKQACGKIDQEILDTWVNPAVWEISGHMVLKRREDYDDASEDYAWRLLSEVSLS  580
              +CYAEKQA G++  E+LDT VNPAVWEISGHMVLKR+EDY+ A+E  AWRLL+EVSLS
Sbjct  322  LPQCYAEKQALGEVSSELLDTQVNPAVWEISGHMVLKRKEDYEGATEANAWRLLAEVSLS  381

Query  579  EERFEEVKAYVSRAAD  532
            E RF+EV A +  A D
Sbjct  382  EARFQEVTALIFEAID  397



>gb|EYU33662.1| hypothetical protein MIMGU_mgv1a006529mg [Erythranthe guttata]
Length=440

 Score =   440 bits (1132),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 212/341 (62%), Positives = 263/341 (77%), Gaps = 9/341 (3%)
 Frame = -1

Query  2044  LMLTIKRVPTVVSNYQDDAPEDSKPESLGCGRNCLGQCCLPVSCLPLFAFKNDEHKCDGD  1865
             +ML IKRVPTVVSNYQ D  E+      GCGRNC   CCLP + LPL+AFK  +   DG 
Sbjct  1     MMLKIKRVPTVVSNYQKDEAEEGVRPVTGCGRNCFRSCCLPGAKLPLYAFKKAK---DGV  57

Query  1864  WNYLSYG-ECPISFLSDLLLGQWEERMSRGLFRYDVTSCETKIIPGTFGFIAQLNEGRHL  1688
                +S   E P+ FL  LL+  WE+RM RGLFRYDVT+C+TK+I G +GFIAQLNEGRHL
Sbjct  58    CEKVSENTEPPVDFLDSLLVAGWEDRMQRGLFRYDVTACDTKVIAGNYGFIAQLNEGRHL  117

Query  1687  KKRPTEFRVDQVLQPFDENKFNFTKIGQEEVLFRFEPSNDCKSHYLPSGLVDARSGSPTV  1508
             KKRPTEFRVD+VLQPFDE KFNFTK+GQEEVLF+FE S+D + HY P+  +D+   SP+V
Sbjct  118   KKRPTEFRVDKVLQPFDETKFNFTKVGQEEVLFQFEASDDNEVHYFPNAPIDS-DNSPSV  176

Query  1507  LAINVSPIEYGHVLLIPRVLDCLPQRIDHDSFFVAMHLAKEAADPFFRVGYNSLGAFATI  1328
             +AINVSPIEYGHVLLIPR+L+ LPQRID +SF +A+H+A E A+P+FR+GYNSLGAFATI
Sbjct  177   VAINVSPIEYGHVLLIPRILEQLPQRIDGESFLLALHMAVETANPYFRLGYNSLGAFATI  236

Query  1327  NHLHFQAYYLQVPFPVEKTPTREIMRGREQGDGGIVVSQLLNYPARALLFEGGSTVRDLS  1148
             NHLHFQAYYL  PFP+E+ P++ I        GG+ +S +LNYP R L+FEGG+T+ DLS
Sbjct  237   NHLHFQAYYLATPFPIERAPSKRIT----TTSGGVKISDILNYPVRGLVFEGGNTLEDLS  292

Query  1147  DAVANSCISLQNNNIPFNLLISERGNKVFLFPQVHSNSVFL  1025
             + V+NSCI LQ NNIP+N+LI++ G +VFLFPQ ++    L
Sbjct  293   NIVSNSCICLQENNIPYNVLIADCGKRVFLFPQCYAEKQAL  333


 Score =   113 bits (283),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 55/85 (65%), Positives = 68/85 (80%), Gaps = 7/85 (8%)
 Frame = -2

Query  759  FSKCYAEKQACGKIDQEILDTWVNPAVWEISGHMVLKRREDYDDASEDYAWRLLSEVSLS  580
            F +CYAEKQA G++  E+LDT VNPAVWEISGHMVLKR+EDY++ASE+ AWRLL+EVSLS
Sbjct  323  FPQCYAEKQALGEVSSELLDTQVNPAVWEISGHMVLKRKEDYEEASEENAWRLLAEVSLS  382

Query  579  EERFEEVKAYVSRAADLLLDSECSN  505
            EER EEVK       +L+ ++ C N
Sbjct  383  EERLEEVK-------ELIFEAICCN  400



>ref|XP_011097847.1| PREDICTED: GDP-L-galactose phosphorylase 2-like [Sesamum indicum]
Length=440

 Score =   440 bits (1132),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 207/341 (61%), Positives = 266/341 (78%), Gaps = 6/341 (2%)
 Frame = -1

Query  2044  LMLTIKRVPTVVSNYQDDAPEDSKPESLGCGRNCLGQCCLPVSCLPLFAFKNDEHKCDGD  1865
             ++L+IKRVPTVVSNYQ +  E+    + GCGRNCL  CCLP + LPL+AF    +     
Sbjct  1     MILSIKRVPTVVSNYQKEEAEEGARHATGCGRNCLRSCCLPGAKLPLYAFTKMGNVVGEK  60

Query  1864  WNY-LSYGECPISFLSDLLLGQWEERMSRGLFRYDVTSCETKIIPGTFGFIAQLNEGRHL  1688
              ++ +   E P++FL  LLLG+WE+RM RGLFRYDVT+CETK+IPG +GFIAQLNEGRHL
Sbjct  61    GSFDIENKEPPVNFLDSLLLGEWEDRMQRGLFRYDVTACETKVIPGEYGFIAQLNEGRHL  120

Query  1687  KKRPTEFRVDQVLQPFDENKFNFTKIGQEEVLFRFEPSNDCKSHYLPSGLVDARSGSPTV  1508
             KKRPTEFRVD+VLQPFDENKFNFTK+GQEEVLF+FE   D +  + P+  +D    SP+V
Sbjct  121   KKRPTEFRVDKVLQPFDENKFNFTKVGQEEVLFQFEGREDNEVQFFPNEPIDI-DNSPSV  179

Query  1507  LAINVSPIEYGHVLLIPRVLDCLPQRIDHDSFFVAMHLAKEAADPFFRVGYNSLGAFATI  1328
             +AINVSPIEYGHVLLIPR+L+CLPQRID +SF +A+++A EA +P+FR+GYNSLGAFATI
Sbjct  180   VAINVSPIEYGHVLLIPRILECLPQRIDRESFLLALYMAVEAGNPYFRLGYNSLGAFATI  239

Query  1327  NHLHFQAYYLQVPFPVEKTPTREIMRGREQGDGGIVVSQLLNYPARALLFEGGSTVRDLS  1148
             NHLHFQAYYL  PFP+EK P+++I        GG+ +S +LNYP R L+FEGG+ + DLS
Sbjct  240   NHLHFQAYYLATPFPIEKAPSKKIT----TTTGGVKISDILNYPVRGLVFEGGNALEDLS  295

Query  1147  DAVANSCISLQNNNIPFNLLISERGNKVFLFPQVHSNSVFL  1025
             + V++SCI LQ NNIP+N+LI++ G ++FLFPQ ++    L
Sbjct  296   NVVSDSCICLQENNIPYNVLIADCGKRIFLFPQCYAEKQAL  336


 Score =   113 bits (282),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 54/82 (66%), Positives = 66/82 (80%), Gaps = 0/82 (0%)
 Frame = -2

Query  759  FSKCYAEKQACGKIDQEILDTWVNPAVWEISGHMVLKRREDYDDASEDYAWRLLSEVSLS  580
            F +CYAEKQA G++  E+LDT VNPAVWEISGHMVLKR+EDY++ASE+ AWRLL+EVSLS
Sbjct  326  FPQCYAEKQALGEVSSELLDTQVNPAVWEISGHMVLKRKEDYEEASEENAWRLLAEVSLS  385

Query  579  EERFEEVKAYVSRAADLLLDSE  514
            EER +EVK  +  A    +D E
Sbjct  386  EERLQEVKELIFEAICCNMDEE  407



>emb|CBI26680.3| unnamed protein product [Vitis vinifera]
Length=427

 Score =   440 bits (1131),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 209/345 (61%), Positives = 264/345 (77%), Gaps = 14/345 (4%)
 Frame = -1

Query  2038  LTIKRVPTVVSNYQDDAPEDSKPESLGCGRNCLGQCCLPVSCLPLFAFKN-----DEHKC  1874
             L IKRVPTVVSNYQ +  +D   +  GCGRNCL QCC+  + LPL+A+K      +E   
Sbjct  4     LRIKRVPTVVSNYQKEDSDDGARQVGGCGRNCLKQCCIQGAKLPLYAYKKVKDVVNEKAS  63

Query  1873  DGDWNYLSYGECPISFLSDLLLGQWEERMSRGLFRYDVTSCETKIIPGTFGFIAQLNEGR  1694
              GD N     E P+ FL  L+LG+WE+RM +GLFRYDVT+CETK+IPG +GFIAQLNEGR
Sbjct  64    SGDEN----KEQPVPFLDSLVLGEWEDRMQKGLFRYDVTACETKVIPGEYGFIAQLNEGR  119

Query  1693  HLKKRPTEFRVDQVLQPFDENKFNFTKIGQEEVLFRFEPSNDCKSHYLPSGLVDARSGSP  1514
             HLKKRPTEFRVD+VLQPFD NKFNFTK+GQEEVLF+FEPSND +  ++P+  +D  + S 
Sbjct  120   HLKKRPTEFRVDKVLQPFDGNKFNFTKVGQEEVLFQFEPSNDEEPEFIPNAPIDVEN-ST  178

Query  1513  TVLAINVSPIEYGHVLLIPRVLDCLPQRIDHDSFFVAMHLAKEAADPFFRVGYNSLGAFA  1334
             +V+AINVSPIEYGHVLLIPR+ +CLPQRID +SF +A+ +A EA +P+FR+GYNSLGAFA
Sbjct  179   SVVAINVSPIEYGHVLLIPRIFECLPQRIDRESFLLALDMAVEAGNPYFRLGYNSLGAFA  238

Query  1333  TINHLHFQAYYLQVPFPVEKTPTREIMRGREQGDGGIVVSQLLNYPARALLFEGGSTVRD  1154
             TINHLHFQAYYL  PFP+EK PTR+I         G+ + +LL YP R L+FEGG T++D
Sbjct  239   TINHLHFQAYYLATPFPIEKAPTRKIT----TAGNGVKIFELLKYPVRGLVFEGGDTLQD  294

Query  1153  LSDAVANSCISLQNNNIPFNLLISERGNKVFLFPQVHSNSVFLSS  1019
             L++ VA+SCI LQ+NNIPFN+LI++ G ++FLF Q ++    L  
Sbjct  295   LANTVADSCICLQDNNIPFNVLIADAGKRIFLFAQCYAEKQALGE  339


 Score =   115 bits (288),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 52/74 (70%), Positives = 65/74 (88%), Gaps = 0/74 (0%)
 Frame = -2

Query  759  FSKCYAEKQACGKIDQEILDTWVNPAVWEISGHMVLKRREDYDDASEDYAWRLLSEVSLS  580
            F++CYAEKQA G+++QE+LDT VNPAVWE+SGH+VLKR+EDY+ ASE  AWRLL+EVSLS
Sbjct  327  FAQCYAEKQALGEVNQELLDTQVNPAVWEVSGHIVLKRKEDYEGASEQNAWRLLAEVSLS  386

Query  579  EERFEEVKAYVSRA  538
            EERF+EV A +  A
Sbjct  387  EERFQEVNALIFEA  400



>ref|XP_010060290.1| PREDICTED: GDP-L-galactose phosphorylase 2-like [Eucalyptus grandis]
 gb|KCW66953.1| hypothetical protein EUGRSUZ_F00715 [Eucalyptus grandis]
Length=439

 Score =   440 bits (1132),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 216/342 (63%), Positives = 270/342 (79%), Gaps = 10/342 (3%)
 Frame = -1

Query  2044  LMLTIKRVPTVVSNYQDDAPEDSKPESLGCGRNCLGQCCLPVSCLPLFAFKNDEHKCDGD  1865
             +ML IKRVPTVVSNYQ +  E  +    GCGRNCL +CC+  +  PL+AFK  E +  GD
Sbjct  1     MMLKIKRVPTVVSNYQKEEVEGGR--VGGCGRNCLNKCCVQGAKFPLYAFKK-EKEVPGD  57

Query  1864  WNYLSY--GECPISFLSDLLLGQWEERMSRGLFRYDVTSCETKIIPGTFGFIAQLNEGRH  1691
                L +   E P++FL  LLLG+WE+RM RGLFRYDVT+CETK+IPG  GFIAQLNEGRH
Sbjct  58    RALLGHVEREPPVAFLDSLLLGEWEDRMQRGLFRYDVTACETKVIPGECGFIAQLNEGRH  117

Query  1690  LKKRPTEFRVDQVLQPFDENKFNFTKIGQEEVLFRFEPSNDCKSHYLPSGLVDARSGSPT  1511
             LKKRPTEFRVD+VLQPFD +KFNFTK+GQEEVLF+FE S D ++ + P+  +D  S SP+
Sbjct  118   LKKRPTEFRVDKVLQPFDGSKFNFTKVGQEEVLFQFEASVDGEAQFFPNAPIDVES-SPS  176

Query  1510  VLAINVSPIEYGHVLLIPRVLDCLPQRIDHDSFFVAMHLAKEAADPFFRVGYNSLGAFAT  1331
             V+AINVSPIEYGHVLLIPRVL+CLPQRID  SF +A+++A EA +P+FR+GYNSLGAFAT
Sbjct  177   VVAINVSPIEYGHVLLIPRVLECLPQRIDRASFLLALYMASEAGNPYFRLGYNSLGAFAT  236

Query  1330  INHLHFQAYYLQVPFPVEKTPTREIMRGREQGDGGIVVSQLLNYPARALLFEGGSTVRDL  1151
             INHLHFQAYYL VPFPVEK  TR I       D G+ VS+L+NYP R L++EGG+T++DL
Sbjct  237   INHLHFQAYYLAVPFPVEKASTRNIT----ALDSGVNVSELVNYPVRGLVYEGGNTIQDL  292

Query  1150  SDAVANSCISLQNNNIPFNLLISERGNKVFLFPQVHSNSVFL  1025
             ++AV++SCI LQ+NNIP+N+LIS+ G ++FLFPQ ++    L
Sbjct  293   ANAVSDSCICLQDNNIPYNVLISDCGKRIFLFPQCYAEKQAL  334


 Score =   113 bits (282),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 57/101 (56%), Positives = 72/101 (71%), Gaps = 1/101 (1%)
 Frame = -2

Query  759  FSKCYAEKQACGKIDQEILDTWVNPAVWEISGHMVLKRREDYDDASEDYAWRLLSEVSLS  580
            F +CYAEKQA G++D E+LDT VNPAVWEISGHMVLKR++DY++ASE+ AWRLL+EVSLS
Sbjct  324  FPQCYAEKQALGEVDAEVLDTQVNPAVWEISGHMVLKRKKDYEEASEENAWRLLAEVSLS  383

Query  579  EERFEEVKAYVSRAADLLLDSECSNGGSQPWETYPEASWTA  457
            EERF EV   +  A    +D    +   +P    P A + A
Sbjct  384  EERFREVSDLIFEAISCSIDDVAPSSLDEP-NAEPLADFAA  423



>gb|KHF98732.1| GDP-L-galactose phosphorylase 1 -like protein [Gossypium arboreum]
Length=442

 Score =   440 bits (1131),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 205/341 (60%), Positives = 267/341 (78%), Gaps = 8/341 (2%)
 Frame = -1

Query  2047  ILMLTIKRVPTVVSNYQDDAPEDSKPESLGCGRNCLGQCCLPVSCLPLFAFKNDEHKCDG  1868
             ++ L+IKRVPTVVSNYQ D  E++   S GCG+NCL  CC+  + LPL+AFK +  K   
Sbjct  1     MMQLSIKRVPTVVSNYQKDEAEETARRSGGCGKNCLRNCCISGAKLPLYAFKKESEK---  57

Query  1867  DWNYLSYGECPISFLSDLLLGQWEERMSRGLFRYDVTSCETKIIPGTFGFIAQLNEGRHL  1688
             D       E P++FL  L+LG+WE+RM RGLFRYDVT+CETK+IPG +GFIAQLNEGRHL
Sbjct  58    DAFESDNKEPPVAFLDSLVLGEWEDRMQRGLFRYDVTACETKVIPGEYGFIAQLNEGRHL  117

Query  1687  KKRPTEFRVDQVLQPFDENKFNFTKIGQEEVLFRFEPSNDCKSHYLPSGLVDARSGSPTV  1508
             KKRPTEFRVD+VLQPFD NKFNFTK+GQEEVLF+FE S D +  + P+  +D  +  P+V
Sbjct  118   KKRPTEFRVDKVLQPFDGNKFNFTKVGQEEVLFQFEASEDGEVQFFPNAPIDVEN-HPSV  176

Query  1507  LAINVSPIEYGHVLLIPRVLDCLPQRIDHDSFFVAMHLAKEAADPFFRVGYNSLGAFATI  1328
             +AINVSPIEYGHVLLIPR+L+CLPQRID +SF + +++A EA +P+FR+GYNSLGAFATI
Sbjct  177   VAINVSPIEYGHVLLIPRILECLPQRIDRESFLLVLYMAAEAGNPYFRLGYNSLGAFATI  236

Query  1327  NHLHFQAYYLQVPFPVEKTPTREIMRGREQGDGGIVVSQLLNYPARALLFEGGSTVRDLS  1148
             NHLHFQAYYL V FP+EK PT++I    +    G+++S+LL YP R ++FEGG+T++DLS
Sbjct  237   NHLHFQAYYLAVAFPIEKAPTKKITTLND----GVIISELLKYPVRGVVFEGGNTLQDLS  292

Query  1147  DAVANSCISLQNNNIPFNLLISERGNKVFLFPQVHSNSVFL  1025
             D V+++CI LQ+NNI +N+LIS+ G ++FL PQ ++    L
Sbjct  293   DTVSDACICLQDNNIAYNVLISDCGKRIFLLPQCYAEKQAL  333


 Score =   111 bits (277),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 51/74 (69%), Positives = 63/74 (85%), Gaps = 0/74 (0%)
 Frame = -2

Query  759  FSKCYAEKQACGKIDQEILDTWVNPAVWEISGHMVLKRREDYDDASEDYAWRLLSEVSLS  580
              +CYAEKQA G++  E+LDT VNPAVWEISGHMVLKRR+DYD+AS++ AWRLL+EVSLS
Sbjct  323  LPQCYAEKQALGEVSVELLDTQVNPAVWEISGHMVLKRRKDYDEASDENAWRLLAEVSLS  382

Query  579  EERFEEVKAYVSRA  538
            +ERF+EV A +  A
Sbjct  383  DERFDEVNALIFEA  396



>gb|EMT04185.1| hypothetical protein F775_27680 [Aegilops tauschii]
Length=430

 Score =   439 bits (1130),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 213/335 (64%), Positives = 259/335 (77%), Gaps = 8/335 (2%)
 Frame = -1

Query  2044  LMLTIKRVPTVVSNYQDDAPEDSKPESLGCGRNCLGQCCLPVSCLPLFAFKNDEHKCDGD  1865
             + LTIKRVPTVVSNYQ+DA E  +P   GCGRNCLG CCLPVS LP++AFK +  K    
Sbjct  1     MKLTIKRVPTVVSNYQEDAGE--RPRG-GCGRNCLGHCCLPVSELPVYAFKANPTKLP--  55

Query  1864  WNYLSYGECPISFLSDLLLGQWEERMSRGLFRYDVTSCETKIIPGTFGFIAQLNEGRHLK  1685
                L     P  F  +LLLGQWE+RM++GLFRYDVT+CETK+IPG  GF+AQLNEGRHLK
Sbjct  56    ---LQEDAVPTDFFINLLLGQWEDRMTQGLFRYDVTACETKVIPGNLGFVAQLNEGRHLK  112

Query  1684  KRPTEFRVDQVLQPFDENKFNFTKIGQEEVLFRFEPSNDCKSHYLPSGLVDARSGSPTVL  1505
             KRPTEFRVD+VLQPFD  KFNFTK+GQEE LF+FE S    S++L S        +P V+
Sbjct  113   KRPTEFRVDRVLQPFDSAKFNFTKVGQEEALFQFENSGSDDSYFLRSAAATVADRAPNVV  172

Query  1504  AINVSPIEYGHVLLIPRVLDCLPQRIDHDSFFVAMHLAKEAADPFFRVGYNSLGAFATIN  1325
             AINVSPIEYGHVLLIPRVLD LPQRID +SF +A+H+A EAA P+FR+GYNSLGAFATIN
Sbjct  173   AINVSPIEYGHVLLIPRVLDHLPQRIDQESFLLALHMAAEAASPYFRLGYNSLGAFATIN  232

Query  1324  HLHFQAYYLQVPFPVEKTPTREIMRGREQGDGGIVVSQLLNYPARALLFEGGSTVRDLSD  1145
             HLHFQAYYL VPFPVEK  T+ I         G+ VS+L+NYP R L+FE G+T+ DL++
Sbjct  233   HLHFQAYYLTVPFPVEKAATQRIPLAEGGIKSGVKVSKLMNYPVRGLVFEEGNTLNDLAN  292

Query  1144  AVANSCISLQNNNIPFNLLISERGNKVFLFPQVHS  1040
              V+++CI LQ+NN+P+N+LIS+ G K+FLFPQ ++
Sbjct  293   LVSSACIWLQDNNVPYNVLISDSGRKIFLFPQCYA  327


 Score =   120 bits (300),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 57/78 (73%), Positives = 68/78 (87%), Gaps = 0/78 (0%)
 Frame = -2

Query  759  FSKCYAEKQACGKIDQEILDTWVNPAVWEISGHMVLKRREDYDDASEDYAWRLLSEVSLS  580
            F +CYAEKQA G++ QE+LDT VNPAVWEISGH+VLKRR+DY++ASE  AWRLL+EVSLS
Sbjct  322  FPQCYAEKQALGEVSQELLDTQVNPAVWEISGHIVLKRRDDYEEASEASAWRLLAEVSLS  381

Query  579  EERFEEVKAYVSRAADLL  526
            E RFEEVKAY+  AA L+
Sbjct  382  EARFEEVKAYIFDAACLV  399



>dbj|BAJ86561.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=432

 Score =   439 bits (1130),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 211/335 (63%), Positives = 258/335 (77%), Gaps = 8/335 (2%)
 Frame = -1

Query  2044  LMLTIKRVPTVVSNYQDDAPEDSKPESLGCGRNCLGQCCLPVSCLPLFAFKNDEHKCDGD  1865
             + LTIKRVPTVVSNYQ+DA E  +    GCGRNCLG CCLPVS LP++AFK +  K    
Sbjct  4     MKLTIKRVPTVVSNYQEDAGEQPRG---GCGRNCLGHCCLPVSELPVYAFKANSTKLP--  58

Query  1864  WNYLSYGECPISFLSDLLLGQWEERMSRGLFRYDVTSCETKIIPGTFGFIAQLNEGRHLK  1685
                L     P  F  +LLLGQWE+RM++GLFRYDVT+CETK+IPG  GF+AQLNEGRHLK
Sbjct  59    ---LQKDAVPTDFFINLLLGQWEDRMTQGLFRYDVTACETKVIPGNLGFVAQLNEGRHLK  115

Query  1684  KRPTEFRVDQVLQPFDENKFNFTKIGQEEVLFRFEPSNDCKSHYLPSGLVDARSGSPTVL  1505
             KRPTEFRVD VLQPFD +KFNFTK+GQEEVLF+FE S    S++L S  +     +P V+
Sbjct  116   KRPTEFRVDNVLQPFDSSKFNFTKVGQEEVLFKFENSGTDDSYFLRSAAITVVDRAPNVV  175

Query  1504  AINVSPIEYGHVLLIPRVLDCLPQRIDHDSFFVAMHLAKEAADPFFRVGYNSLGAFATIN  1325
             AINVSPIEYGHVLLIPRVLD L Q ID +SF +A+H+A EAA P+FR+GYNSLGAFATIN
Sbjct  176   AINVSPIEYGHVLLIPRVLDHLSQMIDQESFLLALHMAAEAASPYFRLGYNSLGAFATIN  235

Query  1324  HLHFQAYYLQVPFPVEKTPTREIMRGREQGDGGIVVSQLLNYPARALLFEGGSTVRDLSD  1145
             HLHFQAYYL VPFPVEK  T+ I         G+ VS+L+NYP R L+FE G+T+ DL++
Sbjct  236   HLHFQAYYLTVPFPVEKAATQRISLPEGGMKSGVKVSKLMNYPVRGLVFEEGNTLNDLAN  295

Query  1144  AVANSCISLQNNNIPFNLLISERGNKVFLFPQVHS  1040
              V+++CI LQ+NN+P+N+LIS+ G K+FLFPQ ++
Sbjct  296   VVSSACIWLQDNNVPYNVLISDSGRKIFLFPQCYA  330


 Score =   122 bits (305),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 60/87 (69%), Positives = 72/87 (83%), Gaps = 1/87 (1%)
 Frame = -2

Query  759  FSKCYAEKQACGKIDQEILDTWVNPAVWEISGHMVLKRREDYDDASEDYAWRLLSEVSLS  580
            F +CYAEKQA G++ QE+LDT VNPAVWEISGH+VLKRR+DY++ASE  AWRLL+EVSLS
Sbjct  325  FPQCYAEKQALGEVSQELLDTQVNPAVWEISGHIVLKRRDDYEEASEASAWRLLAEVSLS  384

Query  579  EERFEEVKAYVSRAADLL-LDSECSNG  502
            E RFEEVKAY+  A  L+ L  E +NG
Sbjct  385  EARFEEVKAYIFDATGLVQLQVEETNG  411



>emb|CDY29254.1| BnaC01g19060D [Brassica napus]
Length=433

 Score =   439 bits (1130),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 211/339 (62%), Positives = 267/339 (79%), Gaps = 16/339 (5%)
 Frame = -1

Query  2041  MLTIKRVPTVVSNYQDDAPEDSKPESLGCGRNCLGQCCLPVSCLPLFAFKNDEHKCDGDW  1862
             ML IKRVPTVVSNYQ D   +S  ES+GCGRNCLG CC+  + LPL+A K    K D   
Sbjct  1     MLKIKRVPTVVSNYQKD---ESADESVGCGRNCLGACCINGARLPLYACK----KLDKS-  52

Query  1861  NYLSYGECPISFLSDLLLGQWEERMSRGLFRYDVTSCETKIIPGTFGFIAQLNEGRHLKK  1682
                  GE P++FL  L+LG+WE+R  RGLFRYDVT+CETK+IPG +GF+AQLNEGRHLKK
Sbjct  53    ---GVGEKPVAFLESLVLGEWEDRFQRGLFRYDVTACETKVIPGKYGFVAQLNEGRHLKK  109

Query  1681  RPTEFRVDQVLQPFDENKFNFTKIGQEEVLFRFEPSNDCKSHYLPSGLVDARSGSPTVLA  1502
             RPTEFRVD+VLQ FD NKFNFTK+GQEE+LF+FE   D +  + P   +DA + SP+V+A
Sbjct  110   RPTEFRVDKVLQSFDGNKFNFTKVGQEELLFQFEAGEDSEVQFFPCMPLDAEN-SPSVVA  168

Query  1501  INVSPIEYGHVLLIPRVLDCLPQRIDHDSFFVAMHLAKEAADPFFRVGYNSLGAFATINH  1322
             INVSPIEYGHVLLIPRVLDCLPQRIDH S  +A+H+A EAA+P+FR+GYNSLGAFATINH
Sbjct  169   INVSPIEYGHVLLIPRVLDCLPQRIDHKSLLLALHMAAEAANPYFRLGYNSLGAFATINH  228

Query  1321  LHFQAYYLQVPFPVEKTPTREIMRGREQGDGGIVVSQLLNYPARALLFEGGSTVRDLSDA  1142
             LHFQAYYL +PFP+EK P++++         G+ +S+LL+YP R+LLFEGGS+++DLSD 
Sbjct  229   LHFQAYYLAMPFPLEKAPSKKLTTTA----SGVKISELLSYPVRSLLFEGGSSMQDLSDT  284

Query  1141  VANSCISLQNNNIPFNLLISERGNKVFLFPQVHSNSVFL  1025
             V+++C+ LQ+NNIPFN+LI++ G ++FL PQ ++    L
Sbjct  285   VSDACVCLQSNNIPFNILITDCGRQIFLMPQCYAEKQAL  323


 Score =   108 bits (270),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 50/74 (68%), Positives = 61/74 (82%), Gaps = 0/74 (0%)
 Frame = -2

Query  759  FSKCYAEKQACGKIDQEILDTWVNPAVWEISGHMVLKRREDYDDASEDYAWRLLSEVSLS  580
              +CYAEKQA G++  E+L+T VNPAVWEISGHMVLKR+EDY+ ASE+ AWRLL+E SLS
Sbjct  313  MPQCYAEKQALGEVSPEVLETQVNPAVWEISGHMVLKRKEDYEGASEENAWRLLAEASLS  372

Query  579  EERFEEVKAYVSRA  538
            EERF+EV A +  A
Sbjct  373  EERFKEVNALIFEA  386



>ref|XP_004294401.1| PREDICTED: GDP-L-galactose phosphorylase 1-like [Fragaria vesca 
subsp. vesca]
Length=446

 Score =   440 bits (1131),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 208/342 (61%), Positives = 272/342 (80%), Gaps = 9/342 (3%)
 Frame = -1

Query  2044  LMLTIKRVPTVVSNYQDDAPEDSKPESLGCGRNCLGQCCLPVSCLPLFAFKNDEHKCDGD  1865
             +ML IKRVPTVVSNYQ D  ++ +  + GCGRNCL +CC+  + LPL+AFK  ++   G+
Sbjct  1     MMLKIKRVPTVVSNYQKDEADEGR-RAGGCGRNCLNKCCISGAKLPLYAFKK-QNNSPGE  58

Query  1864  WNYLSY--GECPISFLSDLLLGQWEERMSRGLFRYDVTSCETKIIPGTFGFIAQLNEGRH  1691
               +  +   + P++FL  L+LG+WE+RM +GLFRYDVT+CETK+IPG FGFIAQLNEGRH
Sbjct  59    KGFSGHEKQDAPVAFLDSLVLGEWEDRMQKGLFRYDVTACETKVIPGQFGFIAQLNEGRH  118

Query  1690  LKKRPTEFRVDQVLQPFDENKFNFTKIGQEEVLFRFEPSNDCKSHYLPSGLVDARSGSPT  1511
             LKKRPTEFRVD+VLQPFD +KFNFTK+GQEEVLF+FE S D +  + P+  +D  + SP+
Sbjct  119   LKKRPTEFRVDKVLQPFDGSKFNFTKVGQEEVLFQFEASEDGEVQFHPNAPIDVEN-SPS  177

Query  1510  VLAINVSPIEYGHVLLIPRVLDCLPQRIDHDSFFVAMHLAKEAADPFFRVGYNSLGAFAT  1331
             V+AINVSPIEYGHVLLIPR+L+ LPQRID +SF +A+H+A EA +P+FR+GYNSLGAFAT
Sbjct  178   VVAINVSPIEYGHVLLIPRILESLPQRIDRESFLLALHMAAEAGNPYFRLGYNSLGAFAT  237

Query  1330  INHLHFQAYYLQVPFPVEKTPTREIMRGREQGDGGIVVSQLLNYPARALLFEGGSTVRDL  1151
             INHLHFQAYYL V FP+EK PT++I       DGG+ +S+LLNYP R L+FEGG+T+ DL
Sbjct  238   INHLHFQAYYLAVTFPIEKAPTKKIT----SLDGGVRISELLNYPVRGLVFEGGNTLEDL  293

Query  1150  SDAVANSCISLQNNNIPFNLLISERGNKVFLFPQVHSNSVFL  1025
             S++V+++CI LQ NNIP+N+LIS+ G ++FL PQ ++    L
Sbjct  294   SNSVSDACICLQENNIPYNVLISDCGKRIFLLPQCYAEKQAL  335


 Score =   110 bits (274),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 59/116 (51%), Positives = 79/116 (68%), Gaps = 3/116 (3%)
 Frame = -2

Query  759  FSKCYAEKQACGKIDQEILDTWVNPAVWEISGHMVLKRREDYDDASEDYAWRLLSEVSLS  580
              +CYAEKQA G++  E+LDT VNPAVWEISGHMVLKR++DYD+AS++ AW+LL+EVSLS
Sbjct  325  LPQCYAEKQALGEVRAELLDTQVNPAVWEISGHMVLKRKKDYDEASDENAWKLLAEVSLS  384

Query  579  EERFEEVKAYVSRAADLLLDSECSNGGSQPWETYPEAS--WTATNELSFTSRLSGA  418
            EERF+EV A +  A    +D   +N    P +  P +     A N+ S  + +SG 
Sbjct  385  EERFQEVNALIFGAIASGVDDGNANLLEDP-DVNPRSHDEVNAINKSSHHAMVSGT  439



>ref|NP_001266145.1| GDP-L-galactose phosphorylase [Solanum lycopersicum]
 gb|AFD54988.1| GDP-L-galactose phosphorylase [Solanum lycopersicum]
Length=437

 Score =   439 bits (1130),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 209/348 (60%), Positives = 263/348 (76%), Gaps = 24/348 (7%)
 Frame = -1

Query  2044  LMLTIKRVPTVVSNYQDDAPEDSKPESLGCGRNCLGQCCLPVSCLPLFAFKNDEHKCDGD  1865
             +ML IKRVPT+VSN+Q D  ++      GCGRNCL  CCLP S LPL+ FKN        
Sbjct  1     MMLKIKRVPTLVSNFQKDEADEIAARGAGCGRNCLRNCCLPGSKLPLYGFKN--------  52

Query  1864  WNYLSYG--------ECPISFLSDLLLGQWEERMSRGLFRYDVTSCETKIIPGTFGFIAQ  1709
                LSYG        E PI FL  L+LG+WE+R  +GLFRYDVT+CETK+IPG +GF+AQ
Sbjct  53    ---LSYGKSVADETKESPIDFLESLVLGEWEDRQQKGLFRYDVTACETKVIPGEYGFVAQ  109

Query  1708  LNEGRHLKKRPTEFRVDQVLQPFDENKFNFTKIGQEEVLFRFEPSNDCKSHYLPSGLVDA  1529
             LNEGRHLKKRPTEFRVD+VLQPFD +KFNFTK+GQEE+LF+FE S + +    P   +D 
Sbjct  110   LNEGRHLKKRPTEFRVDKVLQPFDGSKFNFTKVGQEELLFQFEASEEDEVQLYPDAPIDP  169

Query  1528  RSGSPTVLAINVSPIEYGHVLLIPRVLDCLPQRIDHDSFFVAMHLAKEAADPFFRVGYNS  1349
                SP+V+AINVSPIEYGHVLLIP+VL+CLPQRID DSF +A+H+A EAA+P+FR+GYNS
Sbjct  170   EK-SPSVVAINVSPIEYGHVLLIPKVLECLPQRIDRDSFLLALHMAAEAANPYFRLGYNS  228

Query  1348  LGAFATINHLHFQAYYLQVPFPVEKTPTREIMRGREQGDGGIVVSQLLNYPARALLFEGG  1169
             LGAFATINHLHFQAY+L V FP+EK PT++I       D G+ +S++L+YP R L+FEGG
Sbjct  229   LGAFATINHLHFQAYFLAVQFPIEKAPTQKITV----TDAGVKISEMLHYPVRGLVFEGG  284

Query  1168  STVRDLSDAVANSCISLQNNNIPFNLLISERGNKVFLFPQVHSNSVFL  1025
             +T+ DL+D V++SCI LQ NNIP+N+LIS+ G ++FL PQ ++    L
Sbjct  285   NTLEDLADVVSDSCICLQENNIPYNVLISDSGKRIFLLPQCYAEKQAL  332


 Score =   109 bits (272),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 56/116 (48%), Positives = 76/116 (66%), Gaps = 2/116 (2%)
 Frame = -2

Query  759  FSKCYAEKQACGKIDQEILDTWVNPAVWEISGHMVLKRREDYDDASEDYAWRLLSEVSLS  580
              +CYAEKQA G++  E+LDT VNPAVWEISGHMVLKR+EDY+ A+E  AWRLL+EVSLS
Sbjct  322  LPQCYAEKQALGEVSAELLDTQVNPAVWEISGHMVLKRKEDYEGATEANAWRLLAEVSLS  381

Query  579  EERFEEVKAYVSRAADLLL--DSECSNGGSQPWETYPEASWTATNELSFTSRLSGA  418
            E RF+EV A +  A  L +  + + ++G  +  +  P       + L+  S +  A
Sbjct  382  EARFQEVTALIFEAISLSVEENEDGTDGSPEDLDVTPPQPMEEIDGLNTHSTMVPA  437



>ref|XP_011046712.1| PREDICTED: GDP-L-galactose phosphorylase 1 [Populus euphratica]
Length=453

 Score =   440 bits (1131),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 216/340 (64%), Positives = 266/340 (78%), Gaps = 11/340 (3%)
 Frame = -1

Query  2044  LMLTIKRVPTVVSNYQDDAPEDSKPESLGCGRNCLGQCCLPVSCLPLFAFKN-----DEH  1880
             +ML IKRVPTVVSNYQ +  ++      GCGRNCL  CCL  +CLPL+AFK       E 
Sbjct  1     MMLKIKRVPTVVSNYQKEDGDEGSRRGGGCGRNCLQNCCLQDACLPLYAFKKVDSIVSEK  60

Query  1879  KCDGDWNYLSYGECPISFLSDLLLGQWEERMSRGLFRYDVTSCETKIIPGTFGFIAQLNE  1700
             K    + Y   GE P++FL  LLLG+WEERM RGLFRYDVT+CETK+IPG  GFIAQLNE
Sbjct  61    KGVDVFEY-DKGEPPVAFLDSLLLGEWEERMQRGLFRYDVTACETKVIPGQHGFIAQLNE  119

Query  1699  GRHLKKRPTEFRVDQVLQPFDENKFNFTKIGQEEVLFRFEPSNDCKSHYLPSGLVDARSG  1520
             GRHLKKRPTEFRVD+VLQPFD NKFNFTK+GQEEVLF+F  S D +  + P   +D  + 
Sbjct  120   GRHLKKRPTEFRVDKVLQPFDRNKFNFTKVGQEEVLFQFGASEDGEVQFFPDAPIDPEN-  178

Query  1519  SPTVLAINVSPIEYGHVLLIPRVLDCLPQRIDHDSFFVAMHLAKEAADPFFRVGYNSLGA  1340
             SP+++AINVSPIEYGHVLLIPRVLDCLPQRID DSF +A+++A EA +P+FR+GYNSLGA
Sbjct  179   SPSMVAINVSPIEYGHVLLIPRVLDCLPQRIDRDSFMLAIYMAAEAGNPYFRLGYNSLGA  238

Query  1339  FATINHLHFQAYYLQVPFPVEKTPTREIMRGREQGDGGIVVSQLLNYPARALLFEGGSTV  1160
             FATINHLHFQAYYL VPFP+EK PT+EI       DGG+ +S+L+NYP R L+FEGG+ +
Sbjct  239   FATINHLHFQAYYLAVPFPIEKAPTKEIT----ASDGGVKISELVNYPVRGLVFEGGNAL  294

Query  1159  RDLSDAVANSCISLQNNNIPFNLLISERGNKVFLFPQVHS  1040
              DLS+ V+++CI LQ NNIP+N+LI++ GN++FL PQ ++
Sbjct  295   LDLSNVVSDACICLQENNIPYNVLIADCGNRIFLLPQCYA  334


 Score =   110 bits (276),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 51/74 (69%), Positives = 63/74 (85%), Gaps = 0/74 (0%)
 Frame = -2

Query  759  FSKCYAEKQACGKIDQEILDTWVNPAVWEISGHMVLKRREDYDDASEDYAWRLLSEVSLS  580
              +CYAEKQA G++  E+LDT VNPAVWEISGHMVLKR++DY++ASE+ AWRLL+EVSLS
Sbjct  329  LPQCYAEKQALGEVSPELLDTQVNPAVWEISGHMVLKRKKDYEEASEENAWRLLAEVSLS  388

Query  579  EERFEEVKAYVSRA  538
            EERF+EV A +  A
Sbjct  389  EERFQEVTALIFEA  402



>ref|XP_003519588.1| PREDICTED: GDP-L-galactose phosphorylase 1-like [Glycine max]
 gb|KHN38262.1| GDP-L-galactose phosphorylase 1 [Glycine soja]
Length=439

 Score =   439 bits (1129),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 209/335 (62%), Positives = 260/335 (78%), Gaps = 6/335 (2%)
 Frame = -1

Query  2044  LMLTIKRVPTVVSNYQDDAPEDSKPESLGCGRNCLGQCCLPVSCLPLFAFKNDEHKCDGD  1865
             +ML IKRVPTVVSN+Q D   DS     GCGRNCL  CC+P + LPL+ FK      D  
Sbjct  1     MMLKIKRVPTVVSNFQKDDAADSPRPVGGCGRNCLKACCIPDAKLPLYGFKKANIGKDLA  60

Query  1864  WNYLSYGECPISFLSDLLLGQWEERMSRGLFRYDVTSCETKIIPGTFGFIAQLNEGRHLK  1685
              +  + GE P++FL  LLLG+WE+RM RGLFRYDVT+CETK+IPG +GF+AQLNEGRHLK
Sbjct  61    LHACA-GEPPLAFLDSLLLGEWEDRMQRGLFRYDVTACETKVIPGEYGFVAQLNEGRHLK  119

Query  1684  KRPTEFRVDQVLQPFDENKFNFTKIGQEEVLFRFEPSNDCKSHYLPSGLVDARSGSPTVL  1505
             KRPTEFRVD+VLQPFDENKFNFTK+GQEEVLF+FE S D +  + P+  VD    SP+ +
Sbjct  120   KRPTEFRVDKVLQPFDENKFNFTKVGQEEVLFQFEASEDGQVQFFPNAPVDV-DNSPSFV  178

Query  1504  AINVSPIEYGHVLLIPRVLDCLPQRIDHDSFFVAMHLAKEAADPFFRVGYNSLGAFATIN  1325
             AINVSPIEYGHVLLIPR+ +CLPQRID +SF +A+ +A EA +P+FR+GYNSLGAFATIN
Sbjct  179   AINVSPIEYGHVLLIPRIFECLPQRIDRESFLLALQMAVEADNPYFRLGYNSLGAFATIN  238

Query  1324  HLHFQAYYLQVPFPVEKTPTREIMRGREQGDGGIVVSQLLNYPARALLFEGGSTVRDLSD  1145
             HLHFQAYYL +PFP+EK PT+ I       +GG+ +S+LL YP R  +FEGG  + DLS+
Sbjct  239   HLHFQAYYLALPFPIEKAPTKRIA----SVNGGVKISELLKYPVRGFVFEGGEMLEDLSN  294

Query  1144  AVANSCISLQNNNIPFNLLISERGNKVFLFPQVHS  1040
              V+++CI LQNNNIPFN+LIS+ G +V+L PQ ++
Sbjct  295   VVSDACICLQNNNIPFNVLISDCGKQVYLLPQCYA  329


 Score =   111 bits (277),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 52/74 (70%), Positives = 62/74 (84%), Gaps = 0/74 (0%)
 Frame = -2

Query  759  FSKCYAEKQACGKIDQEILDTWVNPAVWEISGHMVLKRREDYDDASEDYAWRLLSEVSLS  580
              +CYAEKQA G+++ E+LDT VNPAVWEISGHMVLKRR+DYD+ASE  AWRLL+EVSLS
Sbjct  324  LPQCYAEKQALGEVNAELLDTQVNPAVWEISGHMVLKRRKDYDEASEGNAWRLLAEVSLS  383

Query  579  EERFEEVKAYVSRA  538
            +ERF+EV   V  A
Sbjct  384  QERFQEVNDLVFEA  397



>ref|XP_010536681.1| PREDICTED: GDP-L-galactose phosphorylase 1-like [Tarenaya hassleriana]
Length=446

 Score =   439 bits (1129),  Expect = 4e-143, Method: Compositional matrix adjust.
 Identities = 208/343 (61%), Positives = 267/343 (78%), Gaps = 7/343 (2%)
 Frame = -1

Query  2041  MLTIKRVPTVVSNYQDDAPEDSKPESLGCGRNCLGQCCLPVSCLPLFAFKNDEHKCDGDW  1862
             ML IKRVPTVVSNYQ +   +      GCGRNCLG+CC+  + LPL+A K  +    G+ 
Sbjct  1     MLKIKRVPTVVSNYQKEETTEEAVRCGGCGRNCLGKCCIDGARLPLYACKKLDKVIAGEK  60

Query  1861  NYLSYG--ECPISFLSDLLLGQWEERMSRGLFRYDVTSCETKIIPGTFGFIAQLNEGRHL  1688
               + +   E P++FL  L+LG+WE+R  RGLFRYDVT+CETK+IPG +GFIAQLNEGRHL
Sbjct  61    LVVRHEDRELPVAFLESLVLGEWEDRFQRGLFRYDVTACETKVIPGKYGFIAQLNEGRHL  120

Query  1687  KKRPTEFRVDQVLQPFDENKFNFTKIGQEEVLFRFEPSNDCKSHYLPSGLVDARSGSPTV  1508
             KKRPTEFRVD+VLQPFD NKFNFTK+GQEEVLF+FE + D ++ + PS  +DA   SP+V
Sbjct  121   KKRPTEFRVDKVLQPFDGNKFNFTKVGQEEVLFQFEATEDGEAQFFPSMPLDA-DNSPSV  179

Query  1507  LAINVSPIEYGHVLLIPRVLDCLPQRIDHDSFFVAMHLAKEAADPFFRVGYNSLGAFATI  1328
             +AINVSPIEYGHVLLIPRVL+CLPQ+IDH SF +A+H+A EA +P+FR+GYNSLGAFATI
Sbjct  180   VAINVSPIEYGHVLLIPRVLECLPQKIDHQSFLLALHMAAEAGNPYFRLGYNSLGAFATI  239

Query  1327  NHLHFQAYYLQVPFPVEKTPTREIMRGREQGDGGIVVSQLLNYPARALLFEGGSTVRDLS  1148
             NHLHFQAYYL +PFP+EK PT++I       + G+ +S+L+++P R  LFEGG++V++LS
Sbjct  240   NHLHFQAYYLAMPFPIEKAPTKKIT----TTETGVKISKLVSFPVRGFLFEGGNSVQNLS  295

Query  1147  DAVANSCISLQNNNIPFNLLISERGNKVFLFPQVHSNSVFLSS  1019
             D V+ +CI LQNNNIPFN+LIS+ G ++FL PQ ++    L  
Sbjct  296   DTVSEACICLQNNNIPFNILISDCGKRIFLLPQCYAEKQALGE  338


 Score =   106 bits (264),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 49/74 (66%), Positives = 61/74 (82%), Gaps = 0/74 (0%)
 Frame = -2

Query  759  FSKCYAEKQACGKIDQEILDTWVNPAVWEISGHMVLKRREDYDDASEDYAWRLLSEVSLS  580
              +CYAEKQA G++  E+LDT VNPAVWEISGHMVLKR++DY++A+E+ AW LL+EVSLS
Sbjct  326  LPQCYAEKQALGEVRPELLDTQVNPAVWEISGHMVLKRKKDYEEATEENAWSLLAEVSLS  385

Query  579  EERFEEVKAYVSRA  538
            E RFEEV A +  A
Sbjct  386  EARFEEVTALIFEA  399



>gb|AGI78464.1| GDP-L-galactose phosphorylase [Camellia sinensis]
Length=452

 Score =   439 bits (1129),  Expect = 4e-143, Method: Compositional matrix adjust.
 Identities = 216/339 (64%), Positives = 273/339 (81%), Gaps = 10/339 (3%)
 Frame = -1

Query  2044  LMLTIKRVPTVVSNYQ-DDAPEDSKPESLGCGRNCLGQCCLPVSCLPLFAFKNDEHKCDG  1868
             +ML IKRVPTVVSNYQ ++A E ++    GCGRNCL  CC+  + LPL+AFK   +K  G
Sbjct  1     MMLRIKRVPTVVSNYQKEEAEEGARRPGGGCGRNCLQNCCILGAKLPLYAFKR-VNKIVG  59

Query  1867  DWNYLS--YGECPISFLSDLLLGQWEERMSRGLFRYDVTSCETKIIPGTFGFIAQLNEGR  1694
             +   ++  Y E  I+FL  LLLG+WE+RM RGLFRYDVT+CETK+IPG +GFIAQLNEGR
Sbjct  60    EKGLIAHDYIEPSIAFLDSLLLGEWEDRMQRGLFRYDVTACETKVIPGEYGFIAQLNEGR  119

Query  1693  HLKKRPTEFRVDQVLQPFDENKFNFTKIGQEEVLFRFEPSN-DCKSHYLPSGLVDARSGS  1517
             HLKKRPTEFRVD+VLQPFD NKFNFTK+GQEEVLF+FE S+ D ++ + P+  +D  + S
Sbjct  120   HLKKRPTEFRVDKVLQPFDGNKFNFTKVGQEEVLFQFEASDEDNETQFFPNAPIDVVN-S  178

Query  1516  PTVLAINVSPIEYGHVLLIPRVLDCLPQRIDHDSFFVAMHLAKEAADPFFRVGYNSLGAF  1337
             P+V+AINVSPIEYGHVLLIP +L+CLPQRID  SF +A+++A EA +P+FR+GYNSLGAF
Sbjct  179   PSVVAINVSPIEYGHVLLIPWILECLPQRIDRVSFLLALYMAAEAGNPYFRLGYNSLGAF  238

Query  1336  ATINHLHFQAYYLQVPFPVEKTPTREIMRGREQGDGGIVVSQLLNYPARALLFEGGSTVR  1157
             ATINHLHFQAYYL VPFP+EK PT +I       +GG+  S+LLNYP R L+FEGG+T+ 
Sbjct  239   ATINHLHFQAYYLAVPFPIEKAPTVKIT----DLNGGVKTSELLNYPIRGLVFEGGNTLE  294

Query  1156  DLSDAVANSCISLQNNNIPFNLLISERGNKVFLFPQVHS  1040
             DLS+AV+NSCI LQ+NNIP+N+LIS+ G ++FLFPQ ++
Sbjct  295   DLSNAVSNSCICLQDNNIPYNVLISDSGKRIFLFPQCYA  333


 Score =   114 bits (284),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 52/74 (70%), Positives = 65/74 (88%), Gaps = 0/74 (0%)
 Frame = -2

Query  759  FSKCYAEKQACGKIDQEILDTWVNPAVWEISGHMVLKRREDYDDASEDYAWRLLSEVSLS  580
            F +CYAEKQA G++  E+LDT VNPAVWEISGHMVLKR++DY++ASE+ AWRLL+EVSLS
Sbjct  328  FPQCYAEKQALGEVSSELLDTQVNPAVWEISGHMVLKRKKDYEEASEENAWRLLAEVSLS  387

Query  579  EERFEEVKAYVSRA  538
            ++RFEEVKA +  A
Sbjct  388  KDRFEEVKALIFEA  401



>ref|XP_002278339.1| PREDICTED: GDP-L-galactose phosphorylase 2 [Vitis vinifera]
Length=452

 Score =   439 bits (1129),  Expect = 5e-143, Method: Compositional matrix adjust.
 Identities = 209/345 (61%), Positives = 264/345 (77%), Gaps = 14/345 (4%)
 Frame = -1

Query  2038  LTIKRVPTVVSNYQDDAPEDSKPESLGCGRNCLGQCCLPVSCLPLFAFKN-----DEHKC  1874
             L IKRVPTVVSNYQ +  +D   +  GCGRNCL QCC+  + LPL+A+K      +E   
Sbjct  4     LRIKRVPTVVSNYQKEDSDDGARQVGGCGRNCLKQCCIQGAKLPLYAYKKVKDVVNEKAS  63

Query  1873  DGDWNYLSYGECPISFLSDLLLGQWEERMSRGLFRYDVTSCETKIIPGTFGFIAQLNEGR  1694
              GD N     E P+ FL  L+LG+WE+RM +GLFRYDVT+CETK+IPG +GFIAQLNEGR
Sbjct  64    SGDEN----KEQPVPFLDSLVLGEWEDRMQKGLFRYDVTACETKVIPGEYGFIAQLNEGR  119

Query  1693  HLKKRPTEFRVDQVLQPFDENKFNFTKIGQEEVLFRFEPSNDCKSHYLPSGLVDARSGSP  1514
             HLKKRPTEFRVD+VLQPFD NKFNFTK+GQEEVLF+FEPSND +  ++P+  +D  + S 
Sbjct  120   HLKKRPTEFRVDKVLQPFDGNKFNFTKVGQEEVLFQFEPSNDEEPEFIPNAPIDVEN-ST  178

Query  1513  TVLAINVSPIEYGHVLLIPRVLDCLPQRIDHDSFFVAMHLAKEAADPFFRVGYNSLGAFA  1334
             +V+AINVSPIEYGHVLLIPR+ +CLPQRID +SF +A+ +A EA +P+FR+GYNSLGAFA
Sbjct  179   SVVAINVSPIEYGHVLLIPRIFECLPQRIDRESFLLALDMAVEAGNPYFRLGYNSLGAFA  238

Query  1333  TINHLHFQAYYLQVPFPVEKTPTREIMRGREQGDGGIVVSQLLNYPARALLFEGGSTVRD  1154
             TINHLHFQAYYL  PFP+EK PTR+I         G+ + +LL YP R L+FEGG T++D
Sbjct  239   TINHLHFQAYYLATPFPIEKAPTRKIT----TAGNGVKIFELLKYPVRGLVFEGGDTLQD  294

Query  1153  LSDAVANSCISLQNNNIPFNLLISERGNKVFLFPQVHSNSVFLSS  1019
             L++ VA+SCI LQ+NNIPFN+LI++ G ++FLF Q ++    L  
Sbjct  295   LANTVADSCICLQDNNIPFNVLIADAGKRIFLFAQCYAEKQALGE  339


 Score =   115 bits (288),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 52/74 (70%), Positives = 65/74 (88%), Gaps = 0/74 (0%)
 Frame = -2

Query  759  FSKCYAEKQACGKIDQEILDTWVNPAVWEISGHMVLKRREDYDDASEDYAWRLLSEVSLS  580
            F++CYAEKQA G+++QE+LDT VNPAVWE+SGH+VLKR+EDY+ ASE  AWRLL+EVSLS
Sbjct  327  FAQCYAEKQALGEVNQELLDTQVNPAVWEVSGHIVLKRKEDYEGASEQNAWRLLAEVSLS  386

Query  579  EERFEEVKAYVSRA  538
            EERF+EV A +  A
Sbjct  387  EERFQEVNALIFEA  400



>ref|XP_002442954.1| hypothetical protein SORBIDRAFT_08g005410 [Sorghum bicolor]
 gb|EES16792.1| hypothetical protein SORBIDRAFT_08g005410 [Sorghum bicolor]
Length=435

 Score =   438 bits (1127),  Expect = 6e-143, Method: Compositional matrix adjust.
 Identities = 212/335 (63%), Positives = 260/335 (78%), Gaps = 10/335 (3%)
 Frame = -1

Query  2044  LMLTIKRVPTVVSNYQDDAPEDSKPESLGCGRNCLGQCCLPVSCLPLFAFKNDEHKCDGD  1865
             + LTIKRVPTVVSNYQDDA    KP + GCGRNCLG CCLP S LPL+AFK +  K   +
Sbjct  3     MKLTIKRVPTVVSNYQDDA---DKPRA-GCGRNCLGDCCLPASKLPLYAFKLNPAKRSQE  58

Query  1864  WNYLSYGECPISFLSDLLLGQWEERMSRGLFRYDVTSCETKIIPGTFGFIAQLNEGRHLK  1685
                   G      L D+LL +WE+RM+RGLFRYDVT+CETK+IPG  GF+AQLNEGRHLK
Sbjct  59    ------GAASTKLLVDILLSEWEDRMARGLFRYDVTACETKVIPGNLGFVAQLNEGRHLK  112

Query  1684  KRPTEFRVDQVLQPFDENKFNFTKIGQEEVLFRFEPSNDCKSHYLPSGLVDARSGSPTVL  1505
             KRPTEFRVD+VLQPFD  KFNFTK+GQEEVLF+FE  +   S++L    + A   +P V+
Sbjct  113   KRPTEFRVDRVLQPFDPAKFNFTKVGQEEVLFQFENGDGDDSYFLNDAPIIAVDRAPNVV  172

Query  1504  AINVSPIEYGHVLLIPRVLDCLPQRIDHDSFFVAMHLAKEAADPFFRVGYNSLGAFATIN  1325
             AINVSPIEYGHVLLIPRVLD LPQ+ID +SF +A+ +A EAA P+FR+GYNSLGAFATIN
Sbjct  173   AINVSPIEYGHVLLIPRVLDRLPQKIDPESFLLALQMAAEAASPYFRLGYNSLGAFATIN  232

Query  1324  HLHFQAYYLQVPFPVEKTPTREIMRGREQGDGGIVVSQLLNYPARALLFEGGSTVRDLSD  1145
             HLHFQAYYL VPFPVEK  T +I    +    G+ VS+L+NYP R L+FEGG+T+ DL++
Sbjct  233   HLHFQAYYLSVPFPVEKAATLKIPLSEDTMKNGVTVSKLINYPVRGLVFEGGNTLEDLAN  292

Query  1144  AVANSCISLQNNNIPFNLLISERGNKVFLFPQVHS  1040
              V+N+CI LQ+NN+P+N+LIS+ G +VFLFPQ ++
Sbjct  293   VVSNACIWLQDNNVPYNVLISDCGKRVFLFPQCYA  327


 Score =   124 bits (310),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 58/79 (73%), Positives = 69/79 (87%), Gaps = 0/79 (0%)
 Frame = -2

Query  759  FSKCYAEKQACGKIDQEILDTWVNPAVWEISGHMVLKRREDYDDASEDYAWRLLSEVSLS  580
            F +CYAEKQA G++ QE+LDT VNPAVWEISGH+VLKRR DY++ASE  AW+LL+EVSLS
Sbjct  322  FPQCYAEKQALGEVSQELLDTQVNPAVWEISGHIVLKRRSDYEEASETSAWKLLAEVSLS  381

Query  579  EERFEEVKAYVSRAADLLL  523
            EERFEEVKAY+  AA L+L
Sbjct  382  EERFEEVKAYIFSAAGLVL  400



>ref|XP_002530359.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF32020.1| conserved hypothetical protein [Ricinus communis]
Length=453

 Score =   439 bits (1128),  Expect = 7e-143, Method: Compositional matrix adjust.
 Identities = 220/411 (54%), Positives = 293/411 (71%), Gaps = 11/411 (3%)
 Frame = -1

Query  2041  MLTIKRVPTVVSNYQDDAPEDSKPESLGCGRNCLGQCCLPVSCLPLFAFKN-DEHKCDGD  1865
             ML+IKRVPTVVSN+Q D  ED   +S GCGRNCL +CC+  + LPL+AFK  D+   + +
Sbjct  6     MLSIKRVPTVVSNFQKDEAEDGGKKSGGCGRNCLQKCCIQGAKLPLYAFKRVDKIVSEKE  65

Query  1864  WNYLSYGECPISFLSDLLLGQWEERMSRGLFRYDVTSCETKIIPGTFGFIAQLNEGRHLK  1685
                    E P++FL  LLLG+WEER+ RGLFRYDVT+CETK+IPG +GFIAQLNEGRHLK
Sbjct  66    VIEHENTEPPVAFLDSLLLGEWEERVQRGLFRYDVTACETKVIPGQYGFIAQLNEGRHLK  125

Query  1684  KRPTEFRVDQVLQPFDENKFNFTKIGQEEVLFRFEPSNDCKSHYLPSGLVDARSGSPTVL  1505
             KRPTEFRVD+VLQPFD NKFNFTK+GQEEVLF+FE S D    + PS  +D ++ SP+V+
Sbjct  126   KRPTEFRVDKVLQPFDGNKFNFTKVGQEEVLFQFEASEDGDIQFFPSAPIDLKN-SPSVV  184

Query  1504  AINVSPIEYGHVLLIPRVLDCLPQRIDHDSFFVAMHLAKEAADPFFRVGYNSLGAFATIN  1325
             AINVSPIEYGHVLLIPR+L+CLPQRID +S  +A+++A EA +P+FR+GYNSLGAFATIN
Sbjct  185   AINVSPIEYGHVLLIPRILECLPQRIDRESLLLALYMAAEAGNPYFRLGYNSLGAFATIN  244

Query  1324  HLHFQAYYLQVPFPVEKTPTREIMRGREQGDGGIVVSQLLNYPARALLFEGGSTVRDLSD  1145
             HLHFQAYYL + FP+EK PT +I       D G+ +S+L+NYP R LLFE G+T++DLS 
Sbjct  245   HLHFQAYYLAMQFPIEKAPTNKIAT----LDSGVKISELVNYPVRGLLFEDGNTLQDLSS  300

Query  1144  AVANSCISLQNNNIPFNLLISERGNKVFLFPQVHSNSVFLSSREFSIYVSR*NVHFSSVK  965
              ++++CI LQ+N+IP+N+LIS+ G ++FL PQ ++    L      +  ++ N     + 
Sbjct  301   TISDACICLQDNSIPYNVLISDCGKRLFLLPQCYAEKQALGEVSPELLETQVNPAVWEIS  360

Query  964   F*KYGNMVCLIACSFEVV*SLHGFR*LSVAFINDMLNFRSMEGDIYNQFSY  812
                 G+MV      +E     + +R LS   +++   F+ +   I+   SY
Sbjct  361   ----GHMVLKRKEDYEEASEENAWRLLSEVSLSEA-RFQEVNALIFEAISY  406


 Score =   110 bits (274),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 51/74 (69%), Positives = 62/74 (84%), Gaps = 0/74 (0%)
 Frame = -2

Query  759  FSKCYAEKQACGKIDQEILDTWVNPAVWEISGHMVLKRREDYDDASEDYAWRLLSEVSLS  580
              +CYAEKQA G++  E+L+T VNPAVWEISGHMVLKR+EDY++ASE+ AWRLLSEVSLS
Sbjct  330  LPQCYAEKQALGEVSPELLETQVNPAVWEISGHMVLKRKEDYEEASEENAWRLLSEVSLS  389

Query  579  EERFEEVKAYVSRA  538
            E RF+EV A +  A
Sbjct  390  EARFQEVNALIFEA  403



>gb|AEN69451.1| VTC [Vitis pseudoreticulata]
Length=452

 Score =   439 bits (1128),  Expect = 7e-143, Method: Compositional matrix adjust.
 Identities = 209/345 (61%), Positives = 263/345 (76%), Gaps = 14/345 (4%)
 Frame = -1

Query  2038  LTIKRVPTVVSNYQDDAPEDSKPESLGCGRNCLGQCCLPVSCLPLFAFKN-----DEHKC  1874
             L IKRVPTVVSNYQ +  +D   +  GCGRNCL QCC+  + LPL+A+K      +E   
Sbjct  4     LRIKRVPTVVSNYQKEDSDDGARQVGGCGRNCLKQCCIQGAKLPLYAYKKVRDVVNEKAS  63

Query  1873  DGDWNYLSYGECPISFLSDLLLGQWEERMSRGLFRYDVTSCETKIIPGTFGFIAQLNEGR  1694
              GD N     E P+ FL  L+LG+WE+RM +GLFRYDVT+CETK+IPG +GFIAQLNEGR
Sbjct  64    SGDEN----KEQPVPFLDSLVLGEWEDRMQKGLFRYDVTACETKVIPGEYGFIAQLNEGR  119

Query  1693  HLKKRPTEFRVDQVLQPFDENKFNFTKIGQEEVLFRFEPSNDCKSHYLPSGLVDARSGSP  1514
             HLKKRPTEFRVD+VLQPFD NKFNFTK+GQEEVLF+FEPSND +  ++P   +D  + S 
Sbjct  120   HLKKRPTEFRVDKVLQPFDGNKFNFTKVGQEEVLFQFEPSNDEEPEFIPDAPIDVEN-ST  178

Query  1513  TVLAINVSPIEYGHVLLIPRVLDCLPQRIDHDSFFVAMHLAKEAADPFFRVGYNSLGAFA  1334
             +V+AINVSPIEYGHVLLIPR+ +CLPQRID +SF +A+ +A EA +P+FR+GYNSLGAFA
Sbjct  179   SVVAINVSPIEYGHVLLIPRIFECLPQRIDRESFLLALDMAVEAGNPYFRLGYNSLGAFA  238

Query  1333  TINHLHFQAYYLQVPFPVEKTPTREIMRGREQGDGGIVVSQLLNYPARALLFEGGSTVRD  1154
             TINHLHFQAYYL  PFP+EK PTR+I         G+ + +LL YP R L+FEGG T++D
Sbjct  239   TINHLHFQAYYLATPFPIEKAPTRKIT----TAGNGVKIFELLKYPVRGLVFEGGDTLQD  294

Query  1153  LSDAVANSCISLQNNNIPFNLLISERGNKVFLFPQVHSNSVFLSS  1019
             L++ VA+SCI LQ+NNIPFN+LI++ G ++FLF Q ++    L  
Sbjct  295   LANTVADSCICLQDNNIPFNVLIADAGKRIFLFAQCYAEKQALGE  339


 Score =   115 bits (289),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 52/74 (70%), Positives = 66/74 (89%), Gaps = 0/74 (0%)
 Frame = -2

Query  759  FSKCYAEKQACGKIDQEILDTWVNPAVWEISGHMVLKRREDYDDASEDYAWRLLSEVSLS  580
            F++CYAEKQA G+++QE+LDT VNPAVWE+SGH+VLKR+EDY+ ASE+ AWRLL+EVSLS
Sbjct  327  FAQCYAEKQALGEVNQELLDTQVNPAVWEVSGHIVLKRKEDYEGASEENAWRLLAEVSLS  386

Query  579  EERFEEVKAYVSRA  538
            EERF+EV A +  A
Sbjct  387  EERFQEVNALIFEA  400



>ref|XP_010238642.1| PREDICTED: GDP-L-galactose phosphorylase 2-like [Brachypodium 
distachyon]
Length=437

 Score =   437 bits (1125),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 211/340 (62%), Positives = 259/340 (76%), Gaps = 6/340 (2%)
 Frame = -1

Query  2044  LMLTIKRVPTVVSNYQDDAPEDSKPESLGCGRNCLGQCCLPVSCLPLFAFKNDEHKCDGD  1865
             + LTIKRVPT+VSNYQ++A  + +P   GCG+NCLG CCLPVS LP++AFK +  K    
Sbjct  3     MKLTIKRVPTIVSNYQEEAAAE-RPRG-GCGKNCLGDCCLPVSELPVYAFKANPTKLPAS  60

Query  1864  WNYLSYGECPISFLSDLLLGQWEERMSRGLFRYDVTSCETKIIPGTFGFIAQLNEGRHLK  1685
               +      P +   DLLLGQWE+RM++GLFRYDVT+CETK+IPG  GF+AQLNEGRHLK
Sbjct  61    QEH----AVPSNVFIDLLLGQWEDRMTQGLFRYDVTACETKVIPGNLGFVAQLNEGRHLK  116

Query  1684  KRPTEFRVDQVLQPFDENKFNFTKIGQEEVLFRFEPSNDCKSHYLPSGLVDARSGSPTVL  1505
             KRPTEFRVD+VLQPFD  KFNFTK+GQEEVLF+FE      S++L S        +P V+
Sbjct  117   KRPTEFRVDRVLQPFDAAKFNFTKVGQEEVLFQFENGGGDDSYFLKSAPTTVADRAPNVV  176

Query  1504  AINVSPIEYGHVLLIPRVLDCLPQRIDHDSFFVAMHLAKEAADPFFRVGYNSLGAFATIN  1325
             AINVSPIEYGHVLLIPRVLD LPQRID +S  +A+H+A EAA P+FR+GYNSLGAFATIN
Sbjct  177   AINVSPIEYGHVLLIPRVLDRLPQRIDQESLLLALHMAAEAASPYFRLGYNSLGAFATIN  236

Query  1324  HLHFQAYYLQVPFPVEKTPTREIMRGREQGDGGIVVSQLLNYPARALLFEGGSTVRDLSD  1145
             HLHFQAYYL VPFPVEK  T+ I    +    G+ VS+L+NYP R L+FEGG+T+ DL+D
Sbjct  237   HLHFQAYYLTVPFPVEKAATQRIPLADDGMKSGVKVSKLMNYPVRGLVFEGGNTLNDLAD  296

Query  1144  AVANSCISLQNNNIPFNLLISERGNKVFLFPQVHSNSVFL  1025
              V+ +CI LQ NN+P+N+LIS+ G KVFLFPQ ++    L
Sbjct  297   VVSGACIWLQENNVPYNVLISDCGRKVFLFPQCYAEKQAL  336


 Score =   121 bits (304),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 57/78 (73%), Positives = 68/78 (87%), Gaps = 0/78 (0%)
 Frame = -2

Query  759  FSKCYAEKQACGKIDQEILDTWVNPAVWEISGHMVLKRREDYDDASEDYAWRLLSEVSLS  580
            F +CYAEKQA G++ QE+LDT VNPAVWEISGH+VLKRR+DY++ASE  AWRLL+EVSLS
Sbjct  326  FPQCYAEKQALGEVSQELLDTQVNPAVWEISGHIVLKRRDDYEEASEASAWRLLAEVSLS  385

Query  579  EERFEEVKAYVSRAADLL  526
            E RFEEVKAY+  AA L+
Sbjct  386  ESRFEEVKAYIFDAAGLV  403



>ref|NP_001275300.1| GDP-L-galactose phosphorylase 1-like [Solanum tuberosum]
 gb|AEQ64271.1| VTC2-like protein A [Solanum tuberosum]
Length=438

 Score =   437 bits (1125),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 208/349 (60%), Positives = 264/349 (76%), Gaps = 25/349 (7%)
 Frame = -1

Query  2044  LMLTIKRVPTVVSNYQDDAPEDSKPESLGCGRNCLGQCCLPVSCLPLFAFKNDEHKCDGD  1865
             +ML IKRVPT+VSN+Q D  ++      GCGRNCL  CCLP S LPL+ FKN        
Sbjct  1     MMLKIKRVPTLVSNFQKDEADEIGARGAGCGRNCLRNCCLPGSKLPLYGFKN--------  52

Query  1864  WNYLSYG---------ECPISFLSDLLLGQWEERMSRGLFRYDVTSCETKIIPGTFGFIA  1712
                LSYG         E PI FL  L+LG+WE+R  +GLFRYDVT+CETK+IPG +GF+A
Sbjct  53    ---LSYGKSVAADETKESPIDFLESLVLGEWEDRQQKGLFRYDVTACETKVIPGEYGFVA  109

Query  1711  QLNEGRHLKKRPTEFRVDQVLQPFDENKFNFTKIGQEEVLFRFEPSNDCKSHYLPSGLVD  1532
             QLNEGRHLKKRPTEFRVD+VLQPFD +KFNFTK+GQEE+LF+FE S + +    P+  +D
Sbjct  110   QLNEGRHLKKRPTEFRVDKVLQPFDGSKFNFTKVGQEELLFQFEASEEDEVQLYPNAPID  169

Query  1531  ARSGSPTVLAINVSPIEYGHVLLIPRVLDCLPQRIDHDSFFVAMHLAKEAADPFFRVGYN  1352
                 SP+V+AINVSPIEYGHVLLIP+VL+CLPQRID DSF +A+H+A EAA+P+FR+GYN
Sbjct  170   PEK-SPSVIAINVSPIEYGHVLLIPKVLECLPQRIDRDSFLLALHMAAEAANPYFRLGYN  228

Query  1351  SLGAFATINHLHFQAYYLQVPFPVEKTPTREIMRGREQGDGGIVVSQLLNYPARALLFEG  1172
             SLGAFATINHLHFQAY+L V FP+EK PT++I       D G+ +S++LNYP R L+FEG
Sbjct  229   SLGAFATINHLHFQAYFLAVQFPIEKAPTQKITV----TDTGVKISEMLNYPVRGLVFEG  284

Query  1171  GSTVRDLSDAVANSCISLQNNNIPFNLLISERGNKVFLFPQVHSNSVFL  1025
             G+T+ DL++ V++SCI LQ NNIP+N+LIS+ G ++F+ PQ ++    L
Sbjct  285   GNTLEDLANVVSDSCICLQENNIPYNVLISDSGKRIFILPQCYAEKQAL  333


 Score =   111 bits (278),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 55/89 (62%), Positives = 69/89 (78%), Gaps = 1/89 (1%)
 Frame = -2

Query  759  FSKCYAEKQACGKIDQEILDTWVNPAVWEISGHMVLKRREDYDDASEDYAWRLLSEVSLS  580
              +CYAEKQA G++  E+LDT VNPAVWEISGHMVLKR+EDY+ A+E  AWRLL+EVSLS
Sbjct  323  LPQCYAEKQALGEVSAELLDTQVNPAVWEISGHMVLKRKEDYEGATEANAWRLLAEVSLS  382

Query  579  EERFEEVKAYVSRAADLLL-DSECSNGGS  496
            E RF+EV A +  A  L + ++E +N GS
Sbjct  383  EARFQEVTALIFEAISLSVEENENANDGS  411



>gb|KCW52117.1| hypothetical protein EUGRSUZ_J01552 [Eucalyptus grandis]
Length=434

 Score =   437 bits (1124),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 224/342 (65%), Positives = 256/342 (75%), Gaps = 27/342 (8%)
 Frame = -1

Query  2041  MLTIKRVPTVVSNYQDDAPEDSKP-----ESLGCGRNCLGQCCLPVSCLPLFAFKNDEHK  1877
             MLTIKRV TVVSNYQ+   +D+       E+ GCGRNCLG+CCLP S LPL+ FK     
Sbjct  1     MLTIKRVATVVSNYQEGGEKDNAAVAVEGETKGCGRNCLGKCCLPASDLPLYTFKVARED  60

Query  1876  CDGDWNYLSYGECP-ISFLSDLLLGQWEERMSRGLFRYDVTSCETKIIPGTFGFIAQLNE  1700
             C  +   + Y E P  SFL +LLLGQWE RM++GLF YDVT+C+TK+IPG +GFI QLNE
Sbjct  61    CTEE--SIFYQEPPETSFLLNLLLGQWENRMNQGLFHYDVTTCKTKVIPGDYGFIVQLNE  118

Query  1699  GRHLKKRPTEFRVDQVLQPFDENKFNFTKIGQEEVLFRFEPSNDCKSHYLPSGLVDARSG  1520
             GRHLKKRPTEFRVDQVLQ FDE KFNFTK+GQEEVLF FE S+DC SH+ PS     +  
Sbjct  119   GRHLKKRPTEFRVDQVLQDFDEKKFNFTKVGQEEVLFMFEQSDDCYSHFFPSAPAIFKPT  178

Query  1519  SPTVLAINVSPIEYGHVLLIPRVLDCLPQRIDHDSFFVAMHLAKEAADPFFRVGYNSLGA  1340
             SP V    VSPIEYGHVLLIPRVLDCLPQRIDH SFF+A+ LAKEAADPFFRVGYNSLGA
Sbjct  179   SPNV----VSPIEYGHVLLIPRVLDCLPQRIDHMSFFLALSLAKEAADPFFRVGYNSLGA  234

Query  1339  FATINHLHFQAYYLQVPFPVEKTPTREIMRGREQGDGGIVVSQLLNYPARALLFEGGSTV  1160
             FATINHLHFQAYYL  PFPVEK PT               + QLL +P R+L+FEGG T+
Sbjct  235   FATINHLHFQAYYLASPFPVEKVPT---------------LRQLLKFPVRSLVFEGGDTL  279

Query  1159  RDLSDAVANSCISLQNNNIPFNLLISERGNKVFLFPQVHSNS  1034
              DLS AVANSCI LQ NNIPFN+LI++ G +VFLFPQ ++  
Sbjct  280   WDLSSAVANSCILLQYNNIPFNILIADCGKRVFLFPQCYAEK  321


 Score =   121 bits (304),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 59/86 (69%), Positives = 72/86 (84%), Gaps = 1/86 (1%)
 Frame = -2

Query  759  FSKCYAEKQACGKIDQEILDTWVNPAVWEISGHMVLKRREDYDDASEDYAWRLLSEVSLS  580
            F +CYAEKQA G++ QE+L+T VNPAVWEI GH+VLKRRED+++ASEDYAWRLL+EVSLS
Sbjct  314  FPQCYAEKQARGEVSQELLETQVNPAVWEIGGHIVLKRREDFENASEDYAWRLLAEVSLS  373

Query  579  EERFEEVKAYVSRAADLL-LDSECSN  505
            EE F EVKA +S AA L  +D+E  N
Sbjct  374  EESFREVKAQISEAAGLCEIDTEAHN  399



>ref|XP_007146508.1| hypothetical protein PHAVU_006G046700g [Phaseolus vulgaris]
 gb|ESW18502.1| hypothetical protein PHAVU_006G046700g [Phaseolus vulgaris]
Length=434

 Score =   437 bits (1123),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 208/340 (61%), Positives = 267/340 (79%), Gaps = 8/340 (2%)
 Frame = -1

Query  2041  MLTIKRVPTVVSNYQDDAPEDSKPESLGCGRNCLGQCCLPVSCLPLFAFKNDEHKCDGDW  1862
             ML+IKRVPTVVSNYQ +  ++S  E  GCGRNCL  CC+  + LPL+A K  +     + 
Sbjct  1     MLSIKRVPTVVSNYQKEGSDESPAE--GCGRNCLKSCCIQGARLPLYACKRGDKIGGKEL  58

Query  1861  NYLSYGE-CPISFLSDLLLGQWEERMSRGLFRYDVTSCETKIIPGTFGFIAQLNEGRHLK  1685
               L   E  P++FL  L+LG+WEERM RGLFRYDVT+CETK+IPG +GFIAQLNEGRHLK
Sbjct  59    PLLGCKEHYPVAFLDSLILGEWEERMQRGLFRYDVTACETKVIPGEYGFIAQLNEGRHLK  118

Query  1684  KRPTEFRVDQVLQPFDENKFNFTKIGQEEVLFRFEPSNDCKSHYLPSGLVDARSGSPTVL  1505
             KRPTEFRVD+VLQPFDE+KFNFTK+GQEEVLF+ EPS+D ++ + P+  +D    SP+ +
Sbjct  119   KRPTEFRVDKVLQPFDESKFNFTKVGQEEVLFQLEPSDDGEAQFSPNAPIDV-DNSPSFV  177

Query  1504  AINVSPIEYGHVLLIPRVLDCLPQRIDHDSFFVAMHLAKEAADPFFRVGYNSLGAFATIN  1325
             AINVSPIEYGHVLLIPR+ +CLPQRIDH+SF +A+ +A EA +P+FR+GYNSLGAFATIN
Sbjct  178   AINVSPIEYGHVLLIPRIFECLPQRIDHESFLLALQMAVEAGNPYFRLGYNSLGAFATIN  237

Query  1324  HLHFQAYYLQVPFPVEKTPTREIMRGREQGDGGIVVSQLLNYPARALLFEGGSTVRDLSD  1145
             HLHFQAYYL +PFP+EK PTR+I        GG+ VS+LL+YP R L+FEGG T+ +L++
Sbjct  238   HLHFQAYYLAMPFPIEKAPTRKIT----TLSGGVKVSKLLHYPVRGLVFEGGHTLENLAN  293

Query  1144  AVANSCISLQNNNIPFNLLISERGNKVFLFPQVHSNSVFL  1025
             AV+ +CI LQ+NN+P+N+LIS+ G ++FL PQ ++    L
Sbjct  294   AVSEACICLQHNNVPYNVLISDCGRQIFLLPQCYAEKQAL  333


 Score =   112 bits (279),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 54/87 (62%), Positives = 69/87 (79%), Gaps = 3/87 (3%)
 Frame = -2

Query  759  FSKCYAEKQACGKIDQEILDTWVNPAVWEISGHMVLKRREDYDDASEDYAWRLLSEVSLS  580
              +CYAEKQA G++  E+L+T VNPAVWEISGHMVLKR++DYD+ASE  AWRLL+EVSLS
Sbjct  323  LPQCYAEKQALGEVSAELLETQVNPAVWEISGHMVLKRKKDYDEASEANAWRLLAEVSLS  382

Query  579  EERFEEVKAYVSRA---ADLLLDSECS  508
            EER+EEV A V +A    D+ +  +C+
Sbjct  383  EERYEEVTALVFQAIASVDMNVKPQCA  409



>gb|KEH33865.1| GDP-L-galactose phosphorylase [Medicago truncatula]
Length=428

 Score =   436 bits (1122),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 208/341 (61%), Positives = 268/341 (79%), Gaps = 16/341 (5%)
 Frame = -1

Query  2041  MLTIKRVPTVVSNYQ--DDAPEDSKPESLGCGRNCLGQCCLPVSCLPLFAFKNDEHKCDG  1868
             ML+IKRVPTVVSNYQ  +DAP +      GCGRNCL  CC+  + LPL+ FK  E K   
Sbjct  1     MLSIKRVPTVVSNYQKDEDAPVN------GCGRNCLKSCCIQEAKLPLYGFKRGEAK---  51

Query  1867  DWNYLSYGECPISFLSDLLLGQWEERMSRGLFRYDVTSCETKIIPGTFGFIAQLNEGRHL  1688
             D + ++  E P++FL  ++LGQWE+RM RGLFRYDVT+CETK+IPG +GFIAQLNEGRHL
Sbjct  52    DLSPIACKERPVAFLDSIILGQWEDRMQRGLFRYDVTACETKVIPGEYGFIAQLNEGRHL  111

Query  1687  KKRPTEFRVDQVLQPFDENKFNFTKIGQEEVLFRFEPSNDCKSHYLPSGLVDARSGSPTV  1508
             KKRPTEFRVD+VLQPFDE KFNFTK+GQEE+LF+F+ S+D ++ + P   +D  + SP+ 
Sbjct  112   KKRPTEFRVDKVLQPFDETKFNFTKVGQEEILFQFKSSSDGETQFFPDAPIDVEN-SPSF  170

Query  1507  LAINVSPIEYGHVLLIPRVLDCLPQRIDHDSFFVAMHLAKEAADPFFRVGYNSLGAFATI  1328
             +AINVSPIEYGHVLLIPR+ +CLPQRIDH +F +A+H+A EA +P+FR+GYNSLGAFATI
Sbjct  171   VAINVSPIEYGHVLLIPRIFECLPQRIDHANFSLALHMAAEAGNPYFRLGYNSLGAFATI  230

Query  1327  NHLHFQAYYLQVPFPVEKTPTREIMRGREQGDGGIVVSQLLNYPARALLFEGGSTVRDLS  1148
             NHLHFQAYYL +PFP+EK  T++I +     +GG+ VS+LLNYP R L+FEGG  + DL+
Sbjct  231   NHLHFQAYYLALPFPIEKASTKKIAK----LNGGVKVSKLLNYPVRGLVFEGGHALDDLA  286

Query  1147  DAVANSCISLQNNNIPFNLLISERGNKVFLFPQVHSNSVFL  1025
             + V+ +CI LQ+NNIP+N+LIS+ G +VFL PQ ++    L
Sbjct  287   NTVSEACICLQHNNIPYNVLISDCGRRVFLLPQCYAEKQAL  327


 Score =   103 bits (258),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 49/74 (66%), Positives = 61/74 (82%), Gaps = 0/74 (0%)
 Frame = -2

Query  759  FSKCYAEKQACGKIDQEILDTWVNPAVWEISGHMVLKRREDYDDASEDYAWRLLSEVSLS  580
              +CYAEKQA G++  E+LDT VNPAVWEISGHMVLKR++D+D+ASE  A  LL+EVSLS
Sbjct  317  LPQCYAEKQALGEVRAELLDTQVNPAVWEISGHMVLKRKKDFDEASEANARELLAEVSLS  376

Query  579  EERFEEVKAYVSRA  538
            +ERFEEV A + +A
Sbjct  377  KERFEEVNALIFQA  390



>gb|ABK96203.1| unknown [Populus trichocarpa]
Length=453

 Score =   437 bits (1124),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 215/340 (63%), Positives = 266/340 (78%), Gaps = 11/340 (3%)
 Frame = -1

Query  2044  LMLTIKRVPTVVSNYQDDAPEDSKPESLGCGRNCLGQCCLPVSCLPLFAFKN-----DEH  1880
             +ML IKRVPTVVSNYQ +   +      GCGRNCL  CCL  +CLPL+AFK       E 
Sbjct  1     MMLRIKRVPTVVSNYQKEDGNEGSRRGGGCGRNCLQNCCLQDACLPLYAFKKVDSIVSEK  60

Query  1879  KCDGDWNYLSYGECPISFLSDLLLGQWEERMSRGLFRYDVTSCETKIIPGTFGFIAQLNE  1700
             K  G + Y   GE P++FL  LLLG+WE+R+ RGLFRYDVT+CETK+IPG  GFIAQLNE
Sbjct  61    KGVGVFEY-DKGEPPVAFLDSLLLGEWEDRVQRGLFRYDVTACETKVIPGQHGFIAQLNE  119

Query  1699  GRHLKKRPTEFRVDQVLQPFDENKFNFTKIGQEEVLFRFEPSNDCKSHYLPSGLVDARSG  1520
             GRHLKKRPTEFRVD+VLQPFD NKFNFTK+GQEEVLF+F  S D +  + P   +D  + 
Sbjct  120   GRHLKKRPTEFRVDKVLQPFDGNKFNFTKVGQEEVLFQFGASEDGEVQFFPDAPIDPEN-  178

Query  1519  SPTVLAINVSPIEYGHVLLIPRVLDCLPQRIDHDSFFVAMHLAKEAADPFFRVGYNSLGA  1340
             SP+++AINVSPIEYGHVLLIPRVLDCLPQRID DSF +A+++A EA +P+FR+GYNSLGA
Sbjct  179   SPSMVAINVSPIEYGHVLLIPRVLDCLPQRIDRDSFMLAIYMAAEAGNPYFRLGYNSLGA  238

Query  1339  FATINHLHFQAYYLQVPFPVEKTPTREIMRGREQGDGGIVVSQLLNYPARALLFEGGSTV  1160
             FATINHLHFQAYYL VPFP+EK PT+EI       DGG+ +S+L+NYP R L+FEGG+ +
Sbjct  239   FATINHLHFQAYYLAVPFPIEKAPTKEIT----TSDGGVKISELVNYPVRGLVFEGGNAL  294

Query  1159  RDLSDAVANSCISLQNNNIPFNLLISERGNKVFLFPQVHS  1040
              DLS+ V+++CI LQ NNIP+N+LI++ GN++FL PQ ++
Sbjct  295   LDLSNGVSDACICLQENNIPYNVLIADCGNRIFLLPQCYA  334


 Score =   110 bits (276),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 51/74 (69%), Positives = 63/74 (85%), Gaps = 0/74 (0%)
 Frame = -2

Query  759  FSKCYAEKQACGKIDQEILDTWVNPAVWEISGHMVLKRREDYDDASEDYAWRLLSEVSLS  580
              +CYAEKQA G++  E+LDT VNPAVWEISGHMVLKR++DY++ASE+ AWRLL+EVSLS
Sbjct  329  LPQCYAEKQALGEVSPELLDTQVNPAVWEISGHMVLKRKKDYEEASEENAWRLLAEVSLS  388

Query  579  EERFEEVKAYVSRA  538
            EERF+EV A +  A
Sbjct  389  EERFQEVTALIFEA  402



>gb|EYU27365.1| hypothetical protein MIMGU_mgv1a006489mg [Erythranthe guttata]
Length=442

 Score =   437 bits (1123),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 210/337 (62%), Positives = 265/337 (79%), Gaps = 11/337 (3%)
 Frame = -1

Query  2044  LMLTIKRVPTVVSNYQDDAPEDSKPESLGCGRNCLGQCCLPVSCLPLFAFKN-DEHKCD-  1871
             +ML IKRVPTVVSNYQ    ED++    GCGRNCL  CCLP S LPL+AFK  ++  C+ 
Sbjct  1     MMLKIKRVPTVVSNYQK---EDAEEGGAGCGRNCLRSCCLPGSKLPLYAFKKANKLVCEK  57

Query  1870  GDWNYLSYGECPISFLSDLLLGQWEERMSRGLFRYDVTSCETKIIPGTFGFIAQLNEGRH  1691
             G ++ ++  E P+ FL  LLLG+WE+R+ RGLFRYDVT+CETK+IPG +GFIAQLNEGRH
Sbjct  58    GSFDSVN-KEPPVEFLDALLLGEWEDRVQRGLFRYDVTACETKVIPGKYGFIAQLNEGRH  116

Query  1690  LKKRPTEFRVDQVLQPFDENKFNFTKIGQEEVLFRFEPSNDCKSHYLPSGLVDARSGSPT  1511
             LKKRPTEFRVD+VLQPFDE KFNFTK+GQEEVLF+FEPS +    + P+  +D  + SP+
Sbjct  117   LKKRPTEFRVDKVLQPFDETKFNFTKVGQEEVLFQFEPSENNHVQFFPNAPIDLEN-SPS  175

Query  1510  VLAINVSPIEYGHVLLIPRVLDCLPQRIDHDSFFVAMHLAKEAADPFFRVGYNSLGAFAT  1331
             V+AINVSPIEYGHVLLIPR+ +CLPQRID +SF +A+H+A EA +P+FR+GYNSLGAFAT
Sbjct  176   VVAINVSPIEYGHVLLIPRIFECLPQRIDRESFLLALHMAVEAGNPYFRLGYNSLGAFAT  235

Query  1330  INHLHFQAYYLQVPFPVEKTPTREIMRGREQGDGGIVVSQLLNYPARALLFEGGSTVRDL  1151
             INHLHFQAYYL  PFP+E+ P+++I         G+ +S +LNYP R L+FE G  + DL
Sbjct  236   INHLHFQAYYLATPFPIERAPSKKIT----TTSNGVEISYILNYPVRGLVFEHGDNIEDL  291

Query  1150  SDAVANSCISLQNNNIPFNLLISERGNKVFLFPQVHS  1040
             S+AV+ SCI LQ NNIP N+LI++ G +VFLFPQ ++
Sbjct  292   SNAVSESCICLQENNIPHNVLIADSGKRVFLFPQCYA  328


 Score =   112 bits (280),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 54/82 (66%), Positives = 64/82 (78%), Gaps = 0/82 (0%)
 Frame = -2

Query  759  FSKCYAEKQACGKIDQEILDTWVNPAVWEISGHMVLKRREDYDDASEDYAWRLLSEVSLS  580
            F +CYAEKQA G++  E+LDT VNPAVWEISGHMVLKR+EDY+ ASE+ AWRLL+EVSLS
Sbjct  323  FPQCYAEKQALGEVSAELLDTQVNPAVWEISGHMVLKRKEDYEGASEENAWRLLAEVSLS  382

Query  579  EERFEEVKAYVSRAADLLLDSE  514
            EER  EVK  +  AA    + E
Sbjct  383  EERLNEVKELIFEAASCFNNVE  404



>gb|ABR16423.1| unknown [Picea sitchensis]
Length=436

 Score =   436 bits (1122),  Expect = 4e-142, Method: Compositional matrix adjust.
 Identities = 219/347 (63%), Positives = 263/347 (76%), Gaps = 13/347 (4%)
 Frame = -1

Query  2041  MLTIKRVPTVVSNYQDDAPEDSKPESLGCGRNCLGQCCLPVSCLPLFAFKNDEHKCDGDW  1862
             MLTIKR PT++SNYQ+ +      E LGCGRNCLGQCC+P S LPL+ FK   H   G+ 
Sbjct  1     MLTIKRCPTILSNYQEGS------EGLGCGRNCLGQCCVPGSKLPLYTFKR-RHTITGEK  53

Query  1861  NYLSYGECP-ISFLSDLLLGQWEERMSRGLFRYDVTSCETKIIPGTFGFIAQLNEGRHLK  1685
                   E   I FL  +LLG+WEERM RGLFRYDVT+CETK+IPG +GFIAQLNEGRHLK
Sbjct  54    YADKDAEVANIPFLDSVLLGEWEERMQRGLFRYDVTTCETKVIPGNYGFIAQLNEGRHLK  113

Query  1684  KRPTEFRVDQVLQPFDENKFNFTKIGQEEVLFRFEPSNDCKSHYLPSGLVDARSGSPTVL  1505
             KRPTEFRVD+VLQ FD +KFNFTK+GQEEVLFRFE S + K  YL   LV     SP V+
Sbjct  114   KRPTEFRVDKVLQDFDPSKFNFTKVGQEEVLFRFEESAENKVQYLEKALV---LDSPNVI  170

Query  1504  AINVSPIEYGHVLLIPRVLDCLPQRIDHDSFFVAMHLAKEAADPFFRVGYNSLGAFATIN  1325
             AINVSPI+YGHVLL+PRVLDCLPQRIDHDS  +AMHLA EA +  FR+GYNSLGAFATIN
Sbjct  171   AINVSPIDYGHVLLVPRVLDCLPQRIDHDSLLLAMHLAAEAGNTSFRLGYNSLGAFATIN  230

Query  1324  HLHFQAYYLQVPFPVEKTPTREIMRGREQGDGGIVVSQLLNYPARALLFEGGSTVRDLSD  1145
             HLHFQAYYL +PFPVEKTPT+      E+  GG+ +S+L NYP R L+FEG +T+ +LS+
Sbjct  231   HLHFQAYYLALPFPVEKTPTKRAPWKSEK--GGVKISELCNYPVRGLVFEGCNTLENLSN  288

Query  1144  AVANSCISLQNNNIPFNLLISERGNKVFLFPQVHSNSVFLSSREFSI  1004
             AV ++CI LQ+NNIP+N+LI++ G +VFLFPQ ++    L   +  I
Sbjct  289   AVGSACICLQDNNIPYNVLIADCGKRVFLFPQCYAEKQALGEVDQEI  335


 Score =   122 bits (305),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 57/75 (76%), Positives = 67/75 (89%), Gaps = 0/75 (0%)
 Frame = -2

Query  759  FSKCYAEKQACGKIDQEILDTWVNPAVWEISGHMVLKRREDYDDASEDYAWRLLSEVSLS  580
            F +CYAEKQA G++DQEILDT VNPAVWEISGH+VLKR++D+D ASEDYA +LL+EVSLS
Sbjct  318  FPQCYAEKQALGEVDQEILDTQVNPAVWEISGHIVLKRKQDFDRASEDYACKLLAEVSLS  377

Query  579  EERFEEVKAYVSRAA  535
            EERFEEVK Y+  AA
Sbjct  378  EERFEEVKDYILEAA  392



>ref|XP_009349354.1| PREDICTED: GDP-L-galactose phosphorylase 1-like [Pyrus x bretschneideri]
Length=447

 Score =   437 bits (1123),  Expect = 4e-142, Method: Compositional matrix adjust.
 Identities = 211/342 (62%), Positives = 263/342 (77%), Gaps = 8/342 (2%)
 Frame = -1

Query  2044  LMLTIKRVPTVVSNYQDDAPEDSKPESLGCGRNCLGQCCLPVSCLPLFAFKNDEHKCDGD  1865
             +ML IKRVPTVVSNYQ D  E+      GCGRNCL QCC+P + LPL+AFK   +  +GD
Sbjct  1     MMLRIKRVPTVVSNYQKDEAEEGARRVEGCGRNCLNQCCIPGAKLPLYAFKK-RNVNNGD  59

Query  1864  WNYLSYG--ECPISFLSDLLLGQWEERMSRGLFRYDVTSCETKIIPGTFGFIAQLNEGRH  1691
                  +   E P++FL  LLLGQWE+RM RGLFRYDVT+CETK+I G +GFIAQLNEGRH
Sbjct  60    TGVPGHDKREPPVAFLDSLLLGQWEDRMQRGLFRYDVTACETKVIGGQYGFIAQLNEGRH  119

Query  1690  LKKRPTEFRVDQVLQPFDENKFNFTKIGQEEVLFRFEPSNDCKSHYLPSGLVDARSGSPT  1511
             LKKRPTEFRVD+VLQPFD +KFNFTK+GQEEVLF+FE S D + H+ PS  +D  + SP+
Sbjct  120   LKKRPTEFRVDKVLQPFDSSKFNFTKVGQEEVLFQFEASEDGEVHFFPSAPIDVEN-SPS  178

Query  1510  VLAINVSPIEYGHVLLIPRVLDCLPQRIDHDSFFVAMHLAKEAADPFFRVGYNSLGAFAT  1331
             V+AINVSPIEYGHVLLIPR+ + LPQRID +S  +A+H+A EA  P+FR+GYNSLGAFAT
Sbjct  179   VVAINVSPIEYGHVLLIPRIFERLPQRIDRESVLLALHMAAEAGSPYFRLGYNSLGAFAT  238

Query  1330  INHLHFQAYYLQVPFPVEKTPTREIMRGREQGDGGIVVSQLLNYPARALLFEGGSTVRDL  1151
             INHLHFQAY+L V FP+EK PT++I       +  + VS+LLNYP R L+FEGG+T+ DL
Sbjct  239   INHLHFQAYFLAVTFPIEKAPTKKI----STLNAEVKVSELLNYPVRGLVFEGGNTMEDL  294

Query  1150  SDAVANSCISLQNNNIPFNLLISERGNKVFLFPQVHSNSVFL  1025
             S  V+++CI LQ NNIP+N+LIS+ G ++FL PQ ++    L
Sbjct  295   SYTVSDACICLQENNIPYNVLISDCGKRIFLLPQCYAEKQAL  336


 Score =   113 bits (283),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 63/121 (52%), Positives = 79/121 (65%), Gaps = 15/121 (12%)
 Frame = -2

Query  759  FSKCYAEKQACGKIDQEILDTWVNPAVWEISGHMVLKRREDYDDASEDYAWRLLSEVSLS  580
              +CYAEKQA G++  EILDT VNPAVWEISGHMVLKR++DYD+AS++ AW+LL+EVSLS
Sbjct  326  LPQCYAEKQALGEVSAEILDTQVNPAVWEISGHMVLKRKKDYDEASDENAWKLLAEVSLS  385

Query  579  EERFEEVKAYV-SRAADLLLDSECSNGGSQPWETYPEASW-------TATNELSFTSRLS  424
            EERF+EV A +  R A         N GS+     PE          T  N+ S T+ +S
Sbjct  386  EERFQEVNALIFERIAS-------GNNGSENLPEDPEVKPRSHEEVDTTINKSSRTAMVS  438

Query  423  G  421
            G
Sbjct  439  G  439



>gb|KFK29192.1| hypothetical protein AALP_AA7G101600 [Arabis alpina]
Length=448

 Score =   437 bits (1123),  Expect = 4e-142, Method: Compositional matrix adjust.
 Identities = 208/334 (62%), Positives = 266/334 (80%), Gaps = 12/334 (4%)
 Frame = -1

Query  2041  MLTIKRVPTVVSNYQDDAPEDSKPESLGCGRNCLGQCCLPVSCLPLFAFKNDEHKCDGDW  1862
             ML IKRVPTVVSNYQ D   +S  ES+GCGRNCLG CC+  + LPL+A K  +    G+ 
Sbjct  1     MLKIKRVPTVVSNYQKD---ESADESVGCGRNCLGACCINGARLPLYACKKLDKSAAGE-  56

Query  1861  NYLSYGECPISFLSDLLLGQWEERMSRGLFRYDVTSCETKIIPGTFGFIAQLNEGRHLKK  1682
                   E P++FL  L+LG+WE+R  RGLFRYDVT+CETK+IPG +GF+AQLNEGRHLKK
Sbjct  57    ---KPVEPPLAFLESLVLGEWEDRFQRGLFRYDVTACETKVIPGKYGFVAQLNEGRHLKK  113

Query  1681  RPTEFRVDQVLQPFDENKFNFTKIGQEEVLFRFEPSNDCKSHYLPSGLVDARSGSPTVLA  1502
             RPTEFRVD+VLQ FD NKFNFTK+GQEE+LF+FE   D +  + P   +DA + SP+V+A
Sbjct  114   RPTEFRVDKVLQSFDANKFNFTKVGQEELLFQFEAGEDGEVQFFPCMPLDAEN-SPSVVA  172

Query  1501  INVSPIEYGHVLLIPRVLDCLPQRIDHDSFFVAMHLAKEAADPFFRVGYNSLGAFATINH  1322
             INVSPIEYGHVLLIPRVLDCLPQRIDH S  +A+H+A EAA+P+FR+GYNSLGAFATINH
Sbjct  173   INVSPIEYGHVLLIPRVLDCLPQRIDHKSLLLALHMAVEAANPYFRLGYNSLGAFATINH  232

Query  1321  LHFQAYYLQVPFPVEKTPTREIMRGREQGDGGIVVSQLLNYPARALLFEGGSTVRDLSDA  1142
             LHFQAYYL +PFP+EK P+R++    +    G+ +S+L+NYP R+LLF+GG ++++LSD 
Sbjct  233   LHFQAYYLAMPFPLEKAPSRKMTTTVK----GVKISELMNYPVRSLLFQGGYSMQNLSDT  288

Query  1141  VANSCISLQNNNIPFNLLISERGNKVFLFPQVHS  1040
             V+++C+ LQNNNIPFN+LIS+ G ++FL PQ ++
Sbjct  289   VSDACVFLQNNNIPFNILISDCGRQIFLMPQCYA  322


 Score =   107 bits (268),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 49/71 (69%), Positives = 60/71 (85%), Gaps = 0/71 (0%)
 Frame = -2

Query  759  FSKCYAEKQACGKIDQEILDTWVNPAVWEISGHMVLKRREDYDDASEDYAWRLLSEVSLS  580
              +CYAEKQA G++  E+L+T VNPAVWEISGHMVLKR+EDY+ ASE+ AWRLL+E SLS
Sbjct  317  MPQCYAEKQALGEVSPEVLETQVNPAVWEISGHMVLKRKEDYEGASEENAWRLLAEASLS  376

Query  579  EERFEEVKAYV  547
            EERF+EV A +
Sbjct  377  EERFKEVNALI  387



>ref|XP_008447718.1| PREDICTED: GDP-L-galactose phosphorylase 1 [Cucumis melo]
Length=452

 Score =   436 bits (1121),  Expect = 7e-142, Method: Compositional matrix adjust.
 Identities = 209/342 (61%), Positives = 271/342 (79%), Gaps = 20/342 (6%)
 Frame = -1

Query  2041  MLTIKRVPTVVSNYQDDAPEDSKPESLGCGRNCLGQCCLPVSCLPLFAFKNDEHKCDGDW  1862
             ML IKRVPTVVSNYQ+D  E+    + GCGRNCL +CC+  + +PL+AFK   +K  G  
Sbjct  1     MLRIKRVPTVVSNYQEDETENVSRRT-GCGRNCLNKCCIEGAKIPLYAFKK-LNKITG--  56

Query  1861  NYLSYGEC--------PISFLSDLLLGQWEERMSRGLFRYDVTSCETKIIPGTFGFIAQL  1706
                S G C        P++FL  LLLG+WE+RM RGLFRYDVT+CETK+IPG +GFIAQL
Sbjct  57    ---SKGLCCEYENSVPPVAFLDSLLLGEWEDRMQRGLFRYDVTACETKVIPGKYGFIAQL  113

Query  1705  NEGRHLKKRPTEFRVDQVLQPFDENKFNFTKIGQEEVLFRFEPSNDCKSHYLPSGLVDAR  1526
             NEGRHLKKRPTEFRVD+VLQPFD NKFNFTK+GQEEVLFRFE + +  + ++P+   D  
Sbjct  114   NEGRHLKKRPTEFRVDKVLQPFDGNKFNFTKVGQEEVLFRFEANENENTQFIPNAAFDVE  173

Query  1525  SGSPTVLAINVSPIEYGHVLLIPRVLDCLPQRIDHDSFFVAMHLAKEAADPFFRVGYNSL  1346
             + SP+V+AINVSPIEYGHVLLIPRVL+CLPQRID +SF +A+H+A EA + +FR+GYNSL
Sbjct  174   N-SPSVVAINVSPIEYGHVLLIPRVLECLPQRIDRESFLLALHMAAEAGNTYFRLGYNSL  232

Query  1345  GAFATINHLHFQAYYLQVPFPVEKTPTREIMRGREQGDGGIVVSQLLNYPARALLFEGGS  1166
             GAFATINHLHFQAYYL VPFP+EK PT++I+  ++    G+++S+LL YP R L+FEGG+
Sbjct  233   GAFATINHLHFQAYYLGVPFPIEKAPTKKIITLKD----GVIISELLKYPVRGLIFEGGN  288

Query  1165  TVRDLSDAVANSCISLQNNNIPFNLLISERGNKVFLFPQVHS  1040
             T++ LS++V+++CI LQ NNIP+N+LI++ G ++FL PQ ++
Sbjct  289   TLQSLSNSVSDACICLQENNIPYNVLIADCGQRIFLLPQCYA  330


 Score =   111 bits (278),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 54/92 (59%), Positives = 68/92 (74%), Gaps = 0/92 (0%)
 Frame = -2

Query  759  FSKCYAEKQACGKIDQEILDTWVNPAVWEISGHMVLKRREDYDDASEDYAWRLLSEVSLS  580
              +CYAEKQA G++  E+LDT VNPAVWEISGHMVLKR++DY++ASE+ AWRLL+EVSLS
Sbjct  325  LPQCYAEKQALGEVSAELLDTQVNPAVWEISGHMVLKRKKDYEEASEENAWRLLAEVSLS  384

Query  579  EERFEEVKAYVSRAADLLLDSECSNGGSQPWE  484
            EERF+EV A +    D +      +  S P E
Sbjct  385  EERFQEVCALIFEVIDTVDAENTEDSSSMPEE  416



>ref|XP_006283739.1| hypothetical protein CARUB_v10004813mg [Capsella rubella]
 gb|EOA16637.1| hypothetical protein CARUB_v10004813mg [Capsella rubella]
Length=443

 Score =   436 bits (1120),  Expect = 9e-142, Method: Compositional matrix adjust.
 Identities = 207/339 (61%), Positives = 266/339 (78%), Gaps = 8/339 (2%)
 Frame = -1

Query  2041  MLTIKRVPTVVSNYQDDAPEDSKPESLGCGRNCLGQCCLPVSCLPLFAFKNDEHKCDGDW  1862
             ML IKRVPTVVSNYQ D   D   ES+GCGRNCLG CC+  + LPL+A KN E   +   
Sbjct  1     MLKIKRVPTVVSNYQKDEAAD---ESVGCGRNCLGACCINGARLPLYACKNLEKSREKLV  57

Query  1861  NYLSYGECPISFLSDLLLGQWEERMSRGLFRYDVTSCETKIIPGTFGFIAQLNEGRHLKK  1682
                   E P++FL  L+LG+WE+R  RGLFRYDVT+CETK+IPG +GF+AQLNEGRHLKK
Sbjct  58    ISHEAKEPPVAFLESLVLGEWEDRFQRGLFRYDVTACETKVIPGKYGFVAQLNEGRHLKK  117

Query  1681  RPTEFRVDQVLQPFDENKFNFTKIGQEEVLFRFEPSNDCKSHYLPSGLVDARSGSPTVLA  1502
             RPTEFRVD+VLQ FD +KFNFTK+GQEE+LF+FE   D +  + P   +D  + SP+V+A
Sbjct  118   RPTEFRVDKVLQSFDGSKFNFTKVGQEELLFQFEAGEDDQVQFFPCMPLDPEN-SPSVVA  176

Query  1501  INVSPIEYGHVLLIPRVLDCLPQRIDHDSFFVAMHLAKEAADPFFRVGYNSLGAFATINH  1322
             INVSPIEYGHVLLIPRVLDCLPQ+IDH S  +A+H+A EAA+P+FR+GYNSLGAFATINH
Sbjct  177   INVSPIEYGHVLLIPRVLDCLPQKIDHKSLLLAVHMAAEAANPYFRLGYNSLGAFATINH  236

Query  1321  LHFQAYYLQVPFPVEKTPTREIMRGREQGDGGIVVSQLLNYPARALLFEGGSTVRDLSDA  1142
             LHFQAYYL +PFP+E+ P+++++        G+ +S+LLNYP R+LLFEGGS+++DLSD 
Sbjct  237   LHFQAYYLAMPFPLERAPSKKMITTA----SGVKISELLNYPVRSLLFEGGSSMQDLSDT  292

Query  1141  VANSCISLQNNNIPFNLLISERGNKVFLFPQVHSNSVFL  1025
             V+++C+ LQNNNIPFN+LI++ G ++F+ PQ ++    L
Sbjct  293   VSDACVCLQNNNIPFNILIADCGRQIFVMPQCYAEKQAL  331


 Score =   107 bits (267),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 50/74 (68%), Positives = 60/74 (81%), Gaps = 0/74 (0%)
 Frame = -2

Query  759  FSKCYAEKQACGKIDQEILDTWVNPAVWEISGHMVLKRREDYDDASEDYAWRLLSEVSLS  580
              +CYAEKQA G++  E+L+T VNPAVWEISGHMVLKR+EDY+ ASE+ AWRLL E SLS
Sbjct  321  MPQCYAEKQALGEVSPEVLETQVNPAVWEISGHMVLKRKEDYEGASEENAWRLLEEASLS  380

Query  579  EERFEEVKAYVSRA  538
            EERF+EV A +  A
Sbjct  381  EERFKEVNALIFEA  394



>ref|XP_002298816.2| VITAMIN C DEFECTIVE 2 family protein [Populus trichocarpa]
 gb|EEE83621.2| VITAMIN C DEFECTIVE 2 family protein [Populus trichocarpa]
Length=453

 Score =   436 bits (1120),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 214/340 (63%), Positives = 266/340 (78%), Gaps = 11/340 (3%)
 Frame = -1

Query  2044  LMLTIKRVPTVVSNYQDDAPEDSKPESLGCGRNCLGQCCLPVSCLPLFAFKN-----DEH  1880
             +ML IKRVPTVVSNYQ +   +      GCGRNCL  CCL  +CLPL+AFK       + 
Sbjct  1     MMLRIKRVPTVVSNYQKEDGNEGSRRGGGCGRNCLQNCCLQDACLPLYAFKKVDSIVSKK  60

Query  1879  KCDGDWNYLSYGECPISFLSDLLLGQWEERMSRGLFRYDVTSCETKIIPGTFGFIAQLNE  1700
             K  G + Y   GE P++FL  LLLG+WE+R+ RGLFRYDVT+CETK+IPG  GFIAQLNE
Sbjct  61    KGVGVFEY-DKGEPPVAFLDSLLLGEWEDRVQRGLFRYDVTACETKVIPGQHGFIAQLNE  119

Query  1699  GRHLKKRPTEFRVDQVLQPFDENKFNFTKIGQEEVLFRFEPSNDCKSHYLPSGLVDARSG  1520
             GRHLKKRPTEFRVD+VLQPFD NKFNFTK+GQEEVLF+F  S D +  + P   +D  + 
Sbjct  120   GRHLKKRPTEFRVDKVLQPFDGNKFNFTKVGQEEVLFQFGASEDGEVQFFPDAPIDPEN-  178

Query  1519  SPTVLAINVSPIEYGHVLLIPRVLDCLPQRIDHDSFFVAMHLAKEAADPFFRVGYNSLGA  1340
             SP+++AINVSPIEYGHVLLIPRVLDCLPQRID DSF +A+++A EA +P+FR+GYNSLGA
Sbjct  179   SPSMVAINVSPIEYGHVLLIPRVLDCLPQRIDRDSFMLAIYMAAEAGNPYFRLGYNSLGA  238

Query  1339  FATINHLHFQAYYLQVPFPVEKTPTREIMRGREQGDGGIVVSQLLNYPARALLFEGGSTV  1160
             FATINHLHFQAYYL VPFP+EK PT+EI       DGG+ +S+L+NYP R L+FEGG+ +
Sbjct  239   FATINHLHFQAYYLAVPFPIEKAPTKEIT----TSDGGVKISELVNYPVRGLVFEGGNAL  294

Query  1159  RDLSDAVANSCISLQNNNIPFNLLISERGNKVFLFPQVHS  1040
              DLS+ V+++CI LQ NNIP+N+LI++ GN++FL PQ ++
Sbjct  295   LDLSNGVSDACICLQENNIPYNVLIADCGNRIFLLPQCYA  334


 Score =   110 bits (276),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 51/74 (69%), Positives = 63/74 (85%), Gaps = 0/74 (0%)
 Frame = -2

Query  759  FSKCYAEKQACGKIDQEILDTWVNPAVWEISGHMVLKRREDYDDASEDYAWRLLSEVSLS  580
              +CYAEKQA G++  E+LDT VNPAVWEISGHMVLKR++DY++ASE+ AWRLL+EVSLS
Sbjct  329  LPQCYAEKQALGEVSPELLDTQVNPAVWEISGHMVLKRKKDYEEASEENAWRLLAEVSLS  388

Query  579  EERFEEVKAYVSRA  538
            EERF+EV A +  A
Sbjct  389  EERFQEVTALIFEA  402



>gb|EPS59998.1| hypothetical protein M569_14805, partial [Genlisea aurea]
Length=406

 Score =   434 bits (1116),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 211/344 (61%), Positives = 261/344 (76%), Gaps = 17/344 (5%)
 Frame = -1

Query  2041  MLTIKRVPTVVSNYQ-DDAPEDSKPESLGCGRNCLGQCCLPVSCLPLFAFKNDEHKCDGD  1865
             ML IKRVPTVVSNYQ +D+ E  +  S GC RNCL  CCLP + LPL+AFK  +   + D
Sbjct  1     MLRIKRVPTVVSNYQKEDSDETVRHASSGCARNCLRNCCLPGAKLPLYAFKTTK---NVD  57

Query  1864  WNYLSYGECPIS---------FLSDLLLGQWEERMSRGLFRYDVTSCETKIIPGTFGFIA  1712
                   G C I          FL+ LLL +WE+RM RGLFRYDVT+CETK+IPG +GFIA
Sbjct  58    TAKFPSGSCEIESPPPPPPLDFLNSLLLREWEDRMQRGLFRYDVTACETKVIPGKYGFIA  117

Query  1711  QLNEGRHLKKRPTEFRVDQVLQPFDENKFNFTKIGQEEVLFRFEPSNDCKSHYLPSGLVD  1532
             QLNEGRHLKKRPTEF VD VLQPFDE+KFNFTK+GQEEVLF+F PS D  +H+ P   +D
Sbjct  118   QLNEGRHLKKRPTEFCVDMVLQPFDESKFNFTKVGQEEVLFQFMPSEDDDAHFFPCAPID  177

Query  1531  ARSGSPTVLAINVSPIEYGHVLLIPRVLDCLPQRIDHDSFFVAMHLAKEAADPFFRVGYN  1352
             A   SPTV+AINVSPIEYGHVLLIPR+L+CLPQRID  SFF+A+ +A EA +P+FR+GYN
Sbjct  178   AADSSPTVVAINVSPIEYGHVLLIPRILECLPQRIDRHSFFLAVCMAAEAGNPYFRLGYN  237

Query  1351  SLGAFATINHLHFQAYYLQVPFPVEKTPTREIMRGREQGDGGIVVSQLLNYPARALLFEG  1172
             SLGAFATINHLHFQAYYL +PFPVE+ P+++I         G+ +S + NYP R+L+FEG
Sbjct  238   SLGAFATINHLHFQAYYLAIPFPVERAPSKKIA----ATATGVKISHVSNYPVRSLVFEG  293

Query  1171  GSTVRDLSDAVANSCISLQNNNIPFNLLISERGNKVFLFPQVHS  1040
             G  + DLS+ V++SCI LQ +NIP+N+LIS+ G ++FLFPQ ++
Sbjct  294   GDALEDLSNVVSDSCICLQEHNIPYNVLISDSGKRIFLFPQCYA  337


 Score =   103 bits (258),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 48/71 (68%), Positives = 60/71 (85%), Gaps = 0/71 (0%)
 Frame = -2

Query  759  FSKCYAEKQACGKIDQEILDTWVNPAVWEISGHMVLKRREDYDDASEDYAWRLLSEVSLS  580
            F +CYAE+QA G++  E+L+T VNPAVWEISGHMVLKR+EDY+ A+E+ A RLL+EVSLS
Sbjct  332  FPQCYAERQALGEVSPELLETQVNPAVWEISGHMVLKRKEDYEGATEENARRLLAEVSLS  391

Query  579  EERFEEVKAYV  547
            EER EEVK  +
Sbjct  392  EERLEEVKELI  402



>emb|CAN70988.1| hypothetical protein VITISV_043185 [Vitis vinifera]
Length=508

 Score =   437 bits (1124),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 208/338 (62%), Positives = 263/338 (78%), Gaps = 14/338 (4%)
 Frame = -1

Query  2038  LTIKRVPTVVSNYQDDAPEDSKPESLGCGRNCLGQCCLPVSCLPLFAFKN-----DEHKC  1874
             L IKRVPTVVSNYQ +  +D   +  GCGRNCL QCC+  + LPL+A+K      +E   
Sbjct  4     LRIKRVPTVVSNYQKEDSDDGARQVGGCGRNCLKQCCIQGAKLPLYAYKKVKDVVNEKAS  63

Query  1873  DGDWNYLSYGECPISFLSDLLLGQWEERMSRGLFRYDVTSCETKIIPGTFGFIAQLNEGR  1694
              GD N     E P+ FL  L+LG+WE+RM +GLFRYDVT+CETK+IPG +GFIAQLNEGR
Sbjct  64    SGDEN----KEQPVPFLDSLVLGEWEDRMQKGLFRYDVTACETKVIPGEYGFIAQLNEGR  119

Query  1693  HLKKRPTEFRVDQVLQPFDENKFNFTKIGQEEVLFRFEPSNDCKSHYLPSGLVDARSGSP  1514
             HLKKRPTEFRVD+VLQPFD NKFNFTK+GQEEVLF+FEPSND +  ++P+  +D  + S 
Sbjct  120   HLKKRPTEFRVDKVLQPFDGNKFNFTKVGQEEVLFQFEPSNDEEPEFIPNAPIDVEN-ST  178

Query  1513  TVLAINVSPIEYGHVLLIPRVLDCLPQRIDHDSFFVAMHLAKEAADPFFRVGYNSLGAFA  1334
             +V+AINVSPIEYGHVLLIPR+ +CLPQRID +SF +A+ +A EA +P+FR+GYNSLGAFA
Sbjct  179   SVVAINVSPIEYGHVLLIPRIFECLPQRIDRESFLLALDMAVEAGNPYFRLGYNSLGAFA  238

Query  1333  TINHLHFQAYYLQVPFPVEKTPTREIMRGREQGDGGIVVSQLLNYPARALLFEGGSTVRD  1154
             TINHLHFQAYYL  PFP+EK PTR+I         G+ + +LL YP R L+FEGG T++D
Sbjct  239   TINHLHFQAYYLATPFPIEKAPTRKIT----TAGNGVKIFELLKYPVRGLVFEGGDTLQD  294

Query  1153  LSDAVANSCISLQNNNIPFNLLISERGNKVFLFPQVHS  1040
             L++ VA+SCI LQ+NNIPFN+LI++ G ++FLF Q ++
Sbjct  295   LANTVADSCICLQDNNIPFNVLIADAGKRIFLFAQCYA  332


 Score =   114 bits (285),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 52/74 (70%), Positives = 65/74 (88%), Gaps = 0/74 (0%)
 Frame = -2

Query  759  FSKCYAEKQACGKIDQEILDTWVNPAVWEISGHMVLKRREDYDDASEDYAWRLLSEVSLS  580
            F++CYAEKQA G+++QE+LDT VNPAVWE+SGH+VLKR+EDY+ ASE  AWRLL+EVSLS
Sbjct  327  FAQCYAEKQALGEVNQELLDTQVNPAVWEVSGHIVLKRKEDYEGASEQNAWRLLAEVSLS  386

Query  579  EERFEEVKAYVSRA  538
            EERF+EV A +  A
Sbjct  387  EERFQEVNALIFEA  400



>ref|XP_010244129.1| PREDICTED: GDP-L-galactose phosphorylase 2-like [Nelumbo nucifera]
Length=445

 Score =   434 bits (1116),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 211/341 (62%), Positives = 269/341 (79%), Gaps = 15/341 (4%)
 Frame = -1

Query  2044  LMLTIKRVPTVVSNYQ-DDAPEDSKPESLGCGRNCLGQCCLPVSCLPLFAFKN-----DE  1883
             +ML IKRVPT+VSN+Q ++  E ++    GCGRNCL +CC+  + LPL+ FK+     +E
Sbjct  1     MMLRIKRVPTLVSNHQREEEEEKARRNGGGCGRNCLNKCCIQGARLPLYTFKSVNKNVNE  60

Query  1882  HKCDGDWNYLSYGECPISFLSDLLLGQWEERMSRGLFRYDVTSCETKIIPGTFGFIAQLN  1703
                 GD       E P++FL  L+LG+WE+RM RGLFRYDVT+CETK+IPG +GFIAQLN
Sbjct  61    KDLIGD----EKKEPPVAFLDSLVLGEWEDRMQRGLFRYDVTACETKVIPGEYGFIAQLN  116

Query  1702  EGRHLKKRPTEFRVDQVLQPFDENKFNFTKIGQEEVLFRFEPSNDCKSHYLPSGLVDARS  1523
             EGRHLKKRPTEFRVD+VLQPFD NKFNFTK+GQEEVLF+F  S+D ++++ P   +D   
Sbjct  117   EGRHLKKRPTEFRVDKVLQPFDANKFNFTKVGQEEVLFQFGASDDDEANFFPYAPIDV-G  175

Query  1522  GSPTVLAINVSPIEYGHVLLIPRVLDCLPQRIDHDSFFVAMHLAKEAADPFFRVGYNSLG  1343
              SP+V+AINVSPIEYGHVLLIPR+LDCLPQRID +SF +A+H+A EA +P+FR+GYNSLG
Sbjct  176   DSPSVVAINVSPIEYGHVLLIPRILDCLPQRIDRESFLLALHMAAEAGNPYFRLGYNSLG  235

Query  1342  AFATINHLHFQAYYLQVPFPVEKTPTREIMRGREQGDGGIVVSQLLNYPARALLFEGGST  1163
             AFATINHLHFQAYYL VPFP+EK PTR I       D G+ +S+L NYP R L+FEGG+T
Sbjct  236   AFATINHLHFQAYYLAVPFPIEKAPTRRIT----TTDEGVKISELSNYPVRGLVFEGGNT  291

Query  1162  VRDLSDAVANSCISLQNNNIPFNLLISERGNKVFLFPQVHS  1040
             + +LS+AV++SCI LQ+NNIP+N+LIS+ G  +FLFPQ ++
Sbjct  292   LINLSNAVSDSCICLQDNNIPYNVLISDSGKLIFLFPQCYA  332


 Score =   113 bits (282),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 52/81 (64%), Positives = 66/81 (81%), Gaps = 0/81 (0%)
 Frame = -2

Query  759  FSKCYAEKQACGKIDQEILDTWVNPAVWEISGHMVLKRREDYDDASEDYAWRLLSEVSLS  580
            F +CYAEKQA G++  E+LDT VNPAVWEISGHMVLKR++DY++ASE+ AWRLL+EVSLS
Sbjct  327  FPQCYAEKQALGEVSPELLDTQVNPAVWEISGHMVLKRKQDYEEASEENAWRLLAEVSLS  386

Query  579  EERFEEVKAYVSRAADLLLDS  517
            EERF+EV   +  A    +D+
Sbjct  387  EERFQEVMGLIFEAIACKIDA  407



>gb|KDP39175.1| hypothetical protein JCGZ_00932 [Jatropha curcas]
Length=452

 Score =   434 bits (1115),  Expect = 5e-141, Method: Compositional matrix adjust.
 Identities = 209/337 (62%), Positives = 267/337 (79%), Gaps = 9/337 (3%)
 Frame = -1

Query  2044  LMLTIKRVPTVVSNYQDDAPEDSKPESLGCGRNCLGQCCLPVSCLPLFAFKNDEHKCDGD  1865
             LML IKRVPTVVSN+Q +  ED    S GCGRNCL  CC+  + LPL+AF+  E+K  G+
Sbjct  5     LMLRIKRVPTVVSNFQKEEAEDGARRSGGCGRNCLRHCCIQGAKLPLYAFRR-ENKIVGE  63

Query  1864  WNYLSYGEC--PISFLSDLLLGQWEERMSRGLFRYDVTSCETKIIPGTFGFIAQLNEGRH  1691
                L + EC  P++FL  L+LG+WE+R  RGLFRYDVT+CETK+IPG +GFIAQLNEGRH
Sbjct  64    KGVLEH-ECEPPVAFLDSLVLGEWEDRFQRGLFRYDVTACETKVIPGQYGFIAQLNEGRH  122

Query  1690  LKKRPTEFRVDQVLQPFDENKFNFTKIGQEEVLFRFEPSNDCKSHYLPSGLVDARSGSPT  1511
             LKKRPTEFRVD+VLQPFD NKFNFTK+GQEEVLF+FE S D +  + PS  +D  + SP+
Sbjct  123   LKKRPTEFRVDKVLQPFDGNKFNFTKVGQEEVLFQFEASEDGEVQFYPSVPIDVEN-SPS  181

Query  1510  VLAINVSPIEYGHVLLIPRVLDCLPQRIDHDSFFVAMHLAKEAADPFFRVGYNSLGAFAT  1331
             V+AINVSPIEYGHVLLIPR+L+CLPQRID +S  +A+++A EA +P+FR+GYNSLGAFAT
Sbjct  182   VVAINVSPIEYGHVLLIPRILECLPQRIDRESLLLAIYMAAEAGNPYFRLGYNSLGAFAT  241

Query  1330  INHLHFQAYYLQVPFPVEKTPTREIMRGREQGDGGIVVSQLLNYPARALLFEGGSTVRDL  1151
             INHLHFQAYYL   FP+EK  T++I       D G+ +S+L+NYP R LLFEGG+T++DL
Sbjct  242   INHLHFQAYYLAEQFPIEKAATKKI----NTLDNGVKISELINYPVRGLLFEGGNTLQDL  297

Query  1150  SDAVANSCISLQNNNIPFNLLISERGNKVFLFPQVHS  1040
             S+ ++++CI LQ+NNIP+N+LIS+ G + FL PQ ++
Sbjct  298   SNTLSDACICLQDNNIPYNVLISDCGKRNFLLPQCYA  334


 Score =   111 bits (278),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 59/114 (52%), Positives = 79/114 (69%), Gaps = 7/114 (6%)
 Frame = -2

Query  759  FSKCYAEKQACGKIDQEILDTWVNPAVWEISGHMVLKRREDYDDASEDYAWRLLSEVSLS  580
              +CYAEKQA G+++ EILDT VNPAVWEISGHMVLKR++D+++A+E+ AWRLL+EVSLS
Sbjct  329  LPQCYAEKQALGEVNPEILDTQVNPAVWEISGHMVLKRKKDFEEATEENAWRLLAEVSLS  388

Query  579  EERFEEVKAYVSRAADLLLDSECSNGGSQP-WETYPEASWTATNELSFTSRLSG  421
            E RF+EV A +  A        CS+  S+   E  PE S   + E+   ++ SG
Sbjct  389  EARFQEVNALIFEAIS------CSDNRSENDVEDLPEDSNVESLEVDAINKSSG  436



>ref|XP_010448203.1| PREDICTED: GDP-L-galactose phosphorylase 1 [Camelina sativa]
Length=442

 Score =   433 bits (1114),  Expect = 6e-141, Method: Compositional matrix adjust.
 Identities = 208/339 (61%), Positives = 265/339 (78%), Gaps = 8/339 (2%)
 Frame = -1

Query  2041  MLTIKRVPTVVSNYQDDAPEDSKPESLGCGRNCLGQCCLPVSCLPLFAFKNDEHKCDGDW  1862
             ML IKRVPTVVSNYQ D   D   ES+GCGRNCLG CC+  + LPL+A KN E   +   
Sbjct  1     MLKIKRVPTVVSNYQKDEAAD---ESVGCGRNCLGACCINGARLPLYACKNLEKSREKIV  57

Query  1861  NYLSYGECPISFLSDLLLGQWEERMSRGLFRYDVTSCETKIIPGTFGFIAQLNEGRHLKK  1682
                   E P++FL  L+LG+WE+R  RGLFRYDVT+CETK+IPG +GF+AQLNEGRHLKK
Sbjct  58    VSHEAEEPPVAFLESLVLGEWEDRFQRGLFRYDVTACETKVIPGKYGFVAQLNEGRHLKK  117

Query  1681  RPTEFRVDQVLQPFDENKFNFTKIGQEEVLFRFEPSNDCKSHYLPSGLVDARSGSPTVLA  1502
             RPTEFRVD+VLQ FD +KFNFTK+GQEE+LF+FE   D +  + P   +D  + S +V+A
Sbjct  118   RPTEFRVDKVLQSFDGSKFNFTKVGQEELLFQFEAGEDGQVQFFPCMPLDPEN-SFSVVA  176

Query  1501  INVSPIEYGHVLLIPRVLDCLPQRIDHDSFFVAMHLAKEAADPFFRVGYNSLGAFATINH  1322
             INVSPIEYGHVLLIPRVLDCLPQRIDH S  +A+H+A EAA+P+FR+GYNSLGAFATINH
Sbjct  177   INVSPIEYGHVLLIPRVLDCLPQRIDHKSLLLAVHMAAEAANPYFRLGYNSLGAFATINH  236

Query  1321  LHFQAYYLQVPFPVEKTPTREIMRGREQGDGGIVVSQLLNYPARALLFEGGSTVRDLSDA  1142
             LHFQAYYL +PFP+E+ PT++++        G+ +S+LLNYP R+LLFEGGS+++DLSD 
Sbjct  237   LHFQAYYLAMPFPLERAPTKKMITTV----SGVKISELLNYPVRSLLFEGGSSMQDLSDT  292

Query  1141  VANSCISLQNNNIPFNLLISERGNKVFLFPQVHSNSVFL  1025
             V+++C+ LQNNNIPFN+LI++ G ++F+ PQ ++    L
Sbjct  293   VSDACVCLQNNNIPFNILIADCGRQIFVMPQCYAEKQAL  331


 Score =   107 bits (266),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 49/74 (66%), Positives = 60/74 (81%), Gaps = 0/74 (0%)
 Frame = -2

Query  759  FSKCYAEKQACGKIDQEILDTWVNPAVWEISGHMVLKRREDYDDASEDYAWRLLSEVSLS  580
              +CYAEKQA G++  E+L+T VNPAVWEISGHMVLKR+EDY+ ASE+ AWRLL+E SLS
Sbjct  321  MPQCYAEKQALGEVSPEVLETQVNPAVWEISGHMVLKRKEDYEGASEENAWRLLAEASLS  380

Query  579  EERFEEVKAYVSRA  538
            EERF+EV   +  A
Sbjct  381  EERFKEVNTLIFEA  394



>gb|AAL07213.1| unknown protein [Arabidopsis thaliana]
Length=442

 Score =   433 bits (1114),  Expect = 6e-141, Method: Compositional matrix adjust.
 Identities = 211/341 (62%), Positives = 266/341 (78%), Gaps = 12/341 (4%)
 Frame = -1

Query  2041  MLTIKRVPTVVSNYQDDAPEDSKPESLGCGRNCLGQCCLPVSCLPLFAFKNDEHKCDGDW  1862
             ML IKRVPTVVSNYQ D   D   + +GCGRNCLG CCL  + LPL+A KN      G+ 
Sbjct  1     MLKIKRVPTVVSNYQKD---DGAEDPVGCGRNCLGACCLNGARLPLYACKNLVK--SGEK  55

Query  1861  NYLSYG--ECPISFLSDLLLGQWEERMSRGLFRYDVTSCETKIIPGTFGFIAQLNEGRHL  1688
               +S+   E P++FL  L+LG+WE+R  RGLFRYDVT+CETK+IPG +GF+AQLNEGRHL
Sbjct  56    LVISHEAIEPPVAFLESLVLGEWEDRFQRGLFRYDVTACETKVIPGKYGFVAQLNEGRHL  115

Query  1687  KKRPTEFRVDQVLQPFDENKFNFTKIGQEEVLFRFEPSNDCKSHYLPSGLVDARSGSPTV  1508
             KKRPTEFRVD+VLQ FD +KFNFTK+GQEE+LF+FE   D +  + P   +D  + SP+V
Sbjct  116   KKRPTEFRVDKVLQSFDGSKFNFTKVGQEELLFQFEAGEDAQVQFFPCMPIDPEN-SPSV  174

Query  1507  LAINVSPIEYGHVLLIPRVLDCLPQRIDHDSFFVAMHLAKEAADPFFRVGYNSLGAFATI  1328
             +AINVSPIEYGHVLLIPRVLDCLPQRIDH S  +A+H+A EAA+P+FR+GYNSLGAFATI
Sbjct  175   VAINVSPIEYGHVLLIPRVLDCLPQRIDHKSLLLAVHMAAEAANPYFRLGYNSLGAFATI  234

Query  1327  NHLHFQAYYLQVPFPVEKTPTREIMRGREQGDGGIVVSQLLNYPARALLFEGGSTVRDLS  1148
             NHLHFQAYYL +PFP+EK PT++I         G+ +S+LL+YP R+LLFEGGS++++LS
Sbjct  235   NHLHFQAYYLAMPFPLEKAPTKKITTTV----SGVKISELLSYPVRSLLFEGGSSMQELS  290

Query  1147  DAVANSCISLQNNNIPFNLLISERGNKVFLFPQVHSNSVFL  1025
             D V++ C+ LQNNNIPFN+LIS+ G ++FL PQ ++    L
Sbjct  291   DTVSDCCVCLQNNNIPFNILISDCGRQIFLMPQCYAEKQAL  331


 Score =   108 bits (271),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 54/85 (64%), Positives = 63/85 (74%), Gaps = 6/85 (7%)
 Frame = -2

Query  759  FSKCYAEKQACGKIDQEILDTWVNPAVWEISGHMVLKRREDYDDASEDYAWRLLSEVSLS  580
              +CYAEKQA G++  E+L+T VNPAVWEISGHMVLKR+EDY+ ASED AWRLL+E SLS
Sbjct  321  MPQCYAEKQALGEVSPEVLETQVNPAVWEISGHMVLKRKEDYEGASEDNAWRLLAEASLS  380

Query  579  EERFEEVKAYVSRAADLLLDSECSN  505
            EERF+EV A    A        CSN
Sbjct  381  EERFKEVTALAFEAIS------CSN  399



>ref|NP_567759.1| GDP-L-galactose phosphorylase 1 [Arabidopsis thaliana]
 sp|Q8RWE8.1|GGAP1_ARATH RecName: Full=GDP-L-galactose phosphorylase 1; AltName: Full=Protein 
VITAMIN C DEFECTIVE 2 [Arabidopsis thaliana]
 gb|AAM13137.1| putative protein [Arabidopsis thaliana]
 gb|AAP31933.1| At4g26850 [Arabidopsis thaliana]
 dbj|BAE98540.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE85260.1| GDP-L-galactose phosphorylase 1 [Arabidopsis thaliana]
Length=442

 Score =   433 bits (1114),  Expect = 6e-141, Method: Compositional matrix adjust.
 Identities = 211/341 (62%), Positives = 266/341 (78%), Gaps = 12/341 (4%)
 Frame = -1

Query  2041  MLTIKRVPTVVSNYQDDAPEDSKPESLGCGRNCLGQCCLPVSCLPLFAFKNDEHKCDGDW  1862
             ML IKRVPTVVSNYQ D   D   + +GCGRNCLG CCL  + LPL+A KN      G+ 
Sbjct  1     MLKIKRVPTVVSNYQKD---DGAEDPVGCGRNCLGACCLNGARLPLYACKNLVK--SGEK  55

Query  1861  NYLSYG--ECPISFLSDLLLGQWEERMSRGLFRYDVTSCETKIIPGTFGFIAQLNEGRHL  1688
               +S+   E P++FL  L+LG+WE+R  RGLFRYDVT+CETK+IPG +GF+AQLNEGRHL
Sbjct  56    LVISHEAIEPPVAFLESLVLGEWEDRFQRGLFRYDVTACETKVIPGKYGFVAQLNEGRHL  115

Query  1687  KKRPTEFRVDQVLQPFDENKFNFTKIGQEEVLFRFEPSNDCKSHYLPSGLVDARSGSPTV  1508
             KKRPTEFRVD+VLQ FD +KFNFTK+GQEE+LF+FE   D +  + P   +D  + SP+V
Sbjct  116   KKRPTEFRVDKVLQSFDGSKFNFTKVGQEELLFQFEAGEDAQVQFFPCMPIDPEN-SPSV  174

Query  1507  LAINVSPIEYGHVLLIPRVLDCLPQRIDHDSFFVAMHLAKEAADPFFRVGYNSLGAFATI  1328
             +AINVSPIEYGHVLLIPRVLDCLPQRIDH S  +A+H+A EAA+P+FR+GYNSLGAFATI
Sbjct  175   VAINVSPIEYGHVLLIPRVLDCLPQRIDHKSLLLAVHMAAEAANPYFRLGYNSLGAFATI  234

Query  1327  NHLHFQAYYLQVPFPVEKTPTREIMRGREQGDGGIVVSQLLNYPARALLFEGGSTVRDLS  1148
             NHLHFQAYYL +PFP+EK PT++I         G+ +S+LL+YP R+LLFEGGS++++LS
Sbjct  235   NHLHFQAYYLAMPFPLEKAPTKKITTTV----SGVKISELLSYPVRSLLFEGGSSMQELS  290

Query  1147  DAVANSCISLQNNNIPFNLLISERGNKVFLFPQVHSNSVFL  1025
             D V++ C+ LQNNNIPFN+LIS+ G ++FL PQ ++    L
Sbjct  291   DTVSDCCVCLQNNNIPFNILISDCGRQIFLMPQCYAEKQAL  331


 Score =   108 bits (271),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 54/85 (64%), Positives = 63/85 (74%), Gaps = 6/85 (7%)
 Frame = -2

Query  759  FSKCYAEKQACGKIDQEILDTWVNPAVWEISGHMVLKRREDYDDASEDYAWRLLSEVSLS  580
              +CYAEKQA G++  E+L+T VNPAVWEISGHMVLKR+EDY+ ASED AWRLL+E SLS
Sbjct  321  MPQCYAEKQALGEVSPEVLETQVNPAVWEISGHMVLKRKEDYEGASEDNAWRLLAEASLS  380

Query  579  EERFEEVKAYVSRAADLLLDSECSN  505
            EERF+EV A    A        CSN
Sbjct  381  EERFKEVTALAFEAIG------CSN  399



>ref|XP_009403710.1| PREDICTED: GDP-L-galactose phosphorylase 2-like [Musa acuminata 
subsp. malaccensis]
Length=431

 Score =   432 bits (1112),  Expect = 8e-141, Method: Compositional matrix adjust.
 Identities = 219/343 (64%), Positives = 258/343 (75%), Gaps = 16/343 (5%)
 Frame = -1

Query  2041  MLTIKRVPTVVSNYQDDAPEDSKPESLGCGRNCLGQCCLPVSCLPLFAFKNDEH---KCD  1871
             MLTIKRVPTV+SNYQ+D+ E       GC RNCL +CCL VS LPL+AF++D        
Sbjct  1     MLTIKRVPTVLSNYQEDSGEPR-----GCDRNCLSKCCLAVSKLPLYAFESDARPKISSP  55

Query  1870  GDWNYLSYGECPISF-LSDLLLGQWEERMSRGLFRYDVTSCETKIIPGTFGFIAQLNEGR  1694
             GD       E P  F L+ LLLGQWE+ MSRGLFRYDV +CETK+IPG +GF+AQLNEGR
Sbjct  56    GD------DEPPSDFFLNTLLLGQWEDWMSRGLFRYDVMACETKVIPGEYGFVAQLNEGR  109

Query  1693  HLKKRPTEFRVDQVLQPFDENKFNFTKIGQEEVLFRFEPSNDCKSHYLPSGLVDARSGSP  1514
             HLKKRPTEFRVD+VLQPFD  KFNFTK+GQEEVLFRFEP        L    V   + +P
Sbjct  110   HLKKRPTEFRVDRVLQPFDRAKFNFTKVGQEEVLFRFEPGESGSGRLLEDDAV-GDANAP  168

Query  1513  TVLAINVSPIEYGHVLLIPRVLDCLPQRIDHDSFFVAMHLAKEAADPFFRVGYNSLGAFA  1334
              V+AINVSPIEYGHVLLIPRVLDCLPQRID DSF +A+H+A EA  P+FR+GYNSLGAFA
Sbjct  169   NVVAINVSPIEYGHVLLIPRVLDCLPQRIDPDSFLLALHMAAEAGSPYFRLGYNSLGAFA  228

Query  1333  TINHLHFQAYYLQVPFPVEKTPTREIMRGREQGDGGIVVSQLLNYPARALLFEGGSTVRD  1154
             TINHLHFQAY+L +PFPVEK  T+ I         G+ VS+LLNYP R L++EGG+T++D
Sbjct  229   TINHLHFQAYFLSMPFPVEKNSTQRIPIVGGLSHNGVKVSRLLNYPVRGLVYEGGNTLKD  288

Query  1153  LSDAVANSCISLQNNNIPFNLLISERGNKVFLFPQVHSNSVFL  1025
             LSD VANSCI LQ NNIPFN+LIS+ G ++FLFPQ ++    L
Sbjct  289   LSDVVANSCICLQENNIPFNVLISDSGRRIFLFPQCYAEKQAL  331


 Score =   120 bits (302),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 55/78 (71%), Positives = 67/78 (86%), Gaps = 0/78 (0%)
 Frame = -2

Query  759  FSKCYAEKQACGKIDQEILDTWVNPAVWEISGHMVLKRREDYDDASEDYAWRLLSEVSLS  580
            F +CYAEKQA G++ Q++LDT VNPAVWEISGH+VLKR++DYD+ASE YAWRLL+EVSLS
Sbjct  321  FPQCYAEKQALGEVGQDLLDTQVNPAVWEISGHIVLKRKKDYDEASEHYAWRLLAEVSLS  380

Query  579  EERFEEVKAYVSRAADLL  526
            E RFEEVK Y+  A  L+
Sbjct  381  EARFEEVKVYIFEATGLV  398



>ref|XP_002867538.1| hypothetical protein ARALYDRAFT_492115 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43797.1| hypothetical protein ARALYDRAFT_492115 [Arabidopsis lyrata subsp. 
lyrata]
Length=444

 Score =   433 bits (1113),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 208/336 (62%), Positives = 266/336 (79%), Gaps = 10/336 (3%)
 Frame = -1

Query  2041  MLTIKRVPTVVSNYQDDAPEDSKPESLGCGRNCLGQCCLPVSCLPLFAFKNDEHKCDGDW  1862
             ML IKRVPTVVSNYQ D   D   +S+GCGRNCLG CC+  + LPL+A KN       + 
Sbjct  1     MLKIKRVPTVVSNYQKD---DGADDSVGCGRNCLGACCINGARLPLYACKNLAKSGAVEK  57

Query  1861  NYLS--YGECPISFLSDLLLGQWEERMSRGLFRYDVTSCETKIIPGTFGFIAQLNEGRHL  1688
               +S    E P++FL  L+LG+WE+R  RGLFRYDVT+CETK+IPG +GF+AQLNEGRHL
Sbjct  58    LVISNEAKEPPVAFLESLVLGEWEDRFQRGLFRYDVTACETKVIPGKYGFVAQLNEGRHL  117

Query  1687  KKRPTEFRVDQVLQPFDENKFNFTKIGQEEVLFRFEPSNDCKSHYLPSGLVDARSGSPTV  1508
             KKRPTEFRVD+VLQ FD +KFNFTK+GQEE+LF+FE   D +  + P   +D  + SP+V
Sbjct  118   KKRPTEFRVDKVLQSFDGSKFNFTKVGQEELLFQFEAGEDGQVQFFPCMPLDPEN-SPSV  176

Query  1507  LAINVSPIEYGHVLLIPRVLDCLPQRIDHDSFFVAMHLAKEAADPFFRVGYNSLGAFATI  1328
             +AINVSPIEYGHVLLIPRVLDCLPQRIDH S  +A+H+A EAA+P+FR+GYNSLGAFATI
Sbjct  177   VAINVSPIEYGHVLLIPRVLDCLPQRIDHKSLLLAVHMAAEAANPYFRLGYNSLGAFATI  236

Query  1327  NHLHFQAYYLQVPFPVEKTPTREIMRGREQGDGGIVVSQLLNYPARALLFEGGSTVRDLS  1148
             NHLHFQAYYL +PFP+EK+P+++I         G+ +S+LL+YP R+LLFEGGS++++LS
Sbjct  237   NHLHFQAYYLAMPFPLEKSPSKKITTTV----SGVKISELLSYPVRSLLFEGGSSMQELS  292

Query  1147  DAVANSCISLQNNNIPFNLLISERGNKVFLFPQVHS  1040
             D V+++C+ LQNNNIPFN+LIS+ G ++FL PQ ++
Sbjct  293   DTVSDACVCLQNNNIPFNILISDCGRQIFLMPQCYA  328


 Score =   106 bits (264),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 53/85 (62%), Positives = 62/85 (73%), Gaps = 6/85 (7%)
 Frame = -2

Query  759  FSKCYAEKQACGKIDQEILDTWVNPAVWEISGHMVLKRREDYDDASEDYAWRLLSEVSLS  580
              +CYAEKQA G++  E+L+T VNPAVWEISGHMVLKR+EDY+ ASED AWRLL+E SLS
Sbjct  323  MPQCYAEKQALGEVSPEVLETQVNPAVWEISGHMVLKRKEDYEGASEDNAWRLLAEASLS  382

Query  579  EERFEEVKAYVSRAADLLLDSECSN  505
             ERF+EV A    A        CSN
Sbjct  383  AERFKEVIALAFEAIG------CSN  401



>ref|XP_010063041.1| PREDICTED: GDP-L-galactose phosphorylase 2-like [Eucalyptus grandis]
 gb|KCW70215.1| hypothetical protein EUGRSUZ_F03491 [Eucalyptus grandis]
Length=443

 Score =   432 bits (1111),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 209/336 (62%), Positives = 265/336 (79%), Gaps = 6/336 (2%)
 Frame = -1

Query  2044  LMLTIKRVPTVVSNYQDDAPEDSKPESLGCGRNCLGQCCLPVSCLPLFAFKNDEHKCDGD  1865
             +ML IKRVPTVVSNYQ +  E+      GCGRNCL +CC+P + LPL+AFK      D  
Sbjct  1     MMLKIKRVPTVVSNYQKEEAEEGARRGGGCGRNCLNKCCIPGAKLPLYAFKRVNFVADEK  60

Query  1864  WNYLSY-GECPISFLSDLLLGQWEERMSRGLFRYDVTSCETKIIPGTFGFIAQLNEGRHL  1688
                +    E P++FL  LLLG+WE+RM RGLFRYDVT+CETKIIPG +GFIAQLNEGRHL
Sbjct  61    AGIVGENAEPPVAFLDSLLLGEWEDRMQRGLFRYDVTACETKIIPGGYGFIAQLNEGRHL  120

Query  1687  KKRPTEFRVDQVLQPFDENKFNFTKIGQEEVLFRFEPSNDCKSHYLPSGLVDARSGSPTV  1508
             KKRPTEFRVD+VLQPFD +KFNFTK+GQEE+LF+FE S D +  +     +DA   SP+V
Sbjct  121   KKRPTEFRVDKVLQPFDGSKFNFTKVGQEEILFQFEASEDGEVQFFAKAPIDA-DNSPSV  179

Query  1507  LAINVSPIEYGHVLLIPRVLDCLPQRIDHDSFFVAMHLAKEAADPFFRVGYNSLGAFATI  1328
             +AINVSPIEYGHVLLIPRVL+C+PQRID +SF +A+++A EA +P+FR+GYNSLGAFATI
Sbjct  180   VAINVSPIEYGHVLLIPRVLECMPQRIDRESFSLALYMAAEARNPYFRLGYNSLGAFATI  239

Query  1327  NHLHFQAYYLQVPFPVEKTPTREIMRGREQGDGGIVVSQLLNYPARALLFEGGSTVRDLS  1148
             NHLHFQAYYL VPFP+EK PT+++       + G+ + +L+NYP R L+FEGG TV+DLS
Sbjct  240   NHLHFQAYYLAVPFPIEKAPTQKLT----ALESGVTIFELVNYPVRGLVFEGGDTVQDLS  295

Query  1147  DAVANSCISLQNNNIPFNLLISERGNKVFLFPQVHS  1040
             +AV++SCI LQ+NNIP+N+LIS+ G ++FL PQ ++
Sbjct  296   NAVSDSCICLQDNNIPYNVLISDCGKRIFLLPQCYA  331


 Score =   112 bits (280),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 54/97 (56%), Positives = 72/97 (74%), Gaps = 5/97 (5%)
 Frame = -2

Query  759  FSKCYAEKQACGKIDQEILDTWVNPAVWEISGHMVLKRREDYDDASEDYAWRLLSEVSLS  580
              +CYAEKQA G+++ E+LDT VNPAVWEISGH+VLKR++D+++ASE+ AWRLL+EVSLS
Sbjct  326  LPQCYAEKQALGEVNSELLDTQVNPAVWEISGHIVLKRKKDFEEASEENAWRLLAEVSLS  385

Query  579  EERFEEVKAYVSRAADLLLDSECSNGGSQPWETYPEA  469
            EERF+EV A +  A      +   NGG    +  P+A
Sbjct  386  EERFQEVNALIFEAI-----ASVENGGQDNPDVEPQA  417



>ref|XP_007211628.1| hypothetical protein PRUPE_ppa005736mg [Prunus persica]
 gb|EMJ12827.1| hypothetical protein PRUPE_ppa005736mg [Prunus persica]
Length=446

 Score =   432 bits (1112),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 216/342 (63%), Positives = 266/342 (78%), Gaps = 8/342 (2%)
 Frame = -1

Query  2044  LMLTIKRVPTVVSNYQDDAPEDSKPESLGCGRNCLGQCCLPVSCLPLFAFKNDEHKCDGD  1865
             +ML IKRVPTVVSNYQ D  E+      GCGRNCL QCC+P + LPL+AFK    K DGD
Sbjct  1     MMLRIKRVPTVVSNYQKDEAEEGARRVGGCGRNCLNQCCIPGAKLPLYAFKK-LTKIDGD  59

Query  1864  WNY--LSYGECPISFLSDLLLGQWEERMSRGLFRYDVTSCETKIIPGTFGFIAQLNEGRH  1691
                      E P+ FL  LLLG+WE+RM RGLFRYDVT+CETK+IPG FGFIAQLNEGRH
Sbjct  60    KELPGSEKREPPVDFLDSLLLGEWEDRMQRGLFRYDVTACETKVIPGQFGFIAQLNEGRH  119

Query  1690  LKKRPTEFRVDQVLQPFDENKFNFTKIGQEEVLFRFEPSNDCKSHYLPSGLVDARSGSPT  1511
             LKKRPTEFRVD+VLQPFD NKFNFTK+GQEEVLF+FE S D +  ++PS  ++  + SP+
Sbjct  120   LKKRPTEFRVDKVLQPFDGNKFNFTKVGQEEVLFQFEASEDGEVQFIPSAPIEPEN-SPS  178

Query  1510  VLAINVSPIEYGHVLLIPRVLDCLPQRIDHDSFFVAMHLAKEAADPFFRVGYNSLGAFAT  1331
             V+AINVSPIEYGHVLLIPR+L+ LPQRID +SF +A+H+A  A +P+FR+GYNSLGAFAT
Sbjct  179   VVAINVSPIEYGHVLLIPRILEHLPQRIDRESFLLALHMAAAAGNPYFRLGYNSLGAFAT  238

Query  1330  INHLHFQAYYLQVPFPVEKTPTREIMRGREQGDGGIVVSQLLNYPARALLFEGGSTVRDL  1151
             INHLHFQAYYL V FP+EK PT++I         G+ VS+LLNYP R L+FEGG+T++DL
Sbjct  239   INHLHFQAYYLAVTFPIEKAPTKKIT----VSGAGVRVSELLNYPVRGLVFEGGNTLQDL  294

Query  1150  SDAVANSCISLQNNNIPFNLLISERGNKVFLFPQVHSNSVFL  1025
             S+ V+++CI LQ NNIP+N+LIS+ G ++FL PQ ++    L
Sbjct  295   SNTVSDACICLQENNIPYNVLISDCGKRIFLLPQCYAEKQAL  336


 Score =   108 bits (269),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 56/109 (51%), Positives = 75/109 (69%), Gaps = 8/109 (7%)
 Frame = -2

Query  759  FSKCYAEKQACGKIDQEILDTWVNPAVWEISGHMVLKRREDYDDASEDYAWRLLSEVSLS  580
              +CYAEKQA G++  E+LDT VNPAVWEISGHMVLKR++DY++AS++ AW+LL+EVSLS
Sbjct  326  LPQCYAEKQALGEVRAELLDTQVNPAVWEISGHMVLKRKKDYEEASDENAWKLLAEVSLS  385

Query  579  EERFEEVKAYVSRA--------ADLLLDSECSNGGSQPWETYPEASWTA  457
            EERF+EV + +  A        A+LL D E      +  +T   +S  A
Sbjct  386  EERFQEVNSLIFEAIASDDNGNANLLEDPEVKPHSREEVDTINTSSHAA  434



>ref|NP_001066338.1| Os12g0190000 [Oryza sativa Japonica Group]
 gb|ABA96028.1| VTC2, putative, expressed [Oryza sativa Japonica Group]
 dbj|BAF29357.1| Os12g0190000 [Oryza sativa Japonica Group]
Length=438

 Score =   432 bits (1111),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 210/337 (62%), Positives = 260/337 (77%), Gaps = 8/337 (2%)
 Frame = -1

Query  2044  LMLTIKRVPTVVSNYQDDAPEDS--KPESLGCGRNCLGQCCLPVSCLPLFAFKNDEHKCD  1871
             + LTIKRVPTVVSNYQ+DA   +  +P + GCGR+CLG CCLP S LPL+AFK    K  
Sbjct  3     MKLTIKRVPTVVSNYQEDAAATAGERPRA-GCGRDCLGDCCLPDSKLPLYAFKASPKKPS  61

Query  1870  GDWNYLSYGECPISFLSDLLLGQWEERMSRGLFRYDVTSCETKIIPGTFGFIAQLNEGRH  1691
                +  S  E    F  +LLLG WE+RM+RGLFRYDVT+CETK+IPG  GF+AQLNEGRH
Sbjct  62    SQED-ASNDE----FFVNLLLGLWEDRMARGLFRYDVTACETKVIPGNLGFVAQLNEGRH  116

Query  1690  LKKRPTEFRVDQVLQPFDENKFNFTKIGQEEVLFRFEPSNDCKSHYLPSGLVDARSGSPT  1511
             LKKRPTEFRVD+VLQPFD  KFNFTK+GQEEVLF+FE      S ++ S  +     +P 
Sbjct  117   LKKRPTEFRVDRVLQPFDAAKFNFTKVGQEEVLFQFENGGGDDSFFVESSPISVADRAPN  176

Query  1510  VLAINVSPIEYGHVLLIPRVLDCLPQRIDHDSFFVAMHLAKEAADPFFRVGYNSLGAFAT  1331
             V+AINVSPIEYGHVLLIPRVLD LPQRID +SF +A+H+A EAA P+FR+GYNSLGAFAT
Sbjct  177   VVAINVSPIEYGHVLLIPRVLDRLPQRIDQESFLLALHMAAEAASPYFRLGYNSLGAFAT  236

Query  1330  INHLHFQAYYLQVPFPVEKTPTREIMRGREQGDGGIVVSQLLNYPARALLFEGGSTVRDL  1151
             INHLHFQAYYL VPFPVEK  T+ I       + G+ VS+L+NYP R L+FEGG+++ DL
Sbjct  237   INHLHFQAYYLTVPFPVEKAATKRIFLAEGTMNSGVKVSKLMNYPVRGLVFEGGNSLSDL  296

Query  1150  SDAVANSCISLQNNNIPFNLLISERGNKVFLFPQVHS  1040
             ++ V+++CI LQ+NN+P+N+LIS+ G K+FLFPQ ++
Sbjct  297   ANVVSSACIWLQDNNVPYNVLISDCGKKIFLFPQCYA  333


 Score =   122 bits (307),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 58/78 (74%), Positives = 68/78 (87%), Gaps = 0/78 (0%)
 Frame = -2

Query  759  FSKCYAEKQACGKIDQEILDTWVNPAVWEISGHMVLKRREDYDDASEDYAWRLLSEVSLS  580
            F +CYAEKQA G++ QE+LDT VNPAVWEISGH+VLKRR DY++ASE  AWRLL+EVSLS
Sbjct  328  FPQCYAEKQALGEVSQELLDTQVNPAVWEISGHIVLKRRSDYEEASEASAWRLLAEVSLS  387

Query  579  EERFEEVKAYVSRAADLL  526
            EERFEEVKAY+  AA L+
Sbjct  388  EERFEEVKAYIFDAAGLV  405



>ref|XP_010433431.1| PREDICTED: GDP-L-galactose phosphorylase 1-like [Camelina sativa]
Length=443

 Score =   432 bits (1110),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 207/339 (61%), Positives = 265/339 (78%), Gaps = 8/339 (2%)
 Frame = -1

Query  2041  MLTIKRVPTVVSNYQDDAPEDSKPESLGCGRNCLGQCCLPVSCLPLFAFKNDEHKCDGDW  1862
             ML IKRVPTVVSNYQ D   D   ES+GCGRNCLG CC+  + LPL+A KN E   +   
Sbjct  1     MLKIKRVPTVVSNYQKDEAAD---ESVGCGRNCLGACCINGARLPLYACKNLEKSREKIV  57

Query  1861  NYLSYGECPISFLSDLLLGQWEERMSRGLFRYDVTSCETKIIPGTFGFIAQLNEGRHLKK  1682
                   E P++FL  L+LG+WE+R  RGLFRYDVT+CETK+IPG +GF+AQLNEGRHLKK
Sbjct  58    VSHEAEEPPVAFLESLVLGEWEDRFQRGLFRYDVTACETKVIPGKYGFVAQLNEGRHLKK  117

Query  1681  RPTEFRVDQVLQPFDENKFNFTKIGQEEVLFRFEPSNDCKSHYLPSGLVDARSGSPTVLA  1502
             RPTEFRVD+VLQ FD +KFNFTK+GQEE+LF+FE   D +  + P   +D  + S +V+A
Sbjct  118   RPTEFRVDKVLQSFDGSKFNFTKVGQEELLFQFEAGEDGQVQFFPCMPLDPEN-SFSVVA  176

Query  1501  INVSPIEYGHVLLIPRVLDCLPQRIDHDSFFVAMHLAKEAADPFFRVGYNSLGAFATINH  1322
             INVSPIEYGHVLLIPRVLDCLPQRIDH S  +A+H+A EAA+P+FR+GYNSLGAFATINH
Sbjct  177   INVSPIEYGHVLLIPRVLDCLPQRIDHKSLLLAVHMAAEAANPYFRLGYNSLGAFATINH  236

Query  1321  LHFQAYYLQVPFPVEKTPTREIMRGREQGDGGIVVSQLLNYPARALLFEGGSTVRDLSDA  1142
             LHFQAYYL +PFP+E+ PT++++        G+ +S+LLNYP R+LLFEGGS+++DLSD 
Sbjct  237   LHFQAYYLAMPFPLERAPTKKMVTTV----SGVKISELLNYPVRSLLFEGGSSMQDLSDT  292

Query  1141  VANSCISLQNNNIPFNLLISERGNKVFLFPQVHSNSVFL  1025
             V+++C+ LQN+NIPFN+LI++ G ++F+ PQ ++    L
Sbjct  293   VSDACVCLQNDNIPFNILIADCGRQIFVMPQCYAEKQAL  331


 Score =   106 bits (265),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 49/74 (66%), Positives = 60/74 (81%), Gaps = 0/74 (0%)
 Frame = -2

Query  759  FSKCYAEKQACGKIDQEILDTWVNPAVWEISGHMVLKRREDYDDASEDYAWRLLSEVSLS  580
              +CYAEKQA G++  E+L+T VNPAVWEISGHMVLKR+EDY+ ASE+ AWRLL+E SLS
Sbjct  321  MPQCYAEKQALGEVSPEVLETQVNPAVWEISGHMVLKRKEDYEGASEENAWRLLAEASLS  380

Query  579  EERFEEVKAYVSRA  538
            EERF+EV   +  A
Sbjct  381  EERFKEVNTLIFEA  394



>gb|ACN28924.1| unknown [Zea mays]
 gb|AFW74695.1| VTC2 [Zea mays]
Length=435

 Score =   431 bits (1108),  Expect = 4e-140, Method: Compositional matrix adjust.
 Identities = 209/335 (62%), Positives = 256/335 (76%), Gaps = 10/335 (3%)
 Frame = -1

Query  2044  LMLTIKRVPTVVSNYQDDAPEDSKPESLGCGRNCLGQCCLPVSCLPLFAFKNDEHKCDGD  1865
             + LTI+RVPTVVSNYQ+DA    KP + GCGRNCLG CCLP S LPL+AFK    K   +
Sbjct  3     MKLTIRRVPTVVSNYQEDA---DKPRA-GCGRNCLGDCCLPASKLPLYAFKLTPAKGSQE  58

Query  1864  WNYLSYGECPISFLSDLLLGQWEERMSRGLFRYDVTSCETKIIPGTFGFIAQLNEGRHLK  1685
                          L D+LL +WE+RM+RGLFRYDVT+CETK+IPG  GF+AQLNEGRHLK
Sbjct  59    ------DAASTKLLVDILLSEWEDRMTRGLFRYDVTACETKVIPGNLGFVAQLNEGRHLK  112

Query  1684  KRPTEFRVDQVLQPFDENKFNFTKIGQEEVLFRFEPSNDCKSHYLPSGLVDARSGSPTVL  1505
             KRPTEFRVD+VLQPFD  KFNFTK+GQEEVLF+FE S    S++L +  + A   +P V+
Sbjct  113   KRPTEFRVDRVLQPFDPAKFNFTKVGQEEVLFQFENSGGDDSYFLNNAPIIAVDRAPNVI  172

Query  1504  AINVSPIEYGHVLLIPRVLDCLPQRIDHDSFFVAMHLAKEAADPFFRVGYNSLGAFATIN  1325
             AINVSPIEYGHVLLIPRVLD LPQRID +SF +A+ +A E   P+FR+GYNSLGAFATIN
Sbjct  173   AINVSPIEYGHVLLIPRVLDRLPQRIDPESFLLALQMAAEGGSPYFRLGYNSLGAFATIN  232

Query  1324  HLHFQAYYLQVPFPVEKTPTREIMRGREQGDGGIVVSQLLNYPARALLFEGGSTVRDLSD  1145
             HLHFQAYYL VPFPVEK  T +I    +    G+ VS+L+NYP R L+FEGG+T+ DL+ 
Sbjct  233   HLHFQAYYLSVPFPVEKAATHKIPLSEDTKKNGVTVSKLINYPVRGLVFEGGNTLDDLAT  292

Query  1144  AVANSCISLQNNNIPFNLLISERGNKVFLFPQVHS  1040
              V+N+CI LQ+NN+P+N+LIS+ G +VFLFPQ ++
Sbjct  293   VVSNACIWLQDNNVPYNVLISDCGKRVFLFPQCYA  327


 Score =   123 bits (309),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 58/78 (74%), Positives = 68/78 (87%), Gaps = 0/78 (0%)
 Frame = -2

Query  759  FSKCYAEKQACGKIDQEILDTWVNPAVWEISGHMVLKRREDYDDASEDYAWRLLSEVSLS  580
            F +CYAEKQA G++ QE+LDT VNPAVWEISGHMVLKRR DY++ASE  AW+LL+EVSLS
Sbjct  322  FPQCYAEKQALGEVSQELLDTQVNPAVWEISGHMVLKRRMDYEEASETSAWKLLAEVSLS  381

Query  579  EERFEEVKAYVSRAADLL  526
            EERFEEVKAY+  AA L+
Sbjct  382  EERFEEVKAYIFSAAGLV  399



>ref|NP_001150222.1| VTC2 [Zea mays]
 gb|ACG38291.1| VTC2 [Zea mays]
Length=435

 Score =   431 bits (1108),  Expect = 4e-140, Method: Compositional matrix adjust.
 Identities = 209/335 (62%), Positives = 256/335 (76%), Gaps = 10/335 (3%)
 Frame = -1

Query  2044  LMLTIKRVPTVVSNYQDDAPEDSKPESLGCGRNCLGQCCLPVSCLPLFAFKNDEHKCDGD  1865
             + LTI+RVPTVVSNYQ+DA    KP + GCGRNCLG CCLP S LPL+AFK    K   +
Sbjct  3     MKLTIRRVPTVVSNYQEDA---DKPRA-GCGRNCLGDCCLPASKLPLYAFKLTPAKGSQE  58

Query  1864  WNYLSYGECPISFLSDLLLGQWEERMSRGLFRYDVTSCETKIIPGTFGFIAQLNEGRHLK  1685
                          L D+LL +WE+RM+RGLFRYDVT+CETK+IPG  GF+AQLNEGRHLK
Sbjct  59    ------DAASTKLLVDILLSEWEDRMTRGLFRYDVTACETKVIPGNLGFVAQLNEGRHLK  112

Query  1684  KRPTEFRVDQVLQPFDENKFNFTKIGQEEVLFRFEPSNDCKSHYLPSGLVDARSGSPTVL  1505
             KRPTEFRVD+VLQPFD  KFNFTK+GQEEVLF+FE S    S++L +  + A   +P V+
Sbjct  113   KRPTEFRVDRVLQPFDPAKFNFTKVGQEEVLFQFENSGGDDSYFLNNAPIIAVDRAPNVI  172

Query  1504  AINVSPIEYGHVLLIPRVLDCLPQRIDHDSFFVAMHLAKEAADPFFRVGYNSLGAFATIN  1325
             AINVSPIEYGHVLLIPRVLD LPQRID +SF +A+ +A E   P+FR+GYNSLGAFATIN
Sbjct  173   AINVSPIEYGHVLLIPRVLDRLPQRIDPESFLLALQMAAEGGSPYFRLGYNSLGAFATIN  232

Query  1324  HLHFQAYYLQVPFPVEKTPTREIMRGREQGDGGIVVSQLLNYPARALLFEGGSTVRDLSD  1145
             HLHFQAYYL VPFPVEK  T +I    +    G+ VS+L+NYP R L+FEGG+T+ DL+ 
Sbjct  233   HLHFQAYYLSVPFPVEKAATHKIPLSEDTKKNGVTVSKLINYPVRGLVFEGGNTLDDLAT  292

Query  1144  AVANSCISLQNNNIPFNLLISERGNKVFLFPQVHS  1040
              V+N+CI LQ+NN+P+N+LIS+ G +VFLFPQ ++
Sbjct  293   VVSNACIWLQDNNVPYNVLISDCGKRVFLFPQCYA  327


 Score =   123 bits (308),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 58/78 (74%), Positives = 68/78 (87%), Gaps = 0/78 (0%)
 Frame = -2

Query  759  FSKCYAEKQACGKIDQEILDTWVNPAVWEISGHMVLKRREDYDDASEDYAWRLLSEVSLS  580
            F +CYAEKQA G++ QE+LDT VNPAVWEISGHMVLKRR DY++ASE  AW+LL+EVSLS
Sbjct  322  FPQCYAEKQALGEVSQELLDTQVNPAVWEISGHMVLKRRMDYEEASETSAWKLLAEVSLS  381

Query  579  EERFEEVKAYVSRAADLL  526
            EERFEEVKAY+  AA L+
Sbjct  382  EERFEEVKAYIFSAAGLV  399



>ref|XP_004977174.1| PREDICTED: GDP-L-galactose phosphorylase 2-like [Setaria italica]
Length=432

 Score =   431 bits (1108),  Expect = 4e-140, Method: Compositional matrix adjust.
 Identities = 207/335 (62%), Positives = 259/335 (77%), Gaps = 10/335 (3%)
 Frame = -1

Query  2044  LMLTIKRVPTVVSNYQDDAPEDSKPESLGCGRNCLGQCCLPVSCLPLFAFKNDEHKCDGD  1865
             + LTI+RVPTVVSNYQ+DA    KP + GCGRNCLG CCLPVS LPL+AFK +  K   +
Sbjct  3     MKLTIRRVPTVVSNYQEDA---DKPRA-GCGRNCLGDCCLPVSKLPLYAFKANPAKPSQE  58

Query  1864  WNYLSYGECPISFLSDLLLGQWEERMSRGLFRYDVTSCETKIIPGTFGFIAQLNEGRHLK  1685
                          L ++LL +WE+RM+RGLFRYDVT+CETK+IPG  GF+AQLNEGRHLK
Sbjct  59    ------DASSTKSLVNILLTEWEDRMARGLFRYDVTACETKVIPGNLGFVAQLNEGRHLK  112

Query  1684  KRPTEFRVDQVLQPFDENKFNFTKIGQEEVLFRFEPSNDCKSHYLPSGLVDARSGSPTVL  1505
             KRPTEFRVD+VLQPFD  KFNFTK+GQEEVLF+FE      S++L +  +     +P V+
Sbjct  113   KRPTEFRVDRVLQPFDPAKFNFTKVGQEEVLFQFENGAGDDSYFLNNAPITVADRAPNVV  172

Query  1504  AINVSPIEYGHVLLIPRVLDCLPQRIDHDSFFVAMHLAKEAADPFFRVGYNSLGAFATIN  1325
             AINVSPIEYGHVLLIPRVLD LPQRID +SF +A+ +A EAA P+FR+GYNSLGAFATIN
Sbjct  173   AINVSPIEYGHVLLIPRVLDGLPQRIDPESFLLALQMAAEAASPYFRLGYNSLGAFATIN  232

Query  1324  HLHFQAYYLQVPFPVEKTPTREIMRGREQGDGGIVVSQLLNYPARALLFEGGSTVRDLSD  1145
             HLHFQAYYL VPFPVEK  T +I    +    G+ VS+L+NYP R L+FEGG+T+ DL++
Sbjct  233   HLHFQAYYLSVPFPVEKAATHKIPLSEDTMKSGVTVSKLINYPVRGLVFEGGNTLNDLAN  292

Query  1144  AVANSCISLQNNNIPFNLLISERGNKVFLFPQVHS  1040
              V+++CI LQ+NN+P+N+LIS+ G ++FLFPQ ++
Sbjct  293   VVSSACIWLQDNNVPYNVLISDCGKRIFLFPQCYA  327


 Score =   122 bits (307),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 57/78 (73%), Positives = 68/78 (87%), Gaps = 0/78 (0%)
 Frame = -2

Query  759  FSKCYAEKQACGKIDQEILDTWVNPAVWEISGHMVLKRREDYDDASEDYAWRLLSEVSLS  580
            F +CYAEKQA G++ QE+LDT VNPAVWEISGH+VLKRR DY++ASE  AW+LL+EVSLS
Sbjct  322  FPQCYAEKQAMGEVSQELLDTQVNPAVWEISGHIVLKRRNDYEEASETSAWKLLAEVSLS  381

Query  579  EERFEEVKAYVSRAADLL  526
            EERFEEVKAY+  AA L+
Sbjct  382  EERFEEVKAYIFTAAGLV  399



>gb|KHN12517.1| GDP-L-galactose phosphorylase 1 [Glycine soja]
Length=436

 Score =   431 bits (1107),  Expect = 5e-140, Method: Compositional matrix adjust.
 Identities = 207/335 (62%), Positives = 268/335 (80%), Gaps = 7/335 (2%)
 Frame = -1

Query  2041  MLTIKRVPTVVSNYQDDAPEDSKPESLGCGRNCLGQCCLPVSCLPLFAFKNDEHKCDGDW  1862
             ML+IKRVPT+VSNYQ +   ++   + GCGRNCL  CC+  + LPL+AFK  +  C  + 
Sbjct  1     MLSIKRVPTLVSNYQKEETGEAA-AAGGCGRNCLKSCCIQGARLPLYAFKKVDKVCGNEL  59

Query  1861  NYLSYGEC-PISFLSDLLLGQWEERMSRGLFRYDVTSCETKIIPGTFGFIAQLNEGRHLK  1685
               L   E  P++FL  L+LG+WE+RM RGLFRYDVT+CETK+IPG +GFIAQLNEGRHLK
Sbjct  60    PLLGCKEQHPVAFLDSLVLGEWEDRMQRGLFRYDVTACETKVIPGEYGFIAQLNEGRHLK  119

Query  1684  KRPTEFRVDQVLQPFDENKFNFTKIGQEEVLFRFEPSNDCKSHYLPSGLVDARSGSPTVL  1505
             KRPTEFRVD+VLQPFDENKFNFTK+GQEEVLF+ E SND ++ + P+  +D  + SP+ +
Sbjct  120   KRPTEFRVDKVLQPFDENKFNFTKVGQEEVLFQLEASNDGEAQFFPNAPIDVEN-SPSFV  178

Query  1504  AINVSPIEYGHVLLIPRVLDCLPQRIDHDSFFVAMHLAKEAADPFFRVGYNSLGAFATIN  1325
             AINVSPIEYGHVLLIPR+ +CLPQRIDH SF +A+ +A EA +P+FR+GYNSLGAFATIN
Sbjct  179   AINVSPIEYGHVLLIPRIFECLPQRIDHASFLLALQMAVEARNPYFRLGYNSLGAFATIN  238

Query  1324  HLHFQAYYLQVPFPVEKTPTREIMRGREQGDGGIVVSQLLNYPARALLFEGGSTVRDLSD  1145
             HLHFQAYYL +PFP+EK PT++I +      GG+++S+LLNYP R L+FEGG T+ DL++
Sbjct  239   HLHFQAYYLALPFPIEKAPTKKIAK----LSGGVIISKLLNYPVRGLVFEGGHTLEDLAN  294

Query  1144  AVANSCISLQNNNIPFNLLISERGNKVFLFPQVHS  1040
             AV+ +CI LQ+NNIP+N+LIS+ G ++FL PQ ++
Sbjct  295   AVSEACICLQHNNIPYNVLISDCGRQIFLLPQCYA  329


 Score =   105 bits (263),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 50/74 (68%), Positives = 61/74 (82%), Gaps = 0/74 (0%)
 Frame = -2

Query  759  FSKCYAEKQACGKIDQEILDTWVNPAVWEISGHMVLKRREDYDDASEDYAWRLLSEVSLS  580
              +CYAEKQA G++  E+L+T VNPAVWEISGHMVLKR++DY++ASE  AWRLL+EVSLS
Sbjct  324  LPQCYAEKQALGEVSPELLETQVNPAVWEISGHMVLKRKKDYEEASEANAWRLLAEVSLS  383

Query  579  EERFEEVKAYVSRA  538
            EER  EV A V +A
Sbjct  384  EERLLEVTALVFQA  397



>gb|ADM16545.1| GDP-L-galactose guanyltransferase [Rosa roxburghii]
Length=445

 Score =   430 bits (1106),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 206/341 (60%), Positives = 267/341 (78%), Gaps = 9/341 (3%)
 Frame = -1

Query  2041  MLTIKRVPTVVSNYQDDAPEDSKPESLGCGRNCLGQCCLPVSCLPLFAFKNDEHKCDGDW  1862
             ML IKRVPT+VSNYQ D  ++ +  + GCGRNCL +CC+  + LPL+AFK  ++   GD 
Sbjct  1     MLRIKRVPTMVSNYQKDEADEGR-RAGGCGRNCLNKCCISGAKLPLYAFKK-QNNTSGDK  58

Query  1861  NYLSY--GECPISFLSDLLLGQWEERMSRGLFRYDVTSCETKIIPGTFGFIAQLNEGRHL  1688
              +  +   E P++FL  LLLG+WE+RM +GLFRYDVT+CETK+IPG FGFIAQLNEGRHL
Sbjct  59    GFSGHERQEAPVAFLDALLLGEWEDRMQKGLFRYDVTACETKVIPGQFGFIAQLNEGRHL  118

Query  1687  KKRPTEFRVDQVLQPFDENKFNFTKIGQEEVLFRFEPSNDCKSHYLPSGLVDARSGSPTV  1508
             KKRPTEFRVD+VLQPFD +KFNFTK+GQEE LF+FE S D +  + P+  +D  +  P+V
Sbjct  119   KKRPTEFRVDKVLQPFDGSKFNFTKVGQEEDLFQFEASEDGEVQFHPNAPIDVEN-PPSV  177

Query  1507  LAINVSPIEYGHVLLIPRVLDCLPQRIDHDSFFVAMHLAKEAADPFFRVGYNSLGAFATI  1328
             +AINVSPIEYGHVLLIPR+L+ LPQRID +SF +A+H+A EA +P+FR+GYNSLGAFATI
Sbjct  178   VAINVSPIEYGHVLLIPRILESLPQRIDRESFLLALHMAVEAGNPYFRLGYNSLGAFATI  237

Query  1327  NHLHFQAYYLQVPFPVEKTPTREIMRGREQGDGGIVVSQLLNYPARALLFEGGSTVRDLS  1148
             NHLHFQAYYL V FP+EK PT++I       D G+ +S+LLNYP R L+FEGG+T+ DLS
Sbjct  238   NHLHFQAYYLAVTFPIEKAPTKKIT----SLDVGVKISELLNYPVRGLVFEGGNTLEDLS  293

Query  1147  DAVANSCISLQNNNIPFNLLISERGNKVFLFPQVHSNSVFL  1025
             ++V+++CI LQ NNIP+N+LIS+ G ++ L PQ ++    L
Sbjct  294   NSVSDACICLQENNIPYNVLISDCGKRILLLPQCYAEKQAL  334


 Score =   114 bits (285),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 62/115 (54%), Positives = 77/115 (67%), Gaps = 1/115 (1%)
 Frame = -2

Query  759  FSKCYAEKQACGKIDQEILDTWVNPAVWEISGHMVLKRREDYDDASEDYAWRLLSEVSLS  580
              +CYAEKQA G++  E+LDT VNPAVWEISGHMVLKRREDYD+AS++ AW+LL+EVSLS
Sbjct  324  LPQCYAEKQALGEVRAELLDTQVNPAVWEISGHMVLKRREDYDEASDENAWKLLAEVSLS  383

Query  579  EERFEEVKAYVSRAADLLLDSECSNGGSQP-WETYPEASWTATNELSFTSRLSGA  418
            EERF+EV A +  A     D   +N    P  +  P     A N+ S  + LSG 
Sbjct  384  EERFQEVNALIFGAIACGGDDGNANLLEDPDVKPRPHEEVNAINKSSRHAILSGT  438



>ref|XP_006663878.1| PREDICTED: GDP-L-galactose phosphorylase 2-like [Oryza brachyantha]
Length=440

 Score =   430 bits (1105),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 209/340 (61%), Positives = 258/340 (76%), Gaps = 12/340 (4%)
 Frame = -1

Query  2044  LMLTIKRVPTVVSNYQD-----DAPEDSKPESLGCGRNCLGQCCLPVSCLPLFAFKNDEH  1880
             + LTIKRVPTVVSNYQ+     DA  D +P + GCGR+CLG CCLP S LPL+AFK    
Sbjct  3     MKLTIKRVPTVVSNYQEEGAAADAAND-RPRA-GCGRDCLGDCCLPDSKLPLYAFKASPK  60

Query  1879  KCDGDWNYLSYGECPISFLSDLLLGQWEERMSRGLFRYDVTSCETKIIPGTFGFIAQLNE  1700
             K     +  +       F  +LLLG WE++M+RGLFRYDVT+CETK+IPG  GF+AQLNE
Sbjct  61    KPSSQEDAAN-----TDFFVNLLLGLWEDKMARGLFRYDVTACETKVIPGNLGFVAQLNE  115

Query  1699  GRHLKKRPTEFRVDQVLQPFDENKFNFTKIGQEEVLFRFEPSNDCKSHYLPSGLVDARSG  1520
             GRHLKKRPTEFRVD+VLQPFD  KFNFTK+GQEEVLF+FE      S +L S  +     
Sbjct  116   GRHLKKRPTEFRVDRVLQPFDAAKFNFTKVGQEEVLFQFENGGGDDSFFLKSAPISVADR  175

Query  1519  SPTVLAINVSPIEYGHVLLIPRVLDCLPQRIDHDSFFVAMHLAKEAADPFFRVGYNSLGA  1340
             +P V+AINVSPIEYGHVLLIPRVLD LPQRID +SF +A+H+A EAA P+FR+GYNSLGA
Sbjct  176   APNVVAINVSPIEYGHVLLIPRVLDRLPQRIDQESFLLALHMAAEAASPYFRLGYNSLGA  235

Query  1339  FATINHLHFQAYYLQVPFPVEKTPTREIMRGREQGDGGIVVSQLLNYPARALLFEGGSTV  1160
             FATINHLHFQAYYL VPFPVEK  T+ I       + G+ VS+L+NYP R L+FEGG+++
Sbjct  236   FATINHLHFQAYYLTVPFPVEKAATKRIFLAEGVMNSGVKVSKLMNYPVRGLVFEGGNSL  295

Query  1159  RDLSDAVANSCISLQNNNIPFNLLISERGNKVFLFPQVHS  1040
              DL+  V+++CI LQ+NN+P+N+LIS+ G K+FLFPQ ++
Sbjct  296   NDLASVVSSACIWLQDNNVPYNVLISDCGKKIFLFPQCYA  335


 Score =   120 bits (302),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 57/78 (73%), Positives = 67/78 (86%), Gaps = 0/78 (0%)
 Frame = -2

Query  759  FSKCYAEKQACGKIDQEILDTWVNPAVWEISGHMVLKRREDYDDASEDYAWRLLSEVSLS  580
            F +CYAEKQA G++ QE+LDT VNPA WEISGH+VLKRR DY++ASE  AWRLL+EVSLS
Sbjct  330  FPQCYAEKQALGEVSQELLDTQVNPAAWEISGHIVLKRRSDYEEASEASAWRLLAEVSLS  389

Query  579  EERFEEVKAYVSRAADLL  526
            EERFEEVKAY+  AA L+
Sbjct  390  EERFEEVKAYIFDAAGLV  407



>ref|XP_010438688.1| PREDICTED: GDP-L-galactose phosphorylase 1-like [Camelina sativa]
Length=443

 Score =   429 bits (1104),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 206/339 (61%), Positives = 265/339 (78%), Gaps = 8/339 (2%)
 Frame = -1

Query  2041  MLTIKRVPTVVSNYQDDAPEDSKPESLGCGRNCLGQCCLPVSCLPLFAFKNDEHKCDGDW  1862
             ML IKRVPTVVSNYQ +   D   +S+GCGRNCLG CC+  + LPL+A KN E   +   
Sbjct  1     MLKIKRVPTVVSNYQKNEAAD---DSVGCGRNCLGACCINGARLPLYACKNLEKSREKIV  57

Query  1861  NYLSYGECPISFLSDLLLGQWEERMSRGLFRYDVTSCETKIIPGTFGFIAQLNEGRHLKK  1682
                   E P++FL  L+LG+WE+R  RGLFRYDVT+CETK+IPG +GF+AQLNEGRHLKK
Sbjct  58    VSHEAEEPPVAFLESLVLGEWEDRFQRGLFRYDVTACETKVIPGKYGFVAQLNEGRHLKK  117

Query  1681  RPTEFRVDQVLQPFDENKFNFTKIGQEEVLFRFEPSNDCKSHYLPSGLVDARSGSPTVLA  1502
             RPTEFRVD+VLQ FD +KFNFTK+GQEE+LF+FE   D +  + P   +D  + S +V+A
Sbjct  118   RPTEFRVDKVLQSFDGSKFNFTKVGQEELLFQFEAGEDGQVQFFPCMPLDPEN-SFSVVA  176

Query  1501  INVSPIEYGHVLLIPRVLDCLPQRIDHDSFFVAMHLAKEAADPFFRVGYNSLGAFATINH  1322
             INVSPIEYGHVLLIPRVLDCLPQRIDH S  +A+H+A EAA+P+FR+GYNSLGAFATINH
Sbjct  177   INVSPIEYGHVLLIPRVLDCLPQRIDHKSLLLAVHMAAEAANPYFRLGYNSLGAFATINH  236

Query  1321  LHFQAYYLQVPFPVEKTPTREIMRGREQGDGGIVVSQLLNYPARALLFEGGSTVRDLSDA  1142
             LHFQAYYL +PFP+E+ PT++++        G+ +S+LLNYP R+LLFEGGS+++DLSD 
Sbjct  237   LHFQAYYLAMPFPLERAPTKKMVTTV----SGVKISELLNYPVRSLLFEGGSSMQDLSDT  292

Query  1141  VANSCISLQNNNIPFNLLISERGNKVFLFPQVHSNSVFL  1025
             V+++C+ LQNNNIPFN+LI++ G ++F+ PQ ++    L
Sbjct  293   VSDACVCLQNNNIPFNILIADCGRQIFVMPQCYAEKQAL  331


 Score =   105 bits (262),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 48/74 (65%), Positives = 60/74 (81%), Gaps = 0/74 (0%)
 Frame = -2

Query  759  FSKCYAEKQACGKIDQEILDTWVNPAVWEISGHMVLKRREDYDDASEDYAWRLLSEVSLS  580
              +CYAEKQA G++  E+L+T VNPAVWEISGHMVLKR++DY+ ASE+ AWRLL+E SLS
Sbjct  321  MPQCYAEKQALGEVSPEVLETQVNPAVWEISGHMVLKRKDDYEGASEENAWRLLAEASLS  380

Query  579  EERFEEVKAYVSRA  538
            EERF+EV   +  A
Sbjct  381  EERFKEVNTLIFEA  394



>gb|KCW70214.1| hypothetical protein EUGRSUZ_F03491 [Eucalyptus grandis]
Length=444

 Score =   429 bits (1104),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 209/337 (62%), Positives = 264/337 (78%), Gaps = 7/337 (2%)
 Frame = -1

Query  2044  LMLTIKRVPTVVSNYQDDAPEDSKPESLGCGRNCLGQCCLPVSC-LPLFAFKNDEHKCDG  1868
             +ML IKRVPTVVSNYQ +  E+      GCGRNCL +CC+P    LPL+AFK      D 
Sbjct  1     MMLKIKRVPTVVSNYQKEEAEEGARRGGGCGRNCLNKCCIPAGAKLPLYAFKRVNFVADE  60

Query  1867  DWNYLSY-GECPISFLSDLLLGQWEERMSRGLFRYDVTSCETKIIPGTFGFIAQLNEGRH  1691
                 +    E P++FL  LLLG+WE+RM RGLFRYDVT+CETKIIPG +GFIAQLNEGRH
Sbjct  61    KAGIVGENAEPPVAFLDSLLLGEWEDRMQRGLFRYDVTACETKIIPGGYGFIAQLNEGRH  120

Query  1690  LKKRPTEFRVDQVLQPFDENKFNFTKIGQEEVLFRFEPSNDCKSHYLPSGLVDARSGSPT  1511
             LKKRPTEFRVD+VLQPFD +KFNFTK+GQEE+LF+FE S D +  +     +DA   SP+
Sbjct  121   LKKRPTEFRVDKVLQPFDGSKFNFTKVGQEEILFQFEASEDGEVQFFAKAPIDA-DNSPS  179

Query  1510  VLAINVSPIEYGHVLLIPRVLDCLPQRIDHDSFFVAMHLAKEAADPFFRVGYNSLGAFAT  1331
             V+AINVSPIEYGHVLLIPRVL+C+PQRID +SF +A+++A EA +P+FR+GYNSLGAFAT
Sbjct  180   VVAINVSPIEYGHVLLIPRVLECMPQRIDRESFSLALYMAAEARNPYFRLGYNSLGAFAT  239

Query  1330  INHLHFQAYYLQVPFPVEKTPTREIMRGREQGDGGIVVSQLLNYPARALLFEGGSTVRDL  1151
             INHLHFQAYYL VPFP+EK PT+++       + G+ + +L+NYP R L+FEGG TV+DL
Sbjct  240   INHLHFQAYYLAVPFPIEKAPTQKLT----ALESGVTIFELVNYPVRGLVFEGGDTVQDL  295

Query  1150  SDAVANSCISLQNNNIPFNLLISERGNKVFLFPQVHS  1040
             S+AV++SCI LQ+NNIP+N+LIS+ G ++FL PQ ++
Sbjct  296   SNAVSDSCICLQDNNIPYNVLISDCGKRIFLLPQCYA  332


 Score =   112 bits (280),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 54/97 (56%), Positives = 72/97 (74%), Gaps = 5/97 (5%)
 Frame = -2

Query  759  FSKCYAEKQACGKIDQEILDTWVNPAVWEISGHMVLKRREDYDDASEDYAWRLLSEVSLS  580
              +CYAEKQA G+++ E+LDT VNPAVWEISGH+VLKR++D+++ASE+ AWRLL+EVSLS
Sbjct  327  LPQCYAEKQALGEVNSELLDTQVNPAVWEISGHIVLKRKKDFEEASEENAWRLLAEVSLS  386

Query  579  EERFEEVKAYVSRAADLLLDSECSNGGSQPWETYPEA  469
            EERF+EV A +  A      +   NGG    +  P+A
Sbjct  387  EERFQEVNALIFEAI-----ASVENGGQDNPDVEPQA  418



>gb|EEC68977.1| hypothetical protein OsI_37726 [Oryza sativa Indica Group]
Length=438

 Score =   429 bits (1103),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 208/337 (62%), Positives = 257/337 (76%), Gaps = 8/337 (2%)
 Frame = -1

Query  2044  LMLTIKRVPTVVSNYQDDAPEDS--KPESLGCGRNCLGQCCLPVSCLPLFAFKNDEHKCD  1871
             + LTIKRVPTVVSNYQ+ A   +  +P + GCGR+CLG CCLP S LPL+AFK    K  
Sbjct  3     MKLTIKRVPTVVSNYQEYAAATAGERPRA-GCGRDCLGDCCLPDSKLPLYAFKASPKKPS  61

Query  1870  GDWNYLSYGECPISFLSDLLLGQWEERMSRGLFRYDVTSCETKIIPGTFGFIAQLNEGRH  1691
                  L        F  +LLLG WE+RM+RGLFRYDVT+CETK+IPG  GF+AQLNEGRH
Sbjct  62    -----LQEDASNDEFFVNLLLGLWEDRMARGLFRYDVTACETKVIPGNLGFVAQLNEGRH  116

Query  1690  LKKRPTEFRVDQVLQPFDENKFNFTKIGQEEVLFRFEPSNDCKSHYLPSGLVDARSGSPT  1511
             LKKRPTEFRVD+VLQPFD  KFNFTK+GQEEVLF+FE      S ++ S  +     +P 
Sbjct  117   LKKRPTEFRVDRVLQPFDAAKFNFTKVGQEEVLFQFENGGGDDSFFVESSPISVADRAPN  176

Query  1510  VLAINVSPIEYGHVLLIPRVLDCLPQRIDHDSFFVAMHLAKEAADPFFRVGYNSLGAFAT  1331
             V+AINVSPIEYGHVLLIPRVLD LPQRID +SF +A+H+A EAA P+FR+GYNSLGAFAT
Sbjct  177   VVAINVSPIEYGHVLLIPRVLDRLPQRIDQESFLLALHMAAEAASPYFRLGYNSLGAFAT  236

Query  1330  INHLHFQAYYLQVPFPVEKTPTREIMRGREQGDGGIVVSQLLNYPARALLFEGGSTVRDL  1151
             INHLHFQAYYL VPFPVEK  T+ I       + G+ VS+L+NYP R L+FEGG+++ DL
Sbjct  237   INHLHFQAYYLTVPFPVEKAATKRIFLAEGTMNSGVKVSKLMNYPVRGLVFEGGNSLSDL  296

Query  1150  SDAVANSCISLQNNNIPFNLLISERGNKVFLFPQVHS  1040
             ++ V+++CI LQ+NN+P+N+LIS+ G K+FLFPQ ++
Sbjct  297   ANVVSSACIWLQDNNVPYNVLISDCGKKIFLFPQCYA  333


 Score =   122 bits (307),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 58/78 (74%), Positives = 68/78 (87%), Gaps = 0/78 (0%)
 Frame = -2

Query  759  FSKCYAEKQACGKIDQEILDTWVNPAVWEISGHMVLKRREDYDDASEDYAWRLLSEVSLS  580
            F +CYAEKQA G++ QE+LDT VNPAVWEISGH+VLKRR DY++ASE  AWRLL+EVSLS
Sbjct  328  FPQCYAEKQALGEVSQELLDTQVNPAVWEISGHIVLKRRSDYEEASEASAWRLLAEVSLS  387

Query  579  EERFEEVKAYVSRAADLL  526
            EERFEEVKAY+  AA L+
Sbjct  388  EERFEEVKAYIFDAAGLV  405



>dbj|BAJ89242.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=431

 Score =   428 bits (1101),  Expect = 4e-139, Method: Compositional matrix adjust.
 Identities = 209/336 (62%), Positives = 258/336 (77%), Gaps = 14/336 (4%)
 Frame = -1

Query  2044  LMLTIKRVPTVVSNYQDDAPEDSKPESLGCGRNCLGQCCLPVSCLPLFAFKNDEHKCDGD  1865
             + LTIKRV TV+SNYQ++        + GCGRNCLG CCLP S LPL+AFK D  K   D
Sbjct  3     VKLTIKRVATVLSNYQEEG-------AGGCGRNCLGDCCLPASKLPLYAFKADPKKPAQD  55

Query  1864  WNYLSYGECPISF-LSDLLLGQWEERMSRGLFRYDVTSCETKIIPGTFGFIAQLNEGRHL  1688
                    E P  F L+ LLL QWE+R++RGLFRYDVT+CETK+IPG  GF+AQLNEGRHL
Sbjct  56    ------DELPTEFFLNSLLLAQWEDRVARGLFRYDVTACETKVIPGELGFVAQLNEGRHL  109

Query  1687  KKRPTEFRVDQVLQPFDENKFNFTKIGQEEVLFRFEPSNDCKSHYLPSGLVDARSGSPTV  1508
             KKRPTEFRVD+VLQPFD  KFNFTK+GQEEVLFRFE      S++L +        +P+V
Sbjct  110   KKRPTEFRVDRVLQPFDSAKFNFTKVGQEEVLFRFENGGGDSSYFLENAPSIEGDRAPSV  169

Query  1507  LAINVSPIEYGHVLLIPRVLDCLPQRIDHDSFFVAMHLAKEAADPFFRVGYNSLGAFATI  1328
             +AINVSPIEYGHVLLIPRVLD LPQ+ID +SF +A+H+A EAA P+FR+GYNSLGAFATI
Sbjct  170   VAINVSPIEYGHVLLIPRVLDRLPQQIDPESFLLALHMAAEAASPYFRLGYNSLGAFATI  229

Query  1327  NHLHFQAYYLQVPFPVEKTPTREIMRGREQGDGGIVVSQLLNYPARALLFEGGSTVRDLS  1148
             NHLHFQAYYL VPFPVEK PT++I   +   + G+ VS+L N+P R L+FE G+T++DL+
Sbjct  230   NHLHFQAYYLSVPFPVEKAPTKKIPLAKCALNSGVKVSKLTNFPVRGLVFERGNTLKDLA  289

Query  1147  DAVANSCISLQNNNIPFNLLISERGNKVFLFPQVHS  1040
             D V N+CI LQ NN+PFN+LIS+ G ++F+FPQ ++
Sbjct  290   DVVTNACIWLQENNVPFNVLISDSGRRIFVFPQCYA  325


 Score =   117 bits (293),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 55/77 (71%), Positives = 67/77 (87%), Gaps = 0/77 (0%)
 Frame = -2

Query  759  FSKCYAEKQACGKIDQEILDTWVNPAVWEISGHMVLKRREDYDDASEDYAWRLLSEVSLS  580
            F +CYAEKQA G++ Q++LDT VNPAVWEISGH+VLKRR D+++ASE  AWRLL+EVSLS
Sbjct  320  FPQCYAEKQALGEVSQDLLDTQVNPAVWEISGHIVLKRRTDFEEASEASAWRLLAEVSLS  379

Query  579  EERFEEVKAYVSRAADL  529
            EERFEEVKA + +AA L
Sbjct  380  EERFEEVKACIFQAAGL  396



>ref|XP_003577725.1| PREDICTED: GDP-L-galactose phosphorylase 2-like [Brachypodium 
distachyon]
Length=434

 Score =   428 bits (1101),  Expect = 4e-139, Method: Compositional matrix adjust.
 Identities = 209/336 (62%), Positives = 256/336 (76%), Gaps = 12/336 (4%)
 Frame = -1

Query  2044  LMLTIKRVPTVVSNYQDDAPEDSKPESLGCGRNCLGQCCLPVSCLPLFAFKNDEHKCDGD  1865
             + LTIKRVPTV+SNYQ++          GCGRNCLG CCLP S LPL+AFK         
Sbjct  3     VKLTIKRVPTVLSNYQEEGG------GAGCGRNCLGDCCLPASKLPLYAFKASNQN----  52

Query  1864  WNYLSYGECPISF-LSDLLLGQWEERMSRGLFRYDVTSCETKIIPGTFGFIAQLNEGRHL  1688
               +      P  F L+ LLLGQWE+RM++GLFRYDVT+CETK+IPG  GF+AQLNEGRHL
Sbjct  53    -KFAQEDGLPTDFFLNSLLLGQWEDRMAQGLFRYDVTACETKVIPGELGFVAQLNEGRHL  111

Query  1687  KKRPTEFRVDQVLQPFDENKFNFTKIGQEEVLFRFEPSNDCKSHYLPSGLVDARSGSPTV  1508
             KKRPTEFRVD+VLQPF   KFNFTK+GQEEVLFRFE      S++L +      S  P+V
Sbjct  112   KKRPTEFRVDRVLQPFHSAKFNFTKVGQEEVLFRFENGGGDSSYFLANVPNTESSHPPSV  171

Query  1507  LAINVSPIEYGHVLLIPRVLDCLPQRIDHDSFFVAMHLAKEAADPFFRVGYNSLGAFATI  1328
             +AINVSPIEYGHVLLIPRVLD LPQRID +SF +A+H+A EAA P+FR+GYNSLGAFATI
Sbjct  172   VAINVSPIEYGHVLLIPRVLDRLPQRIDPESFLLALHMAAEAASPYFRLGYNSLGAFATI  231

Query  1327  NHLHFQAYYLQVPFPVEKTPTREIMRGREQGDGGIVVSQLLNYPARALLFEGGSTVRDLS  1148
             NHLHFQAYYL VPFPVEK PT++I   + +   G+ VS+L+N+P R L+FE G+T++DL 
Sbjct  232   NHLHFQAYYLSVPFPVEKAPTKKIPLAKCELKSGVKVSKLMNFPVRGLVFERGNTLKDLG  291

Query  1147  DAVANSCISLQNNNIPFNLLISERGNKVFLFPQVHS  1040
             D V N+CI LQ+NN+PFN+LIS+ G K+F+FPQ ++
Sbjct  292   DVVTNACIWLQDNNVPFNVLISDSGQKIFIFPQCYA  327


 Score =   114 bits (285),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 53/77 (69%), Positives = 65/77 (84%), Gaps = 0/77 (0%)
 Frame = -2

Query  759  FSKCYAEKQACGKIDQEILDTWVNPAVWEISGHMVLKRREDYDDASEDYAWRLLSEVSLS  580
            F +CYAEKQA G++ Q++LDT VNPAVWEISGH+VLKRR D+++ASE  AWRLL+EVSLS
Sbjct  322  FPQCYAEKQALGEVSQDLLDTQVNPAVWEISGHIVLKRRADFEEASEASAWRLLAEVSLS  381

Query  579  EERFEEVKAYVSRAADL  529
            EERFEEVKA + +   L
Sbjct  382  EERFEEVKACIFQGTGL  398



>ref|XP_002316755.1| VITAMIN C DEFECTIVE 2 family protein [Populus trichocarpa]
 gb|EEE97367.1| VITAMIN C DEFECTIVE 2 family protein [Populus trichocarpa]
Length=451

 Score =   429 bits (1102),  Expect = 5e-139, Method: Compositional matrix adjust.
 Identities = 211/337 (63%), Positives = 262/337 (78%), Gaps = 7/337 (2%)
 Frame = -1

Query  2044  LMLTIKRVPTVVSNYQDDAPEDSKPESLGCGRNCLGQCCLPVSCLPLFAFKNDEHKCDGD  1865
             +ML IKRVPTVVSNYQ +  E+      GCGRNCL  CCL  + LPL+ FK  +      
Sbjct  1     MMLRIKRVPTVVSNYQKEEGEEGSRRGGGCGRNCLQNCCLQGARLPLYTFKKVDRIITEQ  60

Query  1864  WNYLSY--GECPISFLSDLLLGQWEERMSRGLFRYDVTSCETKIIPGTFGFIAQLNEGRH  1691
              +   +   E P++FL+ LLLG+WE+RM RGLFRYDVT+CETK+IPG  GFIAQLNEGRH
Sbjct  61    KDVFEHDKSEPPVAFLNSLLLGEWEDRMQRGLFRYDVTTCETKVIPGRNGFIAQLNEGRH  120

Query  1690  LKKRPTEFRVDQVLQPFDENKFNFTKIGQEEVLFRFEPSNDCKSHYLPSGLVDARSGSPT  1511
             LKKRPTEFRVD+VLQPFD NKFNFTK+GQEE+LF+F  S D +  + P   +DA + SP+
Sbjct  121   LKKRPTEFRVDKVLQPFDGNKFNFTKVGQEEILFQFGESEDGEVKFFPDATIDAEN-SPS  179

Query  1510  VLAINVSPIEYGHVLLIPRVLDCLPQRIDHDSFFVAMHLAKEAADPFFRVGYNSLGAFAT  1331
             V+AINVSPIEYGHVLLIPRVLDCLPQRID DSF +A+H+A EA DP+FR+GYNSLGAFAT
Sbjct  180   VVAINVSPIEYGHVLLIPRVLDCLPQRIDRDSFLLALHMAAEAGDPYFRLGYNSLGAFAT  239

Query  1330  INHLHFQAYYLQVPFPVEKTPTREIMRGREQGDGGIVVSQLLNYPARALLFEGGSTVRDL  1151
             INHLHFQAYYL VPFP+EK  T++I       DGG+ +S+L+NYP R L FEGG+ ++DL
Sbjct  240   INHLHFQAYYLTVPFPIEKASTKKIT----TLDGGVKISELVNYPVRGLFFEGGNALQDL  295

Query  1150  SDAVANSCISLQNNNIPFNLLISERGNKVFLFPQVHS  1040
             S+ V+++CI LQ NNIP+N+LI++ GN +FL PQ ++
Sbjct  296   SNTVSDACICLQENNIPYNVLIADCGNHIFLLPQCYA  332


 Score =   115 bits (287),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 54/81 (67%), Positives = 67/81 (83%), Gaps = 1/81 (1%)
 Frame = -2

Query  780  GTHSFGEFSKCYAEKQACGKIDQEILDTWVNPAVWEISGHMVLKRREDYDDASEDYAWRL  601
            G H F    +CYAEKQA G++  E+LDT VNPAVWEISGHMVLKR++DY++ASE+ AWRL
Sbjct  321  GNHIF-LLPQCYAEKQALGEVSSELLDTQVNPAVWEISGHMVLKRKKDYEEASEENAWRL  379

Query  600  LSEVSLSEERFEEVKAYVSRA  538
            L+EVSLSEERF+EV A + +A
Sbjct  380  LAEVSLSEERFQEVNALIFKA  400



>ref|XP_004514559.1| PREDICTED: GDP-L-galactose phosphorylase 1-like [Cicer arietinum]
Length=439

 Score =   428 bits (1100),  Expect = 6e-139, Method: Compositional matrix adjust.
 Identities = 205/341 (60%), Positives = 267/341 (78%), Gaps = 11/341 (3%)
 Frame = -1

Query  2041  MLTIKRVPTVVSNYQDDAPEDSKPESLGCGRNCLGQCCLPVSCLPLFAFKNDEHKCDGDW  1862
             ML+IKRVPTVVSNYQ D  ED+ P S GCGRNCL  CC+  + LPL+ FK  ++    D 
Sbjct  1     MLSIKRVPTVVSNYQKD--EDA-PVS-GCGRNCLKSCCIQEAKLPLYGFKKGDNVEGKDL  56

Query  1861  NYLSYGECPISFLSDLLLGQWEERMSRGLFRYDVTSCETKIIPGTFGFIAQLNEGRHLKK  1682
             + ++  E P++FL  ++LGQWE+RM RGLFRYDVT+CETK+IPG +GFIAQLNEGRHLKK
Sbjct  57    SLIACKEGPVAFLDSIILGQWEDRMQRGLFRYDVTTCETKVIPGKYGFIAQLNEGRHLKK  116

Query  1681  RPTEFRVDQVLQPFDENKFNFTKIGQEEVLFRFEPSNDCKSHYLPSGLVDARSGSPTVLA  1502
             RPTEFRVD+VLQPFDE KFNFTK+GQEE+LF+FE S+D +  + P+  +D  + SP+ +A
Sbjct  117   RPTEFRVDKVLQPFDETKFNFTKVGQEEILFQFEASSDGEPQFFPNAPIDVEN-SPSFVA  175

Query  1501  INVSPIEYGHVLLIPRVLDCLPQRIDHDSFFVAMHLAKEAADPFFRVGYNSLGAFATINH  1322
             INVSPIEYGHVLLIPR+ +CLPQRID  SF +A+H+A +A +P+FR+GYNSLGAFATINH
Sbjct  176   INVSPIEYGHVLLIPRIFECLPQRIDRASFMLALHMAADAGNPYFRLGYNSLGAFATINH  235

Query  1321  LHFQAYYLQVPFPVEKTPTREIMRGREQGDGGIVVSQLLNYPARALLFEGGS--TVRDLS  1148
             LHFQAYYL +PFP+EK  T++I +     +G + +S+LLNYP R L+FE G+   + DL+
Sbjct  236   LHFQAYYLSMPFPIEKAATKKIAK----LNGDVKISELLNYPVRGLVFESGTGHALDDLA  291

Query  1147  DAVANSCISLQNNNIPFNLLISERGNKVFLFPQVHSNSVFL  1025
             + V+ +CI LQ+NNIP+N+LIS+ G +VFL PQ ++    L
Sbjct  292   NTVSEACICLQHNNIPYNVLISDCGRRVFLLPQCYAEKQAL  332


 Score =   111 bits (278),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 51/74 (69%), Positives = 62/74 (84%), Gaps = 0/74 (0%)
 Frame = -2

Query  759  FSKCYAEKQACGKIDQEILDTWVNPAVWEISGHMVLKRREDYDDASEDYAWRLLSEVSLS  580
              +CYAEKQA G++  E+LDT VNPAVWEISGHMVLKR++D+D+ASE  AWRLL+EVSLS
Sbjct  322  LPQCYAEKQALGEVSAELLDTQVNPAVWEISGHMVLKRKKDFDEASESNAWRLLAEVSLS  381

Query  579  EERFEEVKAYVSRA  538
            EERFEEV   + +A
Sbjct  382  EERFEEVNTLIFQA  395



>ref|XP_011042805.1| PREDICTED: GDP-L-galactose phosphorylase 2-like [Populus euphratica]
Length=451

 Score =   427 bits (1099),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 210/337 (62%), Positives = 262/337 (78%), Gaps = 7/337 (2%)
 Frame = -1

Query  2044  LMLTIKRVPTVVSNYQDDAPEDSKPESLGCGRNCLGQCCLPVSCLPLFAFKNDEHKCDGD  1865
             +ML IKRVPTV+SNYQ +  E+      GCGRNCL  CCL  + LPL+ FK  +      
Sbjct  1     MMLRIKRVPTVLSNYQKEEGEEGSRRGGGCGRNCLQNCCLQGARLPLYTFKKVDRIITEQ  60

Query  1864  WNYLSY--GECPISFLSDLLLGQWEERMSRGLFRYDVTSCETKIIPGTFGFIAQLNEGRH  1691
              +   +   E P++FL+ LLLG+WE+RM RGLFRYDVT+CETK+IPG  GFIAQLNEGRH
Sbjct  61    KDVFEHDKSEPPVAFLNSLLLGEWEDRMQRGLFRYDVTTCETKVIPGRNGFIAQLNEGRH  120

Query  1690  LKKRPTEFRVDQVLQPFDENKFNFTKIGQEEVLFRFEPSNDCKSHYLPSGLVDARSGSPT  1511
             LKKRPTEFRVD+VLQPFD NKFNFTK+GQEE+LF+F  S D +  + P   +DA + SP+
Sbjct  121   LKKRPTEFRVDKVLQPFDGNKFNFTKVGQEEILFQFGESEDGEVKFFPDATIDAEN-SPS  179

Query  1510  VLAINVSPIEYGHVLLIPRVLDCLPQRIDHDSFFVAMHLAKEAADPFFRVGYNSLGAFAT  1331
             V+AINVSPIEYGHVLLIPRVLDCLPQRID DSF +A+H+A EA DP+FR+GYNSLGAFAT
Sbjct  180   VVAINVSPIEYGHVLLIPRVLDCLPQRIDRDSFLLALHMAAEAGDPYFRLGYNSLGAFAT  239

Query  1330  INHLHFQAYYLQVPFPVEKTPTREIMRGREQGDGGIVVSQLLNYPARALLFEGGSTVRDL  1151
             INHLHFQAYYL VPFP+EK  T++I       DGG+ +S+L+NYP R L FEGG+ ++DL
Sbjct  240   INHLHFQAYYLTVPFPIEKASTKKIT----TLDGGVKISELVNYPVRGLFFEGGNALQDL  295

Query  1150  SDAVANSCISLQNNNIPFNLLISERGNKVFLFPQVHS  1040
             S+ V+++CI LQ NNIP+N+LI++ GN +FL PQ ++
Sbjct  296   SNTVSDACICLQENNIPYNVLIADCGNHIFLLPQCYA  332


 Score =   112 bits (280),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 53/81 (65%), Positives = 66/81 (81%), Gaps = 1/81 (1%)
 Frame = -2

Query  780  GTHSFGEFSKCYAEKQACGKIDQEILDTWVNPAVWEISGHMVLKRREDYDDASEDYAWRL  601
            G H F    +CYAEKQA G++  E+LDT VNPAVWEISGH+VLKR++DY++ASE+ AWRL
Sbjct  321  GNHIF-LLPQCYAEKQALGEVSSEVLDTQVNPAVWEISGHIVLKRKKDYEEASEENAWRL  379

Query  600  LSEVSLSEERFEEVKAYVSRA  538
            L+EVSLSEERF+EV A +  A
Sbjct  380  LAEVSLSEERFQEVNALIFEA  400



>ref|XP_006452438.1| hypothetical protein CICLE_v10008255mg [Citrus clementina]
 ref|XP_006475020.1| PREDICTED: GDP-L-galactose phosphorylase 1-like [Citrus sinensis]
 gb|ADV59925.1| putative GDP-L-galactose-pyrophosphatase [Citrus unshiu]
 gb|ESR65678.1| hypothetical protein CICLE_v10008255mg [Citrus clementina]
 gb|KDO62101.1| hypothetical protein CISIN_1g012827mg [Citrus sinensis]
Length=455

 Score =   426 bits (1096),  Expect = 4e-138, Method: Compositional matrix adjust.
 Identities = 207/348 (59%), Positives = 270/348 (78%), Gaps = 15/348 (4%)
 Frame = -1

Query  2044  LMLTIKRVPTVVSNYQDDAPEDSKPESL---GCGRNCLGQCCLPVSCLPLFAFK-----N  1889
             +ML IKRVPTVVSNYQ +  E++   +    GCGRNCL +CC+  + LPL+AFK      
Sbjct  1     MMLRIKRVPTVVSNYQKEETEEAAAAARRVSGCGRNCLNKCCIQGAKLPLYAFKRVNKFK  60

Query  1888  DEHKCDGDWNYLSYGECPISFLSDLLLGQWEERMSRGLFRYDVTSCETKIIPGTFGFIAQ  1709
              E    G  + +   E P++FL  L+LG+WE+R+ RGLFRYDVT+CET++IPG +GFIAQ
Sbjct  61    TEMGVHG--HEVREPEPPVAFLDSLVLGEWEDRVQRGLFRYDVTACETRVIPGQYGFIAQ  118

Query  1708  LNEGRHLKKRPTEFRVDQVLQPFDENKFNFTKIGQEEVLFRFEPSNDCKSHYLPSGLVDA  1529
             LNEGRHLKKRPTEFRVD+VLQPFD NKFNFTK+GQEEVLF+FE S D +  + PS  +D 
Sbjct  119   LNEGRHLKKRPTEFRVDKVLQPFDGNKFNFTKVGQEEVLFQFEASEDGEVQFHPSAPIDV  178

Query  1528  RSGSPTVLAINVSPIEYGHVLLIPRVLDCLPQRIDHDSFFVAMHLAKEAADPFFRVGYNS  1349
              + SP+V+AINVSPIEYGHVLLIPRVL+CLPQRID DSF +A+++A EA +P+FR+GYNS
Sbjct  179   EN-SPSVVAINVSPIEYGHVLLIPRVLECLPQRIDRDSFLLALYMAAEAGNPYFRLGYNS  237

Query  1348  LGAFATINHLHFQAYYLQVPFPVEKTPTREIMRGREQGDGGIVVSQLLNYPARALLFEGG  1169
             LGAFATINHLHFQAYY+ +PFP+EK PT++I+        G+ +S+LLNYP R L+FEGG
Sbjct  238   LGAFATINHLHFQAYYMALPFPIEKAPTKKII----STGSGVKISELLNYPVRGLVFEGG  293

Query  1168  STVRDLSDAVANSCISLQNNNIPFNLLISERGNKVFLFPQVHSNSVFL  1025
             +++ DLS+ V+++CI LQ NNIP+N+LI++ G ++FL PQ ++    L
Sbjct  294   NSLEDLSNTVSDACICLQENNIPYNVLIADCGKRIFLLPQCYAEKQAL  341


 Score =   110 bits (274),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 53/87 (61%), Positives = 69/87 (79%), Gaps = 3/87 (3%)
 Frame = -2

Query  759  FSKCYAEKQACGKIDQEILDTWVNPAVWEISGHMVLKRREDYDDASEDYAWRLLSEVSLS  580
              +CYAEKQA G++  E+LDT VNPAVWEISGHMVLKR++DY++ASE+ AWRLL+EVSLS
Sbjct  331  LPQCYAEKQALGEVSSELLDTQVNPAVWEISGHMVLKRKKDYEEASEENAWRLLAEVSLS  390

Query  579  EERFEEVKAYVSRAADLLLDSECSNGG  499
            EER++EV A +  A   +   + +NGG
Sbjct  391  EERYQEVNALIFEA---IARGDDANGG  414



>gb|KFK27113.1| hypothetical protein AALP_AA8G336300 [Arabis alpina]
Length=418

 Score =   424 bits (1089),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 207/337 (61%), Positives = 258/337 (77%), Gaps = 25/337 (7%)
 Frame = -1

Query  2044  LMLTIKRVPTVVSNYQDDAPEDSKPESLGCGRNCLGQCCLPVSCLPLFAFKNDEHKCDGD  1865
             ++L IKRVPTVVSNYQ         E   CGRNCL +CC+  + L L+  KN   K    
Sbjct  1     MLLKIKRVPTVVSNYQK--------EEGRCGRNCLNKCCINGARLSLYTCKNVGEKT---  49

Query  1864  WNYLSYGECPISFLSDLLLGQWEERMSRGLFRYDVTSCETKIIPGTFGFIAQLNEGRHLK  1685
                    E P++FL  L+LG+WE+R  RGLFRYDVT+CETK+IPG +GFIAQLNEGRHLK
Sbjct  50    -------ESPVNFLESLVLGEWEDRFQRGLFRYDVTACETKVIPGKYGFIAQLNEGRHLK  102

Query  1684  KRPTEFRVDQVLQPFDENKFNFTKIGQEEVLFRFEPS--NDCKSHYLPSGLVDARSGSPT  1511
             KRPTEF VD+VLQPFD NKFNFTK+GQEE+LF+FE S  +DC+  + P+  +DA   SP+
Sbjct  103   KRPTEFCVDKVLQPFDGNKFNFTKVGQEELLFQFEASSNDDCEIRFFPNMPLDA-DNSPS  161

Query  1510  VLAINVSPIEYGHVLLIPRVLDCLPQRIDHDSFFVAMHLAKEAADPFFRVGYNSLGAFAT  1331
             V+AINVSPIEYGHVLLIPRVLDCLPQRIDH+S  +A+ +A EAA+P+FR+GYNSLGAFAT
Sbjct  162   VVAINVSPIEYGHVLLIPRVLDCLPQRIDHNSLLLALQMATEAANPYFRLGYNSLGAFAT  221

Query  1330  INHLHFQAYYLQVPFPVEKTPTREIMRGREQGDGGIVVSQLLNYPARALLFEGGSTVRDL  1151
             INHLHFQAYYL + FP+EK P+ +I       D G+ +S+LLNYP R LLFEGG++++DL
Sbjct  222   INHLHFQAYYLAMQFPIEKAPSSKIT----TTDNGVKISKLLNYPVRGLLFEGGNSMKDL  277

Query  1150  SDAVANSCISLQNNNIPFNLLISERGNKVFLFPQVHS  1040
             SD VAN+ + LQNNNIPFN+LIS+ G ++FL PQ ++
Sbjct  278   SDTVANASVCLQNNNIPFNILISDSGKQIFLLPQCYT  314


 Score =   100 bits (248),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 46/74 (62%), Positives = 57/74 (77%), Gaps = 0/74 (0%)
 Frame = -2

Query  759  FSKCYAEKQACGKIDQEILDTWVNPAVWEISGHMVLKRREDYDDASEDYAWRLLSEVSLS  580
              +CY EKQA G++  ++LDT VNPAVWE+SGHMVLKR+EDY+ ASE+ A  LL+EVSLS
Sbjct  309  LPQCYTEKQALGEVSSKLLDTQVNPAVWEMSGHMVLKRKEDYEGASEENALSLLAEVSLS  368

Query  579  EERFEEVKAYVSRA  538
            EERF EV   +  A
Sbjct  369  EERFNEVNTMIFEA  382



>gb|AGV54231.1| vitamin C defective 2 [Phaseolus vulgaris]
Length=451

 Score =   424 bits (1091),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 204/335 (61%), Positives = 257/335 (77%), Gaps = 7/335 (2%)
 Frame = -1

Query  2044  LMLTIKRVPTVVSNYQDDAPEDSKPESLGCGRNCLGQCCLPVSCLPLFAFKNDEHKCDGD  1865
             +ML IKRVPTVVSNYQ D   D+     GCGRNCL  CCLP + LPL+AFK   +  + D
Sbjct  1     MMLKIKRVPTVVSNYQKDGAADTSRPVGGCGRNCLKACCLPDAKLPLYAFKKVVN--EKD  58

Query  1864  WNYLSYGECPISFLSDLLLGQWEERMSRGLFRYDVTSCETKIIPGTFGFIAQLNEGRHLK  1685
                   GE P++FL  LLLG+WE+RM +GLFRYDVT+CETK+IPG +GF+AQLNEGRHLK
Sbjct  59    LALQECGEPPVAFLDSLLLGEWEDRMQKGLFRYDVTACETKVIPGEYGFVAQLNEGRHLK  118

Query  1684  KRPTEFRVDQVLQPFDENKFNFTKIGQEEVLFRFEPSNDCKSHYLPSGLVDARSGSPTVL  1505
             KRPTEFRVD+VLQPFDE+KFNFTK+GQEEVLF+FE S+D +  + P+  VD    SP+ +
Sbjct  119   KRPTEFRVDKVLQPFDESKFNFTKVGQEEVLFQFEASDDGQIQFFPNAPVDV-DNSPSFV  177

Query  1504  AINVSPIEYGHVLLIPRVLDCLPQRIDHDSFFVAMHLAKEAADPFFRVGYNSLGAFATIN  1325
             AINVSPIEYGH LL     +CLPQR+D +SF +A+H+A EA +P+FR+G+  LGAFATIN
Sbjct  178   AINVSPIEYGHGLLNSPKFECLPQRMDRESFPLALHMAVEAENPYFRMGFQHLGAFATIN  237

Query  1324  HLHFQAYYLQVPFPVEKTPTREIMRGREQGDGGIVVSQLLNYPARALLFEGGSTVRDLSD  1145
             HLHFQAYYL +PFP+EK PT++I       +GG+ + +LL YP R L+FEGG TV DLS+
Sbjct  238   HLHFQAYYLALPFPIEKAPTKKIAN----LNGGVKIFELLKYPVRGLVFEGGDTVEDLSN  293

Query  1144  AVANSCISLQNNNIPFNLLISERGNKVFLFPQVHS  1040
              V+++CI LQNNNIPFN+ IS+ G +VFL PQ ++
Sbjct  294   VVSDACICLQNNNIPFNVFISDCGKQVFLLPQCYA  328


 Score =   109 bits (272),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 51/76 (67%), Positives = 61/76 (80%), Gaps = 0/76 (0%)
 Frame = -2

Query  759  FSKCYAEKQACGKIDQEILDTWVNPAVWEISGHMVLKRREDYDDASEDYAWRLLSEVSLS  580
              +CYAEKQA G++D E+LDT VNPAVWEISGHMVLKR++DYD+A E  AWRLL+EVSL 
Sbjct  323  LPQCYAEKQALGEVDAELLDTQVNPAVWEISGHMVLKRKKDYDEAFEGNAWRLLAEVSLF  382

Query  579  EERFEEVKAYVSRAAD  532
            EERF+EV   +  A D
Sbjct  383  EERFQEVNDLIFEAID  398



>ref|XP_010443119.1| PREDICTED: GDP-L-galactose phosphorylase 2-like [Camelina sativa]
Length=430

 Score =   423 bits (1088),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 207/338 (61%), Positives = 259/338 (77%), Gaps = 17/338 (5%)
 Frame = -1

Query  2044  LMLTIKRVPTVVSNYQDDAPEDSKPESLGCGRNCLGQCCLPVSCLPLFAFKNDEHKCDGD  1865
             ++L IKRVPTVVSNYQ D   D   E  GCGRNCL +CC+  + LPL++ KN  +K  G+
Sbjct  1     MLLKIKRVPTVVSNYQKD---DETVEEGGCGRNCLSKCCIDGATLPLYSCKN-LNKSIGE  56

Query  1864  WNYLSYGECPISFLSDLLLGQWEERMSRGLFRYDVTSCETKIIPGTFGFIAQLNEGRHLK  1685
                    E P+ FL  L+LG+WE+R  RGLFRYDVT+C TK+IPG +GFIAQLNEGRHLK
Sbjct  57    -----KSESPVKFLESLVLGEWEDRFQRGLFRYDVTACVTKVIPGKYGFIAQLNEGRHLK  111

Query  1684  KRPTEFRVDQVLQPFDENKFNFTKIGQEEVLFRFEPSNDCKS---HYLPSGLVDARSGSP  1514
             KRPTEFRVD+VLQPFD NKFNFTK+GQEE+LF+FE SND         PS  +DA   SP
Sbjct  112   KRPTEFRVDKVLQPFDGNKFNFTKVGQEELLFQFEASNDDNDSGIQLFPSIPLDA-DNSP  170

Query  1513  TVLAINVSPIEYGHVLLIPRVLDCLPQRIDHDSFFVAMHLAKEAADPFFRVGYNSLGAFA  1334
             +V+AINVSPIEYGHVLLIPRVLDCLPQRID  S  +A+ +A EAA+P+FR+GYNSLGAFA
Sbjct  171   SVVAINVSPIEYGHVLLIPRVLDCLPQRIDQKSLLLALQMATEAANPYFRLGYNSLGAFA  230

Query  1333  TINHLHFQAYYLQVPFPVEKTPTREIMRGREQGDGGIVVSQLLNYPARALLFEGGSTVRD  1154
             TINHLHFQAYY+ + FP+EK  + +I    +    G+ +S+LLNYP R LLFEGG++++D
Sbjct  231   TINHLHFQAYYMAMQFPIEKASSLKITSTND----GVKISKLLNYPVRGLLFEGGNSIKD  286

Query  1153  LSDAVANSCISLQNNNIPFNLLISERGNKVFLFPQVHS  1040
             LSD V+++ + LQNNNIPFN+LIS+ G ++FL PQ ++
Sbjct  287   LSDTVSDASVCLQNNNIPFNILISDSGRQIFLLPQCYA  324


 Score =   108 bits (269),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 50/77 (65%), Positives = 63/77 (82%), Gaps = 0/77 (0%)
 Frame = -2

Query  759  FSKCYAEKQACGKIDQEILDTWVNPAVWEISGHMVLKRREDYDDASEDYAWRLLSEVSLS  580
              +CYAEKQA G++  E+LDT VNPAVWE+SGHMVLKR++DY++ASE+ AWRLL+EVSLS
Sbjct  319  LPQCYAEKQALGEVCSELLDTQVNPAVWEMSGHMVLKRKDDYEEASEEKAWRLLAEVSLS  378

Query  579  EERFEEVKAYVSRAADL  529
            EERF+EV   +  A  L
Sbjct  379  EERFKEVNTMIFEAIGL  395



>gb|EMS60286.1| hypothetical protein TRIUR3_28618 [Triticum urartu]
Length=460

 Score =   424 bits (1090),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 214/365 (59%), Positives = 260/365 (71%), Gaps = 38/365 (10%)
 Frame = -1

Query  2044  LMLTIKRVPTVVSNYQDDAPEDSKPESLGCGRNCLGQCCLPVSCLPLFAFKNDEHKCDGD  1865
             + LTIKRVPTVVSNYQ+DA E  +P   GCGRNCLG CCLPVS LP++AFK +  K    
Sbjct  1     MKLTIKRVPTVVSNYQEDAGE--RPRG-GCGRNCLGHCCLPVSELPVYAFKANPTKL---  54

Query  1864  WNYLSYGECPISFLSDLLLGQWEERMSRGLFRYDVTSCETKIIPGTFGFIAQLNEGRHLK  1685
                L     P  F  +LLLGQWE+RM++GLFRYDVT+CETK+IPG  GF+AQLNEGRHLK
Sbjct  55    --LLQEDAVPTDFFINLLLGQWEDRMTQGLFRYDVTACETKVIPGNLGFVAQLNEGRHLK  112

Query  1684  KRPTEFRVDQVLQPFDENKFNFTKIGQEEVLFRFEPSNDCKSHYLPSGLVDARSGSPTVL  1505
             KRPTEFRVD+VLQPFD  KFNFTK+GQEEVLF+FE S    S++L S  V     +P V+
Sbjct  113   KRPTEFRVDRVLQPFDSAKFNFTKVGQEEVLFQFENSGSDDSYFLRSAAVSVADRAPNVV  172

Query  1504  AINV------------------------------SPIEYGHVLLIPRVLDCLPQRIDHDS  1415
             AINV                              SPIEYGHVLLIPRVLD +PQRID +S
Sbjct  173   AINVHPGPVPIYLISNLCTLGAKLLIPVFDILKVSPIEYGHVLLIPRVLDHVPQRIDQES  232

Query  1414  FFVAMHLAKEAADPFFRVGYNSLGAFATINHLHFQAYYLQVPFPVEKTPTREIMRGREQG  1235
             F +A+H+A EAA P+FR+GYNSLGAFATINHLHFQAYYL VPFPVEK  T+ I       
Sbjct  233   FLLALHMAAEAASPYFRLGYNSLGAFATINHLHFQAYYLTVPFPVEKAATQRIPLAEGGI  292

Query  1234  DGGIVVSQLLNYPARALLFEGGSTVRDLSDAVANSCISLQNNNIPFNLLISERGNKVFLF  1055
               G+ VS+L+NYP R L+FE G+T+ DL++ V+++CI LQ+NN+P N+LIS+ G K+FLF
Sbjct  293   KSGVKVSKLMNYPVRGLVFEEGNTLNDLANVVSSACIWLQDNNVPCNVLISDSGRKIFLF  352

Query  1054  PQVHS  1040
             PQ ++
Sbjct  353   PQCYA  357


 Score =   120 bits (301),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 57/78 (73%), Positives = 68/78 (87%), Gaps = 0/78 (0%)
 Frame = -2

Query  759  FSKCYAEKQACGKIDQEILDTWVNPAVWEISGHMVLKRREDYDDASEDYAWRLLSEVSLS  580
            F +CYAEKQA G++ QE+LDT VNPAVWEISGH+VLKRR+DY++ASE  AWRLL+EVSLS
Sbjct  352  FPQCYAEKQALGEVSQELLDTQVNPAVWEISGHIVLKRRDDYEEASEASAWRLLAEVSLS  411

Query  579  EERFEEVKAYVSRAADLL  526
            E RFEEVKAY+  AA L+
Sbjct  412  EARFEEVKAYIFDAACLV  429



>ref|XP_010449106.1| PREDICTED: GDP-L-galactose phosphorylase 2 [Camelina sativa]
Length=429

 Score =   423 bits (1087),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 208/338 (62%), Positives = 259/338 (77%), Gaps = 18/338 (5%)
 Frame = -1

Query  2044  LMLTIKRVPTVVSNYQDDAPEDSKPESLGCGRNCLGQCCLPVSCLPLFAFKNDEHKCDGD  1865
             ++L IKRVPTVVSNYQ    +D   E  GCGRNCL +CC+  + LPL+  KN  +K  G+
Sbjct  1     MLLKIKRVPTVVSNYQ----KDETVEEGGCGRNCLSKCCIDGATLPLYTCKN-LNKSIGE  55

Query  1864  WNYLSYGECPISFLSDLLLGQWEERMSRGLFRYDVTSCETKIIPGTFGFIAQLNEGRHLK  1685
                    E P  FL  L+LG+WE+R  RGLFRYDVT+CETK+IPG +GFIAQLNEGRHLK
Sbjct  56    -----KSEAPGKFLESLVLGEWEDRFQRGLFRYDVTACETKVIPGKYGFIAQLNEGRHLK  110

Query  1684  KRPTEFRVDQVLQPFDENKFNFTKIGQEEVLFRFEPSNDCKS---HYLPSGLVDARSGSP  1514
             KRPTEFRVD+VLQPFD NKFNFTK+GQEE+LF+FE SND         PS  ++A   SP
Sbjct  111   KRPTEFRVDKVLQPFDGNKFNFTKVGQEELLFQFEASNDDNDSGIQLFPSIPLEA-DDSP  169

Query  1513  TVLAINVSPIEYGHVLLIPRVLDCLPQRIDHDSFFVAMHLAKEAADPFFRVGYNSLGAFA  1334
             +V+AINVSPIEYGHVLLIPRVLDCLPQRIDH S  +A+ +A EAA+P+FR+GYNSLGAFA
Sbjct  170   SVVAINVSPIEYGHVLLIPRVLDCLPQRIDHKSLLLALQMATEAANPYFRLGYNSLGAFA  229

Query  1333  TINHLHFQAYYLQVPFPVEKTPTREIMRGREQGDGGIVVSQLLNYPARALLFEGGSTVRD  1154
             TINHLHFQAYYL + FP+EK  + +I    +    G+ +S+LLNYP R LLFEGG++++D
Sbjct  230   TINHLHFQAYYLAMQFPIEKASSLKITSTND----GVKISKLLNYPVRGLLFEGGNSIKD  285

Query  1153  LSDAVANSCISLQNNNIPFNLLISERGNKVFLFPQVHS  1040
             LSD V+++ + LQNNNIPFN+LIS+ G ++FL PQ ++
Sbjct  286   LSDTVSDASVCLQNNNIPFNILISDSGRQIFLLPQCYA  323


 Score =   107 bits (267),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 50/77 (65%), Positives = 62/77 (81%), Gaps = 0/77 (0%)
 Frame = -2

Query  759  FSKCYAEKQACGKIDQEILDTWVNPAVWEISGHMVLKRREDYDDASEDYAWRLLSEVSLS  580
              +CYAEKQA G++  E+LDT VNPAVWE+SGHMVLKR++DY++ASE  AWRLL+EVSLS
Sbjct  318  LPQCYAEKQALGEVCSELLDTQVNPAVWEMSGHMVLKRKDDYEEASEAKAWRLLAEVSLS  377

Query  579  EERFEEVKAYVSRAADL  529
            EERF+EV   +  A  L
Sbjct  378  EERFKEVNTMIFEAIGL  394



>ref|XP_010482932.1| PREDICTED: GDP-L-galactose phosphorylase 2-like [Camelina sativa]
Length=426

 Score =   421 bits (1083),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 204/335 (61%), Positives = 258/335 (77%), Gaps = 15/335 (4%)
 Frame = -1

Query  2044  LMLTIKRVPTVVSNYQDDAPEDSKPESLGCGRNCLGQCCLPVSCLPLFAFKNDEHKCDGD  1865
             ++L IKRVPTVVSNYQ    +D   E  GCGRNCL +CC+  + LPL+  KN  +K  G+
Sbjct  1     MLLKIKRVPTVVSNYQ----KDETVEEGGCGRNCLSKCCIDGATLPLYTCKN-LNKSIGE  55

Query  1864  WNYLSYGECPISFLSDLLLGQWEERMSRGLFRYDVTSCETKIIPGTFGFIAQLNEGRHLK  1685
                    E P+ FL  L+LG+WE+R  RGLFRYDVT+CETK+IPG +GFIAQLNEGRHLK
Sbjct  56    -----KSEAPVKFLESLVLGEWEDRFQRGLFRYDVTACETKVIPGKYGFIAQLNEGRHLK  110

Query  1684  KRPTEFRVDQVLQPFDENKFNFTKIGQEEVLFRFEPSNDCKSHYLPSGLVDARSGSPTVL  1505
             KRP+EFRVD+VLQPFD NKFNFTK+GQEE+LF+FE S+D  S       +   + SP+V+
Sbjct  111   KRPSEFRVDKVLQPFDGNKFNFTKVGQEELLFQFEASSD-DSRIQSFPCIPLEADSPSVV  169

Query  1504  AINVSPIEYGHVLLIPRVLDCLPQRIDHDSFFVAMHLAKEAADPFFRVGYNSLGAFATIN  1325
             AINVSPIEYGHVLLIPRVLDCLPQRIDH S  +A+ +A EAA+P+FR+GYNSLGAFATIN
Sbjct  170   AINVSPIEYGHVLLIPRVLDCLPQRIDHKSLLLALQMATEAANPYFRLGYNSLGAFATIN  229

Query  1324  HLHFQAYYLQVPFPVEKTPTREIMRGREQGDGGIVVSQLLNYPARALLFEGGSTVRDLSD  1145
             HLHFQAYYL + FP+EK  + +I       + G+ +S+LLNYP R LLFEGG++++DLSD
Sbjct  230   HLHFQAYYLTMQFPIEKASSLKIT----STNDGVKISKLLNYPVRGLLFEGGNSIKDLSD  285

Query  1144  AVANSCISLQNNNIPFNLLISERGNKVFLFPQVHS  1040
              V+++ + LQNNNIPFN+LIS+ G ++FL PQ ++
Sbjct  286   TVSDASVCLQNNNIPFNILISDSGRQIFLLPQCYA  320


 Score =   108 bits (271),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 51/77 (66%), Positives = 63/77 (82%), Gaps = 0/77 (0%)
 Frame = -2

Query  759  FSKCYAEKQACGKIDQEILDTWVNPAVWEISGHMVLKRREDYDDASEDYAWRLLSEVSLS  580
              +CYAEKQA G+I  ++LDT VNPAVWE+SGHMVLKR+EDY++ASE+ AWRLL+EVSLS
Sbjct  315  LPQCYAEKQALGEICSKLLDTQVNPAVWEMSGHMVLKRKEDYEEASEEKAWRLLAEVSLS  374

Query  579  EERFEEVKAYVSRAADL  529
            EERF+EV   +  A  L
Sbjct  375  EERFKEVNTMIFEAIGL  391



>ref|XP_002864375.1| hypothetical protein ARALYDRAFT_918651 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH40634.1| hypothetical protein ARALYDRAFT_918651 [Arabidopsis lyrata subsp. 
lyrata]
Length=429

 Score =   421 bits (1083),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 206/338 (61%), Positives = 259/338 (77%), Gaps = 18/338 (5%)
 Frame = -1

Query  2044  LMLTIKRVPTVVSNYQDDAPEDSKPESLGCGRNCLGQCCLPVSCLPLFAFKNDEHKCDGD  1865
             ++L IKRVPTVVSNYQ    +D   E  GCGRNCL +CC+  + LPL+  KN +      
Sbjct  1     MLLKIKRVPTVVSNYQ----KDETVEEGGCGRNCLSKCCINGARLPLYTCKNLDTFVGEK  56

Query  1864  WNYLSYGECPISFLSDLLLGQWEERMSRGLFRYDVTSCETKIIPGTFGFIAQLNEGRHLK  1685
                    E P+ FL  L+LG+WE+R  RGLFRYDVT+CETK+IPG +GFIAQLNEGR LK
Sbjct  57    L------ESPVMFLESLVLGEWEDRFQRGLFRYDVTACETKVIPGKYGFIAQLNEGRLLK  110

Query  1684  KRPTEFRVDQVLQPFDENKFNFTKIGQEEVLFRFEPS---NDCKSHYLPSGLVDARSGSP  1514
             KRPTEFRVD+VLQPFD NKFNFTK+GQEE+LF+FE S   +D +  +LPS  +DA   SP
Sbjct  111   KRPTEFRVDKVLQPFDGNKFNFTKVGQEELLFQFEASDNDDDSQIQFLPSIPLDA-DNSP  169

Query  1513  TVLAINVSPIEYGHVLLIPRVLDCLPQRIDHDSFFVAMHLAKEAADPFFRVGYNSLGAFA  1334
             +V+AINVSPIEYGHVLLIPRVLDCLPQRIDH S  +A+ +A EAA+P+FR+GYNSLGAFA
Sbjct  170   SVVAINVSPIEYGHVLLIPRVLDCLPQRIDHKSLLLALQMAAEAANPYFRLGYNSLGAFA  229

Query  1333  TINHLHFQAYYLQVPFPVEKTPTREIMRGREQGDGGIVVSQLLNYPARALLFEGGSTVRD  1154
             TINHLHFQAYYL + FP+EK  + +I       + G+ +S+LLNYP R LLFEGG++++D
Sbjct  230   TINHLHFQAYYLAMQFPIEKASSLKIT----TTNNGVKISKLLNYPVRGLLFEGGNSIKD  285

Query  1153  LSDAVANSCISLQNNNIPFNLLISERGNKVFLFPQVHS  1040
             LSD V+++ + LQNNNIPFN+LIS+ G ++FL PQ ++
Sbjct  286   LSDTVSDASVCLQNNNIPFNILISDSGKQIFLLPQCYA  323


 Score =   107 bits (268),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 49/74 (66%), Positives = 61/74 (82%), Gaps = 0/74 (0%)
 Frame = -2

Query  759  FSKCYAEKQACGKIDQEILDTWVNPAVWEISGHMVLKRREDYDDASEDYAWRLLSEVSLS  580
              +CYAEKQA G++  ++LDT VNPAVWE+SGHMVLKR+EDY+ ASE+ AWRLL+EVSLS
Sbjct  318  LPQCYAEKQALGEVSSKLLDTQVNPAVWEMSGHMVLKRKEDYEGASEEKAWRLLAEVSLS  377

Query  579  EERFEEVKAYVSRA  538
            EERF+EV   +  A
Sbjct  378  EERFKEVNTMIFEA  391



>ref|NP_200323.1| GDP-L-galactose phosphorylase [Arabidopsis thaliana]
 sp|Q9FLP9.1|GGAP2_ARATH RecName: Full=GDP-L-galactose phosphorylase 2; AltName: Full=Protein 
VITAMIN C DEFECTIVE 5 [Arabidopsis thaliana]
 dbj|BAB08581.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAL36095.1| unknown protein [Arabidopsis thaliana]
 gb|AAM14224.1| unknown protein [Arabidopsis thaliana]
 gb|AED96583.1| GDP-L-galactose phosphorylase [Arabidopsis thaliana]
Length=431

 Score =   421 bits (1081),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 202/338 (60%), Positives = 259/338 (77%), Gaps = 18/338 (5%)
 Frame = -1

Query  2044  LMLTIKRVPTVVSNYQDDAPEDSKPESLGCGRNCLGQCCLPVSCLPLFAFKNDEHKCDGD  1865
             ++L IKRVPTVVSNYQ    +D   E  GCGRNCL +CC+  + LPL+  KN +     +
Sbjct  1     MLLKIKRVPTVVSNYQ----KDETVEEGGCGRNCLSKCCINGARLPLYTCKNLDKSVGEN  56

Query  1864  WNYLSYGECPISFLSDLLLGQWEERMSRGLFRYDVTSCETKIIPGTFGFIAQLNEGRHLK  1685
                    E P++FL  L++G+WE+R  RGLFRYDVT+CETK+IPG +GFIAQLNEGRHLK
Sbjct  57    ------TESPVTFLESLVIGEWEDRFQRGLFRYDVTACETKVIPGKYGFIAQLNEGRHLK  110

Query  1684  KRPTEFRVDQVLQPFDENKFNFTKIGQEEVLFRFEPS---NDCKSHYLPSGLVDARSGSP  1514
             KRPTEFRVD+VLQPFD NKFNFTK+GQEE+LF+F+ S   +D +  +L S  +DA   SP
Sbjct  111   KRPTEFRVDKVLQPFDGNKFNFTKVGQEELLFQFKASTNDDDSEIQFLASMPLDA-DNSP  169

Query  1513  TVLAINVSPIEYGHVLLIPRVLDCLPQRIDHDSFFVAMHLAKEAADPFFRVGYNSLGAFA  1334
             +V+AINVSPIEYGHVLLIPRVLDCLPQRIDH S  +A+ +A EA +P+FR+GYNSLGAFA
Sbjct  170   SVVAINVSPIEYGHVLLIPRVLDCLPQRIDHKSLLLALQMAAEADNPYFRLGYNSLGAFA  229

Query  1333  TINHLHFQAYYLQVPFPVEKTPTREIMRGREQGDGGIVVSQLLNYPARALLFEGGSTVRD  1154
             TINHLHFQAYYL + FP+EK  + +I       + G+ +S+LLNYP R LL EGG+T++D
Sbjct  230   TINHLHFQAYYLAMQFPIEKASSLKIT----TTNNGVKISKLLNYPVRGLLVEGGNTIKD  285

Query  1153  LSDAVANSCISLQNNNIPFNLLISERGNKVFLFPQVHS  1040
             L+D V+++ + LQNNNIPFN+LIS+ G ++FL PQ ++
Sbjct  286   LADTVSDASVCLQNNNIPFNILISDSGKRIFLLPQCYA  323


 Score =   106 bits (265),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 48/71 (68%), Positives = 58/71 (82%), Gaps = 0/71 (0%)
 Frame = -2

Query  759  FSKCYAEKQACGKIDQEILDTWVNPAVWEISGHMVLKRREDYDDASEDYAWRLLSEVSLS  580
              +CYAEKQA G++   +LDT VNPAVWE+SGHMVLKR+EDY+ ASE+ AWRLL+EVSLS
Sbjct  318  LPQCYAEKQALGEVSSTLLDTQVNPAVWEMSGHMVLKRKEDYEGASEEKAWRLLAEVSLS  377

Query  579  EERFEEVKAYV  547
            EERF EV   +
Sbjct  378  EERFREVNTMI  388



>gb|ACG75920.1| GDP-L-galactose phosphorylase [Malpighia glabra]
Length=445

 Score =   421 bits (1082),  Expect = 5e-136, Method: Compositional matrix adjust.
 Identities = 204/335 (61%), Positives = 260/335 (78%), Gaps = 6/335 (2%)
 Frame = -1

Query  2041  MLTIKRVPTVVSNYQDDAPEDSKPESLGCGRNCLGQCCLPVSCLPLFAFKNDEHKCDGDW  1862
             MLT+KRVPTVVSNYQ +  ED      GCGRNCL +CC+  + LPL+AFK        DW
Sbjct  1     MLTVKRVPTVVSNYQKEEGEDGGRRGGGCGRNCLQKCCIEGAKLPLYAFKRGNKIVSDDW  60

Query  1861  NYLSYG-ECPISFLSDLLLGQWEERMSRGLFRYDVTSCETKIIPGTFGFIAQLNEGRHLK  1685
                    E P+ FL   LLG+WE RM R LFRYDVT+CETK+IPG +GFIAQLNEGRHLK
Sbjct  61    ASGDGNFEQPVPFLDSFLLGEWENRMQRVLFRYDVTACETKVIPGPYGFIAQLNEGRHLK  120

Query  1684  KRPTEFRVDQVLQPFDENKFNFTKIGQEEVLFRFEPSNDCKSHYLPSGLVDARSGSPTVL  1505
             KRPTEFRVD+VLQPFD  KFNFTK+GQEE+LF+FE S D ++ +  +  +D  + SP+V+
Sbjct  121   KRPTEFRVDKVLQPFDGKKFNFTKVGQEEILFQFEASEDGETQFFANAPIDVEN-SPSVV  179

Query  1504  AINVSPIEYGHVLLIPRVLDCLPQRIDHDSFFVAMHLAKEAADPFFRVGYNSLGAFATIN  1325
             AINVSPIEYGHVLLIPRVL+CLPQRIDH+SF +A+++A EA +P+FR+GYNSLGAFATIN
Sbjct  180   AINVSPIEYGHVLLIPRVLECLPQRIDHESFLLALYMAAEAGNPYFRLGYNSLGAFATIN  239

Query  1324  HLHFQAYYLQVPFPVEKTPTREIMRGREQGDGGIVVSQLLNYPARALLFEGGSTVRDLSD  1145
             HLHFQAYYL+ PFP+EK P ++I       D G+ +S+++NYP R L+FEGG  ++DL++
Sbjct  240   HLHFQAYYLEAPFPIEKAPMKKIT----TLDDGVKISEIMNYPVRGLVFEGGKMLQDLAN  295

Query  1144  AVANSCISLQNNNIPFNLLISERGNKVFLFPQVHS  1040
              V+++CI LQNNNIP+N+LI++ G +VFL PQ ++
Sbjct  296   TVSDACICLQNNNIPYNVLIADCGKRVFLLPQCYA  330


 Score =   107 bits (267),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 50/74 (68%), Positives = 61/74 (82%), Gaps = 0/74 (0%)
 Frame = -2

Query  759  FSKCYAEKQACGKIDQEILDTWVNPAVWEISGHMVLKRREDYDDASEDYAWRLLSEVSLS  580
              +CYAEKQA G+   E+LD  VNPAVWEISGHMVLKR++DY++ASE+ AWRLL+EVSLS
Sbjct  325  LPQCYAEKQALGEASPELLDAQVNPAVWEISGHMVLKRKKDYEEASEENAWRLLAEVSLS  384

Query  579  EERFEEVKAYVSRA  538
            EERF+EV A +  A
Sbjct  385  EERFQEVNALIFEA  398



>ref|XP_006401493.1| hypothetical protein EUTSA_v10013622mg [Eutrema salsugineum]
 gb|ESQ42946.1| hypothetical protein EUTSA_v10013622mg [Eutrema salsugineum]
Length=428

 Score =   419 bits (1077),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 204/338 (60%), Positives = 257/338 (76%), Gaps = 17/338 (5%)
 Frame = -1

Query  2044  LMLTIKRVPTVVSNYQDDAPEDSKPESLGCGRNCLGQCCLPVSCLPLFAFKNDEHKCDGD  1865
             ++L IKRVPTVVSNYQ D   ++  E  GCGRNCL +CC+  + LPL+   N       D
Sbjct  1     MLLKIKRVPTVVSNYQKD---ETAEEGGGCGRNCLSKCCINGARLPLYTCNN------VD  51

Query  1864  WNYLSYGECPISFLSDLLLGQWEERMSRGLFRYDVTSCETKIIPGTFGFIAQLNEGRHLK  1685
              +     E P++FL  L+LG+WE+R  RGLFRYDVT+CETK+IPG +GFIAQLNEGRHLK
Sbjct  52    KSVGEKAESPVAFLDSLVLGEWEDRFQRGLFRYDVTACETKVIPGKYGFIAQLNEGRHLK  111

Query  1684  KRPTEFRVDQVLQPFDENKFNFTKIGQEEVLFRFEPSNDCKS---HYLPSGLVDARSGSP  1514
             KRPTEFRVD+VLQPFD NKFNFTK+GQEE+LF+FE ++D       + P+  +DA   SP
Sbjct  112   KRPTEFRVDKVLQPFDGNKFNFTKVGQEELLFQFEATDDDDDREIQFFPNMPLDA-DNSP  170

Query  1513  TVLAINVSPIEYGHVLLIPRVLDCLPQRIDHDSFFVAMHLAKEAADPFFRVGYNSLGAFA  1334
             +V+AINVSPIEYGHVLLIP VLDCLPQRIDH S  +A+ +A  AA+ +FR+GYNSLGAFA
Sbjct  171   SVVAINVSPIEYGHVLLIPCVLDCLPQRIDHKSLLLAIQMATVAANSYFRLGYNSLGAFA  230

Query  1333  TINHLHFQAYYLQVPFPVEKTPTREIMRGREQGDGGIVVSQLLNYPARALLFEGGSTVRD  1154
             TINHLHFQAYYL +PFP+EK P+ +I    +     + +S+LL YP R LLFEGGS+++D
Sbjct  231   TINHLHFQAYYLAMPFPIEKAPSLKITTTND----CVKISKLLKYPVRGLLFEGGSSIKD  286

Query  1153  LSDAVANSCISLQNNNIPFNLLISERGNKVFLFPQVHS  1040
             LSD VAN+ + LQNNNIPFN+LIS+ G ++FL PQ ++
Sbjct  287   LSDTVANASVCLQNNNIPFNILISDSGKQIFLLPQCYA  324


 Score =   104 bits (259),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 48/74 (65%), Positives = 59/74 (80%), Gaps = 0/74 (0%)
 Frame = -2

Query  759  FSKCYAEKQACGKIDQEILDTWVNPAVWEISGHMVLKRREDYDDASEDYAWRLLSEVSLS  580
              +CYAEKQA G++  ++LDT VNPAVWE+SGHMVLKR+EDY  ASE+ AW LL+EVSLS
Sbjct  319  LPQCYAEKQALGEVSSKLLDTQVNPAVWEMSGHMVLKRKEDYQGASEEKAWSLLAEVSLS  378

Query  579  EERFEEVKAYVSRA  538
            EERF+EV   +  A
Sbjct  379  EERFKEVNTMIFEA  392



>emb|CAB36531.1| putative protein [Arabidopsis thaliana]
 emb|CAB79540.1| putative protein [Arabidopsis thaliana]
Length=459

 Score =   419 bits (1076),  Expect = 5e-135, Method: Compositional matrix adjust.
 Identities = 212/358 (59%), Positives = 266/358 (74%), Gaps = 29/358 (8%)
 Frame = -1

Query  2041  MLTIKRVPTVVSNYQDDAPEDSKPESLGCGRNCLGQCCL------PVSC----LPLFAFK  1892
             ML IKRVPTVVSNYQ D   D   + +GCGRNCLG CCL      P S     LPL+A K
Sbjct  1     MLKIKRVPTVVSNYQKD---DGAEDPVGCGRNCLGACCLNGTFWKPESSFLIMLPLYACK  57

Query  1891  NDEHKCDGDWNYLSYG--ECPISFLSDLLLGQWEERMSRGLFRYDVTSCETKIIPGTFGF  1718
             N      G+   +S+   E P++FL  L+LG+WE+R  RGLFRYDVT+CETK+IPG +GF
Sbjct  58    NLVK--SGEKLVISHEAIEPPVAFLESLVLGEWEDRFQRGLFRYDVTACETKVIPGKYGF  115

Query  1717  IAQLNEGRHLKKRPTEFRVDQVLQPFDENKFNFTKIGQEEVLFRFEPSNDCKSHYLPSGL  1538
             +AQLNEGRHLKKRPTEFRVD+VLQ FD +KFNFTK+GQEE+LF+FE   D +  + P   
Sbjct  116   VAQLNEGRHLKKRPTEFRVDKVLQSFDGSKFNFTKVGQEELLFQFEAGEDAQVQFFPCMP  175

Query  1537  VDARSGSPTVLAINVS-------PIEYGHVLLIPRVLDCLPQRIDHDSFFVAMHLAKEAA  1379
             +D  + SP+V+AINV        PIEYGHVLLIPRVLDCLPQRIDH S  +A+H+A EAA
Sbjct  176   IDPEN-SPSVVAINVKTLVQRACPIEYGHVLLIPRVLDCLPQRIDHKSLLLAVHMAAEAA  234

Query  1378  DPFFRVGYNSLGAFATINHLHFQAYYLQVPFPVEKTPTREIMRGREQGDGGIVVSQLLNY  1199
             +P+FR+GYNSLGAFATINHLHFQAYYL +PFP+EK PT++I         G+ +S+LL+Y
Sbjct  235   NPYFRLGYNSLGAFATINHLHFQAYYLAMPFPLEKAPTKKITTTV----SGVKISELLSY  290

Query  1198  PARALLFEGGSTVRDLSDAVANSCISLQNNNIPFNLLISERGNKVFLFPQVHSNSVFL  1025
             P R+LLFEGGS++++LSD V++ C+ LQNNNIPFN+LIS+ G ++FL PQ ++    L
Sbjct  291   PVRSLLFEGGSSMQELSDTVSDCCVCLQNNNIPFNILISDCGRQIFLMPQCYAEKQAL  348


 Score =   108 bits (271),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 54/85 (64%), Positives = 63/85 (74%), Gaps = 6/85 (7%)
 Frame = -2

Query  759  FSKCYAEKQACGKIDQEILDTWVNPAVWEISGHMVLKRREDYDDASEDYAWRLLSEVSLS  580
              +CYAEKQA G++  E+L+T VNPAVWEISGHMVLKR+EDY+ ASED AWRLL+E SLS
Sbjct  338  MPQCYAEKQALGEVSPEVLETQVNPAVWEISGHMVLKRKEDYEGASEDNAWRLLAEASLS  397

Query  579  EERFEEVKAYVSRAADLLLDSECSN  505
            EERF+EV A    A        CSN
Sbjct  398  EERFKEVTALAFEAIG------CSN  416



>ref|XP_006280501.1| hypothetical protein CARUB_v10026439mg [Capsella rubella]
 gb|EOA13399.1| hypothetical protein CARUB_v10026439mg [Capsella rubella]
Length=432

 Score =   417 bits (1072),  Expect = 8e-135, Method: Compositional matrix adjust.
 Identities = 203/338 (60%), Positives = 258/338 (76%), Gaps = 18/338 (5%)
 Frame = -1

Query  2044  LMLTIKRVPTVVSNYQDDAPEDSKPESLGCGRNCLGQCCLPVSCLPLFAFKNDEHKCDGD  1865
             ++L IKRVPTVVSNYQ    +D   E  GCGRNCL +CC+  + LPL+   N       D
Sbjct  1     MLLKIKRVPTVVSNYQ----KDETVEEGGCGRNCLRKCCINGARLPLYTCNN------LD  50

Query  1864  WNYLSYGECPISFLSDLLLGQWEERMSRGLFRYDVTSCETKIIPGTFGFIAQLNEGRHLK  1685
              +     E P++FL  ++LG+WE+R  RGLFRYDVT+CETK+IPG  GFIAQLNEGRHLK
Sbjct  51    KSVKDKSESPVTFLESVVLGEWEDRFQRGLFRYDVTACETKVIPGKCGFIAQLNEGRHLK  110

Query  1684  KRPTEFRVDQVLQPFDENKFNFTKIGQEEVLFRFEP---SNDCKSHYLPSGLVDARSGSP  1514
             KRPTEFRVD+VLQPFD NKFNFTK+GQEE+LF+FE     +D    + PS  +DA   SP
Sbjct  111   KRPTEFRVDKVLQPFDGNKFNFTKVGQEELLFQFEARSDDDDSGIQFFPSIPLDA-DNSP  169

Query  1513  TVLAINVSPIEYGHVLLIPRVLDCLPQRIDHDSFFVAMHLAKEAADPFFRVGYNSLGAFA  1334
             +V+AINVSPIEYGHVLLIPRVL+CLPQRIDH S  +A+ +A EAA+P+FR+GYNSLGAFA
Sbjct  170   SVVAINVSPIEYGHVLLIPRVLECLPQRIDHKSLLLALQMATEAANPYFRLGYNSLGAFA  229

Query  1333  TINHLHFQAYYLQVPFPVEKTPTREIMRGREQGDGGIVVSQLLNYPARALLFEGGSTVRD  1154
             TINHLHFQAYYL + FP+EK  + +I   ++    G+ +S+LLNYP R LLFEGG++++D
Sbjct  230   TINHLHFQAYYLAMQFPIEKASSLKITSTKD----GVKISKLLNYPVRGLLFEGGNSIKD  285

Query  1153  LSDAVANSCISLQNNNIPFNLLISERGNKVFLFPQVHS  1040
             LSD V+++ + LQNNNIPFN+LIS+ G ++FL PQ ++
Sbjct  286   LSDTVSDASVCLQNNNIPFNILISDSGRQIFLLPQCYA  323


 Score =   107 bits (266),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 49/74 (66%), Positives = 62/74 (84%), Gaps = 0/74 (0%)
 Frame = -2

Query  759  FSKCYAEKQACGKIDQEILDTWVNPAVWEISGHMVLKRREDYDDASEDYAWRLLSEVSLS  580
              +CYAEKQA G++  ++LDT VNPAVWE+SGHMVLKR+EDY++ASE+ AWRLL+EVSLS
Sbjct  318  LPQCYAEKQALGEVCSKLLDTQVNPAVWEMSGHMVLKRKEDYEEASEEKAWRLLAEVSLS  377

Query  579  EERFEEVKAYVSRA  538
            EERF+EV   +  A
Sbjct  378  EERFKEVNTMIFEA  391



>gb|EMT17985.1| hypothetical protein F775_32461 [Aegilops tauschii]
Length=456

 Score =   418 bits (1074),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 210/361 (58%), Positives = 258/361 (71%), Gaps = 39/361 (11%)
 Frame = -1

Query  2044  LMLTIKRVPTVVSNYQDDAPEDSKPESLGCGRNCLGQCCLPVSCLPLFAFKNDEHKCDGD  1865
             + LTIKRVPTV+SNYQ++          GCGRNCLG CCLP S LPL+AFK D  K   D
Sbjct  3     MKLTIKRVPTVLSNYQEEG-------GGGCGRNCLGDCCLPASKLPLYAFKADPKKPAQD  55

Query  1864  WNYLSYGECPISF-LSDLLLGQ-------------------------WEERMSRGLFRYD  1763
                    E P  F L+ LLL Q                         WE+R++RGLFRYD
Sbjct  56    ------DELPTEFFLNSLLLAQISELYGMFPLRNKNETSSLVTLKHKWEDRVARGLFRYD  109

Query  1762  VTSCETKIIPGTFGFIAQLNEGRHLKKRPTEFRVDQVLQPFDENKFNFTKIGQEEVLFRF  1583
             VT+CETK+IPG  GF+AQLNEGRHLKKRPTEFRVD+VLQPFD  KFNFTK+GQEEVLFRF
Sbjct  110   VTACETKVIPGELGFVAQLNEGRHLKKRPTEFRVDRVLQPFDSAKFNFTKVGQEEVLFRF  169

Query  1582  EPSNDCKSHYLPSGLVDARSGSPTVLAINVSPIEYGHVLLIPRVLDCLPQRIDHDSFFVA  1403
             E      S++L +        +P+V+AINVSPIEYGHVLLIPRVLD LPQ+ID +SF +A
Sbjct  170   ENGGGDNSYFLENAPSTEGDHAPSVVAINVSPIEYGHVLLIPRVLDRLPQQIDPESFLLA  229

Query  1402  MHLAKEAADPFFRVGYNSLGAFATINHLHFQAYYLQVPFPVEKTPTREIMRGREQGDGGI  1223
             +H+A EAA P+FR+GYNSLGAFATINHLHFQAYYL VPFPVEK PT++I   +   + G+
Sbjct  230   LHMAAEAASPYFRLGYNSLGAFATINHLHFQAYYLSVPFPVEKAPTKKIPLAKCALNSGV  289

Query  1222  VVSQLLNYPARALLFEGGSTVRDLSDAVANSCISLQNNNIPFNLLISERGNKVFLFPQVH  1043
              VS+L N+P R L+FE G+T++DL+D V N+CI LQ NN+PFN+LIS+ G ++F+FPQ +
Sbjct  290   KVSKLTNFPVRGLVFERGNTLKDLADVVTNACIWLQENNVPFNVLISDSGRRIFVFPQCY  349

Query  1042  S  1040
             +
Sbjct  350   A  350


 Score =   114 bits (286),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 54/77 (70%), Positives = 64/77 (83%), Gaps = 0/77 (0%)
 Frame = -2

Query  759  FSKCYAEKQACGKIDQEILDTWVNPAVWEISGHMVLKRREDYDDASEDYAWRLLSEVSLS  580
            F +CYAEKQA G++ Q++LDT VNPAVWEISGH+VLKRR D+ +ASE  AWRLL+EVSLS
Sbjct  345  FPQCYAEKQALGEVSQDLLDTQVNPAVWEISGHIVLKRRTDFKEASEASAWRLLAEVSLS  404

Query  579  EERFEEVKAYVSRAADL  529
            EERFEEVKA +  A  L
Sbjct  405  EERFEEVKACIFEATGL  421



>ref|XP_010675741.1| PREDICTED: GDP-L-galactose phosphorylase 1 [Beta vulgaris subsp. 
vulgaris]
Length=447

 Score =   417 bits (1071),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 195/340 (57%), Positives = 258/340 (76%), Gaps = 6/340 (2%)
 Frame = -1

Query  2041  MLTIKRVPTVVSNYQDDAPEDSKPESLGCGRNCLGQCCLPVSCLPLFAFKN-DEHKCDGD  1865
             ML IKRVPT+VSNYQ +  + S     GCGRNCL +CC+  + LPL+A+K  D+      
Sbjct  1     MLRIKRVPTIVSNYQKEEGDGSVRVVGGCGRNCLKECCVQGAKLPLYAYKRVDKIGNQKA  60

Query  1864  WNYLSYGECPISFLSDLLLGQWEERMSRGLFRYDVTSCETKIIPGTFGFIAQLNEGRHLK  1685
              +     E P++FL  LLLG+WE+RM RGLFRYDVT+CETK+IPG +GF+AQLNEGRHLK
Sbjct  61    LDVDEARESPVAFLDSLLLGEWEDRMERGLFRYDVTACETKVIPGDYGFVAQLNEGRHLK  120

Query  1684  KRPTEFRVDQVLQPFDENKFNFTKIGQEEVLFRFEPSNDCKSHYLPSGLVDARSGSPTVL  1505
             KRPTEFRVD+VLQPFD +KFNFTK+GQEEVLF+FE S D +++++P   + A   +P+ +
Sbjct  121   KRPTEFRVDKVLQPFDGSKFNFTKVGQEEVLFQFEASEDGEAYFIPGAPI-AVENTPSFV  179

Query  1504  AINVSPIEYGHVLLIPRVLDCLPQRIDHDSFFVAMHLAKEAADPFFRVGYNSLGAFATIN  1325
             AINVSPIEYGHVLLIPR+ +CLPQRID++SF +A+H+  EA  P+FR+GYNSLGAFATIN
Sbjct  180   AINVSPIEYGHVLLIPRMFECLPQRIDYESFLLALHMTVEAGSPYFRLGYNSLGAFATIN  239

Query  1324  HLHFQAYYLQVPFPVEKTPTREIMRGREQGDGGIVVSQLLNYPARALLFEGGSTVRDLSD  1145
             HLHFQAYYL  PFP+EK PT++I         G+ + +LL YP R L+FEGG++++DL+ 
Sbjct  240   HLHFQAYYLASPFPIEKAPTKKIG----TSSNGVKIFELLKYPVRGLVFEGGNSLQDLAK  295

Query  1144  AVANSCISLQNNNIPFNLLISERGNKVFLFPQVHSNSVFL  1025
              V++ C  LQ+ NIP+N+LI++ G ++FL PQ ++    L
Sbjct  296   EVSDCCTFLQDTNIPYNVLIADSGRRIFLLPQCYAEKQAL  335


 Score =   114 bits (284),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 54/74 (73%), Positives = 62/74 (84%), Gaps = 0/74 (0%)
 Frame = -2

Query  759  FSKCYAEKQACGKIDQEILDTWVNPAVWEISGHMVLKRREDYDDASEDYAWRLLSEVSLS  580
              +CYAEKQA G++  E+LDT VNPAVWEISGH+VLKRREDYD+ASE  AWRLL+EVSLS
Sbjct  325  LPQCYAEKQALGEVSPELLDTQVNPAVWEISGHIVLKRREDYDEASEGNAWRLLAEVSLS  384

Query  579  EERFEEVKAYVSRA  538
            E RFEEVKA +  A
Sbjct  385  EARFEEVKAMIFEA  398



>gb|EMS57447.1| hypothetical protein TRIUR3_28682 [Triticum urartu]
Length=528

 Score =   419 bits (1076),  Expect = 5e-134, Method: Compositional matrix adjust.
 Identities = 211/366 (58%), Positives = 259/366 (71%), Gaps = 39/366 (11%)
 Frame = -1

Query  2044  LMLTIKRVPTVVSNYQDDAPEDSKPESLGCGRNCLGQCCLPVSCLPLFAFKNDEHKCDGD  1865
             + LTIKRVPTV+SNYQ++          GCGRNCLG CCLP S LPL+AFK D  K   D
Sbjct  3     MKLTIKRVPTVLSNYQEEG-------GGGCGRNCLGDCCLPASKLPLYAFKADPKKPAQD  55

Query  1864  WNYLSYGECPISF-LSDLLLGQ-------------------------WEERMSRGLFRYD  1763
                    E P  F L+ LLL Q                         WE+R++RGLFRYD
Sbjct  56    ------DELPTEFFLNSLLLAQISELYQMFPLRNKNETSSLVTLKHKWEDRVARGLFRYD  109

Query  1762  VTSCETKIIPGTFGFIAQLNEGRHLKKRPTEFRVDQVLQPFDENKFNFTKIGQEEVLFRF  1583
             VT+CETK+IPG  GF+AQLNEGRHLKKRPTEFRVD+VLQPFD  KFNFTK+GQEEVLFRF
Sbjct  110   VTACETKVIPGELGFVAQLNEGRHLKKRPTEFRVDRVLQPFDSAKFNFTKVGQEEVLFRF  169

Query  1582  EPSNDCKSHYLPSGLVDARSGSPTVLAINVSPIEYGHVLLIPRVLDCLPQRIDHDSFFVA  1403
             E      S++L +        +P+V+AINVSPIEYGHVLLIPRVLD LPQ+ID +SF +A
Sbjct  170   EKGGGGSSYFLENAPSTEGDHAPSVVAINVSPIEYGHVLLIPRVLDRLPQQIDPESFLLA  229

Query  1402  MHLAKEAADPFFRVGYNSLGAFATINHLHFQAYYLQVPFPVEKTPTREIMRGREQGDGGI  1223
             +H+A EAA P+FR+GYNSLGAFATINHLHFQAYYL VPFPVEK PT++I   +   + G+
Sbjct  230   LHMAAEAASPYFRLGYNSLGAFATINHLHFQAYYLSVPFPVEKAPTKKIPLAKCALNSGV  289

Query  1222  VVSQLLNYPARALLFEGGSTVRDLSDAVANSCISLQNNNIPFNLLISERGNKVFLFPQVH  1043
              VS+L N+P R L+FE G+T++DL+D V N+CI LQ NN+PFN+LIS+ G ++F+FPQ +
Sbjct  290   KVSKLTNFPVRGLVFERGNTLKDLADVVTNACIWLQENNVPFNVLISDSGRRIFVFPQCY  349

Query  1042  SNSVFL  1025
             +    L
Sbjct  350   AEKQAL  355


 Score =   115 bits (288),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 54/77 (70%), Positives = 65/77 (84%), Gaps = 0/77 (0%)
 Frame = -2

Query  759  FSKCYAEKQACGKIDQEILDTWVNPAVWEISGHMVLKRREDYDDASEDYAWRLLSEVSLS  580
            F +CYAEKQA G++ Q++LDT VNPAVWEISGH+VLKRR D+++ASE  AWRLL+EVSLS
Sbjct  345  FPQCYAEKQALGEVSQDLLDTQVNPAVWEISGHIVLKRRTDFEEASEASAWRLLAEVSLS  404

Query  579  EERFEEVKAYVSRAADL  529
            EERFEEVKA +  A  L
Sbjct  405  EERFEEVKACIFEATGL  421



>gb|AAM34266.1|AF508793_1 VTC2 [Arabidopsis thaliana]
Length=459

 Score =   416 bits (1069),  Expect = 6e-134, Method: Compositional matrix adjust.
 Identities = 211/358 (59%), Positives = 265/358 (74%), Gaps = 29/358 (8%)
 Frame = -1

Query  2041  MLTIKRVPTVVSNYQDDAPEDSKPESLGCGRNCLGQCCL------PVSC----LPLFAFK  1892
             ML IKRVPTVVSNYQ D   D   + +GCGRNCLG CCL      P S     LPL+A K
Sbjct  1     MLKIKRVPTVVSNYQKD---DGAEDPVGCGRNCLGACCLNGTFWKPESSFLIMLPLYACK  57

Query  1891  NDEHKCDGDWNYLSYG--ECPISFLSDLLLGQWEERMSRGLFRYDVTSCETKIIPGTFGF  1718
             N      G+   +S+   E P++FL  L+LG+WE+R  RGLFRYDVT+CETK+IPG +GF
Sbjct  58    NLVK--SGEKLVISHEAIEPPVAFLESLVLGEWEDRFQRGLFRYDVTACETKVIPGKYGF  115

Query  1717  IAQLNEGRHLKKRPTEFRVDQVLQPFDENKFNFTKIGQEEVLFRFEPSNDCKSHYLPSGL  1538
             +AQLNEGRHLKKRPTEFRVD+VLQ FD +KFNFTK+GQEE+LF+FE   D +  + P   
Sbjct  116   VAQLNEGRHLKKRPTEFRVDKVLQSFDGSKFNFTKVGQEELLFQFEAGEDAQVQFFPCMP  175

Query  1537  VDARSGSPTVLAINVS-------PIEYGHVLLIPRVLDCLPQRIDHDSFFVAMHLAKEAA  1379
             +D  + SP+V+AINV        PIEYGHVLLIPRVLDCLPQRIDH S  +A+H+A EAA
Sbjct  176   IDPEN-SPSVVAINVKTLVQRACPIEYGHVLLIPRVLDCLPQRIDHKSLLLAVHMAAEAA  234

Query  1378  DPFFRVGYNSLGAFATINHLHFQAYYLQVPFPVEKTPTREIMRGREQGDGGIVVSQLLNY  1199
             +P+FR+ YNSLGAFATINHLHFQAYYL +PFP+EK PT++I         G+ +S+LL+Y
Sbjct  235   NPYFRLDYNSLGAFATINHLHFQAYYLAMPFPLEKAPTKKITTTV----SGVKISELLSY  290

Query  1198  PARALLFEGGSTVRDLSDAVANSCISLQNNNIPFNLLISERGNKVFLFPQVHSNSVFL  1025
             P R+LLFEGGS++++LSD V++ C+ LQNNNIPFN+LIS+ G ++FL PQ ++    L
Sbjct  291   PVRSLLFEGGSSMQELSDTVSDCCVCLQNNNIPFNILISDCGRQIFLMPQCYAEKQAL  348


 Score =   108 bits (270),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 54/85 (64%), Positives = 63/85 (74%), Gaps = 6/85 (7%)
 Frame = -2

Query  759  FSKCYAEKQACGKIDQEILDTWVNPAVWEISGHMVLKRREDYDDASEDYAWRLLSEVSLS  580
              +CYAEKQA G++  E+L+T VNPAVWEISGHMVLKR+EDY+ ASED AWRLL+E SLS
Sbjct  338  MPQCYAEKQALGEVSPEVLETQVNPAVWEISGHMVLKRKEDYEGASEDNAWRLLAEASLS  397

Query  579  EERFEEVKAYVSRAADLLLDSECSN  505
            EERF+EV A    A        CSN
Sbjct  398  EERFKEVTALAFEAIG------CSN  416



>gb|ABR16684.1| unknown [Picea sitchensis]
Length=435

 Score =   413 bits (1062),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 219/347 (63%), Positives = 260/347 (75%), Gaps = 23/347 (7%)
 Frame = -1

Query  2041  MLTIKRVPTVVSNYQDDAPEDSKPESLGCGRNCLGQCCLPVSCLPLFAFKND------EH  1880
             MLTIKR PT+VSNYQ+ +      E LGCGRNCLGQCC+P S LPL+ FK        EH
Sbjct  1     MLTIKRCPTIVSNYQEGS------EGLGCGRNCLGQCCVPGSKLPLYTFKRRHTIVGVEH  54

Query  1879  KCDGDWNYLSYGECPISFLSDLLLGQWEERMSRGLFRYDVTSCETKIIPGTFGFIAQLNE  1700
               D D   +   + P  FL  LL+GQWEERM RGLFRYDVT+CETK+IPG +GFIAQLNE
Sbjct  55    -VDKD---VEMADTP--FLDTLLIGQWEERMQRGLFRYDVTTCETKVIPGNYGFIAQLNE  108

Query  1699  GRHLKKRPTEFRVDQVLQPFDENKFNFTKIGQEEVLFRFEPSNDCKSHYLPSGLVDARSG  1520
             GRHLKKRPTEFRVD+V Q FD +KFNFTK+GQEEVLFRFE S + K  YL    V     
Sbjct  109   GRHLKKRPTEFRVDKVQQDFDRSKFNFTKVGQEEVLFRFEESEEGKVQYLEKAPV---LD  165

Query  1519  SPTVLAINVSPIEYGHVLLIPRVLDCLPQRIDHDSFFVAMHLAKEAADPFFRVGYNSLGA  1340
             SP V+AINVSPIEYGHVLL+PRVLDCLPQRIDHDS  +A+HLA EA +P FR+GYNSLGA
Sbjct  166   SPNVIAINVSPIEYGHVLLVPRVLDCLPQRIDHDSLLLALHLAAEAGNPSFRLGYNSLGA  225

Query  1339  FATINHLHFQAYYLQVPFPVEKTPTREIMRGREQGDGGIVVSQLLNYPARALLFEGGSTV  1160
             FATINHLHFQAYYL +PFPVEK  T+ +    E+  GG+ + +L NYP R L+FEGG+T+
Sbjct  226   FATINHLHFQAYYLALPFPVEKALTKRVPWRSEK--GGVKIFELCNYPVRGLVFEGGNTL  283

Query  1159  RDLSDAVANSCISLQNNNIPFNLLISERGNKVFLFPQVHSNSVFLSS  1019
              DL +AV +SCI LQ+NNIP+N+LI++ G +VFLFPQ ++    L  
Sbjct  284   EDLCNAVGSSCICLQDNNIPYNVLIADCGKRVFLFPQCYAEKQALGE  330


 Score =   122 bits (306),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 56/75 (75%), Positives = 67/75 (89%), Gaps = 0/75 (0%)
 Frame = -2

Query  759  FSKCYAEKQACGKIDQEILDTWVNPAVWEISGHMVLKRREDYDDASEDYAWRLLSEVSLS  580
            F +CYAEKQA G+++Q ILDT VNPAVWEISGH+VLKR++D+D ASEDYAW+LL+EVSLS
Sbjct  318  FPQCYAEKQALGEVNQGILDTQVNPAVWEISGHIVLKRKQDFDRASEDYAWKLLAEVSLS  377

Query  579  EERFEEVKAYVSRAA  535
            EERFEEVKAY+  A 
Sbjct  378  EERFEEVKAYIFEAV  392



>ref|XP_010539307.1| PREDICTED: GDP-L-galactose phosphorylase 1-like [Tarenaya hassleriana]
Length=449

 Score =   413 bits (1061),  Expect = 6e-133, Method: Compositional matrix adjust.
 Identities = 207/335 (62%), Positives = 264/335 (79%), Gaps = 7/335 (2%)
 Frame = -1

Query  2041  MLTIKRVPTVVSNYQ-DDAPEDSKPESLGCGRNCLGQCCLPVSCLPLFAFKNDEHKCDGD  1865
             ML IKRVPTVVSNYQ D+A ++      GCGRNCLG+CC+  + LPL+A K  +     +
Sbjct  1     MLKIKRVPTVVSNYQKDEAADEVVRGGGGCGRNCLGKCCIDGARLPLYACKKLDKVVASE  60

Query  1864  WNYLSYGECPISFLSDLLLGQWEERMSRGLFRYDVTSCETKIIPGTFGFIAQLNEGRHLK  1685
                L   E P++FL  L+L +WE+R  RGLFRYDVT+CETK+IPG +GFIAQLNEGRHLK
Sbjct  61    KPAL-VREPPVAFLESLVLAEWEDRFQRGLFRYDVTACETKVIPGKYGFIAQLNEGRHLK  119

Query  1684  KRPTEFRVDQVLQPFDENKFNFTKIGQEEVLFRFEPSNDCKSHYLPSGLVDARSGSPTVL  1505
             KRPTEFRVD+VLQPFD +KFNFTK+GQEEVLF+FE S D ++ + PS L+DA   SP V+
Sbjct  120   KRPTEFRVDKVLQPFDGSKFNFTKVGQEEVLFQFEASEDGEAQFFPSMLLDA-DNSPNVV  178

Query  1504  AINVSPIEYGHVLLIPRVLDCLPQRIDHDSFFVAMHLAKEAADPFFRVGYNSLGAFATIN  1325
             AINVSPIEYGHVLLIP+V +CLPQ+IDH SF +A+H+A E  +P+FR+GYNSLGAFATIN
Sbjct  179   AINVSPIEYGHVLLIPKVFECLPQKIDHQSFLLALHMAAEMGNPYFRLGYNSLGAFATIN  238

Query  1324  HLHFQAYYLQVPFPVEKTPTREIMRGREQGDGGIVVSQLLNYPARALLFEGGSTVRDLSD  1145
             HLHFQAYYL +PFP+EK PT++I       +  + +S+LL++P R LLFE G+TV++LSD
Sbjct  239   HLHFQAYYLAMPFPIEKAPTKKIT----TTETSVKISKLLSFPVRGLLFEAGNTVQNLSD  294

Query  1144  AVANSCISLQNNNIPFNLLISERGNKVFLFPQVHS  1040
              V+++CI LQNNNIPFN+LIS+ G ++FL PQ ++
Sbjct  295   TVSDACICLQNNNIPFNILISDCGKRIFLLPQCYA  329


 Score =   112 bits (281),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 52/74 (70%), Positives = 63/74 (85%), Gaps = 0/74 (0%)
 Frame = -2

Query  759  FSKCYAEKQACGKIDQEILDTWVNPAVWEISGHMVLKRREDYDDASEDYAWRLLSEVSLS  580
              +CYAEKQA G++  E+LDT VNPAVWEISGHMVLKR++DY++ASE+ AWRLL+EVSLS
Sbjct  324  LPQCYAEKQALGEVSSELLDTQVNPAVWEISGHMVLKRKKDYEEASEENAWRLLAEVSLS  383

Query  579  EERFEEVKAYVSRA  538
            EERFEEV A +  A
Sbjct  384  EERFEEVTALIFEA  397



>gb|ABR16521.1| unknown [Picea sitchensis]
 gb|ACN40513.1| unknown [Picea sitchensis]
Length=431

 Score =   411 bits (1056),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 217/351 (62%), Positives = 257/351 (73%), Gaps = 21/351 (6%)
 Frame = -1

Query  2041  MLTIKRVPTVVSNYQDDAPEDSKPESLGCGRNCLGQCCLPVSCLPLFAFKN-----DEHK  1877
             MLTIKR PT++SNYQ+ +      E LGCGRNCLGQCC+P S LPL+ FK       E  
Sbjct  1     MLTIKRCPTILSNYQEGS------EGLGCGRNCLGQCCVPGSKLPLYTFKRRHTIVGEKH  54

Query  1876  CDGDWNYLSYGECPISFLSDLLLGQWEERMSRGLFRYDVTSCETKIIPGTFGFIAQLNEG  1697
              D D          I  L  LLLG WEERM RGLFRYDVT CETK+IPG +GFIAQLNEG
Sbjct  55    VDNDVKLAD-----IPSLDSLLLGLWEERMQRGLFRYDVTICETKVIPGNYGFIAQLNEG  109

Query  1696  RHLKKRPTEFRVDQVLQPFDENKFNFTKIGQEEVLFRFEPSNDCKSHYLPSGLVDARSGS  1517
             RHLKKRPTEFRVD+V Q FD +KFNFTK+GQEEVLFRFE S + K  YL    V     S
Sbjct  110   RHLKKRPTEFRVDKVQQDFDPSKFNFTKVGQEEVLFRFEESGEDKVQYLEKAPV---LDS  166

Query  1516  PTVLAINVSPIEYGHVLLIPRVLDCLPQRIDHDSFFVAMHLAKEAADPFFRVGYNSLGAF  1337
             P V+AINVSPIEYGHVLL+PRVLDCLPQRIDHDS  +A+HLA EA +P FR+GYNSLGAF
Sbjct  167   PNVVAINVSPIEYGHVLLVPRVLDCLPQRIDHDSLLLALHLAAEARNPSFRLGYNSLGAF  226

Query  1336  ATINHLHFQAYYLQVPFPVEKTPTREIMRGREQGDGGIVVSQLLNYPARALLFEGGSTVR  1157
             ATINHLHFQAYYL +PFPVEK PT+ +    E+   G+ + +L NYP R L+FEGG+T+ 
Sbjct  227   ATINHLHFQAYYLALPFPVEKAPTKRVPWKSEK--AGVKIFELYNYPVRGLVFEGGNTLE  284

Query  1156  DLSDAVANSCISLQNNNIPFNLLISERGNKVFLFPQVHSNSVFLSSREFSI  1004
             DLS+AV +SCI LQ+NNIP+N+L+++ G +VFLFPQ ++    L   +  I
Sbjct  285   DLSNAVGSSCICLQDNNIPYNVLVADCGKRVFLFPQCYAEKQALGEVDQEI  335


 Score =   129 bits (325),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 60/75 (80%), Positives = 69/75 (92%), Gaps = 0/75 (0%)
 Frame = -2

Query  759  FSKCYAEKQACGKIDQEILDTWVNPAVWEISGHMVLKRREDYDDASEDYAWRLLSEVSLS  580
            F +CYAEKQA G++DQEILDT VNPAVWEISGHMVLKR++D+D ASEDYAW+LL+EVSLS
Sbjct  318  FPQCYAEKQALGEVDQEILDTQVNPAVWEISGHMVLKRKQDFDRASEDYAWKLLAEVSLS  377

Query  579  EERFEEVKAYVSRAA  535
            EERFEEVKAY+  AA
Sbjct  378  EERFEEVKAYILEAA  392



>emb|CDX92792.1| BnaC07g40500D [Brassica napus]
Length=399

 Score =   409 bits (1052),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 201/352 (57%), Positives = 261/352 (74%), Gaps = 13/352 (4%)
 Frame = -1

Query  2041  MLTIKRVPTVVSNYQDDAPEDSKPESLGCGRNCLGQCCLPVSCLPLFAFKNDEHKCDGDW  1862
             ML IKRVPTVVSN+Q D   D      GCGRNCL  CC+  + LPL+  K  E   +   
Sbjct  1     MLKIKRVPTVVSNHQKDEASDGSVG--GCGRNCLRACCVNRARLPLYVCKKVEDSGE---  55

Query  1861  NYLSYGECPISFLSDLLLGQWEERMSRGLFRYDVTSCETKIIPGTFGFIAQLNEGRHLKK  1682
                   E P++FL  L+LG+WE+R  RGLFRYD+T+C TK+IPG +GFIAQLNEGRHLK 
Sbjct  56    ---KAREPPVAFLESLVLGEWEDRYQRGLFRYDLTACVTKVIPGKYGFIAQLNEGRHLK-  111

Query  1681  RPTEFRVDQVLQPFDENKFNFTKIGQEEVLFRFEPSNDCKSHYLPSGLVDARSGSPTVLA  1502
             RPTEFRVD+VLQ FD +KFNFTK+ QEE+LF+FE   D ++ + P   + A + SP+V+A
Sbjct  112   RPTEFRVDKVLQSFDGSKFNFTKVSQEELLFQFEAGEDSEARFFPCMPLVAEN-SPSVVA  170

Query  1501  INVSPIEYGHVLLIPRVLDCLPQRIDHDSFFVAMHLAKEAADPFFRVGYNSLGAFATINH  1322
             INVSPIEYGHVLLIPRVLDCLPQR+DH S  +A+H+A E+ +P+FRVGYNSLGAFATINH
Sbjct  171   INVSPIEYGHVLLIPRVLDCLPQRMDHKSMLLALHMASESKNPYFRVGYNSLGAFATINH  230

Query  1321  LHFQAYYLQVPFPVEKTPTREIMRGREQGDGGIVVSQLLNYPARALLFEGGSTVRDLSDA  1142
             LHFQAYYL +PFP+EK  ++E+M      D G+ +S+LL+YP R LLFEGG++++DLSD 
Sbjct  231   LHFQAYYLAMPFPLEKASSKEMMI---TTDNGVKISELLSYPMRGLLFEGGNSMQDLSDT  287

Query  1141  VANSCISLQNNNIPFNLLISERGNKVFLFPQVHSNSVFLSSREFSIYVSR*N  986
             V+++C+ LQNNN+PFN+LIS+ G ++FL PQ ++    L      ++ S+ N
Sbjct  288   VSDACVCLQNNNVPFNVLISDCGRRIFLMPQCYAEKQALGEVSPEVFESQVN  339


 Score = 99.8 bits (247),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 46/72 (64%), Positives = 59/72 (82%), Gaps = 0/72 (0%)
 Frame = -2

Query  753  KCYAEKQACGKIDQEILDTWVNPAVWEISGHMVLKRREDYDDASEDYAWRLLSEVSLSEE  574
            +CYAEKQA G++  E+ ++ VNPAVWEISGHMVLKR+EDY+ A+E+ A RLLS+ SLSEE
Sbjct  318  QCYAEKQALGEVSPEVFESQVNPAVWEISGHMVLKRKEDYEGATEEKACRLLSDASLSEE  377

Query  573  RFEEVKAYVSRA  538
            RF+EV A +  A
Sbjct  378  RFKEVNALIFEA  389



>emb|CDY46677.1| BnaA03g48310D [Brassica napus]
Length=398

 Score =   407 bits (1046),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 201/352 (57%), Positives = 260/352 (74%), Gaps = 14/352 (4%)
 Frame = -1

Query  2041  MLTIKRVPTVVSNYQDDAPEDSKPESLGCGRNCLGQCCLPVSCLPLFAFKNDEHKCDGDW  1862
             ML IKRVPTVVSNYQ +   D      GCGRNCL  CC+ ++ LPL+     E   +   
Sbjct  1     MLKIKRVPTVVSNYQKNEASDGSVG--GCGRNCLRACCVDMARLPLYVCNKVEDSGE---  55

Query  1861  NYLSYGECPISFLSDLLLGQWEERMSRGLFRYDVTSCETKIIPGTFGFIAQLNEGRHLKK  1682
                   E P++FL  L+LG+WE+R  RGLFRYD+T+C TK+IPG +GFIAQLNEGRHLK 
Sbjct  56    ---KAREPPVAFLESLVLGEWEDRYQRGLFRYDLTACVTKVIPGKYGFIAQLNEGRHLK-  111

Query  1681  RPTEFRVDQVLQPFDENKFNFTKIGQEEVLFRFEPSNDCKSHYLPSGLVDARSGSPTVLA  1502
             RPTEFRVD+VLQ FD NKFNFTK+ QEE+LF+FE     ++ +LP   + A + SP+V+A
Sbjct  112   RPTEFRVDKVLQSFDGNKFNFTKVSQEELLFQFEAGEYEEAQFLPCMPLLAEN-SPSVVA  170

Query  1501  INVSPIEYGHVLLIPRVLDCLPQRIDHDSFFVAMHLAKEAADPFFRVGYNSLGAFATINH  1322
             INVSPIEYGHVLLIPRVLDCLPQR+DH S  +A+H+A EA +P+FRVGYNSLGAFATINH
Sbjct  171   INVSPIEYGHVLLIPRVLDCLPQRMDHKSMLLALHMASEAKNPYFRVGYNSLGAFATINH  230

Query  1321  LHFQAYYLQVPFPVEKTPTREIMRGREQGDGGIVVSQLLNYPARALLFEGGSTVRDLSDA  1142
             LHFQAYYL +PFP+EK  ++E++      D G+ VS+LL+YP R LLFEGG++++DLSD 
Sbjct  231   LHFQAYYLAMPFPLEKASSKEMI----TTDNGVKVSELLSYPMRGLLFEGGNSMQDLSDT  286

Query  1141  VANSCISLQNNNIPFNLLISERGNKVFLFPQVHSNSVFLSSREFSIYVSR*N  986
             V+++CI LQN+N+PFN+LIS  G ++FL PQ ++    L      ++ ++ N
Sbjct  287   VSDACIYLQNSNVPFNVLISNCGRQIFLMPQCYAEKQALGEISTEVWEAQVN  338


 Score = 97.1 bits (240),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 46/74 (62%), Positives = 58/74 (78%), Gaps = 0/74 (0%)
 Frame = -2

Query  759  FSKCYAEKQACGKIDQEILDTWVNPAVWEISGHMVLKRREDYDDASEDYAWRLLSEVSLS  580
              +CYAEKQA G+I  E+ +  VNPAVWEISGHMVLKR+EDY+ A+E+ A RLL++ SLS
Sbjct  315  MPQCYAEKQALGEISTEVWEAQVNPAVWEISGHMVLKRKEDYEGATEEKACRLLADASLS  374

Query  579  EERFEEVKAYVSRA  538
            EERF+EV A +  A
Sbjct  375  EERFKEVNALIFEA  388



>ref|XP_009127029.1| PREDICTED: GDP-L-galactose phosphorylase 2 [Brassica rapa]
Length=412

 Score =   396 bits (1018),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 197/335 (59%), Positives = 249/335 (74%), Gaps = 30/335 (9%)
 Frame = -1

Query  2044  LMLTIKRVPTVVSNYQDDAPEDSKPESLGCGRNCLGQCCLPVSCLPLFAFKNDEHKCDGD  1865
             ++L IKRVPTVVSN+Q D   + + E  GCGRN L +CC+ V  LPL+  K  E      
Sbjct  1     MLLKIKRVPTVVSNHQKDETAEEE-EGEGCGRNILSKCCINVERLPLYTCKPAEEN----  55

Query  1864  WNYLSYGECPISFLSDLLLGQWEERMSRGLFRYDVTSCETKIIPGTFGFIAQLNEGRHLK  1685
                       ++FL  LLLG+WE+R  RGLFRYDVT+CETK+IPG +GFIAQLNEGRHLK
Sbjct  56    ----------VTFLESLLLGEWEDRFQRGLFRYDVTACETKVIPGKYGFIAQLNEGRHLK  105

Query  1684  KRPTEFRVDQVLQPFDENKFNFTKIGQEEVLFRFEPSNDCKSHYLPSGLVDARSGSPTVL  1505
             KRPTEFRVD+VLQPFD NKFNFTK+ +EE+LF+FE         +P  +      SP V+
Sbjct  106   KRPTEFRVDKVLQPFDANKFNFTKVCREELLFQFEAD-------MPLDV----DNSPNVV  154

Query  1504  AINVSPIEYGHVLLIPRVLDCLPQRIDHDSFFVAMHLAKEAADPFFRVGYNSLGAFATIN  1325
             AINVSPIEYGHVLLIPRVLDCLPQRIDH S  +A+H+A EAA+P+FRVGYNSLGAFATIN
Sbjct  155   AINVSPIEYGHVLLIPRVLDCLPQRIDHKSLLLALHMAVEAANPYFRVGYNSLGAFATIN  214

Query  1324  HLHFQAYYLQVPFPVEKTPTREIMRGREQGDGGIVVSQLLNYPARALLFEGGSTVRDLSD  1145
             HLHFQAYYL +PFP+EK  + +I       + G+ +S+L++YP R LLFEGG+++++LSD
Sbjct  215   HLHFQAYYLAMPFPIEKAHSLKIT----TTNDGVRISKLMSYPVRGLLFEGGNSIKELSD  270

Query  1144  AVANSCISLQNNNIPFNLLISERGNKVFLFPQVHS  1040
              V+N+ + LQNNNI FN+LIS+ G ++FL PQ ++
Sbjct  271   DVSNASVCLQNNNISFNILISDSGKRIFLLPQCYA  305


 Score = 99.4 bits (246),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 46/74 (62%), Positives = 58/74 (78%), Gaps = 0/74 (0%)
 Frame = -2

Query  759  FSKCYAEKQACGKIDQEILDTWVNPAVWEISGHMVLKRREDYDDASEDYAWRLLSEVSLS  580
              +CYAEKQA G +  E+LDT VNPAVWE+SGHMVLKR++DY+ A+E+ A  LL+EVSLS
Sbjct  300  LPQCYAEKQALGGVSSELLDTQVNPAVWEMSGHMVLKRKKDYEGATEEKARSLLAEVSLS  359

Query  579  EERFEEVKAYVSRA  538
            EERF+EV   +  A
Sbjct  360  EERFKEVNTMIFEA  373



>gb|KCW52128.1| hypothetical protein EUGRSUZ_J015682, partial [Eucalyptus grandis]
Length=316

 Score =   392 bits (1007),  Expect = 8e-127, Method: Compositional matrix adjust.
 Identities = 187/265 (71%), Positives = 217/265 (82%), Gaps = 1/265 (0%)
 Frame = -1

Query  1831  SFLSDLLLGQWEERMSRGLFRYDVTSCETKIIPGTFGFIAQLNEGRHLKKRPTEFRVDQV  1652
             SFL +LLLGQW+ RM+RGLFRYDVT+C+TK+IP  +GFI QLNEGRHLKKRPTEFRVDQV
Sbjct  3     SFLLNLLLGQWKNRMNRGLFRYDVTTCKTKVIPSDYGFIVQLNEGRHLKKRPTEFRVDQV  62

Query  1651  LQPFDENKFNFTKIGQEEVLFRFEPSNDCKSHYLPSGLVDARSGSPTVLAINVSP-IEYG  1475
             LQ FDE KFNFTK+G EEVLF FE S+DC SH+ P      +  SP V+AINVSP I+YG
Sbjct  63    LQDFDEKKFNFTKVGHEEVLFMFEQSDDCYSHFFPGAPAIFKPPSPNVVAINVSPSIKYG  122

Query  1474  HVLLIPRVLDCLPQRIDHDSFFVAMHLAKEAADPFFRVGYNSLGAFATINHLHFQAYYLQ  1295
             H+LLIPRVLDCLPQRIDH SFF+A+ LAKEAADPFFRVGYNSLG FATINHLHFQAYYL 
Sbjct  123   HILLIPRVLDCLPQRIDHMSFFLALSLAKEAADPFFRVGYNSLGTFATINHLHFQAYYLA  182

Query  1294  VPFPVEKTPTREIMRGREQGDGGIVVSQLLNYPARALLFEGGSTVRDLSDAVANSCISLQ  1115
              PFPVEK PT  +M        G+VVSQLL +P R+L+FEG  T+ DLS A+ANSCI LQ
Sbjct  183   SPFPVEKVPTLRVMTSTSMQRNGVVVSQLLKFPVRSLVFEGRDTLWDLSSAIANSCIRLQ  242

Query  1114  NNNIPFNLLISERGNKVFLFPQVHS  1040
             +NNIPFN+LI++ G +VFLFPQ ++
Sbjct  243   HNNIPFNVLIADCGKRVFLFPQCYA  267


 Score = 76.6 bits (187),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 39/69 (57%), Positives = 48/69 (70%), Gaps = 14/69 (20%)
 Frame = -2

Query  759  FSKCYAEKQACGKIDQEILDTWVNPAVWEISGHMVLKRREDYDDASEDYAWRLLSEVSLS  580
            F +CYAEKQA G++ QE+L+T VNP               D+++ASEDYAWRLL+EVSLS
Sbjct  262  FPQCYAEKQARGEVSQELLETQVNPV--------------DFENASEDYAWRLLAEVSLS  307

Query  579  EERFEEVKA  553
            EE F EVKA
Sbjct  308  EESFREVKA  316



>ref|XP_002529463.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF32929.1| conserved hypothetical protein [Ricinus communis]
Length=408

 Score =   394 bits (1011),  Expect = 5e-126, Method: Compositional matrix adjust.
 Identities = 199/368 (54%), Positives = 263/368 (71%), Gaps = 11/368 (3%)
 Frame = -1

Query  1912  LPLFAFKN-DEHKCDGDWNYLSYGECPISFLSDLLLGQWEERMSRGLFRYDVTSCETKII  1736
             LPL+AFK  ++  C+ +       E P++FL  LLLG+WEERM RGLFRYDVT+CETK+I
Sbjct  5     LPLYAFKRLNKIVCEKEEIEHENIEPPVAFLDSLLLGEWEERMQRGLFRYDVTACETKVI  64

Query  1735  PGTFGFIAQLNEGRHLKKRPTEFRVDQVLQPFDENKFNFTKIGQEEVLFRFEPSNDCKSH  1556
             PG +GFIAQLNEGRHLKKRPTEFRVD+VLQPFD NKFNFTK+GQEEVLF+FE S D    
Sbjct  65    PGQYGFIAQLNEGRHLKKRPTEFRVDKVLQPFDGNKFNFTKVGQEEVLFQFEASEDDDIQ  124

Query  1555  YLPSGLVDARSGSPTVLAINVSPIEYGHVLLIPRVLDCLPQRIDHDSFFVAMHLAKEAAD  1376
             + PS  +D  + SP+V+AINVSPIEYGHVLLIPR+LDCLPQRID DS  +A+++A EA +
Sbjct  125   FFPSAPIDVEN-SPSVVAINVSPIEYGHVLLIPRILDCLPQRIDRDSLLLALYMAAEAGN  183

Query  1375  PFFRVGYNSLGAFATINHLHFQAYYLQVPFPVEKTPTREIMRGREQGDGGIVVSQLLNYP  1196
             P+FR+GYNSLGAFATINHLHFQAYYL V FP+EK PT++I       D G+ +++L+NYP
Sbjct  184   PYFRLGYNSLGAFATINHLHFQAYYLAVQFPIEKAPTKKITT----LDCGVKIAELVNYP  239

Query  1195  ARALLFEGGSTVRDLSDAVANSCISLQNNNIPFNLLISERGNKVFLFPQVHSNSVFLSSR  1016
              R LLFEGG+T++DLS+ ++++CI LQ+NNIP+N+LIS+ G  VFL PQ ++    L   
Sbjct  240   VRGLLFEGGNTLQDLSNTISDACICLQDNNIPYNVLISDCGKCVFLLPQCYAEKQALGEV  299

Query  1015  EFSIYVSR*NVHFSSVKF*KYGNMVCLIACSFEVV*SLHGFR*LSVAFINDMLNFRSMEG  836
                +  ++ N     +     G+MV      +E     + +R L+   +++   F+ +  
Sbjct  300   SAELLDTQVNPAVWEIS----GHMVLKRKKDYEEASEENAWRLLAEVSLSEA-RFQEVNA  354

Query  835   DIYNQFSY  812
              I+   SY
Sbjct  355   LIFEAISY  362


 Score =   109 bits (272),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 50/74 (68%), Positives = 62/74 (84%), Gaps = 0/74 (0%)
 Frame = -2

Query  759  FSKCYAEKQACGKIDQEILDTWVNPAVWEISGHMVLKRREDYDDASEDYAWRLLSEVSLS  580
              +CYAEKQA G++  E+LDT VNPAVWEISGHMVLKR++DY++ASE+ AWRLL+EVSLS
Sbjct  286  LPQCYAEKQALGEVSAELLDTQVNPAVWEISGHMVLKRKKDYEEASEENAWRLLAEVSLS  345

Query  579  EERFEEVKAYVSRA  538
            E RF+EV A +  A
Sbjct  346  EARFQEVNALIFEA  359



>ref|XP_001769469.1| predicted protein [Physcomitrella patens]
 gb|EDQ65838.1| predicted protein [Physcomitrella patens]
Length=460

 Score =   394 bits (1012),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 203/352 (58%), Positives = 254/352 (72%), Gaps = 39/352 (11%)
 Frame = -1

Query  2041  MLTIKRVPTVVSNYQ--DDAPEDSKPESLGCGRNCLGQCCLPVSCLPLFAFK--------  1892
             MLTIKRV TVVS +Q  +  P        GCGR+CLG CC+P + LPL+AF         
Sbjct  1     MLTIKRVETVVSMHQQLEQVP--------GCGRDCLGTCCIPGAKLPLYAFGVRQSSGSN  52

Query  1891  ------NDEHKCDGDWNYLSYGECPIS-----FLSDLLLGQWEERMSRGLFRYDVTSCET  1745
                   +D+H C  D    S  E  +S     FL +LLL QWE+RM+RGLFRYDVT+CET
Sbjct  53    KRAHTGSDDH-CVPD----SVKESDVSPQENYFLDELLLAQWEDRMARGLFRYDVTACET  107

Query  1744  KIIPGTFGFIAQLNEGRHLKKRPTEFRVDQVLQPFDENKFNFTKIGQEEVLFRFEPSNDC  1565
             K++PG  GFIAQLNEGRHL+KRPTEFR+DQVLQPFD  KFNFTK+GQEEVLF+F P++  
Sbjct  108   KMLPGDCGFIAQLNEGRHLQKRPTEFRIDQVLQPFDPKKFNFTKVGQEEVLFQFMPNDSD  167

Query  1564  KSHYLPSGLVDARSGSPTVLAINVSPIEYGHVLLIPRVLDCLPQRIDHDSFFVAMHLAKE  1385
              S Y     V   S SP V+AINVSPIEYGH+LL+PRVLD LPQRID +SF +A+++A E
Sbjct  168   MSEYYEKATV---SSSPNVVAINVSPIEYGHILLVPRVLDRLPQRIDQESFLLALYMAAE  224

Query  1384  AADPFFRVGYNSLGAFATINHLHFQAYYLQVPFPVEKTPTREIMRGREQGDGGIVVSQLL  1205
             A +P+FR+GYNSLGAFATINHLHFQAYYL  PFP+E+ P   +  GR++   G+ V +L 
Sbjct  225   ANNPYFRLGYNSLGAFATINHLHFQAYYLAAPFPIERAPATRVSYGRKK--SGVKVYELT  282

Query  1204  NYPARALLFEGGSTVRDLSDAVANSCISLQNNNIPFNLLISERGNKVFLFPQ  1049
              +P R L+FE  +++ DLS AVAN+CI LQN NIP+N+LI++RG++VFL PQ
Sbjct  283   MFPVRGLVFEMCNSMVDLSIAVANACIYLQNENIPYNVLITDRGSRVFLLPQ  334


 Score =   113 bits (283),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 55/89 (62%), Positives = 71/89 (80%), Gaps = 1/89 (1%)
 Frame = -2

Query  801  NSLRIKEGTHSFGEFSKCYAEKQACGKIDQEILDTWVNPAVWEISGHMVLKRREDYDDAS  622
            N L    G+  F    +C+AE+QA G++D++IL+T VNPAVWEISGH+VLKRR+DYD A+
Sbjct  319  NVLITDRGSRVF-LLPQCFAERQARGEVDEDILETQVNPAVWEISGHIVLKRRKDYDLAT  377

Query  621  EDYAWRLLSEVSLSEERFEEVKAYVSRAA  535
            E YAWRL++EVSLS+ERFEEVKA   +AA
Sbjct  378  EGYAWRLMAEVSLSQERFEEVKAKCLKAA  406



>gb|KCW52138.1| hypothetical protein EUGRSUZ_J01579 [Eucalyptus grandis]
Length=376

 Score =   389 bits (999),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 203/341 (60%), Positives = 236/341 (69%), Gaps = 35/341 (10%)
 Frame = -1

Query  2041  MLTIKRVPTVVSNYQDDAPEDSKP------ESLGCGRNCLGQCCLPVSCLPLFAFKNDEH  1880
             MLTIKRV TVVSNYQ++  E          E+ GCGRNCLG+CCLP S LPL+ FK +  
Sbjct  1     MLTIKRVATVVSNYQEEGGEKDNAAVAVEGEAKGCGRNCLGKCCLPASDLPLYTFKGE--  58

Query  1879  KCDGDWNYLSYGECP-ISFLSDLLLGQWEERMSRGLFRYDVTSCETKIIPGTFGFIAQLN  1703
               D     + Y + P  SFL +LLLGQW+ RM+R                          
Sbjct  59    --DCAEESIFYQKPPETSFLLNLLLGQWKNRMNRA------------------------E  92

Query  1702  EGRHLKKRPTEFRVDQVLQPFDENKFNFTKIGQEEVLFRFEPSNDCKSHYLPSGLVDARS  1523
              GRHLKKRPTEFRVDQVLQ FDE KFNFTK+G EEVLF FE S+DC SH+ PS     + 
Sbjct  93    RGRHLKKRPTEFRVDQVLQDFDEKKFNFTKVGHEEVLFMFEQSDDCYSHFFPSAPASFKP  152

Query  1522  GSPTVLAINVSPIEYGHVLLIPRVLDCLPQRIDHDSFFVAMHLAKEAADPFFRVGYNSLG  1343
              SP V+AINVSPIEYGH+LLIP VLDCLPQRI+  SFF+A+ LAKEAADPFFRVGYNSLG
Sbjct  153   TSPNVVAINVSPIEYGHILLIPHVLDCLPQRINRMSFFLALSLAKEAADPFFRVGYNSLG  212

Query  1342  AFATINHLHFQAYYLQVPFPVEKTPTREIMRGREQGDGGIVVSQLLNYPARALLFEGGST  1163
              FATINHLHFQAYYL  PFPVEK PT  +M        G+VVSQLL +P R+L+FEG  T
Sbjct  213   TFATINHLHFQAYYLASPFPVEKVPTLRVMTSTSMLRNGVVVSQLLKFPVRSLVFEGRDT  272

Query  1162  VRDLSDAVANSCISLQNNNIPFNLLISERGNKVFLFPQVHS  1040
             + DLS AVANS I LQ+NNIPFN+LI++ G +VFLFPQ ++
Sbjct  273   LWDLSSAVANSFIRLQHNNIPFNVLIADCGKRVFLFPQCYA  313


 Score =   110 bits (274),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 50/69 (72%), Positives = 60/69 (87%), Gaps = 0/69 (0%)
 Frame = -2

Query  759  FSKCYAEKQACGKIDQEILDTWVNPAVWEISGHMVLKRREDYDDASEDYAWRLLSEVSLS  580
            F +CYAEKQA G++ QE+L+T VNP VWEI GH+VLKRRED+++A EDYAWRLL+EVSLS
Sbjct  308  FPQCYAEKQARGEVSQELLETQVNPVVWEIGGHIVLKRREDFENALEDYAWRLLAEVSLS  367

Query  579  EERFEEVKA  553
            EE F EVKA
Sbjct  368  EESFREVKA  376



>gb|KCW70216.1| hypothetical protein EUGRSUZ_F03491 [Eucalyptus grandis]
Length=425

 Score =   388 bits (997),  Expect = 8e-124, Method: Compositional matrix adjust.
 Identities = 197/341 (58%), Positives = 249/341 (73%), Gaps = 24/341 (7%)
 Frame = -1

Query  2044  LMLTIKRVPTVVSNYQDDAPEDSKPESLGCGRNCLGQCCLPVSCLPLFAFKNDEHKCDGD  1865
             +ML IKRVPTVVSNYQ +  E+      GCGRNCL +CC+P + LPL+AFK      D  
Sbjct  1     MMLKIKRVPTVVSNYQKEEAEEGARRGGGCGRNCLNKCCIPGAKLPLYAFKRVNFVADEK  60

Query  1864  WNYLSY-GECPISFLSDLLLGQWEERMSRGLFRYDVTSCETKIIPGTFGFIAQLNEGRHL  1688
                +    E P++FL  LLLG+WE+RM RGLFRYDVT+CETKIIPG +GFIAQLNEGRHL
Sbjct  61    AGIVGENAEPPVAFLDSLLLGEWEDRMQRGLFRYDVTACETKIIPGGYGFIAQLNEGRHL  120

Query  1687  KKRPTEFRVDQVLQPFDENKFNFTKIGQEEVLFRFEPSNDCKSHYLPSGLVDARSGSPTV  1508
             KKRPTEFRVD+VLQPFD         G  E         D +  +     +DA   SP+V
Sbjct  121   KKRPTEFRVDKVLQPFD---------GSNE---------DGEVQFFAKAPIDA-DNSPSV  161

Query  1507  LAINVSPIEYGHVLLIPRVLDCLPQRIDHDSFFVAMHLAKEAADPFFRVGYNSLGAFATI  1328
             +AINVSPIEYGHVLLIPRVL+C+PQRID +SF +A+++A EA +P+FR+GYNSLGAFATI
Sbjct  162   VAINVSPIEYGHVLLIPRVLECMPQRIDRESFSLALYMAAEARNPYFRLGYNSLGAFATI  221

Query  1327  NHLHFQAYYLQVPFPVEKTPTREIMRGREQGDGGIVVSQLLNYPARALLFEGGSTVRDLS  1148
             NHLHFQAYYL VPFP+EK PT+++       + G+ + +L+NYP R L+FEGG TV+DLS
Sbjct  222   NHLHFQAYYLAVPFPIEKAPTQKLT----ALESGVTIFELVNYPVRGLVFEGGDTVQDLS  277

Query  1147  DAVANSCISLQNNNIPFNLLISERGNKVFLFPQVHSNSVFL  1025
             +AV++SCI LQ+NNIP+N+LIS+ G ++FL PQ ++    L
Sbjct  278   NAVSDSCICLQDNNIPYNVLISDCGKRIFLLPQCYAEKQAL  318


 Score =   112 bits (280),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 54/97 (56%), Positives = 72/97 (74%), Gaps = 5/97 (5%)
 Frame = -2

Query  759  FSKCYAEKQACGKIDQEILDTWVNPAVWEISGHMVLKRREDYDDASEDYAWRLLSEVSLS  580
              +CYAEKQA G+++ E+LDT VNPAVWEISGH+VLKR++D+++ASE+ AWRLL+EVSLS
Sbjct  308  LPQCYAEKQALGEVNSELLDTQVNPAVWEISGHIVLKRKKDFEEASEENAWRLLAEVSLS  367

Query  579  EERFEEVKAYVSRAADLLLDSECSNGGSQPWETYPEA  469
            EERF+EV A +  A      +   NGG    +  P+A
Sbjct  368  EERFQEVNALIFEAI-----ASVENGGQDNPDVEPQA  399



>ref|XP_002973386.1| hypothetical protein SELMODRAFT_99090 [Selaginella moellendorffii]
 gb|EFJ25760.1| hypothetical protein SELMODRAFT_99090 [Selaginella moellendorffii]
Length=420

 Score =   388 bits (997),  Expect = 9e-124, Method: Compositional matrix adjust.
 Identities = 189/335 (56%), Positives = 243/335 (73%), Gaps = 15/335 (4%)
 Frame = -1

Query  2041  MLTIKRVPTVVSNYQDDAPEDSKPESLGCGRNCLGQCCLPVSCLPLFAFKNDEHKCDGDW  1862
             MLTI+R+PT+VSNYQ+     S    +GCG+NCLG CC+P + LPL+ F N E    G+ 
Sbjct  1     MLTIRRIPTIVSNYQE-----SLESKIGCGKNCLGSCCIPGARLPLYLFGNQELDEHGEI  55

Query  1861  NYLSYGECPISFLSDLLLGQWEERMSRGLFRYDVTSCETKIIPGTFGFIAQLNEGRHLKK  1682
                  G+   SFL   +LGQW ++ + GLFRYDVT+C TK++PG +GFIAQLNEGRHLKK
Sbjct  56    QSKELGQN--SFLDSAILGQWADKQAEGLFRYDVTACATKVLPGKYGFIAQLNEGRHLKK  113

Query  1681  RPTEFRVDQVLQPFDENKFNFTKIGQEEVLFRFEPSNDCKSHYLPSGLVDARSGSPTVLA  1502
             RPTEFRVDQVLQPFD  KFNFTK+GQEE+LF FE SN+ KSHY     +    GSP V+ 
Sbjct  114   RPTEFRVDQVLQPFDHKKFNFTKVGQEEMLFCFEQSNNDKSHYHSKAYI---RGSPNVVV  170

Query  1501  INVSPIEYGHVLLIPRVLDCLPQRIDHDSFFVAMHLAKEAADPFFRVGYNSLGAFATINH  1322
             INVSPIEYGH+LL+PRVLDC+PQ ++ D+F +A+++A EA+ PFFR+GYNSLGAFATINH
Sbjct  171   INVSPIEYGHILLVPRVLDCIPQHLETDTFLLAIYMAAEASSPFFRLGYNSLGAFATINH  230

Query  1321  LHFQAYYLQVPFPVEKTPTREIMRGREQGDGGIVVSQLLNYPARALLFE-GGSTVRDLSD  1145
             LHFQAYYL   FPVEK PT+ I+   +    G  V QL NYP + +++E G S   +L+ 
Sbjct  231   LHFQAYYLGNCFPVEKAPTKLILHHYK----GFKVYQLENYPVKGIVYEVGESNFEELAF  286

Query  1144  AVANSCISLQNNNIPFNLLISERGNKVFLFPQVHS  1040
              +   C  LQ  NIP+N+LI+ +G ++FLFPQ ++
Sbjct  287   YIIKVCKGLQGRNIPYNILIANKGCQIFLFPQCYA  321


 Score =   106 bits (264),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 53/96 (55%), Positives = 73/96 (76%), Gaps = 1/96 (1%)
 Frame = -2

Query  801  NSLRIKEGTHSFGEFSKCYAEKQACGKIDQEILDTWVNPAVWEISGHMVLKRREDYDDAS  622
            N L   +G   F  F +CYAEKQA G++D EIL+T VNPAVWEISGH+VLKR+ED++ A+
Sbjct  303  NILIANKGCQIF-LFPQCYAEKQARGEVDLEILETQVNPAVWEISGHIVLKRKEDFERAT  361

Query  621  EDYAWRLLSEVSLSEERFEEVKAYVSRAADLLLDSE  514
            E+YAWRLL+EVS+SE+ F+E+   V  +A+   D++
Sbjct  362  EEYAWRLLAEVSVSEKVFDEIIKLVFSSAEDKFDAK  397



>ref|XP_002976520.1| hypothetical protein SELMODRAFT_105410 [Selaginella moellendorffii]
 gb|EFJ22189.1| hypothetical protein SELMODRAFT_105410 [Selaginella moellendorffii]
Length=420

 Score =   387 bits (993),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 188/335 (56%), Positives = 244/335 (73%), Gaps = 15/335 (4%)
 Frame = -1

Query  2041  MLTIKRVPTVVSNYQDDAPEDSKPESLGCGRNCLGQCCLPVSCLPLFAFKNDEHKCDGDW  1862
             MLTI+R+PT+VSNYQ+     S    +GCG+NCLG CC+P + LPL+ F N E    G+ 
Sbjct  1     MLTIRRIPTIVSNYQE-----SLESKIGCGKNCLGSCCIPGARLPLYLFGNQELDEHGEI  55

Query  1861  NYLSYGECPISFLSDLLLGQWEERMSRGLFRYDVTSCETKIIPGTFGFIAQLNEGRHLKK  1682
                  G+   SFL   +LGQW ++ + GLFRYDVT+C+TK++PG +GFIAQLNEGRHLKK
Sbjct  56    QSKELGQN--SFLDSAILGQWADKQAEGLFRYDVTACDTKVLPGKYGFIAQLNEGRHLKK  113

Query  1681  RPTEFRVDQVLQPFDENKFNFTKIGQEEVLFRFEPSNDCKSHYLPSGLVDARSGSPTVLA  1502
             RPTEFRVDQVLQPFD  KFNFTK+GQEE+LF FE SN+ KS+Y     +    GSP V+ 
Sbjct  114   RPTEFRVDQVLQPFDHKKFNFTKVGQEEMLFCFEQSNNDKSYYHSKAYI---RGSPNVVV  170

Query  1501  INVSPIEYGHVLLIPRVLDCLPQRIDHDSFFVAMHLAKEAADPFFRVGYNSLGAFATINH  1322
             INVSPIEYGH+LL+PRVLDC+PQ ++ D+F +A+++A EA+ PFFR+GYNSLGAFATINH
Sbjct  171   INVSPIEYGHILLVPRVLDCIPQHLETDTFLLAIYMAAEASSPFFRLGYNSLGAFATINH  230

Query  1321  LHFQAYYLQVPFPVEKTPTREIMRGREQGDGGIVVSQLLNYPARALLFE-GGSTVRDLSD  1145
             LHFQAYYL   FPVEK PT+ I+   +    G  V QL NYP + +++E G S   +L+ 
Sbjct  231   LHFQAYYLGNCFPVEKAPTKLILHHYK----GFKVYQLENYPVKGIVYEVGESNFEELAF  286

Query  1144  AVANSCISLQNNNIPFNLLISERGNKVFLFPQVHS  1040
              +   C  LQ  NIP+N+LI+ +G ++FLFPQ ++
Sbjct  287   YIIKVCKGLQGRNIPYNILIANKGCQIFLFPQCYA  321


 Score =   106 bits (264),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 53/96 (55%), Positives = 73/96 (76%), Gaps = 1/96 (1%)
 Frame = -2

Query  801  NSLRIKEGTHSFGEFSKCYAEKQACGKIDQEILDTWVNPAVWEISGHMVLKRREDYDDAS  622
            N L   +G   F  F +CYAEKQA G++D EIL+T VNPAVWEISGH+VLKR+ED++ A+
Sbjct  303  NILIANKGCQIF-LFPQCYAEKQARGEVDLEILETQVNPAVWEISGHIVLKRKEDFERAT  361

Query  621  EDYAWRLLSEVSLSEERFEEVKAYVSRAADLLLDSE  514
            E+YAWRLL+EVS+SE+ F+E+   V  +A+   D++
Sbjct  362  EEYAWRLLAEVSVSEKVFDEIIKLVFSSAEDKFDAK  397



>ref|XP_010660319.1| PREDICTED: GDP-L-galactose phosphorylase 1-like isoform X2 [Vitis 
vinifera]
Length=346

 Score =   383 bits (983),  Expect = 7e-123, Method: Compositional matrix adjust.
 Identities = 185/247 (75%), Positives = 207/247 (84%), Gaps = 6/247 (2%)
 Frame = -1

Query  2041  MLTIKRVPTVVSNYQDDAPEDSKPESLGCGRNCLGQCCLPVSCLPLFAFK-NDEHKCDGD  1865
             MLTIKRVPTVVSNYQ++A E     SLGCGRNCLG CCLPVS LPL+ FK N +   +  
Sbjct  1     MLTIKRVPTVVSNYQEEASE-----SLGCGRNCLGHCCLPVSKLPLYTFKKNVKDSSEAR  55

Query  1864  WNYLSYGECPISFLSDLLLGQWEERMSRGLFRYDVTSCETKIIPGTFGFIAQLNEGRHLK  1685
                 S G+ P +FL +LLLGQWE+RMS+GLFRYDVT CET+I+PG +GFIAQLNEGRH+K
Sbjct  56    VEVSSEGQPPAAFLDNLLLGQWEDRMSQGLFRYDVTLCETRIMPGNYGFIAQLNEGRHMK  115

Query  1684  KRPTEFRVDQVLQPFDENKFNFTKIGQEEVLFRFEPSNDCKSHYLPSGLVDARSGSPTVL  1505
             KRPTEFRVDQVLQPFDENKFNFTKIGQEEVLFRFE SND  +HY P   V A S S +V+
Sbjct  116   KRPTEFRVDQVLQPFDENKFNFTKIGQEEVLFRFEQSNDNNAHYFPVSPVTADSNSSSVV  175

Query  1504  AINVSPIEYGHVLLIPRVLDCLPQRIDHDSFFVAMHLAKEAADPFFRVGYNSLGAFATIN  1325
             AINVSPIEYGHVLLIP VLDCLPQRIDHDSF +A+H+AKEAADPFFR+GYNSLGAFATIN
Sbjct  176   AINVSPIEYGHVLLIPHVLDCLPQRIDHDSFLLALHMAKEAADPFFRLGYNSLGAFATIN  235

Query  1324  HLHFQAY  1304
             HLHFQ +
Sbjct  236   HLHFQCF  242


 Score =   126 bits (316),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 61/91 (67%), Positives = 74/91 (81%), Gaps = 7/91 (8%)
 Frame = -2

Query  780  GTHSFGEFS-------KCYAEKQACGKIDQEILDTWVNPAVWEISGHMVLKRREDYDDAS  622
            G +S G F+       +C+AEKQA G++ QE+LDT VNPAVWEISGHMVLKRREDY++AS
Sbjct  224  GYNSLGAFATINHLHFQCFAEKQALGEVSQELLDTLVNPAVWEISGHMVLKRREDYENAS  283

Query  621  EDYAWRLLSEVSLSEERFEEVKAYVSRAADL  529
            E+YAWRLL+EVSLSEERF+EVK YV  A+ L
Sbjct  284  EEYAWRLLAEVSLSEERFQEVKGYVLEASGL  314



>gb|KDO62102.1| hypothetical protein CISIN_1g012827mg [Citrus sinensis]
Length=393

 Score =   384 bits (986),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 175/273 (64%), Positives = 227/273 (83%), Gaps = 5/273 (2%)
 Frame = -1

Query  1843  ECPISFLSDLLLGQWEERMSRGLFRYDVTSCETKIIPGTFGFIAQLNEGRHLKKRPTEFR  1664
             E P++FL  L+LG+WE+R+ RGLFRYDVT+CET++IPG +GFIAQLNEGRHLKKRPTEFR
Sbjct  12    EPPVAFLDSLVLGEWEDRVQRGLFRYDVTACETRVIPGQYGFIAQLNEGRHLKKRPTEFR  71

Query  1663  VDQVLQPFDENKFNFTKIGQEEVLFRFEPSNDCKSHYLPSGLVDARSGSPTVLAINVSPI  1484
             VD+VLQPFD NKFNFTK+GQEEVLF+FE S D +  + PS  +D  + SP+V+AINVSPI
Sbjct  72    VDKVLQPFDGNKFNFTKVGQEEVLFQFEASEDGEVQFHPSAPIDVEN-SPSVVAINVSPI  130

Query  1483  EYGHVLLIPRVLDCLPQRIDHDSFFVAMHLAKEAADPFFRVGYNSLGAFATINHLHFQAY  1304
             EYGHVLLIPRVL+CLPQRID DSF +A+++A EA +P+FR+GYNSLGAFATINHLHFQAY
Sbjct  131   EYGHVLLIPRVLECLPQRIDRDSFLLALYMAAEAGNPYFRLGYNSLGAFATINHLHFQAY  190

Query  1303  YLQVPFPVEKTPTREIMRGREQGDGGIVVSQLLNYPARALLFEGGSTVRDLSDAVANSCI  1124
             Y+ +PFP+EK PT++I+        G+ +S+LLNYP R L+FEGG+++ DLS+ V+++CI
Sbjct  191   YMALPFPIEKAPTKKII----STGSGVKISELLNYPVRGLVFEGGNSLEDLSNTVSDACI  246

Query  1123  SLQNNNIPFNLLISERGNKVFLFPQVHSNSVFL  1025
              LQ NNIP+N+LI++ G ++FL PQ ++    L
Sbjct  247   CLQENNIPYNVLIADCGKRIFLLPQCYAEKQAL  279


 Score =   110 bits (275),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 53/87 (61%), Positives = 69/87 (79%), Gaps = 3/87 (3%)
 Frame = -2

Query  759  FSKCYAEKQACGKIDQEILDTWVNPAVWEISGHMVLKRREDYDDASEDYAWRLLSEVSLS  580
              +CYAEKQA G++  E+LDT VNPAVWEISGHMVLKR++DY++ASE+ AWRLL+EVSLS
Sbjct  269  LPQCYAEKQALGEVSSELLDTQVNPAVWEISGHMVLKRKKDYEEASEENAWRLLAEVSLS  328

Query  579  EERFEEVKAYVSRAADLLLDSECSNGG  499
            EER++EV A +  A   +   + +NGG
Sbjct  329  EERYQEVNALIFEA---IARGDDANGG  352



>ref|XP_001774558.1| predicted protein [Physcomitrella patens]
 gb|EDQ60626.1| predicted protein [Physcomitrella patens]
Length=386

 Score =   380 bits (976),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 195/334 (58%), Positives = 238/334 (71%), Gaps = 22/334 (7%)
 Frame = -1

Query  2041  MLTIKRVPTVVSNYQDDAPEDSKPESLGCGRNCLGQCCLPVSCLPLFAFKNDEHKCDGDW  1862
             MLTI+RV TVVS  Q         +  GCGR+CLG CC+  + LPL+ F        G  
Sbjct  1     MLTIRRVETVVSMQQ------QLDQGSGCGRDCLGNCCIRGTKLPLYTF--------GLK  46

Query  1861  NYLSYGEC--PISFLSDLLLGQWEERMSRGLFRYDVTSCETKIIPGTFGFIAQLNEGRHL  1688
               LS  +    I     L   QWE+RM RG FRYDVT+CETK++PG +GFIAQLNEGRH 
Sbjct  47    GLLSSNKSVHDIDESHSLFPEQWEDRMERGFFRYDVTACETKMLPGEYGFIAQLNEGRHS  106

Query  1687  KKRPTEFRVDQVLQPFDENKFNFTKIGQEEVLFRFEPSNDCKSHYLPSGLVDARSGSPTV  1508
             +KRPTEFRVDQVLQPFD  KFNFTK+GQEEVLF+F PS D  S Y    LV     SP V
Sbjct  107   QKRPTEFRVDQVLQPFDSKKFNFTKVGQEEVLFQFGPSEDGVSEYYEKALV---LNSPNV  163

Query  1507  LAINVSPIEYGHVLLIPRVLDCLPQRIDHDSFFVAMHLAKEAADPFFRVGYNSLGAFATI  1328
             +AINVSPIEYGH LL+PRVLDCLPQRID DSF +A+++A EA +P+FR+GYNSLGAFATI
Sbjct  164   VAINVSPIEYGHALLVPRVLDCLPQRIDQDSFLLALYMAAEANNPYFRLGYNSLGAFATI  223

Query  1327  NHLHFQ-AYYLQVPFPVEKTPTREIMRGREQGDGGIVVSQLLNYPARALLFEGGSTVRDL  1151
             NHLHFQ AYYL  PFP+E+ PT  I  GR++   G+ V +L  +P R L+FE  +++ DL
Sbjct  224   NHLHFQAAYYLVAPFPIERAPTSRITYGRKK--CGVKVHELTKFPVRGLVFEVCTSLEDL  281

Query  1150  SDAVANSCISLQNNNIPFNLLISERGNKVFLFPQ  1049
             S AV N+C+ LQN NIP+N+LI++RG++VFL PQ
Sbjct  282   SIAVGNACVYLQNENIPYNVLIADRGSRVFLLPQ  315


 Score =   101 bits (251),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 52/88 (59%), Positives = 65/88 (74%), Gaps = 1/88 (1%)
 Frame = -2

Query  801  NSLRIKEGTHSFGEFSKCYAEKQACGKIDQEILDTWVNPAVWEISGHMVLKRREDYDDAS  622
            N L    G+  F    + +AE+QA G++DQEIL+T VNPAVWEISGH+VLKRR DY  A+
Sbjct  300  NVLIADRGSRVF-LLPQYFAERQARGEVDQEILETQVNPAVWEISGHIVLKRRTDYVLAT  358

Query  621  EDYAWRLLSEVSLSEERFEEVKAYVSRA  538
            E+YAW+LL+EVSLS  RFEEVK    +A
Sbjct  359  EEYAWKLLAEVSLSRGRFEEVKVKCLKA  386



>ref|XP_001753398.1| predicted protein [Physcomitrella patens]
 gb|EDQ81621.1| predicted protein, partial [Physcomitrella patens]
Length=388

 Score =   380 bits (975),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 199/339 (59%), Positives = 248/339 (73%), Gaps = 30/339 (9%)
 Frame = -1

Query  2041  MLTIKRVPTVVSNYQ--DDAPEDSKPESLGCGRNCLGQCCLPV----SCLP--LFAFKND  1886
             MLTI+RV T+VS  Q  D AP        GCGR+CLG CC+P     + LP  + +F+  
Sbjct  1     MLTIRRVETLVSINQQLDQAP--------GCGRDCLGNCCIPAQLRFTVLPCTILSFETS  52

Query  1885  EHKCDGDWNYLSYGECPISFLSDLLLGQWEERMSRGLFRYDVTSCETKIIPGTFGFIAQL  1706
                    ++ L +G  P       ++ QWE+RM RGLFRYDVT+CETK++PG +GFIAQL
Sbjct  53    VW-----FHLLIHGFFP----KFSVVAQWEDRMVRGLFRYDVTACETKMLPGEYGFIAQL  103

Query  1705  NEGRHLKKRPTEFRVDQVLQPFDENKFNFTKIGQEEVLFRFEPSNDCKSHYLPSGLVDAR  1526
             NEGRH +KRPTEFRVDQVLQ FD  KFNFTK+GQEEVLF+F PS D  S Y     V A 
Sbjct  104   NEGRHSQKRPTEFRVDQVLQAFDPKKFNFTKVGQEEVLFQFGPSEDEVSDYYEKAPVLA-  162

Query  1525  SGSPTVLAINVSPIEYGHVLLIPRVLDCLPQRIDHDSFFVAMHLAKEAADPFFRVGYNSL  1346
               SP V+AINVSPIEYGHVLL+PRVLD LPQRID DSF +A+H+A EA +P+FR+GYNSL
Sbjct  163   --SPNVIAINVSPIEYGHVLLVPRVLDRLPQRIDQDSFLLALHMAAEANNPYFRLGYNSL  220

Query  1345  GAFATINHLHFQAYYLQVPFPVEKTPTREIMRGREQGDGGIVVSQLLNYPARALLFEGGS  1166
             GAFATINHLHFQAYYL  PFP+E+ PT  I  GR++  GG+ V +L  +P R L+FE  +
Sbjct  221   GAFATINHLHFQAYYLAAPFPIERAPTVRIPYGRKK--GGVKVYELTEFPVRGLVFEICN  278

Query  1165  TVRDLSDAVANSCISLQNNNIPFNLLISERGNKVFLFPQ  1049
             ++ DLS+AVAN+CI LQ+NNIP+N+LI++RG++VFL PQ
Sbjct  279   SMEDLSEAVANACIYLQDNNIPYNVLIADRGSRVFLLPQ  317


 Score =   115 bits (287),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 55/83 (66%), Positives = 68/83 (82%), Gaps = 1/83 (1%)
 Frame = -2

Query  801  NSLRIKEGTHSFGEFSKCYAEKQACGKIDQEILDTWVNPAVWEISGHMVLKRREDYDDAS  622
            N L    G+  F    +C+AE+QA G++DQEILDT VNPAVWEISGH+VLKRR+DYD A+
Sbjct  302  NVLIADRGSRVF-LLPQCFAERQARGEVDQEILDTQVNPAVWEISGHIVLKRRKDYDMAT  360

Query  621  EDYAWRLLSEVSLSEERFEEVKA  553
            EDYAW+LL+EVSL +ERF+EVKA
Sbjct  361  EDYAWKLLAEVSLPQERFDEVKA  383



>emb|CDY20787.1| BnaA02g09270D [Brassica napus]
Length=577

 Score =   386 bits (992),  Expect = 6e-121, Method: Compositional matrix adjust.
 Identities = 191/335 (57%), Positives = 246/335 (73%), Gaps = 31/335 (9%)
 Frame = -1

Query  2044  LMLTIKRVPTVVSNYQDDAPEDSKPESLGCGRNCLGQCCLPVSCLPLFAFKNDEHKCDGD  1865
             ++L IKRVP VVSN+Q D   + +     CGR    +CC+    LPL+  K+ E   + +
Sbjct  173   MLLKIKRVPAVVSNHQKDETAEEE--GEECGR----KCCINGERLPLYTCKHLEKPAEEN  226

Query  1864  WNYLSYGECPISFLSDLLLGQWEERMSRGLFRYDVTSCETKIIPGTFGFIAQLNEGRHLK  1685
                       ++FL  LLLG+WE+R  RGLFRYDVT+CETK+IPG +GFIAQLNEGRHL+
Sbjct  227   ----------VTFLESLLLGEWEDRFQRGLFRYDVTACETKVIPGKYGFIAQLNEGRHLQ  276

Query  1684  KRPTEFRVDQVLQPFDENKFNFTKIGQEEVLFRFEPSNDCKSHYLPSGLVDARSGSPTVL  1505
             KRPTEFRVDQVLQPFD NKFNFTK+ QEE+LF+FE           +G+      SP+V+
Sbjct  277   KRPTEFRVDQVLQPFDVNKFNFTKVSQEELLFQFE-----------AGMPLDVDNSPSVV  325

Query  1504  AINVSPIEYGHVLLIPRVLDCLPQRIDHDSFFVAMHLAKEAADPFFRVGYNSLGAFATIN  1325
             AINVSPIEYGHVLLIPR+LDCLPQRIDH S  +A+H+A EAA+P+FRVGYNSLGAFATIN
Sbjct  326   AINVSPIEYGHVLLIPRILDCLPQRIDHKSLLLALHMAVEAANPYFRVGYNSLGAFATIN  385

Query  1324  HLHFQAYYLQVPFPVEKTPTREIMRGREQGDGGIVVSQLLNYPARALLFEGGSTVRDLSD  1145
             HLHFQAYYL +PFP+EK  + +I    +    G+ +S+L +YP R LLFEGG+++++LSD
Sbjct  386   HLHFQAYYLAMPFPIEKAHSLKITTTND----GVRISKLTSYPVRGLLFEGGNSIKELSD  441

Query  1144  AVANSCISLQNNNIPFNLLISERGNKVFLFPQVHS  1040
              V+N+ + LQNNNI FN+LIS+ G ++FL PQ ++
Sbjct  442   VVSNASVCLQNNNISFNILISDSGKRIFLLPQCYA  476


 Score =   101 bits (251),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 47/75 (63%), Positives = 58/75 (77%), Gaps = 0/75 (0%)
 Frame = -2

Query  759  FSKCYAEKQACGKIDQEILDTWVNPAVWEISGHMVLKRREDYDDASEDYAWRLLSEVSLS  580
              +CYAEKQA G +  E+LDT VNPAVWE+SGHMVLKR+EDY+ A+E+ AW LL+EVSLS
Sbjct  471  LPQCYAEKQALGGVSSELLDTQVNPAVWEMSGHMVLKRKEDYERATEEKAWSLLAEVSLS  530

Query  579  EERFEEVKAYVSRAA  535
            EER +EV   +  A 
Sbjct  531  EERLKEVITMIFEAT  545



>gb|ABR16416.1| unknown [Picea sitchensis]
Length=308

 Score =   375 bits (962),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 191/299 (64%), Positives = 232/299 (78%), Gaps = 7/299 (2%)
 Frame = -1

Query  1942  LGQCCLPVSCLPLFAFKNDEHKCDGDWNYLSYGECP-ISFLSDLLLGQWEERMSRGLFRY  1766
             + +CC+P S LPL+ FK       G+ + +   +   I+ L  +LLGQWEERM RGLFRY
Sbjct  4     IKRCCVPGSKLPLYTFKR-RLTIAGEEDAVKDAKVEDITLLDTVLLGQWEERMQRGLFRY  62

Query  1765  DVTSCETKIIPGTFGFIAQLNEGRHLKKRPTEFRVDQVLQPFDENKFNFTKIGQEEVLFR  1586
             DVT+CETK+IPG +GFIAQLNEGRHLKKRPTEFRVD+VLQ FD +KFNFTK+GQEEVLF 
Sbjct  63    DVTTCETKVIPGNYGFIAQLNEGRHLKKRPTEFRVDKVLQGFDPSKFNFTKVGQEEVLFT  122

Query  1585  FEPSNDCKSHYLPSGLVDARSGSPTVLAINVSPIEYGHVLLIPRVLDCLPQRIDHDSFFV  1406
             FE S + K  YL   LV     SP V+AINVSPIEYGHVLL+PRVLDCLPQRIDHDS  +
Sbjct  123   FEESEENKVQYLEKALV---LDSPNVIAINVSPIEYGHVLLVPRVLDCLPQRIDHDSLLL  179

Query  1405  AMHLAKEAADPFFRVGYNSLGAFATINHLHFQAYYLQVPFPVEKTPTREIMRGREQGDGG  1226
             A+HLA E  +P FR+GYNSLGAFATINHLHFQAYYL +PFP+EK P R +    E+  GG
Sbjct  180   ALHLAAEVGNPSFRLGYNSLGAFATINHLHFQAYYLDLPFPIEKAPKRRVPWKSEK--GG  237

Query  1225  IVVSQLLNYPARALLFEGGSTVRDLSDAVANSCISLQNNNIPFNLLISERGNKVFLFPQ  1049
             I + +LLNYP R L+FEGG+T+ DLS+AV ++CI LQ+NNIP+N+LI++ G + FLFPQ
Sbjct  238   INIFELLNYPVRGLVFEGGNTLEDLSNAVGSACICLQDNNIPYNVLIADCGKRFFLFPQ  296



>gb|EEE52889.1| hypothetical protein OsJ_35472 [Oryza sativa Japonica Group]
Length=445

 Score =   378 bits (971),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 180/293 (61%), Positives = 224/293 (76%), Gaps = 5/293 (2%)
 Frame = -1

Query  1918  SCLPLFAFKNDEHKCDGDWNYLSYGECPISFLSDLLLGQWEERMSRGLFRYDVTSCETKI  1739
             S LPL+AFK    K     +          F  +LLLG WE+RM+RGLFRYDVT+CETK+
Sbjct  53    SKLPLYAFKASPKKPSSQED-----ASNDEFFVNLLLGLWEDRMARGLFRYDVTACETKV  107

Query  1738  IPGTFGFIAQLNEGRHLKKRPTEFRVDQVLQPFDENKFNFTKIGQEEVLFRFEPSNDCKS  1559
             IPG  GF+AQLNEGRHLKKRPTEFRVD+VLQPFD  KFNFTK+GQEEVLF+FE      S
Sbjct  108   IPGNLGFVAQLNEGRHLKKRPTEFRVDRVLQPFDAAKFNFTKVGQEEVLFQFENGGGDDS  167

Query  1558  HYLPSGLVDARSGSPTVLAINVSPIEYGHVLLIPRVLDCLPQRIDHDSFFVAMHLAKEAA  1379
              ++ S  +     +P V+AINVSPIEYGHVLLIPRVLD LPQRID +SF +A+H+A EAA
Sbjct  168   FFVESSPISVADRAPNVVAINVSPIEYGHVLLIPRVLDRLPQRIDQESFLLALHMAAEAA  227

Query  1378  DPFFRVGYNSLGAFATINHLHFQAYYLQVPFPVEKTPTREIMRGREQGDGGIVVSQLLNY  1199
              P+FR+GYNSLGAFATINHLHFQAYYL VPFPVEK  T+ I       + G+ VS+L+NY
Sbjct  228   SPYFRLGYNSLGAFATINHLHFQAYYLTVPFPVEKAATKRIFLAEGTMNSGVKVSKLMNY  287

Query  1198  PARALLFEGGSTVRDLSDAVANSCISLQNNNIPFNLLISERGNKVFLFPQVHS  1040
             P R L+FEGG+++ DL++ V+++CI LQ+NN+P+N+LIS+ G K+FLFPQ ++
Sbjct  288   PVRGLVFEGGNSLSDLANVVSSACIWLQDNNVPYNVLISDCGKKIFLFPQCYA  340


 Score =   123 bits (308),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 58/78 (74%), Positives = 68/78 (87%), Gaps = 0/78 (0%)
 Frame = -2

Query  759  FSKCYAEKQACGKIDQEILDTWVNPAVWEISGHMVLKRREDYDDASEDYAWRLLSEVSLS  580
            F +CYAEKQA G++ QE+LDT VNPAVWEISGH+VLKRR DY++ASE  AWRLL+EVSLS
Sbjct  335  FPQCYAEKQALGEVSQELLDTQVNPAVWEISGHIVLKRRSDYEEASEASAWRLLAEVSLS  394

Query  579  EERFEEVKAYVSRAADLL  526
            EERFEEVKAY+  AA L+
Sbjct  395  EERFEEVKAYIFDAAGLV  412



>ref|XP_008647912.1| PREDICTED: VTC2 isoform X2 [Zea mays]
Length=422

 Score =   371 bits (952),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 172/263 (65%), Positives = 213/263 (81%), Gaps = 0/263 (0%)
 Frame = -1

Query  1828  FLSDLLLGQWEERMSRGLFRYDVTSCETKIIPGTFGFIAQLNEGRHLKKRPTEFRVDQVL  1649
              L D+LL +WE+RM+RGLFRYDVT+CETK+IPG  GF+AQLNEGRHLKKRPTEFRVD+VL
Sbjct  52    LLVDILLSEWEDRMTRGLFRYDVTACETKVIPGNLGFVAQLNEGRHLKKRPTEFRVDRVL  111

Query  1648  QPFDENKFNFTKIGQEEVLFRFEPSNDCKSHYLPSGLVDARSGSPTVLAINVSPIEYGHV  1469
             QPFD  KFNFTK+GQEEVLF+FE S    S++L +  + A   +P V+AINVSPIEYGHV
Sbjct  112   QPFDPAKFNFTKVGQEEVLFQFENSGGDDSYFLNNAPIIAVDRAPNVIAINVSPIEYGHV  171

Query  1468  LLIPRVLDCLPQRIDHDSFFVAMHLAKEAADPFFRVGYNSLGAFATINHLHFQAYYLQVP  1289
             LLIPRVLD LPQRID +SF +A+ +A E   P+FR+GYNSLGAFATINHLHFQAYYL VP
Sbjct  172   LLIPRVLDRLPQRIDPESFLLALQMAAEGGSPYFRLGYNSLGAFATINHLHFQAYYLSVP  231

Query  1288  FPVEKTPTREIMRGREQGDGGIVVSQLLNYPARALLFEGGSTVRDLSDAVANSCISLQNN  1109
             FPVEK  T +I    +    G+ VS+L+NYP R L+FEGG+T+ DL+  V+N+CI LQ+N
Sbjct  232   FPVEKAATHKIPLSEDTKKNGVTVSKLINYPVRGLVFEGGNTLDDLATVVSNACIWLQDN  291

Query  1108  NIPFNLLISERGNKVFLFPQVHS  1040
             N+P+N+LIS+ G +VFLFPQ ++
Sbjct  292   NVPYNVLISDCGKRVFLFPQCYA  314


 Score =   124 bits (310),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 58/78 (74%), Positives = 68/78 (87%), Gaps = 0/78 (0%)
 Frame = -2

Query  759  FSKCYAEKQACGKIDQEILDTWVNPAVWEISGHMVLKRREDYDDASEDYAWRLLSEVSLS  580
            F +CYAEKQA G++ QE+LDT VNPAVWEISGHMVLKRR DY++ASE  AW+LL+EVSLS
Sbjct  309  FPQCYAEKQALGEVSQELLDTQVNPAVWEISGHMVLKRRMDYEEASETSAWKLLAEVSLS  368

Query  579  EERFEEVKAYVSRAADLL  526
            EERFEEVKAY+  AA L+
Sbjct  369  EERFEEVKAYIFSAAGLV  386



>ref|XP_008647911.1| PREDICTED: VTC2 isoform X1 [Zea mays]
Length=426

 Score =   371 bits (952),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 172/263 (65%), Positives = 213/263 (81%), Gaps = 0/263 (0%)
 Frame = -1

Query  1828  FLSDLLLGQWEERMSRGLFRYDVTSCETKIIPGTFGFIAQLNEGRHLKKRPTEFRVDQVL  1649
              L D+LL +WE+RM+RGLFRYDVT+CETK+IPG  GF+AQLNEGRHLKKRPTEFRVD+VL
Sbjct  56    LLVDILLSEWEDRMTRGLFRYDVTACETKVIPGNLGFVAQLNEGRHLKKRPTEFRVDRVL  115

Query  1648  QPFDENKFNFTKIGQEEVLFRFEPSNDCKSHYLPSGLVDARSGSPTVLAINVSPIEYGHV  1469
             QPFD  KFNFTK+GQEEVLF+FE S    S++L +  + A   +P V+AINVSPIEYGHV
Sbjct  116   QPFDPAKFNFTKVGQEEVLFQFENSGGDDSYFLNNAPIIAVDRAPNVIAINVSPIEYGHV  175

Query  1468  LLIPRVLDCLPQRIDHDSFFVAMHLAKEAADPFFRVGYNSLGAFATINHLHFQAYYLQVP  1289
             LLIPRVLD LPQRID +SF +A+ +A E   P+FR+GYNSLGAFATINHLHFQAYYL VP
Sbjct  176   LLIPRVLDRLPQRIDPESFLLALQMAAEGGSPYFRLGYNSLGAFATINHLHFQAYYLSVP  235

Query  1288  FPVEKTPTREIMRGREQGDGGIVVSQLLNYPARALLFEGGSTVRDLSDAVANSCISLQNN  1109
             FPVEK  T +I    +    G+ VS+L+NYP R L+FEGG+T+ DL+  V+N+CI LQ+N
Sbjct  236   FPVEKAATHKIPLSEDTKKNGVTVSKLINYPVRGLVFEGGNTLDDLATVVSNACIWLQDN  295

Query  1108  NIPFNLLISERGNKVFLFPQVHS  1040
             N+P+N+LIS+ G +VFLFPQ ++
Sbjct  296   NVPYNVLISDCGKRVFLFPQCYA  318


 Score =   124 bits (310),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 58/78 (74%), Positives = 68/78 (87%), Gaps = 0/78 (0%)
 Frame = -2

Query  759  FSKCYAEKQACGKIDQEILDTWVNPAVWEISGHMVLKRREDYDDASEDYAWRLLSEVSLS  580
            F +CYAEKQA G++ QE+LDT VNPAVWEISGHMVLKRR DY++ASE  AW+LL+EVSLS
Sbjct  313  FPQCYAEKQALGEVSQELLDTQVNPAVWEISGHMVLKRRMDYEEASETSAWKLLAEVSLS  372

Query  579  EERFEEVKAYVSRAADLL  526
            EERFEEVKAY+  AA L+
Sbjct  373  EERFEEVKAYIFSAAGLV  390



>ref|XP_006413132.1| hypothetical protein EUTSA_v10025206mg [Eutrema salsugineum]
 gb|ESQ54585.1| hypothetical protein EUTSA_v10025206mg [Eutrema salsugineum]
Length=368

 Score =   367 bits (943),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 169/255 (66%), Positives = 215/255 (84%), Gaps = 5/255 (2%)
 Frame = -1

Query  1804  QWEERMSRGLFRYDVTSCETKIIPGTFGFIAQLNEGRHLKKRPTEFRVDQVLQPFDENKF  1625
             QWE+R  RGLFRYDVT+CETK+IPG +GF+AQLNEGRHLKKRPTEFRVD+VLQ FD NKF
Sbjct  3     QWEDRFQRGLFRYDVTACETKVIPGKYGFVAQLNEGRHLKKRPTEFRVDKVLQSFDGNKF  62

Query  1624  NFTKIGQEEVLFRFEPSNDCKSHYLPSGLVDARSGSPTVLAINVSPIEYGHVLLIPRVLD  1445
             NFTK+GQEE+LF+FE   D +  + P   +DA + SP+V+AINVSPIEYGHVLLIPRVLD
Sbjct  63    NFTKVGQEELLFQFEAGEDGEVQFFPCMPLDAEN-SPSVVAINVSPIEYGHVLLIPRVLD  121

Query  1444  CLPQRIDHDSFFVAMHLAKEAADPFFRVGYNSLGAFATINHLHFQAYYLQVPFPVEKTPT  1265
             CLPQRIDH S  +A+H+A EAA+P+FR+GYNSLGAFATINHLHFQAYYL +PFP+EK  +
Sbjct  122   CLPQRIDHKSLLLAVHMAAEAANPYFRLGYNSLGAFATINHLHFQAYYLAMPFPLEKALS  181

Query  1264  REIMRGREQGDGGIVVSQLLNYPARALLFEGGSTVRDLSDAVANSCISLQNNNIPFNLLI  1085
             ++++        G+ +S+LLNYP R+LLFEGG++++DLSD V+++C+ LQNNNIPFN+LI
Sbjct  182   KKMITTV----SGVKISELLNYPVRSLLFEGGNSMQDLSDTVSDACVCLQNNNIPFNILI  237

Query  1084  SERGNKVFLFPQVHS  1040
             S+ G ++FL PQ ++
Sbjct  238   SDCGRQIFLMPQCYA  252


 Score =   107 bits (266),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 59/127 (46%), Positives = 80/127 (63%), Gaps = 13/127 (10%)
 Frame = -2

Query  753  KCYAEKQACGKIDQEILDTWVNPAVWEISGHMVLKRREDYDDASEDYAWRLLSEVSLSEE  574
            +CYAEKQA G++  E+L+T VNPAVWEISGHMVLKR+EDY+ ASE+ AWRLL+E SLSEE
Sbjct  249  QCYAEKQALGEVSPEVLETQVNPAVWEISGHMVLKRKEDYEGASEENAWRLLAEASLSEE  308

Query  573  RFEEVKAYVSRAADLLLDS-ECSNG-----GSQPWETYPEASWTATNELSFTSRLSGATL  412
            RF+EV        DL+ ++  CSN      G+   +  P  S    +  +    ++  T 
Sbjct  309  RFKEVN-------DLIFEAIGCSNQEEELEGTIVHQQSPSGSVNQKSNRTHGGPITNGTA  361

Query  411  KFC*ILK  391
              C +L+
Sbjct  362  SECLVLQ  368



>gb|KCW52131.1| hypothetical protein EUGRSUZ_J01570 [Eucalyptus grandis]
Length=313

 Score =   363 bits (932),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 173/250 (69%), Positives = 199/250 (80%), Gaps = 0/250 (0%)
 Frame = -1

Query  1789  MSRGLFRYDVTSCETKIIPGTFGFIAQLNEGRHLKKRPTEFRVDQVLQPFDENKFNFTKI  1610
             M+RGLFRY++T+C+TK+IP  +GFI QLNEGRHLKKRPTEFRVDQVLQ FDE KFNFTK+
Sbjct  1     MNRGLFRYNLTTCKTKVIPSDYGFIVQLNEGRHLKKRPTEFRVDQVLQDFDEKKFNFTKV  60

Query  1609  GQEEVLFRFEPSNDCKSHYLPSGLVDARSGSPTVLAINVSPIEYGHVLLIPRVLDCLPQR  1430
             G EEVLF FE  +DC SH+ PS     +  SP V+A N SPIEYGH+LLIPRVLDCLPQR
Sbjct  61    GHEEVLFMFEQRDDCYSHFFPSAPAIFKPTSPNVVATNFSPIEYGHILLIPRVLDCLPQR  120

Query  1429  IDHDSFFVAMHLAKEAADPFFRVGYNSLGAFATINHLHFQAYYLQVPFPVEKTPTREIMR  1250
             IDH SFF+A+ LAKEAAD FFRVGYNSLG FATINHLHFQ YYL  PFPVEK PT  +M 
Sbjct  121   IDHMSFFLALSLAKEAADLFFRVGYNSLGTFATINHLHFQLYYLASPFPVEKVPTLRVMT  180

Query  1249  GREQGDGGIVVSQLLNYPARALLFEGGSTVRDLSDAVANSCISLQNNNIPFNLLISERGN  1070
                    G+VVSQLL +P R+L+FEG  T+ DLS AVANSCI LQ+NNIPFN+LI+  G 
Sbjct  181   STSMQRNGVVVSQLLKFPVRSLVFEGRDTLWDLSSAVANSCIRLQHNNIPFNVLIANCGK  240

Query  1069  KVFLFPQVHS  1040
              VFLFPQ ++
Sbjct  241   SVFLFPQCYA  250


 Score =   111 bits (277),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 51/69 (74%), Positives = 60/69 (87%), Gaps = 0/69 (0%)
 Frame = -2

Query  759  FSKCYAEKQACGKIDQEILDTWVNPAVWEISGHMVLKRREDYDDASEDYAWRLLSEVSLS  580
            F +CYAEKQA G++ QE+L+T VNP VWEI GH VLKRRED+++ASEDYAWRLL+EVSLS
Sbjct  245  FPQCYAEKQARGEVSQELLETQVNPVVWEIGGHKVLKRREDFENASEDYAWRLLAEVSLS  304

Query  579  EERFEEVKA  553
            EE F EVKA
Sbjct  305  EESFREVKA  313



>gb|KCW70217.1| hypothetical protein EUGRSUZ_F03491 [Eucalyptus grandis]
 gb|KCW70218.1| hypothetical protein EUGRSUZ_F03491 [Eucalyptus grandis]
Length=357

 Score =   358 bits (919),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 166/250 (66%), Positives = 210/250 (84%), Gaps = 5/250 (2%)
 Frame = -1

Query  1789  MSRGLFRYDVTSCETKIIPGTFGFIAQLNEGRHLKKRPTEFRVDQVLQPFDENKFNFTKI  1610
             M RGLFRYDVT+CETKIIPG +GFIAQLNEGRHLKKRPTEFRVD+VLQPFD +KFNFTK+
Sbjct  1     MQRGLFRYDVTACETKIIPGGYGFIAQLNEGRHLKKRPTEFRVDKVLQPFDGSKFNFTKV  60

Query  1609  GQEEVLFRFEPSNDCKSHYLPSGLVDARSGSPTVLAINVSPIEYGHVLLIPRVLDCLPQR  1430
             GQEE+LF+FE S D +  +     +DA   SP+V+AINVSPIEYGHVLLIPRVL+C+PQR
Sbjct  61    GQEEILFQFEASEDGEVQFFAKAPIDA-DNSPSVVAINVSPIEYGHVLLIPRVLECMPQR  119

Query  1429  IDHDSFFVAMHLAKEAADPFFRVGYNSLGAFATINHLHFQAYYLQVPFPVEKTPTREIMR  1250
             ID +SF +A+++A EA +P+FR+GYNSLGAFATINHLHFQAYYL VPFP+EK PT+++  
Sbjct  120   IDRESFSLALYMAAEARNPYFRLGYNSLGAFATINHLHFQAYYLAVPFPIEKAPTQKLT-  178

Query  1249  GREQGDGGIVVSQLLNYPARALLFEGGSTVRDLSDAVANSCISLQNNNIPFNLLISERGN  1070
                  + G+ + +L+NYP R L+FEGG TV+DLS+AV++SCI LQ+NNIP+N+LIS+ G 
Sbjct  179   ---ALESGVTIFELVNYPVRGLVFEGGDTVQDLSNAVSDSCICLQDNNIPYNVLISDCGK  235

Query  1069  KVFLFPQVHS  1040
             ++FL PQ ++
Sbjct  236   RIFLLPQCYA  245


 Score =   112 bits (281),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 54/97 (56%), Positives = 72/97 (74%), Gaps = 5/97 (5%)
 Frame = -2

Query  759  FSKCYAEKQACGKIDQEILDTWVNPAVWEISGHMVLKRREDYDDASEDYAWRLLSEVSLS  580
              +CYAEKQA G+++ E+LDT VNPAVWEISGH+VLKR++D+++ASE+ AWRLL+EVSLS
Sbjct  240  LPQCYAEKQALGEVNSELLDTQVNPAVWEISGHIVLKRKKDFEEASEENAWRLLAEVSLS  299

Query  579  EERFEEVKAYVSRAADLLLDSECSNGGSQPWETYPEA  469
            EERF+EV A +  A      +   NGG    +  P+A
Sbjct  300  EERFQEVNALIFEAI-----ASVENGGQDNPDVEPQA  331



>gb|KHM99535.1| GDP-L-galactose phosphorylase 1 [Glycine soja]
Length=317

 Score =   355 bits (910),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 163/250 (65%), Positives = 208/250 (83%), Gaps = 5/250 (2%)
 Frame = -1

Query  1789  MSRGLFRYDVTSCETKIIPGTFGFIAQLNEGRHLKKRPTEFRVDQVLQPFDENKFNFTKI  1610
             M RGLFRYDVT+CETK+IPG +GFIAQLNEGRHLKKRPTEFRVD+VLQPFDENKFNFTK+
Sbjct  1     MQRGLFRYDVTTCETKVIPGKYGFIAQLNEGRHLKKRPTEFRVDKVLQPFDENKFNFTKV  60

Query  1609  GQEEVLFRFEPSNDCKSHYLPSGLVDARSGSPTVLAINVSPIEYGHVLLIPRVLDCLPQR  1430
             GQEEVLF+ E SND ++ + P+  +D  + SP+ +AINVSPIEYGHVLLIP++ +CLPQR
Sbjct  61    GQEEVLFQLEASNDGEAQFFPNVPIDVEN-SPSFVAINVSPIEYGHVLLIPQIFECLPQR  119

Query  1429  IDHDSFFVAMHLAKEAADPFFRVGYNSLGAFATINHLHFQAYYLQVPFPVEKTPTREIMR  1250
             IDH SF +A+ +A EA +P+FR+GYNSLGAFATINHLHFQAYYL +PFP+EK PT++I +
Sbjct  120   IDHASFLLALQMAAEARNPYFRLGYNSLGAFATINHLHFQAYYLALPFPIEKAPTKKIAK  179

Query  1249  GREQGDGGIVVSQLLNYPARALLFEGGSTVRDLSDAVANSCISLQNNNIPFNLLISERGN  1070
                   GG+ +S+LLNYP R L+FEGG ++  L++ V+ +CI LQ NNIP+N+LIS+ G 
Sbjct  180   ----LSGGVKISKLLNYPVRGLVFEGGHSLEGLANVVSEACICLQLNNIPYNILISDCGR  235

Query  1069  KVFLFPQVHS  1040
             ++FL PQ ++
Sbjct  236   QIFLLPQCYA  245


 Score = 97.8 bits (242),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 45/66 (68%), Positives = 56/66 (85%), Gaps = 0/66 (0%)
 Frame = -2

Query  759  FSKCYAEKQACGKIDQEILDTWVNPAVWEISGHMVLKRREDYDDASEDYAWRLLSEVSLS  580
              +CYAEKQA G++  E+L+T VNPAVWEISGH+VLKR +DY++ASE  A RLL+EVSLS
Sbjct  240  LPQCYAEKQALGEVSAELLETQVNPAVWEISGHLVLKREKDYEEASEANACRLLAEVSLS  299

Query  579  EERFEE  562
            EERF+E
Sbjct  300  EERFQE  305



>ref|XP_010926167.1| PREDICTED: GDP-L-galactose phosphorylase 2-like isoform X1 [Elaeis 
guineensis]
Length=466

 Score =   357 bits (916),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 185/333 (56%), Positives = 231/333 (69%), Gaps = 12/333 (4%)
 Frame = -1

Query  2029  KRVPTVV-SNYQDDAPEDSKPESLGCGRNCLGQCCL--PVSCLPLFAFKNDEHKCDGDWN  1859
             +  PT++  N +     + +    GCGRNCL +CCL    + LPL++F     K   D  
Sbjct  47    QEFPTMMCGNQEGQVGNNDESGGGGCGRNCLSKCCLLQGGAKLPLYSFS----KSAKDSG  102

Query  1858  YLSYGECPISFLSDLLLGQWEERMSRGLFRYDVTSCETKIIPGTFGFIAQLNEGRHLKKR  1679
               S    P S   D LL  WEE    GLF +D+T+CETKI+PG  GFI  L EGR LKKR
Sbjct  103   RSSEERVPHSLFLDRLLKVWEECRLIGLFHHDITACETKILPGEHGFIVVLVEGRDLKKR  162

Query  1678  PTEFRVDQVLQPFDENKFNFTKIGQEEVLFRFEPSNDCKSHYLPSGLVDARSGSPTVLAI  1499
             PTEF +D+VLQ FD  KFNFTKIGQEEV+FRFE S   ++ YL    V A S  P V+AI
Sbjct  163   PTEFGLDKVLQHFDGRKFNFTKIGQEEVVFRFEESETNEAQYLEHAPVMA-SACPNVIAI  221

Query  1498  NVSPIEYGHVLLIPRVLDCLPQRIDHDSFFVAMHLAKEAADPFFRVGYNSLGAFATINHL  1319
             NVSPI YGHVLLIPR+LDC+PQRID +SF +AMH+A+EA +P+FRVGYNSLGAFATINHL
Sbjct  222   NVSPIAYGHVLLIPRMLDCMPQRIDRESFLLAMHMAREAQNPYFRVGYNSLGAFATINHL  281

Query  1318  HFQAYYLQVPFPVEKTPTREIMRGREQGDGGIVVSQLLNYPARALLFEGGSTVRDLSDAV  1139
             HFQAYYL  PFPVEK PT+ I         G+ +SQLL+YP R L+FEGGS++ DLSD +
Sbjct  282   HFQAYYLTEPFPVEKAPTQRIA----TLGSGVKISQLLHYPVRGLVFEGGSSLEDLSDVI  337

Query  1138  ANSCISLQNNNIPFNLLISERGNKVFLFPQVHS  1040
             +++CI LQ+NN P+N LIS+ G ++FL PQ ++
Sbjct  338   SSACIFLQDNNFPYNALISDSGKQIFLLPQWYA  370


 Score = 85.5 bits (210),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 45/88 (51%), Positives = 56/88 (64%), Gaps = 1/88 (1%)
 Frame = -2

Query  810  FELNSLRIKEGTHSFGEFSKCYAEKQACGKIDQEILDTWVNPAVWEISGHMVLKRREDYD  631
            F  N+L    G   F    + YAEK+A GK+ QEIL+  VNPAVWE+ GH  LKRR+DY+
Sbjct  349  FPYNALISDSGKQIF-LLPQWYAEKRAQGKVSQEILEKQVNPAVWELGGHFALKRRQDYE  407

Query  630  DASEDYAWRLLSEVSLSEERFEEVKAYV  547
            +ASE      L  VSLSEERF  +K Y+
Sbjct  408  EASEGSICSFLEMVSLSEERFAAMKGYI  435



>gb|AGO64470.1| GDP-L-galactose phosphorylase, partial [Rosa roxburghii]
Length=260

 Score =   346 bits (888),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 162/244 (66%), Positives = 205/244 (84%), Gaps = 5/244 (2%)
 Frame = -1

Query  1771  RYDVTSCETKIIPGTFGFIAQLNEGRHLKKRPTEFRVDQVLQPFDENKFNFTKIGQEEVL  1592
             RYDVT+CETK+IPG FGFIAQLNEGRHLKKRPTEFRVD+VLQPFD +KFNFTK+GQEEVL
Sbjct  1     RYDVTACETKVIPGQFGFIAQLNEGRHLKKRPTEFRVDKVLQPFDGSKFNFTKVGQEEVL  60

Query  1591  FRFEPSNDCKSHYLPSGLVDARSGSPTVLAINVSPIEYGHVLLIPRVLDCLPQRIDHDSF  1412
             F+FE S D +  + P+  +D  + SP+V+AINVSPIEYGHVLLIPR+L+ LPQRID +SF
Sbjct  61    FQFEASEDGEVQFHPNAPIDVEN-SPSVVAINVSPIEYGHVLLIPRILESLPQRIDRESF  119

Query  1411  FVAMHLAKEAADPFFRVGYNSLGAFATINHLHFQAYYLQVPFPVEKTPTREIMRGREQGD  1232
              +A+H+A EA +P+FR+GYNSLGAFATINHLHFQAYYL V FP+EK PT++I       D
Sbjct  120   LLALHMAAEAGNPYFRLGYNSLGAFATINHLHFQAYYLAVTFPIEKAPTKKIT----SLD  175

Query  1231  GGIVVSQLLNYPARALLFEGGSTVRDLSDAVANSCISLQNNNIPFNLLISERGNKVFLFP  1052
              G+ +S+LLNYP R L+FEGG+T+ DLS++V+++CI LQ NNIP+N+LIS+ G ++FL P
Sbjct  176   VGVKISELLNYPVRGLVFEGGNTLEDLSNSVSDACICLQENNIPYNVLISDCGKRIFLLP  235

Query  1051  QVHS  1040
             Q ++
Sbjct  236   QCYA  239



>emb|CAN80482.1| hypothetical protein VITISV_017519 [Vitis vinifera]
Length=409

 Score =   346 bits (887),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 170/242 (70%), Positives = 191/242 (79%), Gaps = 1/242 (0%)
 Frame = -1

Query  1903  FAFKNDEHKCDGDWNYLSYGECPISFLSDLLLGQWEERMSRGLFRYDVTSCETKIIPGTF  1724
              A KN +   +      S G+ P +FL +LLLGQWE+RMS+GLFRYDVT CET+IIPG +
Sbjct  78    IARKNVKDSSEARVEVSSEGQPPAAFLDNLLLGQWEDRMSQGLFRYDVTLCETRIIPGNY  137

Query  1723  GFIAQLNEGRHLKKRPTEFRVDQVLQPFDENKFNFTKIGQEEVLFRFEPSNDCKSHYLPS  1544
             GFIAQLNEGRH+KKRPTEFRVDQVLQPFD+NKFNFTKIGQEEVLFRFE SND  +HY P 
Sbjct  138   GFIAQLNEGRHMKKRPTEFRVDQVLQPFDDNKFNFTKIGQEEVLFRFEQSNDNNAHYFPV  197

Query  1543  GLVDARSGSPTVLAINVSPIEYGHVLLIPRVLDCLPQRIDHDSFFVAMHLAKEAADPFFR  1364
               V A S S +V+AINVSPIEYGHVLLIP VLDCLPQRIDHDSF +A+H+AKEAADPFFR
Sbjct  198   SPVTADSNSSSVVAINVSPIEYGHVLLIPHVLDCLPQRIDHDSFLLALHMAKEAADPFFR  257

Query  1363  VGYNSLGAFATINHLHFQAYYLQVPFPVEKTPT-REIMRGREQGDGGIVVSQLLNYPARA  1187
             +GYNSLGAFATINHLHFQAYYL  PFPVEK PT R I RG+    G     Q L   ++ 
Sbjct  258   LGYNSLGAFATINHLHFQAYYLMAPFPVEKAPTERIIRRGKLPNSGCFAEKQALGEVSQE  317

Query  1186  LL  1181
             LL
Sbjct  318   LL  319


 Score =   124 bits (312),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 59/76 (78%), Positives = 68/76 (89%), Gaps = 0/76 (0%)
 Frame = -2

Query  756  SKCYAEKQACGKIDQEILDTWVNPAVWEISGHMVLKRREDYDDASEDYAWRLLSEVSLSE  577
            S C+AEKQA G++ QE+LDT VNPAVWEISGHMVLKRREDY++ASE+YAWRLL+EVSLSE
Sbjct  302  SGCFAEKQALGEVSQELLDTLVNPAVWEISGHMVLKRREDYENASEEYAWRLLAEVSLSE  361

Query  576  ERFEEVKAYVSRAADL  529
            ERF+EVK YV  AA L
Sbjct  362  ERFQEVKRYVLEAAGL  377



>ref|XP_008780932.1| PREDICTED: GDP-L-galactose phosphorylase 1-like [Phoenix dactylifera]
Length=403

 Score =   345 bits (886),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 177/307 (58%), Positives = 220/307 (72%), Gaps = 11/307 (4%)
 Frame = -1

Query  1951  RNCLGQCCL--PVSCLPLFAFKNDEHKCDGDWNYLSYGECPISFLSDLLLGQWEERMSRG  1778
             RNCL +CCL    + LPL++F     K        S  + P S   D LL  WE+R  RG
Sbjct  23    RNCLSKCCLLHGGAKLPLYSFS----KSAKGSGLSSERKKPHSLFLDRLLKVWEDRRLRG  78

Query  1777  LFRYDVTSCETKIIPGTFGFIAQLNEGRHLKKRPTEFRVDQVLQPFDENKFNFTKIGQEE  1598
             LF +D+T+CETKI+PG  GFI  L EGR LKKRPTEF +D+VLQ FD  KFNFTKIGQEE
Sbjct  79    LFHHDITACETKILPGEHGFIVVLVEGRDLKKRPTEFGLDEVLQHFDGRKFNFTKIGQEE  138

Query  1597  VLFRFEPSNDCKSHYLPSGLVDARSGSPTVLAINVSPIEYGHVLLIPRVLDCLPQRIDHD  1418
             VLFRFE S + ++ YL    V A S  P V+AINVSPI YGHVLLIPR+LDC+PQRID +
Sbjct  139   VLFRFEESGNDEAQYLEHAPVMA-SACPNVIAINVSPIAYGHVLLIPRILDCMPQRIDRE  197

Query  1417  SFFVAMHLAKEAADPFFRVGYNSLGAFATINHLHFQAYYLQVPFPVEKTPTREIMRGREQ  1238
             SF +AM +A+EA +P+FRVGYNSLGAFATINHLHFQAY L   FPVEK PT+ I      
Sbjct  198   SFLLAMRMAREAHNPYFRVGYNSLGAFATINHLHFQAYCLTESFPVEKAPTQMIT----T  253

Query  1237  GDGGIVVSQLLNYPARALLFEGGSTVRDLSDAVANSCISLQNNNIPFNLLISERGNKVFL  1058
                G+ +SQLL+YP R L+FEGGS++ DLSD ++++CI LQ+ N P+N+LIS+ G ++FL
Sbjct  254   LGSGVKISQLLHYPVRGLVFEGGSSLEDLSDVISSACIFLQDTNCPYNVLISDSGKQIFL  313

Query  1057  FPQVHSN  1037
             FPQ ++ 
Sbjct  314   FPQCYAE  320


 Score = 92.4 bits (228),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 43/74 (58%), Positives = 53/74 (72%), Gaps = 0/74 (0%)
 Frame = -2

Query  759  FSKCYAEKQACGKIDQEILDTWVNPAVWEISGHMVLKRREDYDDASEDYAWRLLSEVSLS  580
            F +CYAEK+A GK+ QEIL+  VNPA+WE+ GH  LKRR+DY +ASE      L  VSLS
Sbjct  314  FPQCYAEKRAQGKVSQEILEKQVNPAIWELGGHFALKRRQDYVEASEGSLCSFLEMVSLS  373

Query  579  EERFEEVKAYVSRA  538
            EERF E+K Y+  A
Sbjct  374  EERFTEMKGYILEA  387



>ref|XP_003617600.1| hypothetical protein MTR_5g093390 [Medicago truncatula]
Length=282

 Score =   341 bits (874),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 163/251 (65%), Positives = 200/251 (80%), Gaps = 9/251 (4%)
 Frame = -1

Query  2044  LMLTIKRVPTVVSNYQDDAPEDSKPESLG-CGRNCLGQCCLPVSCLPLFAFKNDEHKCDG  1868
             +ML IKRVPTVVSNYQ +   ++ P ++G CGRNCL  CC+  + LPL+AFK  +   + 
Sbjct  1     MMLKIKRVPTVVSNYQKEEVGEAAPRTVGGCGRNCLKSCCIQDAKLPLYAFKKIDKVTEK  60

Query  1867  DWNYLSYGEC----PISFLSDLLLGQWEERMSRGLFRYDVTSCETKIIPGTFGFIAQLNE  1700
             D   L+  EC    P++FL  L+LG+WE+RM RGLFRYDVT+CETK+IPG  GFIAQLNE
Sbjct  61    D---LAIHECQEELPMAFLDSLVLGEWEDRMQRGLFRYDVTACETKVIPGECGFIAQLNE  117

Query  1699  GRHLKKRPTEFRVDQVLQPFDENKFNFTKIGQEEVLFRFEPSNDCKSHYLPSGLVDARSG  1520
             GRHLKKRPTEFRVD+VLQPFDENKFNFTK+GQEEVLF+FE S D +  + P+  +D    
Sbjct  118   GRHLKKRPTEFRVDKVLQPFDENKFNFTKVGQEEVLFQFEASEDGEVQFYPNAPIDV-DN  176

Query  1519  SPTVLAINVSPIEYGHVLLIPRVLDCLPQRIDHDSFFVAMHLAKEAADPFFRVGYNSLGA  1340
              P+ +AINVSPIEYGHVLLIPR+ +CLPQRIDH+SF +A+H+A EAA+P+FR+GYNSLGA
Sbjct  177   YPSFVAINVSPIEYGHVLLIPRIFECLPQRIDHESFLLALHMAAEAANPYFRLGYNSLGA  236

Query  1339  FATINHLHFQA  1307
             FATINHLHFQ 
Sbjct  237   FATINHLHFQV  247



>ref|XP_010916132.1| PREDICTED: GDP-L-galactose phosphorylase 2-like [Elaeis guineensis]
Length=441

 Score =   342 bits (877),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 182/331 (55%), Positives = 228/331 (69%), Gaps = 15/331 (5%)
 Frame = -1

Query  2020  PTVVSNYQDDAPEDSKPESLGCG---RNCLGQC-CLPVSCLPLFAFKNDEHKCDGDWNYL  1853
             PTV+S  Q+   +D      G     R+CL +C  L    LPL+ F     K   ++   
Sbjct  48    PTVMSGNQEG--QDGNNGERGGEEFVRDCLSKCRLLRGGELPLYCFS----KAAQEYTSP  101

Query  1852  SYGECPISFLSDLLLGQWEERMSRGLFRYDVTSCETKIIPGTFGFIAQLNEGRHLKKRPT  1673
             S  + P S   D LL +WE+R  RGLF +D+T+CETKI+PG +GF+  L EGR LKKRPT
Sbjct  102   SDKKEPQSLFLDRLLKEWEDRRLRGLFHHDITACETKILPGEYGFMVVLVEGRDLKKRPT  161

Query  1672  EFRVDQVLQPFDENKFNFTKIGQEEVLFRFEPSNDCKSHYLPSGLVDARSGSPTVLAINV  1493
             EF +D+VLQPFD  KFNFTKIGQEEVLFRFE S +    Y+    V   S SP V+AINV
Sbjct  162   EFGLDKVLQPFDGRKFNFTKIGQEEVLFRFEESENDVVQYVQHAPV-MPSASPNVIAINV  220

Query  1492  SPIEYGHVLLIPRVLDCLPQRIDHDSFFVAMHLAKEAADPFFRVGYNSLGAFATINHLHF  1313
             SPI YGHVLLIP VLDC+PQRID +SF +AMH+A+EA + +FRVGYNSLGAFATINHLHF
Sbjct  221   SPIAYGHVLLIPHVLDCMPQRIDRESFLLAMHMAREAKNSYFRVGYNSLGAFATINHLHF  280

Query  1312  QAYYLQVPFPVEKTPTREIMRGREQGDGGIVVSQLLNYPARALLFEGGSTVRDLSDAVAN  1133
             QAYYL  PFPVEK P + I         G+ +SQLL+YP R L+ EGGS+++DLS  V++
Sbjct  281   QAYYLTEPFPVEKAPFQRIA----TLGSGVKISQLLHYPVRGLVLEGGSSLQDLSTVVSS  336

Query  1132  SCISLQNNNIPFNLLISERGNKVFLFPQVHS  1040
             +CI LQ+NN P+N LIS+ G K+FL PQ ++
Sbjct  337   ACIFLQDNNCPYNALISDSGKKIFLLPQWYA  367


 Score = 86.7 bits (213),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 40/65 (62%), Positives = 51/65 (78%), Gaps = 0/65 (0%)
 Frame = -2

Query  747  YAEKQACGKIDQEILDTWVNPAVWEISGHMVLKRREDYDDASEDYAWRLLSEVSLSEERF  568
            YAEK+A G++ QEIL+  VNPA+WE+SGH  LKRR+DY++ASE   +  L  VSLSEERF
Sbjct  366  YAEKKAKGEVSQEILEKQVNPAIWELSGHFALKRRQDYEEASEGNLYSFLEMVSLSEERF  425

Query  567  EEVKA  553
            EE+K 
Sbjct  426  EEMKG  430



>ref|XP_010926168.1| PREDICTED: GDP-L-galactose phosphorylase 1-like isoform X2 [Elaeis 
guineensis]
Length=424

 Score =   340 bits (871),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 172/292 (59%), Positives = 210/292 (72%), Gaps = 9/292 (3%)
 Frame = -1

Query  1912  LPLFAFKNDEHKCDGDWNYLSYGECPISFLSDLLLGQWEERMSRGLFRYDVTSCETKIIP  1733
             LPL++F     K   D    S    P S   D LL  WEE    GLF +D+T+CETKI+P
Sbjct  47    LPLYSFS----KSAKDSGRSSEERVPHSLFLDRLLKVWEECRLIGLFHHDITACETKILP  102

Query  1732  GTFGFIAQLNEGRHLKKRPTEFRVDQVLQPFDENKFNFTKIGQEEVLFRFEPSNDCKSHY  1553
             G  GFI  L EGR LKKRPTEF +D+VLQ FD  KFNFTKIGQEEV+FRFE S   ++ Y
Sbjct  103   GEHGFIVVLVEGRDLKKRPTEFGLDKVLQHFDGRKFNFTKIGQEEVVFRFEESETNEAQY  162

Query  1552  LPSGLVDARSGSPTVLAINVSPIEYGHVLLIPRVLDCLPQRIDHDSFFVAMHLAKEAADP  1373
             L    V A S  P V+AINVSPI YGHVLLIPR+LDC+PQRID +SF +AMH+A+EA +P
Sbjct  163   LEHAPVMA-SACPNVIAINVSPIAYGHVLLIPRMLDCMPQRIDRESFLLAMHMAREAQNP  221

Query  1372  FFRVGYNSLGAFATINHLHFQAYYLQVPFPVEKTPTREIMRGREQGDGGIVVSQLLNYPA  1193
             +FRVGYNSLGAFATINHLHFQAYYL  PFPVEK PT+ I         G+ +SQLL+YP 
Sbjct  222   YFRVGYNSLGAFATINHLHFQAYYLTEPFPVEKAPTQRIA----TLGSGVKISQLLHYPV  277

Query  1192  RALLFEGGSTVRDLSDAVANSCISLQNNNIPFNLLISERGNKVFLFPQVHSN  1037
             R L+FEGGS++ DLSD ++++CI LQ+NN P+N LIS+ G ++FL PQ ++ 
Sbjct  278   RGLVFEGGSSLEDLSDVISSACIFLQDNNFPYNALISDSGKQIFLLPQWYAE  329


 Score = 85.5 bits (210),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 45/88 (51%), Positives = 56/88 (64%), Gaps = 1/88 (1%)
 Frame = -2

Query  810  FELNSLRIKEGTHSFGEFSKCYAEKQACGKIDQEILDTWVNPAVWEISGHMVLKRREDYD  631
            F  N+L    G   F    + YAEK+A GK+ QEIL+  VNPAVWE+ GH  LKRR+DY+
Sbjct  307  FPYNALISDSGKQIF-LLPQWYAEKRAQGKVSQEILEKQVNPAVWELGGHFALKRRQDYE  365

Query  630  DASEDYAWRLLSEVSLSEERFEEVKAYV  547
            +ASE      L  VSLSEERF  +K Y+
Sbjct  366  EASEGSICSFLEMVSLSEERFAAMKGYI  393



>dbj|BAH03300.1| GDP-L-galactose:hexose-1-phosphate guanylyltransferase [Prunus 
persica]
Length=260

 Score =   330 bits (845),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 168/255 (66%), Positives = 202/255 (79%), Gaps = 8/255 (3%)
 Frame = -1

Query  1960  GCGRNCLGQCCLPVSCLPLFAFKNDEHKCDGDWNY--LSYGECPISFLSDLLLGQWEERM  1787
             GCGRNCL QCC+P + LPL+AFK   +K DGD         E P+ FL  LLLG+WE+RM
Sbjct  12    GCGRNCLNQCCIPGAKLPLYAFKK-LNKIDGDKELPGSEKREPPVDFLDSLLLGEWEDRM  70

Query  1786  SRGLFRYDVTSCETKIIPGTFGFIAQLNEGRHLKKRPTEFRVDQVLQPFDENKFNFTKIG  1607
              RGLFRYDVT+ ETK+IPG FGFIAQLNEGRHLKKRPTEFRVD+VLQPFD NKFNFTK+G
Sbjct  71    QRGLFRYDVTARETKVIPGQFGFIAQLNEGRHLKKRPTEFRVDKVLQPFDGNKFNFTKVG  130

Query  1606  QEEVLFRFEPSNDCKSHYLPSGLVDARSGSPTVLAINVSPIEYGHVLLIPRVLDCLPQRI  1427
             QEEVLF+FE S D +  ++PS  ++  + SP+V+AINVSPIEYGHVLLIPR+L+ LPQRI
Sbjct  131   QEEVLFQFEASEDGEVQFIPSAPIEPEN-SPSVVAINVSPIEYGHVLLIPRILEHLPQRI  189

Query  1426  DHDSFFVAMHLAKEAADPFFRVGYNSLGAFATINHLHFQAYYLQVPFPVEKTPTREIMRG  1247
             D +SF +A+H+A  A +P+FR+GYNSLGAFATINHLHFQAYYL V FP+EK PT++I   
Sbjct  190   DRESFLLALHMAAAAGNPYFRLGYNSLGAFATINHLHFQAYYLAVTFPIEKAPTKKIT--  247

Query  1246  REQGDGGIVVSQLLN  1202
                   G+ VS+LLN
Sbjct  248   --VSGAGVRVSELLN  260



>ref|XP_010034477.1| PREDICTED: GDP-L-galactose phosphorylase 1-like [Eucalyptus grandis]
Length=242

 Score =   325 bits (832),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 166/243 (68%), Positives = 188/243 (77%), Gaps = 10/243 (4%)
 Frame = -1

Query  2041  MLTIKRVPTVVSNYQ------DDAPEDSKPESLGCGRNCLGQCCLPVSCLPLFAFKNDEH  1880
             MLTIKR+ TVVSNYQ      D+A    + E+ GCGRNCLG+CCLP S LPL+ FK    
Sbjct  1     MLTIKRIATVVSNYQEERGEKDNAAVAVEGEAKGCGRNCLGKCCLPASDLPLYTFKVAGE  60

Query  1879  KCDGDWNYLSYGECP-ISFLSDLLLGQWEERMSRGLFRYDVTSCETKIIPGTFGFIAQLN  1703
              C  +  +  Y E P  SFL +LLLGQWE RM+RGLFRYDVT+C+TK+IP  +GFI QLN
Sbjct  61    DCTEESIF--YQEPPETSFLLNLLLGQWENRMNRGLFRYDVTTCKTKVIPSDYGFIVQLN  118

Query  1702  EGRHLKKRPTEFRVDQVLQPFDENKFNFTKIGQEEVLFRFEPSNDCKSHYLPSGLVDARS  1523
             EGRHLKKRPTEFRVDQVLQ FDE KFNFTK+G EEVLF FE S+DC SH+ PS     + 
Sbjct  119   EGRHLKKRPTEFRVDQVLQDFDEKKFNFTKVGHEEVLFMFEQSDDCYSHFFPSAPAIFKP  178

Query  1522  GSPTVLAINVS-PIEYGHVLLIPRVLDCLPQRIDHDSFFVAMHLAKEAADPFFRVGYNSL  1346
              SP V+AINVS PIEYGH+LLIPRVLDCLPQRIDH SFF+A+ LAKEAADPFFRVGYNSL
Sbjct  179   TSPNVVAINVSPPIEYGHILLIPRVLDCLPQRIDHMSFFLALSLAKEAADPFFRVGYNSL  238

Query  1345  GAF  1337
             G F
Sbjct  239   GTF  241



>gb|AFW74694.1| hypothetical protein ZEAMMB73_918708 [Zea mays]
Length=241

 Score =   323 bits (829),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 160/245 (65%), Positives = 188/245 (77%), Gaps = 10/245 (4%)
 Frame = -1

Query  2044  LMLTIKRVPTVVSNYQDDAPEDSKPESLGCGRNCLGQCCLPVSCLPLFAFKNDEHKCDGD  1865
             + LTI+RVPTVVSNYQ+DA    KP + GCGRNCLG CCLP S LPL+AFK    K   +
Sbjct  3     MKLTIRRVPTVVSNYQEDA---DKPRA-GCGRNCLGDCCLPASKLPLYAFKLTPAKGSQE  58

Query  1864  WNYLSYGECPISFLSDLLLGQWEERMSRGLFRYDVTSCETKIIPGTFGFIAQLNEGRHLK  1685
                          L D+LL +WE+RM+RGLFRYDVT+CETK+IPG  GF+AQLNEGRHLK
Sbjct  59    ------DAASTKLLVDILLSEWEDRMTRGLFRYDVTACETKVIPGNLGFVAQLNEGRHLK  112

Query  1684  KRPTEFRVDQVLQPFDENKFNFTKIGQEEVLFRFEPSNDCKSHYLPSGLVDARSGSPTVL  1505
             KRPTEFRVD+VLQPFD  KFNFTK+GQEEVLF+FE S    S++L +  + A   +P V+
Sbjct  113   KRPTEFRVDRVLQPFDPAKFNFTKVGQEEVLFQFENSGGDDSYFLNNAPIIAVDRAPNVI  172

Query  1504  AINVSPIEYGHVLLIPRVLDCLPQRIDHDSFFVAMHLAKEAADPFFRVGYNSLGAFATIN  1325
             AINVSPIEYGHVLLIPRVLD LPQRID +SF +A+ +A E   P+FR+GYNSLGAFATIN
Sbjct  173   AINVSPIEYGHVLLIPRVLDRLPQRIDPESFLLALQMAAEGGSPYFRLGYNSLGAFATIN  232

Query  1324  HLHFQ  1310
             HLHFQ
Sbjct  233   HLHFQ  237



>ref|XP_002988631.1| hypothetical protein SELMODRAFT_427287 [Selaginella moellendorffii]
 gb|EFJ10427.1| hypothetical protein SELMODRAFT_427287 [Selaginella moellendorffii]
Length=375

 Score =   315 bits (808),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 167/374 (45%), Positives = 238/374 (64%), Gaps = 29/374 (8%)
 Frame = -1

Query  1981  DSKPESLGCGRNCLGQCCLPVSCLPLFAFKNDEHKCDGDWNYLSYGECPISFLSDLLLGQ  1802
             D    + GCGRNCLG CC P + +PL+ +   E +C       + GE  I FL   +L  
Sbjct  11    DRSETNHGCGRNCLGPCCFPGARVPLYLY--GEAQCMD-----TKGET-IDFLHSFILAP  62

Query  1801  WEERMSRGLFRYDVTSCETKIIPGTFGFIAQLNEGRHLKKRPTEFRVDQVLQPFDENKFN  1622
             W E+   GLFRYDVTSCETKI+ G  GFIAQLNEGRH KKRPTEF++DQVLQ FD +KFN
Sbjct  63    WMEKQKLGLFRYDVTSCETKILSGDCGFIAQLNEGRHSKKRPTEFKMDQVLQDFDPSKFN  122

Query  1621  FTKIGQEEVLFRFEPSNDCKSHYLPSGLVDARSGSPTVLAINVSPIEYGHVLLIPRVLDC  1442
             FTK+GQEE+LF F+P N             + + S  ++ INVSPIE+GH+LLIPR+LDC
Sbjct  123   FTKVGQEEILFSFDPEN------------SSLATSSNMVIINVSPIEFGHILLIPRLLDC  170

Query  1441  LPQRIDHDSFFVAMHLAKEAADPFFRVGYNSLGAFATINHLHFQAYYLQVPFPVEKTPTR  1262
             LPQR++ ++F +A+ +AK+A + +FR+G+NSLGAFATINHLHFQAYYL+  FPVEK   +
Sbjct  171   LPQRLEVNTFIIALQMAKQANNIYFRLGFNSLGAFATINHLHFQAYYLEYIFPVEKASKK  230

Query  1261  EIMRGREQGDGGIVVSQLLNYPARALLFE-GGSTVRDLSDAVANSCISLQNNNIPFNLLI  1085
              ++   +    G  + +L NYP + +++E G S  ++LS  +   C +L+  NIP+N+LI
Sbjct  231   LLVNHVK----GFNIYKLENYPVKGIIYELGSSNFQELSYQIVTICNTLEEQNIPYNVLI  286

Query  1084  SERGNKVFLFPQVHSNSVFLSSREFSIYVSR*NVHFSSVKF*KYGNMVCLIACSFEVV*S  905
             +++G++++LFPQ  +        E  I  ++ N     +     G++V      FE V  
Sbjct  287   ADKGSQIYLFPQCFAERQVRGEVEAEILETQVNPAVWEIS----GHIVLKRKQDFENVTQ  342

Query  904   LHGFR*LSVAFIND  863
              + ++ L+   +ND
Sbjct  343   EYAWKLLAEVSLND  356


 Score = 93.6 bits (231),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 37/73 (51%), Positives = 61/73 (84%), Gaps = 0/73 (0%)
 Frame = -2

Query  759  FSKCYAEKQACGKIDQEILDTWVNPAVWEISGHMVLKRREDYDDASEDYAWRLLSEVSLS  580
            F +C+AE+Q  G+++ EIL+T VNPAVWEISGH+VLKR++D+++ +++YAW+LL+EVSL+
Sbjct  296  FPQCFAERQVRGEVEAEILETQVNPAVWEISGHIVLKRKQDFENVTQEYAWKLLAEVSLN  355

Query  579  EERFEEVKAYVSR  541
            ++ F ++   V+ 
Sbjct  356  DKAFNKIINLVTN  368



>ref|XP_009404393.1| PREDICTED: GDP-L-galactose phosphorylase 1-like [Musa acuminata 
subsp. malaccensis]
Length=395

 Score =   315 bits (806),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 169/308 (55%), Positives = 213/308 (69%), Gaps = 15/308 (5%)
 Frame = -1

Query  1954  GRNCLGQCCLPVSCLPLFAFKNDEHKCDGDWNYLSYGECPISFLSDLLLGQWEERMSRGL  1775
             GR+CL Q       LPL+ F   E         L   E   +FL D LL +WE+R  RGL
Sbjct  17    GRSCLLQGIR----LPLYYFSKAEKDSGCS---LEKIEAQSTFL-DRLLKEWEDRKVRGL  68

Query  1774  FRYDVTSCETKIIPGTFGFIAQLNEGRHLKKRPTEFRVDQVLQPFDENKFNFTKIGQEEV  1595
             F +DV + ETKI+ G +GFI QL EGR LKKRPTEFR+D+VLQPFD  KFNFTKI QEE+
Sbjct  69    FHHDVNAYETKILSGDYGFILQLIEGRDLKKRPTEFRIDRVLQPFDGKKFNFTKIAQEEM  128

Query  1594  LFRFEPS-NDCKSHYLPSGLVDARSGSPTVLAINVSPIEYGHVLLIPRVLDCLPQRIDHD  1418
             L RFE S ND +  +  + + D  S SP V+AINVSPI+YGHVLLIPR+LDCLPQR+D  
Sbjct  129   LIRFEESENDDRGFFENTPIAD--SESPNVVAINVSPIDYGHVLLIPRILDCLPQRLDEQ  186

Query  1417  SFFVAMHLAKEAADPFFRVGYNSLGAFATINHLHFQAYYLQVPFPVEKTPTREIMRGREQ  1238
             SF +A+++A+EA  P FRV YNSLGAFATINHLHFQA+YL   FPVEK PT+ IM     
Sbjct  187   SFSLAVYVAREAETPHFRVAYNSLGAFATINHLHFQAFYLVGAFPVEKAPTQRIM----T  242

Query  1237  GDGGIVVSQLLNYPARALLFEGGSTVRDLSDAVANSCISLQNNNIPFNLLISERGNKVFL  1058
                G+ + QL +YP R L+F GGS + DLS AV+ +CI LQ+N+IP+N++IS+ G ++FL
Sbjct  243   LASGVEIFQLSHYPVRGLVFGGGSNLEDLSIAVSIACIFLQDNDIPYNVIISDAGKRIFL  302

Query  1057  FPQVHSNS  1034
               Q ++  
Sbjct  303   LLQCYAEK  310


 Score = 81.6 bits (200),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 36/67 (54%), Positives = 52/67 (78%), Gaps = 1/67 (1%)
 Frame = -2

Query  753  KCYAEKQACGKIDQEILDTWVNPAVWEISGHMVLKRREDYDDASEDYAWRLLSEV-SLSE  577
            +CYAEK+  G+++QE L+  +NPA WE+ G+MV+KRR+DY + SED  WR L EV S+S 
Sbjct  305  QCYAEKRTRGEVNQEFLEMQINPAAWELGGYMVVKRRKDYQETSEDTLWRFLDEVASVSA  364

Query  576  ERFEEVK  556
            E+F+E+K
Sbjct  365  EQFKEIK  371



>gb|AAT45011.1| unknown, partial [Xerophyta humilis]
Length=343

 Score =   311 bits (796),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 153/239 (64%), Positives = 183/239 (77%), Gaps = 2/239 (1%)
 Frame = -1

Query  1750  ETKIIPGTFGFIAQLNEGRHLKKRPTEFRVDQVLQPFDENKFNFTKIGQEEVLFRFEPSN  1571
             ETK+IPG  GFIAQLNEGRHLKKRPTEFRVD+VLQPFD+ KFNFTK+GQEEVLFRFEPS 
Sbjct  1     ETKVIPGKHGFIAQLNEGRHLKKRPTEFRVDRVLQPFDQGKFNFTKVGQEEVLFRFEPSV  60

Query  1570  DCKSHYLPSGLVDARSGSPTVLAINVSPIEYGHVLLIPRVLDCLPQRIDHDSFFVAMHLA  1391
               KS++  S  +DA + +P V+AINVSPIEYGHVLLIPRV DC+PQRID  SF +A+ +A
Sbjct  61    HGKSNFSESASIDA-NDTPNVVAINVSPIEYGHVLLIPRVFDCIPQRIDRLSFELAVRMA  119

Query  1390  KEAADPFFRVGYNSLGAFATINHLHFQAYYLQVPFPVEKTPTREIMRGREQGDGGIV-VS  1214
              EA  P+FR+GYNSLGAFATINHLHFQAYYL V  PVEK  TR IM  R + +     VS
Sbjct  120   AEAGSPYFRLGYNSLGAFATINHLHFQAYYLSVALPVEKALTRRIMVARSRDENSWSGVS  179

Query  1213  QLLNYPARALLFEGGSTVRDLSDAVANSCISLQNNNIPFNLLISERGNKVFLFPQVHSN  1037
              +L+YP R L+FEG S  R L+D VA++C+ LQ N  P   L S+ G ++FLFPQ ++ 
Sbjct  180   GILDYPVRGLVFEGQSPSRGLADVVADACVYLQENTFPLMCLCSDLGRRIFLFPQCYAE  238


 Score =   127 bits (319),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 63/87 (72%), Positives = 72/87 (83%), Gaps = 3/87 (3%)
 Frame = -2

Query  759  FSKCYAEKQACGKIDQEILDTWVNPAVWEISGHMVLKRREDYDDASEDYAWRLLSEVSLS  580
            F +CYAEKQA G++ QE+LDT VNPAVWEISGHMVLKRR+DY DASE+YAWRLLSEVSLS
Sbjct  232  FPQCYAEKQALGQVSQELLDTQVNPAVWEISGHMVLKRRKDYKDASEEYAWRLLSEVSLS  291

Query  579  EERFEEVKAYVSRAADLLLDSECSNGG  499
            EERFEEVKA +  A  L   +E  +GG
Sbjct  292  EERFEEVKASMFEAVGL---TEYEDGG  315



>gb|KCW52136.1| hypothetical protein EUGRSUZ_J01577 [Eucalyptus grandis]
Length=332

 Score =   307 bits (787),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 158/244 (65%), Positives = 180/244 (74%), Gaps = 20/244 (8%)
 Frame = -1

Query  2041  MLTIKRVPTVVSNYQ------DDAPEDSKPESLGCGRNCLGQCCLPVSCLPLFAFKNDEH  1880
             MLTIKR+ TVVSNYQ      D+A    + E+ GCGRNCLG+CCLP S LPL+ FK    
Sbjct  1     MLTIKRIATVVSNYQEERGEKDNAAVAVEGEAKGCGRNCLGKCCLPASDLPLYTFKVAGE  60

Query  1879  KCDGDWNYLSYGECP-ISFLSDLLLGQWEERMSRGLFRYDVTSCETKIIPGTFGFIAQLN  1703
              C  +   + Y E P  SFL +LLLGQWE RM+RGLFRYDVT+C+TK+IP  +GFI QLN
Sbjct  61    DCTEE--SIFYQEPPETSFLLNLLLGQWENRMNRGLFRYDVTTCKTKVIPSDYGFIVQLN  118

Query  1702  EGRHLKKRPTEFRVDQVLQPFDENKFNFTKIGQEEVLFRFEPSNDCKSHYLPSGLVDARS  1523
             EGRHLKKRPTEFRVDQVLQ FDE KFNFTK+G EEVLF FE S+DC SH+ PS     + 
Sbjct  119   EGRHLKKRPTEFRVDQVLQDFDEKKFNFTKVGHEEVLFMFEQSDDCYSHFFPSAPAIFKP  178

Query  1522  GSPTVLAIN-----------VSPIEYGHVLLIPRVLDCLPQRIDHDSFFVAMHLAKEAAD  1376
              SP V+AIN           VSPIEYGH+LLIPRVLDCLPQRIDH SFF+A+ LAKEAAD
Sbjct  179   TSPNVVAINLLMNKVVKFLLVSPIEYGHILLIPRVLDCLPQRIDHMSFFLALSLAKEAAD  238

Query  1375  PFFR  1364
             PFFR
Sbjct  239   PFFR  242


 Score =   107 bits (268),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 49/67 (73%), Positives = 59/67 (88%), Gaps = 0/67 (0%)
 Frame = -2

Query  753  KCYAEKQACGKIDQEILDTWVNPAVWEISGHMVLKRREDYDDASEDYAWRLLSEVSLSEE  574
            +CYAEKQA G++ QE+L+T VNP VWEI GH+VLKRRED+++ SEDYAWRLL+EVSLSEE
Sbjct  266  QCYAEKQARGEVSQELLETQVNPVVWEIGGHVVLKRREDFENVSEDYAWRLLAEVSLSEE  325

Query  573  RFEEVKA  553
             F EVKA
Sbjct  326  SFREVKA  332



>ref|XP_002979321.1| hypothetical protein SELMODRAFT_110588 [Selaginella moellendorffii]
 gb|EFJ19729.1| hypothetical protein SELMODRAFT_110588 [Selaginella moellendorffii]
Length=371

 Score =   306 bits (783),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 157/313 (50%), Positives = 213/313 (68%), Gaps = 31/313 (10%)
 Frame = -1

Query  1981  DSKPESLGCGRNCLGQCCLPVSCLPLFAFKNDEHKCDGDWNYLSYGECPISFLSDLLLGQ  1802
             D    + GCGRNCLG CC P + +PL+ +   E +C       + GE  I FL   +L  
Sbjct  11    DRSETNHGCGRNCLGPCCFPGARVPLYLY--GEAQCMD-----TKGET-IDFLHSFILAP  62

Query  1801  WEERMSRGLFRYDVTSCETKIIPGTFGFIAQLNEGRHLKKRPTEFRVDQVLQPFDENKFN  1622
             W E+  +GLFRYDVTSCETKI+ G  GFIAQLNEGRH KKRPTEF++DQVLQ FD +KFN
Sbjct  63    WMEKQKQGLFRYDVTSCETKILSGDCGFIAQLNEGRHSKKRPTEFKMDQVLQDFDPSKFN  122

Query  1621  FTKIGQEEVLFRFEPSNDCKSHYLPSGLVDARSGSPTVLAIN-VSPIEYGHVLLIPRVLD  1445
             FTK+GQEEVLF F+P N                 SP   + N VSPIE+GH+LLIPR+L+
Sbjct  123   FTKVGQEEVLFCFDPEN-----------------SPFATSSNMVSPIEFGHILLIPRLLN  165

Query  1444  CLPQRIDHDSFFVAMHLAKEAADPFFRVGYNSLGAFATINHLHFQAYYLQVPFPVEKTPT  1265
             CLPQR++ ++F +A+ +AK+A + +FR+G+NSLGAFATINHLHFQAYYL+  FPVEK   
Sbjct  166   CLPQRLEVNTFIIALQMAKQANNIYFRLGFNSLGAFATINHLHFQAYYLEYIFPVEKASK  225

Query  1264  REIMRGREQGDGGIVVSQLLNYPARALLFE-GGSTVRDLSDAVANSCISLQNNNIPFNLL  1088
             + ++   +    G  + +L NYP R +++E G S  ++LS  +   C  L+  NIP+N+L
Sbjct  226   KLLVNNVK----GFNIYKLENYPVRGIIYELGSSNFQELSYQIVTVCNILEEQNIPYNIL  281

Query  1087  ISERGNKVFLFPQ  1049
             I+++G++++LFPQ
Sbjct  282   IADKGSQIYLFPQ  294


 Score = 95.1 bits (235),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 38/73 (52%), Positives = 62/73 (85%), Gaps = 0/73 (0%)
 Frame = -2

Query  759  FSKCYAEKQACGKIDQEILDTWVNPAVWEISGHMVLKRREDYDDASEDYAWRLLSEVSLS  580
            F +C+AE+Q  G+++ EIL+T VNPAVWEISGH+VLKR++D+++A+++YAW+LL+EVSL+
Sbjct  292  FPQCFAERQVRGEVEAEILETQVNPAVWEISGHIVLKRKQDFENATQEYAWKLLAEVSLN  351

Query  579  EERFEEVKAYVSR  541
            ++ F ++   V+ 
Sbjct  352  DKAFNKIINLVTN  364



>gb|EEC71974.1| hypothetical protein OsI_04811 [Oryza sativa Indica Group]
Length=357

 Score =   305 bits (780),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 150/270 (56%), Positives = 191/270 (71%), Gaps = 7/270 (3%)
 Frame = -1

Query  1813  LLGQWEERMSRGLFRYDVTSCETKIIPGTFGFIAQLNEGRHLKKRPTEFRVDQVLQPFDE  1634
             L  +W++R +RGLF +D++SCETK++PG   F+A L EGR  KKRPT+F ++QVLQPFD 
Sbjct  29    LFKEWDDRKARGLFHHDISSCETKVLPGEHNFVATLIEGRDQKKRPTQFGMNQVLQPFDS  88

Query  1633  NKFNFTKIGQEEVLFRFEPSNDCKSHYLPSGLVDARSGSPTVLAINVSPIEYGHVLLIPR  1454
              KFNFTKI  EEV+F F+ S +    Y    +  A + SPT + INVSPI Y HVLLIPR
Sbjct  89    VKFNFTKISPEEVIFTFKESQNDSVKYF-DNVPHAVAASPTAILINVSPIGYCHVLLIPR  147

Query  1453  VLDCLPQRIDHDSFFVAMHLAKEAADPFFRVGYNSLGAFATINHLHFQAYYLQVPFPVEK  1274
             + DCLPQR+D +SF +AM++A EA DPFFRVGYNSLG FATINHLHFQAYYL+V +PVEK
Sbjct  148   IQDCLPQRVDKESFLLAMYVASEAKDPFFRVGYNSLGGFATINHLHFQAYYLKVQYPVEK  207

Query  1273  TPTREIMRGREQGDGGIVVSQLLNYPARALLFEGGSTVRDLSDAVANSCISLQNNNIPFN  1094
              PT ++         G+ + QL+ YP    +FEGG+ + DLSD V+  CI LQ NN PFN
Sbjct  208   APTEKLT----TLGNGVSIIQLVQYPVSGFVFEGGACLEDLSDVVSKVCIFLQENNKPFN  263

Query  1093  LLISERGNKVFLFPQVHSNSVFL--SSREF  1010
              LISE G +VFL PQ ++    L  +S+EF
Sbjct  264   ALISESGKRVFLLPQCYAEKQALGRASQEF  293


 Score = 93.6 bits (231),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 49/94 (52%), Positives = 63/94 (67%), Gaps = 5/94 (5%)
 Frame = -2

Query  804  LNSLRIKEGTHSFGEFSKCYAEKQACGKIDQEILDTWVNPAVWEISGHMVLKRREDYDDA  625
             N+L  + G   F    +CYAEKQA G+  QE LD  +NPAVWE+SGH+VLKRR+DYD+A
Sbjct  262  FNALISESGKRVF-LLPQCYAEKQALGRASQEFLDMRINPAVWELSGHLVLKRRKDYDEA  320

Query  624  SEDYAWRLLSEVSLSEERFEEVKA----YVSRAA  535
            SE    R L E SLSE  F+E+K+    ++S AA
Sbjct  321  SEATICRFLVEASLSESEFQELKSCILEFLSSAA  354



>gb|EMS49953.1| hypothetical protein TRIUR3_21856 [Triticum urartu]
Length=371

 Score =   301 bits (771),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 144/257 (56%), Positives = 191/257 (74%), Gaps = 5/257 (2%)
 Frame = -1

Query  1810  LGQWEERMSRGLFRYDVTSCETKIIPGTFGFIAQLNEGRHLKKRPTEFRVDQVLQPFDEN  1631
             L QW++R +RGLF +++T+CETK++PG   F+A L EGR  KKRPTEF ++QVLQPF  +
Sbjct  44    LLQWDDRKARGLFHHNITTCETKVLPGEHNFVATLIEGRDQKKRPTEFGMNQVLQPFHSD  103

Query  1630  KFNFTKIGQEEVLFRFEPSNDCKSHYLPSGLVDARSGSPTVLAINVSPIEYGHVLLIPRV  1451
             KFNFTK+  EEV+FRF+ + +  + Y   G     S SP+ + INVSPI Y HVLLIPRV
Sbjct  104   KFNFTKVKPEEVIFRFQETENDSAQYF-DGAPPTVSASPSSILINVSPIGYCHVLLIPRV  162

Query  1450  LDCLPQRIDHDSFFVAMHLAKEAADPFFRVGYNSLGAFATINHLHFQAYYLQVPFPVEKT  1271
              +CLPQR+D +SF +AM++A+EA +PFFRVGYNSLGAFATINHLHFQAYYL+V +PVEK 
Sbjct  163   QECLPQRVDQESFLLAMYVAREAKNPFFRVGYNSLGAFATINHLHFQAYYLKVQYPVEKA  222

Query  1270  PTREIMRGREQGDGGIVVSQLLNYPARALLFEGGSTVRDLSDAVANSCISLQNNNIPFNL  1091
             PT ++         G+ +SQL+ YP    +FEGG+++ DLS  V+++CI LQ NN PFN+
Sbjct  223   PTEKLTV----VGNGVTISQLVWYPVSGFVFEGGASLEDLSQVVSDACIFLQENNRPFNV  278

Query  1090  LISERGNKVFLFPQVHS  1040
             LISE G +VFL  Q ++
Sbjct  279   LISESGKRVFLLLQCYA  295


 Score = 87.4 bits (215),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 42/69 (61%), Positives = 50/69 (72%), Gaps = 0/69 (0%)
 Frame = -2

Query  753  KCYAEKQACGKIDQEILDTWVNPAVWEISGHMVLKRREDYDDASEDYAWRLLSEVSLSEE  574
            +CYAEKQA GK  QE LD  +NPAVWE+SGH+VLKRR+DYD+AS       L E SLSE 
Sbjct  292  QCYAEKQASGKASQEFLDMRINPAVWELSGHLVLKRRKDYDEASAATLCGFLVEASLSEA  351

Query  573  RFEEVKAYV  547
             F+E+K  V
Sbjct  352  EFQELKKCV  360



>ref|XP_002967093.1| hypothetical protein SELMODRAFT_439945 [Selaginella moellendorffii]
 gb|EFJ31692.1| hypothetical protein SELMODRAFT_439945 [Selaginella moellendorffii]
Length=389

 Score =   302 bits (773),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 168/339 (50%), Positives = 218/339 (64%), Gaps = 28/339 (8%)
 Frame = -1

Query  2041  MLTIKRVPTVVSNYQDDAPEDSKPESLGCG---RNCLGQCCLPVSCLPLFAF----KNDE  1883
             ML IKRVPTVVS  QD            CG   R+CL  C L    LPLF +    K  E
Sbjct  1     MLAIKRVPTVVSVNQD------------CGSVSRDCLQSCFLTGFDLPLFKYTKKMKTTE  48

Query  1882  HKCDGDWNYLSYG-ECPISFLSDLLLGQWEERMSRGLFRYDVTSCETKIIPGTFGFIAQL  1706
              +  GD    S       SFL  LLL +WEER S+GLFRYDVT+CE++++ G +GFIAQL
Sbjct  49    LQLLGDEEVPSSPPTIERSFLGTLLLSKWEERASQGLFRYDVTACESRVLSGNYGFIAQL  108

Query  1705  NEGRHLKKRPTEFRVDQVLQPFDENKFNFTKIGQEEVLFRFEPSNDCKSHYLPSGLVDAR  1526
             NEGRHLKKR TEFRVDQVLQ FD  KFNF+K+ + EVLF+F    +   + +   L    
Sbjct  109   NEGRHLKKRLTEFRVDQVLQEFDPKKFNFSKVNRNEVLFQFGEGEEAGYYDITPIL----  164

Query  1525  SGSPTVLAINVSPIEYGHVLLIPRVLDCLPQRIDHDSFFVAMHLAKEAADPFFRVGYNSL  1346
               SP ++ INVSPIEYGHVLL+PR+ D +PQR+  +   +A++   E   P+FRVGYNSL
Sbjct  165   -SSPDIVLINVSPIEYGHVLLVPRLFDFVPQRLCANDLLLALYFTAEVDCPYFRVGYNSL  223

Query  1345  GAFATINHLHFQAYYLQVPFPVEKTPTREIMRGREQGDGGIVVSQLLNYPARALLFEGGS  1166
             GAFATINHLHFQAYYL  PFPVE      I +G  +    + +S+L++YP + +++E   
Sbjct  224   GAFATINHLHFQAYYLAYPFPVECASITRINKGSLK--SSLRISELVDYPVKGVVYESMD  281

Query  1165  TVRDLSDAVANSCISLQNNNIPFNLLISERGNKVFLFPQ  1049
              + +++ +VA++C  L+  NIPFNLLI + G +VFLFPQ
Sbjct  282   -LNEIAISVASTCQELELRNIPFNLLICDCGTRVFLFPQ  319


 Score = 90.9 bits (224),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 43/88 (49%), Positives = 61/88 (69%), Gaps = 1/88 (1%)
 Frame = -2

Query  804  LNSLRIKEGTHSFGEFSKCYAEKQACGKIDQEILDTWVNPAVWEISGHMVLKRREDYDDA  625
             N L    GT  F  F +C+A KQA  ++ Q++LDT VNPA WEI GH+VLKR+EDY+ A
Sbjct  303  FNLLICDCGTRVF-LFPQCFARKQALHQVSQKVLDTQVNPAAWEIGGHIVLKRKEDYEHA  361

Query  624  SEDYAWRLLSEVSLSEERFEEVKAYVSR  541
            +E++   LL+EVSLS+  F++VK  + +
Sbjct  362  TEEFVTALLAEVSLSDPDFQDVKNIICK  389



>gb|EEE55829.1| hypothetical protein OsJ_04435 [Oryza sativa Japonica Group]
Length=357

 Score =   300 bits (767),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 148/270 (55%), Positives = 189/270 (70%), Gaps = 7/270 (3%)
 Frame = -1

Query  1813  LLGQWEERMSRGLFRYDVTSCETKIIPGTFGFIAQLNEGRHLKKRPTEFRVDQVLQPFDE  1634
             L  +W++R +RGLF +D++SCETK++PG   F+A L EGR  KKRPT+F ++QVLQPFD 
Sbjct  29    LFKEWDDRKARGLFHHDISSCETKVLPGEHNFVATLIEGRDQKKRPTQFGMNQVLQPFDS  88

Query  1633  NKFNFTKIGQEEVLFRFEPSNDCKSHYLPSGLVDARSGSPTVLAINVSPIEYGHVLLIPR  1454
              KFNFTK+  EEV+F F+ S +    Y    +  A + SPT + INVSPI Y HVLLIPR
Sbjct  89    VKFNFTKVSPEEVIFTFKESQNDSVKYF-DNVPHAVAASPTAILINVSPIGYCHVLLIPR  147

Query  1453  VLDCLPQRIDHDSFFVAMHLAKEAADPFFRVGYNSLGAFATINHLHFQAYYLQVPFPVEK  1274
             + DCLPQR+D +SF +AM++A EA DPFFRVGYNSLG FATINHLHFQAYYL+V +PVEK
Sbjct  148   IQDCLPQRVDKESFLLAMYVASEAKDPFFRVGYNSLGGFATINHLHFQAYYLKVQYPVEK  207

Query  1273  TPTREIMRGREQGDGGIVVSQLLNYPARALLFEGGSTVRDLSDAVANSCISLQNNNIPFN  1094
               T ++         G+ + QL+ YP    +FEGG+ + DLSD V+  CI LQ NN PFN
Sbjct  208   ALTEKLT----TLGNGVSIIQLVQYPVSGFVFEGGACLEDLSDVVSKVCIFLQENNKPFN  263

Query  1093  LLISERGNKVFLFPQVHSNSVFLS--SREF  1010
              LISE G +VFL PQ ++    L   S+EF
Sbjct  264   ALISESGKRVFLLPQCYAEKQALGRVSQEF  293


 Score = 95.5 bits (236),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 49/94 (52%), Positives = 64/94 (68%), Gaps = 5/94 (5%)
 Frame = -2

Query  804  LNSLRIKEGTHSFGEFSKCYAEKQACGKIDQEILDTWVNPAVWEISGHMVLKRREDYDDA  625
             N+L  + G   F    +CYAEKQA G++ QE LD  +NPAVWE+SGH+VLKRR+DYD+A
Sbjct  262  FNALISESGKRVF-LLPQCYAEKQALGRVSQEFLDMRINPAVWELSGHLVLKRRKDYDEA  320

Query  624  SEDYAWRLLSEVSLSEERFEEVKA----YVSRAA  535
            SE    R L E SLSE  F+E+K+    ++S AA
Sbjct  321  SEATICRFLVEASLSESEFQELKSCILEFLSSAA  354



>ref|XP_004970941.1| PREDICTED: GDP-L-galactose phosphorylase 1-like isoform X2 [Setaria 
italica]
Length=361

 Score =   300 bits (767),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 147/270 (54%), Positives = 192/270 (71%), Gaps = 7/270 (3%)
 Frame = -1

Query  1813  LLGQWEERMSRGLFRYDVTSCETKIIPGTFGFIAQLNEGRHLKKRPTEFRVDQVLQPFDE  1634
             L  +WE+R +RGLF +D++SCETK++PG   F+A L EGR  KKRPTEF ++QVLQPFD 
Sbjct  28    LFREWEDRKARGLFHHDISSCETKVLPGQHNFVATLIEGRDQKKRPTEFGMNQVLQPFDS  87

Query  1633  NKFNFTKIGQEEVLFRFEPSNDCKSHYLPSGLVDARSGSPTVLAINVSPIEYGHVLLIPR  1454
              KFNFTK+  EEV+FRF  ++   + Y      D  S S + + INVSPI Y HVLL P+
Sbjct  88    GKFNFTKVRPEEVIFRFCEADKDSAQYFNDA-PDTVSSSSSAILINVSPIGYCHVLLTPQ  146

Query  1453  VLDCLPQRIDHDSFFVAMHLAKEAADPFFRVGYNSLGAFATINHLHFQAYYLQVPFPVEK  1274
             + DCLPQRIDH+SF +AM++A+EA +PFFRVGYNSLG FATINHLHFQAYYL+V +PVEK
Sbjct  147   IQDCLPQRIDHESFLMAMYVAREARNPFFRVGYNSLGGFATINHLHFQAYYLKVQYPVEK  206

Query  1273  TPTREIMRGREQGDGGIVVSQLLNYPARALLFEGGSTVRDLSDAVANSCISLQNNNIPFN  1094
               T ++         G+ ++QL+ YP    +FEGG+++ DLS  V+  CI LQ NN PFN
Sbjct  207   ATTEKLTTLV----NGVSIAQLVGYPVSGFVFEGGASLEDLSCMVSKVCIFLQENNRPFN  262

Query  1093  LLISERGNKVFLFPQVHSNSVFL--SSREF  1010
             +LISE G +VFL PQ ++    L  +S+EF
Sbjct  263   VLISESGRRVFLLPQCYAEKQLLGKASQEF  292


 Score = 87.0 bits (214),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 38/69 (55%), Positives = 52/69 (75%), Gaps = 0/69 (0%)
 Frame = -2

Query  753  KCYAEKQACGKIDQEILDTWVNPAVWEISGHMVLKRREDYDDASEDYAWRLLSEVSLSEE  574
            +CYAEKQ  GK  QE L+  +NPA+WE+SGH+VLKR++DYD+ASE Y  R L E ++SE 
Sbjct  277  QCYAEKQLLGKASQEFLEMRINPAIWELSGHLVLKRKKDYDEASELYICRFLVEAAVSET  336

Query  573  RFEEVKAYV  547
             F+++K  V
Sbjct  337  EFQQLKQCV  345



>ref|XP_002960918.1| hypothetical protein SELMODRAFT_139516 [Selaginella moellendorffii]
 gb|EFJ38457.1| hypothetical protein SELMODRAFT_139516 [Selaginella moellendorffii]
Length=389

 Score =   300 bits (768),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 168/339 (50%), Positives = 217/339 (64%), Gaps = 28/339 (8%)
 Frame = -1

Query  2041  MLTIKRVPTVVSNYQDDAPEDSKPESLGCG---RNCLGQCCLPVSCLPLFAF----KNDE  1883
             ML IKRVPTVVS  QD            CG   R+CL  C L    LPLF +    K  E
Sbjct  1     MLAIKRVPTVVSVNQD------------CGSVSRDCLQSCFLTGFDLPLFKYTKKMKTTE  48

Query  1882  HKCDGDWNYLSYG-ECPISFLSDLLLGQWEERMSRGLFRYDVTSCETKIIPGTFGFIAQL  1706
              +  GD    S       SFL  LLL +WEER S+GLFRYDVT+CE++++ G +GFIAQL
Sbjct  49    LQLLGDEEVPSSPPTIERSFLGTLLLSKWEERASQGLFRYDVTACESRVLSGNYGFIAQL  108

Query  1705  NEGRHLKKRPTEFRVDQVLQPFDENKFNFTKIGQEEVLFRFEPSNDCKSHYLPSGLVDAR  1526
             NEGRHLKKR TEFRVDQVLQ FD  KFNF+K+ + EVLF+F    +   + +   L    
Sbjct  109   NEGRHLKKRLTEFRVDQVLQEFDPKKFNFSKVNRNEVLFQFGEGEEAGYYDITPIL----  164

Query  1525  SGSPTVLAINVSPIEYGHVLLIPRVLDCLPQRIDHDSFFVAMHLAKEAADPFFRVGYNSL  1346
               SP  + INVSPIEYGHVLL+PR+ D +PQR+  +   +A++   E   P+FRVGYNSL
Sbjct  165   -SSPDFVLINVSPIEYGHVLLVPRLFDFVPQRLCANDLLLALYFTAEVDCPYFRVGYNSL  223

Query  1345  GAFATINHLHFQAYYLQVPFPVEKTPTREIMRGREQGDGGIVVSQLLNYPARALLFEGGS  1166
             GAFATINHLHFQAYYL  PFPVE      I +G  +    + +S+L++YP + +++E   
Sbjct  224   GAFATINHLHFQAYYLAYPFPVECASITRINKGSLK--SSLRISELVDYPVKGVVYESMD  281

Query  1165  TVRDLSDAVANSCISLQNNNIPFNLLISERGNKVFLFPQ  1049
              + +++ +VA++C  L+  NIPFNLLI + G +VFLFPQ
Sbjct  282   -LNEIAISVASTCQELELRNIPFNLLICDCGTRVFLFPQ  319


 Score = 90.9 bits (224),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 43/88 (49%), Positives = 61/88 (69%), Gaps = 1/88 (1%)
 Frame = -2

Query  804  LNSLRIKEGTHSFGEFSKCYAEKQACGKIDQEILDTWVNPAVWEISGHMVLKRREDYDDA  625
             N L    GT  F  F +C+A KQA  ++ Q++LDT VNPA WEI GH+VLKR+EDY+ A
Sbjct  303  FNLLICDCGTRVF-LFPQCFARKQALHQVSQKVLDTQVNPAAWEIGGHIVLKRKEDYEHA  361

Query  624  SEDYAWRLLSEVSLSEERFEEVKAYVSR  541
            +E++   LL+EVSLS+  F++VK  + +
Sbjct  362  TEEFVTALLAEVSLSDPDFQDVKNIICK  389



>ref|XP_004970940.1| PREDICTED: GDP-L-galactose phosphorylase 1-like isoform X1 [Setaria 
italica]
Length=402

 Score =   300 bits (767),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 147/270 (54%), Positives = 192/270 (71%), Gaps = 7/270 (3%)
 Frame = -1

Query  1813  LLGQWEERMSRGLFRYDVTSCETKIIPGTFGFIAQLNEGRHLKKRPTEFRVDQVLQPFDE  1634
             L  +WE+R +RGLF +D++SCETK++PG   F+A L EGR  KKRPTEF ++QVLQPFD 
Sbjct  69    LFREWEDRKARGLFHHDISSCETKVLPGQHNFVATLIEGRDQKKRPTEFGMNQVLQPFDS  128

Query  1633  NKFNFTKIGQEEVLFRFEPSNDCKSHYLPSGLVDARSGSPTVLAINVSPIEYGHVLLIPR  1454
              KFNFTK+  EEV+FRF  ++   + Y      D  S S + + INVSPI Y HVLL P+
Sbjct  129   GKFNFTKVRPEEVIFRFCEADKDSAQYFNDA-PDTVSSSSSAILINVSPIGYCHVLLTPQ  187

Query  1453  VLDCLPQRIDHDSFFVAMHLAKEAADPFFRVGYNSLGAFATINHLHFQAYYLQVPFPVEK  1274
             + DCLPQRIDH+SF +AM++A+EA +PFFRVGYNSLG FATINHLHFQAYYL+V +PVEK
Sbjct  188   IQDCLPQRIDHESFLMAMYVAREARNPFFRVGYNSLGGFATINHLHFQAYYLKVQYPVEK  247

Query  1273  TPTREIMRGREQGDGGIVVSQLLNYPARALLFEGGSTVRDLSDAVANSCISLQNNNIPFN  1094
               T ++         G+ ++QL+ YP    +FEGG+++ DLS  V+  CI LQ NN PFN
Sbjct  248   ATTEKLTTLV----NGVSIAQLVGYPVSGFVFEGGASLEDLSCMVSKVCIFLQENNRPFN  303

Query  1093  LLISERGNKVFLFPQVHSNSVFL--SSREF  1010
             +LISE G +VFL PQ ++    L  +S+EF
Sbjct  304   VLISESGRRVFLLPQCYAEKQLLGKASQEF  333


 Score = 87.4 bits (215),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 42/83 (51%), Positives = 56/83 (67%), Gaps = 3/83 (4%)
 Frame = -2

Query  753  KCYAEKQACGKIDQEILDTWVNPAVWEISGHMVLKRREDYDDASEDYAWRLLSEVSLSEE  574
            +CYAEKQ  GK  QE L+  +NPA+WE+SGH+VLKR++DYD+ASE Y  R L E ++SE 
Sbjct  318  QCYAEKQLLGKASQEFLEMRINPAIWELSGHLVLKRKKDYDEASELYICRFLVEAAVSET  377

Query  573  RFEEVKAYVSRAADLLLDSECSN  505
             F+++K  V    D L  S   N
Sbjct  378  EFQQLKQCV---LDFLTASAACN  397



>tpg|DAA56303.1| TPA: VTC2 [Zea mays]
Length=451

 Score =   300 bits (767),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 159/325 (49%), Positives = 212/325 (65%), Gaps = 16/325 (5%)
 Frame = -1

Query  1954  GRNC-----LGQCCLPVSCLPLFAFKNDEHKCDGDWNYLSYGECPISFLSDLLL---GQW  1799
             GR+C     LG+  L  SC+ + A  +   K   D       E   S LS  LL    +W
Sbjct  71    GRHCRLFFVLGKA-LSDSCIFILAMLSAATKLTMDGTSFDLTEHEGSNLSPFLLKLFNEW  129

Query  1798  EERMSRGLFRYDVTSCETKIIPGTFGFIAQLNEGRHLKKRPTEFRVDQVLQPFDENKFNF  1619
             ++R +RGLF +D++SCETK++PG   F+A L EGR  KKRPTEF ++QVLQPF   KFNF
Sbjct  130   DDRKTRGLFHHDISSCETKVLPGVHNFVATLIEGRDQKKRPTEFTMNQVLQPFVSEKFNF  189

Query  1618  TKIGQEEVLFRFEPSNDCKSHYLPSGLVDARSGSPTVLAINVSPIEYGHVLLIPRVLDCL  1439
             TK+   EV+FRF  +    + Y   G+ D  S S + + INVSPI Y HVLL P++ DCL
Sbjct  190   TKVSPLEVIFRFNDTEKDSAQYF-DGVPDTVSASSSAILINVSPIGYCHVLLTPKIQDCL  248

Query  1438  PQRIDHDSFFVAMHLAKEAADPFFRVGYNSLGAFATINHLHFQAYYLQVPFPVEKTPTRE  1259
             PQRID +SF +AM++A+EA  PFFRVGYNSLG FATINHLHFQAYYL+V +PVEK  T +
Sbjct  249   PQRIDQESFLIAMYVAREARTPFFRVGYNSLGGFATINHLHFQAYYLKVQYPVEKAITEK  308

Query  1258  IMRGREQGDGGIVVSQLLNYPARALLFEGGSTVRDLSDAVANSCISLQNNNIPFNLLISE  1079
             +   +  G+  + +  L++YP    +FEGG+++ DLSD V+  CI LQ NN PFN+LISE
Sbjct  309   L---KTLGN-SVSIFHLVDYPVNGFVFEGGASLEDLSDVVSKVCIFLQENNRPFNVLISE  364

Query  1078  RGNKVFLFPQVHSNSVFL--SSREF  1010
              G ++FL PQ ++    L  +S+EF
Sbjct  365   SGKRIFLLPQCYAEKQLLGKASQEF  389


 Score = 86.7 bits (213),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 39/69 (57%), Positives = 50/69 (72%), Gaps = 0/69 (0%)
 Frame = -2

Query  753  KCYAEKQACGKIDQEILDTWVNPAVWEISGHMVLKRREDYDDASEDYAWRLLSEVSLSEE  574
            +CYAEKQ  GK  QE LD  +NPA+WE+SGH+VLKRR+DY++ASE    R L E +LSE 
Sbjct  374  QCYAEKQLLGKASQEFLDMRINPAIWELSGHLVLKRRKDYEEASEANICRFLVEAALSET  433

Query  573  RFEEVKAYV  547
             F+E+   V
Sbjct  434  EFQELNLCV  442



>ref|NP_001140486.1| uncharacterized protein LOC100272546 [Zea mays]
 ref|XP_008672349.1| PREDICTED: uncharacterized protein LOC100272546 isoform X1 [Zea 
mays]
 gb|ACF83928.1| unknown [Zea mays]
 gb|ACN26071.1| unknown [Zea mays]
 tpg|DAA56302.1| TPA: VTC2 [Zea mays]
Length=358

 Score =   295 bits (755),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 143/270 (53%), Positives = 191/270 (71%), Gaps = 7/270 (3%)
 Frame = -1

Query  1813  LLGQWEERMSRGLFRYDVTSCETKIIPGTFGFIAQLNEGRHLKKRPTEFRVDQVLQPFDE  1634
             L  +W++R +RGLF +D++SCETK++PG   F+A L EGR  KKRPTEF ++QVLQPF  
Sbjct  32    LFNEWDDRKTRGLFHHDISSCETKVLPGVHNFVATLIEGRDQKKRPTEFTMNQVLQPFVS  91

Query  1633  NKFNFTKIGQEEVLFRFEPSNDCKSHYLPSGLVDARSGSPTVLAINVSPIEYGHVLLIPR  1454
              KFNFTK+   EV+FRF  +    + Y   G+ D  S S + + INVSPI Y HVLL P+
Sbjct  92    EKFNFTKVSPLEVIFRFNDTEKDSAQYF-DGVPDTVSASSSAILINVSPIGYCHVLLTPK  150

Query  1453  VLDCLPQRIDHDSFFVAMHLAKEAADPFFRVGYNSLGAFATINHLHFQAYYLQVPFPVEK  1274
             + DCLPQRID +SF +AM++A+EA  PFFRVGYNSLG FATINHLHFQAYYL+V +PVEK
Sbjct  151   IQDCLPQRIDQESFLIAMYVAREARTPFFRVGYNSLGGFATINHLHFQAYYLKVQYPVEK  210

Query  1273  TPTREIMRGREQGDGGIVVSQLLNYPARALLFEGGSTVRDLSDAVANSCISLQNNNIPFN  1094
               T ++   +  G+  + +  L++YP    +FEGG+++ DLSD V+  CI LQ NN PFN
Sbjct  211   AITEKL---KTLGN-SVSIFHLVDYPVNGFVFEGGASLEDLSDVVSKVCIFLQENNRPFN  266

Query  1093  LLISERGNKVFLFPQVHSNSVFL--SSREF  1010
             +LISE G ++FL PQ ++    L  +S+EF
Sbjct  267   VLISESGKRIFLLPQCYAEKQLLGKASQEF  296


 Score = 86.3 bits (212),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 39/69 (57%), Positives = 50/69 (72%), Gaps = 0/69 (0%)
 Frame = -2

Query  753  KCYAEKQACGKIDQEILDTWVNPAVWEISGHMVLKRREDYDDASEDYAWRLLSEVSLSEE  574
            +CYAEKQ  GK  QE LD  +NPA+WE+SGH+VLKRR+DY++ASE    R L E +LSE 
Sbjct  281  QCYAEKQLLGKASQEFLDMRINPAIWELSGHLVLKRRKDYEEASEANICRFLVEAALSET  340

Query  573  RFEEVKAYV  547
             F+E+   V
Sbjct  341  EFQELNLCV  349



>ref|XP_008672350.1| PREDICTED: uncharacterized protein LOC100272546 isoform X3 [Zea 
mays]
 tpg|DAA56301.1| TPA: VTC2 [Zea mays]
Length=349

 Score =   294 bits (753),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 143/270 (53%), Positives = 191/270 (71%), Gaps = 7/270 (3%)
 Frame = -1

Query  1813  LLGQWEERMSRGLFRYDVTSCETKIIPGTFGFIAQLNEGRHLKKRPTEFRVDQVLQPFDE  1634
             L  +W++R +RGLF +D++SCETK++PG   F+A L EGR  KKRPTEF ++QVLQPF  
Sbjct  23    LFNEWDDRKTRGLFHHDISSCETKVLPGVHNFVATLIEGRDQKKRPTEFTMNQVLQPFVS  82

Query  1633  NKFNFTKIGQEEVLFRFEPSNDCKSHYLPSGLVDARSGSPTVLAINVSPIEYGHVLLIPR  1454
              KFNFTK+   EV+FRF  +    + Y   G+ D  S S + + INVSPI Y HVLL P+
Sbjct  83    EKFNFTKVSPLEVIFRFNDTEKDSAQYF-DGVPDTVSASSSAILINVSPIGYCHVLLTPK  141

Query  1453  VLDCLPQRIDHDSFFVAMHLAKEAADPFFRVGYNSLGAFATINHLHFQAYYLQVPFPVEK  1274
             + DCLPQRID +SF +AM++A+EA  PFFRVGYNSLG FATINHLHFQAYYL+V +PVEK
Sbjct  142   IQDCLPQRIDQESFLIAMYVAREARTPFFRVGYNSLGGFATINHLHFQAYYLKVQYPVEK  201

Query  1273  TPTREIMRGREQGDGGIVVSQLLNYPARALLFEGGSTVRDLSDAVANSCISLQNNNIPFN  1094
               T ++   +  G+  + +  L++YP    +FEGG+++ DLSD V+  CI LQ NN PFN
Sbjct  202   AITEKL---KTLGN-SVSIFHLVDYPVNGFVFEGGASLEDLSDVVSKVCIFLQENNRPFN  257

Query  1093  LLISERGNKVFLFPQVHSNSVFL--SSREF  1010
             +LISE G ++FL PQ ++    L  +S+EF
Sbjct  258   VLISESGKRIFLLPQCYAEKQLLGKASQEF  287


 Score = 86.3 bits (212),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 39/69 (57%), Positives = 50/69 (72%), Gaps = 0/69 (0%)
 Frame = -2

Query  753  KCYAEKQACGKIDQEILDTWVNPAVWEISGHMVLKRREDYDDASEDYAWRLLSEVSLSEE  574
            +CYAEKQ  GK  QE LD  +NPA+WE+SGH+VLKRR+DY++ASE    R L E +LSE 
Sbjct  272  QCYAEKQLLGKASQEFLDMRINPAIWELSGHLVLKRRKDYEEASEANICRFLVEAALSET  331

Query  573  RFEEVKAYV  547
             F+E+   V
Sbjct  332  EFQELNLCV  340



>gb|ACG33623.1| VTC2 [Zea mays]
Length=349

 Score =   293 bits (751),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 143/270 (53%), Positives = 191/270 (71%), Gaps = 7/270 (3%)
 Frame = -1

Query  1813  LLGQWEERMSRGLFRYDVTSCETKIIPGTFGFIAQLNEGRHLKKRPTEFRVDQVLQPFDE  1634
             L  +W++R +RGLF +D++SCETK++PG   F+A L EGR  KKRPTEF ++QVLQPF  
Sbjct  23    LFNEWDDRKTRGLFHHDISSCETKVLPGVHNFVATLIEGRDQKKRPTEFTMNQVLQPFVS  82

Query  1633  NKFNFTKIGQEEVLFRFEPSNDCKSHYLPSGLVDARSGSPTVLAINVSPIEYGHVLLIPR  1454
              KFNFTK+   EV+FRF  +    + Y   G+ D  S S + + INVSPI Y HVLL P+
Sbjct  83    EKFNFTKVSPLEVIFRFNDTEKDPAQYF-DGVPDTVSASSSAILINVSPIGYCHVLLTPK  141

Query  1453  VLDCLPQRIDHDSFFVAMHLAKEAADPFFRVGYNSLGAFATINHLHFQAYYLQVPFPVEK  1274
             + DCLPQRID +SF +AM++A+EA  PFFRVGYNSLG FATINHLHFQAYYL+V +PVEK
Sbjct  142   IQDCLPQRIDQESFLIAMYVAREARTPFFRVGYNSLGGFATINHLHFQAYYLKVQYPVEK  201

Query  1273  TPTREIMRGREQGDGGIVVSQLLNYPARALLFEGGSTVRDLSDAVANSCISLQNNNIPFN  1094
               T ++   +  G+  + +  L++YP    +FEGG+++ DLSD V+  CI LQ NN PFN
Sbjct  202   AITEKL---KTLGN-SVSIFHLVDYPVNGFVFEGGASLEDLSDVVSKVCIFLQENNRPFN  257

Query  1093  LLISERGNKVFLFPQVHSNSVFL--SSREF  1010
             +LISE G ++FL PQ ++    L  +S+EF
Sbjct  258   VLISESGKRIFLLPQCYAEKQLLGKASQEF  287


 Score = 85.9 bits (211),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 38/66 (58%), Positives = 49/66 (74%), Gaps = 0/66 (0%)
 Frame = -2

Query  753  KCYAEKQACGKIDQEILDTWVNPAVWEISGHMVLKRREDYDDASEDYAWRLLSEVSLSEE  574
            +CYAEKQ  GK  QE LD  +NPA+WE+SGH+VLKRR+DY++ASE    R L E +LSE 
Sbjct  272  QCYAEKQLLGKASQEFLDMRINPAIWELSGHLVLKRRKDYEEASEANIRRFLVEAALSET  331

Query  573  RFEEVK  556
             F+E+ 
Sbjct  332  EFQELN  337



>ref|XP_008672348.1| PREDICTED: uncharacterized protein LOC100272546 isoform X2 [Zea 
mays]
Length=390

 Score =   295 bits (754),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 143/270 (53%), Positives = 191/270 (71%), Gaps = 7/270 (3%)
 Frame = -1

Query  1813  LLGQWEERMSRGLFRYDVTSCETKIIPGTFGFIAQLNEGRHLKKRPTEFRVDQVLQPFDE  1634
             L  +W++R +RGLF +D++SCETK++PG   F+A L EGR  KKRPTEF ++QVLQPF  
Sbjct  64    LFNEWDDRKTRGLFHHDISSCETKVLPGVHNFVATLIEGRDQKKRPTEFTMNQVLQPFVS  123

Query  1633  NKFNFTKIGQEEVLFRFEPSNDCKSHYLPSGLVDARSGSPTVLAINVSPIEYGHVLLIPR  1454
              KFNFTK+   EV+FRF  +    + Y   G+ D  S S + + INVSPI Y HVLL P+
Sbjct  124   EKFNFTKVSPLEVIFRFNDTEKDSAQYF-DGVPDTVSASSSAILINVSPIGYCHVLLTPK  182

Query  1453  VLDCLPQRIDHDSFFVAMHLAKEAADPFFRVGYNSLGAFATINHLHFQAYYLQVPFPVEK  1274
             + DCLPQRID +SF +AM++A+EA  PFFRVGYNSLG FATINHLHFQAYYL+V +PVEK
Sbjct  183   IQDCLPQRIDQESFLIAMYVAREARTPFFRVGYNSLGGFATINHLHFQAYYLKVQYPVEK  242

Query  1273  TPTREIMRGREQGDGGIVVSQLLNYPARALLFEGGSTVRDLSDAVANSCISLQNNNIPFN  1094
               T ++   +  G+  + +  L++YP    +FEGG+++ DLSD V+  CI LQ NN PFN
Sbjct  243   AITEKL---KTLGN-SVSIFHLVDYPVNGFVFEGGASLEDLSDVVSKVCIFLQENNRPFN  298

Query  1093  LLISERGNKVFLFPQVHSNSVFL--SSREF  1010
             +LISE G ++FL PQ ++    L  +S+EF
Sbjct  299   VLISESGKRIFLLPQCYAEKQLLGKASQEF  328


 Score = 86.7 bits (213),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 39/69 (57%), Positives = 50/69 (72%), Gaps = 0/69 (0%)
 Frame = -2

Query  753  KCYAEKQACGKIDQEILDTWVNPAVWEISGHMVLKRREDYDDASEDYAWRLLSEVSLSEE  574
            +CYAEKQ  GK  QE LD  +NPA+WE+SGH+VLKRR+DY++ASE    R L E +LSE 
Sbjct  313  QCYAEKQLLGKASQEFLDMRINPAIWELSGHLVLKRRKDYEEASEANICRFLVEAALSET  372

Query  573  RFEEVKAYV  547
             F+E+   V
Sbjct  373  EFQELNLCV  381



>ref|XP_006421135.1| hypothetical protein CICLE_v10006850mg, partial [Citrus clementina]
 gb|ESR34375.1| hypothetical protein CICLE_v10006850mg, partial [Citrus clementina]
Length=307

 Score =   289 bits (739),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 157/326 (48%), Positives = 216/326 (66%), Gaps = 38/326 (12%)
 Frame = -1

Query  2044  LMLTIKRVPTVVSNYQDDAPEDSKPESLGCGRNCLGQCCLPVSCLPLFAFK---NDEHKC  1874
             ++L IKRVP VV NYQ +  E+     +    +  G      + LPL+AFK     E + 
Sbjct  1     MILRIKRVPMVVLNYQKEDMEE-----VAAAHHVTG------TKLPLYAFKRVNKIETEM  49

Query  1873  DGDWNYLSYGECPISFLSDLLLGQWEERMSRGLFRYDVTSCETKIIPGTFGFIAQLNEGR  1694
             D   + +   E PI+FL  L+LG+W++ + RGLFRY        +I G +GFIAQLN  R
Sbjct  50    DVHGHEVREPEPPIAFLDLLILGEWKDHVRRGLFRY--------VISGQYGFIAQLNYPR  101

Query  1693  HLKKRPTEFRVDQVLQPFDENKFNFTKIGQEEVLFRFEPSNDCKSHYLPSGLVDARSGSP  1514
             HLKKRP EFRV++V Q           +GQEEVLF+FE S DC+  +  S   D  + SP
Sbjct  102   HLKKRPAEFRVEKVYQ-----------MGQEEVLFQFEASEDCEVQFHLSAPFDVEN-SP  149

Query  1513  TVLAINVSPIEYGHVLLIPRVLDCLPQRIDHDSFFVAMHLAKEAADPFFRVGYNSLGAFA  1334
             +V++INVSPI+YGHVLLIPRVL+CL QRI   SF +A++ A  A +P FR+GYNSLGAFA
Sbjct  150   SVVSINVSPIKYGHVLLIPRVLECLLQRIYCVSFLLALYTAAGAGNPHFRLGYNSLGAFA  209

Query  1333  TINHLHFQAYYLQVPFPVEKTPTREIMRGREQGDGGIVVSQLLNYPARALLFEGGSTVRD  1154
             TINHLHFQA Y+ +PFP++K PTR+I+       G + +S+  NYP R L+FEGG++++D
Sbjct  210   TINHLHFQASYMALPFPIQKAPTRKII----TSGGCVKISEHFNYPVRGLVFEGGNSLQD  265

Query  1153  LSDAVANSCISLQNNNIPFNLLISER  1076
             LS+ V+++C+ LQ NNIP+N+LI ++
Sbjct  266   LSNTVSDACVCLQENNIPYNVLIRKK  291



>ref|XP_006646570.1| PREDICTED: GDP-L-galactose phosphorylase 2-like [Oryza brachyantha]
Length=357

 Score =   290 bits (743),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 140/258 (54%), Positives = 183/258 (71%), Gaps = 5/258 (2%)
 Frame = -1

Query  1813  LLGQWEERMSRGLFRYDVTSCETKIIPGTFGFIAQLNEGRHLKKRPTEFRVDQVLQPFDE  1634
             L  +W++R +RGLF +D++SCETKI+ G   F+A L EGR  KKRPT+F ++QV+QPFD 
Sbjct  29    LFKEWDDRKARGLFHHDISSCETKILHGEHNFVATLIEGRDQKKRPTQFGMNQVIQPFDG  88

Query  1633  NKFNFTKIGQEEVLFRFEPSNDCKSHYLPSGLVDARSGSPTVLAINVSPIEYGHVLLIPR  1454
              KFNFTK+  EEV+F  E + D    Y    +  A + SP+ + INVSPI Y HVLLIPR
Sbjct  89    AKFNFTKVSLEEVIFTLEEAQDDSEKYF-GNVPHALAASPSAILINVSPIGYCHVLLIPR  147

Query  1453  VLDCLPQRIDHDSFFVAMHLAKEAADPFFRVGYNSLGAFATINHLHFQAYYLQVPFPVEK  1274
             V DCLPQR+D +SF +AM++A+EA +PFFRVGYNSLG FATINHLHFQAYYL+V +PVEK
Sbjct  148   VQDCLPQRVDKESFLLAMYVAREARNPFFRVGYNSLGGFATINHLHFQAYYLKVQYPVEK  207

Query  1273  TPTREIMRGREQGDGGIVVSQLLNYPARALLFEGGSTVRDLSDAVANSCISLQNNNIPFN  1094
             TP  ++       +  + + QL+ YP     FEGGS + DLSD V+   I +Q+NN PFN
Sbjct  208   TPIEKLA----TLENDVSIFQLVQYPVSGFAFEGGSCLEDLSDVVSRVSIFMQDNNRPFN  263

Query  1093  LLISERGNKVFLFPQVHS  1040
             +LISE   +VFL PQ ++
Sbjct  264   VLISESAKRVFLLPQCYA  281


 Score = 90.5 bits (223),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 46/92 (50%), Positives = 60/92 (65%), Gaps = 4/92 (4%)
 Frame = -2

Query  798  SLRIKEGTHSFGEFSKCYAEKQACGKIDQEILDTWVNPAVWEISGHMVLKRREDYDDASE  619
            ++ I E         +CYAEKQA GK   + LD  +NPAVWE+SGH+VLKR+EDYD+ASE
Sbjct  263  NVLISESAKRVFLLPQCYAEKQALGKASPQFLDMRINPAVWELSGHLVLKRKEDYDEASE  322

Query  618  DYAWRLLSEVSLSEERFEEVKA----YVSRAA  535
                R L E SLSE  F+E+K+    ++S AA
Sbjct  323  ATMSRFLVEASLSESEFQELKSCILEFLSTAA  354



>ref|XP_002506606.1| hypothetical protein MICPUN_64582 [Micromonas sp. RCC299]
 gb|ACO67864.1| hypothetical protein MICPUN_64582 [Micromonas sp. RCC299]
Length=503

 Score =   293 bits (751),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 168/377 (45%), Positives = 222/377 (59%), Gaps = 48/377 (13%)
 Frame = -1

Query  2044  LMLTIKRVPTVVSNYQDDAPEDSKPESLGCGRNCLGQCCLPVSCLPLFAFKNDEHK----  1877
             + LTIK++PTV+S +Q D  ED  P+  G  R    +CC     LP   F  +  +    
Sbjct  1     MSLTIKKIPTVLSIHQMDEEED--PKFAGAVR----RCCRAGKKLPTLTFAPESARDSRL  54

Query  1876  -----------------CDGDWNYL--SYGECPISF-----------LSDLLLGQWEERM  1787
                               DG  N    SY     SF              +LL  WE+R 
Sbjct  55    MKKVRSFGSFDDLRVPDIDGYSNEETGSYNSDSDSFSGGGYVQDVSPFDRILLAAWEDRF  114

Query  1786  SRGLFRYDVTSCETKIIPGTFGFIAQLNEGRHLKKRPTEFRVDQVLQPFDENKFNFTKIG  1607
             + GLFRYDVT+C+TK++PG +GF+AQ NEGR  KKRPTEF VD+V+Q FD  KFNFTK  
Sbjct  115   AAGLFRYDVTACKTKVVPGGYGFVAQFNEGRATKKRPTEFAVDEVVQAFDGGKFNFTKAD  174

Query  1606  QEEVLFRFEPSNDC--KSHYLPSGLVDARSGSPTVLAINVSPIEYGHVLLIPRVLDCLPQ  1433
             + E+LF FE  +     S Y  +  +++   SP V+ INVSPIEYGHVLL PRV DCLPQ
Sbjct  175   KAEILFAFERGDRAMKSSAYNSAKTIES---SPNVMLINVSPIEYGHVLLCPRVTDCLPQ  231

Query  1432  RIDHDSFFVAMHLAKEAADPFFRVGYNSLGAFATINHLHFQAYYLQVPFPVEKTPTREIM  1253
             RI  +     +++A E+ +P+FRVGYNSLGA+ATINHLHFQAYYL   FP+E+  T  + 
Sbjct  232   RISPELLLPPLYMAAESRNPYFRVGYNSLGAYATINHLHFQAYYLMEAFPIERAQTTRLP  291

Query  1252  RG--REQGDGGIVVSQLLNYPARALLFE-GGSTVRDLSDAVANSCISLQNNNIPFNLLIS  1082
             +   +++   G+ V+Q+  YP R L FE   +T   L+D + N+C  LQ  NIPFNLLI+
Sbjct  292   QRVYKKRHRHGVAVNQVTGYPVRCLCFERKDATFEALADLLGNACERLQERNIPFNLLIA  351

Query  1081  ERGNKVFLFPQVHSNSV  1031
             + G +VFL PQV S+ V
Sbjct  352   DHGARVFLIPQVFSHRV  368


 Score = 64.3 bits (155),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 31/86 (36%), Positives = 54/86 (63%), Gaps = 1/86 (1%)
 Frame = -2

Query  804  LNSLRIKEGTHSFGEFSKCYAEKQACGKIDQEILDTWVNPAVWEISGHMVLKRREDYDDA  625
             N L    G   F    + ++ + A G+I +++  T VNPAV+EISGH++ K+++DYD  
Sbjct  346  FNLLIADHGARVF-LIPQVFSHRVAKGEIPEDVAATGVNPAVFEISGHLLYKQQDDYDAC  404

Query  624  SEDYAWRLLSEVSLSEERFEEVKAYV  547
            ++D A+++L+  SL EE F E  +++
Sbjct  405  TQDAAFKMLACASLGEEEFYETCSHI  430



>ref|XP_010232701.1| PREDICTED: GDP-L-galactose phosphorylase 1-like isoform X2 [Brachypodium 
distachyon]
Length=365

 Score =   288 bits (737),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 140/270 (52%), Positives = 188/270 (70%), Gaps = 7/270 (3%)
 Frame = -1

Query  1813  LLGQWEERMSRGLFRYDVTSCETKIIPGTFGFIAQLNEGRHLKKRPTEFRVDQVLQPFDE  1634
             L  QW+   +RGLF +D+T+CETK++PG   F+A L EGR  KKRPTEF ++QVLQPFD 
Sbjct  31    LFKQWDNCKARGLFHHDITACETKVLPGEHNFVATLIEGRDQKKRPTEFGMNQVLQPFDS  90

Query  1633  NKFNFTKIGQEEVLFRFEPSNDCKSHYLPSGLVDARSGSPTVLAINVSPIEYGHVLLIPR  1454
              KFNFTK+  EEV+F F  + D    Y   G       SP+ + INVSPI Y HVLLIPR
Sbjct  91    GKFNFTKVRPEEVIFTFHETEDESDRYF-DGAPPTVLASPSSILINVSPIGYCHVLLIPR  149

Query  1453  VLDCLPQRIDHDSFFVAMHLAKEAADPFFRVGYNSLGAFATINHLHFQAYYLQVPFPVEK  1274
             +L+CLPQR+D ++  +AM++A+EA +PFFRVGYNSLG FATINH+HFQAYYL+V +PVEK
Sbjct  150   ILECLPQRVDQENLLLAMYVAREARNPFFRVGYNSLGGFATINHIHFQAYYLEVKYPVEK  209

Query  1273  TPTREIMRGREQGDGGIVVSQLLNYPARALLFEGGSTVRDLSDAVANSCISLQNNNIPFN  1094
              P  ++   +     G+ +S+L+ YP    +FEG  ++ DLS  V+N+C  +Q+NN PFN
Sbjct  210   APKEKLTVLK----NGVSISELVQYPVSGFVFEGEVSLEDLSYVVSNACTFMQDNNRPFN  265

Query  1093  LLISERGNKVFLFPQVHSNSVFL--SSREF  1010
             +LISE   +VFL PQ ++    L  +S+EF
Sbjct  266   VLISESAKRVFLLPQCYAEKQALGKASQEF  295


 Score = 92.4 bits (228),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 45/84 (54%), Positives = 56/84 (67%), Gaps = 0/84 (0%)
 Frame = -2

Query  798  SLRIKEGTHSFGEFSKCYAEKQACGKIDQEILDTWVNPAVWEISGHMVLKRREDYDDASE  619
            ++ I E         +CYAEKQA GK  QE LD  +NPAVWE+SGH+VLKRR+DYDDASE
Sbjct  265  NVLISESAKRVFLLPQCYAEKQALGKASQEFLDMRINPAVWELSGHLVLKRRKDYDDASE  324

Query  618  DYAWRLLSEVSLSEERFEEVKAYV  547
                R L E +LS   F+E+K+ V
Sbjct  325  ATLCRFLVEATLSGAEFQELKSCV  348



>ref|XP_003567366.2| PREDICTED: GDP-L-galactose phosphorylase 1-like isoform X1 [Brachypodium 
distachyon]
Length=404

 Score =   288 bits (737),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 140/270 (52%), Positives = 188/270 (70%), Gaps = 7/270 (3%)
 Frame = -1

Query  1813  LLGQWEERMSRGLFRYDVTSCETKIIPGTFGFIAQLNEGRHLKKRPTEFRVDQVLQPFDE  1634
             L  QW+   +RGLF +D+T+CETK++PG   F+A L EGR  KKRPTEF ++QVLQPFD 
Sbjct  70    LFKQWDNCKARGLFHHDITACETKVLPGEHNFVATLIEGRDQKKRPTEFGMNQVLQPFDS  129

Query  1633  NKFNFTKIGQEEVLFRFEPSNDCKSHYLPSGLVDARSGSPTVLAINVSPIEYGHVLLIPR  1454
              KFNFTK+  EEV+F F  + D    Y   G       SP+ + INVSPI Y HVLLIPR
Sbjct  130   GKFNFTKVRPEEVIFTFHETEDESDRYF-DGAPPTVLASPSSILINVSPIGYCHVLLIPR  188

Query  1453  VLDCLPQRIDHDSFFVAMHLAKEAADPFFRVGYNSLGAFATINHLHFQAYYLQVPFPVEK  1274
             +L+CLPQR+D ++  +AM++A+EA +PFFRVGYNSLG FATINH+HFQAYYL+V +PVEK
Sbjct  189   ILECLPQRVDQENLLLAMYVAREARNPFFRVGYNSLGGFATINHIHFQAYYLEVKYPVEK  248

Query  1273  TPTREIMRGREQGDGGIVVSQLLNYPARALLFEGGSTVRDLSDAVANSCISLQNNNIPFN  1094
              P  ++   +     G+ +S+L+ YP    +FEG  ++ DLS  V+N+C  +Q+NN PFN
Sbjct  249   APKEKLTVLK----NGVSISELVQYPVSGFVFEGEVSLEDLSYVVSNACTFMQDNNRPFN  304

Query  1093  LLISERGNKVFLFPQVHSNSVFL--SSREF  1010
             +LISE   +VFL PQ ++    L  +S+EF
Sbjct  305   VLISESAKRVFLLPQCYAEKQALGKASQEF  334


 Score = 92.8 bits (229),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 45/81 (56%), Positives = 54/81 (67%), Gaps = 0/81 (0%)
 Frame = -2

Query  789  IKEGTHSFGEFSKCYAEKQACGKIDQEILDTWVNPAVWEISGHMVLKRREDYDDASEDYA  610
            I E         +CYAEKQA GK  QE LD  +NPAVWE+SGH+VLKRR+DYDDASE   
Sbjct  307  ISESAKRVFLLPQCYAEKQALGKASQEFLDMRINPAVWELSGHLVLKRRKDYDDASEATL  366

Query  609  WRLLSEVSLSEERFEEVKAYV  547
             R L E +LS   F+E+K+ V
Sbjct  367  CRFLVEATLSGAEFQELKSCV  387



>ref|XP_003063182.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH52318.1| predicted protein [Micromonas pusilla CCMP1545]
Length=607

 Score =   291 bits (744),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 147/286 (51%), Positives = 188/286 (66%), Gaps = 20/286 (7%)
 Frame = -1

Query  1834  ISFLSDLLLGQWEERMSRGLFRYDVTSCETKIIPGTFGFIAQLNEGRHLKKRPTEFRVDQ  1655
             +S    +LL  WE+R + GLFRYDVT+C+TKIIPG  GF+AQ NEGR  KKRPTEF+VDQ
Sbjct  137   VSPFDRILLAAWEDRFAAGLFRYDVTACDTKIIPGRIGFVAQYNEGRATKKRPTEFKVDQ  196

Query  1654  VLQPFDENKFNFTKIGQEEVLFRFEPSN--DCKSHYLPSGLVD--------ARSGSPTVL  1505
             V Q FD  KFNFTK  + E+LFRF P      +S Y+ S  ++          S +PTV+
Sbjct  197   VCQEFDAGKFNFTKADKAEILFRFSPGGVGQTRSEYVASAPIEYADADRVRGESDAPTVV  256

Query  1504  AINVSPIEYGHVLLIPRVLDCLPQRIDHDSFFVAMHLAKEAADPFFRVGYNSLGAFATIN  1325
              INVSPIEYGHVLL PRV DCLPQRI  D+   A+ +A E+ +P+FRVGYNSLGA+ATIN
Sbjct  257   FINVSPIEYGHVLLTPRVTDCLPQRISKDALLPALFMAAESRNPYFRVGYNSLGAYATIN  316

Query  1324  HLHFQAYYLQVPFPVEKTPTREI-MRGREQG---DGGIVVSQLLNYPARALLFE------  1175
             HLHFQAYYL   FP+E+ PTR + +    +G     G+VV  +++YPAR L FE      
Sbjct  317   HLHFQAYYLMEAFPIERAPTRALGLHVHAEGGALSSGVVVKNVVDYPARCLCFERADPSR  376

Query  1174  GGSTVRDLSDAVANSCISLQNNNIPFNLLISERGNKVFLFPQVHSN  1037
             G      L+ ++A  C  LQ  ++PFNLL+++ G +VFL P   S 
Sbjct  377   GSDGFESLAASLAVCCERLQARDVPFNLLVADHGARVFLIPNQFSQ  422


 Score = 62.0 bits (149),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 30/67 (45%), Positives = 46/67 (69%), Gaps = 0/67 (0%)
 Frame = -2

Query  747  YAEKQACGKIDQEILDTWVNPAVWEISGHMVLKRREDYDDASEDYAWRLLSEVSLSEERF  568
            ++++ A G +  +++ T VNPAV+EISGH++ K+RED++   E  A RLLS  SLSEE +
Sbjct  420  FSQRAAKGALPADVVSTGVNPAVFEISGHLLYKQREDFETCDEASATRLLSCASLSEEDY  479

Query  567  EEVKAYV  547
            +   A V
Sbjct  480  DAACADV  486



>gb|KDO36138.1| hypothetical protein CISIN_1g045630mg, partial [Citrus sinensis]
Length=240

 Score =   274 bits (700),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 134/243 (55%), Positives = 182/243 (75%), Gaps = 16/243 (7%)
 Frame = -1

Query  1768  YDVTSCETKIIPGTFGFIAQLNEGRHLKKRPTEFRVDQVLQPFDENKFNFTKIGQEEVLF  1589
             YD+T+ ETK+I G +GFIAQLN  RHLK+RP EFRV++V Q           +GQEEVLF
Sbjct  14    YDITAYETKVISGQYGFIAQLNYPRHLKERPAEFRVEKVYQ-----------MGQEEVLF  62

Query  1588  RFEPSNDCKSHYLPSGLVDARSGSPTVLAINVSPIEYGHVLLIPRVLDCLPQRIDHDSFF  1409
             +FE S DC+  +  S   D  + SP+V++INVSPI+YGHVLLIPRVL+CL QRID  SF 
Sbjct  63    QFEASEDCEVQFHLSAPFDVEN-SPSVVSINVSPIKYGHVLLIPRVLECLLQRIDCVSFL  121

Query  1408  VAMHLAKEAADPFFRVGYNSLGAFATINHLHFQAYYLQVPFPVEKTPTREIMRGREQGDG  1229
             +A++ A  A +P FR+GYNSLGAFATINHLHFQA Y+ +PFP++K PTR+I+       G
Sbjct  122   LALYTAAGAGNPHFRLGYNSLGAFATINHLHFQASYMALPFPIQKAPTRKII----TSGG  177

Query  1228  GIVVSQLLNYPARALLFEGGSTVRDLSDAVANSCISLQNNNIPFNLLISERGNKVFLFPQ  1049
              + +S+L NYP R L+FEGG++++DLS+ V+++C+ LQ NNIP+N+LI + G ++FLFPQ
Sbjct  178   CVKISELFNYPVRGLVFEGGNSLQDLSNTVSDACVCLQENNIPYNVLIVDCGKRIFLFPQ  237

Query  1048  VHS  1040
              ++
Sbjct  238   RYA  240



>ref|XP_005850444.1| hypothetical protein CHLNCDRAFT_57139 [Chlorella variabilis]
 gb|EFN58342.1| hypothetical protein CHLNCDRAFT_57139 [Chlorella variabilis]
Length=490

 Score =   280 bits (717),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 139/283 (49%), Positives = 185/283 (65%), Gaps = 26/283 (9%)
 Frame = -1

Query  1831  SFLSDLLLGQWEERMSRGLFRYDVTSCETKIIPGTFGFIAQLNEGRHLKKRPTEFRVDQV  1652
             S L  LLLG+WE+R   GLFRYDVT+C TK++PG++GFIAQ NEGR  KKRPTEFRVD V
Sbjct  137   SVLDALLLGEWEDRAEAGLFRYDVTACPTKLVPGSYGFIAQCNEGRLSKKRPTEFRVDLV  196

Query  1651  LQPFDENKFNFTKIGQEEVLFRFEPSND-----CKSHYLPSGLVDARSGSPTVLAINVSP  1487
              QP+D  KFNFTK  Q+EVLF FEP+        K  + P+    A   SP ++ INVSP
Sbjct  197   AQPYDAAKFNFTKALQQEVLFMFEPAGGRGGRRAKPAFRPAAQPRA---SPNLVYINVSP  253

Query  1486  IEYGHVLLIPRVLDCLPQRIDHDSFFVAMHLAKEAADPFFRVGYNSLGAFATINHLHFQA  1307
             IEYGHVLL+PR LD L Q +  D+  +A+  A+EA +P+FR+ +NSLGA+ TINHLHFQA
Sbjct  254   IEYGHVLLVPRALDALCQLVTPDTLLLALQFAREADNPYFRLAFNSLGAYGTINHLHFQA  313

Query  1306  YYLQVPFPVEKTPTREIM------------------RGREQGDGGIVVSQLLNYPARALL  1181
             YYL  P+ +E+ PT  +                   +GR +   G+ V QL  YP R+L+
Sbjct  314   YYLAAPYAMERAPTVPLELEGLGAGAGAGSPPPQGGKGRRRAATGVRVDQLREYPVRSLV  373

Query  1180  FEGGSTVRDLSDAVANSCISLQNNNIPFNLLISERGNKVFLFP  1052
             FE G ++R++++ V  +C  L   N+P NL I++ G ++FLFP
Sbjct  374   FEAGDSLREVAELVGTACQRLTAANVPHNLFIADCGARIFLFP  416


 Score = 86.7 bits (213),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 38/67 (57%), Positives = 53/67 (79%), Gaps = 0/67 (0%)
 Frame = -2

Query  759  FSKCYAEKQACGKIDQEILDTWVNPAVWEISGHMVLKRREDYDDASEDYAWRLLSEVSLS  580
            F  C+AEK+A G+I +++L+T V+PA WEI+GH+VLKR++DY+  S++ AWRLL   S S
Sbjct  415  FPNCFAEKKARGQIPEDVLETQVDPAAWEIAGHIVLKRQQDYEAVSQESAWRLLEFASCS  474

Query  579  EERFEEV  559
            EERF EV
Sbjct  475  EERFAEV  481



>ref|XP_005649851.1| hypothetical protein COCSUDRAFT_13851 [Coccomyxa subellipsoidea 
C-169]
 gb|EIE25307.1| hypothetical protein COCSUDRAFT_13851 [Coccomyxa subellipsoidea 
C-169]
Length=367

 Score =   271 bits (694),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 134/268 (50%), Positives = 182/268 (68%), Gaps = 7/268 (3%)
 Frame = -1

Query  1831  SFLSDLLLGQWEERMSRGLFRYDVTSCETKIIPGTFGFIAQLNEGRHLKKRPTEFRVDQV  1652
             S L  +LL +WE+R  +GLFRYDVT+C TK++PG +GF+AQ NEGR  KKRPTEF VDQV
Sbjct  39    SLLDTVLLAEWEDRAEQGLFRYDVTACPTKVVPGAYGFVAQFNEGRGSKKRPTEFCVDQV  98

Query  1651  LQPFDENKFNFTKIGQEEVLFRFEPSNDCK--SHYLPSGLVDARSGSPTVLAINVSPIEY  1478
             +Q FD  KFNFTK  Q+EVLF+FE ++     S +LP   V   SGSP ++ INVSPIEY
Sbjct  99    VQRFDNGKFNFTKALQKEVLFQFEAADMSSKGSAFLPLAPV---SGSPNLVFINVSPIEY  155

Query  1477  GHVLLIPRVLDCLPQRIDHDSFFVAMHLAKEAADPFFRVGYNSLGAFATINHLHFQAYYL  1298
             GHVLL+PR LD L Q +  D+  +A+  A EAA+P+FR+ +NSLGA+ T+NHLHFQAYY+
Sbjct  156   GHVLLVPRALDRLNQLVQPDTLKLALQFAHEAANPYFRLAFNSLGAYGTVNHLHFQAYYM  215

Query  1297  QVPFPVEKTPTREIMRGREQGDGGIVVSQLLNYPARALLFEGGSTVRDLSDAVANSCISL  1118
               PF VE+ PT ++   R+     + V+ L +YP   L+FE   ++ +L+  V  +C  L
Sbjct  216   AAPFAVERAPTVDLCCLRKYRH--VRVAMLADYPVCGLVFEASDSIDELASVVGEACQRL  273

Query  1117  QNNNIPFNLLISERGNKVFLFPQVHSNS  1034
                NIP NL + + G ++FLFP   + +
Sbjct  274   SAANIPHNLFVVDCGQRIFLFPNAFARA  301


 Score = 64.7 bits (156),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 28/61 (46%), Positives = 42/61 (69%), Gaps = 0/61 (0%)
 Frame = -2

Query  759  FSKCYAEKQACGKIDQEILDTWVNPAVWEISGHMVLKRREDYDDASEDYAWRLLSEVSLS  580
            F   +A  +A G + +++LD+ V+PA +EISGH++ KR +DY+  S+D  WRLLS  S S
Sbjct  294  FPNAFARAKAKGLVPEDLLDSQVDPAAFEISGHIIYKRSQDYEHVSQDAVWRLLSYASYS  353

Query  579  E  577
            E
Sbjct  354  E  354



>dbj|BAB90526.1| B1065G12.8 [Oryza sativa Japonica Group]
Length=352

 Score =   265 bits (677),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 131/232 (56%), Positives = 163/232 (70%), Gaps = 5/232 (2%)
 Frame = -1

Query  1744  KIIPGTFGFIAQLNEGRHLKKRPTEFRVDQVLQPFDENKFNFTKIGQEEVLFRFEPSNDC  1565
             +++PG   F+A L EGR  KKRPT+F ++QVLQPFD  KFNFTK+  EEV+F F+ S + 
Sbjct  32    EVLPGEHNFVATLIEGRDQKKRPTQFGMNQVLQPFDSVKFNFTKVSPEEVIFTFKESQND  91

Query  1564  KSHYLPSGLVDARSGSPTVLAINVSPIEYGHVLLIPRVLDCLPQRIDHDSFFVAMHLAKE  1385
                Y    +  A + SPT + INVSPI Y HVLLIPR+ DCLPQR+D +SF +AM++A E
Sbjct  92    SVKYF-DNVPHAVAASPTAILINVSPIGYCHVLLIPRIQDCLPQRVDKESFLLAMYVASE  150

Query  1384  AADPFFRVGYNSLGAFATINHLHFQAYYLQVPFPVEKTPTREIMRGREQGDGGIVVSQLL  1205
             A DPFFRVGYNSLG FATINHLHFQAYYL+V +PVEK  T ++         G+ + QL+
Sbjct  151   AKDPFFRVGYNSLGGFATINHLHFQAYYLKVQYPVEKALTEKLT----TLGNGVSIIQLV  206

Query  1204  NYPARALLFEGGSTVRDLSDAVANSCISLQNNNIPFNLLISERGNKVFLFPQ  1049
              YP    +FEGG+ + DLSD V+  CI LQ NN PFN LISE G +VFL PQ
Sbjct  207   QYPVSGFVFEGGACLEDLSDVVSKVCIFLQENNKPFNALISESGKRVFLLPQ  258


 Score = 95.1 bits (235),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 45/77 (58%), Positives = 58/77 (75%), Gaps = 4/77 (5%)
 Frame = -2

Query  753  KCYAEKQACGKIDQEILDTWVNPAVWEISGHMVLKRREDYDDASEDYAWRLLSEVSLSEE  574
            +CYAEKQA G++ QE LD  +NPAVWE+SGH+VLKRR+DYD+ASE    R L E SLSE 
Sbjct  273  QCYAEKQALGRVSQEFLDMRINPAVWELSGHLVLKRRKDYDEASEATICRFLVEASLSES  332

Query  573  RFEEVKA----YVSRAA  535
             F+E+K+    ++S AA
Sbjct  333  EFQELKSCILEFLSSAA  349



>ref|XP_001420569.1| predicted protein, partial [Ostreococcus lucimarinus CCE9901]
 gb|ABO98862.1| predicted protein, partial [Ostreococcus lucimarinus CCE9901]
Length=319

 Score =   261 bits (667),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 137/265 (52%), Positives = 172/265 (65%), Gaps = 12/265 (5%)
 Frame = -1

Query  1816  LLLGQWEERMSRGLFRYDVTSCETKIIPGTFGFIAQLNEGRHLKKRPTEFRVDQVLQPFD  1637
             +L+  WE+R + GLFRYDVT+  TK+I G   ++AQ N GR   KRPTEF VD+V Q FD
Sbjct  3     ILISAWEDRFAGGLFRYDVTAVSTKVIDGKKKYVAQFNIGRATNKRPTEFSVDKVCQDFD  62

Query  1636  ENKFNFTKIGQEEVLFRFEP------SNDCKSHYLPSGLVDARSGSPTVLAINVSPIEYG  1475
              NKFNFTK   +EVLF F         N  +S + PS  V     SPTV+ INVSPIEYG
Sbjct  63    ANKFNFTKADLKEVLFSFTKLAGEADENVSRSVFEPSAAV---GESPTVVLINVSPIEYG  119

Query  1474  HVLLIPRVLDCLPQRIDHDSFFVAMHLAKEAADPFFRVGYNSLGAFATINHLHFQAYYLQ  1295
             HVLL PRV D LPQ+I  ++   A+++A E+ +P+FRVGYNSLGA+ATINHLHFQAYYL 
Sbjct  120   HVLLCPRVTDMLPQQISPENLLPALYMAAESRNPYFRVGYNSLGAYATINHLHFQAYYLM  179

Query  1294  VPFPVEKTPTREIMRGREQGDGGIVVSQLLNYPARALLFEGGSTVRDLSDAVANSCISLQ  1115
               FP+E+  T EI  G     G   V ++  YP R L FE G +  +L+  V    + LQ
Sbjct  180   EAFPIERANTVEIFPGTH---GDCTVYRVNGYPVRCLCFEVGDSFEELASLVGGCAVKLQ  236

Query  1114  NNNIPFNLLISERGNKVFLFPQVHS  1040
               NIPFN+LI++ G +VFL PQV S
Sbjct  237   GANIPFNILIADHGARVFLIPQVFS  261


 Score = 58.9 bits (141),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 31/79 (39%), Positives = 46/79 (58%), Gaps = 1/79 (1%)
 Frame = -2

Query  804  LNSLRIKEGTHSFGEFSKCYAEKQACGKIDQEILDTWVNPAVWEISGHMVLKRREDYDDA  625
             N L    G   F    + ++ + A  KI + ++ T VNPAV+EISGH++ K+  DYD  
Sbjct  242  FNILIADHGARVF-LIPQVFSIRIANNKIPEHVIHTGVNPAVFEISGHLLYKQESDYDQC  300

Query  624  SEDYAWRLLSEVSLSEERF  568
            +E  A  LL+  SL+EE+F
Sbjct  301  TETSAEELLACASLTEEQF  319



>ref|XP_002948819.1| hypothetical protein VOLCADRAFT_58668 [Volvox carteri f. nagariensis]
 gb|EFJ50199.1| hypothetical protein VOLCADRAFT_58668 [Volvox carteri f. nagariensis]
Length=391

 Score =   235 bits (599),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 130/276 (47%), Positives = 163/276 (59%), Gaps = 18/276 (7%)
 Frame = -1

Query  1831  SFLSDLLLGQWEERMSRGLFRYDVTSCETKIIPGTFGFIAQLNEGRHLKKRPTEFRVDQV  1652
             S L   L+  WE+R  RGLFRYDVT C T+++PG+ GFIAQLNEGR  KKRPTE  +D+V
Sbjct  36    SLLESALMTLWEDRADRGLFRYDVTLCPTRVLPGSRGFIAQLNEGRATKKRPTEVTLDRV  95

Query  1651  LQPFDENKFNFTKIGQEEVLFRFEPSNDCKS----------HYLPS-----GLVDARSGS  1517
             LQPFD  KFNF K    E L  F P +                LPS         A  GS
Sbjct  96    LQPFDSAKFNFKKAAMAEALVGFFPDDAGSGGGAGGGNGGRSLLPSVAPLGAAAVAAGGS  155

Query  1516  PTVLAINVSPIEYGHVLLIPRVLDCLPQRIDHDSFFVAMHLAKEAADPFFRVGYNSLGAF  1337
             P ++ INVSPI+YGHVLL+PRVLD LPQ +   +  +A+  A E  +  FRVGYNSLGA+
Sbjct  156   PNLVLINVSPIDYGHVLLVPRVLDNLPQALSCGTVLLALQFAGELGNSHFRVGYNSLGAY  215

Query  1336  ATINHLHFQAYYLQVPFPVEKTPTREIMRGREQGDGGIVVSQLLNYPARALLFEGGSTVR  1157
             ATINHLHFQ+Y+L    P E   T  +          + VS+L++YP  A + E    + 
Sbjct  216   ATINHLHFQSYFLAKTMPCEAAATVPLPGVGVLAGAAVRVSRLVDYPVNAFVIEA---LT  272

Query  1156  DLSDAVANSCISLQNNNIPFNLLISERGNKVFLFPQ  1049
              L  ++ +    LQ  N PFNLLIS+ G +VFLFPQ
Sbjct  273   SLETSLYDCAERLQAANQPFNLLISDAGRRVFLFPQ  308


 Score = 89.7 bits (221),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 40/77 (52%), Positives = 56/77 (73%), Gaps = 0/77 (0%)
 Frame = -2

Query  798  SLRIKEGTHSFGEFSKCYAEKQACGKIDQEILDTWVNPAVWEISGHMVLKRREDYDDASE  619
            +L I +       F +C+AE+QA G I  E+L+T VNPA +EI+GH+VLKR +DY +A+E
Sbjct  293  NLLISDAGRRVFLFPQCFAERQAAGLIPPELLETGVNPAAFEIAGHLVLKRTQDYTEATE  352

Query  618  DYAWRLLSEVSLSEERF  568
            D A +LL++ SLSEERF
Sbjct  353  DLAMQLLAQASLSEERF  369



>ref|XP_007508728.1| predicted protein [Bathycoccus prasinos]
 emb|CCO20345.1| predicted protein [Bathycoccus prasinos]
Length=611

 Score =   234 bits (598),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 127/280 (45%), Positives = 181/280 (65%), Gaps = 21/280 (8%)
 Frame = -1

Query  1816  LLLGQWEERMSRGLFRYDVTSCETKIIPGTFGFIAQLNEGRHLKKRPTEFRVDQVLQPFD  1637
             +L+  WE+R + GLFRYDVT+  T++I G   ++AQ NEGR  KKR TEF++D V Q FD
Sbjct  231   VLIEAWEDRFAGGLFRYDVTAVLTRLIEGPSRYVAQYNEGRATKKRQTEFKMDLVCQEFD  290

Query  1636  ENKFNFTKIGQEEVLFRFEPSNDC----------KSHYLPSGLVDARSGSPTVLAINVSP  1487
               KFNFTK  Q+EVLF FE  ++           ++ ++  G +   S SP ++ INVSP
Sbjct  291   GKKFNFTKADQKEVLFTFEEQDEDEEENENEEPGRTEFIERGEI---SKSPNLVLINVSP  347

Query  1486  IEYGHVLLIPRVLDCLPQRIDHDSFFVAMHLAKEAADPFFRVGYNSLGAFATINHLHFQA  1307
             IEYGHVLL PRV + LPQ+I  D+    + +  E+ +P+FRVGYNSLGA+ATINHLHFQA
Sbjct  348   IEYGHVLLCPRVSEMLPQQIFADALIPPLRMCAESKNPYFRVGYNSLGAYATINHLHFQA  407

Query  1306  YYLQVPFPVEKTPTR----EIMRGREQGDGGIVVSQLL---NYPARALLFEGGST-VRDL  1151
             YYL   FP+E+  ++    ++ +  ++  G  V ++ L   +YP R ++FE GS    DL
Sbjct  408   YYLMEAFPIERALSKPFAEDVFKNPKRPMGKQVHAECLRVYDYPVRCIVFELGSKGFVDL  467

Query  1150  SDAVANSCISLQNNNIPFNLLISERGNKVFLFPQVHSNSV  1031
             +  +  +C  LQ  NIPFNLL+++ G +VFL PQ+ S+ +
Sbjct  468   AKWIGRACSRLQKRNIPFNLLMTDHGARVFLIPQIFSHKI  507


 Score = 61.6 bits (148),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 33/79 (42%), Positives = 46/79 (58%), Gaps = 1/79 (1%)
 Frame = -2

Query  804  LNSLRIKEGTHSFGEFSKCYAEKQACGKIDQEILDTWVNPAVWEISGHMVLKRREDYDDA  625
             N L    G   F    + ++ K A  KI + I+DT +NPAV+EISGHM+ KR EDY+  
Sbjct  485  FNLLMTDHGARVF-LIPQIFSHKIAQNKIPEWIVDTGINPAVFEISGHMLFKREEDYEIC  543

Query  624  SEDYAWRLLSEVSLSEERF  568
            SE  A  +L+  S+ E+ F
Sbjct  544  SEAMASEILASASIEEDEF  562



>gb|KFM25983.1| GDP-L-galactose phosphorylase 1 [Auxenochlorella protothecoides]
Length=433

 Score =   223 bits (568),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 116/260 (45%), Positives = 150/260 (58%), Gaps = 40/260 (15%)
 Frame = -1

Query  1831  SFLSDLLLGQWEERMSRGLFRYDVTSCETKIIPGTFGFIAQLNEGRHLKKRPTEFRVDQV  1652
             S LS LLL +WE+R  RGLFRYDVT+C T+++PG  GF+AQ NEGR  KKRPTEFRVDQV
Sbjct  126   SVLSMLLLAEWEDRAERGLFRYDVTACPTRVLPGHLGFVAQCNEGRASKKRPTEFRVDQV  185

Query  1651  LQPFDENKFNFTKIGQEEVLFRFEPSNDCKSHYLPSGLVDARSGSPTVLAINVSPIEYGH  1472
              Q FD  KFNFTK  Q+E                                       YGH
Sbjct  186   TQAFDPAKFNFTKAAQKE---------------------------------------YGH  206

Query  1471  VLLIPRVLDCLPQRIDHDSFFVAMHLAKEAADPFFRVGYNSLGAFATINHLHFQAYYLQV  1292
             VLL+P  L    Q +D  S  +A+  A+EA  P+ R+G+NSLGA+ TINHLHFQAY+L  
Sbjct  207   VLLVPDALSRRAQAVDTASLLLALQFAREADTPYLRLGFNSLGAYGTINHLHFQAYFLYA  266

Query  1291  PFPVEKTPTREIMRGREQGDGGIVVSQLLNYPARALLFEGGSTVRDLSDAVANSCISLQN  1112
             P   E+ P  E++R       G+ V+ L  YP   L+F+ G ++ DL+  V  +C +L  
Sbjct  267   PLAAERAPAAELLRA-GGALAGVSVASLEGYPVAGLVFQAGGSLADLARCVGAACEALAA  325

Query  1111  NNIPFNLLISERGNKVFLFP  1052
               +P NLLI++ G +VFLFP
Sbjct  326   AGVPHNLLIADCGVRVFLFP  345


 Score = 71.2 bits (173),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 30/67 (45%), Positives = 48/67 (72%), Gaps = 0/67 (0%)
 Frame = -2

Query  759  FSKCYAEKQACGKIDQEILDTWVNPAVWEISGHMVLKRREDYDDASEDYAWRLLSEVSLS  580
            F   +AE++A G+I ++++++ V+PA WEI+GH+V+KR++DYD AS++ AW LLS  S  
Sbjct  344  FPNAFAERKARGEIPEDVVESQVDPACWEIAGHIVMKRQQDYDTASQESAWHLLSCASYD  403

Query  579  EERFEEV  559
               F  V
Sbjct  404  PANFARV  410



>ref|XP_001693879.1| predicted protein [Chlamydomonas reinhardtii]
 gb|EDP09133.1| predicted protein [Chlamydomonas reinhardtii]
Length=369

 Score =   217 bits (552),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 128/300 (43%), Positives = 177/300 (59%), Gaps = 38/300 (13%)
 Frame = -1

Query  1831  SFLSDLLLGQWEERMSRGLFRYDVTSCETKIIPGTFGFIAQLNEGRHLKKRPTEFRVDQV  1652
             S L  +++  WE+R  RG+FRYDV+ CET+++PG  GF+AQLNEGR  KKRPTEF  D+V
Sbjct  4     SLLEGVVMALWEDRADRGMFRYDVSQCETRVLPGPAGFVAQLNEGRATKKRPTEFSADRV  63

Query  1651  LQPFDENKFNFTKIGQEEVLFRFEPS-----NDCKSHYLPSGLVDARSGSPTVLAINVSP  1487
             +QPFD  +F+F K    EVLF F+           +   P  L+    GSP ++ INVSP
Sbjct  64    MQPFDPARFHFNKAAMGEVLFAFQADATASATSATATAAPRLLL---PGSPNLVLINVSP  120

Query  1486  IEYGHVLLIPRVLDCLPQRIDHDSFFVAMHLAKE--------AADPFFRVGYNSLGAFAT  1331
             I++ HVLL+PRVLDCLPQ +  D+  +A+  A E        +    FRVGYNSLGAFAT
Sbjct  121   IDHCHVLLVPRVLDCLPQALTPDTALLALQFAAELGGSSSSRSGSGAFRVGYNSLGAFAT  180

Query  1330  INHLHFQAYYLQVPFPVEKTPT---------------REIMRGREQ-----GDGGIVVSQ  1211
             INHLHF AY+L    P E+ PT               +   RG E+       G + VS+
Sbjct  181   INHLHFHAYHLPAALPCERAPTCPLPGALARPLAASQQPRKRGAEEVAGAGSAGSVRVSR  240

Query  1210  LLNYPARALL--FEGGSTVRDLSDAVANSCISLQNNNIPFNLLISERGNKVFLFPQVHSN  1037
             L+ YP R+ +   E G+ +  ++  VA +  ++Q  N PFN++ S+ G +VFLFPQ ++ 
Sbjct  241   LVGYPVRSFVVEAEAGAALEAVAAVVARAADAMQAANQPFNIIASDGGRRVFLFPQCYAE  300


 Score = 91.3 bits (225),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 43/67 (64%), Positives = 54/67 (81%), Gaps = 0/67 (0%)
 Frame = -2

Query  759  FSKCYAEKQACGKIDQEILDTWVNPAVWEISGHMVLKRREDYDDASEDYAWRLLSEVSLS  580
            F +CYAE+QA G++ +E+LDT VNPA +EI+GH+VLKR ED+  A E +A RLLS VSLS
Sbjct  294  FPQCYAERQAAGEVPEELLDTGVNPASFEIAGHLVLKRAEDFALADEAWAARLLSGVSLS  353

Query  579  EERFEEV  559
            EERF EV
Sbjct  354  EERFMEV  360



>ref|XP_010034466.1| PREDICTED: GDP-L-galactose phosphorylase 2-like [Eucalyptus grandis]
Length=368

 Score =   216 bits (551),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 113/203 (56%), Positives = 139/203 (68%), Gaps = 20/203 (10%)
 Frame = -1

Query  2041  MLTIKRVPTVVSNYQDDAPEDSKP------ESLGCGRNCLGQCCLPVSCLPLFAFKNDEH  1880
             MLTIKRV TVVSNYQ++  E          E+ GCGRNCLG+CCLP S LPL+ FK    
Sbjct  1     MLTIKRVATVVSNYQEEGDEKDNAAVAVEGETKGCGRNCLGKCCLPASDLPLYTFKVAGE  60

Query  1879  KCDGDWNYLSYGECP-ISFLSDLLLGQWEERMSRGLFRYDVTSCETKIIPGTFGFIAQLN  1703
              C  +   + Y E P  SFL +LLLGQWE RM+RGLFRYDVT+C+TK+IP  +GFI QLN
Sbjct  61    DCTEE--SIFYQEPPETSFLLNLLLGQWENRMNRGLFRYDVTTCKTKVIPSDYGFIVQLN  118

Query  1702  EGRHLKKRPTEFRVDQVLQPFDENKFNFTKIGQEEVLFRFEPSNDCKSHYLPSGLVDARS  1523
             EG+HLKK PTEFRV+QVLQ FDE KFNFTK+G EEVLF FE S+DC S++ PS       
Sbjct  119   EGQHLKKCPTEFRVNQVLQDFDEKKFNFTKVGHEEVLFMFEQSDDCYSYFFPS-------  171

Query  1522  GSPTVLA---INVSPIEYGHVLL  1463
              +P +      N S ++  H+++
Sbjct  172   -APAIFKPSMFNFSSLKTSHLMM  193


 Score =   103 bits (256),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 46/63 (73%), Positives = 57/63 (90%), Gaps = 0/63 (0%)
 Frame = -2

Query  750  CYAEKQACGKIDQEILDTWVNPAVWEISGHMVLKRREDYDDASEDYAWRLLSEVSLSEER  571
            CYAEKQA G++ QE+L+T VNPA+WEI GH+VLKRR+D+++ASEDYAWRLL+EVSLSEE 
Sbjct  224  CYAEKQARGEVSQELLETQVNPAIWEIGGHIVLKRRKDFENASEDYAWRLLAEVSLSEES  283

Query  570  FEE  562
            F E
Sbjct  284  FRE  286



>gb|AEZ51834.1| GDP-galactose:glucose-1-phosphate guanyltransferase [Chlamydomonas 
reinhardtii]
Length=618

 Score =   220 bits (561),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 134/316 (42%), Positives = 180/316 (57%), Gaps = 54/316 (17%)
 Frame = -1

Query  1831  SFLSDLLLGQWEERMSRGLFRYDVTSCETKIIPGTFGFIAQLNEGRHLKKRPTEFRVDQV  1652
             S L  +++  WE+R  RG+FRYDV+ CET+++PG  GF+AQLNEGR  KKRPTEF  D+V
Sbjct  237   SLLEGVVMALWEDRADRGMFRYDVSQCETRVLPGPAGFVAQLNEGRATKKRPTEFSADRV  296

Query  1651  LQPFDENKFNFTKIGQEEVLFRFE--------------------PSND-CKSHYLPSGLV  1535
             +QPFD  +F+F K    EVLF F+                    PS    KS  L S  V
Sbjct  297   MQPFDPARFHFNKAAMGEVLFAFQADATASATSATATAAPRLLLPSAPMAKSALLASNPV  356

Query  1534  DARSGSPTVLAINVSPIEYGHVLLIPRVLDCLPQRIDHDSFFVAMHLAKE--------AA  1379
                SGSP ++ INVSPI++ HVLL+PRVLDCLPQ +  D+  +A+  A E        + 
Sbjct  357   ---SGSPNLVLINVSPIDHCHVLLVPRVLDCLPQALTPDTALLALQFAAELGGSSSSRSG  413

Query  1378  DPFFRVGYNSLGAFATINHLHFQAYYLQVPFPVEKTPT---------------REIMRGR  1244
                FRVGYNSLGAFATINHLHF AY+L    P E+ PT               +   RG 
Sbjct  414   SGAFRVGYNSLGAFATINHLHFHAYHLPAALPCERAPTCPLPGALARPLAASQQPRKRGA  473

Query  1243  EQ-----GDGGIVVSQLLNYPARALL--FEGGSTVRDLSDAVANSCISLQNNNIPFNLLI  1085
             E+       G + VS+L+ YP R+ +   E G+ +  ++  VA +  ++Q  N PFN++ 
Sbjct  474   EEVAGAGSAGSVRVSRLVGYPVRSFVVEAEAGAALEAVAAVVARAADAMQAANQPFNIIA  533

Query  1084  SERGNKVFLFPQVHSN  1037
             S  G +VFLFPQ ++ 
Sbjct  534   SNGGRRVFLFPQCYAE  549


 Score = 92.4 bits (228),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 43/67 (64%), Positives = 54/67 (81%), Gaps = 0/67 (0%)
 Frame = -2

Query  759  FSKCYAEKQACGKIDQEILDTWVNPAVWEISGHMVLKRREDYDDASEDYAWRLLSEVSLS  580
            F +CYAE+QA G++ +E+LDT VNPA +EI+GH+VLKR ED+  A E +A RLLS VSLS
Sbjct  543  FPQCYAERQAAGEVPEELLDTGVNPASFEIAGHLVLKRAEDFALADEAWAARLLSGVSLS  602

Query  579  EERFEEV  559
            EERF EV
Sbjct  603  EERFMEV  609



>dbj|BAM76580.1| VTC2, partial [Brassica oleracea var. italica]
Length=164

 Score =   201 bits (510),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 88/142 (62%), Positives = 120/142 (85%), Gaps = 4/142 (3%)
 Frame = -1

Query  1465  LIPRVLDCLPQRIDHDSFFVAMHLAKEAADPFFRVGYNSLGAFATINHLHFQAYYLQVPF  1286
             LIPRVLDCLPQRIDH S  +A+H+A EAA+P+FR+GYNSLGAFATINHLHFQAYYL +PF
Sbjct  1     LIPRVLDCLPQRIDHKSLLLALHMAAEAANPYFRLGYNSLGAFATINHLHFQAYYLAMPF  60

Query  1285  PVEKTPTREIMRGREQGDGGIVVSQLLNYPARALLFEGGSTVRDLSDAVANSCISLQNNN  1106
             P+EK P+++++        G+ +S+LL+YP R+LLFEGGS+++DLSD V+++C+ LQNNN
Sbjct  61    PLEKAPSKKMVTTA----SGVKISELLSYPVRSLLFEGGSSMQDLSDTVSDACVCLQNNN  116

Query  1105  IPFNLLISERGNKVFLFPQVHS  1040
             IPFN+LI++ G ++FL PQ ++
Sbjct  117   IPFNILIADCGRQIFLMPQCYA  138


 Score = 51.2 bits (121),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 21/32 (66%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = -2

Query  759  FSKCYAEKQACGKIDQEILDTWVNPAVWEISG  664
              +CYAEKQA G++  E+L+T VNPAVWEISG
Sbjct  133  MPQCYAEKQALGEVSPEVLETQVNPAVWEISG  164



>dbj|BAJ91935.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=252

 Score =   203 bits (516),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 91/146 (62%), Positives = 119/146 (82%), Gaps = 0/146 (0%)
 Frame = -1

Query  1477  GHVLLIPRVLDCLPQRIDHDSFFVAMHLAKEAADPFFRVGYNSLGAFATINHLHFQAYYL  1298
             GHVLLIPRVLD LPQ+ID +SF +A+H+A EAA P+FR+ YNSLGAFATINHLHFQAYYL
Sbjct  1     GHVLLIPRVLDRLPQQIDPESFLLALHMAAEAASPYFRLSYNSLGAFATINHLHFQAYYL  60

Query  1297  QVPFPVEKTPTREIMRGREQGDGGIVVSQLLNYPARALLFEGGSTVRDLSDAVANSCISL  1118
              VPFPVEK PT++I   +   + G+ VS+L N+P R L+FE G+T++DL+D V N+CI L
Sbjct  61    SVPFPVEKAPTKKIPLAKCALNSGVKVSKLTNFPVRGLVFERGNTLKDLADVVTNACIWL  120

Query  1117  QNNNIPFNLLISERGNKVFLFPQVHS  1040
             Q NN+PFN+LIS+ G ++F+FPQ ++
Sbjct  121   QENNVPFNVLISDSGRRIFVFPQCYA  146


 Score =   117 bits (294),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 55/77 (71%), Positives = 67/77 (87%), Gaps = 0/77 (0%)
 Frame = -2

Query  759  FSKCYAEKQACGKIDQEILDTWVNPAVWEISGHMVLKRREDYDDASEDYAWRLLSEVSLS  580
            F +CYAEKQA G++ Q++LDT VNPAVWEISGH+VLKRR D+++ASE  AWRLL+EVSLS
Sbjct  141  FPQCYAEKQALGEVSQDLLDTQVNPAVWEISGHIVLKRRTDFEEASEASAWRLLAEVSLS  200

Query  579  EERFEEVKAYVSRAADL  529
            EERFEEVKA + +AA L
Sbjct  201  EERFEEVKACIFQAAGL  217



>ref|NP_001045110.1| Os01g0901300 [Oryza sativa Japonica Group]
 dbj|BAF07024.1| Os01g0901300, partial [Oryza sativa Japonica Group]
Length=224

 Score =   193 bits (490),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 95/164 (58%), Positives = 116/164 (71%), Gaps = 6/164 (4%)
 Frame = -1

Query  1495  VSPIEYGHVLLIPRVLDCLPQRIDHDSFFVAMHLAKEAADPFFRVGYNSLGAFATINHLH  1316
             VSPI Y HVLLIPR+ DCLPQR+D +SF +AM++A EA DPFFRVGYNSLG FATINHLH
Sbjct  1     VSPIGYCHVLLIPRIQDCLPQRVDKESFLLAMYVASEAKDPFFRVGYNSLGGFATINHLH  60

Query  1315  FQAYYLQVPFPVEKTPTREIMRGREQGDGGIVVSQLLNYPARALLFEGGSTVRDLSDAVA  1136
             FQAYYL+V +PVEK  T ++         G+ + QL+ YP    +FEGG+ + DLSD V+
Sbjct  61    FQAYYLKVQYPVEKALTEKLT----TLGNGVSIIQLVQYPVSGFVFEGGACLEDLSDVVS  116

Query  1135  NSCISLQNNNIPFNLLISERGNKVFLFPQVHSNSVFLS--SREF  1010
               CI LQ NN PFN LISE G +VFL PQ ++    L   S+EF
Sbjct  117   KVCIFLQENNKPFNALISESGKRVFLLPQCYAEKQALGRVSQEF  160


 Score = 95.5 bits (236),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 49/94 (52%), Positives = 64/94 (68%), Gaps = 5/94 (5%)
 Frame = -2

Query  804  LNSLRIKEGTHSFGEFSKCYAEKQACGKIDQEILDTWVNPAVWEISGHMVLKRREDYDDA  625
             N+L  + G   F    +CYAEKQA G++ QE LD  +NPAVWE+SGH+VLKRR+DYD+A
Sbjct  129  FNALISESGKRVF-LLPQCYAEKQALGRVSQEFLDMRINPAVWELSGHLVLKRRKDYDEA  187

Query  624  SEDYAWRLLSEVSLSEERFEEVKA----YVSRAA  535
            SE    R L E SLSE  F+E+K+    ++S AA
Sbjct  188  SEATICRFLVEASLSESEFQELKSCILEFLSSAA  221



>gb|AJC01343.1| GDP-L-galactose-phosphorylase, partial [Myrciaria dubia]
Length=121

 Score =   181 bits (460),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 85/122 (70%), Positives = 105/122 (86%), Gaps = 1/122 (1%)
 Frame = -1

Query  1705  NEGRHLKKRPTEFRVDQVLQPFDENKFNFTKIGQEEVLFRFEPSNDCKSHYLPSGLVDAR  1526
             NEGRHLKKRPT FRVD+VLQPFD +KFNFTK+GQEE+LF+FE S D ++ + P   +DA 
Sbjct  1     NEGRHLKKRPTGFRVDKVLQPFDGSKFNFTKVGQEEILFQFEASEDGEAQFFPKAPIDAD  60

Query  1525  SGSPTVLAINVSPIEYGHVLLIPRVLDCLPQRIDHDSFFVAMHLAKEAADPFFRVGYNSL  1346
             S SP+V+AINVSPIEYGHVLLIPRVL+CLPQRID +SF +A+++A EA +P+FR+ YNSL
Sbjct  61    S-SPSVVAINVSPIEYGHVLLIPRVLECLPQRIDRESFSLALYMAAEAGNPYFRLEYNSL  119

Query  1345  GA  1340
             GA
Sbjct  120   GA  121



>ref|XP_010245347.1| PREDICTED: GDP-L-galactose phosphorylase 1-like [Nelumbo nucifera]
Length=378

 Score =   174 bits (442),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 99/264 (38%), Positives = 151/264 (57%), Gaps = 9/264 (3%)
 Frame = -1

Query  1831  SFLSDLLLGQWEERMSRGLFRYDVTSCETKIIPGTFGFIAQLNEGRHLKKRPTEFRVDQV  1652
             S L  LLL QWE+R  +GL RYD+T+CE K+I G   FIAQ NEG +L   P E    + 
Sbjct  62    SLLDSLLLAQWEDRTWKGLLRYDITTCEMKVIDGKKKFIAQFNEG-YLNPFP-ELEESKF  119

Query  1651  LQPFDENKFNFTKIGQEEVLFRFEPSNDCKSHYLPSGLVDARSGSPTVLAINVSPIEYGH  1472
              +  D  KFN  ++ +E +LF  +        ++ S  +       T++ +NV+P+EYGH
Sbjct  120   FKKEDHLKFNCMRMQREALLFCVKSGEKTNPEFVHSSTI---PNDATLVIVNVNPVEYGH  176

Query  1471  VLLIPRVLDCLPQRIDHDSFFVAMHLAKEAADPFFRVGYNSLGAFATINHLHFQAYYLQV  1292
             V L+P  ++  PQ +D  S  +A+ +A E  +  FRV ++   ++A+   L+FQA Y   
Sbjct  177   VFLVPCGINSPPQCMDSRSLEMAIRVAVEINNCCFRVSFDYSPSYAS--GLYFQACYFSN  234

Query  1291  PFPVEKTPTREIMRGREQGDGGIVVSQLLNYPARALLFEGGSTVRDLSDAVANSCISLQN  1112
             P PVE  P   +    ++   G+ + ++LNYP + L  +G  T++ L   VA  C SLQ 
Sbjct  235   PLPVELMPVVTLCGPWQER--GMHIQEILNYPVKVLSVKGTGTLKSLIKVVAEICSSLQE  292

Query  1111  NNIPFNLLISERGNKVFLFPQVHS  1040
               IP++LL+S+ G KVFLFPQ+H+
Sbjct  293   QEIPYSLLMSDYGTKVFLFPQLHT  316



>dbj|BAJ34309.1| unnamed protein product [Thellungiella halophila]
Length=231

 Score =   167 bits (423),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 75/130 (58%), Positives = 100/130 (77%), Gaps = 4/130 (3%)
 Frame = -1

Query  1429  IDHDSFFVAMHLAKEAADPFFRVGYNSLGAFATINHLHFQAYYLQVPFPVEKTPTREIMR  1250
             IDH S  +A+ +A  AA+ +FR+GYNSLGAFATINHLHFQAYYL +PFP+EK P+ +I  
Sbjct  2     IDHKSLLLAIQMATVAANSYFRLGYNSLGAFATINHLHFQAYYLAMPFPIEKAPSLKITT  61

Query  1249  GREQGDGGIVVSQLLNYPARALLFEGGSTVRDLSDAVANSCISLQNNNIPFNLLISERGN  1070
               +     + +S+LL YP R LLFEGGS+++DLSD VAN+ + LQNNNIPFN+LIS+ G 
Sbjct  62    TND----CVKISKLLKYPVRGLLFEGGSSIKDLSDTVANASVCLQNNNIPFNILISDSGK  117

Query  1069  KVFLFPQVHS  1040
             ++FL PQ ++
Sbjct  118   QIFLLPQCYA  127


 Score =   105 bits (263),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 48/72 (67%), Positives = 59/72 (82%), Gaps = 0/72 (0%)
 Frame = -2

Query  753  KCYAEKQACGKIDQEILDTWVNPAVWEISGHMVLKRREDYDDASEDYAWRLLSEVSLSEE  574
            +CYAEKQA G++  ++LDT VNPAVWE+SGHMVLKR+EDY  ASE+ AW LL+EVSLSEE
Sbjct  124  QCYAEKQALGEVSSKLLDTQVNPAVWEMSGHMVLKRKEDYQGASEEKAWSLLAEVSLSEE  183

Query  573  RFEEVKAYVSRA  538
            RF+EV   +  A
Sbjct  184  RFKEVNTMIFEA  195



>ref|XP_006845994.1| hypothetical protein AMTR_s00155p00050480 [Amborella trichopoda]
 gb|ERN07669.1| hypothetical protein AMTR_s00155p00050480 [Amborella trichopoda]
Length=385

 Score =   167 bits (422),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 95/261 (36%), Positives = 144/261 (55%), Gaps = 9/261 (3%)
 Frame = -1

Query  1831  SFLSDLLLGQWEERMSRGLFRYDVTSCETKIIPGTFGFIAQLNEGRHLKKRPTEFRVDQV  1652
             S +  LLL QWE+R ++GL  YDVT+CETKII G   FIAQ  EG + K       V   
Sbjct  62    SLIDTLLLAQWEDRAAKGLLSYDVTACETKIICGRSKFIAQFIEGWNSKHSLRHVGV---  118

Query  1651  LQPFDENKFNFTKIGQEEVLFRFEPSNDCKSHYLPSGLVDARSGSPTVLAINVSPIEYGH  1472
              +  D +K+    + +EEVLF    S +     + S  V +++   T++ IN +PIEYGH
Sbjct  119   -KDLDPSKYKMMNLNREEVLFCVAESENMTYELISSATVLSKA---TLIIINENPIEYGH  174

Query  1471  VLLIPRVLDCLPQRIDHDSFFVAMHLAKEAADPFFRVGYNSLGAFATINHLHFQAYYLQV  1292
             V +IP  +    Q +D +S  VA  +A    + FF++ Y+S  A  T N+LHF+A Y   
Sbjct  175   VFIIPSAVCGFHQLLDLNSLEVAARIAVHVNNCFFQIVYDSSAASTTGNYLHFEACYFAN  234

Query  1291  PFPVEKTPTREIMRGREQGDGGIVVSQLLNYPARALLFEGGSTVRDLSDAVANSCISLQN  1112
             P PVE  P   ++   E  +  + + ++ +YP + L+F+     + +   VA  C  LQ+
Sbjct  235   PLPVEMVPVIPVLGDWENIE--LKIFEIASYPIKGLVFKCKENFKLMVSLVAEVCSRLQD  292

Query  1111  NNIPFNLLISERGNKVFLFPQ  1049
              ++P  LLI++ G K+FLFPQ
Sbjct  293   QDVPHKLLITDCGTKIFLFPQ  313



>ref|XP_008804719.1| PREDICTED: GDP-L-galactose phosphorylase 1-like [Phoenix dactylifera]
 ref|XP_008804720.1| PREDICTED: GDP-L-galactose phosphorylase 1-like [Phoenix dactylifera]
 ref|XP_008804721.1| PREDICTED: GDP-L-galactose phosphorylase 1-like [Phoenix dactylifera]
Length=382

 Score =   164 bits (415),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 105/284 (37%), Positives = 158/284 (56%), Gaps = 20/284 (7%)
 Frame = -1

Query  1873  DGDWNYLSY---GECPISFLSDLLLGQWEERMSRGLFRYDVTSCETKIIPGTFGFIAQLN  1703
             +G+  Y+S+    E   S L  LLL QWE+  S+GL +YDVT+CE K++ G   F+ QLN
Sbjct  49    EGNDAYVSFPFTAEETQSLLDALLLSQWEDHASKGLLKYDVTTCEIKVVSGEKNFVTQLN  108

Query  1702  EGRHLK-KRPTEFRVDQVLQPFDENKFNFTKIGQEEVLFRFEPSNDCKSHYLPSGLVDAR  1526
             E  +    +  E  V Q L+P    K +  KI +E++LF         S  +PS +V  +
Sbjct  109   ENWNPNFLQNFENNVLQTLEPI---KSSCIKICKEDILFCVAHGEKESSEIIPSTIV-PK  164

Query  1525  SGSPTVLAINVSPIEYGHVLLIPRVLDCLPQRIDHDSFFVAMHLAKEAADPFFRVGYNSL  1346
              G   ++ IN +P+EYGHV L+P  +  LPQ +D   F +   +A E  +  FR+ +N  
Sbjct  165   DG--ILIVINANPVEYGHVFLMPYKIHQLPQSLDKKMFGLITQIAVEVNNCAFRIFFNHS  222

Query  1345  GAFATINHLHFQAYYLQVPFPVEKTPTREIMRGREQGD---GGIVVSQLLNYPARALLFE  1175
              +  + + ++FQA Y   P PVE  PT  +      GD    GI + ++ +YP +AL+F 
Sbjct  223   DSTCS-DQIYFQASYFANPLPVEVLPTVPVY-----GDLLTTGICICEVAHYPLKALVF-  275

Query  1174  GGSTVRDLSDAVANSCISLQNNNIPFNLLISERGNKVFLFPQVH  1043
                 ++ L+D VA  C +L N++  FNLLIS+ G K+FLFPQVH
Sbjct  276   ISKNLKALADVVAEICSTLHNHDAAFNLLISDCGAKIFLFPQVH  319



>ref|XP_002263657.1| PREDICTED: GDP-L-galactose phosphorylase 1-like isoform X2 [Vitis 
vinifera]
Length=375

 Score =   162 bits (411),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 111/286 (39%), Positives = 154/286 (54%), Gaps = 31/286 (11%)
 Frame = -1

Query  1831  SFLSDLLLGQWEERMSRGLFRYDVTSCETKIIPGTFGFIAQLNEGRHLKKRPTEFRVDQV  1652
             S L  LLL QWE+RM +G++RYDVT+ E KII G   F+AQLNE         E+ +D +
Sbjct  61    STLESLLLAQWEDRMWKGIYRYDVTTSEIKIIGGRRKFLAQLNE---------EWNMDHL  111

Query  1651  LQPFDENK---------FNFTKIGQEEVLFRFEPSNDCKSHYLPSGLVDARSGSPTVLAI  1499
               P DEN+         FN+ K   EE+LF            +P+  V   + S  VL+ 
Sbjct  112   SDP-DENEVCWRGDSFIFNWVK-HHEELLFCVASGEKAIPELIPTAPVP--NASILVLS-  166

Query  1498  NVSPIEYGHVLLIPRVLDCLPQRIDHDSFFVAMHLAKEAADPFFRVGYNSLGAFATINHL  1319
             NV+P+EYGHV L+P     + Q +D  S  +   +A E  +  FRV Y+     A+   L
Sbjct  167   NVTPVEYGHVFLVPHGFTSISQFMDARSLEMVTRVAMEVNNRSFRVFYDCSMPSAS---L  223

Query  1318  HFQAYYLQVPFPVEKTPTREIMRGREQGDGGIVVSQLLNYPARALLFEGGSTVRDLSDAV  1139
             +FQA Y   P PVE  P   +    + G GG  +  L++YP +ALLFE  S V+   + +
Sbjct  224   YFQACYFSNPLPVEVMPVVTLW---DNGLGGTRICSLIDYPIKALLFESKSNVKVSVEVL  280

Query  1138  ANSCISLQNNNIPFNLLISERGNKVFLFPQVH--SNSVFLSSREFS  1007
             A  C  LQ  NIP++ LIS+ G ++FLFPQ+   +NS  LSS E S
Sbjct  281   AEICSCLQGKNIPYSFLISDCGKRIFLFPQMRASANSHALSSWECS  326



>ref|XP_010923696.1| PREDICTED: GDP-L-galactose phosphorylase 1-like isoform X2 [Elaeis 
guineensis]
Length=381

 Score =   162 bits (409),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 99/266 (37%), Positives = 145/266 (55%), Gaps = 15/266 (6%)
 Frame = -1

Query  1831  SFLSDLLLGQWEERMSRGLFRYDVTSCETKIIPGTFGFIAQLNEGRHLKKRPTEFRVDQV  1652
             S L  LLL QWE+   +G  +YDVT+CE K++ G   FI QLNE  +     TEF  + V
Sbjct  62    SLLDALLLSQWEDHAWKGQLKYDVTACEMKVVGGGKNFIVQLNENWN-PNFLTEFE-NNV  119

Query  1651  LQPFDENKFNFTKIGQEEVLFRFEPSNDCKSHYLPSGLVDARSGSPTVLAINVSPIEYGH  1472
             LQP +  K ++ K  ++++LF         S  + S +V        ++ +N +P+EYGH
Sbjct  120   LQPLESIKSSYMKTHEQDILFCITQGERESSEIIFSTMVPK---DEILVVVNANPVEYGH  176

Query  1471  VLLIPRVLDCLPQRIDHDSFFVAMHLAKEAADPFFRVGYNSLGAFATINHLHFQAYYLQV  1292
             V LIP  +  LPQ +D   F +   +A E  +  FR+ ++   A    N ++FQA Y   
Sbjct  177   VFLIPYKIHRLPQSLDKKMFGLITQIAVEVNNCSFRIFFDH-SASPCSNQIYFQASYFAN  235

Query  1291  PFPVEKTPTREIMRGREQGD---GGIVVSQLLNYPARALLFEGGSTVRDLSDAVANSCIS  1121
             P PVE  PT  +      GD    GI + ++ +YP + L+F     ++ L+D VA  C +
Sbjct  236   PLPVEVLPTVPVY-----GDVLTTGICICEVADYPLKTLVFT-SKNLKALADIVAEICST  289

Query  1120  LQNNNIPFNLLISERGNKVFLFPQVH  1043
             L N+N  FNLLIS+ G K+FLFPQVH
Sbjct  290   LHNHNAAFNLLISDCGTKMFLFPQVH  315



>ref|XP_010655755.1| PREDICTED: GDP-L-galactose phosphorylase 1-like isoform X1 [Vitis 
vinifera]
 ref|XP_010655756.1| PREDICTED: GDP-L-galactose phosphorylase 1-like isoform X1 [Vitis 
vinifera]
 emb|CBI31025.3| unnamed protein product [Vitis vinifera]
Length=376

 Score =   161 bits (408),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 111/287 (39%), Positives = 153/287 (53%), Gaps = 32/287 (11%)
 Frame = -1

Query  1831  SFLSDLLLGQWEERMSRGLFRYDVTSCETKIIPGTFGFIAQLNEGRHLKKRPTEFRVDQV  1652
             S L  LLL QWE+RM +G++RYDVT+ E KII G   F+AQLNE         E+ +D +
Sbjct  61    STLESLLLAQWEDRMWKGIYRYDVTTSEIKIIGGRRKFLAQLNE---------EWNMDHL  111

Query  1651  LQPFDENK---------FNFTKIGQEEVLFRFEPSNDCKSHYLPSGLVDARSGSPTVLAI  1499
               P DEN+         FN+ K   EE+LF            +P+  V   + S  VL+ 
Sbjct  112   SDP-DENEVCWRGDSFIFNWVK-HHEELLFCVASGEKAIPELIPTAPVP--NASILVLS-  166

Query  1498  NVSPIEYGHVLLIPRVLDCLPQRIDHDSFFVAMHLAKEAADPFFRVGYNSLGAFATINHL  1319
             NV+P+EYGHV L+P     + Q +D  S  +   +A E  +  FRV Y+     A+   L
Sbjct  167   NVTPVEYGHVFLVPHGFTSISQFMDARSLEMVTRVAMEVNNRSFRVFYDCSMPSAS---L  223

Query  1318  HFQAYYLQVPFPVEKTPTREIMRGREQGDGGIVVSQLLNYPARALLFEGGSTVRDLSDAV  1139
             +FQA Y   P PVE  P   +    + G GG  +  L++YP +ALLFE  S V+   + +
Sbjct  224   YFQACYFSNPLPVEVMPVVTLW---DNGLGGTRICSLIDYPIKALLFESKSNVKVSVEVL  280

Query  1138  ANSCISLQNNNIPFNLLISERGNKVFLFPQ---VHSNSVFLSSREFS  1007
             A  C  LQ  NIP++ LIS+ G ++FLFPQ     +NS  LSS E S
Sbjct  281   AEICSCLQGKNIPYSFLISDCGKRIFLFPQQMRASANSHALSSWECS  327



>ref|XP_001631502.1| predicted protein [Nematostella vectensis]
 gb|EDO39439.1| predicted protein [Nematostella vectensis]
Length=356

 Score =   161 bits (407),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 90/252 (36%), Positives = 137/252 (54%), Gaps = 25/252 (10%)
 Frame = -1

Query  1834  ISFLSDLLLGQWEERMSRGLFRYDVTSCETKIIPGTFGFIAQLNEGRHLKKRPTEFRVDQ  1655
             +S   +LL   W + M+ G F+Y + S ETK++PG FG +AQLNE R +++R  + ++  
Sbjct  42    LSKFDNLLRTSWTQAMADGCFKYTLDSMETKLVPGKFGVVAQLNEKRFVERRKPQ-QITS  100

Query  1654  VLQPFDENKFNFTKIGQEEVLFRFEPSNDCKSHYLPSGLVDARSGSPTVLAINVSPIEYG  1475
             V QP+D  KFNFTK+  +E+LF   PS             D  S  P  + INVSP+E+G
Sbjct  101   VSQPYDPGKFNFTKVQDKEILFEVCPS-------------DQNSSPPNYMIINVSPLEFG  147

Query  1474  HVLLIPRVLDCLPQRIDHDSFFVAMHLAKEAADPFFRVGYNSLGAFATINHLHFQAYYLQ  1295
             + LL+P V D  PQ +  DS  +A  +A  ++   F +GYNSL AFA++NHLHF  +YL 
Sbjct  148   NCLLVPSVFDQTPQILTVDSLKLAFDIAFLSSHRGFHIGYNSLCAFASVNHLHFHVWYLD  207

Query  1294  VPFPVEKTPTREIMRGREQGDGGIVVSQLLNYPARALLF--EGGSTVRDLSDAVANSCIS  1121
              P P+E  PT+ + +          + ++ N+P +  +F     + V  ++  V      
Sbjct  208   YPSPLETLPTKHVHKD---------MYEVTNFPTKIFVFYLSSAADVERIARQVHAVTSY  258

Query  1120  LQNNNIPFNLLI  1085
               +N I  NL I
Sbjct  259   FVSNEIAHNLSI  270



>ref|XP_010655757.1| PREDICTED: GDP-L-galactose phosphorylase 1-like isoform X3 [Vitis 
vinifera]
Length=317

 Score =   158 bits (400),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 104/270 (39%), Positives = 146/270 (54%), Gaps = 29/270 (11%)
 Frame = -1

Query  1831  SFLSDLLLGQWEERMSRGLFRYDVTSCETKIIPGTFGFIAQLNEGRHLKKRPTEFRVDQV  1652
             S L  LLL QWE+RM +G++RYDVT+ E KII G   F+AQLNE         E+ +D +
Sbjct  61    STLESLLLAQWEDRMWKGIYRYDVTTSEIKIIGGRRKFLAQLNE---------EWNMDHL  111

Query  1651  LQPFDENK---------FNFTKIGQEEVLFRFEPSNDCKSHYLPSGLVDARSGSPTVLAI  1499
               P DEN+         FN+ K   EE+LF            +P+  V   + S  VL+ 
Sbjct  112   SDP-DENEVCWRGDSFIFNWVK-HHEELLFCVASGEKAIPELIPTAPVP--NASILVLS-  166

Query  1498  NVSPIEYGHVLLIPRVLDCLPQRIDHDSFFVAMHLAKEAADPFFRVGYNSLGAFATINHL  1319
             NV+P+EYGHV L+P     + Q +D  S  +   +A E  +  FRV Y+     A+   L
Sbjct  167   NVTPVEYGHVFLVPHGFTSISQFMDARSLEMVTRVAMEVNNRSFRVFYDCSMPSAS---L  223

Query  1318  HFQAYYLQVPFPVEKTPTREIMRGREQGDGGIVVSQLLNYPARALLFEGGSTVRDLSDAV  1139
             +FQA Y   P PVE  P   ++   + G GG  +  L++YP +ALLFE  S V+   + +
Sbjct  224   YFQACYFSNPLPVEVMP---VVTLWDNGLGGTRICSLIDYPIKALLFESKSNVKVSVEVL  280

Query  1138  ANSCISLQNNNIPFNLLISERGNKVFLFPQ  1049
             A  C  LQ  NIP++ LIS+ G ++FLFPQ
Sbjct  281   AEICSCLQGKNIPYSFLISDCGKRIFLFPQ  310



>ref|XP_004070140.1| PREDICTED: GDP-D-glucose phosphorylase 1-like [Oryzias latipes]
Length=372

 Score =   159 bits (403),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 90/252 (36%), Positives = 137/252 (54%), Gaps = 11/252 (4%)
 Frame = -1

Query  1837  PISFLSDLLLGQWEERMSRGLFRYDVTSCETKIIPGTFGFIAQLNEGRHLKKRPTEFRVD  1658
             P  F S +  G W +RM +GLFRY +++ ET+++PG +GF+AQLN  R  ++R  +  + 
Sbjct  27    PTVFDSAIRAG-WTDRMEKGLFRYQLSALETRVLPGPYGFVAQLNIKRGTERRKPQ-EIL  84

Query  1657  QVLQPFDENKFNFTKIGQEEVLFRFEPSNDCKSHYLPSGLVDARSGSPTVLAINVSPIEY  1478
              + Q F+  +FNF KI  +EVLF      D        GL  A S S   + INVSP+E+
Sbjct  85    SIKQEFNGKQFNFNKISPDEVLFEMVKGRDGSPALPDDGL--APSPSKMFVMINVSPLEF  142

Query  1477  GHVLLIPRVLDCLPQRIDHDSFFVAMHLAKEAADPFFRVGYNSLGAFATINHLHFQAYYL  1298
             GH L IP    C PQ +   +  ++M     ++DP FRVG+NSLGAFA++NHLH   YYL
Sbjct  143   GHCLFIPDPSRCFPQILTKSTIRISMESVLLSSDPSFRVGFNSLGAFASVNHLHLHGYYL  202

Query  1297  QVPFPVEKTPTREIMRGREQGDGGIVVSQLLNYPARALLFEGGSTVRDLSDAVANSCISL  1118
                  +E  P   ++      + G+ +SQ   +P   + +    TV  +++ V      L
Sbjct  203   DHELKIESIPVEPLL-----PEKGLYLSQ--EFPGGFVFYAEADTVEKVAEVVCQVTDFL  255

Query  1117  QNNNIPFNLLIS  1082
              +NN+  NL ++
Sbjct  256   VDNNVAHNLFLT  267



>gb|AIW66501.1| VTC2 protein, partial [Oryza rufipogon]
 gb|AIW66502.1| VTC2 protein, partial [Oryza rufipogon]
 gb|AIW66503.1| VTC2 protein, partial [Oryza rufipogon]
 gb|AIW66504.1| VTC2 protein, partial [Oryza nivara]
 gb|AIW66505.1| VTC2 protein, partial [Oryza nivara]
 gb|AIW66506.1| VTC2 protein, partial [Oryza nivara]
 gb|AIW66507.1| VTC2 protein, partial [Oryza nivara]
 gb|AIW66508.1| VTC2 protein, partial [Oryza nivara]
 gb|AIW66509.1| VTC2 protein, partial [Oryza nivara]
 gb|AIW66510.1| VTC2 protein, partial [Oryza nivara]
 gb|AIW66511.1| VTC2 protein, partial [Oryza nivara]
 gb|AIW66512.1| VTC2 protein, partial [Oryza rufipogon]
 gb|AIW66513.1| VTC2 protein, partial [Oryza rufipogon]
 gb|AIW66514.1| VTC2 protein, partial [Oryza rufipogon]
 gb|AIW66515.1| VTC2 protein, partial [Oryza nivara]
 gb|AIW66516.1| VTC2 protein, partial [Oryza nivara]
 gb|AIW66517.1| VTC2 protein, partial [Oryza nivara]
 gb|AIW66518.1| VTC2 protein, partial [Oryza rufipogon]
 gb|AIW66519.1| VTC2 protein, partial [Oryza rufipogon]
 gb|AIW66520.1| VTC2 protein, partial [Oryza rufipogon]
 gb|AIW66521.1| VTC2 protein, partial [Oryza nivara]
 gb|AIW66522.1| VTC2 protein, partial [Oryza nivara]
 gb|AIW66523.1| VTC2 protein, partial [Oryza nivara]
 gb|AIW66524.1| VTC2 protein, partial [Oryza rufipogon]
 gb|AIW66525.1| VTC2 protein, partial [Oryza rufipogon]
 gb|AIW66526.1| VTC2 protein, partial [Oryza rufipogon]
 gb|AIW66527.1| VTC2 protein, partial [Oryza nivara]
 gb|AIW66528.1| VTC2 protein, partial [Oryza nivara]
 gb|AIW66529.1| VTC2 protein, partial [Oryza nivara]
 gb|AIW66530.1| VTC2 protein, partial [Oryza nivara]
 gb|AIW66531.1| VTC2 protein, partial [Oryza rufipogon]
 gb|AIW66532.1| VTC2 protein, partial [Oryza rufipogon]
 gb|AIW66533.1| VTC2 protein, partial [Oryza rufipogon]
 gb|AIW66534.1| VTC2 protein, partial [Oryza rufipogon]
 gb|AIW66535.1| VTC2 protein, partial [Oryza rufipogon]
 gb|AIW66536.1| VTC2 protein, partial [Oryza rufipogon]
Length=102

 Score =   151 bits (381),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 69/102 (68%), Positives = 82/102 (80%), Gaps = 0/102 (0%)
 Frame = -1

Query  1801  WEERMSRGLFRYDVTSCETKIIPGTFGFIAQLNEGRHLKKRPTEFRVDQVLQPFDENKFN  1622
             WE+RM+RGLFRYDVT+CETK+IPG  GF+AQLNEGRHLKKRPTEFRVD+VLQPFD  KFN
Sbjct  1     WEDRMARGLFRYDVTACETKVIPGNLGFVAQLNEGRHLKKRPTEFRVDRVLQPFDAAKFN  60

Query  1621  FTKIGQEEVLFRFEPSNDCKSHYLPSGLVDARSGSPTVLAIN  1496
             FTK+GQEEVLF+FE      S ++ S  +     +P V+AIN
Sbjct  61    FTKVGQEEVLFQFENGGGDDSFFVESSPISVADRAPNVVAIN  102



>ref|XP_009362225.1| PREDICTED: GDP-L-galactose phosphorylase 2-like isoform X1 [Pyrus 
x bretschneideri]
Length=368

 Score =   159 bits (402),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 103/297 (35%), Positives = 160/297 (54%), Gaps = 17/297 (6%)
 Frame = -1

Query  1912  LPLFAFKND---EHKCDGDWNYLSYGECPISFLSDLLLGQWEERMSRGLFRYDVTSCETK  1742
             +PL+ F ++   +  C G  + +  GE   S L  ++L QWE+RM +GLFRYDVT+ E K
Sbjct  26    IPLYRFGSNSILDDGCAGRISCVLEGEEEESVLDSIVLAQWEDRMWKGLFRYDVTASEIK  85

Query  1741  IIPGTFGFIAQLNEGRHLKKRPTEFRVDQVLQPFDENKFNFTKIGQ-EEVLFRFEPSNDC  1565
             ++ G   FIAQ NEG      P   R+ +      E+ F F+ + + EE+LF        
Sbjct  86    LVGGRKKFIAQFNEGWSRDFMP---RMGKNTSFCQEDLFKFSWMERHEELLFSVASGEKS  142

Query  1564  KSHYLPSGLVDARSGSPTVLAINVSPIEYGHVLLIPRVLDCLPQRIDHDSFFVAMHLAKE  1385
              +  + S  V        ++AINVSP+EYGHV L+P     + Q +D  S  + +H+A E
Sbjct  143   NAELVLSAAV---PDCALLIAINVSPVEYGHVFLVPHGSKIIHQFLDKRSLELVLHVAVE  199

Query  1384  AADPFFRVGYNSLGAFATINHLHFQAYYLQVPFPVEKTPTREIMRGREQGDGGIVVSQLL  1205
               +  FR+ Y   G   +  H++FQA YLQ+P PVE      I      G  G+ +S + 
Sbjct  200   INNCSFRLFY---GYSPSAPHMYFQACYLQIPLPVEFMRFDTIFGA---GKEGMRISSVA  253

Query  1204  NYPARALLFEGGSTVRDLSDAVANSCISLQNNNIPFNLLISERGNKVFLFPQVHSNS  1034
             +YP + L+ E  + ++ + + +A  C  LQ   IP+NLLIS+ G ++FLF Q+ S++
Sbjct  254   DYPIKTLVLE-SNHLKTMMEVLAEICSCLQEKLIPYNLLISDHGKRIFLFFQLPSST  309



>emb|CEF97775.1| unnamed product, partial [Ostreococcus tauri]
Length=265

 Score =   155 bits (392),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 81/156 (52%), Positives = 102/156 (65%), Gaps = 8/156 (5%)
 Frame = -1

Query  1816  LLLGQWEERMSRGLFRYDVTSCETKIIPGTFGFIAQLNEGRHLKKRPTEFRVDQVLQPFD  1637
             +L+  WE+R + GLFRYDVT+  TK+I G   ++AQ N GR   KRPTEF VD+V Q FD
Sbjct  112   ILISLWEDRFAGGLFRYDVTAVSTKVIEGKKQYVAQFNIGRATNKRPTEFSVDKVCQDFD  171

Query  1636  ENKFNFTKIGQEEVLFRF-----EPSNDCKSHYLPSGLVDARSGSPTVLAINVSPIEYGH  1472
              NKFNFTK   +EVLF F        N  +S + P+  V     SPTV+ INVSPIEYGH
Sbjct  172   PNKFNFTKADLKEVLFSFTNIGEADENVTRSVFEPNASV---GESPTVVLINVSPIEYGH  228

Query  1471  VLLIPRVLDCLPQRIDHDSFFVAMHLAKEAADPFFR  1364
             VLL PRV D LPQ+I  D    A+++A E+ +P+FR
Sbjct  229   VLLCPRVTDMLPQQISPDKLLPALYMAAESRNPYFR  264



>ref|XP_008372237.1| PREDICTED: GDP-L-galactose phosphorylase 2-like [Malus domestica]
Length=368

 Score =   158 bits (399),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 103/307 (34%), Positives = 162/307 (53%), Gaps = 21/307 (7%)
 Frame = -1

Query  1930  CLPVSC----LPLFAFKND---EHKCDGDWNYLSYGECPISFLSDLLLGQWEERMSRGLF  1772
             C P S     +PL+ F ++   +  C G  + +  GE   S L  ++L QWE+RM +GLF
Sbjct  16    CSPFSVQGIKIPLYRFGSNSILDDGCAGRISCVLEGEEEESVLDSIVLAQWEDRMWKGLF  75

Query  1771  RYDVTSCETKIIPGTFGFIAQLNEGRHLKKRPTEFRVDQVLQPFDENKFNFTKIG-QEEV  1595
             RYDVT+ E K++ G   FIAQ NEG      P   R+ + +    E+ F F+ +  QEE+
Sbjct  76    RYDVTASEIKVVRGRKKFIAQFNEGWSRDFMP---RMGKNISFCQEDMFKFSWMERQEEL  132

Query  1594  LFRFEPSNDCKSHYLPSGLVDARSGSPTVLAINVSPIEYGHVLLIPRVLDCLPQRIDHDS  1415
             LF         +  + S  V        ++AIN SP+EYGHV L+P     + Q +D  S
Sbjct  133   LFSVASGEKSNAELVLSAAV---PDCALLIAINASPVEYGHVFLVPHGSKIIHQFLDKRS  189

Query  1414  FFVAMHLAKEAADPFFRVGYNSLGAFATINHLHFQAYYLQVPFPVEKTPTREIMRGREQG  1235
               + +H+A E  +  FR+ Y+      +   ++FQA YLQ+P PVE      I      G
Sbjct  190   LELILHVAVEINNCSFRLFYDYS---PSAPRMYFQACYLQIPLPVEFMRFDTIFGA---G  243

Query  1234  DGGIVVSQLLNYPARALLFEGGSTVRDLSDAVANSCISLQNNNIPFNLLISERGNKVFLF  1055
               G+ +S + +YP + L+ E  +  + + + +A  C+ LQ   IP+NLLIS+ G ++FLF
Sbjct  244   KEGMSISSVADYPIKTLVLE-SNHFKTMMEVLAEICLCLQEKLIPYNLLISDHGKRIFLF  302

Query  1054  PQVHSNS  1034
              Q+ +++
Sbjct  303   FQLQTST  309



>ref|XP_010906479.1| PREDICTED: GDP-L-galactose phosphorylase 1-like isoform X1 [Elaeis 
guineensis]
Length=382

 Score =   155 bits (392),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 98/267 (37%), Positives = 145/267 (54%), Gaps = 15/267 (6%)
 Frame = -1

Query  1831  SFLSDLLLGQWEERMSRGLFRYDVTSCETKIIPGTFGFIAQLNEGRHLKKRPTEFRVDQV  1652
             S L  LLL QWE+   +G   YDVT+CE K++ G   F+ QLNE  H     TEF  + V
Sbjct  66    SLLDALLLSQWEDHAWKGQLNYDVTACEIKVVSGEKNFVTQLNENWH-PNFLTEFE-NNV  123

Query  1651  LQPFDENKFNFTKIGQEEVLFRFEPSNDCKSHYLPSGLVDARSGSPTVLAINVSPIEYGH  1472
              QP +  K +  KI +E++L          S  +P  +V  + G   ++ IN +P+EYGH
Sbjct  124   FQPLEPIKSSCMKICEEDILCCAAHGEKESSVIIPLTMV-PKDG--ILIVINANPVEYGH  180

Query  1471  VLLIPRVLDCLPQRIDHDSFFVAMHLAKEAADPFFRVGYNSLGAFATINHLHFQAYYLQV  1292
             V L+P  +  L Q +D   F +   +A E  +  FR+ YN   +  + + ++F+A Y   
Sbjct  181   VFLMPYKIHQLSQSLDKKMFGLITQIAVEVNNCAFRIFYNHRVSTCS-DQIYFEASYFAN  239

Query  1291  PFPVEKTPTREIMRGREQGD---GGIVVSQLLNYPARALLFEGGSTVRDLSDAVANSCIS  1121
             P PVE  PT  +      GD    GI + ++ +YP +AL+F     ++ L+D VA  C +
Sbjct  240   PLPVEVLPTVPVY-----GDLLKTGICICEVADYPLKALVF-ISKNLKALADVVAEICST  293

Query  1120  LQNNNIPFNLLISERGNKVFLFPQVHS  1040
             L N+N  FNLLIS+ G K+FLFPQV +
Sbjct  294   LHNHNSAFNLLISDHGAKIFLFPQVRT  320



>ref|XP_007906745.1| PREDICTED: GDP-D-glucose phosphorylase 1 [Callorhinchus milii]
Length=436

 Score =   155 bits (392),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 86/192 (45%), Positives = 114/192 (59%), Gaps = 11/192 (6%)
 Frame = -1

Query  1831  SFLSDLLLGQWEERMSRGLFRYDVTSCETKIIPGTFGFIAQLNEGRHLKKRPTEFRVDQV  1652
             S L   L   WEE+M RGLFRY +   E++++PG   F+AQLN  R  ++R  +  +  V
Sbjct  51    SRLDCALRSGWEEKMCRGLFRYVLRELESRVLPGPRRFVAQLNISRGRERRKPQ-EISSV  109

Query  1651  LQPFDENKFNFTKIGQEEVLF---RFEPSNDCKSHYLPSGLVDARSGSPTVLAINVSPIE  1481
             LQPFD N+FNF +I   E+LF   R EP+        P  + +      T+L INVSP+E
Sbjct  110   LQPFDLNQFNFNRISSSEILFSLRRAEPA-------CPGPVTEDPGHRDTLLVINVSPLE  162

Query  1480  YGHVLLIPRVLDCLPQRIDHDSFFVAMHLAKEAADPFFRVGYNSLGAFATINHLHFQAYY  1301
             YGHVL +P     LPQ +  D   +A+ L   ++DP FRVG+NSLGAFA++NHLH   YY
Sbjct  163   YGHVLAVPDPARGLPQVLTPDLLRIALELVFLSSDPGFRVGFNSLGAFASVNHLHIHGYY  222

Query  1300  LQVPFPVEKTPT  1265
             LQ    VE  PT
Sbjct  223   LQYELEVEWAPT  234



>ref|XP_010923694.1| PREDICTED: GDP-L-galactose phosphorylase 1-like isoform X1 [Elaeis 
guineensis]
 ref|XP_010923695.1| PREDICTED: GDP-L-galactose phosphorylase 1-like isoform X1 [Elaeis 
guineensis]
Length=405

 Score =   154 bits (390),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 94/257 (37%), Positives = 140/257 (54%), Gaps = 15/257 (6%)
 Frame = -1

Query  1804  QWEERMSRGLFRYDVTSCETKIIPGTFGFIAQLNEGRHLKKRPTEFRVDQVLQPFDENKF  1625
             QWE+   +G  +YDVT+CE K++ G   FI QLNE  +     TEF  + VLQP +  K 
Sbjct  95    QWEDHAWKGQLKYDVTACEMKVVGGGKNFIVQLNENWN-PNFLTEFE-NNVLQPLESIKS  152

Query  1624  NFTKIGQEEVLFRFEPSNDCKSHYLPSGLVDARSGSPTVLAINVSPIEYGHVLLIPRVLD  1445
             ++ K  ++++LF         S  + S +V        ++ +N +P+EYGHV LIP  + 
Sbjct  153   SYMKTHEQDILFCITQGERESSEIIFSTMVPK---DEILVVVNANPVEYGHVFLIPYKIH  209

Query  1444  CLPQRIDHDSFFVAMHLAKEAADPFFRVGYNSLGAFATINHLHFQAYYLQVPFPVEKTPT  1265
              LPQ +D   F +   +A E  +  FR+ ++   A    N ++FQA Y   P PVE  PT
Sbjct  210   RLPQSLDKKMFGLITQIAVEVNNCSFRIFFDH-SASPCSNQIYFQASYFANPLPVEVLPT  268

Query  1264  REIMRGREQGD---GGIVVSQLLNYPARALLFEGGSTVRDLSDAVANSCISLQNNNIPFN  1094
               +      GD    GI + ++ +YP + L+F     ++ L+D VA  C +L N+N  FN
Sbjct  269   VPVY-----GDVLTTGICICEVADYPLKTLVFTS-KNLKALADIVAEICSTLHNHNAAFN  322

Query  1093  LLISERGNKVFLFPQVH  1043
             LLIS+ G K+FLFPQVH
Sbjct  323   LLISDCGTKMFLFPQVH  339



>ref|XP_008383397.1| PREDICTED: GDP-L-galactose phosphorylase 2-like [Malus domestica]
Length=374

 Score =   154 bits (388),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 102/275 (37%), Positives = 148/275 (54%), Gaps = 14/275 (5%)
 Frame = -1

Query  1831  SFLSDLLLGQWEERMSRGLFRYDVTSCETKIIPGTFGFIAQLNEGRHLKKRPTEFRVDQV  1652
             S L  +LL QWE+RM +GLFRYDVT+ E K+I G   FIAQ NEG      P   +  + 
Sbjct  61    SVLDSILLAQWEDRMWKGLFRYDVTTSEIKVIGGRKKFIAQFNEGWSRDFIPRMGKNKKF  120

Query  1651  LQPFDENKFNFTKIGQEEVLFRFEPSNDCKSHYLPSGLVDARSGSPTVLAINVSPIEYGH  1472
             LQ  D  KF++ ++ QEE+LF            + S  V        ++AIN SP+EYGH
Sbjct  121   LQE-DAFKFSWMEL-QEELLFCVSSGEKSNPELVLSAAV---PDCALLIAINASPVEYGH  175

Query  1471  VLLIPRVLDCLPQRIDHDSFFVAMHLAKEAADPFFRVGYNSLGAFATINHLHFQAYYLQV  1292
             VLL+P     + Q +D  S  + + +A E  +  FR+ Y+      + + L+FQA YLQ+
Sbjct  176   VLLVPHGSKIIHQYLDKRSLELVLRIAVEINNCSFRLFYD---YSPSASPLYFQACYLQI  232

Query  1291  PFPVEKTPTREIMRGREQGDGGIVVSQLLNYPARALLFEGGSTVRDLSDAVANSCISLQN  1112
             P PVE      I      G  G+ +S +  YP + L+ E  +    + + +A  C  LQ 
Sbjct  233   PLPVEFMHFDTIFGA---GKEGVRISCVAEYPIKTLVLE-SNHFNTMMEVLAEICSCLQQ  288

Query  1111  NNIPFNLLISERGNKVFLFPQVHS--NSVFLSSRE  1013
               IP+NLLIS+ G ++FLF Q+H+  +S  LS+ E
Sbjct  289   KLIPYNLLISDHGKRIFLFFQLHTSKDSCTLSAWE  323



>ref|XP_008225604.1| PREDICTED: GDP-L-galactose phosphorylase 1-like isoform X2 [Prunus 
mume]
Length=368

 Score =   153 bits (387),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 109/315 (35%), Positives = 163/315 (52%), Gaps = 23/315 (7%)
 Frame = -1

Query  1948  NCLGQCCLPVSC----LPLFAFKNDEHKCDGDWNYLSYGECPI----SFLSDLLLGQWEE  1793
             N L QC  P+S     +PL+ F ++    +G    +S   C I    S L  +LL QWE+
Sbjct  11    NFLSQCPPPLSLQDIRIPLYRFGSNSVLDNGSVGGIS---CLIEEEQSVLDSILLAQWED  67

Query  1792  RMSRGLFRYDVTSCETKIIPGTFGFIAQLNEGRHLKKRPTEFRVDQVLQPFDENKFNFTK  1613
             RM +GLFRYDVT+ E K+I G   FIAQ NEG      P +   +++    D  +F++ +
Sbjct  68    RMWKGLFRYDVTTSEIKVIGGRRKFIAQFNEGWSRDCMP-KLGKNKIRHQKDVFEFSWME  126

Query  1612  IGQEEVLFRFEPSNDCKSHYLPSGLVDARSGSPTVLAINVSPIEYGHVLLIPRVLDCLPQ  1433
               QEE+LF            + S  V        ++ IN SP+EYGHV L+P     L Q
Sbjct  127   -RQEELLFCVASGEKLNPELVLSAAV---PDCGLLITINSSPVEYGHVFLVPHSSYILHQ  182

Query  1432  RIDHDSFFVAMHLAKEAADPFFRVGYNSLGAFATINHLHFQAYYLQVPFPVEKTPTREIM  1253
              +D  S  + + +A E  +  FR+ Y+      + +H++FQA YLQ+P PVE  P     
Sbjct  183   FLDARSLELVLRVAVEVNNCSFRLFYD---YSPSASHIYFQACYLQIPLPVEFMPLDTFF  239

Query  1252  RGREQGDGGIVVSQLLNYPARALLFEGGSTVRDLSDAVANSCISLQNNNIPFNLLISERG  1073
                  G  G+ +S + +YP + L+FE    +  +   +A  C  LQ   IP+NLLIS+ G
Sbjct  240   GN---GQEGMRISSVTDYPIKTLVFESNH-LNMMMVVLAEICSCLQEKLIPYNLLISDHG  295

Query  1072  NKVFLFPQVHSNSVF  1028
              ++FLF Q+H++  F
Sbjct  296   KRIFLFFQLHTSENF  310



>ref|XP_007526351.1| PREDICTED: GDP-D-glucose phosphorylase 1 [Erinaceus europaeus]
Length=385

 Score =   153 bits (387),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 93/254 (37%), Positives = 132/254 (52%), Gaps = 20/254 (8%)
 Frame = -1

Query  1834  ISFLSDLLLGQWEERMSRGLFRYDVTSCETKIIPGTFGFIAQLNEGRHLKKRPTEFRVDQ  1655
             +S     +L  WE+R+  GLFRY +   +T+I+PG  GF+AQLN  R  ++R  +  +  
Sbjct  56    LSRFDSAVLSAWEQRVELGLFRYRLRDLQTRILPGAVGFVAQLNVERGAQRRLPQ-NIWG  114

Query  1654  VLQPFDENKFNFTKIGQEEVLFRFEPSNDCKSHYLPSGLVDARSGSPTVLAINVSPIEYG  1475
             V QPFD ++FNF KI   EVLFR +   D         L  A      ++ INVSP+E+G
Sbjct  115   VRQPFDPDQFNFNKIRPGEVLFRLQRGPD---------LSPALQQEDILVVINVSPLEWG  165

Query  1474  HVLLIPRVLDCLPQRIDHDSFFVAMHLAKEAADPFFRVGYNSLGAFATINHLHFQAYYLQ  1295
             HVLL+P     LPQR+   +    +     ++ P FRVG+NSLG  A++NHLH   YYL 
Sbjct  166   HVLLVPEPARGLPQRLLPGALRAGLEAVLLSSHPGFRVGFNSLGGLASVNHLHLHGYYLA  225

Query  1294  VPFPVEKTPTREIMRGREQGDGGIVVSQLLNYPARALLFEGGSTVRDLSDAVANSCIS--  1121
                PVE  P++ +       D G  + +L   PA   LF    T  DL   V+  C +  
Sbjct  226   HRLPVEGAPSQPL-------DPGGHLHELQTLPAPGFLFYTSRTDSDLDALVSRVCRATN  278

Query  1120  -LQNNNIPFNLLIS  1082
              L ++ I  NL  +
Sbjct  279   YLTDHEIAHNLFAT  292



>ref|XP_008794437.1| PREDICTED: GDP-L-galactose phosphorylase 1-like isoform X1 [Phoenix 
dactylifera]
 ref|XP_008794438.1| PREDICTED: GDP-L-galactose phosphorylase 1-like isoform X1 [Phoenix 
dactylifera]
Length=381

 Score =   153 bits (386),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 97/266 (36%), Positives = 144/266 (54%), Gaps = 15/266 (6%)
 Frame = -1

Query  1831  SFLSDLLLGQWEERMSRGLFRYDVTSCETKIIPGTFGFIAQLNEGRHLKKRPTEFRVDQV  1652
             S L  LLL QWE+   +G  +YDVTSCE K+I G   FI QLNE  +     TEF  + V
Sbjct  62    SLLDALLLSQWEDHAWKGQLKYDVTSCEIKVIGGGKNFITQLNENWN-SNFLTEFE-NNV  119

Query  1651  LQPFDENKFNFTKIGQEEVLFRFEPSNDCKSHYLPSGLVDARSGSPTVLAINVSPIEYGH  1472
             LQP +  + ++ K  +E++LF         S  + S +V  + G   ++ +N +P+EYGH
Sbjct  120   LQPLESIRSSYMKTHKEDILFCIAHGEKESSEIIFSTVV-PKDG--ILVLVNANPVEYGH  176

Query  1471  VLLIPRVLDCLPQRIDHDSFFVAMHLAKEAADPFFRVGYNSLGAFATINHLHFQAYYLQV  1292
             V LIP  +  L   +D   F +   +A E  +  FR+ ++   A    + ++FQA Y   
Sbjct  177   VFLIPYKIHQLSLSLDKKMFGLITRIAVEVNNCSFRIFFDH-SASTCSDQIYFQASYFAN  235

Query  1291  PFPVEKTPTREIMRGREQGDG---GIVVSQLLNYPARALLFEGGSTVRDLSDAVANSCIS  1121
             P PVE  PT  +      GD    GI + ++ +YP + L+F   + ++ L+D VA  C +
Sbjct  236   PLPVEVLPTVPVY-----GDALTTGICICEVADYPLKTLVFM-SNNLKALADMVAEICST  289

Query  1120  LQNNNIPFNLLISERGNKVFLFPQVH  1043
             L  +N  FNLLIS+ G K+FLFPQ H
Sbjct  290   LHKHNAAFNLLISDCGTKMFLFPQAH  315



>ref|XP_009344416.1| PREDICTED: GDP-L-galactose phosphorylase 2-like isoform X2 [Pyrus 
x bretschneideri]
Length=361

 Score =   152 bits (384),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 103/275 (37%), Positives = 146/275 (53%), Gaps = 14/275 (5%)
 Frame = -1

Query  1831  SFLSDLLLGQWEERMSRGLFRYDVTSCETKIIPGTFGFIAQLNEGRHLKKRPTEFRVDQV  1652
             S L  +LL QWE+RM +GLFRYDVT+ E K+I G   FIAQ NEG      P   +    
Sbjct  48    SVLDSILLAQWEDRMWKGLFRYDVTTSEIKVIGGKKKFIAQFNEGWSRDFIPRMGKNKNF  107

Query  1651  LQPFDENKFNFTKIGQEEVLFRFEPSNDCKSHYLPSGLVDARSGSPTVLAINVSPIEYGH  1472
              Q  D  KF++ +  QEE+LF            L S  V        ++AIN SP+EYGH
Sbjct  108   RQE-DALKFSWME-RQEELLFCVSSGEKSNPELLLSAAV---PDCALLIAINASPVEYGH  162

Query  1471  VLLIPRVLDCLPQRIDHDSFFVAMHLAKEAADPFFRVGYNSLGAFATINHLHFQAYYLQV  1292
             VLL+P     + Q +D  S    + +A E  +  FR+ Y+S     + + L+FQA YLQ+
Sbjct  163   VLLVPHGSKIMHQYLDKRSLEFVLRIAVEINNCSFRLFYDS---SPSASPLYFQACYLQI  219

Query  1291  PFPVEKTPTREIMRGREQGDGGIVVSQLLNYPARALLFEGGSTVRDLSDAVANSCISLQN  1112
             P PVE      I      G  G+ +S + +YP + L+ E  +    + + +A  C  LQ 
Sbjct  220   PLPVEFMHFDTIFGA---GKEGMRISCVADYPIKTLVLE-SNHFNTMMEVLAEICSCLQQ  275

Query  1111  NNIPFNLLISERGNKVFLFPQVHS--NSVFLSSRE  1013
               IP+NLLIS+ G ++FLF Q+H+  +S  LS+ E
Sbjct  276   RLIPYNLLISDHGKRIFLFFQLHALKDSCTLSAWE  310



>ref|XP_003514267.1| PREDICTED: GDP-D-glucose phosphorylase 1 [Cricetulus griseus]
 ref|XP_007652592.1| PREDICTED: GDP-D-glucose phosphorylase 1 [Cricetulus griseus]
 ref|XP_007619159.1| PREDICTED: GDP-D-glucose phosphorylase 1 [Cricetulus griseus]
 ref|XP_007619160.1| PREDICTED: GDP-D-glucose phosphorylase 1 [Cricetulus griseus]
 gb|EGW06016.1| UPF0580 protein C15orf58-like [Cricetulus griseus]
Length=385

 Score =   152 bits (385),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 92/255 (36%), Positives = 131/255 (51%), Gaps = 20/255 (8%)
 Frame = -1

Query  1837  PISFLSDLLLGQWEERMSRGLFRYDVTSCETKIIPGTFGFIAQLNEGRHLKKRPTEFRVD  1658
             P S     L   W++R+  GLFRY +   +T+I+PG+ GF+AQLN  R +++RP +  + 
Sbjct  55    PRSRFDSALCSAWKQRVELGLFRYRLEDLQTQILPGSVGFVAQLNIERGVQRRPPQ-NIK  113

Query  1657  QVLQPFDENKFNFTKIGQEEVLFRFEPSNDCKSHYLPSGLVDARSGSPTVLAINVSPIEY  1478
              V Q FD  +FNFTKI   EVLFR +          P+G   ++      + INVSP+E+
Sbjct  114   SVRQEFDPEQFNFTKIRPGEVLFRLQRE--------PNGPAASKQED-IFVVINVSPLEW  164

Query  1477  GHVLLIPRVLDCLPQRIDHDSFFVAMHLAKEAADPFFRVGYNSLGAFATINHLHFQAYYL  1298
             GHVLL+P     LPQR+        +     +  P FRVG+NSLG  A++NHLH   YYL
Sbjct  165   GHVLLVPEPAHGLPQRLLPGVLRAGLEAVLLSLHPGFRVGFNSLGGLASVNHLHLHGYYL  224

Query  1297  QVPFPVEKTPTREIMRGREQGDGGIVVSQLLNYPARALLFEGGSTVRDLSDAVANSCIS-  1121
               P PVE  P+  +       D    +  L N PA   LF       DL   ++  C + 
Sbjct  225   AHPLPVEGAPSTPL-------DPKACIYLLQNLPAPGFLFYTSGPGPDLEALISRVCRAT  277

Query  1120  --LQNNNIPFNLLIS  1082
               L ++ I  NL ++
Sbjct  278   DYLSDHEIAHNLFVT  292



>ref|XP_009344415.1| PREDICTED: GDP-L-galactose phosphorylase 2-like isoform X1 [Pyrus 
x bretschneideri]
Length=374

 Score =   152 bits (383),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 103/275 (37%), Positives = 146/275 (53%), Gaps = 14/275 (5%)
 Frame = -1

Query  1831  SFLSDLLLGQWEERMSRGLFRYDVTSCETKIIPGTFGFIAQLNEGRHLKKRPTEFRVDQV  1652
             S L  +LL QWE+RM +GLFRYDVT+ E K+I G   FIAQ NEG      P   +    
Sbjct  61    SVLDSILLAQWEDRMWKGLFRYDVTTSEIKVIGGKKKFIAQFNEGWSRDFIPRMGKNKNF  120

Query  1651  LQPFDENKFNFTKIGQEEVLFRFEPSNDCKSHYLPSGLVDARSGSPTVLAINVSPIEYGH  1472
              Q  D  KF++ +  QEE+LF            L S  V        ++AIN SP+EYGH
Sbjct  121   RQE-DALKFSWME-RQEELLFCVSSGEKSNPELLLSAAV---PDCALLIAINASPVEYGH  175

Query  1471  VLLIPRVLDCLPQRIDHDSFFVAMHLAKEAADPFFRVGYNSLGAFATINHLHFQAYYLQV  1292
             VLL+P     + Q +D  S    + +A E  +  FR+ Y+S     + + L+FQA YLQ+
Sbjct  176   VLLVPHGSKIMHQYLDKRSLEFVLRIAVEINNCSFRLFYDSS---PSASPLYFQACYLQI  232

Query  1291  PFPVEKTPTREIMRGREQGDGGIVVSQLLNYPARALLFEGGSTVRDLSDAVANSCISLQN  1112
             P PVE      I      G  G+ +S + +YP + L+ E  +    + + +A  C  LQ 
Sbjct  233   PLPVEFMHFDTIFGA---GKEGMRISCVADYPIKTLVLE-SNHFNTMMEVLAEICSCLQQ  288

Query  1111  NNIPFNLLISERGNKVFLFPQVHS--NSVFLSSRE  1013
               IP+NLLIS+ G ++FLF Q+H+  +S  LS+ E
Sbjct  289   RLIPYNLLISDHGKRIFLFFQLHALKDSCTLSAWE  323



>ref|XP_008225603.1| PREDICTED: GDP-L-galactose phosphorylase 1-like isoform X1 [Prunus 
mume]
Length=372

 Score =   151 bits (382),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 109/319 (34%), Positives = 163/319 (51%), Gaps = 27/319 (8%)
 Frame = -1

Query  1948  NCLGQCCLPVSC--------LPLFAFKNDEHKCDGDWNYLSYGECPI----SFLSDLLLG  1805
             N L QC  P+S         +PL+ F ++    +G    +S   C I    S L  +LL 
Sbjct  11    NFLSQCPPPLSLQGIFSDIRIPLYRFGSNSVLDNGSVGGIS---CLIEEEQSVLDSILLA  67

Query  1804  QWEERMSRGLFRYDVTSCETKIIPGTFGFIAQLNEGRHLKKRPTEFRVDQVLQPFDENKF  1625
             QWE+RM +GLFRYDVT+ E K+I G   FIAQ NEG      P +   +++    D  +F
Sbjct  68    QWEDRMWKGLFRYDVTTSEIKVIGGRRKFIAQFNEGWSRDCMP-KLGKNKIRHQKDVFEF  126

Query  1624  NFTKIGQEEVLFRFEPSNDCKSHYLPSGLVDARSGSPTVLAINVSPIEYGHVLLIPRVLD  1445
             ++ +  QEE+LF            + S  V        ++ IN SP+EYGHV L+P    
Sbjct  127   SWME-RQEELLFCVASGEKLNPELVLSAAV---PDCGLLITINSSPVEYGHVFLVPHSSY  182

Query  1444  CLPQRIDHDSFFVAMHLAKEAADPFFRVGYNSLGAFATINHLHFQAYYLQVPFPVEKTPT  1265
              L Q +D  S  + + +A E  +  FR+ Y+      + +H++FQA YLQ+P PVE  P 
Sbjct  183   ILHQFLDARSLELVLRVAVEVNNCSFRLFYD---YSPSASHIYFQACYLQIPLPVEFMPL  239

Query  1264  REIMRGREQGDGGIVVSQLLNYPARALLFEGGSTVRDLSDAVANSCISLQNNNIPFNLLI  1085
                      G  G+ +S + +YP + L+FE    +  +   +A  C  LQ   IP+NLLI
Sbjct  240   DTFFGN---GQEGMRISSVTDYPIKTLVFESNH-LNMMMVVLAEICSCLQEKLIPYNLLI  295

Query  1084  SERGNKVFLFPQVHSNSVF  1028
             S+ G ++FLF Q+H++  F
Sbjct  296   SDHGKRIFLFFQLHTSENF  314



>ref|XP_007022928.1| Mannose-1-phosphate guanylyltransferase, putative isoform 1 [Theobroma 
cacao]
 ref|XP_007022930.1| Mannose-1-phosphate guanylyltransferase, putative isoform 1 [Theobroma 
cacao]
 gb|EOY25550.1| Mannose-1-phosphate guanylyltransferase, putative isoform 1 [Theobroma 
cacao]
 gb|EOY25552.1| Mannose-1-phosphate guanylyltransferase, putative isoform 1 [Theobroma 
cacao]
Length=375

 Score =   151 bits (381),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 99/292 (34%), Positives = 151/292 (52%), Gaps = 18/292 (6%)
 Frame = -1

Query  1912  LPLFAFKNDEHKCDGDWNYLS-YGECPISFLSDLLLGQWEERMSRGLFRYDVTSCETKII  1736
              P++ F +   + D  +  LS   E   S L  +LL QWE+RM +G FRYDVT+ E K I
Sbjct  34    FPMYCFGSQSIEEDNSFEGLSCIAEEEQSILDAVLLSQWEDRMRKGCFRYDVTASEIKAI  93

Query  1735  PGTFGFIAQLNEGR---HLKKRPTEFRVDQVLQPFDENKFNFTKIGQEEVLFRFEPSNDC  1565
              G   F++QLNEG+   HL K          L+ +D   F+  +   EE+LF    S   
Sbjct  94    AGKMKFLSQLNEGQITGHLSKPE-----GNTLREWDPFAFDCMR-QPEELLFCVSSSKKA  147

Query  1564  KSHYLPSGLVDARSGSPTVLAINVSPIEYGHVLLIPRVLDCLPQRIDHDSFFVAMHLAKE  1385
             KS  +PS  V     S  ++ INV+P+EYGHV L+P   + L Q +D  S  +   +A E
Sbjct  148   KSELIPSASV---PDSAILVIINVTPVEYGHVFLVPCTTNRLYQFLDPRSVELVTRVAAE  204

Query  1384  AADPFFRVGYNSLGAFATINHLHFQAYYLQVPFPVEKTPTREIMRGREQGDGGIVVSQLL  1205
               +  FRV Y+        ++++FQA Y   P PVE  P   +  G   G  GI +  ++
Sbjct  205   INNCSFRVFYDCCR--PNRSNVYFQACYFPDPLPVEFRPVDTVYSG---GRRGIHICSVI  259

Query  1204  NYPARALLFEGGSTVRDLSDAVANSCISLQNNNIPFNLLISERGNKVFLFPQ  1049
             +YP + L F+    ++ ++ A+   C  L+  N+ +NL+I++ G K+ LF Q
Sbjct  260   DYPIKTLSFQTTHNLKIMAAAICEICSHLEEKNVQYNLMITDSGKKILLFLQ  311



>ref|XP_007022929.1| Mannose-1-phosphate guanylyltransferase, putative isoform 2 [Theobroma 
cacao]
 gb|EOY25551.1| Mannose-1-phosphate guanylyltransferase, putative isoform 2 [Theobroma 
cacao]
Length=379

 Score =   151 bits (381),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 99/292 (34%), Positives = 151/292 (52%), Gaps = 18/292 (6%)
 Frame = -1

Query  1912  LPLFAFKNDEHKCDGDWNYLS-YGECPISFLSDLLLGQWEERMSRGLFRYDVTSCETKII  1736
              P++ F +   + D  +  LS   E   S L  +LL QWE+RM +G FRYDVT+ E K I
Sbjct  38    FPMYCFGSQSIEEDNSFEGLSCIAEEEQSILDAVLLSQWEDRMRKGCFRYDVTASEIKAI  97

Query  1735  PGTFGFIAQLNEGR---HLKKRPTEFRVDQVLQPFDENKFNFTKIGQEEVLFRFEPSNDC  1565
              G   F++QLNEG+   HL K          L+ +D   F+  +   EE+LF    S   
Sbjct  98    AGKMKFLSQLNEGQITGHLSKPE-----GNTLREWDPFAFDCMR-QPEELLFCVSSSKKA  151

Query  1564  KSHYLPSGLVDARSGSPTVLAINVSPIEYGHVLLIPRVLDCLPQRIDHDSFFVAMHLAKE  1385
             KS  +PS  V     S  ++ INV+P+EYGHV L+P   + L Q +D  S  +   +A E
Sbjct  152   KSELIPSASV---PDSAILVIINVTPVEYGHVFLVPCTTNRLYQFLDPRSVELVTRVAAE  208

Query  1384  AADPFFRVGYNSLGAFATINHLHFQAYYLQVPFPVEKTPTREIMRGREQGDGGIVVSQLL  1205
               +  FRV Y+        ++++FQA Y   P PVE  P   +  G   G  GI +  ++
Sbjct  209   INNCSFRVFYDCCR--PNRSNVYFQACYFPDPLPVEFRPVDTVYSG---GRRGIHICSVI  263

Query  1204  NYPARALLFEGGSTVRDLSDAVANSCISLQNNNIPFNLLISERGNKVFLFPQ  1049
             +YP + L F+    ++ ++ A+   C  L+  N+ +NL+I++ G K+ LF Q
Sbjct  264   DYPIKTLSFQTTHNLKIMAAAICEICSHLEEKNVQYNLMITDSGKKILLFLQ  315



>dbj|BAG94528.1| unnamed protein product [Oryza sativa Japonica Group]
Length=193

 Score =   145 bits (366),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 73/133 (55%), Positives = 90/133 (68%), Gaps = 6/133 (5%)
 Frame = -1

Query  1402  MHLAKEAADPFFRVGYNSLGAFATINHLHFQAYYLQVPFPVEKTPTREIMRGREQGDGGI  1223
             M++A EA DPFFRVGYNSLG FATINHLHFQAYYL+V +PVEK  T ++         G+
Sbjct  1     MYVASEAKDPFFRVGYNSLGGFATINHLHFQAYYLKVQYPVEKALTEKLT----TLGNGV  56

Query  1222  VVSQLLNYPARALLFEGGSTVRDLSDAVANSCISLQNNNIPFNLLISERGNKVFLFPQVH  1043
              + QL+ YP    +FEGG+ + DLSD V+  CI LQ NN PFN LISE G +VFL PQ +
Sbjct  57    SIIQLVQYPVSGFVFEGGACLEDLSDVVSKVCIFLQENNKPFNALISESGKRVFLLPQCY  116

Query  1042  SNSVFLS--SREF  1010
             +    L   S+EF
Sbjct  117   AEKQALGRVSQEF  129


 Score = 95.9 bits (237),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 49/94 (52%), Positives = 64/94 (68%), Gaps = 5/94 (5%)
 Frame = -2

Query  804  LNSLRIKEGTHSFGEFSKCYAEKQACGKIDQEILDTWVNPAVWEISGHMVLKRREDYDDA  625
             N+L  + G   F    +CYAEKQA G++ QE LD  +NPAVWE+SGH+VLKRR+DYD+A
Sbjct  98   FNALISESGKRVF-LLPQCYAEKQALGRVSQEFLDMRINPAVWELSGHLVLKRRKDYDEA  156

Query  624  SEDYAWRLLSEVSLSEERFEEVKA----YVSRAA  535
            SE    R L E SLSE  F+E+K+    ++S AA
Sbjct  157  SEATICRFLVEASLSESEFQELKSCILEFLSSAA  190



>ref|XP_003641882.1| PREDICTED: GDP-D-glucose phosphorylase 1 [Gallus gallus]
Length=367

 Score =   150 bits (378),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 93/275 (34%), Positives = 139/275 (51%), Gaps = 21/275 (8%)
 Frame = -1

Query  1903  FAFKNDEHKCDGDWNYLSYGECPISFLSDLLLGQWEERMSRGLFRYDVTSCETKIIPGTF  1724
               +  DE   +G    +++    +S     LLG W+ERM+RGLFRY +    T+++PG  
Sbjct  23    LVYHEDEFILEG----VAWPGTTLSHFDRALLGAWQERMARGLFRYHLAELPTRVLPGPM  78

Query  1723  GFIAQLNEGRHLKKRPTEFRVDQVLQPFDENKFNFTKIGQEEVLFRFEPSNDCKSHYLPS  1544
               +AQLN  R  ++R  +  V  + QPFD  +FNFT+I   EVL R +     +S     
Sbjct  79    RLLAQLNVQRGTERRRPQA-VHSLTQPFDPRQFNFTQIRPGEVLLRLQRRPPAES-----  132

Query  1543  GLVDARSGSPTVLAINVSPIEYGHVLLIPRVLDCLPQRIDHDSFFVAMHLAKEAADPFFR  1364
                D  +    ++ IN+SP+E GHVLL+P     LPQ +  +   V +     +A P FR
Sbjct  133   ---DLAATDHVLVVINISPLERGHVLLLPEPTLHLPQVLTPELLRVGLEAVLLSAHPGFR  189

Query  1363  VGYNSLGAFATINHLHFQAYYLQVPFPVEKTPTREIMRGREQGDGGIVVSQLLNYPARAL  1184
             VG+NSLGA A++NHLH   +YL  P  VE  P   +   R        +S L   PA AL
Sbjct  190   VGFNSLGASASVNHLHLHGFYLAHPLLVETAPAEPLCPSRG-------LSLLHEAPAPAL  242

Query  1183  LF-EGGSTVRDLSDAVANSCISLQNNNIPFNLLIS  1082
             LF   G+ +  L+  V  +   L    + +N+ ++
Sbjct  243   LFYTAGAGLEALARDVCRAAARLLAMGLAYNVFVT  277



>ref|XP_004370690.1| PREDICTED: GDP-D-glucose phosphorylase 1 [Trichechus manatus 
latirostris]
Length=385

 Score =   150 bits (378),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 93/259 (36%), Positives = 128/259 (49%), Gaps = 22/259 (8%)
 Frame = -1

Query  1846  GECPISFLSDLLLGQWEERMSRGLFRYDVTSCETKIIPGTFGFIAQLNEGRHL-KKRPTE  1670
             G  P+S     +   W +RM  GLFRY +   +T+ +PG  GF+AQLN  R + ++RP  
Sbjct  52    GALPLSRFDSAVCSAWRQRMELGLFRYHLGELQTQTLPGAVGFVAQLNVERGVQRRRPQS  111

Query  1669  FRVDQVLQPFDENKFNFTKIGQEEVLFRFEPSNDCKSHYLPSGLVDARSGSPTVLAINVS  1490
              R   V QPFD  +FNF K+   E+LFR     D         L  A      ++ INVS
Sbjct  112   IR--SVRQPFDPEQFNFNKVRPGEILFRLHREPD---------LPGAVQQEDILVMINVS  160

Query  1489  PIEYGHVLLIPRVLDCLPQRIDHDSFFVAMHLAKEAADPFFRVGYNSLGAFATINHLHFQ  1310
             P+E+GHVLL+P     LPQR+   +    +     +  P FRVG+NSLG  A++NHLH  
Sbjct  161   PLEWGHVLLVPEPARGLPQRLLPGALRAGVEAVLLSLHPGFRVGFNSLGGLASVNHLHLH  220

Query  1309  AYYLQVPFPVEKTPTREIMRGREQGDGGIVVSQLLNYPARALLFEGGSTVRDLSDAVANS  1130
              YYL    PVE  P+  +       D G  +  L   PA   LF  G    DL   V+  
Sbjct  221   GYYLAHRLPVEGAPSEPL-------DPGGHLHFLQALPAPGFLFYTGGPGPDLEALVSRV  273

Query  1129  CIS---LQNNNIPFNLLIS  1082
             C +   L ++ I  NL ++
Sbjct  274   CRATDYLTDHEIAHNLFVT  292



>ref|XP_006905337.1| PREDICTED: GDP-D-glucose phosphorylase 1 isoform X1 [Pteropus 
alecto]
 ref|XP_006905338.1| PREDICTED: GDP-D-glucose phosphorylase 1 isoform X2 [Pteropus 
alecto]
 gb|ELK18277.1| hypothetical protein PAL_GLEAN10009502 [Pteropus alecto]
Length=385

 Score =   150 bits (378),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 95/258 (37%), Positives = 128/258 (50%), Gaps = 26/258 (10%)
 Frame = -1

Query  1837  PISFLSDLLLGQWEERMSRGLFRYDVTSCETKIIPGTFGFIAQLNEGRHL-KKRPTEFRV  1661
             P+S     L   W +RM  GLFRY +   +T+ +PG  GF+AQLN  R + ++RP   R 
Sbjct  55    PLSRFDAALRSAWRQRMELGLFRYCLGELQTQTLPGAVGFVAQLNMERGMQRRRPQNIR-  113

Query  1660  DQVLQPFDENKFNFTKIGQEEVLFRF--EPSNDCKSHYLPSGLVDARSGSPTVLAINVSP  1487
               V QPFD  +FNF KI   EVLFR   EP           GL         ++ IN+SP
Sbjct  114   -SVRQPFDPEQFNFNKIQPGEVLFRLRQEP-----------GLSGVLQQEDILVVINISP  161

Query  1486  IEYGHVLLIPRVLDCLPQRIDHDSFFVAMHLAKEAADPFFRVGYNSLGAFATINHLHFQA  1307
             +E+GHVLL+P     LPQR+        +     +A P FRVG+NSLG  A++NHLH   
Sbjct  162   LEWGHVLLVPEPAQGLPQRLLPGVLRAGLEAVLLSAHPGFRVGFNSLGGLASVNHLHLHG  221

Query  1306  YYLQVPFPVEKTPTREIMRGREQGDGGIVVSQLLNYPARALLFEGGSTVRDLSDAVANSC  1127
             YYL    PVE  P++ +       D G  +  L   PA   LF       DL   V+  C
Sbjct  222   YYLDHRLPVEGAPSKTL-------DPGGHLHLLQALPAPGFLFYTSGPGPDLEALVSRVC  274

Query  1126  IS---LQNNNIPFNLLIS  1082
              +   L ++ I  NL ++
Sbjct  275   RATDYLTDHEIAHNLFVT  292



>ref|XP_006885279.1| PREDICTED: GDP-D-glucose phosphorylase 1 [Elephantulus edwardii]
Length=390

 Score =   150 bits (378),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 96/265 (36%), Positives = 135/265 (51%), Gaps = 23/265 (9%)
 Frame = -1

Query  1846  GECPISFLSDLLLGQWEERMSRGLFRYDVTSCETKIIPGTFGFIAQLNEGRHL-KKRPTE  1670
             G  P+S     +   W +RM  GLFRY + + +T+I+PG  GF+AQLN  R + ++RP  
Sbjct  52    GALPLSRFDSAVCTAWRQRMELGLFRYCLGNLQTQILPGAVGFVAQLNVERGVQRRRPQS  111

Query  1669  FRVDQVLQPFDENKFNFTKIGQEEVLFRFEPSNDCKSHYLPSGLVDARSGSPTVLAINVS  1490
              R   + Q FD  +FNFTKI Q E LFR     D         L  A      ++ INVS
Sbjct  112   IR--SMRQAFDPKEFNFTKIQQGETLFRLRREPD---------LPGAPGQEDILVMINVS  160

Query  1489  PIEYGHVLLIPRVLDCLPQRIDHDSFFVAMHLAKEAADPFFRVGYNSLGAFATINHLHFQ  1310
             P+E+GHVLL+P     LPQR+   +    +     +  P FRVG+NSLG  A++NHLH  
Sbjct  161   PLEWGHVLLVPEPARELPQRLLPGALRAGVEAVLLSRHPGFRVGFNSLGGLASVNHLHLH  220

Query  1309  AYYLQVPFPVEKTPTREIMRGREQGDGGIVVSQLLNYPARALLFEGGSTVRDLSDAVANS  1130
              YYL    PVE  P++ +       D G  +  L   PA   LF   S   +L   V+  
Sbjct  221   GYYLTHRLPVEGAPSKRL-------DPGGRLHLLQALPAPGFLFYTCSAGPELEALVSRV  273

Query  1129  CIS---LQNNNIPFNLLISERGNKV  1064
             C +   L +++I  NL ++ RG + 
Sbjct  274   CRATDYLTDHDIAHNLFVT-RGAQA  297



>ref|XP_001168711.1| PREDICTED: GDP-D-glucose phosphorylase 1 isoform X2 [Pan troglodytes]
 ref|XP_009428104.1| PREDICTED: GDP-D-glucose phosphorylase 1 isoform X2 [Pan troglodytes]
Length=385

 Score =   149 bits (377),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 97/285 (34%), Positives = 141/285 (49%), Gaps = 24/285 (8%)
 Frame = -1

Query  1915  CLPLFAFKNDEHKCDG-DWNYLSYG---ECPISFLSDLLLGQWEERMSRGLFRYDVTSCE  1748
              +P F +   +   +G  W   + G     P S     L   W++R+  GLFRY +   +
Sbjct  25    TIPDFVYGQKDLTAEGIQWPRNAPGIPDALPQSPFDAALCSAWKQRVELGLFRYRLRELQ  84

Query  1747  TKIIPGTFGFIAQLNEGRHLKKRPTEFRVDQVLQPFDENKFNFTKIGQEEVLFRFEPSND  1568
             T+I+PG  GF+AQLN  R +++RP +  +  V Q FD  +FNF KI   EVLFR     D
Sbjct  85    TQILPGAVGFVAQLNVERGVQRRPPQ-TIKSVRQAFDPVQFNFNKIRPGEVLFRLHREPD  143

Query  1567  CKSHYLPSGLVDARSGSPTVLAINVSPIEYGHVLLIPRVLDCLPQRIDHDSFFVAMHLAK  1388
                  LP  L+        ++ INVSP+E+GHVLL+P     LPQR+   +    +    
Sbjct  144   -----LPGTLLQED----ILVVINVSPLEWGHVLLVPEPARQLPQRLLPGALRAGIEAVL  194

Query  1387  EAADPFFRVGYNSLGAFATINHLHFQAYYLQVPFPVEKTPTREIMRGREQGDGGIVVSQL  1208
              +  P FRVG+NSLG  A++NHLH   YYL    PVE+ P+  +       D G  +  L
Sbjct  195   LSLHPGFRVGFNSLGGLASVNHLHLHGYYLAHRLPVEQAPSEPL-------DPGGHLHLL  247

Query  1207  LNYPARALLFEGGSTVRDLSDAVANSCIS---LQNNNIPFNLLIS  1082
              + PA   LF       DL   ++  C +   L ++ I  NL ++
Sbjct  248   QDLPAPGFLFYARGPGPDLESLISRVCRATDYLTDHEIAHNLFVT  292



>gb|ABG81448.1| hypothetical protein LOC390637 [Bos taurus]
Length=372

 Score =   149 bits (377),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 100/285 (35%), Positives = 140/285 (49%), Gaps = 26/285 (9%)
 Frame = -1

Query  1912  LPLFAFKNDEHKCDG-DW--NYLSY-GECPISFLSDLLLGQWEERMSRGLFRYDVTSCET  1745
             +P F ++ +E   +G  W    LS     P+S     L   W +RM  GLFRY +    T
Sbjct  26    IPDFVYEQEELMMEGVQWPRGALSLLNTPPLSHFDSALCSAWRQRMELGLFRYPLGELPT  85

Query  1744  KIIPGTFGFIAQLNEGRHLKKRPTEFRVDQVLQPFDENKFNFTKIGQEEVLFRFEPSNDC  1565
             + +PGT GF+AQLN  R +++R  +  +  V Q FD  +FNF +I   EVLFR     DC
Sbjct  86    QTLPGTVGFVAQLNVERGVQRRCPQ-NIKSVRQEFDPEQFNFNQIRPGEVLFRLHRKQDC  144

Query  1564  KSHYLPSGLVDARSGSPTVLAINVSPIEYGHVLLIPRVLDCLPQRIDHDSFFVAMHLAKE  1385
                   SG V        ++ INVSP+E+GHVLL+P     LPQR+   +    +     
Sbjct  145   ------SGTVQQED---ILVVINVSPLEWGHVLLVPEPARGLPQRLLPGALRAGVEAVLL  195

Query  1384  AADPFFRVGYNSLGAFATINHLHFQAYYLQVPFPVEKTPTREI-MRGREQGDGGIVVSQL  1208
             ++ P FRVG+NSLG  A++NHLH   YYL    PVE  P+  +  RGR        +  L
Sbjct  196   SSHPGFRVGFNSLGGLASVNHLHLHGYYLAHRLPVEGAPSEPLDPRGR--------LHVL  247

Query  1207  LNYPARALLFEGGSTVRDLSDAVANSCIS---LQNNNIPFNLLIS  1082
                PA   LF       DL   ++  C +   L +  I  NL ++
Sbjct  248   QALPAPGFLFYTSRPGPDLEALISRVCRATDYLTDCEIAHNLFVT  292



>gb|AAH37479.1| D330012F22Rik protein [Mus musculus]
Length=386

 Score =   149 bits (377),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 92/257 (36%), Positives = 127/257 (49%), Gaps = 21/257 (8%)
 Frame = -1

Query  1840  CPISFLSDLLLGQWEERMSRGLFRYDVTSCETKIIPGTFGFIAQLNEGRHL-KKRPTEFR  1664
              P+S     L   W +R+  GLFRY +   +T+I+PG+ GF+AQLN  R + ++RP   R
Sbjct  54    VPLSRFDSALRSAWRQRLELGLFRYRLEDLQTQILPGSVGFVAQLNIDRGIQRRRPQNIR  113

Query  1663  VDQVLQPFDENKFNFTKIGQEEVLFRFEPSNDCKSHYLPSGLVDARSGSPTVLAINVSPI  1484
                V Q FD  +FNF KI   EVLFR +          P G    +     ++ INVSP+
Sbjct  114   --SVRQEFDPEQFNFNKIRPGEVLFRMQRE--------PKGPATPKQEDDVLVVINVSPL  163

Query  1483  EYGHVLLIPRVLDCLPQRIDHDSFFVAMHLAKEAADPFFRVGYNSLGAFATINHLHFQAY  1304
             E+GHVLL+P     LPQR+      V +     +  P FRVG+NSLG  A++NHLH   Y
Sbjct  164   EWGHVLLVPAPAQGLPQRLLPGVLRVGLEAVLLSLHPGFRVGFNSLGGLASVNHLHLHCY  223

Query  1303  YLQVPFPVEKTPTREIMRGREQGDGGIVVSQLLNYPARALLFEGGSTVRDLSDAVANSCI  1124
             YL  P PVE  P+  +       D    +  L   PA   LF       DL   ++  C 
Sbjct  224   YLAHPLPVEGAPSTPL-------DPKGCIHLLQALPAPGFLFYTSGPGPDLEVLISRVCR  276

Query  1123  S---LQNNNIPFNLLIS  1082
             +   L +  I  NL ++
Sbjct  277   ATDYLSDREIAHNLFVT  293



>ref|XP_003440556.1| PREDICTED: GDP-D-glucose phosphorylase 1-like [Oreochromis niloticus]
Length=365

 Score =   149 bits (376),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 83/246 (34%), Positives = 135/246 (55%), Gaps = 11/246 (4%)
 Frame = -1

Query  1807  GQWEERMSRGLFRYDVTSCETKIIPGTFGFIAQLNEGRHLKKRPTEFRVDQVLQPFDENK  1628
             G W +RM+RG+FRY +   +T+++ G+ G++AQLN  R +++R  +  +  + Q F   +
Sbjct  39    GGWADRMARGIFRYHLGDLKTRVLLGSHGYVAQLNIQRGIQRRKPQ-EILSIKQEFSAKQ  97

Query  1627  FNFTKIGQEEVLFRFEPSNDCKSHYLPSGLVDARSGSPTVLAINVSPIEYGHVLLIPRVL  1448
             FNF KI  +E++F  E   D K     +   +       V+ +NVSP+E+GH L +P   
Sbjct  98    FNFNKIKHDEIIF--EMIKDKKGCTPLTNNAECPQPQKMVVLVNVSPLEFGHCLFVPDPA  155

Query  1447  DCLPQRIDHDSFFVAMHLAKEAADPFFRVGYNSLGAFATINHLHFQAYYLQVPFPVEKTP  1268
              CLPQ +   +  V +     ++DP FRVG+NSLGAFA++NHLH   YYL  P  +E  P
Sbjct  156   HCLPQILTKFAIHVGIEAVLLSSDPSFRVGFNSLGAFASVNHLHLHGYYLDHPLKIESKP  215

Query  1267  TREIMRGREQGDGGIVVSQLLNYPARALLFEGGSTVRDLSDAVANSCISLQNNNIPFNLL  1088
              + +    E+G       ++L++PA  L +     V  ++  +      L N+NI  NL 
Sbjct  216   VKPLC--PEKG-----FYRILDFPAGFLFYAESEEVEKVAQTICEVTDFLVNDNIAHNLF  268

Query  1087  ISERGN  1070
             ++ RG+
Sbjct  269   LT-RGS  273



>ref|NP_001015629.1| GDP-D-glucose phosphorylase 1 [Bos taurus]
 sp|Q5E9T1.1|GDPP1_BOVIN RecName: Full=GDP-D-glucose phosphorylase 1 [Bos taurus]
 gb|AAX08856.1| similar to RIKEN cDNA D330012F22 gene [Bos taurus]
 gb|AAX31339.1| similar to RIKEN cDNA D330012F22 gene [Bos taurus]
 gb|AAX31342.1| similar to RIKEN cDNA D330012F22 gene [Bos taurus]
 tpg|DAA17663.1| TPA: hypothetical protein LOC522909 [Bos taurus]
Length=385

 Score =   149 bits (377),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 100/285 (35%), Positives = 140/285 (49%), Gaps = 26/285 (9%)
 Frame = -1

Query  1912  LPLFAFKNDEHKCDG-DW--NYLSY-GECPISFLSDLLLGQWEERMSRGLFRYDVTSCET  1745
             +P F ++ +E   +G  W    LS     P+S     L   W +RM  GLFRY +    T
Sbjct  26    IPDFVYEQEELMMEGVQWPRGALSLLNTPPLSHFDSALCSAWRQRMELGLFRYPLGELPT  85

Query  1744  KIIPGTFGFIAQLNEGRHLKKRPTEFRVDQVLQPFDENKFNFTKIGQEEVLFRFEPSNDC  1565
             + +PGT GF+AQLN  R +++R  +  +  V Q FD  +FNF +I   EVLFR     DC
Sbjct  86    QTLPGTVGFVAQLNVERGVQRRCPQ-NIKSVRQEFDPEQFNFNQIRPGEVLFRLHRKQDC  144

Query  1564  KSHYLPSGLVDARSGSPTVLAINVSPIEYGHVLLIPRVLDCLPQRIDHDSFFVAMHLAKE  1385
                   SG V        ++ INVSP+E+GHVLL+P     LPQR+   +    +     
Sbjct  145   ------SGTVQQED---ILVVINVSPLEWGHVLLVPEPARGLPQRLLPGALRAGVEAVLL  195

Query  1384  AADPFFRVGYNSLGAFATINHLHFQAYYLQVPFPVEKTPTREI-MRGREQGDGGIVVSQL  1208
             ++ P FRVG+NSLG  A++NHLH   YYL    PVE  P+  +  RGR        +  L
Sbjct  196   SSHPGFRVGFNSLGGLASVNHLHLHGYYLAHRLPVEGAPSEPLDPRGR--------LHVL  247

Query  1207  LNYPARALLFEGGSTVRDLSDAVANSCIS---LQNNNIPFNLLIS  1082
                PA   LF       DL   ++  C +   L +  I  NL ++
Sbjct  248   QALPAPGFLFYTSRPGPDLEALISRVCRATDYLTDCEIAHNLFVT  292



>ref|XP_009428103.1| PREDICTED: GDP-D-glucose phosphorylase 1 isoform X1 [Pan troglodytes]
Length=406

 Score =   150 bits (378),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 97/285 (34%), Positives = 141/285 (49%), Gaps = 24/285 (8%)
 Frame = -1

Query  1915  CLPLFAFKNDEHKCDG-DWNYLSYG---ECPISFLSDLLLGQWEERMSRGLFRYDVTSCE  1748
              +P F +   +   +G  W   + G     P S     L   W++R+  GLFRY +   +
Sbjct  25    TIPDFVYGQKDLTAEGIQWPRNAPGIPDALPQSPFDAALCSAWKQRVELGLFRYRLRELQ  84

Query  1747  TKIIPGTFGFIAQLNEGRHLKKRPTEFRVDQVLQPFDENKFNFTKIGQEEVLFRFEPSND  1568
             T+I+PG  GF+AQLN  R +++RP +  +  V Q FD  +FNF KI   EVLFR     D
Sbjct  85    TQILPGAVGFVAQLNVERGVQRRPPQ-TIKSVRQAFDPVQFNFNKIRPGEVLFRLHREPD  143

Query  1567  CKSHYLPSGLVDARSGSPTVLAINVSPIEYGHVLLIPRVLDCLPQRIDHDSFFVAMHLAK  1388
                  LP  L+        ++ INVSP+E+GHVLL+P     LPQR+   +    +    
Sbjct  144   -----LPGTLLQED----ILVVINVSPLEWGHVLLVPEPARQLPQRLLPGALRAGIEAVL  194

Query  1387  EAADPFFRVGYNSLGAFATINHLHFQAYYLQVPFPVEKTPTREIMRGREQGDGGIVVSQL  1208
              +  P FRVG+NSLG  A++NHLH   YYL    PVE+ P+  +       D G  +  L
Sbjct  195   LSLHPGFRVGFNSLGGLASVNHLHLHGYYLAHRLPVEQAPSEPL-------DPGGHLHLL  247

Query  1207  LNYPARALLFEGGSTVRDLSDAVANSCIS---LQNNNIPFNLLIS  1082
              + PA   LF       DL   ++  C +   L ++ I  NL ++
Sbjct  248   QDLPAPGFLFYARGPGPDLESLISRVCRATDYLTDHEIAHNLFVT  292



>dbj|BAE38719.1| unnamed protein product [Mus musculus]
Length=386

 Score =   149 bits (376),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 92/257 (36%), Positives = 127/257 (49%), Gaps = 21/257 (8%)
 Frame = -1

Query  1840  CPISFLSDLLLGQWEERMSRGLFRYDVTSCETKIIPGTFGFIAQLNEGRHL-KKRPTEFR  1664
              P+S     L   W +R+  GLFRY +   +T+I+PG+ GF+AQLN  R + ++RP   R
Sbjct  54    VPLSRFDSALRSAWRQRLELGLFRYRLEDLQTQILPGSVGFVAQLNIERGIQRRRPQNIR  113

Query  1663  VDQVLQPFDENKFNFTKIGQEEVLFRFEPSNDCKSHYLPSGLVDARSGSPTVLAINVSPI  1484
                V Q FD  +FNF KI   EVLFR +          P G    +     ++ INVSP+
Sbjct  114   --SVRQEFDPEQFNFNKIRPGEVLFRMQRE--------PKGPATPKQEDDVLVVINVSPL  163

Query  1483  EYGHVLLIPRVLDCLPQRIDHDSFFVAMHLAKEAADPFFRVGYNSLGAFATINHLHFQAY  1304
             E+GHVLL+P     LPQR+      V +     +  P FRVG+NSLG  A++NHLH   Y
Sbjct  164   EWGHVLLVPAPAQGLPQRLLPGVLRVGLEAVLLSLHPGFRVGFNSLGGLASVNHLHLHCY  223

Query  1303  YLQVPFPVEKTPTREIMRGREQGDGGIVVSQLLNYPARALLFEGGSTVRDLSDAVANSCI  1124
             YL  P PVE  P+  +       D    +  L   PA   LF       DL   ++  C 
Sbjct  224   YLAHPLPVEGAPSTPL-------DPKGCIHLLQALPAPGFLFYTSGPGPDLEVLISRVCR  276

Query  1123  S---LQNNNIPFNLLIS  1082
             +   L +  I  NL ++
Sbjct  277   ATDYLSDREIAHNLFVT  293



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 6726315549818