BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c576_g1_i1 len=1377 path=[1355:0-1376]

Length=1377
                                                                      Score     E

ref|XP_011030843.1|  PREDICTED: pectinesterase-like                     366   4e-117   
ref|XP_011016647.1|  PREDICTED: pectinesterase-like                     366   5e-117   
ref|XP_011016743.1|  PREDICTED: pectinesterase-like                     360   5e-115   
ref|XP_011095339.1|  PREDICTED: pectinesterase 2.1-like                 357   1e-113   
ref|XP_006377839.1|  hypothetical protein POPTR_0011s13830g             356   3e-113   
ref|XP_011095338.1|  PREDICTED: pectinesterase 2.1-like                 356   9e-113   
ref|XP_007213952.1|  hypothetical protein PRUPE_ppa003697mg             348   5e-110   
ref|XP_010267745.1|  PREDICTED: pectinesterase                          348   6e-110   
ref|XP_008224789.1|  PREDICTED: pectinesterase                          347   1e-109   
ref|XP_006573891.1|  PREDICTED: pectinesterase/pectinesterase inh...    347   1e-109   
ref|XP_007157172.1|  hypothetical protein PHAVU_002G048700g             345   4e-109   
ref|XP_002522859.1|  Pectinesterase-2 precursor, putative               345   4e-109   Ricinus communis
gb|AHC69829.1|  pectin methylesterase PME2.1                            343   3e-108   
ref|XP_009768199.1|  PREDICTED: pectinesterase 2.1-like                 343   3e-108   
ref|XP_007157169.1|  hypothetical protein PHAVU_002G048400g             338   2e-106   
emb|CBI23178.3|  unnamed protein product                                335   7e-106   
gb|AAF23891.1|  pectin methyl esterase                                  336   8e-106   Solanum tuberosum [potatoes]
ref|XP_002518523.1|  Pectinesterase precursor, putative                 337   9e-106   Ricinus communis
gb|KDP20786.1|  hypothetical protein JCGZ_21257                         337   9e-106   
ref|NP_001274785.1|  pectin methyl esterase                             336   1e-105   
ref|NP_001233948.1|  pectinesterase 2.1                                 336   1e-105   
gb|AAB67739.1|  pectin methylesterase PME2.1                            336   2e-105   Solanum lycopersicum
ref|XP_002266980.1|  PREDICTED: pectinesterase                          335   2e-105   Vitis vinifera
gb|KHN30453.1|  Pectinesterase 2.2                                      331   1e-104   
ref|XP_003622699.1|  Pectinesterase                                     334   1e-104   
gb|AFK44272.1|  unknown                                                 333   3e-104   
sp|Q96575.1|PME22_SOLLC  RecName: Full=Pectinesterase 2.2; Short=...    333   3e-104   Solanum lycopersicum
ref|XP_007157170.1|  hypothetical protein PHAVU_002G048500g             332   5e-104   
emb|CAD29733.1|  pectin methylesterase                                  330   5e-103   Sesbania rostrata
ref|XP_007025998.1|  Pectinesterase/pectinesterase inhibitor, put...    329   5e-103   
ref|XP_003622688.1|  Pectinesterase                                     329   7e-103   
ref|NP_001044480.1|  Os01g0788400                                       329   7e-103   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004492228.1|  PREDICTED: pectinesterase 2.1-like                 329   8e-103   
gb|EYU19222.1|  hypothetical protein MIMGU_mgv1a003983mg                329   9e-103   
ref|XP_007157171.1|  hypothetical protein PHAVU_002G048600g             329   1e-102   
ref|XP_011000694.1|  PREDICTED: pectinesterase                          329   1e-102   
ref|XP_009364480.1|  PREDICTED: pectinesterase                          329   1e-102   
gb|ACJ85768.1|  unknown                                                 328   2e-102   Medicago truncatula
dbj|BAC67661.1|  pectin methylesterase                                  328   2e-102   Pisum sativum [garden pea]
ref|NP_001234151.1|  pectinesterase 1 precursor                         327   3e-102   
gb|AFK35109.1|  unknown                                                 327   4e-102   
ref|XP_006360083.1|  PREDICTED: pectinesterase 2.1-like                 327   5e-102   
gb|EAY76103.1|  hypothetical protein OsI_04029                          326   1e-101   Oryza sativa Indica Group [Indian rice]
emb|CAA47810.1|  pectinesterase                                         326   2e-101   Pisum sativum [garden pea]
ref|XP_002317208.1|  pectin methylesterase family protein               325   2e-101   Populus trichocarpa [western balsam poplar]
ref|XP_006467993.1|  PREDICTED: pectinesterase/pectinesterase inh...    325   5e-101   
ref|XP_006360082.1|  PREDICTED: pectinesterase 3-like                   324   5e-101   
gb|KDO75533.1|  hypothetical protein CISIN_1g008722mg                   324   7e-101   
ref|XP_008371117.1|  PREDICTED: pectinesterase                          324   9e-101   
ref|XP_006449081.1|  hypothetical protein CICLE_v10014787mg             323   1e-100   
emb|CDP05792.1|  unnamed protein product                                320   2e-100   
dbj|BAC67662.1|  pectin methylesterase                                  323   2e-100   Pisum sativum [garden pea]
ref|XP_010101471.1|  Pectinesterase/pectinesterase inhibitor            323   2e-100   
emb|CDO99717.1|  unnamed protein product                                322   3e-100   
gb|AAC14742.1|  pectin methylesterase                                   322   4e-100   Pisum sativum [garden pea]
ref|XP_003622696.1|  Pectinesterase                                     322   7e-100   
ref|XP_006646399.1|  PREDICTED: LOW QUALITY PROTEIN: pectinestera...    320   2e-99    
emb|CDO99718.1|  unnamed protein product                                318   2e-98    
ref|XP_010057972.1|  PREDICTED: pectinesterase-like                     317   3e-98    
gb|AAB67740.1|  PME1.9                                                  313   4e-98    Solanum lycopersicum
ref|XP_004293266.1|  PREDICTED: pectinesterase/pectinesterase inh...    316   5e-98    
ref|XP_009397166.1|  PREDICTED: pectinesterase-like                     316   1e-97    
ref|XP_004492227.1|  PREDICTED: pectinesterase/pectinesterase inh...    316   1e-97    
ref|XP_010057974.1|  PREDICTED: pectinesterase-like                     315   2e-97    
gb|KHG26245.1|  Pectinesterase/pectinesterase inhibitor                 312   5e-97    
ref|XP_009769268.1|  PREDICTED: pectinesterase-like                     314   6e-97    
sp|Q96576.1|PME3_SOLLC  RecName: Full=Pectinesterase 3; Short=PE ...    313   9e-97    Solanum lycopersicum
ref|XP_010324324.1|  PREDICTED: pectinesterase 3                        311   4e-96    
ref|XP_004232737.1|  PREDICTED: pectinesterase-like                     310   2e-95    
ref|XP_010316615.1|  PREDICTED: pectinesterase-like                     310   2e-95    
ref|XP_004134752.1|  PREDICTED: pectinesterase/pectinesterase inh...    309   3e-95    
gb|AAB38794.1|  pectin methylesterase                                   305   7e-95    Solanum lycopersicum
ref|XP_006348082.1|  PREDICTED: pectinesterase/pectinesterase inh...    306   1e-94    
ref|XP_004155595.1|  PREDICTED: pectinesterase/pectinesterase inh...    307   4e-94    
ref|XP_009589755.1|  PREDICTED: pectinesterase-like                     305   9e-94    
ref|XP_010923950.1|  PREDICTED: pectinesterase-like                     304   2e-93    
ref|XP_009589961.1|  PREDICTED: LOW QUALITY PROTEIN: pectinestera...    304   4e-93    
gb|EPS63029.1|  hypothetical protein M569_11757                         303   5e-93    
ref|XP_008809854.1|  PREDICTED: pectinesterase-like                     303   5e-93    
ref|XP_008439965.1|  PREDICTED: pectinesterase                          303   1e-92    
ref|XP_009771261.1|  PREDICTED: pectinesterase-like                     302   2e-92    
ref|XP_010101474.1|  Pectinesterase/pectinesterase inhibitor            300   1e-91    
sp|P83947.1|PME1_FICPW  RecName: Full=Pectinesterase/pectinestera...    299   2e-91    Ficus pumila var. awkeotsang [jelly fig]
ref|XP_010088582.1|  Pectinesterase/pectinesterase inhibitor            300   2e-90    
ref|XP_006843574.1|  hypothetical protein AMTR_s00007p00101250          294   3e-89    
dbj|BAK05307.1|  predicted protein                                      293   7e-89    
ref|XP_003564371.1|  PREDICTED: pectinesterase                          292   1e-88    
ref|XP_006307176.1|  hypothetical protein CARUB_v10008769mg             291   2e-88    
ref|XP_009118185.1|  PREDICTED: pectinesterase/pectinesterase inh...    291   4e-88    
gb|ACJ02103.1|  pectin methylesterase                                   290   5e-88    
ref|XP_006417343.1|  hypothetical protein EUTSA_v10007263mg             291   5e-88    
ref|XP_002456465.1|  hypothetical protein SORBIDRAFT_03g036790          290   9e-88    Sorghum bicolor [broomcorn]
ref|XP_010476087.1|  PREDICTED: pectinesterase/pectinesterase inh...    288   4e-87    
ref|XP_010553426.1|  PREDICTED: pectinesterase/pectinesterase inh...    286   3e-86    
ref|XP_010458561.1|  PREDICTED: pectinesterase/pectinesterase inh...    285   5e-86    
ref|NP_172624.1|  methylesterase PCR A                                  285   5e-86    Arabidopsis thaliana [mouse-ear cress]
gb|AAK59760.1|  At1g11580/T23J18_33                                     285   6e-86    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010493017.1|  PREDICTED: pectinesterase/pectinesterase inh...    285   6e-86    
gb|AFC98398.1|  pectin methylesterase                                   285   1e-85    
ref|XP_002889876.1|  At1g11580/T23J18_33                                283   6e-85    
pir||S00629  pectinesterase (EC 3.1.1.11) precursor (clone PE1) -...    278   7e-85 
gb|KFK43434.1|  hypothetical protein AALP_AA1G125000                    281   2e-84    
emb|CDM84519.1|  unnamed protein product                                273   9e-83    
emb|CDY34642.1|  BnaC08g42010D                                          274   1e-82    
gb|ABK24761.1|  unknown                                                 275   5e-82    Picea sitchensis
sp|Q43062.1|PME_PRUPE  RecName: Full=Pectinesterase/pectinesteras...    273   2e-81    Prunus persica
ref|XP_007204326.1|  hypothetical protein PRUPE_ppa004300mg             272   3e-81    
ref|XP_010273802.1|  PREDICTED: pectinesterase/pectinesterase inh...    271   4e-81    
ref|XP_009369733.1|  PREDICTED: pectinesterase/pectinesterase inh...    271   7e-81    
ref|XP_004510571.1|  PREDICTED: pectinesterase 3-like                   272   1e-80    
ref|XP_008337790.1|  PREDICTED: pectinesterase/pectinesterase inh...    267   1e-79    
gb|AGR44473.1|  pectin methylesterase 4                                 265   2e-79    
ref|XP_008242144.1|  PREDICTED: pectinesterase/pectinesterase inh...    266   4e-79    
ref|XP_009359674.1|  PREDICTED: pectinesterase/pectinesterase inh...    265   1e-78    
dbj|BAF42041.1|  pectin methylesterase 4                                264   3e-78    Pyrus communis
ref|XP_010932330.1|  PREDICTED: pectinesterase-like                     263   7e-78    
ref|XP_010271268.1|  PREDICTED: pectinesterase-like                     263   1e-77    
ref|XP_010259481.1|  PREDICTED: pectinesterase-like                     264   2e-77    
gb|EYU28290.1|  hypothetical protein MIMGU_mgv1a004392mg                262   2e-77    
ref|XP_008803239.1|  PREDICTED: pectinesterase                          262   2e-77    
gb|EPS63648.1|  pectinesterase                                          260   6e-77    
emb|CDY00192.1|  BnaA06g20930D                                          259   1e-76    
ref|XP_011093902.1|  PREDICTED: pectinesterase/pectinesterase inh...    259   1e-76    
ref|XP_004159762.1|  PREDICTED: pectinesterase/pectinesterase inh...    257   1e-76    
gb|ABJ99595.1|  pectinesterase inhibitor                                261   2e-76    Lycoris aurea [golden hurricane-lily]
ref|XP_008795768.1|  PREDICTED: pectinesterase-like                     260   2e-76    
ref|XP_009768722.1|  PREDICTED: probable pectinesterase/pectinest...    260   3e-76    
gb|ABJ99594.1|  pectinesterase inhibitor                                260   4e-76    Lycoris aurea [golden hurricane-lily]
ref|XP_008359413.1|  PREDICTED: pectinesterase-like                     259   6e-76    
ref|XP_004146188.1|  PREDICTED: pectinesterase/pectinesterase inh...    258   6e-76    
ref|XP_008806757.1|  PREDICTED: LOW QUALITY PROTEIN: probable pec...    260   7e-76    
ref|XP_004508051.1|  PREDICTED: pectinesterase/pectinesterase inh...    258   7e-76    
ref|XP_011092101.1|  PREDICTED: putative pectinesterase/pectinest...    258   9e-76    
gb|AFK36090.1|  unknown                                                 255   1e-75    
ref|XP_010259035.1|  PREDICTED: pectinesterase 2-like                   258   1e-75    
gb|ABQ42392.1|  pectin methylesterase-like protein                      259   1e-75    Taiwania cryptomerioides
ref|XP_008235121.1|  PREDICTED: pectinesterase-like                     258   2e-75    
ref|XP_008448427.1|  PREDICTED: pectinesterase/pectinesterase inh...    258   2e-75    
ref|XP_006444399.1|  hypothetical protein CICLE_v100237231mg            257   2e-75    
gb|AHB84678.1|  pectin methylesterase                                   258   3e-75    
ref|XP_006576426.1|  PREDICTED: pectinesterase 2-like                   256   3e-75    
ref|XP_003608136.1|  Pectinesterase                                     256   3e-75    
gb|KGN55582.1|  hypothetical protein Csa_3G000060                       258   3e-75    
ref|XP_010687599.1|  PREDICTED: pectinesterase/pectinesterase inh...    256   4e-75    
ref|XP_010271283.1|  PREDICTED: pectinesterase                          256   4e-75    
gb|ABZ89800.1|  pectin methylesterase-like protein                      257   5e-75    Taiwania cryptomerioides
ref|XP_009604014.1|  PREDICTED: probable pectinesterase/pectinest...    257   5e-75    
ref|XP_007201179.1|  hypothetical protein PRUPE_ppa003400mg             257   5e-75    
ref|XP_006480001.1|  PREDICTED: probable pectinesterase/pectinest...    257   5e-75    
ref|XP_011034009.1|  PREDICTED: pectinesterase 2                        254   1e-74    
gb|AGG23325.1|  pectin methylesterase 1                                 256   1e-74    
ref|XP_010230835.1|  PREDICTED: pectinesterase-like                     256   1e-74    
gb|ACQ85264.1|  pectin methylesterase                                   255   2e-74    Musa acuminata AAA Group [Cavendish banana]
ref|XP_011015915.1|  PREDICTED: pectinesterase-like                     255   2e-74    
gb|EEC82670.1|  hypothetical protein OsI_27314                          256   2e-74    Oryza sativa Indica Group [Indian rice]
ref|XP_011010963.1|  PREDICTED: pectinesterase-like                     255   2e-74    
ref|NP_001060620.1|  Os07g0675100                                       255   2e-74    Oryza sativa Japonica Group [Japonica rice]
gb|AGJ83739.1|  pectinesterase/pectinesterase inhibitor PPE8B-lik...    253   2e-74    
ref|XP_009150156.1|  PREDICTED: probable pectinesterase/pectinest...    256   3e-74    
ref|XP_010266280.1|  PREDICTED: pectinesterase-like                     254   3e-74    
ref|XP_010925933.1|  PREDICTED: probable pectinesterase/pectinest...    255   3e-74    
ref|NP_001147569.1|  pectinesterase PPE8B precursor                     254   3e-74    Zea mays [maize]
ref|XP_009382521.1|  PREDICTED: pectinesterase-like                     255   3e-74    
ref|XP_007134831.1|  hypothetical protein PHAVU_010G079900g             253   5e-74    
ref|XP_003517029.1|  PREDICTED: pectinesterase 2-like                   253   6e-74    
ref|XP_002320714.1|  putative pectin methylesterase LuPME1 family...    253   7e-74    Populus trichocarpa [western balsam poplar]
ref|XP_010049304.1|  PREDICTED: pectinesterase/pectinesterase inh...    253   7e-74    
ref|XP_003534983.1|  PREDICTED: pectinesterase/pectinesterase inh...    253   7e-74    
ref|XP_006490097.1|  PREDICTED: pectinesterase 2-like                   253   7e-74    
gb|KDP33983.1|  hypothetical protein JCGZ_07554                         252   8e-74    
ref|XP_010917364.1|  PREDICTED: pectinesterase                          253   8e-74    
ref|XP_009385286.1|  PREDICTED: putative pectinesterase/pectinest...    254   8e-74    
ref|XP_010271267.1|  PREDICTED: pectinesterase-like                     253   8e-74    
ref|XP_006421695.1|  hypothetical protein CICLE_v10004742mg             252   9e-74    
ref|XP_010271269.1|  PREDICTED: pectinesterase-like                     253   9e-74    
gb|KDO65446.1|  hypothetical protein CISIN_1g010103mg                   252   1e-73    
ref|XP_004287682.1|  PREDICTED: pectinesterase/pectinesterase inh...    252   1e-73    
ref|XP_009421463.1|  PREDICTED: probable pectinesterase/pectinest...    254   1e-73    
ref|XP_002875955.1|  pectinesterase family protein                      254   2e-73    
gb|KCW73020.1|  hypothetical protein EUGRSUZ_E01454                     251   2e-73    
ref|XP_003595386.1|  Pectinesterase                                     252   2e-73    
gb|AAQ21124.1|  pectinesterase                                          251   2e-73    Fragaria x ananassa
gb|AFW03483.1|  pectin methylesterase 4                                 251   2e-73    
ref|XP_004290811.1|  PREDICTED: probable pectinesterase/pectinest...    252   3e-73    
ref|XP_009783075.1|  PREDICTED: pectinesterase-like                     252   3e-73    
gb|KHF97563.1|  Pectinesterase/pectinesterase inhibitor PPE8B           251   3e-73    
emb|CAA64217.1|  pectinmethylesterase                                   245   3e-73    Vigna radiata var. radiata [golden gram]
ref|NP_190491.1|  putative pectinesterase/pectinesterase inhibito...    253   3e-73    Arabidopsis thaliana [mouse-ear cress]
ref|XP_004511148.1|  PREDICTED: probable pectinesterase/pectinest...    252   4e-73    
ref|XP_010056335.1|  PREDICTED: pectinesterase 2-like                   251   4e-73    
gb|AFW03478.1|  pectin methylesterase 4                                 251   4e-73    
ref|XP_011076284.1|  PREDICTED: probable pectinesterase/pectinest...    252   4e-73    
emb|CDY08117.1|  BnaA06g16090D                                          250   4e-73    
ref|XP_004136014.1|  PREDICTED: probable pectinesterase/pectinest...    251   5e-73    
ref|XP_008242331.1|  PREDICTED: pectinesterase-like                     251   6e-73    
ref|XP_010056339.1|  PREDICTED: pectinesterase 2-like                   250   6e-73    
gb|AFW03477.1|  pectin methylesterase 3                                 250   6e-73    
ref|XP_002301486.2|  hypothetical protein POPTR_0002s20370g             251   6e-73    Populus trichocarpa [western balsam poplar]
emb|CDY05911.1|  BnaC08g20880D                                          249   7e-73    
ref|XP_008653464.1|  PREDICTED: pectinesterase-like                     252   7e-73    
gb|KEH29125.1|  pectinesterase/pectinesterase inhibitor                 249   8e-73    
gb|AFW03484.1|  pectin methylesterase 5                                 250   8e-73    
gb|AER38246.1|  PME3                                                    250   8e-73    
ref|XP_004958677.1|  PREDICTED: pectinesterase 3-like                   252   8e-73    
gb|KGN44975.1|  Pectinesterase                                          252   9e-73    
ref|XP_010269596.1|  PREDICTED: pectinesterase-like                     251   9e-73    
ref|XP_010056338.1|  PREDICTED: pectinesterase 2-like                   249   9e-73    
ref|XP_011029953.1|  PREDICTED: pectinesterase 2-like                   249   9e-73    
gb|AFK41384.1|  unknown                                                 246   9e-73    
gb|KHN47891.1|  Pectinesterase 2                                        249   1e-72    
emb|CDX86987.1|  BnaC03g52570D                                          254   1e-72    
ref|XP_010432596.1|  PREDICTED: probable pectinesterase/pectinest...    249   1e-72    
ref|XP_011076334.1|  PREDICTED: probable pectinesterase/pectinest...    248   2e-72    
ref|XP_008460354.1|  PREDICTED: pectinesterase 3                        251   2e-72    
ref|XP_008795812.1|  PREDICTED: putative pectinesterase/pectinest...    249   2e-72    
gb|ACN40984.1|  unknown                                                 251   2e-72    Picea sitchensis
ref|XP_006852649.1|  hypothetical protein AMTR_s00021p00242180          251   2e-72    
ref|XP_008812473.1|  PREDICTED: pectinesterase-like                     249   2e-72    
ref|XP_007163135.1|  hypothetical protein PHAVU_001G209400g             251   2e-72    
gb|KHN08672.1|  Putative pectinesterase/pectinesterase inhibitor 40     247   2e-72    
ref|XP_006445298.1|  hypothetical protein CICLE_v10019773mg             248   2e-72    
ref|XP_010264199.1|  PREDICTED: pectinesterase 2-like                   249   2e-72    
ref|XP_009417531.1|  PREDICTED: probable pectinesterase/pectinest...    251   2e-72    
ref|XP_011078158.1|  PREDICTED: pectinesterase/pectinesterase inh...    249   2e-72    
ref|XP_010098938.1|  Pectinesterase 2                                   248   3e-72    
gb|AER38245.1|  PME4                                                    248   3e-72    
ref|XP_010271266.1|  PREDICTED: pectinesterase-like                     249   3e-72    
ref|XP_007052106.1|  Pectinesterase 2                                   248   3e-72    
ref|XP_009404434.1|  PREDICTED: probable pectinesterase/pectinest...    250   3e-72    
ref|XP_004171768.1|  PREDICTED: probable pectinesterase/pectinest...    250   4e-72    
ref|XP_008783207.1|  PREDICTED: probable pectinesterase/pectinest...    250   4e-72    
gb|AFW03479.1|  pectin methylesterase 5                                 248   4e-72    
ref|XP_006404164.1|  hypothetical protein EUTSA_v10010220mg             250   4e-72    
ref|XP_010526022.1|  PREDICTED: probable pectinesterase/pectinest...    248   4e-72    
ref|NP_001172245.1|  Os01g0234300                                       250   5e-72    
ref|XP_009614349.1|  PREDICTED: probable pectinesterase/pectinest...    249   5e-72    
gb|KHN43320.1|  Putative pectinesterase/pectinesterase inhibitor 22     248   5e-72    
ref|XP_007204488.1|  hypothetical protein PRUPE_ppa019698mg             248   5e-72    
ref|XP_010257625.1|  PREDICTED: pectinesterase 2-like                   248   5e-72    
ref|XP_006841486.1|  hypothetical protein AMTR_s00003p00120050          248   6e-72    
gb|AER38244.1|  PME5                                                    248   6e-72    
gb|KEH24404.1|  pectinesterase/pectinesterase inhibitor                 248   7e-72    
ref|XP_004144445.1|  PREDICTED: pectinesterase 3-like                   249   7e-72    
ref|XP_010447268.1|  PREDICTED: probable pectinesterase/pectinest...    248   8e-72    
ref|XP_009149756.1|  PREDICTED: probable pectinesterase/pectinest...    249   8e-72    
emb|CAB36796.1|  pectinesterase-like protein                            246   8e-72    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010437787.1|  PREDICTED: probable pectinesterase/pectinest...    247   9e-72    
ref|XP_006412377.1|  hypothetical protein EUTSA_v10024900mg             247   9e-72    
ref|XP_002463382.1|  hypothetical protein SORBIDRAFT_02g042780          249   1e-71    Sorghum bicolor [broomcorn]
ref|XP_010556724.1|  PREDICTED: pectinesterase-like                     248   1e-71    
ref|XP_011010931.1|  PREDICTED: pectinesterase 2-like                   247   1e-71    
ref|XP_009596446.1|  PREDICTED: probable pectinesterase/pectinest...    249   1e-71    
gb|ABK94644.1|  unknown                                                 241   1e-71    Populus trichocarpa [western balsam poplar]
ref|XP_003530788.1|  PREDICTED: probable pectinesterase/pectinest...    247   1e-71    
ref|XP_003554631.1|  PREDICTED: putative pectinesterase/pectinest...    247   1e-71    
gb|KDO85751.1|  hypothetical protein CISIN_1g010441mg                   246   1e-71    
emb|CAA66361.1|  pectin methylesterase                                  237   1e-71    Solanum tuberosum [potatoes]
ref|XP_006412378.1|  hypothetical protein EUTSA_v10024900mg             246   2e-71    
ref|XP_006283426.1|  hypothetical protein CARUB_v10004474mg             248   2e-71    
ref|XP_010915944.1|  PREDICTED: probable pectinesterase/pectinest...    248   2e-71    
ref|NP_001275775.1|  pectinesterase 2 precursor                         246   2e-71    
emb|CDP20891.1|  unnamed protein product                                246   2e-71    
ref|XP_004514851.1|  PREDICTED: pectinesterase 2-like                   246   2e-71    
ref|XP_002511679.1|  Pectinesterase-2 precursor, putative               246   2e-71    Ricinus communis
ref|XP_010426432.1|  PREDICTED: probable pectinesterase/pectinest...    248   2e-71    
ref|XP_006355816.1|  PREDICTED: pectinesterase-like                     245   2e-71    
gb|KHG19575.1|  Uncharacterized protein F383_07269                      246   2e-71    
ref|XP_002322401.1|  putative pectin methylesterase family protein      246   2e-71    Populus trichocarpa [western balsam poplar]
ref|XP_003519757.1|  PREDICTED: probable pectinesterase/pectinest...    247   2e-71    
sp|O04887.1|PME2_CITSI  RecName: Full=Pectinesterase 2; Short=PE ...    246   2e-71    Citrus sinensis [Valencia orange]
ref|XP_004514850.1|  PREDICTED: pectinesterase 2-like                   246   2e-71    
ref|XP_007219746.1|  hypothetical protein PRUPE_ppa024156mg             247   2e-71    
gb|EPS62329.1|  pectinesterase                                          247   2e-71    
ref|XP_010503572.1|  PREDICTED: probable pectinesterase/pectinest...    248   2e-71    
ref|XP_006658118.1|  PREDICTED: pectinesterase 3-like                   247   2e-71    
ref|XP_003521940.1|  PREDICTED: pectinesterase 2-like                   246   3e-71    
ref|XP_004499740.1|  PREDICTED: putative pectinesterase/pectinest...    247   3e-71    
sp|Q43111.1|PME3_PHAVU  RecName: Full=Pectinesterase 3; Short=PE ...    248   3e-71    Phaseolus vulgaris [French bean]
ref|XP_009592542.1|  PREDICTED: pectinesterase-like                     247   3e-71    
gb|KHG05999.1|  putative pectinesterase/pectinesterase inhibitor ...    247   3e-71    
gb|KHN35617.1|  Pectinesterase 2                                        245   3e-71    
ref|XP_010261671.1|  PREDICTED: pectinesterase-like                     247   3e-71    
ref|XP_003521947.1|  PREDICTED: pectinesterase 2-like                   245   3e-71    
ref|XP_002455538.1|  hypothetical protein SORBIDRAFT_03g012830          247   3e-71    
ref|NP_567917.4|  pectinesterase 44                                     246   4e-71    
ref|XP_004148139.1|  PREDICTED: pectinesterase 2-like                   246   4e-71    
emb|CDP19933.1|  unnamed protein product                                246   4e-71    
emb|CDP00815.1|  unnamed protein product                                246   4e-71    
ref|XP_007012504.1|  Pectinesterase/pectinesterase inhibitor PPE8B      246   4e-71    
ref|XP_006344555.1|  PREDICTED: pectinesterase/pectinesterase inh...    246   5e-71    
ref|XP_007154532.1|  hypothetical protein PHAVU_003G126500g             245   5e-71    
ref|XP_002523113.1|  Pectinesterase-3 precursor, putative               246   6e-71    
emb|CDY45033.1|  BnaA08g11860D                                          244   6e-71    
ref|XP_003598363.1|  Pectinesterase                                     246   6e-71    
ref|XP_002318285.1|  putative pectin methylesterase family protein      245   7e-71    
emb|CAB95025.1|  pectin methylesterase                                  246   7e-71    
ref|XP_006578909.1|  PREDICTED: probable pectinesterase/pectinest...    246   8e-71    
ref|XP_008380734.1|  PREDICTED: pectinesterase 3                        246   8e-71    
ref|XP_010515266.1|  PREDICTED: probable pectinesterase/pectinest...    247   8e-71    
dbj|BAJ96804.1|  predicted protein                                      246   8e-71    
ref|XP_010519424.1|  PREDICTED: probable pectinesterase/pectinest...    247   8e-71    
emb|CDY49170.1|  BnaA02g10290D                                          243   9e-71    
ref|XP_006826911.1|  hypothetical protein AMTR_s00010p00161740          244   9e-71    
ref|XP_007138594.1|  hypothetical protein PHAVU_009G222100g             244   1e-70    
gb|KEH21379.1|  pectinesterase/pectinesterase inhibitor                 245   1e-70    
ref|XP_006828609.1|  hypothetical protein AMTR_s00129p00068690          246   1e-70    
ref|XP_007146997.1|  hypothetical protein PHAVU_006G088000g             245   1e-70    
ref|XP_009628637.1|  PREDICTED: pectinesterase-like                     245   1e-70    
ref|XP_009108811.1|  PREDICTED: probable pectinesterase/pectinest...    244   1e-70    
ref|XP_010464091.1|  PREDICTED: putative pectinesterase/pectinest...    244   1e-70    
ref|XP_010056336.1|  PREDICTED: pectinesterase 2-like                   244   1e-70    
ref|XP_009766156.1|  PREDICTED: pectinesterase 2-like                   244   1e-70    
ref|XP_010486018.1|  PREDICTED: putative pectinesterase/pectinest...    244   1e-70    
ref|XP_007038413.1|  Pectinesterase                                     244   1e-70    
ref|XP_006433467.1|  hypothetical protein CICLE_v10000816mg             244   1e-70    
ref|XP_004303759.1|  PREDICTED: pectinesterase 3-like                   246   1e-70    
ref|XP_009765668.1|  PREDICTED: pectinesterase-like                     245   1e-70    
gb|KGN57272.1|  hypothetical protein Csa_3G175720                       245   1e-70    
ref|XP_004240956.1|  PREDICTED: probable pectinesterase/pectinest...    246   2e-70    
ref|XP_008439095.1|  PREDICTED: pectinesterase-like                     245   2e-70    
ref|XP_008803383.1|  PREDICTED: pectinesterase                          244   2e-70    
ref|XP_008231878.1|  PREDICTED: probable pectinesterase/pectinest...    245   2e-70    
ref|XP_003526711.1|  PREDICTED: probable pectinesterase/pectinest...    245   2e-70    
ref|XP_010321856.1|  PREDICTED: pectinesterase                          245   2e-70    
gb|KHN26433.1|  Putative pectinesterase/pectinesterase inhibitor 24     244   2e-70    
ref|XP_006426799.1|  hypothetical protein CICLE_v10025232mg             245   2e-70    
ref|XP_003526361.1|  PREDICTED: putative pectinesterase/pectinest...    245   2e-70    
ref|XP_007145198.1|  hypothetical protein PHAVU_007G218500g             244   2e-70    
ref|XP_009628696.1|  PREDICTED: pectinesterase 2                        244   2e-70    
ref|XP_002510940.1|  Pectinesterase-2 precursor, putative               242   2e-70    
gb|EYU40533.1|  hypothetical protein MIMGU_mgv1a019770mg                243   2e-70    
ref|XP_010056337.1|  PREDICTED: pectinesterase 2-like                   243   2e-70    
ref|XP_004502642.1|  PREDICTED: probable pectinesterase/pectinest...    245   2e-70    
emb|CDY28287.1|  BnaC03g66720D                                          243   2e-70    
emb|CDX96216.1|  BnaC02g14350D                                          241   2e-70    
ref|XP_009111740.1|  PREDICTED: putative pectinesterase/pectinest...    248   2e-70    
ref|XP_003546532.1|  PREDICTED: pectinesterase/pectinesterase inh...    243   3e-70    
emb|CDX99968.1|  BnaC09g03330D                                          247   3e-70    
ref|NP_566038.1|  putative pectinesterase/pectinesterase inhibito...    243   3e-70    
ref|XP_007024771.1|  Pectin methylesterase 3 isoform 2                  243   3e-70    
ref|XP_007031047.1|  Plant invertase/pectin methylesterase inhibi...    243   3e-70    
ref|XP_010910186.1|  PREDICTED: pectinesterase-like                     243   3e-70    
ref|XP_008234391.1|  PREDICTED: pectinesterase 2-like                   243   4e-70    
ref|XP_003517028.1|  PREDICTED: pectinesterase 2-like                   243   4e-70    
ref|XP_009762395.1|  PREDICTED: pectinesterase/pectinesterase inh...    244   4e-70    
ref|XP_009414355.1|  PREDICTED: putative pectinesterase/pectinest...    243   4e-70    
gb|KHN47892.1|  Pectinesterase 2                                        242   4e-70    
gb|KDP22414.1|  hypothetical protein JCGZ_26245                         243   4e-70    
ref|XP_010921646.1|  PREDICTED: putative pectinesterase/pectinest...    243   4e-70    
emb|CBI29628.3|  unnamed protein product                                243   5e-70    
ref|XP_010044212.1|  PREDICTED: pectinesterase                          243   5e-70    
gb|KHN42841.1|  Pectinesterase/pectinesterase inhibitor PPE8B           243   5e-70    
ref|XP_009763675.1|  PREDICTED: probable pectinesterase/pectinest...    244   5e-70    
gb|EYU42198.1|  hypothetical protein MIMGU_mgv1a019879mg                242   5e-70    
emb|CBI27756.3|  unnamed protein product                                243   5e-70    
ref|XP_010325628.1|  PREDICTED: pectinesterase 2                        242   6e-70    
ref|XP_004242901.1|  PREDICTED: pectinesterase/pectinesterase inh...    243   6e-70    
emb|CDX83392.1|  BnaA03g21140D                                          240   6e-70    
ref|XP_006363205.1|  PREDICTED: probable pectinesterase/pectinest...    243   7e-70    
emb|CDY35644.1|  BnaC09g29660D                                          240   7e-70    
ref|XP_003634048.1|  PREDICTED: pectinesterase 2-like                   242   7e-70    
emb|CDX95641.1|  BnaC03g25220D                                          240   7e-70    
ref|XP_008375414.1|  PREDICTED: putative pectinesterase/pectinest...    243   7e-70    
ref|NP_001268091.1|  pectin methylesterase PME1 precursor               242   8e-70    
ref|XP_009372890.1|  PREDICTED: pectinesterase 2-like                   242   8e-70    
gb|AFW03482.1|  pectin methylesterase 3                                 242   8e-70    
ref|XP_008356804.1|  PREDICTED: putative pectinesterase/pectinest...    243   8e-70    
ref|XP_006382445.1|  pectinesterase family protein                      241   8e-70    
ref|XP_011070723.1|  PREDICTED: LOW QUALITY PROTEIN: pectinesterase     241   8e-70    
ref|XP_006347887.1|  PREDICTED: pectinesterase 2-like                   242   9e-70    
ref|XP_009370475.1|  PREDICTED: pectinesterase 2-like                   242   9e-70    
ref|XP_007220109.1|  hypothetical protein PRUPE_ppa021446mg             241   9e-70    
emb|CAN60612.1|  hypothetical protein VITISV_003251                     242   9e-70    
ref|XP_010541676.1|  PREDICTED: probable pectinesterase/pectinest...    242   9e-70    
ref|XP_007141001.1|  hypothetical protein PHAVU_008G158900g             244   1e-69    
ref|XP_008436965.1|  PREDICTED: pectinesterase 2-like                   241   1e-69    
ref|XP_006360163.1|  PREDICTED: probable pectinesterase/pectinest...    243   1e-69    
ref|XP_006290776.1|  hypothetical protein CARUB_v10016881mg             244   1e-69    
gb|KDP42887.1|  hypothetical protein JCGZ_23829                         243   1e-69    
ref|XP_002869219.1|  predicted protein                                  242   1e-69    
ref|XP_007136533.1|  hypothetical protein PHAVU_009G053000g             243   1e-69    
ref|XP_006293950.1|  hypothetical protein CARUB_v10022941mg             242   1e-69    
ref|XP_010518135.1|  PREDICTED: probable pectinesterase/pectinest...    241   1e-69    
ref|XP_010508199.1|  PREDICTED: probable pectinesterase/pectinest...    241   1e-69    
ref|XP_004234932.2|  PREDICTED: probable pectinesterase/pectinest...    241   1e-69    
ref|XP_002882002.1|  predicted protein                                  241   1e-69    
ref|XP_010520512.1|  PREDICTED: probable pectinesterase/pectinest...    241   1e-69    
ref|XP_010506460.1|  PREDICTED: probable pectinesterase/pectinest...    241   1e-69    
ref|XP_003627449.1|  Pectinesterase                                     243   1e-69    
ref|XP_009402043.1|  PREDICTED: putative pectinesterase/pectinest...    242   1e-69    
ref|XP_006367816.1|  PREDICTED: probable pectinesterase/pectinest...    240   1e-69    
ref|XP_007160398.1|  hypothetical protein PHAVU_002G318500g             241   2e-69    
ref|XP_004174049.1|  PREDICTED: pectinesterase 2-like                   239   2e-69    
ref|XP_002277473.1|  PREDICTED: pectinesterase                          243   2e-69    
ref|XP_002444448.1|  hypothetical protein SORBIDRAFT_07g022090          243   2e-69    
ref|XP_010524372.1|  PREDICTED: probable pectinesterase/pectinest...    241   2e-69    
ref|XP_011036906.1|  PREDICTED: putative pectinesterase/pectinest...    241   2e-69    
ref|XP_007024770.1|  Pectin methylesterase 3 isoform 1                  242   2e-69    
ref|XP_004160886.1|  PREDICTED: pectinesterase 2-like                   246   2e-69    
ref|XP_010101977.1|  putative pectinesterase/pectinesterase inhib...    241   2e-69    
emb|CDP15270.1|  unnamed protein product                                242   2e-69    
ref|XP_011079312.1|  PREDICTED: pectinesterase 1-like                   242   2e-69    
ref|XP_009151913.1|  PREDICTED: probable pectinesterase/pectinest...    243   2e-69    
ref|XP_006465803.1|  PREDICTED: pectinesterase 3-like                   242   2e-69    
gb|KDP28780.1|  hypothetical protein JCGZ_14551                         240   3e-69    
ref|XP_006350555.1|  PREDICTED: probable pectinesterase/pectinest...    242   3e-69    
ref|XP_004247400.1|  PREDICTED: pectinesterase-like                     241   3e-69    
ref|XP_009133718.1|  PREDICTED: probable pectinesterase/pectinest...    240   3e-69    
gb|KEH19215.1|  pectinesterase/pectinesterase inhibitor                 242   3e-69    
ref|XP_010271372.1|  PREDICTED: pectinesterase-like                     241   3e-69    
emb|CAA96434.1|  pectin methylesterase                                  234   3e-69    
gb|KHN42842.1|  Pectinesterase/pectinesterase inhibitor PPE8B           240   3e-69    
ref|XP_006397702.1|  hypothetical protein EUTSA_v10001409mg             240   4e-69    
ref|XP_006452917.1|  hypothetical protein CICLE_v10007993mg             240   4e-69    
ref|XP_006474555.1|  PREDICTED: pectinesterase/pectinesterase inh...    240   4e-69    
ref|XP_003551027.1|  PREDICTED: pectinesterase/pectinesterase inh...    240   4e-69    
ref|XP_011076457.1|  PREDICTED: probable pectinesterase/pectinest...    242   4e-69    
pdb|1XG2|A  Chain A, Crystal Structure Of The Complex Between Pec...    234   5e-69    
ref|XP_006359860.1|  PREDICTED: probable pectinesterase/pectinest...    241   5e-69    
ref|XP_009127175.1|  PREDICTED: probable pectinesterase/pectinest...    241   5e-69    
ref|XP_009766961.1|  PREDICTED: probable pectinesterase/pectinest...    241   5e-69    
ref|XP_004494389.1|  PREDICTED: probable pectinesterase/pectinest...    241   5e-69    
gb|KHN21590.1|  Putative pectinesterase/pectinesterase inhibitor 6      240   5e-69    
ref|XP_010654104.1|  PREDICTED: pectinesterase                          240   5e-69    
ref|XP_002280446.1|  PREDICTED: pectinesterase 2                        239   6e-69    
ref|XP_006580437.1|  PREDICTED: probable pectinesterase/pectinest...    240   6e-69    
ref|XP_004235526.1|  PREDICTED: pectinesterase 3                        241   6e-69    
gb|AAO85706.1|  pectin methyl-esterase                                  241   6e-69    
emb|CAA96435.1|  pectin methylesterase                                  233   7e-69    
ref|XP_003574571.1|  PREDICTED: pectinesterase/pectinesterase inh...    240   7e-69    
ref|XP_010101979.1|  putative pectinesterase/pectinesterase inhib...    238   7e-69    
ref|XP_009773838.1|  PREDICTED: pectinesterase 2-like                   239   8e-69    
ref|XP_009413991.1|  PREDICTED: pectinesterase-like                     240   8e-69    
ref|XP_010088302.1|  putative pectinesterase/pectinesterase inhib...    240   8e-69    
ref|XP_006828586.1|  hypothetical protein AMTR_s00129p00044320          240   9e-69    
ref|XP_010107092.1|  Pectinesterase/pectinesterase inhibitor PPE8B      247   9e-69    
gb|KFK34211.1|  hypothetical protein AALP_AA5G115200                    241   9e-69    
ref|XP_008450601.1|  PREDICTED: putative pectinesterase/pectinest...    238   9e-69    
gb|EYU45917.1|  hypothetical protein MIMGU_mgv1a003666mg                240   1e-68    
ref|XP_009612569.1|  PREDICTED: probable pectinesterase/pectinest...    240   1e-68    
gb|KDO87160.1|  hypothetical protein CISIN_1g015794mg                   236   1e-68    
ref|XP_006342896.1|  PREDICTED: pectinesterase 3-like                   240   1e-68    
ref|XP_009627969.1|  PREDICTED: probable pectinesterase/pectinest...    239   1e-68    
emb|CDX98441.1|  BnaC05g39340D                                          240   1e-68    
ref|XP_006828588.1|  hypothetical protein AMTR_s00129p00047530          239   1e-68    
ref|XP_004307817.1|  PREDICTED: pectinesterase 2-like                   237   1e-68    
ref|XP_010659655.1|  PREDICTED: LOW QUALITY PROTEIN: putative pec...    239   1e-68    
ref|XP_008377824.1|  PREDICTED: pectinesterase 2-like                   239   1e-68    
emb|CDX74715.1|  BnaA05g04610D                                          236   1e-68    
ref|XP_006381541.1|  Pectinesterase PPE8B precursor family protein      239   1e-68    
ref|XP_010495536.1|  PREDICTED: putative pectinesterase/pectinest...    241   1e-68    
gb|KDP28190.1|  hypothetical protein JCGZ_13961                         236   1e-68    
ref|XP_007135363.1|  hypothetical protein PHAVU_010G123100g             247   1e-68    
ref|XP_006401715.1|  hypothetical protein EUTSA_v10013056mg             240   1e-68    
ref|XP_010656074.1|  PREDICTED: pectinesterase-like                     240   2e-68    
gb|KHN42767.1|  Pectinesterase 2                                        236   2e-68    
ref|XP_004494573.1|  PREDICTED: putative pectinesterase/pectinest...    239   2e-68    
ref|XP_010930858.1|  PREDICTED: pectinesterase-like                     237   2e-68    
gb|AFQ23194.1|  pectin methylesterase                                   240   2e-68    
ref|XP_009606552.1|  PREDICTED: pectinesterase/pectinesterase inh...    240   2e-68    
ref|XP_004972208.1|  PREDICTED: LOW QUALITY PROTEIN: pectinestera...    238   2e-68    
ref|XP_009142158.1|  PREDICTED: probable pectinesterase/pectinest...    238   2e-68    
gb|ABK92470.1|  unknown                                                 239   2e-68    
ref|XP_011005053.1|  PREDICTED: pectinesterase/pectinesterase inh...    239   2e-68    
emb|CBI39536.3|  unnamed protein product                                239   2e-68    
ref|NP_200149.1|  pectin methylesterase PCR fragment F                  240   2e-68    
ref|XP_004143735.1|  PREDICTED: pectinesterase 2-like                   238   2e-68    
ref|XP_009398948.1|  PREDICTED: probable pectinesterase/pectinest...    239   2e-68    
ref|XP_002981054.1|  hypothetical protein SELMODRAFT_114014             235   2e-68    
gb|KHG13374.1|  Pectinesterase/pectinesterase inhibitor PPE8B           236   2e-68    
ref|XP_010659656.1|  PREDICTED: putative pectinesterase/pectinest...    240   2e-68    
ref|XP_009383893.1|  PREDICTED: pectinesterase-like                     239   2e-68    
gb|KDP34079.1|  hypothetical protein JCGZ_07650                         239   2e-68    
ref|XP_010267633.1|  PREDICTED: probable pectinesterase/pectinest...    240   2e-68    
ref|XP_010088303.1|  putative pectinesterase/pectinesterase inhib...    239   2e-68    
ref|XP_010069353.1|  PREDICTED: pectinesterase-like                     238   3e-68    
ref|XP_010542351.1|  PREDICTED: pectinesterase 1                        239   3e-68    
ref|XP_008451545.1|  PREDICTED: pectinesterase-like                     239   3e-68    
ref|XP_002865971.1|  pectinesterase family protein                      239   3e-68    
ref|XP_002271665.2|  PREDICTED: pectinesterase-like                     239   3e-68    
ref|XP_011072690.1|  PREDICTED: pectinesterase 3-like                   239   3e-68    
ref|XP_002877272.1|  pectinesterase family protein                      238   3e-68    
emb|CDX75340.1|  BnaA01g03620D                                          238   3e-68    
gb|KHN17768.1|  Pectinesterase/pectinesterase inhibitor PPE8B           237   4e-68    
ref|XP_002532945.1|  Pectinesterase-3 precursor, putative               239   4e-68    
emb|CDX68957.1|  BnaC01g04960D                                          237   4e-68    
ref|XP_011079629.1|  PREDICTED: pectinesterase-like                     239   4e-68    
ref|XP_010056340.1|  PREDICTED: pectinesterase 2-like                   237   4e-68    
ref|XP_006828611.1|  hypothetical protein AMTR_s00129p00070300          241   4e-68    
ref|XP_009776000.1|  PREDICTED: probable pectinesterase/pectinest...    239   4e-68    
gb|KFK26958.1|  hypothetical protein AALP_AA8G315400                    239   5e-68    
ref|XP_003528738.1|  PREDICTED: pectinesterase 3                        239   5e-68    
ref|XP_008370416.1|  PREDICTED: putative pectinesterase/pectinest...    238   5e-68    
ref|XP_011017474.1|  PREDICTED: pectinesterase 2                        237   5e-68    
emb|CDY33229.1|  BnaC01g37020D                                          238   5e-68    
gb|KDP25318.1|  hypothetical protein JCGZ_20474                         238   5e-68    
ref|XP_002982529.1|  hypothetical protein SELMODRAFT_116557             234   6e-68    
ref|XP_009348912.1|  PREDICTED: pectinesterase-like                     238   6e-68    
ref|XP_007138600.1|  hypothetical protein PHAVU_009G222500g             237   6e-68    
ref|XP_002265599.1|  PREDICTED: pectinesterase 2                        237   6e-68    



>ref|XP_011030843.1| PREDICTED: pectinesterase-like [Populus euphratica]
Length=550

 Score =   366 bits (939),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 186/377 (49%), Positives = 251/377 (67%), Gaps = 9/377 (2%)
 Frame = -3

Query  1114  LCRTAIDPAACKTILKQTVKSYG---GTPAGLLREFLADYLPSMEAAKMEFGMVRGEFTH  944
             +C  A DP  C +IL + V + G       GLL+ FL   L  M  AK     V  +   
Sbjct  56    ICNQAHDPQECLSILSEAVSTEGVQESNGVGLLKTFLVKSLSQMRMAKAAANAVNSKIND  115

Query  943   PREVQAVADCVELMGLSINDVRDAIKDL--QGSKTRNSDAQTSLSAVLTNHLTCMEGLNP  770
              +   A+ADCVELM +SI+ V D +  L   GS++  SDA T LS VLTNH+TC++G++ 
Sbjct  116   HKHQAALADCVELMDMSIDRVTDTLSALGNWGSQSDASDANTWLSGVLTNHVTCLDGVDT  175

Query  769   PEKSPVKGILDALISRSRVALAVLAEIIGQTDEEQNFRVPFNGKFPSWVKSSDRKLVRRK  590
              ++  +K +L  LISR R +LA ++ +   +  + +   P NG FPSW+   DRKL+   
Sbjct  176   IDQPSMKKLLQDLISRMRTSLATVSSL---SASDTDLVQPLNGGFPSWILGRDRKLLESS  232

Query  589   HGNLKADIIVSQDGKGNFTTLKKAMESVSAVSKARVFIYVKKGTYKENVEMNVKSP-VMI  413
               N++A++IV+QDG G++TT+++A+ SV   SK+R  I+VK G YKENVE+  K   VMI
Sbjct  233   VSNVEANVIVAQDGSGDYTTIQEAVNSVPDKSKSRYVIHVKSGIYKENVEVGKKKKNVMI  292

Query  412   YGDGMTQTVFSGDHSFGDNYTTFKSYTLASKGPAAILQDLCVRNTAGAAKHQAVALLVGG  233
              GDGM  T+ +G+ +  D  TTF+S TLA  G   ILQD+ ++NTAG  KHQAVAL V  
Sbjct  293   VGDGMDFTILTGNLNVVDGSTTFRSATLAVAGDGFILQDIWIQNTAGPEKHQAVALRVSA  352

Query  232   DKSIINRCRLEGYQDTLYAHSKRQFYRDCTITGTIDFVFGDAAVVLQNCTLIAKKPLAAQ  53
             D+S+INRCR++ YQDTLY H+ RQFYRDC+I GTIDF+FG+ AVVLQNC +I++KP+A Q
Sbjct  353   DQSVINRCRIDAYQDTLYTHNYRQFYRDCSIIGTIDFIFGNGAVVLQNCQIISRKPMANQ  412

Query  52    KNMVTAQGRSDPNQNTG  2
             KNMVTAQGR DPNQNTG
Sbjct  413   KNMVTAQGRIDPNQNTG  429



>ref|XP_011016647.1| PREDICTED: pectinesterase-like [Populus euphratica]
Length=550

 Score =   366 bits (939),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 186/377 (49%), Positives = 251/377 (67%), Gaps = 9/377 (2%)
 Frame = -3

Query  1114  LCRTAIDPAACKTILKQTVKSYG---GTPAGLLREFLADYLPSMEAAKMEFGMVRGEFTH  944
             +C  A DP  C +IL + V + G       GLL+ FL   L  M  AK     V  +   
Sbjct  56    ICNQAHDPQECLSILSEAVSTEGVQESNGVGLLKTFLVKSLSQMRMAKAAANAVNSKIND  115

Query  943   PREVQAVADCVELMGLSINDVRDAIKDL--QGSKTRNSDAQTSLSAVLTNHLTCMEGLNP  770
              +   A+ADCVELM +SI+ V D +  L   GS++  SDA T LS VLTNH+TC++G++ 
Sbjct  116   HKHQAALADCVELMDMSIDRVTDTLSALGNWGSQSDASDANTWLSGVLTNHVTCLDGVDT  175

Query  769   PEKSPVKGILDALISRSRVALAVLAEIIGQTDEEQNFRVPFNGKFPSWVKSSDRKLVRRK  590
              ++  +K +L  LISR R +LA ++ +   +  + +   P NG FPSW+   DRKL+   
Sbjct  176   IDQPSMKKLLQDLISRMRTSLATVSSL---SASDTDLVQPLNGGFPSWILGRDRKLLESS  232

Query  589   HGNLKADIIVSQDGKGNFTTLKKAMESVSAVSKARVFIYVKKGTYKENVEMNVKSP-VMI  413
               N++A++IV+QDG G++TT+++A+ SV   SK+R  I+VK G YKENVE+  K   VMI
Sbjct  233   VSNVEANVIVAQDGSGDYTTIQEAVNSVPDKSKSRYVIHVKSGIYKENVEVGKKKKNVMI  292

Query  412   YGDGMTQTVFSGDHSFGDNYTTFKSYTLASKGPAAILQDLCVRNTAGAAKHQAVALLVGG  233
              GDGM  T+ +G+ +  D  TTF+S TLA  G   ILQD+ ++NTAG  KHQAVAL V  
Sbjct  293   VGDGMDFTILTGNLNVVDGSTTFRSATLAVAGDGFILQDIWIQNTAGPEKHQAVALRVSA  352

Query  232   DKSIINRCRLEGYQDTLYAHSKRQFYRDCTITGTIDFVFGDAAVVLQNCTLIAKKPLAAQ  53
             D+S+INRCR++ YQDTLY H+ RQFYRDC+I GTIDF+FG+ AVVLQNC +I++KP+A Q
Sbjct  353   DQSVINRCRIDAYQDTLYTHNYRQFYRDCSIIGTIDFIFGNGAVVLQNCQIISRKPMANQ  412

Query  52    KNMVTAQGRSDPNQNTG  2
             KNMVTAQGR DPNQNTG
Sbjct  413   KNMVTAQGRIDPNQNTG  429



>ref|XP_011016743.1| PREDICTED: pectinesterase-like [Populus euphratica]
Length=550

 Score =   360 bits (925),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 184/377 (49%), Positives = 250/377 (66%), Gaps = 9/377 (2%)
 Frame = -3

Query  1114  LCRTAIDPAACKTILKQTVKSYG---GTPAGLLREFLADYLPSMEAAKMEFGMVRGEFTH  944
             +C  A DP  C +IL + V + G       GLL+ FL   L  M  AK     V  +   
Sbjct  56    ICNQAHDPQECLSILSEAVSTEGVQESNGVGLLKIFLVKSLSQMRMAKAVANAVNSKIND  115

Query  943   PREVQAVADCVELMGLSINDVRDAIKDL--QGSKTRNSDAQTSLSAVLTNHLTCMEGLNP  770
              +   A+ADCVELM +SI+ V D +  L   GS++  SDA T LS VLTNH+TC++G++ 
Sbjct  116   HKHQAALADCVELMDMSIDRVTDTLSALGNWGSQSDASDANTWLSGVLTNHVTCLDGVDT  175

Query  769   PEKSPVKGILDALISRSRVALAVLAEIIGQTDEEQNFRVPFNGKFPSWVKSSDRKLVRRK  590
              ++  +K +L  LISR R +LA ++ +   +  + +   P NG  PSW+   DRKL+   
Sbjct  176   IDQPSMKKLLQDLISRMRTSLATVSSL---SAPDTDLVQPLNGGVPSWILGRDRKLLESS  232

Query  589   HGNLKADIIVSQDGKGNFTTLKKAMESVSAVSKARVFIYVKKGTYKENVEMNVKSP-VMI  413
               N++A+++V+QDG G++TT+++A+ SV   SK+R  I+VK G YKENVE+  K   VMI
Sbjct  233   VSNVEANVVVAQDGSGDYTTIQEAVNSVPDKSKSRYVIHVKSGIYKENVEVGKKKKNVMI  292

Query  412   YGDGMTQTVFSGDHSFGDNYTTFKSYTLASKGPAAILQDLCVRNTAGAAKHQAVALLVGG  233
              GDGM  T+ +G+ +  D  TTF+S TLA  G   ILQD+ ++NTAG  KHQAVAL V  
Sbjct  293   VGDGMDFTILTGNLNVVDGSTTFRSATLAVAGDGFILQDIWIQNTAGPEKHQAVALRVSA  352

Query  232   DKSIINRCRLEGYQDTLYAHSKRQFYRDCTITGTIDFVFGDAAVVLQNCTLIAKKPLAAQ  53
             D+S+INRCR++ YQDTLY H+ RQFYRDC+I GTIDF+FG+ AVVLQNC +I++KP+A Q
Sbjct  353   DQSVINRCRIDAYQDTLYTHNYRQFYRDCSIIGTIDFIFGNGAVVLQNCQIISRKPMANQ  412

Query  52    KNMVTAQGRSDPNQNTG  2
             KNMVTAQGR DPNQNTG
Sbjct  413   KNMVTAQGRIDPNQNTG  429



>ref|XP_011095339.1| PREDICTED: pectinesterase 2.1-like [Sesamum indicum]
Length=550

 Score =   357 bits (916),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 187/377 (50%), Positives = 258/377 (68%), Gaps = 10/377 (3%)
 Frame = -3

Query  1114  LCRTAIDPAACKTILKQTVKSYGGTPAG---LLREFLADYLPSMEAAKMEFGMVRGEFT-  947
             LCRTA +P AC+  + + V S G  P     +L++FL + +  +  A      ++ +   
Sbjct  57    LCRTAFNPRACQGFVSEVV-SDGVAPRDATIVLQKFLINQVHHLNGALFNTRKLKNQLNG  115

Query  946   HPREVQAVADCVELMGLSINDVRDAIKDLQG-SKTRNSDAQTSLSAVLTNHLTCMEGLNP  770
                E  A+ADCVEL+ LSI+ V D+IK L+  + T ++DAQ  LSAVL NH+TC +GLN 
Sbjct  116   QNNEHGALADCVELIDLSIDLVFDSIKALRNETSTSHADAQAWLSAVLDNHVTCFDGLNS  175

Query  769   PEKSPVKGILDALISRSRVALAVLAEIIGQTDEEQNFRVPFNGKFPSWVKSSDRKLVRRK  590
               ++ +  +L+ LISR+R +LA+LA +   ++ E+       GK PSW+ + DRKL++ +
Sbjct  176   FGRNSLGAVLEDLISRARASLAMLAAV---SEPEKEMVQSLRGKLPSWITAVDRKLLQSR  232

Query  589   HGNLKADIIVSQDGKGNFTTLKKAMESVSAVSKARVFIYVKKGTYKENVEMNV-KSPVMI  413
                + AD++V++DG GN+ T+ +A+ +    SK R  IYVKKGTYKENVE+   K  +MI
Sbjct  233   ANAIDADLVVAKDGSGNYKTVAEAIAAAPDKSKKRYVIYVKKGTYKENVEVGKNKKNLMI  292

Query  412   YGDGMTQTVFSGDHSFGDNYTTFKSYTLASKGPAAILQDLCVRNTAGAAKHQAVALLVGG  233
              GDGM  T+ +GD +  D  TTFKS TLA+ G   +LQD+ ++NTAG  KHQAVAL VG 
Sbjct  293   IGDGMDSTIITGDLNVVDGSTTFKSATLAAVGEGFMLQDIRIQNTAGPEKHQAVALRVGA  352

Query  232   DKSIINRCRLEGYQDTLYAHSKRQFYRDCTITGTIDFVFGDAAVVLQNCTLIAKKPLAAQ  53
             DKS+INRCR++ YQDTLYAHS RQFYRD  ITGT+DF+FG+AAVV Q C L+A+KP+ +Q
Sbjct  353   DKSVINRCRIDAYQDTLYAHSLRQFYRDSYITGTVDFIFGNAAVVFQKCKLVARKPMKSQ  412

Query  52    KNMVTAQGRSDPNQNTG  2
             KNMVTAQGR+DPNQNTG
Sbjct  413   KNMVTAQGRTDPNQNTG  429



>ref|XP_006377839.1| hypothetical protein POPTR_0011s13830g [Populus trichocarpa]
 gb|ERP55636.1| hypothetical protein POPTR_0011s13830g [Populus trichocarpa]
Length=550

 Score =   356 bits (913),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 182/377 (48%), Positives = 247/377 (66%), Gaps = 9/377 (2%)
 Frame = -3

Query  1114  LCRTAIDPAACKTILKQTVKSYG---GTPAGLLREFLADYLPSMEAAKMEFGMVRGEFTH  944
             +C  A DP  C +IL + V + G       GLL+ FL   L  M  AK     V  +   
Sbjct  56    ICNQARDPQECLSILSEAVSTEGVQESNGVGLLKTFLVKSLSQMRMAKAAANAVNSKING  115

Query  943   PREVQAVADCVELMGLSINDVRDAIKDL--QGSKTRNSDAQTSLSAVLTNHLTCMEGLNP  770
              +   A+ADCVELM +SI+ V D +  L   GS++  SDA T LS VLTNH+TC++G++ 
Sbjct  116   HKHQAALADCVELMDMSIDRVTDTLSALANWGSQSDASDANTWLSGVLTNHVTCLDGIDT  175

Query  769   PEKSPVKGILDALISRSRVALAVLAEIIGQTDEEQNFRVPFNGKFPSWVKSSDRKLVRRK  590
              ++  +K +L  LISR R +LA ++ +   +  + +   P NG FPSW+   DRKL+   
Sbjct  176   IDQPSMKKLLQDLISRMRTSLAAVSSL---SASDTDLVQPLNGGFPSWILGRDRKLLESS  232

Query  589   HGNLKADIIVSQDGKGNFTTLKKAMESVSAVSKARVFIYVKKGTYKENVEMNVKSP-VMI  413
                ++A+++V+QDG G+ TT+++++ SV   SK+R  I VK G YKENVE+  K   VMI
Sbjct  233   VSTVEANVVVAQDGSGDNTTIQESVNSVPDKSKSRYVICVKSGIYKENVEVGKKKKNVMI  292

Query  412   YGDGMTQTVFSGDHSFGDNYTTFKSYTLASKGPAAILQDLCVRNTAGAAKHQAVALLVGG  233
              GDGM  T+ +G+ +  D  TTF+S TLA  G   +LQD+ ++NTAG  KHQAVAL V  
Sbjct  293   VGDGMDSTILTGNLNVVDGSTTFRSATLAVAGDGFVLQDIWIQNTAGPEKHQAVALRVSA  352

Query  232   DKSIINRCRLEGYQDTLYAHSKRQFYRDCTITGTIDFVFGDAAVVLQNCTLIAKKPLAAQ  53
             D+S+INRCR++ YQDTLY H+ RQFYRDC I GTIDF+FG+ AVVLQNC +I++KP+A Q
Sbjct  353   DQSVINRCRIDAYQDTLYTHNYRQFYRDCFIIGTIDFIFGNGAVVLQNCHIISRKPMANQ  412

Query  52    KNMVTAQGRSDPNQNTG  2
             KNMVTAQGR DPNQNTG
Sbjct  413   KNMVTAQGRIDPNQNTG  429



>ref|XP_011095338.1| PREDICTED: pectinesterase 2.1-like [Sesamum indicum]
Length=587

 Score =   356 bits (913),  Expect = 9e-113, Method: Compositional matrix adjust.
 Identities = 181/378 (48%), Positives = 258/378 (68%), Gaps = 12/378 (3%)
 Frame = -3

Query  1114  LCRTAIDPAACKTILKQTVKSYGGTPAG---LLREFLADYLPSMEAAKMEFGMVRGEFTH  944
             LCRTA++P AC+  + + V S G TP     +L++FL      + +A    G ++ +   
Sbjct  95    LCRTALNPQACQDYVSEVV-SDGVTPPDATMVLQKFLIKQAHHLNSAIFRAGKLKNKLNG  153

Query  943   PREVQ-AVADCVELMGLSINDVRDAIKDLQGSKTRNS--DAQTSLSAVLTNHLTCMEGLN  773
               + Q A+ADCVEL+ LSIN V D+IK L G KTR S  DAQ  LS VL NH+TC++GLN
Sbjct  154   QNDKQGAIADCVELIDLSINLVSDSIKAL-GKKTRTSHADAQAWLSGVLANHITCLDGLN  212

Query  772   PPEKSPVKGILDALISRSRVALAVLAEIIGQTDEEQNFRVPFNGKFPSWVKSSDRKLVRR  593
                +  +   ++ L+SR+R +LAVLA +   +++++       G+ PSW++ +DRKL+++
Sbjct  213   SSGRKSLGATIEDLVSRARASLAVLAAV---SEQDKEMMQSLRGRLPSWIRPADRKLLQK  269

Query  592   KHGNLKADIIVSQDGKGNFTTLKKAMESVSAVSKARVFIYVKKGTYKENVEMNVKS-PVM  416
                 ++AD++V++DG G+F T+ +A+ +  + S+ R  IYVKKGTYKENVE+  +   +M
Sbjct  270   TANAIEADLVVAKDGSGDFKTVAEAVAAAPSNSERRYVIYVKKGTYKENVEVGSRQRNLM  329

Query  415   IYGDGMTQTVFSGDHSFGDNYTTFKSYTLASKGPAAILQDLCVRNTAGAAKHQAVALLVG  236
             I GDGM  T+ +GD    +N+TTF++ TLA+ G   ILQD+C++NTAG    QAVAL +G
Sbjct  330   IIGDGMNSTIITGDRYNSENFTTFRTATLAAVGKGFILQDICIQNTAGPENGQAVALRIG  389

Query  235   GDKSIINRCRLEGYQDTLYAHSKRQFYRDCTITGTIDFVFGDAAVVLQNCTLIAKKPLAA  56
              D+SIINRC ++ YQDTLY HS+RQFYRDC ITGT+DF+FG A  VLQ C L+A++P   
Sbjct  390   ADESIINRCYMDAYQDTLYTHSQRQFYRDCYITGTVDFIFGFAPAVLQKCELVARRPRVG  449

Query  55    QKNMVTAQGRSDPNQNTG  2
             Q NMVTAQGRSDPN+NTG
Sbjct  450   QSNMVTAQGRSDPNENTG  467



>ref|XP_007213952.1| hypothetical protein PRUPE_ppa003697mg [Prunus persica]
 gb|EMJ15151.1| hypothetical protein PRUPE_ppa003697mg [Prunus persica]
Length=555

 Score =   348 bits (893),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 183/378 (48%), Positives = 246/378 (65%), Gaps = 7/378 (2%)
 Frame = -3

Query  1114  LCRTAIDPAACKTILKQTV--KSYGGTPAGLLREFLADYLPSMEAAKMEFGMVRGEFTHP  941
             +C  A D  +C  ++ +    K+   +   LL+  L    P +E A            +P
Sbjct  57    ICDHAHDQKSCLAMVTEVAGDKTKPVSDVDLLQALLEKSTPHIEKALEIAKDASSGINNP  116

Query  940   REVQAVADCVELMGLSINDVRDAIKDLQGSKTRNS--DAQTSLSAVLTNHLTCMEGLNPP  767
             + + A+ADCVELM +S + V  +I  LQ    +NS  DA   LS++LTNH+TC++GL  P
Sbjct  117   KNLAAIADCVELMDVSRDRVMHSIIALQNFTLQNSLEDAHAWLSSILTNHVTCLDGLQGP  176

Query  766   EKSPVKGILDALISRSRVALAVLAEIIGQTDEEQNFRVPFNGKFPSWVKSSDRKLVRRKH  587
              ++ ++  L+ LISRSR +LA++  I   +  +     P NG+FPSWV S DR+L++  +
Sbjct  177   ARTIMEPRLNDLISRSRASLAIMVAISNPSKPKAEIHEPLNGEFPSWVTSRDRRLLQDYN  236

Query  586   --GNLKADIIVSQDGKGNFTTLKKAMESVSAVSKARVFIYVKKGTYKENVEMNV-KSPVM  416
                 +KA+I+V++DG GN+ TLK+A+ +    SK R  IYVKKGTYKENVE+   K  +M
Sbjct  237   LAKEVKANIVVAKDGSGNYKTLKEAVAAAPNNSKTRYIIYVKKGTYKENVEVGKDKKNLM  296

Query  415   IYGDGMTQTVFSGDHSFGDNYTTFKSYTLASKGPAAILQDLCVRNTAGAAKHQAVALLVG  236
             I GDGM  TV +G  +  D  TTFKS TLA+ G   I QD+  +NTAGA KHQAVAL VG
Sbjct  297   IVGDGMDDTVITGSLNVVDGSTTFKSATLAAVGDGFIAQDMWFQNTAGAVKHQAVALRVG  356

Query  235   GDKSIINRCRLEGYQDTLYAHSKRQFYRDCTITGTIDFVFGDAAVVLQNCTLIAKKPLAA  56
              D+S+INRCR++ YQDTLY HS RQFYRD  ITGT+DF+FG+AAVV QNC L+A+KP+  
Sbjct  357   ADQSVINRCRIDAYQDTLYTHSNRQFYRDSYITGTVDFIFGNAAVVFQNCKLVARKPMTG  416

Query  55    QKNMVTAQGRSDPNQNTG  2
             Q NMVTAQGR DPNQNTG
Sbjct  417   QNNMVTAQGRIDPNQNTG  434



>ref|XP_010267745.1| PREDICTED: pectinesterase [Nelumbo nucifera]
Length=553

 Score =   348 bits (892),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 187/378 (49%), Positives = 252/378 (67%), Gaps = 12/378 (3%)
 Frame = -3

Query  1114  LCRTAIDPAACKTILKQTVKSYGG---TPAGLLREFLA-DYLPSMEAAKMEFGMVRGEFT  947
             LC  A D  +C +++ + V + G        LLR FL    L   EA K+    V     
Sbjct  60    LCHPAHDRESCLSMVYEAVAAKGAKQLNDVDLLRSFLEKSALLVKEALKVAHS-VNSRIN  118

Query  946   HPREVQAVADCVELMGLSINDVRDAIKDLQGSKTRNS--DAQTSLSAVLTNHLTCMEGLN  773
                E  A+ DCVELM LSI+ + D +  L G++T  S  DA + LS++LTNH+TC++GLN
Sbjct  119   DRTEQAALVDCVELMDLSIDRLTDTVAVL-GTRTSRSPADAHSWLSSILTNHVTCLDGLN  177

Query  772   PPEKSPVKGILDALISRSRVALAVLAEIIGQTDEEQNFRVPFNGKFPSWVKSSDRKLVRR  593
                ++ ++  L  LI+R++ +LA+L  I   + +E   R P +GKFPSWV  +DRKL++ 
Sbjct  178   GSARAAMEDKLQGLIARAKTSLAMLTAI--SSSKEDALR-PLDGKFPSWVTKNDRKLLQS  234

Query  592   KHGNLKADIIVSQDGKGNFTTLKKAMESVSAVSKARVFIYVKKGTYKENVEMNVKS-PVM  416
                N+KA+++V++DG GN+ T+++A+ S     K+R  IYVKKGTYKENVE+  K   VM
Sbjct  235   LPRNIKANVVVAKDGSGNYQTVQEAVNSAPDKGKSRYVIYVKKGTYKENVEVGKKKMNVM  294

Query  415   IYGDGMTQTVFSGDHSFGDNYTTFKSYTLASKGPAAILQDLCVRNTAGAAKHQAVALLVG  236
             + GDGM  T+ +G  +  D  TTFKS T+A+ G   I QD+  +NTAG  KHQAVAL VG
Sbjct  295   LVGDGMDSTIITGSLNVVDGSTTFKSATVAAVGDGFIAQDMWFQNTAGPEKHQAVALRVG  354

Query  235   GDKSIINRCRLEGYQDTLYAHSKRQFYRDCTITGTIDFVFGDAAVVLQNCTLIAKKPLAA  56
              D+S+INRCR++ YQDTLY HS RQFYRD  ITGT+DF+FGDAAVV QNC L+A+KP+A+
Sbjct  355   ADQSVINRCRIDAYQDTLYVHSLRQFYRDSYITGTVDFIFGDAAVVFQNCKLVARKPMAS  414

Query  55    QKNMVTAQGRSDPNQNTG  2
             QKNMVTAQGR DPNQNTG
Sbjct  415   QKNMVTAQGRVDPNQNTG  432



>ref|XP_008224789.1| PREDICTED: pectinesterase [Prunus mume]
Length=555

 Score =   347 bits (890),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 182/378 (48%), Positives = 246/378 (65%), Gaps = 7/378 (2%)
 Frame = -3

Query  1114  LCRTAIDPAACKTILKQTV--KSYGGTPAGLLREFLADYLPSMEAAKMEFGMVRGEFTHP  941
             +C  A D  +C  ++ +    K+   +   LL+  L    P +E A            +P
Sbjct  57    ICDHAHDQKSCLAMVTEVAGDKTKPVSDVHLLQSLLEKSTPRIEKALEIAKDASSRINNP  116

Query  940   REVQAVADCVELMGLSINDVRDAIKDLQGSKTRNS--DAQTSLSAVLTNHLTCMEGLNPP  767
             ++  A+ADCVELM +SI+ V  +   LQ    +NS  DA   LS++LTNH+TC++GL  P
Sbjct  117   KDQAAIADCVELMDVSIDRVMHSTIALQNFTLQNSLEDAHAWLSSILTNHVTCLDGLQGP  176

Query  766   EKSPVKGILDALISRSRVALAVLAEIIGQTDEEQNFRVPFNGKFPSWVKSSDRKLVRRKH  587
              ++ ++  L+ LISRSR +LA++  I   +  +     P NG+FPSWV S DR+L++  +
Sbjct  177   ARTIMEPRLNDLISRSRASLAIMVAISNLSKLKAEIHEPLNGEFPSWVTSRDRRLLQDYN  236

Query  586   --GNLKADIIVSQDGKGNFTTLKKAMESVSAVSKARVFIYVKKGTYKENVEMNV-KSPVM  416
                 +KA+I+V++DG GN+ T+K+A+ +    SK R  IYVKKGTYKENVE+   K  +M
Sbjct  237   LAKEVKANIVVAKDGSGNYKTVKEAVAAAPNNSKTRYIIYVKKGTYKENVEVGKNKKNLM  296

Query  415   IYGDGMTQTVFSGDHSFGDNYTTFKSYTLASKGPAAILQDLCVRNTAGAAKHQAVALLVG  236
             I GDGM  TV +G  +  D  TTFKS TLA+ G   I QD+  +NTAGA KHQAVAL VG
Sbjct  297   IVGDGMDNTVITGSLNVVDGSTTFKSATLAAVGDGFIAQDMWFQNTAGAVKHQAVALRVG  356

Query  235   GDKSIINRCRLEGYQDTLYAHSKRQFYRDCTITGTIDFVFGDAAVVLQNCTLIAKKPLAA  56
              D+S+INRCR++ YQDTLY HS RQFYRD  ITGT+DF+FG+AAVV QNC L+A+KP+  
Sbjct  357   ADQSVINRCRIDAYQDTLYTHSNRQFYRDSYITGTVDFIFGNAAVVFQNCQLVARKPMTG  416

Query  55    QKNMVTAQGRSDPNQNTG  2
             Q NMVTAQGR DPNQNTG
Sbjct  417   QNNMVTAQGRIDPNQNTG  434



>ref|XP_006573891.1| PREDICTED: pectinesterase/pectinesterase inhibitor 18-like [Glycine 
max]
Length=553

 Score =   347 bits (890),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 182/378 (48%), Positives = 245/378 (65%), Gaps = 8/378 (2%)
 Frame = -3

Query  1114  LCRTAIDPAACKTILKQTVKSYGGTPA-----GLLREFLADYLPSMEAAKMEFGMVRGEF  950
             LC  A+D A C T + + V+    TP       LL+ FL  Y   ++        ++   
Sbjct  54    LCDHALDRATCLTHVSEVVQGPILTPTKDHKFNLLQSFLMKYTSHIKRVMNTASSIKLRI  113

Query  949   THPREVQAVADCVELMGLSINDVRDAIKDLQGSKTRNS-DAQTSLSAVLTNHLTCMEGLN  773
               P+E +A+ DCVELM LSI+ VRD++  L      +  DA T LS+VLTNH TC++GL 
Sbjct  114   NSPKEEEALHDCVELMDLSISRVRDSMVTLTKQTIESQQDAHTWLSSVLTNHATCLDGLE  173

Query  772   PPEKSPVKGILDALISRSRVALAVLAEIIGQTDEEQNFRVPFNGKFPSWVKSSDRKLVRR  593
                ++ +K  L+ LISR+R +LA+   ++     EQ    P +G FPSWV S DR+L+  
Sbjct  174   GSARAFMKDELEDLISRARTSLAMFVAVL-PPKVEQIIDEPLSGDFPSWVSSKDRRLLES  232

Query  592   KHGNLKADIIVSQDGKGNFTTLKKAMESVSAVSKARVFIYVKKGTYKENVEM-NVKSPVM  416
               G++KA+++V++DG G F T+ +A+ S     K R  IYVKKGTYKENVE+   K+ VM
Sbjct  233   TVGDIKANVVVAKDGSGKFKTVAEAVASAPDNGKTRYVIYVKKGTYKENVEIGKKKTNVM  292

Query  415   IYGDGMTQTVFSGDHSFGDNYTTFKSYTLASKGPAAILQDLCVRNTAGAAKHQAVALLVG  236
             + GDG   TV +G+ +F D  TTFK+ T+A+ G   I QD+  +NTAG  KHQAVAL VG
Sbjct  293   LVGDGKDATVITGNLNFIDGTTTFKTATVAAVGDGFIAQDIWFQNTAGPQKHQAVALRVG  352

Query  235   GDKSIINRCRLEGYQDTLYAHSKRQFYRDCTITGTIDFVFGDAAVVLQNCTLIAKKPLAA  56
              D+S+INRCR++ +QDTLYAHS RQFYRD  ITGT+DF+FG+AAVV Q C L+A+KP+  
Sbjct  353   ADQSVINRCRIDAFQDTLYAHSNRQFYRDSFITGTVDFIFGNAAVVFQKCDLVARKPMDK  412

Query  55    QKNMVTAQGRSDPNQNTG  2
             Q NMVTAQGR DPNQNTG
Sbjct  413   QNNMVTAQGREDPNQNTG  430



>ref|XP_007157172.1| hypothetical protein PHAVU_002G048700g [Phaseolus vulgaris]
 gb|ESW29166.1| hypothetical protein PHAVU_002G048700g [Phaseolus vulgaris]
Length=549

 Score =   345 bits (886),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 180/378 (48%), Positives = 246/378 (65%), Gaps = 7/378 (2%)
 Frame = -3

Query  1114  LCRTAIDPAACKTILKQTVKSYGGTPA-----GLLREFLADYLPSMEAAKMEFGMVRGEF  950
             +C  A+D A+C T + +  K++  T        LL+ FL  Y   +E        ++   
Sbjct  49    VCDQALDTASCLTHVSEVTKTHTFTTTEHHKLNLLKSFLMKYTSHIEKVMDTTSAIKLRV  108

Query  949   THPREVQAVADCVELMGLSINDVRDAIKDL-QGSKTRNSDAQTSLSAVLTNHLTCMEGLN  773
              +PRE  A+ DC ELM LS++ V  ++  + + S     DA T LS+VLTNH TC++GL 
Sbjct  109   NNPREEAALRDCAELMDLSLDRVWSSMLAVTEQSIESRQDAHTWLSSVLTNHATCLDGLE  168

Query  772   PPEKSPVKGILDALISRSRVALAVLAEIIGQTDEEQNFRVPFNGKFPSWVKSSDRKLVRR  593
                +S ++G ++ LISR+R +LA+L   +     E+    P NG+FPSWV S DR+L+  
Sbjct  169   GASRSVMEGEVEDLISRARTSLAILVGSVLPPKVEEIIDEPLNGEFPSWVSSKDRRLLES  228

Query  592   KHGNLKADIIVSQDGKGNFTTLKKAMESVSAVSKARVFIYVKKGTYKENVEMNVKSP-VM  416
               G++KA+++V++DG G F T+ +A+ S     K R  IYVKKGTYKENVE+  K   VM
Sbjct  229   GVGDIKANVVVAKDGSGKFKTVTEAVASAPDNGKTRYVIYVKKGTYKENVEIGKKKKNVM  288

Query  415   IYGDGMTQTVFSGDHSFGDNYTTFKSYTLASKGPAAILQDLCVRNTAGAAKHQAVALLVG  236
             + GDGM  T+ +G  +F D  TTF S T+A+ G   I QD+  +NTAG  KHQAVAL VG
Sbjct  289   LVGDGMDATIITGSLNFIDGTTTFNSATVAAVGDGFIGQDIWFQNTAGPEKHQAVALRVG  348

Query  235   GDKSIINRCRLEGYQDTLYAHSKRQFYRDCTITGTIDFVFGDAAVVLQNCTLIAKKPLAA  56
              D+S+INRCR++ +QDTLYAHS RQFYRD  ITGT+DF+FG+AAVV Q C L+A+KP++ 
Sbjct  349   ADQSVINRCRIDAFQDTLYAHSNRQFYRDSFITGTVDFIFGNAAVVFQKCNLVARKPMSN  408

Query  55    QKNMVTAQGRSDPNQNTG  2
             QKNMVTAQGR DPNQNTG
Sbjct  409   QKNMVTAQGREDPNQNTG  426



>ref|XP_002522859.1| Pectinesterase-2 precursor, putative [Ricinus communis]
 gb|EEF39557.1| Pectinesterase-2 precursor, putative [Ricinus communis]
Length=553

 Score =   345 bits (886),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 179/378 (47%), Positives = 247/378 (65%), Gaps = 10/378 (3%)
 Frame = -3

Query  1114  LCRTAIDPAACKTILKQTVKSYGGTP----AGLLREFLADYLPSMEAAKMEFGMVRGEFT  947
             +C  A +P AC  ++ + V +  G        LL+  L + LP M       G +     
Sbjct  58    VCDRAHEPQACLRMVSEAVAADDGVQELNGVHLLKTLLIESLPQMRMGIESAGYIIRRTN  117

Query  946   HPREVQAVADCVELMGLSINDVRDAIKDL--QGSKTRNSDAQTSLSAVLTNHLTCMEGLN  773
               ++  A+ADC+ELM LSI+ V   +  L   GSK+   DA T LS VLTNH+TC++G+ 
Sbjct  118   DHKDKAALADCLELMDLSIDRVNHTLAALANWGSKSDADDAHTWLSGVLTNHVTCLDGIV  177

Query  772   PPEKSPVKGILDALISRSRVALAVLAEIIGQTDEEQNFRVPFNGKFPSWVKSSDRKLVRR  593
                +  +K ++  LISR+R +LAVLA +      + N R P +G FP W++  DRK++  
Sbjct  178   LTGQQSIKNLMQDLISRTRTSLAVLASL--SASNKGNLR-PLSGGFPWWIRVKDRKILGS  234

Query  592   KHGNLKADIIVSQDGKGNFTTLKKAMESVSAVSKARVFIYVKKGTYKENVEM-NVKSPVM  416
                N++A+++V+QDG G+++T+++A+ S    SK R  IYVKKGTY ENVE+   K  +M
Sbjct  235   SSENIQANVVVAQDGSGDYSTIQEAVASAPDKSKTRYVIYVKKGTYIENVEIAKKKKNLM  294

Query  415   IYGDGMTQTVFSGDHSFGDNYTTFKSYTLASKGPAAILQDLCVRNTAGAAKHQAVALLVG  236
             I+GDGM  T+ +G  +  D  TTF+S TLA  G   ILQD+ V+NTAG  KHQAVAL V 
Sbjct  295   IFGDGMNLTIITGSLNVADGSTTFRSATLAVAGDGFILQDVWVQNTAGPEKHQAVALRVS  354

Query  235   GDKSIINRCRLEGYQDTLYAHSKRQFYRDCTITGTIDFVFGDAAVVLQNCTLIAKKPLAA  56
              D+++INRC+++ +QDTLYAHS RQFYRDC I GTIDF+FG+AAVVLQ C +IA+KP++ 
Sbjct  355   ADQAVINRCQIDAFQDTLYAHSYRQFYRDCYILGTIDFIFGNAAVVLQKCEIIARKPMSH  414

Query  55    QKNMVTAQGRSDPNQNTG  2
             QKNMVTAQGR DPNQNTG
Sbjct  415   QKNMVTAQGRVDPNQNTG  432



>gb|AHC69829.1| pectin methylesterase PME2.1 [Nicotiana tabacum]
Length=559

 Score =   343 bits (881),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 184/379 (49%), Positives = 247/379 (65%), Gaps = 11/379 (3%)
 Frame = -3

Query  1114  LCRTAIDPAACKTILKQTVKSYGGTPAG----LLREFLADYLPSMEAAKMEFGMVRGEFT  947
             LC  A D   C + + + V +   T       +L++FL  Y+  M +A      +R +  
Sbjct  61    LCEAAQDSQLCLSYVSELVSNGIVTSDSDGLTVLQKFLVKYVHHMNSAIPVVHKIRNQIN  120

Query  946   HPREVQAVADCVELMGLSINDVRDAIKDLQGSKTR--NSDAQTSLSAVLTNHLTCMEGLN  773
                   A+ADC+EL+ LSI  V D+I  L  S++R  +++AQ  LS +LTNH+TC++GLN
Sbjct  121   DISHKGALADCLELLDLSIELVTDSIAALGKSRSRLAHANAQIWLSGMLTNHVTCLDGLN  180

Query  772   PPEKSPVKG-ILDALISRSRVALAVLAEIIGQTDEEQNFRVPFNGKFPSWVKSSDRKLVR  596
                 +   G IL+ LISR++ ALA+LA +   T  E+ F  P +G+ PSWV S DRKL+ 
Sbjct  181   SLSNTTSIGTILEELISRAKTALAILASV--TTPNEEVF-TPLSGRMPSWVNSRDRKLLE  237

Query  595   RKHGNLKADIIVSQDGKGNFTTLKKAMESVSAVSKARVFIYVKKGTYKENVEMNVKS-PV  419
                  +KA+ +V+QDG G++ TL +A+ +    SK R  IYVKKG YKENVE+  K   +
Sbjct  238   SSAKEIKANAVVAQDGSGDYQTLTEAVAAAPDKSKTRYVIYVKKGIYKENVEVTKKKMNL  297

Query  418   MIYGDGMTQTVFSGDHSFGDNYTTFKSYTLASKGPAAILQDLCVRNTAGAAKHQAVALLV  239
             MI GDGM  T+ +G  +  D  TTF+S TLA+ G   ILQD+C++NTAG  KHQAVAL V
Sbjct  298   MIVGDGMNSTIITGSLNVVDGSTTFRSATLAAVGQGFILQDICIQNTAGPEKHQAVALRV  357

Query  238   GGDKSIINRCRLEGYQDTLYAHSKRQFYRDCTITGTIDFVFGDAAVVLQNCTLIAKKPLA  59
             G D S+INRCR++ YQDTLYAHS RQFYRDC +TGT+DF+FG+AAVV Q C L+ +KP  
Sbjct  358   GADMSVINRCRIDAYQDTLYAHSLRQFYRDCYVTGTVDFIFGNAAVVFQKCQLVPRKPGK  417

Query  58    AQKNMVTAQGRSDPNQNTG  2
              QKNMVTAQGR+DPNQ TG
Sbjct  418   NQKNMVTAQGRTDPNQATG  436



>ref|XP_009768199.1| PREDICTED: pectinesterase 2.1-like [Nicotiana sylvestris]
Length=559

 Score =   343 bits (881),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 184/379 (49%), Positives = 247/379 (65%), Gaps = 11/379 (3%)
 Frame = -3

Query  1114  LCRTAIDPAACKTILKQTVKSYGGTPAG----LLREFLADYLPSMEAAKMEFGMVRGEFT  947
             LC  A D   C + + + V +   T       +L++FL  Y+  M +A      +R +  
Sbjct  61    LCEAAQDSQLCLSYVSELVSNGIVTSDSDGLTVLQKFLVKYVHHMNSAIPVVHKIRNQIN  120

Query  946   HPREVQAVADCVELMGLSINDVRDAIKDLQGSKTR--NSDAQTSLSAVLTNHLTCMEGLN  773
                   A+ADC+EL+ LSI  V D+I  L  S++R  +++AQ  LS +LTNH+TC++GLN
Sbjct  121   DISHKGALADCLELLDLSIELVTDSIAALGKSRSRLAHANAQIWLSGMLTNHVTCLDGLN  180

Query  772   PPEKSPVKG-ILDALISRSRVALAVLAEIIGQTDEEQNFRVPFNGKFPSWVKSSDRKLVR  596
                 +   G IL+ LISR++ ALA+LA +   T  E+ F  P +G+ PSWV S DRKL+ 
Sbjct  181   SLSNTTSIGTILEELISRAKTALAILASV--TTPNEEVF-TPLSGRMPSWVNSRDRKLLE  237

Query  595   RKHGNLKADIIVSQDGKGNFTTLKKAMESVSAVSKARVFIYVKKGTYKENVEMNVKS-PV  419
                  +KA+ +V+QDG G++ TL +A+ +    SK R  IYVKKG YKENVE+  K   +
Sbjct  238   SSAKEIKANAVVAQDGSGDYQTLTEAVAAAPDKSKTRYVIYVKKGIYKENVEVTKKKMNL  297

Query  418   MIYGDGMTQTVFSGDHSFGDNYTTFKSYTLASKGPAAILQDLCVRNTAGAAKHQAVALLV  239
             MI GDGM  T+ +G  +  D  TTF+S TLA+ G   ILQD+C++NTAG  KHQAVAL V
Sbjct  298   MIVGDGMNSTIITGSLNVVDGSTTFRSATLAAVGQGFILQDICIQNTAGPEKHQAVALRV  357

Query  238   GGDKSIINRCRLEGYQDTLYAHSKRQFYRDCTITGTIDFVFGDAAVVLQNCTLIAKKPLA  59
             G D S+INRCR++ YQDTLYAHS RQFYRDC +TGT+DF+FG+AAVV Q C L+ +KP  
Sbjct  358   GADMSVINRCRIDAYQDTLYAHSLRQFYRDCYVTGTVDFIFGNAAVVFQKCQLVPRKPGK  417

Query  58    AQKNMVTAQGRSDPNQNTG  2
              QKNMVTAQGR+DPNQ TG
Sbjct  418   NQKNMVTAQGRTDPNQATG  436



>ref|XP_007157169.1| hypothetical protein PHAVU_002G048400g [Phaseolus vulgaris]
 gb|ESW29163.1| hypothetical protein PHAVU_002G048400g [Phaseolus vulgaris]
Length=549

 Score =   338 bits (868),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 181/375 (48%), Positives = 242/375 (65%), Gaps = 6/375 (2%)
 Frame = -3

Query  1114  LCRTAIDPAACKTILKQTVKS--YGGTPAGLLREFLADYLPSMEAAKMEFGMVRGEFTHP  941
             +C  AID  AC   + + V+         GLL+ FLA     +E A       R    +P
Sbjct  54    VCDHAIDTPACLAHVLELVQDPISQNHKFGLLQSFLARSASHIEKAMEAANATRVRMNNP  113

Query  940   REVQAVADCVELMGLSINDVRDAIKDL-QGSKTRNSDAQTSLSAVLTNHLTCMEGLNPPE  764
             RE  A+ DCVELM LS+  VRD+   L + +     DA T LS+VLTNH+TC++GL    
Sbjct  114   REEAALRDCVELMELSMERVRDSKASLAKDTADSVEDAHTWLSSVLTNHVTCLDGLEERG  173

Query  763   KSPVKGILDALISRSRVALAVLAEIIGQTDEEQNFRVPFNGKFPSWVKSSDRKLVRRKHG  584
                ++  +  LISR+R +LA+L  ++    + +   V  NGKFPSWV+S DRKL+    G
Sbjct  174   GRVMEEEVQELISRARTSLAMLVAVLPPNPKVE--EVSENGKFPSWVRSRDRKLLESWAG  231

Query  583   NLKADIIVSQDGKGNFTTLKKAMESVSAVSKARVFIYVKKGTYKENVEM-NVKSPVMIYG  407
              + A+++V++DG G+F T+ +A+ S    SK R  I+VK GTYKENVE+   K  VM+ G
Sbjct  232   EITANVVVAKDGSGDFKTVAEAVASAPEKSKKRYVIHVKSGTYKENVEIGKRKKNVMLVG  291

Query  406   DGMTQTVFSGDHSFGDNYTTFKSYTLASKGPAAILQDLCVRNTAGAAKHQAVALLVGGDK  227
             DGM  T+ +G  +F D   TF++ T+A+ G   I QD+  +NTAG  KHQAVAL VG D+
Sbjct  292   DGMNTTIITGSLNFIDGTGTFRTATVAAVGDGFIAQDIWFQNTAGPEKHQAVALRVGSDE  351

Query  226   SIINRCRLEGYQDTLYAHSKRQFYRDCTITGTIDFVFGDAAVVLQNCTLIAKKPLAAQKN  47
             S+INRCR++ YQDTLYAHS RQFYRD  I GTIDF+FG+AA V QNC L A+KP+++QKN
Sbjct  352   SVINRCRVDAYQDTLYAHSNRQFYRDSFIAGTIDFIFGNAAAVFQNCKLEARKPMSSQKN  411

Query  46    MVTAQGRSDPNQNTG  2
             MVTAQGR+DPNQNTG
Sbjct  412   MVTAQGRTDPNQNTG  426



>emb|CBI23178.3| unnamed protein product [Vitis vinifera]
Length=503

 Score =   335 bits (860),  Expect = 7e-106, Method: Compositional matrix adjust.
 Identities = 169/345 (49%), Positives = 238/345 (69%), Gaps = 7/345 (2%)
 Frame = -3

Query  1027  LREFLADYLPSMEAAKMEFGM-VRGEFTHPREVQAVADCVELMGLSINDVRDAIKDL-QG  854
             L+ FL + +  ++   ME  + V      PR+  A++DCVELM LS+  +RD+++ L +G
Sbjct  67    LQRFLKESMSHLQGV-MEMTVDVNRRMNDPRDQAALSDCVELMDLSMGRIRDSVEALGRG  125

Query  853   SKTRNSDAQTSLSAVLTNHLTCMEGLNPPEKSPVKGILDALISRSRVALAVLAEIIGQTD  674
             +   ++DA   LS VLTN++TC +G+N P +  ++  L  LISR+  +LA+L  +   + 
Sbjct  126   TVDSHADAHAWLSGVLTNYITCTDGINGPSRISMERGLKHLISRAETSLAMLVAV---SP  182

Query  673   EEQNFRVPFNGKFPSWVKSSDRKLVRRKHGNLKADIIVSQDGKGNFTTLKKAMESVSAVS  494
              +++   P + +FP WV S DRK++     ++KA+++V++DG GN+ T+K+A+ SV   S
Sbjct  183   AKEDVLQPLHSEFPPWVDSRDRKILESSSKDIKANVVVAKDGSGNYKTVKEAIASVPNNS  242

Query  493   KARVFIYVKKGTYKENVEMNVKSP-VMIYGDGMTQTVFSGDHSFGDNYTTFKSYTLASKG  317
             K R  I+VKKGTYKENVE+  K   VMI GDGM  TV +G  +  D  TTFKS TLA+ G
Sbjct  243   KTRYVIHVKKGTYKENVEIVTKQKNVMIVGDGMDSTVITGSLNVIDGSTTFKSATLAAVG  302

Query  316   PAAILQDLCVRNTAGAAKHQAVALLVGGDKSIINRCRLEGYQDTLYAHSKRQFYRDCTIT  137
                I QD+  +NTAG  KHQAVAL VG D+++INRCR++ YQDTLYAH+ RQFYRDC IT
Sbjct  303   DGFIAQDIWFQNTAGPQKHQAVALRVGADQAVINRCRIDAYQDTLYAHTNRQFYRDCYIT  362

Query  136   GTIDFVFGDAAVVLQNCTLIAKKPLAAQKNMVTAQGRSDPNQNTG  2
             GT+DF+FG+AAVV QNC L+A+KP+  Q NMVTAQGR++P QNTG
Sbjct  363   GTVDFIFGNAAVVFQNCKLVARKPMDKQANMVTAQGRTNPYQNTG  407



>gb|AAF23891.1| pectin methyl esterase [Solanum tuberosum]
Length=530

 Score =   336 bits (862),  Expect = 8e-106, Method: Compositional matrix adjust.
 Identities = 177/377 (47%), Positives = 248/377 (66%), Gaps = 13/377 (3%)
 Frame = -3

Query  1114  LCRTAIDPAACKT----ILKQTVKSYGGTPAGLLREFLADYLPSMEAAKMEFGMVRGEFT  947
             LC+ A D   C +    ++   + +       +L++FL  Y+  M +A      ++ +  
Sbjct  38    LCKAAQDSQLCLSYVSDLMSNEIVTSSSDGLSILKKFLVKYVHQMNSAIPVVRKIKNQIN  97

Query  946   HPREVQAVADCVELMGLSINDVRDAIKDL-QGSKTRNSDAQTSLSAVLTNHLTCMEGLNP  770
               R+  A+ DC+EL+ LS++ V D+I  + + S + +++AQ+ LS VLTNH+TC++ L+ 
Sbjct  98    DIRQQGALTDCLELLDLSVDLVSDSIVAIDKRSHSGHANAQSWLSGVLTNHVTCLDSLST  157

Query  769   PEKSPVKGILDALISRSRVALAVLAEIIGQTDEEQNFRVPFNGKFPSWVKSSDRKLVRRK  590
                +    +LD LI+R+RVALA+LA +   T  E  FR    GK PSWV S DRKL+   
Sbjct  158   KNGT----VLDELITRARVALAMLASV--TTQNEDVFRTVL-GKMPSWVSSRDRKLMESS  210

Query  589   HGNLKADIIVSQDGKGNFTTLKKAMESVSAVSKARVFIYVKKGTYKENVEMNV-KSPVMI  413
               ++KA+ +V+QDG G++ TL +A+ +    SK R  IYVK G YKENVE+   K  +MI
Sbjct  211   GKDIKANAVVAQDGTGDYQTLAEAVAAAPDKSKTRYVIYVKMGIYKENVEVTSRKMNLMI  270

Query  412   YGDGMTQTVFSGDHSFGDNYTTFKSYTLASKGPAAILQDLCVRNTAGAAKHQAVALLVGG  233
              GDGM  T+ +G  ++ D  TTF+S TLA+ G   ILQD+C++NTAG  KHQAVAL VGG
Sbjct  271   VGDGMNATIITGSLNYVDGTTTFRSATLAAVGQGFILQDICIQNTAGPEKHQAVALRVGG  330

Query  232   DKSIINRCRLEGYQDTLYAHSKRQFYRDCTITGTIDFVFGDAAVVLQNCTLIAKKPLAAQ  53
             D S+INRC ++ YQDTLYAHS+RQFYRD  ++GTIDF+FG+AAVV Q C L+A+KP   Q
Sbjct  331   DMSVINRCPIDAYQDTLYAHSQRQFYRDSYVSGTIDFIFGNAAVVFQKCQLVARKPSKNQ  390

Query  52    KNMVTAQGRSDPNQNTG  2
             KNMVTAQGR+DPNQ TG
Sbjct  391   KNMVTAQGRTDPNQATG  407



>ref|XP_002518523.1| Pectinesterase precursor, putative [Ricinus communis]
 gb|EEF43910.1| Pectinesterase precursor, putative [Ricinus communis]
Length=547

 Score =   337 bits (863),  Expect = 9e-106, Method: Compositional matrix adjust.
 Identities = 173/375 (46%), Positives = 242/375 (65%), Gaps = 7/375 (2%)
 Frame = -3

Query  1114  LCRTAIDPAACKTILKQ--TVKSYGGTPAGLLREFLADYLPSMEAAKMEFGMVRGEFTHP  941
             LC  A D A+C+ ++ +  T  +       LL+  L      ++ A +E   VR     P
Sbjct  55    LCDRATDEASCQAMVSEIATNTTMKLNHVKLLQVLLTKSTSHIQNAILEANHVRIMINDP  114

Query  940   REVQAVADCVELMGLSINDVRDAIKDLQGSKT-RNSDAQTSLSAVLTNHLTCMEGLNPPE  764
                 A+ DCV+LM LS++ +++++  L    T  ++DA + LS VLTNH+TC++GL    
Sbjct  115   VNQAALVDCVDLMELSLDKIKNSVLALDNVTTDSHADAHSWLSTVLTNHVTCLDGLKGLA  174

Query  763   KSPVKGILDALISRSRVALAVLAEIIGQTDEEQNFRVPFNGKFPSWVKSSDRKLVRRKHG  584
             +S ++  L  +I+R+R +LA++  I   +  + +   P NG FPSWV S DRKL+     
Sbjct  175   RSTMEPGLKDIITRARTSLAMVVAI---SPAKNDLISPLNGDFPSWVTSKDRKLLESSGK  231

Query  583   NLKADIIVSQDGKGNFTTLKKAMESVSAVSKARVFIYVKKGTYKENVEM-NVKSPVMIYG  407
             N+ AD+IV++DG G + T+K+A+ +     K R  IYVKKGTYKENVE+ N K  +M+ G
Sbjct  232   NINADVIVAKDGSGKYKTVKEAVAAAPNNGKTRYVIYVKKGTYKENVEIGNSKKNIMLVG  291

Query  406   DGMTQTVFSGDHSFGDNYTTFKSYTLASKGPAAILQDLCVRNTAGAAKHQAVALLVGGDK  227
             D M  T+ +G  +  D  TTF S T+A+ G   I QD+  +NTAG  KHQAVAL VG D+
Sbjct  292   DSMDSTIITGSLNVVDGSTTFNSATVAAVGDGFIAQDIWFQNTAGPQKHQAVALRVGSDQ  351

Query  226   SIINRCRLEGYQDTLYAHSKRQFYRDCTITGTIDFVFGDAAVVLQNCTLIAKKPLAAQKN  47
             S+INRCR++ YQDTLYAHS R FYRD  ITGT+DF+FG+AA V QNC ++A+KP+A QKN
Sbjct  352   SVINRCRIDAYQDTLYAHSDRHFYRDSFITGTVDFIFGNAAAVFQNCKIVARKPMAGQKN  411

Query  46    MVTAQGRSDPNQNTG  2
             MVTAQGR+DPNQNTG
Sbjct  412   MVTAQGRTDPNQNTG  426



>gb|KDP20786.1| hypothetical protein JCGZ_21257 [Jatropha curcas]
Length=544

 Score =   337 bits (863),  Expect = 9e-106, Method: Compositional matrix adjust.
 Identities = 178/375 (47%), Positives = 240/375 (64%), Gaps = 7/375 (2%)
 Frame = -3

Query  1114  LCRTAIDPAACKTILKQTVKSYGGTP--AGLLREFLADYLPSMEAAKMEFGMVRGEFTHP  941
             LC  A D A+C  I+ +   +    P    LL+  L      ++ +  E   V  +   P
Sbjct  52    LCDNAHDKASCLGIVTEIASNTSKKPNQVNLLQILLKKSKYQIQNSIQEATHVSRQINDP  111

Query  940   REVQAVADCVELMGLSINDVRDAIKDLQ-GSKTRNSDAQTSLSAVLTNHLTCMEGLNPPE  764
                 A+ DCV+LM LSI+   D+I  LQ G+   +++A   LS+VLTNH TC++GL  P 
Sbjct  112   VNQAALVDCVQLMELSIDRTNDSIVALQSGTVNSHANAHVWLSSVLTNHFTCLDGLTGPA  171

Query  763   KSPVKGILDALISRSRVALAVLAEIIGQTDEEQNFRVPFNGKFPSWVKSSDRKLVRRKHG  584
             +S ++  L+ LIS+SR +LA+L   +G +  +     P N  FPSWV + DRKL+     
Sbjct  172   RSIMEPELNDLISKSRTSLALL---VGISPAKDYLISPLNRDFPSWVTTKDRKLLEASVK  228

Query  583   NLKADIIVSQDGKGNFTTLKKAMESVSAVSKARVFIYVKKGTYKENVEM-NVKSPVMIYG  407
             ++KA++IV++DG GN+ T+K+A+ +     K R  IYVKKGTYKE VE+   K  VM+ G
Sbjct  229   DIKANVIVAKDGSGNYKTIKEAVAAAPNNGKTRHVIYVKKGTYKEQVEIGKSKKNVMLVG  288

Query  406   DGMTQTVFSGDHSFGDNYTTFKSYTLASKGPAAILQDLCVRNTAGAAKHQAVALLVGGDK  227
             DGM  T+ +G  +  D  TTF S T+A+ G   I QD+  +NTAG  KHQAVAL VG D+
Sbjct  289   DGMDLTIITGSLNVVDGSTTFDSATVAAVGDGFIAQDIWFQNTAGPEKHQAVALRVGADQ  348

Query  226   SIINRCRLEGYQDTLYAHSKRQFYRDCTITGTIDFVFGDAAVVLQNCTLIAKKPLAAQKN  47
             S+INRCR++ YQDTLY HS RQFYRD  ITGT+DF+FG+AAVV QNC L+A+KP+  QKN
Sbjct  349   SVINRCRMDAYQDTLYTHSNRQFYRDSLITGTVDFIFGNAAVVFQNCKLVARKPMNGQKN  408

Query  46    MVTAQGRSDPNQNTG  2
             MVTAQGR DPNQNTG
Sbjct  409   MVTAQGRIDPNQNTG  423



>ref|NP_001274785.1| pectin methyl esterase [Solanum tuberosum]
 emb|CBY44654.1| pectin methyl esterase [Solanum tuberosum]
Length=545

 Score =   336 bits (862),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 177/377 (47%), Positives = 248/377 (66%), Gaps = 13/377 (3%)
 Frame = -3

Query  1114  LCRTAIDPAACKT----ILKQTVKSYGGTPAGLLREFLADYLPSMEAAKMEFGMVRGEFT  947
             LC+ A D   C +    ++   + +       +L++FL  Y+  M +A      ++ +  
Sbjct  53    LCKAAQDSQLCLSYVSDLMSNEIVTSSSDGLSILKKFLVKYVHQMNSAIPVVRKIKNQIN  112

Query  946   HPREVQAVADCVELMGLSINDVRDAIKDL-QGSKTRNSDAQTSLSAVLTNHLTCMEGLNP  770
               R+  A+ DC+EL+ LS++ V D+I  + + S + +++AQ+ LS VLTNH+TC++ L+ 
Sbjct  113   DIRQQGALTDCLELLDLSVDLVSDSIVAIDKRSHSGHANAQSWLSGVLTNHVTCLDSLST  172

Query  769   PEKSPVKGILDALISRSRVALAVLAEIIGQTDEEQNFRVPFNGKFPSWVKSSDRKLVRRK  590
                +    +LD LI+R+RVALA+LA +   T  E  FR    GK PSWV S DRKL+   
Sbjct  173   KNGT----VLDELITRARVALAMLASV--TTQNEDVFRTVL-GKMPSWVSSRDRKLMESS  225

Query  589   HGNLKADIIVSQDGKGNFTTLKKAMESVSAVSKARVFIYVKKGTYKENVEMNV-KSPVMI  413
               ++KA+ +V+QDG G++ TL +A+ +    SK R  IYVK G YKENVE+   K  +MI
Sbjct  226   GKDIKANAVVAQDGTGDYQTLAEAVAAAPDKSKTRYVIYVKMGIYKENVEVTSRKMNLMI  285

Query  412   YGDGMTQTVFSGDHSFGDNYTTFKSYTLASKGPAAILQDLCVRNTAGAAKHQAVALLVGG  233
              GDGM  T+ +G  ++ D  TTF+S TLA+ G   ILQD+C++NTAG  KHQAVAL VGG
Sbjct  286   VGDGMNATIITGSLNYVDGTTTFRSATLAAVGQGFILQDICIQNTAGPEKHQAVALRVGG  345

Query  232   DKSIINRCRLEGYQDTLYAHSKRQFYRDCTITGTIDFVFGDAAVVLQNCTLIAKKPLAAQ  53
             D S+INRC ++ YQDTLYAHS+RQFYRD  ++GTIDF+FG+AAVV Q C L+A+KP   Q
Sbjct  346   DMSVINRCPIDAYQDTLYAHSQRQFYRDSYVSGTIDFIFGNAAVVFQKCQLVARKPSKNQ  405

Query  52    KNMVTAQGRSDPNQNTG  2
             KNMVTAQGR+DPNQ TG
Sbjct  406   KNMVTAQGRTDPNQATG  422



>ref|NP_001233948.1| pectinesterase 2.1 [Solanum lycopersicum]
 sp|P09607.2|PME21_SOLLC RecName: Full=Pectinesterase 2.1; Short=PE 2.1; AltName: Full=Pectin 
methylesterase 2.1; Flags: Precursor [Solanum lycopersicum]
 emb|CAA52704.1| pectin esterase [Solanum lycopersicum]
Length=550

 Score =   336 bits (862),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 180/378 (48%), Positives = 250/378 (66%), Gaps = 10/378 (3%)
 Frame = -3

Query  1114  LCRTAIDPAACKT----ILKQTVKSYGGTPAGLLREFLADYLPSMEAAKMEFGMVRGEFT  947
             LC+TA D   C +    ++   + +       +L++FL   +  M  A      ++ +  
Sbjct  53    LCKTAQDSQLCLSYVSDLISNEIVTSDSDGLSILKKFLVYSVHQMNNAIPVVRKIKNQIN  112

Query  946   HPREVQAVADCVELMGLSINDVRDAIKDL-QGSKTRNSDAQTSLSAVLTNHLTCMEGLNP  770
               RE  A+ DC+EL+ LS++ V D+I  + + S++ +++AQ+ LS VLTNH+TC++ L+ 
Sbjct  113   DIREQGALTDCLELLDLSVDLVCDSIAAIDKRSRSEHANAQSWLSGVLTNHVTCLDELDS  172

Query  769   PEKSPVKGI-LDALISRSRVALAVLAEIIGQTDEEQNFRVPFNGKFPSWVKSSDRKLVRR  593
               K+ + G  LD LISR++VALA+LA +    DE      P  GK PSWV S DRKL+  
Sbjct  173   FTKAMINGTNLDELISRAKVALAMLASVTTPNDEVLR---PGLGKMPSWVSSRDRKLMES  229

Query  592   KHGNLKADIIVSQDGKGNFTTLKKAMESVSAVSKARVFIYVKKGTYKENVEMNV-KSPVM  416
                ++ A+ +V++DG G + TL +A+ +    SK R  IYVK+GTYKENVE++  K  +M
Sbjct  230   SGKDIGANAVVAKDGTGKYRTLAEAVAAAPDKSKTRYVIYVKRGTYKENVEVSSRKMNLM  289

Query  415   IYGDGMTQTVFSGDHSFGDNYTTFKSYTLASKGPAAILQDLCVRNTAGAAKHQAVALLVG  236
             I GDGM  T+ +G  +  D  TTF S TLA+ G   ILQD+C++NTAG AKHQAVAL VG
Sbjct  290   IIGDGMYATIITGSLNVVDGSTTFHSATLAAVGKGFILQDICIQNTAGPAKHQAVALRVG  349

Query  235   GDKSIINRCRLEGYQDTLYAHSKRQFYRDCTITGTIDFVFGDAAVVLQNCTLIAKKPLAA  56
              DKS+INRCR++ YQDTLYAHS+RQFYRD  +TGTIDF+FG+AAVV Q C L+A+KP   
Sbjct  350   ADKSVINRCRIDAYQDTLYAHSQRQFYRDSYVTGTIDFIFGNAAVVFQKCQLVARKPGKY  409

Query  55    QKNMVTAQGRSDPNQNTG  2
             Q+NMVTAQGR+DPNQ TG
Sbjct  410   QQNMVTAQGRTDPNQATG  427



>gb|AAB67739.1| pectin methylesterase PME2.1 [Solanum lycopersicum]
Length=550

 Score =   336 bits (861),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 180/378 (48%), Positives = 250/378 (66%), Gaps = 10/378 (3%)
 Frame = -3

Query  1114  LCRTAIDPAACKT----ILKQTVKSYGGTPAGLLREFLADYLPSMEAAKMEFGMVRGEFT  947
             LC+TA D   C +    ++   + +       +L++FL   +  M  A      ++ +  
Sbjct  53    LCKTAQDSQLCLSYVSDLISNEIVTSDSDGLSILKKFLVYSVHQMNNAIPVVRKIKNQIN  112

Query  946   HPREVQAVADCVELMGLSINDVRDAIKDL-QGSKTRNSDAQTSLSAVLTNHLTCMEGLNP  770
               RE  A+ DC+EL+ LS++ V D+I  + + S++ +++AQ+ LS VLTNH+TC++ L+ 
Sbjct  113   DIREQGALTDCLELLDLSVDLVCDSIAAIDKRSRSEHANAQSWLSGVLTNHVTCLDELDS  172

Query  769   PEKSPVKGI-LDALISRSRVALAVLAEIIGQTDEEQNFRVPFNGKFPSWVKSSDRKLVRR  593
               K+ + G  LD LISR++VALA+LA +    DE      P  GK PSWV S DRKL+  
Sbjct  173   FTKAMINGTNLDELISRAKVALAMLASVTTPNDEVLR---PGLGKMPSWVSSRDRKLMES  229

Query  592   KHGNLKADIIVSQDGKGNFTTLKKAMESVSAVSKARVFIYVKKGTYKENVEMNV-KSPVM  416
                ++ A+ +V++DG G + TL +A+ +    SK R  IYVK+GTYKENVE++  K  +M
Sbjct  230   SGKDIGANAVVAKDGTGKYRTLAEAVAAAPDKSKTRYVIYVKRGTYKENVEVSSRKMNLM  289

Query  415   IYGDGMTQTVFSGDHSFGDNYTTFKSYTLASKGPAAILQDLCVRNTAGAAKHQAVALLVG  236
             I GDGM  T+ +G  +  D  TTF S TLA+ G   ILQD+C++NTAG AKHQAVAL VG
Sbjct  290   IIGDGMYATIITGSLNVVDGSTTFHSATLAAVGKGFILQDICIQNTAGPAKHQAVALRVG  349

Query  235   GDKSIINRCRLEGYQDTLYAHSKRQFYRDCTITGTIDFVFGDAAVVLQNCTLIAKKPLAA  56
              DKS+INRCR++ YQDTLYAHS+RQFYRD  +TGTIDF+FG+AAVV Q C L+A+KP   
Sbjct  350   ADKSVINRCRIDAYQDTLYAHSQRQFYRDSYVTGTIDFIFGNAAVVFQKCQLVARKPGKY  409

Query  55    QKNMVTAQGRSDPNQNTG  2
             Q+NMVTAQGR+DPNQ TG
Sbjct  410   QQNMVTAQGRTDPNQATG  427



>ref|XP_002266980.1| PREDICTED: pectinesterase [Vitis vinifera]
Length=528

 Score =   335 bits (859),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 169/345 (49%), Positives = 238/345 (69%), Gaps = 7/345 (2%)
 Frame = -3

Query  1027  LREFLADYLPSMEAAKMEFGM-VRGEFTHPREVQAVADCVELMGLSINDVRDAIKDL-QG  854
             L+ FL + +  ++   ME  + V      PR+  A++DCVELM LS+  +RD+++ L +G
Sbjct  67    LQRFLKESMSHLQGV-MEMTVDVNRRMNDPRDQAALSDCVELMDLSMGRIRDSVEALGRG  125

Query  853   SKTRNSDAQTSLSAVLTNHLTCMEGLNPPEKSPVKGILDALISRSRVALAVLAEIIGQTD  674
             +   ++DA   LS VLTN++TC +G+N P +  ++  L  LISR+  +LA+L  +   + 
Sbjct  126   TVDSHADAHAWLSGVLTNYITCTDGINGPSRISMERGLKHLISRAETSLAMLVAV---SP  182

Query  673   EEQNFRVPFNGKFPSWVKSSDRKLVRRKHGNLKADIIVSQDGKGNFTTLKKAMESVSAVS  494
              +++   P + +FP WV S DRK++     ++KA+++V++DG GN+ T+K+A+ SV   S
Sbjct  183   AKEDVLQPLHSEFPPWVDSRDRKILESSSKDIKANVVVAKDGSGNYKTVKEAIASVPNNS  242

Query  493   KARVFIYVKKGTYKENVEMNVKSP-VMIYGDGMTQTVFSGDHSFGDNYTTFKSYTLASKG  317
             K R  I+VKKGTYKENVE+  K   VMI GDGM  TV +G  +  D  TTFKS TLA+ G
Sbjct  243   KTRYVIHVKKGTYKENVEIVTKQKNVMIVGDGMDSTVITGSLNVIDGSTTFKSATLAAVG  302

Query  316   PAAILQDLCVRNTAGAAKHQAVALLVGGDKSIINRCRLEGYQDTLYAHSKRQFYRDCTIT  137
                I QD+  +NTAG  KHQAVAL VG D+++INRCR++ YQDTLYAH+ RQFYRDC IT
Sbjct  303   DGFIAQDIWFQNTAGPQKHQAVALRVGADQAVINRCRIDAYQDTLYAHTNRQFYRDCYIT  362

Query  136   GTIDFVFGDAAVVLQNCTLIAKKPLAAQKNMVTAQGRSDPNQNTG  2
             GT+DF+FG+AAVV QNC L+A+KP+  Q NMVTAQGR++P QNTG
Sbjct  363   GTVDFIFGNAAVVFQNCKLVARKPMDKQANMVTAQGRTNPYQNTG  407



>gb|KHN30453.1| Pectinesterase 2.2 [Glycine soja]
Length=461

 Score =   331 bits (849),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 167/316 (53%), Positives = 220/316 (70%), Gaps = 3/316 (1%)
 Frame = -3

Query  943  PREVQAVADCVELMGLSINDVRDAIKDLQGSKTRNS-DAQTSLSAVLTNHLTCMEGLNPP  767
            P+E +A+ DCVELM LSI+ VRD++  L      +  DA T LS+VLTNH TC++GL   
Sbjct  24   PKEEEALHDCVELMDLSISRVRDSMVTLTKQTIESQQDAHTWLSSVLTNHATCLDGLEGS  83

Query  766  EKSPVKGILDALISRSRVALAVLAEIIGQTDEEQNFRVPFNGKFPSWVKSSDRKLVRRKH  587
              + +K  L+ LISR+R +LA+   ++     EQ    P +G FPSWV S DR+L+    
Sbjct  84   ASAFMKDELEDLISRARTSLAMFVAVL-PPKVEQIIDEPLSGDFPSWVSSKDRRLLESTV  142

Query  586  GNLKADIIVSQDGKGNFTTLKKAMESVSAVSKARVFIYVKKGTYKENVEM-NVKSPVMIY  410
            G++KA+++V++DG G F T+ +A+ S     K R  IYVKKGTYKENVE+   K+ VM+ 
Sbjct  143  GDIKANVVVAKDGSGKFKTVAEAVASAPDNGKTRYVIYVKKGTYKENVEIGKKKTNVMLV  202

Query  409  GDGMTQTVFSGDHSFGDNYTTFKSYTLASKGPAAILQDLCVRNTAGAAKHQAVALLVGGD  230
            GDG   TV +G+ +F D  TTFK+ T+A+ G   I QD+  +NTAG  KHQAVAL VG D
Sbjct  203  GDGKDATVITGNLNFIDGTTTFKTATVAAVGDGFIAQDIWFQNTAGPQKHQAVALRVGAD  262

Query  229  KSIINRCRLEGYQDTLYAHSKRQFYRDCTITGTIDFVFGDAAVVLQNCTLIAKKPLAAQK  50
            +S+INRCR++ +QDTLYAHS RQFYRD  ITGT+DF+FG+AAVV Q C L+A+KP+  Q 
Sbjct  263  QSVINRCRIDAFQDTLYAHSNRQFYRDSFITGTVDFIFGNAAVVFQKCDLVARKPMDKQN  322

Query  49   NMVTAQGRSDPNQNTG  2
            NMVTAQGR DPNQNTG
Sbjct  323  NMVTAQGREDPNQNTG  338



>ref|XP_003622699.1| Pectinesterase [Medicago truncatula]
 gb|ABD33414.1| Pectinesterase; Pectinesterase inhibitor [Medicago truncatula]
 gb|AES78917.1| pectinesterase/pectinesterase inhibitor [Medicago truncatula]
Length=555

 Score =   334 bits (856),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 174/377 (46%), Positives = 239/377 (63%), Gaps = 7/377 (2%)
 Frame = -3

Query  1111  CRTAIDPAACKTILKQ-----TVKSYGGTPAGLLREFLADYLPSMEAAKMEFGMVRGEFT  947
             C  A+D  +C   + +     T+ +       +L   L      ++ A     +++    
Sbjct  56    CEHAVDTKSCLAHVSEVSHVPTLVTTKDQNLHVLLSLLTKSTTHIQNAMDTASVIKRRIN  115

Query  946   HPREVQAVADCVELMGLSINDVRDAIKDL-QGSKTRNSDAQTSLSAVLTNHLTCMEGLNP  770
              PRE  A++DC +LM LS+N + D +  L + +     DA T LS+VLTNH TC++GL  
Sbjct  116   SPREEIALSDCEQLMDLSMNRIWDTMLKLTKNNIDSQQDAHTWLSSVLTNHATCLDGLEG  175

Query  769   PEKSPVKGILDALISRSRVALAVLAEIIGQTDEEQNFRVPFNGKFPSWVKSSDRKLVRRK  590
               +  ++  L  LISR+R +LAV   +  Q D +Q       G+FPSWV S DR+L+   
Sbjct  176   SSRVVMENDLQDLISRARSSLAVFLVVFPQKDRDQFIDETLIGEFPSWVTSKDRRLLETA  235

Query  589   HGNLKADIIVSQDGKGNFTTLKKAMESVSAVSKARVFIYVKKGTYKENVEM-NVKSPVMI  413
              G++KA+++V+QDG G F T+ +A+ S     K +  IYVKKGTYKENVE+ + K+ VM+
Sbjct  236   VGDIKANVVVAQDGSGKFKTVAEAVASAPDNGKTKYVIYVKKGTYKENVEIGSKKTNVML  295

Query  412   YGDGMTQTVFSGDHSFGDNYTTFKSYTLASKGPAAILQDLCVRNTAGAAKHQAVALLVGG  233
              GDGM  T+ +G+ +F D  TTFKS T+A+ G   I QD+  +N AGAAKHQAVAL VG 
Sbjct  296   VGDGMDATIITGNLNFIDGTTTFKSSTVAAVGDGFIAQDIWFQNMAGAAKHQAVALRVGS  355

Query  232   DKSIINRCRLEGYQDTLYAHSKRQFYRDCTITGTIDFVFGDAAVVLQNCTLIAKKPLAAQ  53
             D+S+INRCR++ +QDTLYAHS RQFYRD  ITGTIDF+FG+AAVV Q C L+A+KP+A Q
Sbjct  356   DQSVINRCRIDAFQDTLYAHSNRQFYRDSVITGTIDFIFGNAAVVFQKCKLVARKPMANQ  415

Query  52    KNMVTAQGRSDPNQNTG  2
              NM TAQGR DP QNTG
Sbjct  416   NNMFTAQGREDPGQNTG  432



>gb|AFK44272.1| unknown [Lotus japonicus]
Length=554

 Score =   333 bits (854),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 167/377 (44%), Positives = 242/377 (64%), Gaps = 7/377 (2%)
 Frame = -3

Query  1111  CRTAIDPAAC----KTILKQTVKSYGGTPAGLLREFLADYLPSMEAAKMEFGMVRGEFTH  944
             C  A+D ++C      + +  + +       +L   +      ++ A ++   ++    +
Sbjct  55    CEHALDASSCLAHVSEVSQSPISATKDPKLNILISLMTKSTSHIQEAMVKTKAIKNRINN  114

Query  943   PREVQAVADCVELMGLSINDVRDAIKDLQGSKT-RNSDAQTSLSAVLTNHLTCMEGLNPP  767
             PRE  A++DC +LM LSI+ V D++  L    T  + DA   LS VLTNH TC++GL  P
Sbjct  115   PREEAALSDCEQLMDLSIDRVWDSVMALTKDNTDSHQDAHAWLSGVLTNHATCLDGLEGP  174

Query  766   EKSPVKGILDALISRSRVALAVLAEIIG-QTDEEQNFRVPFNGKFPSWVKSSDRKLVRRK  590
              ++ ++  ++ LISRS+ +LA+L  ++  +   EQ    P +G FPSWV   DR+L+   
Sbjct  175   SRALMEAEIEDLISRSKTSLALLVSVLAPKGGNEQIIDEPLDGDFPSWVTRKDRRLLESS  234

Query  589   HGNLKADIIVSQDGKGNFTTLKKAMESVSAVSKARVFIYVKKGTYKENVEM-NVKSPVMI  413
              G++ A+++V++DG G F T+ +A+ S     K R  IYVKKGTYKEN+E+   K+ VM+
Sbjct  235   VGDVNANVVVAKDGSGRFKTVAEAVASAPDSGKTRYVIYVKKGTYKENIEIGKKKTNVML  294

Query  412   YGDGMTQTVFSGDHSFGDNYTTFKSYTLASKGPAAILQDLCVRNTAGAAKHQAVALLVGG  233
              GDGM  T+ +G+ +  D  TTFKS T+A+ G   I QD+  +NTAG  KHQAVAL VG 
Sbjct  295   TGDGMDATIITGNLNVIDGSTTFKSATVAAVGDGFIAQDIWFQNTAGPEKHQAVALRVGA  354

Query  232   DKSIINRCRLEGYQDTLYAHSKRQFYRDCTITGTIDFVFGDAAVVLQNCTLIAKKPLAAQ  53
             D+SIINRCR++ YQDTLYAH+ RQF RD  ITGT+DF+FG+AAVV Q C ++A+KP++ Q
Sbjct  355   DQSIINRCRIDAYQDTLYAHTNRQFSRDSFITGTVDFIFGNAAVVFQKCNIVARKPMSNQ  414

Query  52    KNMVTAQGRSDPNQNTG  2
             KNM+TAQGR DPNQNTG
Sbjct  415   KNMLTAQGREDPNQNTG  431



>sp|Q96575.1|PME22_SOLLC RecName: Full=Pectinesterase 2.2; Short=PE 2.2; AltName: Full=Pectin 
methylesterase 2.2; Flags: Precursor [Solanum lycopersicum]
 gb|AAB38792.1| pectin methylesterase [Solanum lycopersicum]
Length=550

 Score =   333 bits (853),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 176/378 (47%), Positives = 249/378 (66%), Gaps = 10/378 (3%)
 Frame = -3

Query  1114  LCRTAIDPAACKT----ILKQTVKSYGGTPAGLLREFLADYLPSMEAAKMEFGMVRGEFT  947
             LC+TA D   C +    ++   + +       +L +FL +Y+  M  A      ++ +  
Sbjct  53    LCKTAQDSQLCLSYVSDLMSNEIVTTDSDGLSILMKFLVNYVHQMNNAIPVVSKMKNQIN  112

Query  946   HPREVQAVADCVELMGLSINDVRDAIKDL-QGSKTRNSDAQTSLSAVLTNHLTCMEGLNP  770
               R+  A+ DC+EL+  S++ V D+I  + + + + +++AQ+ LS VLTNH+TC++ L+ 
Sbjct  113   DIRQEGALTDCLELLDQSVDLVSDSIAAIDKRTHSEHANAQSWLSGVLTNHVTCLDELDS  172

Query  769   PEKSPVKGI-LDALISRSRVALAVLAEIIGQTDEEQNFRVPFNGKFPSWVKSSDRKLVRR  593
               K+ + G  LD LISR++VALA+LA +    D+      P  GK PSWV S DRKL+  
Sbjct  173   FTKAMINGTNLDELISRAKVALAMLASVTTPNDDVLR---PGLGKMPSWVSSRDRKLMES  229

Query  592   KHGNLKADIIVSQDGKGNFTTLKKAMESVSAVSKARVFIYVKKGTYKENVEMNV-KSPVM  416
                ++ A+ +V++DG G + TL +A+ +    SK R  IYVK+G YKENVE++  K  +M
Sbjct  230   SGKDIGANAVVAKDGTGKYRTLAEAVAAAPDKSKTRYVIYVKRGIYKENVEVSSRKMKLM  289

Query  415   IYGDGMTQTVFSGDHSFGDNYTTFKSYTLASKGPAAILQDLCVRNTAGAAKHQAVALLVG  236
             I GDGM  T+ +G+ +  D  TTF S TLA+ G   ILQD+C++NTAG AKHQAVAL VG
Sbjct  290   IVGDGMHATIITGNLNVVDGSTTFHSATLAAVGKGFILQDICIQNTAGPAKHQAVALRVG  349

Query  235   GDKSIINRCRLEGYQDTLYAHSKRQFYRDCTITGTIDFVFGDAAVVLQNCTLIAKKPLAA  56
              DKS+INRCR++ YQDTLYAHS+RQFYRD  +TGTIDF+FG+AAVV Q C L+A+KP   
Sbjct  350   ADKSVINRCRIDAYQDTLYAHSQRQFYRDSYVTGTIDFIFGNAAVVFQKCKLVARKPGKY  409

Query  55    QKNMVTAQGRSDPNQNTG  2
             Q+NMVTAQGR+DPNQ TG
Sbjct  410   QQNMVTAQGRTDPNQATG  427



>ref|XP_007157170.1| hypothetical protein PHAVU_002G048500g [Phaseolus vulgaris]
 gb|ESW29164.1| hypothetical protein PHAVU_002G048500g [Phaseolus vulgaris]
Length=552

 Score =   332 bits (852),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 176/378 (47%), Positives = 239/378 (63%), Gaps = 9/378 (2%)
 Frame = -3

Query  1114  LCRTAIDPAACKTILKQTVKSYGGTPA-----GLLREFLADYLPSMEAAKMEFGMVRGEF  950
             LC  A+D  +C   L + V+    T        L   FL      ++ A      ++   
Sbjct  54    LCHHALDNPSCLAHLSEVVQGPIFTTTKDHSFNLFHSFLLKSTSHIQRAMNTASSIKLRV  113

Query  949   THPREVQAVADCVELMGLSINDVRDAIKDLQGSKTRNS-DAQTSLSAVLTNHLTCMEGLN  773
               P+E  A+ DCVELM LSI+ V D++  L    T +  DA T LS+VLTNH TC++GL 
Sbjct  114   NSPKEEAALNDCVELMDLSIDRVLDSMLTLTNQTTESQQDAHTWLSSVLTNHATCLDGLE  173

Query  772   PPEKSPVKGILDALISRSRVALAVLAEIIGQTDEEQNFRVPFNGKFPSWVKSSDRKLVRR  593
                ++ ++  L+ LISR+R ALA+   ++    E      P NG+FPSW+ S DR+L+  
Sbjct  174   GTARALMEAELEDLISRARTALAMFVTVLPPRVEP--IDEPLNGEFPSWLSSKDRRLLES  231

Query  592   KHGNLKADIIVSQDGKGNFTTLKKAMESVSAVSKARVFIYVKKGTYKENVEMNVKSP-VM  416
               G++ A+++V++DG G F T+ +A+ S    SK R  IYVKKGTYKENVE+  K   VM
Sbjct  232   SVGDINANVVVAKDGSGKFKTVAEAVASAPDNSKTRYVIYVKKGTYKENVEIGKKKKNVM  291

Query  415   IYGDGMTQTVFSGDHSFGDNYTTFKSYTLASKGPAAILQDLCVRNTAGAAKHQAVALLVG  236
             + GDG   TV +G  ++ D   TF++ T+A+ G   I QD+  +NTAG  KHQAVAL VG
Sbjct  292   LVGDGKDLTVITGSLNYIDGTGTFQTATVAAVGDGFIGQDIWFQNTAGPQKHQAVALRVG  351

Query  235   GDKSIINRCRLEGYQDTLYAHSKRQFYRDCTITGTIDFVFGDAAVVLQNCTLIAKKPLAA  56
              D+S+INRCR++ YQDTLYAH+ RQFYRD  ITGT+DF+FG+AAVV Q C L+A+KP++ 
Sbjct  352   ADQSVINRCRVDAYQDTLYAHTNRQFYRDSFITGTVDFIFGNAAVVFQKCYLVARKPMSN  411

Query  55    QKNMVTAQGRSDPNQNTG  2
             QKNMVTAQGR DPNQNTG
Sbjct  412   QKNMVTAQGREDPNQNTG  429



>emb|CAD29733.1| pectin methylesterase [Sesbania rostrata]
Length=554

 Score =   330 bits (845),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 170/378 (45%), Positives = 239/378 (63%), Gaps = 7/378 (2%)
 Frame = -3

Query  1114  LCRTAIDPAACKTILKQTVK-----SYGGTPAGLLREFLADYLPSMEAAKMEFGMVRGEF  950
             +C  A+D  +C   + +  +     +       LL   L    P ++ A      ++ + 
Sbjct  54    VCEHALDTKSCLAHVSEVAQGPILATTKDHKLNLLISLLTQSTPQIQNAMDTVKAIKHKI  113

Query  949   THPREVQAVADCVELMGLSINDVRDAIKDL-QGSKTRNSDAQTSLSAVLTNHLTCMEGLN  773
              +P+E  A+ DC +LM LSI+ V D++  L + +     D  + LS+VLTNH TC++GL 
Sbjct  114   NNPKEEAALHDCEQLMDLSIDRVWDSVVALTKNTIDSQQDTHSWLSSVLTNHATCLDGLE  173

Query  772   PPEKSPVKGILDALISRSRVALAVLAEIIGQTDEEQNFRVPFNGKFPSWVKSSDRKLVRR  593
                ++ ++  L+ L+SR+R +LA+L  ++     EQ      NG FPSWV S DR+L+  
Sbjct  174   GTSRALMEAELEDLMSRARTSLAMLVAVLPPKGNEQFIDESLNGDFPSWVTSKDRRLLES  233

Query  592   KHGNLKADIIVSQDGKGNFTTLKKAMESVSAVSKARVFIYVKKGTYKENVEM-NVKSPVM  416
                ++KA+++V++DG G F T+ +A+ S     K R  IYVKKGTYKENVE+   K+ VM
Sbjct  234   SIRDIKANVVVAKDGSGKFKTVAEAIASAPDNGKTRYVIYVKKGTYKENVEIGKKKTNVM  293

Query  415   IYGDGMTQTVFSGDHSFGDNYTTFKSYTLASKGPAAILQDLCVRNTAGAAKHQAVALLVG  236
             + GDGM  TV +G+ +  D  TTFKS T+A+ G   I QD+  +NTAG  KHQAVAL VG
Sbjct  294   LVGDGMDATVITGNLNVIDGSTTFKSATVAAVGDGFIAQDIWFQNTAGPQKHQAVALRVG  353

Query  235   GDKSIINRCRLEGYQDTLYAHSKRQFYRDCTITGTIDFVFGDAAVVLQNCTLIAKKPLAA  56
              D+S+INRCR++ +QDTLYAHS RQFYRD  ITGT+DF+FG+A VV Q C L+A+KP+  
Sbjct  354   ADQSVINRCRMDAFQDTLYAHSNRQFYRDSFITGTVDFIFGNAPVVFQKCKLVARKPMNN  413

Query  55    QKNMVTAQGRSDPNQNTG  2
             QKNMVTAQGR DPNQNTG
Sbjct  414   QKNMVTAQGREDPNQNTG  431



>ref|XP_007025998.1| Pectinesterase/pectinesterase inhibitor, putative [Theobroma 
cacao]
 gb|EOY28620.1| Pectinesterase/pectinesterase inhibitor, putative [Theobroma 
cacao]
Length=543

 Score =   329 bits (844),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 175/379 (46%), Positives = 246/379 (65%), Gaps = 15/379 (4%)
 Frame = -3

Query  1114  LCRTAIDPAACKTILKQ-----TVKSYGGTPAGLLREFLADYLPSMEAAKMEFGMVRGEF  950
             +C  A+D  +C  +L +     T+K  G     +L  FL      M+ A       +   
Sbjct  51    VCLGAVDQKSCSALLSEVASNSTIKMKG---VDVLHAFLEKSTAQMQNAINLANNFKHRI  107

Query  949   THPREVQAVADCVELMGLSINDVRDAIKDLQGSKT--RNSDAQTSLSAVLTNHLTCMEGL  776
              +PR+  A+ADC+ELM  S++ + D++  L G K    +SDA   LS+VLTNH+TC++G+
Sbjct  108   NNPRDQAALADCLELMESSMDRIADSMVAL-GKKDVDSHSDAHAWLSSVLTNHVTCLDGV  166

Query  775   NPPEKSPVKGILDALISRSRVALAVLAEIIGQTDEEQNFRVPFNGKFPSWVKSSDRKLVR  596
                 ++ ++  L+ LISR+R +LAV   I   +  +  F  P   +FPSWV S DRKL++
Sbjct  167   QGSARTLMEPGLNDLISRARTSLAVFVSI---SPGKTRFVDPSIDEFPSWVSSKDRKLLQ  223

Query  595   RKHGNLKADIIVSQDGKGNFTTLKKAMESVSAVSKARVFIYVKKGTYKENVEMNVKSP-V  419
                  +KA+++V++DG GN+ TL +A+ +    SK R  I+VK GTYKENVE+  K   +
Sbjct  224   ALLNEIKANVVVAKDGSGNYKTLAEAVAAAPDKSKIRYIIHVKNGTYKENVEIGKKKKNL  283

Query  418   MIYGDGMTQTVFSGDHSFGDNYTTFKSYTLASKGPAAILQDLCVRNTAGAAKHQAVALLV  239
             MI GDGM  T+ +G  +F D  TTFKS T+A+ G   I QD+  +NTAG  KHQAVAL V
Sbjct  284   MIVGDGMNSTIITGSLNFVDGTTTFKSATVAAVGDGFIAQDIWFQNTAGPEKHQAVALRV  343

Query  238   GGDKSIINRCRLEGYQDTLYAHSKRQFYRDCTITGTIDFVFGDAAVVLQNCTLIAKKPLA  59
             G D+S+INRC+++ YQDTLY HS RQFYRD  +TGT+DF+FG+AAVV QNC L+A+KP++
Sbjct  344   GADQSVINRCKIDAYQDTLYTHSNRQFYRDSYVTGTVDFIFGNAAVVFQNCKLVARKPMS  403

Query  58    AQKNMVTAQGRSDPNQNTG  2
             +Q NMVTAQGR+DPNQNTG
Sbjct  404   SQSNMVTAQGRTDPNQNTG  422



>ref|XP_003622688.1| Pectinesterase [Medicago truncatula]
 gb|AES78906.1| pectinesterase/pectinesterase inhibitor [Medicago truncatula]
Length=554

 Score =   329 bits (844),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 177/382 (46%), Positives = 239/382 (63%), Gaps = 15/382 (4%)
 Frame = -3

Query  1114  LCRTAIDPAACKTILKQTVKSYG---------GTPAGLLREFLADYLPSMEAAKMEFGMV  962
             LC  A+D  +C T + + V+             T   LL +  A    +M+ A +    +
Sbjct  54    LCEHALDTKSCLTHVSEVVQGSTLSNTKDHKLSTLVSLLTKSTAHIRKAMDTANV----I  109

Query  961   RGEFTHPREVQAVADCVELMGLSINDVRDAIKDL-QGSKTRNSDAQTSLSAVLTNHLTCM  785
             +     PRE  A+ DC ELM LS++ V D++  L + +     DA T LS+VLTNH TC+
Sbjct  110   KRRVNSPREEIALNDCEELMDLSMDRVWDSVLTLTKNNIDSQHDAHTWLSSVLTNHATCL  169

Query  784   EGLNPPEKSPVKGILDALISRSRVALAVLAEIIGQTDEEQNFRVPFNGKFPSWVKSSDRK  605
             +GL    +  ++  L  LISR+R +LAVL  ++     +       NG FPSWV S DR+
Sbjct  170   DGLEGSSRVVMESDLHDLISRARSSLAVLVSVLPPKANDGFIDEKLNGDFPSWVTSKDRR  229

Query  604   LVRRKHGNLKADIIVSQDGKGNFTTLKKAMESVSAVSKARVFIYVKKGTYKENVEM-NVK  428
             L+    G++KA+++V+QDG G F T+ +A+ S     K R  IYVKKGTYKEN+E+   K
Sbjct  230   LLESSVGDIKANVVVAQDGSGKFKTVAQAVASAPDNGKTRYVIYVKKGTYKENIEIGKKK  289

Query  427   SPVMIYGDGMTQTVFSGDHSFGDNYTTFKSYTLASKGPAAILQDLCVRNTAGAAKHQAVA  248
             + VM+ GDGM  T+ +G  +F D  TTFKS T+A+ G   I QD+  +NTAG  KHQAVA
Sbjct  290   TNVMLVGDGMDATIITGSLNFIDGTTTFKSATVAAVGDGFIAQDIRFQNTAGPQKHQAVA  349

Query  247   LLVGGDKSIINRCRLEGYQDTLYAHSKRQFYRDCTITGTIDFVFGDAAVVLQNCTLIAKK  68
             L VG D+S+INRC+++ +QDTLYAHS RQFYRD  ITGT+DF+FG+AAVV Q   L A+K
Sbjct  350   LRVGADQSVINRCKIDAFQDTLYAHSNRQFYRDSYITGTVDFIFGNAAVVFQKSKLAARK  409

Query  67    PLAAQKNMVTAQGRSDPNQNTG  2
             P+A QKNMVTAQGR DPNQNT 
Sbjct  410   PMANQKNMVTAQGREDPNQNTA  431



>ref|NP_001044480.1| Os01g0788400 [Oryza sativa Japonica Group]
 dbj|BAD53265.1| putative pectin esterase [Oryza sativa Japonica Group]
 dbj|BAF06394.1| Os01g0788400 [Oryza sativa Japonica Group]
 dbj|BAH00252.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE55512.1| hypothetical protein OsJ_03720 [Oryza sativa Japonica Group]
Length=546

 Score =   329 bits (844),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 181/380 (48%), Positives = 243/380 (64%), Gaps = 16/380 (4%)
 Frame = -3

Query  1114  LCRTAIDPAACKTILKQTV----KSYGGTPAGLLREFLADYLPSMEAAKMEFGMVRGEFT  947
             LC ++ DPA+C+ I+   V     S+   PA +LR  LA  L   +AA      +R   +
Sbjct  52    LCASSPDPASCQAIVADAVLASPHSHPSRPAHVLRAILATSLDRHDAAAEAVAGMRRRAS  111

Query  946   HPREVQAVADCVELMGLSINDVRDAIKDLQGSKTRNSD---AQTSLSAVLTNHLTCMEGL  776
              PR   A+ DCV+LMGL+    RD + D  G+   + D   A+T LSAVLT+H+TC++GL
Sbjct  112   DPRHRAALEDCVQLMGLA----RDRLADAAGAPDVDVDVDDARTWLSAVLTDHVTCLDGL  167

Query  775   NP-PEKSPVKGILDALISRSRVALAVLAEIIGQTDEEQNFRVPFNGKFPSWVKSSDRKLV  599
             +  P +  V   L+ L S +  +LAVL+         ++       +FPSW+ + DR L+
Sbjct  168   DDGPLRDSVGAHLEPLKSLASASLAVLS---AAGRGARDVLAEAVDRFPSWLTARDRTLL  224

Query  598   RRKHGNLKADIIVSQDGKGNFTTLKKAMESVSAVSKARVFIYVKKGTYKENVEMN-VKSP  422
                 G ++AD++V++DG G +TT+K+A+++     K+R  IYVKKG YKEN+E+   K  
Sbjct  225   DAGAGAVQADVVVAKDGSGKYTTIKEAVDAAPDGGKSRYVIYVKKGVYKENLEVGKTKRV  284

Query  421   VMIYGDGMTQTVFSGDHSFGDNYTTFKSYTLASKGPAAILQDLCVRNTAGAAKHQAVALL  242
             +MI GDGM QTV +G  +  D  TTF S TLA  G   ILQDL V NTAGA K QAVAL 
Sbjct  285   LMIVGDGMDQTVITGSRNVVDGSTTFNSATLALSGDGIILQDLKVENTAGAEKQQAVALR  344

Query  241   VGGDKSIINRCRLEGYQDTLYAHSKRQFYRDCTITGTIDFVFGDAAVVLQNCTLIAKKPL  62
             V  D+++INRCRL+GYQDTLYAH  RQFYRDC ++GT+DFVFG+AA VLQ C L A++P 
Sbjct  345   VSADRAVINRCRLDGYQDTLYAHQLRQFYRDCAVSGTVDFVFGNAAAVLQGCVLTARRPA  404

Query  61    AAQKNMVTAQGRSDPNQNTG  2
              AQKN VTAQGR+DPNQNTG
Sbjct  405   QAQKNAVTAQGRTDPNQNTG  424



>ref|XP_004492228.1| PREDICTED: pectinesterase 2.1-like [Cicer arietinum]
Length=555

 Score =   329 bits (844),  Expect = 8e-103, Method: Compositional matrix adjust.
 Identities = 160/323 (50%), Positives = 220/323 (68%), Gaps = 2/323 (1%)
 Frame = -3

Query  964  VRGEFTHPREVQAVADCVELMGLSINDVRDAIKDL-QGSKTRNSDAQTSLSAVLTNHLTC  788
            ++     PRE  A+ DC +LM +S++ + D++  L + +     DA T LS+VLTNH+TC
Sbjct  110  IKSRINSPREETALRDCEQLMEISMDRIWDSMLALTKNTIDSQQDAHTWLSSVLTNHVTC  169

Query  787  MEGLNPPEKSPVKGILDALISRSRVALAVLAEIIGQTDEEQNFRVPFNGKFPSWVKSSDR  608
            ++GL    +  ++     LISR+R +LAV   +  Q   +Q      NG FPSW+ S DR
Sbjct  170  LDGLEAISQVLMESDFQDLISRARTSLAVFLAVFPQQGHDQFVDETLNGDFPSWITSKDR  229

Query  607  KLVRRKHGNLKADIIVSQDGKGNFTTLKKAMESVSAVSKARVFIYVKKGTYKENVEM-NV  431
            +L+    G++KA+++V++DG G F T+ +A+ +     K R  IYVKKGTYKEN+E+ ++
Sbjct  230  RLLESSVGDIKANVVVAKDGSGKFKTVAEAVATAPDNGKTRYVIYVKKGTYKENIEIGSI  289

Query  430  KSPVMIYGDGMTQTVFSGDHSFGDNYTTFKSYTLASKGPAAILQDLCVRNTAGAAKHQAV  251
            K  VM+ GDGM  T+ +G+ +F D  TTFKS T+A+ G   I QD+  +NTAGA KHQAV
Sbjct  290  KKNVMLVGDGMDATIITGNLNFIDGTTTFKSATVAAVGDGFIAQDIGFQNTAGAEKHQAV  349

Query  250  ALLVGGDKSIINRCRLEGYQDTLYAHSKRQFYRDCTITGTIDFVFGDAAVVLQNCTLIAK  71
            AL VG D+S+INRCR++ +QDTLYAHS RQFYRD  ITGTIDF+FG+AAVV Q C L+A+
Sbjct  350  ALRVGADQSVINRCRIDAFQDTLYAHSNRQFYRDSVITGTIDFIFGNAAVVFQKCKLVAR  409

Query  70   KPLAAQKNMVTAQGRSDPNQNTG  2
            KP+A Q NM TAQGR DP QNTG
Sbjct  410  KPMANQNNMYTAQGREDPGQNTG  432



>gb|EYU19222.1| hypothetical protein MIMGU_mgv1a003983mg [Erythranthe guttata]
Length=551

 Score =   329 bits (843),  Expect = 9e-103, Method: Compositional matrix adjust.
 Identities = 173/383 (45%), Positives = 243/383 (63%), Gaps = 13/383 (3%)
 Frame = -3

Query  1114  LCRTAIDPAACKTILKQTVKSYGG---TP----AGLLREFLADYLPSMEAAKMEFGMVRG  956
             LC  A++P +C+  + +          TP      LL++FL      M  A  +   ++ 
Sbjct  49    LCSRALNPQSCQDFVSEVTSDNSAIAITPQQDGTTLLQKFLIRQAHHMSRAISQTRKLKN  108

Query  955   EFTHPREVQAVADCVELMGLSINDVRDAIKDL--QGSKTRNSDAQTSLSAVLTNHLTCME  782
                   E  A+ADC+ L+ LSI+ V D+I+DL  + S     +A+  LS VLTNH+TC +
Sbjct  109   RMNAQIERGALADCLHLIDLSIDLVLDSIRDLNNETSAMSRDNARAWLSGVLTNHVTCFD  168

Query  781   GLNPPEKSPVKGILDALISRSRVALAVLAEIIGQTDEEQNFRVPFNGK--FPSWVKSSDR  608
             GL+  EK  +  +++ LI R+  +LAV A  + + D  +   +P  G+   PSW+   +R
Sbjct  169   GLDSFEKQYLGEVIEDLIERASASLAVFAVAVSKLDHNE-VDIPSFGQNYMPSWITKVER  227

Query  607   KLVRRKHGNLKADIIVSQDGKGNFTTLKKAMESVSAVSKARVFIYVKKGTYKENVEMNV-  431
             +L++     + AD+ V+ DG GN+ T+ +A+ +    SK R  IYVKKGTYKENVE+   
Sbjct  228   QLLQSTADAVAADLTVAADGSGNYKTVAEAVAAAPDKSKKRYVIYVKKGTYKENVEVGKN  287

Query  430   KSPVMIYGDGMTQTVFSGDHSFGDNYTTFKSYTLASKGPAAILQDLCVRNTAGAAKHQAV  251
             K  +MI GDGM  T+ +GD +  D  TTF S TLA+ G   I+QD+C++NTAG  KHQAV
Sbjct  288   KKNLMIIGDGMNNTIITGDLNVADGATTFNSATLAAVGEGFIMQDICIQNTAGPEKHQAV  347

Query  250   ALLVGGDKSIINRCRLEGYQDTLYAHSKRQFYRDCTITGTIDFVFGDAAVVLQNCTLIAK  71
             AL VG DKS+INRCR++ YQDTLY HS RQFYR+  +TGT+DF+FG+AAVV Q C L+A+
Sbjct  348   ALRVGADKSVINRCRIDAYQDTLYTHSLRQFYRESYVTGTVDFIFGNAAVVFQKCKLVAR  407

Query  70    KPLAAQKNMVTAQGRSDPNQNTG  2
             KP+ +QKNMVTAQGR+DPNQNTG
Sbjct  408   KPMKSQKNMVTAQGRTDPNQNTG  430



>ref|XP_007157171.1| hypothetical protein PHAVU_002G048600g [Phaseolus vulgaris]
 gb|ESW29165.1| hypothetical protein PHAVU_002G048600g [Phaseolus vulgaris]
Length=553

 Score =   329 bits (843),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 174/378 (46%), Positives = 238/378 (63%), Gaps = 8/378 (2%)
 Frame = -3

Query  1114  LCRTAIDPAACKTILKQTVKSYGGTPA-----GLLREFLADYLPSMEAAKMEFGMVRGEF  950
             LC  A+D  +C   L + V+    T        L   FL      ++ A      ++   
Sbjct  54    LCHHALDNPSCLAHLSEVVQGPIFTTTKDHSFNLFHSFLLKSTSHIQRAMNTASSIKLRV  113

Query  949   THPREVQAVADCVELMGLSINDVRDAIKDLQGSKTRNS-DAQTSLSAVLTNHLTCMEGLN  773
               P+E  A+ DCVELM LSI+ V D++  L    T +  DA T LS+VLTNH TC++GL 
Sbjct  114   NSPKEEAALNDCVELMDLSIDRVLDSMLTLTNQTTESQQDAHTWLSSVLTNHATCLDGLE  173

Query  772   PPEKSPVKGILDALISRSRVALAVLAEIIGQTDEEQNFRVPFNGKFPSWVKSSDRKLVRR  593
                ++ ++  L+ LISR+R  LA+   ++    E      P NG+FPSW++S DR+L+  
Sbjct  174   GTARALMEAELEDLISRARTTLAMFVTVLPPRVEPI-VDEPLNGEFPSWLRSKDRRLLES  232

Query  592   KHGNLKADIIVSQDGKGNFTTLKKAMESVSAVSKARVFIYVKKGTYKENVEM-NVKSPVM  416
               G++ A+++V++DG   F T+ +A++S    SK R  IYVKKGTYKENVE+   K  VM
Sbjct  233   SVGDINANVVVAKDGSDKFKTVAEAVKSAPVNSKTRYVIYVKKGTYKENVEICQTKKNVM  292

Query  415   IYGDGMTQTVFSGDHSFGDNYTTFKSYTLASKGPAAILQDLCVRNTAGAAKHQAVALLVG  236
             + GDG   TV +G  ++ D   TF++ T+A+ G   I QD+  +NTAG  K QAVAL VG
Sbjct  293   LVGDGKDLTVITGSLNYVDGTGTFQTATVAAVGDGFIGQDIWFQNTAGPQKQQAVALRVG  352

Query  235   GDKSIINRCRLEGYQDTLYAHSKRQFYRDCTITGTIDFVFGDAAVVLQNCTLIAKKPLAA  56
              DKS+INRCR++ +QDTLYAHS RQFYRD  ITGT+DF+FG+AAVV Q C L+A+KP++ 
Sbjct  353   ADKSVINRCRIDAFQDTLYAHSNRQFYRDSFITGTVDFIFGNAAVVFQKCNLVARKPMSN  412

Query  55    QKNMVTAQGRSDPNQNTG  2
             QKNMVTAQGR DPNQNTG
Sbjct  413   QKNMVTAQGREDPNQNTG  430



>ref|XP_011000694.1| PREDICTED: pectinesterase [Populus euphratica]
Length=557

 Score =   329 bits (843),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 180/376 (48%), Positives = 243/376 (65%), Gaps = 8/376 (2%)
 Frame = -3

Query  1114  LCRTAIDPAACKTILKQTVKSYGGTP---AGLLREFLADYLPSMEAAKMEFGMVRGEFTH  944
             LC  A D  +C  ++ Q + SY  T     GLL+  L      ++    +  ++      
Sbjct  64    LCDHAYDQESCLAMVSQ-IASYTSTKMSQVGLLQLLLGKSTSHIQDTIEKAEVIHSRIND  122

Query  943   PREVQAVADCVELMGLSINDVRDAIKDLQG-SKTRNSDAQTSLSAVLTNHLTCMEGLNPP  767
              RE  A+ DCVELM +S   ++D I  L+  +   +++A T LS+VLTNH TC++GLN P
Sbjct  123   AREQAALGDCVELMEISKYRIKDTIVALERVTSESHANALTWLSSVLTNHDTCLDGLNGP  182

Query  766   EKSPVKGILDALISRSRVALAVLAEIIGQTDEEQNFRVPFNGKFPSWVKSSDRKLVRRKH  587
              +S ++  L+ LI R+R +LA+LA I     +E N   P    FPSW+ S DRKL+    
Sbjct  183   ARSTMELDLNDLILRARTSLAILAAI--SPSKENNDIFPLKEDFPSWLPSMDRKLLITLP  240

Query  586   GNLKADIIVSQDGKGNFTTLKKAMESVSAVSKARVFIYVKKGTYKENVEMNVKSP-VMIY  410
              ++ AD+ V++DG G + T+K+A+ S     K R  IYVKKGTYKENVE+  K   VM+ 
Sbjct  241   KDINADVTVAKDGSGKYKTVKEAVASAPDNGKTRYVIYVKKGTYKENVEVGKKKKNVMLV  300

Query  409   GDGMTQTVFSGDHSFGDNYTTFKSYTLASKGPAAILQDLCVRNTAGAAKHQAVALLVGGD  230
             GDGM  T+ +G+ +  D  TTFKS T+A+ G   I QD+  +NTAG  KHQAVAL VG D
Sbjct  301   GDGMDSTIITGNLNVVDGSTTFKSATVAAVGDGFIAQDIWFQNTAGPEKHQAVALRVGAD  360

Query  229   KSIINRCRLEGYQDTLYAHSKRQFYRDCTITGTIDFVFGDAAVVLQNCTLIAKKPLAAQK  50
             +S+INRCR++ YQDTLY HS RQFYRD  ITGT+DF+FG+AAVVLQNC L+ +KP++ QK
Sbjct  361   QSVINRCRIDAYQDTLYTHSLRQFYRDSYITGTVDFIFGNAAVVLQNCKLVPRKPMSGQK  420

Query  49    NMVTAQGRSDPNQNTG  2
             NMVTAQGR+DPNQNTG
Sbjct  421   NMVTAQGRTDPNQNTG  436



>ref|XP_009364480.1| PREDICTED: pectinesterase [Pyrus x bretschneideri]
Length=558

 Score =   329 bits (843),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 175/384 (46%), Positives = 245/384 (64%), Gaps = 18/384 (5%)
 Frame = -3

Query  1114  LCRTAIDPAACKTILKQTVKSYGGTP----AGLLREFLADYLPSMEAAKMEFGMVRGEFT  947
             +C  A+D  +C +I+ +T  S+G T     A LL+  L + +P ++       +      
Sbjct  59    ICDHALDQKSCLSIVSET--SHGTTKPMSGADLLQTILQNSIPQLQKTLEIAKVAHSRIN  116

Query  946   HPREVQAVADCVELMGLSINDVRDAIKDLQGSKTRN----SDAQTSLSAVLTNHLTCMEG  779
              P++  A+ DCVELM ++ + V D++  LQ    +N     D    LS+VLTNH+TC++G
Sbjct  117   SPKDRAAIVDCVELMDVTKDRVMDSMVALQKFGAQNYYSLEDVHGWLSSVLTNHVTCLDG  176

Query  778   LNPPEKSPVKGILDALISRSRVALAVLAEIIGQTDEEQNFRVPFNGKFPSWVKSSDRKLV  599
             L  P ++ ++  L+ L+SRSR +LA++  I     +    +   +G FP+WV S DR+L+
Sbjct  177   LEGPARTMMEPWLNDLVSRSRASLAIVVAI-SDPSKSNTIKERLDGNFPTWVTSKDRRLL  235

Query  598   RRKHGNL----KADIIVSQDGKGNFTTLKKAMESVSAVSKARVFIYVKKGTYKENVEMNV  431
                  NL     A+ +V++DG GN+ T+K+A+ +    SK R  I+VKKGTYKEN E+  
Sbjct  236   L--DSNLAKESNANAVVAKDGSGNYKTVKEAVAAAPDNSKTRYTIHVKKGTYKENFEVGK  293

Query  430   KSP-VMIYGDGMTQTVFSGDHSFGDNYTTFKSYTLASKGPAAILQDLCVRNTAGAAKHQA  254
             K   +MI GDGM  T+ +G  +  D  TTF S TLA+ G   I QD+  +NTAGAAKHQA
Sbjct  294   KKKNLMITGDGMHNTIITGSLNVVDGATTFNSATLAAVGDGFIAQDIWFQNTAGAAKHQA  353

Query  253   VALLVGGDKSIINRCRLEGYQDTLYAHSKRQFYRDCTITGTIDFVFGDAAVVLQNCTLIA  74
             VAL VG D+S+INRCR++ YQDTLYAHS RQFYRD  ITGT+DF+FG+AAVV QNC ++A
Sbjct  354   VALRVGADQSVINRCRIDAYQDTLYAHSNRQFYRDSNITGTVDFIFGNAAVVFQNCKIVA  413

Query  73    KKPLAAQKNMVTAQGRSDPNQNTG  2
             +KP+  Q NMVTAQGR DPNQNTG
Sbjct  414   RKPMTGQNNMVTAQGRIDPNQNTG  437



>gb|ACJ85768.1| unknown [Medicago truncatula]
Length=554

 Score =   328 bits (842),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 176/382 (46%), Positives = 239/382 (63%), Gaps = 15/382 (4%)
 Frame = -3

Query  1114  LCRTAIDPAACKTILKQTVKSYG---------GTPAGLLREFLADYLPSMEAAKMEFGMV  962
             LC  A+D  +C T + + V+             T   LL +  A    +M+ A +    +
Sbjct  54    LCEHALDTKSCLTHVSEVVQGSTLSNTKDHKLSTLVSLLTKSTAHIRKAMDTANV----I  109

Query  961   RGEFTHPREVQAVADCVELMGLSINDVRDAIKDL-QGSKTRNSDAQTSLSAVLTNHLTCM  785
             +     PRE  A+ DC ELM LS++ V D++  L + +     DA T LS+VLTNH TC+
Sbjct  110   KRRVNSPREEIALNDCEELMDLSMDRVWDSVLTLTKNNIDSQHDAHTWLSSVLTNHATCL  169

Query  784   EGLNPPEKSPVKGILDALISRSRVALAVLAEIIGQTDEEQNFRVPFNGKFPSWVKSSDRK  605
             +GL    +  ++  L  LISR+R +LAVL  ++     +       NG FPSWV S DR+
Sbjct  170   DGLEGSSRVVMESDLHDLISRARSSLAVLVSVLPPKANDGFIDEKLNGDFPSWVTSKDRR  229

Query  604   LVRRKHGNLKADIIVSQDGKGNFTTLKKAMESVSAVSKARVFIYVKKGTYKENVEM-NVK  428
             L+    G++KA+++V+QDG G F T+ +A+ S     + R  IYVKKGTYKEN+E+   K
Sbjct  230   LLESSVGDIKANVVVAQDGSGKFKTVAQAVASAPDNGETRYVIYVKKGTYKENIEIGKKK  289

Query  427   SPVMIYGDGMTQTVFSGDHSFGDNYTTFKSYTLASKGPAAILQDLCVRNTAGAAKHQAVA  248
             + VM+ GDGM  T+ +G  +F D  TTFKS T+A+ G   I QD+  +NTAG  KHQAVA
Sbjct  290   TNVMLVGDGMDATIITGSLNFTDGTTTFKSATVAAVGDGFIAQDIRFQNTAGPQKHQAVA  349

Query  247   LLVGGDKSIINRCRLEGYQDTLYAHSKRQFYRDCTITGTIDFVFGDAAVVLQNCTLIAKK  68
             L VG D+S+INRC+++ +QDTLYAHS RQFYRD  ITGT+DF+FG+AAVV Q   L A+K
Sbjct  350   LHVGADQSVINRCKIDAFQDTLYAHSNRQFYRDSYITGTVDFIFGNAAVVFQKSKLAARK  409

Query  67    PLAAQKNMVTAQGRSDPNQNTG  2
             P+A QKNMVTAQGR DPNQNT 
Sbjct  410   PMANQKNMVTAQGREDPNQNTA  431



>dbj|BAC67661.1| pectin methylesterase [Pisum sativum]
Length=554

 Score =   328 bits (841),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 173/382 (45%), Positives = 240/382 (63%), Gaps = 15/382 (4%)
 Frame = -3

Query  1114  LCRTAIDPAACKTILKQTVKSYG---------GTPAGLLREFLADYLPSMEAAKMEFGMV  962
             LC  A+D  +C T + + V+             T   LL +  +    +ME A +    +
Sbjct  54    LCEHAVDTKSCLTHVSEVVQGQALANTKDHKLSTLISLLTKSTSHIQKAMETANV----I  109

Query  961   RGEFTHPREVQAVADCVELMGLSINDVRDAIKDL-QGSKTRNSDAQTSLSAVLTNHLTCM  785
             +     PRE  A+ DC +LM LS++ V D++  L + +     DA T LS+VLTNH TC+
Sbjct  110   KRRVNSPREETALNDCEQLMDLSMDRVWDSVLTLTKNNIDSQQDAHTWLSSVLTNHATCL  169

Query  784   EGLNPPEKSPVKGILDALISRSRVALAVLAEIIGQTDEEQNFRVPFNGKFPSWVKSSDRK  605
              GL    +  ++G L  LISR+R +LAVL  ++     +       NG+FPSWV S DR+
Sbjct  170   NGLEGTSRVVMEGDLQDLISRARSSLAVLVSVLPAKSNDGFIDESLNGEFPSWVTSKDRR  229

Query  604   LVRRKHGNLKADIIVSQDGKGNFTTLKKAMESVSAVSKARVFIYVKKGTYKENVEM-NVK  428
             L+    G++KA+++V++DG G F T+ +A+ S     KAR  IYVK+GTYKE VE+   K
Sbjct  230   LLESTVGDIKANVVVAKDGSGKFKTVAEAVASAPDNGKARYVIYVKRGTYKEKVEIGKKK  289

Query  427   SPVMIYGDGMTQTVFSGDHSFGDNYTTFKSYTLASKGPAAILQDLCVRNTAGAAKHQAVA  248
             + VM+ GDGM  T+ +G+ +F D  TTF S T+A+ G   I QD+  +NTAG  KHQAVA
Sbjct  290   TNVMLVGDGMDATIITGNLNFIDGTTTFNSATVAAVGDGFIAQDIGFQNTAGPEKHQAVA  349

Query  247   LLVGGDKSIINRCRLEGYQDTLYAHSKRQFYRDCTITGTIDFVFGDAAVVLQNCTLIAKK  68
             L VG D+S+INRC+++ +QDTLYAHS RQFYRD  ITGT+DF+FG+A VV Q   L+A+K
Sbjct  350   LRVGADQSVINRCKIDAFQDTLYAHSNRQFYRDSFITGTVDFIFGNAGVVFQKSKLVARK  409

Query  67    PLAAQKNMVTAQGRSDPNQNTG  2
             P++ QKNMVTAQGR DPNQNT 
Sbjct  410   PMSNQKNMVTAQGREDPNQNTA  431



>ref|NP_001234151.1| pectinesterase 1 precursor [Solanum lycopersicum]
 sp|P14280.5|PME1_SOLLC RecName: Full=Pectinesterase 1; Short=PE 1; AltName: Full=Pectin 
methylesterase 1; Flags: Precursor [Solanum lycopersicum]
 emb|CAA52703.1| pectin esterase [Solanum lycopersicum]
Length=546

 Score =   327 bits (839),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 173/378 (46%), Positives = 251/378 (66%), Gaps = 10/378 (3%)
 Frame = -3

Query  1114  LCRTAIDPAACKT----ILKQTVKSYGGTPAGLLREFLADYLPSMEAAKMEFGMVRGEFT  947
             LC+TA D   C +    ++   + +       +L +FL +Y+  M  A      ++ +  
Sbjct  49    LCKTAQDSQLCLSYVSDLISNEIVTTESDGHSILMKFLVNYVHQMNNAIPVVRKMKNQIN  108

Query  946   HPREVQAVADCVELMGLSINDVRDAIKDL-QGSKTRNSDAQTSLSAVLTNHLTCMEGLNP  770
               R+  A+ DC+EL+  S++   D+I  + + S++ +++AQ+ LS VLTNH+TC++ L+ 
Sbjct  109   DIRQHGALTDCLELLDQSVDFASDSIAAIDKRSRSEHANAQSWLSGVLTNHVTCLDELDS  168

Query  769   PEKSPVKGI-LDALISRSRVALAVLAEIIGQTDEEQNFRVPFNGKFPSWVKSSDRKLVRR  593
               K+ + G  L+ LISR++VALA+LA +   T ++++  +   GK PSWV S DRKL+  
Sbjct  169   FTKAMINGTNLEELISRAKVALAMLASL---TTQDEDVFMTVLGKMPSWVSSMDRKLMES  225

Query  592   KHGNLKADIIVSQDGKGNFTTLKKAMESVSAVSKARVFIYVKKGTYKENVEM-NVKSPVM  416
                ++ A+ +V+QDG G++ TL +A+ +    SK R  IYVK+GTYKENVE+ + K  +M
Sbjct  226   SGKDIIANAVVAQDGTGDYQTLAEAVAAAPDKSKTRYVIYVKRGTYKENVEVASNKMNLM  285

Query  415   IYGDGMTQTVFSGDHSFGDNYTTFKSYTLASKGPAAILQDLCVRNTAGAAKHQAVALLVG  236
             I GDGM  T  +G  +  D  TTF+S TLA+ G   ILQD+C++NTAG AK QAVAL VG
Sbjct  286   IVGDGMYATTITGSLNVVDGSTTFRSATLAAVGQGFILQDICIQNTAGPAKDQAVALRVG  345

Query  235   GDKSIINRCRLEGYQDTLYAHSKRQFYRDCTITGTIDFVFGDAAVVLQNCTLIAKKPLAA  56
              D S+INRCR++ YQDTLYAHS+RQFYRD  +TGT+DF+FG+AAVV Q C L+A+KP   
Sbjct  346   ADMSVINRCRIDAYQDTLYAHSQRQFYRDSYVTGTVDFIFGNAAVVFQKCQLVARKPGKY  405

Query  55    QKNMVTAQGRSDPNQNTG  2
             Q+NMVTAQGR+DPNQ TG
Sbjct  406   QQNMVTAQGRTDPNQATG  423



>gb|AFK35109.1| unknown [Medicago truncatula]
Length=554

 Score =   327 bits (839),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 176/382 (46%), Positives = 238/382 (62%), Gaps = 15/382 (4%)
 Frame = -3

Query  1114  LCRTAIDPAACKTILKQTVKSYG---------GTPAGLLREFLADYLPSMEAAKMEFGMV  962
             LC  A+D  +C T + + V+             T   LL +  A    +M+ A +    +
Sbjct  54    LCEHALDTKSCLTHVSEVVQGSTLSNTKDHKLSTLVSLLTKSTAHIRKAMDTANV----I  109

Query  961   RGEFTHPREVQAVADCVELMGLSINDVRDAIKDL-QGSKTRNSDAQTSLSAVLTNHLTCM  785
             +     PRE  A+ DC ELM LS++ V D++  L + +     DA T LS+VLTNH TC+
Sbjct  110   KRRVNSPREEIALNDCEELMDLSMDRVWDSVLTLTKNNIDSQHDAHTWLSSVLTNHATCL  169

Query  784   EGLNPPEKSPVKGILDALISRSRVALAVLAEIIGQTDEEQNFRVPFNGKFPSWVKSSDRK  605
             +GL    +  ++  L  LISR+R +LAVL  ++     +       NG FPSWV S DR+
Sbjct  170   DGLEGSSRVVMESDLHDLISRARSSLAVLVSVLPPKANDGFIDEKLNGDFPSWVTSKDRR  229

Query  604   LVRRKHGNLKADIIVSQDGKGNFTTLKKAMESVSAVSKARVFIYVKKGTYKENVEM-NVK  428
             L+    G++KA+++V+QDG G F T+ +A+ S     K R  IYVKKGTYKEN+E+   K
Sbjct  230   LLESSVGDIKANVVVAQDGSGKFKTVAQAVASAPDNGKTRYVIYVKKGTYKENIEIGKKK  289

Query  427   SPVMIYGDGMTQTVFSGDHSFGDNYTTFKSYTLASKGPAAILQDLCVRNTAGAAKHQAVA  248
             + VM+ GDGM  T+ +G  +F D  TTFKS T+A+ G   I QD+  +NTAG  KHQAVA
Sbjct  290   TNVMLVGDGMDATIITGSLNFIDGTTTFKSATVAAVGDGFIAQDIRFQNTAGPQKHQAVA  349

Query  247   LLVGGDKSIINRCRLEGYQDTLYAHSKRQFYRDCTITGTIDFVFGDAAVVLQNCTLIAKK  68
             L VG D+S+INRC+++ +QDTLYAHS RQFYRD  ITGT+DF+FG+AAVV Q   L  +K
Sbjct  350   LRVGADQSVINRCKIDAFQDTLYAHSNRQFYRDSYITGTVDFIFGNAAVVFQKSKLATRK  409

Query  67    PLAAQKNMVTAQGRSDPNQNTG  2
             P+A QKNMVTAQGR DPNQNT 
Sbjct  410   PMANQKNMVTAQGREDPNQNTA  431



>ref|XP_006360083.1| PREDICTED: pectinesterase 2.1-like [Solanum tuberosum]
Length=550

 Score =   327 bits (838),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 175/378 (46%), Positives = 246/378 (65%), Gaps = 10/378 (3%)
 Frame = -3

Query  1114  LCRTAIDPAACKT----ILKQTVKSYGGTPAGLLREFLADYLPSMEAAKMEFGMVRGEFT  947
             LC+TA D   C +    ++   + +       +L++FL  Y+  M  A      ++ +  
Sbjct  53    LCKTAQDSQLCLSYVSDLMSNEIVTSNSDGLSILKKFLVKYVHQMNNAIPVVRKIKNQIN  112

Query  946   HPREVQAVADCVELMGLSINDVRDAIKDL-QGSKTRNSDAQTSLSAVLTNHLTCMEGLNP  770
                +  A+ DC+EL+ LS++ V D+I+ + + S + +++AQ+ LS VLTNH+TC++ L+ 
Sbjct  113   DIHQQGALTDCLELLDLSVDLVSDSIEAIDKTSGSGHANAQSWLSGVLTNHVTCLDELDS  172

Query  769   PEKSPVKGI-LDALISRSRVALAVLAEIIGQTDEEQNFRVPFNGKFPSWVKSSDRKLVRR  593
               K+ + G  LD LISR++VALA+LA +   T  E  FR    G+ PSWV S DRKL+  
Sbjct  173   FTKTMINGTNLDELISRAKVALAMLASV--TTHNEDVFRTVL-GRMPSWVSSRDRKLMES  229

Query  592   KHGNLKADIIVSQDGKGNFTTLKKAMESVSAVSKARVFIYVKKGTYKENVEM-NVKSPVM  416
                ++K + +V+QDG G++ TL +A+ +    SK R  IYVK G YKENVE+ N K  +M
Sbjct  230   LGKDIKTNAVVAQDGTGDYQTLAEAVAAAPDNSKKRYVIYVKMGIYKENVEVTNNKMNLM  289

Query  415   IYGDGMTQTVFSGDHSFGDNYTTFKSYTLASKGPAAILQDLCVRNTAGAAKHQAVALLVG  236
             I GDGM  T+ +G  +  D  TTF+S TLA+ G   ILQD+C++NTAG  KHQAVAL VG
Sbjct  290   IVGDGMNATIITGSLNVVDGSTTFRSATLAAVGQGFILQDICIQNTAGPDKHQAVALRVG  349

Query  235   GDKSIINRCRLEGYQDTLYAHSKRQFYRDCTITGTIDFVFGDAAVVLQNCTLIAKKPLAA  56
              D S+INRC ++ YQDTLYA S RQFYRD  +TGT+DF+FG+AAVV Q C L+A+KP   
Sbjct  350   ADMSVINRCHIDAYQDTLYAFSLRQFYRDSYVTGTVDFIFGNAAVVFQKCQLVARKPNKN  409

Query  55    QKNMVTAQGRSDPNQNTG  2
             Q+NMVTAQGR+DPNQ TG
Sbjct  410   QQNMVTAQGRTDPNQATG  427



>gb|EAY76103.1| hypothetical protein OsI_04029 [Oryza sativa Indica Group]
Length=546

 Score =   326 bits (835),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 179/380 (47%), Positives = 242/380 (64%), Gaps = 16/380 (4%)
 Frame = -3

Query  1114  LCRTAIDPAACKTILKQTV----KSYGGTPAGLLREFLADYLPSMEAAKMEFGMVRGEFT  947
             LC ++ DPA+C+ I+   V     ++   PA +LR  LA  L   +AA      +R   +
Sbjct  52    LCASSPDPASCQAIVADAVLASPHAHPSRPAHVLRAILATSLDRHDAAAEAVAGMRRRAS  111

Query  946   HPREVQAVADCVELMGLSINDVRDAIKDLQGSKTRNSDA---QTSLSAVLTNHLTCMEGL  776
              PR   A+ DCV+LMGL+    RD + D  G+   + D    +T LSAVLT+H+TC++GL
Sbjct  112   DPRHRAALEDCVQLMGLA----RDRLADAAGAPDVDVDVDDVRTWLSAVLTDHVTCLDGL  167

Query  775   NP-PEKSPVKGILDALISRSRVALAVLAEIIGQTDEEQNFRVPFNGKFPSWVKSSDRKLV  599
             +  P +  V   L+ L S +  +LAVL+         ++       +FPSW+ + DR L+
Sbjct  168   DDGPLRDSVGAHLEPLKSLASASLAVLS---AAGRGARDVLAEAVDRFPSWLTARDRTLL  224

Query  598   RRKHGNLKADIIVSQDGKGNFTTLKKAMESVSAVSKARVFIYVKKGTYKENVEMN-VKSP  422
                 G ++AD++V++DG G +TT+K+A+++     K+R  IYVKKG YKEN+E+   K  
Sbjct  225   DAGAGAVQADVVVAKDGSGKYTTIKEAVDAAPDGGKSRYVIYVKKGVYKENLEVGKTKRV  284

Query  421   VMIYGDGMTQTVFSGDHSFGDNYTTFKSYTLASKGPAAILQDLCVRNTAGAAKHQAVALL  242
             +MI GDGM QTV +G  +  D  TTF S TLA  G   ILQDL V NTAGA K QAVAL 
Sbjct  285   LMIVGDGMDQTVITGSRNVVDGSTTFNSATLALSGDGIILQDLKVENTAGAEKQQAVALR  344

Query  241   VGGDKSIINRCRLEGYQDTLYAHSKRQFYRDCTITGTIDFVFGDAAVVLQNCTLIAKKPL  62
             V  D+++INRCRL+GYQDTLYAH  RQFYRDC ++GT+DFVFG+AA VLQ C L A++P 
Sbjct  345   VSADRAVINRCRLDGYQDTLYAHQLRQFYRDCAVSGTVDFVFGNAAAVLQGCVLTARRPA  404

Query  61    AAQKNMVTAQGRSDPNQNTG  2
              AQKN VTAQGR+DPNQNTG
Sbjct  405   QAQKNAVTAQGRTDPNQNTG  424



>emb|CAA47810.1| pectinesterase [Pisum sativum]
Length=554

 Score =   326 bits (835),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 172/382 (45%), Positives = 239/382 (63%), Gaps = 15/382 (4%)
 Frame = -3

Query  1114  LCRTAIDPAACKTILKQTVKSYG---------GTPAGLLREFLADYLPSMEAAKMEFGMV  962
             LC  A+D  +C T + + V+             T   LL +  +    +ME A +    +
Sbjct  54    LCEHAVDTKSCLTHVSEVVQGQALANTKDHKLSTLISLLTKSTSHIQKAMETANV----I  109

Query  961   RGEFTHPREVQAVADCVELMGLSINDVRDAIKDL-QGSKTRNSDAQTSLSAVLTNHLTCM  785
             +     PRE  A+ DC +LM LS++ V D++  L + +     DA T LS+VLTNH TC+
Sbjct  110   KRRVNSPREETALNDCEQLMDLSMDRVWDSVLTLTKNNIDSQQDAHTWLSSVLTNHATCL  169

Query  784   EGLNPPEKSPVKGILDALISRSRVALAVLAEIIGQTDEEQNFRVPFNGKFPSWVKSSDRK  605
              GL    +  ++  L  LISR+R +LAVL  ++     +       NG+FPSWV S DR+
Sbjct  170   NGLEGTSRVVMESDLQDLISRARSSLAVLVSVLPAKSNDGFIDESLNGEFPSWVTSKDRR  229

Query  604   LVRRKHGNLKADIIVSQDGKGNFTTLKKAMESVSAVSKARVFIYVKKGTYKENVEM-NVK  428
             L+    G++KA+++V++DG G F T+ +A+ S     KAR  IYVK+GTYKE VE+   K
Sbjct  230   LLESTVGDIKANVVVAKDGSGKFKTVAEAVASAPDNGKARYVIYVKRGTYKEKVEIGKKK  289

Query  427   SPVMIYGDGMTQTVFSGDHSFGDNYTTFKSYTLASKGPAAILQDLCVRNTAGAAKHQAVA  248
             + VM+ GDGM  T+ +G+ +F D  TTF S T+A+ G   I QD+  +NTAG  KHQAVA
Sbjct  290   TNVMLVGDGMDATIITGNLNFIDGTTTFNSATVAAVGDGFIAQDIGFQNTAGPEKHQAVA  349

Query  247   LLVGGDKSIINRCRLEGYQDTLYAHSKRQFYRDCTITGTIDFVFGDAAVVLQNCTLIAKK  68
             L VG D+S+INRC+++ +QDTLYAHS RQFYRD  ITGT+DF+FG+A VV Q   L+A+K
Sbjct  350   LRVGADQSVINRCKIDAFQDTLYAHSNRQFYRDSFITGTVDFIFGNAGVVFQKSKLVARK  409

Query  67    PLAAQKNMVTAQGRSDPNQNTG  2
             P++ QKNMVTAQGR DPNQNT 
Sbjct  410   PMSNQKNMVTAQGREDPNQNTA  431



>ref|XP_002317208.1| pectin methylesterase family protein [Populus trichocarpa]
 gb|EEE97820.1| pectin methylesterase family protein [Populus trichocarpa]
Length=549

 Score =   325 bits (834),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 177/375 (47%), Positives = 240/375 (64%), Gaps = 6/375 (2%)
 Frame = -3

Query  1114  LCRTAIDPAACKTILKQTVK--SYGGTPAGLLREFLADYLPSMEAAKMEFGMVRGEFTHP  941
             LC  A D  +C  ++ Q     S   +  GLL+  L    P ++    +  ++       
Sbjct  56    LCDHAYDQESCLAMVSQIASNTSTKMSQVGLLQLLLGKSTPHIQNTIEKAEVIHSRINDA  115

Query  940   REVQAVADCVELMGLSINDVRDAIKDLQGSKTR-NSDAQTSLSAVLTNHLTCMEGLNPPE  764
             RE  A+ DCVELM +S   ++D I  L+   ++ +++A T LS+VLTNH TC++GLN P 
Sbjct  116   REQAALGDCVELMEISKYRIKDTIVALERVTSKSHANALTWLSSVLTNHDTCLDGLNGPA  175

Query  763   KSPVKGILDALISRSRVALAVLAEIIGQTDEEQNFRVPFNGKFPSWVKSSDRKLVRRKHG  584
             +S ++  L+ LI R+R +LA+LA I     +E N        FPSW+ S DRKL+     
Sbjct  176   RSTMEPDLNDLILRARTSLAILAAI--SPSKENNDIFSLKEDFPSWLPSMDRKLLVALPK  233

Query  583   NLKADIIVSQDGKGNFTTLKKAMESVSAVSKARVFIYVKKGTYKENVEMNVKSP-VMIYG  407
             ++ AD+ V++DG G + T+K+A+ S     K R  IYVKKGTYKENVE+  K   VM+ G
Sbjct  234   DINADVTVAKDGSGKYKTVKEAVASAPDNGKTRYVIYVKKGTYKENVEVGKKKKNVMLVG  293

Query  406   DGMTQTVFSGDHSFGDNYTTFKSYTLASKGPAAILQDLCVRNTAGAAKHQAVALLVGGDK  227
             DGM  T+ +G  +  D  TTF S T+A+ G   I QD+  +NTAG  KHQAVAL VG D+
Sbjct  294   DGMDSTIITGSLNVVDGSTTFNSATVAAVGDGFIAQDIWFQNTAGPEKHQAVALRVGADQ  353

Query  226   SIINRCRLEGYQDTLYAHSKRQFYRDCTITGTIDFVFGDAAVVLQNCTLIAKKPLAAQKN  47
             S+INRCR++ YQDTLY HS RQFYRD  ITGT+DF+FG+AAVVLQNC L+ +KP++ QKN
Sbjct  354   SVINRCRIDAYQDTLYTHSLRQFYRDSYITGTVDFIFGNAAVVLQNCKLVPRKPMSGQKN  413

Query  46    MVTAQGRSDPNQNTG  2
             MVTAQGR+DPNQNTG
Sbjct  414   MVTAQGRTDPNQNTG  428



>ref|XP_006467993.1| PREDICTED: pectinesterase/pectinesterase inhibitor-like [Citrus 
sinensis]
Length=556

 Score =   325 bits (832),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 175/378 (46%), Positives = 240/378 (63%), Gaps = 7/378 (2%)
 Frame = -3

Query  1114  LCRTAIDPAACKTILKQTVKSYGGT---PAGLLREFLADYLPSMEAAKMEFGMVRGEFTH  944
              C  A D ++C  ++ +T      T      LL  FL+    +++        V+     
Sbjct  58    FCAKAQDQSSCIAMVSETTSINATTKMNEVDLLLIFLSKSTSNIQETIEVANHVKHRINS  117

Query  943   PREVQAVADCVELMGLSINDVRDAIKDLQGSKTR-NSDAQTSLSAVLTNHLTCMEGLNPP  767
             PR   A+ DCVEL+ LS++ + D++  L+  +T  N DA   LS VLTNH+TC++GL+  
Sbjct  118   PRGQAALTDCVELLELSVDRITDSMAALKKRRTSSNEDAHAWLSGVLTNHVTCLDGLDGS  177

Query  766   EKSPVKGILDALISRSRVALAVLAEIIG-QTDEEQNFRVPFNGKFPSWVKSSDRKLVRRK  590
                 ++  L  L++R+  +LA+L  I    T+  Q + +    +FPSWV S DR L+R  
Sbjct  178   ATKLMEPRLVELMARAANSLAILVAISPYNTNVIQQYYLRKEIQFPSWVTSRDRLLLRPS  237

Query  589   HGNL-KADIIVSQDGKGNFTTLKKAMESVSAVSKARVFIYVKKGTYKENVEMNVKSP-VM  416
                  KA+++V++DG GN+ T+K+A+ S    SK R  IYVKKGTYKENVE+  K   +M
Sbjct  238   QAEAAKANVVVAKDGSGNYKTVKEAVASAPDNSKTRYVIYVKKGTYKENVEVGKKKKNLM  297

Query  415   IYGDGMTQTVFSGDHSFGDNYTTFKSYTLASKGPAAILQDLCVRNTAGAAKHQAVALLVG  236
             I GDGM  T+ +G  +  D  TTFKS T+A  G   I QDL ++NTAG  KHQAVAL V 
Sbjct  298   IVGDGMDLTIITGSLNVVDGSTTFKSATIAVGGDGFIAQDLWIQNTAGPEKHQAVALRVS  357

Query  235   GDKSIINRCRLEGYQDTLYAHSKRQFYRDCTITGTIDFVFGDAAVVLQNCTLIAKKPLAA  56
              D+S+INRCR++ YQDTLYAH+ RQFYRDC ITGT+DF+FG+AAVVLQNC + A+KP++ 
Sbjct  358   ADQSVINRCRIDAYQDTLYAHTNRQFYRDCDITGTVDFIFGNAAVVLQNCKIAARKPMSK  417

Query  55    QKNMVTAQGRSDPNQNTG  2
             Q NMVTAQGR+DPNQNTG
Sbjct  418   QSNMVTAQGRTDPNQNTG  435



>ref|XP_006360082.1| PREDICTED: pectinesterase 3-like [Solanum tuberosum]
Length=540

 Score =   324 bits (831),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 175/373 (47%), Positives = 241/373 (65%), Gaps = 10/373 (3%)
 Frame = -3

Query  1114  LCRTAIDPAACKTILKQTVKSYGGTPAGLLREFLADYLPSMEAAKMEFGMVRGEFTHPRE  935
             LC+TA D   C T + + V S       +L++FL  Y+  M  A      ++       +
Sbjct  53    LCKTAQDSQLCLTCVSEIVTS-DSDGLSILKKFLVKYVHQMNNAIPVVRKIKNHINDIHQ  111

Query  934   VQAVADCVELMGLSINDVRDAIKDL-QGSKTRNSDAQTSLSAVLTNHLTCMEGLNPPEKS  758
              +A+ DC+EL+ LS++ V D+I  + + S + +++AQ+ LS VL NH+TC++ L+    +
Sbjct  112   QEALTDCLELLDLSVDLVSDSIVAIDKRSHSGHANAQSWLSGVLANHVTCLDSLSNKNGT  171

Query  757   PVKGILDALISRSRVALAVLAEIIGQTDEEQNFRVPFNGKFPSWVKSSDRKLVRRKHGNL  578
                 +LD LI+R++VALA+LA +   T  E  FR    GK PSWV   DRKL+     ++
Sbjct  172   ----VLDELITRAKVALAMLASV--TTQNEDVFRTVL-GKMPSWVSLRDRKLMESSGKDI  224

Query  577   KADIIVSQDGKGNFTTLKKAMESVSAVSKARVFIYVKKGTYKENVEMNVKS-PVMIYGDG  401
              A+ +V+QDG G++ TL +A+ +    +K R  IYVK G YKENVE+  K   +MI GDG
Sbjct  225   IANAVVAQDGTGDYQTLAEAVAAAPDKNKTRYVIYVKMGIYKENVEVTKKKMNLMIVGDG  284

Query  400   MTQTVFSGDHSFGDNYTTFKSYTLASKGPAAILQDLCVRNTAGAAKHQAVALLVGGDKSI  221
             M  T+ +G  +  D  TTF+S TLA+ G   ILQDLC++NTAG  K QAVAL VG D S+
Sbjct  285   MNATIITGSLNVVDGSTTFRSATLAAVGQGFILQDLCIQNTAGPEKGQAVALRVGADMSV  344

Query  220   INRCRLEGYQDTLYAHSKRQFYRDCTITGTIDFVFGDAAVVLQNCTLIAKKPLAAQKNMV  41
             INRCR++ YQDTLYAHS RQFYRD  +TGT+DF+FG+AAVV Q C L+A+KP   QKNMV
Sbjct  345   INRCRIDAYQDTLYAHSLRQFYRDSYVTGTVDFIFGNAAVVFQKCQLVARKPNKRQKNMV  404

Query  40    TAQGRSDPNQNTG  2
             TAQGR+DPNQ TG
Sbjct  405   TAQGRTDPNQATG  417



>gb|KDO75533.1| hypothetical protein CISIN_1g008722mg [Citrus sinensis]
Length=556

 Score =   324 bits (831),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 175/378 (46%), Positives = 240/378 (63%), Gaps = 7/378 (2%)
 Frame = -3

Query  1114  LCRTAIDPAACKTILKQTVKSYGGT---PAGLLREFLADYLPSMEAAKMEFGMVRGEFTH  944
              C  A D ++C  ++ +T      T      LL  FL+    +++        V+     
Sbjct  58    FCAKAQDQSSCIAMVSETTSINATTKMNEVDLLLIFLSKSTSNIQETIEVANHVKHRINS  117

Query  943   PREVQAVADCVELMGLSINDVRDAIKDLQGSKTR-NSDAQTSLSAVLTNHLTCMEGLNPP  767
             PR   A+ DCVEL+ LS++ + D++  L+  +T  N DA   LS VLTNH+TC++GL+  
Sbjct  118   PRGQAALTDCVELLELSVDRITDSMAALKKRRTSSNEDAHAWLSGVLTNHVTCLDGLDGS  177

Query  766   EKSPVKGILDALISRSRVALAVLAEIIG-QTDEEQNFRVPFNGKFPSWVKSSDRKLVRRK  590
                 ++  L  L++R+  +LA+L  I    T+  Q + +    +FPSWV S DR L+R  
Sbjct  178   ATKLMEPRLVELMARAANSLAILVAISPYNTNVIQQYYLRKEIQFPSWVTSRDRLLLRPS  237

Query  589   HGNL-KADIIVSQDGKGNFTTLKKAMESVSAVSKARVFIYVKKGTYKENVEMNVKSP-VM  416
                  KA+++V++DG GN+ T+K+A+ S    SK R  IYVKKGTYKENVE+  K   +M
Sbjct  238   QAEAAKANVVVAKDGSGNYKTVKEAVASAPDNSKTRYVIYVKKGTYKENVEVGKKKKNLM  297

Query  415   IYGDGMTQTVFSGDHSFGDNYTTFKSYTLASKGPAAILQDLCVRNTAGAAKHQAVALLVG  236
             I GDGM  T+ +G  +  D  TTFKS T+A  G   I QDL ++NTAG  KHQAVAL V 
Sbjct  298   IVGDGMDLTIITGSLNVVDGSTTFKSATIAVGGDGFIAQDLWIQNTAGPEKHQAVALRVS  357

Query  235   GDKSIINRCRLEGYQDTLYAHSKRQFYRDCTITGTIDFVFGDAAVVLQNCTLIAKKPLAA  56
              D+S+INRCR++ YQDTLYAH+ RQFYRDC ITGT+DF+FG+AAVVLQNC + A+KP++ 
Sbjct  358   ADQSVINRCRIDAYQDTLYAHTNRQFYRDCYITGTVDFIFGNAAVVLQNCKIAARKPMSK  417

Query  55    QKNMVTAQGRSDPNQNTG  2
             Q NMVTAQGR+DPNQNTG
Sbjct  418   QSNMVTAQGRTDPNQNTG  435



>ref|XP_008371117.1| PREDICTED: pectinesterase [Malus domestica]
Length=558

 Score =   324 bits (831),  Expect = 9e-101, Method: Compositional matrix adjust.
 Identities = 174/384 (45%), Positives = 245/384 (64%), Gaps = 18/384 (5%)
 Frame = -3

Query  1114  LCRTAIDPAACKTILKQTVKSYGGTP----AGLLREFLADYLPSMEAAKMEFGMVRGEFT  947
             +C  A+D  +C +I+ +T  S+G T     A LL+  L + +P ++       +      
Sbjct  59    VCDHALDQKSCLSIVSET--SHGTTKPMSGADLLQTILQNSMPQLQKTLDIAKVAHSRIN  116

Query  946   HPREVQAVADCVELMGLSINDVRDAIKDLQGSKTRN----SDAQTSLSAVLTNHLTCMEG  779
              P++  A+ DCVELM ++ + V D++  LQ     N     D    LS+VLTNH+TC++G
Sbjct  117   SPKDRAAIVDCVELMDVTKDRVMDSMVALQKFGAHNYYSLEDVHGWLSSVLTNHVTCLDG  176

Query  778   LNPPEKSPVKGILDALISRSRVALAVLAEIIGQTDEEQNFRVPFNGKFPSWVKSSDRKLV  599
             L  P ++ ++  L+ L+SRS  +LA++  I  ++ +    +   +G FP+WV S DR+L+
Sbjct  177   LEGPARTMMEPWLNDLVSRSXASLAIVVAISDRS-KSNPIKERLDGIFPTWVTSKDRRLL  235

Query  598   RRKHGNL----KADIIVSQDGKGNFTTLKKAMESVSAVSKARVFIYVKKGTYKENVEMNV  431
                  NL     A+ +V++DG GN+ T+K+A+ +    SK R  I+VKKGTYKENVE+  
Sbjct  236   L--DSNLAKESNANAVVAKDGSGNYKTVKEAVAAAPDNSKTRYXIHVKKGTYKENVEVGK  293

Query  430   KSP-VMIYGDGMTQTVFSGDHSFGDNYTTFKSYTLASKGPAAILQDLCVRNTAGAAKHQA  254
             K   +M  GDGM  T+ +G  +  D  TTF S TLA+ G   I QD+  +NTAGAAKHQA
Sbjct  294   KKKNLMXTGDGMHNTIITGSLNVVDGATTFNSATLAAVGDGFIAQDIWFQNTAGAAKHQA  353

Query  253   VALLVGGDKSIINRCRLEGYQDTLYAHSKRQFYRDCTITGTIDFVFGDAAVVLQNCTLIA  74
             VAL VG D+S+INRCR++ YQDTLYAHS RQFYRD  ITGT+DF+FG+AAVV QNC ++A
Sbjct  354   VALRVGADRSVINRCRIDAYQDTLYAHSNRQFYRDSXITGTVDFIFGNAAVVFQNCKIVA  413

Query  73    KKPLAAQKNMVTAQGRSDPNQNTG  2
             +KP+  Q NMVTAQGR DPNQNTG
Sbjct  414   RKPMTGQNNMVTAQGRIDPNQNTG  437



>ref|XP_006449081.1| hypothetical protein CICLE_v10014787mg [Citrus clementina]
 gb|ESR62321.1| hypothetical protein CICLE_v10014787mg [Citrus clementina]
Length=556

 Score =   323 bits (829),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 175/378 (46%), Positives = 239/378 (63%), Gaps = 7/378 (2%)
 Frame = -3

Query  1114  LCRTAIDPAACKTILKQTVKSYGGTPAG---LLREFLADYLPSMEAAKMEFGMVRGEFTH  944
             +C  A D ++C  ++ +T      T      LL  FL      ++        V+     
Sbjct  58    ICANARDQSSCMAMVSETTSINATTKMNEVDLLLIFLNKSTSYIQETIEVANHVKHRINS  117

Query  943   PREVQAVADCVELMGLSINDVRDAIKDLQGSKTR-NSDAQTSLSAVLTNHLTCMEGLNPP  767
             PR   A+ DCVEL+ LS++ + D++  L+  +T  N DA   LS VLTNH+TC++GL+  
Sbjct  118   PRGQAALTDCVELLELSVDRITDSMAALKKRRTSSNEDAHAWLSGVLTNHVTCLDGLDGS  177

Query  766   EKSPVKGILDALISRSRVALAVLAEIIG-QTDEEQNFRVPFNGKFPSWVKSSDRKLVRRK  590
                 ++  L  L++R+  +LA+L  I    T+  Q + +    +FPSWV S DR L+R  
Sbjct  178   ATKLMEPRLVELMARAANSLAILVAISPYNTNVIQQYYLRKEIQFPSWVTSRDRLLLRPS  237

Query  589   HGNL-KADIIVSQDGKGNFTTLKKAMESVSAVSKARVFIYVKKGTYKENVEMNVKSP-VM  416
                  KA+++V++DG GN+ T+K+A+ S    SK R  IYVKKGTYKENVE+  K   +M
Sbjct  238   QAEAAKANVVVAKDGSGNYKTVKEAVASAPDNSKTRYVIYVKKGTYKENVEVGKKKKNLM  297

Query  415   IYGDGMTQTVFSGDHSFGDNYTTFKSYTLASKGPAAILQDLCVRNTAGAAKHQAVALLVG  236
             I GDGM  T+ +G  +  D  TTFKS T+A  G   I QDL ++NTAG  KHQAVAL V 
Sbjct  298   IVGDGMDLTIITGSLNVVDGSTTFKSATIAVGGDGFIAQDLWIQNTAGPEKHQAVALRVS  357

Query  235   GDKSIINRCRLEGYQDTLYAHSKRQFYRDCTITGTIDFVFGDAAVVLQNCTLIAKKPLAA  56
              D+S+INRCR++ YQDTLYAH+ RQFYRDC ITGT+DF+FG+AAVVLQNC + A+KP++ 
Sbjct  358   ADQSVINRCRIDAYQDTLYAHTNRQFYRDCYITGTVDFIFGNAAVVLQNCKIAARKPMSK  417

Query  55    QKNMVTAQGRSDPNQNTG  2
             Q NMVTAQGR+DPNQNTG
Sbjct  418   QSNMVTAQGRTDPNQNTG  435



>emb|CDP05792.1| unnamed protein product [Coffea canephora]
Length=454

 Score =   320 bits (820),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 171/334 (51%), Positives = 229/334 (69%), Gaps = 4/334 (1%)
 Frame = -3

Query  994  MEAAKMEFGMVRGEFTHPREVQAVADCVELMGLSINDVRDAIKDLQGSKTRNS--DAQTS  821
            M  A +E   +  +     E  A+ DC++L+ LS++ V D++  L G  TR S  + QT 
Sbjct  1    MNHAILETQKIMNQINDQNEQGALEDCLDLLDLSVDRVTDSMMALGGGTTRISYLNVQTW  60

Query  820  LSAVLTNHLTCMEGLNPPEKSPVKGILDALISRSRVALAVLAEIIGQTDEEQNFRVPFNG  641
            LS  LTNH+TC +GLN   +  +  ++  LISR+R +LA+LA +    +EE+  + P  G
Sbjct  61   LSGALTNHVTCFDGLNISGRKLMGEVVQDLISRARASLAMLAAVHTAPNEEEMMQ-PLKG  119

Query  640  KFPSWVKSSDRKLVRRKHGNLKADIIVSQDGKGNFTTLKKAMESVSAVSKARVFIYVKKG  461
            + PSW+   DRKL+ +   ++KAD +V++DG G++ T+ +A+ +    SK R  IYVKKG
Sbjct  120  EAPSWLTLRDRKLLEKSAEDIKADAVVARDGTGDYKTIAEAVAAAPDKSKKRYVIYVKKG  179

Query  460  TYKENVEMNVKSP-VMIYGDGMTQTVFSGDHSFGDNYTTFKSYTLASKGPAAILQDLCVR  284
            TY ENVE+  K   +MI GDGM  TV SG  +  D  TTFKS TLA+ G   ILQD+C++
Sbjct  180  TYVENVEVTKKKKNLMIVGDGMDLTVVSGSLNVVDGSTTFKSATLAAVGDGLILQDICIQ  239

Query  283  NTAGAAKHQAVALLVGGDKSIINRCRLEGYQDTLYAHSKRQFYRDCTITGTIDFVFGDAA  104
            NTAG  KHQAVAL VG D+S+INRCR++ YQDTLY+HS RQFYRDC +TGTIDF+FG+AA
Sbjct  240  NTAGPEKHQAVALRVGADQSVINRCRIDAYQDTLYSHSLRQFYRDCYVTGTIDFIFGNAA  299

Query  103  VVLQNCTLIAKKPLAAQKNMVTAQGRSDPNQNTG  2
            VVLQNCTL+ + P+  QKNMVTAQGR DPNQNTG
Sbjct  300  VVLQNCTLVPRLPMKDQKNMVTAQGRIDPNQNTG  333



>dbj|BAC67662.1| pectin methylesterase [Pisum sativum]
Length=553

 Score =   323 bits (828),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 171/378 (45%), Positives = 236/378 (62%), Gaps = 7/378 (2%)
 Frame = -3

Query  1114  LCRTAIDPAACKTILKQ-----TVKSYGGTPAGLLREFLADYLPSMEAAKMEFGMVRGEF  950
             LC  A+D  +C T + +     T+ +        L   L      +  A  +  +++   
Sbjct  54    LCEHALDTESCLTHVSEVAQGPTLANTKDHKLSTLISLLTKSTTHIREAMNKASVIKSRV  113

Query  949   THPREVQAVADCVELMGLSINDVRDAIKDL-QGSKTRNSDAQTSLSAVLTNHLTCMEGLN  773
                +E  A+ DC +LM LSI  V D++  L Q +     DA T LS+VLTNH TC++GL 
Sbjct  114   NSGKEEIALNDCEQLMKLSIERVWDSVLTLTQDNMDSQQDAHTWLSSVLTNHATCLDGLE  173

Query  772   PPEKSPVKGILDALISRSRVALAVLAEIIGQTDEEQNFRVPFNGKFPSWVKSSDRKLVRR  593
                +  ++  L  LISR+R +LAVL  ++ +   +       NG+FPSWV S DR+L+  
Sbjct  174   GTSRMVMESDLQDLISRARSSLAVLVAVLPEKSNDGFIDESLNGEFPSWVTSKDRRLLES  233

Query  592   KHGNLKADIIVSQDGKGNFTTLKKAMESVSAVSKARVFIYVKKGTYKENVEMNV-KSPVM  416
               G++ A+++V++DG G F T+ +A+ SV    K R  IYVKKGTYKENVE++  K+ VM
Sbjct  234   SVGDITANVVVAKDGSGKFKTVAEAVASVPNKGKTRYVIYVKKGTYKENVEISSQKTNVM  293

Query  415   IYGDGMTQTVFSGDHSFGDNYTTFKSYTLASKGPAAILQDLCVRNTAGAAKHQAVALLVG  236
             + GDGM  T+ +G  +  D   TF+S T+A+ G   I QD+  +NTAG  KHQAVAL VG
Sbjct  294   LVGDGMDATIITGSLNVVDGTGTFQSATVAAVGDGFIAQDIGFKNTAGPEKHQAVALRVG  353

Query  235   GDKSIINRCRLEGYQDTLYAHSKRQFYRDCTITGTIDFVFGDAAVVLQNCTLIAKKPLAA  56
              D+S+INRCR++ +QDTLYAHS RQFYRDC ITGTIDF+FG+AA V Q   L+A+KP++ 
Sbjct  354   SDQSVINRCRIDAFQDTLYAHSNRQFYRDCFITGTIDFIFGNAAAVFQKSKLVARKPMSN  413

Query  55    QKNMVTAQGRSDPNQNTG  2
             QKNMVTAQGR DPNQNT 
Sbjct  414   QKNMVTAQGRLDPNQNTA  431



>ref|XP_010101471.1| Pectinesterase/pectinesterase inhibitor [Morus notabilis]
 gb|EXB88454.1| Pectinesterase/pectinesterase inhibitor [Morus notabilis]
Length=552

 Score =   323 bits (827),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 170/381 (45%), Positives = 238/381 (62%), Gaps = 15/381 (4%)
 Frame = -3

Query  1114  LCRTAIDPAACKTILKQTVKSYGGTP--AGLLREFLADYLPSMEAAKMEFGMVRGEFTHP  941
             +C  ++D  +C  ++ +  + Y        LL+ FL    P ++ A      VR    +P
Sbjct  56    ICDQSVDKESCLAMVSEAARQYSTVADHHDLLKAFLEKTTPRIQQALKMANDVRLRINNP  115

Query  940   REVQAVADCVELMGLSINDVRDAIKDL---QGSKTRNSDAQTSLSAVLTNHLTCMEGLNP  770
             R+   + DC ELM +S + V D+I  L   + +   + D    LS+VLTNH+TC++ L  
Sbjct  116   RDRATLLDCAELMDISKDRVVDSISTLFLQKQTSHSHEDVHAWLSSVLTNHVTCLDALE-  174

Query  769   PEKSPVKGILDA----LISRSRVALAVLAEIIGQTDEEQNFRVPFNGKFPSWVKSSDRKL  602
              + S  K ++D+    LI R+R +LA+L  +     E            P+WV + DR+L
Sbjct  175   -DGSYAKNLMDSHLNELILRARTSLAILVSVFPSNSEAIE---TLTDDLPTWVTAGDRRL  230

Query  601   VRRKHGNLKADIIVSQDGKGNFTTLKKAMESVSAVSKARVFIYVKKGTYKENVEMNVKSP  422
             ++     +KADI+V++DG G + T+K+A+ +V   SK R  IYVKKGTYKENVE+  K  
Sbjct  231   LQASVKAIKADIVVAEDGSGKYKTVKEAVAAVPDNSKTRFTIYVKKGTYKENVEIGKKKK  290

Query  421   -VMIYGDGMTQTVFSGDHSFGDNYTTFKSYTLASKGPAAILQDLCVRNTAGAAKHQAVAL  245
              VM+ GDGM  T+ +G  +  D  TTF S T+A+ G   I QD+  +NTAG  KHQAVAL
Sbjct  291   NVMLVGDGMDSTIITGSLNVIDGSTTFNSATVAAVGDGFIAQDIWFQNTAGPQKHQAVAL  350

Query  244   LVGGDKSIINRCRLEGYQDTLYAHSKRQFYRDCTITGTIDFVFGDAAVVLQNCTLIAKKP  65
              VG D+S+INRCR++ YQDTLYAHS RQFYRD T+TGT+DF+FG+AAVV QNC L+A+K 
Sbjct  351   RVGADQSVINRCRIDAYQDTLYAHSNRQFYRDSTVTGTVDFIFGNAAVVFQNCKLVARKG  410

Query  64    LAAQKNMVTAQGRSDPNQNTG  2
             ++ QKNMVTAQGR+DPNQNTG
Sbjct  411   MSGQKNMVTAQGRTDPNQNTG  431



>emb|CDO99717.1| unnamed protein product [Coffea canephora]
Length=533

 Score =   322 bits (825),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 173/382 (45%), Positives = 245/382 (64%), Gaps = 20/382 (5%)
 Frame = -3

Query  1114  LCRTAIDPAACKTILKQTVKSYGGTPAGLLREFLADYLPSMEAAKMEFGMVRGEFTHP--  941
             LC  A D  +C  ++ +       T AGLL+    + L  + A          E T+   
Sbjct  57    LCSKAHDQPSCMALVSEL------TSAGLLQSSDVELLQMLLAKSSSRIQETIELTNNIN  110

Query  940   REVQ------AVADCVELMGLSINDVRDAIKDLQGSKTRNS--DAQTSLSAVLTNHLTCM  785
             R +       A+ADC+ELM +S++ V D++  L GS+T NS  D  + LS+VLTNH+TC+
Sbjct  111   RRINDQKGQAALADCLELMDISMDRVMDSMVSL-GSQTANSHSDVHSWLSSVLTNHVTCL  169

Query  784   EGLNPPEKSPVKGILDALISRSRVALAVLAEIIGQTDEEQNFRVPFNGKFPSWVKSSDRK  605
             +GLN   +  ++ ++  LISR+R +LA+L  I     EE+  + P NG FPSWV   DR+
Sbjct  170   DGLNGLARPAMEPLMKELISRARTSLAMLVAI--APSEEEMIQEPLNGDFPSWVTHKDRR  227

Query  604   LVRRKHGNLKADIIVSQDGKGNFTTLKKAMESVSAVSKARVFIYVKKGTYKENVEM-NVK  428
             L++    N+ A+++V+QDG GN+ T+++A+ +     + R  IYVKKGTYKE V++   K
Sbjct  228   LLQSSAKNINANVVVAQDGSGNYKTVQEAVTAAPNNPQTRYVIYVKKGTYKEKVDIGKSK  287

Query  427   SPVMIYGDGMTQTVFSGDHSFGDNYTTFKSYTLASKGPAAILQDLCVRNTAGAAKHQAVA  248
               +M+ GDGM  T+ +G  +  D  TTF+S T+A+     I QD+  +NTAG  K QAVA
Sbjct  288   KNLMLVGDGMDLTIITGSLNVVDGTTTFQSATVAAVADGFIGQDIWFQNTAGPQKQQAVA  347

Query  247   LLVGGDKSIINRCRLEGYQDTLYAHSKRQFYRDCTITGTIDFVFGDAAVVLQNCTLIAKK  68
             L VG D+S+INRC+++ +QDTLYAHS RQFYRDC ITGT+D++FGDAAVV QN  L+A+K
Sbjct  348   LRVGADQSVINRCKIDAFQDTLYAHSLRQFYRDCYITGTVDYIFGDAAVVFQNSQLVARK  407

Query  67    PLAAQKNMVTAQGRSDPNQNTG  2
             PL+ Q+NMVTAQGR DPN NTG
Sbjct  408   PLSNQQNMVTAQGRVDPNSNTG  429



>gb|AAC14742.1| pectin methylesterase [Pisum sativum]
 gb|AAC32273.1| pectin methylesterase [Pisum sativum]
Length=554

 Score =   322 bits (826),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 170/382 (45%), Positives = 239/382 (63%), Gaps = 15/382 (4%)
 Frame = -3

Query  1114  LCRTAIDPAACKTILKQTVKSYG---------GTPAGLLREFLADYLPSMEAAKMEFGMV  962
             LC  A+D  +C T + + V+             T   LL +  +    +ME A +    +
Sbjct  54    LCEHAVDTKSCLTHVSEVVQGQALANTKDHKLSTLISLLTKSTSHIQKAMETANV----I  109

Query  961   RGEFTHPREVQAVADCVELMGLSINDVRDAIKDL-QGSKTRNSDAQTSLSAVLTNHLTCM  785
             +     P++  A+ DC +LM LS++ V D++  L + +     DA T LS+VLTNH TC+
Sbjct  110   KRRVNSPKKETALNDCEQLMDLSMDRVWDSVLTLTKNNIDSQQDAHTWLSSVLTNHATCL  169

Query  784   EGLNPPEKSPVKGILDALISRSRVALAVLAEIIGQTDEEQNFRVPFNGKFPSWVKSSDRK  605
              GL    +  ++  L  LISR+R +LAVL  ++     +       NG+FPSWV S DR+
Sbjct  170   NGLEGTSRVVMESDLQDLISRARSSLAVLVSVLPAKSNDGFIDESLNGEFPSWVTSKDRR  229

Query  604   LVRRKHGNLKADIIVSQDGKGNFTTLKKAMESVSAVSKARVFIYVKKGTYKENVEM-NVK  428
             L+    G++KA+++V++DG G F T+ +A+ S     KAR  IYVK+GTYKE VE+   K
Sbjct  230   LLESTVGDIKANVVVAKDGSGKFKTVAEAVASAPDNGKARYVIYVKRGTYKEKVEIGKKK  289

Query  427   SPVMIYGDGMTQTVFSGDHSFGDNYTTFKSYTLASKGPAAILQDLCVRNTAGAAKHQAVA  248
             + VM+ GDGM  T+ +G+ +F D  TTF S T+A+ G   I QD+  +NTAG  KHQAVA
Sbjct  290   TNVMLVGDGMDATIITGNLNFIDGTTTFNSATVAAVGDGFIAQDIGFQNTAGPEKHQAVA  349

Query  247   LLVGGDKSIINRCRLEGYQDTLYAHSKRQFYRDCTITGTIDFVFGDAAVVLQNCTLIAKK  68
             L VG D+S+INRC+++ +QDTLYAHS RQFYRD  ITGT+DF+FG+A VV Q   L+A+K
Sbjct  350   LRVGADQSVINRCKIDAFQDTLYAHSNRQFYRDSFITGTVDFIFGNAGVVFQKSKLVARK  409

Query  67    PLAAQKNMVTAQGRSDPNQNTG  2
             P++ QKNMVTAQGR DPNQNT 
Sbjct  410   PMSNQKNMVTAQGREDPNQNTA  431



>ref|XP_003622696.1| Pectinesterase [Medicago truncatula]
 gb|AES78914.1| pectinesterase/pectinesterase inhibitor [Medicago truncatula]
Length=553

 Score =   322 bits (824),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 169/382 (44%), Positives = 240/382 (63%), Gaps = 15/382 (4%)
 Frame = -3

Query  1114  LCRTAIDPAACKTILKQTVKSYG---------GTPAGLLREFLADYLPSMEAAKMEFGMV  962
             +C  A+D  +C T + + V+             T   LL +       +M+ A +    +
Sbjct  54    VCEHAVDTNSCLTHVAEVVQGSTLDNTKDHKLSTLISLLTKSTTHIRKAMDTANV----I  109

Query  961   RGEFTHPREVQAVADCVELMGLSINDVRDAIKDL-QGSKTRNSDAQTSLSAVLTNHLTCM  785
             +     PRE  A+  C +LM LS+  V D++  L + +     DA T LS+VLTNH TC+
Sbjct  110   KRRINSPREENALNVCEKLMNLSMERVWDSVLTLTKDNMDSQQDAHTWLSSVLTNHATCL  169

Query  784   EGLNPPEKSPVKGILDALISRSRVALAVLAEIIGQTDEEQNFRVPFNGKFPSWVKSSDRK  605
             +GL    ++ ++  +  LI+R+R +LAVL  ++   D ++      NG FPSWV S DR+
Sbjct  170   DGLEGTSRAVMENDIQDLIARARSSLAVLVAVLPPKDHDEFIDESLNGDFPSWVTSKDRR  229

Query  604   LVRRKHGNLKADIIVSQDGKGNFTTLKKAMESVSAVSKARVFIYVKKGTYKENVEM-NVK  428
             L+    G++KA+++V++DG G F T+ +A+ S      AR  IYVKKG YKENVE+ + K
Sbjct  230   LLESSVGDVKANVVVAKDGSGKFKTVAEAVASAPNKGTARYVIYVKKGIYKENVEIASSK  289

Query  427   SPVMIYGDGMTQTVFSGDHSFGDNYTTFKSYTLASKGPAAILQDLCVRNTAGAAKHQAVA  248
             + VM+ GDGM  T+ +G  ++ D   TF++ T+A+ G   I QD+  +NTAG  KHQAVA
Sbjct  290   TNVMLLGDGMDATIITGSLNYVDGTGTFQTATVAAVGDWFIAQDIGFQNTAGPQKHQAVA  349

Query  247   LLVGGDKSIINRCRLEGYQDTLYAHSKRQFYRDCTITGTIDFVFGDAAVVLQNCTLIAKK  68
             L VG D+S+INRC+++ +QDTLYAH+ RQFYRD  ITGTIDF+FGDAAVVLQ C L+A+K
Sbjct  350   LRVGSDRSVINRCKIDAFQDTLYAHTNRQFYRDSFITGTIDFIFGDAAVVLQKCKLVARK  409

Query  67    PLAAQKNMVTAQGRSDPNQNTG  2
             P+A Q NMVTAQGR DPNQNT 
Sbjct  410   PMANQNNMVTAQGRIDPNQNTA  431



>ref|XP_006646399.1| PREDICTED: LOW QUALITY PROTEIN: pectinesterase 2.2-like [Oryza 
brachyantha]
Length=523

 Score =   320 bits (819),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 176/380 (46%), Positives = 230/380 (61%), Gaps = 34/380 (9%)
 Frame = -3

Query  1114  LCRTAIDPAACKTILKQTVKSYG------GTPAGLLREFLADYLPSMEAAKMEFGMVRGE  953
             LC  + DPA+C+TI+   V +          PA +LR  +A  L   +AA      +R  
Sbjct  46    LCANSPDPASCQTIVADAVLASSPHAHRPSRPAQILRAIIATSLDRHDAAAEAVAGMRRR  105

Query  952   FTHPREVQAVADCVELMGLSINDVRDAIKDLQGSKTRNSDAQTSLSAVLTNHLTCMEGLN  773
              + PR+  A+ DCV+LM                      DA+T LSAVLT+H+TC++GL+
Sbjct  106   ASDPRQRAALEDCVQLM---------------------DDARTWLSAVLTDHVTCLDGLD  144

Query  772   P--PEKSPVKGILDALISRSRVALAVLAEIIGQTDEEQNFRVPFNGKFPSWVKSSDRKLV  599
                P +  V   L+ L S +  +LAVL  + G  D           +FPSWV + DR L+
Sbjct  145   ADGPLRDSVGAHLEPLKSLASASLAVLNAVGGARD----VLAEVVDRFPSWVPARDRALL  200

Query  598   RRKHGNLKADIIVSQDGKGNFTTLKKAMESVSAVSKARVFIYVKKGTYKENVEMNVKS-P  422
                 G ++AD++V+QDG G + T+K+A+++     K+R  IYVKKG YKEN+E+  K   
Sbjct  201   EAGAGAVQADVVVAQDGSGKYKTIKEAVDAAPDGGKSRYVIYVKKGVYKENLEVGKKKRE  260

Query  421   VMIYGDGMTQTVFSGDHSFGDNYTTFKSYTLASKGPAAILQDLCVRNTAGAAKHQAVALL  242
             VMI GDGM QTV +G  +  D  TTF S TLA  G   ILQDL V NTAG  KHQA AL 
Sbjct  261   VMIVGDGMDQTVITGSRNVVDGATTFNSATLALSGDGIILQDLRVENTAGPEKHQAGALR  320

Query  241   VGGDKSIINRCRLEGYQDTLYAHSKRQFYRDCTITGTIDFVFGDAAVVLQNCTLIAKKPL  62
                D+++INRC L+GYQDTLYAH  RQFYRDC ++GT+DFVFG+AA VLQ C L A++P 
Sbjct  321   ASADRAVINRCSLDGYQDTLYAHQLRQFYRDCAVSGTVDFVFGNAAAVLQGCVLTARRPA  380

Query  61    AAQKNMVTAQGRSDPNQNTG  2
             AAQKN VTAQGR+DPNQNTG
Sbjct  381   AAQKNAVTAQGRTDPNQNTG  400



>emb|CDO99718.1| unnamed protein product [Coffea canephora]
Length=548

 Score =   318 bits (814),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 169/375 (45%), Positives = 243/375 (65%), Gaps = 8/375 (2%)
 Frame = -3

Query  1114  LCRTAIDPAACKTILKQTVKSYGGTPAGLLREFLADYLPSM-EAAKMEFGMVRGEFTHPR  938
             LC  A D ++C   + +   S   +   LL+  LA     + E  K+   + R      R
Sbjct  57    LCSHAHDQSSCLQAVSEVASSGQSSDVDLLQMILAKSSAQIQETIKLTENINR-RINDQR  115

Query  937   EVQAVADCVELMGLSINDVRDAIKDLQGSKT--RNSDAQTSLSAVLTNHLTCMEGLNPPE  764
             E  A+ADC+ELM +S++ + D++  L GS+T    SDA + L +VLTNH+TC++GLN P 
Sbjct  116   EQAALADCLELMDMSVDRLMDSMVAL-GSQTAQSQSDAHSWLGSVLTNHVTCLDGLNGPA  174

Query  763   KSPVKGILDALISRSRVALAVLAEIIGQTDEEQNFRVPFNGKFPSWVKSSDRKLVRRKHG  584
             +S V+ ++  LI ++R +LA++  I     +E+    P NG  PSWV S DR+L+     
Sbjct  175   RSVVEPMMKDLILKARTSLAMVVAI--APPKEEMIEQPLNGDLPSWVTSKDRRLLEALPK  232

Query  583   NLKADIIVSQDGKGNFTTLKKAMESVSAVSKARVFIYVKKGTYKENVEMNV-KSPVMIYG  407
             ++KA+ +V++DG GN+ T+++A+ +    +++R  IYVK GTYKE V++   K  +M+ G
Sbjct  233   DVKANSVVAKDGSGNYKTVQEAVNAAPNNAQSRYVIYVKAGTYKEKVDIGKNKKNLMLVG  292

Query  406   DGMTQTVFSGDHSFGDNYTTFKSYTLASKGPAAILQDLCVRNTAGAAKHQAVALLVGGDK  227
             DGM +T+ +G  +  D  TTF S T+A+     I QDL  +NTAG  KHQAVAL VG DK
Sbjct  293   DGMDKTIITGSLNVVDGSTTFNSATVAAVADGFIAQDLGFQNTAGPQKHQAVALRVGADK  352

Query  226   SIINRCRLEGYQDTLYAHSKRQFYRDCTITGTIDFVFGDAAVVLQNCTLIAKKPLAAQKN  47
             S+INRC+++ +QDTLY HS RQF+RDC ITGT+DF+FGDAAVV QN  L A+KP++ Q+N
Sbjct  353   SVINRCKIDAFQDTLYTHSLRQFFRDCYITGTVDFIFGDAAVVFQNSKLAARKPMSNQQN  412

Query  46    MVTAQGRSDPNQNTG  2
             MVTAQGR DPN NTG
Sbjct  413   MVTAQGRVDPNSNTG  427



>ref|XP_010057972.1| PREDICTED: pectinesterase-like [Eucalyptus grandis]
Length=549

 Score =   317 bits (813),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 171/378 (45%), Positives = 237/378 (63%), Gaps = 9/378 (2%)
 Frame = -3

Query  1114  LCRTAIDPAACKTILKQTVKSYGG----TPAGLLREFLADYLPSMEAAKMEFGMVRGEFT  947
             +C  A D A C+ ++ + V  YG     +   LL+ F+         A      VR    
Sbjct  53    VCSKAQDQAQCRALVSEIVP-YGAASFMSDDKLLQVFVKKMAIRTGNAVEAVKDVRRRVN  111

Query  946   HPREVQAVADCVELMGLSINDVRDAIKDLQGSKTRNSDAQTSLSAVLTNHLTCMEGL--N  773
             +PRE  A+ADCVELM +S++ + D+ + LQ  K+ ++D  T LS+ LTN++TC++G   +
Sbjct  112   YPREEAALADCVELMEMSVDRLEDSTRSLQEQKS-SADVHTWLSSSLTNYITCLDGFEGS  170

Query  772   PPEKSPVKGILDALISRSRVALAVLAEIIGQTDEEQNFRVPFNGKFPSWVKSSDRKLVRR  593
                KS +K IL  LISR+R +LA+            +      G FPSWV   D +L++ 
Sbjct  171   SSAKSSIKPILSDLISRARTSLAIFVSTSSPEGRRPDVLESLIGDFPSWVTRKDHRLLQS  230

Query  592   KHGNLKADIIVSQDGKGNFTTLKKAMESVSAVSKARVFIYVKKGTYKENVEM-NVKSPVM  416
                 + AD++V++DG G F T+K+A+ +  + ++ R  IYVKKGTYKENVE+   K+ +M
Sbjct  231   LVNAVNADVVVAKDGTGKFKTVKEAIAAAPSKAQTRYVIYVKKGTYKENVEVAKTKTNIM  290

Query  415   IYGDGMTQTVFSGDHSFGDNYTTFKSYTLASKGPAAILQDLCVRNTAGAAKHQAVALLVG  236
             + GDGM  TV +G  +  D  TTF S T+A  G   I QD+  +NTAG  KHQAVAL V 
Sbjct  291   LVGDGMDSTVITGSLNVIDGATTFNSATVAVNGDGFIAQDIWFQNTAGPQKHQAVALRVS  350

Query  235   GDKSIINRCRLEGYQDTLYAHSKRQFYRDCTITGTIDFVFGDAAVVLQNCTLIAKKPLAA  56
              DKS+INRCR++ YQDTLY H+ RQFYRD  ITGT+DF+FG+A VV QNC L+A+KP++ 
Sbjct  351   ADKSVINRCRIDAYQDTLYTHTSRQFYRDSYITGTVDFIFGNAGVVFQNCNLVARKPMSG  410

Query  55    QKNMVTAQGRSDPNQNTG  2
             Q NMVTAQGR+DPNQNTG
Sbjct  411   QSNMVTAQGRTDPNQNTG  428



>gb|AAB67740.1| PME1.9 [Solanum lycopersicum]
Length=430

 Score =   313 bits (802),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 159/309 (51%), Positives = 222/309 (72%), Gaps = 6/309 (2%)
 Frame = -3

Query  919  DCVELMGLSINDVRDAIKDL-QGSKTRNSDAQTSLSAVLTNHLTCMEGLNPPEKSPVKGI  743
            DC+EL+  S++   D+I  + + S++ +++AQ+ LS VLTNH+TC++ L+   K+ + G 
Sbjct  2    DCLELLDQSVDFASDSIAAIDKRSRSEHANAQSWLSGVLTNHVTCLDELDSFTKAMINGT  61

Query  742  -LDALISRSRVALAVLAEIIGQTDEEQNFRVPFNGKFPSWVKSSDRKLVRRKHGNLKADI  566
             L+ LISR++VALA+LA +   T ++++  +   GK PSWV S DRKL+     ++ A+ 
Sbjct  62   NLEELISRAKVALAMLASL---TTQDEDVLMTVLGKMPSWVSSMDRKLMESSGKDIIANA  118

Query  565  IVSQDGKGNFTTLKKAMESVSAVSKARVFIYVKKGTYKENVEMNV-KSPVMIYGDGMTQT  389
            +V+QDG G++ TL +A+ +    SK R  IYVK+GTYKENVE++  K  +MI GDGM  T
Sbjct  119  VVAQDGTGDYQTLAEAVAAAPDKSKTRYVIYVKRGTYKENVEVSSNKMNLMIVGDGMYAT  178

Query  388  VFSGDHSFGDNYTTFKSYTLASKGPAAILQDLCVRNTAGAAKHQAVALLVGGDKSIINRC  209
              +G  +  D  TTF+S TLA+ G   ILQD+C++NTAG AK QAVAL VG D S+INRC
Sbjct  179  TITGSLNVVDGSTTFRSATLAAVGQGFILQDICIQNTAGPAKDQAVALRVGADMSVINRC  238

Query  208  RLEGYQDTLYAHSKRQFYRDCTITGTIDFVFGDAAVVLQNCTLIAKKPLAAQKNMVTAQG  29
            R++ YQDTLYAHS+RQFYRD  +TGT+DF+FG+AAVV Q C L+A+KP   Q+NMVTAQG
Sbjct  239  RIDAYQDTLYAHSQRQFYRDSYVTGTVDFIFGNAAVVFQKCQLVARKPGKYQQNMVTAQG  298

Query  28   RSDPNQNTG  2
            R+DPNQ TG
Sbjct  299  RTDPNQATG  307



>ref|XP_004293266.1| PREDICTED: pectinesterase/pectinesterase inhibitor-like [Fragaria 
vesca subsp. vesca]
Length=528

 Score =   316 bits (810),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 168/352 (48%), Positives = 234/352 (66%), Gaps = 15/352 (4%)
 Frame = -3

Query  1033  GLLREFLADYLPSMEAAKMEFGMVRGEFTHPREVQAVADCVELMGLSINDVRDAIKDLQG  854
             GLL E       ++E AK  +     +   P++  A+ DCVELM ++++ + D+   L+ 
Sbjct  63    GLLEESTPHLQQALETAKDAYA----KINDPKDRAALVDCVELMEVTMDRILDSRVALKN  118

Query  853   SKTRNS--DAQTSLSAVLTNHLTCMEGLNP-PEKSPVKGILDALISRSRVALAVLAEIIG  683
              K +N+  D  T LS+VLTNH+TC++GL     ++ ++  L+ LIS+S+  LA L EI  
Sbjct  119   LKVQNTMEDVHTWLSSVLTNHVTCLDGLKGLSARTIMEPRLNGLISKSKAFLAKLVEISP  178

Query  682   QTDE---EQNFRVPFNGKFPSWVKSSDRKLVRRK-HGNLKADIIVSQDGKGNFTTLKKAM  515
               ++   +Q   +   G FP+WVK  DR+L+ R     ++A+++V+ DG G + T+K+A+
Sbjct  179   SKEKVIGDQPLEI---GDFPTWVKRRDRRLMSRDFQKGVEANVVVANDGSGKYKTVKEAV  235

Query  514   ESVSAVSKARVFIYVKKGTYKENVEM-NVKSPVMIYGDGMTQTVFSGDHSFGDNYTTFKS  338
              +    S  R  IYVKKGTYKENVE+   K  +MI GDGM +T+ +G  +  D  TTF S
Sbjct  236   AAAPDKSTTRYVIYVKKGTYKENVEVVKNKKNLMIVGDGMDKTIITGSLNVVDGSTTFNS  295

Query  337   YTLASKGPAAILQDLCVRNTAGAAKHQAVALLVGGDKSIINRCRLEGYQDTLYAHSKRQF  158
              TLA+ G   I QD+  +NTAG  KHQAVAL VG D+S+INRCR++ YQDTLYAHS RQF
Sbjct  296   ATLAAVGDGFIAQDIWFQNTAGPDKHQAVALRVGADQSVINRCRIDAYQDTLYAHSNRQF  355

Query  157   YRDCTITGTIDFVFGDAAVVLQNCTLIAKKPLAAQKNMVTAQGRSDPNQNTG  2
             YRDC ITGT+DF+FG+AAVVLQNC ++A+KP + Q NMVTAQGR+DPNQNTG
Sbjct  356   YRDCYITGTVDFIFGNAAVVLQNCKIVARKPASGQNNMVTAQGRTDPNQNTG  407



>ref|XP_009397166.1| PREDICTED: pectinesterase-like [Musa acuminata subsp. malaccensis]
Length=553

 Score =   316 bits (810),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 173/378 (46%), Positives = 241/378 (64%), Gaps = 13/378 (3%)
 Frame = -3

Query  1114  LCRTAIDPAACKTILKQ----TVKSYGGTPAGLLREFLADYLPSMEAAKMEFGMVRGEFT  947
             LC  + +P +C  I+ Q    + +++  TP  + R  L + L  ++AA      +     
Sbjct  61    LCAKSPNPTSCHAIVSQVMLTSAENHHPTPVQIFRSLLHNSLVQLDAAAASAADIHLRLL  120

Query  946   -HPREVQAVADCVELMGLSINDVRDAIKDLQGSKTRNSDAQTSLSAVLTNHLTCMEGLNP  770
               P++  A+ADC++L+ LS    RD I  +       +DA+T +SAVLTNH TC++GL+ 
Sbjct  121   KEPKQQAALADCMQLLQLS----RDRI--VSSGDAAGTDARTWMSAVLTNHATCLDGLHG  174

Query  769   PEKSPVKGILDALISRSRVALAVLAEIIGQTDEEQNFRVPFNGKFPSWVKSSDRKLVRRK  590
               KS ++  L++L + +  +LAVL  +     +  +  V     FPSW+   DRKL++  
Sbjct  175   AAKSAMQAHLESLKASASASLAVLHAVPSSEHDNDDDIVKPVATFPSWLSHRDRKLLQMT  234

Query  589   HGN-LKADIIVSQDGKGNFTTLKKAMESVSAVSKARVFIYVKKGTYKENVEMNVKSP-VM  416
               N ++A+ +V++DG G F T++ A++SV   +K R  IYVKKG YKENV +  K+  VM
Sbjct  235   SPNAVQANAVVAKDGSGTFKTVQAAVDSVPNGNKNRYVIYVKKGVYKENVSLGKKTTNVM  294

Query  415   IYGDGMTQTVFSGDHSFGDNYTTFKSYTLASKGPAAILQDLCVRNTAGAAKHQAVALLVG  236
             I GDGM  TV +G  +  D  TTF S TLA+ G   ILQDL + NTAG  KHQAVAL VG
Sbjct  295   IVGDGMDATVITGSLNVVDGSTTFDSATLAAVGDGLILQDLKIENTAGPQKHQAVALRVG  354

Query  235   GDKSIINRCRLEGYQDTLYAHSKRQFYRDCTITGTIDFVFGDAAVVLQNCTLIAKKPLAA  56
              D+S+INRCRL+GYQDTLYAH+ RQFYRD  I+GT+DFVFG+AAVV QNC L A++P+  
Sbjct  355   ADRSVINRCRLDGYQDTLYAHTLRQFYRDSFISGTVDFVFGNAAVVFQNCNLTARRPMDN  414

Query  55    QKNMVTAQGRSDPNQNTG  2
             Q+N+VTAQGR DPNQNTG
Sbjct  415   QQNLVTAQGREDPNQNTG  432



>ref|XP_004492227.1| PREDICTED: pectinesterase/pectinesterase inhibitor 18-like [Cicer 
arietinum]
Length=557

 Score =   316 bits (809),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 170/378 (45%), Positives = 230/378 (61%), Gaps = 7/378 (2%)
 Frame = -3

Query  1114  LCRTAIDPAACKTILK-----QTVKSYGGTPAGLLREFLADYLPSMEAAKMEFGMVRGEF  950
             LC+ AID  +C T +      QT+ +        L   L      ++    +  +++   
Sbjct  57    LCQLAIDTKSCLTHVSEVSQHQTLPNTKDHKFNTLISLLTKSTTHIKKTMDKANVIKRRV  116

Query  949   THPREVQAVADCVELMGLSINDVRDAIKDLQGSKT-RNSDAQTSLSAVLTNHLTCMEGLN  773
               P+E  A+ DC ELM LS++ V +++  L  +      +A T LS VLTNH+TC++GL 
Sbjct  117   NSPKEELALNDCEELMDLSMDRVWNSVLTLTNNNIDSQQNAHTWLSTVLTNHVTCLDGLE  176

Query  772   PPEKSPVKGILDALISRSRVALAVLAEIIGQTDEEQNFRVPFNGKFPSWVKSSDRKLVRR  593
                   ++  L  LISR+R +LAVL  +    D +       NG FPSWV S DRKL+  
Sbjct  177   GSSLVVMESDLHDLISRARSSLAVLVAVFPSKDSDGFIEEKLNGDFPSWVTSKDRKLLES  236

Query  592   KHGNLKADIIVSQDGKGNFTTLKKAMESVSAVSKARVFIYVKKGTYKENVEMNVKSP-VM  416
               G++KA+++V++DG G F T+ +A+ S       R  IYVKKG YKENVE+  K   VM
Sbjct  237   SIGDIKANVVVAKDGSGKFKTVVEAVASAPDNGNTRYVIYVKKGIYKENVEIGKKKKNVM  296

Query  415   IYGDGMTQTVFSGDHSFGDNYTTFKSYTLASKGPAAILQDLCVRNTAGAAKHQAVALLVG  236
             + GDGM  T  +G  +  D  TTFKS T+A+ G   I QD+  +NTAG  KHQAVAL VG
Sbjct  297   LVGDGMDVTTITGSLNVIDGSTTFKSATVAAVGDGFIAQDIGFQNTAGPEKHQAVALRVG  356

Query  235   GDKSIINRCRLEGYQDTLYAHSKRQFYRDCTITGTIDFVFGDAAVVLQNCTLIAKKPLAA  56
              D+S+INRCR++ +QDTLYAHS RQFYRD  ITGT+DF+FG+AAVV Q   L A++P++ 
Sbjct  357   ADQSVINRCRIDAFQDTLYAHSNRQFYRDSYITGTVDFIFGNAAVVFQKSKLAARRPMSN  416

Query  55    QKNMVTAQGRSDPNQNTG  2
             QKNMVTAQGR DPNQNT 
Sbjct  417   QKNMVTAQGREDPNQNTA  434



>ref|XP_010057974.1| PREDICTED: pectinesterase-like [Eucalyptus grandis]
Length=549

 Score =   315 bits (807),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 167/377 (44%), Positives = 233/377 (62%), Gaps = 7/377 (2%)
 Frame = -3

Query  1114  LCRTAIDPAACKTILKQTVKSYGGTPAG---LLREFLADYLPSMEAAKMEFGMVRGEFTH  944
             +C  A D A C+ ++ + V     +      LLR F+         A      VR     
Sbjct  53    ICSKAQDQARCRVLVSEIVPYDAASFMSNDKLLRVFVEKMAIRTGNAVEAVKDVRRLVND  112

Query  943   PREVQAVADCVELMGLSINDVRDAIKDLQGSKTRNSDAQTSLSAVLTNHLTCMEGL--NP  770
              RE  A+ADCVELM +S++ + D+ + L+  K+ ++D  T LS+ LTN++TC++G   + 
Sbjct  113   LREEAALADCVELMEMSLDRLEDSTRSLREQKS-SADVHTWLSSSLTNYVTCLDGFEGSS  171

Query  769   PEKSPVKGILDALISRSRVALAVLAEIIGQTDEEQNFRVPFNGKFPSWVKSSDRKLVRRK  590
               KS ++ IL  LISR+R +LA+          + +      G FPSWV   DR+L++  
Sbjct  172   SAKSLIEPILSDLISRARTSLAIFVSTSSPEGRKPDVLESLIGDFPSWVTGKDRRLLQSP  231

Query  589   HGNLKADIIVSQDGKGNFTTLKKAMESVSAVSKARVFIYVKKGTYKENVEM-NVKSPVMI  413
                + AD++V++DG G + T+K+A+ +  + ++ R  I+VKKGTYKENVE+   K  +M+
Sbjct  232   ANAVNADVVVAKDGSGKYKTVKQAIAAAPSKAQTRYVIHVKKGTYKENVEVAKTKKNIML  291

Query  412   YGDGMTQTVFSGDHSFGDNYTTFKSYTLASKGPAAILQDLCVRNTAGAAKHQAVALLVGG  233
              GDGM  TV +G  +  D  TTFKS T+A  G   I QD+  +NTAG  KHQAVAL V  
Sbjct  292   VGDGMNLTVITGSLNVIDGATTFKSATVAVNGDGFIAQDIWFQNTAGPQKHQAVALRVSA  351

Query  232   DKSIINRCRLEGYQDTLYAHSKRQFYRDCTITGTIDFVFGDAAVVLQNCTLIAKKPLAAQ  53
             DKS+INRCR++ YQDTLY H+ RQFYRD  ITGT+DF+FGDA VV QNC L+A+KP+  Q
Sbjct  352   DKSVINRCRIDAYQDTLYTHTNRQFYRDSYITGTVDFIFGDAGVVFQNCKLVARKPMRGQ  411

Query  52    KNMVTAQGRSDPNQNTG  2
              NMVTAQGR+DP QNTG
Sbjct  412   SNMVTAQGRTDPYQNTG  428



>gb|KHG26245.1| Pectinesterase/pectinesterase inhibitor [Gossypium arboreum]
Length=477

 Score =   312 bits (799),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 162/345 (47%), Positives = 224/345 (65%), Gaps = 5/345 (1%)
 Frame = -3

Query  1030  LLREFLADYLPSMEAAKMEFGMVRGEFTHPREVQAVADCVELMGLSINDVRDAIKDL-QG  854
             +L+ FL      M+ A       +    +P E  A+ADC+ELM  S++ + D++  + + 
Sbjct  15    VLQAFLEQSKVRMQNAMNVAKKFKHRINNPGEQAALADCMELMESSMDRIMDSMVAVDKQ  74

Query  853   SKTRNSDAQTSLSAVLTNHLTCMEGLNPPEKSPVKGILDALISRSRVALAVLAEIIGQTD  674
               T  S+A   LS+VLTNH+TC++GL    ++ ++  L+ LISR+R +LA+       + 
Sbjct  75    DATSYSNAHAWLSSVLTNHVTCLDGLEGSARTLMEPGLNDLISRARTSLAIFVSF---SP  131

Query  673   EEQNFRVPFNGKFPSWVKSSDRKLVRRKHGNLKADIIVSQDGKGNFTTLKKAMESVSAVS  494
              +     P    FPSWV S DRKL++     +KA+++V++DG G + TL +A+ +    S
Sbjct  132   RKTKLIDPLIDGFPSWVSSKDRKLLQSLPNEIKANVVVAKDGSGKYKTLGEAVAAAPDKS  191

Query  493   KARVFIYVKKGTYKENVEMNV-KSPVMIYGDGMTQTVFSGDHSFGDNYTTFKSYTLASKG  317
             K R  IYVKKGTYKENVE+   K  +MI GDGM  T+ +G  +  D  TTF+S T+A+ G
Sbjct  192   KTRYIIYVKKGTYKENVEIGKNKKNLMIVGDGMKSTIITGSLNVIDGSTTFRSATVAAVG  251

Query  316   PAAILQDLCVRNTAGAAKHQAVALLVGGDKSIINRCRLEGYQDTLYAHSKRQFYRDCTIT  137
                + QD+  +NTAG  KHQAVAL VG D+S+INRC+++GYQDTLY HS RQFYRD  IT
Sbjct  252   DGFMAQDIWFQNTAGPQKHQAVALRVGADQSVINRCQIDGYQDTLYTHSNRQFYRDSEIT  311

Query  136   GTIDFVFGDAAVVLQNCTLIAKKPLAAQKNMVTAQGRSDPNQNTG  2
             GT+DF+FGDAAVV QNC L+ +KP+  Q NMVTAQGR DPNQNTG
Sbjct  312   GTVDFIFGDAAVVFQNCKLVVRKPMDKQSNMVTAQGRIDPNQNTG  356



>ref|XP_009769268.1| PREDICTED: pectinesterase-like [Nicotiana sylvestris]
Length=548

 Score =   314 bits (804),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 175/383 (46%), Positives = 236/383 (62%), Gaps = 23/383 (6%)
 Frame = -3

Query  1114  LCRTAIDPAACKTILKQTVKSYGGTPAGLLREFLADYLPSMEAAKMEFGM---------V  962
             +C  A D  +C   + +        PAGL+     D L  M   K    +         V
Sbjct  57    VCDQAHDQPSCLATVSEVA------PAGLMDTTTVDLL-QMVLHKSSLKIHETIDLVSNV  109

Query  961   RGEFTHPREVQAVADCVELMGLSINDVRDAIKDLQG-SKTRNSDAQTSLSAVLTNHLTCM  785
              G   +  E  A+ADC+ELM LS + + D++  L   S   + D  T LS++LTNH+TCM
Sbjct  110   NGRINNDNEQAALADCLELMNLSRDRLMDSMMALGNLSAQAHFDVHTWLSSILTNHVTCM  169

Query  784   EGLNPPEKSPVKGILDALISRSRVALAVLAEIIGQTDEEQNFRVP-FNGKFPSWVKSSDR  608
             +GLN   +S +K +L  LI R++ +LA++ ++           +P      PSWV S+DR
Sbjct  170   DGLNGQAQSIMKPMLKDLIVRAKTSLALMVKMT----PSNTMDLPSVTDGLPSWVTSNDR  225

Query  607   KLVRRKHGNLKADIIVSQDGKGNFTTLKKAMESVSAVSKARVFIYVKKGTYKENVEMNVK  428
             +L++     +KA++IV++DG G + T+K+A+ S    SK R  IYVKKG YKENVE+  K
Sbjct  226   RLLQLSANAIKANVIVAKDGSGKYKTVKEAVASAPDNSKTRYVIYVKKGIYKENVEIGKK  285

Query  427   SP-VMIYGDGMTQTVFSGDHSFGDNYTTFKSYTLASKGPAAILQDLCVRNTAGAAKHQAV  251
                VM+ GDGM  T+ +G  +  D  TTFKS T+A+ G   I QDL  +NTAGAAKHQAV
Sbjct  286   KKNVMLVGDGMDATIITGSLNVVDGSTTFKSATVAAVGDGFIAQDLRFQNTAGAAKHQAV  345

Query  250   ALLVGGDKSIINRCRLEGYQDTLYAHSKRQFYRDCTITGTIDFVFGDAAVVLQNCTLIAK  71
             AL VG D+S+INRC+++ +QDTLYAHS RQFYRDC I GT+DF+FG+AAVV QN  + A+
Sbjct  346   ALRVGADQSVINRCKIDAFQDTLYAHSLRQFYRDCYIAGTVDFIFGNAAVVFQNSKIAAR  405

Query  70    KPLAAQKNMVTAQGRSDPNQNTG  2
             KP   QKNMVTAQGR DPNQNTG
Sbjct  406   KPGPGQKNMVTAQGREDPNQNTG  428



>sp|Q96576.1|PME3_SOLLC RecName: Full=Pectinesterase 3; Short=PE 3; AltName: Full=Pectin 
methylesterase 3; Flags: Precursor [Solanum lycopersicum]
 gb|AAB38793.1| pectin methylesterase [Solanum lycopersicum]
Length=544

 Score =   313 bits (802),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 174/378 (46%), Positives = 244/378 (65%), Gaps = 16/378 (4%)
 Frame = -3

Query  1114  LCRTAIDPAACKTILKQ--TVKSYGGTPAGLLREFLADYLPSMEAAKMEFGMVRGEFTHP  941
             LC+TA D   C + + +  T +S G T   +L++FL  Y+  M  A      ++ +    
Sbjct  53    LCKTAQDSQLCLSYVSEIVTTESDGVT---VLKKFLVKYVHQMNNAIPVVRKIKNQINDI  109

Query  940   REVQAVADCVELMGLSINDVRDAIKDL-QGSKTRNSDAQTSLSAVLTNHLTCMEGLNPPE  764
             R+  A+ DC+EL+  S++ V D+I  + + S++ +++AQ+ LS VLTNH+TC++ L    
Sbjct  110   RQQGALTDCLELLDQSVDLVSDSIAAIDKRSRSEHANAQSWLSGVLTNHVTCLDELTSFS  169

Query  763   KSPVKG-ILDALISRSRVALAVLAEIIGQTDE--EQNFRVPFNGKFPSWVKSSDRKLVRR  593
              S   G +LD LI+R++VALA+LA +    DE   Q       GK P WV S DRKL+  
Sbjct  170   LSTKNGTVLDELITRAKVALAMLASVTTPNDEVLRQGL-----GKMPYWVSSRDRKLMES  224

Query  592   KHGNLKADIIVSQDGKGNFTTLKKAMESVSAVSKARVFIYVKKGTYKENVEMNVKS-PVM  416
                ++ A+ +V+QDG G++ TL +A+ +    +K R  IYVK G YKENV +  K   +M
Sbjct  225   SGKDIIANRVVAQDGTGDYQTLAEAVAAAPDKNKTRYVIYVKMGIYKENVVVTKKKMNLM  284

Query  415   IYGDGMTQTVFSGDHSFGDNYTTFKSYTLASKGPAAILQDLCVRNTAGAAKHQAVALLVG  236
             I GDGM  T+ +G  +  D  +TF S TLA+ G   ILQD+C++NTAG  K QAVAL VG
Sbjct  285   IVGDGMNATIITGSLNVVDG-STFPSNTLAAVGQGFILQDICIQNTAGPEKDQAVALRVG  343

Query  235   GDKSIINRCRLEGYQDTLYAHSKRQFYRDCTITGTIDFVFGDAAVVLQNCTLIAKKPLAA  56
              D S+INRCR++ YQDTLYAHS+RQFYRD  +TGT+DF+FG+AAVV Q C ++A+KP   
Sbjct  344   ADMSVINRCRIDAYQDTLYAHSQRQFYRDSYVTGTVDFIFGNAAVVFQKCQIVARKPNKR  403

Query  55    QKNMVTAQGRSDPNQNTG  2
             QKNMVTAQGR+DPNQ TG
Sbjct  404   QKNMVTAQGRTDPNQATG  421



>ref|XP_010324324.1| PREDICTED: pectinesterase 3 [Solanum lycopersicum]
Length=543

 Score =   311 bits (798),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 173/378 (46%), Positives = 243/378 (64%), Gaps = 17/378 (4%)
 Frame = -3

Query  1114  LCRTAIDPAACKTILKQ--TVKSYGGTPAGLLREFLADYLPSMEAAKMEFGMVRGEFTHP  941
             LC++A     C + + +  T +S G T   +L++FL  Y+  M  A      ++ +    
Sbjct  53    LCKSAQGSQLCLSYVSEIVTTESDGVT---VLKKFLVKYVHQMNNAIPVVRKIKNQINDI  109

Query  940   REVQAVADCVELMGLSINDVRDAIKDL-QGSKTRNSDAQTSLSAVLTNHLTCMEGLNPPE  764
             R+  A+ DC+EL+  S++ V D+I  + + S+  +++ Q+ LS VLTNH+TC++ L    
Sbjct  110   RQHGALTDCLELLDQSVDLVSDSIAAIDKRSRLEHANVQSWLSGVLTNHVTCLDELT--S  167

Query  763   KSPVKG-ILDALISRSRVALAVLAEIIGQTDE--EQNFRVPFNGKFPSWVKSSDRKLVRR  593
              S   G +LD LI+R++VALA+LA +    DE   Q       GK P WV S DRKL+  
Sbjct  168   LSTKNGTVLDELITRAKVALAMLASVTTPNDEVLRQGL-----GKMPYWVSSRDRKLMES  222

Query  592   KHGNLKADIIVSQDGKGNFTTLKKAMESVSAVSKARVFIYVKKGTYKENVEMNVKS-PVM  416
                ++ A+ +V+QDG G++ TL +A+++    +K R  IYVK G YKENV +  K   +M
Sbjct  223   SGKDIIANAVVAQDGTGDYQTLAEAVDAAPDKNKTRYVIYVKMGIYKENVVVTKKKMNLM  282

Query  415   IYGDGMTQTVFSGDHSFGDNYTTFKSYTLASKGPAAILQDLCVRNTAGAAKHQAVALLVG  236
             I GDGM  T+ +G  +  D  TTF+S TLA+ G   ILQDLC++NTAG  K QAVAL VG
Sbjct  283   IVGDGMNATIITGSLNVVDGSTTFRSATLAAVGQGFILQDLCIQNTAGPEKGQAVALRVG  342

Query  235   GDKSIINRCRLEGYQDTLYAHSKRQFYRDCTITGTIDFVFGDAAVVLQNCTLIAKKPLAA  56
              D S+INRCR++ YQDTLYAHS+RQFYRD  +TGT+DF+FG+AAVV Q C ++A+KP   
Sbjct  343   ADMSVINRCRIDAYQDTLYAHSQRQFYRDSYVTGTVDFIFGNAAVVFQKCQIVARKPNKR  402

Query  55    QKNMVTAQGRSDPNQNTG  2
             QKNMVTAQGR+DPNQ TG
Sbjct  403   QKNMVTAQGRTDPNQATG  420



>ref|XP_004232737.1| PREDICTED: pectinesterase-like [Solanum lycopersicum]
Length=546

 Score =   310 bits (794),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 169/383 (44%), Positives = 243/383 (63%), Gaps = 24/383 (6%)
 Frame = -3

Query  1114  LCRTAIDPAACKTILKQTVKSYGGTPAGLLREFLADYLPSMEAAKMEFGM---------V  962
             +C TA D  +C  +L +        PAGL+     D L  M   K    +         V
Sbjct  55    VCDTAHDQPSCLAMLSEV------APAGLMDIKTVDLL-QMVLHKSSLKIHETIHLASNV  107

Query  961   RGEFTHPREVQAVADCVELMGLSINDVRDAIKDLQGSKTRNS--DAQTSLSAVLTNHLTC  788
              G   + +E  A+ DC+ELM LS + + D++  L G+ T  +  D  + LS++LTNH+TC
Sbjct  108   NGRINNGQEQVALEDCLELMDLSRDRLMDSMVGL-GNLTVQAHFDVHSWLSSILTNHVTC  166

Query  787   MEGLNPPEKSPVKGILDALISRSRVALAVLAEIIGQTDEEQNFRVPFNGKFPSWVKSSDR  608
             ++GLN   +S ++ +L+ L++R+R +LA++  I  Q    +N     +   PSWV ++DR
Sbjct  167   IDGLNGQVRSIMEPMLNDLVARARTSLALMVAIAPQ----KNIVPTVSDGLPSWVSANDR  222

Query  607   KLVRRKHGNLKADIIVSQDGKGNFTTLKKAMESVSAVSKARVFIYVKKGTYKENVEMNVK  428
             +L++     + A+++V++DG G + T+K+A+ S    SK R  IYVKKGTYKENVE+  K
Sbjct  223   RLLQLSANAIAANVVVAKDGSGKYKTVKEAVASAPDNSKTRYVIYVKKGTYKENVEIGKK  282

Query  427   SP-VMIYGDGMTQTVFSGDHSFGDNYTTFKSYTLASKGPAAILQDLCVRNTAGAAKHQAV  251
                +M+ GDGM  T+ +G+ +  D  TTFKS T+A+ G   I QD+  +NTAG  KHQAV
Sbjct  283   KKNIMLVGDGMDATIITGNLNVIDGSTTFKSATVAAVGDGFIAQDIQFQNTAGPQKHQAV  342

Query  250   ALLVGGDKSIINRCRLEGYQDTLYAHSKRQFYRDCTITGTIDFVFGDAAVVLQNCTLIAK  71
             AL VG D+S+INRC+++ +QDTLY H+ RQFYRDC I GT+DF+FG+AAVV QN  L A+
Sbjct  343   ALRVGADQSVINRCKMDAFQDTLYTHTLRQFYRDCYIIGTVDFIFGNAAVVFQNSKLAAR  402

Query  70    KPLAAQKNMVTAQGRSDPNQNTG  2
             KP++ QKNMVTAQGR DPNQNTG
Sbjct  403   KPMSGQKNMVTAQGREDPNQNTG  425



>ref|XP_010316615.1| PREDICTED: pectinesterase-like [Solanum lycopersicum]
Length=548

 Score =   310 bits (794),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 168/383 (44%), Positives = 242/383 (63%), Gaps = 24/383 (6%)
 Frame = -3

Query  1114  LCRTAIDPAACKTILKQTVKSYGGTPAGLLREFLADYLPSMEAAKMEFGM---------V  962
             +C TA D  +C  +L +        PAGL+     D L  M   K    +         V
Sbjct  57    VCDTAHDQPSCLAMLSEVA------PAGLMDTKTVDLL-QMVLHKSSLKIHETIHLASNV  109

Query  961   RGEFTHPREVQAVADCVELMGLSINDVRDAIKDLQGSKTRNS--DAQTSLSAVLTNHLTC  788
              G   + +E  A+ DC+ELM LS + + D++  L G+ T  +  D  + LS++LTNH+TC
Sbjct  110   NGRINNGQEQVALEDCLELMDLSRDRLMDSMMGL-GNLTAQAHFDVHSWLSSILTNHVTC  168

Query  787   MEGLNPPEKSPVKGILDALISRSRVALAVLAEIIGQTDEEQNFRVPFNGKFPSWVKSSDR  608
             ++GLN   +S ++ +L+ L++R+R +LA++  I  Q    +N     +   PSWV ++DR
Sbjct  169   IDGLNGQVRSIMEPMLNDLVARARTSLALMVAIAPQ----KNIVPTVSDGLPSWVSANDR  224

Query  607   KLVRRKHGNLKADIIVSQDGKGNFTTLKKAMESVSAVSKARVFIYVKKGTYKENVEMN-V  431
             +L++     + A+++V++DG G + T+K+A+ S    SK R  IYVKKG YKENVE+   
Sbjct  225   RLLQLSANAIAANVVVAKDGSGKYKTVKEAVASAPDNSKTRYVIYVKKGIYKENVEIGKT  284

Query  430   KSPVMIYGDGMTQTVFSGDHSFGDNYTTFKSYTLASKGPAAILQDLCVRNTAGAAKHQAV  251
             K  +M+ GDGM  T+ +G+ +  D  TTFKS T+A+ G   I QD+  +NTAG  KHQAV
Sbjct  285   KKNLMLVGDGMDATIITGNLNVIDGSTTFKSATVAAVGDGFIAQDIQFQNTAGPQKHQAV  344

Query  250   ALLVGGDKSIINRCRLEGYQDTLYAHSKRQFYRDCTITGTIDFVFGDAAVVLQNCTLIAK  71
             AL VG D+S+INRC+++ +QDTLY H+ RQFYRDC ITGT+DF+FG+AAVV QN  L A+
Sbjct  345   ALRVGADQSVINRCKMDAFQDTLYTHTLRQFYRDCYITGTVDFIFGNAAVVFQNSKLAAR  404

Query  70    KPLAAQKNMVTAQGRSDPNQNTG  2
             KP++ Q NMVTAQGR DPNQNTG
Sbjct  405   KPMSGQSNMVTAQGREDPNQNTG  427



>ref|XP_004134752.1| PREDICTED: pectinesterase/pectinesterase inhibitor-like [Cucumis 
sativus]
 gb|KGN49128.1| Pectinesterase [Cucumis sativus]
Length=555

 Score =   309 bits (792),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 171/385 (44%), Positives = 237/385 (62%), Gaps = 21/385 (5%)
 Frame = -3

Query  1114  LCRTAIDPAAC---------KTILKQTVKSYGGTPAGLLREFLADYLPSMEAAKMEFGMV  962
             +C  A DP++C          +I+K T           L+ FL   +P + +       +
Sbjct  57    ICHKAYDPSSCIEMAASEFPLSIIKTT------NEVDFLQSFLRKSMPKVISTIERAKDI  110

Query  961   RGEFTHPREVQAVADCVELMGLSINDVRDAIKDLQGSKTRNS--DAQTSLSAVLTNHLTC  788
             R     PR   A+ADC+ELM +S   + D++  L+ ++T  S  ++ T LS+VLTNH+TC
Sbjct  111   RQRINSPRGEAALADCIELMEISNGRIMDSVLALK-NRTSGSIENSHTWLSSVLTNHVTC  169

Query  787   MEGLNPP--EKSPVKGILDALISRSRVALAVLAEIIGQTDEEQNFRVPFNGKFPSWVKSS  614
              + +       +P+   L+ LI R R +L +L  I G   +           +PSW+K  
Sbjct  170   WDEVESSLSRAAPMDLGLEELIMRGRNSLGMLVSIWGLDIKNLGELEKKGNGYPSWLKKG  229

Query  613   DRKLVRRKHGNLKADIIVSQDGKGNFTTLKKAMESVSAVSKARVFIYVKKGTYKENVEMN  434
             DR+L+      ++ +I+V++DG GNF T+K+A+ESV   SK R+ IYVK+GTY+ENVE+ 
Sbjct  230   DRRLLGVLGREMEPNIVVAKDGSGNFKTVKEAVESVPDKSKNRIVIYVKRGTYEENVEVG  289

Query  433   VKSP-VMIYGDGMTQTVFSGDHSFGDNYTTFKSYTLASKGPAAILQDLCVRNTAGAAKHQ  257
              K   VMI GDGM  T+ +G  +  D  TTFKS T+A+ G   I QD+  +NTAG  KHQ
Sbjct  290   KKKKNVMIVGDGMDSTIITGSLNVVDGSTTFKSATVAAVGDGFIAQDIWFQNTAGPEKHQ  349

Query  256   AVALLVGGDKSIINRCRLEGYQDTLYAHSKRQFYRDCTITGTIDFVFGDAAVVLQNCTLI  77
             AVAL VG D+S+INRCR++ YQDTLY HS RQFYRD TITGT+DF+FG+AAVVLQNC + 
Sbjct  350   AVALRVGADQSVINRCRIDAYQDTLYTHSNRQFYRDSTITGTVDFIFGNAAVVLQNCKIE  409

Query  76    AKKPLAAQKNMVTAQGRSDPNQNTG  2
              ++P+  Q NMVTAQGR DPNQNTG
Sbjct  410   PRRPMNNQANMVTAQGRIDPNQNTG  434



>gb|AAB38794.1| pectin methylesterase, partial [Solanum lycopersicum]
Length=439

 Score =   305 bits (781),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 159/316 (50%), Positives = 221/316 (70%), Gaps = 6/316 (2%)
 Frame = -3

Query  940  REVQAVADCVELMGLSINDVRDAIKDL-QGSKTRNSDAQTSLSAVLTNHLTCMEGLNPPE  764
            R+  A+ DC+EL+  S++   D+I  + + S++ ++++++ LS VLTNH+TC++ L+   
Sbjct  4    RQHGALTDCLELLDQSVDLASDSIAAIDKRSRSEHANSESWLSGVLTNHVTCLDELDSFT  63

Query  763  KSPVKGI-LDALISRSRVALAVLAEIIGQTDEEQNFRVPFNGKFPSWVKSSDRKLVRRKH  587
            K+ + G  L+ LISR++VALA+LA +   T +E  F     GK PSWV S DRKL+    
Sbjct  64   KAMINGTNLEELISRAKVALAMLASLT--TQDEDVFMTGL-GKMPSWVSSMDRKLMESSG  120

Query  586  GNLKADIIVSQDGKGNFTTLKKAMESVSAVSKARVFIYVKKGTYKENVEMNV-KSPVMIY  410
             ++ A+ +V+QDG G + TL +A+ +    SK R  IYVK+G YKENVE++  K  +MI 
Sbjct  121  KDIIANRVVAQDGTGKYRTLAEAVAAAPNRSKKRYVIYVKRGIYKENVEVSSNKMNLMIV  180

Query  409  GDGMTQTVFSGDHSFGDNYTTFKSYTLASKGPAAILQDLCVRNTAGAAKHQAVALLVGGD  230
            GDGM  T  +G  +  D  TTF+S TLA+ G   ILQD+C++NTAG AK QAVAL VG D
Sbjct  181  GDGMYATTITGSLNVVDGSTTFRSATLAAVGQGFILQDICIQNTAGPAKDQAVALRVGAD  240

Query  229  KSIINRCRLEGYQDTLYAHSKRQFYRDCTITGTIDFVFGDAAVVLQNCTLIAKKPLAAQK  50
             S+INRCR++ YQDTLYAHS+RQFYRD  +TGT+DF+FG+AAVV Q C L+A+KP   Q+
Sbjct  241  MSVINRCRIDAYQDTLYAHSQRQFYRDSYVTGTVDFIFGNAAVVFQKCQLVARKPGKYQQ  300

Query  49   NMVTAQGRSDPNQNTG  2
            NMVTAQG +DPNQ TG
Sbjct  301  NMVTAQGTTDPNQATG  316



>ref|XP_006348082.1| PREDICTED: pectinesterase/pectinesterase inhibitor 18-like [Solanum 
tuberosum]
Length=486

 Score =   306 bits (783),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 156/325 (48%), Positives = 221/325 (68%), Gaps = 4/325 (1%)
 Frame = -3

Query  964  VRGEFTHPREVQAVADCVELMGLSINDVRDAIKDLQG-SKTRNSDAQTSLSAVLTNHLTC  788
            V G   + +E  A+ADC+ELM LS + + D++  L   S   + D  + LS++LTNH+TC
Sbjct  41   VNGRINNGQEQAALADCLELMDLSRDRLMDSMMGLGNLSAQAHFDVHSWLSSILTNHVTC  100

Query  787  MEGLNPPEKSPVKGILDALISRSRVALAVLAEIIGQTDEEQNFRVP--FNGKFPSWVKSS  614
            ++GLN   +S ++ +L+ LI+R+R +LA++  I        N  +P   +   PSWV ++
Sbjct  101  IDGLNGQARSIMEPMLNDLIARARTSLALMVAIAPPKSTNNNNNLPPTVSDGLPSWVSAN  160

Query  613  DRKLVRRKHGNLKADIIVSQDGKGNFTTLKKAMESVSAVSKARVFIYVKKGTYKENVEMN  434
            DRKL++     + A+++V++DG G + T+K+A+ S     K R  IYVKKGTYKENVE+ 
Sbjct  161  DRKLLQLSANAIAANVVVAKDGSGKYKTVKEAVASAPDNGKTRFVIYVKKGTYKENVEIG  220

Query  433  VKSP-VMIYGDGMTQTVFSGDHSFGDNYTTFKSYTLASKGPAAILQDLCVRNTAGAAKHQ  257
             K   +M+ GDGM  T+ +G+ +  D  TTFKS T+A+ G   I QDL  +NTAG  KHQ
Sbjct  221  KKKKNIMLMGDGMDATIITGNLNVIDGSTTFKSATVAAVGDGFIAQDLQFQNTAGPQKHQ  280

Query  256  AVALLVGGDKSIINRCRLEGYQDTLYAHSKRQFYRDCTITGTIDFVFGDAAVVLQNCTLI  77
            AVAL VG D+S+INRC+++ ++DTLY H+ RQFYRDC ITGT+DF+FG+AAVV QN  L 
Sbjct  281  AVALRVGADQSVINRCKIDAFRDTLYTHTLRQFYRDCYITGTVDFIFGNAAVVFQNSKLA  340

Query  76   AKKPLAAQKNMVTAQGRSDPNQNTG  2
            A+KP++ QKNMVTAQGR DPNQ TG
Sbjct  341  ARKPMSGQKNMVTAQGREDPNQVTG  365



>ref|XP_004155595.1| PREDICTED: pectinesterase/pectinesterase inhibitor-like [Cucumis 
sativus]
Length=555

 Score =   307 bits (786),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 172/388 (44%), Positives = 238/388 (61%), Gaps = 27/388 (7%)
 Frame = -3

Query  1114  LCRTAIDPAAC---------KTILKQTVKSYGGTPAGLLREFLADYLPSMEAAKMEFGMV  962
             +C  A DP++C          +I+K T           L+ FL   +P + +       +
Sbjct  57    ICHKAYDPSSCIEMAASEFPLSIIKTT------NEVDFLQSFLRKSMPKVISTIERAKDI  110

Query  961   RGEFTHPREVQAVADCVELMGLSINDVRDAIKDLQGSKTRNS--DAQTSLSAVLTNHLTC  788
             R     PR   A+ADC+ELM +S   + D++  L+ ++T  S  ++ T LS+VLTNH+TC
Sbjct  111   RQRINRPRGEAALADCIELMEISNGRIMDSVLALK-NRTSGSIENSHTWLSSVLTNHVTC  169

Query  787   MEGLNPPEKSPVKGI-----LDALISRSRVALAVLAEIIGQTDEEQNFRVPFNGKFPSWV  623
              + +   E S  +       L+ LI R R +L +L  I G   +           +PSW+
Sbjct  170   WDEV---ESSLSRAAAMDLGLEELIMRGRNSLGMLVSIWGLDIKNLGELEKKGNGYPSWL  226

Query  622   KSSDRKLVRRKHGNLKADIIVSQDGKGNFTTLKKAMESVSAVSKARVFIYVKKGTYKENV  443
             K  DR+L+     +++ +I+V++DG GNF T+K+A+ESV   SK R+ IYVK+GTY+ENV
Sbjct  227   KKGDRRLLGVLGRDMEPNIVVAKDGSGNFKTVKEAVESVPDKSKNRIVIYVKRGTYEENV  286

Query  442   EMNVKSP-VMIYGDGMTQTVFSGDHSFGDNYTTFKSYTLASKGPAAILQDLCVRNTAGAA  266
             E+  K   VMI GDGM  T+ +G  +  D  TTFKS T+A+ G   I QD+  +NTAG  
Sbjct  287   EVGKKKKNVMIVGDGMDSTIITGSLNVVDGSTTFKSATVAAVGDGFIAQDIWFQNTAGPE  346

Query  265   KHQAVALLVGGDKSIINRCRLEGYQDTLYAHSKRQFYRDCTITGTIDFVFGDAAVVLQNC  86
             KHQAVAL VG D+S+INRCR++ YQDTLY HS RQFYRD TITGT+DF+FG+AAVVLQNC
Sbjct  347   KHQAVALRVGADQSVINRCRIDAYQDTLYTHSNRQFYRDSTITGTVDFIFGNAAVVLQNC  406

Query  85    TLIAKKPLAAQKNMVTAQGRSDPNQNTG  2
              +  ++P+  Q NMVTAQGR DPNQNTG
Sbjct  407   KIEPRRPMNNQANMVTAQGRIDPNQNTG  434



>ref|XP_009589755.1| PREDICTED: pectinesterase-like [Nicotiana tomentosiformis]
Length=548

 Score =   305 bits (782),  Expect = 9e-94, Method: Compositional matrix adjust.
 Identities = 158/324 (49%), Positives = 217/324 (67%), Gaps = 7/324 (2%)
 Frame = -3

Query  964  VRGEFTHPREVQAVADCVELMGLSINDVRDAIKDLQG-SKTRNSDAQTSLSAVLTNHLTC  788
            V     + +E  A+ADC+ELM LS + + D++  L   S   + D  T LS++LTNH+TC
Sbjct  109  VNSRINNGKEQAALADCLELMDLSRDRLMDSMMSLGNLSSQAHFDVHTWLSSILTNHVTC  168

Query  787  MEGLNPPEKSPVKGILDALISRSRVALAVLAEIIGQTDEEQNFRVP-FNGKFPSWVKSSD  611
             +GLN   +S +K +L  LI+R++ +LA++ ++           +P      PSWV S+D
Sbjct  169  KDGLNAQAQSIMKPMLKDLIARAKTSLALMVKMA----PSNTMDLPSVTHGLPSWVTSND  224

Query  610  RKLVRRKHGNLKADIIVSQDGKGNFTTLKKAMESVSAVSKARVFIYVKKGTYKENVEMNV  431
            R+L++     + A+++V++DG G F T+K+A+ S     K R  IYVKKG YKENVE+  
Sbjct  225  RRLLQLSANAITANVVVAKDGSGKFKTVKEAVASAPDNGKTRYVIYVKKGIYKENVEIGK  284

Query  430  KSP-VMIYGDGMTQTVFSGDHSFGDNYTTFKSYTLASKGPAAILQDLCVRNTAGAAKHQA  254
            K   VM+ GDGM  T+ +G+ +  D  TTF S T+A+ G   I QDL  +NTAGAAKHQA
Sbjct  285  KKKNVMLVGDGMDTTIITGNLNVVDGATTFNSATVAAVGDGFIAQDLQFQNTAGAAKHQA  344

Query  253  VALLVGGDKSIINRCRLEGYQDTLYAHSKRQFYRDCTITGTIDFVFGDAAVVLQNCTLIA  74
            VAL VG D+S+INRC+++ +QDTLY HS RQFYRDC ITGT+DF+FG+AAVV QN  + A
Sbjct  345  VALRVGADQSVINRCKIDAFQDTLYTHSLRQFYRDCYITGTVDFIFGNAAVVFQNSKIAA  404

Query  73   KKPLAAQKNMVTAQGRSDPNQNTG  2
            +KP + QKNMVTAQGR DPNQNTG
Sbjct  405  RKPGSGQKNMVTAQGREDPNQNTG  428



>ref|XP_010923950.1| PREDICTED: pectinesterase-like [Elaeis guineensis]
Length=547

 Score =   304 bits (779),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 171/381 (45%), Positives = 239/381 (63%), Gaps = 18/381 (5%)
 Frame = -3

Query  1114  LCRTAIDPAACKTILKQTVKSYG----GTPAGLLREFLADYLPSMEA----AKMEFGMVR  959
             LC  + +PA C   +   + + G      P  +L+  L   L  +++    A   +  + 
Sbjct  54    LCANSPNPATCNAAISTALSALGRRPKPDPVQVLQTVLHRSLLLIDSFLTFANNSYRPIG  113

Query  958   GEFTHPREVQAVADCVELMGLSINDVRDAIKDLQGSKTRNSDAQTSLSAVLTNHLTCMEG  779
             G  T  R    +ADC+ LM LS +   D+   +  S    +DA+T LSAVLTNH+TC +G
Sbjct  114   GPDTIQRS--PLADCIHLMDLSRDLFLDSASAI--SAEAYTDARTWLSAVLTNHVTCSDG  169

Query  778   LNPPEKSPVKGILDALISRSRVALAVLAEIIGQTDEEQNFRVPFNGKFPSWVKSSDRKLV  599
             L+ P   P++  L++L + +   LAVL+ +   +D +   RV    +FPSW+   DRKL+
Sbjct  170   LSGPIGPPMEAHLESLTALAGATLAVLSAV-SPSDGDAIERV---SRFPSWLTVKDRKLL  225

Query  598   RRKHGN-LKADIIVSQDGKGNFTTLKKAMESVSAVSKARVFIYVKKGTYKENVEMNVK-S  425
                  + +  ++ V+ DG G++ T+++A++S     K R  IYVK+GTYKENV +  K +
Sbjct  226   ESSSSDGVAVNVTVAADGSGDYKTVQEAVDSAPDKGKVRYVIYVKEGTYKENVIVGKKKT  285

Query  424   PVMIYGDGMTQTVFSGDHSFGDNYTTFKSYTLASKGPAAILQDLCVRNTAGAAKHQAVAL  245
              VMI GDGM  TV +G  +  D  TTF S TLA+ G   ILQD+C+ NTAG  KHQAVAL
Sbjct  286   NVMIVGDGMNSTVITGSLNVVDGSTTFNSATLAAVGEGFILQDICIENTAGPEKHQAVAL  345

Query  244   LVGGDKSIINRCRLEGYQDTLYAHSKRQFYRDCTITGTIDFVFGDAAVVLQNCTLIAKKP  65
              VG D+S+INRCR++GYQDTLYAHS RQFY D  I+GT+DF+FG+AAVV QNC LIA+KP
Sbjct  346   RVGADRSVINRCRVDGYQDTLYAHSLRQFYGDSIISGTVDFIFGNAAVVFQNCNLIARKP  405

Query  64    LAAQKNMVTAQGRSDPNQNTG  2
             ++ Q+N+VTAQGR DPNQNTG
Sbjct  406   MSNQQNLVTAQGRVDPNQNTG  426



>ref|XP_009589961.1| PREDICTED: LOW QUALITY PROTEIN: pectinesterase-like [Nicotiana 
tomentosiformis]
Length=548

 Score =   304 bits (778),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 156/324 (48%), Positives = 219/324 (68%), Gaps = 7/324 (2%)
 Frame = -3

Query  964  VRGEFTHPREVQAVADCVELMGLSINDVRDAIKDLQGSKTR-NSDAQTSLSAVLTNHLTC  788
            V     + +E  A+ADC+ELM LS + + D++  L    T+ + D  T LS++LTNH+TC
Sbjct  109  VNSRINNDKEQAALADCLELMDLSRDRLMDSMMSLGNLSTQVHFDVHTWLSSILTNHVTC  168

Query  787  MEGLNPPEKSPVKGILDALISRSRVALAVLAEIIGQTDEEQNFRVP-FNGKFPSWVKSSD  611
             +GLN   +S ++ +L  LI+R++ +LA++ ++       +   +P      PSWV S+D
Sbjct  169  KDGLNGLVQSIMEPMLKDLITRAKTSLALMVKMA----PVKTMDLPSVTHGLPSWVTSND  224

Query  610  RKLVRRKHGNLKADIIVSQDGKGNFTTLKKAMESVSAVSKARVFIYVKKGTYKENVEMNV  431
            R+L++     + A+++V++DG G F T+K+A+ S     K R  IYVKKG YKENVE+  
Sbjct  225  RRLLQLSANAITANVVVAKDGSGKFKTVKEAVASAPDNGKTRYVIYVKKGIYKENVEIGK  284

Query  430  KSP-VMIYGDGMTQTVFSGDHSFGDNYTTFKSYTLASKGPAAILQDLCVRNTAGAAKHQA  254
            K   VM+ GDGM  T+ +G  +F D  TTFKS T+A+ G   I QDL  +NTAG +KHQA
Sbjct  285  KKKNVMLVGDGMDATIITGSLNFVDGSTTFKSATVAAVGDGFIAQDLQFQNTAGPSKHQA  344

Query  253  VALLVGGDKSIINRCRLEGYQDTLYAHSKRQFYRDCTITGTIDFVFGDAAVVLQNCTLIA  74
            VAL +G D+S+INRC+++ +QDTLY HS RQFYRDC ITGT+DF+FG+AAVV QN  + A
Sbjct  345  VALRIGADQSVINRCKIDAFQDTLYTHSLRQFYRDCYITGTVDFIFGNAAVVFQNSKIAA  404

Query  73   KKPLAAQKNMVTAQGRSDPNQNTG  2
            +KP + QKNMVTAQGR DPNQNTG
Sbjct  405  RKPGSGQKNMVTAQGREDPNQNTG  428



>gb|EPS63029.1| hypothetical protein M569_11757, partial [Genlisea aurea]
Length=526

 Score =   303 bits (776),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 171/375 (46%), Positives = 234/375 (62%), Gaps = 8/375 (2%)
 Frame = -3

Query  1111  CRTAIDPAACKTILKQTVKSYGGTP--AGLLREFLADYLPSMEAAKMEFGMVRGEFTHPR  938
             C  A++P +C+  + + V   G     A L  + L   +  M  A +    +R       
Sbjct  34    CHKALNPESCRDTVLRAVSDDGSASEAADLQPKLLNRQVDEMRRALVLIQKLRS--NQAE  91

Query  937   EVQAVADCVELMGLSINDVRDAIKDLQGSKTRN--SDAQTSLSAVLTNHLTCMEGLNPPE  764
             E  A++DC ELM +SI+ V ++I++L+    R+  +DAQT LS VLTNH TC + +    
Sbjct  92    ESGALSDCEELMEISIDLVLNSIRELEKGMGRSQYTDAQTWLSGVLTNHFTCADEIGGGR  151

Query  763   KSPVKGILDALISRSRVALAVLAEIIGQTDEEQNFRVPFNGKFPSWVKSSDRKLVRRKHG  584
                ++ + + LI  +R +LAVLA +    DE    R   +G  P+W+   DRKL++    
Sbjct  152   LLGIRSMTEGLIDTTRASLAVLASVTLPEDE-ITIRPVTSGMDPTWLTPMDRKLLQVTAD  210

Query  583   NLKADIIVSQDGKGNFTTLKKAMESVSAVSKARVFIYVKKGTYKENVEMNV-KSPVMIYG  407
              +KAD++V++DG G+F T+  A+++    S+ R  I VKKGTY+ENV +   K  +MI G
Sbjct  211   RVKADLVVARDGSGDFRTVSGAVDAAPENSEKRFVIRVKKGTYRENVVVGKNKKNLMIIG  270

Query  406   DGMTQTVFSGDHSFGDNYTTFKSYTLASKGPAAILQDLCVRNTAGAAKHQAVALLVGGDK  227
             DG  +T  +   +  D  TT+ S TLA+ G   ILQD+ +RNTAG  K QAVAL +G DK
Sbjct  271   DGKGKTTITAHLNVVDGSTTYNSATLAAVGEGFILQDIRIRNTAGREKAQAVALRIGSDK  330

Query  226   SIINRCRLEGYQDTLYAHSKRQFYRDCTITGTIDFVFGDAAVVLQNCTLIAKKPLAAQKN  47
             S INRC++EGYQDTLYAHS RQFYRD TI GTIDF+FGDAAVVLQ CT+ A+ PL +QKN
Sbjct  331   SAINRCKIEGYQDTLYAHSLRQFYRDSTIKGTIDFIFGDAAVVLQKCTIEARIPLKSQKN  390

Query  46    MVTAQGRSDPNQNTG  2
              VTAQGRSDPNQNTG
Sbjct  391   TVTAQGRSDPNQNTG  405



>ref|XP_008809854.1| PREDICTED: pectinesterase-like [Phoenix dactylifera]
Length=550

 Score =   303 bits (777),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 171/383 (45%), Positives = 239/383 (62%), Gaps = 22/383 (6%)
 Frame = -3

Query  1114  LCRTAIDPAACKTILKQTVKSYG----GTPAGLLREFLADYLPSMEAAKMEFGMVRGEFT  947
             LC  +  PA C  ++   + + G      P  +L+  L   L  +++    F  V   F 
Sbjct  57    LCANSPSPAPCNAVISTALSALGRRSKPDPVQVLQTILHQSLLQIDS----FLTVADNFH  112

Query  946   HPRE----VQ--AVADCVELMGLSINDVRDAIKDLQGSKTRNSDAQTSLSAVLTNHLTCM  785
              P +    +Q  A+ADC+ LM LS + +RD+   +  S    + A+T LSA LTNH+TC 
Sbjct  113   RPIDGTGSIQRSALADCIHLMDLSRDLLRDSASAI--SAEAYTKARTWLSAALTNHVTCS  170

Query  784   EGLNPPEKSPVKGILDALISRSRVALAVLAEIIGQTDEEQNFRVPFNGKFPSWVKSSDRK  605
             +GL  P    ++  L++L + +  +LAVL+ +   +D +   RV    +FPSW+   DRK
Sbjct  171   DGLTRPIGPLMEAHLESLTALASASLAVLSAV-SPSDGDAIERV---RRFPSWLTVKDRK  226

Query  604   LVRRKHGN-LKADIIVSQDGKGNFTTLKKAMESVSAVSKARVFIYVKKGTYKENVEMNVK  428
             L+     + + A++ V+ +G G++ T+++A++S     K R  IYVK+GTYKENV +  K
Sbjct  227   LLESSSSDGIAANVTVAAEGSGDYKTVQEAVDSAPDKGKVRYVIYVKEGTYKENVVVGKK  286

Query  427   -SPVMIYGDGMTQTVFSGDHSFGDNYTTFKSYTLASKGPAAILQDLCVRNTAGAAKHQAV  251
              + V I GDGM  TV +G  +  D  TTF S T A+ G   ILQD+C+ NTAG  KHQAV
Sbjct  287   KTNVTIVGDGMNSTVITGSLNVVDGSTTFNSATFAAVGEGFILQDICIENTAGPEKHQAV  346

Query  250   ALLVGGDKSIINRCRLEGYQDTLYAHSKRQFYRDCTITGTIDFVFGDAAVVLQNCTLIAK  71
             AL VG D+S INRCRL+GYQDTLYAHS RQFYRD  I+GT+DF+FG+AAVV QNC LIA+
Sbjct  347   ALRVGADRSAINRCRLDGYQDTLYAHSLRQFYRDSVISGTVDFIFGNAAVVFQNCNLIAR  406

Query  70    KPLAAQKNMVTAQGRSDPNQNTG  2
             KP++ Q+N+VTAQGR DPNQNTG
Sbjct  407   KPMSHQQNLVTAQGRVDPNQNTG  429



>ref|XP_008439965.1| PREDICTED: pectinesterase [Cucumis melo]
Length=555

 Score =   303 bits (775),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 171/387 (44%), Positives = 234/387 (60%), Gaps = 25/387 (6%)
 Frame = -3

Query  1114  LCRTAIDPAAC---------KTILKQTVKSYGGTPAGLLREFLADYLPSMEAAKMEFGMV  962
             +C  A +P++C          +I+K T + +       L+ FL   +P +         +
Sbjct  57    ICHKAYNPSSCIEMAASEFPLSIIKTTNEEH------FLQSFLKKSMPKVINTIERAKDL  110

Query  961   RGEFTHPREVQAVADCVELMGLSINDVRDAIKDLQGSKTRNS----DAQTSLSAVLTNHL  794
             R     PR   A+ DC+ELM +S   + D++  L   K R S     + T LS+VLTNH+
Sbjct  111   RQRINSPRGEGALDDCIELMEISNGRIMDSVLAL---KNRTSGYIESSHTWLSSVLTNHV  167

Query  793   TCMEGLNPP--EKSPVKGILDALISRSRVALAVLAEIIGQTDEEQNFRVPFNGKFPSWVK  620
             TC + +       + +   L+ LI R R +L +L  I G   +           +PSW+K
Sbjct  168   TCWDEVESSLSRAAAMDLGLEELIMRGRNSLGMLVSIWGLEIKNLGELGKRGNGYPSWLK  227

Query  619   SSDRKLVRRKHGNLKADIIVSQDGKGNFTTLKKAMESVSAVSKARVFIYVKKGTYKENVE  440
               DR+L+      ++ +I+V++DG GNF T+++A+ESV   SK R+ IYVKKGTYKENVE
Sbjct  228   KGDRRLLGVLGREMEPNIVVAKDGSGNFKTVQEAVESVPDKSKNRIVIYVKKGTYKENVE  287

Query  439   MNVKSP-VMIYGDGMTQTVFSGDHSFGDNYTTFKSYTLASKGPAAILQDLCVRNTAGAAK  263
             +  K   VMI GDGM  T+ +G  +  D  TTFKS T+A+ G   I QD+  +NTAG AK
Sbjct  288   VGKKKKNVMIVGDGMDSTIITGSLNVVDGSTTFKSATVAAVGDGFIAQDIWFQNTAGPAK  347

Query  262   HQAVALLVGGDKSIINRCRLEGYQDTLYAHSKRQFYRDCTITGTIDFVFGDAAVVLQNCT  83
             HQAVAL VG D+S+INRCR++ YQDTLY HS RQFYRD TITGT+DF+FG+AAVVLQNC 
Sbjct  348   HQAVALRVGADQSVINRCRIDAYQDTLYTHSNRQFYRDSTITGTVDFIFGNAAVVLQNCK  407

Query  82    LIAKKPLAAQKNMVTAQGRSDPNQNTG  2
             +  ++P+  Q NMVTAQGR DPNQNTG
Sbjct  408   IEPRRPMNNQANMVTAQGRIDPNQNTG  434



>ref|XP_009771261.1| PREDICTED: pectinesterase-like [Nicotiana sylvestris]
Length=547

 Score =   302 bits (773),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 158/316 (50%), Positives = 212/316 (67%), Gaps = 7/316 (2%)
 Frame = -3

Query  940  REVQAVADCVELMGLSINDVRDAIKDLQG-SKTRNSDAQTSLSAVLTNHLTCMEGLNPPE  764
            +E  A+ADC+ELM LS + + D++  L   S   + D  T LS++LTNH TCM+GL+   
Sbjct  116  KEQAALADCLELMDLSSDRLMDSMMLLGNLSAQTHFDVHTWLSSILTNHATCMDGLSGLA  175

Query  763  KSPVKGILDALISRSRVALAVLAEIIGQTDEEQNFRVP-FNGKFPSWVKSSDRKLVRRKH  587
            ++ +K IL  LI R++ +LA++ ++           +P      PSWV S DR+L++   
Sbjct  176  RTIMKPILKDLIVRAKTSLALMVKMA----PSNTMDLPSVTDGLPSWVTSYDRRLLQLSA  231

Query  586  GNLKADIIVSQDGKGNFTTLKKAMESVSAVSKARVFIYVKKGTYKENVEMNVKSP-VMIY  410
              + A+++V++DG G F T+K+A+ S    SK R  IYVKKG YKENVE+  K   VM+ 
Sbjct  232  NAITANVVVAKDGSGKFKTIKEAVASAPDNSKTRYVIYVKKGIYKENVEIGKKKKNVMLV  291

Query  409  GDGMTQTVFSGDHSFGDNYTTFKSYTLASKGPAAILQDLCVRNTAGAAKHQAVALLVGGD  230
            GDGM  T+ +G  +  D  TTF S T+A+ G   I QDL  +NTAGAAKHQAVAL VG D
Sbjct  292  GDGMDATIITGSLNVVDGATTFNSATVAAVGDGFIAQDLQFQNTAGAAKHQAVALRVGAD  351

Query  229  KSIINRCRLEGYQDTLYAHSKRQFYRDCTITGTIDFVFGDAAVVLQNCTLIAKKPLAAQK  50
            +S+INRC+++ +QDTLY HS RQFYRDC ITGT+DF+FG+AAVV QN  + A+KP   QK
Sbjct  352  QSVINRCKIDAFQDTLYTHSLRQFYRDCYITGTVDFIFGNAAVVFQNSKIAARKPGPGQK  411

Query  49   NMVTAQGRSDPNQNTG  2
            NMVTAQGR DPNQNTG
Sbjct  412  NMVTAQGREDPNQNTG  427



>ref|XP_010101474.1| Pectinesterase/pectinesterase inhibitor [Morus notabilis]
 gb|EXB88457.1| Pectinesterase/pectinesterase inhibitor [Morus notabilis]
Length=556

 Score =   300 bits (768),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 165/379 (44%), Positives = 229/379 (60%), Gaps = 11/379 (3%)
 Frame = -3

Query  1114  LCRTAIDPAACKTILKQTVKSYGGTP-AGLLREFLADYLPSMEAA-KMEFGMVRGEFTHP  941
             +C  +++  +C  ++ +  + Y       LL+ FL    P ++ A +M   + R     P
Sbjct  58    ICDQSVNKESCLAMVSEAAQEYSTMADHELLKAFLEKTNPRIQLALEMVNNVSRRINISP  117

Query  940   REVQAVADCVELMGLSINDVRDAIKDL--QGSKTRN-SDAQTSLSAVLTNHLTCMEGLNP  770
             R+  A+ DC ELM LS + V D+I  L  Q   T +  D    LS +L+NH+TC++GL  
Sbjct  118   RDRAALLDCAELMDLSKDRVLDSISTLLLQNLTTHSREDVNAWLSGILSNHVTCLDGLED  177

Query  769   PE--KSPVKGILDALISRSRVALAVLAEIIGQTDEEQNFRVPFNGKFPSWVKSSDRKLVR  596
                 K+ ++  L+ LIS +R +LA+L        E      P    FP+WV   DR+L+R
Sbjct  178   GSYAKNLMESHLNELISGARTSLAILVSFSQSKCEALE---PLTKDFPTWVTPGDRRLLR  234

Query  595   RKHGNLKADIIVSQDGKGNFTTLKKAMESVSAVSKARVFIYVKKGTYKENVEM-NVKSPV  419
                  +  DI+V++DG G++TT+ +A+ +V   SK R  IYV  G Y ENVE+   K  V
Sbjct  235   SLEKEITPDIVVAKDGSGDYTTVNEAVAAVPKNSKKRFVIYVTTGVYYENVELAKNKKNV  294

Query  418   MIYGDGMTQTVFSGDHSFGDNYTTFKSYTLASKGPAAILQDLCVRNTAGAAKHQAVALLV  239
             M+ GDGM  T+ +   +  D  TT+KS T+A  G   I QD+  +NTAG  KHQAVAL V
Sbjct  295   MLLGDGMDYTIITASLNVDDGSTTYKSATVAVNGDGFIAQDMWFQNTAGPQKHQAVALRV  354

Query  238   GGDKSIINRCRLEGYQDTLYAHSKRQFYRDCTITGTIDFVFGDAAVVLQNCTLIAKKPLA  59
               DKS+INRCR++ YQDTLY HS RQFYRD T+TGT+DF+FG+AAVVLQ C +I +K + 
Sbjct  355   SADKSVINRCRIDAYQDTLYTHSHRQFYRDSTVTGTVDFIFGNAAVVLQRCKIIPRKGMT  414

Query  58    AQKNMVTAQGRSDPNQNTG  2
              QKNMVTAQGR+DPNQNTG
Sbjct  415   GQKNMVTAQGRTDPNQNTG  433



>sp|P83947.1|PME1_FICPW RecName: Full=Pectinesterase/pectinesterase inhibitor; Includes: 
RecName: Full=Pectinesterase inhibitor; AltName: Full=Pectin 
methylesterase inhibitor; Includes: RecName: Full=Pectinesterase; 
Short=PE; AltName: Full=Pectin methylesterase; Flags: 
Precursor [Ficus pumila var. awkeotsang]
Length=545

 Score =   299 bits (766),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 155/379 (41%), Positives = 230/379 (61%), Gaps = 11/379 (3%)
 Frame = -3

Query  1114  LCRTAIDPAACKTILKQTVKSYGGTPAGLLREFLADYLPSMEAAKMEFGMVRGEFTHPRE  935
             +C  +++  +C  ++ +           LL+ FL    P ++ A            +P+E
Sbjct  47    ICDQSVNKESCLAMISEVTGLNMADHRNLLKSFLEKTTPRIQKAFETANDASRRINNPQE  106

Query  934   VQAVADCVELMGLSINDVRDAIKDL--QGSKTR-NSDAQTSLSAVLTNHLTCMEGLNPPE  764
               A+ DC ELM LS   V D+I  L  Q   TR + D    LS VLTNH+TC++GL    
Sbjct  107   RTALLDCAELMDLSKERVVDSISILFHQNLTTRSHEDLHVWLSGVLTNHVTCLDGLEEGS  166

Query  763   KSPVKGILDA----LISRSRVALAVLAEIIGQTDEEQNFRVPFNGKFPSWVKSSDRKLVR  596
                +K ++++    LI R+R +LA+   +      + N   P  G FP+WV + DR+L++
Sbjct  167   TDYIKTLMESHLNELILRARTSLAIFVTLF---PAKSNVIEPVTGNFPTWVTAGDRRLLQ  223

Query  595   RKHGNLKADIIVSQDGKGNFTTLKKAMESVSAVSKARVFIYVKKGTYKENVEMNV-KSPV  419
                 +++ DI+V++DG G++ TL +A+ ++   SK RV + V+ G Y+ENV+    K  V
Sbjct  224   TLGKDIEPDIVVAKDGSGDYETLNEAVAAIPDNSKKRVIVLVRTGIYEENVDFGYQKKNV  283

Query  418   MIYGDGMTQTVFSGDHSFGDNYTTFKSYTLASKGPAAILQDLCVRNTAGAAKHQAVALLV  239
             M+ G+GM  T+ +G  +  D  TTF S T+A+ G   I QD+C +NTAG  K+QAVAL +
Sbjct  284   MLVGEGMDYTIITGSRNVVDGSTTFDSATVAAVGDGFIAQDICFQNTAGPEKYQAVALRI  343

Query  238   GGDKSIINRCRLEGYQDTLYAHSKRQFYRDCTITGTIDFVFGDAAVVLQNCTLIAKKPLA  59
             G D+++INRCR++ YQDTLY H+ RQFYRD  ITGT+DF+FG+AAVV QNC LI +K + 
Sbjct  344   GADETVINRCRIDAYQDTLYPHNYRQFYRDRNITGTVDFIFGNAAVVFQNCNLIPRKQMK  403

Query  58    AQKNMVTAQGRSDPNQNTG  2
              Q+N +TAQGR+DPNQNTG
Sbjct  404   GQENTITAQGRTDPNQNTG  422



>ref|XP_010088582.1| Pectinesterase/pectinesterase inhibitor [Morus notabilis]
 gb|EXB36723.1| Pectinesterase/pectinesterase inhibitor [Morus notabilis]
Length=658

 Score =   300 bits (768),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 166/380 (44%), Positives = 231/380 (61%), Gaps = 12/380 (3%)
 Frame = -3

Query  1114  LCRTAIDPAACKTILKQTVKSYGGTP-AGLLREFLADYLPSMEAA-KMEFGMVRGEFTHP  941
             +C  +++  +C  ++ + V+ Y       LL+ FL    P ++ A +M   + R     P
Sbjct  159   ICDQSVNKESCLAMVSEAVQEYSTMADHELLKAFLEKTNPLIQLALEMLNNVSRRINVSP  218

Query  940   REVQAVADCVELMGLSINDVRDAIKDL--QGSKTRN-SDAQTSLSAVLTNHLTCMEGLN-  773
             R+  A+ DC ELM LS + V D+I  L  Q   T +  D    LS +LTNH+TC++GL  
Sbjct  219   RDRAALLDCAELMDLSKDRVLDSISTLLLQNLTTHSREDVNAWLSGILTNHVTCLDGLER  278

Query  772   --PPEKSPVKGILDALISRSRVALAVLAEIIGQTDEEQNFRVPFNGKFPSWVKSSDRKLV  599
                  K+ ++  L+ LISR+R +LA+L        E      P    FP+WV   DR+L+
Sbjct  279   DGSYAKNLMESHLNELISRARTSLAILVSFSQSKFEALE---PLTKDFPTWVTPGDRRLL  335

Query  598   RRKHGNLKADIIVSQDGKGNFTTLKKAMESVSAVSKARVFIYVKKGTYKENVEM-NVKSP  422
             R     + ADI+V++DG G++TT+ +A+ +V   SK R+ IYV  G Y EN E+   K  
Sbjct  336   RSLGKEITADIVVAKDGSGDYTTVNEAVAAVPKNSKKRLVIYVTTGVYYENFELAKNKKN  395

Query  421   VMIYGDGMTQTVFSGDHSFGDNYTTFKSYTLASKGPAAILQDLCVRNTAGAAKHQAVALL  242
             VM+ GDGM  T+ +   +  D  TTFKS T+A  G   I QD+  +NTAG  KHQAVAL 
Sbjct  396   VMLLGDGMDYTLITASLNADDGSTTFKSATVAVNGDGFIAQDIWFQNTAGPQKHQAVALR  455

Query  241   VGGDKSIINRCRLEGYQDTLYAHSKRQFYRDCTITGTIDFVFGDAAVVLQNCTLIAKKPL  62
             V  DKS+INRC ++ Y+DTLY HS RQFYRD T+TGT+DF+FG+AAV LQ C +I++K +
Sbjct  456   VSADKSVINRCHIDAYEDTLYTHSHRQFYRDSTVTGTVDFIFGNAAVALQRCKIISRKGM  515

Query  61    AAQKNMVTAQGRSDPNQNTG  2
               QKNMVTAQGR+DPNQNTG
Sbjct  516   RGQKNMVTAQGRTDPNQNTG  535



>ref|XP_006843574.1| hypothetical protein AMTR_s00007p00101250 [Amborella trichopoda]
 gb|ERN05249.1| hypothetical protein AMTR_s00007p00101250 [Amborella trichopoda]
Length=553

 Score =   294 bits (752),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 159/336 (47%), Positives = 217/336 (65%), Gaps = 24/336 (7%)
 Frame = -3

Query  952  FTHPREVQAVADCVELMGLSINDVRDAIKDLQG-----SKTRNSDAQTSLSAVLTNHLTC  788
             + P++ Q  ADC EL+    +  RD + + +      S    ++A T LSA LTN++TC
Sbjct  102  LSKPQKHQPFADCTELL----DQARDRLLETRAALRTPSPLSLAEAHTWLSATLTNYITC  157

Query  787  MEGLNPP----EKSPVKGIL------DALISRSRVALAVLAEIIGQTDE---EQNFRVPF  647
             +GLN      E    K ++       A+ S S   ++ +   +G T+    E    V  
Sbjct  158  EDGLNEGKTKLEAKATKAMVVALGECKAMASTSLATISAMRNALGSTEASGYEPMIEVG-  216

Query  646  NGKFPSWVKSSDRKLVRRKHGNLKADIIVSQDGKGNFTTLKKAMESVSAVSKARVFIYVK  467
            + + P+WV+  + +L+  K   +KAD++V++DG GN+ T+ +A+ +    SK R  IYVK
Sbjct  217  STRLPAWVRDIETRLLESKVSEIKADVVVAKDGSGNYKTVSEAVAAAPDKSKKRYVIYVK  276

Query  466  KGTYKENVEMNV-KSPVMIYGDGMTQTVFSGDHSFGDNYTTFKSYTLASKGPAAILQDLC  290
            KGTY+E VE+   K  +M+ GDGM  TV +G  +F D  TTF S TLA  G   I QD+C
Sbjct  277  KGTYEEKVEIGKNKKNLMLVGDGMDFTVITGSLNFIDGTTTFNSATLAVVGEGFIAQDMC  336

Query  289  VRNTAGAAKHQAVALLVGGDKSIINRCRLEGYQDTLYAHSKRQFYRDCTITGTIDFVFGD  110
             +NTAG  KHQAVAL VG DKSIINRCR+EGYQDTLYAHS+RQFYRD  I+GTIDF+FG+
Sbjct  337  FQNTAGPKKHQAVALRVGADKSIINRCRIEGYQDTLYAHSQRQFYRDSVISGTIDFIFGN  396

Query  109  AAVVLQNCTLIAKKPLAAQKNMVTAQGRSDPNQNTG  2
            AAVVLQNCT+IA+KP++ Q+N+VTAQGR+DPNQNTG
Sbjct  397  AAVVLQNCTIIARKPMSNQQNLVTAQGRTDPNQNTG  432



>dbj|BAK05307.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=548

 Score =   293 bits (749),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 165/379 (44%), Positives = 231/379 (61%), Gaps = 11/379 (3%)
 Frame = -3

Query  1114  LCRTAIDPAACKTILKQTVKSYGGT----PAGLLREFLADYLPSMEAAKMEFGMVRGEFT  947
             LC  + DPA+C  I+   V +  G     P+ +LR  +   L   +AA +    +    +
Sbjct  52    LCTNSPDPASCHAIVADAVLTSPGAHPSRPSQVLRAIIDRSLYQHDAAAVAVADMHRRAS  111

Query  946   HPREVQAVADCVELMGLSINDVRDAIKDLQGSKTRNSDAQTSLSAVLTNHLTCMEGLNP-  770
              PR+  A+ADCV+LM L+   +  A      +K    DA+T LSA LT+H+TC++GL+  
Sbjct  112   DPRQRAALADCVQLMELARERLAGAADR---AKVAPEDARTWLSAALTDHVTCLDGLDGG  168

Query  769   PEKSPVKGILDALISRSRVALAVLAEIIGQTDEEQNF-RVPFNGKFPSWVKSSDRKLVRR  593
             P +  V   L+ L S +  +LAVL  +   T    +  R     + PSW+ ++DR L+  
Sbjct  169   PLRDAVGAHLEPLESLASASLAVLNAVGSGTAAAADIARDVAADELPSWLPTADRALLEL  228

Query  592   KHGN-LKADIIVSQDGKGNFTTLKKAMESVSAVSKARVFIYVKKGTYKENVEMNVKS-PV  419
             +    ++ D++V++DG G +TT++ A+++     K+R  IYVKKG YKEN+E+  K   +
Sbjct  229   EGARAVQPDVVVAKDGSGKYTTVQAAVDAAPDGGKSRYVIYVKKGVYKENLEVGKKKRKL  288

Query  418   MIYGDGMTQTVFSGDHSFGDNYTTFKSYTLASKGPAAILQDLCVRNTAGAAKHQAVALLV  239
             MI  DGM  TV +G  +  D  TTF S TLA      ILQDL + NTAG  KHQAVAL V
Sbjct  289   MIVRDGMDATVITGSRNVVDGATTFNSATLAVAADGVILQDLRIENTAGPEKHQAVALRV  348

Query  238   GGDKSIINRCRLEGYQDTLYAHSKRQFYRDCTITGTIDFVFGDAAVVLQNCTLIAKKPLA  59
               D+++INRCR++GYQDTLYAH  R FYRDC ++GT+DFVFG+AA VLQ C L A++P  
Sbjct  349   SADRAVINRCRVDGYQDTLYAHQLRHFYRDCAVSGTVDFVFGNAAAVLQGCVLTARRPAR  408

Query  58    AQKNMVTAQGRSDPNQNTG  2
              QKN VTAQGR+DPNQNTG
Sbjct  409   GQKNAVTAQGRTDPNQNTG  427



>ref|XP_003564371.1| PREDICTED: pectinesterase [Brachypodium distachyon]
Length=549

 Score =   292 bits (748),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 169/382 (44%), Positives = 230/382 (60%), Gaps = 16/382 (4%)
 Frame = -3

Query  1114  LCRTAIDPAACKTILKQTVKS----YGGTPAGLLREFLADYLPSMEAAKMEFGMVRGEFT  947
             LCR++ DPA C  I+   V +    +   P  +LR  LA  L   +AA      +     
Sbjct  52    LCRSSPDPATCHAIVADAVLASQTPHPTPPVQVLRAILARSLHQHDAAASALAGMHRRAV  111

Query  946   HPREVQ--AVADCVELMGLSINDVRDAIKDLQGSKTRNSDAQTSLSAVLTNHLTCMEGLN  773
               R  Q   +ADC+ L+ L+    RD + D   ++  + DA+T LSAVLT+H+TC++GL+
Sbjct  112   SDRSGQRAPLADCILLLELA----RDRLADAAVARHED-DARTWLSAVLTDHVTCLDGLD  166

Query  772   P---PEKSPVKGILDALISRSRVALAVLAEIIGQTDEEQNFRVPFNGKFPSWVKSSDRKL  602
                 P +  V   L+ L S +  +LAVL  +      +          FPSWV + DR L
Sbjct  167   DDDQPLRDVVGAHLEPLKSLASASLAVLNTVSSDDARDVLQLAEAVDGFPSWVPTRDRAL  226

Query  601   VRRK-HGNLKADIIVSQDGKGNFTTLKKAMESVSAVSKARVFIYVKKGTYKENVEMNVKS  425
             +       ++AD++V++DG G + T+K+A+++       R  I VKKG YKENVE+  K 
Sbjct  227   LEGGGERAVEADVVVAKDGSGRYKTVKEAVDAAPENKGRRYVIRVKKGVYKENVEVGRKK  286

Query  424   -PVMIYGDGMTQTVFSGDHSFGDNYTTFKSYTLASKGPAAILQDLCVRNTAGAAKHQAVA  248
               +MI GDGM  TV +G  +  D  TTF S TLA  G   ILQDL + NTAG  KHQAVA
Sbjct  287   RELMIVGDGMDATVITGSRNVVDGATTFNSATLAVAGDGIILQDLKIENTAGPEKHQAVA  346

Query  247   LLVGGDKSIINRCRLEGYQDTLYAHSKRQFYRDCTITGTIDFVFGDAAVVLQNCTLIAKK  68
             L V  D+++I+RCR++GYQDTLYAH  RQFYR C ++GT+DFVFG+AA VLQ+CTL A++
Sbjct  347   LRVSADRAVISRCRVDGYQDTLYAHQLRQFYRGCFVSGTVDFVFGNAAAVLQDCTLAARR  406

Query  67    PLAAQKNMVTAQGRSDPNQNTG  2
             P+ AQKN VTAQGR DPNQNTG
Sbjct  407   PMRAQKNAVTAQGREDPNQNTG  428



>ref|XP_006307176.1| hypothetical protein CARUB_v10008769mg [Capsella rubella]
 gb|EOA40074.1| hypothetical protein CARUB_v10008769mg [Capsella rubella]
Length=547

 Score =   291 bits (746),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 155/379 (41%), Positives = 234/379 (62%), Gaps = 14/379 (4%)
 Frame = -3

Query  1114  LCRTAIDPAACKTILKQ--TVKSYGGTPAGLLREFLADYLPSMEAAKMEFGMVRGEFTHP  941
             +C  A D  +C+ +L +  T+         LL  FL + +  +++A       R      
Sbjct  54    ICNGAHDQDSCQVLLSEFTTLSLSKLNRLDLLHVFLKNSVSRVDSAMSMVKEARTRLNGA  113

Query  940   REVQAVADCVELMGLSINDVRDAIKDLQGSKTR---NSDAQTSLSAVLTNHLTCMEGLNP  770
             R+   +ADC E+M +S + +  ++++L+G        S+  T LS+VLTN++TC++  N 
Sbjct  114   RDEAGLADCEEMMDVSRDRMVSSVEELRGGNLNLESYSNVHTWLSSVLTNYMTCLDTTNE  173

Query  769   PEKSPVKGILDALISRSRVALAVLAEIIGQTDEEQNFRVPFNGKFPSWVKSSDRKLVRRK  590
             P    VK  L+ L+SR+RVALA+   ++   D+    ++     FPSW+ + DR+L+   
Sbjct  174   PR---VKAQLEDLVSRARVALAIFVSVLPARDD---LKMILFDHFPSWLTTLDRELLESA  227

Query  589   HGNLK--ADIIVSQDGKGNFTTLKKAMESVSAVSKARVFIYVKKGTYKENVEMNVKSP-V  419
                LK  A+++V++DG G + T+ +A+ +    S +R  IYVKKG YKE +++  K   +
Sbjct  228   PKALKVNANVVVAKDGSGKYKTVNEAVAAAPENSNSRYVIYVKKGVYKETIDIGKKKKNL  287

Query  418   MIYGDGMTQTVFSGDHSFGDNYTTFKSYTLASKGPAAILQDLCVRNTAGAAKHQAVALLV  239
             M+ GDG   T+ +G  +  D  TTF+S T+A+ G   + QDL ++NTAG AKHQAVAL V
Sbjct  288   MLVGDGKDATIITGSLNVVDGSTTFRSATIAANGDGFMAQDLWIQNTAGPAKHQAVALRV  347

Query  238   GGDKSIINRCRLEGYQDTLYAHSKRQFYRDCTITGTIDFVFGDAAVVLQNCTLIAKKPLA  59
               D+++INRCR++ YQDTLY H+ RQFYRD  ITGT+DF+FG++AVV QNC ++A+KP A
Sbjct  348   SADQTVINRCRIDAYQDTLYTHTLRQFYRDSYITGTVDFIFGNSAVVFQNCDIVARKPGA  407

Query  58    AQKNMVTAQGRSDPNQNTG  2
              QKNMVTAQGR D NQNT 
Sbjct  408   GQKNMVTAQGREDQNQNTA  426



>ref|XP_009118185.1| PREDICTED: pectinesterase/pectinesterase inhibitor 18 [Brassica 
rapa]
Length=556

 Score =   291 bits (745),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 157/382 (41%), Positives = 236/382 (62%), Gaps = 14/382 (4%)
 Frame = -3

Query  1114  LCRTAIDPAACKTILKQTVKSYGGTPA--GLLREFLADYLPSMEAAKMEFGMVRGEFTHP  941
             +C  A DP +C+T+L +        P    LL  FL + +  +E+        R      
Sbjct  57    ICHGAHDPDSCQTLLSEFTTLSLSKPKRLDLLHVFLKNSVWQLESTTNMVNEARTRSNEV  116

Query  940   REVQAVADCVELMGLSINDVRDAIKDLQGSKTR---NSDAQTSLSAVLTNHLTCMEGLNP  770
             R+    ADC E+M +S + +  ++++L+G        S+  T LS+VLTN++TC++ ++ 
Sbjct  117   RDKAHFADCKEMMDVSKDRMVSSMEELRGGNLNLESYSNVHTWLSSVLTNYMTCLDSISD  176

Query  769   ---PEKSPVKGILDALISRSRVALAVLAEIIGQTDEEQNFRVPFNGKFPSWVKSSDRKLV  599
                  K  V+  L+ L+SR+RVAL++   ++   D  +   +P +  FPSW+ S DRKL+
Sbjct  177   VSIDSKHRVQPKLEDLVSRARVALSIFVSVLPSKDYLEMI-LPIH--FPSWLNSLDRKLL  233

Query  598   RR--KHGNLKADIIVSQDGKGNFTTLKKAMESVSAVSKARVFIYVKKGTYKENVEMNVKS  425
                 K   +KA+++V++DG G + T+ +A+ +    S +R  IYVKKG YKE +++  K 
Sbjct  234   ESAPKTFEVKANVVVAKDGTGKYKTVNEAVAAAPENSNSRYVIYVKKGVYKETIDIGKKK  293

Query  424   P-VMIYGDGMTQTVFSGDHSFGDNYTTFKSYTLASKGPAAILQDLCVRNTAGAAKHQAVA  248
               +M+ GDG   T+ +G  +  D  TTF+S T+A+ G   + QD+  +NTAG AKHQAVA
Sbjct  294   KNLMLVGDGKDVTIITGSLNVVDGSTTFRSATVAANGDGFMAQDIWFQNTAGPAKHQAVA  353

Query  247   LLVGGDKSIINRCRLEGYQDTLYAHSKRQFYRDCTITGTIDFVFGDAAVVLQNCTLIAKK  68
             L V  D+S+INRCR++ YQDTLY H+ RQFYRD  ITGT+DF+FG++AVV QNC ++A+K
Sbjct  354   LRVSADQSVINRCRIDAYQDTLYTHTLRQFYRDSFITGTVDFIFGNSAVVFQNCDIVARK  413

Query  67    PLAAQKNMVTAQGRSDPNQNTG  2
             P A QKNM+TAQGR DPNQNT 
Sbjct  414   PGAGQKNMLTAQGREDPNQNTA  435



>gb|ACJ02103.1| pectin methylesterase [Oncidium hybrid cultivar]
Length=529

 Score =   290 bits (742),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 168/377 (45%), Positives = 225/377 (60%), Gaps = 24/377 (6%)
 Frame = -3

Query  1114  LCRTAIDPAACKTI--LKQTVKSYGGTPAGLLREFLADYLPSMEAAKMEFGMVRGEFTHP  941
             LC  + +P   + +  L  TV+S    P  LL   L   L  + A   +   +  +   P
Sbjct  50    LCVHSPNPTLRRLLSDLISTVRS----PISLLHALLHRSLLEIHATLSQSTNLHRQINDP  105

Query  940   REVQAVADCVELMGLSINDVRDAIKDLQGSKTRNS--DAQTSLSAVLTNHLTCMEGLNPP  767
                  +ADC+EL+ LS    RD I     +    S  DA+T LSAVLTNH+TC +GLN P
Sbjct  106   H----IADCIELLDLS----RDRILSSNAAIAAGSYADARTWLSAVLTNHVTCRDGLNDP  157

Query  766   EKSPVKGILDALISRSRVALAVLAEIIGQTDEEQNFRVPFNGKFPSWVKSSDRKLVRRKH  587
               SP+K  LD+L +++  ALAVL  +     E          + P WV  +DRKL+    
Sbjct  158   --SPLKAHLDSLTAQTSAALAVLRAVTVDGGELMELVT----ELPKWVSPADRKLLEATS  211

Query  586   -GNLKADIIVSQDGKGNFTTLKKAMESVSAVSKARVFIYVKKGTYKENVEMNVKSP-VMI  413
                + AD+ VS +G GN+ T++ A+++      +R  IYVKKGTYKENV +  K   +MI
Sbjct  212   LAAVTADVTVSANGGGNYKTVQAAVDAAPEKGNSRYVIYVKKGTYKENVIVGKKKKNLMI  271

Query  412   YGDGMTQTVFSGDHSFGDNYTTFKSYTLASKGPAAILQDLCVRNTAGAAKHQAVALLVGG  233
              GDG + T+ +G  +F D  TT+ S TLAS G   ILQDLCV NTAG  KHQAVAL +  
Sbjct  272   VGDGQSNTIITGSLNFVDGTTTYNSATLASMGDGFILQDLCVENTAGPQKHQAVALRINA  331

Query  232   DKSIINRCRLEGYQDTLYAHSKRQFYRDCTITGTIDFVFGDAAVVLQNCTLIAKKPLAAQ  53
             D++++NRC++  YQDTLY HS RQFYR+  I+GT+DF+FG+AAVV Q   L A+KP++ Q
Sbjct  332   DQAVVNRCQIRAYQDTLYTHSLRQFYRESLISGTVDFIFGNAAVVFQKSQLEARKPMSGQ  391

Query  52    KNMVTAQGRSDPNQNTG  2
             KN VTAQGR DPNQNTG
Sbjct  392   KNAVTAQGRVDPNQNTG  408



>ref|XP_006417343.1| hypothetical protein EUTSA_v10007263mg [Eutrema salsugineum]
 gb|ESQ35696.1| hypothetical protein EUTSA_v10007263mg [Eutrema salsugineum]
Length=557

 Score =   291 bits (744),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 157/383 (41%), Positives = 235/383 (61%), Gaps = 15/383 (4%)
 Frame = -3

Query  1114  LCRTAIDPAACKTILKQ--TVKSYGGTPAGLLREFLADYLPSMEAAKMEFGMVRGEFTHP  941
             +C  A D  +C+ +L +  T+         LL  FL + +  +++A       R      
Sbjct  57    ICHGAHDHYSCQALLSEFTTLSLSKLKRLDLLHVFLKNSVWRLKSAINMVNEARTRSNEA  116

Query  940   REVQAVADCVELMGLSINDVRDAIKDLQGSKTR---NSDAQTSLSAVLTNHLTCMEGLNP  770
             R+    ADC E+M +S + +  ++++++G        S+  + LS+VLTN++TC++G + 
Sbjct  117   RDEARFADCEEMMDVSKDRMVSSMEEMRGGNLNLESYSNVHSWLSSVLTNYMTCLDGFSD  176

Query  769   PEKSP----VKGILDALISRSRVALAVLAEIIGQTDEEQNFRVPFNGKFPSWVKSSDRKL  602
                      VK  L+ L+SR+RVALA+   ++   DE + F   F   FPSW+ + DRKL
Sbjct  177   ASVDSKLLGVKPKLEDLVSRARVALAIFVSVLPSRDEHEMF---FPIHFPSWLSALDRKL  233

Query  601   VRRKHGNLK--ADIIVSQDGKGNFTTLKKAMESVSAVSKARVFIYVKKGTYKENVEM-NV  431
             +      L+  A+++V++DG G + T+ +A+ +    SK R  IYVKKG YKE V++   
Sbjct  234   LESAPKTLEVNANVVVAKDGTGKYKTVNEAVAAAPENSKTRYVIYVKKGVYKETVDIGKK  293

Query  430   KSPVMIYGDGMTQTVFSGDHSFGDNYTTFKSYTLASKGPAAILQDLCVRNTAGAAKHQAV  251
             K+ +M+ GDG   T+ +G  +  D  TTF+S T+A+ G   + QD+  +NTAG AKHQAV
Sbjct  294   KTNLMLVGDGKDTTIITGSLNVIDGSTTFRSATVAANGDGFMAQDIWFQNTAGPAKHQAV  353

Query  250   ALLVGGDKSIINRCRLEGYQDTLYAHSKRQFYRDCTITGTIDFVFGDAAVVLQNCTLIAK  71
             AL V  D+++INRCR++ YQDTLY H+ RQFYRDC ITGT+DF+FG++AVV QNC ++A+
Sbjct  354   ALRVSADQTVINRCRIDAYQDTLYTHTLRQFYRDCYITGTVDFIFGNSAVVFQNCDIVAR  413

Query  70    KPLAAQKNMVTAQGRSDPNQNTG  2
             KP A QKNMVTAQGR D NQNT 
Sbjct  414   KPGAGQKNMVTAQGREDQNQNTA  436



>ref|XP_002456465.1| hypothetical protein SORBIDRAFT_03g036790 [Sorghum bicolor]
 gb|EES01585.1| hypothetical protein SORBIDRAFT_03g036790 [Sorghum bicolor]
Length=552

 Score =   290 bits (742),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 171/383 (45%), Positives = 230/383 (60%), Gaps = 15/383 (4%)
 Frame = -3

Query  1114  LCRTAIDPAACKTILKQTVKSYGGT------PAGLLREFLADYLPSMEAAKMEF-GMVR-  959
             LC ++ DP +C  I+   V +          PA +LR  +A  L   +AA     GM+R 
Sbjct  51    LCASSPDPTSCHAIVADAVLASPRAHLTRPGPAQVLRAIVARSLVQHDAAAAAVSGMLRH  110

Query  958   -GEFTHPREVQAVADCVELMGLSINDVRDAIKDLQGSKTRNSDAQTSLSAVLTNHLTCME  782
              G  + PR+  A+ADCV+LM L+ +  R A      +     DA+T LSA LT + TC +
Sbjct  111   TGSDSDPRQRAALADCVQLMDLARD--RLADASPAVAAAAADDARTWLSAALTYYATCTD  168

Query  781   GL--NPPEKSPVKGILDALISRSRVALAVLAEIIGQTDEEQNFRVPFNGKFPSWVKSSDR  608
             G+  + P +  V   L+ L S +  +LAVL+ ++  +             FPSWV + DR
Sbjct  169   GVVVDGPLRDAVVARLEPLKSLASASLAVLSAVVDDSGSRDAGLADTTYTFPSWVPARDR  228

Query  607   KLVRRKHGNLKADIIVSQDGKGNFTTLKKAMESVSAVSKARVFIYVKKGTYKENVEMNVK  428
              L+      ++AD++V+QDG G F T+K+A+++     K+R  IYVKKG YKENVE+  K
Sbjct  229   ALLE-AGAAIEADVVVAQDGSGKFRTVKEAVDAAPDGGKSRYVIYVKKGVYKENVEVGKK  287

Query  427   S-PVMIYGDGMTQTVFSGDHSFGDNYTTFKSYTLASKGPAAILQDLCVRNTAGAAKHQAV  251
                +MI GDGM  TV +G  +  D  TTF S TLA  G   ILQDL V NTAG AKHQAV
Sbjct  288   KRELMIVGDGMDATVITGSRNVVDGATTFNSATLAVAGDGIILQDLRVENTAGPAKHQAV  347

Query  250   ALLVGGDKSIINRCRLEGYQDTLYAHSKRQFYRDCTITGTIDFVFGDAAVVLQNCTLIAK  71
             AL V  D+++  RCR++GYQDTLYAH+ R  YR+C ++GT+DFVFG+AA VLQ C L A+
Sbjct  348   ALRVSADRAVAYRCRVDGYQDTLYAHALRHLYRECFVSGTVDFVFGNAAAVLQGCALAAR  407

Query  70    KPLAAQKNMVTAQGRSDPNQNTG  2
              PL  Q+N VTAQGR DPNQNTG
Sbjct  408   LPLRGQQNAVTAQGREDPNQNTG  430



>ref|XP_010476087.1| PREDICTED: pectinesterase/pectinesterase inhibitor 18 [Camelina 
sativa]
Length=550

 Score =   288 bits (738),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 155/379 (41%), Positives = 233/379 (61%), Gaps = 14/379 (4%)
 Frame = -3

Query  1114  LCRTAIDPAACKTILKQ--TVKSYGGTPAGLLREFLADYLPSMEAAKMEFGMVRGEFTHP  941
             +C  A D  +C+ +L +  T+         LL  FL + +  +E         R      
Sbjct  57    ICHGAHDQESCQVLLSEFTTLSLSKLNRLDLLHVFLKNSVWRLERTMNMVKETRTRSNGV  116

Query  940   REVQAVADCVELMGLSINDVRDAIKDLQGSKTR---NSDAQTSLSAVLTNHLTCMEGLNP  770
             R+   +ADC E+M +S + + ++++ L+G        S+  T LS+VLTN++TC++  N 
Sbjct  117   RDEAVLADCEEMMDVSKDRMVNSMEQLRGGNLNFESYSNVHTWLSSVLTNYMTCLDTTNE  176

Query  769   PEKSPVKGILDALISRSRVALAVLAEIIGQTDEEQNFRVPFNGKFPSWVKSSDRKLVRRK  590
             P+   VK  L+ L+SR+RVALA+   ++   D+    ++     FPSW+ + DR+L+   
Sbjct  177   PK---VKPQLEDLVSRARVALAIFVSVLPARDD---LKMVLFDHFPSWLTALDRELLESD  230

Query  589   HGNLK--ADIIVSQDGKGNFTTLKKAMESVSAVSKARVFIYVKKGTYKENVEMNVKSP-V  419
                +K  A+++V++DG G F T+ +A+ +    S +R  IYVKKG YKE +++  K   +
Sbjct  231   PKTIKVNANVVVAKDGSGKFKTVNEAVAAAPENSNSRYVIYVKKGVYKETIDIGKKKKNL  290

Query  418   MIYGDGMTQTVFSGDHSFGDNYTTFKSYTLASKGPAAILQDLCVRNTAGAAKHQAVALLV  239
             M+ GDG   T+ +G  +  D  TTF+S T+A+ G   + QDL ++NTAG AKHQAVAL V
Sbjct  291   MLVGDGKDATIITGSLNVVDGSTTFRSATIAANGDGFMAQDLWIQNTAGPAKHQAVALRV  350

Query  238   GGDKSIINRCRLEGYQDTLYAHSKRQFYRDCTITGTIDFVFGDAAVVLQNCTLIAKKPLA  59
               D+++INRCR++ YQDTLY H+ RQFYRD  ITGT+DF+FG++AVV QNC ++A+KP A
Sbjct  351   SADQTVINRCRIDAYQDTLYTHTLRQFYRDSFITGTVDFIFGNSAVVFQNCDIVARKPGA  410

Query  58    AQKNMVTAQGRSDPNQNTG  2
              QKNMVTAQGR D NQNT 
Sbjct  411   GQKNMVTAQGREDQNQNTA  429



>ref|XP_010553426.1| PREDICTED: pectinesterase/pectinesterase inhibitor 18 [Tarenaya 
hassleriana]
Length=555

 Score =   286 bits (732),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 153/384 (40%), Positives = 238/384 (62%), Gaps = 17/384 (4%)
 Frame = -3

Query  1114  LCRTAIDPAACKTILKQTVKSYGGTPA------GLLREFLADYLPSMEAAKMEFGMVRGE  953
             +C+ A D  +C + L + +++   +P       GL+  FL   +  +E         +  
Sbjct  55    ICQGAHDKDSCHSHLSE-LETSPASPLSKLKRLGLMHGFLKSSVSRLENVMEAVNEAKNR  113

Query  952   FTHPREVQAVADCVELMGLSINDVRDAIKDLQGSKT--RNSDAQTSLSAVLTNHLTCMEG  779
                 R+   +ADC EL+ +S + + +++++L+G+ +    S+  + LS+VLTN++TC++G
Sbjct  114   ANRARDFAGLADCEELLDVSKDRMVNSMEELRGNPSFLSYSNVHSWLSSVLTNYMTCLDG  173

Query  778   LNPP--EKSPVKGILDALISRSRVALAVLAEIIGQTDEEQNFRVPFNGKFPSWVKSSDRK  605
             +N     K  V+  L+ L+SR+R  LA+   I   +  E +     +G+FP W+ +  RK
Sbjct  174   INDSIEAKREVEPKLEDLVSRARAGLALFVSI---SPSETDMIKTVSGEFPRWLTAXXRK  230

Query  604   LVRRKHGNLKA--DIIVSQDGKGNFTTLKKAMESVSAVSKARVFIYVKKGTYKENVEM-N  434
             L+  +   ++A  D++V+ DG G + T+ +A+ +  A S+ R  I+VKKG YKENV++  
Sbjct  231   LLESEPVKVQANADVVVATDGSGKYKTVNEAVAAAPANSQKRYVIFVKKGVYKENVDIAK  290

Query  433   VKSPVMIYGDGMTQTVFSGDHSFGDNYTTFKSYTLASKGPAAILQDLCVRNTAGAAKHQA  254
              K  +MI G+G   T+ +G  +  D  TTF+S TLA+ G   + QD+  +NTAG  KHQA
Sbjct  291   NKKNLMIVGEGQDATIITGSLNVVDGSTTFRSATLAANGDGFMAQDIWFQNTAGPQKHQA  350

Query  253   VALLVGGDKSIINRCRLEGYQDTLYAHSKRQFYRDCTITGTIDFVFGDAAVVLQNCTLIA  74
             VAL V  D+++INRCR++ YQDTLY H+ RQFYRD  ITGT+DF+FG+AAVV QNC ++A
Sbjct  351   VALRVSADQAVINRCRIDAYQDTLYTHTLRQFYRDSYITGTVDFIFGNAAVVFQNCDIVA  410

Query  73    KKPLAAQKNMVTAQGRSDPNQNTG  2
             +KP   QKNM+TAQGR DPNQNTG
Sbjct  411   RKPDKGQKNMLTAQGREDPNQNTG  434



>ref|XP_010458561.1| PREDICTED: pectinesterase/pectinesterase inhibitor 18-like [Camelina 
sativa]
Length=547

 Score =   285 bits (730),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 155/379 (41%), Positives = 232/379 (61%), Gaps = 14/379 (4%)
 Frame = -3

Query  1114  LCRTAIDPAACKTILKQ-TVKSYGG-TPAGLLREFLADYLPSMEAAKMEFGMVRGEFTHP  941
             +C    D  +C+ +L + T+ S        LL  FL + +  +E         R      
Sbjct  54    ICHRTHDQDSCQVLLSEFTMLSLSKLNRLDLLHVFLKNSVWRLERTMTMVKEARTSSNGV  113

Query  940   REVQAVADCVELMGLSINDVRDAIKDLQGSKTR---NSDAQTSLSAVLTNHLTCMEGLNP  770
             R+   +ADC E+M +S + + ++++ L+G        S+  T LS+VLTN++TC++  N 
Sbjct  114   RDEAVLADCEEMMDVSKDRMVNSMEQLRGGNLNFESYSNVHTWLSSVLTNYMTCLDTTNE  173

Query  769   PEKSPVKGILDALISRSRVALAVLAEIIGQTDEEQNFRVPFNGKFPSWVKSSDRKLVRRK  590
             P    VK  L+ L+SR+RVALA+   ++   D+    ++     FPSW+ + DR+L+   
Sbjct  174   PR---VKPQLEDLVSRARVALAIFVSVLPARDD---LKMVLFDHFPSWLTALDRELLESA  227

Query  589   HGNLK--ADIIVSQDGKGNFTTLKKAMESVSAVSKARVFIYVKKGTYKENVEMNVKSP-V  419
                LK  A+++V++DG G + T+ +A+ +    S +R  IYVKKG YKE +++  K   +
Sbjct  228   PKTLKVNANVVVAKDGSGKYKTVNEAVAAAPENSNSRYVIYVKKGVYKETIDIGKKKKNL  287

Query  418   MIYGDGMTQTVFSGDHSFGDNYTTFKSYTLASKGPAAILQDLCVRNTAGAAKHQAVALLV  239
             M+ GDG   T+ +G  +  D  TTF+S T+A+ G   + QDL ++NTAG AKHQAVAL V
Sbjct  288   MLVGDGKDATIITGSLNVVDGSTTFRSATIAANGDGFMAQDLWIQNTAGPAKHQAVALRV  347

Query  238   GGDKSIINRCRLEGYQDTLYAHSKRQFYRDCTITGTIDFVFGDAAVVLQNCTLIAKKPLA  59
               D+++INRCR++ YQDTLY H+ RQFYRD  ITGT+DF+FG++AVV QNC ++A+KP A
Sbjct  348   SADQTVINRCRIDAYQDTLYTHTLRQFYRDSFITGTVDFIFGNSAVVFQNCDIVARKPGA  407

Query  58    AQKNMVTAQGRSDPNQNTG  2
              QKNMVTAQGR D NQNT 
Sbjct  408   GQKNMVTAQGREDQNQNTA  426



>ref|NP_172624.1| methylesterase PCR A [Arabidopsis thaliana]
 sp|Q1JPL7.3|PME18_ARATH RecName: Full=Pectinesterase/pectinesterase inhibitor 18; AltName: 
Full=AtPMEpcrA; Contains: RecName: Full=Pectinesterase 
inhibitor 18; AltName: Full=Pectin methylesterase inhibitor 
18; Contains: RecName: Full=Bifunctional pectinesterase 18/rRNA 
N-glycosylase; Short=PE 18; AltName: Full=Pectin methylesterase 
18; AltName: Full=Pectin methylesterase 4; Short=AtPME4; 
AltName: Full=Ribosome-inactivating protein; Flags: Precursor 
[Arabidopsis thaliana]
 gb|ABF57292.1| At1g11580 [Arabidopsis thaliana]
 gb|AEE28755.1| methylesterase PCR A [Arabidopsis thaliana]
Length=557

 Score =   285 bits (730),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 154/382 (40%), Positives = 232/382 (61%), Gaps = 14/382 (4%)
 Frame = -3

Query  1114  LCRTAIDPAACKTILKQ--TVKSYGGTPAGLLREFLADYLPSMEAAKMEFGMVRGEFTHP  941
             +C  A D  +C+ +L +  T+         LL  FL + +  +E+        R      
Sbjct  58    ICHGAHDQDSCQALLSEFTTLSLSKLNRLDLLHVFLKNSVWRLESTMTMVSEARIRSNGV  117

Query  940   REVQAVADCVELMGLSINDVRDAIKDLQGSK---TRNSDAQTSLSAVLTNHLTCMEGLNP  770
             R+    ADC E+M +S + +  ++++L+G        S+  T LS+VLTN++TC+E ++ 
Sbjct  118   RDKAGFADCEEMMDVSKDRMMSSMEELRGGNYNLESYSNVHTWLSSVLTNYMTCLESISD  177

Query  769   ---PEKSPVKGILDALISRSRVALAVLAEIIGQTDEEQNFRVPFNGKFPSWVKSSDRKLV  599
                  K  VK  L+ L+SR+RVALA+   ++   D+    ++  + +FPSW+ + DRKL+
Sbjct  178   VSVNSKQIVKPQLEDLVSRARVALAIFVSVLPARDD---LKMIISNRFPSWLTALDRKLL  234

Query  598   RRKHGNLK--ADIIVSQDGKGNFTTLKKAMESVSAVSKARVFIYVKKGTYKENVEMNVKS  425
                   LK  A+++V++DG G F T+ +A+ +    S  R  IYVKKG YKE +++  K 
Sbjct  235   ESSPKTLKVTANVVVAKDGTGKFKTVNEAVAAAPENSNTRYVIYVKKGVYKETIDIGKKK  294

Query  424   P-VMIYGDGMTQTVFSGDHSFGDNYTTFKSYTLASKGPAAILQDLCVRNTAGAAKHQAVA  248
               +M+ GDG   T+ +G  +  D  TTF+S T+A+ G   + QD+  +NTAG AKHQAVA
Sbjct  295   KNLMLVGDGKDATIITGSLNVIDGSTTFRSATVAANGDGFMAQDIWFQNTAGPAKHQAVA  354

Query  247   LLVGGDKSIINRCRLEGYQDTLYAHSKRQFYRDCTITGTIDFVFGDAAVVLQNCTLIAKK  68
             L V  D+++INRCR++ YQDTLY H+ RQFYRD  ITGT+DF+FG++AVV QNC ++A+ 
Sbjct  355   LRVSADQTVINRCRIDAYQDTLYTHTLRQFYRDSYITGTVDFIFGNSAVVFQNCDIVARN  414

Query  67    PLAAQKNMVTAQGRSDPNQNTG  2
             P A QKNM+TAQGR D NQNT 
Sbjct  415   PGAGQKNMLTAQGREDQNQNTA  436



>gb|AAK59760.1| At1g11580/T23J18_33 [Arabidopsis thaliana]
Length=557

 Score =   285 bits (730),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 154/382 (40%), Positives = 232/382 (61%), Gaps = 14/382 (4%)
 Frame = -3

Query  1114  LCRTAIDPAACKTILKQ--TVKSYGGTPAGLLREFLADYLPSMEAAKMEFGMVRGEFTHP  941
             +C  A D  +C+ +L +  T+         LL  FL + +  +E+        R      
Sbjct  58    ICHGAHDQDSCQALLSEFTTLSLSKLNRLDLLHVFLKNSVWRLESTMTMVSEARIRSNGV  117

Query  940   REVQAVADCVELMGLSINDVRDAIKDLQGSK---TRNSDAQTSLSAVLTNHLTCMEGLNP  770
             R+    ADC E+M +S + +  ++++L+G        S+  T LS+VLTN++TC+E ++ 
Sbjct  118   RDKAGFADCEEMMDVSKDRMMSSMEELRGGNYNLESYSNVHTWLSSVLTNYMTCLESISD  177

Query  769   ---PEKSPVKGILDALISRSRVALAVLAEIIGQTDEEQNFRVPFNGKFPSWVKSSDRKLV  599
                  K  VK  L+ L+SR+RVALA+   ++   D+    ++  + +FPSW+ + DRKL+
Sbjct  178   VSVNSKQIVKPQLEDLVSRARVALAIFVSVLPARDD---LKMIISNRFPSWLTALDRKLL  234

Query  598   RRKHGNLK--ADIIVSQDGKGNFTTLKKAMESVSAVSKARVFIYVKKGTYKENVEMNVKS  425
                   LK  A+++V++DG G F T+ +A+ +    S  R  IYVKKG YKE +++  K 
Sbjct  235   ESSPKTLKVTANVVVAKDGTGKFKTVNEAVAAAPENSNTRYVIYVKKGVYKETIDIGKKK  294

Query  424   P-VMIYGDGMTQTVFSGDHSFGDNYTTFKSYTLASKGPAAILQDLCVRNTAGAAKHQAVA  248
               +M+ GDG   T+ +G  +  D  TTF+S T+A+ G   + QD+  +NTAG AKHQAVA
Sbjct  295   KNLMLVGDGKDATIITGSLNVIDGSTTFRSATVAANGDGFMAQDIWFQNTAGPAKHQAVA  354

Query  247   LLVGGDKSIINRCRLEGYQDTLYAHSKRQFYRDCTITGTIDFVFGDAAVVLQNCTLIAKK  68
             L V  D+++INRCR++ YQDTLY H+ RQFYRD  ITGT+DF+FG++AVV QNC ++A+ 
Sbjct  355   LRVSADQTVINRCRIDAYQDTLYTHTLRQFYRDSYITGTVDFIFGNSAVVFQNCDIVARN  414

Query  67    PLAAQKNMVTAQGRSDPNQNTG  2
             P A QKNM+TAQGR D NQNT 
Sbjct  415   PGAGQKNMLTAQGREDQNQNTA  436



>ref|XP_010493017.1| PREDICTED: pectinesterase/pectinesterase inhibitor 18-like [Camelina 
sativa]
Length=547

 Score =   285 bits (729),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 155/379 (41%), Positives = 230/379 (61%), Gaps = 14/379 (4%)
 Frame = -3

Query  1114  LCRTAIDPAACKTILKQ--TVKSYGGTPAGLLREFLADYLPSMEAAKMEFGMVRGEFTHP  941
             +C    D  +C+ +L +  T+         LL  FL + +  +E         R      
Sbjct  54    ICHGTHDQDSCQVLLSEFTTLSLSKLNRLDLLHVFLKNSVWRLERTMNMVKEARTSSNGV  113

Query  940   REVQAVADCVELMGLSINDVRDAIKDLQGSKTR---NSDAQTSLSAVLTNHLTCMEGLNP  770
             R+   +ADC E+M  S + + ++++ L+G        S+  T LS+VLTN++TC++  N 
Sbjct  114   RDEAVLADCEEMMDASKDRMVNSMEQLRGGNLNFESYSNVHTWLSSVLTNYMTCLDTTNE  173

Query  769   PEKSPVKGILDALISRSRVALAVLAEIIGQTDEEQNFRVPFNGKFPSWVKSSDRKLVRRK  590
             P    VK  L+ L+SR+RVALA+   ++   D+    ++     FPSW+ + DR+L+   
Sbjct  174   PR---VKPQLEDLVSRARVALAIFVSVLPARDD---LKMVLFDHFPSWLTALDRELLESD  227

Query  589   HGNLK--ADIIVSQDGKGNFTTLKKAMESVSAVSKARVFIYVKKGTYKENVEMNVKSP-V  419
                LK  A+++V++DG G + T+ +A+ +    S +R  IYVKKG YKE +++  K   +
Sbjct  228   PKTLKVNANVVVAKDGSGKYKTVNEAVAAAPENSNSRYVIYVKKGVYKETIDIGKKKKNL  287

Query  418   MIYGDGMTQTVFSGDHSFGDNYTTFKSYTLASKGPAAILQDLCVRNTAGAAKHQAVALLV  239
             M+ GDG   TV +G  +  D  TTF+S T+A+ G   + QDL ++NTAG AKHQAVAL V
Sbjct  288   MLVGDGKDATVITGSLNVVDGSTTFRSATIAANGDGFMAQDLWIQNTAGPAKHQAVALRV  347

Query  238   GGDKSIINRCRLEGYQDTLYAHSKRQFYRDCTITGTIDFVFGDAAVVLQNCTLIAKKPLA  59
               D+++INRCR++ YQDTLY H+ RQFYRD  ITGT+DF+FG++AVV QNC ++A+KP A
Sbjct  348   SADQTVINRCRIDAYQDTLYTHTLRQFYRDSYITGTVDFIFGNSAVVFQNCDIVARKPGA  407

Query  58    AQKNMVTAQGRSDPNQNTG  2
              QKNMVTAQGR D NQNT 
Sbjct  408   GQKNMVTAQGREDQNQNTA  426



>gb|AFC98398.1| pectin methylesterase [Lepidium sativum]
Length=556

 Score =   285 bits (728),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 155/382 (41%), Positives = 232/382 (61%), Gaps = 14/382 (4%)
 Frame = -3

Query  1114  LCRTAIDPAACKTILKQ--TVKSYGGTPAGLLREFLADYLPSMEAAKMEFGMVRGEFTHP  941
             +C    D  +C+ +L +  T+         LL+ FL + +  +E         R      
Sbjct  57    ICHGVHDQDSCQVLLSEFTTLPLSKVNRQDLLQVFLKNSVWRLERTTSIVKEARTSSNGL  116

Query  940   REVQAVADCVELMGLSINDVRDAIKDLQGSKTR---NSDAQTSLSAVLTNHLTCMEGLNP  770
              +   ++DC E+M +S + +  +IK+L+G        S+  T LS+VLTN++TC E +  
Sbjct  117   NDKVGLSDCDEMMDVSKDRMVSSIKELRGGNLELESYSNVHTWLSSVLTNYMTCQESITD  176

Query  769   ---PEKSPVKGILDALISRSRVALAVLAEIIGQTDEEQNFRVPFNGKFPSWVKSSDRKLV  599
                   S V   L+ L+SR+RVALA+   +    D+ Q   +  +  FPSW+ + DRKL+
Sbjct  177   VSVDSNSRVMPQLEDLVSRARVALAIFVSVTPVKDDLQ---MIVSNHFPSWLTTFDRKLL  233

Query  598   RRKHGNLK--ADIIVSQDGKGNFTTLKKAMESVSAVSKARVFIYVKKGTYKENVEMNVKS  425
                  +L+  A+++V++DG G F T+ +A+ +    S +R  +YVKKG YKE +++  K 
Sbjct  234   ESAPKSLEVNANVVVAKDGTGKFKTVNEAVTAAPENSNSRYVVYVKKGVYKETIDIGKKK  293

Query  424   P-VMIYGDGMTQTVFSGDHSFGDNYTTFKSYTLASKGPAAILQDLCVRNTAGAAKHQAVA  248
               +M+ GDG   T+ +G  +  D  TTF+S T+A+ G   + QD+ ++NTAG AKHQAVA
Sbjct  294   KNLMLVGDGKDLTIITGSLNVVDGSTTFRSATVAANGDGFMAQDIWIQNTAGPAKHQAVA  353

Query  247   LLVGGDKSIINRCRLEGYQDTLYAHSKRQFYRDCTITGTIDFVFGDAAVVLQNCTLIAKK  68
             L V  D+S+INRCR++ YQDTLY H+ RQFYRDC ITGT+DF+FG++AVV QNC ++A+K
Sbjct  354   LRVSADQSVINRCRIDAYQDTLYTHTLRQFYRDCFITGTVDFIFGNSAVVFQNCDIVARK  413

Query  67    PLAAQKNMVTAQGRSDPNQNTG  2
             P A QKNM+TAQGR DPNQNT 
Sbjct  414   PDAGQKNMLTAQGREDPNQNTA  435



>ref|XP_002889876.1| At1g11580/T23J18_33 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH66135.1| At1g11580/T23J18_33 [Arabidopsis lyrata subsp. lyrata]
Length=556

 Score =   283 bits (723),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 154/382 (40%), Positives = 233/382 (61%), Gaps = 14/382 (4%)
 Frame = -3

Query  1114  LCRTAIDPAACKTILKQ--TVKSYGGTPAGLLREFLADYLPSMEAAKMEFGMVRGEFTHP  941
             +C  A +  +C+ +L +  T+         LL  FL + +  +E+        R      
Sbjct  57    ICHGAHNQDSCQALLSEFTTLSLSKVNRLDLLHVFLKNSVWRLESTMTMVSEARIRSNGV  116

Query  940   REVQAVADCVELMGLSINDVRDAIKDLQGSK---TRNSDAQTSLSAVLTNHLTCMEGLNP  770
             R+   +ADC E+M +S + +  ++++L+G        S+  T LS+VLTN++TC+E ++ 
Sbjct  117   RDKAGLADCEEMMDVSKDRMVSSMEELRGGNYNLESYSNVHTWLSSVLTNYMTCLESISD  176

Query  769   ---PEKSPVKGILDALISRSRVALAVLAEIIGQTDEEQNFRVPFNGKFPSWVKSSDRKLV  599
                  K  VK  L+ L+SR+RVALA+   ++   D+    ++  +  FPSW+ + DRKL+
Sbjct  177   VSVNSKPRVKPQLEDLVSRARVALAIFVSVLPARDD---LKMIISNSFPSWLTALDRKLL  233

Query  598   RRKHGNLK--ADIIVSQDGKGNFTTLKKAMESVSAVSKARVFIYVKKGTYKENVEMNVKS  425
                   LK  A+++V++DG G F T+ +A+ +    S +R  IYVKKG YKE +++  K 
Sbjct  234   ESAPKTLKVTANVVVAKDGTGKFKTVNEAVAAAPENSNSRYVIYVKKGVYKETIDIGKKK  293

Query  424   P-VMIYGDGMTQTVFSGDHSFGDNYTTFKSYTLASKGPAAILQDLCVRNTAGAAKHQAVA  248
               +M+ GDG   TV +G  +  D  TTF+S T+A+ G   + QD+  +NTAG AKHQAVA
Sbjct  294   KNLMLVGDGKDVTVITGSLNVIDGSTTFRSATVAANGDGFMAQDIWFQNTAGPAKHQAVA  353

Query  247   LLVGGDKSIINRCRLEGYQDTLYAHSKRQFYRDCTITGTIDFVFGDAAVVLQNCTLIAKK  68
             L V  D+++INRCR++ YQDTLY H+ RQFYRD  ITGT+DF+FG++AVV QNC ++A+ 
Sbjct  354   LRVSADQTVINRCRIDAYQDTLYTHTLRQFYRDSYITGTVDFIFGNSAVVFQNCDIVARN  413

Query  67    PLAAQKNMVTAQGRSDPNQNTG  2
             P A QKNM+TAQGR D NQNT 
Sbjct  414   PGAGQKNMLTAQGREDQNQNTA  435



>pir||S00629 pectinesterase (EC 3.1.1.11) precursor (clone PE1) - tomato
 emb|CAA30746.1| unnamed protein product [Solanum lycopersicum]
Length=389

 Score =   278 bits (710),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 140/248 (56%), Positives = 178/248 (72%), Gaps = 4/248 (2%)
 Frame = -3

Query  742  LDALISRSRVALAVLAEIIGQTDEEQNFRVPFNGKFPSWVKSSDRKLVRRKHGNLKADII  563
            LD LISR++VALA+LA +    DE      P  GK PSWV S DRKL+     ++ A+ +
Sbjct  7    LDELISRAKVALAMLASVTTPNDEVLR---PGLGKMPSWVSSRDRKLMESSGKDIGANAV  63

Query  562  VSQDGKGNFTTLKKAMESVSAVSKARVFIYVKKGTYKENVEMNV-KSPVMIYGDGMTQTV  386
            V++DG G + TL +A+ +    SK R  IYVK+GTYKENVE++  K  +MI GDGM  T+
Sbjct  64   VAKDGTGKYRTLAEAVAAAPDKSKTRYVIYVKRGTYKENVEVSSRKMNLMIIGDGMYATI  123

Query  385  FSGDHSFGDNYTTFKSYTLASKGPAAILQDLCVRNTAGAAKHQAVALLVGGDKSIINRCR  206
             +G  +  D  TTF S TLA+ G   ILQD+C++NTAG AKHQAVAL VG DKS+INRCR
Sbjct  124  ITGSLNVVDGSTTFHSATLAAVGKGFILQDICIQNTAGPAKHQAVALRVGADKSVINRCR  183

Query  205  LEGYQDTLYAHSKRQFYRDCTITGTIDFVFGDAAVVLQNCTLIAKKPLAAQKNMVTAQGR  26
            ++ YQDTLYAHS+RQFY+   +TGTIDF+FG+AAVV Q C L+A+KP   Q+NMVTAQGR
Sbjct  184  IDAYQDTLYAHSQRQFYQSSYVTGTIDFIFGNAAVVFQKCQLVARKPGKYQQNMVTAQGR  243

Query  25   SDPNQNTG  2
            +DPNQ TG
Sbjct  244  TDPNQATG  251



>gb|KFK43434.1| hypothetical protein AALP_AA1G125000 [Arabis alpina]
Length=556

 Score =   281 bits (720),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 157/382 (41%), Positives = 231/382 (60%), Gaps = 14/382 (4%)
 Frame = -3

Query  1114  LCRTAIDPAACKTILKQ--TVKSYGGTPAGLLREFLADYLPSMEAAKMEFGMVRGEFTHP  941
             +C  A D A+C+ +L +  T+         LL  FL + +  +++        +      
Sbjct  57    ICHGAHDQASCQALLSEFTTLSLSKLNRLDLLHVFLKNSVWRLDSTMNTVNEAKTRSNGV  116

Query  940   REVQAVADCVELMGLSINDVRDAIKDLQGSKTR---NSDAQTSLSAVLTNHLTCMEGLNP  770
             R+    ADC E+M +S + V  +I++L+G        S+  T LS+VLTN++TC++ ++ 
Sbjct  117   RDEAHFADCEEMMDVSKDRVISSIEELRGGNLNLESYSNVHTWLSSVLTNYMTCLDSISD  176

Query  769   PE---KSPVKGILDALISRSRVALAVLAEIIGQTDEEQNFRVPFNGKFPSWVKSSDRKLV  599
                  K  VK  L+ L+SR+RVALA+   ++   DE     + F   FP W+ + DRKL+
Sbjct  177   ISIDSKLSVKPKLEDLVSRARVALAIFVSVLPSRDE---LDMIFPIHFPYWLTALDRKLL  233

Query  598   RRKHGNLK--ADIIVSQDGKGNFTTLKKAMESVSAVSKARVFIYVKKGTYKENVEMNVKS  425
                   L+  A++IV++DG G + T+ +A+ +    S  R  IYVKKG YKE +++  K 
Sbjct  234   ESTPKTLEVTANVIVAKDGTGKYKTVNEAVTAAPENSNTRYVIYVKKGVYKETIDIGKKK  293

Query  424   P-VMIYGDGMTQTVFSGDHSFGDNYTTFKSYTLASKGPAAILQDLCVRNTAGAAKHQAVA  248
               +M+ GDG   T+ +G  +  D  TTF+S T+A+ G   + QD+  +NTAG  KHQAVA
Sbjct  294   KNLMLVGDGKDLTIITGSLNVIDGSTTFRSATVAANGDGFMAQDIWFQNTAGPDKHQAVA  353

Query  247   LLVGGDKSIINRCRLEGYQDTLYAHSKRQFYRDCTITGTIDFVFGDAAVVLQNCTLIAKK  68
             L V  D+++INRCR++ YQDTLY HS RQFYRD  ITGT+DF+FG++AVV QNC ++A+K
Sbjct  354   LRVSADQTVINRCRIDAYQDTLYTHSLRQFYRDSYITGTVDFIFGNSAVVFQNCDIVARK  413

Query  67    PLAAQKNMVTAQGRSDPNQNTG  2
             P A QKNMVTAQGR DPNQNT 
Sbjct  414   PGAGQKNMVTAQGREDPNQNTA  435



>emb|CDM84519.1| unnamed protein product [Triticum aestivum]
Length=441

 Score =   273 bits (699),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 146/300 (49%), Positives = 194/300 (65%), Gaps = 8/300 (3%)
 Frame = -3

Query  880  RDAIKDLQGSKTRN-SDAQTSLSAVLTNHLTCMEGLN-PPEKSPVKGILDALISRSRVAL  707
            RD + D     T    DA+T LSA+LT+H+TC++GLN  P +  V   L+ L+S +  +L
Sbjct  22   RDRLADAADHTTATPEDARTWLSAMLTDHVTCLDGLNNGPPRDAVGAQLEPLMSLASASL  81

Query  706  AVLAEIIGQTDEEQNFRVPFN----GKFPSWVKSSDRKLVRRKHGNLKADIIVSQDGKGN  539
            AVL  +   T  +   R         + PSWV S+DR L+    G ++AD++V++DG G 
Sbjct  82   AVLNAVGSCTAADDIARDVLAEAAADELPSWVPSADRALLE-GSGAVQADVVVAKDGSGK  140

Query  538  FTTLKKAMESVSAVSKARVFIYVKKGTYKENVEM-NVKSPVMIYGDGMTQTVFSGDHSFG  362
            + T++ A+++     K R  IYVKKG YKEN+ +   K  +MI GDGM  TV +G  +  
Sbjct  141  YNTVQAAVDAAPDRGKRRYVIYVKKGVYKENLAVWKKKRELMIVGDGMDATVITGSRNVV  200

Query  361  DNYTTFKSYTLASKGPAAILQDLCVRNTAGAAKHQAVALLVGGDKSIINRCRLEGYQDTL  182
            D  TTF S TLA      ILQDL + NTAG  KHQAVAL V  D+++INRCR++GYQDTL
Sbjct  201  DGATTFNSATLAVAADGVILQDLRIDNTAGPEKHQAVALRVSADRAVINRCRVDGYQDTL  260

Query  181  YAHSKRQFYRDCTITGTIDFVFGDAAVVLQNCTLIAKKPLAAQKNMVTAQGRSDPNQNTG  2
            YAH  RQFYRDC ++GT+DFVFG+AA VLQNC +  ++P   QKN VTAQGR+DPNQNTG
Sbjct  261  YAHQLRQFYRDCFVSGTVDFVFGNAAAVLQNCVITTRRPARGQKNAVTAQGRTDPNQNTG  320



>emb|CDY34642.1| BnaC08g42010D [Brassica napus]
Length=451

 Score =   274 bits (700),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 143/322 (44%), Positives = 212/322 (66%), Gaps = 12/322 (4%)
 Frame = -3

Query  940  REVQAVADCVELMGLSINDVRDAIKDLQGSKTR---NSDAQTSLSAVLTNHLTCMEGLNP  770
            R+    ADC E+M +S + +  ++++L+G        S+  T LS+VLTN++TC++ ++ 
Sbjct  12   RDEAHFADCKEMMDVSKDRMVSSMEELRGGNLNLESYSNVHTWLSSVLTNYMTCLDSISD  71

Query  769  ---PEKSPVKGILDALISRSRVALAVLAEIIGQTDEEQNFRVPFNGKFPSWVKSSDRKLV  599
                 K  V+  L+ L+SR+RVAL++   +    D  +   +P +  FPSW+ S DRKL+
Sbjct  72   VSIDSKHRVQPKLEDLVSRARVALSIFVSVSPSKDYLEMI-LPIH--FPSWLNSLDRKLL  128

Query  598  RR--KHGNLKADIIVSQDGKGNFTTLKKAMESVSAVSKARVFIYVKKGTYKENVEMNVKS  425
                K   +KA+++V++DG G + T+ +A+ +    S +R  IYVKKG YKE +++  K 
Sbjct  129  ESAPKTLEVKANVVVAKDGTGKYKTVNEAVAAAPENSNSRYVIYVKKGVYKETIDIGKKK  188

Query  424  P-VMIYGDGMTQTVFSGDHSFGDNYTTFKSYTLASKGPAAILQDLCVRNTAGAAKHQAVA  248
              +M+ GDG   T+ +G  +  D  TTF+S T+A+ G   + QD+  +NTAG AKHQAVA
Sbjct  189  KNLMLVGDGKDVTIITGSLNVVDGSTTFRSATVAANGDGFMAQDIWFQNTAGPAKHQAVA  248

Query  247  LLVGGDKSIINRCRLEGYQDTLYAHSKRQFYRDCTITGTIDFVFGDAAVVLQNCTLIAKK  68
            L V  D+S+INRCR++ YQDTLY H+ RQFYRD  ITGT+DF+FG++AVV QNC ++A+K
Sbjct  249  LRVSADQSVINRCRIDAYQDTLYTHTLRQFYRDSFITGTVDFIFGNSAVVFQNCDIVARK  308

Query  67   PLAAQKNMVTAQGRSDPNQNTG  2
            P A QKNM+TAQGR DPNQNT 
Sbjct  309  PGAGQKNMLTAQGREDPNQNTA  330



>gb|ABK24761.1| unknown [Picea sitchensis]
Length=557

 Score =   275 bits (704),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 152/386 (39%), Positives = 224/386 (58%), Gaps = 21/386 (5%)
 Frame = -3

Query  1114  LCRTAIDPAACKTILKQTVKSYGGTPAGLLREFLADYLPSMEAAKMEFGMVRGEFTHPRE  935
             +C   + P  C   L   + S    P  LL   L   + ++E A   F +V       ++
Sbjct  55    VCSKTLYPEICYYSLSPHLGSSPAQPKKLLHVAL---MIALEEANKAFALV---LRFVKQ  108

Query  934   VQAVADCVELMGLSINDVRDAI-----KDLQG-SKTRNSDAQTSLSAVLTNHLTCMEGLN  773
               A+ DC+ELM ++ + +  +I      DL+   + + SD QT LSA +TN  TC++G++
Sbjct  109   TSALQDCMELMDITRDQLDSSIALLKRHDLKALMREQASDLQTWLSASITNQDTCLDGIS  168

Query  772   PPEKSPVKGILDALISRSRVALAVLAEIIGQTDEEQNFRVP--------FNGKFPSWVKS  617
                KS  + +++  +   R  ++    I     E + +  P            FPSW+  
Sbjct  169   DYSKSIARALVENSVQNVRKLISNSLAIAKAAYESRPYPSPALRLPSDSIKDDFPSWLSP  228

Query  616   SDRKLVRRKHGNLKADIIVSQDGKGNFTTLKKAMESVSAVSKARVFIYVKKGTYKENVEM  437
              DR+L+R    ++  ++IV+QDG GNF T+ +A+ +    S  R  I VKKGTYKENV++
Sbjct  229   GDRRLLRTSANDVVPNVIVAQDGSGNFKTITQAIAAAPEKSPKRYVIKVKKGTYKENVQV  288

Query  436   -NVKSPVMIYGDGMTQTVFSGDHSFGDNYTTFKSYTLASKGPAAILQDLCVRNTAGAAKH  260
                K+ +M+ G+GM  T+ +G  +  D  TTF S T A+ G   + QD+   NTAG  KH
Sbjct  289   GKTKTNIMLIGEGMEATIVTGSRNVIDGSTTFNSATFAAVGNGFMAQDMAFVNTAGPQKH  348

Query  259   QAVALLVGGDKSIINRCRLEGYQDTLYAHSKRQFYRDCTITGTIDFVFGDAAVVLQNCTL  80
             QAVAL VG D+S++ RC++  YQDTLYAHS RQFYR+C I+GT+DF+FG+AAVV Q+C L
Sbjct  349   QAVALRVGSDQSVLYRCKIAAYQDTLYAHSLRQFYRECKISGTVDFIFGNAAVVFQSCIL  408

Query  79    IAKKPLAAQKNMVTAQGRSDPNQNTG  2
             + +KP A QKN +TAQGR+DPNQNTG
Sbjct  409   VPRKPGANQKNAITAQGRTDPNQNTG  434



>sp|Q43062.1|PME_PRUPE RecName: Full=Pectinesterase/pectinesterase inhibitor PPE8B; 
Includes: RecName: Full=Pectinesterase inhibitor PPE8B; AltName: 
Full=Pectin methylesterase inhibitor PPE8B; Includes: RecName: 
Full=Pectinesterase PPE8B; Short=PE PPE8B; AltName: 
Full=Pectin methylesterase PPE8B; Flags: Precursor [Prunus persica]
 emb|CAA65237.1| pectinesterase [Prunus persica]
Length=522

 Score =   273 bits (697),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 152/353 (43%), Positives = 213/353 (60%), Gaps = 19/353 (5%)
 Frame = -3

Query  1036  AGLLREFLADYLPSMEAAKMEFGMVRGEFTHPREVQAVADCVELMGLSINDVRDAIKDLQ  857
             AG L++ + D +  + +   +F    G+F   R   A++DC++L+  S +++  ++   Q
Sbjct  57    AGSLKDTI-DAVQQVASILSQFANAFGDF---RLANAISDCLDLLDFSADELNWSLSASQ  112

Query  856   GSKTRN-------SDAQTSLSAVLTNHLTCMEGLNPPEKSPVKGILDALISRSRVALAVL  698
               K +N       SD +T LSA L N  TC  G      S V+G++ A + +     +++
Sbjct  113   NQKGKNNSTGKLSSDLRTWLSAALVNQDTCSNGFEG-TNSIVQGLISAGLGQ---VTSLV  168

Query  697   AEIIGQTDEEQNFRVPFNGKFPSWVKSSDRKLVRRKHGNLKADIIVSQDGKGNFTTLKKA  518
              E++ Q     N + P NG+ PSWVK+ DRKL++     +  D IV+QDG GNFT +  A
Sbjct  169   QELLTQVHPNSNQQGP-NGQIPSWVKTKDRKLLQAD--GVSVDAIVAQDGTGNFTNVTDA  225

Query  517   MESVSAVSKARVFIYVKKGTYKENVEMNVKS-PVMIYGDGMTQTVFSGDHSFGDNYTTFK  341
             + +    S  R  IY+K+GTYKENVE+  K   +M+ GDGM  T+ SG+ SF D +TTF+
Sbjct  226   VLAAPDYSMRRYVIYIKRGTYKENVEIKKKKWNLMMIGDGMDATIISGNRSFVDGWTTFR  285

Query  340   SYTLASKGPAAILQDLCVRNTAGAAKHQAVALLVGGDKSIINRCRLEGYQDTLYAHSKRQ  161
             S T A  G   I +D+   NTAG  KHQAVAL    D S+  RC + GYQDTLY H+ RQ
Sbjct  286   SATFAVSGRGFIARDITFENTAGPEKHQAVALRSDSDLSVFYRCNIRGYQDTLYTHTMRQ  345

Query  160   FYRDCTITGTIDFVFGDAAVVLQNCTLIAKKPLAAQKNMVTAQGRSDPNQNTG  2
             FYRDC I+GT+DF+FGDA VV QNC ++AKK L  QKN +TAQGR DPN+ TG
Sbjct  346   FYRDCKISGTVDFIFGDATVVFQNCQILAKKGLPNQKNSITAQGRKDPNEPTG  398



>ref|XP_007204326.1| hypothetical protein PRUPE_ppa004300mg [Prunus persica]
 gb|EMJ05525.1| hypothetical protein PRUPE_ppa004300mg [Prunus persica]
Length=517

 Score =   272 bits (695),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 151/353 (43%), Positives = 213/353 (60%), Gaps = 19/353 (5%)
 Frame = -3

Query  1036  AGLLREFLADYLPSMEAAKMEFGMVRGEFTHPREVQAVADCVELMGLSINDVRDAIKDLQ  857
             AG L++ + D +  + +   +F    G+F   R   A++DC++L+  S +++  ++   Q
Sbjct  52    AGSLKDTI-DAVQQVASILSQFANAFGDF---RLANAISDCLDLLDFSADELNWSLSASQ  107

Query  856   GSKTRN-------SDAQTSLSAVLTNHLTCMEGLNPPEKSPVKGILDALISRSRVALAVL  698
               K +N       SD +T LSA L N  TC  G      S V+G++ A + +     +++
Sbjct  108   NQKGKNNSTGKLSSDLRTWLSAALVNQDTCSNGFEG-TNSIVQGLISAGLGQ---VTSLV  163

Query  697   AEIIGQTDEEQNFRVPFNGKFPSWVKSSDRKLVRRKHGNLKADIIVSQDGKGNFTTLKKA  518
              E++ Q     N + P NG+ PSWVK+ DRKL++     +  D IV+QDG GNFT +  A
Sbjct  164   QELLTQVHPNSNQQGP-NGQIPSWVKTKDRKLLQAD--GVSVDAIVAQDGTGNFTNVTDA  220

Query  517   MESVSAVSKARVFIYVKKGTYKENVEMNVKS-PVMIYGDGMTQTVFSGDHSFGDNYTTFK  341
             + +    S  R  IY+K+GTY+ENVE+  K   +M+ GDGM  T+ SG+ SF D +TTF+
Sbjct  221   VLAAPDYSMRRYVIYIKRGTYRENVEIKKKKWNLMMIGDGMDATIISGNRSFVDGWTTFR  280

Query  340   SYTLASKGPAAILQDLCVRNTAGAAKHQAVALLVGGDKSIINRCRLEGYQDTLYAHSKRQ  161
             S T A  G   I +D+   NTAG  KHQAVAL    D S+  RC + GYQDTLY H+ RQ
Sbjct  281   SATFAVSGRGFIARDITFENTAGPEKHQAVALRSDSDLSVFYRCNIRGYQDTLYTHTMRQ  340

Query  160   FYRDCTITGTIDFVFGDAAVVLQNCTLIAKKPLAAQKNMVTAQGRSDPNQNTG  2
             FYRDC I+GT+DF+FGDA VV QNC ++AKK L  QKN +TAQGR DPN+ TG
Sbjct  341   FYRDCKISGTVDFIFGDATVVFQNCQILAKKGLPNQKNSITAQGRKDPNEPTG  393



>ref|XP_010273802.1| PREDICTED: pectinesterase/pectinesterase inhibitor PPE8B [Nelumbo 
nucifera]
Length=502

 Score =   271 bits (693),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 149/334 (45%), Positives = 200/334 (60%), Gaps = 23/334 (7%)
 Frame = -3

Query  955  EFTHPREVQAVADCVELM-------GLSINDVRDAIKDLQGSKTRNSDAQTSLSAVLTNH  797
            +F   R   A+ DCV+L+       G +++   +   +   +  RNSD +  LSA L N 
Sbjct  53   QFDDFRLSNALNDCVDLLDYSADELGWTLSATENPNSNDNSTGNRNSDLKAWLSAALGNQ  112

Query  796  LTCM---EGLNPPEKSPVKGILDALISRSRVALAVLAEIIGQTDEEQNF-----RVPFNG  641
             TC+   EG N   K  V G LD + S       +++E++GQ             V   G
Sbjct  113  DTCLDGFEGTNSFVKGLVAGSLDTVTS-------LVSEVLGQIPSGGRLGRKLKSVSEGG  165

Query  640  KFPSWVKSSDRKLVRRKHGNLKADIIVSQDGKGNFTTLKKAMESVSAVSKARVFIYVKKG  461
             FP+W+K SDR+L++   G + AD +V+QDG G FT++  A+ +    S+ R  IYVK+G
Sbjct  166  GFPAWMKGSDRRLLQAPAGGVSADAVVAQDGTGQFTSVMDAVLAAPDYSERRYVIYVKRG  225

Query  460  TYKENVEMNVKS-PVMIYGDGMTQTVFSGDHSFGDNYTTFKSYTLASKGPAAILQDLCVR  284
             YKENVE+  K   +MI GDGM  T+ SG  +F D +TTF+S T A  G   I +D+   
Sbjct  226  VYKENVEIKKKKWNLMIVGDGMDVTIISGSRNFVDGWTTFRSATFAVSGKGFIARDITFE  285

Query  283  NTAGAAKHQAVALLVGGDKSIINRCRLEGYQDTLYAHSKRQFYRDCTITGTIDFVFGDAA  104
            NTAG  KHQAVAL    D S   RC ++GYQDTLYAHS RQFYR+C I+GT+DF+FG+ A
Sbjct  286  NTAGPEKHQAVALRSDSDLSAYYRCAIKGYQDTLYAHSLRQFYRECRISGTVDFIFGNGA  345

Query  103  VVLQNCTLIAKKPLAAQKNMVTAQGRSDPNQNTG  2
            VV+QNC ++AKK L  QKN +TAQGR DPNQNTG
Sbjct  346  VVIQNCQILAKKGLPNQKNTITAQGRKDPNQNTG  379



>ref|XP_009369733.1| PREDICTED: pectinesterase/pectinesterase inhibitor PPE8B [Pyrus 
x bretschneideri]
Length=509

 Score =   271 bits (692),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 151/353 (43%), Positives = 216/353 (61%), Gaps = 19/353 (5%)
 Frame = -3

Query  1036  AGLLREFLADYLPSMEAAKMEFGMVRGEFTHPREVQAVADCVELMGLSINDVRDAIKDLQ  857
             AG LR+ + D +  +     +F    G+F   R   A++DC++L+  S +++  ++   Q
Sbjct  45    AGSLRDTI-DAVQQVATILSQFANAFGDF---RLSNAISDCLDLLDFSADELNWSLSASQ  100

Query  856   GSKTRN-------SDAQTSLSAVLTNHLTCMEGLNPPEKSPVKGILDALISRSRVALAVL  698
               K ++       SD +T LSA L N  TC +G      S VKG++   +++     +++
Sbjct  101   NQKGKSNSTGKLSSDLRTWLSAALVNQDTCSDGFEG-TNSIVKGLVSTGLNQ---VTSLV  156

Query  697   AEIIGQTDEEQNFRVPFNGKFPSWVKSSDRKLVRRKHGNLKADIIVSQDGKGNFTTLKKA  518
              +++ Q     + + P NG+ P+WVK+ DRKL++    N+  D +V+QDG GNFT +  A
Sbjct  157   QDLLTQVHPNSDHQGP-NGQIPTWVKTEDRKLLQADGVNV--DAVVAQDGTGNFTNVMDA  213

Query  517   MESVSAVSKARVFIYVKKGTYKENVEMNVKS-PVMIYGDGMTQTVFSGDHSFGDNYTTFK  341
             + +    S +R  IY+KKGTYKENVE+  K   +M+ GDGM  T+ SG+ S+ D +TTF+
Sbjct  214   VLAAPDYSMSRYVIYIKKGTYKENVEIKKKKWNLMMIGDGMDATIISGNRSYIDGWTTFR  273

Query  340   SYTLASKGPAAILQDLCVRNTAGAAKHQAVALLVGGDKSIINRCRLEGYQDTLYAHSKRQ  161
             S T A  G   I +D+   NTAG  KHQAVAL    D S+  RC + GYQDTLYAH+ RQ
Sbjct  274   SATFAVSGRGFIARDITFENTAGPQKHQAVALRSDSDLSVFYRCEIRGYQDTLYAHTMRQ  333

Query  160   FYRDCTITGTIDFVFGDAAVVLQNCTLIAKKPLAAQKNMVTAQGRSDPNQNTG  2
             FYRDC I+GT+DF+FGDA VV QNC ++AKK L  QKN VTAQGR DPN+ TG
Sbjct  334   FYRDCKISGTVDFIFGDATVVFQNCQILAKKGLPNQKNSVTAQGRKDPNEPTG  386



>ref|XP_004510571.1| PREDICTED: pectinesterase 3-like [Cicer arietinum]
Length=584

 Score =   272 bits (696),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 143/328 (44%), Positives = 209/328 (64%), Gaps = 15/328 (5%)
 Frame = -3

Query  940  REVQAVADCVELMGLSINDVRDAIKDLQG-----SKTRNSDAQTSLSAVLTNHLTCMEGL  776
            R  +A+  C E++  +++ + D++  + G     S  +  D +T LSA LT+H TC+E +
Sbjct  138  RLKKAIGVCGEVLDDALDRLNDSMSSIVGAGKILSPEKIRDVETWLSAALTDHATCLEAV  197

Query  775  NPPEKSPVKGIL----DALISRSRVA---LAVLAEIIGQTD--EEQNFRVPFNGKFPSWV  623
            +    +  +G+L     A+ + +  A   LA++ +IIG     E  N      G FP W+
Sbjct  198  DEVNSTAARGVLREIETAMKNSTEFASNSLAIVTKIIGLLSNFETSNHHRRLLGGFPEWL  257

Query  622  KSSDRKLVRRKHGNLKADIIVSQDGKGNFTTLKKAMESVSAVSKARVFIYVKKGTYKENV  443
             S++RKL+  +    K D +V++DG G FTT+ +A++ V+  S  R  +YVKKG Y EN+
Sbjct  258  GSAERKLLATEVNETKPDAVVAKDGTGQFTTITEALKMVNKKSVKRFVVYVKKGEYIENI  317

Query  442  EMNVKS-PVMIYGDGMTQTVFSGDHSFGDNYTTFKSYTLASKGPAAILQDLCVRNTAGAA  266
            +++ K+  VMIYGDGM++TV  G  +F D   TF++ T A KG   I +D+   NTAGA+
Sbjct  318  DIDKKTWNVMIYGDGMSETVVLGSRNFMDGTPTFETATFAVKGMGFIAKDIKFVNTAGAS  377

Query  265  KHQAVALLVGGDKSIINRCRLEGYQDTLYAHSKRQFYRDCTITGTIDFVFGDAAVVLQNC  86
            KHQAVAL  G D+S+  RC   GYQDTLYAHS RQFYR+C ITGTIDF+FG+AAVV QNC
Sbjct  378  KHQAVALRSGSDRSVFYRCSFVGYQDTLYAHSNRQFYRECDITGTIDFIFGNAAVVFQNC  437

Query  85   TLIAKKPLAAQKNMVTAQGRSDPNQNTG  2
             ++ ++P++ Q N +TAQG+ DPNQNTG
Sbjct  438  RIMPRQPMSNQFNTITAQGKKDPNQNTG  465



>ref|XP_008337790.1| PREDICTED: pectinesterase/pectinesterase inhibitor PPE8B [Malus 
domestica]
Length=509

 Score =   267 bits (683),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 147/334 (44%), Positives = 204/334 (61%), Gaps = 20/334 (6%)
 Frame = -3

Query  976  EFGMVRGEFTHPREVQAVADCVELMGLSINDVRDAIKDLQGSKTRN-------SDAQTSL  818
            +F    G+F   R   A++DC++L+  S +++  ++   Q  + ++       SD +T L
Sbjct  64   QFANAFGDF---RLSNAISDCLDLLDFSADELNWSLSASQNPEGKDNSTGKLSSDLRTWL  120

Query  817  SAVLTNHLTCMEGLNPPEKSPVKGILDALISR-SRVALAVLAEIIGQTDEEQNFRVPFNG  641
            SA L N  TC +G      S VKG++   +++ + +   +L ++   TD         NG
Sbjct  121  SAALVNQDTCSDGFEG-TNSIVKGLVSTGLNQVTSLVQGLLTQVHPNTDHHGP-----NG  174

Query  640  KFPSWVKSSDRKLVRRKHGNLKADIIVSQDGKGNFTTLKKAMESVSAVSKARVFIYVKKG  461
            + PSWVK+ DRKL+  + G +  D +V+QDG GNFT +  A+ +       R  IY+KKG
Sbjct  175  EIPSWVKTEDRKLL--QAGGVNVDAVVAQDGTGNFTNVMDAVLAAPDERMTRYVIYIKKG  232

Query  460  TYKENVEMNVKS-PVMIYGDGMTQTVFSGDHSFGDNYTTFKSYTLASKGPAAILQDLCVR  284
            TYKENVE+  K   +M+ GDGM  T+ SG+ +F D +TTF+S T A  G   I +DL   
Sbjct  233  TYKENVEIKKKKWNLMMIGDGMDATIISGNRNFVDGWTTFRSATFAVSGRGFIARDLTFE  292

Query  283  NTAGAAKHQAVALLVGGDKSIINRCRLEGYQDTLYAHSKRQFYRDCTITGTIDFVFGDAA  104
            NTAG  KHQAVAL    D S+  RC++ GYQDTLYAH+ RQFYRDC I+GT+DF+FGDA 
Sbjct  293  NTAGPEKHQAVALRSDSDLSVFYRCQIRGYQDTLYAHAMRQFYRDCKISGTVDFIFGDAT  352

Query  103  VVLQNCTLIAKKPLAAQKNMVTAQGRSDPNQNTG  2
            VV QNC ++AKK L  QKN VTAQGR DPN+ TG
Sbjct  353  VVFQNCQILAKKGLPNQKNSVTAQGRKDPNEPTG  386



>gb|AGR44473.1| pectin methylesterase 4, partial [Pyrus x bretschneideri]
Length=427

 Score =   265 bits (676),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 145/334 (43%), Positives = 203/334 (61%), Gaps = 20/334 (6%)
 Frame = -3

Query  976  EFGMVRGEFTHPREVQAVADCVELMGLSINDVRDAIKDLQGSKTRN-------SDAQTSL  818
            +F    G+F       A++DC++L+  + +++  ++   Q  + ++       SD +T L
Sbjct  34   QFATAFGDF---HLSNAISDCLDLLDFTADELNWSLSASQNPEGKDNSTGKLSSDLRTWL  90

Query  817  SAVLTNHLTCMEGLNPPEKSPVKGILDALISR-SRVALAVLAEIIGQTDEEQNFRVPFNG  641
            SA L N  TC +G      S VKG++   +++ + +   +L ++   TD         NG
Sbjct  91   SAALVNQDTCSDGFEG-TNSIVKGLVTTGLNQVTSLVQGLLTQVQPNTDHHGP-----NG  144

Query  640  KFPSWVKSSDRKLVRRKHGNLKADIIVSQDGKGNFTTLKKAMESVSAVSKARVFIYVKKG  461
            + PSWVK+ DRKL+  + G +  D +V+QDG GNFT +  A+ +    S  R  IY+K+G
Sbjct  145  EIPSWVKAEDRKLL--QAGGVNVDAVVAQDGTGNFTNVTDAVLAAPDESMTRYVIYIKRG  202

Query  460  TYKENVEMNVKS-PVMIYGDGMTQTVFSGDHSFGDNYTTFKSYTLASKGPAAILQDLCVR  284
            TYKENVE+  K   +M+ GDGM  T+ SG  +F D +TTF+S T A  G   I +DL   
Sbjct  203  TYKENVEIKKKKWNLMMIGDGMDATIISGSRNFVDGWTTFRSATFAVSGRGFIARDLTFE  262

Query  283  NTAGAAKHQAVALLVGGDKSIINRCRLEGYQDTLYAHSKRQFYRDCTITGTIDFVFGDAA  104
            NTAG  KHQAVAL    D S+  RC++ GYQDTLYAH+ RQFYRDC I+GT+DF+FGDA 
Sbjct  263  NTAGPEKHQAVALRSDSDLSVFYRCQIRGYQDTLYAHAMRQFYRDCKISGTVDFIFGDAT  322

Query  103  VVLQNCTLIAKKPLAAQKNMVTAQGRSDPNQNTG  2
            VV QNC ++AKK L  QKN VTAQGR DPN+ TG
Sbjct  323  VVFQNCQILAKKGLPNQKNSVTAQGRKDPNEPTG  356



>ref|XP_008242144.1| PREDICTED: pectinesterase/pectinesterase inhibitor PPE8B [Prunus 
mume]
Length=517

 Score =   266 bits (681),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 151/353 (43%), Positives = 211/353 (60%), Gaps = 19/353 (5%)
 Frame = -3

Query  1036  AGLLREFLADYLPSMEAAKMEFGMVRGEFTHPREVQAVADCVELMGLSINDVRDAIKDLQ  857
             AG L++ + D +  + +    F    G+F   R   A++DC++L+  S +++  +I   Q
Sbjct  52    AGSLKDTI-DAVQQVASILSPFANAFGDF---RLSNAISDCLDLLDFSADELNWSISASQ  107

Query  856   GSKTRN-------SDAQTSLSAVLTNHLTCMEGLNPPEKSPVKGILDALISRSRVALAVL  698
               K +N       SD +T LSA L N  TC  G      S V+G++ A + +     +++
Sbjct  108   NQKGKNNSTGKLSSDLRTWLSAALVNQDTCSNGFEG-TNSIVQGLVSAGLDQ---VTSLV  163

Query  697   AEIIGQTDEEQNFRVPFNGKFPSWVKSSDRKLVRRKHGNLKADIIVSQDGKGNFTTLKKA  518
              E++ Q     N + P NG+ PSWVK+ DRKL++     +  D IV+QDG GNFT +  A
Sbjct  164   QELLTQVHPNSNQQGP-NGQIPSWVKTEDRKLLQAD--GVSVDAIVAQDGTGNFTNVTDA  220

Query  517   MESVSAVSKARVFIYVKKGTYKENVEMNVKS-PVMIYGDGMTQTVFSGDHSFGDNYTTFK  341
             + +    S  R  IY+K+GTYKENVE+  K   +M+ GDGM  T+ SG+ +F D +TTF+
Sbjct  221   VLAAPDYSMRRYVIYIKRGTYKENVEIKKKKWNLMMIGDGMDATIISGNRNFVDGWTTFR  280

Query  340   SYTLASKGPAAILQDLCVRNTAGAAKHQAVALLVGGDKSIINRCRLEGYQDTLYAHSKRQ  161
             S T A  G   I +D+   NTAG  KHQAVAL    D S+  RC + GYQDTLY H+ RQ
Sbjct  281   SATFAVSGRGFIARDITFENTAGPEKHQAVALRSDSDLSVFYRCNIRGYQDTLYTHTMRQ  340

Query  160   FYRDCTITGTIDFVFGDAAVVLQNCTLIAKKPLAAQKNMVTAQGRSDPNQNTG  2
             FYRDC I+GT+DF+FGDA VV QNC ++AKK L  QKN +TAQGR D N+ TG
Sbjct  341   FYRDCKISGTVDFIFGDATVVFQNCQILAKKGLPNQKNSITAQGRKDLNEPTG  393



>ref|XP_009359674.1| PREDICTED: pectinesterase/pectinesterase inhibitor PPE8B-like 
[Pyrus x bretschneideri]
Length=509

 Score =   265 bits (677),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 145/334 (43%), Positives = 203/334 (61%), Gaps = 20/334 (6%)
 Frame = -3

Query  976  EFGMVRGEFTHPREVQAVADCVELMGLSINDVRDAIKDLQGSKTRN-------SDAQTSL  818
            +F    G+F       A++DC++L+  + +++  ++   Q  + ++       SD +T L
Sbjct  64   QFATAFGDF---HLSNAISDCLDLLDFTADELNWSLSASQNPEGKDNSTGKLSSDLRTWL  120

Query  817  SAVLTNHLTCMEGLNPPEKSPVKGILDALISR-SRVALAVLAEIIGQTDEEQNFRVPFNG  641
            SA L N  TC +G      S VKG++   +++ + +   +L ++   TD         NG
Sbjct  121  SAALVNQDTCSDGFEG-TNSIVKGLVTTGLNQVTSLVQGLLTQVQPNTDHHGP-----NG  174

Query  640  KFPSWVKSSDRKLVRRKHGNLKADIIVSQDGKGNFTTLKKAMESVSAVSKARVFIYVKKG  461
            + PSWVK+ DRKL+  + G +  D +V+QDG GNFT +  A+ +    S  R  IY+K+G
Sbjct  175  EIPSWVKAEDRKLL--QAGGVNVDAVVAQDGTGNFTNVTDAVLAAPDESMTRYVIYIKRG  232

Query  460  TYKENVEMNVKS-PVMIYGDGMTQTVFSGDHSFGDNYTTFKSYTLASKGPAAILQDLCVR  284
            TYKENVE+  K   +M+ GDGM  T+ SG  +F D +TTF+S T A  G   I +DL   
Sbjct  233  TYKENVEIKKKKWNLMMIGDGMDATIISGSRNFVDGWTTFRSATFAVSGRGFIARDLTFE  292

Query  283  NTAGAAKHQAVALLVGGDKSIINRCRLEGYQDTLYAHSKRQFYRDCTITGTIDFVFGDAA  104
            NTAG  KHQAVAL    D S+  RC++ GYQDTLYAH+ RQFYRDC I+GT+DF+FGDA 
Sbjct  293  NTAGPEKHQAVALRSDSDLSVFYRCQIRGYQDTLYAHAMRQFYRDCKISGTVDFIFGDAT  352

Query  103  VVLQNCTLIAKKPLAAQKNMVTAQGRSDPNQNTG  2
            VV QNC ++AKK L  QKN VTAQGR DPN+ TG
Sbjct  353  VVFQNCQILAKKGLPNQKNSVTAQGRKDPNEPTG  386



>dbj|BAF42041.1| pectin methylesterase 4 [Pyrus communis]
Length=509

 Score =   264 bits (674),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 145/334 (43%), Positives = 202/334 (60%), Gaps = 20/334 (6%)
 Frame = -3

Query  976  EFGMVRGEFTHPREVQAVADCVELMGLSINDVRDAIKDLQGSKTRN-------SDAQTSL  818
            +F    G+F       A++DC++L+  + +++  ++   Q  + ++       SD +T L
Sbjct  64   QFATAFGDF---HLSNAISDCLDLLDFTADELNWSLSASQNPEGKDNSTGKLSSDLRTWL  120

Query  817  SAVLTNHLTCMEGLNPPEKSPVKGILDALISR-SRVALAVLAEIIGQTDEEQNFRVPFNG  641
            SA L N  TC +G      S VKG++   +++ + +   +L ++   TD         NG
Sbjct  121  SAALVNQDTCSDGFEG-TNSIVKGLVTTGLNQVTSLVQGLLTQVQPNTDHHGP-----NG  174

Query  640  KFPSWVKSSDRKLVRRKHGNLKADIIVSQDGKGNFTTLKKAMESVSAVSKARVFIYVKKG  461
            + PSWVK+ DRKL+  + G +  D +V+QDG GNFT +  A+ +    S  R  IY+K G
Sbjct  175  EIPSWVKAEDRKLL--QAGGVNVDAVVAQDGTGNFTNVTDAVLAAPDESMTRYVIYIKGG  232

Query  460  TYKENVEMNVKS-PVMIYGDGMTQTVFSGDHSFGDNYTTFKSYTLASKGPAAILQDLCVR  284
            TYKENVE+  K   +M+ GDGM  T+ SG  +F D +TTF+S T A  G   I +DL   
Sbjct  233  TYKENVEIKKKKWNLMMIGDGMDATIISGSRNFVDGWTTFRSATFAVSGRGFIARDLTFE  292

Query  283  NTAGAAKHQAVALLVGGDKSIINRCRLEGYQDTLYAHSKRQFYRDCTITGTIDFVFGDAA  104
            NTAG  KHQAVAL    D S+  RC++ GYQDTLYAH+ RQFYRDC I+GT+DF+FGDA 
Sbjct  293  NTAGPEKHQAVALRSDSDLSVFYRCQIRGYQDTLYAHAMRQFYRDCKISGTVDFIFGDAT  352

Query  103  VVLQNCTLIAKKPLAAQKNMVTAQGRSDPNQNTG  2
            VV QNC ++AKK L  QKN VTAQGR DPN+ TG
Sbjct  353  VVFQNCQILAKKGLPNQKNSVTAQGRKDPNEPTG  386



>ref|XP_010932330.1| PREDICTED: pectinesterase-like [Elaeis guineensis]
Length=537

 Score =   263 bits (673),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 153/330 (46%), Positives = 198/330 (60%), Gaps = 18/330 (5%)
 Frame = -3

Query  940  REVQAVADCVELMGLSINDVRDAIKDLQ--------GSKTRNSDAQTSLSAVLTNHLTC-  788
            R   AV+DC++L+ LS +++   I   Q        G+  R SD ++ LSA L N  TC 
Sbjct  86   RLSSAVSDCLDLLDLSSDEISSTISASQPSTASATAGTGNRRSDVRSWLSAALGNQETCK  145

Query  787  --MEGLNPPEKSPVKGILDALISRSRVALA-VLAEIIGQTDEEQNFRVPFNGK----FPS  629
              +EG N    S V G L ++ S    +L  V A   G        R    GK    FP 
Sbjct  146  ESLEGTNSVLGSLVSGGLQSITSLVADSLRDVAAGSGGVGGAGNAGRRRLMGKVSDGFPG  205

Query  628  WVKSSDRKLVRRKHGNLKADIIVSQDGKGNFTTLKKAMESVSAVSKARVFIYVKKGTYKE  449
            WV   DR+L++   G   AD +V++DG G +TT+  A+ +    S  R  IYVKKG YKE
Sbjct  206  WVSLGDRRLLQAPAGT-AADAVVAKDGSGKYTTVGAAVAAAPTESTKRYVIYVKKGAYKE  264

Query  448  NVEMNVKS-PVMIYGDGMTQTVFSGDHSFGDNYTTFKSYTLASKGPAAILQDLCVRNTAG  272
            NVE+  K+  +M+ GDG+ QT+ SG  +F D +TT++S T A  G   I++DL + NTAG
Sbjct  265  NVEIKKKTWNIMLVGDGLGQTIISGSRNFVDGWTTYRSATFAVSGKGFIVRDLTIENTAG  324

Query  271  AAKHQAVALLVGGDKSIINRCRLEGYQDTLYAHSKRQFYRDCTITGTIDFVFGDAAVVLQ  92
             +KHQAVAL    D S+  RC   GYQDTLYAHS RQFYR+C I GT+DFVFGDAA V Q
Sbjct  325  PSKHQAVALRSDSDLSVYYRCSFLGYQDTLYAHSLRQFYRECRIAGTVDFVFGDAAAVFQ  384

Query  91   NCTLIAKKPLAAQKNMVTAQGRSDPNQNTG  2
            +CTL+A++PL  QKN VTAQGR DPNQNTG
Sbjct  385  SCTLLARRPLPDQKNSVTAQGRKDPNQNTG  414



>ref|XP_010271268.1| PREDICTED: pectinesterase-like [Nelumbo nucifera]
Length=529

 Score =   263 bits (671),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 144/322 (45%), Positives = 198/322 (61%), Gaps = 21/322 (7%)
 Frame = -3

Query  928  AVADCVELMGLSINDVRDAIKDLQGSKT--RNSDAQTSLSAVLTNHLTCMEG---LNPPE  764
            A ADCVEL      D    +    GSK     SDAQT LSA +TN  TC  G   LN P 
Sbjct  96   AWADCVELYA----DTVTQLNRTMGSKNPLSWSDAQTWLSAAITNEQTCQNGFTELNLPS  151

Query  763  K--------SPVKGILDALISRSRVALAVLAEIIGQTDEEQNFRVPFNGKFPSWVKSSDR  608
                     S    ++   ++ ++ A + +A ++G+  +  N R+  +G FP+WV ++DR
Sbjct  152  YLSSFPFMLSNFSKMVSNSLAINKAAASSVASLMGK--QGGNRRLLSDG-FPTWVSAADR  208

Query  607  KLVRRKHGNLKADIIVSQDGKGNFTTLKKAMESVSAVSKARVFIYVKKGTYKENVEMNVK  428
            KL++      +AD++V+ DG GN+ T+ +A+ + S  S  R  IYVK+G YKENVE+   
Sbjct  209  KLLQSSSAASQADVVVAADGSGNYRTISQAVAASSKRSGKRFVIYVKRGVYKENVEIKA-  267

Query  427  SPVMIYGDGMTQTVFSGDHSFGDNYTTFKSYTLASKGPAAILQDLCVRNTAGAAKHQAVA  248
            S +M+ GDG+  T+ +G  +  D  TTF+S T+A  G   I +D+  +NTAG  KHQAVA
Sbjct  268  SNIMLIGDGIDATIVTGSKNVQDGSTTFRSATVAVTGGGFIARDMTFQNTAGPQKHQAVA  327

Query  247  LLVGGDKSIINRCRLEGYQDTLYAHSKRQFYRDCTITGTIDFVFGDAAVVLQNCTLIAKK  68
            L  G D S+  RC  +GYQDTLY +S+RQFYRDC I GT+DF+FGDA  VLQNC +  +K
Sbjct  328  LRSGSDLSVFYRCSFKGYQDTLYVYSQRQFYRDCDIYGTVDFIFGDAVAVLQNCNIYVRK  387

Query  67   PLAAQKNMVTAQGRSDPNQNTG  2
            P++ QKN VTAQGR DPN+NTG
Sbjct  388  PMSGQKNTVTAQGRKDPNENTG  409



>ref|XP_010259481.1| PREDICTED: pectinesterase-like [Nelumbo nucifera]
Length=583

 Score =   264 bits (674),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 140/326 (43%), Positives = 204/326 (63%), Gaps = 12/326 (4%)
 Frame = -3

Query  943  PREVQAVADCVELMGLSINDVRDAIKDL--QGSKTRN-SDAQTSLSAVLTNHLTCMEGLN  773
            P E +A+ DC+EL   +I++++ A+ DL  + S +++ +D QT LSA +TN  TC++GL+
Sbjct  136  PLEQRALDDCLELFDETISELQTALSDLSPKSSPSKHYNDLQTLLSAAMTNQYTCLDGLS  195

Query  772  PPE----KSPVKGILDALISRSRVALAVLAEIIGQTDEEQNFRVP----FNGKFPSWVKS  617
                   +  +K  L+ +      +LA+L ++    D  ++   P      G+FP WV  
Sbjct  196  LGNEQVIREEIKQNLNNISHLVSNSLAMLTKMPKAADTLKDEVFPEYGKMAGRFPGWVSP  255

Query  616  SDRKLVRRKHGNLKADIIVSQDGKGNFTTLKKAMESVSAVSKARVFIYVKKGTYKENVEM  437
             DRKL++     +K D++V++DG GNF T+ +A+ +    S  R  IY+K GTY ENV++
Sbjct  256  KDRKLLQASTNTMKFDLVVAKDGSGNFRTIGEAVAAAPNSSATRFVIYIKAGTYFENVDV  315

Query  436  NVKSPVMIY-GDGMTQTVFSGDHSFGDNYTTFKSYTLASKGPAAILQDLCVRNTAGAAKH  260
              K  ++++ GDG+ +TV     +  D +TTF+S T+A  G   I +D+ + N AG +KH
Sbjct  316  GKKKTMLMFVGDGIGKTVVKASRNVVDGWTTFRSATVAVVGNGFIARDMTIENAAGPSKH  375

Query  259  QAVALLVGGDKSIINRCRLEGYQDTLYAHSKRQFYRDCTITGTIDFVFGDAAVVLQNCTL  80
            QAVAL  G D S   RC   GYQDTLY HS RQFYR+C I GT+DF+FG+AAVV QNC L
Sbjct  376  QAVALRSGSDLSAFYRCSFVGYQDTLYVHSLRQFYRECDIYGTVDFIFGNAAVVFQNCNL  435

Query  79   IAKKPLAAQKNMVTAQGRSDPNQNTG  2
             A++P A QKN+ TAQGR DPNQNTG
Sbjct  436  YARRPNANQKNIFTAQGREDPNQNTG  461



>gb|EYU28290.1| hypothetical protein MIMGU_mgv1a004392mg [Erythranthe guttata]
Length=530

 Score =   262 bits (670),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 152/347 (44%), Positives = 208/347 (60%), Gaps = 29/347 (8%)
 Frame = -3

Query  970  GMVRGEFTHPREVQAVADCVELMGLSINDVRDAI--------KDLQGSKTRNSDAQTSLS  815
            G   G+F   R+  AV+DC++LM LSI+++   +        KD  G+    SD +T LS
Sbjct  67   GAFGGDF---RQSNAVSDCLDLMDLSIDELTLTMSASKNPNAKD-NGTGNVGSDMKTWLS  122

Query  814  AVLTNHLTC---MEGLNPPEKSPVKGILDALISRSRVALAVL----------AEIIGQTD  674
              LTN  TC    EG N   KS V G LD + S     L+ +          A   G ++
Sbjct  123  GALTNQDTCSLGFEGTNGIVKSLVVGSLDQVTSLIYDMLSAVKTAPAPPPKAASSPGGSN  182

Query  673  EEQNFR--VPFNGKFPSWVKSSDRKLVRRKHGNLKADIIVSQDGKGNFTTLKKAMESVSA  500
            +    R  +P   K+P WVK+ D+ L++  +G + AD++V+ DG GNFT++K A+E+   
Sbjct  183  KGVGSRKLIPNTDKYPDWVKTHDQNLLQVANGPM-ADVVVAADGTGNFTSIKDAIEAAPE  241

Query  499  VSKARVFIYVKKGTYKENVEMNVKS-PVMIYGDGMTQTVFSGDHSFGDNYTTFKSYTLAS  323
             S  R  IYVKKG YK+ VE+  K   +M+ GDG+  TV SG+ +F D +TT+++ + A 
Sbjct  242  YSTKRYIIYVKKGVYKDYVEIGKKKWNIMMIGDGVDVTVISGNRNFIDGWTTYRTASFAV  301

Query  322  KGPAAILQDLCVRNTAGAAKHQAVALLVGGDKSIINRCRLEGYQDTLYAHSKRQFYRDCT  143
            KG   I +D+   NTAG  KHQAVA     D S++ RC   GYQDTLYAHS+RQFYR+C 
Sbjct  302  KGQGFIARDITFENTAGPEKHQAVAFRSDSDLSVLYRCAFRGYQDTLYAHSQRQFYRECV  361

Query  142  ITGTIDFVFGDAAVVLQNCTLIAKKPLAAQKNMVTAQGRSDPNQNTG  2
            ITGT+DF+FGD AVV QNC + A+K L  QKN +TAQGR +P QNTG
Sbjct  362  ITGTVDFIFGDGAVVFQNCNIQARKGLPDQKNTITAQGRKEPVQNTG  408



>ref|XP_008803239.1| PREDICTED: pectinesterase [Phoenix dactylifera]
Length=534

 Score =   262 bits (670),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 151/375 (40%), Positives = 215/375 (57%), Gaps = 11/375 (3%)
 Frame = -3

Query  1111  CRTAIDPAAC--KTILKQTVKSYGGTPAGLLREFLADYLPSMEAAKMEFGMVRGEFTHPR  938
             C + +D ++C  K  L   +KS   +P  +L   L   L  M  A      +  +    R
Sbjct  47    CSSTVDLSSCLAKATLIAGIKSQA-SPVQVLTTILNKSLDEMNVANAMATYIYDQSNETR  105

Query  937   EVQAVADCVELMGLSINDVRDAIKDLQGSKTRNSDAQTSLSAVLTNHLTCMEGLNPPEKS  758
             +  A+ADC+ LM LS +   ++   L  +K    DAQT +SAVLTNH TC++ L  P +S
Sbjct  106   QRVALADCMHLMDLSRDHATNSA--LAITKGAWIDAQTWMSAVLTNHNTCLDWLKGPARS  163

Query  757   PVKGILDALISRSRVALAVLAEIIGQTDEEQNFRVPFNGKFPSWVKSSDRKLVRRKHGN-  581
              ++ +L  L + +  +L  L  I   +   ++F        PSW+   D+KL+R    N 
Sbjct  164   AMESVLKGLTTLTATSLCALKAI---SPSSEDFFRSSAVDVPSWLPHHDKKLLRHPFKNE  220

Query  580   LKADIIVSQDGKGNFTTLKKAMESVSAVSKARVFIYVKKGTYKENVEMN-VKSPVMIYGD  404
             ++ +++V+ DG GN+ T+++AM+S    S  R  I+VK G YKE V ++  K+ +MI G+
Sbjct  221   VQPNVVVAADGSGNYKTVQQAMDSAPNSSAQRYVIHVKNGVYKETVRIHRTKTNIMIVGE  280

Query  403   GMTQTVFSGDHSFGDNYTTFKSYTLASKGPAAILQDLCVRNTAGAAKHQAVALLVGGDKS  224
             G   T+ +G  S      T  S TLA+ G   ILQDL + N AG    QAVALLV GD+S
Sbjct  281   GFDSTIITGSLSNASGVRTIHSATLAAFGAGLILQDLKIENKAGPHGVQAVALLVAGDQS  340

Query  223   IINRCRLEGYQDTLYAHSKRQFYRDCTITGTIDFVFGDAAVVLQNCTLIAKKPLAAQ-KN  47
             +INRC +EGY DTLYAHS RQFYRD  I+GT+D +FG+AA   QNC + A+KPL    KN
Sbjct  341   VINRCGIEGYHDTLYAHSNRQFYRDSWISGTVDVIFGNAAAAFQNCQIFARKPLNGHNKN  400

Query  46    MVTAQGRSDPNQNTG  2
              +TAQGR  P QN+G
Sbjct  401   TITAQGRICPTQNSG  415



>gb|EPS63648.1| pectinesterase [Genlisea aurea]
Length=514

 Score =   260 bits (665),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 145/336 (43%), Positives = 204/336 (61%), Gaps = 23/336 (7%)
 Frame = -3

Query  952  FTHPREVQAVADCVELMGLSINDVRDAIKDLQ-----GSKTRNS--DAQTSLSAVLTNHL  794
            F   R+  AV+DC++LM LS++ +  +I  +Q     G+ T N+  D +T LS  L N  
Sbjct  60   FGDFRQRNAVSDCLDLMDLSLDQMSLSISAMQHPYGKGNGTGNAAVDMRTWLSGALINQD  119

Query  793  TCMEGLNPPE---KSPVKGILDALISRSRVALAVLA--------EIIGQTDEEQNFRVPF  647
            TC EG +  +   +  V G LD + S     L+ +         E++G+ +     ++  
Sbjct  120  TCKEGFDGTDGLVRDLVAGSLDQITSLVYDILSTIKSVPKFYGNEVVGRLNGR---KLIG  176

Query  646  NGKFPSWVKSSDRKLVRRKHGNLKADIIVSQDGKGNFTTLKKAMESVSAVSKARVFIYVK  467
            + +FP W++  DR+L++   G  +AD +V+ DG GNFT + +A+ +    S  R  IYVK
Sbjct  177  DDRFPEWIRPRDRRLLQSGPG-FQADAVVAADGTGNFTRISEAVHAAPDYSTKRFIIYVK  235

Query  466  KGTYKENVEMNVKS-PVMIYGDGMTQTVFSGDHSFGDNYTTFKSYTLASKGPAAILQDLC  290
             G Y E VE++ K   VM+ GDG+  TV SG+ +F D +TT++S T A KG   I +DL 
Sbjct  236  GGVYNEYVEISKKKWNVMLIGDGINSTVISGNRNFIDGWTTYRSATFAVKGQGFIARDLT  295

Query  289  VRNTAGAAKHQAVALLVGGDKSIINRCRLEGYQDTLYAHSKRQFYRDCTITGTIDFVFGD  110
            + NTAG  KHQAVA     D S+I RC + GYQDTLYAHS+RQFYR+CTITGTIDF+FGD
Sbjct  296  IENTAGPEKHQAVAFRSDSDLSVIFRCAIRGYQDTLYAHSQRQFYRECTITGTIDFIFGD  355

Query  109  AAVVLQNCTLIAKKPLAAQKNMVTAQGRSDPNQNTG  2
              VV Q+C + A+K L  QKN VTAQGR +P +NTG
Sbjct  356  GTVVFQSCEITARKGLPNQKNTVTAQGRKEPVENTG  391



>emb|CDY00192.1| BnaA06g20930D [Brassica napus]
Length=475

 Score =   259 bits (661),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 140/330 (42%), Positives = 190/330 (58%), Gaps = 17/330 (5%)
 Frame = -3

Query  943  PREVQAVADCVELMGLSINDVRDAIKDLQGSKTRNSDAQTSLSAVLTNHLTCMEGLNPPE  764
            PR   A   C+EL+  S++ +  A+  + G +T+  D  T LS+ LTNH TC EG +   
Sbjct  23   PRVRSAYDACIELLDDSVDALSRALSSVSGGQTKPQDVMTWLSSALTNHDTCAEGFDGVN  82

Query  763  KSPVKGILDALISRSRVALAVLAEIIGQTDEEQNFR-VPF------------NGKFPSWV  623
               VK  + A +      ++    I   +    +F  VP             N KFP W 
Sbjct  83   DGGVKDQMTAALKNLSELVSNCLAIFAASSNGNDFDGVPIQNRRLLGVGGDENSKFPRWT  142

Query  622  KSSDRKLVRRKHGNLKADIIVSQDGKGNFTTLKKAMESVSAVSKARVFIYVKKGTYKENV  443
            K  +R+++      ++ADIIVS+DG G   T+ +A++     S  R  IYVK G Y+EN 
Sbjct  143  KRREREILEMPVSQIQADIIVSKDGNGTCKTISEAIKKAPQYSPRRTIIYVKAGRYEEN-  201

Query  442  EMNV---KSPVMIYGDGMTQTVFSGDHSFGDNYTTFKSYTLASKGPAAILQDLCVRNTAG  272
             + V   K  +M  GDG  +T+ SG  S  DN TTF + T A+ G   I +D+   N AG
Sbjct  202  NLKVGRKKINLMFVGDGKGKTIISGGKSIFDNITTFHTATFAATGAGFIARDITFENYAG  261

Query  271  AAKHQAVALLVGGDKSIINRCRLEGYQDTLYAHSKRQFYRDCTITGTIDFVFGDAAVVLQ  92
             AKHQAVAL VG D ++I RC + GYQDTLY HS RQF+R+C I GT+DF+FG+AAVVLQ
Sbjct  262  PAKHQAVALRVGADHAVIYRCNIIGYQDTLYVHSNRQFFRECDIYGTVDFIFGNAAVVLQ  321

Query  91   NCTLIAKKPLAAQKNMVTAQGRSDPNQNTG  2
            NC++ A+KP+  QKN +TAQ R DPNQNTG
Sbjct  322  NCSIYARKPMDLQKNTITAQNRKDPNQNTG  351



>ref|XP_011093902.1| PREDICTED: pectinesterase/pectinesterase inhibitor PPE8B-like 
[Sesamum indicum]
Length=510

 Score =   259 bits (663),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 145/341 (43%), Positives = 198/341 (58%), Gaps = 32/341 (9%)
 Frame = -3

Query  958  GEFTHPREVQAVADCVELMGLSINDVRDAIKDLQGSKTRN-------SDAQTSLSAVLTN  800
            G F+  R   AVADC++LM  S++ +   +   Q  K ++       +D  T LS  + N
Sbjct  62   GAFSDFRLNNAVADCLDLMDFSVDQLSWTLAASQNPKGKDNSTGNVIADMNTWLSGAMAN  121

Query  799  HLTCMEGL---NPPEKSPVKGILDALISRSRVALAVLAEIIGQTDEEQNFRVPFNG----  641
              TC EG    N P +  V G LD L S     L+++         + N   P  G    
Sbjct  122  QETCKEGFDGTNSPVRGLVFGSLDQLTSLVHNLLSMV---------KPNPTTPSKGGSGG  172

Query  640  -------KFPSWVKSSDRKLVRRKHGNLKADIIVSQDGKGNFTTLKKAMESVSAVSKARV  482
                   +FP W+KS DRKL++   G + AD +V+ DG GNFT++++A+ +V   S  R 
Sbjct  173  RKLITSAQFPDWLKSHDRKLLQASSGEV-ADAVVAADGTGNFTSIEEAVRAVPDYSSRRY  231

Query  481  FIYVKKGTYKENVEMNVKS-PVMIYGDGMTQTVFSGDHSFGDNYTTFKSYTLASKGPAAI  305
             I++KKG YKE VE++ K   +M+ GDGM  TV SGD +F D +TT++S T A +G   I
Sbjct  232  VIHIKKGVYKEYVEISKKKWNIMLIGDGMDATVISGDRNFVDGWTTYRSATFAVRGQGFI  291

Query  304  LQDLCVRNTAGAAKHQAVALLVGGDKSIINRCRLEGYQDTLYAHSKRQFYRDCTITGTID  125
             +D+   NTAG  KHQAVA     D S++ RC   GYQDTLYAHS RQFYR+C ITGT+D
Sbjct  292  ARDITFENTAGPEKHQAVAFRSDSDLSVLYRCAFRGYQDTLYAHSMRQFYRECKITGTVD  351

Query  124  FVFGDAAVVLQNCTLIAKKPLAAQKNMVTAQGRSDPNQNTG  2
            F+FGD  VV QNC ++A+K LA QKN +TAQGR +  + TG
Sbjct  352  FMFGDGTVVFQNCDILARKGLANQKNTITAQGRKEQTERTG  392



>ref|XP_004159762.1| PREDICTED: pectinesterase/pectinesterase inhibitor PPE8B-like 
[Cucumis sativus]
Length=434

 Score =   257 bits (657),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 150/354 (42%), Positives = 207/354 (58%), Gaps = 35/354 (10%)
 Frame = -3

Query  1030  LLREFLADYLPSMEAAKMEFGMVRGEFTHPREVQAVADCVELMGLSINDVRDAIKDLQGS  851
             ++R+ +A + P        F  + G+F   R   A++DC++L+  S + +  ++   Q  
Sbjct  54    VVRQVMAIFSP--------FSKLLGDF---RLSTAISDCLDLLDSSADQLSWSLSATQNP  102

Query  850   KTRN-------SDAQTSLSAVLTNHLTCM---EGLNPPEKSPVKGILDALISRSRVALAV  701
             K +N       SD +T LSA + N  TCM   EG N   K  V G ++ L S+    L++
Sbjct  103   KAKNHSTGDLSSDLKTWLSAAVVNPETCMDGFEGTNSIIKGLVSGGVNQLTSQLYDLLSM  162

Query  700   LAEIIGQTDEEQNFRVPFNGKFPSWVKSSDRKLVRRKHGNLKADIIVSQDGKGNFTTLKK  521
             +  I  Q  E           FPSW+KS D+ L+  +  +L AD  V+ DG G+FT +  
Sbjct  163   VKSIPNQPSE-----------FPSWLKSEDQNLL--QINDLAADATVAADGTGDFTNVMD  209

Query  520   AMESVSAVSKARVFIYVKKGTYKENVEMNVKS-PVMIYGDGMTQTVFSGDHSFGDNYTTF  344
             A+ +    S  R  IY+KKG Y ENVE+  K   +M+ GDG+  T+ SG+ SF D +TTF
Sbjct  210   AVLAAPDNSIRRYVIYIKKGVYLENVEIKKKKWNLMMIGDGIDATIISGNRSFIDGWTTF  269

Query  343   KSYTLASKGPAAILQDLCVRNTAGAAKHQAVALLVGGDKSIINRCRLEGYQDTLYAHSKR  164
             +S T A  G   I +D+   NTAGA KHQAVAL    D S+  RCR+ GYQDTLY H+ R
Sbjct  270   RSATFAVSGRGFIARDITFENTAGAEKHQAVALRSDSDLSVFFRCRIRGYQDTLYTHTMR  329

Query  163   QFYRDCTITGTIDFVFGDAAVVLQNCTLIAKKPLAAQKNMVTAQGRSDPNQNTG  2
             QFYR+C I+GT+DF+FGDA VV QNC+++AKK L  QKN +TAQGR DPNQ TG
Sbjct  330   QFYRECQISGTVDFLFGDATVVFQNCSILAKKGLPNQKNTITAQGRKDPNQPTG  383



>gb|ABJ99595.1| pectinesterase inhibitor [Lycoris aurea]
Length=580

 Score =   261 bits (667),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 142/333 (43%), Positives = 202/333 (61%), Gaps = 28/333 (8%)
 Frame = -3

Query  928  AVADCVELMGLSINDVRDA---IKDLQGSKTR------NSDAQTSLSAVLTNHLTCMEGL  776
            A  DC+EL+  SI+ +  +   +  +Q  K R      + D  T LSA LTN  TC +GL
Sbjct  129  AYEDCIELLDSSIDQLSRSMLVVGPVQSQKPRGGPPFDDEDVLTWLSAALTNQDTCSDGL  188

Query  775  NPPEKSPVK----GILDALISRSRVALAVLAEIIGQTDEEQNFR-VPFNGK---------  638
            +      V+    G L  L      +LA+ A     + + ++F  +P   K         
Sbjct  189  SGVTDDYVRQQMTGYLKDLSELVSNSLAIFA----ISSKNKDFSGIPIQNKKRKLLGMEN  244

Query  637  FPSWVKSSDRKLVRRKHGNLKADIIVSQDGKGNFTTLKKAMESVSAVSKARVFIYVKKGT  458
            FP+WVK SDR+L++     ++ADI+VS+DG G +TT+  A++     S  R+ IYVK G 
Sbjct  245  FPNWVKKSDRRLLQVPATGVQADIVVSKDGNGTYTTIADAIKHAPEGSSRRIIIYVKAGR  304

Query  457  YKENVEMNVKS-PVMIYGDGMTQTVFSGDHSFGDNYTTFKSYTLASKGPAAILQDLCVRN  281
            Y+EN+++  K   +M  GDG  +TV +G  S  D+YTTF + T A+ G   I++D+ + N
Sbjct  305  YEENIKVGRKKINLMFIGDGKEKTVIAGSRSVFDSYTTFHTATFAATGAGFIMRDMTIEN  364

Query  280  TAGAAKHQAVALLVGGDKSIINRCRLEGYQDTLYAHSKRQFYRDCTITGTIDFVFGDAAV  101
             AG  KHQAVAL VG D+S++ RC + GYQDTLY HS+RQF+R+C + GT+DF+FG+AAV
Sbjct  365  WAGPQKHQAVALRVGADRSVVYRCNIIGYQDTLYVHSQRQFFRECDVYGTVDFIFGNAAV  424

Query  100  VLQNCTLIAKKPLAAQKNMVTAQGRSDPNQNTG  2
            V QNC+L A+KP+  QKN +TAQ R DPNQNTG
Sbjct  425  VFQNCSLWARKPMTMQKNTITAQNRKDPNQNTG  457



>ref|XP_008795768.1| PREDICTED: pectinesterase-like [Phoenix dactylifera]
Length=557

 Score =   260 bits (665),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 142/325 (44%), Positives = 197/325 (61%), Gaps = 15/325 (5%)
 Frame = -3

Query  940  REVQAVADCVELMGLSINDVRDAIKDLQG--SKTRNSDAQTSLSAVLTNHLTCMEGLNPP  767
            R+  A+ DC+EL+  +++D+R AI DL G  S    SD QT LSA +TN  TC++G    
Sbjct  115  RQRLALNDCLELLDQTLDDLRTAIADLAGCNSSAHVSDLQTVLSAAITNQYTCLDGFAYV  174

Query  766  EKSPVKGILDA-------LISRSRVALAVLAEIIGQTDEEQNFRV--PFNGKFPSWVKSS  614
                V+  ++        L+S S   LA++ +I  Q    + F      +G FP+WV   
Sbjct  175  NGGGVRPSIEGRLYHVSHLVSNS---LAMVKKIRRQRRGREAFEEYGRMSGGFPTWVTRK  231

Query  613  DRKLVRRKHGNLKADIIVSQDGKGNFTTLKKAMESVSAVSKARVFIYVKKGTYKENVEM-  437
            DR+L++        D++V++DG GNFTT+ +A+ +    S  R  IY+K G Y ENV++ 
Sbjct  232  DRRLLQAAANATSPDLVVAKDGSGNFTTIGEAVAAAPNNSATRFVIYIKAGAYFENVDVA  291

Query  436  NVKSPVMIYGDGMTQTVFSGDHSFGDNYTTFKSYTLASKGPAAILQDLCVRNTAGAAKHQ  257
              K  +M  GDG+ +TV     +  D +TTF+S T+A  G   + +D+ + N+AG +KHQ
Sbjct  292  KNKKNLMFIGDGIGKTVVKASRNVVDGWTTFRSATVAVVGDGFLARDITIENSAGPSKHQ  351

Query  256  AVALLVGGDKSIINRCRLEGYQDTLYAHSKRQFYRDCTITGTIDFVFGDAAVVLQNCTLI  77
            AVAL VG D S   RC    YQDTLY HS RQFYRDC + GT+DF+FG+AAVVLQ+C L 
Sbjct  352  AVALRVGADLSAFYRCSFVAYQDTLYVHSLRQFYRDCDVYGTVDFIFGNAAVVLQSCNLY  411

Query  76   AKKPLAAQKNMVTAQGRSDPNQNTG  2
            A+KP   QKN+ TAQGR DPNQNTG
Sbjct  412  ARKPDPNQKNIFTAQGREDPNQNTG  436



>ref|XP_009768722.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 46 
[Nicotiana sylvestris]
Length=577

 Score =   260 bits (665),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 156/403 (39%), Positives = 223/403 (55%), Gaps = 43/403 (11%)
 Frame = -3

Query  1114  LCRTAIDPAACKTILKQTVKSYGGTPAGLLREFLADYLPSMEAAKMEFGMVRGEF-----  950
             +C   + P +C + L    KS    P  +       Y  S++ A  E      +F     
Sbjct  66    ICDITLYPQSCYSSLGPLAKSNNLKPQDI-------YKLSVQVATDELSRASDDFFNMPE  118

Query  949   ----THPREVQAVADCVELMGLSINDVRDAIKDLQGSKTRN-SDAQTSLSAVLTNHLTCM  785
                 + P  V+A+  C EL+ LS++ + +++     S +   SD +T LSA  T   TC+
Sbjct  119   LKNISDPMAVKALESCHELISLSLDSLNESLSIPNKSFSEAFSDLKTRLSAAGTYQQTCI  178

Query  784   EGL----------------NPPE-KSPVKGILDALISRSRVALAVLAEI--IGQTDEEQN  662
             EG                 N  E  S    I+D +    + ++  +  +  IG+     N
Sbjct  179   EGFGNVTYAFASIASHNFKNSGEYTSNSLAIIDNIDQSIQNSIDSMDSLGGIGRRRRLMN  238

Query  661   FRVPFNGKFPSWVKSSDRKLVRRKHG--NLKADIIVSQDGKGNFTTLKKAMESVSAVSKA  488
             F    +G FPSW+ S+DRKL++   G  + K D++V++DG G+F T+ KA+++V   S  
Sbjct  239   F----DGDFPSWMGSNDRKLLQSSKGKNSTKVDVVVAKDGSGDFITITKALQAVPEKSNK  294

Query  487   RVFIYVKKGTYKENVEMNVKS-PVMIYGDGMTQTVFSGDHSFGDNYTTFKSYTLASKGPA  311
             R  IYVKKG Y ENV +  K   VM+ GDGM  T+ SG  +F D   TF++ T A  G  
Sbjct  295   RFVIYVKKGVYVENVRVEKKKWNVMMIGDGMDATIVSGSLNFIDGTPTFQTATFAVFGKG  354

Query  310   AILQDLCVRNTAGAAKHQAVALLVGGDKSIINRCRLEGYQDTLYAHSKRQFYRDCTITGT  131
              I +D+  RNTAGAAKHQAVAL+   D S+  RC+ + YQDTLY HS RQFYR+C+I GT
Sbjct  355   FIARDMGFRNTAGAAKHQAVALMSTADLSVFYRCKFDAYQDTLYTHSNRQFYRECSIYGT  414

Query  130   IDFVFGDAAVVLQNCTLIAKKPLAAQKNMVTAQGRSDPNQNTG  2
             +DF+FG++AVV QNC ++ KKP+  QKN +TAQG+ DPNQNTG
Sbjct  415   VDFIFGNSAVVFQNCHILPKKPMPGQKNTITAQGKIDPNQNTG  457



>gb|ABJ99594.1| pectinesterase inhibitor [Lycoris aurea]
Length=580

 Score =   260 bits (664),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 140/333 (42%), Positives = 202/333 (61%), Gaps = 28/333 (8%)
 Frame = -3

Query  928  AVADCVELMGLSINDVRDAI---------KDLQGSKTRNSDAQTSLSAVLTNHLTCMEGL  776
            A  DC+EL+  SI+ +  ++         K + G  + + D  T LSA LTN  TC +GL
Sbjct  129  AYEDCIELLDSSIDQLSRSMLVVGPVQSQKPMGGPPSDDEDELTWLSAALTNQDTCSDGL  188

Query  775  NPPEKSPVK----GILDALISRSRVALAVLAEIIGQTDEEQNFR-VPFNGK---------  638
            +      V+    G L  L      +LA+ A     + + ++F  +P   K         
Sbjct  189  SGVTDDYVRQQMTGYLKDLSELVSNSLAIFA----ISSKNKDFSGIPIQNKKRNLLGMEN  244

Query  637  FPSWVKSSDRKLVRRKHGNLKADIIVSQDGKGNFTTLKKAMESVSAVSKARVFIYVKKGT  458
            FP+WV+ SDR+L++     ++ADI+VS+DG G +TT+  A++     S  R+ IYVK G 
Sbjct  245  FPNWVEKSDRRLLQVPATGVQADIVVSKDGNGTYTTIADAIKHAPEGSSRRIIIYVKAGR  304

Query  457  YKENVEMNVKS-PVMIYGDGMTQTVFSGDHSFGDNYTTFKSYTLASKGPAAILQDLCVRN  281
            Y+EN+++  K   +M  GDG  +TV +G  S  D+YTTF + T A+ G   I++D+ + N
Sbjct  305  YEENIKVGRKKINLMFIGDGKGKTVIAGSRSVFDSYTTFHTATFAATGAGFIMRDMTIEN  364

Query  280  TAGAAKHQAVALLVGGDKSIINRCRLEGYQDTLYAHSKRQFYRDCTITGTIDFVFGDAAV  101
             AG  KHQAVAL VG D+S++ RC + GYQDTLY HS+RQF+R+C + GT+DF+FG+AAV
Sbjct  365  WAGPQKHQAVALRVGADRSVVYRCDIIGYQDTLYVHSQRQFFRECDVYGTVDFIFGNAAV  424

Query  100  VLQNCTLIAKKPLAAQKNMVTAQGRSDPNQNTG  2
            V QNC+L A+KP+  QKN +TAQ R DPNQNTG
Sbjct  425  VFQNCSLWARKPMMMQKNTITAQNRKDPNQNTG  457



>ref|XP_008359413.1| PREDICTED: pectinesterase-like [Malus domestica]
Length=579

 Score =   259 bits (663),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 140/334 (42%), Positives = 197/334 (59%), Gaps = 25/334 (7%)
 Frame = -3

Query  928  AVADCVELMGLSINDVRDAIKDLQGSKTRNS----DAQTSLSAVLTNHLTCMEGLNPPEK  761
            A+ DC+EL+  +I++++ AI DL  +KT NS    D +  LSA +TN  TC++G +    
Sbjct  123  ALDDCLELLDNTIDELKSAISDLSXNKTLNSNRYYDLKALLSAAMTNQDTCLDGFSANGT  182

Query  760  SP-----------VKGILDALISRSRVALAVLAEIIGQTDEEQNFRV---------PFNG  641
            +P           ++G ++ +      AL +L +I G    E +  +         P   
Sbjct  183  APRSSNXGIVRSEIEGRINTISQHVSNALVMLKKIPGAHKYEYSETMKSEMFPDFGPAKK  242

Query  640  KFPSWVKSSDRKLVRRKHGNLKADIIVSQDGKGNFTTLKKAMESVSAVSKARVFIYVKKG  461
            KFP+WV S DR+L++      K D++V++DG GNFTT+ +A++     S  R  IY+K G
Sbjct  243  KFPTWVSSKDRRLLQSSTNETKYDLVVAKDGTGNFTTISEAVDVAPNSSATRFVIYIKAG  302

Query  460  TYKENVEM-NVKSPVMIYGDGMTQTVFSGDHSFGDNYTTFKSYTLASKGPAAILQDLCVR  284
             Y ENVE+   K+ +M  GDG+  T+     +  D +TTF+S T+A  G   I + +   
Sbjct  303  AYFENVEVVKKKTNLMFLGDGIGNTIVKASRNVVDGWTTFRSATVAVVGBGFIAKGITFE  362

Query  283  NTAGAAKHQAVALLVGGDKSIINRCRLEGYQDTLYAHSKRQFYRDCTITGTIDFVFGDAA  104
            N AG +KHQAVAL  G D S   +C   GYQDTLY HS RQFYR+C + GT+DF+FG+AA
Sbjct  363  NGAGPSKHQAVALRSGADFSAFYKCSFVGYQDTLYVHSLRQFYRECDVYGTVDFIFGNAA  422

Query  103  VVLQNCTLIAKKPLAAQKNMVTAQGRSDPNQNTG  2
            VVLQNC L A+KP   QKN+ TAQGR DPNQNTG
Sbjct  423  VVLQNCNLYARKPNENQKNIFTAQGREDPNQNTG  456



>ref|XP_004146188.1| PREDICTED: pectinesterase/pectinesterase inhibitor PPE8B-like 
[Cucumis sativus]
Length=507

 Score =   258 bits (658),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 150/354 (42%), Positives = 207/354 (58%), Gaps = 35/354 (10%)
 Frame = -3

Query  1030  LLREFLADYLPSMEAAKMEFGMVRGEFTHPREVQAVADCVELMGLSINDVRDAIKDLQGS  851
             ++R+ +A + P        F  + G+F   R   A++DC++L+  S + +  ++   Q  
Sbjct  54    VVRQVMAIFSP--------FSKLLGDF---RLSTAISDCLDLLDSSADQLSWSLSATQNP  102

Query  850   KTRN-------SDAQTSLSAVLTNHLTCM---EGLNPPEKSPVKGILDALISRSRVALAV  701
             K +N       SD +T LSA + N  TCM   EG N   K  V G ++ L S+    L++
Sbjct  103   KAKNHSTGDLSSDLKTWLSAAVVNPETCMDGFEGTNSIIKGLVSGGVNQLTSQLYDLLSM  162

Query  700   LAEIIGQTDEEQNFRVPFNGKFPSWVKSSDRKLVRRKHGNLKADIIVSQDGKGNFTTLKK  521
             +  I  Q  E           FPSW+KS D+ L++    +L AD  V+ DG G+FT +  
Sbjct  163   VKSIPNQPSE-----------FPSWLKSEDQNLLQIN--DLAADATVAADGTGDFTNVMD  209

Query  520   AMESVSAVSKARVFIYVKKGTYKENVEMNVKS-PVMIYGDGMTQTVFSGDHSFGDNYTTF  344
             A+ +    S  R  IY+KKG Y ENVE+  K   +M+ GDG+  T+ SG+ SF D +TTF
Sbjct  210   AVLAAPDNSIRRYVIYIKKGVYLENVEIKKKKWNLMMIGDGIDATIISGNRSFIDGWTTF  269

Query  343   KSYTLASKGPAAILQDLCVRNTAGAAKHQAVALLVGGDKSIINRCRLEGYQDTLYAHSKR  164
             +S T A  G   I +D+   NTAGA KHQAVAL    D S+  RCR+ GYQDTLY H+ R
Sbjct  270   RSATFAVSGRGFIARDITFENTAGAEKHQAVALRSDSDLSVFFRCRIRGYQDTLYTHTMR  329

Query  163   QFYRDCTITGTIDFVFGDAAVVLQNCTLIAKKPLAAQKNMVTAQGRSDPNQNTG  2
             QFYR+C I+GT+DF+FGDA VV QNC+++AKK L  QKN +TAQGR DPNQ TG
Sbjct  330   QFYRECQISGTVDFLFGDATVVFQNCSILAKKGLPNQKNTITAQGRKDPNQPTG  383



>ref|XP_008806757.1| PREDICTED: LOW QUALITY PROTEIN: probable pectinesterase/pectinesterase 
inhibitor 34 [Phoenix dactylifera]
Length=587

 Score =   260 bits (664),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 134/332 (40%), Positives = 201/332 (61%), Gaps = 18/332 (5%)
 Frame = -3

Query  943  PREVQAVADCVELMGLSINDVRDAIKDLQGSKT-----RNSDAQTSLSAVLTNHLTCMEG  779
            P    A  DC+EL+  S++ +  ++  +  S +      + D  T LSA LTN  TC EG
Sbjct  133  PLARAAYEDCMELLDDSLDQLSQSLAVVSPSASGPAGSSDVDVLTWLSAALTNQDTCTEG  192

Query  778  LNPPEKSPVKGILDALISRSRVALAVLAEIIGQTDEEQNFR-VPF-----------NGKF  635
            L       V+G +++ +      ++    I   T   ++F  +P            +G+F
Sbjct  193  LADVADGYVRGQMESYLKDLAELVSNCLAIFSATRRNKDFSGIPIQNKKRRLLSSGDGEF  252

Query  634  PSWVKSSDRKLVRRKHGNLKADIIVSQDGKGNFTTLKKAMESVSAVSKARVFIYVKKGTY  455
            P W+   DR+L++     ++AD++VS+DG G   ++  A+++    S  R+ IYVK G Y
Sbjct  253  PEWLGRRDRRLLQVPVAKIQADMVVSKDGNGTHKSIADAVKAAPEHSTRRIVIYVKAGRY  312

Query  454  KENVEMN-VKSPVMIYGDGMTQTVFSGDHSFGDNYTTFKSYTLASKGPAAILQDLCVRNT  278
             EN++++  K+ +M  GDG  +T+ +G  S  +NYTTF + T AS G   I++D+ + N 
Sbjct  313  DENIKISRKKTNLMFIGDGKAKTIVAGSRSVAENYTTFHTATFASTGNGFIMRDMTIENW  372

Query  277  AGAAKHQAVALLVGGDKSIINRCRLEGYQDTLYAHSKRQFYRDCTITGTIDFVFGDAAVV  98
            AG AKHQAVAL VG D +++ RC + GYQDTLY HS+RQF+R+C + GT+DF+FG+AAVV
Sbjct  373  AGPAKHQAVALRVGADHAVVYRCNIIGYQDTLYVHSQRQFFRECDVYGTVDFIFGNAAVV  432

Query  97   LQNCTLIAKKPLAAQKNMVTAQGRSDPNQNTG  2
            LQNC+L A+KP+A QKN +TAQ R DPNQNTG
Sbjct  433  LQNCSLWARKPMAMQKNTITAQNRKDPNQNTG  464



>ref|XP_004508051.1| PREDICTED: pectinesterase/pectinesterase inhibitor PPE8B-like 
[Cicer arietinum]
Length=510

 Score =   258 bits (658),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 145/335 (43%), Positives = 202/335 (60%), Gaps = 21/335 (6%)
 Frame = -3

Query  973  FGMVRGEFTHPREVQAVADCVELMGLSINDVRDAIKDLQGSKTRN-------SDAQTSLS  815
            FG V   F + R   A+ DC++L+ L  +++  A+   Q S  ++       SD +T LS
Sbjct  63   FGNV---FGNSRFSHAITDCLDLLDLCSDELNWAMSASQNSNGKDNSTGNLSSDLRTWLS  119

Query  814  AVLTNHLTCMEGLNPPEKSPVKGILDALISRSRV-ALAVLAEIIGQTDE-EQNFRVPFN-  644
            AVL N  TC+EGL         GI++ L+S   V  ++++  ++ Q D    +F      
Sbjct  120  AVLVNPDTCIEGLEG-----TNGIVEGLVSTGLVRIMSLVKNLLLQVDPISDHFETKLGK  174

Query  643  GKFPSWVKSSDRKLVRRKHGNLKADIIVSQDGKGNFTTLKKAMESVSAVSKARVFIYVKK  464
             +FPSW+K +D KL+  K   + AD +V+ DG G++TT+  A+ +    S  R  IYVKK
Sbjct  175  DRFPSWLKDADMKLL--KTNGVTADAVVAADGSGDYTTVMDAVMAAPDNSMKRYVIYVKK  232

Query  463  GTYKENVEMNVKS-PVMIYGDGMTQTVFSGDHSFGDNYTTFKSYTLASKGPAAILQDLCV  287
            G Y ENVE+  K   +MI G+GM  TV SG  S+GD +TTF+S T A  G   I +D+  
Sbjct  233  GVYVENVEIKKKKWNIMIIGEGMDATVISGSRSYGDGWTTFRSATFAVSGRGFIARDISF  292

Query  286  RNTAGAAKHQAVALLVGGDKSIINRCRLEGYQDTLYAHSKRQFYRDCTITGTIDFVFGDA  107
            +NTAG  KHQAVAL    D S+  RC + GYQD+LY H+ RQFYR+C I+GT+DF+FGDA
Sbjct  293  QNTAGPEKHQAVALRSDSDLSVFYRCGILGYQDSLYTHTMRQFYRECKISGTVDFIFGDA  352

Query  106  AVVLQNCTLIAKKPLAAQKNMVTAQGRSDPNQNTG  2
              + QNC ++AKK +  QKN +TAQGR DPNQ TG
Sbjct  353  TAMFQNCQILAKKGMEKQKNTITAQGRKDPNQPTG  387



>ref|XP_011092101.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 22 
[Sesamum indicum]
Length=537

 Score =   258 bits (659),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 146/395 (37%), Positives = 221/395 (56%), Gaps = 33/395 (8%)
 Frame = -3

Query  1111  CRTAIDPAACKTILKQTVKSYGG-TPAGLLREFLADYLPSMEAAKMEFGMVRGEFTHPRE  935
             C    + A+C   L+  +KSYG  +P  +LR  L   L    +A             PRE
Sbjct  37    CDRIQNQASCFLNLQFQIKSYGRRSPDSVLRAALQHTLNEASSASEALTKFTTLSISPRE  96

Query  934   VQAVADCVELMGLSINDVRDAIKDLQ----GSKTRNSDA--QTSLSAVLTNHLTCMEGLN  773
               A+ DC EL+  S++++  ++ ++     G K+ +S+   +  LSA L+N  TC+EG  
Sbjct  97    QMAIDDCKELLDFSVSELAWSVDEMNRIHAGLKSPHSEGNLKAWLSAALSNQDTCLEGFE  156

Query  772   PPEKSPVKGILDALISRSRVALAVLAEIIGQ--TDEEQNFRVPF---------------N  644
               ++      L+  I   R +L+ + ++IG   T   Q   +PF               N
Sbjct  157   GTDRR-----LEHFI---RGSLSQVNQLIGNVLTLYTQMHSLPFRPPRNNSTAADNENRN  208

Query  643   GKFPSWVKSSDRKLVRRKHGNLKADIIVSQDGKGNFTTLKKAMESVSAVSKARVFIYVKK  464
               FP W+   D++L+      +  D +V+ DG G + ++ +A+    + S  R  IYVKK
Sbjct  209   KGFPQWMTEGDKELLVSSQNGMHVDAVVAVDGSGQYRSIAQAIYEAPSYSNRRYVIYVKK  268

Query  463   GTYKENVEMNVK-SPVMIYGDGMTQTVFSGDHSFGDNYTTFKSYTLASKGPAAILQDLCV  287
             G YKEN++M  K + +M+ GDG+ QT+ +G+ +F   +TTF++ T+A  G   + +D+  
Sbjct  269   GVYKENIDMKKKKTNIMLVGDGIGQTIVTGNRNFMQGWTTFRTATVAVSGKGFLARDITF  328

Query  286   RNTAGAAKHQAVALLVGGDKSIINRCRLEGYQDTLYAHSKRQFYRDCTITGTIDFVFGDA  107
             RNTAG   HQ VAL V  D+S   RC +EGYQDTLYAHS RQFYR+C+I+GTIDF+FG+ 
Sbjct  329   RNTAGPESHQGVALRVDSDQSAFYRCSMEGYQDTLYAHSLRQFYRECSISGTIDFIFGNG  388

Query  106   AVVLQNCTLIAKKPLAAQKNMVTAQGRSDPNQNTG  2
             A VLQNC +  ++PL  QK  +TAQGR DP+Q+TG
Sbjct  389   AAVLQNCKIYTRQPLPLQKVTITAQGRKDPHQSTG  423



>gb|AFK36090.1| unknown [Medicago truncatula]
Length=451

 Score =   255 bits (652),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 138/326 (42%), Positives = 199/326 (61%), Gaps = 17/326 (5%)
 Frame = -3

Query  952  FTHPREVQAVADCVELMGLSINDVRDAIKDLQGSKTR-------NSDAQTSLSAVLTNHL  794
            F H R   AV+DC++L+ +S++ +  +I   Q  K +       N D +T LSAVL    
Sbjct  78   FGHSRTSNAVSDCLDLLDMSLDQLNQSISAAQKPKEKDNSTGKLNCDLRTWLSAVLVYPD  137

Query  793  TCMEGLNPPEKSPVKGILDALISRSRVALAVLAEIIGQTDEEQNFRVPFN-GKFPSWVKS  617
            TC+EGL   E S VKG++ + +      ++++A ++G+     + ++  N  +FPSW++ 
Sbjct  138  TCIEGL---EGSIVKGLISSGLDH---VMSLVANLLGEVVSGNDDQLATNKDRFPSWIRD  191

Query  616  SDRKLVRRKHGNLKADIIVSQDGKGNFTTLKKAMESVSAVSKARVFIYVKKGTYKENVEM  437
             D KL+  +   + AD +V+ DG G++  +  A+ +    S  R  IYVKKG Y ENVE+
Sbjct  192  EDTKLL--QANGVTADAVVAADGSGDYAKVMDAVSAAPEGSMKRYVIYVKKGVYVENVEI  249

Query  436  NVKS-PVMIYGDGMTQTVFSGDHSFGDNYTTFKSYTLASKGPAAILQDLCVRNTAGAAKH  260
              K   +M+ G+GM  T+ SG  ++ D  TTF+S T A  G   I +D+  +NTAGA KH
Sbjct  250  KKKKWNIMLIGEGMDATIISGSRNYVDGSTTFRSATFAVSGRGFIARDISFQNTAGAEKH  309

Query  259  QAVALLVGGDKSIINRCRLEGYQDTLYAHSKRQFYRDCTITGTIDFVFGDAAVVLQNCTL  80
            QAVAL    D S+  RC + GYQD+LY H+ RQFYR+C I+GT+DF+FGDA  V QNC +
Sbjct  310  QAVALRSDSDLSVFYRCGIFGYQDSLYTHTMRQFYRECKISGTVDFIFGDATAVFQNCQI  369

Query  79   IAKKPLAAQKNMVTAQGRSDPNQNTG  2
            +AKK +  QKN VTAQGR DPNQ TG
Sbjct  370  LAKKGMPKQKNTVTAQGRKDPNQPTG  395



>ref|XP_010259035.1| PREDICTED: pectinesterase 2-like [Nelumbo nucifera]
Length=528

 Score =   258 bits (658),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 146/321 (45%), Positives = 194/321 (60%), Gaps = 20/321 (6%)
 Frame = -3

Query  940  REVQAVADCVELMG---LSINDVRDAIKDLQGSKTRNSDAQTSLSAVLTNHLTCMEGLNP  770
            RE  A ADC++L     L +N   D        K  + DAQT LS  LTN  TC  G   
Sbjct  99   REKAAWADCLKLYQDTVLQLNRTLDP-----SIKCTDFDAQTWLSTALTNLQTCRAGF--  151

Query  769  PEKSPVKGILDALISR--SRVALAVLAEIIGQTDEEQNFRVPFNGKFPSWVKSSDRKLVR  596
              +  V   +  L+S   S++    LA I     + QN+    +G+FPSWV   DRKL++
Sbjct  152  -IELGVSDFMLPLMSNNVSKLISNTLA-INKAISQNQNYT---DGRFPSWVSPGDRKLLQ  206

Query  595  RKHGNLKADIIVSQDGKGNFTTLKKAMESVSAVSKA--RVFIYVKKGTYKENVEM-NVKS  425
                  +A+++V+QDG GNF T+K A+++VS   K   R  I+VK G Y+EN+E+ N   
Sbjct  207  SSSPASRANMVVAQDGSGNFRTIKAALDAVSKQRKGSGRFIIHVKAGVYRENLEIGNGMK  266

Query  424  PVMIYGDGMTQTVFSGDHSFGDNYTTFKSYTLASKGPAAILQDLCVRNTAGAAKHQAVAL  245
             +M+ GDGM  T+ +G  S G  +TTF S T+A  G   I   +  RNTAG   HQAVAL
Sbjct  267  NIMLVGDGMRSTIITGSRSVGGGFTTFNSATVAVTGEGFIAMGITFRNTAGPQNHQAVAL  326

Query  244  LVGGDKSIINRCRLEGYQDTLYAHSKRQFYRDCTITGTIDFVFGDAAVVLQNCTLIAKKP  65
              G D S+  RC  EGYQDTLY HS+RQFYR+C I GT+DF+FG+AAVVLQNC ++ ++P
Sbjct  327  RSGSDLSVFYRCGFEGYQDTLYVHSQRQFYRECYIYGTVDFIFGNAAVVLQNCMILPRRP  386

Query  64   LAAQKNMVTAQGRSDPNQNTG  2
            +  Q N+VTAQGR+DPNQNTG
Sbjct  387  MDGQSNVVTAQGRTDPNQNTG  407



>gb|ABQ42392.1| pectin methylesterase-like protein [Taiwania cryptomerioides]
Length=595

 Score =   259 bits (662),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 159/406 (39%), Positives = 224/406 (55%), Gaps = 53/406 (13%)
 Frame = -3

Query  1087  ACKTILKQ-----TVKSYGG--TPAGLLREFLADYLPSMEAAKMEFGMVRGEFTH---PR  938
             AC + L Q     ++ SY G  + AG +    A    ++ A K      R  F+     R
Sbjct  77    ACSSTLYQELCVSSISSYEGLSSQAGHMEILDAAVNVAINAVKKGQAHTRSLFSRDLDSR  136

Query  937   EVQAVADCVELMGLSINDVRDAIKDLQGSK-----TRNSDAQTSLSAVLTNHLTCMEGLN  773
             +  A+ DC+E+   +++++ D + DL  +         +D +T LSA +TN  TC+EG  
Sbjct  137   QRGALNDCMEMYDDTLDELHDTLSDLHNATFLSMPKHAADLETLLSAAITNQFTCLEGFT  196

Query  772   PPE---KSPVKGIL---DALIS-----------RSRVALAV----------LAEIIGQTD  674
               +   K  VKG L     L+S           R++ AL +          L+E    TD
Sbjct  197   LCKGHLKQQVKGELHNVSHLVSNSLATVGNISARAKQALGIADSLADRRRLLSESFVSTD  256

Query  673   EEQNFRVPFNGKFPSWVKSSDRKLVRRKHGNLKADIIVSQDGKGNFTTLKKAMESVSAVS  494
             EE          FPSW+   DR+L++    N+ A+ +V++DG G+++T+  A+++    S
Sbjct  257   EE---------GFPSWMSVGDRRLLQVNVTNITANAVVAKDGSGHYSTISAAVDAAPEKS  307

Query  493   KARVFIYVKKGTYKENVEMNVKSPVMIY-GDGMTQTVFSGDHSF-GDNYTTFKSYTLASK  320
               R  IYVKKG Y+ENVE++ K   +++ GDG   TV +   S  G N+TTF S T+A  
Sbjct  308   TTRFIIYVKKGVYQENVEIHKKKHFLMFIGDGEGVTVVTASRSVRGSNHTTFHSATVAVT  367

Query  319   GPAAILQDLCVRNTAGAAKHQAVALLVGGDKSIINRCRLEGYQDTLYAHSKRQFYRDCTI  140
             G   I +D+   NTAG + HQAVAL VG D S+  RC  +GYQDTLY HS RQF+RDC I
Sbjct  368   GKGFIARDMTFENTAGPSNHQAVALRVGSDFSVFYRCSFKGYQDTLYVHSLRQFFRDCDI  427

Query  139   TGTIDFVFGDAAVVLQNCTLIAKKPLAAQKNMVTAQGRSDPNQNTG  2
              GT+DF+FG+AAVV QNC L A+KPL  Q+ M TAQGR DPNQNTG
Sbjct  428   YGTVDFIFGNAAVVFQNCNLYARKPLENQQIMYTAQGRQDPNQNTG  473



>ref|XP_008235121.1| PREDICTED: pectinesterase-like [Prunus mume]
Length=562

 Score =   258 bits (659),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 143/337 (42%), Positives = 193/337 (57%), Gaps = 14/337 (4%)
 Frame = -3

Query  970  GMVRGEFTHPREVQAVA--DCVELMGLSINDVRDAIKDL---QGSKTRNSDAQTSLSAVL  806
            G+++ +F     +Q +A  DC+EL   +I ++   I DL   + S  R  D +T LS  +
Sbjct  103  GIIKKQFKKLDALQQIALDDCLELFDDTIAELNAVISDLSIKKLSSNRYYDLKTLLSGAM  162

Query  805  TNHLTCMEGLNPPE--KSPVKGILDALISRSRVALAVLAEIIGQTDEEQNFRV------P  650
            TN  TC++G N     +  ++  L  +      AL +L +I G    E +         P
Sbjct  163  TNQYTCLDGFNDTGIVRQEIQSRLQTISQHVSNALVMLKKIPGALKYENSKSEMFPEFGP  222

Query  649  FNGKFPSWVKSSDRKLVRRKHGNLKADIIVSQDGKGNFTTLKKAMESVSAVSKARVFIYV  470
                FP+WV S DRKL++      K D++V++DG GNFTT+ +A+      S  R  IY+
Sbjct  223  MKNGFPTWVSSKDRKLLQSVANGTKYDLVVAKDGTGNFTTISEAVAVAPNSSATRFVIYI  282

Query  469  KKGTYKENVEM-NVKSPVMIYGDGMTQTVFSGDHSFGDNYTTFKSYTLASKGPAAILQDL  293
            K G Y ENVE+   K+ +M  GDG+ +TV     +  D +TTF+S T+A  G   I Q +
Sbjct  283  KSGAYFENVEVVRKKTNLMFLGDGIGKTVVKASRNVVDGWTTFRSATVAVVGDGFIAQGI  342

Query  292  CVRNTAGAAKHQAVALLVGGDKSIINRCRLEGYQDTLYAHSKRQFYRDCTITGTIDFVFG  113
               N AG +KHQAVA   G D S   +C   GYQDTLY HS RQFYR+C I GT+DF+FG
Sbjct  343  TFENAAGPSKHQAVAFRSGSDFSAFYKCSFVGYQDTLYVHSLRQFYRECDIYGTVDFIFG  402

Query  112  DAAVVLQNCTLIAKKPLAAQKNMVTAQGRSDPNQNTG  2
            +AAVVLQNC L A+KP   QKNM TAQGR DPNQNTG
Sbjct  403  NAAVVLQNCNLYARKPNENQKNMFTAQGREDPNQNTG  439



>ref|XP_008448427.1| PREDICTED: pectinesterase/pectinesterase inhibitor PPE8B-like 
[Cucumis melo]
Length=576

 Score =   258 bits (660),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 150/354 (42%), Positives = 207/354 (58%), Gaps = 35/354 (10%)
 Frame = -3

Query  1030  LLREFLADYLPSMEAAKMEFGMVRGEFTHPREVQAVADCVELMGLSINDVRDAIKDLQGS  851
             ++R+ +A + P        F  + G+F   R   A++DC++L+  S + +  ++   Q  
Sbjct  123   VVRQVMAIFSP--------FSKLLGDF---RLSTAISDCLDLLDSSADQLSWSLSATQNP  171

Query  850   KTRN-------SDAQTSLSAVLTNHLTCM---EGLNPPEKSPVKGILDALISRSRVALAV  701
             K ++       SD +T LSA + N  TCM   EG N   K  V G ++ L S+    L++
Sbjct  172   KAKDHSTGDLSSDLKTWLSAAVVNPETCMDGFEGTNSIIKGLVSGGINQLTSQLYDLLSM  231

Query  700   LAEIIGQTDEEQNFRVPFNGKFPSWVKSSDRKLVRRKHGNLKADIIVSQDGKGNFTTLKK  521
             +  I  Q  E           FPSW+KS DR L++    +L AD  V+ DG G+FT +  
Sbjct  232   VKSIPNQPSE-----------FPSWLKSEDRNLLQLN--DLAADATVAADGTGDFTNVMD  278

Query  520   AMESVSAVSKARVFIYVKKGTYKENVEMNVKS-PVMIYGDGMTQTVFSGDHSFGDNYTTF  344
             A+ +    S  R  IY+KKG Y ENVE+  K   +M+ GDG+  T+ SG+ SF D +TTF
Sbjct  279   AVLAAPDKSTRRYVIYIKKGVYLENVEIKKKKWNLMMIGDGIDATIISGNRSFIDGWTTF  338

Query  343   KSYTLASKGPAAILQDLCVRNTAGAAKHQAVALLVGGDKSIINRCRLEGYQDTLYAHSKR  164
             +S T A  G   I +D+   NTAGA KHQAVAL    D S+  RCR+ GYQDTLY H+ R
Sbjct  339   RSATFAVSGRGFIARDITFENTAGAEKHQAVALRSDSDLSVFFRCRIRGYQDTLYTHTMR  398

Query  163   QFYRDCTITGTIDFVFGDAAVVLQNCTLIAKKPLAAQKNMVTAQGRSDPNQNTG  2
             QFYR+C I+GT+DF+FGDA VV QNC+++AKK L  QKN +TAQGR DPNQ TG
Sbjct  399   QFYRECQISGTVDFLFGDATVVFQNCSILAKKGLPNQKNTITAQGRKDPNQPTG  452



>ref|XP_006444399.1| hypothetical protein CICLE_v100237231mg, partial [Citrus clementina]
 gb|ESR57639.1| hypothetical protein CICLE_v100237231mg, partial [Citrus clementina]
Length=548

 Score =   257 bits (657),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 139/323 (43%), Positives = 198/323 (61%), Gaps = 11/323 (3%)
 Frame = -3

Query  937  EVQAVADCVELMGLSINDVRDAIKDLQGSKT---RNSDAQTSLSAVLTNHLTCMEGLNPP  767
            E +A+ DC+EL   +I +++ A+ DL   K       D QT  S  +TN  TC++G    
Sbjct  103  EKRAINDCLELFHDTIVELKSALNDLSPKKLPSKHYHDLQTLFSGAMTNQYTCLDGFAYS  162

Query  766  EKSPVKGILDALISRSRV---ALAVLAEIIGQTDEEQNFRVPFNGK----FPSWVKSSDR  608
            + +    I  +L + SR    +L +L +I G     +    P  G+    FP+W+  +DR
Sbjct  163  DGNVRDVIKSSLYNISRHVSNSLVMLKKIPGDNMSSKYEVFPEYGRIKRGFPTWLSLNDR  222

Query  607  KLVRRKHGNLKADIIVSQDGKGNFTTLKKAMESVSAVSKARVFIYVKKGTYKENVEMNVK  428
            KL+++     K D+IV++DG GNFTT+ +A+E+    S  R  IY+K G Y ENVE++ K
Sbjct  223  KLLQKSVNLTKFDLIVAKDGSGNFTTITEAVEAAPNKSNTRFVIYIKAGAYFENVEVDKK  282

Query  427  SPVMIY-GDGMTQTVFSGDHSFGDNYTTFKSYTLASKGPAAILQDLCVRNTAGAAKHQAV  251
              ++++ GDG+ +TV   + S  D +TTF+S T+A  G   I + + V N+AG +KHQAV
Sbjct  283  KTMLMFVGDGIGKTVVKANRSVVDGWTTFRSATVAVVGTGFIAKGITVENSAGPSKHQAV  342

Query  250  ALLVGGDKSIINRCRLEGYQDTLYAHSKRQFYRDCTITGTIDFVFGDAAVVLQNCTLIAK  71
            AL  G D S   +C   GYQDTLY HS RQFYR+C + GT+DF+FG+AAVV Q C L A+
Sbjct  343  ALRSGSDLSAFYKCSFVGYQDTLYVHSLRQFYRECDVYGTVDFIFGNAAVVFQICNLYAR  402

Query  70   KPLAAQKNMVTAQGRSDPNQNTG  2
            KP A QKN++TAQGR DPNQNTG
Sbjct  403  KPNANQKNIITAQGREDPNQNTG  425



>gb|AHB84678.1| pectin methylesterase [Citrus reticulata]
Length=569

 Score =   258 bits (658),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 138/323 (43%), Positives = 201/323 (62%), Gaps = 11/323 (3%)
 Frame = -3

Query  937  EVQAVADCVELMGLSINDVRDAIKDLQGSKTRNS---DAQTSLSAVLTNHLTCMEGLNPP  767
            E +A+ DC+EL   +I +++ A+ DL   K+ +    D QT  S  +TN  TC++G    
Sbjct  124  EKRAINDCLELFHDTIVELKSALNDLSPKKSPSKHYHDLQTLFSGAMTNQYTCLDGFAYS  183

Query  766  EKSPVKGILDALISRSRV---ALAVLAEIIGQTDEEQNFRVPFNGK----FPSWVKSSDR  608
            + +  + I  +L + SR    +L +L +I G     +    P  G+    FP+W+  +DR
Sbjct  184  DGNVREVIKSSLYNISRHVSNSLVMLKKIPGDNMSSKYEVFPEYGRIKRGFPTWLSLNDR  243

Query  607  KLVRRKHGNLKADIIVSQDGKGNFTTLKKAMESVSAVSKARVFIYVKKGTYKENVEMNVK  428
            KL+++     K D+IV++DG GNFTT+ +A+E+    S  R  IY+K G Y ENVE++ K
Sbjct  244  KLLQKSVNLTKFDLIVAKDGSGNFTTITEAVEAAPNKSNTRFVIYIKAGAYFENVEVDKK  303

Query  427  SPVMIY-GDGMTQTVFSGDHSFGDNYTTFKSYTLASKGPAAILQDLCVRNTAGAAKHQAV  251
              ++++ GDG+ +T+   + S  D +TTF+S T+A  G   I + + V N+AG +KHQAV
Sbjct  304  KTMLMFVGDGIGKTLVKANRSVVDGWTTFRSATVAVVGTGFIAKGITVENSAGPSKHQAV  363

Query  250  ALLVGGDKSIINRCRLEGYQDTLYAHSKRQFYRDCTITGTIDFVFGDAAVVLQNCTLIAK  71
            AL  G D S   +C   GYQDTLY HS RQFYR+C + GT+DF+FG+AAVV Q C L A+
Sbjct  364  ALRSGSDLSAFYKCSFVGYQDTLYVHSLRQFYRECDVYGTVDFIFGNAAVVFQICNLYAR  423

Query  70   KPLAAQKNMVTAQGRSDPNQNTG  2
            KP A QKN++TAQGR DPNQNTG
Sbjct  424  KPNANQKNIITAQGREDPNQNTG  446



>ref|XP_006576426.1| PREDICTED: pectinesterase 2-like [Glycine max]
Length=517

 Score =   256 bits (654),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 138/315 (44%), Positives = 189/315 (60%), Gaps = 8/315 (3%)
 Frame = -3

Query  946  HPREVQAVADCVELMGLSINDVRDAIKDLQGSKTRNSDAQTSLSAVLTNHLTCMEGLNPP  767
            +PRE  A ADCVEL   +I  + + +     +K    DAQT LS  LTN  TC  G    
Sbjct  90   NPRERGAWADCVELYEQTIRKLNETLNPDPNTKYSQVDAQTWLSTALTNLETCKAGF---  146

Query  766  EKSPVKGILDALISRSRVALAVLAEIIGQTDEEQNFRVPFNGKFPSWVKSSDRKLVRRKH  587
             +  V+  +  L+S +   L      + + + E+     +   FP WVK  DRKL++   
Sbjct  147  YELGVQDYVLPLMSNNVTKLLSNTLSLNKVEYEE---PSYKEGFPKWVKPDDRKLLQSSS  203

Query  586  GNLKADIIVSQDGKGNFTTLKKAMESVSAVSKARVFIYVKKGTYKENVEMNVKSPVMIYG  407
               +A+++V++DG G +TT+  A+ S    S+ R  IYVK G Y E VE+  K+ +M+ G
Sbjct  204  PASRANVVVAKDGSGKYTTVSAAVNSAPKNSRGRYVIYVKGGIYNEQVEVKSKN-IMLVG  262

Query  406  DGMTQTVFSGDHSFGDNYTTFKSYTLASKGPAAILQDLCVRNTAGAAKHQAVALLVGGDK  227
            DG+ +T+ +G  S G   TTF+S T+A  G   I Q +  RNTAGA  HQAVAL  G D 
Sbjct  263  DGIGKTIITGSKSVGGGTTTFRSATVAVVGDGFIAQGITFRNTAGAKNHQAVALRSGSDL  322

Query  226  SIINRCRLEGYQDTLYAHSKRQFYRDCTITGTIDFVFGDAAVVLQNCTLIAKKPLAAQKN  47
            S+  +C  EGYQDTLY HS+RQFYR+C I GT+DF+FG+AAVVLQNC + A+ P   + N
Sbjct  323  SVFYKCSFEGYQDTLYVHSERQFYRECNIYGTVDFIFGNAAVVLQNCNIFARNP-PNKVN  381

Query  46   MVTAQGRSDPNQNTG  2
             +TAQGR+DPNQNTG
Sbjct  382  TITAQGRTDPNQNTG  396



>ref|XP_003608136.1| Pectinesterase [Medicago truncatula]
 ref|XP_003609931.1| Pectinesterase [Medicago truncatula]
 gb|AES90333.1| pectinesterase/pectinesterase inhibitor [Medicago truncatula]
Length=518

 Score =   256 bits (654),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 138/326 (42%), Positives = 199/326 (61%), Gaps = 17/326 (5%)
 Frame = -3

Query  952  FTHPREVQAVADCVELMGLSINDVRDAIKDLQGSKTR-------NSDAQTSLSAVLTNHL  794
            F H R   AV+DC++L+ +S++ +  +I   Q  K +       N D +T LSAVL    
Sbjct  78   FGHSRTSNAVSDCLDLLDMSLDQLNQSISAAQKPKEKDNSTGKLNCDLRTWLSAVLVYPD  137

Query  793  TCMEGLNPPEKSPVKGILDALISRSRVALAVLAEIIGQTDEEQNFRVPFN-GKFPSWVKS  617
            TC+EGL   E S VKG++ + +      ++++A ++G+     + ++  N  +FPSW++ 
Sbjct  138  TCIEGL---EGSIVKGLISSGLDH---VMSLVANLLGEVVSGNDDQLATNKDRFPSWIRD  191

Query  616  SDRKLVRRKHGNLKADIIVSQDGKGNFTTLKKAMESVSAVSKARVFIYVKKGTYKENVEM  437
             D KL++     + AD +V+ DG G++  +  A+ +    S  R  IYVKKG Y ENVE+
Sbjct  192  EDTKLLQAN--GVTADAVVAADGSGDYAKVMDAVSAAPESSMKRYVIYVKKGVYVENVEI  249

Query  436  NVKS-PVMIYGDGMTQTVFSGDHSFGDNYTTFKSYTLASKGPAAILQDLCVRNTAGAAKH  260
              K   +M+ G+GM  T+ SG  ++ D  TTF+S T A  G   I +D+  +NTAGA KH
Sbjct  250  KKKKWNIMLIGEGMDATIISGSRNYVDGSTTFRSATFAVSGRGFIARDISFQNTAGAEKH  309

Query  259  QAVALLVGGDKSIINRCRLEGYQDTLYAHSKRQFYRDCTITGTIDFVFGDAAVVLQNCTL  80
            QAVAL    D S+  RC + GYQD+LY H+ RQFYR+C I+GT+DF+FGDA  V QNC +
Sbjct  310  QAVALRSDSDLSVFYRCGIFGYQDSLYTHTMRQFYRECKISGTVDFIFGDATAVFQNCQI  369

Query  79   IAKKPLAAQKNMVTAQGRSDPNQNTG  2
            +AKK +  QKN VTAQGR DPNQ TG
Sbjct  370  LAKKGMPKQKNTVTAQGRKDPNQPTG  395



>gb|KGN55582.1| hypothetical protein Csa_3G000060 [Cucumis sativus]
Length=576

 Score =   258 bits (658),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 150/354 (42%), Positives = 207/354 (58%), Gaps = 35/354 (10%)
 Frame = -3

Query  1030  LLREFLADYLPSMEAAKMEFGMVRGEFTHPREVQAVADCVELMGLSINDVRDAIKDLQGS  851
             ++R+ +A + P        F  + G+F   R   A++DC++L+  S + +  ++   Q  
Sbjct  123   VVRQVMAIFSP--------FSKLLGDF---RLSTAISDCLDLLDSSADQLSWSLSATQNP  171

Query  850   KTRN-------SDAQTSLSAVLTNHLTCM---EGLNPPEKSPVKGILDALISRSRVALAV  701
             K +N       SD +T LSA + N  TCM   EG N   K  V G ++ L S+    L++
Sbjct  172   KAKNHSTGDLSSDLKTWLSAAVVNPETCMDGFEGTNSIIKGLVSGGVNQLTSQLYDLLSM  231

Query  700   LAEIIGQTDEEQNFRVPFNGKFPSWVKSSDRKLVRRKHGNLKADIIVSQDGKGNFTTLKK  521
             +  I  Q  E           FPSW+KS D+ L++    +L AD  V+ DG G+FT +  
Sbjct  232   VKSIPNQPSE-----------FPSWLKSEDQNLLQIN--DLAADATVAADGTGDFTNVMD  278

Query  520   AMESVSAVSKARVFIYVKKGTYKENVEMNVKS-PVMIYGDGMTQTVFSGDHSFGDNYTTF  344
             A+ +    S  R  IY+KKG Y ENVE+  K   +M+ GDG+  T+ SG+ SF D +TTF
Sbjct  279   AVLAAPDNSIRRYVIYIKKGVYLENVEIKKKKWNLMMIGDGIDATIISGNRSFIDGWTTF  338

Query  343   KSYTLASKGPAAILQDLCVRNTAGAAKHQAVALLVGGDKSIINRCRLEGYQDTLYAHSKR  164
             +S T A  G   I +D+   NTAGA KHQAVAL    D S+  RCR+ GYQDTLY H+ R
Sbjct  339   RSATFAVSGRGFIARDITFENTAGAEKHQAVALRSDSDLSVFFRCRIRGYQDTLYTHTMR  398

Query  163   QFYRDCTITGTIDFVFGDAAVVLQNCTLIAKKPLAAQKNMVTAQGRSDPNQNTG  2
             QFYR+C I+GT+DF+FGDA VV QNC+++AKK L  QKN +TAQGR DPNQ TG
Sbjct  399   QFYRECQISGTVDFLFGDATVVFQNCSILAKKGLPNQKNTITAQGRKDPNQPTG  452



>ref|XP_010687599.1| PREDICTED: pectinesterase/pectinesterase inhibitor PPE8B-like 
[Beta vulgaris subsp. vulgaris]
Length=544

 Score =   256 bits (655),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 145/363 (40%), Positives = 205/363 (56%), Gaps = 55/363 (15%)
 Frame = -3

Query  976  EFGMVRGEFTHPREVQAVADCVELMGLSINDVRDAIKDLQ-----GSKTRNSDAQTSLSA  812
            +FG V GEF   R   A++DC++L+ LS +++   +   Q     G+    SD +T LSA
Sbjct  70   KFGGVFGEF---RVSNAISDCLDLLELSSDELSWTLSASQHGKGNGTGDMASDLKTWLSA  126

Query  811  VLTNHLTCMEGLNPPEKSPVKGILDALISRSRVALAVLAE--------------------  692
             L N  TC+EG +         I+ AL+S S   L+ L +                    
Sbjct  127  ALGNQETCLEGFDG-----TGNIVKALVSGSINQLSSLIQNILHMVHLAPRPIHGSNSRA  181

Query  691  ------------IIGQTDEEQNFRVPFNGKFPSWVKSSDRKLVRRKHGNLKADIIVSQDG  548
                        ++ + D+E         +FPSW++S DRKL++   G L  +++V+QDG
Sbjct  182  NGARPGGGGRRLLMAKNDDEH--------EFPSWIRSKDRKLLQTT-GVLTPNVVVAQDG  232

Query  547  KGNFTTLKKAMESVSAVSKARVFIYVKKGTYKENVEMN-VKSPVMIYGDGMTQTVFSGDH  371
             GNF+ +  A+E   + +  R  IYVKKG Y+ENVE+   K+ +M+YGDGM  T+ + +H
Sbjct  233  SGNFSQIMDAIEVAPSHNTDRFVIYVKKGVYEENVEIKRKKTNIMMYGDGMDVTIITSNH  292

Query  370  SFGDNYTTFKSYTLASKGPAAILQDLCVRNTAGAAKHQAVALLVGGDKSIINRCRLEGYQ  191
            S  D +TT++S T A  G   I +D+  +NTAG  KHQAVA     D S + RC   GYQ
Sbjct  293  SVVDGWTTYRSATFAVTGAGFIARDMTFQNTAGPEKHQAVAFRSDSDLSALYRCAFRGYQ  352

Query  190  DTLYAHSKRQFYRDCTITGTIDFVFGDAAVVLQNCTLIAKKPLAAQKNMVTAQGRSDPNQ  11
            DTLYAH+ RQF+R+CTITGT+DF+FGD   V QNC + A+K L  QKN +TAQGR DP +
Sbjct  353  DTLYAHANRQFFRECTITGTVDFIFGDGVAVFQNCQIQARKGLTNQKNTITAQGRKDPGE  412

Query  10   NTG  2
            NTG
Sbjct  413  NTG  415



>ref|XP_010271283.1| PREDICTED: pectinesterase [Nelumbo nucifera]
Length=531

 Score =   256 bits (654),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 136/321 (42%), Positives = 196/321 (61%), Gaps = 17/321 (5%)
 Frame = -3

Query  928  AVADCVELMGLSINDVRDAIKDLQGSKTRNSDAQTSLSAVLTNHLTCMEGLN--------  773
            A ADCVEL   +I  +   +     +  R SDAQT LSA +TN  TC  G          
Sbjct  96   AWADCVELYADTITQLNRTMGS-NKNPLRWSDAQTWLSAAITNQQTCQNGFTELNLSSYL  154

Query  772  ----PPEKSPVKGILDALISRSRVALAVLAEIIGQTDEEQNFRVPFNGKFPSWVKSSDRK  605
                P   S    ++   ++ ++ A + +A ++G+  +  N R+  +G FP+WV ++DRK
Sbjct  155  SNSFPFMLSNFSKMISNSLAINKAAASSVASLMGK--QGGNRRLLSDG-FPTWVSAADRK  211

Query  604  LVRRKHGNLKADIIVSQDGKGNFTTLKKAMESVSAVSKARVFIYVKKGTYKENVEMNVKS  425
            L++      +AD++V+ DG GN+ T+ +A+ + S  S  R  IYVK+G YKENVE+   S
Sbjct  212  LLQSSSAASQADVVVAADGSGNYRTISQAVAASSKRSGKRFVIYVKRGVYKENVEIKA-S  270

Query  424  PVMIYGDGMTQTVFSGDHSFGDNYTTFKSYTLASKGPAAILQDLCVRNTAGAAKHQAVAL  245
             +M+ GDG+  T+ +G  +  D  TTF+S T+A      + +D+   NTAG  KHQAVAL
Sbjct  271  NIMLIGDGIDATIVTGSKNVQDGSTTFRSATVAVTRDRFMARDMTFENTAGPQKHQAVAL  330

Query  244  LVGGDKSIINRCRLEGYQDTLYAHSKRQFYRDCTITGTIDFVFGDAAVVLQNCTLIAKKP  65
              G D S+  RC  +GYQDTLY +S+RQFYRDC I GT+DF+FGDA  VLQNC +  +KP
Sbjct  331  RSGSDLSVFYRCSFKGYQDTLYVYSQRQFYRDCDIYGTVDFIFGDAVAVLQNCNIYVRKP  390

Query  64   LAAQKNMVTAQGRSDPNQNTG  2
            ++ Q+N +TAQGR+DPN+NTG
Sbjct  391  MSGQRNTLTAQGRTDPNENTG  411



>gb|ABZ89800.1| pectin methylesterase-like protein [Taiwania cryptomerioides]
Length=584

 Score =   257 bits (657),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 149/406 (37%), Positives = 224/406 (55%), Gaps = 46/406 (11%)
 Frame = -3

Query  1111  CRTAIDPAACKTILKQTVKSYGGTPAGLLREFLADYLPSMEAA-KMEFGMVRGEFTHPRE  935
             C + + P  C +    ++ SYGG  +       AD++  +E+A ++  G V     H R 
Sbjct  67    CSSTLHPELCVS----SIASYGGLSSK------ADHMEIVESAVRVGIGAVEKAKAHVRR  116

Query  934   VQ----------AVADCVELMGLSINDVRDAIKDLQGSKTRN-----SDAQTSLSAVLTN  800
             +           A+ DC+E+   ++ +++D + DLQ +   +      D +T LS  +TN
Sbjct  117   LSRPGLDFRQRGALKDCMEMFDDTLEELQDTLTDLQNATFMSLPKYADDLKTLLSGAITN  176

Query  799   HLTCMEGLNPPEKSPVKGILDALISRSRVALAVLAEI----------IGQTDE-------  671
               TC++G +  +    + +   L++ S +    LA +          +G  D        
Sbjct  177   QYTCLDGFHLCKGHLRQDLNAELLNISHLVSNSLAMVCNFSQQANLALGNADSLSDRRRR  236

Query  670   --EQNFRVPFNGKFPSWVKSSDRKLVRRKHGNLKADIIVSQDGKGNFTTLKKAMESVSAV  497
                 +F    +  FPSW+ + DR+L++    N+ A+ +V++DG G++TT+  A+ +    
Sbjct  237   LLSNDFMSSDDHGFPSWMSAGDRRLLQTPAQNINANAVVAKDGSGSYTTISAAVAAAPEK  296

Query  496   SKARVFIYVKKGTYKENVEM-NVKSPVMIYGDGMTQTVFSGDHSFGDNYTTFKSYTLASK  320
             S +R  I++KKG Y+ENV++   K  +M  GDG   TV + + +  D YTTF S T A  
Sbjct  297   STSRYVIHIKKGVYQENVDIPKNKHNLMFIGDGKDVTVVTANRNVVDGYTTFHSATAAVT  356

Query  319   GPAAILQDLCVRNTAGAAKHQAVALLVGGDKSIINRCRLEGYQDTLYAHSKRQFYRDCTI  140
             G   + +D+  +NTAG  KHQAVAL VG D S   RC  EGYQDTLY HS RQFYR+C +
Sbjct  357   GKGFVARDMTFKNTAGPTKHQAVALRVGSDLSAFLRCTFEGYQDTLYVHSLRQFYRECDV  416

Query  139   TGTIDFVFGDAAVVLQNCTLIAKKPLAAQKNMVTAQGRSDPNQNTG  2
              GT+DFVFG+AAVVLQNC ++A+KP A QK M TAQGR DPNQNTG
Sbjct  417   YGTVDFVFGNAAVVLQNCNIMARKPSANQKIMYTAQGREDPNQNTG  462



>ref|XP_009604014.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 46 
[Nicotiana tomentosiformis]
Length=574

 Score =   257 bits (657),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 155/403 (38%), Positives = 222/403 (55%), Gaps = 43/403 (11%)
 Frame = -3

Query  1114  LCRTAIDPAACKTILKQTVKSYGGTPAGLLREFLADYLPSMEAAKMEFGMVRGEF-----  950
             +C   + P +C   L    KS    P  +       Y  S++ A  E      +F     
Sbjct  66    ICDITLYPQSCYNSLGPLAKSNNLKPQDI-------YKLSVQVAIDELSRTSDDFFNMPE  118

Query  949   ----THPREVQAVADCVELMGLSINDVRDAIKDLQGSKTRN-SDAQTSLSAVLTNHLTCM  785
                 + P  V+A+  C EL+ LS++ + +++     S +   SD +T LSA  T   TC+
Sbjct  119   LKNISDPMAVKALGSCHELISLSLDSLNESLSIPNKSFSEAFSDLKTRLSAAGTYQQTCI  178

Query  784   EGL----------------NPPE-KSPVKGILDALISRSRVALAVLAEI--IGQTDEEQN  662
             +G                 N  E  S    I+D +    + ++  +  +  IG+     N
Sbjct  179   DGFGNVTYAFASIASHNFKNSGEYTSNSLAIIDNIDQSIQNSIDSMDSLGGIGRRRRLMN  238

Query  661   FRVPFNGKFPSWVKSSDRKLVRRKHG--NLKADIIVSQDGKGNFTTLKKAMESVSAVSKA  488
             F    +G FPSW+ S+DRKL++   G  + K D++V++DG G+F T+ KA+++V   S  
Sbjct  239   F----DGDFPSWMGSNDRKLLQSSKGKNSTKVDVVVAKDGSGDFITISKALKAVPEKSNK  294

Query  487   RVFIYVKKGTYKENVEMNVKS-PVMIYGDGMTQTVFSGDHSFGDNYTTFKSYTLASKGPA  311
             R  IYVKKG Y ENV +  K   VM+ GDGM  T+ SG  +F D   TF++ T A  G  
Sbjct  295   RFVIYVKKGVYVENVRVEKKKWNVMMIGDGMDATIVSGSLNFVDGTPTFQTATFAVFGKG  354

Query  310   AILQDLCVRNTAGAAKHQAVALLVGGDKSIINRCRLEGYQDTLYAHSKRQFYRDCTITGT  131
              I +D+  RNTAGAAKHQAVAL+   D S+  RC+ + YQDTLY HS RQFYR+C I GT
Sbjct  355   FIARDMGFRNTAGAAKHQAVALMSTADLSVFYRCKFDAYQDTLYPHSNRQFYRECRIYGT  414

Query  130   IDFVFGDAAVVLQNCTLIAKKPLAAQKNMVTAQGRSDPNQNTG  2
             +DF+FG++AVV QNC ++ KKP++ QKN +TAQG+ DPNQNTG
Sbjct  415   VDFIFGNSAVVFQNCHILPKKPMSGQKNTITAQGKIDPNQNTG  457



>ref|XP_007201179.1| hypothetical protein PRUPE_ppa003400mg [Prunus persica]
 gb|EMJ02378.1| hypothetical protein PRUPE_ppa003400mg [Prunus persica]
Length=578

 Score =   257 bits (657),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 143/341 (42%), Positives = 193/341 (57%), Gaps = 18/341 (5%)
 Frame = -3

Query  970  GMVRGEFTHPREVQAVA--DCVELMGLSINDVRDAIKDLQGSKT---RNSDAQTSLSAVL  806
            G+++ +F     +Q +A  DC+EL   +I +++  I DL   K    R  D +T LS  +
Sbjct  115  GIIKKQFKKLDALQQIALDDCLELFDDTIAELKAVISDLSVEKLSSDRYYDLKTLLSGAM  174

Query  805  TNHLTCMEGLNPPE--KSPVKGILDALISRSRVALAVLAEIIGQTDEEQNFRV-------  653
            TN  TC++G N     +  ++  L  +      AL +L +I G    E +          
Sbjct  175  TNQYTCLDGFNDTGIVRHEIQSRLQTISQHVSNALVMLKKIPGALKYENSKSSTSSEMFP  234

Query  652  ---PFNGKFPSWVKSSDRKLVRRKHGNLKADIIVSQDGKGNFTTLKKAMESVSAVSKARV  482
               P    FP+WV S DRKL++      K D++V++DG GNFTT+ +A+      S  R 
Sbjct  235  EFGPMRNGFPTWVSSKDRKLLQSVVNGTKYDLVVAKDGTGNFTTISEAVAVAPNSSATRF  294

Query  481  FIYVKKGTYKENVEM-NVKSPVMIYGDGMTQTVFSGDHSFGDNYTTFKSYTLASKGPAAI  305
             IY+K G Y ENVE+   K+ +M  GDG+ +TV     +  D +TTF+S T+A  G   I
Sbjct  295  VIYIKSGAYFENVEVVRKKTKLMFLGDGIGKTVVKASRNVVDGWTTFRSATVAVVGDGFI  354

Query  304  LQDLCVRNTAGAAKHQAVALLVGGDKSIINRCRLEGYQDTLYAHSKRQFYRDCTITGTID  125
             Q +   N AG +KHQAVA   G D S   +C   GYQDTLY HS RQFYR+C I GT+D
Sbjct  355  AQGITFENAAGPSKHQAVAFRSGSDFSAFYKCSFVGYQDTLYVHSLRQFYRECDIYGTVD  414

Query  124  FVFGDAAVVLQNCTLIAKKPLAAQKNMVTAQGRSDPNQNTG  2
            F+FG+AAVVLQNC L A+KP   QKNM TAQGR DPNQNTG
Sbjct  415  FIFGNAAVVLQNCNLYARKPNENQKNMFTAQGREDPNQNTG  455



>ref|XP_006480001.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 40-like 
[Citrus sinensis]
Length=569

 Score =   257 bits (656),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 139/323 (43%), Positives = 199/323 (62%), Gaps = 11/323 (3%)
 Frame = -3

Query  937  EVQAVADCVELMGLSINDVRDAIKDLQGSKTRNS---DAQTSLSAVLTNHLTCMEGLNPP  767
            E +A+ DC+EL   +I +++ A+ DL   K  +    D QT  S  +TN  TC++G    
Sbjct  124  EKRAINDCLELFHDTIVELKSALNDLSPKKLPSKHYHDLQTLFSGAMTNQYTCLDGFAYS  183

Query  766  EKSPVKGILDALISRSRV---ALAVLAEIIGQTDEEQNFRVPFNGK----FPSWVKSSDR  608
            + +    I  +L + SR    +L +L +I G     +    P  G+    FP+W+  +DR
Sbjct  184  DGNVRDVIKSSLYNISRHVSNSLVMLKKIPGDNMSSKYEVFPEYGRIKRGFPTWLSLNDR  243

Query  607  KLVRRKHGNLKADIIVSQDGKGNFTTLKKAMESVSAVSKARVFIYVKKGTYKENVEMNVK  428
            KL+++     K D+IV++DG GNFTT+ +A+E+    S  R  IY+K G Y ENVE++ K
Sbjct  244  KLLQKSVNLTKFDLIVAKDGSGNFTTITEAVEAAPNKSNTRFVIYIKAGAYFENVEVDKK  303

Query  427  SPVMIY-GDGMTQTVFSGDHSFGDNYTTFKSYTLASKGPAAILQDLCVRNTAGAAKHQAV  251
              ++++ GDG+ +TV   + S  D +TTF+S T+A  G   I + + V N+AG +KHQAV
Sbjct  304  KTMLMFVGDGIGKTVVKANRSVVDGWTTFRSATVAVVGTGFIAKGITVENSAGPSKHQAV  363

Query  250  ALLVGGDKSIINRCRLEGYQDTLYAHSKRQFYRDCTITGTIDFVFGDAAVVLQNCTLIAK  71
            AL  G D S   +C   GYQDTLY HS RQFYR+C + GT+DF+FG+AAVV Q C L A+
Sbjct  364  ALRSGSDLSAFYKCSFVGYQDTLYVHSLRQFYRECDVYGTVDFIFGNAAVVFQICNLYAR  423

Query  70   KPLAAQKNMVTAQGRSDPNQNTG  2
            KP A QKN++TAQGR DPNQNTG
Sbjct  424  KPNANQKNIITAQGREDPNQNTG  446



>ref|XP_011034009.1| PREDICTED: pectinesterase 2 [Populus euphratica]
Length=514

 Score =   254 bits (650),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 149/317 (47%), Positives = 192/317 (61%), Gaps = 19/317 (6%)
 Frame = -3

Query  937  EVQAVADCVELMGLSINDVRDAIKDLQGSKTRNSDAQTSLSAVLTNHLTCMEGLNPPEKS  758
            E  A  DC+EL      ++   +    GSK    DAQT LS  LTN  TC  G    E  
Sbjct  91   EKAAWEDCLELY----QEIVLWLNKTTGSKCTKYDAQTWLSTALTNLATCRTGF--AEFG  144

Query  757  PVKGILDALISRSRVALAVLAEIIGQT--DEEQNFRVP-FNGKFPSWVKSSDRKLVRRKH  587
                IL  L+S +      ++++I  T    +  +R P FNG FPSWV+  DRKL++   
Sbjct  145  MTDYIL-PLMSNN------VSKLISNTLAINKAPYREPSFNGGFPSWVRPGDRKLLQSSS  197

Query  586  GNLKADIIVSQDGKGNFTTLKKAMESVSAVS-KARVFIYVKKGTYKENVEMNVK-SPVMI  413
               +A+I+V+QDG GN  T+K+A+++ S  S   R  IYVK GTY ENVE+  K   VM+
Sbjct  198  PASQANIVVAQDGSGNVKTIKEAIDAASKRSGSGRYVIYVKAGTYNENVEIARKVKNVMV  257

Query  412  YGDGMTQTVFSGDHSFGDNYTTFKSYTLASKGPAAILQDLCVRNTAGAAKHQAVALLVGG  233
             GDG+ +T+ +G  S G   TTFKS T A  G   I +D+  RNTAGA  HQAVAL  G 
Sbjct  258  VGDGIGKTIVTGSKSVGGGTTTFKSATFAVVGDNFIARDMTFRNTAGAKNHQAVALRSGS  317

Query  232  DKSIINRCRLEGYQDTLYAHSKRQFYRDCTITGTIDFVFGDAAVVLQNCTLIAKKPLAAQ  53
            D S+  +C  EGYQDTLY HS+RQFYR+C I GT+DF+FG+AAVV QNC + A+ P   +
Sbjct  318  DLSVFYKCSFEGYQDTLYVHSQRQFYRECDIYGTVDFIFGNAAVVFQNCNIYARNP-PNK  376

Query  52   KNMVTAQGRSDPNQNTG  2
             N VTAQGR+DPNQNTG
Sbjct  377  TNTVTAQGRTDPNQNTG  393



>gb|AGG23325.1| pectin methylesterase 1 [Musa acuminata AAA Group]
Length=566

 Score =   256 bits (653),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 138/326 (42%), Positives = 197/326 (60%), Gaps = 14/326 (4%)
 Frame = -3

Query  940  REVQAVADCVELMGLSINDVRDAIKDLQGSKTRNSD-AQTSLSAVLTNHLTCMEGL----  776
            R+  A+ DC++L   +++++ DA  DL  +   + D  QT LSA +TN  TC++G     
Sbjct  120  RQRYALTDCLDLFSQTLDELLDATSDLTANPGSHVDHVQTLLSAAITNQYTCLDGFAYVG  179

Query  775  -NPPEKSPVKGILDALISRSRVALAVLAEIIGQTDEEQNFRVPFNGK------FPSWVKS  617
             +   +S ++  L  +      +LA++ +I  Q       R    G       FP WV  
Sbjct  180  KDGGYRSVIEQPLYHVSHLVSNSLAMMKKIQRQKPXHPR-REALEGYGEVAEGFPVWVSG  238

Query  616  SDRKLVRRKHGNLKADIIVSQDGKGNFTTLKKAMESVSAVSKARVFIYVKKGTYKENVEM  437
             DR+L++        ++IV++DG GNFTT+  A+ +  + S+ R  IY+K G Y ENVE+
Sbjct  239  KDRRLLQAAANTTTPNLIVAKDGSGNFTTISDAVAAAPSKSETRFVIYIKAGAYLENVEV  298

Query  436  N-VKSPVMIYGDGMTQTVFSGDHSFGDNYTTFKSYTLASKGPAAILQDLCVRNTAGAAKH  260
               K+ +M  GDG+ +TV     +  D +TTF+S T+A  G   +++D+ + N+AG +KH
Sbjct  299  GKSKTNLMFMGDGIGKTVVKASRNVVDGWTTFRSATVAIVGNGFLMRDMTIENSAGPSKH  358

Query  259  QAVALLVGGDKSIINRCRLEGYQDTLYAHSKRQFYRDCTITGTIDFVFGDAAVVLQNCTL  80
            QAVAL VG D S   RC   GYQDTLYAHS RQFYR+C + GTIDF+FG+A VVLQNC L
Sbjct  359  QAVALRVGADLSAFYRCSFVGYQDTLYAHSLRQFYRECDVYGTIDFIFGNAGVVLQNCNL  418

Query  79   IAKKPLAAQKNMVTAQGRSDPNQNTG  2
             A+KPL+ QKN+ TAQGR DPNQNTG
Sbjct  419  YARKPLSNQKNIFTAQGREDPNQNTG  444



>ref|XP_010230835.1| PREDICTED: pectinesterase-like [Brachypodium distachyon]
Length=561

 Score =   256 bits (653),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 145/347 (42%), Positives = 201/347 (58%), Gaps = 28/347 (8%)
 Frame = -3

Query  961  RGEFTHPREVQAVADCVELMGLSINDVRDAIKDLQ---GSKTRNSDAQTSLSAVLTNHLT  791
            +G+   PR+  A+ADC+EL+G ++++++    DLQ      T      T LS  +TN  T
Sbjct  95   QGKSLPPRDRVAIADCIELLGTTMDELQATTSDLQQPSNGATVVDHVMTVLSGAITNQHT  154

Query  790  CMEGL------NPPEKSPVKGILDALISR-SRVALAVLAEIIGQTDEEQNF---------  659
            C+ G       N  + S  +  ++  I   SR+    LA        + N          
Sbjct  155  CLSGFTYHGPRNGGQVSLARPYMEPGIRHISRMVSNTLAMAKKMRSTKPNSPSPSVQVQR  214

Query  658  RVPFNGK------FPSWVKSSDRKLVRRKHGNLKADIIVSQDGKGNFTTLKKAMESVSAV  497
            R PF G       FP WV+  DR+L++     + A+ +V++DG G +TT+  A+ +  A 
Sbjct  215  RQPFTGYGQMVKGFPRWVRPGDRRLLQAAASGITANAVVAKDGSGGYTTVSAAVTAAPAN  274

Query  496  SKARVFIYVKKGTYKENVEM--NVKSPVMIYGDGMTQTVFSGDHSFGDNYTTFKSYTLAS  323
            SK+R  IY+K G Y ENVE+  N K+ +M  GDG+ +TV     +  D YTTF+S T+A 
Sbjct  275  SKSRYVIYIKAGAYLENVEVGKNQKN-LMFIGDGIGKTVIKASRNVVDGYTTFRSATVAV  333

Query  322  KGPAAILQDLCVRNTAGAAKHQAVALLVGGDKSIINRCRLEGYQDTLYAHSKRQFYRDCT  143
             G   I +DL + N+AG +KHQAVAL VG D S   RC   GYQDTLY HS RQF+RDC 
Sbjct  334  VGNNFIARDLTIENSAGPSKHQAVALRVGADLSAFYRCSFVGYQDTLYVHSLRQFFRDCD  393

Query  142  ITGTIDFVFGDAAVVLQNCTLIAKKPLAAQKNMVTAQGRSDPNQNTG  2
            + GT+DFVFG++AVVLQ C+L A++PLA Q N  TAQGR+DPNQNTG
Sbjct  394  VYGTVDFVFGNSAVVLQGCSLYARRPLAGQSNTYTAQGRTDPNQNTG  440



>gb|ACQ85264.1| pectin methylesterase [Musa acuminata AAA Group]
Length=565

 Score =   255 bits (652),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 138/326 (42%), Positives = 197/326 (60%), Gaps = 14/326 (4%)
 Frame = -3

Query  940  REVQAVADCVELMGLSINDVRDAIKDLQGSKTRNSD-AQTSLSAVLTNHLTCMEGL----  776
            R+  A+ DC++L   +++++ DA  DL  +   + D  QT LSA +TN  TC++G     
Sbjct  119  RQRYALTDCLDLFSQTLDELLDATSDLTANPGSHVDHVQTLLSAAITNQYTCLDGFAYVG  178

Query  775  -NPPEKSPVKGILDALISRSRVALAVLAEIIGQTDEEQNFRVPFNGK------FPSWVKS  617
             +   +S ++  L  +      +LA++ +I  Q       R    G       FP WV  
Sbjct  179  KDGGYRSVIEQPLYHVSHLVSNSLAMMKKIQRQKPPHPR-REALEGYGEVAEGFPVWVSG  237

Query  616  SDRKLVRRKHGNLKADIIVSQDGKGNFTTLKKAMESVSAVSKARVFIYVKKGTYKENVEM  437
             DR+L++        ++IV++DG GNFTT+  A+ +  + S+ R  IY+K G Y ENVE+
Sbjct  238  KDRRLLQAAANTTTPNLIVAKDGSGNFTTISDAVAAAPSKSETRFVIYIKAGAYLENVEV  297

Query  436  N-VKSPVMIYGDGMTQTVFSGDHSFGDNYTTFKSYTLASKGPAAILQDLCVRNTAGAAKH  260
               K+ +M  GDG+ +TV     +  D +TTF+S T+A  G   +++D+ + N+AG +KH
Sbjct  298  GKSKTNLMFMGDGIGKTVVKASRNVVDGWTTFRSATVAIVGNGFLMRDMTIENSAGPSKH  357

Query  259  QAVALLVGGDKSIINRCRLEGYQDTLYAHSKRQFYRDCTITGTIDFVFGDAAVVLQNCTL  80
            QAVAL VG D S   RC   GYQDTLYAHS RQFYR+C + GTIDF+FG+A VVLQNC L
Sbjct  358  QAVALRVGADLSAFYRCSFVGYQDTLYAHSLRQFYRECDVYGTIDFIFGNAGVVLQNCNL  417

Query  79   IAKKPLAAQKNMVTAQGRSDPNQNTG  2
             A+KPL+ QKN+ TAQGR DPNQNTG
Sbjct  418  YARKPLSNQKNIFTAQGREDPNQNTG  443



>ref|XP_011015915.1| PREDICTED: pectinesterase-like [Populus euphratica]
Length=558

 Score =   255 bits (651),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 143/324 (44%), Positives = 195/324 (60%), Gaps = 10/324 (3%)
 Frame = -3

Query  943  PREVQAVADCVELMGLSINDVRDAIKDLQGSKTRNS---DAQTSLSAVLTNHLTCMEGLN  773
            P E  A+ DC+EL   +I +++ AI DL   K+ +    D QT LS  +TN  TC++G  
Sbjct  113  PLEKVALKDCIELFDDTIAELKSAISDLAPRKSTSKHYHDLQTLLSGAMTNQYTCLDGFA  172

Query  772  PPEKSPVKGILDALISRSRV---ALAVLAEIIG-QTDEEQNFRVPFNGK--FPSWVKSSD  611
              +    K I   L + S     +LA+L +I G  T + + F    N K  FPSW+ S D
Sbjct  173  RSKGKVRKAIKKGLYNISHHVSNSLAMLKKIPGVNTSKSEVFPEYGNVKHGFPSWLSSKD  232

Query  610  RKLVRRKHGNLKADIIVSQDGKGNFTTLKKAMESVSAVSKARVFIYVKKGTYKENVEMNV  431
            RKL++      K D+IV++DG GNFTT+ +A+ +    S  R  IY+K G Y ENVE+  
Sbjct  233  RKLLQASANATKFDLIVAKDGTGNFTTISEAVRAAPNSSDTRFVIYIKAGAYFENVEVER  292

Query  430  KSPVMIY-GDGMTQTVFSGDHSFGDNYTTFKSYTLASKGPAAILQDLCVRNTAGAAKHQA  254
            K  ++++ GDG+ +TV     S  D +TTF+S T+A  G   I + +   N+AG +KHQA
Sbjct  293  KKKMLVFIGDGIGKTVVKAKRSVVDGWTTFRSATVAVVGDGFIAKGITFENSAGPSKHQA  352

Query  253  VALLVGGDKSIINRCRLEGYQDTLYAHSKRQFYRDCTITGTIDFVFGDAAVVLQNCTLIA  74
            VAL  G D S   +C   GYQDTLY HS RQFYR+C + GTIDF+FG+AAVV Q   L A
Sbjct  353  VALRSGSDLSAFYQCSFVGYQDTLYVHSLRQFYRECDVYGTIDFIFGNAAVVFQTSNLYA  412

Query  73   KKPLAAQKNMVTAQGRSDPNQNTG  2
            +KP + Q+N+ TAQGR DPNQNTG
Sbjct  413  RKPNSNQRNIFTAQGREDPNQNTG  436



>gb|EEC82670.1| hypothetical protein OsI_27314 [Oryza sativa Indica Group]
Length=579

 Score =   256 bits (653),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 148/335 (44%), Positives = 198/335 (59%), Gaps = 30/335 (9%)
 Frame = -3

Query  940  REVQAVADCVELMGLSINDVRDAIKDLQ-GSKTRNSDA---QTSLSAVLTNHLTCMEGLN  773
            R+  A++DC+EL G +++ +  A  +L  G+ T    A   QT LSA +TN  TC++G  
Sbjct  131  RDRLALSDCLELFGHTLDLLGTAAAELSAGNSTAEESAAGVQTVLSAAMTNQYTCLDGFA  190

Query  772  PPEKSP-------VKGILDALISRSRVALAVLAEIIGQ----TDEEQNFRVPFNGK----  638
             P  S        ++G +  +      +LA++  +  Q     +EE     P  G     
Sbjct  191  GPSASEDGRVRPFIQGRIYHVAHLVSNSLAMVRRLPTQRRRGAEEE-----PLEGYGRVR  245

Query  637  --FPSWVKSSDRKLVRRKHGNLKADIIVSQDGKGNFTTLKKAMESVSAVSKARVFIYVKK  464
              FPSWV +SDR   RR    + AD++V++DG G FTT+ +A+ +    S+ R  IY+K 
Sbjct  246  RGFPSWVSASDR---RRLQQQVAADVVVAKDGSGKFTTVSEAVAAAPNNSETRYVIYIKA  302

Query  463  GTYKENVEM-NVKSPVMIYGDGMTQTVFSGDHSFGDNYTTFKSYTLASKGPAAILQDLCV  287
            G Y ENVE+ + K+ +M  GDG  +TV     +  DN TTF+S TLA  G   + +D+ V
Sbjct  303  GGYFENVEVGSEKTNIMFVGDGTWKTVIKASRNVVDNSTTFRSATLAVVGTGFLARDITV  362

Query  286  RNTAGAAKHQAVALLVGGDKSIINRCRLEGYQDTLYAHSKRQFYRDCTITGTIDFVFGDA  107
             N AG +KHQAVAL V  D S   RC   GYQDTLYAHS RQFYRDC I GT+DF+FGDA
Sbjct  363  ENAAGPSKHQAVALRVNADLSAFYRCSFAGYQDTLYAHSLRQFYRDCDIYGTVDFIFGDA  422

Query  106  AVVLQNCTLIAKKPLAAQKNMVTAQGRSDPNQNTG  2
            AVVLQNC L A++P   QKN+ TAQGR DPNQNTG
Sbjct  423  AVVLQNCNLYARRPDPNQKNVFTAQGREDPNQNTG  457



>ref|XP_011010963.1| PREDICTED: pectinesterase-like [Populus euphratica]
Length=558

 Score =   255 bits (651),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 143/324 (44%), Positives = 195/324 (60%), Gaps = 10/324 (3%)
 Frame = -3

Query  943  PREVQAVADCVELMGLSINDVRDAIKDLQGSKTRNS---DAQTSLSAVLTNHLTCMEGLN  773
            P E  A+ DC+EL   +I +++ AI DL   K+ +    D QT LS  +TN  TC++G  
Sbjct  113  PLEKVALKDCIELFDDTIAELKSAISDLAPRKSTSKHYHDLQTLLSGAMTNQYTCLDGFA  172

Query  772  PPEKSPVKGILDALISRSRV---ALAVLAEIIG-QTDEEQNFRVPFNGK--FPSWVKSSD  611
              +    K I   L + S     +LA+L +I G  T + + F    N K  FPSW+ S D
Sbjct  173  RSKGKVRKAIKKGLYNISHHVSNSLAMLKKIPGVNTSKSEVFPEYGNVKHGFPSWLSSKD  232

Query  610  RKLVRRKHGNLKADIIVSQDGKGNFTTLKKAMESVSAVSKARVFIYVKKGTYKENVEMNV  431
            RKL++      K D+IV++DG GNFTT+ +A+ +    S  R  IY+K G Y ENVE+  
Sbjct  233  RKLLQASANATKFDLIVAKDGTGNFTTISEAVRAAPNSSDTRFVIYIKAGAYFENVEVER  292

Query  430  KSPVMIY-GDGMTQTVFSGDHSFGDNYTTFKSYTLASKGPAAILQDLCVRNTAGAAKHQA  254
            K  ++++ GDG+ +TV     S  D +TTF+S T+A  G   I + +   N+AG +KHQA
Sbjct  293  KKKMLVFIGDGIGKTVVKAKRSVVDGWTTFRSATVAVVGDGFIAKGITFENSAGPSKHQA  352

Query  253  VALLVGGDKSIINRCRLEGYQDTLYAHSKRQFYRDCTITGTIDFVFGDAAVVLQNCTLIA  74
            VAL  G D S   +C   GYQDTLY HS RQFYR+C + GTIDF+FG+AAVV Q   L A
Sbjct  353  VALRSGSDLSAFYQCSFVGYQDTLYVHSLRQFYRECDVYGTIDFIFGNAAVVFQTSNLYA  412

Query  73   KKPLAAQKNMVTAQGRSDPNQNTG  2
            +KP + Q+N+ TAQGR DPNQNTG
Sbjct  413  RKPNSNQRNIFTAQGREDPNQNTG  436



>ref|NP_001060620.1| Os07g0675100 [Oryza sativa Japonica Group]
 dbj|BAC83543.1| putative pectinesterase [Oryza sativa Japonica Group]
 dbj|BAD31979.1| putative pectinesterase [Oryza sativa Japonica Group]
 dbj|BAF22534.1| Os07g0675100 [Oryza sativa Japonica Group]
 dbj|BAG94978.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE67808.1| hypothetical protein OsJ_25560 [Oryza sativa Japonica Group]
Length=579

 Score =   255 bits (652),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 148/335 (44%), Positives = 198/335 (59%), Gaps = 30/335 (9%)
 Frame = -3

Query  940  REVQAVADCVELMGLSINDVRDAIKDLQ-GSKTRNSDA---QTSLSAVLTNHLTCMEGLN  773
            R+  A++DC+EL G +++ +  A  +L  G+ T    A   QT LSA +TN  TC++G  
Sbjct  131  RDRLALSDCLELFGHTLDLLGTAAAELSAGNSTAEESAAGVQTVLSAAMTNQYTCLDGFA  190

Query  772  PPEKSP-------VKGILDALISRSRVALAVLAEIIGQ----TDEEQNFRVPFNGK----  638
             P  S        ++G +  +      +LA++  +  Q     +EE     P  G     
Sbjct  191  GPSASEDGRVRPFIQGRIYHVAHLVSNSLAMVRRLPTQRRRGAEEE-----PLEGYGRVR  245

Query  637  --FPSWVKSSDRKLVRRKHGNLKADIIVSQDGKGNFTTLKKAMESVSAVSKARVFIYVKK  464
              FPSWV +SDR   RR    + AD++V++DG G FTT+ +A+ +    S+ R  IY+K 
Sbjct  246  RGFPSWVSASDR---RRLQQQVAADVVVAKDGSGKFTTVSEAVAAAPNNSETRYVIYIKA  302

Query  463  GTYKENVEM-NVKSPVMIYGDGMTQTVFSGDHSFGDNYTTFKSYTLASKGPAAILQDLCV  287
            G Y ENVE+ + K+ +M  GDG  +TV     +  DN TTF+S TLA  G   + +D+ V
Sbjct  303  GGYFENVEVGSEKTNIMFVGDGTWKTVIKASRNVVDNSTTFRSATLAVVGTGFLARDITV  362

Query  286  RNTAGAAKHQAVALLVGGDKSIINRCRLEGYQDTLYAHSKRQFYRDCTITGTIDFVFGDA  107
             N AG +KHQAVAL V  D S   RC   GYQDTLYAHS RQFYRDC I GT+DF+FGDA
Sbjct  363  ENAAGPSKHQAVALRVNADLSAFYRCSFAGYQDTLYAHSLRQFYRDCDIYGTVDFIFGDA  422

Query  106  AVVLQNCTLIAKKPLAAQKNMVTAQGRSDPNQNTG  2
            AVVLQNC L A++P   QKN+ TAQGR DPNQNTG
Sbjct  423  AVVLQNCNLYARRPDPNQKNVFTAQGREDPNQNTG  457



>gb|AGJ83739.1| pectinesterase/pectinesterase inhibitor PPE8B-like protein, partial 
[Caragana korshinskii]
Length=480

 Score =   253 bits (645),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 146/354 (41%), Positives = 207/354 (58%), Gaps = 20/354 (6%)
 Frame = -3

Query  1036  AGLLREFLADYLPSMEAAKMEFGMVR-GEFTHPREVQAVADCVELMGLSINDVRDAIKDL  860
             AG +R+ + D L  + +   EFG    G+F   R   AV+DC++L+ LS +++  ++   
Sbjct  15    AGSIRDVI-DILQEVTSILSEFGGPGFGDF---RLSNAVSDCLDLLDLSFDELDWSVSAT  70

Query  859   QGSKTRN-------SDAQTSLSAVLTNHLTCMEGLNPPEKSPVKGILDALISRSRVALAV  701
                K ++       SD +T LSA L N  TCM+G      S VKG++           ++
Sbjct  71    DNPKGKHNSTGNLSSDLRTWLSAALANPETCMDGFEG-TNSIVKGLVSTGFGE---MTSL  126

Query  700   LAEIIGQTDEEQNFRVPFNGKFPSWVKSSDRKLVRRKHGNLKADIIVSQDGKGNFTTLKK  521
             L +++ Q     +   P  GKFPSWVK  +RKL++     +  D +V+ DG GNFT +  
Sbjct  127   LKQLLTQVSPVSD-HFPQQGKFPSWVKQGERKLLQANR--VHVDAVVAADGTGNFTKVMD  183

Query  520   AMESVSAVSKARVFIYVKKGTYKENVEMNVKS-PVMIYGDGMTQTVFSGDHSFGDNYTTF  344
             A+ +    S  R  IY+K+G Y E+VE+  K   +M+ GDGM  TV SG+ SF D +TTF
Sbjct  184   AVHAAPEHSMERYVIYIKRGVYNESVEIKKKKWNLMMIGDGMNATVISGNRSFVDGWTTF  243

Query  343   KSYTLASKGPAAILQDLCVRNTAGAAKHQAVALLVGGDKSIINRCRLEGYQDTLYAHSKR  164
             +S T A  G   I +D+  +NTAG  KHQAVAL    D S+  RC + GYQD+LY H+ R
Sbjct  244   RSATFAVSGRGFIARDITFQNTAGPEKHQAVALRSDSDLSVFYRCGIFGYQDSLYTHTMR  303

Query  163   QFYRDCTITGTIDFVFGDAAVVLQNCTLIAKKPLAAQKNMVTAQGRSDPNQNTG  2
             QFYR+C I+GT+DF+FGDA  + QNC ++AKK L  QKN +TA GR DPN+ TG
Sbjct  304   QFYRECKISGTVDFIFGDATALFQNCQILAKKGLPNQKNPITAHGRKDPNEPTG  357



>ref|XP_009150156.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 34 
[Brassica rapa]
Length=591

 Score =   256 bits (653),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 139/330 (42%), Positives = 189/330 (57%), Gaps = 17/330 (5%)
 Frame = -3

Query  943  PREVQAVADCVELMGLSINDVRDAIKDLQGSKTRNSDAQTSLSAVLTNHLTCMEGLNPPE  764
            PR   A   C+EL+  S++ +  A+  + G +T+  D  T LS+ LTNH TC EG +   
Sbjct  139  PRVRSAYDACIELLDDSVDALSRALSSVSGGQTKPQDVMTWLSSALTNHDTCAEGFDGVN  198

Query  763  KSPVKGILDALISRSRVALAVLAEIIGQTDEEQNFR-VPF------------NGKFPSWV  623
               VK  + A +      ++    I   +    +F  VP             N K P W 
Sbjct  199  DGGVKDQMTAALKNLSELVSNCLAIFAASSNGNDFAGVPIQNRRLLGVGGDENSKCPRWT  258

Query  622  KSSDRKLVRRKHGNLKADIIVSQDGKGNFTTLKKAMESVSAVSKARVFIYVKKGTYKENV  443
            K  +R+++      ++ADIIVS+DG G   T+  A++     S  R+ IYVK G Y+EN 
Sbjct  259  KRREREILEMPVSQIQADIIVSKDGNGTCKTISAAIKKAPQYSPRRIIIYVKAGRYEEN-  317

Query  442  EMNV---KSPVMIYGDGMTQTVFSGDHSFGDNYTTFKSYTLASKGPAAILQDLCVRNTAG  272
             + V   K  +M  GDG  +T+ SG  S  DN TTF + T A+ G   I +D+   N AG
Sbjct  318  NLKVGRKKINLMFVGDGKGKTIISGGKSIFDNITTFHTATFAATGAGFIARDITFENYAG  377

Query  271  AAKHQAVALLVGGDKSIINRCRLEGYQDTLYAHSKRQFYRDCTITGTIDFVFGDAAVVLQ  92
             AKHQAVAL VG D ++I RC + GYQDTLY HS RQF+R+C I GT+DF+FG+AAVVLQ
Sbjct  378  PAKHQAVALRVGADHAVIYRCNIIGYQDTLYVHSNRQFFRECDIYGTVDFIFGNAAVVLQ  437

Query  91   NCTLIAKKPLAAQKNMVTAQGRSDPNQNTG  2
            NC++ A+KP+  QKN +TAQ R DPNQNTG
Sbjct  438  NCSIYARKPMDLQKNTITAQNRKDPNQNTG  467



>ref|XP_010266280.1| PREDICTED: pectinesterase-like [Nelumbo nucifera]
Length=529

 Score =   254 bits (649),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 139/325 (43%), Positives = 195/325 (60%), Gaps = 25/325 (8%)
 Frame = -3

Query  928  AVADCVELMGLSINDVRDAIKDLQGSKTRN----SDAQTSLSAVLTNHLTCMEGLNPPEK  761
            A ADCVEL   +++ +  ++       ++N    SDAQT LSA +TN  TC  G      
Sbjct  94   AWADCVELYADTVSQLNRSMA------SKNPLIWSDAQTWLSAAITNEQTCRNGFIELSS  147

Query  760  SPV------------KGILDALISRSRVALAVLAEIIGQTDEEQNFRVPFNGKFPSWVKS  617
            S              K + ++L      A    A + G+  +  N R   +  FP+WV +
Sbjct  148  SSQLSSFPFMLTNLSKMVSNSLAINKAAASTSSASLFGK--QGANNRRLLSDGFPTWVSA  205

Query  616  SDRKLVRRKHGNLKADIIVSQDGKGNFTTLKKAMESVSAVSKARVFIYVKKGTYKENVEM  437
            +DRKL++      +AD++V+ DG GN+ T+ +A+ + S  S +R  IYVK+G YKENVE+
Sbjct  206  ADRKLLQSSGAASQADVVVAADGSGNYKTISEAVAASSKRSGSRFVIYVKRGVYKENVEI  265

Query  436  NVKSPVMIYGDGMTQTVFSGDHSFGDNYTTFKSYTLASKGPAAILQDLCVRNTAGAAKHQ  257
               S +M+ GDG+  T+ +G  +  D  TTF+S T+A  G   I +D+   NTAG  KHQ
Sbjct  266  KA-SNIMLIGDGIDATIVTGSRNVQDGSTTFRSATVAVTGGGFIARDMTFENTAGPQKHQ  324

Query  256  AVALLVGGDKSIINRCRLEGYQDTLYAHSKRQFYRDCTITGTIDFVFGDAAVVLQNCTLI  77
            AVAL  G D S+  RC L+GYQDTLY +S+RQFYRDC I GT+DF+FGDA  V+QNC + 
Sbjct  325  AVALRSGSDLSVFYRCSLKGYQDTLYVYSQRQFYRDCDIYGTVDFIFGDAVAVIQNCNIY  384

Query  76   AKKPLAAQKNMVTAQGRSDPNQNTG  2
             +KP++ QKN VTAQGR+DPN+NTG
Sbjct  385  VRKPMSGQKNTVTAQGRTDPNENTG  409



>ref|XP_010925933.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 34 
[Elaeis guineensis]
Length=587

 Score =   255 bits (652),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 131/327 (40%), Positives = 196/327 (60%), Gaps = 18/327 (6%)
 Frame = -3

Query  928  AVADCVELMGLSINDVRDAIKDLQGSKT-----RNSDAQTSLSAVLTNHLTCMEGLNPPE  764
            A  DC+EL+  S++ + +++  +  S +      N D  T LSA LTN  TC EGL    
Sbjct  138  AYEDCMELLEDSLDQLSESLAVVSPSASGPAGASNEDVLTWLSAALTNQDTCTEGLTDVA  197

Query  763  KSPVKGILDALISRSRVALAVLAEIIGQTDEEQNFR-VPF-----------NGKFPSWVK  620
               V+  + + +      ++    I       ++F  +P            +G FP W+ 
Sbjct  198  DGYVRAQMQSKLKDLAELVSNCLAIFSAVSRNKDFSGIPIKNKKRRLLSSGDGDFPEWLG  257

Query  619  SSDRKLVRRKHGNLKADIIVSQDGKGNFTTLKKAMESVSAVSKARVFIYVKKGTYKENVE  440
              DRKL++     ++AD++VS+DG G + ++  A+++    S  R+ IYVK G Y EN++
Sbjct  258  RRDRKLLQVPVAQIQADMVVSKDGNGTYKSIADAVKAAPERSTRRIIIYVKAGRYDENIK  317

Query  439  MN-VKSPVMIYGDGMTQTVFSGDHSFGDNYTTFKSYTLASKGPAAILQDLCVRNTAGAAK  263
            ++  K+ +M  GDG  +T+ +   S  +NYTTF + T AS G   I++D+ + N AG AK
Sbjct  318  VSRKKTNLMFIGDGKGKTIVAASRSVAENYTTFHTATFASTGNGFIMRDMTIENWAGPAK  377

Query  262  HQAVALLVGGDKSIINRCRLEGYQDTLYAHSKRQFYRDCTITGTIDFVFGDAAVVLQNCT  83
            HQAVAL VG D +++ RC + GYQDTLY HS+RQF+R+C + GT+DF+FG+AAVVLQNC+
Sbjct  378  HQAVALRVGADHAVVYRCNIIGYQDTLYVHSQRQFFRECDVYGTVDFIFGNAAVVLQNCS  437

Query  82   LIAKKPLAAQKNMVTAQGRSDPNQNTG  2
            L A+KP+  QKN +TAQ R DPNQNTG
Sbjct  438  LWARKPMPMQKNTITAQNRKDPNQNTG  464



>ref|NP_001147569.1| pectinesterase PPE8B precursor [Zea mays]
 gb|ACG27953.1| pectinesterase PPE8B precursor [Zea mays]
 gb|AFW61863.1| pectinesterase [Zea mays]
Length=559

 Score =   254 bits (650),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 149/339 (44%), Positives = 195/339 (58%), Gaps = 33/339 (10%)
 Frame = -3

Query  940  REVQAVADCVELMGLSINDVRDAIKDLQGSKTR----------NSDAQTSLSAVLTNHLT  791
            R   AVADC++L+ LS +++  ++     S              SD Q+ LS  L N  T
Sbjct  92   RLSSAVADCLDLLDLSSDEMSWSMSMSTDSSGAGGGRLGTGDARSDLQSWLSGALGNQDT  151

Query  790  CMEGLNPPEK---SPVKGILDALISRSRVALAVLAEIIGQT---DEEQNFRVPF------  647
            C EGL+       S V   LDA+ S       +LA+ +GQ    D+              
Sbjct  152  CKEGLDATGSVLGSLVAAGLDAVTS-------LLADGLGQVAGGDDATAPASSLPPSSSR  204

Query  646  -NGKFPSWVKSSDRKLVRRK--HGNLKADIIVSQDGKGNFTTLKKAMESVSAVSKARVFI  476
                 P W+++ +R+L++     G L  D +V+QDG GNFTT+  A+E+  A S AR  +
Sbjct  205  RGAAPPRWLRARERRLLQMPVGPGGLAVDAVVAQDGSGNFTTVGAAVEAAPAQSAARYVV  264

Query  475  YVKKGTYKENVEMNVKS-PVMIYGDGMTQTVFSGDHSFGDNYTTFKSYTLASKGPAAILQ  299
            YV+KG Y+E VE+  K   +M+ GDGM  TV SG  S+GD YTT++S T+A  G   I +
Sbjct  265  YVRKGVYRETVEVKKKKWNLMLVGDGMGATVISGRRSYGDGYTTYRSATVAVNGKGFIAR  324

Query  298  DLCVRNTAGAAKHQAVALLVGGDKSIINRCRLEGYQDTLYAHSKRQFYRDCTITGTIDFV  119
            DL   NTAG AKHQAVAL    D S+  RC  EGYQDTLYAHS RQFYRDC + GT+DFV
Sbjct  325  DLTFENTAGPAKHQAVALRCDSDLSVFYRCAFEGYQDTLYAHSLRQFYRDCRVAGTVDFV  384

Query  118  FGDAAVVLQNCTLIAKKPLAAQKNMVTAQGRSDPNQNTG  2
            FG+AA V Q+C L+A++PL  QKN VTAQGR D N  TG
Sbjct  385  FGNAAAVFQDCALLARRPLPGQKNSVTAQGRLDANMTTG  423



>ref|XP_009382521.1| PREDICTED: pectinesterase-like [Musa acuminata subsp. malaccensis]
Length=566

 Score =   255 bits (651),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 137/326 (42%), Positives = 198/326 (61%), Gaps = 14/326 (4%)
 Frame = -3

Query  940  REVQAVADCVELMGLSINDVRDAIKDLQGSKTRNSD-AQTSLSAVLTNHLTCMEGL----  776
            R+  A+ DC++L   +++++ DA  DL  +   + D  QT LSA +TN  TC++G     
Sbjct  120  RQRYALTDCLDLFSQTLDELLDATSDLTANPGSHVDHVQTLLSAAITNQYTCLDGFAYVG  179

Query  775  -NPPEKSPVKGILDALISRSRVALAVLAEIIGQTDEEQNFRVPFNGK------FPSWVKS  617
             +   +S ++  L  +      +LA++ +I  Q       R    G       FP WV  
Sbjct  180  KDGGYRSVIEQPLYHVSHLVSNSLAMMKKIQRQKPPHPR-REALEGYGEVAEGFPVWVSG  238

Query  616  SDRKLVRRKHGNLKADIIVSQDGKGNFTTLKKAMESVSAVSKARVFIYVKKGTYKENVEM  437
             DR+L++        ++IV++DG GNFTT+ +A+ +  + S+ R  IY+K G Y ENVE+
Sbjct  239  KDRRLLQAAANTTTPNLIVAKDGSGNFTTISEAVAAAPSKSETRFVIYIKAGAYLENVEV  298

Query  436  N-VKSPVMIYGDGMTQTVFSGDHSFGDNYTTFKSYTLASKGPAAILQDLCVRNTAGAAKH  260
               ++ +M  GDG+ +TV     +  D +TTF+S T+A  G   +++D+ + N+AG +KH
Sbjct  299  GKSQTNLMFMGDGIGKTVVKASRNVVDGWTTFRSATVAIVGNGFLMRDMTIENSAGPSKH  358

Query  259  QAVALLVGGDKSIINRCRLEGYQDTLYAHSKRQFYRDCTITGTIDFVFGDAAVVLQNCTL  80
            QAVAL VG D S   RC   GYQDTLYAHS RQFYR+C + GTIDF+FG+A VVLQNC L
Sbjct  359  QAVALRVGADLSAFYRCSFVGYQDTLYAHSLRQFYRECDVYGTIDFIFGNAGVVLQNCNL  418

Query  79   IAKKPLAAQKNMVTAQGRSDPNQNTG  2
             A+KPL+ QKN+ TAQGR DPNQNTG
Sbjct  419  YARKPLSNQKNVFTAQGREDPNQNTG  444



>ref|XP_007134831.1| hypothetical protein PHAVU_010G079900g [Phaseolus vulgaris]
 gb|ESW06825.1| hypothetical protein PHAVU_010G079900g [Phaseolus vulgaris]
Length=520

 Score =   253 bits (646),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 138/316 (44%), Positives = 194/316 (61%), Gaps = 13/316 (4%)
 Frame = -3

Query  940  REVQAVADCVELMGLSINDVRDAIKDLQGSKTRNSDAQTSLSAVLTNHLTCMEGLNPPEK  761
             E  A  DC+EL   +I  +   +     +K   +D QT LS  LTN  TC  GL    +
Sbjct  96   HEKSAWTDCIELYDYTIQRLNKTLDPY--TKCTQTDTQTWLSTALTNLETCRAGL---YE  150

Query  760  SPVKGILDALISRSRVALAVLAEIIG-QTDEEQNFRVPFNGK-FPSWVKSSDRKLVRRKH  587
              V+  +  L+S +   L  L+  +    D    F+ P + + +P+WVK  DRKL++   
Sbjct  151  LGVQDYMLPLMSNNVTKL--LSNTLSLNKDSNYPFKPPSSQEGYPTWVKPGDRKLLQSSS  208

Query  586  GNLKADIIVSQDGKGNFTTLKKAMESVSAVSKARVFIYVKKGTYKENVEMNVKSPVMIYG  407
               +A+++V++DG G +TT+K A+++  + S  R  IYVK G Y E VE+  K+ +M+ G
Sbjct  209  AASQANVVVAKDGSGKYTTVKAAVDAAPSSSSGRYVIYVKSGVYNEQVEIKSKN-IMLVG  267

Query  406  DGMTQTVFSGDHSFGDNYTTFKSYTLASKGPAAILQDLCVRNTAGAAKHQAVALLVGGDK  227
            DG+ +T+ +G  S G   TTF+S T+A+ G   I QD+  RNTAGAA HQAVA   G D 
Sbjct  268  DGIGKTIITGSKSVGGGSTTFRSATVAAVGDGFIAQDITFRNTAGAANHQAVAFRSGSDL  327

Query  226  SIINRCRLEGYQDTLYAHSKRQFYRDCTITGTIDFVFGDAAVVLQNCTLIAKKPLAAQKN  47
            S+  RC  EGYQDTLY HS+RQFYR+C + GT+DF+FG+AAVVLQNC + A+ P   Q+ 
Sbjct  328  SVFYRCSFEGYQDTLYVHSERQFYRECDVYGTVDFIFGNAAVVLQNCNIYARTP--PQRT  385

Query  46   M-VTAQGRSDPNQNTG  2
            + VTAQGR+DPNQNTG
Sbjct  386  ITVTAQGRTDPNQNTG  401



>ref|XP_003517029.1| PREDICTED: pectinesterase 2-like [Glycine max]
 ref|XP_003517030.1| PREDICTED: pectinesterase 2-like [Glycine max]
Length=515

 Score =   253 bits (645),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 138/315 (44%), Positives = 188/315 (60%), Gaps = 10/315 (3%)
 Frame = -3

Query  946  HPREVQAVADCVELMGLSINDVRDAIKDLQGSKTRNSDAQTSLSAVLTNHLTCMEGLNPP  767
            +PRE  A ADCVEL   +I  +   +K    +K    DAQT LS  LTN  TC  G    
Sbjct  90   NPRERVAWADCVELYEQTIRKLNQTLKP--NTKLSQVDAQTWLSTALTNLETCKAGF---  144

Query  766  EKSPVKGILDALISRSRVALAVLAEIIGQTDEEQNFRVPFNGKFPSWVKSSDRKLVRRKH  587
             +  V+  +  L+S +   L      + +   ++     +   FP+WVK  DRKL++   
Sbjct  145  YELGVQDYVLPLMSNNVTKLLSNTLALNKVPYQE---PSYKEGFPTWVKPGDRKLLQASS  201

Query  586  GNLKADIIVSQDGKGNFTTLKKAMESVSAVSKARVFIYVKKGTYKENVEMNVKSPVMIYG  407
               +A+++V++DG G FTT+  A+ +    S  R  IYVK G Y E VE+  K+ +M+ G
Sbjct  202  PASRANVVVAKDGSGRFTTVSAAINAAPKSSSGRYVIYVKGGVYDEQVEVKAKN-IMLVG  260

Query  406  DGMTQTVFSGDHSFGDNYTTFKSYTLASKGPAAILQDLCVRNTAGAAKHQAVALLVGGDK  227
            DG+ +T+ +G  S G   TTF+S T+A  G   I Q +  RNTAGA  HQAVAL  G D 
Sbjct  261  DGIGKTIITGSKSVGGGTTTFRSATVAVVGDGFIAQGITFRNTAGAKNHQAVALRSGSDL  320

Query  226  SIINRCRLEGYQDTLYAHSKRQFYRDCTITGTIDFVFGDAAVVLQNCTLIAKKPLAAQKN  47
            S+  +C  EGYQDTLY HS+RQFYR+C I GT+DF+FG+AAVVLQNC + A+ P   + N
Sbjct  321  SVFYKCSFEGYQDTLYVHSERQFYRECNIYGTVDFIFGNAAVVLQNCNIFARNP-PNKVN  379

Query  46   MVTAQGRSDPNQNTG  2
             +TAQGR+DPNQNTG
Sbjct  380  TITAQGRTDPNQNTG  394



>ref|XP_002320714.1| putative pectin methylesterase LuPME1 family protein [Populus 
trichocarpa]
 gb|EEE99029.1| putative pectin methylesterase LuPME1 family protein [Populus 
trichocarpa]
Length=514

 Score =   253 bits (645),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 142/314 (45%), Positives = 184/314 (59%), Gaps = 13/314 (4%)
 Frame = -3

Query  937  EVQAVADCVELMGLSINDVRDAIKDLQGSKTRNSDAQTSLSAVLTNHLTCMEGLNPPEKS  758
            E  A  DC+EL      ++   +    GSK    DAQT LS  LTN  TC  G       
Sbjct  91   EKAAWEDCLELY----QEIVLWLNKTTGSKCTKYDAQTWLSTALTNLETCRTGFAE----  142

Query  757  PVKGILDALISRSRVALAVLAEIIGQTDEEQNFRVPFNGKFPSWVKSSDRKLVRRKHGNL  578
               G+ D ++      ++ L       ++       FNG FPSWV+  DRKL++      
Sbjct  143  --FGMTDYILPMMSNNVSKLISNTLAINKAPYSEPSFNGGFPSWVRPGDRKLLQSSSPAS  200

Query  577  KADIIVSQDGKGNFTTLKKAMESVSAVS-KARVFIYVKKGTYKENVEMNVK-SPVMIYGD  404
            +A+I+V+QDG GN  T+K+A+ + S  S   R  IYVK GTY ENVE+  K   VM+ GD
Sbjct  201  QANIVVAQDGSGNVKTIKEAIVAASKRSGSGRYVIYVKAGTYNENVEVGQKVKNVMVVGD  260

Query  403  GMTQTVFSGDHSFGDNYTTFKSYTLASKGPAAILQDLCVRNTAGAAKHQAVALLVGGDKS  224
            G+ +T+ +G  S G   TTFKS T A  G   I +D+  RNTAGA  HQAVAL  G D S
Sbjct  261  GIGKTIVTGSKSVGGGTTTFKSATFAVVGDNFIARDMTFRNTAGAKNHQAVALRSGSDLS  320

Query  223  IINRCRLEGYQDTLYAHSKRQFYRDCTITGTIDFVFGDAAVVLQNCTLIAKKPLAAQKNM  44
            +  +C  EGYQDTLY HS+RQFYR+C I GT+DF+FG+AAVV QNC + A+ P   + N 
Sbjct  321  VFYKCSFEGYQDTLYVHSQRQFYRECNIYGTVDFIFGNAAVVFQNCNIYARNP-PNKTNT  379

Query  43   VTAQGRSDPNQNTG  2
            +TAQGR+DPNQNTG
Sbjct  380  ITAQGRTDPNQNTG  393



>ref|XP_010049304.1| PREDICTED: pectinesterase/pectinesterase inhibitor PPE8B [Eucalyptus 
grandis]
Length=534

 Score =   253 bits (646),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 155/386 (40%), Positives = 217/386 (56%), Gaps = 40/386 (10%)
 Frame = -3

Query  1054  SYGGTPAGLLR---------EFLADYLPSMEAAKM------EFGMVRGEFTHPREVQAVA  920
             S G  P+ LL+         +FL+    ++E  +       +FG V G+F   R   AV 
Sbjct  31    SPGSAPSDLLQRECLAVPTSQFLSSLRSTVEVLRQVSGIVSQFGTVFGDF---RLSNAVT  87

Query  919   DCVELMGLSINDVRDAIKDLQGSKTRN-------SDAQTSLSAVLTNHLTC---MEGLNP  770
             DC++L+  S +++   I   Q  K ++       SD +T LSA L N  TC    EG + 
Sbjct  88    DCLDLLDFSSDELSWTISATQNPKGKHNSTGDLSSDLRTWLSAALANQETCRDGFEGTSG  147

Query  769   PEKSPVKGILD---ALISRSRVALAVLAEIIGQTDEEQNFRVP----FNG--KFPSWVKS  617
               KS V G L+   +L++R    +   +            + P    F+   +FP WVK+
Sbjct  148   IVKSVVSGSLNQITSLLTRLLTMVHPSSGSNSAAAAAAGSKGPGRKLFDDGPQFPRWVKT  207

Query  616   SDRKLVRRKHGNLKADIIVSQDGKGNFTTLKKAMESVSAVSKARVFIYVKKGTYKENVEM  437
              DR+L+      + AD++V+QDG  NFT ++ A+ +V      R  IYVKKG Y+ENVE+
Sbjct  208   KDRRLLLAN--GVAADLVVAQDGSSNFTKVEDAIAAVPDYGTRRFVIYVKKGVYRENVEI  265

Query  436   NVKS-PVMIYGDGMTQTVFSGDHSFGDNYTTFKSYTLASKGPAAILQDLCVRNTAGAAKH  260
               K   +M+ GDG+  T+ SG+ +F D +TTF++ T A  G   I +D+   NTAG  KH
Sbjct  266   KKKKWNIMMIGDGIDATIISGNRNFVDGWTTFRTATFAVSGRGFIARDMAFENTAGPEKH  325

Query  259   QAVALLVGGDKSIINRCRLEGYQDTLYAHSKRQFYRDCTITGTIDFVFGDAAVVLQNCTL  80
             QAVAL    D S+  RC + GYQD+LY H+ RQFYR+C I+GTIDFVFG+AAVV QNC +
Sbjct  326   QAVALRSDSDLSVYYRCAIRGYQDSLYTHTMRQFYRECRISGTIDFVFGNAAVVFQNCQI  385

Query  79    IAKKPLAAQKNMVTAQGRSDPNQNTG  2
             +AKK L  QKN +TAQGR DPNQ TG
Sbjct  386   LAKKGLPQQKNTITAQGRKDPNQPTG  411



>ref|XP_003534983.1| PREDICTED: pectinesterase/pectinesterase inhibitor PPE8B-like 
[Glycine max]
 gb|KHN10379.1| Pectinesterase/pectinesterase inhibitor PPE8B [Glycine soja]
Length=528

 Score =   253 bits (645),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 147/379 (39%), Positives = 212/379 (56%), Gaps = 15/379 (4%)
 Frame = -3

Query  1114  LCRTAIDPAACKTILKQTVKSYGGTPAGLLREFLADYLPSMEAAKMEFGMVRGEFTHPRE  935
             L  TA+      T+  + +K      AG +R  + D L  + +   EFG     F   R 
Sbjct  28    LFLTALGNTNTNTVGSELLKVAPSEFAGTVRT-VVDVLQDITSILSEFG---SGFGDSRL  83

Query  934   VQAVADCVELMGLSINDVRDAIKDLQGSKTRN-------SDAQTSLSAVLTNHLTCMEGL  776
               AV+DC+EL+ +S +++  ++   Q  K ++       SD +T LSA L N  TCM+G 
Sbjct  84    SNAVSDCLELLDMSSDELDWSVSATQSPKGKHNSTGNTSSDLRTWLSAALANQDTCMDGF  143

Query  775   NPPEKSPVKGILDALISRSRVALAVLAEIIGQTDEEQNFRVPFNGKFPSWVKSSDRKLVR  596
             +      VKG++   + +    L  L   +    +   F  P  G FP WVK  +RKL++
Sbjct  144   DG-TNGIVKGLVSTGLGQVMSLLQQLLTQVNPVSDHYTFSSP-QGHFPPWVKPGERKLLQ  201

Query  595   RKHGNLKADIIVSQDGKGNFTTLKKAMESVSAVSKARVFIYVKKGTYKENVEMNVKS-PV  419
               +G +  D +V+ DG GNFT +  A+ +    S  R  I++K+G Y ENVE+  K   +
Sbjct  202   AANG-VSFDAVVAADGTGNFTKVMDAVLAAPNYSMQRYVIHIKRGVYNENVEIKKKKWNL  260

Query  418   MIYGDGMTQTVFSGDHSFGDNYTTFKSYTLASKGPAAILQDLCVRNTAGAAKHQAVALLV  239
             M+ GDGM  TV SG+ SF D +TTF+S T A  G   + +D+  +NTAG  KHQAVAL  
Sbjct  261   MMVGDGMDNTVISGNRSFIDGWTTFRSATFAVSGRGFVARDITFQNTAGPEKHQAVALRS  320

Query  238   GGDKSIINRCRLEGYQDTLYAHSKRQFYRDCTITGTIDFVFGDAAVVLQNCTLIAKKPLA  59
               D S+  RC + GYQD+LY H+ RQFYR+C I+GT+DF+FGDA  + QNC + AKK L 
Sbjct  321   DSDLSVFFRCGIFGYQDSLYTHTMRQFYRECKISGTVDFIFGDATAIFQNCHISAKKGLP  380

Query  58    AQKNMVTAQGRSDPNQNTG  2
              QKN +TA GR +P++ TG
Sbjct  381   NQKNTITAHGRKNPDEPTG  399



>ref|XP_006490097.1| PREDICTED: pectinesterase 2-like [Citrus sinensis]
Length=518

 Score =   253 bits (645),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 148/377 (39%), Positives = 216/377 (57%), Gaps = 20/377 (5%)
 Frame = -3

Query  1111  CRTAIDPAACKTILKQTVKSYG--GTPAGLLREFLADYLPSMEAAKMEFGMVRGEFTHPR  938
             C     P  CK  ++Q  K +      +   R  ++  L     A+     +  +  + +
Sbjct  34    CSKTPHPEPCKYFMQQNSKHFAVPKQKSEFRRMAMSLALDRALTAQSHNKWLGSKCRNHK  93

Query  937   EVQAVADCVELMGLSINDVRDAIKDLQGSKTRNSDAQTSLSAVLTNHLTCMEGLNPPEKS  758
             E  A ADC++L   +IN +   +     +K  + DAQT LS  LTN  TC  G     + 
Sbjct  94    EKVAWADCLKLYQDTINQLNHTLDS--NTKCTDFDAQTWLSTALTNLETCRAGF---VEL  148

Query  757   PVKGILDALISRSRVALAVLAEIIGQTDEEQNFR-VP--FNGKFPSWVKSSDRKLVRRKH  587
              V   +  L+S +      + ++I  T   +N   VP  + G FPSWVK  DRKL++   
Sbjct  149   GVPDYVLPLMSNN------VTKLISNTLALRNASTVPETYKGGFPSWVKPGDRKLLQTSP  202

Query  586   GNLKADIIVSQDGKGNFTTLKKAMESVSA-VSKARVFIYVKKGTYKENVEM-NVKSPVMI  413
               ++ +++V+QDG GN+ T+K A+++ +      R  I+VK+G YKEN+E+ N    +M+
Sbjct  203   --VRPNLVVAQDGSGNYRTIKAALDAAAKRTGSGRFVIHVKRGVYKENLEIGNKMKNIML  260

Query  412   YGDGMTQTVFSGDHSFGDNYTTFKSYTLASKGPAAILQDLCVRNTAGAAKHQAVALLVGG  233
              GDG+  T+ +G  S G  +TTF S T+A  G   I + +  RNTAG   HQAVAL  G 
Sbjct  261   VGDGLRYTIITGSRSVGGGFTTFNSATVAVTGDGFIARGITFRNTAGPQNHQAVALRAGS  320

Query  232   DKSIINRCRLEGYQDTLYAHSKRQFYRDCTITGTIDFVFGDAAVVLQNCTLIAKKPLAAQ  53
             D S+  +C  EGYQDTLY HS+RQFY++C I GT+DF+FG+AAVVLQNC + A++P+  Q
Sbjct  321   DLSVFYQCGFEGYQDTLYVHSQRQFYKECYIYGTVDFIFGNAAVVLQNCMIYARRPMDKQ  380

Query  52    KNMVTAQGRSDPNQNTG  2
             KN+VTAQGR+DPNQNTG
Sbjct  381   KNVVTAQGRTDPNQNTG  397



>gb|KDP33983.1| hypothetical protein JCGZ_07554 [Jatropha curcas]
Length=508

 Score =   252 bits (644),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 144/352 (41%), Positives = 208/352 (59%), Gaps = 27/352 (8%)
 Frame = -3

Query  1015  LADYLPSMEAAKMEFGMVRGEFTHPREVQAVADCVELMGLSINDVRDAIKDLQGSKTRN-  839
             + D +  + +   +FG   G+F   R   A+ DC++L+ LS +++  +I   Q  K +N 
Sbjct  47    IIDVVTDVTSTISKFGNFFGDF---RLGNAITDCLDLLELSADELSWSISASQNPKGKNN  103

Query  838   ------SDAQTSLSAVLTNHLTCMEGLNPPE---KSPVKGILDALISRSRVALAVLAEII  686
                   SD +T LSA L N  TC++G        K+ V G L+ + S       ++ +++
Sbjct  104   STGDLSSDLRTWLSAALVNQDTCIDGFQGSSSILKNIVAGGLNQITS-------LVQQLL  156

Query  685   GQTDEEQNFRVPFNGK---FPSWVKSSDRKLVRRKHGNLKADIIVSQDGKGNFTTLKKAM  515
              + D + +  V F GK   FPSW+K  DRKL+      + AD++V+ DG GNF+ +  A+
Sbjct  157   TKVDSKPS-GVNFTGKNDKFPSWIKHVDRKLLLVN--GISADVVVAADGTGNFSKIMDAV  213

Query  514   ESVSAVSKARVFIYVKKGTYKENVEMNVKS-PVMIYGDGMTQTVFSGDHSFGDNYTTFKS  338
             ES    S  R  IY+KKG Y E VE+  K   +M+ G+GM  TV SG+ ++ D +TTF++
Sbjct  214   ESAPDNSLRRYVIYIKKGIYNEYVEIKKKKWNLMMIGEGMGVTVISGNRNYIDGWTTFRT  273

Query  337   YTLASKGPAAILQDLCVRNTAGAAKHQAVALLVGGDKSIINRCRLEGYQDTLYAHSKRQF  158
              T A  G   I +D+   NTAG AKHQAVAL    D S+  RC ++GYQD+LY H+ RQF
Sbjct  274   ATFAVSGRGFIARDITFENTAGPAKHQAVALRSDSDLSVFFRCEIKGYQDSLYTHTMRQF  333

Query  157   YRDCTITGTIDFVFGDAAVVLQNCTLIAKKPLAAQKNMVTAQGRSDPNQNTG  2
             YR+C I+GT+DF+FGDA  V QNC ++A+K L  QKN +TA GR DPNQ TG
Sbjct  334   YRECRISGTVDFIFGDATAVFQNCQILARKGLQNQKNTITAHGRKDPNQPTG  385



>ref|XP_010917364.1| PREDICTED: pectinesterase [Elaeis guineensis]
Length=520

 Score =   253 bits (645),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 147/334 (44%), Positives = 198/334 (59%), Gaps = 25/334 (7%)
 Frame = -3

Query  940  REVQAVADCVELMGLSINDVRDAIKDLQGSKT-------------RNSDAQTSLSAVLTN  800
            R   A++DC++L+ LS +++   I   Q S+T             R SD ++ LSA L N
Sbjct  68   RLSSAISDCLDLLDLSSDELSLTISASQASRTSTATSSAAEGTGNRRSDLRSWLSAALGN  127

Query  799  HLTCMEGLNPPEK---SPVKGILDALISRSRVALAVLAEIIGQTDEEQNFRVPFNGK---  638
              TC E L+       S V G L+ + S   +    L +++  +      R    GK   
Sbjct  128  QDTCKESLDGTSSVVGSLVGGGLETVTS---LVADGLRQVVAGSGGGNAGRRRLLGKVSE  184

Query  637  -FPSWVKSSDRKLVRRKHGNLKADIIVSQDGKGNFTTLKKAMESVSAVSKARVFIYVKKG  461
             FP WV + DR+L++   G + AD +V+QDG G +TT+  A+E+    S  R  IYVK+G
Sbjct  185  GFPKWVSAGDRRLLQ-APGAVAADAVVAQDGSGQYTTVGAAVEAAPTESTKRYVIYVKRG  243

Query  460  TYKENVEMNVKS-PVMIYGDGMTQTVFSGDHSFGDNYTTFKSYTLASKGPAAILQDLCVR  284
             Y ENV++  K   +M+ GDGM QT+ SG  +F D +TT++S T A  G   I +DL + 
Sbjct  244  VYNENVDIKKKWWNIMLVGDGMGQTIISGSRNFVDGWTTYRSATFAVSGKGFIARDLTIE  303

Query  283  NTAGAAKHQAVALLVGGDKSIINRCRLEGYQDTLYAHSKRQFYRDCTITGTIDFVFGDAA  104
            NTAG +KHQAVAL    D S+  RC   GYQDTLYAH+ RQFYR+C ITGT+DFVFG+AA
Sbjct  304  NTAGPSKHQAVALRSDSDLSVYYRCSFLGYQDTLYAHALRQFYRECLITGTVDFVFGNAA  363

Query  103  VVLQNCTLIAKKPLAAQKNMVTAQGRSDPNQNTG  2
             V QNC L+A++PL  QKN VTA GR DPNQNTG
Sbjct  364  AVFQNCVLLARRPLPDQKNSVTAHGRKDPNQNTG  397



>ref|XP_009385286.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Musa acuminata subsp. malaccensis]
Length=576

 Score =   254 bits (648),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 141/364 (39%), Positives = 212/364 (58%), Gaps = 18/364 (5%)
 Frame = -3

Query  1039  PAGLLREFLADYLPSMEAAKMEFGMVRGEFTHPREVQAVADCVELMGLSINDVRDAIKDL  860
             P  L+       + S+  A     +++     PR  +A+ +C EL+  +I+D+++++   
Sbjct  92    PKKLVELSFTSAMDSLREAFNHSSVLQEAAKDPRTSEALENCKELLDYAIDDLKNSVARF  151

Query  859   QGSKTRN-----SDAQTSLSAVLTNHLTCMEGLNPPEKSPVKGILDALISRSRVALAVLA  695
              G           D +  LSA +T   TC++G +         +  AL S S +    LA
Sbjct  152   GGVDMAKMSDVVDDLKVWLSATITYQQTCLDGFDNTTGDAADNMSKALNSSSALTSNALA  211

Query  694   EIIGQTDEEQNFRVPF------------NGKFPSWVKSSDRKLVRRKHGNLKADIIVSQD  551
              I G +    +F++               G+FPSWV +  RKL+     ++K D+ V+QD
Sbjct  212   IIDGISSVLASFQLSSLGRRLLSDDEGERGEFPSWVGNDKRKLLALSTKDIKPDVTVAQD  271

Query  550   GKGNFTTLKKAMESVSAVSKARVFIYVKKGTYKENVEMNVK-SPVMIYGDGMTQTVFSGD  374
             G G + T+ +A+ +V     A   IY+K+G YKENV ++   + VM++GDG T+T  +G 
Sbjct  272   GSGKYKTITQALSAVPKKGNATFVIYIKEGVYKENVMVDRSMTNVMMFGDGPTKTKITGS  331

Query  373   HSFGDNYTTFKSYTLASKGPAAILQDLCVRNTAGAAKHQAVALLVGGDKSIINRCRLEGY  194
              ++ D  +TFK+ TLA  G   I ++L V NTAGAAKHQAVAL V  DKS+   C+++GY
Sbjct  332   LNYVDGTSTFKTATLAVVGDGFIGKNLGVENTAGAAKHQAVALRVQSDKSVFYLCQMDGY  391

Query  193   QDTLYAHSKRQFYRDCTITGTIDFVFGDAAVVLQNCTLIAKKPLAAQKNMVTAQGRSDPN  14
             QDTLY H+KRQFYR+CTI+GTIDF+FGDAAVV QNC ++ +KP+A Q+ +VTAQGR D +
Sbjct  392   QDTLYTHTKRQFYRECTISGTIDFLFGDAAVVFQNCLMLVRKPMANQQCIVTAQGRKDRH  451

Query  13    QNTG  2
             + TG
Sbjct  452   EATG  455



>ref|XP_010271267.1| PREDICTED: pectinesterase-like [Nelumbo nucifera]
Length=526

 Score =   253 bits (645),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 139/322 (43%), Positives = 194/322 (60%), Gaps = 21/322 (7%)
 Frame = -3

Query  928  AVADCVELMGLSINDVRDAIKDLQGSKT--RNSDAQTSLSAVLTNHLTCMEGLNPPEKSP  755
            A ADCVEL   ++  +  A+    GSK     SDAQT LSA +TN  TC  G     KS 
Sbjct  93   AWADCVELYSDTVTQLNRAM----GSKNPLSWSDAQTWLSAAITNQQTCQNGFVELGKSS  148

Query  754  VKGILDALISR-----------SRVALAVLAEIIGQTDEEQNFRVPFNGKFPSWVKSSDR  608
                   ++S            ++ A +  A ++G+  +  N R+  +G FP+WV ++DR
Sbjct  149  YLSSFPFMLSNFSKMVSNSLAINKEADSSAASLLGK--QGGNRRLLSDG-FPTWVSAADR  205

Query  607  KLVRRKHGNLKADIIVSQDGKGNFTTLKKAMESVSAVSKARVFIYVKKGTYKENVEMNVK  428
            KL++      +AD++V+ DG GN+ T+ +A+ + S  S  R  IYVKKG YKENVE+   
Sbjct  206  KLLQSPSAASQADVVVAADGSGNYKTISEAVAASSKRSGKRFVIYVKKGVYKENVEIKA-  264

Query  427  SPVMIYGDGMTQTVFSGDHSFGDNYTTFKSYTLASKGPAAILQDLCVRNTAGAAKHQAVA  248
            S +M+ GDG+  T+ +   +  D  TTF++ T+   G   + +D+   NTAG  KHQAVA
Sbjct  265  SNIMLIGDGIDATIVTDSKNAQDGSTTFRTATVGVTGDGFMARDMTFENTAGPQKHQAVA  324

Query  247  LLVGGDKSIINRCRLEGYQDTLYAHSKRQFYRDCTITGTIDFVFGDAAVVLQNCTLIAKK  68
            L  G D S+   C  +GYQDTLY +S+RQFYRDC I GT+DF+FGDA  VLQNC +  +K
Sbjct  325  LRSGSDLSVFYSCSFKGYQDTLYVYSQRQFYRDCDIYGTVDFIFGDAVAVLQNCNIYVRK  384

Query  67   PLAAQKNMVTAQGRSDPNQNTG  2
            P++ QKN VTAQGR+DPN+NTG
Sbjct  385  PMSGQKNTVTAQGRTDPNENTG  406



>ref|XP_006421695.1| hypothetical protein CICLE_v10004742mg [Citrus clementina]
 gb|ESR34935.1| hypothetical protein CICLE_v10004742mg [Citrus clementina]
Length=518

 Score =   252 bits (644),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 148/377 (39%), Positives = 216/377 (57%), Gaps = 20/377 (5%)
 Frame = -3

Query  1111  CRTAIDPAACKTILKQTVKSYG--GTPAGLLREFLADYLPSMEAAKMEFGMVRGEFTHPR  938
             C     P  CK  ++Q  K +      +   R  ++  L     A+     +  +  + +
Sbjct  34    CSKTPHPEPCKYFMQQNSKHFAVPKQESEFRRMAMSLALDRALTAQNHNKWLGSKCRNHK  93

Query  937   EVQAVADCVELMGLSINDVRDAIKDLQGSKTRNSDAQTSLSAVLTNHLTCMEGLNPPEKS  758
             E  A ADC++L   +IN +   +     +K  + DAQT LS  LTN  TC  G     + 
Sbjct  94    EKVAWADCLKLYQDTINQLNHTLDS--NTKCTDFDAQTWLSTALTNLETCRAGF---VEL  148

Query  757   PVKGILDALISRSRVALAVLAEIIGQTDEEQNFR-VP--FNGKFPSWVKSSDRKLVRRKH  587
              V   +  L+S +      + ++I  T   +N   VP  + G FPSWVK  DRKL++   
Sbjct  149   GVPDYVLPLMSNN------VTKLISNTLALRNASTVPETYKGGFPSWVKPGDRKLLQTSP  202

Query  586   GNLKADIIVSQDGKGNFTTLKKAMESVSA-VSKARVFIYVKKGTYKENVEM-NVKSPVMI  413
               ++ +++V+QDG GN+ T+K A+++ +      R  I+VK+G YKEN+E+ N    +M+
Sbjct  203   --VRPNLVVAQDGSGNYRTIKAALDAAAKRTGSGRFVIHVKRGVYKENLEIGNKMKNIML  260

Query  412   YGDGMTQTVFSGDHSFGDNYTTFKSYTLASKGPAAILQDLCVRNTAGAAKHQAVALLVGG  233
              GDG+  T+ +G  S G  +TTF S T+A  G   I + +  RNTAG   HQAVAL  G 
Sbjct  261   VGDGLRYTIITGSRSVGGGFTTFNSATVAVTGDGFIARGITFRNTAGPQNHQAVALRAGS  320

Query  232   DKSIINRCRLEGYQDTLYAHSKRQFYRDCTITGTIDFVFGDAAVVLQNCTLIAKKPLAAQ  53
             D S+  +C  EGYQDTLY HS+RQFY++C I GT+DF+FG+AAVVLQNC + A++P+  Q
Sbjct  321   DLSVFYQCGFEGYQDTLYVHSQRQFYKECYIYGTVDFIFGNAAVVLQNCMIYARRPMDKQ  380

Query  52    KNMVTAQGRSDPNQNTG  2
             KN+VTAQGR+DPNQNTG
Sbjct  381   KNVVTAQGRTDPNQNTG  397



>ref|XP_010271269.1| PREDICTED: pectinesterase-like [Nelumbo nucifera]
Length=529

 Score =   253 bits (645),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 137/322 (43%), Positives = 194/322 (60%), Gaps = 21/322 (7%)
 Frame = -3

Query  928  AVADCVELMGLSINDVRDAIKDLQGSKT--RNSDAQTSLSAVLTNHLTCMEGLNPPEKSP  755
            A  DCVEL   ++  +  A+    GSK     SDAQT LSA +TN  TC  G     KS 
Sbjct  96   AWDDCVELYADTVTQLNRAL----GSKNPLSWSDAQTWLSAAITNQQTCQNGFIELGKSS  151

Query  754  VKGILDALISR-----------SRVALAVLAEIIGQTDEEQNFRVPFNGKFPSWVKSSDR  608
                   ++S            ++ A +  A ++G+  +  N R+  +G FP+WV ++DR
Sbjct  152  YLSSFPFMLSNFSKMVSNSLAINKEAASSAASLLGK--QGGNRRLLSDG-FPTWVSAADR  208

Query  607  KLVRRKHGNLKADIIVSQDGKGNFTTLKKAMESVSAVSKARVFIYVKKGTYKENVEMNVK  428
            KL++      +AD++V+ DG GN+ T+ +A+ +    S  R  IYVK+G Y+ENVE+   
Sbjct  209  KLLQSPSAASQADVVVAADGSGNYKTISQAVAASPKRSGKRFVIYVKRGVYRENVEITA-  267

Query  427  SPVMIYGDGMTQTVFSGDHSFGDNYTTFKSYTLASKGPAAILQDLCVRNTAGAAKHQAVA  248
            S +M+ GDG+  T  +G  +  D  TTF++ T+A  G   I +D+   NTAG  KHQAV+
Sbjct  268  SNIMLIGDGIDATTVTGSKNVQDGSTTFRTATVAVTGDGFIARDMTFENTAGPQKHQAVS  327

Query  247  LLVGGDKSIINRCRLEGYQDTLYAHSKRQFYRDCTITGTIDFVFGDAAVVLQNCTLIAKK  68
            L  G D S+  RC  +GYQDTLY +S+RQFYRDC I GT+DF+FGDA  VLQNC +  +K
Sbjct  328  LRSGSDLSVFYRCSFKGYQDTLYVYSQRQFYRDCDIYGTVDFIFGDAVAVLQNCNIYVRK  387

Query  67   PLAAQKNMVTAQGRSDPNQNTG  2
            P++ Q+N VTAQGR+DPN+NTG
Sbjct  388  PMSGQQNTVTAQGRTDPNENTG  409



>gb|KDO65446.1| hypothetical protein CISIN_1g010103mg [Citrus sinensis]
Length=518

 Score =   252 bits (644),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 148/377 (39%), Positives = 216/377 (57%), Gaps = 20/377 (5%)
 Frame = -3

Query  1111  CRTAIDPAACKTILKQTVKSYG--GTPAGLLREFLADYLPSMEAAKMEFGMVRGEFTHPR  938
             C     P  CK  ++Q  K +      +   R  ++  L     A+     +  +  + +
Sbjct  34    CSKTPHPEPCKYFMQQNSKHFAVPKQKSEFRRMAMSLALDRALTAQNHNKWLGSKCRNHK  93

Query  937   EVQAVADCVELMGLSINDVRDAIKDLQGSKTRNSDAQTSLSAVLTNHLTCMEGLNPPEKS  758
             E  A ADC++L   +IN +   +     +K  + DAQT LS  LTN  TC  G     + 
Sbjct  94    EKVAWADCLKLYQDTINQLNHTLDS--NTKCTDFDAQTWLSTALTNLETCRAGF---VEL  148

Query  757   PVKGILDALISRSRVALAVLAEIIGQTDEEQNFR-VP--FNGKFPSWVKSSDRKLVRRKH  587
              V   +  L+S +      + ++I  T   +N   VP  + G FPSWVK  DRKL++   
Sbjct  149   GVPDYVLPLMSNN------VTKLISNTLALRNASTVPETYKGGFPSWVKPGDRKLLQTSP  202

Query  586   GNLKADIIVSQDGKGNFTTLKKAMESVSA-VSKARVFIYVKKGTYKENVEM-NVKSPVMI  413
               ++ +++V+QDG GN+ T+K A+++ +      R  I+VK+G YKEN+E+ N    +M+
Sbjct  203   --VRPNLVVAQDGSGNYRTIKAALDAAAKRTGSGRFVIHVKRGVYKENLEIGNKMKNIML  260

Query  412   YGDGMTQTVFSGDHSFGDNYTTFKSYTLASKGPAAILQDLCVRNTAGAAKHQAVALLVGG  233
              GDG+  T+ +G  S G  +TTF S T+A  G   I + +  RNTAG   HQAVAL  G 
Sbjct  261   VGDGLRYTIITGSRSVGGGFTTFNSATVAVTGDGFIARGITFRNTAGPQNHQAVALRAGS  320

Query  232   DKSIINRCRLEGYQDTLYAHSKRQFYRDCTITGTIDFVFGDAAVVLQNCTLIAKKPLAAQ  53
             D S+  +C  EGYQDTLY HS+RQFY++C I GT+DF+FG+AAVVLQNC + A++P+  Q
Sbjct  321   DLSVFYQCGFEGYQDTLYVHSQRQFYKECYIYGTVDFIFGNAAVVLQNCMIYARRPMDKQ  380

Query  52    KNMVTAQGRSDPNQNTG  2
             KN+VTAQGR+DPNQNTG
Sbjct  381   KNVVTAQGRTDPNQNTG  397



>ref|XP_004287682.1| PREDICTED: pectinesterase/pectinesterase inhibitor PPE8B-like 
[Fragaria vesca subsp. vesca]
Length=514

 Score =   252 bits (643),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 143/328 (44%), Positives = 187/328 (57%), Gaps = 20/328 (6%)
 Frame = -3

Query  952  FTHPREVQAVADCVELMGLSINDVRDAIKDLQGSKTRN-------SDAQTSLSAVLTNHL  794
            F   R   AV DC+ELM  S + +   +   Q    ++       SD +T LSA L N  
Sbjct  71   FGDFRLSNAVDDCLELMDDSTDQLSWTLSATQNKNGKHNSTGNLSSDLRTWLSATLVNQD  130

Query  793  TCMEGL---NPPEKSPVKGILDALISRSRVALAVLAEIIGQTDEEQNFRVPFNGKFPSWV  623
            TC EGL   N   KS V G L+ + S       ++ E++GQ     +     NG+ P+W 
Sbjct  131  TCNEGLDGTNSIVKSLVSGSLNQITS-------LVLELLGQVHPTSDQHESSNGQTPAWF  183

Query  622  KSSDRKLVRRKHGNLKADIIVSQDGKGNFTTLKKAMESVSAVSKARVFIYVKKGTYKENV  443
            K+ DRKL++     +  D++V+QDG GNFT +  A+ S    S  R  IYVKKG YKE V
Sbjct  184  KAEDRKLLQAN--GVPVDVVVAQDGTGNFTNITAAILSAPDYSLKRYVIYVKKGLYKEYV  241

Query  442  EMNVKS-PVMIYGDGMTQTVFSGDHSFGDNYTTFKSYTLASKGPAAILQDLCVRNTAGAA  266
            E+  K   +M+ GDGM  TV SG+H+F D +TTF+S T A  G   I +D+   NTAG  
Sbjct  242  EIKKKKWNIMMIGDGMDATVISGNHNFVDGWTTFRSATFAVSGRGFIARDITFENTAGPE  301

Query  265  KHQAVALLVGGDKSIINRCRLEGYQDTLYAHSKRQFYRDCTITGTIDFVFGDAAVVLQNC  86
            KH AVAL    D S   RC   GYQDTLY HS RQFYRDC I+GT+DF+FGD  V+ QNC
Sbjct  302  KHMAVALRSDSDLSAFYRCEFRGYQDTLYTHSMRQFYRDCKISGTVDFIFGDGTVIFQNC  361

Query  85   TLIAKKPLAAQKNMVTAQGRSDPNQNTG  2
             ++A+K L  QKN +TA GR   ++ TG
Sbjct  362  QILARKALPNQKNSITAHGRKYKDEPTG  389



>ref|XP_009421463.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 34 
[Musa acuminata subsp. malaccensis]
Length=591

 Score =   254 bits (648),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 128/293 (44%), Positives = 183/293 (62%), Gaps = 15/293 (5%)
 Frame = -3

Query  835  DAQTSLSAVLTNHLTCMEGLNPPEKSPVK-GILDALISRSRVALAVLAEIIGQTDEEQNF  659
            D  T LS  LTN  TC EGL P +   VK  + + L   + +    LA   G +  E   
Sbjct  176  DVLTWLSGALTNQDTCNEGLQPVKDLYVKKHMANQLKDLTELVSNCLAIFSGVSRNEDFT  235

Query  658  RVPFNGK-------------FPSWVKSSDRKLVRRKHGNLKADIIVSQDGKGNFTTLKKA  518
             +P + K             FP+WV   DR+L++    +++AD++VS+DG G +T++  A
Sbjct  236  GIPIHNKKRKLLNAIDVDDGFPAWVAKKDRRLLQVPAADIQADMVVSKDGNGTYTSIVDA  295

Query  517  MESVSAVSKARVFIYVKKGTYKENVEMN-VKSPVMIYGDGMTQTVFSGDHSFGDNYTTFK  341
            +++    S  R+ IY+K G Y EN+++   K+ +M  GDG  QT+ +G  S  DN+TTF 
Sbjct  296  VKAAPEYSSRRIIIYIKAGRYYENIKVGRKKTNLMFIGDGKNQTIIAGSRSVYDNFTTFH  355

Query  340  SYTLASKGPAAILQDLCVRNTAGAAKHQAVALLVGGDKSIINRCRLEGYQDTLYAHSKRQ  161
            + T A+ G   I++D+ ++N AG  KHQAVAL VG D +++ RC + GYQDTLY HS+RQ
Sbjct  356  TATFAATGTGFIMRDITIQNWAGPEKHQAVALRVGADHAVVYRCNVIGYQDTLYVHSQRQ  415

Query  160  FYRDCTITGTIDFVFGDAAVVLQNCTLIAKKPLAAQKNMVTAQGRSDPNQNTG  2
            F+R+C I GT+DF+FG+AAVVLQNC+L A+KP+  QKN +TAQ R DPNQNTG
Sbjct  416  FFRECDIYGTVDFIFGNAAVVLQNCSLWARKPMDMQKNTITAQNRKDPNQNTG  468



>ref|XP_002875955.1| pectinesterase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH52214.1| pectinesterase family protein [Arabidopsis lyrata subsp. lyrata]
Length=598

 Score =   254 bits (648),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 141/329 (43%), Positives = 190/329 (58%), Gaps = 16/329 (5%)
 Frame = -3

Query  943  PREVQAVADCVELMGLSINDVRDAIKDLQGSKTRNSDAQTSLSAVLTNHLTCMEGLNPPE  764
            PR   A   CVEL+  S++ +  A+  +  S  +  D  T LSA LTNH TC EG +  +
Sbjct  148  PRARSAYDSCVELLDDSVDALSRALSSVVSSSAKPQDVTTWLSAALTNHDTCTEGFDGVD  207

Query  763  KSPVKGILDALISR-SRVALAVLAEIIGQTDEEQNFRVPFNG-----------KFPSWVK  620
               VK  + A I   S +    LA      D +    VP              KFP W++
Sbjct  208  DGGVKDHMTAAIKNLSELVSNCLAIFSASHDGDDFAGVPIQNRRLLGVEEREDKFPRWMR  267

Query  619  SSDRKLVRRKHGNLKADIIVSQDGKGNFTTLKKAMESVSAVSKARVFIYVKKGTYKENVE  440
              +R+++      ++ADIIVS+DG G   T+ +A++     S  R+ IYVK G Y+EN  
Sbjct  268  PREREILEMPVSQIQADIIVSKDGNGTCKTISEAIKKAPQNSTRRIIIYVKAGRYEEN-N  326

Query  439  MNV---KSPVMIYGDGMTQTVFSGDHSFGDNYTTFKSYTLASKGPAAILQDLCVRNTAGA  269
            + V   K  +M  GDG  +TV SG  S  DN TTF + + A+ G   I +D+   N AG 
Sbjct  327  LKVGRKKINLMFVGDGKGKTVISGGRSIFDNITTFHTASFAATGAGFIARDITFENWAGP  386

Query  268  AKHQAVALLVGGDKSIINRCRLEGYQDTLYAHSKRQFYRDCTITGTIDFVFGDAAVVLQN  89
            AKHQAVAL +G D ++I RC + GYQDTLY HS RQF+R+C I GT+DF+FG+AAVVLQN
Sbjct  387  AKHQAVALRIGADHAVIYRCNIIGYQDTLYVHSNRQFFRECDIYGTVDFIFGNAAVVLQN  446

Query  88   CTLIAKKPLAAQKNMVTAQGRSDPNQNTG  2
            C++ A+KP+  QKN +TAQ R DPNQNTG
Sbjct  447  CSIYARKPMDFQKNTITAQNRKDPNQNTG  475



>gb|KCW73020.1| hypothetical protein EUGRSUZ_E01454 [Eucalyptus grandis]
Length=480

 Score =   251 bits (640),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 150/348 (43%), Positives = 198/348 (57%), Gaps = 41/348 (12%)
 Frame = -3

Query  979  MEFGMVRGEFTHP------------REVQAVADCVELMGLSI-----NDVRDAIKDLQGS  851
            M+  + R +  H              E  A ADC++L   +I       V D  +D    
Sbjct  31   MQLALERAQMAHSNTHSLGSKCSNEHEKAAWADCLQLYEYTILRLNRTIVHDCTQD----  86

Query  850  KTRNSDAQTSLSAVLTNHLTCMEGLNPPEKSPVKGILDALISRSRVALAVLAEIIGQTD-  674
                 +AQT LS  LTN  TC  G     +  V G +  L+S +      ++++I  T  
Sbjct  87   -----EAQTWLSTALTNLETCQAGF---VELGVSGNVLPLMSNN------VSKLISNTLA  132

Query  673  -EEQNFRVP-FNGKFPSWVKSSDRKLVRRKHGNLKADIIVSQDGKGNFTTLKKAMESVSA  500
                 +  P +  KFP+WV+  DRKL++      KA+IIV+QDG GN+ T+ +A+ + S 
Sbjct  133  LNYAPYTTPNYTKKFPTWVRPGDRKLLQSSSAVSKANIIVAQDGSGNYKTISEAITAASK  192

Query  499  VS-KARVFIYVKKGTYKENVEMNVK-SPVMIYGDGMTQTVFSGDHSFGDNYTTFKSYTLA  326
             S  AR  IY+K GTY ENVE+  K   +M  GDG+ +T+ +G  S G   TTF S T+A
Sbjct  193  RSGTARYIIYIKAGTYSENVEVGSKLENIMFVGDGIGKTIITGSKSVGGGSTTFNSATVA  252

Query  325  SKGPAAILQDLCVRNTAGAAKHQAVALLVGGDKSIINRCRLEGYQDTLYAHSKRQFYRDC  146
              G   I QD+  RNTAGAA HQAVAL  G D S+  RC  EGYQDTLY HS+RQFYR+C
Sbjct  253  VVGDGFIAQDITFRNTAGAANHQAVALRSGSDLSVFYRCGFEGYQDTLYVHSERQFYREC  312

Query  145  TITGTIDFVFGDAAVVLQNCTLIAKKPLAAQKNMVTAQGRSDPNQNTG  2
             I GT+DF+FG+AAVVLQNC + A+ P   + N VTAQGR+DPNQNTG
Sbjct  313  DIYGTVDFIFGNAAVVLQNCNIYARNP-PNKVNTVTAQGRTDPNQNTG  359



>ref|XP_003595386.1| Pectinesterase [Medicago truncatula]
 gb|AES65637.1| pectinesterase/pectinesterase inhibitor [Medicago truncatula]
Length=527

 Score =   252 bits (643),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 140/334 (42%), Positives = 195/334 (58%), Gaps = 30/334 (9%)
 Frame = -3

Query  952  FTHPREVQAVADCVELMGLSINDVRDAIKDLQGSKTR-------NSDAQTSLSAVLTNHL  794
            F   R   AV+DC++++ LS + +  +    Q  K +       NSD +T LS+ L N  
Sbjct  84   FGDSRLSNAVSDCIDMLDLSSDALTWSASAAQNPKGKHNSTGNVNSDVRTWLSSALANPE  143

Query  793  TCMEGLNPPEKSPVKGILDALISRS-RVALAVLAEIIGQTD--------EEQNFRVPFNG  641
            TCM+G          GI   L+S      +++LAE++ Q D        +EQ       G
Sbjct  144  TCMDGFEG-----TSGIESQLVSTGLSQMMSMLAELLTQVDPNLDSFTQKEQK------G  192

Query  640  KFPSWVKSSDRKLVRRKHGNLKADIIVSQDGKGNFTTLKKAMESVSAVSKARVFIYVKKG  461
            +FPSWVK  DRKL++    N+  D++V+ DG GNFT +  A+ +    S  R  IYVK+G
Sbjct  193  RFPSWVKRDDRKLLQANGVNV--DVVVATDGSGNFTKVMDAVHAAPDYSMKRYVIYVKRG  250

Query  460  TYKENVEMNVKS-PVMIYGDGMTQTVFSGDHSFGDNYTTFKSYTLASKGPAAILQDLCVR  284
             Y ENVE+  K   +M+ GDGM  T+ +G+ SF D +TTF+S T A  G   I +D+  +
Sbjct  251  VYIENVEIKKKKWNLMMVGDGMNATIITGNRSFIDGWTTFRSATFAVSGRGFIARDISFQ  310

Query  283  NTAGAAKHQAVALLVGGDKSIINRCRLEGYQDTLYAHSKRQFYRDCTITGTIDFVFGDAA  104
            NTAG  KHQAVAL    D S+  RC + GYQD+LY H+ RQF+R+C I+GT+DF+FGDA 
Sbjct  311  NTAGPEKHQAVALRSDSDLSVFYRCGIFGYQDSLYTHTMRQFFRECKISGTVDFIFGDAT  370

Query  103  VVLQNCTLIAKKPLAAQKNMVTAQGRSDPNQNTG  2
             + QNC ++ KK L  QKN +TA GR DPN+ TG
Sbjct  371  TLFQNCQILVKKGLPNQKNTITAHGRKDPNEPTG  404



>gb|AAQ21124.1| pectinesterase [Fragaria x ananassa]
Length=514

 Score =   251 bits (642),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 144/330 (44%), Positives = 189/330 (57%), Gaps = 23/330 (7%)
 Frame = -3

Query  958  GEFTHPREVQAVADCVELMGLSINDVRDAIKDLQGSKTRN-------SDAQTSLSAVLTN  800
            G+F   R   AV DC+ELM  S + +   +   Q    ++       SD +T LSA L N
Sbjct  72   GDF---RLSNAVDDCLELMDDSTDQLSWTLSATQNKNGKHNSTGNLSSDLRTWLSATLVN  128

Query  799  HLTCMEGL---NPPEKSPVKGILDALISRSRVALAVLAEIIGQTDEEQNFRVPFNGKFPS  629
              TC EGL   N   KS V G L+ + S       ++ E++GQ     +     NG+ P+
Sbjct  129  QDTCNEGLDGTNSIVKSLVSGSLNQITS-------LVLELLGQVHPTSDQHESSNGQTPA  181

Query  628  WVKSSDRKLVRRKHGNLKADIIVSQDGKGNFTTLKKAMESVSAVSKARVFIYVKKGTYKE  449
            W K+ DRKL++     +  D++V+QDG GNFT +  A+ S    S  R  IYVKKG YKE
Sbjct  182  WFKAEDRKLLQAN--GVPVDVVVAQDGTGNFTNITAAILSAPDYSLKRYVIYVKKGLYKE  239

Query  448  NVEMNVKS-PVMIYGDGMTQTVFSGDHSFGDNYTTFKSYTLASKGPAAILQDLCVRNTAG  272
             VE+  K   +M+ GDGM  TV SG+H+F D +TTF+S T A  G   I +D+   NTAG
Sbjct  240  YVEIKKKKWNIMMIGDGMDATVISGNHNFVDGWTTFRSATFAVSGRGFIARDITFENTAG  299

Query  271  AAKHQAVALLVGGDKSIINRCRLEGYQDTLYAHSKRQFYRDCTITGTIDFVFGDAAVVLQ  92
              KH AVAL    D S   RC   GYQDTLY HS RQFYRDC I+GT+DF+FGD  V+ Q
Sbjct  300  PEKHMAVALRSDSDLSAFYRCEFRGYQDTLYTHSMRQFYRDCKISGTVDFIFGDGTVMFQ  359

Query  91   NCTLIAKKPLAAQKNMVTAQGRSDPNQNTG  2
            NC ++A+K L  QKN +TA GR   ++ TG
Sbjct  360  NCQILARKALPNQKNSITAHGRKYKDEPTG  389



>gb|AFW03483.1| pectin methylesterase 4 [Gossypium hirsutum]
Length=525

 Score =   251 bits (642),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 147/363 (40%), Positives = 209/363 (58%), Gaps = 25/363 (7%)
 Frame = -3

Query  1021  EFLADYLPSMEAAKMEFGMVR--GEFTHP-REVQAVADCVELMGLSINDVRDAIKDLQGS  851
             EF+     +++A +    +V   G F H  R   A++DC++L+  S +++   +   Q  
Sbjct  42    EFIGSLKTTIDAIRKATSVVSQFGGFFHDFRLSNAISDCLDLLDSSADELSWTMSASQNP  101

Query  850   KTRN-------SDAQTSLSAVLTNHLTCM---EGLNPPEKSPVKGILDALISRSRVALAV  701
               ++       SD +T LSA + N  TC+   EG N   K+ V G L+ + S  R  L +
Sbjct  102   NAKDNSTGDLSSDLRTWLSAAMVNQQTCIDGFEGTNSMVKTVVSGSLNQITSLVRNLLIM  161

Query  700   L-----AEIIGQTDEEQNFRV----PFNGKFPSWVKSSDRKLVRRKHGNLKADIIVSQDG  548
             +     ++  G  +  Q        P   +FP W K  DR+L   +   + A+++V+ DG
Sbjct  162   VHPGPNSKSNGTRNGSQKGGGGGGHPGQSRFPVWFKREDRRL--SQINGVTANVVVAADG  219

Query  547   KGNFTTLKKAMESVSAVSKARVFIYVKKGTYKENVEMNVKS-PVMIYGDGMTQTVFSGDH  371
              GNFT +  A+E+    S  R  IY+KKG YKENVE+  K   +M+ GDGM  TV SG+ 
Sbjct  220   SGNFTRIMDAVETAPDKSLNRYVIYIKKGLYKENVEIKKKKWNLMMIGDGMDVTVISGNR  279

Query  370   SFGDNYTTFKSYTLASKGPAAILQDLCVRNTAGAAKHQAVALLVGGDKSIINRCRLEGYQ  191
             SF D +TTF+S T A  G   I +D+   NTAG  KHQAVAL    D S+  RC ++GYQ
Sbjct  280   SFIDGWTTFRSATFAVSGRGFIARDITFENTAGPQKHQAVALRSDSDLSVFFRCAIKGYQ  339

Query  190   DTLYAHSKRQFYRDCTITGTIDFVFGDAAVVLQNCTLIAKKPLAAQKNMVTAQGRSDPNQ  11
             D+LY H+ RQFYR+C ITGT+DF+FGD AV+ QNC ++AK+ L +QKN +TAQGR DPNQ
Sbjct  340   DSLYTHTMRQFYRECKITGTVDFIFGDGAVLFQNCQILAKQGLPSQKNTITAQGRKDPNQ  399

Query  10    NTG  2
              TG
Sbjct  400   PTG  402



>ref|XP_004290811.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 40-like 
[Fragaria vesca subsp. vesca]
Length=567

 Score =   252 bits (644),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 142/325 (44%), Positives = 192/325 (59%), Gaps = 16/325 (5%)
 Frame = -3

Query  931  QAVADCVELMGLSINDVRDAIKDLQGSKT----RNSDAQTSLSAVLTNHLTCMEGLNPPE  764
            QA+ DC+EL   ++  ++  + +L   K+      +  +T LSA +TN  TC+EG +   
Sbjct  122  QALDDCLELFDDTVAQLKVTMSELSSKKSPAAKHYNHLRTLLSAAMTNQYTCLEGFDSST  181

Query  763  KSPVKGILDALISRSRV-------ALAVLAEIIGQTDEEQN--FRVPFNGKFPSWVKSSD  611
             S VK +   L SR          AL +L +I G  + E    F    NG FP+WV S  
Sbjct  182  SSTVKAVKAELESRLNTTCKHFSNALVMLKKIRGVVERESTDEFGAMKNG-FPTWVGSKA  240

Query  610  RKLVRRKHGN-LKADIIVSQDGKGNFTTLKKAMESVSAVSKARVFIYVKKGTYKENVEM-  437
            RKL++    N  K D++V++DG GNFTT+  A+ +    S  R  IY+K G Y ENVE+ 
Sbjct  241  RKLLQTSSANQTKYDLLVAKDGSGNFTTITDAVAAAPNSSATRFVIYIKAGAYFENVEVV  300

Query  436  NVKSPVMIYGDGMTQTVFSGDHSFGDNYTTFKSYTLASKGPAAILQDLCVRNTAGAAKHQ  257
            + K+ +M  GDG+ +TV     +  D +TTF+S T+A  G   I + +   N+AG +KHQ
Sbjct  301  SKKTNLMFLGDGIGKTVVKASRNVVDGWTTFRSATVAVVGGGFIAKGITFENSAGPSKHQ  360

Query  256  AVALLVGGDKSIINRCRLEGYQDTLYAHSKRQFYRDCTITGTIDFVFGDAAVVLQNCTLI  77
            AVAL  G D S   +C   GYQDTLY HS RQFYR+C I GT+DF+FG+AAVV QNC L 
Sbjct  361  AVALRSGSDLSAFYQCSFVGYQDTLYVHSLRQFYRECDIYGTVDFIFGNAAVVFQNCNLY  420

Query  76   AKKPLAAQKNMVTAQGRSDPNQNTG  2
            A+KP   QKN+ TAQGR DPNQNTG
Sbjct  421  ARKPNDGQKNIFTAQGREDPNQNTG  445



>ref|XP_009783075.1| PREDICTED: pectinesterase-like [Nicotiana sylvestris]
Length=567

 Score =   252 bits (644),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 139/326 (43%), Positives = 197/326 (60%), Gaps = 12/326 (4%)
 Frame = -3

Query  943  PREVQAVADCVELMGLSINDVRDAIKDLQGSKTRN---SDAQTSLSAVLTNHLTCMEGLN  773
            P E +A+ DCVEL+G +I ++R A+ DL   K+ +   +D QT LSA +TN  TC++GL 
Sbjct  118  PIEKRALQDCVELLGETIAELRTALTDLSPKKSASKHYNDIQTLLSAAMTNEDTCLDGLF  177

Query  772  PPEKSP----VKGILDALISRSRVALAVLAEIIGQTDEEQNFRVPFNGK----FPSWVKS  617
               K+     V+  L  +      +LA+L +I   +        P  G     FP+W+K 
Sbjct  178  YCTKNNLTRYVEDNLHTIAHHVSNSLAMLNKIKRTSVSSSEEVFPEYGAVKNGFPNWLKR  237

Query  616  SDRKLVRRKHGNLKADIIVSQDGKGNFTTLKKAMESVSAVSKARVFIYVKKGTYKENVEM  437
             +R L++      K D++V++DG GNFTT+ +A+ +    S  R  IY+K+G+Y E VE+
Sbjct  238  RERALLQTPVSQTKLDLVVAKDGSGNFTTINEALSAAPNSSSTRFVIYIKEGSYFEYVEV  297

Query  436  NVK-SPVMIYGDGMTQTVFSGDHSFGDNYTTFKSYTLASKGPAAILQDLCVRNTAGAAKH  260
            + K + +M  GDG+ +T   G+ +  D +TTF+S T+A  G   + + +   N AG +KH
Sbjct  298  DKKKTMIMFVGDGIGKTKIKGNRNHVDGWTTFRSATVAVVGKGFLAKGITFENYAGPSKH  357

Query  259  QAVALLVGGDKSIINRCRLEGYQDTLYAHSKRQFYRDCTITGTIDFVFGDAAVVLQNCTL  80
            QAVAL    D S   +C    YQDTLY HS RQFYRDC + GT+DF+FG+AAVVLQNC L
Sbjct  358  QAVALRSSSDLSAFYQCSFVAYQDTLYVHSLRQFYRDCDVYGTVDFIFGNAAVVLQNCNL  417

Query  79   IAKKPLAAQKNMVTAQGRSDPNQNTG  2
             A+KP   QKN+ TAQGR DPNQNTG
Sbjct  418  YARKPDPNQKNLFTAQGREDPNQNTG  443



>gb|KHF97563.1| Pectinesterase/pectinesterase inhibitor PPE8B [Gossypium arboreum]
Length=525

 Score =   251 bits (641),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 147/363 (40%), Positives = 209/363 (58%), Gaps = 25/363 (7%)
 Frame = -3

Query  1021  EFLADYLPSMEAAKMEFGMVR--GEFTHP-REVQAVADCVELMGLSINDVRDAIKDLQGS  851
             EF+     +++A +    +V   G F H  R   A+ DC++L+  S +++   +   Q  
Sbjct  42    EFIGSLKTTIDAIRKATSVVSQFGGFFHDFRLSNAIFDCLDLLDSSADELSWTMSASQNP  101

Query  850   KTRN-------SDAQTSLSAVLTNHLTCM---EGLNPPEKSPVKGILDALISRSRVALAV  701
               ++       SD +T LSA + N  TC+   EG N   K+ V G L+ + S  R  L +
Sbjct  102   NAKDNSTGDLSSDLRTWLSAAMVNQQTCIDGFEGTNSMVKTVVSGSLNQITSLVRNLLIM  161

Query  700   L-----AEIIGQTDEEQNFRV----PFNGKFPSWVKSSDRKLVRRKHGNLKADIIVSQDG  548
             +     ++  G  +  Q        P   +FP W K  DR+L++     + A+++V+ DG
Sbjct  162   VHPGPNSKSNGTRNGSQKGGGGGGHPGQNRFPVWFKREDRRLLQIN--GVTANVVVAADG  219

Query  547   KGNFTTLKKAMESVSAVSKARVFIYVKKGTYKENVEMNVKS-PVMIYGDGMTQTVFSGDH  371
              GNFT +  A+E+    S  R  IY+KKG YKENVE+  K   +M+ GDGM  TV SG+ 
Sbjct  220   SGNFTRIMDAVETAPDKSMNRYVIYIKKGLYKENVEIKKKKWNLMMIGDGMDVTVISGNR  279

Query  370   SFGDNYTTFKSYTLASKGPAAILQDLCVRNTAGAAKHQAVALLVGGDKSIINRCRLEGYQ  191
             SF D +TTF+S T A  G   I +D+   NTAG  KHQAVAL    D S+  RC ++GYQ
Sbjct  280   SFIDGWTTFRSATFAVSGRGFIARDITFENTAGPQKHQAVALRSDSDLSVFFRCAIKGYQ  339

Query  190   DTLYAHSKRQFYRDCTITGTIDFVFGDAAVVLQNCTLIAKKPLAAQKNMVTAQGRSDPNQ  11
             D+LY H+ RQFYR+C ITGT+DF+FGD AV+ QNC ++AK+ L +QKN +TAQGR DPNQ
Sbjct  340   DSLYTHTMRQFYRECKITGTVDFIFGDGAVLFQNCQILAKQGLPSQKNTITAQGRKDPNQ  399

Query  10    NTG  2
              TG
Sbjct  400   PTG  402



>emb|CAA64217.1| pectinmethylesterase [Vigna radiata var. radiata]
Length=320

 Score =   245 bits (625),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 117/195 (60%), Positives = 148/195 (76%), Gaps = 1/195 (1%)
 Frame = -3

Query  583  NLKADIIVSQDGKGNFTTLKKAMESVSAVSKARVFIYVKKGTYKENVEMNVKSP-VMIYG  407
            ++KA+++V+QDG G F T+ +A+ S     K R  IYVKKGTYKE+VE+  K   +M+ G
Sbjct  3    DVKANVVVAQDGSGKFKTVTEAVASAPDNGKTRYVIYVKKGTYKEHVEIGKKKKNIMLVG  62

Query  406  DGMTQTVFSGDHSFGDNYTTFKSYTLASKGPAAILQDLCVRNTAGAAKHQAVALLVGGDK  227
            DGM  T+ +G  +F D  TTF S T+A+ G   I QD+  +NTAGAAKHQAVAL VG D+
Sbjct  63   DGMDATIITGSLNFIDGTTTFNSATVAAVGDGFIGQDIWFQNTAGAAKHQAVALRVGADQ  122

Query  226  SIINRCRLEGYQDTLYAHSKRQFYRDCTITGTIDFVFGDAAVVLQNCTLIAKKPLAAQKN  47
            S+INRCR++ +QDTLYAHS RQFYRD  ITGTIDF+FG+AAVV Q C L+A+KP++ QKN
Sbjct  123  SVINRCRIDAFQDTLYAHSNRQFYRDSVITGTIDFIFGNAAVVFQKCNLVARKPMSNQKN  182

Query  46   MVTAQGRSDPNQNTG  2
            MVTAQGR DPNQNTG
Sbjct  183  MVTAQGREDPNQNTG  197



>ref|NP_190491.1| putative pectinesterase/pectinesterase inhibitor 34 [Arabidopsis 
thaliana]
 sp|Q9M3B0.1|PME34_ARATH RecName: Full=Probable pectinesterase/pectinesterase inhibitor 
34; Includes: RecName: Full=Pectinesterase inhibitor 34; AltName: 
Full=Pectin methylesterase inhibitor 34; Includes: RecName: 
Full=Pectinesterase 34; Short=PE 34; AltName: Full=Pectin 
methylesterase 34; Short=AtPME34 [Arabidopsis thaliana]
 emb|CAB66401.1| pectinesterase-like protein [Arabidopsis thaliana]
 gb|AAL24316.1| pectinesterase-like protein [Arabidopsis thaliana]
 gb|AAP37714.1| At3g49220 [Arabidopsis thaliana]
 dbj|BAE98692.1| pectinesterase like protein [Arabidopsis thaliana]
 gb|AEE78512.1| putative pectinesterase/pectinesterase inhibitor 34 [Arabidopsis 
thaliana]
Length=598

 Score =   253 bits (646),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 141/329 (43%), Positives = 191/329 (58%), Gaps = 16/329 (5%)
 Frame = -3

Query  943  PREVQAVADCVELMGLSINDVRDAIKDLQGSKTRNSDAQTSLSAVLTNHLTCMEGLNPPE  764
            PR   A   CVEL+  S++ +  A+  +  S  +  D  T LSA LTNH TC EG +  +
Sbjct  148  PRARSAYDSCVELLDDSVDALSRALSSVVSSSAKPQDVTTWLSAALTNHDTCTEGFDGVD  207

Query  763  KSPVKGILDA-LISRSRVALAVLAEIIGQTDEEQNFRVPFNG-----------KFPSWVK  620
               VK  + A L + S +    LA      D +    VP              KFP W++
Sbjct  208  DGGVKDHMTAALQNLSELVSNCLAIFSASHDGDDFAGVPIQNRRLLGVEEREEKFPRWMR  267

Query  619  SSDRKLVRRKHGNLKADIIVSQDGKGNFTTLKKAMESVSAVSKARVFIYVKKGTYKENVE  440
              +R+++      ++ADIIVS+DG G   T+ +A++     S  R+ IYVK G Y+EN  
Sbjct  268  PKEREILEMPVSQIQADIIVSKDGNGTCKTISEAIKKAPQNSTRRIIIYVKAGRYEEN-N  326

Query  439  MNV---KSPVMIYGDGMTQTVFSGDHSFGDNYTTFKSYTLASKGPAAILQDLCVRNTAGA  269
            + V   K  +M  GDG  +TV SG  S  DN TTF + + A+ G   I +D+   N AG 
Sbjct  327  LKVGRKKINLMFVGDGKGKTVISGGKSIFDNITTFHTASFAATGAGFIARDITFENWAGP  386

Query  268  AKHQAVALLVGGDKSIINRCRLEGYQDTLYAHSKRQFYRDCTITGTIDFVFGDAAVVLQN  89
            AKHQAVAL +G D ++I RC + GYQDTLY HS RQF+R+C I GT+DF+FG+AAVVLQN
Sbjct  387  AKHQAVALRIGADHAVIYRCNIIGYQDTLYVHSNRQFFRECDIYGTVDFIFGNAAVVLQN  446

Query  88   CTLIAKKPLAAQKNMVTAQGRSDPNQNTG  2
            C++ A+KP+  QKN +TAQ R DPNQNTG
Sbjct  447  CSIYARKPMDFQKNTITAQNRKDPNQNTG  475



>ref|XP_004511148.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 46-like 
[Cicer arietinum]
Length=574

 Score =   252 bits (644),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 151/389 (39%), Positives = 223/389 (57%), Gaps = 23/389 (6%)
 Frame = -3

Query  1114  LCRTAIDPAACKTILKQTVKSYGGTPAGLLREFLADYLPSMEAAK-MEFGMVRGEFTH--  944
             +C   + P +C + L   VKS    P  L +  L+  +   E +K + +   +G F    
Sbjct  75    VCDVTLYPDSCYSSLNPLVKSGRIRPEDLSK--LSIQVALNEVSKGVRYFSEKGGFNELN  132

Query  943   ----PREVQAVADCVELMGLSINDVRDAIKDLQGSKTRNSDA----QTSLSAVLTNHLTC  788
                  R  +A+ +C +L+GL+++ + D++    G K+   DA    +T LSA  T   TC
Sbjct  133   LNVDKRTKEALMNCKDLLGLAVDHLNDSLA--YGGKSSLLDALEDLETWLSASGTYQQTC  190

Query  787   MEGLNPPEKSPVKGILDALISRSRVALAVLAEI--IGQTDEEQNFRVPFN----GKFPSW  626
             ++G+   +K+    I + L   +++    LA I  + +     NFR   +     + P W
Sbjct  191   IDGIEEADKALKSSITNNLKDSTQLTSNSLAIITWLNKATTSVNFRRLLSSSNQNEEPKW  250

Query  625   VKSSDRKLVRRKHGNLKADIIVSQDGKGNFTTLKKAMESVSAVSKARVFIYVKKGTYKEN  446
             +    RKL++ K  N+K DI+V++DG G ++T+  A+E V   S  R  IYVKKGTY EN
Sbjct  251   LDPKVRKLLK-KSDNIKPDIVVAKDGSGKYSTISDALEHVPNKSDKRTVIYVKKGTYLEN  309

Query  445   VEMN-VKSPVMIYGDGMTQTVFSGDHSFGDNYTTFKSYTLASKGPAAILQDLCVRNTAGA  269
             V +   K  VMI GDGM  T+ SG  +F D   TF S T A  G   I +D+  +NTAG 
Sbjct  310   VRVEKTKWNVMIIGDGMNVTIVSGSLNFVDGTPTFSSATFAVFGKNFIARDIGFKNTAGP  369

Query  268   AKHQAVALLVGGDKSIINRCRLEGYQDTLYAHSKRQFYRDCTITGTIDFVFGDAAVVLQN  89
              KHQAVAL+   D+++  RC ++ YQDTLYAHS RQFYR+C I GT+DF+FG++AVVLQN
Sbjct  370   EKHQAVALMTSADQAVFYRCSMDAYQDTLYAHSNRQFYRECKIYGTVDFIFGNSAVVLQN  429

Query  88    CTLIAKKPLAAQKNMVTAQGRSDPNQNTG  2
             C ++ + P+  Q+N +TAQG+SDPN NTG
Sbjct  430   CNILPRVPMQGQQNTITAQGKSDPNMNTG  458



>ref|XP_010056335.1| PREDICTED: pectinesterase 2-like [Eucalyptus grandis]
Length=515

 Score =   251 bits (640),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 150/348 (43%), Positives = 198/348 (57%), Gaps = 41/348 (12%)
 Frame = -3

Query  979  MEFGMVRGEFTHP------------REVQAVADCVELMGLSI-----NDVRDAIKDLQGS  851
            M+  + R +  H              E  A ADC++L   +I       V D  +D    
Sbjct  66   MQLALERAQMAHSNTHSLGSKCSNEHEKAAWADCLQLYEYTILRLNRTIVHDCTQD----  121

Query  850  KTRNSDAQTSLSAVLTNHLTCMEGLNPPEKSPVKGILDALISRSRVALAVLAEIIGQTD-  674
                 +AQT LS  LTN  TC  G     +  V G +  L+S +      ++++I  T  
Sbjct  122  -----EAQTWLSTALTNLETCQAGF---VELGVSGNVLPLMSNN------VSKLISNTLA  167

Query  673  -EEQNFRVP-FNGKFPSWVKSSDRKLVRRKHGNLKADIIVSQDGKGNFTTLKKAMESVSA  500
                 +  P +  KFP+WV+  DRKL++      KA+IIV+QDG GN+ T+ +A+ + S 
Sbjct  168  LNYAPYTTPNYTKKFPTWVRPGDRKLLQSSSAVSKANIIVAQDGSGNYKTISEAITAASK  227

Query  499  VS-KARVFIYVKKGTYKENVEMNVK-SPVMIYGDGMTQTVFSGDHSFGDNYTTFKSYTLA  326
             S  AR  IY+K GTY ENVE+  K   +M  GDG+ +T+ +G  S G   TTF S T+A
Sbjct  228  RSGTARYIIYIKAGTYSENVEVGSKLENIMFVGDGIGKTIITGSKSVGGGSTTFNSATVA  287

Query  325  SKGPAAILQDLCVRNTAGAAKHQAVALLVGGDKSIINRCRLEGYQDTLYAHSKRQFYRDC  146
              G   I QD+  RNTAGAA HQAVAL  G D S+  RC  EGYQDTLY HS+RQFYR+C
Sbjct  288  VVGDGFIAQDITFRNTAGAANHQAVALRSGSDLSVFYRCGFEGYQDTLYVHSERQFYREC  347

Query  145  TITGTIDFVFGDAAVVLQNCTLIAKKPLAAQKNMVTAQGRSDPNQNTG  2
             I GT+DF+FG+AAVVLQNC + A+ P   + N VTAQGR+DPNQNTG
Sbjct  348  DIYGTVDFIFGNAAVVLQNCNIYARNP-PNKVNTVTAQGRTDPNQNTG  394



>gb|AFW03478.1| pectin methylesterase 4 [Gossypium barbadense]
Length=525

 Score =   251 bits (640),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 149/364 (41%), Positives = 211/364 (58%), Gaps = 27/364 (7%)
 Frame = -3

Query  1021  EFLADYLPSMEAAKMEFGMVR--GEFTHP-REVQAVADCVELMGLSINDVRDAIKDLQGS  851
             EF+     +++A +    +V   G F H  R   A++DC++L+  S +++   +   Q  
Sbjct  42    EFIGSLKTTIDAIRKATSVVSQFGGFFHDFRLSNAISDCLDLLDSSADELSWTMSASQNP  101

Query  850   KTRN-------SDAQTSLSAVLTNHLTCM---EGLNPPEKSPVKGILDALISRSRVALAV  701
               ++       SD +T LSA + N  TC+   EG N   K+ V G L+ + S  R  L +
Sbjct  102   NAKDNSTGDLSSDLRTWLSAAMVNQQTCIDGFEGTNSMVKTVVSGSLNQITSLVRNLLIM  161

Query  700   L-----AEIIGQTDEEQNFRV----PFNGKFPSWVKSSDRKLVRRKHGNLKADIIVSQDG  548
             +     ++  G  +  Q        P   +FP W K  DR+L++     + A+++V+ DG
Sbjct  162   VHPGPNSKSNGTRNGSQKGGGGGGHPGQSRFPVWFKREDRRLLQIN--GVTANVVVAADG  219

Query  547   KGNFTTLKKAMESVSAVSKARVFIYVKKGTYKENVEMNVK--SPVMIYGDGMTQTVFSGD  374
              GNFT +  A+E+    S  R  IY+KKG YKENVE+  K  + VMI GDGM  TV SG+
Sbjct  220   SGNFTRIMDAVETAPDKSMNRYVIYIKKGLYKENVEIKKKKWNLVMI-GDGMDVTVISGN  278

Query  373   HSFGDNYTTFKSYTLASKGPAAILQDLCVRNTAGAAKHQAVALLVGGDKSIINRCRLEGY  194
              SF D +TTF+S T A  G   I +D+   NTAG  KHQAVAL    D S+  RC ++GY
Sbjct  279   RSFIDGWTTFRSATFAVSGRGFIARDITFENTAGPQKHQAVALRSDSDLSVFFRCAIKGY  338

Query  193   QDTLYAHSKRQFYRDCTITGTIDFVFGDAAVVLQNCTLIAKKPLAAQKNMVTAQGRSDPN  14
             QD+LY H+ RQFYR+C ITGT+DF+FGD AV+ QNC ++AK+ L +QKN +TAQGR DPN
Sbjct  339   QDSLYTHTMRQFYRECKITGTVDFIFGDGAVLFQNCQILAKQGLPSQKNTITAQGRKDPN  398

Query  13    QNTG  2
             Q TG
Sbjct  399   QPTG  402



>ref|XP_011076284.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 46 
[Sesamum indicum]
Length=573

 Score =   252 bits (643),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 151/393 (38%), Positives = 209/393 (53%), Gaps = 31/393 (8%)
 Frame = -3

Query  1114  LCRTAIDPAACKTILKQTVKSYGGTPAGLLR---EFLADYLPSMEAAKMEFGMVRGEFTH  944
             +C   + P +C   L    KS    P  L +   +   D L       +E G+ +   T 
Sbjct  73    VCNVTLYPDSCYNSLAPLAKSGNFKPQDLYKLSVQVAIDELSMASKNFVEHGVKKLNITD  132

Query  943   PREVQAVADCVELMGLSINDVRDAIKDLQGSKTRN-----SDAQTSLSAVLTNHLTCMEG  779
              + + A+  C EL  L+++ + +++      KT N      D  T LS+  T   TC++ 
Sbjct  133   QKTLAAIDSCQELFSLALDHLNNSLS----IKTTNLFEALDDLTTWLSSAGTYQQTCID-  187

Query  778   LNPPEKSPVKGILD-----------ALISRSRVALAVLAEIIGQTDEEQNFRVPF--NGK  638
                 E   V G+L            A  S S   L+   E IG        R+     G 
Sbjct  188   ----ELESVSGVLTTFANENFKNSTAYTSNSLAILSSFEESIGALGAVGRRRLMSLGGGD  243

Query  637   FPSWVKSSDRKLVRRKHGNLKADIIVSQDGKGNFTTLKKAMESVSAVSKARVFIYVKKGT  458
              P WV   DR+L++     +KAD +V++DG G + T+K A+++V   SK R  IYVKKG 
Sbjct  244   APEWVSFKDRRLLQTPSSRIKADAVVAKDGSGKYKTIKAALKAVPEKSKKRFVIYVKKGV  303

Query  457   YKENVEMN-VKSPVMIYGDGMTQTVFSGDHSFGDNYTTFKSYTLASKGPAAILQDLCVRN  281
             Y ENV +   K  VM+ GDG   T+ SG  +F D   TFK+ T A  G   I +D+  RN
Sbjct  304   YVENVRVEKTKWNVMMVGDGKDATIVSGSLNFVDGTPTFKTATFAVAGQGFIARDMGFRN  363

Query  280   TAGAAKHQAVALLVGGDKSIINRCRLEGYQDTLYAHSKRQFYRDCTITGTIDFVFGDAAV  101
             TAG AKHQAVAL+   D S+  RC ++ YQDTLYAHS RQFYR+C I GT+DF+FG++AV
Sbjct  364   TAGPAKHQAVALMSTADHSVFYRCTMDAYQDTLYAHSNRQFYRECNIYGTVDFIFGNSAV  423

Query  100   VLQNCTLIAKKPLAAQKNMVTAQGRSDPNQNTG  2
             V QNC ++ KKP+  Q+N +TAQG+ DPNQNTG
Sbjct  424   VFQNCNILPKKPMLGQQNTITAQGKIDPNQNTG  456



>emb|CDY08117.1| BnaA06g16090D [Brassica napus]
Length=498

 Score =   250 bits (638),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 148/332 (45%), Positives = 198/332 (60%), Gaps = 18/332 (5%)
 Frame = -3

Query  943  PREVQAVADCVELMGLSINDVRDAIKDL---QGSKTRNSDAQTSLSAVLTNHLTCMEGLN  773
            PR   A   CVEL+  S++ +  A+  +    G +T+  D  T LS+ LTNH TC EG +
Sbjct  44   PRVRSAYESCVELLDDSVDALTRALSSVVSVSGGQTKPQDVMTWLSSALTNHDTCTEGFD  103

Query  772  PPEKSPVKG-ILDALISRSRVA---LAVLAEIIGQTDEE----QNFRV-----PFNGKFP  632
                  VK  + DAL + S +    LA+ A   G  D      QN R+       N KFP
Sbjct  104  GVGDGGVKDQMTDALKNLSELVSNCLAIFAASGGGDDFAGVPIQNRRLLEVGGDRNMKFP  163

Query  631  SWVKSSDRKLVRRKHGNLKADIIVSQDGKGNFTTLKKAMESVSAVSKARVFIYVKKGTYK  452
             W K  +R+L+      ++ADIIVS+DG G   T+ +A++     S  R  IYVK G Y+
Sbjct  164  RWTKRRERELLEMPVSQIQADIIVSKDGNGTCKTISEAIKKAPQHSTRRTIIYVKAGRYE  223

Query  451  E-NVEMNVKS-PVMIYGDGMTQTVFSGDHSFGDNYTTFKSYTLASKGPAAILQDLCVRNT  278
            E N+++  K   +M  GDG  +TV SG  S  DN TTF + + A+ G   I +D+  +N 
Sbjct  224  EKNLKVGRKKINLMFVGDGKGKTVISGGKSIFDNITTFHTASFAATGAGFIARDITFQNW  283

Query  277  AGAAKHQAVALLVGGDKSIINRCRLEGYQDTLYAHSKRQFYRDCTITGTIDFVFGDAAVV  98
            AG  KHQAVAL VG D ++I RC + GYQDTLY HS RQF+R+C I GT+DF+FG+AAVV
Sbjct  284  AGPEKHQAVALRVGADHAVIYRCSIIGYQDTLYVHSNRQFFRECDIYGTVDFIFGNAAVV  343

Query  97   LQNCTLIAKKPLAAQKNMVTAQGRSDPNQNTG  2
            LQNC++ A+KP+A QKN +TAQ R DPNQNTG
Sbjct  344  LQNCSIYARKPMALQKNTITAQNRKDPNQNTG  375



>ref|XP_004136014.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 40-like 
[Cucumis sativus]
Length=561

 Score =   251 bits (642),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 139/328 (42%), Positives = 196/328 (60%), Gaps = 13/328 (4%)
 Frame = -3

Query  946  HPREVQAVADCVELMGLSINDVRDAIKDLQGSKT---RNSDAQTSLSAVLTNHLTCMEGL  776
            +P +  A+ DC+EL+  SI +++ +I DL  S++    + D  T +SA +TNH TC++G 
Sbjct  110  NPTDRHALDDCLELLDGSIAELKASIFDLAPSQSPALHSHDLLTLVSAAMTNHRTCVDGF  169

Query  775  NPPE---KSPVKGILDALISRSRVALAVLAEIIG---QTDEEQNFRVPFN---GKFPSWV  623
                   +S V+  L  +     + LA+L +I G    T  +Q     +    G FP WV
Sbjct  170  YNSSGTVRSRVELYLGKIGQHLSIDLAMLKKIPGVNRATGVDQEMLPEYGAVKGGFPKWV  229

Query  622  KSSDRKLVRRKHGNLKADIIVSQDGKGNFTTLKKAMESVSAVSKARVFIYVKKGTYKENV  443
               DR+L++      K +++V++DG GNFTT+ +A+ +    S  R  IY+K G Y ENV
Sbjct  230  SVKDRRLLQAAVNETKFNMVVAKDGSGNFTTVSEAVAAAPNASTTRFVIYIKAGAYFENV  289

Query  442  EMN-VKSPVMIYGDGMTQTVFSGDHSFGDNYTTFKSYTLASKGPAAILQDLCVRNTAGAA  266
            E+   KS +M  GDG+ +T+   D +  D +TTF+S T+A  G   I + +   N AG +
Sbjct  290  EIGRAKSNLMFVGDGIGKTLIKADRNVVDGWTTFRSATVAVVGTGFIAKGITFENYAGPS  349

Query  265  KHQAVALLVGGDKSIINRCRLEGYQDTLYAHSKRQFYRDCTITGTIDFVFGDAAVVLQNC  86
            KHQAVAL    D S   +C   GYQDTLY HS RQFYRDC + GTIDF+FG+AAVV QNC
Sbjct  350  KHQAVALRSNSDFSAFYQCSFIGYQDTLYVHSLRQFYRDCDVYGTIDFIFGNAAVVFQNC  409

Query  85   TLIAKKPLAAQKNMVTAQGRSDPNQNTG  2
             L A+KP + Q+N+ TAQGR DPNQNTG
Sbjct  410  NLYARKPNSNQRNIFTAQGREDPNQNTG  437



>ref|XP_008242331.1| PREDICTED: pectinesterase-like [Prunus mume]
Length=554

 Score =   251 bits (641),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 149/384 (39%), Positives = 220/384 (57%), Gaps = 16/384 (4%)
 Frame = -3

Query  1111  CRTAIDPAACKTILKQT-VKSYGGTPAGLLREFLADYLPSMEAAKMEF-GMVRGEFTHPR  938
             C T + P+ C T L       +  T   LL   +   + S+E+ +    G+++ +  + +
Sbjct  50    CTTLLHPSLCFTALASAKTHDHFTTFHHLLEANINQTVASVESTRQSIKGLLKLQDLYLQ  109

Query  937   EVQAVADCVELMGLSINDVRDAIKDLQGSKTRNSDAQTSLSAVLTNHLTCMEGLNPPEKS  758
             E  A+ DC+E++  ++ ++  A+ DL G +    + +T LSA +TN  TC++G    E+ 
Sbjct  110   ERNALKDCLEMLDQTLYELGQAVDDLHGFRVSYGNLKTLLSAAMTNENTCIDGFFELEEF  169

Query  757   P------VKGILDALISR-SRVALAVLAEIIGQTD--EEQNFRVPFNGK--FPSWVKSSD  611
                    +KG L  L++  S +    LA I  Q     EQ   V    K  FP W+   D
Sbjct  170   DSENQIGLKGHLQGLLAPISELMSDCLAMIRYQEQALNEQKRLVTKKPKKRFPMWMLPGD  229

Query  610   RKLVRRKHGNLKADIIVSQDGKGNFTTLKKAMESVSAVSKARVFIYVKKGTYKENVEMN-  434
             R L++R+   +KADI+V+ DG G++ T+ +A++    +S+ R  I +K G Y E VE++ 
Sbjct  230   RNLMQRE-PTMKADIVVAADGNGDYETIGEALKMAPNMSRTRFVIKIKAGVYNETVEISR  288

Query  433   VKSPVMIYGDGMTQTVFSGDHSFGDNYTTFKSYTLASKGPAAILQDLCVRNTAGAAKHQA  254
              K+ +M+ GDGM  T+ +G  SF D ++TF + TL   G   + +DL V NTAG+ K QA
Sbjct  289   EKANIMLVGDGMNTTIITGSKSFADGFSTFATATLTVIGDRFLARDLTVTNTAGSKKFQA  348

Query  253   VALLVGGDKSIINRCRLEGYQDTLYAHSKRQFYRDCTITGTIDFVFGDAAVVLQNCTLIA  74
             VA  V  + S    C    YQDTLY HS RQFYRDC I GTIDF+FG+AA V QNCT+I 
Sbjct  349   VAARVTSN-SAFYHCNFSSYQDTLYVHSLRQFYRDCIIEGTIDFIFGNAAAVFQNCTVIV  407

Query  73    KKPLAAQKNMVTAQGRSDPNQNTG  2
             +KP+  QK M+TAQGR+DPNQNTG
Sbjct  408   RKPIPGQKLMITAQGRTDPNQNTG  431



>ref|XP_010056339.1| PREDICTED: pectinesterase 2-like [Eucalyptus grandis]
 gb|KCW73022.1| hypothetical protein EUGRSUZ_E01463 [Eucalyptus grandis]
Length=515

 Score =   250 bits (638),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 149/344 (43%), Positives = 199/344 (58%), Gaps = 33/344 (10%)
 Frame = -3

Query  979  MEFGMVRGEFTHP------------REVQAVADCVELMGLSINDV-RDAIKDLQGSKTRN  839
            M+  + R +  H             RE    ADC++L   +I  + R  + D       +
Sbjct  66   MQLALERAQMAHSNTHSLGSKCSNEREKAVWADCLQLYEHTILRLNRTIVHDCT-----H  120

Query  838  SDAQTSLSAVLTNHLTCMEGLNPPEKSPVKGILDALISRSRVALAVLAEIIGQTD--EEQ  665
             +AQT LS  LTN  TC  G     +  V G +  L+S +      ++++I  T      
Sbjct  121  DEAQTWLSTALTNLETCRAGF---VELGVSGNVLPLMSNN------VSKLISNTLALNYA  171

Query  664  NFRVP-FNGKFPSWVKSSDRKLVRRKHGNLKADIIVSQDGKGNFTTLKKAMESVSAVS-K  491
             +  P +  KFP+WV+  DRKL++      KA+IIV+QDG GN+ T+ +A+ + S  S  
Sbjct  172  PYTTPNYTKKFPTWVRPGDRKLLQSSSAVSKANIIVAQDGSGNYKTISEAITAASKRSGT  231

Query  490  ARVFIYVKKGTYKENVEMNVK-SPVMIYGDGMTQTVFSGDHSFGDNYTTFKSYTLASKGP  314
            AR  IY+K GTY ENVE+  K   +M  GDG+ +T+ +G  S G   TTF S T+A  G 
Sbjct  232  ARYIIYIKAGTYSENVEVGSKLENIMFVGDGIGKTIITGSKSVGGGSTTFNSATVAVVGD  291

Query  313  AAILQDLCVRNTAGAAKHQAVALLVGGDKSIINRCRLEGYQDTLYAHSKRQFYRDCTITG  134
              I QD+  RNTAGAA HQAVAL  G D S+  RC  EGYQDTLY HS+RQFYR+C I G
Sbjct  292  GFIAQDITFRNTAGAANHQAVALRSGSDLSVFYRCGFEGYQDTLYVHSERQFYRECDIYG  351

Query  133  TIDFVFGDAAVVLQNCTLIAKKPLAAQKNMVTAQGRSDPNQNTG  2
            T+DF+FG+AAVVLQNC + A+ P   + N VTAQGR+DPNQNTG
Sbjct  352  TVDFIFGNAAVVLQNCNIYARNP-PNKVNTVTAQGRTDPNQNTG  394



>gb|AFW03477.1| pectin methylesterase 3 [Gossypium barbadense]
Length=514

 Score =   250 bits (638),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 138/336 (41%), Positives = 198/336 (59%), Gaps = 16/336 (5%)
 Frame = -3

Query  976  EFGMVRGEFTHPREVQAVADCVELMGLSINDVRDAIKDLQGSKTRN-------SDAQTSL  818
            +FG   G+F   R   A++DC++L+  S + +  ++   Q    ++       SD +T L
Sbjct  61   QFGSFFGDF---RLSNAISDCLDLLDFSADQLSWSLSASQNPNGKHNSTGDVASDLRTWL  117

Query  817  SAVLTNHLTCMEGL---NPPEKSPVKGILDALISRSRVALAVLAEIIGQTDEEQNFRVPF  647
            SA + N  TC+EG    N   K+ V G L+ + S     L ++      +    + +V  
Sbjct  118  SAAMANQETCIEGFEGTNGIAKTVVAGGLNQVTSLVSDLLTMVQPPGSDSRSNGDRKVAE  177

Query  646  NGKFPSWVKSSDRKLVRRKHGNLKADIIVSQDGKGNFTTLKKAMESVSAVSKARVFIYVK  467
              +FPSW +  D+KL++     + AD +V+ DG G FT +  A+ +    S  R  IY+K
Sbjct  178  KNRFPSWFEREDQKLLQAN--GVTADAVVALDGTGTFTNIMDAVAAAPDYSMNRHVIYIK  235

Query  466  KGTYKENVEMNVKS-PVMIYGDGMTQTVFSGDHSFGDNYTTFKSYTLASKGPAAILQDLC  290
            KG YKENVE+  K   +M+ GDG+  T+ SG+ SF D +TTF+S T A  G   I +D+ 
Sbjct  236  KGLYKENVEIKKKKWNLMMVGDGINGTIISGNRSFVDGWTTFRSATFAVSGRGFIARDIT  295

Query  289  VRNTAGAAKHQAVALLVGGDKSIINRCRLEGYQDTLYAHSKRQFYRDCTITGTIDFVFGD  110
              NTAG  KHQAVAL    D S+  RC ++GYQD+LY H+ RQF+R+C ITGT+DF+FGD
Sbjct  296  FENTAGPQKHQAVALRSDSDLSVFFRCAIKGYQDSLYTHTMRQFFRECKITGTVDFIFGD  355

Query  109  AAVVLQNCTLIAKKPLAAQKNMVTAQGRSDPNQNTG  2
            A+VV QNC ++AK+ L  QKN +TAQGR DPNQ TG
Sbjct  356  ASVVFQNCQILAKQGLPNQKNTITAQGRKDPNQPTG  391



>ref|XP_002301486.2| hypothetical protein POPTR_0002s20370g [Populus trichocarpa]
 gb|EEE80759.2| hypothetical protein POPTR_0002s20370g [Populus trichocarpa]
Length=558

 Score =   251 bits (641),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 151/385 (39%), Positives = 219/385 (57%), Gaps = 19/385 (5%)
 Frame = -3

Query  1111  CRTAIDPAACKTILKQTVKSYGGTPAGLLREFLADYL----PSMEAAKMEFGMVRGEFT-  947
             C+  + P  C +    T+ S     +  L+EF++  L      + A+  +   +R +   
Sbjct  56    CKGTLYPELCVS----TLVSLPDLASKSLQEFISATLNKTMDEVRASSADCNAIRNKMKL  111

Query  946   HPREVQAVADCVELMGLSINDVRDAIKDL---QGSKTRNSDAQTSLSAVLTNHLTCMEGL  776
              P E  A+ DC+EL   +I +++ AI +L   + +     D QT LS  +TN  TC++G 
Sbjct  112   GPLEKVALKDCIELFDDTIAELKSAISNLALRKPTSKHYHDLQTLLSGAMTNQYTCLDGF  171

Query  775   NPPEKSPVKGILDALISRSRV---ALAVLAEIIG-QTDEEQNFRVPFNGK--FPSWVKSS  614
                +    K I   L + S     +LA+L +I G    + + F    N K  FPSW+ + 
Sbjct  172   ARSKGKVRKAIKKGLYNISHHVSNSLAMLKKIPGVNASKSEVFPEYGNVKHGFPSWLSTK  231

Query  613   DRKLVRRKHGNLKADIIVSQDGKGNFTTLKKAMESVSAVSKARVFIYVKKGTYKENVEMN  434
             DRKL++      K D+IV++DG GNFTT+ +A+ +    S  R  I++K G Y ENVE+ 
Sbjct  232   DRKLLQASANATKFDLIVAKDGTGNFTTISEAVRAAPNSSDTRFVIHIKAGAYFENVEVE  291

Query  433   VKSPVMIY-GDGMTQTVFSGDHSFGDNYTTFKSYTLASKGPAAILQDLCVRNTAGAAKHQ  257
              K  ++++ GDG+ +TV   + S  D +TTF+S T+A  G   I + +   N+AG +KHQ
Sbjct  292   RKKKMLVFIGDGIGKTVVKANRSVVDGWTTFRSATVAVVGDGFIAKGITFENSAGPSKHQ  351

Query  256   AVALLVGGDKSIINRCRLEGYQDTLYAHSKRQFYRDCTITGTIDFVFGDAAVVLQNCTLI  77
             AVAL  G D S   +C   GYQDTLY H+ RQFYR+C I GTIDF+FG+AAVV QN  L 
Sbjct  352   AVALRSGSDLSAFYQCSFVGYQDTLYVHTLRQFYRECDIYGTIDFIFGNAAVVFQNSNLY  411

Query  76    AKKPLAAQKNMVTAQGRSDPNQNTG  2
             A+KP + QKN+ TAQGR DPNQNTG
Sbjct  412   ARKPNSNQKNIFTAQGREDPNQNTG  436



>emb|CDY05911.1| BnaC08g20880D [Brassica napus]
Length=500

 Score =   249 bits (637),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 144/334 (43%), Positives = 193/334 (58%), Gaps = 20/334 (6%)
 Frame = -3

Query  943  PREVQAVADCVELMGLSINDVRDAIKDL---QGSKTRNSDAQTSLSAVLTNHLTCMEGLN  773
            PR   A   CVEL+  S++ +  A+  +    G +T+  D  T LS+ LTNH TC EG +
Sbjct  44   PRVRSAYESCVELLDDSVDALSRALSSVVSVSGGQTKPQDVMTWLSSALTNHDTCTEGFD  103

Query  772  PPEKSPVKG-ILDALISRSRVALAVLAEIIGQTDEEQNFRVPFNG--------------K  638
                  VK  + DAL + S +    LA      D +    VP                 K
Sbjct  104  GVGDGGVKDQMTDALKNLSELVSNCLAIFAASGDGDDFAGVPIQNRRLLEVGGGGDKDKK  163

Query  637  FPSWVKSSDRKLVRRKHGNLKADIIVSQDGKGNFTTLKKAMESVSAVSKARVFIYVKKGT  458
            FP W K  +R+L+      ++ADIIVS+DG G   T+ +A++     S  R  IYVK G 
Sbjct  164  FPRWTKRRERELLEMPVSQIQADIIVSKDGNGTCKTIAEAIKKAPQRSTRRTIIYVKAGR  223

Query  457  YKE-NVEMNVKS-PVMIYGDGMTQTVFSGDHSFGDNYTTFKSYTLASKGPAAILQDLCVR  284
            Y+E N+++  K   +M  GDG  +TV SG  S  DN TTF + + A+ G   I +D+  +
Sbjct  224  YEEKNLKVGRKKINLMFVGDGKGKTVISGGKSIFDNITTFHTASFAATGAGFIARDITFQ  283

Query  283  NTAGAAKHQAVALLVGGDKSIINRCRLEGYQDTLYAHSKRQFYRDCTITGTIDFVFGDAA  104
            N AG  KHQAVAL VG D ++I RC + GYQDTLY HS RQF+R+C I GT+DF+FG+AA
Sbjct  284  NWAGPEKHQAVALRVGADHAVIYRCSIIGYQDTLYVHSNRQFFRECDIYGTVDFIFGNAA  343

Query  103  VVLQNCTLIAKKPLAAQKNMVTAQGRSDPNQNTG  2
            VVLQNC++ A+KP+A QKN +TAQ R DPNQNTG
Sbjct  344  VVLQNCSIYARKPMALQKNTITAQNRKDPNQNTG  377



>ref|XP_008653464.1| PREDICTED: pectinesterase-like [Zea mays]
 tpg|DAA64103.1| TPA: hypothetical protein ZEAMMB73_876271 [Zea mays]
Length=605

 Score =   252 bits (644),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 145/338 (43%), Positives = 197/338 (58%), Gaps = 25/338 (7%)
 Frame = -3

Query  940  REVQAVADCVELMGLSINDVRDAIKDLQGSKTRNSDA----------QTSLSAVLTNHLT  791
            R+  A+ADCVEL+G ++  +  A  +L       ++A          QT LSA LTN  T
Sbjct  146  RDRLALADCVELLGHTLAQLGTAEAELSAGNFTAAEAEVESESLAAVQTVLSAALTNQYT  205

Query  790  CMEGLNPPEKSP-------VKGIL---DALISRSRVALAVLAEIIGQTDEEQNFRVPFNG  641
            C++G   P  S        ++G +     L+S S   L  L +   +        +   G
Sbjct  206  CLDGFAGPSASEDGRVRPYIQGRMYHVAHLVSNSLAMLRRLPQRRRRRQGRGALELEGYG  265

Query  640  K----FPSWVKSSDRKLVRRKHGNLKADIIVSQDGKGNFTTLKKAMESVSAVSKARVFIY  473
            +    FPSWV  +DR+ ++++      D++V++DG GNFTT+ +A+ +    S+ R  IY
Sbjct  266  RVRRGFPSWVSGADRRRLQQQQVVPGPDLVVAKDGSGNFTTVGEAVAAAPNNSETRFVIY  325

Query  472  VKKGTYKENVEM-NVKSPVMIYGDGMTQTVFSGDHSFGDNYTTFKSYTLASKGPAAILQD  296
            +K G Y ENVE+ + K+ +M  GDGM +TV     +  DN TTF+S TLA  G   + +D
Sbjct  326  IKAGGYFENVEVGSEKTNLMFVGDGMWRTVIKASRNVVDNSTTFRSATLAVVGTGFLARD  385

Query  295  LCVRNTAGAAKHQAVALLVGGDKSIINRCRLEGYQDTLYAHSKRQFYRDCTITGTIDFVF  116
            L V N AG +KHQAVAL V  D S   RC   GYQDTLYAHS RQFYRDC + GT+DFVF
Sbjct  386  LTVENAAGPSKHQAVALRVNADLSAFYRCAFAGYQDTLYAHSLRQFYRDCDVYGTVDFVF  445

Query  115  GDAAVVLQNCTLIAKKPLAAQKNMVTAQGRSDPNQNTG  2
            GDAA VLQ C+L A++P   QKN+VTAQGR DPNQ+TG
Sbjct  446  GDAAAVLQGCSLYARRPSPGQKNVVTAQGREDPNQSTG  483



>gb|KEH29125.1| pectinesterase/pectinesterase inhibitor [Medicago truncatula]
Length=509

 Score =   249 bits (637),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 137/314 (44%), Positives = 188/314 (60%), Gaps = 13/314 (4%)
 Frame = -3

Query  943  PREVQAVADCVELMGLSINDVRDAIKDLQGSKTRNSDAQTSLSAVLTNHLTCMEGLNPPE  764
            P+E  A ADC+EL   ++      +   + +K    ++QT LS  LTN  TC  G     
Sbjct  90   PQEKAAWADCLELYDFTVQK----LSQTKYTKCTQYESQTWLSTALTNLETCKNGF---Y  142

Query  763  KSPVKGILDALISRSRVALAVLAEIIGQTDEEQNFRVPFNGKFPSWVKSSDRKLVRRKHG  584
               V   +  L+S +   L      + +   +Q     +   FP+WVK  DRKL++    
Sbjct  143  DLGVTNYVLPLLSNNVTKLLSNTLSLNKVPYQQ---PSYKDGFPTWVKPGDRKLLQTSSA  199

Query  583  NLKADIIVSQDGKGNFTTLKKAMESVSAVSKARVFIYVKKGTYKENVEMNVKSPVMIYGD  404
              KA+++V++DG G +TT+K A ++  + S  R  IYVK G Y E VE+  K+ VM+ GD
Sbjct  200  ASKANVVVAKDGSGKYTTVKAATDAAPSGS-GRYVIYVKAGVYNEQVEIKAKN-VMLVGD  257

Query  403  GMTQTVFSGDHSFGDNYTTFKSYTLASKGPAAILQDLCVRNTAGAAKHQAVALLVGGDKS  224
            G+ +T+ +G  S G   TTF+S T+A+ G   I QD+  RNTAGAA HQAVA   G D S
Sbjct  258  GIGKTIITGSKSVGGGTTTFRSATVAATGDGFIAQDITFRNTAGAANHQAVAFRSGSDLS  317

Query  223  IINRCRLEGYQDTLYAHSKRQFYRDCTITGTIDFVFGDAAVVLQNCTLIAKKPLAAQKNM  44
            +  +C  EGYQDTLY HS+RQFYR+C I GT+DF+FG+AAVVLQNC + A+ P  A+   
Sbjct  318  VFYKCSFEGYQDTLYVHSERQFYRECNIYGTVDFIFGNAAVVLQNCNIFARNP-PAKTIT  376

Query  43   VTAQGRSDPNQNTG  2
            VTAQGR+DPNQNTG
Sbjct  377  VTAQGRTDPNQNTG  390



>gb|AFW03484.1| pectin methylesterase 5 [Gossypium hirsutum]
Length=519

 Score =   250 bits (638),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 151/377 (40%), Positives = 207/377 (55%), Gaps = 18/377 (5%)
 Frame = -3

Query  1114  LCRTAIDPAACKTILKQTVKSYGGTPAGLLREF--LADYLPSMEAAKMEFGM--VRGEFT  947
              CR   +P  C+  L    K+   TP     +F  ++ +L    AA+ E     +  +  
Sbjct  34    WCRKTPNPQPCEYFLSHDPKN---TPIKDESQFFKISMHLALERAARAESNTHSLGPKCR  90

Query  946   HPREVQAVADCVELMGLSINDVRDAIKDLQGSKTRNSDAQTSLSAVLTNHLTCMEGLNPP  767
             + RE+ A +DCV L  L+I  +   +    G+     DAQT LS  LTN  TC  G    
Sbjct  91    NGREMAAWSDCVNLYELTILRLNKTVD--SGTNLNKDDAQTWLSTALTNLETCQTGFME-  147

Query  766   EKSPVKGILDALISRSRVALAVLAEIIGQTDEEQNFRVPFNGKFPSWVKSSDRKLVRRKH  587
                   G+ D L+      ++ L       ++       +   FP+WVK  DRKL++   
Sbjct  148   -----LGVPDYLLPMMSNNVSQLISNTLALNKAPYQEPTYKDGFPTWVKPGDRKLLQSSS  202

Query  586   GNLKADIIVSQDGKGNFTTLKKAMESVSAVS-KARVFIYVKKGTYKENVEMNVK-SPVMI  413
                 A+I+V+QDG GN+ T+K A+ + S  S   R  IYVK GTYKENVE+  K   +M+
Sbjct  203   PASTANIVVAQDGSGNYKTIKDAISAASKRSGSGRYVIYVKAGTYKENVEIGSKLKNIMM  262

Query  412   YGDGMTQTVFSGDHSFGDNYTTFKSYTLASKGPAAILQDLCVRNTAGAAKHQAVALLVGG  233
              GDG+ +T+ +G  S G   TTF S T+A  G   I + +  RNTAG   HQAVAL  G 
Sbjct  263   VGDGIGKTIITGSKSVGGGSTTFNSATVAVVGDGFIARGITFRNTAGPTNHQAVALRSGS  322

Query  232   DKSIINRCRLEGYQDTLYAHSKRQFYRDCTITGTIDFVFGDAAVVLQNCTLIAKKPLAAQ  53
             D S+  +C  EGYQDTLY HS+RQFYR+C I GT+D++FG+AAVV QNC + A+ P   +
Sbjct  323   DLSVFYKCSFEGYQDTLYVHSERQFYRECDIYGTVDWIFGNAAVVFQNCNIYARNP-PNK  381

Query  52    KNMVTAQGRSDPNQNTG  2
              N VTAQGR+DPNQNTG
Sbjct  382   TNTVTAQGRTDPNQNTG  398



>gb|AER38246.1| PME3 [Gossypium barbadense]
Length=514

 Score =   250 bits (638),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 138/336 (41%), Positives = 198/336 (59%), Gaps = 16/336 (5%)
 Frame = -3

Query  976  EFGMVRGEFTHPREVQAVADCVELMGLSINDVRDAIKDLQGSKTRN-------SDAQTSL  818
            +FG   G+F   R   A++DC++L+  S + +  ++   Q    ++       SD +T L
Sbjct  61   QFGSFFGDF---RLSNAISDCLDLLDFSADQLSWSLSASQNPNGKHNSTGDVASDLRTWL  117

Query  817  SAVLTNHLTCMEGL---NPPEKSPVKGILDALISRSRVALAVLAEIIGQTDEEQNFRVPF  647
            SA + N  TC+EG    N   K+ V G L+ + S     L ++      +    + +V  
Sbjct  118  SAAMANQETCIEGFEGTNGIAKTVVAGGLNQVTSLVSDLLTMVQPPGSDSRSNGDRKVAE  177

Query  646  NGKFPSWVKSSDRKLVRRKHGNLKADIIVSQDGKGNFTTLKKAMESVSAVSKARVFIYVK  467
              +FPSW +  D+KL++     + AD +V+ DG G FT +  A+ +    S  R  IY+K
Sbjct  178  KNRFPSWFEREDQKLLQAN--GVTADAVVALDGTGTFTNIMDAVAAAPDYSMNRHVIYIK  235

Query  466  KGTYKENVEMNVKS-PVMIYGDGMTQTVFSGDHSFGDNYTTFKSYTLASKGPAAILQDLC  290
            KG YKENVE+  K   +M+ GDG+  T+ SG+ SF D +TTF+S T A  G   I +D+ 
Sbjct  236  KGLYKENVEIKKKKWNLMMVGDGINGTIISGNRSFVDGWTTFRSATFAVSGRGFIARDIT  295

Query  289  VRNTAGAAKHQAVALLVGGDKSIINRCRLEGYQDTLYAHSKRQFYRDCTITGTIDFVFGD  110
              NTAG  KHQAVAL    D S+  RC ++GYQD+LY H+ RQF+R+C ITGT+DF+FGD
Sbjct  296  FENTAGPQKHQAVALRSDSDLSVFFRCAIKGYQDSLYTHTMRQFFRECRITGTVDFIFGD  355

Query  109  AAVVLQNCTLIAKKPLAAQKNMVTAQGRSDPNQNTG  2
            A+VV QNC ++AK+ L  QKN +TAQGR DPNQ TG
Sbjct  356  ASVVFQNCQILAKQGLPNQKNTITAQGRKDPNQPTG  391



>ref|XP_004958677.1| PREDICTED: pectinesterase 3-like [Setaria italica]
Length=598

 Score =   252 bits (643),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 145/330 (44%), Positives = 197/330 (60%), Gaps = 19/330 (6%)
 Frame = -3

Query  940  REVQAVADCVELMGLSINDVRDAIKDLQ-GSKTRN---SDAQTSLSAVLTNHLTCMEGLN  773
            R+  A++DC+EL G ++  +  A  +L  G++T     +  QT LSA LTN  TC+EG  
Sbjct  149  RDRLALSDCLELFGRTLGQLGTAADELSAGNRTAEESIAGVQTVLSAALTNQYTCLEGFA  208

Query  772  PPEKSP-------VKGILDALISRSRVALAVLAEIIGQTDEEQNFRVPFNGK----FPSW  626
             P  S        ++G +  +      +LA+L  +  +        +   G+    FPSW
Sbjct  209  GPSASEDGRVRPYIQGRIYHVAHLVSNSLAMLRRLPQRRRRRGREALEGYGRVRRGFPSW  268

Query  625  VKSSDRK-LVRRKHGNLKADIIVSQDGKGNFTTLKKAMESVSAVSKARVFIYVKKGTYKE  449
            V + DR+ L+    G   AD++V++DG GNFTT+ +A+ +    S++R  IY+K G Y E
Sbjct  269  VSAGDRRRLLEPSAG--AADLVVAKDGSGNFTTVGEAVAAAPNNSESRFVIYIKAGGYFE  326

Query  448  NVEMNV-KSPVMIYGDGMTQTVFSGDHSFGDNYTTFKSYTLASKGPAAILQDLCVRNTAG  272
            NVE+   K+ +M  GDGM +TV     +  DN TT++S TLA  G   + +DL V N AG
Sbjct  327  NVEVGPEKTNLMFVGDGMWKTVIKASRNVVDNSTTYRSATLAVVGTGFLARDLTVENAAG  386

Query  271  AAKHQAVALLVGGDKSIINRCRLEGYQDTLYAHSKRQFYRDCTITGTIDFVFGDAAVVLQ  92
             +KHQAVAL V  D S   RC   GYQDTLYAHS RQFYRDC + GT+DFVFGDAA VLQ
Sbjct  387  PSKHQAVALRVNADLSAFYRCSFAGYQDTLYAHSLRQFYRDCDVYGTVDFVFGDAAAVLQ  446

Query  91   NCTLIAKKPLAAQKNMVTAQGRSDPNQNTG  2
             C+L A++P   QKN+ TAQGR DPNQNTG
Sbjct  447  GCSLYARRPDPRQKNVFTAQGREDPNQNTG  476



>gb|KGN44975.1| Pectinesterase [Cucumis sativus]
Length=614

 Score =   252 bits (644),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 139/328 (42%), Positives = 196/328 (60%), Gaps = 13/328 (4%)
 Frame = -3

Query  946  HPREVQAVADCVELMGLSINDVRDAIKDLQGSKT---RNSDAQTSLSAVLTNHLTCMEGL  776
            +P +  A+ DC+EL+  SI +++ +I DL  S++    + D  T +SA +TNH TC++G 
Sbjct  163  NPTDRHALDDCLELLDGSIAELKASIFDLAPSQSPALHSHDLLTLVSAAMTNHRTCVDGF  222

Query  775  NPPE---KSPVKGILDALISRSRVALAVLAEIIG---QTDEEQNFRVPFN---GKFPSWV  623
                   +S V+  L  +     + LA+L +I G    T  +Q     +    G FP WV
Sbjct  223  YNSSGTVRSRVELYLGKIGQHLSIDLAMLKKIPGVNRATGVDQEMLPEYGAVKGGFPKWV  282

Query  622  KSSDRKLVRRKHGNLKADIIVSQDGKGNFTTLKKAMESVSAVSKARVFIYVKKGTYKENV  443
               DR+L++      K +++V++DG GNFTT+ +A+ +    S  R  IY+K G Y ENV
Sbjct  283  SVKDRRLLQAAVNETKFNMVVAKDGSGNFTTVSEAVAAAPNASTTRFVIYIKAGAYFENV  342

Query  442  EMN-VKSPVMIYGDGMTQTVFSGDHSFGDNYTTFKSYTLASKGPAAILQDLCVRNTAGAA  266
            E+   KS +M  GDG+ +T+   D +  D +TTF+S T+A  G   I + +   N AG +
Sbjct  343  EIGRAKSNLMFVGDGIGKTLIKADRNVVDGWTTFRSATVAVVGTGFIAKGITFENYAGPS  402

Query  265  KHQAVALLVGGDKSIINRCRLEGYQDTLYAHSKRQFYRDCTITGTIDFVFGDAAVVLQNC  86
            KHQAVAL    D S   +C   GYQDTLY HS RQFYRDC + GTIDF+FG+AAVV QNC
Sbjct  403  KHQAVALRSNSDFSAFYQCSFIGYQDTLYVHSLRQFYRDCDVYGTIDFIFGNAAVVFQNC  462

Query  85   TLIAKKPLAAQKNMVTAQGRSDPNQNTG  2
             L A+KP + Q+N+ TAQGR DPNQNTG
Sbjct  463  NLYARKPNSNQRNIFTAQGREDPNQNTG  490



>ref|XP_010269596.1| PREDICTED: pectinesterase-like [Nelumbo nucifera]
Length=561

 Score =   251 bits (640),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 137/324 (42%), Positives = 196/324 (60%), Gaps = 11/324 (3%)
 Frame = -3

Query  943  PREVQAVADCVELMGLSINDVRDAIKDL--QGSKTRN-SDAQTSLSAVLTNHLTCMEGLN  773
            P +  A+ DC+EL+  ++ +++ A+ DL  + S +R+ +D  T LSA +TN  TC++G  
Sbjct  115  PLQQMALDDCLELLDETVAELKSALSDLSPKNSPSRHYNDLGTLLSAAMTNEYTCLDGFV  174

Query  772  PPEKSPVKGILDALISRSRV---ALAVLAEIIGQTDEEQNFRVPFNGK----FPSWVKSS  614
              + +  + I   L + S     +LA+L +I       +    P  G+    FP WV   
Sbjct  175  HSKGNVREEIKQGLYNISHSVSNSLAMLKKIPKSNRSSKAEVFPEYGRMVGGFPRWVSPR  234

Query  613  DRKLVRRKHGNLKADIIVSQDGKGNFTTLKKAMESVSAVSKARVFIYVKKGTYKENVEMN  434
            DRKL++      K D++V++DG GNFTT+  A+ +    +  R  IY+K G Y ENV+++
Sbjct  235  DRKLLQASTNTTKFDLVVAKDGSGNFTTISDAVAAAPNSTTTRFVIYIKAGAYFENVDVD  294

Query  433  VKSPVMIY-GDGMTQTVFSGDHSFGDNYTTFKSYTLASKGPAAILQDLCVRNTAGAAKHQ  257
             K  ++++ GDG+ +TV   + S  D +TTF+S T+A  G   I +D+   N+AG  KHQ
Sbjct  295  KKKTMLMFVGDGIGKTVVKANRSVVDGWTTFRSATVAVVGNGFIARDMTFENSAGPNKHQ  354

Query  256  AVALLVGGDKSIINRCRLEGYQDTLYAHSKRQFYRDCTITGTIDFVFGDAAVVLQNCTLI  77
            AVAL  G D S   RC   GYQDTLY HS RQFYRDC I GT+DF+FG+AAVV QNC L 
Sbjct  355  AVALRSGSDLSAFYRCSFVGYQDTLYVHSLRQFYRDCDIYGTVDFIFGNAAVVFQNCNLY  414

Query  76   AKKPLAAQKNMVTAQGRSDPNQNT  5
            A++P   QKN+ TAQGR DPNQNT
Sbjct  415  ARRPNDNQKNIFTAQGRQDPNQNT  438



>ref|XP_010056338.1| PREDICTED: pectinesterase 2-like [Eucalyptus grandis]
Length=515

 Score =   249 bits (637),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 144/343 (42%), Positives = 197/343 (57%), Gaps = 31/343 (9%)
 Frame = -3

Query  979  MEFGMVRGEFTH------------PREVQAVADCVELMGLSINDVRDAIKDLQGSKTRNS  836
            M+  + R +  H             RE  A ADC++L   ++  +   I    G +    
Sbjct  66   MQLALERAQLAHDHTHSLESKCSNEREKAAWADCLQLYEHTVLRLNRTI----GHECTQD  121

Query  835  DAQTSLSAVLTNHLTCMEGLNPPEKSPVKGILDALISRSRVALAVLAEIIGQTD--EEQN  662
            +AQT LS  LTN  TC  G          GI D ++    +    ++++I  T       
Sbjct  122  EAQTWLSTALTNLETCRAGFVE------LGISDNVLP---LMSNNVSKLISNTLALNYAP  172

Query  661  FRVP-FNGKFPSWVKSSDRKLVRRKHGNLKADIIVSQDGKGNFTTLKKAMESVS-AVSKA  488
            F  P +  KFP+WV+ SDRKL++      KA+I+V++DG GN+ T+ +A+ + S     A
Sbjct  173  FTTPNYTKKFPTWVRPSDRKLLQSSSAVSKANIVVARDGSGNYKTISEAITAASKQTGAA  232

Query  487  RVFIYVKKGTYKENVEMNVK-SPVMIYGDGMTQTVFSGDHSFGDNYTTFKSYTLASKGPA  311
            R  IY+K GTY EN+E+  K   +M  GDG+ +T+ +G  S G   TTFKS T+A  G  
Sbjct  233  RYIIYIKAGTYNENIEVGSKLDNIMFVGDGIGKTIITGSKSVGGGSTTFKSATVAVVGDG  292

Query  310  AILQDLCVRNTAGAAKHQAVALLVGGDKSIINRCRLEGYQDTLYAHSKRQFYRDCTITGT  131
             + QD+  RNTAGAA HQAVAL  G D S+  RC  EGYQDTLY HS+RQFYR+C I GT
Sbjct  293  FVAQDITFRNTAGAANHQAVALRSGSDLSVFYRCSFEGYQDTLYVHSERQFYRECDIYGT  352

Query  130  IDFVFGDAAVVLQNCTLIAKKPLAAQKNMVTAQGRSDPNQNTG  2
            +DF+FG+AAVV QNC + A+ P   + N +TAQGR+DPNQNTG
Sbjct  353  VDFIFGNAAVVFQNCNIYARNP-PNKVNTLTAQGRTDPNQNTG  394



>ref|XP_011029953.1| PREDICTED: pectinesterase 2-like [Populus euphratica]
Length=519

 Score =   249 bits (637),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 148/376 (39%), Positives = 214/376 (57%), Gaps = 17/376 (5%)
 Frame = -3

Query  1111  CRTAIDPAACKTILKQTVKSYGGTPAGLLREFLADYLPSMEAAKMEFGMVRG---EFTHP  941
             C    +P  CK  +KQ  K +        R+   +   SM+ A       +G   +  + 
Sbjct  34    CNKTPNPEPCKYFMKQNPKHFVPQQKSDFRKLAIEL--SMQRAHTALIHNKGLGSKCRND  91

Query  940   REVQAVADCVELMGLSINDVRDAIKDLQGSKTRNSDAQTSLSAVLTNHLTCMEGLNPPEK  761
             +E  A ADC+ L   +I ++   +     +K    DAQT LS  LTN  TC  G    + 
Sbjct  92    KERAAWADCLRLYEDTIVELNHTLD--SHTKCTEFDAQTWLSTALTNLETCKAGF---KD  146

Query  760   SPVKGILDALISRSRVALAVLAEIIGQTDEEQNFRVPFNGKFPSWVKSSDRKLVRRKHGN  581
               V   +  L+S + V+  +   +  + +   N    +N  FPSWVK  DRKL++     
Sbjct  147   FGVSDFMLPLMSNN-VSKLICNSLALKDNASSNPPQTYNDGFPSWVKPGDRKLLQASSST  205

Query  580   LKADIIVSQDGKGNFTTLKKAMESVSAVS-KARVFIYVKKGTYKENVEM--NVKSPVMIY  410
               ++++V+QDG GN  T+K A+++ +  S   R  I +K G Y+EN+++  N+K+ +M+ 
Sbjct  206   --SNLVVAQDGSGNHRTIKAALDAAAKRSGSGRFVIRIKSGVYRENLDIGKNLKN-IMLV  262

Query  409   GDGMTQTVFSGDHSFGDNYTTFKSYTLASKGPAAILQDLCVRNTAGAAKHQAVALLVGGD  230
             GDG+  T+ +G  S G   TTFKS T+A  G   I + +  RNTAG   HQAVAL  G D
Sbjct  263   GDGLKNTIITGSRSVGGGSTTFKSATVAVTGGGFIARGITFRNTAGPQNHQAVALRSGAD  322

Query  229   KSIINRCRLEGYQDTLYAHSKRQFYRDCTITGTIDFVFGDAAVVLQNCTLIAKKPLAAQK  50
              S+  RC  EGYQDTLY HS+RQFY++C I GT+DF+FG+AAVVLQNC + A++P+  QK
Sbjct  323   LSVFYRCGFEGYQDTLYVHSQRQFYKECDIYGTVDFIFGNAAVVLQNCMIYARRPMDKQK  382

Query  49    NMVTAQGRSDPNQNTG  2
             N+VTAQGR+DPNQNTG
Sbjct  383   NVVTAQGRTDPNQNTG  398



>gb|AFK41384.1| unknown [Lotus japonicus]
Length=381

 Score =   246 bits (627),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 132/326 (40%), Positives = 195/326 (60%), Gaps = 8/326 (2%)
 Frame = -3

Query  1111  CRTAIDPAAC----KTILKQTVKSYGGTPA-GLLREFLADYLPSMEAAKMEFGMVRGEFT  947
             C  A+D ++C      + +  + +    P   +L   +      ++ A ++   ++    
Sbjct  55    CEHALDASSCLAHVSEVSQSPISATTKDPKLNILISLMTKSTSHIQEAMVKTKAIKNRIN  114

Query  946   HPREVQAVADCVELMGLSINDVRDAIKDLQGSKT-RNSDAQTSLSAVLTNHLTCMEGLNP  770
             +P+E  A++DC +LM LSI+ V D++  L    T  + DA   LS VLTNH TC++GL  
Sbjct  115   NPKEEAALSDCEQLMDLSIDRVWDSVMALTKDTTDSHQDAHAWLSGVLTNHATCLDGLEG  174

Query  769   PEKSPVKGILDALISRSRVALAVLAEIIGQTD-EEQNFRVPFNGKFPSWVKSSDRKLVRR  593
             P +S +   ++ LISRSR +LA+L  ++      EQ    P NG FPSWV   DR+L+  
Sbjct  175   PSRSLMGVEIEDLISRSRTSLALLVSVLAPNGGHEQFIDEPLNGDFPSWVTRKDRRLLES  234

Query  592   KHGNLKADIIVSQDGKGNFTTLKKAMESVSAVSKARVFIYVKKGTYKENVEM-NVKSPVM  416
               G++ A+++V++DG G F T+ +A+ S     K R  IYVKKGTYKEN+E+   K+ VM
Sbjct  235   SVGDVNANVVVAKDGSGRFKTVAEAVASAPDSGKTRYVIYVKKGTYKENIEIGKKKTNVM  294

Query  415   IYGDGMTQTVFSGDHSFGDNYTTFKSYTLASKGPAAILQDLCVRNTAGAAKHQAVALLVG  236
             + GDGM  T+ +G+ +  D  TTFKS T+A+ G   I QD+  +NTAG  K QAVAL VG
Sbjct  295   LTGDGMGATIITGNLNVIDGSTTFKSATVAAVGDGFIAQDIWFQNTAGPQKEQAVALRVG  354

Query  235   GDKSIINRCRLEGYQDTLYAHSKRQF  158
              D+SIINRCR++ YQD+LY H+ RQF
Sbjct  355   ADQSIINRCRIDAYQDSLYTHTNRQF  380



>gb|KHN47891.1| Pectinesterase 2 [Glycine soja]
Length=513

 Score =   249 bits (637),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 138/316 (44%), Positives = 189/316 (60%), Gaps = 12/316 (4%)
 Frame = -3

Query  946  HPREVQAVADCVELMGLSINDVRDAIKDLQGSKTRNSDAQTSLSAVLTNHLTCMEGLNPP  767
            +PRE  A ADCVEL   +I  +   +K    +K    DAQT LS  LTN  TC  G    
Sbjct  90   NPRERVAWADCVELYEQTIRKLNQTLKP--NTKLSQVDAQTWLSTALTNLETCKAGF---  144

Query  766  EKSPVKGILDALISRSRVALAVLAEIIGQTDEEQNFRVPFNGKFPSWVKSSDRKLVRRKH  587
             +  V+  +  L+S +   L      + +   ++     +   FP+WVK  DRKL++   
Sbjct  145  YELGVQDYVLPLMSNNVTKLLSNTLALNKVPYQE---PSYKEGFPTWVKPGDRKLLQASS  201

Query  586  GNLKADIIVSQDGKGNFTTLKKAMESVSAVSKARVFIYVKKGTYKENVEMNVKSPVMIYG  407
               +A+++V++DG G FTT+  A+ +    S  R  IYVK G Y E VE+  K+ +M+ G
Sbjct  202  PASRANVVVAKDGSGRFTTVSAAINAAPKSSSGRYVIYVKGGVYDEQVEVKAKN-IMLVG  260

Query  406  DGMTQTVFSGDHSFGDNYTTFKSYTLASKGPAAILQDLCVRNTAGAAKHQAVALLVGGDK  227
            DG+ +T+ +G  S G   TTF+S T+A+ G   I QD+  RNTAGAA HQAVA   G D 
Sbjct  261  DGIGKTIITGSKSVGGGTTTFRSATVAAVGDGFIAQDITFRNTAGAANHQAVAFRSGSDL  320

Query  226  SIINRCRLEGYQDTLYAHSKRQFYRDCTITGTIDFVFGDAAVVLQNCTLIAKKPLAAQKN  47
            S+  RC  EG+QDTLY HS+RQFY+ C I GT+DF+FG+AA VLQNC + A+ P   Q+ 
Sbjct  321  SVFYRCSFEGFQDTLYVHSERQFYKACDIYGTVDFIFGNAAAVLQNCNIYARTP--PQRT  378

Query  46   M-VTAQGRSDPNQNTG  2
            + VTAQGR+DPNQNTG
Sbjct  379  ITVTAQGRTDPNQNTG  394



>emb|CDX86987.1| BnaC03g52570D [Brassica napus]
Length=697

 Score =   254 bits (648),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 142/350 (41%), Positives = 198/350 (57%), Gaps = 26/350 (7%)
 Frame = -3

Query  1003  LPSMEAAKMEFGMVRGEFTHPREVQAVADCVELMGLSINDVRDAIKDLQGSKTRNSDAQT  824
             LPS   AK+            ++ Q +A  + L+  S++ +  A+  + G +T+  D  T
Sbjct  234   LPSTSQAKLR--------NQAKQFQKLATWL-LLDDSVDALSRALSSVSGGQTKPQDVMT  284

Query  823   SLSAVLTNHLTCMEGLNPPEKSPVKGILDALISRSRVALAVLAEIIGQTDEEQNFR-VPF  647
              LS+ LTNH TC EG +      VK  + A +      ++    I   +    +F  VP 
Sbjct  285   WLSSALTNHDTCAEGFDGVNDGGVKDQMTAALKNLSELVSNCLAIFAASSNGNDFSGVPI  344

Query  646   ------------NGKFPSWVKSSDRKLVRRKHGNLKADIIVSQDGKGNFTTLKKAMESVS  503
                         N KFP W K  +R+++  +   ++ADIIVS+DG G   T+ +A++   
Sbjct  345   QNRRLLEVGGDENSKFPRWTKRREREILEMQVSQIQADIIVSKDGNGTCKTISEAIKKAP  404

Query  502   AVSKARVFIYVKKGTYKENVEMNV---KSPVMIYGDGMTQTVFSGDHSFGDNYTTFKSYT  332
               S +R  IYVK G Y+EN  + V   K  +M  GDG  +T+ SG  S  DN TTF + T
Sbjct  405   QYSPSRTIIYVKAGRYEEN-NLKVGRKKINLMFVGDGKGKTIISGGKSIFDNITTFHTAT  463

Query  331   LASKGPAAILQDLCVRNTAGAAKHQAVALLVGGDKSIINRCRLEGYQDTLYAHSKRQFYR  152
              A+ G   I +D+   N AG AKHQAVAL VG D ++I RC + GYQDTLY HS RQF+R
Sbjct  464   FAATGAGFIARDITFENYAGPAKHQAVALRVGADHAVIYRCNIIGYQDTLYVHSNRQFFR  523

Query  151   DCTITGTIDFVFGDAAVVLQNCTLIAKKPLAAQKNMVTAQGRSDPNQNTG  2
             +C I GT+DF+FG+AAVVLQNC++ A+KP+  QKN +TAQ R DPNQNTG
Sbjct  524   ECDIYGTVDFIFGNAAVVLQNCSIYARKPMDLQKNTITAQNRKDPNQNTG  573


 Score =   102 bits (255),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 68/212 (32%), Positives = 102/212 (48%), Gaps = 17/212 (8%)
 Frame = -3

Query  943  PREVQAVADCVELMGLSINDVRDAIKDLQGSKTRNSDAQTSLSAVLTNHLTCMEGLNPPE  764
            PR   A   C+EL+  S++ +  A+  + G +T+  D  T LS+ LTNH TC EG +   
Sbjct  23   PRVRSAYDACIELLDDSVDALSRALSSVSGGQTKPQDVMTWLSSALTNHDTCAEGFDGVN  82

Query  763  KSPVKGILDALISRSRVALAVLAEIIGQTDEEQNFR-VPF------------NGKFPSWV  623
               VK  + A +      ++    I   +    +F  VP             N KFP W 
Sbjct  83   DGGVKDQMTAALKNLSELVSNCLAIFAASSNGNDFDGVPIQNRRLLGVGGDENSKFPRWT  142

Query  622  KSSDRKLVRRKHGNLKADIIVSQDGKGNFTTLKKAMESVSAVSKARVFIYVKKGTYKENV  443
            K  +R+++      ++ADIIVS+DG G   T+ +A++     S  R  IYVK G Y+EN 
Sbjct  143  KRREREILEMPVSQIQADIIVSKDGNGTCKTISEAIKKAPQYSPRRTIIYVKAGRYEEN-  201

Query  442  EMNV---KSPVMIYGDGMTQTVFSGDHSFGDN  356
             + V   K  +M  GDG  +T+ SG  S  +N
Sbjct  202  NLKVGRKKINLMFVGDGKGKTIISGGKSIFEN  233



>ref|XP_010432596.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 44 
[Camelina sativa]
Length=526

 Score =   249 bits (637),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 145/353 (41%), Positives = 199/353 (56%), Gaps = 42/353 (12%)
 Frame = -3

Query  955  EFTHPREVQ-AVADCVELMGLSINDVRDAIKDLQGSKTRN-------SDAQTSLSAVLTN  800
            +F+  R +Q AV+DC++L+  S  ++  +    +  K +        SD +T LSA L+N
Sbjct  58   DFSGDRRLQNAVSDCLDLLDFSSEELSWSASASENPKGKGNGTGNVASDTRTWLSAALSN  117

Query  799  HLTCMEGLNPPE---KSPVKGILDALISRSRVALAVLAEIIGQTDEEQNFRVPFNG----  641
              TC EG +      KS + G LD L S  R  L ++     QTDE+    +   G    
Sbjct  118  QDTCREGFDGTSGLVKSLIAGSLDQLYSMLRELLPLV-----QTDEKHTKPISKPGPIAK  172

Query  640  -------------------KFPSWVKSSDRKLVRRKHGNLKADIIVSQDGKGNFTTLKKA  518
                               +FP WV+S DRKL+  +      D+ V+ DG GNFT +  A
Sbjct  173  GPKAPPGRTLRDTDDDESLQFPDWVRSDDRKLL--ESNGRSYDVSVALDGTGNFTKIMDA  230

Query  517  MESVSAVSKARVFIYVKKGTYKENVEMNVKS-PVMIYGDGMTQTVFSGDHSFGDNYTTFK  341
            +E V   S  R+ IY+KKG Y ENVE+  K   +++ GDG+  T+ SG+ SF D +TTF+
Sbjct  231  IEQVPDYSSTRIVIYIKKGLYLENVEIKKKKWNIVMLGDGIDVTIISGNRSFIDGWTTFR  290

Query  340  SYTLASKGPAAILQDLCVRNTAGAAKHQAVALLVGGDKSIINRCRLEGYQDTLYAHSKRQ  161
            S T A  G   + +D+  +NTAG  KHQAVAL    D S+  RC + GYQDTLY H+ RQ
Sbjct  291  SATFAVSGRGFLARDITFQNTAGPEKHQAVALRSDSDLSVFYRCAMRGYQDTLYTHTMRQ  350

Query  160  FYRDCTITGTIDFVFGDAAVVLQNCTLIAKKPLAAQKNMVTAQGRSDPNQNTG  2
            FYR+CTITGT+DF+FGD  VV QNC ++AK+ L  QKN +TAQGR D NQ +G
Sbjct  351  FYRECTITGTVDFIFGDGTVVFQNCQILAKRGLPNQKNTITAQGRKDMNQPSG  403



>ref|XP_011076334.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 17 
[Sesamum indicum]
Length=475

 Score =   248 bits (633),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 138/317 (44%), Positives = 194/317 (61%), Gaps = 12/317 (4%)
 Frame = -3

Query  940  REVQAVADCVELMGLSINDVRDAIKDLQGSKTRNSDAQTSLSAVLTNHLTCMEGLNPPEK  761
            RE  A ADCV+L   +I  +   I     +K  + DAQT LS  LTN  TC  G     +
Sbjct  46   REKAAWADCVKLYDNAIEQLNKTID--PNTKCTDFDAQTWLSTALTNLETCRTGF---VE  100

Query  760  SPVKGILDALISR--SRVALAVLAEIIGQTDEEQNFRVPFNGKFPSWVKSSDRKLVRRKH  587
              V   +  L+S   S++    LA    +T  E +     +G FP+WV   DR+L+  + 
Sbjct  101  LGVSDFVLPLMSNNVSKLICNTLALGSNKTTHETSGYYKDDG-FPTWVSPGDRRLL--QS  157

Query  586  GNLKADIIVSQDGKGNFTTLKKAMESVSAVS-KARVFIYVKKGTYKENVEMNVK-SPVMI  413
             +++ +++V+QDG GN+ T+K A+++ +  S   R  I+VK+G Y+EN+E+  K   +M+
Sbjct  158  SSVRPNLVVAQDGSGNYRTIKAALDAAAGRSGSGRFVIHVKRGVYRENLEIGSKLRNIML  217

Query  412  YGDGMTQTVFSGDHSFGDNYTTFKSYTLASKGPAAILQDLCVRNTAGAAKHQAVALLVGG  233
             GDGM  T+ +G  S G   TTF S T+A  G   I + +  RNTAG   HQAVAL  G 
Sbjct  218  VGDGMKYTIITGSRSVGGGSTTFNSATVAVTGEGFIARGITFRNTAGPQNHQAVALRSGS  277

Query  232  DKSIINRCRLEGYQDTLYAHSKRQFYRDCTITGTIDFVFGDAAVVLQNCTLIAKKPLAAQ  53
            D S+  RC  EGYQDTLY HS+RQFY++C + GT+DF+FG+AAVVLQNC + A++P+  Q
Sbjct  278  DLSVFYRCGFEGYQDTLYVHSQRQFYKECYVFGTVDFIFGNAAVVLQNCMIYARRPMDKQ  337

Query  52   KNMVTAQGRSDPNQNTG  2
            KN +TAQGR+DPNQNTG
Sbjct  338  KNTITAQGRTDPNQNTG  354



>ref|XP_008460354.1| PREDICTED: pectinesterase 3 [Cucumis melo]
Length=576

 Score =   251 bits (640),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 150/390 (38%), Positives = 221/390 (57%), Gaps = 30/390 (8%)
 Frame = -3

Query  1114  LCRTAIDPAACKTILKQTVKSYGGTPAGLLREFL---ADYLPSMEAAKMEFGMVRGEFTH  944
             LC     P++C++ L+ +  +    P  L +  L    D L  +      F    G+   
Sbjct  80    LCSVTQYPSSCQSSLQNSNTT---DPVFLFKLSLRVATDSLSKLSDYTSNFNSNTGD---  133

Query  943   PREVQAVADCVELMGLSINDVRDAIKDLQG--------SKTRNSDAQTSLSAVLTNHLTC  788
             P+   A+  C  +   +I+ + D I  ++         S +R  D +T LS  +T+  TC
Sbjct  134   PKVKAAIKICQSVFEDAIDTLNDTISSMEVDRHSEKFLSPSRIEDLKTWLSTTITDQETC  193

Query  787   MEGLNPPEKSPVKGILDALISRSRV----ALAVLAEIIGQTDEEQNFRVPFNGKF---PS  629
             ++ L    ++ V   L   ++ S      +LA++ +I+G      +F +P + K    P 
Sbjct  194   LDALRDLNQTTVLQDLQTAMANSTEFTSNSLAIVTKILGLL---ADFNIPIHRKLMGLPE  250

Query  628   WVKSSDRKLVRRKHGNLKADIIVSQDGKGNFTTLKKAMESVSAVSKARVFIYVKKGTYKE  449
             WV S DR+L++    N+ A + VS+DGKG++TT+K A+ +V   SK R  I+VK+G Y+E
Sbjct  251   WVSSGDRRLLQEN--NVTAHVTVSKDGKGDYTTIKDAVAAVPKKSKERFIIHVKEGIYEE  308

Query  448   NVEMN-VKSPVMIYGDGMTQTVFSGDHSFGDNYTTFKSYTLASKGPAAILQDLCVRNTAG  272
             NV ++  K  VM+YGDG T+T+ SG  +F D   TF + T A  G   I +D+   NTAG
Sbjct  309   NVILDKSKWNVMMYGDGRTKTIVSGHLNFIDGTPTFSTATFAVAGKGFIGKDMGFINTAG  368

Query  271   AAKHQAVALLVGGDKSIINRCRLEGYQDTLYAHSKRQFYRDCTITGTIDFVFGDAAVVLQ  92
              AKHQAVA   G D S+++ C  +GYQDTLYAHS RQFYRDC ITGTIDF+FG+AAVV Q
Sbjct  369   PAKHQAVAFRSGSDLSVMSGCSFDGYQDTLYAHSNRQFYRDCDITGTIDFIFGNAAVVFQ  428

Query  91    NCTLIAKKPLAAQKNMVTAQGRSDPNQNTG  2
             NC +  ++PL  Q N +TAQG+ D NQN+G
Sbjct  429   NCNIRPRQPLPNQFNTITAQGKKDINQNSG  458



>ref|XP_008795812.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 22 
[Phoenix dactylifera]
Length=541

 Score =   249 bits (637),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 138/332 (42%), Positives = 192/332 (58%), Gaps = 26/332 (8%)
 Frame = -3

Query  940  REVQAVADCVELMGLSINDVRDAIKDLQGSKTRNS------DAQTSLSAVLTNHLTCMEG  779
            RE  A+ DCVEL+G S++++  ++ ++   ++  S      + +  LSA L N  TC+EG
Sbjct  103  REEMAIHDCVELLGYSVDELGWSLAEMSWIESETSSMNHEENLRAWLSAALGNQDTCLEG  162

Query  778  LNPPE---KSPVKGIL---DALISRSRVALAVLAEIIGQ------TDEEQNFRVPFNGKF  635
                +   K  +KG L     L+S   +    +  II        +D  QN       + 
Sbjct  163  FEGTDGRLKHYIKGSLTEVSQLLSNLLMMHKRMRSIIPHVPIKNISDSSQNL------EL  216

Query  634  PSWVKSSDRKLVRRKHGNLKADIIVSQDGKGNFTTLKKAMESVSAVSKARVFIYVKKGTY  455
            P W++  + +L R     +  D +V+ DG G F ++ +A+    + S  R  IYVKKG Y
Sbjct  217  PPWIEIGE-ELTRADPKTMHVDAVVALDGSGRFRSINEAVNQAPSQSPKRYVIYVKKGEY  275

Query  454  KENVEMNVK-SPVMIYGDGMTQTVFSGDHSFGDNYTTFKSYTLASKGPAAILQDLCVRNT  278
            KENVE+  K + +M+ GDGM QTV +G  +F   +TTF++ T A  G   + +D+  RNT
Sbjct  276  KENVELKKKKTNIMLVGDGMGQTVITGGRNFMQGWTTFRTATFAVSGQGFVARDITFRNT  335

Query  277  AGAAKHQAVALLVGGDKSIINRCRLEGYQDTLYAHSKRQFYRDCTITGTIDFVFGDAAVV  98
            AG   HQAVAL VG D+S   RC +EGYQDTLYAHS RQFYRDC I GTIDF+FG+  VV
Sbjct  336  AGPQNHQAVALRVGSDRSAFFRCSIEGYQDTLYAHSLRQFYRDCNIYGTIDFIFGNGLVV  395

Query  97   LQNCTLIAKKPLAAQKNMVTAQGRSDPNQNTG  2
            LQ+C +  +KPL  QK  +TAQGR DPNQ TG
Sbjct  396  LQHCNIYTRKPLPYQKITITAQGRKDPNQKTG  427



>gb|ACN40984.1| unknown [Picea sitchensis]
Length=601

 Score =   251 bits (641),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 144/402 (36%), Positives = 227/402 (56%), Gaps = 39/402 (10%)
 Frame = -3

Query  1111  CRTAIDPAACKTILKQTVKSYGGT-----PAGLLREFLADYLPSMEAAKMEFGMVRGEFT  947
             C + + P  C +    +V S+ G      P  ++   L+  + ++E A     + R  +T
Sbjct  85    CSSTLYPELCVS----SVSSFPGLSDRAGPIEIVHVVLSVSIAAVEKAN---ALARIMWT  137

Query  946   HP----REVQAVADCVELMGLSINDVRDAIKDLQG-----SKTRNSDAQTSLSAVLTNHL  794
              P    R+  A+ DC+EL   +++++ + + +L+      +  + +D +T LSA +TN  
Sbjct  138   RPGLSHRKRGALQDCLELFDETLDELYETVSNLKNGSCMSAPEKVNDLETLLSAAITNQY  197

Query  793   TCMEGLNPPE-KSPVKGILDALISRSRVALAVLAEIIGQT----------------DEEQ  665
             TC++       +  ++G L ++      +LA++  I  +                 D+  
Sbjct  198   TCLDSSARSNLRQELQGGLMSISHLVSNSLAIVKNIATRASNVTVNSIHNRRLLSDDQGS  257

Query  664   NFRVPFNGKFPSWVKSSDRKLVRRKHGNLKADIIVSQDGKGNFTTLKKAMESVSAVSKAR  485
              F    +  FPSW+ + +R L++    N+  + +V++DG G+ T++  A+ +    S+ R
Sbjct  258   EFMAMESDGFPSWMSAKERSLLQSSRDNIMPNAVVAKDGSGHHTSIGDAVNAAPQKSRTR  317

Query  484   VFIYVKKGTYKENVEMNVK-SPVMIYGDGMTQTVFSGDHSFGDNYTTFKSYTLASKGPAA  308
               I++K G Y ENVE+N K + +M  GDG+  TV +G+ +  D YTT++S T+A  G   
Sbjct  318   YVIHIKAGIYWENVEVNKKKTHLMFIGDGIGATVVAGNRNVKDGYTTYRSATVAVNGNGF  377

Query  307   ILQDLCVRNTAGAAKHQAVALLVGGDKSIINRCRLEGYQDTLYAHSKRQFYRDCTITGTI  128
             I +D+   NTAGAAKHQAVAL VG D S   RC  +GYQDTLY HS RQFYR+C + GT+
Sbjct  378   IARDITFENTAGAAKHQAVALRVGSDFSAFYRCSFQGYQDTLYVHSLRQFYRECNVYGTV  437

Query  127   DFVFGDAAVVLQNCTLIAKKPLAAQKNMVTAQGRSDPNQNTG  2
             DF+FG+AAVVLQNC L A+KPLA Q+ + TAQGR DPN+NTG
Sbjct  438   DFIFGNAAVVLQNCNLFARKPLANQQIVYTAQGRQDPNENTG  479



>ref|XP_006852649.1| hypothetical protein AMTR_s00021p00242180 [Amborella trichopoda]
 gb|ERN14116.1| hypothetical protein AMTR_s00021p00242180 [Amborella trichopoda]
Length=613

 Score =   251 bits (641),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 141/353 (40%), Positives = 198/353 (56%), Gaps = 54/353 (15%)
 Frame = -3

Query  928  AVADCVELMGLSINDVRDAIKDLQGSKTRNS--DAQTSLSAVLTNHLTCMEGLNPPEKSP  755
            A  DC+EL+  S+ ++ D++  + GS  R S  D  T LSA LTN  TC EGL       
Sbjct  148  AYDDCIELLDDSMQELYDSLGVVSGSVKRASFADVSTWLSAALTNQDTCREGL-------  200

Query  754  VKGILDALISRSRVALAVLAEII----------GQTDEEQNFRVPFNGK----------F  635
             +G+   +  +  + L  L+E+I          G  DE Q   +P   K          F
Sbjct  201  -EGVTGNVKEKMEMHLKDLSELISNCLAIFSANGGGDEFQG--IPIQNKRRLMGAGESIF  257

Query  634  PS---------------------WVKSSDRKLVRRKHGNLKADIIVSQDGKGNFTTLKKA  518
            PS                     WV + +R+L+      ++AD++V + G G F T+ +A
Sbjct  258  PSTKSGFQEKKGGFWGGKGGFPAWVTAGERRLLLASVAGVQADVVVDKSGNGTFKTISEA  317

Query  517  MESVSAVSKARVFIYVKKGTYKENVEMN-VKSPVMIYGDGMTQTVFSGDHSFGDNYTTFK  341
            ++  +  S  R+ IYVK G Y+EN+++   K+ +M  GDG+  TV SG  S  D +TTF 
Sbjct  318  VKWAAEESSKRIIIYVKAGRYEENIKVGRKKTNLMFIGDGIGNTVVSGSRSVSDGFTTFH  377

Query  340  SYTLASKGPAAILQDLCVRNTAGAAKHQAVALLVGGDKSIINRCRLEGYQDTLYAHSKRQ  161
            + T A+ G   I +D+   NTAG  KHQAVAL VG D  ++ RC + GYQDTLY HS+RQ
Sbjct  378  TATFAASGTGFIARDMTFENTAGPGKHQAVALRVGADHGVVYRCNIIGYQDTLYVHSQRQ  437

Query  160  FYRDCTITGTIDFVFGDAAVVLQNCTLIAKKPLAAQKNMVTAQGRSDPNQNTG  2
            F+R+C I GT+DF+FG+AAVV+QNC+L A+KP+  QKN +TAQ R DPNQNTG
Sbjct  438  FFRECAIYGTVDFIFGNAAVVIQNCSLYARKPMPLQKNTITAQNRKDPNQNTG  490



>ref|XP_008812473.1| PREDICTED: pectinesterase-like [Phoenix dactylifera]
Length=515

 Score =   249 bits (635),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 140/321 (44%), Positives = 192/321 (60%), Gaps = 28/321 (9%)
 Frame = -3

Query  928  AVADCVELMGLSINDVRDAIKDLQGSKTRNS--DAQTSLSAVLTNHLTCMEGL------N  773
            A  DC+EL         D I  L  S + +S  DAQT LSA + N  TC  G        
Sbjct  90   AWVDCLEL-------CEDTIGKLNRSMSSSSYDDAQTWLSAAMANQQTCRNGFIELGSSF  142

Query  772  PPEKSPVKG--ILDALISRSRVALAVLAEIIGQTDEEQNFRVPFNGKFPSWVKSSDRKLV  599
            P   SP     I ++L +   +  A  A   G        R   +G FP+W+ ++DRKL+
Sbjct  143  PFGSSPFTSYNISESLSNSLAINKATTAAKSGGN------RRLLSGGFPNWLSAADRKLL  196

Query  598  RRKHGNLKADIIVSQDGKGNFTTLKKAMESVSAVS--KARVFIYVKKGTYKENVEMNVKS  425
                  + AD++V++DG GN+ T+ +A+ + +  S  ++R  I+VK G Y ENV+  +K+
Sbjct  197  HSS--TINADLVVAKDGSGNYKTISEAIAAATKQSNGRSRFVIHVKAGVYNENVQTPMKN  254

Query  424  PVMIYGDGMTQTVFSGDHSFGDNYTTFKSYTLASKGPAAILQDLCVRNTAGAAKHQAVAL  245
             +MI GDGM  TV +G  +  D  TTF+S T A  G   I +D+  +NTAG  KHQAVAL
Sbjct  255  -LMIVGDGMNATVVTGSRNVQDGSTTFRSATFAVTGDGFIARDMTFQNTAGPHKHQAVAL  313

Query  244  LVGGDKSIINRCRLEGYQDTLYAHSKRQFYRDCTITGTIDFVFGDAAVVLQNCTLIAKKP  65
              G D S+  RC  EGYQDTLY +S+RQFYR+C + GT+DF+FGDAAVVLQNC++  +KP
Sbjct  314  RSGSDLSVFYRCSFEGYQDTLYIYSQRQFYRNCDVYGTVDFIFGDAAVVLQNCSMYVRKP  373

Query  64   LAAQKNMVTAQGRSDPNQNTG  2
            ++ QKN VTAQGR+DPN+NTG
Sbjct  374  MSGQKNTVTAQGRTDPNENTG  394



>ref|XP_007163135.1| hypothetical protein PHAVU_001G209400g [Phaseolus vulgaris]
 gb|ESW35129.1| hypothetical protein PHAVU_001G209400g [Phaseolus vulgaris]
Length=601

 Score =   251 bits (640),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 138/324 (43%), Positives = 196/324 (60%), Gaps = 13/324 (4%)
 Frame = -3

Query  937  EVQAVADCVELMGLSINDVRDAIKDLQ----GSKTRNSDAQTSLSAVLTNHLTCMEGLNP  770
            E +A+ DC+ L   ++ +++  +KDL     GSK R  D+QT LS  +TN  TC++G   
Sbjct  157  EKRALDDCLNLFDETVEELKTTVKDLSQSTIGSK-RYHDSQTFLSGAMTNLYTCLDGFAY  215

Query  769  PEKSPVKGILDALISRSRV---ALAVLAEIIGQTDEEQNFRVPFNGK----FPSWVKSSD  611
             + +    I + ++  S +   +LA+L ++  +  + +N   P  GK    FPSWV  +D
Sbjct  216  SKGNVRDRIEEGVLEISHLVSNSLAMLKKVPEKKKQSKNEVFPEYGKMKDGFPSWVSPND  275

Query  610  RKLVRRKHGNLKADIIVSQDGKGNFTTLKKAMESVSAVSKARVFIYVKKGTYKENVE-MN  434
            RKL++      K D++V++DG GNFTT+  A+ +    S  R  I++K G Y ENVE + 
Sbjct  276  RKLLQAAVNETKFDLVVAKDGSGNFTTIGAAVAAAPNSSATRFVIHIKAGAYFENVEVIR  335

Query  433  VKSPVMIYGDGMTQTVFSGDHSFGDNYTTFKSYTLASKGPAAILQDLCVRNTAGAAKHQA  254
             KS +M  GDG+ +TV     +  D +TTF+S T+A  G   I + +   N+AG +KHQA
Sbjct  336  KKSNLMWVGDGIGKTVVKASRNVVDGWTTFQSATVAVVGDGFIAKGITFENSAGPSKHQA  395

Query  253  VALLVGGDKSIINRCRLEGYQDTLYAHSKRQFYRDCTITGTIDFVFGDAAVVLQNCTLIA  74
            VAL  G D S   +C    YQDTLY HS RQFYR+C + GT+DF+FG+AA VLQNC L A
Sbjct  396  VALRSGADLSAFYQCSFVAYQDTLYVHSLRQFYRECDVYGTVDFIFGNAAAVLQNCNLYA  455

Query  73   KKPLAAQKNMVTAQGRSDPNQNTG  2
            +KP   QKN+ TAQGR DPNQNTG
Sbjct  456  RKPNPNQKNLFTAQGREDPNQNTG  479



>gb|KHN08672.1| Putative pectinesterase/pectinesterase inhibitor 40 [Glycine 
soja]
Length=471

 Score =   247 bits (631),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 145/329 (44%), Positives = 196/329 (60%), Gaps = 15/329 (5%)
 Frame = -3

Query  946  HPREVQAVADCVELMGLSINDVRDAIKDLQ----GSKTRNSDAQTSLSAVLTNHLTCMEG  779
            +P + +A+ DC++L   +  +++  I DL     GSK R+ D QT LS  +TN  TC++G
Sbjct  22   NPLDQRALDDCLKLFEDTNVELKATIDDLSKSTIGSK-RHHDLQTMLSGAMTNLYTCLDG  80

Query  778  LNPPEKSPVKGILDALISRSRV---ALAVLAEIIG----QTDEEQNFRVPFNGK--FPSW  626
                +      I   L+  S     +LA+L ++ G     T E   F    N K  FPSW
Sbjct  81   FAYSKGRVRDRIEKKLLEISHHVSNSLAMLNKVPGVKKLTTSESVVFPEYGNMKKGFPSW  140

Query  625  VKSSDRKLVRRKHGNLKADIIVSQDGKGNFTTLKKAMESVSAVSKARVFIYVKKGTYKEN  446
            V S DRKL++ K    K D++V++DG GNFTT+ +A+      S  R  I++K+G Y EN
Sbjct  141  VSSKDRKLLQAKVKETKFDLLVAKDGTGNFTTIGEALAVAPNSSTTRFVIHIKEGAYFEN  200

Query  445  VE-MNVKSPVMIYGDGMTQTVFSGDHSFGDNYTTFKSYTLASKGPAAILQDLCVRNTAGA  269
            VE +  K+ +M  GDG+ +TV  G  +  D +TTF+S T+A  G   I + +   N+AG 
Sbjct  201  VEVIRKKTNLMFVGDGIGKTVVKGSRNVVDGWTTFQSATVAVVGAGFIAKGITFENSAGP  260

Query  268  AKHQAVALLVGGDKSIINRCRLEGYQDTLYAHSKRQFYRDCTITGTIDFVFGDAAVVLQN  89
             KHQAVAL  G D S   +C   GYQDTLY HS RQFYR+C I GT+DF+FG+AAVV QN
Sbjct  261  DKHQAVALRSGADFSAFYQCSFVGYQDTLYVHSLRQFYRECDIYGTVDFIFGNAAVVFQN  320

Query  88   CTLIAKKPLAAQKNMVTAQGRSDPNQNTG  2
            C L A+KP   QKN+ TAQGR DPNQNTG
Sbjct  321  CNLYARKPNENQKNLFTAQGREDPNQNTG  349



>ref|XP_006445298.1| hypothetical protein CICLE_v10019773mg [Citrus clementina]
 gb|ESR58538.1| hypothetical protein CICLE_v10019773mg [Citrus clementina]
Length=510

 Score =   248 bits (634),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 145/328 (44%), Positives = 196/328 (60%), Gaps = 43/328 (13%)
 Frame = -3

Query  940  REVQAVADCVELMGLSINDVRDAIKDLQGSKTRNS-------DAQTSLSAVLTNHLTC--  788
            RE  A  DC EL  L++         L+ ++T NS       D QT LS+ LTN  TC  
Sbjct  90   REKAAWEDCRELYELTV---------LKLNQTSNSSPGCTKVDKQTWLSSALTNLETCRA  140

Query  787  -MEGLNPPEKSPVKGILDALISRSRVALAVLAEIIGQTDEEQNFRVPFNGK-----FPSW  626
             +E L  PE       +  L+S +   L   A  +         +VP+N       FP+W
Sbjct  141  SLEDLGVPE------YVLPLLSNNVTKLISNALSLN--------KVPYNEPSYKDGFPTW  186

Query  625  VKSSDRKLVRRKHGNLKADIIVSQDGKGNFTTLKKAMESVSAVSKARVFIYVKKGTYKEN  446
            VK  DRKL++      +A+I+V+QDG GN  T+++A+ + S    +R  IY+K GTY EN
Sbjct  187  VKPGDRKLLQTTP---RANIVVAQDGSGNVKTIQEAVAAASRAGGSRYVIYIKAGTYNEN  243

Query  445  VEMNVKSPVMIYGDGMTQTVFSGDHSFGDNYTTFKSYTLASKGPAAILQDLCVRNTAGAA  266
            +E+ +K+ +M  GDG+ +T+ +G  S G   TTFKS T+A  G   I +D+ +RNTAG  
Sbjct  244  IEVKLKN-IMFVGDGIGKTIITGSKSVGGGATTFKSATVAVVGDNFIARDITIRNTAGPN  302

Query  265  KHQAVALLVGGDKSIINRCRLEGYQDTLYAHSKRQFYRDCTITGTIDFVFGDAAVVLQNC  86
             HQAVAL  G D S+  RC  EGYQDTLY HS+RQFYR+C I GT+DF+FG+AAVVLQNC
Sbjct  303  NHQAVALRSGSDLSVFYRCSFEGYQDTLYVHSQRQFYRECDIYGTVDFIFGNAAVVLQNC  362

Query  85   TLIAKKPLAAQKNMVTAQGRSDPNQNTG  2
             + A+KP   + N +TAQGR+DPNQNTG
Sbjct  363  NIFARKP-PNRTNTLTAQGRTDPNQNTG  389



>ref|XP_010264199.1| PREDICTED: pectinesterase 2-like [Nelumbo nucifera]
Length=527

 Score =   249 bits (635),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 140/318 (44%), Positives = 188/318 (59%), Gaps = 13/318 (4%)
 Frame = -3

Query  940  REVQAVADCVELMGLSINDVRDAIKDLQGSKTRNSDAQTSLSAVLTNHLTCMEGLNPPEK  761
            RE  A ADC++L   ++  +   +     S+  + D QT LS  LTN  TC  G     +
Sbjct  97   REKVAWADCLQLYQNTVLQLNTTLNPY--SRYTDVDVQTWLSTALTNLETCKTGF---IE  151

Query  760  SPVKGILDALISR--SRVALAVLAEIIGQTDEEQNFRVPFNGKFPSWVKSSDRKLVRRKH  587
              V   +  L+S   S++    LA I       QN    + G +PSWV + DRKL++   
Sbjct  152  LGVSDFMLPLMSNNVSKLISNTLA-INNNATTTQN--QSYTGGYPSWVSAGDRKLLQSSS  208

Query  586  GNLKADIIVSQDGKGNFTTLKKAMESVSA--VSKARVFIYVKKGTYKENVEMNVK-SPVM  416
               +A+I+V+QDG GNF T+K+A+ + S       R  IYVKKG Y EN+E+      +M
Sbjct  209  PASQANIVVAQDGSGNFRTIKEALSAASQQRTGSGRFVIYVKKGAYIENLEIGSSLQNIM  268

Query  415  IYGDGMTQTVFSGDHSFGDNYTTFKSYTLASKGPAAILQDLCVRNTAGAAKHQAVALLVG  236
            + GDGM  T+ +G+ S G   TTF S T+A  G   I   +  RNTAG   HQAVAL  G
Sbjct  269  LVGDGMRNTIITGNRSVGGGSTTFNSATVAVTGQGFIAMGITFRNTAGPENHQAVALRSG  328

Query  235  GDKSIINRCRLEGYQDTLYAHSKRQFYRDCTITGTIDFVFGDAAVVLQNCTLIAKKPLAA  56
             D S+  RC  EGYQDTLY HS+RQ Y++C I GT+DF+FG+AAVVLQNC + A++P+  
Sbjct  329  SDLSVFYRCGFEGYQDTLYVHSQRQLYKECYIYGTVDFIFGNAAVVLQNCMIFARRPMDN  388

Query  55   QKNMVTAQGRSDPNQNTG  2
            Q N+VTAQGR+DPNQNTG
Sbjct  389  QNNVVTAQGRTDPNQNTG  406



>ref|XP_009417531.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 16 
[Musa acuminata subsp. malaccensis]
Length=632

 Score =   251 bits (642),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 148/389 (38%), Positives = 224/389 (58%), Gaps = 30/389 (8%)
 Frame = -3

Query  1111  CRTAIDPAACKTILKQTVKSYGGTPAGLLREFLADYLPSMEAAKMEFGMVRG---EFTHP  941
             C++ + P AC+  L  +V S   T     +E    +  S+E+AK +  + R      T P
Sbjct  138   CKSTLYPEACEAALA-SVASTAST-----KEM---FDVSVESAKSKARVARDVAYNLTQP  188

Query  940   -------REVQAVADCVELMGLSINDVRDAIKDLQGSKTRNSDAQTSLSAVLTNHLTCME  782
                    R   +V DC+EL+ ++++ + D ++  + S     D QT LSA LTN  TC E
Sbjct  189   SAQKSTSRSQSSVNDCLELLDITLDQLDDVLRAKKSSGFH--DVQTWLSAALTNQATCSE  246

Query  781   GLNPPEK---SPVKGILDALISRSRVALAVLAEIIGQTDEEQNFRVPFNGKFPSWVKSSD  611
             GL   +      +   +++L      ALA+  ++  +  +    R   + +FP W+ + D
Sbjct  247   GLETVKAKGGDSLNAQVESLSQYISNALALHKKVKAKDKDGHGGRKLLSDRFPEWLSAGD  306

Query  610   RKLVRRKHGNLKADIIVSQDGKGNFTTLKKAMESVSAVSK-----ARVFIYVKKGTYKEN  446
             R+L++    +++AD +V++DG G  TT+ +A+  VS  SK     +   IYVK GTYKE 
Sbjct  307   RRLLQASPEDIRADAVVAKDGSGTHTTINEAIAFVSLASKGSGDGSTKVIYVKAGTYKEY  366

Query  445   VEMNVKSP-VMIYGDGMTQTVFSGDHSFGDNYTTFKSYTLASKGPAAILQDLCVRNTAGA  269
             + +  K   VM+ GDG  +++  G  +  D YTT+ S T+A+ G   I + L + N +G 
Sbjct  367   INIPTKQKNVMLMGDGKGKSIVVGSRNANDGYTTYGSATVAAMGAGFIAKGLTIINNSGP  426

Query  268   AKHQAVALLVGGDKSIINRCRLEGYQDTLYAHSKRQFYRDCTITGTIDFVFGDAAVVLQN  89
             +KHQAVAL VG DKS++ +C ++GYQDTLY HS RQFY +  I GT+DF+FG++AVVLQN
Sbjct  427   SKHQAVALRVGADKSVVYQCSVQGYQDTLYTHSNRQFYTETDIYGTVDFIFGNSAVVLQN  486

Query  88    CTLIAKKPLAAQKNMVTAQGRSDPNQNTG  2
             C +  +KP   QKN VTAQGR+DPNQNTG
Sbjct  487   CYIQPRKPGGGQKNSVTAQGRTDPNQNTG  515



>ref|XP_011078158.1| PREDICTED: pectinesterase/pectinesterase inhibitor PPE8B-like 
[Sesamum indicum]
Length=536

 Score =   249 bits (636),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 148/389 (38%), Positives = 213/389 (55%), Gaps = 46/389 (12%)
 Frame = -3

Query  1051  YGGTPAGLLREFLADYLPSMEAAKMEFGMVR---GEFTHPREVQAVADCVELMGLSINDV  881
             Y G PA    EF+     ++        MV    G F   R   A++DC++LM LS++ +
Sbjct  35    YLGVPA---SEFVGTVRSTINIIGQVISMVSQFAGGFGDFRLTNAISDCLDLMDLSMDQL  91

Query  880   RDAIKDLQGSKTRN-------SDAQTSLSAVLTNHLTCMEGL---NPPEKSPVKGILDAL  731
                +   Q    ++       +D +T LS  L N  TC EGL   N   K+ + G LD +
Sbjct  92    SWTLSVSQNPNGKDNSTGNVGADMKTWLSGALINQDTCKEGLDGTNSIVKNLIAGSLDQV  151

Query  730   ISRSRVALAVLAEI-------------------------IGQTDEEQNFRVPFNGKFPSW  626
              S   +   +L+ +                          G         +  + +FP W
Sbjct  152   TS---LVYDILSNVKTTPTTPPKGSPSSGPGGGKGSGSGGGGGGRGGRKLIADDHQFPKW  208

Query  625   VKSSDRKLVRRKHGNLKADIIVSQDGKGNFTTLKKAMESVSAVSKARVFIYVKKGTYKEN  446
             ++S DR L++  +G + AD++V+ DG GNFT++K A+++    S  R  IY+K+G YKE 
Sbjct  209   LRSHDRNLLQAANGAM-ADVVVAADGTGNFTSIKDAVQAAPEYSTRRFVIYLKRGVYKEY  267

Query  445   VEMNVKS-PVMIYGDGMTQTVFSGDHSFGDNYTTFKSYTLASKGPAAILQDLCVRNTAGA  269
             VE++ K   +M+ GDG+  TV SG+ +F D +TT++S T A KG   I +D+   NTAG 
Sbjct  268   VEISKKKWNIMMIGDGVNVTVISGNRNFIDGWTTYRSATFAVKGQGFIARDITFENTAGP  327

Query  268   AKHQAVALLVGGDKSIINRCRLEGYQDTLYAHSKRQFYRDCTITGTIDFVFGDAAVVLQN  89
              KHQAVA     D S++ RC + GYQDTLYAHS+RQFYR+C ITGT+DF+FGD AVV QN
Sbjct  328   EKHQAVAFRSDSDLSVLYRCSIRGYQDTLYAHSQRQFYRECIITGTVDFIFGDGAVVFQN  387

Query  88    CTLIAKKPLAAQKNMVTAQGRSDPNQNTG  2
             C + A+K L  QKN +TAQGR +P +NTG
Sbjct  388   CQIQARKGLPNQKNTITAQGRKEPVENTG  416



>ref|XP_010098938.1| Pectinesterase 2 [Morus notabilis]
 gb|EXB76240.1| Pectinesterase 2 [Morus notabilis]
Length=518

 Score =   248 bits (634),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 141/314 (45%), Positives = 195/314 (62%), Gaps = 12/314 (4%)
 Frame = -3

Query  940  REVQAVADCVELMGLSINDVRDAIKDLQGSKTRNSDAQTSLSAVLTNHLTCMEGLNPPEK  761
            +E  A ADC+EL   ++  +    K    SK    D QT LS  LTN  TC  GL    +
Sbjct  99   QEKAAWADCLELYESTVLRLNKTSKPT--SKCTQDDLQTWLSTALTNLETCRAGL---LE  153

Query  760  SPVKGILDALISRSRVALAVLAEIIGQTDEEQNFRVPFNGKFPSWVKSSDRKLVRRKHGN  581
              V   L  L+S +   L   +  I ++  + + +  +N  FP+WVK  DR+L++     
Sbjct  154  LGVSDYLLPLMSNNVSKLISNSLAINKSPYKPDNK--YNNGFPTWVKPGDRRLLQSSSSP  211

Query  580  L-KADIIVSQDGKGNFTTLKKAMESVSAVSKARVFIYVKKGTYKENVEMNVKSPVMIYGD  404
              +A+++V++DG G++TT+K A+ +V      R  IYVK GTY ENVE+ VK+ VM+ GD
Sbjct  212  ASRANVVVAKDGSGDYTTVKAAVTAVKG--SGRFVIYVKAGTYNENVEIKVKN-VMLLGD  268

Query  403  GMTQTVFSGDHSFGDNYTTFKSYTLASKGPAAILQDLCVRNTAGAAKHQAVALLVGGDKS  224
            G+ +T+ +G  S G   TTF+S T+A  G   I QD+  RNTAGA+ HQAVAL  G D+S
Sbjct  269  GIGKTIITGSKSVGGGSTTFQSATVAVVGDGFIAQDITFRNTAGASNHQAVALRSGSDQS  328

Query  223  IINRCRLEGYQDTLYAHSKRQFYRDCTITGTIDFVFGDAAVVLQNCTLIAKKPLAAQKNM  44
            +  +C  EGYQDTLY HS+RQFYR+C I GT+DF+FG+AAVVLQNC + A+ P   + N 
Sbjct  329  VFYKCSFEGYQDTLYVHSERQFYRECDIYGTVDFIFGNAAVVLQNCNIYARDP-PNKTNT  387

Query  43   VTAQGRSDPNQNTG  2
            +TAQGR+D NQNTG
Sbjct  388  ITAQGRTDSNQNTG  401



>gb|AER38245.1| PME4 [Gossypium barbadense]
Length=525

 Score =   248 bits (634),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 148/364 (41%), Positives = 210/364 (58%), Gaps = 27/364 (7%)
 Frame = -3

Query  1021  EFLADYLPSMEAAKMEFGMVR--GEFTHP-REVQAVADCVELMGLSINDVRDAIKDLQGS  851
             EF+     +++A +    +V   G F H  R   A++DC++L+  S +++   +   Q  
Sbjct  42    EFIGSLKTTIDAIRKATSVVSQFGGFFHDFRLSNAISDCLDLLDSSADELSWTMSASQNP  101

Query  850   KTRN-------SDAQTSLSAVLTNHLTCM---EGLNPPEKSPVKGILDALISRSRVALAV  701
               ++       SD +T LSA + N  TC+   EG N   K+ V G L+ + S  R  L +
Sbjct  102   NAKDNSTGDLSSDLRTWLSAAMVNQQTCIDGFEGTNSMVKTVVSGSLNQITSLVRNLLIM  161

Query  700   L-----AEIIGQTDEEQNFRV----PFNGKFPSWVKSSDRKLVRRKHGNLKADIIVSQDG  548
             +     ++  G  +  Q        P   +FP W K  DR+L++     + A+++V+ DG
Sbjct  162   VHPGPNSKSNGTRNGSQKGGGGGGHPGQSRFPVWFKREDRRLLQIN--GVTANVVVAADG  219

Query  547   KGNFTTLKKAMESVSAVSKARVFIYVKKGTYKENVEMNVK--SPVMIYGDGMTQTVFSGD  374
              GNFT +  A+E+    S  R  IY+KKG YKENVE+  K  + VMI GDGM  TV SG+
Sbjct  220   SGNFTRIMDAVETAPDKSMNRYVIYIKKGLYKENVEIKKKKWNLVMI-GDGMDVTVISGN  278

Query  373   HSFGDNYTTFKSYTLASKGPAAILQDLCVRNTAGAAKHQAVALLVGGDKSIINRCRLEGY  194
              SF D +TT +S T A  G   I +D+   NTAG  KHQAVAL    D S+  RC ++GY
Sbjct  279   RSFIDGWTTLRSATFAVSGRGFIARDITFENTAGPQKHQAVALRSDSDLSVFFRCAIKGY  338

Query  193   QDTLYAHSKRQFYRDCTITGTIDFVFGDAAVVLQNCTLIAKKPLAAQKNMVTAQGRSDPN  14
             QD+LY H+ RQFYR+C ITGT+DF+FGD AV+ QNC ++AK+ L +QKN +TAQGR DPN
Sbjct  339   QDSLYTHTMRQFYRECKITGTVDFIFGDGAVLFQNCQILAKQGLPSQKNTITAQGRKDPN  398

Query  13    QNTG  2
             Q TG
Sbjct  399   QPTG  402



>ref|XP_010271266.1| PREDICTED: pectinesterase-like [Nelumbo nucifera]
Length=532

 Score =   249 bits (635),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 137/325 (42%), Positives = 194/325 (60%), Gaps = 18/325 (6%)
 Frame = -3

Query  940  REVQAVADCVELMGLSINDVRDAIKDLQGSKTRNSDAQTSLSAVLTNHLTCMEG---LN-  773
            R   A ADCVEL   +I  +   +   Q       +AQT LSA + N  TC  G   LN 
Sbjct  94   RAKVAWADCVELYADTITQLNRTVLVTQNPLAW-WNAQTWLSAAIANEQTCQNGFLDLNM  152

Query  772  -------PPEKSPVKGILDALISRSRVALAVLAEIIGQTDEEQNFRVPFNGKFPSWVKSS  614
                   P   S    ++   ++ ++ ++   A ++G+  +  N R+  +G FP+WV ++
Sbjct  153  SSYLSSFPYMLSNFSKMVSNSLAINKASVLSAASLLGK--QGGNRRLLSDG-FPTWVSAA  209

Query  613  DRKLVRRKHGNLKADIIVSQDGKGNFTTLKKAMESVSAVSKARVFIYVKKGTYKENVEMN  434
            DRKL++     L+AD++V+ DG GN+ T+ +A+ +       R  IYVK+G YKE VE  
Sbjct  210  DRKLLQSPGAALRADVVVAADGSGNYKTISQAVAAAPGGGSKRFVIYVKRGVYKETVE--  267

Query  433  VKSP-VMIYGDGMTQTVFSGDHSFGDNYTTFKSYTLASKGPAAILQDLCVRNTAGAAKHQ  257
            +K+P +M+ GDG+  TV +G  S  D  T+F+S T+   G   I +D+   NTAG  KHQ
Sbjct  268  IKAPNIMLIGDGIDVTVVTGSKSIQDAGTSFRSATVGITGNGFIARDMTFENTAGPQKHQ  327

Query  256  AVALLVGGDKSIINRCRLEGYQDTLYAHSKRQFYRDCTITGTIDFVFGDAAVVLQNCTLI  77
            AVAL  G D S+  RC  +GYQDTLY HS RQFYR+C I GT+DF++GDA  VLQNC + 
Sbjct  328  AVALRSGSDLSVFYRCSFKGYQDTLYVHSNRQFYRNCDIYGTVDFIWGDAVAVLQNCNIY  387

Query  76   AKKPLAAQKNMVTAQGRSDPNQNTG  2
             +KP++ QKN VTAQGR+DPN+NTG
Sbjct  388  VRKPMSGQKNTVTAQGRTDPNENTG  412



>ref|XP_007052106.1| Pectinesterase 2 [Theobroma cacao]
 gb|EOX96263.1| Pectinesterase 2 [Theobroma cacao]
Length=517

 Score =   248 bits (633),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 149/376 (40%), Positives = 206/376 (55%), Gaps = 18/376 (5%)
 Frame = -3

Query  1111  CRTAIDPAACKTILKQTVKSYGGTP----AGLLREFLADYLPSMEAAKMEFGMVRGEFTH  944
             C    +P  C+  L    K+   TP       L+  +   L   E A+    ++  +  +
Sbjct  33    CSKTPNPQPCEYFLSNDPKN---TPIKDEPDFLKISMQLALERAERAQSHTYLLGPKCRN  89

Query  943   PREVQAVADCVELMGLSINDVRDAIKDLQGSKTRNSDAQTSLSAVLTNHLTCMEGLNPPE  764
              RE  A ADC+ L  L+I  +   +      K    DAQT LS  LTN  TC  G     
Sbjct  90    KREKAAWADCLNLYELTILRLNKTVD--SSIKLNKDDAQTWLSTALTNLETCRTGFIE--  145

Query  763   KSPVKGILDALISRSRVALAVLAEIIGQTDEEQNFRVPFNGKFPSWVKSSDRKLVRRKHG  584
                  G+ D ++      ++ L       ++       +   FP+WVK  DRKL++    
Sbjct  146   ----LGVPDYILPMMSNNVSNLISNTLALNKAPYKEPSYKDGFPTWVKPGDRKLLQSSSP  201

Query  583   NLKADIIVSQDGKGNFTTLKKAMESVSAVS-KARVFIYVKKGTYKENVEMNVK-SPVMIY  410
               +A+I+V+QDG GN+ T+K A+ + S  S   R  IYVK GTYKENVE+  K   +M+ 
Sbjct  202   ASRANIVVAQDGSGNYKTIKDAISAASKRSGSGRYVIYVKAGTYKENVEIRSKLKNIMLV  261

Query  409   GDGMTQTVFSGDHSFGDNYTTFKSYTLASKGPAAILQDLCVRNTAGAAKHQAVALLVGGD  230
             GDG+ +T+ +G  S G   TTF S T+A+ G   I +D+ +RNTAG   HQAV+L  G D
Sbjct  262   GDGIGKTIITGSKSVGQGSTTFNSATVAAVGDGFIARDITIRNTAGPQNHQAVSLRSGSD  321

Query  229   KSIINRCRLEGYQDTLYAHSKRQFYRDCTITGTIDFVFGDAAVVLQNCTLIAKKPLAAQK  50
              S+  RC  EGYQDTLY HS+RQFYR+C I GT+D +FG+AAVVLQNC + A++P   + 
Sbjct  322   LSVFYRCSFEGYQDTLYVHSERQFYRECDIYGTVDVIFGNAAVVLQNCNIYARRP-PNKT  380

Query  49    NMVTAQGRSDPNQNTG  2
             N VTAQ R+DPNQNTG
Sbjct  381   NTVTAQSRTDPNQNTG  396



>ref|XP_009404434.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 34 
[Musa acuminata subsp. malaccensis]
Length=589

 Score =   250 bits (638),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 130/338 (38%), Positives = 202/338 (60%), Gaps = 31/338 (9%)
 Frame = -3

Query  928  AVADCVELMGLSINDVRDAI--------------KDLQGSKTRNSDAQTSLSAVLTNHLT  791
            A  DC+EL+  S++ + D++                ++G+   + D  T LS  LTN  T
Sbjct  131  AYDDCMELLDDSLDQLSDSLLVIFPSASPSPSSQARVKGAS--DDDVLTWLSGALTNQDT  188

Query  790  CMEGLNPPEKSPVKGILDALISRSRVALAVLAEIIGQTDEEQNFR-VPFNGK--------  638
            C EGL   +   VKG ++  +      ++    I       ++F  +P + K        
Sbjct  189  CNEGLQQVKNLYVKGHMENQLKDLTELVSNCLAIFAGVGRNKDFAGIPIHNKRRKLLNAI  248

Query  637  -----FPSWVKSSDRKLVRRKHGNLKADIIVSQDGKGNFTTLKKAMESVSAVSKARVFIY  473
                 FP+W+   DR+L++    +++AD++VS+ G G + ++  A+++    S  R+ IY
Sbjct  249  EDDDEFPTWMGKKDRRLLQVSAASIQADMVVSKGGNGTYRSIADAVKAAPDYSSRRIVIY  308

Query  472  VKKGTYKENVEMNVK-SPVMIYGDGMTQTVFSGDHSFGDNYTTFKSYTLASKGPAAILQD  296
            +K G Y EN+++  K + +M  GDG T+T+ +G  S  DN+TTF + T A+ G   I++D
Sbjct  309  IKAGRYDENIKVGRKKTNLMFIGDGKTRTIVAGSRSVYDNFTTFHTATFAATGTGFIMRD  368

Query  295  LCVRNTAGAAKHQAVALLVGGDKSIINRCRLEGYQDTLYAHSKRQFYRDCTITGTIDFVF  116
            + ++N AG  KHQAVAL VG D++ + RC + GYQDTLY HS+RQF+R+C + GT+DF+F
Sbjct  369  ITIQNWAGPEKHQAVALRVGADRAAVYRCNIIGYQDTLYVHSQRQFFRECDVYGTVDFIF  428

Query  115  GDAAVVLQNCTLIAKKPLAAQKNMVTAQGRSDPNQNTG  2
            G+AAVVLQNCTL A++P+A+QKN +TAQ R DPNQNTG
Sbjct  429  GNAAVVLQNCTLWARRPMASQKNTITAQNRKDPNQNTG  466



>ref|XP_004171768.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 40-like 
[Cucumis sativus]
Length=591

 Score =   250 bits (638),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 138/328 (42%), Positives = 196/328 (60%), Gaps = 13/328 (4%)
 Frame = -3

Query  946  HPREVQAVADCVELMGLSINDVRDAIKDLQGSKT---RNSDAQTSLSAVLTNHLTCMEGL  776
            +P +  A+ DC+EL+  SI +++ +I DL  S++    + D  T +SA +TNH TC++G 
Sbjct  140  NPTDRHALDDCLELLDGSIAELKASIFDLAPSQSPALHSHDLLTLVSAAMTNHRTCVDGF  199

Query  775  NPPE---KSPVKGILDALISRSRVALAVLAEIIG---QTDEEQNFRVPFN---GKFPSWV  623
                   +S V+  L  +     + LA+L +I G    T  +Q     +    G FP WV
Sbjct  200  YNSSGTVRSRVELYLGKIGQHLSIDLAMLKKIPGVNRATGVDQEMLPEYGAVKGGFPKWV  259

Query  622  KSSDRKLVRRKHGNLKADIIVSQDGKGNFTTLKKAMESVSAVSKARVFIYVKKGTYKENV  443
               DR+L++      K +++V++DG GNFTT+ +A+ +    S  R  IY+K G Y ENV
Sbjct  260  SVKDRRLLQAAVNETKFNMVVAKDGSGNFTTVSEAVAAAPNASTTRFVIYIKAGAYFENV  319

Query  442  EMN-VKSPVMIYGDGMTQTVFSGDHSFGDNYTTFKSYTLASKGPAAILQDLCVRNTAGAA  266
            E+   KS +M  GDG+ +T+   D +  D +TTF+S T+A  G   I + +   N AG +
Sbjct  320  EIGRAKSNLMFVGDGIGKTLIKADRNVVDGWTTFRSATVAVVGTGFIAKGITFENYAGPS  379

Query  265  KHQAVALLVGGDKSIINRCRLEGYQDTLYAHSKRQFYRDCTITGTIDFVFGDAAVVLQNC  86
            KHQAVAL    D S   +C   GYQDTLY HS RQFYR+C + GTIDF+FG+AAVV QNC
Sbjct  380  KHQAVALRSNSDFSAFYQCSFIGYQDTLYVHSLRQFYRECDVYGTIDFIFGNAAVVFQNC  439

Query  85   TLIAKKPLAAQKNMVTAQGRSDPNQNTG  2
             L A+KP + Q+N+ TAQGR DPNQNTG
Sbjct  440  NLYARKPNSNQRNIFTAQGREDPNQNTG  467



>ref|XP_008783207.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 34 
[Phoenix dactylifera]
Length=588

 Score =   250 bits (638),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 128/328 (39%), Positives = 196/328 (60%), Gaps = 19/328 (6%)
 Frame = -3

Query  928  AVADCVELMGLSINDVRDAIKDLQGSKTR-----NSDAQTSLSAVLTNHLTCMEGLNPPE  764
            A  DC+EL+  S++ +  ++  +  + +      + D  T LS+ +TN  TC EGL    
Sbjct  138  AYDDCMELLDDSLDQLSQSLAVIAPTGSHPAGASDEDVLTWLSSAVTNQDTCTEGLADVA  197

Query  763  KSPVKGILDALISRSRVALAVLAEIIGQTDEEQNFR-VPF------------NGKFPSWV  623
               V+  +++ +      ++    I       ++F  +P             +G+FP WV
Sbjct  198  NGYVRAQMESNLKDLAELVSNCLAIFSAASRNKDFSGIPIQNKKRRLLSSAGDGEFPEWV  257

Query  622  KSSDRKLVRRKHGNLKADIIVSQDGKGNFTTLKKAMESVSAVSKARVFIYVKKGTYKENV  443
               DR+L++     ++AD++V++DG G   ++  A+++   +S  R+ IYVK G Y EN+
Sbjct  258  GRRDRRLLQVPAAKIQADMVVAKDGNGTHKSIAAAVKAAPELSARRIIIYVKAGRYVENI  317

Query  442  EMN-VKSPVMIYGDGMTQTVFSGDHSFGDNYTTFKSYTLASKGPAAILQDLCVRNTAGAA  266
            ++   K+ +M  GDG   T+ +G  S  D YTTF + T AS G   I++D+ + N AG A
Sbjct  318  KVGRKKTNLMFIGDGKGMTIVAGSRSVADKYTTFSTATFASTGNGFIMKDMTIENWAGPA  377

Query  265  KHQAVALLVGGDKSIINRCRLEGYQDTLYAHSKRQFYRDCTITGTIDFVFGDAAVVLQNC  86
            KHQAVAL VG D++++ RC + GYQDTLY HS+RQF+R+C I GT+DF+FG+AAVVLQNC
Sbjct  378  KHQAVALRVGADQAVVYRCNIIGYQDTLYVHSQRQFFRECDIFGTVDFIFGNAAVVLQNC  437

Query  85   TLIAKKPLAAQKNMVTAQGRSDPNQNTG  2
            +L A+KP+  QKN +TAQ R DPNQNTG
Sbjct  438  SLWARKPMEKQKNTITAQNRKDPNQNTG  465



>gb|AFW03479.1| pectin methylesterase 5 [Gossypium barbadense]
Length=519

 Score =   248 bits (633),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 151/377 (40%), Positives = 205/377 (54%), Gaps = 18/377 (5%)
 Frame = -3

Query  1114  LCRTAIDPAACKTILKQTVKSYGGTPAGLLREF--LADYLPSMEAAKMEFGM--VRGEFT  947
              CR   +P  C+  L    K    TP     +F  ++ +L    AA+ E     +  +  
Sbjct  34    WCRKTPNPQPCEYFLSHDPKK---TPIKDEFQFFKISTHLALERAARAESNTHSLGTKCR  90

Query  946   HPREVQAVADCVELMGLSINDVRDAIKDLQGSKTRNSDAQTSLSAVLTNHLTCMEGLNPP  767
             + RE  A +DCV L  L+I  +   +    G+     DAQT LS  LTN  TC  G    
Sbjct  91    NEREKAAWSDCVNLYELTILRLNKTVD--SGTNHNKDDAQTWLSTALTNLETCRTGFME-  147

Query  766   EKSPVKGILDALISRSRVALAVLAEIIGQTDEEQNFRVPFNGKFPSWVKSSDRKLVRRKH  587
                   G+ D L+      ++ L       ++       +   FP+WVK  DRKL++   
Sbjct  148   -----LGVPDYLLPMMSNNVSQLISNTLALNKAPYKEPTYKDGFPTWVKPGDRKLLQSSS  202

Query  586   GNLKADIIVSQDGKGNFTTLKKAMESVSAVS-KARVFIYVKKGTYKENVEMNVK-SPVMI  413
                 A+I+V+QDG GN+ T+K A+ + S  S   R  IYVK GTYKENVE+  K   +M+
Sbjct  203   PASTANIVVAQDGSGNYKTIKDAISAASKRSGSGRYVIYVKAGTYKENVEIGSKLKNIMM  262

Query  412   YGDGMTQTVFSGDHSFGDNYTTFKSYTLASKGPAAILQDLCVRNTAGAAKHQAVALLVGG  233
              GDG+ +T+ +G  S G   TTF S T+A  G   I + +  RNTAG   HQAVAL  G 
Sbjct  263   VGDGIGKTIITGSKSVGGGSTTFNSATVAVVGDGFIARGITFRNTAGPTNHQAVALRSGS  322

Query  232   DKSIINRCRLEGYQDTLYAHSKRQFYRDCTITGTIDFVFGDAAVVLQNCTLIAKKPLAAQ  53
             D S+  +C  EGYQDTLY HS+RQFYR+C I GT+D++FG+AAVV QNC + A+ P   +
Sbjct  323   DLSVFYKCSFEGYQDTLYVHSERQFYRECDIYGTVDWIFGNAAVVFQNCNIYARNP-PNK  381

Query  52    KNMVTAQGRSDPNQNTG  2
              N VTAQGR+DPNQNTG
Sbjct  382   TNTVTAQGRTDPNQNTG  398



>ref|XP_006404164.1| hypothetical protein EUTSA_v10010220mg [Eutrema salsugineum]
 gb|ESQ45617.1| hypothetical protein EUTSA_v10010220mg [Eutrema salsugineum]
Length=602

 Score =   250 bits (638),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 143/334 (43%), Positives = 192/334 (57%), Gaps = 21/334 (6%)
 Frame = -3

Query  943  PREVQAVADCVELMGLSINDVRDAIKDL-QGSKTRNSDAQTSLSAVLTNHLTCMEGLNPP  767
            PR   A   C+EL+  S++ +  A+  +  G KT+  D  T LS+ LTN  TC EG +  
Sbjct  147  PRVRSAYDSCIELLDDSVDALSRALSSVVSGGKTKPQDVTTWLSSALTNQDTCAEGFDGV  206

Query  766  EKSPVKG-ILDALISRSRVALAVLAEIIGQTDEEQN--FRVPFNG-------------KF  635
            +   VK  +  AL + S +    LA      D + N    VP                KF
Sbjct  207  DDGGVKDQMTAALKNLSELVSNCLAIFAASGDGDGNDFAGVPIQNRRLLEVEGSERDEKF  266

Query  634  PSWVKSSDRKLVRRKHGNLKADIIVSQDGKGNFTTLKKAMESVSAVSKARVFIYVKKGTY  455
            P W K  +R+++      ++ADIIVS+DG G   T+ +A++     S  R  IYVK G Y
Sbjct  267  PRWTKRREREILEMPVSQIQADIIVSKDGNGTCKTISEAIKKAPQYSTRRTIIYVKAGRY  326

Query  454  KENVEMNV---KSPVMIYGDGMTQTVFSGDHSFGDNYTTFKSYTLASKGPAAILQDLCVR  284
            +EN  + V   K  +M  GDG  +TV SG  S  DN TTF + T A+ G   I +D+  +
Sbjct  327  EEN-NLKVGRKKINLMFVGDGKGKTVISGGKSIFDNITTFHTATFAATGAGFIARDITFQ  385

Query  283  NTAGAAKHQAVALLVGGDKSIINRCRLEGYQDTLYAHSKRQFYRDCTITGTIDFVFGDAA  104
            N AG AKHQAVAL +G D ++I RC + GYQDTLY HS RQF+R+C I GT+DF+FG+AA
Sbjct  386  NWAGPAKHQAVALRIGADHAVIYRCNIIGYQDTLYVHSNRQFFRECDIYGTVDFIFGNAA  445

Query  103  VVLQNCTLIAKKPLAAQKNMVTAQGRSDPNQNTG  2
            VVLQNC++ A+KP+  QKN +TAQ R DPNQNTG
Sbjct  446  VVLQNCSIYARKPMDLQKNTITAQNRKDPNQNTG  479



>ref|XP_010526022.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 44 
[Tarenaya hassleriana]
Length=531

 Score =   248 bits (634),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 149/355 (42%), Positives = 203/355 (57%), Gaps = 39/355 (11%)
 Frame = -3

Query  958  GEFTHPREVQ-AVADCVELMGLSINDVRDAIKDLQGSKTRN--------SDAQTSLSAVL  806
            GEF     +Q AV+DC++L+  S +++  +    Q  K +         SD +T LSA L
Sbjct  57   GEFGGDLRLQNAVSDCLDLLDFSSDELSWSASASQNPKGKGENGTGDVGSDMKTWLSAAL  116

Query  805  TNHLTCMEGL---NPPEKSPVKGILDALISRSRVALAVLAE------------IIGQTDE  671
            +N  TC+EG    N   K+ V G L+ L S  R  L ++              I+     
Sbjct  117  SNQDTCIEGFDGTNGLVKALVAGSLNQLYSMLRELLPLVQPDTSARPKPNPRPIVKPGPT  176

Query  670  EQNFRVPFNGK----------FPSWVKSSDRKLVRRKHGNLKADIIVSQDGKGNFTTLKK  521
             +  R P   K          FP WV+S DRKL+  +  ++K D+ V+ DG G+FT +  
Sbjct  177  SKRPRGPPGRKLINTDDEIRRFPDWVRSDDRKLL--EANDVKVDVTVALDGTGDFTKITD  234

Query  520  AMESVSAVSKARVFIYVKKGTYKENVEMNVK--SPVMIYGDGMTQTVFSGDHSFGDNYTT  347
            A+++    S  R  IYVKKG Y ENVE+  K  + VMI GDG+  TV SG+ SF D +TT
Sbjct  235  AVKAAPDYSSKRFVIYVKKGVYSENVEIKKKKWNLVMI-GDGIDVTVISGNRSFIDGWTT  293

Query  346  FKSYTLASKGPAAILQDLCVRNTAGAAKHQAVALLVGGDKSIINRCRLEGYQDTLYAHSK  167
            F+S T A  G   + +D+  +NTAG  KHQAVA+    D S+  RC ++GYQDTLY H+ 
Sbjct  294  FRSATFAVSGRGFLARDITFQNTAGPEKHQAVAMRSDSDLSVFYRCAMKGYQDTLYTHTM  353

Query  166  RQFYRDCTITGTIDFVFGDAAVVLQNCTLIAKKPLAAQKNMVTAQGRSDPNQNTG  2
            RQFYRDC +TGT+DF+FGDA VV QNC ++A++ L  QKN +TAQGR DPNQ TG
Sbjct  354  RQFYRDCIVTGTVDFIFGDATVVFQNCQILARRGLPNQKNTITAQGRKDPNQPTG  408



>ref|NP_001172245.1| Os01g0234300 [Oryza sativa Japonica Group]
 dbj|BAH90975.1| Os01g0234300 [Oryza sativa Japonica Group]
Length=621

 Score =   250 bits (639),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 145/360 (40%), Positives = 201/360 (56%), Gaps = 53/360 (15%)
 Frame = -3

Query  940  REVQAVADCVE-------LMGLSINDVR------DAIKDLQGSKTRNSDAQTSLSAVLTN  800
            R   A  DCVE       L+  S+  +       D++ D   +   + D  T LSA LT+
Sbjct  140  RSGAAYGDCVEMLDAAEELLARSVGAIAAPPPPPDSV-DADTAGRDDDDIMTWLSAALTS  198

Query  799  HLTCMEGLNP----------------PEKSPVKGILDALISRSRVALAVLAEIIGQTDEE  668
            H TCM+ L                  P+     G L   +S S    A      G+  + 
Sbjct  199  HDTCMDSLQEVGAGGDAGDDDGGRIKPQMLGYLGNLGEHLSNSLAIFAARGRPGGELSD-  257

Query  667  QNFRVPFN-----------------GKFPSWVKSSDRKLVRRKHGNLKADIIVSQDGKGN  539
                VP +                 G FP WV+ +DR+L++     ++AD++V++DG G 
Sbjct  258  ----VPVHNQLHRRLLTIDDDDDDDGSFPRWVRHNDRRLLQAAAAEIEADMVVAKDGTGT  313

Query  538  FTTLKKAMESVSAVSKARVFIYVKKGTYKENVEMNVK-SPVMIYGDGMTQTVFSGDHSFG  362
               ++ A+++    S+ RV IYVK G Y ENV++  K + +M+ GDG  +TV  G  S  
Sbjct  314  HRKIRDAIKAAPEHSRRRVVIYVKAGVYTENVKIGSKKTNLMLVGDGAGKTVVVGYRSVH  373

Query  361  DNYTTFKSYTLASKGPAAILQDLCVRNTAGAAKHQAVALLVGGDKSIINRCRLEGYQDTL  182
            DNYTTF + TLA  G   I++D+ V N AGAA+HQAVALL+ GD +++ R  + GYQDTL
Sbjct  374  DNYTTFHTATLAVAGAGFIMRDMTVENRAGAARHQAVALLLSGDHAVVYRSAVLGYQDTL  433

Query  181  YAHSKRQFYRDCTITGTIDFVFGDAAVVLQNCTLIAKKPLAAQKNMVTAQGRSDPNQNTG  2
            YAH++RQFYRDC + GT+DFVFG+AAVVLQNCTL A++PL  Q+N VTAQGR DPNQ+TG
Sbjct  434  YAHAQRQFYRDCDVAGTVDFVFGNAAVVLQNCTLWARRPLPGQENTVTAQGRRDPNQSTG  493



>ref|XP_009614349.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 46 
[Nicotiana tomentosiformis]
Length=573

 Score =   249 bits (636),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 148/403 (37%), Positives = 213/403 (53%), Gaps = 45/403 (11%)
 Frame = -3

Query  1114  LCRTAIDPAACKTILKQTVKSYGGTPAGLLREFLADYLPSMEAAKMEFGMVRGEF-----  950
             +C   + P +C   L    KS    P  +       Y  S++ A  E      EF     
Sbjct  67    VCDVTLYPQSCYNSLGPLAKSDNLKPQDI-------YKLSVQVAINELSKASDEFFNMPQ  119

Query  949   ----THPREVQAVADCVELMGLSINDVRDAIKDLQGSKTRN-SDAQTSLSAVLTNHLTCM  785
                 + P  V+ +  C EL+ L+++ + +++     S     SD +T LSA  T   TC+
Sbjct  120   VKNISDPMAVKTLGSCHELLSLALDSLNESLSIPSKSLFDGFSDLKTKLSAAGTYQQTCI  179

Query  784   EGL-------------------NPPEKSPVKGILDALISRSRVALAVLAEIIGQTDEEQN  662
             +G                    +      +  I+D  I  S  ++  +  I       + 
Sbjct  180   DGFGDITYASDTASNKLKNSGQHTSNSLSIVDIMDQSIQDSADSIDRMGRI------GRR  233

Query  661   FRVPFNGKFPSWVKSSDRKLVRRKHGN--LKADIIVSQDGKGNFTTLKKAMESVSAVSKA  488
               + F+G FPSW+ S DRKL++   G   +K D++V++DG G+F  +  A+E+V   S  
Sbjct  234   RLMNFDGDFPSWMASKDRKLLQSSKGKSLIKVDVVVAKDGSGDFINISDALEAVPEKSNK  293

Query  487   RVFIYVKKGTYKENVEMNVKS-PVMIYGDGMTQTVFSGDHSFGDNYTTFKSYTLASKGPA  311
             R  IYVKKG Y ENV +  K   VM+ GDGM  T  SG  +F D   TF++ T A  G  
Sbjct  294   RFVIYVKKGVYVENVIVEKKKWNVMMIGDGMDATTVSGSLNFVDGTPTFQTATFAVFGKG  353

Query  310   AILQDLCVRNTAGAAKHQAVALLVGGDKSIINRCRLEGYQDTLYAHSKRQFYRDCTITGT  131
              I +D+  RNTAGAAKHQAVAL+   D S+  RC+ + YQDTLY+HS RQFYR+C+I GT
Sbjct  354   FIARDMGFRNTAGAAKHQAVALMSTADLSVFYRCKFDAYQDTLYSHSNRQFYRECSIYGT  413

Query  130   IDFVFGDAAVVLQNCTLIAKKPLAAQKNMVTAQGRSDPNQNTG  2
             +DF+FG++AVV QNC ++ +KP+  Q N +TAQG+ DPNQNTG
Sbjct  414   VDFIFGNSAVVFQNCHILPRKPMPGQMNTITAQGKIDPNQNTG  456



>gb|KHN43320.1| Putative pectinesterase/pectinesterase inhibitor 22 [Glycine 
soja]
Length=508

 Score =   248 bits (632),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 130/333 (39%), Positives = 200/333 (60%), Gaps = 25/333 (8%)
 Frame = -3

Query  940  REVQAVADCVELMGLSINDVRDAIKDLQGSKTRNSDAQTS------LSAVLTNHLTCMEG  779
            RE QA+ DC EL+  S++++  ++ +++  ++ +++AQ        LSA L+N  TC+EG
Sbjct  67   REQQAIEDCRELLDFSVSELAWSMGEMRRIRSGDTNAQYEGNLEAWLSAALSNQDTCLEG  126

Query  778  LNPPEK---SPVKGILDALISRSRVALAVLAEIIGQTDEEQNFRVPFNG----------K  638
                ++   S + G L  +       L++  ++         F+ P N           +
Sbjct  127  FEGTDRRLESYISGSLTQVTQLISNVLSLYTQL-----HSLPFKPPRNTTTPLTSHETLE  181

Query  637  FPSWVKSSDRKLVRRKHGNLKADIIVSQDGKGNFTTLKKAMESVSAVSKARVFIYVKKGT  458
            FP W+   D++L++ K   ++AD +V+ DG G++ ++  A+ +  + S+ R  IYVKKG 
Sbjct  182  FPEWMSEGDQELLKAKPHGVRADAVVALDGSGHYRSITDAVNAAPSYSQRRYVIYVKKGL  241

Query  457  YKENVEMNVK-SPVMIYGDGMTQTVFSGDHSFGDNYTTFKSYTLASKGPAAILQDLCVRN  281
            YKENV+M  K + +M+ GDG+ QT+ + + +F   +TTF++ TLA  G   I +D+  RN
Sbjct  242  YKENVDMKRKMTNIMLVGDGIGQTIITSNRNFMQGWTTFRTATLAVSGKGFIAKDMSFRN  301

Query  280  TAGAAKHQAVALLVGGDKSIINRCRLEGYQDTLYAHSKRQFYRDCTITGTIDFVFGDAAV  101
            TAG   HQAVAL V  D+S   RC +EG+QDTLYAHS RQFYR+C I GTIDF+FG+ A 
Sbjct  302  TAGPVNHQAVALRVDSDQSAFYRCSVEGHQDTLYAHSLRQFYRECEIYGTIDFIFGNGAA  361

Query  100  VLQNCTLIAKKPLAAQKNMVTAQGRSDPNQNTG  2
            VLQNC +  + PL  QK  +TAQGR  P+Q+TG
Sbjct  362  VLQNCKIYTRVPLPLQKVTITAQGRKSPHQSTG  394



>ref|XP_007204488.1| hypothetical protein PRUPE_ppa019698mg [Prunus persica]
 gb|EMJ05687.1| hypothetical protein PRUPE_ppa019698mg [Prunus persica]
Length=530

 Score =   248 bits (633),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 142/386 (37%), Positives = 223/386 (58%), Gaps = 20/386 (5%)
 Frame = -3

Query  1111  CRTAIDPAACKTILKQTVKSYGGTPA--GLLREFLADYLPSMEAAKMEF-GMVRGEFTHP  941
             C T + P+ C T L  + K++    A   LL   +   + S+E+ +    G+++ +  + 
Sbjct  26    CTTLLHPSLCFTALA-SAKTHDHFTAFHHLLEANINQTVASVESTRQSIKGLLKLQDLYL  84

Query  940   REVQAVADCVELMGLSINDVRDAIKDLQGSKTRNSDAQTSLSAVLTNHLTCMEGLNPPEK  761
             +E  A+ DC+E++  ++ ++  A+ DL G +    + +T LSA +TN  TC++G    E+
Sbjct  85    QERNALKDCLEMLDQTLYELGQAVDDLHGFRVSYGNLKTLLSAAMTNENTCIDGFFELEE  144

Query  760   ----------SPVKGILDALISRSRVALAVLAEIIGQTDEEQNF--RVPFNGKFPSWVKS  617
                         ++G+L  +       LA++       +E++    + P   +FP W+  
Sbjct  145   FDSENQIGLNGHLQGLLAPISELMSDCLAMIRYQEQALNEQKRLVTKKP-KKRFPVWMLP  203

Query  616   SDRKLVRRKHGNLKADIIVSQDGKGNFTTLKKAMESVSAVSKARVFIYVKKGTYKENVEM  437
              DR L++R+   +KADI+V+ DG G++ T+ +A++    +S+ R  I +K G Y E VE+
Sbjct  204   GDRNLMQRE-PTMKADIVVAADGNGDYETIGEALKMAPNMSRTRFVIKIKAGVYNETVEI  262

Query  436   N-VKSPVMIYGDGMTQTVFSGDHSFGDNYTTFKSYTLASKGPAAILQDLCVRNTAGAAKH  260
             +  K+ +M+ GDGM  T+ +G  SF D ++TF + TL   G   + +DL + NTAG+ K 
Sbjct  263   SREKANIMLVGDGMNTTIITGSKSFADGFSTFATATLTVIGDRFLARDLTITNTAGSKKF  322

Query  259   QAVALLVGGDKSIINRCRLEGYQDTLYAHSKRQFYRDCTITGTIDFVFGDAAVVLQNCTL  80
             QAVA  V  + S    C    YQDTLY HS RQFYRDC I GTIDF+FG+AA V QNCT+
Sbjct  323   QAVAARVTSN-SAFYHCNFSSYQDTLYVHSLRQFYRDCIIEGTIDFIFGNAAAVFQNCTV  381

Query  79    IAKKPLAAQKNMVTAQGRSDPNQNTG  2
             I +KP+  QK M+TAQGR+DPNQNTG
Sbjct  382   IVRKPIPGQKLMITAQGRTDPNQNTG  407



>ref|XP_010257625.1| PREDICTED: pectinesterase 2-like [Nelumbo nucifera]
Length=527

 Score =   248 bits (633),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 137/316 (43%), Positives = 191/316 (60%), Gaps = 12/316 (4%)
 Frame = -3

Query  940  REVQAVADCVELMGLSINDVRDAIKDLQGSKTRNSDAQTSLSAVLTNHLTCMEGLNPPEK  761
            RE  A  DC++L   +I  +   +  +  +   +SD QT LS  LTN  TC  G+    +
Sbjct  100  RERAAWVDCLKLYEDTILQLNRTLNPI--ANCTDSDTQTWLSTALTNLDTCKAGI---VE  154

Query  760  SPVKGILDALISRSRVALAVLAEIIGQTDEEQNFRVPFNGKFPSWVKSSDRKLVRRKHGN  581
              V  +L  L+S +   L   A  I     EQ     + G FP+WV ++DRKL++     
Sbjct  155  LGVSDVLLPLVSNNVSHLISNALAINDIPSEQQ---NYTGGFPTWVSAADRKLLQSSSLA  211

Query  580  LKADIIVSQDGKGNFTTLKKAMESVSAVSKA--RVFIYVKKGTYKENVEMNVKSP-VMIY  410
             +A+++V+QDG G+F T+K A+ + S + +   R  IYVK G Y+EN+E+    P +M+ 
Sbjct  212  SRANLVVAQDGSGHFRTIKAAISAASKLRRGSRRFIIYVKAGVYRENIEIGNNMPNIMLI  271

Query  409  GDGMTQTVFSGDHSFGDNYTTFKSYTLASKGPAAILQDLCVRNTAGAAKHQAVALLVGGD  230
            GDGM +T+ +G  S    YTTF S T+A  G   +   +  RNTAG    QAVAL+ G D
Sbjct  272  GDGMRRTLITGSRSVRKGYTTFNSATVAVSGERFVATGITFRNTAGPLS-QAVALVSGSD  330

Query  229  KSIINRCRLEGYQDTLYAHSKRQFYRDCTITGTIDFVFGDAAVVLQNCTLIAKKPLAAQK  50
             S+  RC   GYQDTLY HS+RQFY+ C I GTIDF+FG+AAVVLQNC ++A++PL  Q 
Sbjct  331  LSVFYRCGFIGYQDTLYVHSQRQFYKQCYIYGTIDFIFGNAAVVLQNCMIVARRPLHGQA  390

Query  49   NMVTAQGRSDPNQNTG  2
            N++TAQGRSDP+QNTG
Sbjct  391  NVITAQGRSDPHQNTG  406



>ref|XP_006841486.1| hypothetical protein AMTR_s00003p00120050 [Amborella trichopoda]
 gb|ERN03161.1| hypothetical protein AMTR_s00003p00120050 [Amborella trichopoda]
Length=540

 Score =   248 bits (633),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 137/325 (42%), Positives = 199/325 (61%), Gaps = 17/325 (5%)
 Frame = -3

Query  931  QAVADCVELMGLSINDVRDAIKDLQGSKTRNS--DAQTSLSAVLTNHLTCMEGLNPPEKS  758
            +A++DC EL+  S+ D+   + DL  S +R+S    QT LSA +TN  TC++G +    +
Sbjct  96   RALSDCEELLSTSLGDISSCLADLSNSSSRSSSIHLQTFLSAAITNQYTCLDGFSYANHT  155

Query  757  PVKGILDALISRSRV---ALAVL-----AEIIGQTDEEQNF----RVPFNGKFPSWVKSS  614
                I   +++ SR    +LA+      +E+   +D  + F    RV  +G FP+W+   
Sbjct  156  LRSRIEANIVNISRHISNSLAMFKKVRASELPENSDSGEVFEEYGRV--DGGFPAWIPPK  213

Query  613  DRKLVRRKHGNLKADIIVSQDGKGNFTTLKKAMESVSAVSKARVFIYVKKGTYKENVEM-  437
            DR+L++       AD++V++DG G+FTT+ +A+  V    K R  IY+K G Y ENV++ 
Sbjct  214  DRRLLQASANQTNADLVVAKDGSGDFTTISEAIAKVPDNGKTRFVIYIKTGEYLENVDVG  273

Query  436  NVKSPVMIYGDGMTQTVFSGDHSFGDNYTTFKSYTLASKGPAAILQDLCVRNTAGAAKHQ  257
              K+ +M+ GDG+ +TV     +  D +TTF+S T A  G   I +D+   N+AG +KHQ
Sbjct  274  EKKTNLMLIGDGIEKTVVKASRNVVDGWTTFRSATFAVVGSNFIARDMSFENSAGPSKHQ  333

Query  256  AVALLVGGDKSIINRCRLEGYQDTLYAHSKRQFYRDCTITGTIDFVFGDAAVVLQNCTLI  77
            AVAL  G D S   RC   GYQDTLY HS RQFYR+C + GT+DF+FG+AAVVLQ+C L 
Sbjct  334  AVALRSGADLSAFYRCSFVGYQDTLYVHSLRQFYRECDVYGTVDFIFGNAAVVLQDCNLY  393

Query  76   AKKPLAAQKNMVTAQGRSDPNQNTG  2
            A++P   Q+N+ TAQGR DPNQNTG
Sbjct  394  ARRPNPNQRNLFTAQGRVDPNQNTG  418



>gb|AER38244.1| PME5 [Gossypium barbadense]
Length=519

 Score =   248 bits (632),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 153/381 (40%), Positives = 203/381 (53%), Gaps = 26/381 (7%)
 Frame = -3

Query  1114  LCRTAIDPAACKTILKQTVKSYGGTPAGLLREF--LADYLPSMEAAKMEFGM------VR  959
              CR   +P  C+  L    K    TP     +F  +  +L    AA+ E          R
Sbjct  34    WCRKTPNPQPCEYFLSHDPKK---TPTKDEFQFFKIPTHLALERAARAESNTHSLGTKCR  90

Query  958   GEFTHPREVQAVADCVELMGLSINDVRDAIKDLQGSKTRNSDAQTSLSAVLTNHLTCMEG  779
              E    RE  A +DCV L  L+I  +   +    G+     DAQT LS  LTN  TC  G
Sbjct  91    SE----REKAAWSDCVNLYELTILRLNKTVD--SGTNLNKDDAQTWLSTALTNLETCRTG  144

Query  778   LNPPEKSPVKGILDALISRSRVALAVLAEIIGQTDEEQNFRVPFNGKFPSWVKSSDRKLV  599
                       G+ D L+      ++ L       ++       +   FP+WVK  DRKL+
Sbjct  145   FME------LGVPDHLLPMMSNNVSQLISNTLALNKAPYKEPTYKDGFPTWVKPGDRKLL  198

Query  598   RRKHGNLKADIIVSQDGKGNFTTLKKAMESVSAVS-KARVFIYVKKGTYKENVEMNVK-S  425
             +       A+I+V+QDG GN+ T+K A+ + S  S   R  IYVK GTYKENVE+  K  
Sbjct  199   QSSSPASTANIVVAQDGSGNYKTIKDAISAASKRSGSGRYVIYVKAGTYKENVEIGSKLK  258

Query  424   PVMIYGDGMTQTVFSGDHSFGDNYTTFKSYTLASKGPAAILQDLCVRNTAGAAKHQAVAL  245
              +M+ GDG+ +T+ +G  S G   TTF S T+A  G   I + +  RNTAG   HQAVAL
Sbjct  259   NIMMVGDGIGKTIITGSKSVGGGSTTFNSATVAVVGDGFIARGITFRNTAGPTNHQAVAL  318

Query  244   LVGGDKSIINRCRLEGYQDTLYAHSKRQFYRDCTITGTIDFVFGDAAVVLQNCTLIAKKP  65
               G D S+  +C  EGYQDTLY HS+RQFYR+C I GT+D++FG+AAVV QNC + A+ P
Sbjct  319   RSGSDLSVFYKCSFEGYQDTLYVHSERQFYRECDIYGTVDWIFGNAAVVFQNCNIYARNP  378

Query  64    LAAQKNMVTAQGRSDPNQNTG  2
                + N VTAQGR+DPNQNTG
Sbjct  379   -PNKTNTVTAQGRTDPNQNTG  398



>gb|KEH24404.1| pectinesterase/pectinesterase inhibitor [Medicago truncatula]
Length=557

 Score =   248 bits (634),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 135/324 (42%), Positives = 193/324 (60%), Gaps = 14/324 (4%)
 Frame = -3

Query  931  QAVADCVELMGLSINDVRDAIKDLQGSKT-----RNSDAQTSLSAVLTNHLTCMEGLNPP  767
            +A+ DCV L   +I++++  I DL  ++T        D QT LS  +TN  TC++G    
Sbjct  112  RALEDCVNLFDTTIDELKTTISDLSQTQTTVASSSKRDCQTLLSGAMTNVYTCLDGFAYS  171

Query  766  E---KSPVKGILDALISRSRVALAVLAEIIG-QTDEEQNFRVPFNGK----FPSWVKSSD  611
            +   +  ++  L+ + S    +LA+L ++ G +T   ++   P  GK    FPSWV   D
Sbjct  172  KSKLRKKIEAKLNDISSHVSNSLAMLKKVPGVKTKASESETFPEYGKVKDGFPSWVSPKD  231

Query  610  RKLVRRKHGNLKADIIVSQDGKGNFTTLKKAMESVSAVSKARVFIYVKKGTYKENVE-MN  434
            RKL++      K D++V++DG GNF T+ +A+ +    S  R  I++K G Y ENVE + 
Sbjct  232  RKLLQAAVNQTKFDLVVAKDGTGNFATIGEAIAAAPNSSATRFVIHIKAGAYFENVEVIK  291

Query  433  VKSPVMIYGDGMTQTVFSGDHSFGDNYTTFKSYTLASKGPAAILQDLCVRNTAGAAKHQA  254
             K+ +M+ GDG+ QTV     +  D +TTF+S T A  G   I + +   N+AG +KHQA
Sbjct  292  KKTNLMLVGDGIGQTVVKASRNVVDGWTTFQSSTFAVVGDKFIAKGITFENSAGPSKHQA  351

Query  253  VALLVGGDKSIINRCRLEGYQDTLYAHSKRQFYRDCTITGTIDFVFGDAAVVLQNCTLIA  74
            VA+  G D S   +C    YQDTLY HS RQFYR+C + GT+DF+FG+AAVV QNC L A
Sbjct  352  VAVRNGADFSAFYQCSFVAYQDTLYVHSLRQFYRECDVYGTVDFIFGNAAVVFQNCNLYA  411

Query  73   KKPLAAQKNMVTAQGRSDPNQNTG  2
            +KP   QKN+ TAQGR DPNQNTG
Sbjct  412  RKPDPKQKNLFTAQGREDPNQNTG  435



>ref|XP_004144445.1| PREDICTED: pectinesterase 3-like [Cucumis sativus]
 ref|XP_004171375.1| PREDICTED: pectinesterase 3-like [Cucumis sativus]
 gb|KGN58475.1| hypothetical protein Csa_3G646620 [Cucumis sativus]
Length=576

 Score =   249 bits (635),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 148/390 (38%), Positives = 220/390 (56%), Gaps = 30/390 (8%)
 Frame = -3

Query  1114  LCRTAIDPAACKTILKQTVKSYGGTPAGLLREFL---ADYLPSMEAAKMEFGMVRGEFTH  944
             LC     P++C++ L+ +  +    P  L +  L    D L  +      F    G+   
Sbjct  80    LCSVTQYPSSCQSSLQNSNTT---DPVFLFKLSLRVATDSLSKLSDYTSNFNSTTGD---  133

Query  943   PREVQAVADCVELMGLSINDVRDAIKDLQG--------SKTRNSDAQTSLSAVLTNHLTC  788
             P+   A+  C  +   +I+ + D +  ++         S +R  D +T LS  +T+  TC
Sbjct  134   PKVEAAIKICRSVFEDAIDTLNDTVSSMEVDRHSEKFLSPSRIEDLKTWLSTTITDQETC  193

Query  787   MEGLNPPEKSPVKGILDALISRSRV----ALAVLAEIIGQTDEEQNFRVPFNGKF---PS  629
             ++ L    ++ V   L   ++ S      +LA++ +I+G      +F +P + K    P 
Sbjct  194   LDALRDLNQTTVLQDLQTAMANSTEFTSNSLAIVTKILGLL---ADFNIPIHRKLMGLPE  250

Query  628   WVKSSDRKLVRRKHGNLKADIIVSQDGKGNFTTLKKAMESVSAVSKARVFIYVKKGTYKE  449
             WV S DR+L+  +  N+ A + VS+DGKG +TT++ A+ +V   SK R  I+VK+G Y+E
Sbjct  251   WVSSGDRRLL--QENNVTAHVTVSKDGKGQYTTIQDAVAAVPKKSKERFIIHVKEGIYEE  308

Query  448   NVEMN-VKSPVMIYGDGMTQTVFSGDHSFGDNYTTFKSYTLASKGPAAILQDLCVRNTAG  272
             NV ++  K  VM+YGDG T+T+ SG  +F D   TF + T A  G   I +D+   NTAG
Sbjct  309   NVILDKSKWNVMMYGDGRTKTIVSGHLNFIDGTPTFSTATFAVAGKGFIGKDMGFINTAG  368

Query  271   AAKHQAVALLVGGDKSIINRCRLEGYQDTLYAHSKRQFYRDCTITGTIDFVFGDAAVVLQ  92
              AKHQAVA   G D S+++ C  +GYQDTLYAHS RQFYRDC ITGTIDF+FG+AAVV Q
Sbjct  369   PAKHQAVAFRSGSDLSVMSGCSFDGYQDTLYAHSNRQFYRDCDITGTIDFIFGNAAVVFQ  428

Query  91    NCTLIAKKPLAAQKNMVTAQGRSDPNQNTG  2
             NC +  ++PL  Q N +TAQG+ D NQN+G
Sbjct  429   NCNIRPRQPLPNQFNTITAQGKKDINQNSG  458



>ref|XP_010447268.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 44 
[Camelina sativa]
Length=529

 Score =   248 bits (632),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 144/355 (41%), Positives = 198/355 (56%), Gaps = 44/355 (12%)
 Frame = -3

Query  955  EFTHPREVQ-AVADCVELMGLSINDVRDAIKDLQGSKTRN-------SDAQTSLSAVLTN  800
            +F+  R +Q AV+DC++L+  S  ++  +    +  K +        SD +T LSA L+N
Sbjct  59   DFSGDRRLQNAVSDCLDLLDFSSEELSWSASASENPKGKGNGTGNVASDTRTWLSAALSN  118

Query  799  HLTCMEGLNPPE---KSPVKGILDALISRSRVALAVLAEIIGQTDEEQNFRVPFNG----  641
              TC EG +      KS + G LD L S  R  L ++     QTDE+     P +     
Sbjct  119  QDTCREGFDGTTGLVKSLIAGSLDQLYSMLRELLPLV-----QTDEKPTITKPISKPGPI  173

Query  640  ---------------------KFPSWVKSSDRKLVRRKHGNLKADIIVSQDGKGNFTTLK  524
                                 +FP WV+S DRKL+  +      D+ V+ DG GNFT + 
Sbjct  174  AKGPKNPPGRTLRDTNDDESLQFPDWVRSDDRKLL--ESNGRSYDVSVALDGTGNFTKIM  231

Query  523  KAMESVSAVSKARVFIYVKKGTYKENVEMNVKS-PVMIYGDGMTQTVFSGDHSFGDNYTT  347
             A+E V   S  R  IY+KKG Y ENVE+  K   +++ GDG+  T+ SG+ +F D +TT
Sbjct  232  DAIEQVPDYSSTRFVIYIKKGLYLENVEIKKKKWNIVMLGDGIDVTIISGNRNFIDGWTT  291

Query  346  FKSYTLASKGPAAILQDLCVRNTAGAAKHQAVALLVGGDKSIINRCRLEGYQDTLYAHSK  167
            F+S T A  G   + +D+  +NTAG  KHQAVAL    D S+  RC + GYQDTLY H+ 
Sbjct  292  FRSATFAVSGRGFLARDITFQNTAGPEKHQAVALRSDSDLSVFYRCAMRGYQDTLYTHTM  351

Query  166  RQFYRDCTITGTIDFVFGDAAVVLQNCTLIAKKPLAAQKNMVTAQGRSDPNQNTG  2
            RQFYR+CTITGT+DF+FGD  VV QNC ++AK+ L  QKN +TAQGR D NQ +G
Sbjct  352  RQFYRECTITGTVDFIFGDGTVVFQNCQILAKRGLPNQKNTITAQGRKDMNQPSG  406



>ref|XP_009149756.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 34 
[Brassica rapa]
Length=604

 Score =   249 bits (636),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 148/334 (44%), Positives = 198/334 (59%), Gaps = 20/334 (6%)
 Frame = -3

Query  943  PREVQAVADCVELMGLSINDVRDAIKDL---QGSKTRNSDAQTSLSAVLTNHLTCMEGLN  773
            PR   A   CVEL+  S++ +  A+  +    G +T+  D  T LS+ LTNH TC EG +
Sbjct  148  PRVRSAYESCVELLDDSVDALTRALSSVVSVSGGQTKPQDVMTWLSSALTNHDTCTEGFD  207

Query  772  PPEKSPVKG-ILDALISRSRVA---LAVLAEIIGQTD----EEQNFRV-------PFNGK  638
                  VK  + DAL + S +    LA+ A   G  D      QN R+         N K
Sbjct  208  GVGDGGVKDQMTDALKNLSELVSNCLAIFAASGGGDDFAGVPIQNRRLLEVGGGGDRNMK  267

Query  637  FPSWVKSSDRKLVRRKHGNLKADIIVSQDGKGNFTTLKKAMESVSAVSKARVFIYVKKGT  458
            FP W K  +R+L+      ++ADIIVS+DG G   T+ +A++     S  R  IYVK G 
Sbjct  268  FPRWTKRRERELLEMPVSQIQADIIVSKDGNGTCKTISEAIKKAPQHSTRRTIIYVKAGR  327

Query  457  YKE-NVEMNVKS-PVMIYGDGMTQTVFSGDHSFGDNYTTFKSYTLASKGPAAILQDLCVR  284
            Y+E N+++  K   +M  GDG  +TV SG  S  DN TTF + + A+ G   I +D+  +
Sbjct  328  YEEKNLKVGRKKINLMFVGDGKGKTVISGGKSIFDNITTFHTASFAATGAGFIARDITFQ  387

Query  283  NTAGAAKHQAVALLVGGDKSIINRCRLEGYQDTLYAHSKRQFYRDCTITGTIDFVFGDAA  104
            N AG  KHQAVAL VG D ++I RC + GYQDTLY HS RQF+R+C I GT+DF+FG+AA
Sbjct  388  NWAGPEKHQAVALRVGADHAVIYRCSIIGYQDTLYVHSNRQFFRECDIYGTVDFIFGNAA  447

Query  103  VVLQNCTLIAKKPLAAQKNMVTAQGRSDPNQNTG  2
            VVLQNC++ A+KP+A QKN +TAQ R DPNQNTG
Sbjct  448  VVLQNCSIYARKPMALQKNTITAQNRKDPNQNTG  481



>emb|CAB36796.1| pectinesterase-like protein [Arabidopsis thaliana]
 emb|CAB80039.1| pectinesterase-like protein [Arabidopsis thaliana]
Length=477

 Score =   246 bits (628),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 143/353 (41%), Positives = 197/353 (56%), Gaps = 43/353 (12%)
 Frame = -3

Query  955  EFTHPREVQ-AVADCVELMGLSINDVRDAIKDLQGSKTRN-------SDAQTSLSAVLTN  800
            +F+  R +Q AV+DC++L+  S  ++  +    +  K +        SD +T LSA L+N
Sbjct  10   DFSGDRRLQNAVSDCLDLLDFSSEELTWSASASENPKGKGNGTGDVGSDTRTWLSAALSN  69

Query  799  HLTCMEGLNPPE---KSPVKGILDALISRSRVALAVL-----------------------  698
              TCMEG +      KS V G LD L S  R  L ++                       
Sbjct  70   QATCMEGFDGTSGLVKSLVAGSLDQLYSMLRELLPLVQPEQKPKAVSKPGPIAKGPKAPP  129

Query  697  AEIIGQTDEEQNFRVPFNGKFPSWVKSSDRKLVRRKHGNLKADIIVSQDGKGNFTTLKKA  518
               +  TDE+++       +FP WV+  DRKL+  +      D+ V+ DG GNFT +  A
Sbjct  130  GRKLRDTDEDESL------QFPDWVRPDDRKLL--ESNGRTYDVSVALDGTGNFTKIMDA  181

Query  517  MESVSAVSKARVFIYVKKGTYKENVEMNVKS-PVMIYGDGMTQTVFSGDHSFGDNYTTFK  341
            ++     S  R  IY+KKG Y ENVE+  K   +++ GDG+  TV SG+ SF D +TTF+
Sbjct  182  IKKAPDYSSTRFVIYIKKGLYLENVEIKKKKWNIVMLGDGIDVTVISGNRSFIDGWTTFR  241

Query  340  SYTLASKGPAAILQDLCVRNTAGAAKHQAVALLVGGDKSIINRCRLEGYQDTLYAHSKRQ  161
            S T A  G   + +D+  +NTAG  KHQAVAL    D S+  RC + GYQDTLY H+ RQ
Sbjct  242  SATFAVSGRGFLARDITFQNTAGPEKHQAVALRSDSDLSVFFRCAMRGYQDTLYTHTMRQ  301

Query  160  FYRDCTITGTIDFVFGDAAVVLQNCTLIAKKPLAAQKNMVTAQGRSDPNQNTG  2
            FYR+CTITGT+DF+FGD  VV QNC ++AK+ L  QKN +TAQGR D NQ +G
Sbjct  302  FYRECTITGTVDFIFGDGTVVFQNCQILAKRGLPNQKNTITAQGRKDVNQPSG  354



>ref|XP_010437787.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 44 
[Camelina sativa]
Length=527

 Score =   247 bits (631),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 145/353 (41%), Positives = 198/353 (56%), Gaps = 42/353 (12%)
 Frame = -3

Query  955  EFTHPREVQ-AVADCVELMGLSINDVRDAIKDLQGSKTRN-------SDAQTSLSAVLTN  800
            +F+  R +Q AV+DC++L+  S  ++  +    +  K +        SD +T LSA L+N
Sbjct  59   DFSGDRRLQNAVSDCLDLLDFSSEELSWSASASENPKGKGNGTGNVASDTRTWLSAALSN  118

Query  799  HLTCMEGLNPPE---KSPVKGILDALISRSRVALAVLAEIIGQTDEEQNFRVPFNG----  641
              TC EG +      KS + G LD L S  R  L ++     QTDE+    +   G    
Sbjct  119  QDTCREGFDGTSGLVKSLIAGSLDQLYSMLRELLPLV-----QTDEKPTKPISKPGPIAK  173

Query  640  -------------------KFPSWVKSSDRKLVRRKHGNLKADIIVSQDGKGNFTTLKKA  518
                               +FP WV+S DRKL+  +      D+ V+ DG GNFT +  A
Sbjct  174  GPKAPPGRTLRDTDDHESLQFPDWVRSDDRKLL--ESNGRSYDVSVALDGTGNFTKIMDA  231

Query  517  MESVSAVSKARVFIYVKKGTYKENVEMNVKS-PVMIYGDGMTQTVFSGDHSFGDNYTTFK  341
            +E V   S  R  IY+KKG Y ENVE+  K   +++ GDG+  T+ SG+ SF D +TTF+
Sbjct  232  IEQVPDYSSTRFVIYIKKGLYLENVEIKKKKWNIVMLGDGIDVTIISGNRSFIDGWTTFR  291

Query  340  SYTLASKGPAAILQDLCVRNTAGAAKHQAVALLVGGDKSIINRCRLEGYQDTLYAHSKRQ  161
            S T A  G   + +D+  +NTAG  KHQAVAL    D S+  RC + GYQDTLY H+ RQ
Sbjct  292  SATFAVSGRGFLARDITFQNTAGPEKHQAVALRSDSDLSVFYRCAMRGYQDTLYTHTMRQ  351

Query  160  FYRDCTITGTIDFVFGDAAVVLQNCTLIAKKPLAAQKNMVTAQGRSDPNQNTG  2
            FYR+CTITGT+DF+FGD  VV QNC ++AK+ L  QKN +TAQGR D NQ +G
Sbjct  352  FYRECTITGTVDFIFGDGTVVFQNCQILAKRGLPNQKNTITAQGRKDMNQPSG  404



>ref|XP_006412377.1| hypothetical protein EUTSA_v10024900mg [Eutrema salsugineum]
 gb|ESQ53830.1| hypothetical protein EUTSA_v10024900mg [Eutrema salsugineum]
Length=525

 Score =   247 bits (631),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 144/352 (41%), Positives = 200/352 (57%), Gaps = 41/352 (12%)
 Frame = -3

Query  955  EFTHPREVQ-AVADCVELMGLSINDV-------RDAIKDLQGSKTRNSDAQTSLSAVLTN  800
            EF+  R +Q AV+DC++L+  S  ++        +      G+    SD +T LSA L+N
Sbjct  58   EFSGDRRLQNAVSDCLDLLDFSSEELSWSASASENPTGKGNGTGNVGSDTKTWLSAALSN  117

Query  799  HLTCMEGLNPPE---KSPVKGILDALISRSRVALAVLAEIIGQTDEEQ------------  665
              TCMEG +      KS V G LD L S  R  L ++     Q D++Q            
Sbjct  118  QDTCMEGFDGTSGLVKSLVAGSLDQLYSMLRDLLPLV-----QPDQKQKPISKPGPIAKG  172

Query  664  ----------NFRVPFNGKFPSWVKSSDRKLVRRKHGNLKADIIVSQDGKGNFTTLKKAM  515
                      N +   + +FP WV+S+DRKL+  +   +  D+ V+ DG GNFT +  A+
Sbjct  173  PRAPPGRRLRNTKDNESRRFPDWVRSNDRKLL--ETNGVSYDVSVALDGTGNFTNIMDAI  230

Query  514  ESVSAVSKARVFIYVKKGTYKENVEMNVKS-PVMIYGDGMTQTVFSGDHSFGDNYTTFKS  338
            +     S  R  IY+KKG Y ENVE+  K   +++ GDG+  T+ SG+ SF D +TTF+S
Sbjct  231  KEAPDYSSKRYVIYIKKGLYLENVEIKKKKWNLVMLGDGIDVTIISGNRSFVDGWTTFRS  290

Query  337  YTLASKGPAAILQDLCVRNTAGAAKHQAVALLVGGDKSIINRCRLEGYQDTLYAHSKRQF  158
             T A  G   + +D+  +NTAG  KHQAVAL    D S+  RC + GYQDTLY H+ RQF
Sbjct  291  ATFAVSGRGFLARDITFQNTAGPEKHQAVALRSDSDLSVFYRCAMRGYQDTLYTHTMRQF  350

Query  157  YRDCTITGTIDFVFGDAAVVLQNCTLIAKKPLAAQKNMVTAQGRSDPNQNTG  2
            YR+CTITGT+DF+FGD  VV QNC ++A++ L  QKN +TAQGR D NQ +G
Sbjct  351  YRECTITGTVDFIFGDGTVVFQNCQILARRGLPNQKNTITAQGRKDFNQPSG  402



>ref|XP_002463382.1| hypothetical protein SORBIDRAFT_02g042780 [Sorghum bicolor]
 gb|EER99903.1| hypothetical protein SORBIDRAFT_02g042780 [Sorghum bicolor]
Length=599

 Score =   249 bits (635),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 141/338 (42%), Positives = 196/338 (58%), Gaps = 27/338 (8%)
 Frame = -3

Query  940  REVQAVADCVELMGLSINDVRDAIKDLQGSKTRN-----------SDAQTSLSAVLTNHL  794
            R+  A++DCVEL+  ++  +  A  +L  + +             +  QT LSA LTN  
Sbjct  142  RDRLALSDCVELLQHTLAQLGTAEAELSAANSSTSTSTSTDEESVAGVQTVLSAALTNQY  201

Query  793  TCMEGLNPPEKSP-------VKGILDALISRSRVALAVLAEIIGQTDEEQNFRVPFNGK-  638
            TC++G   P  S        ++G +  +      +LA+L  +  +        +   G  
Sbjct  202  TCLDGFAGPSASEDGRVRPYIQGRIYHVAHLVSNSLAMLRRLPQRRRRRGREALELEGYG  261

Query  637  -----FPSWVKSSDRKLVRRKHGNLKADIIVSQDGKGNFTTLKKAMESVSAVSKARVFIY  473
                 FPSWV ++DR+  R +   +  D++V++DG GNFTT+ +A+ +    S++R  IY
Sbjct  262  RVRRGFPSWVSAADRR--RLQQQQVVPDLVVAKDGSGNFTTVGEAVAAAPNNSESRFVIY  319

Query  472  VKKGTYKENVEM-NVKSPVMIYGDGMTQTVFSGDHSFGDNYTTFKSYTLASKGPAAILQD  296
            +K G Y ENVE+ + K+ +M  GDGM +TV     +  DN TTF+S TLA  G   + +D
Sbjct  320  IKAGGYFENVEVGSEKTNLMFVGDGMWKTVIKASRNVVDNSTTFRSATLAVVGTGFLARD  379

Query  295  LCVRNTAGAAKHQAVALLVGGDKSIINRCRLEGYQDTLYAHSKRQFYRDCTITGTIDFVF  116
            L V N AG +KHQAVAL V  D +   RC   GYQDTLYAHS RQFYRDC + GT+DFVF
Sbjct  380  LTVENAAGPSKHQAVALRVNADLAAFYRCSFAGYQDTLYAHSLRQFYRDCDVYGTVDFVF  439

Query  115  GDAAVVLQNCTLIAKKPLAAQKNMVTAQGRSDPNQNTG  2
            GDAA VLQ C+L A++P   QKN+VTAQGR DPNQNTG
Sbjct  440  GDAAAVLQGCSLYARRPGPGQKNVVTAQGREDPNQNTG  477



>ref|XP_010556724.1| PREDICTED: pectinesterase-like [Tarenaya hassleriana]
Length=547

 Score =   248 bits (632),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 139/320 (43%), Positives = 192/320 (60%), Gaps = 11/320 (3%)
 Frame = -3

Query  943  PREVQAVADCVELMGLSINDVRDAIKDLQGSKTRNS--DAQTSLSAVLTNHLTCMEGLNP  770
            PR+ +A+ DC+EL+G +  D+ DA+ DL          D QT LSA +TN  TC++G   
Sbjct  110  PRDSRALEDCLELLGDTAGDLDDALADLHSPSAAREFYDLQTLLSAAMTNQYTCLDGFAF  169

Query  769  PEKSPV----KGILDALISRSRV---ALAVLAEIIGQTDEEQNFRVPFNGKFPSWVKSSD  611
             E++        I D+L + SR    +LA+L EI  +      +    NG FP+WV  SD
Sbjct  170  NERNRKYRVRDSIKDSLFNISRHVSNSLAMLQEIPAKPGVFPEYGRVENGGFPTWVSRSD  229

Query  610  RKLVRRKHGNLKA-DIIVSQDGKGNFTTLKKAMESVSAVSKARVFIYVKKGTYKENVEMN  434
            R+L++    + K  D++V++DG GNFTT+  A+ +    S  R  IY+K+G Y ENVE+ 
Sbjct  230  RRLLQAPANDTKLFDLVVAKDGTGNFTTVSAAVAAAPNSSTTRFVIYIKEGAYFENVEVG  289

Query  433  -VKSPVMIYGDGMTQTVFSGDHSFGDNYTTFKSYTLASKGPAAILQDLCVRNTAGAAKHQ  257
              K+ +M+ GDG+ +TV   + +  D +TTF+S T+A  G   I + +   N AG  KHQ
Sbjct  290  RKKTMLMLVGDGIGKTVVKANRNVVDGWTTFRSATVAVVGNGFIAKGITFENFAGPTKHQ  349

Query  256  AVALLVGGDKSIINRCRLEGYQDTLYAHSKRQFYRDCTITGTIDFVFGDAAVVLQNCTLI  77
            AVAL  G D S    C   GYQDTLY HS RQF+R+C I GT+DF+FG+AAVV QNC L 
Sbjct  350  AVALRSGSDHSAFYLCSFVGYQDTLYVHSFRQFFRECDIYGTVDFIFGNAAVVFQNCNLY  409

Query  76   AKKPLAAQKNMVTAQGRSDP  17
            A+KP   QKN+ TAQGR DP
Sbjct  410  ARKPNPNQKNIYTAQGREDP  429



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3723430368294