BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c57640_g1_i1 len=103 path=[1:0-102]

Length=103
                                                                      Score     E

ref|XP_009599386.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     65.9    3e-11   
ref|XP_006353193.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     65.5    4e-11   
ref|XP_004250128.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     65.5    4e-11   
ref|XP_009760570.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     65.5    4e-11   
gb|EYU34569.1|  hypothetical protein MIMGU_mgv1a004816mg              63.5    2e-10   
ref|XP_010681038.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     62.4    5e-10   
ref|XP_004137180.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     62.4    5e-10   
gb|EYU34572.1|  hypothetical protein MIMGU_mgv1a026854mg              60.8    6e-10   
ref|XP_010681039.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     62.0    9e-10   
gb|EPS64505.1|  hypothetical protein M569_10277                       61.6    9e-10   
ref|XP_011097507.1|  PREDICTED: protein TRANSPARENT TESTA 12          61.2    2e-09   
emb|CBI41036.3|  unnamed protein product                              60.8    2e-09   
gb|KDP29740.1|  hypothetical protein JCGZ_18675                       60.8    2e-09   
ref|XP_008383420.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     60.8    2e-09   
ref|XP_010647092.1|  PREDICTED: protein TRANSPARENT TESTA 12          60.5    2e-09   
ref|XP_007205111.1|  hypothetical protein PRUPE_ppa004771mg           60.5    3e-09   
emb|CAN73286.1|  hypothetical protein VITISV_009768                   60.5    3e-09   Vitis vinifera
ref|XP_008235361.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     60.5    3e-09   
ref|XP_010681037.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     60.5    3e-09   
ref|XP_007047830.1|  MATE efflux family protein                       60.5    3e-09   
gb|KDO60642.1|  hypothetical protein CISIN_1g011371mg                 59.3    3e-09   
ref|XP_006426305.1|  hypothetical protein CICLE_v10025480mg           59.3    3e-09   
ref|XP_004489769.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     60.1    3e-09   
ref|XP_003517710.1|  PREDICTED: protein TRANSPARENT TESTA 12          60.1    4e-09   
gb|KHN14526.1|  Protein TRANSPARENT TESTA 12                          60.1    4e-09   
ref|XP_010681034.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...  60.1    4e-09   
ref|XP_009117173.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     57.8    4e-09   
ref|XP_010681036.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...  59.7    4e-09   
ref|XP_010681035.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...  59.7    5e-09   
gb|KDO60639.1|  hypothetical protein CISIN_1g011371mg                 59.7    5e-09   
ref|XP_006466280.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     59.7    5e-09   
gb|KDO60638.1|  hypothetical protein CISIN_1g011371mg                 59.7    5e-09   
gb|KDO60641.1|  hypothetical protein CISIN_1g011371mg                 59.7    5e-09   
ref|XP_006426307.1|  hypothetical protein CICLE_v10025480mg           59.7    5e-09   
ref|XP_006426304.1|  hypothetical protein CICLE_v10025480mg           59.7    5e-09   
gb|KDO60640.1|  hypothetical protein CISIN_1g011371mg                 59.3    6e-09   
ref|XP_010106306.1|  Protein TRANSPARENT TESTA 12                     59.3    6e-09   
ref|XP_003519833.2|  PREDICTED: protein TRANSPARENT TESTA 12-like     59.3    7e-09   
gb|KHN00401.1|  Protein TRANSPARENT TESTA 12                          59.3    7e-09   
ref|XP_002533972.1|  multidrug resistance pump, putative              59.3    7e-09   Ricinus communis
ref|XP_002310871.1|  hypothetical protein POPTR_0007s14390g           58.9    8e-09   Populus trichocarpa [western balsam poplar]
ref|XP_004308030.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     58.5    1e-08   
ref|XP_004289485.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     58.2    1e-08   
ref|XP_009112179.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     57.8    2e-08   
ref|XP_006394040.1|  hypothetical protein EUTSA_v100040871mg          55.1    3e-08   
ref|XP_007158392.1|  hypothetical protein PHAVU_002G149300g           57.4    3e-08   
ref|NP_001132745.1|  uncharacterized protein LOC100194232             54.3    4e-08   Zea mays [maize]
ref|XP_002533973.1|  multidrug resistance pump, putative              57.0    4e-08   Ricinus communis
emb|CDP01535.1|  unnamed protein product                              57.0    4e-08   
ref|XP_011021836.1|  PREDICTED: protein TRANSPARENT TESTA 12          57.0    5e-08   
ref|XP_003613099.1|  Protein TRANSPARENT TESTA                        56.6    6e-08   
gb|KDO60636.1|  hypothetical protein CISIN_1g011035mg                 56.2    6e-08   
ref|XP_010484373.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     56.6    7e-08   
ref|XP_010444534.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     56.2    7e-08   
ref|XP_006280377.1|  hypothetical protein CARUB_v10026304mg           56.2    8e-08   
gb|KDO60635.1|  hypothetical protein CISIN_1g011035mg                 55.8    8e-08   
gb|KDO60633.1|  hypothetical protein CISIN_1g011035mg                 56.2    8e-08   
ref|XP_006466279.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     56.2    9e-08   
gb|KDO60634.1|  hypothetical protein CISIN_1g011035mg                 55.8    9e-08   
gb|KDO60632.1|  hypothetical protein CISIN_1g011035mg                 55.8    9e-08   
ref|XP_006426302.1|  hypothetical protein CICLE_v10025455mg           55.8    1e-07   
ref|XP_009150628.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     55.8    1e-07   
ref|XP_010025407.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     55.8    1e-07   
ref|XP_010519285.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...  55.5    1e-07   
emb|CDY54720.1|  BnaA09g52510D                                        55.8    1e-07   
emb|CDY61495.1|  BnaC03g74630D                                        55.5    1e-07   
ref|NP_001049214.2|  Os03g0188000                                     52.8    2e-07   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008804797.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     55.1    2e-07   
ref|XP_006426303.1|  hypothetical protein CICLE_v10026995mg           55.1    2e-07   
emb|CDY33962.1|  BnaC02g43750D                                        54.7    2e-07   
ref|XP_009122058.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...  55.1    2e-07   
emb|CDX97001.1|  BnaC09g46240D                                        55.1    2e-07   
ref|XP_010519277.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...  55.1    2e-07   
ref|XP_006399537.1|  hypothetical protein EUTSA_v10015947mg           55.1    2e-07   
ref|XP_009122057.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...  55.1    2e-07   
emb|CDX81281.1|  BnaC09g06920D                                        55.1    2e-07   
ref|XP_009122055.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...  54.7    2e-07   
ref|NP_201341.1|  MATE efflux family protein                          54.7    3e-07   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010547604.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     54.3    3e-07   
ref|XP_010916697.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     54.3    4e-07   
ref|XP_003613101.1|  Protein TRANSPARENT TESTA                        54.3    4e-07   
emb|CDX69836.1|  BnaA10g21850D                                        54.7    4e-07   
ref|XP_010439174.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     51.6    5e-07   
gb|AAZ66940.1|  117M18_21                                             53.9    5e-07   Brassica rapa
gb|KFK28219.1|  hypothetical protein AALP_AA8G488100                  53.9    5e-07   
gb|KCW62062.1|  hypothetical protein EUGRSUZ_H04732                   53.9    6e-07   
gb|KDO60637.1|  hypothetical protein CISIN_1g046971mg                 52.4    6e-07   
gb|EEC74654.1|  hypothetical protein OsI_10313                        53.5    6e-07   Oryza sativa Indica Group [Indian rice]
ref|XP_004985412.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...  53.5    6e-07   
dbj|BAJ34389.1|  unnamed protein product                              53.1    6e-07   
emb|CDX78378.1|  BnaA03g02900D                                        53.5    6e-07   
emb|CDX81172.1|  BnaC03g04260D                                        53.5    7e-07   
ref|XP_009131156.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     53.5    7e-07   
emb|CDP01532.1|  unnamed protein product                              53.5    7e-07   
ref|XP_009150627.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     53.5    7e-07   
ref|XP_004985411.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...  53.5    7e-07   
ref|XP_009125302.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     53.5    7e-07   
gb|EEE58464.1|  hypothetical protein OsJ_09708                        53.5    7e-07   Oryza sativa Japonica Group [Japonica rice]
emb|CDY08796.1|  BnaA06g24280D                                        53.5    8e-07   
gb|KCW83097.1|  hypothetical protein EUGRSUZ_B00056                   53.1    8e-07   
emb|CDY40093.1|  BnaC02g00370D                                        53.5    8e-07   
ref|XP_004172197.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     52.4    8e-07   
ref|XP_010026089.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     53.1    9e-07   
gb|KGN48722.1|  hypothetical protein Csa_6G499170                     53.1    9e-07   
ref|XP_004143555.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     53.1    1e-06   
ref|NP_001147792.1|  transparent testa 12 protein                     53.1    1e-06   Zea mays [maize]
tpg|DAA43788.1|  TPA: putative MATE efflux family protein             53.1    1e-06   
emb|CDY08797.1|  BnaA06g24270D                                        53.1    1e-06   
gb|ACU15197.1|  unknown                                               50.8    1e-06   Glycine max [soybeans]
ref|XP_010463146.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...  52.8    1e-06   
ref|XP_010463159.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...  52.8    1e-06   
ref|XP_002468362.1|  hypothetical protein SORBIDRAFT_01g044660        52.8    1e-06   Sorghum bicolor [broomcorn]
gb|KDO81079.1|  hypothetical protein CISIN_1g011186mg                 52.4    2e-06   
ref|XP_007018127.1|  MATE efflux family protein isoform 1             52.4    2e-06   
ref|XP_004985413.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     52.4    2e-06   
ref|XP_010045479.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     52.4    2e-06   
emb|CDY08798.1|  BnaA06g24260D                                        51.6    2e-06   
ref|XP_002285728.2|  PREDICTED: protein TRANSPARENT TESTA 12-like     52.4    2e-06   Vitis vinifera
emb|CBI19217.3|  unnamed protein product                              52.4    2e-06   
ref|XP_010041730.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     51.6    2e-06   
gb|KFK28218.1|  hypothetical protein AALP_AA8G488000                  52.0    2e-06   
emb|CDX97004.1|  BnaC09g46210D                                        51.2    3e-06   
gb|KDO45799.1|  hypothetical protein CISIN_1g0118571mg                51.2    3e-06   
ref|XP_009122059.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     52.0    3e-06   
emb|CDY70471.1|  BnaCnng68540D                                        51.2    3e-06   
gb|KFK22837.1|  hypothetical protein AALP_AAs68044U000100             51.6    3e-06   
ref|XP_002866668.1|  hypothetical protein ARALYDRAFT_496771           51.6    3e-06   
ref|XP_006578309.1|  PREDICTED: protein TRANSPARENT TESTA 12 isof...  51.6    3e-06   
ref|XP_007227652.1|  hypothetical protein PRUPE_ppa016490mg           51.6    3e-06   
gb|KHN08294.1|  Protein TRANSPARENT TESTA 12                          51.6    3e-06   
ref|XP_008219412.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     51.6    4e-06   
ref|XP_006478600.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     51.2    4e-06   
ref|XP_006442840.1|  hypothetical protein CICLE_v10024205mg           51.2    4e-06   
dbj|BAE98722.1|  hypothetical protein                                 49.3    4e-06   Arabidopsis thaliana [mouse-ear cress]
emb|CDP01121.1|  unnamed protein product                              51.2    4e-06   
ref|XP_004299688.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     51.2    5e-06   
ref|XP_008363528.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     51.2    5e-06   
gb|EMS63313.1|  Protein TRANSPARENT TESTA 12                          51.2    5e-06   
ref|XP_006399538.1|  hypothetical protein EUTSA_v10013393mg           51.2    5e-06   
ref|XP_008440567.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     51.2    5e-06   
gb|EEC84726.1|  hypothetical protein OsI_31704                        48.1    5e-06   Oryza sativa Indica Group [Indian rice]
ref|XP_004143554.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     50.8    6e-06   
ref|XP_008441115.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     50.8    6e-06   
emb|CDX97005.1|  BnaC09g46200D                                        50.8    6e-06   
gb|EMT26118.1|  Protein TRANSPARENT TESTA 12                          50.8    6e-06   
gb|KHG03893.1|  Protein TRANSPARENT TESTA 12 -like protein            50.8    6e-06   
dbj|BAJ95959.1|  predicted protein                                    50.8    6e-06   
emb|CDX81177.1|  BnaC03g04310D                                        50.1    6e-06   
emb|CDX69835.1|  BnaA10g21840D                                        50.8    6e-06   
ref|NP_199218.1|  MATE efflux family protein                          50.8    6e-06   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010675571.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     50.8    6e-06   
ref|XP_011016879.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     50.8    6e-06   
ref|XP_002302326.1|  hypothetical protein POPTR_0002s10250g           50.8    7e-06   Populus trichocarpa [western balsam poplar]
ref|XP_002865386.1|  mate efflux family protein                       50.8    7e-06   
ref|XP_009409170.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     50.8    7e-06   
emb|CAB89401.1|  putative protein                                     50.4    7e-06   Arabidopsis thaliana [mouse-ear cress]
ref|NP_196604.2|  MATE efflux family protein                          50.8    7e-06   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006433900.1|  hypothetical protein CICLE_v10000950mg           50.4    7e-06   
ref|XP_004299689.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     50.8    7e-06   
ref|XP_009413656.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     50.4    7e-06   
ref|XP_010530703.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     50.4    7e-06   
ref|XP_007018128.1|  MATE efflux family protein isoform 2             50.4    7e-06   
ref|XP_006472534.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     50.4    8e-06   
ref|XP_009131157.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     50.4    8e-06   
emb|CDX78379.1|  BnaA03g02910D                                        50.4    8e-06   
emb|CDX85762.1|  BnaA02g00510D                                        48.5    9e-06   
gb|AAZ66942.1|  117M18_23                                             50.4    9e-06   Brassica rapa
ref|XP_009373462.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     50.4    9e-06   
emb|CDY14558.1|  BnaC03g49010D                                        49.7    9e-06   
ref|XP_010026078.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     50.4    9e-06   
ref|XP_010455084.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     48.1    1e-05   
ref|XP_003561965.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     50.1    1e-05   
emb|CDP01124.1|  unnamed protein product                              50.1    1e-05   
gb|KCW44120.1|  hypothetical protein EUGRSUZ_L02464                   49.3    1e-05   
ref|XP_010484857.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     49.7    1e-05   
ref|XP_006289718.1|  hypothetical protein CARUB_v10003295mg           49.7    2e-05   
ref|XP_009393552.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     49.7    2e-05   
ref|XP_002455429.1|  hypothetical protein SORBIDRAFT_03g010660        47.4    2e-05   Sorghum bicolor [broomcorn]
ref|XP_007226903.1|  hypothetical protein PRUPE_ppa016334mg           49.7    2e-05   
ref|XP_004967732.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...  49.7    2e-05   
ref|XP_004967731.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...  49.3    2e-05   
gb|KGN48723.1|  hypothetical protein Csa_6G499180                     49.3    2e-05   
ref|XP_009150626.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     49.3    2e-05   
ref|XP_010421569.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...  49.3    2e-05   
ref|XP_008355304.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     48.9    2e-05   
ref|XP_004169810.1|  PREDICTED: LOW QUALITY PROTEIN: protein TRAN...  49.3    2e-05   
ref|XP_004143451.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     49.3    2e-05   
ref|XP_008219413.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     49.3    2e-05   
ref|XP_007136291.1|  hypothetical protein PHAVU_009G034100g           48.9    3e-05   
gb|KDP41437.1|  hypothetical protein JCGZ_15844                       48.9    3e-05   
ref|XP_006827931.1|  hypothetical protein AMTR_s00008p00178100        48.9    3e-05   
ref|XP_007224466.1|  hypothetical protein PRUPE_ppa022569mg           48.9    3e-05   
emb|CDY40095.1|  BnaC02g00350D                                        48.9    3e-05   
ref|XP_006394042.1|  hypothetical protein EUTSA_v10004090mg           48.9    3e-05   
emb|CDX81176.1|  BnaC03g04300D                                        48.5    4e-05   
ref|XP_003602857.1|  Ripening regulated protein DDTFR18               48.5    4e-05   
emb|CDP01534.1|  unnamed protein product                              48.5    4e-05   
ref|XP_008219362.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     48.5    4e-05   
ref|XP_010098694.1|  Protein TRANSPARENT TESTA 12                     48.1    5e-05   
ref|XP_010060062.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     48.1    5e-05   
ref|XP_010456744.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     47.8    6e-05   
ref|XP_010098693.1|  Protein TRANSPARENT TESTA 12                     48.1    6e-05   
gb|KFK25316.1|  hypothetical protein AALP_AA8G096900                  48.1    6e-05   
ref|XP_004501679.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     47.8    7e-05   
ref|XP_002513990.1|  multidrug resistance pump, putative              47.8    7e-05   Ricinus communis
ref|XP_006280365.1|  hypothetical protein CARUB_v10026293mg           47.8    8e-05   
ref|XP_011083823.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     47.4    1e-04   
gb|EMT23905.1|  Protein TRANSPARENT TESTA 12                          44.7    1e-04   
ref|XP_004967733.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     47.0    1e-04   
dbj|BAD09757.1|  unknown protein                                      44.7    1e-04   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002513989.1|  multidrug resistance pump, putative              44.3    1e-04   Ricinus communis
ref|XP_010491708.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     46.6    2e-04   
emb|CDP01122.1|  unnamed protein product                              46.2    2e-04   
ref|XP_004489770.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     46.2    2e-04   
ref|XP_009789598.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...  46.2    3e-04   
ref|XP_007018129.1|  MATE efflux family protein                       46.2    3e-04   
ref|XP_009373481.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...  46.2    3e-04   
ref|XP_009789596.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...  46.2    3e-04   
ref|XP_009373472.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...  45.8    3e-04   
ref|XP_009596939.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     45.8    4e-04   
ref|XP_010026044.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...  45.8    4e-04   
gb|KCW83094.1|  hypothetical protein EUGRSUZ_B00053                   45.4    4e-04   
ref|XP_006338107.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     45.4    4e-04   
gb|EMT23528.1|  Protein TRANSPARENT TESTA 12                          45.4    5e-04   
ref|XP_004237959.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     45.4    5e-04   
ref|XP_006433899.1|  hypothetical protein CICLE_v10003999mg           45.4    5e-04   
ref|NP_001063428.1|  Os09g0468000                                     45.1    6e-04   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010320056.1|  PREDICTED: ripening regulated protein DDTFR1...  45.1    6e-04   
ref|XP_002460371.1|  hypothetical protein SORBIDRAFT_02g027170        45.1    6e-04   Sorghum bicolor [broomcorn]
ref|XP_010026120.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     45.1    6e-04   
gb|KCW83104.1|  hypothetical protein EUGRSUZ_B00058                   45.1    6e-04   
gb|KCW83105.1|  hypothetical protein EUGRSUZ_B00058                   45.1    6e-04   
gb|KCW83102.1|  hypothetical protein EUGRSUZ_B00058                   45.1    6e-04   
gb|EEC84727.1|  hypothetical protein OsI_31705                        45.1    6e-04   Oryza sativa Indica Group [Indian rice]
ref|NP_001234398.1|  ripening regulated protein DDTFR18               45.1    6e-04   
ref|XP_010453066.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     45.1    7e-04   
ref|XP_009380883.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     45.1    7e-04   
ref|XP_004152620.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     44.7    0.001   



>ref|XP_009599386.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Nicotiana tomentosiformis]
Length=496

 Score = 65.9 bits (159),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 31/34 (91%), Positives = 33/34 (97%), Gaps = 0/34 (0%)
 Frame = -1

Query  103  SYSMFVITEAFAGHLGDLELAAMSIACNVILGFD  2
            SYSMFVIT+AFAGHLGDLELAAMSIA NV+LGFD
Sbjct  62   SYSMFVITQAFAGHLGDLELAAMSIASNVVLGFD  95



>ref|XP_006353193.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Solanum tuberosum]
Length=493

 Score = 65.5 bits (158),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 31/34 (91%), Positives = 33/34 (97%), Gaps = 0/34 (0%)
 Frame = -1

Query  103  SYSMFVITEAFAGHLGDLELAAMSIACNVILGFD  2
            SYSMFVIT+AFAGHLGDLELAAMSIA NV+LGFD
Sbjct  59   SYSMFVITQAFAGHLGDLELAAMSIASNVVLGFD  92



>ref|XP_004250128.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Solanum lycopersicum]
Length=493

 Score = 65.5 bits (158),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 31/34 (91%), Positives = 33/34 (97%), Gaps = 0/34 (0%)
 Frame = -1

Query  103  SYSMFVITEAFAGHLGDLELAAMSIACNVILGFD  2
            SYSMFVIT+AFAGHLGDLELAAMSIA NV+LGFD
Sbjct  59   SYSMFVITQAFAGHLGDLELAAMSIASNVVLGFD  92



>ref|XP_009760570.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Nicotiana sylvestris]
Length=496

 Score = 65.5 bits (158),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 31/34 (91%), Positives = 33/34 (97%), Gaps = 0/34 (0%)
 Frame = -1

Query  103  SYSMFVITEAFAGHLGDLELAAMSIACNVILGFD  2
            SYSMFVIT+AFAGHLGDLELAAMSIA NV+LGFD
Sbjct  62   SYSMFVITQAFAGHLGDLELAAMSIASNVVLGFD  95



>gb|EYU34569.1| hypothetical protein MIMGU_mgv1a004816mg [Erythranthe guttata]
Length=508

 Score = 63.5 bits (153),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 30/34 (88%), Positives = 33/34 (97%), Gaps = 0/34 (0%)
 Frame = -1

Query  103  SYSMFVITEAFAGHLGDLELAAMSIACNVILGFD  2
            SYSMFVIT+AFAGHLGDLELAAMSIA +VI+GFD
Sbjct  74   SYSMFVITQAFAGHLGDLELAAMSIATSVIMGFD  107



>ref|XP_010681038.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Beta vulgaris subsp. 
vulgaris]
Length=511

 Score = 62.4 bits (150),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 28/34 (82%), Positives = 32/34 (94%), Gaps = 0/34 (0%)
 Frame = -1

Query  103  SYSMFVITEAFAGHLGDLELAAMSIACNVILGFD  2
            SY+M VIT+AFAGHLGDLELAA+SI CNVI+GFD
Sbjct  81   SYTMLVITQAFAGHLGDLELAAVSIGCNVIVGFD  114



>ref|XP_004137180.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Cucumis sativus]
 ref|XP_004154748.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Cucumis sativus]
 gb|KGN53672.1| hypothetical protein Csa_4G099750 [Cucumis sativus]
Length=484

 Score = 62.4 bits (150),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 30/34 (88%), Positives = 32/34 (94%), Gaps = 0/34 (0%)
 Frame = -1

Query  103  SYSMFVITEAFAGHLGDLELAAMSIACNVILGFD  2
            SYSM VIT+AFAGHLGDLELAAMSIA NVI+GFD
Sbjct  51   SYSMLVITQAFAGHLGDLELAAMSIANNVIVGFD  84



>gb|EYU34572.1| hypothetical protein MIMGU_mgv1a026854mg, partial [Erythranthe 
guttata]
Length=277

 Score = 60.8 bits (146),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 28/34 (82%), Positives = 32/34 (94%), Gaps = 0/34 (0%)
 Frame = -1

Query  103  SYSMFVITEAFAGHLGDLELAAMSIACNVILGFD  2
            +Y+MFVIT+AFAGHLGDLELAAMSIA  VI+GFD
Sbjct  60   TYAMFVITQAFAGHLGDLELAAMSIAITVIMGFD  93



>ref|XP_010681039.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Beta vulgaris subsp. 
vulgaris]
Length=511

 Score = 62.0 bits (149),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 28/34 (82%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = -1

Query  103  SYSMFVITEAFAGHLGDLELAAMSIACNVILGFD  2
            SY+MFVIT+AFAGHLGDLELAA SI C VI+GFD
Sbjct  81   SYTMFVITQAFAGHLGDLELAAFSIGCTVIVGFD  114



>gb|EPS64505.1| hypothetical protein M569_10277, partial [Genlisea aurea]
Length=421

 Score = 61.6 bits (148),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 29/34 (85%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = -1

Query  103  SYSMFVITEAFAGHLGDLELAAMSIACNVILGFD  2
            SYSMF IT+AF+GHLGDLELAAMSI  NVILGFD
Sbjct  24   SYSMFSITQAFSGHLGDLELAAMSIGSNVILGFD  57



>ref|XP_011097507.1| PREDICTED: protein TRANSPARENT TESTA 12 [Sesamum indicum]
Length=497

 Score = 61.2 bits (147),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 29/34 (85%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = -1

Query  103  SYSMFVITEAFAGHLGDLELAAMSIACNVILGFD  2
            SYSMFVIT+AFAGHLGDLELA +SIA  VILGFD
Sbjct  63   SYSMFVITQAFAGHLGDLELAGVSIATTVILGFD  96



>emb|CBI41036.3| unnamed protein product [Vitis vinifera]
Length=433

 Score = 60.8 bits (146),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 29/34 (85%), Positives = 32/34 (94%), Gaps = 0/34 (0%)
 Frame = -1

Query  103  SYSMFVITEAFAGHLGDLELAAMSIACNVILGFD  2
            SYSM VIT+AFAGHLGDLELAA+SIA NVI+GFD
Sbjct  22   SYSMLVITQAFAGHLGDLELAAISIANNVIVGFD  55



>gb|KDP29740.1| hypothetical protein JCGZ_18675 [Jatropha curcas]
Length=504

 Score = 60.8 bits (146),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 29/34 (85%), Positives = 32/34 (94%), Gaps = 0/34 (0%)
 Frame = -1

Query  103  SYSMFVITEAFAGHLGDLELAAMSIACNVILGFD  2
            SYSM VIT+AFAGHLGDLELAA+SIA NVI+GFD
Sbjct  74   SYSMLVITQAFAGHLGDLELAAISIANNVIVGFD  107



>ref|XP_008383420.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Malus domestica]
Length=493

 Score = 60.8 bits (146),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 29/34 (85%), Positives = 32/34 (94%), Gaps = 0/34 (0%)
 Frame = -1

Query  103  SYSMFVITEAFAGHLGDLELAAMSIACNVILGFD  2
            SYSM VIT+AFAGHLGDLELAA+SIA NVI+GFD
Sbjct  63   SYSMLVITQAFAGHLGDLELAAISIANNVIVGFD  96



>ref|XP_010647092.1| PREDICTED: protein TRANSPARENT TESTA 12 [Vitis vinifera]
Length=504

 Score = 60.5 bits (145),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 29/34 (85%), Positives = 32/34 (94%), Gaps = 0/34 (0%)
 Frame = -1

Query  103  SYSMFVITEAFAGHLGDLELAAMSIACNVILGFD  2
            SYSM VIT+AFAGHLGDLELAA+SIA NVI+GFD
Sbjct  58   SYSMLVITQAFAGHLGDLELAAISIANNVIVGFD  91



>ref|XP_007205111.1| hypothetical protein PRUPE_ppa004771mg [Prunus persica]
 gb|EMJ06310.1| hypothetical protein PRUPE_ppa004771mg [Prunus persica]
Length=492

 Score = 60.5 bits (145),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 29/34 (85%), Positives = 32/34 (94%), Gaps = 0/34 (0%)
 Frame = -1

Query  103  SYSMFVITEAFAGHLGDLELAAMSIACNVILGFD  2
            SYSM VIT+AFAGHLGDLELAA+SIA NVI+GFD
Sbjct  62   SYSMLVITQAFAGHLGDLELAAISIANNVIVGFD  95



>emb|CAN73286.1| hypothetical protein VITISV_009768 [Vitis vinifera]
Length=488

 Score = 60.5 bits (145),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 29/34 (85%), Positives = 32/34 (94%), Gaps = 0/34 (0%)
 Frame = -1

Query  103  SYSMFVITEAFAGHLGDLELAAMSIACNVILGFD  2
            SYSM VIT+AFAGHLGDLELAA+SIA NVI+GFD
Sbjct  58   SYSMLVITQAFAGHLGDLELAAISIANNVIVGFD  91



>ref|XP_008235361.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Prunus mume]
 ref|XP_008235370.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Prunus mume]
Length=492

 Score = 60.5 bits (145),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 29/34 (85%), Positives = 32/34 (94%), Gaps = 0/34 (0%)
 Frame = -1

Query  103  SYSMFVITEAFAGHLGDLELAAMSIACNVILGFD  2
            SYSM VIT+AFAGHLGDLELAA+SIA NVI+GFD
Sbjct  62   SYSMLVITQAFAGHLGDLELAAISIANNVIVGFD  95



>ref|XP_010681037.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Beta vulgaris subsp. 
vulgaris]
Length=513

 Score = 60.5 bits (145),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 25/34 (74%), Positives = 32/34 (94%), Gaps = 0/34 (0%)
 Frame = -1

Query  103  SYSMFVITEAFAGHLGDLELAAMSIACNVILGFD  2
            SYS+ + T+AFAGHLGDLELAAMSI+CN+++GFD
Sbjct  83   SYSLLIATQAFAGHLGDLELAAMSISCNIVVGFD  116



>ref|XP_007047830.1| MATE efflux family protein [Theobroma cacao]
 gb|EOX91987.1| MATE efflux family protein [Theobroma cacao]
Length=490

 Score = 60.5 bits (145),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 28/34 (82%), Positives = 32/34 (94%), Gaps = 0/34 (0%)
 Frame = -1

Query  103  SYSMFVITEAFAGHLGDLELAAMSIACNVILGFD  2
            SYSM VIT+AFAGHLGDLELAA+SIA NV++GFD
Sbjct  60   SYSMLVITQAFAGHLGDLELAAISIANNVVVGFD  93



>gb|KDO60642.1| hypothetical protein CISIN_1g011371mg [Citrus sinensis]
Length=323

 Score = 59.3 bits (142),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 28/34 (82%), Positives = 32/34 (94%), Gaps = 0/34 (0%)
 Frame = -1

Query  103  SYSMFVITEAFAGHLGDLELAAMSIACNVILGFD  2
            SYSM VIT+AFAGHLGD+ELAA+SIA NVI+GFD
Sbjct  57   SYSMLVITQAFAGHLGDIELAAISIANNVIVGFD  90



>ref|XP_006426305.1| hypothetical protein CICLE_v10025480mg [Citrus clementina]
 ref|XP_006426306.1| hypothetical protein CICLE_v10025480mg [Citrus clementina]
 gb|ESR39545.1| hypothetical protein CICLE_v10025480mg [Citrus clementina]
 gb|ESR39546.1| hypothetical protein CICLE_v10025480mg [Citrus clementina]
Length=323

 Score = 59.3 bits (142),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 28/34 (82%), Positives = 32/34 (94%), Gaps = 0/34 (0%)
 Frame = -1

Query  103  SYSMFVITEAFAGHLGDLELAAMSIACNVILGFD  2
            SYSM VIT+AFAGHLGD+ELAA+SIA NVI+GFD
Sbjct  57   SYSMLVITQAFAGHLGDIELAAISIANNVIVGFD  90



>ref|XP_004489769.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Cicer arietinum]
Length=492

 Score = 60.1 bits (144),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 28/34 (82%), Positives = 32/34 (94%), Gaps = 0/34 (0%)
 Frame = -1

Query  103  SYSMFVITEAFAGHLGDLELAAMSIACNVILGFD  2
            SYSM VIT+AFAGHLGDLELAA+SIA NV++GFD
Sbjct  58   SYSMLVITQAFAGHLGDLELAAISIANNVVVGFD  91



>ref|XP_003517710.1| PREDICTED: protein TRANSPARENT TESTA 12 [Glycine max]
Length=491

 Score = 60.1 bits (144),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 28/34 (82%), Positives = 32/34 (94%), Gaps = 0/34 (0%)
 Frame = -1

Query  103  SYSMFVITEAFAGHLGDLELAAMSIACNVILGFD  2
            SYSM VIT+AFAGHLGDLELAA+SIA NV++GFD
Sbjct  57   SYSMLVITQAFAGHLGDLELAAISIANNVVVGFD  90



>gb|KHN14526.1| Protein TRANSPARENT TESTA 12 [Glycine soja]
Length=475

 Score = 60.1 bits (144),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 28/34 (82%), Positives = 32/34 (94%), Gaps = 0/34 (0%)
 Frame = -1

Query  103  SYSMFVITEAFAGHLGDLELAAMSIACNVILGFD  2
            SYSM VIT+AFAGHLGDLELAA+SIA NV++GFD
Sbjct  57   SYSMLVITQAFAGHLGDLELAAISIANNVVVGFD  90



>ref|XP_010681034.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=513

 Score = 60.1 bits (144),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 26/34 (76%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = -1

Query  103  SYSMFVITEAFAGHLGDLELAAMSIACNVILGFD  2
            SYS  V+T+AFAGHLGDLELAAMSI+CN+I+G D
Sbjct  83   SYSFLVVTQAFAGHLGDLELAAMSISCNIIVGLD  116



>ref|XP_009117173.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Brassica rapa]
Length=190

 Score = 57.8 bits (138),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 27/34 (79%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = -1

Query  103  SYSMFVITEAFAGHLGDLELAAMSIACNVILGFD  2
            SYSM VIT+AFAGHLGDLELAA+SI  NVI+GF+
Sbjct  52   SYSMLVITQAFAGHLGDLELAAISIVNNVIIGFN  85



>ref|XP_010681036.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X3 [Beta 
vulgaris subsp. vulgaris]
Length=437

 Score = 59.7 bits (143),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 26/34 (76%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = -1

Query  103  SYSMFVITEAFAGHLGDLELAAMSIACNVILGFD  2
            SYS  V+T+AFAGHLGDLELAAMSI+CN+I+G D
Sbjct  83   SYSFLVVTQAFAGHLGDLELAAMSISCNIIVGLD  116



>ref|XP_010681035.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=508

 Score = 59.7 bits (143),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 26/34 (76%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = -1

Query  103  SYSMFVITEAFAGHLGDLELAAMSIACNVILGFD  2
            SYS  V+T+AFAGHLGDLELAAMSI+CN+I+G D
Sbjct  83   SYSFLVVTQAFAGHLGDLELAAMSISCNIIVGLD  116



>gb|KDO60639.1| hypothetical protein CISIN_1g011371mg [Citrus sinensis]
Length=481

 Score = 59.7 bits (143),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 28/34 (82%), Positives = 32/34 (94%), Gaps = 0/34 (0%)
 Frame = -1

Query  103  SYSMFVITEAFAGHLGDLELAAMSIACNVILGFD  2
            SYSM VIT+AFAGHLGD+ELAA+SIA NVI+GFD
Sbjct  57   SYSMLVITQAFAGHLGDIELAAISIANNVIVGFD  90



>ref|XP_006466280.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Citrus sinensis]
Length=487

 Score = 59.7 bits (143),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 28/34 (82%), Positives = 32/34 (94%), Gaps = 0/34 (0%)
 Frame = -1

Query  103  SYSMFVITEAFAGHLGDLELAAMSIACNVILGFD  2
            SYSM VIT+AFAGHLGD+ELAA+SIA NVI+GFD
Sbjct  57   SYSMLVITQAFAGHLGDIELAAISIANNVIVGFD  90



>gb|KDO60638.1| hypothetical protein CISIN_1g011371mg [Citrus sinensis]
Length=487

 Score = 59.7 bits (143),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 28/34 (82%), Positives = 32/34 (94%), Gaps = 0/34 (0%)
 Frame = -1

Query  103  SYSMFVITEAFAGHLGDLELAAMSIACNVILGFD  2
            SYSM VIT+AFAGHLGD+ELAA+SIA NVI+GFD
Sbjct  57   SYSMLVITQAFAGHLGDIELAAISIANNVIVGFD  90



>gb|KDO60641.1| hypothetical protein CISIN_1g011371mg [Citrus sinensis]
Length=456

 Score = 59.7 bits (143),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 28/34 (82%), Positives = 32/34 (94%), Gaps = 0/34 (0%)
 Frame = -1

Query  103  SYSMFVITEAFAGHLGDLELAAMSIACNVILGFD  2
            SYSM VIT+AFAGHLGD+ELAA+SIA NVI+GFD
Sbjct  57   SYSMLVITQAFAGHLGDIELAAISIANNVIVGFD  90



>ref|XP_006426307.1| hypothetical protein CICLE_v10025480mg [Citrus clementina]
 gb|ESR39547.1| hypothetical protein CICLE_v10025480mg [Citrus clementina]
Length=487

 Score = 59.7 bits (143),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 28/34 (82%), Positives = 32/34 (94%), Gaps = 0/34 (0%)
 Frame = -1

Query  103  SYSMFVITEAFAGHLGDLELAAMSIACNVILGFD  2
            SYSM VIT+AFAGHLGD+ELAA+SIA NVI+GFD
Sbjct  57   SYSMLVITQAFAGHLGDIELAAISIANNVIVGFD  90



>ref|XP_006426304.1| hypothetical protein CICLE_v10025480mg [Citrus clementina]
 gb|ESR39544.1| hypothetical protein CICLE_v10025480mg [Citrus clementina]
Length=456

 Score = 59.7 bits (143),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 28/34 (82%), Positives = 32/34 (94%), Gaps = 0/34 (0%)
 Frame = -1

Query  103  SYSMFVITEAFAGHLGDLELAAMSIACNVILGFD  2
            SYSM VIT+AFAGHLGD+ELAA+SIA NVI+GFD
Sbjct  57   SYSMLVITQAFAGHLGDIELAAISIANNVIVGFD  90



>gb|KDO60640.1| hypothetical protein CISIN_1g011371mg [Citrus sinensis]
Length=471

 Score = 59.3 bits (142),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 28/34 (82%), Positives = 32/34 (94%), Gaps = 0/34 (0%)
 Frame = -1

Query  103  SYSMFVITEAFAGHLGDLELAAMSIACNVILGFD  2
            SYSM VIT+AFAGHLGD+ELAA+SIA NVI+GFD
Sbjct  57   SYSMLVITQAFAGHLGDIELAAISIANNVIVGFD  90



>ref|XP_010106306.1| Protein TRANSPARENT TESTA 12 [Morus notabilis]
 gb|EXC09723.1| Protein TRANSPARENT TESTA 12 [Morus notabilis]
Length=499

 Score = 59.3 bits (142),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 28/34 (82%), Positives = 32/34 (94%), Gaps = 0/34 (0%)
 Frame = -1

Query  103  SYSMFVITEAFAGHLGDLELAAMSIACNVILGFD  2
            SYSM VIT+AFAGHLGDLELAA+SI+ NVI+GFD
Sbjct  66   SYSMLVITQAFAGHLGDLELAAISISNNVIVGFD  99



>ref|XP_003519833.2| PREDICTED: protein TRANSPARENT TESTA 12-like [Glycine max]
Length=492

 Score = 59.3 bits (142),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 28/34 (82%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = -1

Query  103  SYSMFVITEAFAGHLGDLELAAMSIACNVILGFD  2
            ++SMFVIT+AFAGHLGDLELAA SIA NVILG D
Sbjct  58   TFSMFVITQAFAGHLGDLELAATSIAINVILGLD  91



>gb|KHN00401.1| Protein TRANSPARENT TESTA 12 [Glycine soja]
Length=492

 Score = 59.3 bits (142),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 28/34 (82%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = -1

Query  103  SYSMFVITEAFAGHLGDLELAAMSIACNVILGFD  2
            ++SMFVIT+AFAGHLGDLELAA SIA NVILG D
Sbjct  58   TFSMFVITQAFAGHLGDLELAATSIAINVILGLD  91



>ref|XP_002533972.1| multidrug resistance pump, putative [Ricinus communis]
 gb|EEF28410.1| multidrug resistance pump, putative [Ricinus communis]
Length=482

 Score = 59.3 bits (142),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 28/34 (82%), Positives = 32/34 (94%), Gaps = 0/34 (0%)
 Frame = -1

Query  103  SYSMFVITEAFAGHLGDLELAAMSIACNVILGFD  2
            S+SM VIT+AFAGHLGDLELAA+SIA NVI+GFD
Sbjct  52   SFSMIVITQAFAGHLGDLELAAISIANNVIIGFD  85



>ref|XP_002310871.1| hypothetical protein POPTR_0007s14390g [Populus trichocarpa]
 gb|EEE91321.1| hypothetical protein POPTR_0007s14390g [Populus trichocarpa]
Length=488

 Score = 58.9 bits (141),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 28/34 (82%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = -1

Query  103  SYSMFVITEAFAGHLGDLELAAMSIACNVILGFD  2
            SYSM VIT+AFAGHLGDLELA +SIA NVI+GFD
Sbjct  58   SYSMLVITQAFAGHLGDLELAGISIANNVIVGFD  91



>ref|XP_004308030.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Fragaria vesca 
subsp. vesca]
Length=501

 Score = 58.5 bits (140),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 28/34 (82%), Positives = 32/34 (94%), Gaps = 0/34 (0%)
 Frame = -1

Query  103  SYSMFVITEAFAGHLGDLELAAMSIACNVILGFD  2
            SYSM VIT+AFAGHLG+LELAA+SIA NVI+GFD
Sbjct  71   SYSMLVITQAFAGHLGELELAAISIANNVIVGFD  104



>ref|XP_004289485.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Fragaria vesca 
subsp. vesca]
Length=399

 Score = 58.2 bits (139),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 28/34 (82%), Positives = 32/34 (94%), Gaps = 0/34 (0%)
 Frame = -1

Query  103  SYSMFVITEAFAGHLGDLELAAMSIACNVILGFD  2
            SYSM VIT+AFAGHLG+LELAA+SIA NVI+GFD
Sbjct  72   SYSMVVITQAFAGHLGELELAAISIANNVIVGFD  105



>ref|XP_009112179.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Brassica rapa]
Length=483

 Score = 57.8 bits (138),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 27/34 (79%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = -1

Query  103  SYSMFVITEAFAGHLGDLELAAMSIACNVILGFD  2
            SYSM VIT+AFAGHLGDLELAA+SI  NVI+GF+
Sbjct  52   SYSMLVITQAFAGHLGDLELAAISIVNNVIIGFN  85



>ref|XP_006394040.1| hypothetical protein EUTSA_v100040871mg, partial [Eutrema salsugineum]
 gb|ESQ31326.1| hypothetical protein EUTSA_v100040871mg, partial [Eutrema salsugineum]
Length=188

 Score = 55.1 bits (131),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 26/34 (76%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = -1

Query  103  SYSMFVITEAFAGHLGDLELAAMSIACNVILGFD  2
            SYSM +IT+AFAGHLGDLELAA+SI  NVI+GF+
Sbjct  58   SYSMLIITQAFAGHLGDLELAAISIVNNVIVGFN  91



>ref|XP_007158392.1| hypothetical protein PHAVU_002G149300g [Phaseolus vulgaris]
 gb|ESW30386.1| hypothetical protein PHAVU_002G149300g [Phaseolus vulgaris]
Length=488

 Score = 57.4 bits (137),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 27/34 (79%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = -1

Query  103  SYSMFVITEAFAGHLGDLELAAMSIACNVILGFD  2
            SYSM VIT+AFAG LGDLELAA+SIA NV++GFD
Sbjct  54   SYSMLVITQAFAGRLGDLELAAISIANNVVVGFD  87



>ref|NP_001132745.1| uncharacterized protein LOC100194232 [Zea mays]
 gb|ACF81728.1| unknown [Zea mays]
 tpg|DAA43789.1| TPA: putative MATE efflux family protein [Zea mays]
Length=122

 Score = 54.3 bits (129),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 25/34 (74%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = -1

Query  103  SYSMFVITEAFAGHLGDLELAAMSIACNVILGFD  2
            +YSM VIT+AFAGHLGDLELAA+SIA  V++GF+
Sbjct  57   TYSMNVITQAFAGHLGDLELAAISIANTVVVGFN  90



>ref|XP_002533973.1| multidrug resistance pump, putative [Ricinus communis]
 gb|EEF28411.1| multidrug resistance pump, putative [Ricinus communis]
Length=507

 Score = 57.0 bits (136),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 27/34 (79%), Positives = 32/34 (94%), Gaps = 0/34 (0%)
 Frame = -1

Query  103  SYSMFVITEAFAGHLGDLELAAMSIACNVILGFD  2
            S+SM VIT+AFAGHLG+LELAA+SIA NVI+GFD
Sbjct  52   SFSMLVITQAFAGHLGNLELAAISIANNVIVGFD  85



>emb|CDP01535.1| unnamed protein product [Coffea canephora]
Length=494

 Score = 57.0 bits (136),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 26/34 (76%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = -1

Query  103  SYSMFVITEAFAGHLGDLELAAMSIACNVILGFD  2
            SYSMFV+++AFAGHLGDLELA +SIA +VI GFD
Sbjct  62   SYSMFVVSQAFAGHLGDLELAGLSIASSVICGFD  95



>ref|XP_011021836.1| PREDICTED: protein TRANSPARENT TESTA 12 [Populus euphratica]
Length=491

 Score = 57.0 bits (136),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 27/34 (79%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = -1

Query  103  SYSMFVITEAFAGHLGDLELAAMSIACNVILGFD  2
            SYSM VIT+AFAGHLGDLELA +SIA NVI+G D
Sbjct  61   SYSMLVITQAFAGHLGDLELAGISIANNVIVGLD  94



>ref|XP_003613099.1| Protein TRANSPARENT TESTA [Medicago truncatula]
 gb|AES96057.1| MATE efflux family protein [Medicago truncatula]
Length=490

 Score = 56.6 bits (135),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 26/34 (76%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = -1

Query  103  SYSMFVITEAFAGHLGDLELAAMSIACNVILGFD  2
            SY M VIT++FAGHLGDLELAA+SIA NV++GFD
Sbjct  55   SYMMLVITQSFAGHLGDLELAAISIANNVVVGFD  88



>gb|KDO60636.1| hypothetical protein CISIN_1g011035mg [Citrus sinensis]
Length=334

 Score = 56.2 bits (134),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 26/34 (76%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = -1

Query  103  SYSMFVITEAFAGHLGDLELAAMSIACNVILGFD  2
            SYSMFVIT+AFAGHLGDLELAA+SIA  V++ F+
Sbjct  68   SYSMFVITQAFAGHLGDLELAAISIANTVVVAFN  101



>ref|XP_010484373.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Camelina sativa]
Length=486

 Score = 56.6 bits (135),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 26/34 (76%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = -1

Query  103  SYSMFVITEAFAGHLGDLELAAMSIACNVILGFD  2
            +YSM VIT+AFAGHLGDLELAA+SI  NVI+GF+
Sbjct  55   TYSMLVITQAFAGHLGDLELAAISIVNNVIVGFN  88



>ref|XP_010444534.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Camelina sativa]
Length=487

 Score = 56.2 bits (134),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 26/34 (76%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = -1

Query  103  SYSMFVITEAFAGHLGDLELAAMSIACNVILGFD  2
            +YSM VIT+AFAGHLGDLELAA+SI  NVI+GF+
Sbjct  56   TYSMLVITQAFAGHLGDLELAAISIVNNVIVGFN  89



>ref|XP_006280377.1| hypothetical protein CARUB_v10026304mg [Capsella rubella]
 gb|EOA13275.1| hypothetical protein CARUB_v10026304mg [Capsella rubella]
Length=486

 Score = 56.2 bits (134),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 26/34 (76%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = -1

Query  103  SYSMFVITEAFAGHLGDLELAAMSIACNVILGFD  2
            +YSM VIT+AFAGHLGDLELAA+SI  NVI+GF+
Sbjct  55   TYSMLVITQAFAGHLGDLELAAISIVNNVIVGFN  88



>gb|KDO60635.1| hypothetical protein CISIN_1g011035mg [Citrus sinensis]
Length=350

 Score = 55.8 bits (133),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 26/34 (76%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = -1

Query  103  SYSMFVITEAFAGHLGDLELAAMSIACNVILGFD  2
            SYSMFVIT+AFAGHLGDLELAA+SIA  V++ F+
Sbjct  68   SYSMFVITQAFAGHLGDLELAAISIANTVVVAFN  101



>gb|KDO60633.1| hypothetical protein CISIN_1g011035mg [Citrus sinensis]
Length=476

 Score = 56.2 bits (134),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 26/34 (76%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = -1

Query  103  SYSMFVITEAFAGHLGDLELAAMSIACNVILGFD  2
            SYSMFVIT+AFAGHLGDLELAA+SIA  V++ F+
Sbjct  68   SYSMFVITQAFAGHLGDLELAAISIANTVVVAFN  101



>ref|XP_006466279.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Citrus sinensis]
Length=495

 Score = 56.2 bits (134),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 26/34 (76%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = -1

Query  103  SYSMFVITEAFAGHLGDLELAAMSIACNVILGFD  2
            SYSMFVIT+AFAGHLGDLELAA+SIA  V++ F+
Sbjct  68   SYSMFVITQAFAGHLGDLELAAISIANTVVVAFN  101



>gb|KDO60634.1| hypothetical protein CISIN_1g011035mg [Citrus sinensis]
Length=439

 Score = 55.8 bits (133),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 26/34 (76%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = -1

Query  103  SYSMFVITEAFAGHLGDLELAAMSIACNVILGFD  2
            SYSMFVIT+AFAGHLGDLELAA+SIA  V++ F+
Sbjct  68   SYSMFVITQAFAGHLGDLELAAISIANTVVVAFN  101



>gb|KDO60632.1| hypothetical protein CISIN_1g011035mg [Citrus sinensis]
Length=495

 Score = 55.8 bits (133),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 26/34 (76%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = -1

Query  103  SYSMFVITEAFAGHLGDLELAAMSIACNVILGFD  2
            SYSMFVIT+AFAGHLGDLELAA+SIA  V++ F+
Sbjct  68   SYSMFVITQAFAGHLGDLELAAISIANTVVVAFN  101



>ref|XP_006426302.1| hypothetical protein CICLE_v10025455mg [Citrus clementina]
 gb|ESR39542.1| hypothetical protein CICLE_v10025455mg [Citrus clementina]
Length=495

 Score = 55.8 bits (133),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 26/34 (76%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = -1

Query  103  SYSMFVITEAFAGHLGDLELAAMSIACNVILGFD  2
            SYSMFVIT+AFAGHLGDLELAA+SIA  V++ F+
Sbjct  68   SYSMFVITQAFAGHLGDLELAAISIANTVVVAFN  101



>ref|XP_009150628.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Brassica rapa]
Length=484

 Score = 55.8 bits (133),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 25/34 (74%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = -1

Query  103  SYSMFVITEAFAGHLGDLELAAMSIACNVILGFD  2
            +YSM VIT+AFAGHLGDLELAA+SI  NV++GF+
Sbjct  53   TYSMLVITQAFAGHLGDLELAAISIVNNVVVGFN  86



>ref|XP_010025407.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Eucalyptus grandis]
 gb|KCW62061.1| hypothetical protein EUGRSUZ_H04732 [Eucalyptus grandis]
Length=494

 Score = 55.8 bits (133),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 24/34 (71%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = -1

Query  103  SYSMFVITEAFAGHLGDLELAAMSIACNVILGFD  2
            SYSM VIT+AFAGHLGDLELAAM++  N+++G D
Sbjct  64   SYSMLVITQAFAGHLGDLELAAMALTTNLVIGLD  97



>ref|XP_010519285.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X2 [Tarenaya 
hassleriana]
Length=421

 Score = 55.5 bits (132),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 26/32 (81%), Positives = 29/32 (91%), Gaps = 0/32 (0%)
 Frame = -1

Query  100  YSMFVITEAFAGHLGDLELAAMSIACNVILGF  5
            YSM VIT+AFAGHLGDLELAA+SI  NVI+GF
Sbjct  70   YSMLVITQAFAGHLGDLELAAISIVQNVIVGF  101



>emb|CDY54720.1| BnaA09g52510D [Brassica napus]
Length=562

 Score = 55.8 bits (133),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 27/34 (79%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = -1

Query  103  SYSMFVITEAFAGHLGDLELAAMSIACNVILGFD  2
            SYSM VIT+AFAGHLGDLELAA+SI  NVI+GF+
Sbjct  52   SYSMLVITQAFAGHLGDLELAAISIVNNVIIGFN  85



>emb|CDY61495.1| BnaC03g74630D [Brassica napus]
Length=545

 Score = 55.5 bits (132),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 25/34 (74%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = -1

Query  103  SYSMFVITEAFAGHLGDLELAAMSIACNVILGFD  2
            +YSM VIT+AFAGHLGDLELAA+SI  NV++GF+
Sbjct  53   TYSMLVITQAFAGHLGDLELAAISIVNNVVVGFN  86



>ref|NP_001049214.2| Os03g0188000 [Oryza sativa Japonica Group]
 gb|AAN64139.1| Hypothetical protein [Oryza sativa Japonica Group]
 gb|ABF94377.1| expressed protein [Oryza sativa Japonica Group]
 dbj|BAF11128.2| Os03g0188000 [Oryza sativa Japonica Group]
Length=109

 Score = 52.8 bits (125),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 25/34 (74%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = -1

Query  103  SYSMFVITEAFAGHLGDLELAAMSIACNVILGFD  2
            +YSM VIT+AFAGHLGDLELAA+SIA  V++GF+
Sbjct  61   TYSMNVITQAFAGHLGDLELAAISIANTVVVGFN  94



>ref|XP_008804797.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Phoenix dactylifera]
 ref|XP_008804798.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Phoenix dactylifera]
Length=476

 Score = 55.1 bits (131),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 26/34 (76%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = -1

Query  103  SYSMFVITEAFAGHLGDLELAAMSIACNVILGFD  2
            +YSM VIT+AFAGHLGDLELAAMSIA  V++GF+
Sbjct  47   TYSMNVITQAFAGHLGDLELAAMSIANTVVVGFN  80



>ref|XP_006426303.1| hypothetical protein CICLE_v10026995mg [Citrus clementina]
 gb|ESR39543.1| hypothetical protein CICLE_v10026995mg [Citrus clementina]
Length=393

 Score = 55.1 bits (131),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 25/34 (74%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = -1

Query  103  SYSMFVITEAFAGHLGDLELAAMSIACNVILGFD  2
            SYS+FVIT+AFAGHLGDLELAA+SIA NV++  +
Sbjct  59   SYSLFVITQAFAGHLGDLELAAISIANNVVVALN  92



>emb|CDY33962.1| BnaC02g43750D [Brassica napus]
Length=320

 Score = 54.7 bits (130),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 25/34 (74%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = -1

Query  103  SYSMFVITEAFAGHLGDLELAAMSIACNVILGFD  2
            +YSM VIT+AFAGHLG+LELAA+SI  NVI+GF+
Sbjct  54   AYSMLVITQAFAGHLGELELAAISIVNNVIVGFN  87



>ref|XP_009122058.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X3 [Brassica 
rapa]
Length=461

 Score = 55.1 bits (131),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 24/34 (71%), Positives = 32/34 (94%), Gaps = 0/34 (0%)
 Frame = -1

Query  103  SYSMFVITEAFAGHLGDLELAAMSIACNVILGFD  2
            +YS+F+IT+AFAGHLG+LELAA+SI  NVI+GF+
Sbjct  58   TYSIFIITQAFAGHLGELELAAISIVNNVIVGFN  91



>emb|CDX97001.1| BnaC09g46240D [Brassica napus]
Length=491

 Score = 55.1 bits (131),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 24/34 (71%), Positives = 32/34 (94%), Gaps = 0/34 (0%)
 Frame = -1

Query  103  SYSMFVITEAFAGHLGDLELAAMSIACNVILGFD  2
            +YS+F+IT+AFAGHLG+LELAA+SI  NVI+GF+
Sbjct  58   TYSIFIITQAFAGHLGELELAAISIVNNVIVGFN  91



>ref|XP_010519277.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Tarenaya 
hassleriana]
Length=500

 Score = 55.1 bits (131),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 26/32 (81%), Positives = 29/32 (91%), Gaps = 0/32 (0%)
 Frame = -1

Query  100  YSMFVITEAFAGHLGDLELAAMSIACNVILGF  5
            YSM VIT+AFAGHLGDLELAA+SI  NVI+GF
Sbjct  70   YSMLVITQAFAGHLGDLELAAISIVQNVIVGF  101



>ref|XP_006399537.1| hypothetical protein EUTSA_v10015947mg [Eutrema salsugineum]
 gb|ESQ40990.1| hypothetical protein EUTSA_v10015947mg [Eutrema salsugineum]
Length=490

 Score = 55.1 bits (131),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 25/34 (74%), Positives = 32/34 (94%), Gaps = 0/34 (0%)
 Frame = -1

Query  103  SYSMFVITEAFAGHLGDLELAAMSIACNVILGFD  2
            +YS+FVIT+AFAGHLG+LELAA+SI  NVI+GF+
Sbjct  57   TYSIFVITQAFAGHLGELELAAISIINNVIIGFN  90



>ref|XP_009122057.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X2 [Brassica 
rapa]
Length=491

 Score = 55.1 bits (131),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 24/34 (71%), Positives = 32/34 (94%), Gaps = 0/34 (0%)
 Frame = -1

Query  103  SYSMFVITEAFAGHLGDLELAAMSIACNVILGFD  2
            +YS+F+IT+AFAGHLG+LELAA+SI  NVI+GF+
Sbjct  58   TYSIFIITQAFAGHLGELELAAISIVNNVIVGFN  91



>emb|CDX81281.1| BnaC09g06920D [Brassica napus]
Length=484

 Score = 55.1 bits (131),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 27/34 (79%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = -1

Query  103  SYSMFVITEAFAGHLGDLELAAMSIACNVILGFD  2
            SYSM VIT+AFAGHLGDLELAA+SI  NVI+GF+
Sbjct  52   SYSMLVITQAFAGHLGDLELAAISIVNNVIIGFN  85



>ref|XP_009122055.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Brassica 
rapa]
 ref|XP_009122056.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Brassica 
rapa]
Length=497

 Score = 54.7 bits (130),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 24/34 (71%), Positives = 32/34 (94%), Gaps = 0/34 (0%)
 Frame = -1

Query  103  SYSMFVITEAFAGHLGDLELAAMSIACNVILGFD  2
            +YS+F+IT+AFAGHLG+LELAA+SI  NVI+GF+
Sbjct  58   TYSIFIITQAFAGHLGELELAAISIVNNVIVGFN  91



>ref|NP_201341.1| MATE efflux family protein [Arabidopsis thaliana]
 gb|AAK53040.1|AF375456_1 AT5g65380/MNA5_11 [Arabidopsis thaliana]
 dbj|BAB11560.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAN28899.1| At5g65380/MNA5_11 [Arabidopsis thaliana]
 gb|AED98045.1| MATE efflux family protein [Arabidopsis thaliana]
Length=486

 Score = 54.7 bits (130),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 25/34 (74%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = -1

Query  103  SYSMFVITEAFAGHLGDLELAAMSIACNVILGFD  2
            +YSM VIT+AFAGHLGDLELAA+SI  NV +GF+
Sbjct  55   TYSMLVITQAFAGHLGDLELAAISIVNNVTVGFN  88



>ref|XP_010547604.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Tarenaya hassleriana]
Length=483

 Score = 54.3 bits (129),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 25/33 (76%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = -1

Query  103  SYSMFVITEAFAGHLGDLELAAMSIACNVILGF  5
            +YSM VIT+AFAGHLGD+ELAA+SI  NVI+GF
Sbjct  52   TYSMIVITQAFAGHLGDVELAAISIVNNVIIGF  84



>ref|XP_010916697.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Elaeis guineensis]
Length=476

 Score = 54.3 bits (129),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 26/34 (76%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = -1

Query  103  SYSMFVITEAFAGHLGDLELAAMSIACNVILGFD  2
            SYSM VIT+AFAGHLGDLELAA+SIA  V++GF+
Sbjct  47   SYSMNVITQAFAGHLGDLELAAISIANTVVVGFN  80



>ref|XP_003613101.1| Protein TRANSPARENT TESTA [Medicago truncatula]
 gb|AES96059.1| MATE efflux family protein [Medicago truncatula]
Length=489

 Score = 54.3 bits (129),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 25/34 (74%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = -1

Query  103  SYSMFVITEAFAGHLGDLELAAMSIACNVILGFD  2
            +YSM VIT+ FAGHLGD+ELAA SIA N+ILG D
Sbjct  55   NYSMLVITQVFAGHLGDMELAATSIAMNLILGLD  88



>emb|CDX69836.1| BnaA10g21850D [Brassica napus]
Length=1026

 Score = 54.7 bits (130),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 24/34 (71%), Positives = 32/34 (94%), Gaps = 0/34 (0%)
 Frame = -1

Query  103  SYSMFVITEAFAGHLGDLELAAMSIACNVILGFD  2
            +YS+F+IT+AFAGHLG+LELAA+SI  NVI+GF+
Sbjct  583  TYSIFIITQAFAGHLGELELAAISIVNNVIVGFN  616


 Score = 52.0 bits (123),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 24/34 (71%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = -1

Query  103  SYSMFVITEAFAGHLGDLELAAMSIACNVILGFD  2
            +YS+FVIT+AFAGHLG+LELAA+SI  NVI+ F 
Sbjct  58   TYSIFVITQAFAGHLGELELAAISIVHNVIISFS  91



>ref|XP_010439174.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Camelina sativa]
 ref|XP_010439183.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Camelina sativa]
Length=172

 Score = 51.6 bits (122),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 25/34 (74%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = -1

Query  103  SYSMFVITEAFAGHLGDLELAAMSIACNVILGFD  2
            SYS  VIT+AFAGHLGDLELAA+SI  +VI+GF+
Sbjct  93   SYSTLVITQAFAGHLGDLELAAISIVNSVIVGFN  126



>gb|AAZ66940.1| 117M18_21 [Brassica rapa]
Length=431

 Score = 53.9 bits (128),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 24/34 (71%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = -1

Query  103  SYSMFVITEAFAGHLGDLELAAMSIACNVILGFD  2
            +YS+FVIT+AFAGHLG+LELAA++I  NVI+GF 
Sbjct  52   TYSIFVITQAFAGHLGELELAAIAIVQNVIIGFS  85



>gb|KFK28219.1| hypothetical protein AALP_AA8G488100 [Arabis alpina]
Length=486

 Score = 53.9 bits (128),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 25/34 (74%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = -1

Query  103  SYSMFVITEAFAGHLGDLELAAMSIACNVILGFD  2
            +YSM VIT+AFAGHLGDLELAA+SI  NV++GF+
Sbjct  55   TYSMLVITQAFAGHLGDLELAAISIVNNVVVGFN  88



>gb|KCW62062.1| hypothetical protein EUGRSUZ_H04732 [Eucalyptus grandis]
Length=474

 Score = 53.9 bits (128),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 24/34 (71%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = -1

Query  103  SYSMFVITEAFAGHLGDLELAAMSIACNVILGFD  2
            SYSM VIT+AFAGHLGDLELAAM++  N+++G D
Sbjct  64   SYSMLVITQAFAGHLGDLELAAMALTTNLVIGLD  97



>gb|KDO60637.1| hypothetical protein CISIN_1g046971mg [Citrus sinensis]
Length=244

 Score = 52.4 bits (124),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 25/34 (74%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = -1

Query  103  SYSMFVITEAFAGHLGDLELAAMSIACNVILGFD  2
            SYS+FVIT+AFAGHLGDLELAA+SIA NV++  +
Sbjct  59   SYSLFVITQAFAGHLGDLELAAISIANNVVVALN  92



>gb|EEC74654.1| hypothetical protein OsI_10313 [Oryza sativa Indica Group]
Length=490

 Score = 53.5 bits (127),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 25/34 (74%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = -1

Query  103  SYSMFVITEAFAGHLGDLELAAMSIACNVILGFD  2
            +YSM VIT+AFAGHLGDLELAA+SIA  V++GF+
Sbjct  61   TYSMNVITQAFAGHLGDLELAAISIANTVVVGFN  94



>ref|XP_004985412.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X2 [Setaria 
italica]
Length=495

 Score = 53.5 bits (127),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 25/34 (74%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = -1

Query  103  SYSMFVITEAFAGHLGDLELAAMSIACNVILGFD  2
            +YSM VIT+AFAGHLGDLELAA+SIA  V++GF+
Sbjct  66   TYSMNVITQAFAGHLGDLELAAISIANTVVVGFN  99



>dbj|BAJ34389.1| unnamed protein product [Thellungiella halophila]
Length=364

 Score = 53.1 bits (126),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 24/34 (71%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = -1

Query  103  SYSMFVITEAFAGHLGDLELAAMSIACNVILGFD  2
            +YS+ VIT+AFAGHLG+LELAA+SI  NVI+GF+
Sbjct  57   TYSILVITQAFAGHLGELELAAISIVNNVIIGFN  90



>emb|CDX78378.1| BnaA03g02900D [Brassica napus]
Length=485

 Score = 53.5 bits (127),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 24/34 (71%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = -1

Query  103  SYSMFVITEAFAGHLGDLELAAMSIACNVILGFD  2
            +YS+FVIT+AFAGHLG+LELAA++I  NVI+GF 
Sbjct  52   TYSIFVITQAFAGHLGELELAAIAIVQNVIIGFS  85



>emb|CDX81172.1| BnaC03g04260D [Brassica napus]
Length=485

 Score = 53.5 bits (127),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 24/34 (71%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = -1

Query  103  SYSMFVITEAFAGHLGDLELAAMSIACNVILGFD  2
            +YS+FVIT+AFAGHLG+LELAA++I  NVI+GF 
Sbjct  52   TYSIFVITQAFAGHLGELELAAIAIVQNVIIGFS  85



>ref|XP_009131156.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Brassica rapa]
Length=485

 Score = 53.5 bits (127),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 24/34 (71%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = -1

Query  103  SYSMFVITEAFAGHLGDLELAAMSIACNVILGFD  2
            +YS+FVIT+AFAGHLG+LELAA++I  NVI+GF 
Sbjct  52   TYSIFVITQAFAGHLGELELAAIAIVQNVIIGFS  85



>emb|CDP01532.1| unnamed protein product [Coffea canephora]
Length=495

 Score = 53.5 bits (127),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 25/34 (74%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = -1

Query  103  SYSMFVITEAFAGHLGDLELAAMSIACNVILGFD  2
            +YSM VIT+AFAGHLGD ELAA+SI  NV++GFD
Sbjct  65   TYSMNVITQAFAGHLGDTELAAISIINNVVVGFD  98



>ref|XP_009150627.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Brassica rapa]
Length=487

 Score = 53.5 bits (127),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 24/34 (71%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = -1

Query  103  SYSMFVITEAFAGHLGDLELAAMSIACNVILGFD  2
            +YS  VIT+AFAGHLGDLELAA+SI  NV++GF+
Sbjct  56   TYSTLVITQAFAGHLGDLELAAISIVYNVVVGFN  89



>ref|XP_004985411.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Setaria 
italica]
Length=547

 Score = 53.5 bits (127),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 25/34 (74%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = -1

Query  103  SYSMFVITEAFAGHLGDLELAAMSIACNVILGFD  2
            +YSM VIT+AFAGHLGDLELAA+SIA  V++GF+
Sbjct  66   TYSMNVITQAFAGHLGDLELAAISIANTVVVGFN  99



>ref|XP_009125302.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Brassica rapa]
 emb|CDX85764.1| BnaA02g00490D [Brassica napus]
Length=500

 Score = 53.5 bits (127),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 24/34 (71%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = -1

Query  103  SYSMFVITEAFAGHLGDLELAAMSIACNVILGFD  2
            +YS+ VIT+AFAGHLG+LELAA+SI  NVI+GF+
Sbjct  57   TYSILVITQAFAGHLGELELAAISIVNNVIIGFN  90



>gb|EEE58464.1| hypothetical protein OsJ_09708 [Oryza sativa Japonica Group]
Length=489

 Score = 53.5 bits (127),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 25/34 (74%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = -1

Query  103  SYSMFVITEAFAGHLGDLELAAMSIACNVILGFD  2
            +YSM VIT+AFAGHLGDLELAA+SIA  V++GF+
Sbjct  61   TYSMNVITQAFAGHLGDLELAAISIANTVVVGFN  94



>emb|CDY08796.1| BnaA06g24280D [Brassica napus]
Length=542

 Score = 53.5 bits (127),  Expect = 8e-07, Method: Composition-based stats.
 Identities = 25/34 (74%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = -1

Query  103  SYSMFVITEAFAGHLGDLELAAMSIACNVILGFD  2
            +YSM VIT+AFAGHLGDLELAA+SI  NV++GF+
Sbjct  53   TYSMLVITQAFAGHLGDLELAAISIVNNVVVGFN  86



>gb|KCW83097.1| hypothetical protein EUGRSUZ_B00056 [Eucalyptus grandis]
Length=463

 Score = 53.1 bits (126),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 22/34 (65%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = -1

Query  103  SYSMFVITEAFAGHLGDLELAAMSIACNVILGFD  2
             Y+M ++T+AFAGHLG++ELAAMSI  NVI+GF+
Sbjct  24   QYTMMIVTQAFAGHLGEVELAAMSIGINVIIGFN  57



>emb|CDY40093.1| BnaC02g00370D [Brassica napus]
Length=502

 Score = 53.5 bits (127),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 24/34 (71%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = -1

Query  103  SYSMFVITEAFAGHLGDLELAAMSIACNVILGFD  2
            +YS+ VIT+AFAGHLG+LELAA+SI  NVI+GF+
Sbjct  56   TYSILVITQAFAGHLGELELAAISIVNNVIIGFN  89



>ref|XP_004172197.1| PREDICTED: protein TRANSPARENT TESTA 12-like, partial [Cucumis 
sativus]
Length=268

 Score = 52.4 bits (124),  Expect = 8e-07, Method: Composition-based stats.
 Identities = 24/34 (71%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = -1

Query  103  SYSMFVITEAFAGHLGDLELAAMSIACNVILGFD  2
            SYS+ V+ +AFAGHL DL+LAA+SIA NVI+GFD
Sbjct  51   SYSILVLAQAFAGHLNDLDLAALSIAVNVIIGFD  84



>ref|XP_010026089.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Eucalyptus grandis]
Length=501

 Score = 53.1 bits (126),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 22/34 (65%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = -1

Query  103  SYSMFVITEAFAGHLGDLELAAMSIACNVILGFD  2
             Y+M ++T+AFAGHLG++ELAAMSI  NVI+GF+
Sbjct  62   QYTMMIVTQAFAGHLGEVELAAMSIGINVIIGFN  95



>gb|KGN48722.1| hypothetical protein Csa_6G499170 [Cucumis sativus]
Length=486

 Score = 53.1 bits (126),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 24/34 (71%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = -1

Query  103  SYSMFVITEAFAGHLGDLELAAMSIACNVILGFD  2
            SYS+ V+ +AFAGHL DL+LAA+SIA NVI+GFD
Sbjct  51   SYSILVLAQAFAGHLNDLDLAALSIAVNVIIGFD  84



>ref|XP_004143555.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Cucumis sativus]
Length=486

 Score = 53.1 bits (126),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 24/34 (71%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = -1

Query  103  SYSMFVITEAFAGHLGDLELAAMSIACNVILGFD  2
            SYS+ V+ +AFAGHL DL+LAA+SIA NVI+GFD
Sbjct  51   SYSILVLAQAFAGHLNDLDLAALSIAVNVIIGFD  84



>ref|NP_001147792.1| transparent testa 12 protein [Zea mays]
 gb|ACG28719.1| transparent testa 12 protein [Zea mays]
Length=484

 Score = 53.1 bits (126),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 25/34 (74%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = -1

Query  103  SYSMFVITEAFAGHLGDLELAAMSIACNVILGFD  2
            +YSM VIT+AFAGHLGDLELAA+SIA  V++GF+
Sbjct  55   TYSMNVITQAFAGHLGDLELAAISIANTVVVGFN  88



>tpg|DAA43788.1| TPA: putative MATE efflux family protein [Zea mays]
Length=486

 Score = 53.1 bits (126),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 25/34 (74%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = -1

Query  103  SYSMFVITEAFAGHLGDLELAAMSIACNVILGFD  2
            +YSM VIT+AFAGHLGDLELAA+SIA  V++GF+
Sbjct  57   TYSMNVITQAFAGHLGDLELAAISIANTVVVGFN  90



>emb|CDY08797.1| BnaA06g24270D [Brassica napus]
Length=565

 Score = 53.1 bits (126),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 24/34 (71%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = -1

Query  103  SYSMFVITEAFAGHLGDLELAAMSIACNVILGFD  2
            +YS  VIT+AFAGHLGDLELAA+SI  NV++GF+
Sbjct  56   TYSTLVITQAFAGHLGDLELAAISIVYNVVVGFN  89



>gb|ACU15197.1| unknown [Glycine max]
Length=188

 Score = 50.8 bits (120),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 23/34 (68%), Positives = 32/34 (94%), Gaps = 0/34 (0%)
 Frame = -1

Query  103  SYSMFVITEAFAGHLGDLELAAMSIACNVILGFD  2
            S++M V+T+AFAGHLGD+ELAA+SIA NV++GF+
Sbjct  64   SFTMNVVTQAFAGHLGDVELAAISIANNVLVGFN  97



>ref|XP_010463146.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Camelina 
sativa]
 ref|XP_010463153.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Camelina 
sativa]
Length=524

 Score = 52.8 bits (125),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 25/34 (74%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = -1

Query  103  SYSMFVITEAFAGHLGDLELAAMSIACNVILGFD  2
            SYS  VIT+AFAGHLGDLELAA+SI  +VI+GF+
Sbjct  93   SYSTLVITQAFAGHLGDLELAAISIVNSVIVGFN  126



>ref|XP_010463159.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X2 [Camelina 
sativa]
Length=496

 Score = 52.8 bits (125),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 25/34 (74%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = -1

Query  103  SYSMFVITEAFAGHLGDLELAAMSIACNVILGFD  2
            SYS  VIT+AFAGHLGDLELAA+SI  +VI+GF+
Sbjct  65   SYSTLVITQAFAGHLGDLELAAISIVNSVIVGFN  98



>ref|XP_002468362.1| hypothetical protein SORBIDRAFT_01g044660 [Sorghum bicolor]
 gb|EER95360.1| hypothetical protein SORBIDRAFT_01g044660 [Sorghum bicolor]
Length=525

 Score = 52.8 bits (125),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 25/34 (74%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = -1

Query  103  SYSMFVITEAFAGHLGDLELAAMSIACNVILGFD  2
            +YSM VIT+AFAGHLGDLELAA+SIA  V++GF 
Sbjct  73   TYSMNVITQAFAGHLGDLELAAISIANTVVVGFS  106



>gb|KDO81079.1| hypothetical protein CISIN_1g011186mg [Citrus sinensis]
Length=449

 Score = 52.4 bits (124),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 24/34 (71%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = -1

Query  103  SYSMFVITEAFAGHLGDLELAAMSIACNVILGFD  2
            SY+M +IT+AFAGHLGD+ELAA+SIA  VI+GF+
Sbjct  52   SYTMNIITQAFAGHLGDVELAAISIANTVIVGFN  85



>ref|XP_007018127.1| MATE efflux family protein isoform 1 [Theobroma cacao]
 gb|EOY15352.1| MATE efflux family protein isoform 1 [Theobroma cacao]
Length=493

 Score = 52.4 bits (124),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 24/34 (71%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = -1

Query  103  SYSMFVITEAFAGHLGDLELAAMSIACNVILGFD  2
            +YSM +IT+AFAGHLGD+ELAA+SIA  VI+GF+
Sbjct  65   AYSMNIITQAFAGHLGDVELAAISIANTVIVGFN  98



>ref|XP_004985413.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Setaria italica]
Length=496

 Score = 52.4 bits (124),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 25/34 (74%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = -1

Query  103  SYSMFVITEAFAGHLGDLELAAMSIACNVILGFD  2
            ++SM VIT+AFAGHLGDLELAA+SIA  VI+GF+
Sbjct  65   TFSMNVITQAFAGHLGDLELAAISIANTVIVGFN  98



>ref|XP_010045479.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Eucalyptus grandis]
 gb|KCW83096.1| hypothetical protein EUGRSUZ_B00055 [Eucalyptus grandis]
Length=502

 Score = 52.4 bits (124),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 24/34 (71%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = -1

Query  103  SYSMFVITEAFAGHLGDLELAAMSIACNVILGFD  2
            SY+M V+T+AFAGHLG++ELAAMSIA  VI+GF+
Sbjct  63   SYTMNVVTQAFAGHLGEVELAAMSIANTVIVGFN  96



>emb|CDY08798.1| BnaA06g24260D [Brassica napus]
Length=321

 Score = 51.6 bits (122),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 24/32 (75%), Positives = 29/32 (91%), Gaps = 0/32 (0%)
 Frame = -1

Query  97  SMFVITEAFAGHLGDLELAAMSIACNVILGFD  2
           S+ VIT+AFAGHLGD+ELAA+SI  NVILGF+
Sbjct  57  SILVITQAFAGHLGDVELAAISIVINVILGFN  88



>ref|XP_002285728.2| PREDICTED: protein TRANSPARENT TESTA 12-like [Vitis vinifera]
Length=490

 Score = 52.4 bits (124),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 24/34 (71%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = -1

Query  103  SYSMFVITEAFAGHLGDLELAAMSIACNVILGFD  2
            SYSM V+T+AFAGHLG+LELA++SIA  VI+GF+
Sbjct  55   SYSMNVVTQAFAGHLGELELASISIANTVIVGFN  88



>emb|CBI19217.3| unnamed protein product [Vitis vinifera]
Length=521

 Score = 52.4 bits (124),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 24/34 (71%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = -1

Query  103  SYSMFVITEAFAGHLGDLELAAMSIACNVILGFD  2
            SYSM V+T+AFAGHLG+LELA++SIA  VI+GF+
Sbjct  86   SYSMNVVTQAFAGHLGELELASISIANTVIVGFN  119



>ref|XP_010041730.1| PREDICTED: protein TRANSPARENT TESTA 12-like, partial [Eucalyptus 
grandis]
Length=335

 Score = 51.6 bits (122),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 21/34 (62%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = -1

Query  103  SYSMFVITEAFAGHLGDLELAAMSIACNVILGFD  2
             Y+M ++T+AFAGHLG++ELAA+SI  NVI+GF+
Sbjct  62   QYTMMIVTQAFAGHLGEVELAAVSIGINVIIGFN  95



>gb|KFK28218.1| hypothetical protein AALP_AA8G488000 [Arabis alpina]
Length=484

 Score = 52.0 bits (123),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 24/34 (71%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = -1

Query  103  SYSMFVITEAFAGHLGDLELAAMSIACNVILGFD  2
            +YS  VIT+AFAGHLGDLELAA+SI  NV +GF+
Sbjct  53   TYSTLVITQAFAGHLGDLELAAISIVNNVTVGFN  86



>emb|CDX97004.1| BnaC09g46210D [Brassica napus]
Length=310

 Score = 51.2 bits (121),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 24/33 (73%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = -1

Query  103  SYSMFVITEAFAGHLGDLELAAMSIACNVILGF  5
            +YS+FVIT+AFAGHLG+LELAA+SI  NVI+ F
Sbjct  60   TYSIFVITQAFAGHLGELELAAISIVHNVIISF  92



>gb|KDO45799.1| hypothetical protein CISIN_1g0118571mg, partial [Citrus sinensis]
Length=315

 Score = 51.2 bits (121),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 25/34 (74%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = -1

Query  103  SYSMFVITEAFAGHLGDLELAAMSIACNVILGFD  2
            +YSM V+T AFAGHLGDLELAA+SIA NVI+ F+
Sbjct  49   TYSMSVVTIAFAGHLGDLELAAISIANNVIVAFN  82



>ref|XP_009122059.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Brassica rapa]
Length=491

 Score = 52.0 bits (123),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 24/34 (71%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = -1

Query  103  SYSMFVITEAFAGHLGDLELAAMSIACNVILGFD  2
            +YS+FVIT+AFAGHLG+LELAA+SI  NVI+ F 
Sbjct  58   TYSIFVITQAFAGHLGELELAAISIVHNVIISFS  91



>emb|CDY70471.1| BnaCnng68540D [Brassica napus]
Length=303

 Score = 51.2 bits (121),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 24/34 (71%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = -1

Query  103  SYSMFVITEAFAGHLGDLELAAMSIACNVILGFD  2
            +YS  VIT+AFAGHLGDLELAA+SI  NV++GF+
Sbjct  56   TYSTLVITQAFAGHLGDLELAAISIVYNVVVGFN  89



>gb|KFK22837.1| hypothetical protein AALP_AAs68044U000100, partial [Arabis alpina]
Length=452

 Score = 51.6 bits (122),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 24/34 (71%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = -1

Query  103  SYSMFVITEAFAGHLGDLELAAMSIACNVILGFD  2
            +YS  VIT+AFAGHLGDLELAA+SI  NV  GF+
Sbjct  57   TYSTIVITQAFAGHLGDLELAAISIVSNVTTGFN  90



>ref|XP_002866668.1| hypothetical protein ARALYDRAFT_496771 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH42927.1| hypothetical protein ARALYDRAFT_496771 [Arabidopsis lyrata subsp. 
lyrata]
Length=486

 Score = 51.6 bits (122),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 25/34 (74%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = -1

Query  103  SYSMFVITEAFAGHLGDLELAAMSIACNVILGFD  2
            +YSM VIT+AFAGHLGDLELAA+SI  NV +GF+
Sbjct  55   TYSMLVITQAFAGHLGDLELAAISIVNNVTVGFN  88



>ref|XP_006578309.1| PREDICTED: protein TRANSPARENT TESTA 12 isoform X1 [Glycine max]
Length=494

 Score = 51.6 bits (122),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 23/34 (68%), Positives = 32/34 (94%), Gaps = 0/34 (0%)
 Frame = -1

Query  103  SYSMFVITEAFAGHLGDLELAAMSIACNVILGFD  2
            S++M V+T+AFAGHLGD+ELAA+SIA NV++GF+
Sbjct  64   SFTMNVVTQAFAGHLGDVELAAISIANNVLVGFN  97



>ref|XP_007227652.1| hypothetical protein PRUPE_ppa016490mg [Prunus persica]
 gb|EMJ28851.1| hypothetical protein PRUPE_ppa016490mg [Prunus persica]
Length=473

 Score = 51.6 bits (122),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 23/32 (72%), Positives = 30/32 (94%), Gaps = 0/32 (0%)
 Frame = -1

Query  100 YSMFVITEAFAGHLGDLELAAMSIACNVILGF  5
           YSM VIT+AFAGHLG++ELA++SIA N+I+GF
Sbjct  46  YSMTVITQAFAGHLGNVELASISIATNIIVGF  77



>gb|KHN08294.1| Protein TRANSPARENT TESTA 12 [Glycine soja]
Length=503

 Score = 51.6 bits (122),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 23/34 (68%), Positives = 32/34 (94%), Gaps = 0/34 (0%)
 Frame = -1

Query  103  SYSMFVITEAFAGHLGDLELAAMSIACNVILGFD  2
            S++M V+T+AFAGHLGD+ELAA+SIA NV++GF+
Sbjct  64   SFTMNVVTQAFAGHLGDVELAAISIANNVLVGFN  97



>ref|XP_008219412.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Prunus mume]
Length=534

 Score = 51.6 bits (122),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 23/32 (72%), Positives = 30/32 (94%), Gaps = 0/32 (0%)
 Frame = -1

Query  100 YSMFVITEAFAGHLGDLELAAMSIACNVILGF  5
           YSM VIT+AFAGHLG++ELA++SIA N+I+GF
Sbjct  46  YSMTVITQAFAGHLGNVELASISIATNIIVGF  77



>ref|XP_006478600.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Citrus sinensis]
Length=476

 Score = 51.2 bits (121),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 25/34 (74%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = -1

Query  103  SYSMFVITEAFAGHLGDLELAAMSIACNVILGFD  2
            +YSM V+T AFAGHLGDLELAA+SIA NVI+ F+
Sbjct  49   TYSMSVVTIAFAGHLGDLELAAISIANNVIVAFN  82



>ref|XP_006442840.1| hypothetical protein CICLE_v10024205mg, partial [Citrus clementina]
 gb|ESR56080.1| hypothetical protein CICLE_v10024205mg, partial [Citrus clementina]
Length=464

 Score = 51.2 bits (121),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 25/34 (74%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = -1

Query  103  SYSMFVITEAFAGHLGDLELAAMSIACNVILGFD  2
            +YSM V+T AFAGHLGDLELAA+SIA NVI+ F+
Sbjct  49   TYSMSVVTIAFAGHLGDLELAAISIANNVIVAFN  82



>dbj|BAE98722.1| hypothetical protein [Arabidopsis thaliana]
Length=195

 Score = 49.3 bits (116),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 23/31 (74%), Positives = 29/31 (94%), Gaps = 0/31 (0%)
 Frame = -1

Query  94  MFVITEAFAGHLGDLELAAMSIACNVILGFD  2
           +FVIT+AFAGHLG+LELAA+SI  NVI+GF+
Sbjct  61  IFVITQAFAGHLGELELAAISIVNNVIIGFN  91



>emb|CDP01121.1| unnamed protein product [Coffea canephora]
Length=498

 Score = 51.2 bits (121),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 24/34 (71%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = -1

Query  103  SYSMFVITEAFAGHLGDLELAAMSIACNVILGFD  2
            SYSM VIT+AFAGHLG++ELA++SIA  VI+GF+
Sbjct  63   SYSMNVITQAFAGHLGEVELASVSIANTVIVGFN  96



>ref|XP_004299688.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Fragaria vesca 
subsp. vesca]
Length=495

 Score = 51.2 bits (121),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 26/34 (76%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = -1

Query  103  SYSMFVITEAFAGHLGDLELAAMSIACNVILGFD  2
            S+SM VIT+AFAGHLGD ELAA SI  NVILGF 
Sbjct  58   SFSMNVITQAFAGHLGDNELAAFSIVNNVILGFS  91



>ref|XP_008363528.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Malus domestica]
Length=490

 Score = 51.2 bits (121),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 23/32 (72%), Positives = 30/32 (94%), Gaps = 0/32 (0%)
 Frame = -1

Query  100 YSMFVITEAFAGHLGDLELAAMSIACNVILGF  5
           YSM VIT+AFAGHLGD+ELA++S+A N+I+GF
Sbjct  52  YSMTVITQAFAGHLGDVELASISMANNIIVGF  83



>gb|EMS63313.1| Protein TRANSPARENT TESTA 12 [Triticum urartu]
Length=635

 Score = 51.2 bits (121),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 24/34 (71%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = -1

Query  103  SYSMFVITEAFAGHLGDLELAAMSIACNVILGFD  2
            ++SM VIT+AFAGHLGDLELAA+SIA  V++GF 
Sbjct  66   TFSMNVITQAFAGHLGDLELAAISIANTVVVGFS  99



>ref|XP_006399538.1| hypothetical protein EUTSA_v10013393mg [Eutrema salsugineum]
 gb|ESQ40991.1| hypothetical protein EUTSA_v10013393mg [Eutrema salsugineum]
Length=486

 Score = 51.2 bits (121),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 23/34 (68%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = -1

Query  103  SYSMFVITEAFAGHLGDLELAAMSIACNVILGFD  2
            +Y +FVIT+AFAGHLG+LELAA+SI  NV +GF+
Sbjct  53   TYLVFVITQAFAGHLGELELAAISIVNNVTIGFN  86



>ref|XP_008440567.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Cucumis melo]
Length=487

 Score = 51.2 bits (121),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 23/34 (68%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = -1

Query  103  SYSMFVITEAFAGHLGDLELAAMSIACNVILGFD  2
            +YS+ VI++AFAGHL DL+LAA SIA NV++GFD
Sbjct  52   TYSVLVISQAFAGHLNDLDLAAFSIAFNVVIGFD  85



>gb|EEC84726.1| hypothetical protein OsI_31704 [Oryza sativa Indica Group]
Length=94

 Score = 48.1 bits (113),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 22/33 (67%), Positives = 27/33 (82%), Gaps = 0/33 (0%)
 Frame = -1

Query  100 YSMFVITEAFAGHLGDLELAAMSIACNVILGFD  2
           YS  +I++AFAGH+GDLELAA SIA NVI G +
Sbjct  54  YSFNIISQAFAGHIGDLELAAFSIANNVITGLN  86



>ref|XP_004143554.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Cucumis sativus]
 ref|XP_004172198.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Cucumis sativus]
 gb|KGN48721.1| hypothetical protein Csa_6G499160 [Cucumis sativus]
Length=494

 Score = 50.8 bits (120),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 23/34 (68%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = -1

Query  103  SYSMFVITEAFAGHLGDLELAAMSIACNVILGFD  2
            ++S+ V ++AFAGHLGDL+LAA+SIA NVI+GFD
Sbjct  59   THSVMVTSQAFAGHLGDLDLAAISIALNVIIGFD  92



>ref|XP_008441115.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Cucumis melo]
Length=493

 Score = 50.8 bits (120),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 23/34 (68%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = -1

Query  103  SYSMFVITEAFAGHLGDLELAAMSIACNVILGFD  2
            ++S+ V ++AFAGHLGDL+LAA+SIA NVI+GFD
Sbjct  58   THSVMVTSQAFAGHLGDLDLAAISIALNVIIGFD  91



>emb|CDX97005.1| BnaC09g46200D [Brassica napus]
Length=487

 Score = 50.8 bits (120),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 23/34 (68%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = -1

Query  103  SYSMFVITEAFAGHLGDLELAAMSIACNVILGFD  2
            +Y + VIT+AFAGHLG+LELAA+SI  NVI+GF+
Sbjct  52   TYLILVITQAFAGHLGELELAAISIVNNVIIGFN  85



>gb|EMT26118.1| Protein TRANSPARENT TESTA 12 [Aegilops tauschii]
Length=553

 Score = 50.8 bits (120),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 24/34 (71%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = -1

Query  103  SYSMFVITEAFAGHLGDLELAAMSIACNVILGFD  2
            ++SM VIT+AFAGHLGDLELAA+SIA  V++GF 
Sbjct  66   TFSMNVITQAFAGHLGDLELAAISIANTVVVGFS  99



>gb|KHG03893.1| Protein TRANSPARENT TESTA 12 -like protein [Gossypium arboreum]
Length=435

 Score = 50.8 bits (120),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 24/33 (73%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = -1

Query  100 YSMFVITEAFAGHLGDLELAAMSIACNVILGFD  2
           YSM +IT+AFAGHLGD+ELAA+SIA  VI+GF+
Sbjct  65  YSMNIITQAFAGHLGDVELAAISIANTVIVGFN  97



>dbj|BAJ95959.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=494

 Score = 50.8 bits (120),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 24/34 (71%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = -1

Query  103  SYSMFVITEAFAGHLGDLELAAMSIACNVILGFD  2
            ++SM VIT+AFAGHLGDLELAA+SIA  V++GF 
Sbjct  65   TFSMNVITQAFAGHLGDLELAAISIANTVVVGFS  98



>emb|CDX81177.1| BnaC03g04310D [Brassica napus]
Length=277

 Score = 50.1 bits (118),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 23/34 (68%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = -1

Query  103  SYSMFVITEAFAGHLGDLELAAMSIACNVILGFD  2
            +Y + VIT+AFAGHLG+LELAA+SI  NVI+GF+
Sbjct  14   TYLILVITQAFAGHLGELELAAISIISNVIVGFN  47



>emb|CDX69835.1| BnaA10g21840D [Brassica napus]
Length=487

 Score = 50.8 bits (120),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 23/34 (68%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = -1

Query  103  SYSMFVITEAFAGHLGDLELAAMSIACNVILGFD  2
            +Y + VIT+AFAGHLG+LELAA+SI  NVI+GF+
Sbjct  52   TYLILVITQAFAGHLGELELAAISIVNNVIIGFN  85



>ref|NP_199218.1| MATE efflux family protein [Arabidopsis thaliana]
 dbj|BAB09065.1| unnamed protein product [Arabidopsis thaliana]
 gb|AED95052.1| MATE efflux family protein [Arabidopsis thaliana]
Length=491

 Score = 50.8 bits (120),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 23/31 (74%), Positives = 29/31 (94%), Gaps = 0/31 (0%)
 Frame = -1

Query  94  MFVITEAFAGHLGDLELAAMSIACNVILGFD  2
           +FVIT+AFAGHLG+LELAA+SI  NVI+GF+
Sbjct  61  IFVITQAFAGHLGELELAAISIVNNVIIGFN  91



>ref|XP_010675571.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Beta vulgaris subsp. 
vulgaris]
Length=502

 Score = 50.8 bits (120),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 24/34 (71%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = -1

Query  103  SYSMFVITEAFAGHLGDLELAAMSIACNVILGFD  2
            S+SM V+T AFAGHLGD+ELAA+SIA  VI+GF+
Sbjct  66   SFSMNVVTTAFAGHLGDVELAALSIANTVIVGFN  99



>ref|XP_011016879.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Populus euphratica]
Length=492

 Score = 50.8 bits (120),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 23/34 (68%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = -1

Query  103  SYSMFVITEAFAGHLGDLELAAMSIACNVILGFD  2
            ++SM +IT+AFAGHLGD+ELAA+SIA  VI+GF+
Sbjct  58   TFSMNIITQAFAGHLGDVELAAISIANTVIVGFN  91



>ref|XP_002302326.1| hypothetical protein POPTR_0002s10250g [Populus trichocarpa]
 gb|EEE81599.1| hypothetical protein POPTR_0002s10250g [Populus trichocarpa]
Length=492

 Score = 50.8 bits (120),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 23/34 (68%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = -1

Query  103  SYSMFVITEAFAGHLGDLELAAMSIACNVILGFD  2
            ++SM +IT+AFAGHLGD+ELAA+SIA  VI+GF+
Sbjct  58   TFSMNIITQAFAGHLGDVELAAISIANTVIVGFN  91



>ref|XP_002865386.1| mate efflux family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH41645.1| mate efflux family protein [Arabidopsis lyrata subsp. lyrata]
Length=490

 Score = 50.8 bits (120),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 23/31 (74%), Positives = 29/31 (94%), Gaps = 0/31 (0%)
 Frame = -1

Query  94  MFVITEAFAGHLGDLELAAMSIACNVILGFD  2
           +FVIT+AFAGHLG+LELAA+SI  NVI+GF+
Sbjct  60  IFVITQAFAGHLGELELAAISIVNNVIIGFN  90



>ref|XP_009409170.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Musa acuminata 
subsp. malaccensis]
Length=485

 Score = 50.8 bits (120),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 23/34 (68%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = -1

Query  103  SYSMFVITEAFAGHLGDLELAAMSIACNVILGFD  2
            SYSM VIT+AFAGHLG+LELA+++IA  V++GF+
Sbjct  54   SYSMNVITQAFAGHLGNLELASITIANTVVVGFN  87



>emb|CAB89401.1| putative protein [Arabidopsis thaliana]
Length=456

 Score = 50.4 bits (119),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 23/34 (68%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = -1

Query  103  SYSMFVITEAFAGHLGDLELAAMSIACNVILGFD  2
            +YS+ +IT+AFAGHLGDLELAA+SI  N  LGF+
Sbjct  56   TYSILIITQAFAGHLGDLELAAISIINNFTLGFN  89



>ref|NP_196604.2| MATE efflux family protein [Arabidopsis thaliana]
 gb|ABE66150.1| ripening-responsive protein [Arabidopsis thaliana]
 gb|AED91538.1| MATE efflux family protein [Arabidopsis thaliana]
Length=489

 Score = 50.8 bits (120),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 23/34 (68%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = -1

Query  103  SYSMFVITEAFAGHLGDLELAAMSIACNVILGFD  2
            +YS+ +IT+AFAGHLGDLELAA+SI  N  LGF+
Sbjct  56   TYSILIITQAFAGHLGDLELAAISIINNFTLGFN  89



>ref|XP_006433900.1| hypothetical protein CICLE_v10000950mg [Citrus clementina]
 gb|ESR47140.1| hypothetical protein CICLE_v10000950mg [Citrus clementina]
Length=492

 Score = 50.4 bits (119),  Expect = 7e-06, Method: Composition-based stats.
 Identities = 24/34 (71%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = -1

Query  103  SYSMFVITEAFAGHLGDLELAAMSIACNVILGFD  2
            SY+M +IT+AFAGHLGD+ELAA+SIA  VI+GF+
Sbjct  53   SYTMNIITQAFAGHLGDVELAAISIANTVIVGFN  86



>ref|XP_004299689.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Fragaria vesca 
subsp. vesca]
Length=507

 Score = 50.8 bits (120),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 23/34 (68%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = -1

Query  103  SYSMFVITEAFAGHLGDLELAAMSIACNVILGFD  2
            SY+M V+T+AFAGHLG++ELAA+SIA  VI+GF+
Sbjct  65   SYTMNVVTQAFAGHLGEVELAAISIANTVIVGFN  98



>ref|XP_009413656.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Musa acuminata 
subsp. malaccensis]
Length=488

 Score = 50.4 bits (119),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 23/34 (68%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = -1

Query  103  SYSMFVITEAFAGHLGDLELAAMSIACNVILGFD  2
            +YS+ VIT+AFAGHLGDLELA++SIA  V++GF 
Sbjct  57   TYSLNVITQAFAGHLGDLELASISIANTVVVGFS  90



>ref|XP_010530703.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Tarenaya hassleriana]
Length=495

 Score = 50.4 bits (119),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 23/34 (68%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = -1

Query  103  SYSMFVITEAFAGHLGDLELAAMSIACNVILGFD  2
            SY+M V+T+AFAGHLG++ELAA+SIA  VI+GF+
Sbjct  59   SYTMNVVTQAFAGHLGEVELAAISIANTVIVGFN  92



>ref|XP_007018128.1| MATE efflux family protein isoform 2 [Theobroma cacao]
 gb|EOY15353.1| MATE efflux family protein isoform 2 [Theobroma cacao]
Length=462

 Score = 50.4 bits (119),  Expect = 7e-06, Method: Composition-based stats.
 Identities = 24/34 (71%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = -1

Query  103  SYSMFVITEAFAGHLGDLELAAMSIACNVILGFD  2
            +YSM +IT+AFAGHLGD+ELAA+SIA  VI+GF+
Sbjct  65   AYSMNIITQAFAGHLGDVELAAISIANTVIVGFN  98



>ref|XP_006472534.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Citrus sinensis]
 gb|KDO81078.1| hypothetical protein CISIN_1g011186mg [Citrus sinensis]
Length=491

 Score = 50.4 bits (119),  Expect = 8e-06, Method: Composition-based stats.
 Identities = 24/34 (71%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = -1

Query  103  SYSMFVITEAFAGHLGDLELAAMSIACNVILGFD  2
            SY+M +IT+AFAGHLGD+ELAA+SIA  VI+GF+
Sbjct  52   SYTMNIITQAFAGHLGDVELAAISIANTVIVGFN  85



>ref|XP_009131157.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Brassica rapa]
Length=487

 Score = 50.4 bits (119),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 23/34 (68%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = -1

Query  103  SYSMFVITEAFAGHLGDLELAAMSIACNVILGFD  2
            +Y + VIT+AFAGHLG+LELAA+SI  NVI+GF+
Sbjct  52   TYLILVITQAFAGHLGELELAAISIISNVIVGFN  85



>emb|CDX78379.1| BnaA03g02910D [Brassica napus]
Length=462

 Score = 50.4 bits (119),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 23/34 (68%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = -1

Query  103  SYSMFVITEAFAGHLGDLELAAMSIACNVILGFD  2
            +Y + VIT+AFAGHLG+LELAA+SI  NVI+GF+
Sbjct  52   TYLILVITQAFAGHLGELELAAISIISNVIVGFN  85



>emb|CDX85762.1| BnaA02g00510D [Brassica napus]
Length=195

 Score = 48.5 bits (114),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 22/31 (71%), Positives = 28/31 (90%), Gaps = 0/31 (0%)
 Frame = -1

Query  94  MFVITEAFAGHLGDLELAAMSIACNVILGFD  2
           + VIT+AFAGHLG+LELAA+SI  NVI+GF+
Sbjct  55  ILVITQAFAGHLGELELAAISIVSNVIIGFN  85



>gb|AAZ66942.1| 117M18_23 [Brassica rapa]
Length=518

 Score = 50.4 bits (119),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 23/34 (68%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = -1

Query  103  SYSMFVITEAFAGHLGDLELAAMSIACNVILGFD  2
            +Y + VIT+AFAGHLG+LELAA+SI  NVI+GF+
Sbjct  52   TYLILVITQAFAGHLGELELAAISIISNVIVGFN  85



>ref|XP_009373462.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Pyrus x bretschneideri]
Length=502

 Score = 50.4 bits (119),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 24/33 (73%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = -1

Query  103  SYSMFVITEAFAGHLGDLELAAMSIACNVILGF  5
            SY+M VIT+AFAGHLG++ELAA+SIA  VI+GF
Sbjct  62   SYTMNVITQAFAGHLGEVELAAISIANTVIVGF  94



>emb|CDY14558.1| BnaC03g49010D [Brassica napus]
Length=322

 Score = 49.7 bits (117),  Expect = 9e-06, Method: Composition-based stats.
 Identities = 24/32 (75%), Positives = 29/32 (91%), Gaps = 0/32 (0%)
 Frame = -1

Query  97  SMFVITEAFAGHLGDLELAAMSIACNVILGFD  2
           S+ VIT+AFAGHLGD+ELAA+SI  NVILGF+
Sbjct  58  SILVITQAFAGHLGDVELAAISIVINVILGFN  89



>ref|XP_010026078.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Eucalyptus grandis]
 gb|KCW83095.1| hypothetical protein EUGRSUZ_B00054 [Eucalyptus grandis]
Length=506

 Score = 50.4 bits (119),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 24/33 (73%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = -1

Query  100 YSMFVITEAFAGHLGDLELAAMSIACNVILGFD  2
           YSM VIT+ F+GHLG++ELAAMSIA  VILGF+
Sbjct  65  YSMNVITQIFSGHLGEVELAAMSIANTVILGFN  97



>ref|XP_010455084.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Camelina sativa]
Length=175

 Score = 48.1 bits (113),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 21/34 (62%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = -1

Query  103  SYSMFVITEAFAGHLGDLELAAMSIACNVILGFD  2
            +YS+ +IT+AF GHLGDLELAA++I  N  LGF+
Sbjct  53   TYSILIITQAFGGHLGDLELAAIAIINNFTLGFN  86



>ref|XP_003561965.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Brachypodium distachyon]
Length=506

 Score = 50.1 bits (118),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 23/34 (68%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = -1

Query  103  SYSMFVITEAFAGHLGDLELAAMSIACNVILGFD  2
            ++SM VIT+AFAGH+GDLELAA+SIA  V++GF 
Sbjct  77   TFSMNVITQAFAGHIGDLELAAISIANTVVVGFS  110



>emb|CDP01124.1| unnamed protein product [Coffea canephora]
Length=522

 Score = 50.1 bits (118),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 24/34 (71%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = -1

Query  103  SYSMFVITEAFAGHLGDLELAAMSIACNVILGFD  2
            SYSM V T+AFAGHLGD+ELA++SIA  VI+GF+
Sbjct  66   SYSMNVATQAFAGHLGDVELASISIANTVIVGFN  99



>gb|KCW44120.1| hypothetical protein EUGRSUZ_L02464 [Eucalyptus grandis]
Length=280

 Score = 49.3 bits (116),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 21/33 (64%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = -1

Query  100 YSMFVITEAFAGHLGDLELAAMSIACNVILGFD  2
           Y+M ++T+AFAGHLG++ELAA+SI  NVI+GF+
Sbjct  63  YTMMIVTQAFAGHLGEVELAAVSIGINVIIGFN  95



>ref|XP_010484857.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Camelina sativa]
Length=492

 Score = 49.7 bits (117),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 22/31 (71%), Positives = 29/31 (94%), Gaps = 0/31 (0%)
 Frame = -1

Query  94  MFVITEAFAGHLGDLELAAMSIACNVILGFD  2
           +FVIT+AFAGHLG+LELA++SI  NVI+GF+
Sbjct  61  IFVITQAFAGHLGELELASISIVNNVIIGFN  91



>ref|XP_006289718.1| hypothetical protein CARUB_v10003295mg [Capsella rubella]
 gb|EOA22616.1| hypothetical protein CARUB_v10003295mg [Capsella rubella]
Length=490

 Score = 49.7 bits (117),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 22/34 (65%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = -1

Query  103  SYSMFVITEAFAGHLGDLELAAMSIACNVILGFD  2
            +YS+ +IT+AFAGHLGDLELAA+S+  N  LGF+
Sbjct  57   TYSILIITQAFAGHLGDLELAAISLINNFTLGFN  90



>ref|XP_009393552.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Musa acuminata 
subsp. malaccensis]
Length=481

 Score = 49.7 bits (117),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 23/33 (70%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = -1

Query  100 YSMFVITEAFAGHLGDLELAAMSIACNVILGFD  2
           YS+ VIT+AFAGHLGDLELA++SIA  V++GF 
Sbjct  51  YSLNVITQAFAGHLGDLELASISIANTVVVGFS  83



>ref|XP_002455429.1| hypothetical protein SORBIDRAFT_03g010660 [Sorghum bicolor]
 gb|EES00549.1| hypothetical protein SORBIDRAFT_03g010660 [Sorghum bicolor]
Length=148

 Score = 47.4 bits (111),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 20/33 (61%), Positives = 27/33 (82%), Gaps = 0/33 (0%)
 Frame = -1

Query  100  YSMFVITEAFAGHLGDLELAAMSIACNVILGFD  2
            YS+ V+ +A AGHLGDLELA++S AC V+ GF+
Sbjct  77   YSLNVVMQAVAGHLGDLELASVSFACTVLTGFN  109



>ref|XP_007226903.1| hypothetical protein PRUPE_ppa016334mg [Prunus persica]
 gb|EMJ28102.1| hypothetical protein PRUPE_ppa016334mg [Prunus persica]
Length=491

 Score = 49.7 bits (117),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/32 (75%), Positives = 29/32 (91%), Gaps = 0/32 (0%)
 Frame = -1

Query  100 YSMFVITEAFAGHLGDLELAAMSIACNVILGF  5
           YSM VIT+AFAGHLG +ELA++SIA NV+LGF
Sbjct  53  YSMGVITQAFAGHLGVVELASISIANNVVLGF  84



>ref|XP_004967732.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X2 [Setaria 
italica]
Length=485

 Score = 49.7 bits (117),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 22/34 (65%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = -1

Query  103  SYSMFVITEAFAGHLGDLELAAMSIACNVILGFD  2
            +YS+ VI +AFAGHLGDLELA++S AC V+ GF+
Sbjct  59   TYSLNVIMQAFAGHLGDLELASVSFACTVLAGFN  92



>ref|XP_004967731.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Setaria 
italica]
Length=487

 Score = 49.3 bits (116),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 22/34 (65%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = -1

Query  103  SYSMFVITEAFAGHLGDLELAAMSIACNVILGFD  2
            +YS+ VI +AFAGHLGDLELA++S AC V+ GF+
Sbjct  59   TYSLNVIMQAFAGHLGDLELASVSFACTVLAGFN  92



>gb|KGN48723.1| hypothetical protein Csa_6G499180 [Cucumis sativus]
Length=485

 Score = 49.3 bits (116),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 22/34 (65%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = -1

Query  103  SYSMFVITEAFAGHLGDLELAAMSIACNVILGFD  2
            SY++ V+ +AFAGHL D +LAA SIA NVI+GFD
Sbjct  51   SYTVLVLAQAFAGHLNDFDLAAFSIAVNVIIGFD  84



>ref|XP_009150626.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Brassica rapa]
Length=486

 Score = 49.3 bits (116),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 24/32 (75%), Positives = 29/32 (91%), Gaps = 0/32 (0%)
 Frame = -1

Query  97  SMFVITEAFAGHLGDLELAAMSIACNVILGFD  2
           S+ VIT+AFAGHLGD+ELAA+SI  NVILGF+
Sbjct  57  SILVITQAFAGHLGDVELAAISIVINVILGFN  88



>ref|XP_010421569.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Camelina 
sativa]
Length=486

 Score = 49.3 bits (116),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 22/34 (65%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = -1

Query  103  SYSMFVITEAFAGHLGDLELAAMSIACNVILGFD  2
            +YS+ +IT+AF GHLGDLELAA+SI  N  LGF+
Sbjct  53   TYSILIITQAFGGHLGDLELAAISIINNFTLGFN  86



>ref|XP_008355304.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Malus domestica]
Length=311

 Score = 48.9 bits (115),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 23/33 (70%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = -1

Query  103  SYSMFVITEAFAGHLGDLELAAMSIACNVILGF  5
            ++SM VIT+AFAGHLG +ELA++SIA NVI+GF
Sbjct  61   AFSMIVITQAFAGHLGVVELASISIANNVIVGF  93



>ref|XP_004169810.1| PREDICTED: LOW QUALITY PROTEIN: protein TRANSPARENT TESTA 12-like 
[Cucumis sativus]
Length=485

 Score = 49.3 bits (116),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 22/34 (65%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = -1

Query  103  SYSMFVITEAFAGHLGDLELAAMSIACNVILGFD  2
            SY++ V+ +AFAGHL D +LAA SIA NVI+GFD
Sbjct  51   SYTVLVLAQAFAGHLNDFDLAAFSIAVNVIIGFD  84



>ref|XP_004143451.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Cucumis sativus]
Length=485

 Score = 49.3 bits (116),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 22/34 (65%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = -1

Query  103  SYSMFVITEAFAGHLGDLELAAMSIACNVILGFD  2
            SY++ V+ +AFAGHL D +LAA SIA NVI+GFD
Sbjct  51   SYTVLVLAQAFAGHLNDFDLAAFSIAVNVIIGFD  84



>ref|XP_008219413.1| PREDICTED: protein TRANSPARENT TESTA 12-like, partial [Prunus 
mume]
Length=491

 Score = 49.3 bits (116),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 22/34 (65%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = -1

Query  103  SYSMFVITEAFAGHLGDLELAAMSIACNVILGFD  2
            SY+M VIT+AFAGHLG+++LA++SIA  VI+GF+
Sbjct  51   SYTMNVITQAFAGHLGEVQLASISIANTVIVGFN  84



>ref|XP_007136291.1| hypothetical protein PHAVU_009G034100g [Phaseolus vulgaris]
 gb|ESW08285.1| hypothetical protein PHAVU_009G034100g [Phaseolus vulgaris]
Length=505

 Score = 48.9 bits (115),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 22/33 (67%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = -1

Query  100 YSMFVITEAFAGHLGDLELAAMSIACNVILGFD  2
           ++M V+T+AFAGHLGD+ELAA+SIA  VI+GF+
Sbjct  67  FNMNVVTQAFAGHLGDVELAAISIANTVIVGFN  99



>gb|KDP41437.1| hypothetical protein JCGZ_15844 [Jatropha curcas]
Length=492

 Score = 48.9 bits (115),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 22/34 (65%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = -1

Query  103  SYSMFVITEAFAGHLGDLELAAMSIACNVILGFD  2
            S+SM +IT+AFAGHLGD+ LA++SIA  VI+GF+
Sbjct  54   SFSMNIITQAFAGHLGDIPLASISIANTVIVGFN  87



>ref|XP_006827931.1| hypothetical protein AMTR_s00008p00178100 [Amborella trichopoda]
 gb|ERM95347.1| hypothetical protein AMTR_s00008p00178100 [Amborella trichopoda]
Length=442

 Score = 48.9 bits (115),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 24/33 (73%), Positives = 27/33 (82%), Gaps = 0/33 (0%)
 Frame = -1

Query  100 YSMFVITEAFAGHLGDLELAAMSIACNVILGFD  2
           Y M VIT  FAGHLGDLELAA+SIA  VI+GF+
Sbjct  47  YGMNVITLVFAGHLGDLELAAISIASTVIVGFN  79



>ref|XP_007224466.1| hypothetical protein PRUPE_ppa022569mg, partial [Prunus persica]
 gb|EMJ25665.1| hypothetical protein PRUPE_ppa022569mg, partial [Prunus persica]
Length=475

 Score = 48.9 bits (115),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 22/34 (65%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = -1

Query  103  SYSMFVITEAFAGHLGDLELAAMSIACNVILGFD  2
            SY+M VIT+AFAGHLG+++LA++SIA  VI+GF+
Sbjct  60   SYTMNVITQAFAGHLGEVQLASISIANTVIVGFN  93



>emb|CDY40095.1| BnaC02g00350D [Brassica napus]
Length=487

 Score = 48.9 bits (115),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 22/31 (71%), Positives = 28/31 (90%), Gaps = 0/31 (0%)
 Frame = -1

Query  94  MFVITEAFAGHLGDLELAAMSIACNVILGFD  2
           + VIT+AFAGHLG+LELAA+SI  NVI+GF+
Sbjct  55  ILVITQAFAGHLGELELAAISIVSNVIIGFN  85



>ref|XP_006394042.1| hypothetical protein EUTSA_v10004090mg [Eutrema salsugineum]
 gb|ESQ31328.1| hypothetical protein EUTSA_v10004090mg [Eutrema salsugineum]
Length=486

 Score = 48.9 bits (115),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 24/32 (75%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = -1

Query  97  SMFVITEAFAGHLGDLELAAMSIACNVILGFD  2
           S+ VIT+AFAGHLGDLELAA+SI  NVIL F+
Sbjct  57  SILVITQAFAGHLGDLELAAISIVTNVILSFN  88



>emb|CDX81176.1| BnaC03g04300D [Brassica napus]
Length=488

 Score = 48.5 bits (114),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 22/34 (65%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = -1

Query  103  SYSMFVITEAFAGHLGDLELAAMSIACNVILGFD  2
            +Y +  IT+AFAGHLG+LELAA+SI  NVI+GF+
Sbjct  53   TYLILFITQAFAGHLGELELAAISIVSNVIVGFN  86



>ref|XP_003602857.1| Ripening regulated protein DDTFR18 [Medicago truncatula]
 gb|AES73108.1| MATE efflux family protein [Medicago truncatula]
Length=504

 Score = 48.5 bits (114),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 21/34 (62%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = -1

Query  103  SYSMFVITEAFAGHLGDLELAAMSIACNVILGFD  2
            S++M V+T+AFAGHLGD++LA++SIA  VI+GF+
Sbjct  65   SFTMNVVTQAFAGHLGDVQLASISIANTVIVGFN  98



>emb|CDP01534.1| unnamed protein product [Coffea canephora]
Length=506

 Score = 48.5 bits (114),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 23/33 (70%), Positives = 28/33 (85%), Gaps = 0/33 (0%)
 Frame = -1

Query  103  SYSMFVITEAFAGHLGDLELAAMSIACNVILGF  5
            ++SMF  ++AFAGHLGDLELAA+SIA  VI GF
Sbjct  74   NFSMFFFSQAFAGHLGDLELAALSIAGTVISGF  106



>ref|XP_008219362.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Prunus mume]
Length=491

 Score = 48.5 bits (114),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 23/32 (72%), Positives = 29/32 (91%), Gaps = 0/32 (0%)
 Frame = -1

Query  100 YSMFVITEAFAGHLGDLELAAMSIACNVILGF  5
           YSM VIT+AFAGHLG ++LA++SIA NV+LGF
Sbjct  53  YSMGVITQAFAGHLGVVQLASISIANNVVLGF  84



>ref|XP_010098694.1| Protein TRANSPARENT TESTA 12 [Morus notabilis]
 gb|EXB75597.1| Protein TRANSPARENT TESTA 12 [Morus notabilis]
Length=487

 Score = 48.1 bits (113),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 22/34 (65%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = -1

Query  103  SYSMFVITEAFAGHLGDLELAAMSIACNVILGFD  2
            ++SM VIT++FAGHLGD+ELA++SIA  VI+GF+
Sbjct  62   AFSMNVITQSFAGHLGDVELASISIANTVIVGFN  95



>ref|XP_010060062.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Eucalyptus grandis]
 gb|KCW66594.1| hypothetical protein EUGRSUZ_F00387 [Eucalyptus grandis]
Length=513

 Score = 48.1 bits (113),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 22/34 (65%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = -1

Query  103  SYSMFVITEAFAGHLGDLELAAMSIACNVILGFD  2
            +YSM +I++AFAGHLG++ELAA SIA  VI+GF+
Sbjct  62   AYSMNIISQAFAGHLGEVELAAFSIANTVIVGFN  95



>ref|XP_010456744.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Camelina sativa]
Length=417

 Score = 47.8 bits (112),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 21/34 (62%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = -1

Query  103  SYSMFVITEAFAGHLGDLELAAMSIACNVILGFD  2
            +YS+ +IT+AF GHLGDLELAA++I  N  LGF+
Sbjct  25   TYSILIITQAFGGHLGDLELAAIAIINNFTLGFN  58



>ref|XP_010098693.1| Protein TRANSPARENT TESTA 12 [Morus notabilis]
 gb|EXB75596.1| Protein TRANSPARENT TESTA 12 [Morus notabilis]
Length=471

 Score = 48.1 bits (113),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 22/34 (65%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = -1

Query  103  SYSMFVITEAFAGHLGDLELAAMSIACNVILGFD  2
            SYSM +IT+AFAGHL ++ELA++SIA  VI+GF+
Sbjct  56   SYSMNIITQAFAGHLSEVELASISIANTVIVGFN  89



>gb|KFK25316.1| hypothetical protein AALP_AA8G096900 [Arabis alpina]
Length=491

 Score = 48.1 bits (113),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 21/34 (62%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = -1

Query  103  SYSMFVITEAFAGHLGDLELAAMSIACNVILGFD  2
            +YS+ VIT+ FAGHLG+LELAA+SI  N+I+ F 
Sbjct  58   TYSILVITQTFAGHLGELELAAISIVSNLIISFS  91



>ref|XP_004501679.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Cicer arietinum]
Length=493

 Score = 47.8 bits (112),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 21/34 (62%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = -1

Query  103  SYSMFVITEAFAGHLGDLELAAMSIACNVILGFD  2
            S++M V+T+AFAGHLGD++LA++SIA  VI+GF+
Sbjct  54   SFTMNVVTQAFAGHLGDVQLASISIANAVIVGFN  87



>ref|XP_002513990.1| multidrug resistance pump, putative [Ricinus communis]
 gb|EEF48573.1| multidrug resistance pump, putative [Ricinus communis]
Length=497

 Score = 47.8 bits (112),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 20/34 (59%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = -1

Query  103  SYSMFVITEAFAGHLGDLELAAMSIACNVILGFD  2
            SYSM ++T+ FAGHLG+++LA++SIA  VI+GF+
Sbjct  59   SYSMNIVTQGFAGHLGEVQLASISIANTVIVGFN  92



>ref|XP_006280365.1| hypothetical protein CARUB_v10026293mg [Capsella rubella]
 gb|EOA13263.1| hypothetical protein CARUB_v10026293mg [Capsella rubella]
Length=490

 Score = 47.8 bits (112),  Expect = 8e-05, Method: Composition-based stats.
 Identities = 22/31 (71%), Positives = 29/31 (94%), Gaps = 0/31 (0%)
 Frame = -1

Query  94  MFVITEAFAGHLGDLELAAMSIACNVILGFD  2
           +FVIT+AFAGHLG+LELA++SI  NVI+GF+
Sbjct  60  IFVITQAFAGHLGELELASISIVNNVIIGFN  90



>ref|XP_011083823.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Sesamum indicum]
Length=531

 Score = 47.4 bits (111),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 20/32 (63%), Positives = 30/32 (94%), Gaps = 0/32 (0%)
 Frame = -1

Query  97   SMFVITEAFAGHLGDLELAAMSIACNVILGFD  2
            +M +I++++AGHLGDLELA++SIA NVI+GF+
Sbjct  98   TMNIISQSYAGHLGDLELASVSIANNVIVGFN  129



>gb|EMT23905.1| Protein TRANSPARENT TESTA 12 [Aegilops tauschii]
Length=95

 Score = 44.7 bits (104),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 20/33 (61%), Positives = 26/33 (79%), Gaps = 0/33 (0%)
 Frame = -1

Query  100 YSMFVITEAFAGHLGDLELAAMSIACNVILGFD  2
           Y + V+++AF GH+GDLELAA SIA  VI GF+
Sbjct  55  YGINVVSQAFIGHIGDLELAAFSIASTVIAGFN  87



>ref|XP_004967733.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Setaria italica]
Length=427

 Score = 47.0 bits (110),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 21/31 (68%), Positives = 27/31 (87%), Gaps = 0/31 (0%)
 Frame = -1

Query  94  MFVITEAFAGHLGDLELAAMSIACNVILGFD  2
           M VI +AFAGHLGDLELA++S AC V++GF+
Sbjct  1   MNVIMQAFAGHLGDLELASVSFACTVLVGFN  31



>dbj|BAD09757.1| unknown protein [Oryza sativa Japonica Group]
 gb|EAZ07369.1| hypothetical protein OsI_29620 [Oryza sativa Indica Group]
 gb|EAZ43096.1| hypothetical protein OsJ_27687 [Oryza sativa Japonica Group]
Length=104

 Score = 44.7 bits (104),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 19/33 (58%), Positives = 26/33 (79%), Gaps = 0/33 (0%)
 Frame = -1

Query  100 YSMFVITEAFAGHLGDLELAAMSIACNVILGFD  2
           Y + V+++AF GH+GDLELAA SIA  V+ GF+
Sbjct  61  YGINVVSQAFIGHMGDLELAAFSIASTVVAGFN  93



>ref|XP_002513989.1| multidrug resistance pump, putative [Ricinus communis]
 gb|EEF48572.1| multidrug resistance pump, putative [Ricinus communis]
Length=89

 Score = 44.3 bits (103),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 19/31 (61%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = -1

Query  94  MFVITEAFAGHLGDLELAAMSIACNVILGFD  2
           M +I + FAGHLGD++LA+MSIA  VI+GF+
Sbjct  1   MNIIAQGFAGHLGDVQLASMSIANTVIIGFN  31



>ref|XP_010491708.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Camelina sativa]
Length=486

 Score = 46.6 bits (109),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 22/32 (69%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = -1

Query  97  SMFVITEAFAGHLGDLELAAMSIACNVILGFD  2
           S+ VIT+AF GHLGDLELAA+SI  N  LGF+
Sbjct  55  SILVITQAFGGHLGDLELAAISIINNFTLGFN  86



>emb|CDP01122.1| unnamed protein product [Coffea canephora]
Length=424

 Score = 46.2 bits (108),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 21/31 (68%), Positives = 28/31 (90%), Gaps = 0/31 (0%)
 Frame = -1

Query  94  MFVITEAFAGHLGDLELAAMSIACNVILGFD  2
           M V+T+AFAGHLGD+ELA++SIA NVI+ F+
Sbjct  1   MNVVTQAFAGHLGDVELASISIANNVIVAFN  31



>ref|XP_004489770.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Cicer arietinum]
Length=489

 Score = 46.2 bits (108),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 21/34 (62%), Positives = 27/34 (79%), Gaps = 0/34 (0%)
 Frame = -1

Query  103  SYSMFVITEAFAGHLGDLELAAMSIACNVILGFD  2
            +Y+M V+T+ FAG +GD ELAA +IA NVILG D
Sbjct  55   NYTMLVMTQIFAGRIGDAELAATAIAINVILGLD  88



>ref|XP_009789598.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X2 [Nicotiana 
sylvestris]
Length=437

 Score = 46.2 bits (108),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 20/34 (59%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = -1

Query  103  SYSMFVITEAFAGHLGDLELAAMSIACNVILGFD  2
            SY+M +IT+ FAGHLG++ELAA+SI+  VI+G +
Sbjct  66   SYTMNIITQGFAGHLGEVELAAISISNTVIVGLN  99



>ref|XP_007018129.1| MATE efflux family protein [Theobroma cacao]
 gb|EOY15354.1| MATE efflux family protein [Theobroma cacao]
Length=489

 Score = 46.2 bits (108),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 22/30 (73%), Positives = 26/30 (87%), Gaps = 0/30 (0%)
 Frame = -1

Query  100 YSMFVITEAFAGHLGDLELAAMSIACNVIL  11
           +SM VIT+AFAGHLGDL LAA+SIA  VI+
Sbjct  61  FSMTVITQAFAGHLGDLNLAAISIATTVII  90



>ref|XP_009373481.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X2 [Pyrus 
x bretschneideri]
Length=448

 Score = 46.2 bits (108),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 19/34 (56%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = -1

Query  103  SYSMFVITEAFAGHLGDLELAAMSIACNVILGFD  2
            ++SM VIT+AFAGHLG++ELA++SI   +++GF+
Sbjct  61   TFSMNVITQAFAGHLGEVELASVSIGITLVIGFN  94



>ref|XP_009789596.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Nicotiana 
sylvestris]
Length=501

 Score = 46.2 bits (108),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 20/34 (59%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = -1

Query  103  SYSMFVITEAFAGHLGDLELAAMSIACNVILGFD  2
            SY+M +IT+ FAGHLG++ELAA+SI+  VI+G +
Sbjct  66   SYTMNIITQGFAGHLGEVELAAISISNTVIVGLN  99



>ref|XP_009373472.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Pyrus 
x bretschneideri]
Length=501

 Score = 45.8 bits (107),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 19/34 (56%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = -1

Query  103  SYSMFVITEAFAGHLGDLELAAMSIACNVILGFD  2
            ++SM VIT+AFAGHLG++ELA++SI   +++GF+
Sbjct  61   TFSMNVITQAFAGHLGEVELASVSIGITLVIGFN  94



>ref|XP_009596939.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Nicotiana tomentosiformis]
Length=501

 Score = 45.8 bits (107),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 20/34 (59%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = -1

Query  103  SYSMFVITEAFAGHLGDLELAAMSIACNVILGFD  2
            +Y+M VIT+ FAGHLG++ELAA+SI+  VI+G +
Sbjct  66   TYTMNVITQGFAGHLGEVELAAISISNTVIVGLN  99



>ref|XP_010026044.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Eucalyptus 
grandis]
 ref|XP_010026051.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Eucalyptus 
grandis]
 ref|XP_010026058.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Eucalyptus 
grandis]
Length=497

 Score = 45.8 bits (107),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 21/30 (70%), Positives = 27/30 (90%), Gaps = 0/30 (0%)
 Frame = -1

Query  103  SYSMFVITEAFAGHLGDLELAAMSIACNVI  14
            +YSM V+T+AF+GHLG++ELAAMSIA  VI
Sbjct  58   TYSMNVVTQAFSGHLGEVELAAMSIANTVI  87



>gb|KCW83094.1| hypothetical protein EUGRSUZ_B00053, partial [Eucalyptus grandis]
Length=470

 Score = 45.4 bits (106),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 21/30 (70%), Positives = 27/30 (90%), Gaps = 0/30 (0%)
 Frame = -1

Query  103  SYSMFVITEAFAGHLGDLELAAMSIACNVI  14
            +YSM V+T+AF+GHLG++ELAAMSIA  VI
Sbjct  31   TYSMNVVTQAFSGHLGEVELAAMSIANTVI  60



>ref|XP_006338107.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Solanum tuberosum]
Length=499

 Score = 45.4 bits (106),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 19/34 (56%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = -1

Query  103  SYSMFVITEAFAGHLGDLELAAMSIACNVILGFD  2
            +Y+M +IT++FAGHLG++ELAA+SI+  VI+G +
Sbjct  64   TYTMNIITQSFAGHLGEVELAAISISNTVIVGLN  97



>gb|EMT23528.1| Protein TRANSPARENT TESTA 12 [Aegilops tauschii]
Length=478

 Score = 45.4 bits (106),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 21/33 (64%), Positives = 27/33 (82%), Gaps = 0/33 (0%)
 Frame = -1

Query  100 YSMFVITEAFAGHLGDLELAAMSIACNVILGFD  2
           YS+ +I+++FAGHLGD ELAA SIA  VI GF+
Sbjct  50  YSLNIISQSFAGHLGDAELAAFSIASTVISGFN  82



>ref|XP_004237959.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Solanum lycopersicum]
Length=503

 Score = 45.4 bits (106),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 20/34 (59%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = -1

Query  103  SYSMFVITEAFAGHLGDLELAAMSIACNVILGFD  2
            +YSM +IT+ FAGHLG++ELAA+SI+  VI+G  
Sbjct  68   TYSMNIITQGFAGHLGEVELAAISISNTVIVGLS  101



>ref|XP_006433899.1| hypothetical protein CICLE_v10003999mg [Citrus clementina]
 gb|ESR47139.1| hypothetical protein CICLE_v10003999mg [Citrus clementina]
Length=478

 Score = 45.4 bits (106),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 21/30 (70%), Positives = 26/30 (87%), Gaps = 0/30 (0%)
 Frame = -1

Query  100 YSMFVITEAFAGHLGDLELAAMSIACNVIL  11
           +SM V+T+AFAGHLGDL LAA+SIA  VI+
Sbjct  60  FSMTVVTQAFAGHLGDLNLAAISIATTVII  89



>ref|NP_001063428.1| Os09g0468000 [Oryza sativa Japonica Group]
 dbj|BAD19740.1| putative ripening regulated protein DDTFR18 [Oryza sativa Japonica 
Group]
 dbj|BAF25342.1| Os09g0468000 [Oryza sativa Japonica Group]
 dbj|BAG96102.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE69877.1| hypothetical protein OsJ_29692 [Oryza sativa Japonica Group]
Length=482

 Score = 45.1 bits (105),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 22/33 (67%), Positives = 27/33 (82%), Gaps = 0/33 (0%)
 Frame = -1

Query  100 YSMFVITEAFAGHLGDLELAAMSIACNVILGFD  2
           YS  +I++AFAGH+GDLELAA SIA NVI G +
Sbjct  54  YSFNIISQAFAGHIGDLELAAFSIANNVITGLN  86



>ref|XP_010320056.1| PREDICTED: ripening regulated protein DDTFR18 isoform X1 [Solanum 
lycopersicum]
Length=482

 Score = 45.1 bits (105),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 19/34 (56%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = -1

Query  103  SYSMFVITEAFAGHLGDLELAAMSIACNVILGFD  2
            SY+M +IT++FAGHLG+++LAA+SI+  VI+G +
Sbjct  47   SYTMNIITQSFAGHLGEVQLAAISISNTVIVGLN  80



>ref|XP_002460371.1| hypothetical protein SORBIDRAFT_02g027170 [Sorghum bicolor]
 gb|EER96892.1| hypothetical protein SORBIDRAFT_02g027170 [Sorghum bicolor]
Length=512

 Score = 45.1 bits (105),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 21/33 (64%), Positives = 25/33 (76%), Gaps = 0/33 (0%)
 Frame = -1

Query  100 YSMFVITEAFAGHLGDLELAAMSIACNVILGFD  2
           Y M V+++AFAGH+GDLELAA SIA  VI G  
Sbjct  54  YGMTVVSQAFAGHIGDLELAAFSIATTVISGLS  86



>ref|XP_010026120.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Eucalyptus grandis]
 gb|KCW83103.1| hypothetical protein EUGRSUZ_B00058 [Eucalyptus grandis]
Length=493

 Score = 45.1 bits (105),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 20/30 (67%), Positives = 27/30 (90%), Gaps = 0/30 (0%)
 Frame = -1

Query  100 YSMFVITEAFAGHLGDLELAAMSIACNVIL  11
           YS+ V+T+AFAGHLGD++LAA+SIA  VI+
Sbjct  62  YSITVVTQAFAGHLGDIDLAAISIATTVII  91



>gb|KCW83104.1| hypothetical protein EUGRSUZ_B00058 [Eucalyptus grandis]
Length=430

 Score = 45.1 bits (105),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 20/30 (67%), Positives = 27/30 (90%), Gaps = 0/30 (0%)
 Frame = -1

Query  100 YSMFVITEAFAGHLGDLELAAMSIACNVIL  11
           YS+ V+T+AFAGHLGD++LAA+SIA  VI+
Sbjct  62  YSITVVTQAFAGHLGDIDLAAISIATTVII  91



>gb|KCW83105.1| hypothetical protein EUGRSUZ_B00058 [Eucalyptus grandis]
Length=447

 Score = 45.1 bits (105),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 20/30 (67%), Positives = 27/30 (90%), Gaps = 0/30 (0%)
 Frame = -1

Query  100 YSMFVITEAFAGHLGDLELAAMSIACNVIL  11
           YS+ V+T+AFAGHLGD++LAA+SIA  VI+
Sbjct  62  YSITVVTQAFAGHLGDIDLAAISIATTVII  91



>gb|KCW83102.1| hypothetical protein EUGRSUZ_B00058 [Eucalyptus grandis]
Length=491

 Score = 45.1 bits (105),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 20/30 (67%), Positives = 27/30 (90%), Gaps = 0/30 (0%)
 Frame = -1

Query  100 YSMFVITEAFAGHLGDLELAAMSIACNVIL  11
           YS+ V+T+AFAGHLGD++LAA+SIA  VI+
Sbjct  62  YSITVVTQAFAGHLGDIDLAAISIATTVII  91



>gb|EEC84727.1| hypothetical protein OsI_31705 [Oryza sativa Indica Group]
Length=482

 Score = 45.1 bits (105),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 22/33 (67%), Positives = 27/33 (82%), Gaps = 0/33 (0%)
 Frame = -1

Query  100 YSMFVITEAFAGHLGDLELAAMSIACNVILGFD  2
           YS  +I++AFAGH+GDLELAA SIA NVI G +
Sbjct  54  YSFNIISQAFAGHIGDLELAAFSIANNVITGLN  86



>ref|NP_001234398.1| ripening regulated protein DDTFR18 [Solanum lycopersicum]
 gb|AAG49032.1|AF204785_1 ripening regulated protein DDTFR18 [Solanum lycopersicum]
Length=447

 Score = 45.1 bits (105),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 19/34 (56%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = -1

Query  103  SYSMFVITEAFAGHLGDLELAAMSIACNVILGFD  2
            SY+M +IT++FAGHLG+++LAA+SI+  VI+G +
Sbjct  47   SYTMNIITQSFAGHLGEVQLAAISISNTVIVGLN  80



>ref|XP_010453066.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Camelina sativa]
Length=486

 Score = 45.1 bits (105),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 21/34 (62%), Positives = 27/34 (79%), Gaps = 0/34 (0%)
 Frame = -1

Query  103  SYSMFVITEAFAGHLGDLELAAMSIACNVILGFD  2
            +YS+ +IT+AF GHLGDLELAA+SI     LGF+
Sbjct  53   TYSIVIITQAFGGHLGDLELAAISIINIFTLGFN  86



>ref|XP_009380883.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Musa acuminata 
subsp. malaccensis]
Length=481

 Score = 45.1 bits (105),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 21/26 (81%), Positives = 24/26 (92%), Gaps = 0/26 (0%)
 Frame = -1

Query  103  SYSMFVITEAFAGHLGDLELAAMSIA  26
            SYSM + T+AFAGHLGDLELAAMS+A
Sbjct  51   SYSMNLATQAFAGHLGDLELAAMSVA  76



>ref|XP_004152620.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Cucumis sativus]
 ref|XP_004164229.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Cucumis sativus]
 gb|KGN62721.1| hypothetical protein Csa_2G369230 [Cucumis sativus]
Length=474

 Score = 44.7 bits (104),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 19/34 (56%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = -1

Query  103  SYSMFVITEAFAGHLGDLELAAMSIACNVILGFD  2
            S++M +IT+AF+G LGD++LA++SIA  VI+GF+
Sbjct  36   SFTMNIITQAFSGRLGDVQLASISIANTVIVGFN  69



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 527207176184