BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c57189_g1_i1 len=471 path=[449:0-470]

Length=471
                                                                      Score     E

ref|XP_006574083.1|  PREDICTED: uncharacterized mitochondrial pro...    137   3e-36   
emb|CAN73071.1|  hypothetical protein VITISV_032383                     143   4e-36   Vitis vinifera
emb|CAN78022.1|  hypothetical protein VITISV_015518                     143   6e-36   Vitis vinifera
gb|AAT85031.1|  putative polyprotein                                    141   3e-35   Oryza sativa Japonica Group [Japonica rice]
emb|CAN61823.1|  hypothetical protein VITISV_008493                     136   6e-35   Vitis vinifera
ref|XP_006595350.1|  PREDICTED: uncharacterized mitochondrial pro...    132   8e-35   
ref|XP_010430787.1|  PREDICTED: uncharacterized protein LOC104715028    137   6e-34   
gb|KHN30958.1|  Retrovirus-related Pol polyprotein from transposo...    136   1e-33   
gb|KHN05629.1|  Retrovirus-related Pol polyprotein from transposo...    136   1e-33   
gb|KHN45997.1|  Retrovirus-related Pol polyprotein from transposo...    136   1e-33   
emb|CAE05127.3|  OSJNBa0079F16.14                                       131   1e-33   Oryza sativa [red rice]
emb|CAN67588.1|  hypothetical protein VITISV_036280                     136   2e-33   Vitis vinifera
emb|CAN71676.1|  hypothetical protein VITISV_015838                     135   2e-33   Vitis vinifera
gb|AAP53968.1|  retrotransposon protein, putative, Ty1-copia subc...    135   2e-33   Oryza sativa Japonica Group [Japonica rice]
gb|EEC76475.1|  hypothetical protein OsI_14210                          131   3e-33   Oryza sativa Indica Group [Indian rice]
gb|AAK55460.1|AC069300_15  putative gag-pol polyprotein                 135   3e-33   Oryza sativa Japonica Group [Japonica rice]
gb|KHN17953.1|  Retrovirus-related Pol polyprotein from transposo...    135   4e-33   
ref|NP_001175678.1|  Os08g0544300                                       133   8e-33   
emb|CAN72527.1|  hypothetical protein VITISV_009255                     133   1e-32   Vitis vinifera
ref|XP_008665822.1|  PREDICTED: uncharacterized protein LOC103644390    132   2e-32   
gb|AAX96193.1|  retrotransposon protein, putative, Ty1-copia sub-...    133   2e-32   Oryza sativa Japonica Group [Japonica rice]
emb|CAN79182.1|  hypothetical protein VITISV_024133                     130   2e-32   Vitis vinifera
emb|CAC37623.1|  copia-like polyprotein                                 133   2e-32   Arabidopsis thaliana [mouse-ear cress]
gb|AAD43604.1|AC005698_3  T3P18.3                                       133   2e-32   Arabidopsis thaliana [mouse-ear cress]
pir||T02087  gag/pol polyprotein - maize retrotransposon Hopscotch      132   3e-32
gb|AAK51235.1|AF287471_1  polyprotein                                   132   4e-32   Arabidopsis thaliana [mouse-ear cress]
gb|AAL66754.1|AF464738_5  putative copia-like retrotransposon Hop...    132   4e-32   Zea mays [maize]
emb|CAB40035.1|  retrotransposon like protein                           132   5e-32   Arabidopsis thaliana [mouse-ear cress]
emb|CAN61640.1|  hypothetical protein VITISV_021909                     132   5e-32   Vitis vinifera
gb|ABA98286.2|  retrotransposon protein, putative, Ty1-copia subc...    132   6e-32   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002466349.1|  hypothetical protein SORBIDRAFT_01g006185          129   6e-32   Sorghum bicolor [broomcorn]
gb|ABA98049.1|  retrotransposon protein, putative, Ty1-copia subc...    131   7e-32   Oryza sativa Japonica Group [Japonica rice]
gb|AAC35532.1|  contains similarity to proteases                        131   7e-32   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007019438.1|  Cysteine-rich RLK (RECEPTOR-like protein kin...    129   8e-32   
gb|AAR88589.1|  putative copia-like retrotransposon protein             131   8e-32   Oryza sativa Japonica Group [Japonica rice]
gb|AID60162.1|  copia-like LTR-retrotransposon                          129   8e-32   
gb|ACY72569.1|  unknown                                                 130   1e-31   Oryza sativa Japonica Group [Japonica rice]
gb|AAT69582.1|  putative polyprotein                                    130   1e-31   Oryza sativa Japonica Group [Japonica rice]
gb|ABA95721.1|  retrotransposon protein, putative, Ty1-copia subc...    130   2e-31   Oryza sativa Japonica Group [Japonica rice]
gb|AAD22324.1|  putative retroelement pol polyprotein                   126   2e-31   Arabidopsis thaliana [mouse-ear cress]
gb|AID60119.1|  hypothetical protein                                    129   2e-31   
emb|CAN61230.1|  hypothetical protein VITISV_010115                     127   2e-31   Vitis vinifera
gb|AAT07563.1|  putative polyprotein                                    130   2e-31   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008390439.1|  PREDICTED: uncharacterized protein LOC103452682    130   2e-31   
emb|CAN80686.1|  hypothetical protein VITISV_033813                     126   2e-31   Vitis vinifera
gb|ABA97008.1|  retrotransposon protein, putative, Ty1-copia subc...    130   2e-31   Oryza sativa Japonica Group [Japonica rice]
gb|AAU90288.2|  Polyprotein, putative                                   130   2e-31   Solanum demissum
gb|AAN06870.1|  Putative gag-pol polyprotein                            130   2e-31   Oryza sativa Japonica Group [Japonica rice]
gb|AAB82754.1|  retrofit                                                130   3e-31   Oryza longistaminata [long-staminate rice]
emb|CAN78042.1|  hypothetical protein VITISV_041808                     127   3e-31   Vitis vinifera
emb|CAN69607.1|  hypothetical protein VITISV_009561                     129   3e-31   Vitis vinifera
ref|XP_008646486.1|  PREDICTED: uncharacterized protein LOC103627967    129   3e-31   
gb|AAW56918.1|  putative polyprotein                                    129   4e-31   Oryza sativa Japonica Group [Japonica rice]
gb|ABA99232.1|  retrotransposon protein, putative, Ty1-copia subc...    124   4e-31   Oryza sativa Japonica Group [Japonica rice]
gb|AAT85012.1|  putative reverse transcriptase                          125   4e-31   Oryza sativa Japonica Group [Japonica rice]
gb|ABF95616.1|  retrotransposon protein, putative, Ty1-copia subc...    129   4e-31   Oryza sativa Japonica Group [Japonica rice]
dbj|BAB90546.1|  putative rice retrotransposon retrofit gag/pol p...    129   4e-31   Oryza sativa Japonica Group [Japonica rice]
gb|ABA91195.1|  retrotransposon protein, putative, Ty1-copia subc...    129   5e-31   Oryza sativa Japonica Group [Japonica rice]
emb|CAN69370.1|  hypothetical protein VITISV_010057                     126   6e-31   Vitis vinifera
emb|CAN79884.1|  hypothetical protein VITISV_002539                     129   6e-31   Vitis vinifera
ref|XP_002445564.1|  hypothetical protein SORBIDRAFT_07g021665          126   6e-31   Sorghum bicolor [broomcorn]
gb|AAX95666.1|  Reverse transcriptase (RNA-dependent DNA polymera...    127   7e-31   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001174286.1|  Os05g0235100                                       127   7e-31   
gb|KFK30733.1|  hypothetical protein AALP_AA6G020200                    129   7e-31   
gb|ACP30598.1|  disease resistance protein                              129   9e-31   Brassica rapa subsp. pekinensis [bai cai]
gb|AAU10682.1|  putative polyprotein                                    128   1e-30   Oryza sativa Japonica Group [Japonica rice]
gb|KFK26434.1|  hypothetical protein AALP_AA8G247800                    120   1e-30   
ref|XP_006465491.1|  PREDICTED: uncharacterized protein LOC102624640    128   1e-30   
emb|CAN81355.1|  hypothetical protein VITISV_039158                     128   1e-30   Vitis vinifera
dbj|BAA78425.1|  polyprotein                                            128   1e-30   Arabidopsis thaliana [mouse-ear cress]
dbj|BAK41507.1|  polyprotein                                            128   1e-30   
gb|AAK62788.1|AC027036_9  polyprotein, putative                         128   1e-30   Arabidopsis thaliana [mouse-ear cress]
gb|AAK62793.1|AC027036_14  polyprotein, putative                        128   1e-30   Arabidopsis thaliana [mouse-ear cress]
dbj|BAK41511.1|  polyprotein                                            128   1e-30   
emb|CAE04381.1|  OSJNBa0027G07.23                                       124   1e-30   Oryza sativa Japonica Group [Japonica rice]
dbj|BAA78423.1|  polyprotein                                            127   1e-30   Arabidopsis thaliana [mouse-ear cress]
gb|AAT93988.1|  putative polyprotein                                    127   2e-30   Oryza sativa Japonica Group [Japonica rice]
emb|CAH66819.1|  OSIGBa0093K19.6                                        124   2e-30   Oryza sativa [red rice]
dbj|BAM44531.1|  polyprotein                                            127   2e-30   
ref|XP_010436786.1|  PREDICTED: uncharacterized protein LOC104720600    126   2e-30   
emb|CAN83506.1|  hypothetical protein VITISV_027576                     127   2e-30   Vitis vinifera
ref|XP_010525654.1|  PREDICTED: uncharacterized protein LOC104803422    125   2e-30   
gb|AAD21687.1|  Strong similarity to gi|3600044 T12H20.12 proteas...    127   2e-30   Arabidopsis thaliana [mouse-ear cress]
ref|YP_514636.1|  hypothetical protein OrsaiPp07                        124   3e-30   Oryza sativa Indica Group [Indian rice]
emb|CAN61322.1|  hypothetical protein VITISV_012106                     127   3e-30   Vitis vinifera
emb|CAN61420.1|  hypothetical protein VITISV_023544                     127   3e-30   Vitis vinifera
dbj|BAM44534.1|  polyprotein                                            127   3e-30   
dbj|BAM44530.1|  polyprotein                                            127   3e-30   
dbj|BAA78426.1|  polyprotein                                            127   3e-30   Arabidopsis thaliana [mouse-ear cress]
dbj|BAM44529.1|  polyprotein                                            127   3e-30   
ref|XP_002443133.1|  hypothetical protein SORBIDRAFT_08g010840          125   4e-30   Sorghum bicolor [broomcorn]
dbj|BAM42649.1|  Polyprotein                                            127   4e-30   
dbj|BAM44532.1|  polyprotein                                            126   4e-30   
ref|XP_006577484.1|  PREDICTED: uncharacterized mitochondrial pro...    120   4e-30   
gb|AAC79110.1|  putative polyprotein of LTR transposon                  126   4e-30   Arabidopsis thaliana [mouse-ear cress]
dbj|BAM42647.1|  polyprotein                                            126   4e-30   
ref|XP_002489074.1|  hypothetical protein SORBIDRAFT_0139s002040        127   4e-30   Sorghum bicolor [broomcorn]
dbj|BAM42650.1|  Polyprotein                                            126   4e-30   
ref|XP_004963727.1|  PREDICTED: uncharacterized protein LOC101777694    126   4e-30   
dbj|BAA78424.1|  polyprotein                                            126   4e-30   Arabidopsis thaliana [mouse-ear cress]
emb|CAN69753.1|  hypothetical protein VITISV_024937                     125   5e-30   Vitis vinifera
ref|XP_002460196.1|  hypothetical protein SORBIDRAFT_02g024427          126   5e-30   Sorghum bicolor [broomcorn]
ref|XP_002455933.1|  hypothetical protein SORBIDRAFT_03g027495          125   5e-30   Sorghum bicolor [broomcorn]
ref|XP_002456118.1|  hypothetical protein SORBIDRAFT_03g030787          126   5e-30   Sorghum bicolor [broomcorn]
emb|CAN62863.1|  hypothetical protein VITISV_030334                     126   6e-30   Vitis vinifera
ref|YP_002000554.1|  orf490                                             122   6e-30   Oryza sativa Japonica Group [Japonica rice]
gb|KFK33814.1|  hypothetical protein AALP_AA5G063400                    123   7e-30   
gb|KFK27477.1|  hypothetical protein AALP_AA8G388700                    125   7e-30   
ref|XP_008671960.1|  PREDICTED: uncharacterized protein LOC103649473    125   7e-30   
dbj|BAB10876.1|  polyprotein                                            125   7e-30   Arabidopsis thaliana [mouse-ear cress]
emb|CAN68480.1|  hypothetical protein VITISV_007280                     124   7e-30   Vitis vinifera
ref|XP_002446435.1|  hypothetical protein SORBIDRAFT_06g016046          125   9e-30   Sorghum bicolor [broomcorn]
ref|XP_008675247.1|  PREDICTED: uncharacterized protein LOC103651...    125   9e-30   
gb|AAF63122.1|AC009526_7  Hypothetical protein                          123   9e-30   Arabidopsis thaliana [mouse-ear cress]
dbj|BAM44535.1|  polyprotein                                            125   1e-29   
dbj|BAM42646.1|  polyprotein                                            125   1e-29   
emb|CAN67073.1|  hypothetical protein VITISV_011746                     124   1e-29   Vitis vinifera
gb|ABA97652.1|  retrotransposon protein, putative, Ty1-copia subc...    125   1e-29   Oryza sativa Japonica Group [Japonica rice]
ref|XP_011016404.1|  PREDICTED: uncharacterized protein LOC105119910    124   1e-29   
emb|CAN81099.1|  hypothetical protein VITISV_017741                     125   2e-29   Vitis vinifera
emb|CAN74243.1|  hypothetical protein VITISV_037117                     124   2e-29   Vitis vinifera
dbj|BAA78427.1|  polyprotein                                            124   2e-29   Arabidopsis thaliana [mouse-ear cress]
gb|ABA93844.2|  retrotransposon protein, putative, unclassified         124   2e-29   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002438095.1|  hypothetical protein SORBIDRAFT_10g007953          124   2e-29   Sorghum bicolor [broomcorn]
ref|XP_002489193.1|  hypothetical protein SORBIDRAFT_0013s009070        124   2e-29   Sorghum bicolor [broomcorn]
gb|ACV42639.1|  gag/pol                                                 124   3e-29   
emb|CAN83352.1|  hypothetical protein VITISV_022160                     124   3e-29   Vitis vinifera
emb|CAE04646.2|  OSJNBa0061G20.2                                        121   3e-29   Oryza sativa Japonica Group [Japonica rice]
emb|CAN66863.1|  hypothetical protein VITISV_013500                     124   3e-29   Vitis vinifera
emb|CAE04319.3|  OSJNBb0016D16.10                                       123   3e-29   Oryza sativa [red rice]
ref|XP_010236748.1|  PREDICTED: uncharacterized protein LOC104584242    123   4e-29   
ref|XP_008240661.1|  PREDICTED: uncharacterized protein LOC103339149    123   4e-29   
emb|CAN71553.1|  hypothetical protein VITISV_034738                     123   4e-29   Vitis vinifera
emb|CAN64816.1|  hypothetical protein VITISV_010668                     123   4e-29   Vitis vinifera
gb|AAF02855.1|AC009324_4  Similar to retrotransposon proteins           123   4e-29   Arabidopsis thaliana [mouse-ear cress]
emb|CAN59952.1|  hypothetical protein VITISV_006720                     123   5e-29   Vitis vinifera
ref|XP_002444548.1|  hypothetical protein SORBIDRAFT_07g023610          122   6e-29   Sorghum bicolor [broomcorn]
emb|CAN60809.1|  hypothetical protein VITISV_044451                     119   6e-29   Vitis vinifera
gb|AAU43956.1|  unknown protein                                         123   7e-29   Oryza sativa Japonica Group [Japonica rice]
gb|ABA94365.1|  retrotransposon protein, putative, unclassified         122   7e-29   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010666841.1|  PREDICTED: uncharacterized protein LOC104883959    122   8e-29   
ref|XP_004986808.1|  PREDICTED: uncharacterized protein LOC101773259    123   8e-29   
gb|AAK43485.1|AC084807_10  polyprotein, putative                        122   9e-29   Arabidopsis thaliana [mouse-ear cress]
gb|ACF87376.2|  unknown                                                 119   1e-28   Zea mays [maize]
emb|CAA36616.1|  unnamed protein product                                119   1e-28   Solanum tuberosum [potatoes]
emb|CAN66496.1|  hypothetical protein VITISV_036886                     122   1e-28   Vitis vinifera
ref|XP_010655804.1|  PREDICTED: uncharacterized protein LOC104880556    122   1e-28   
emb|CAN83285.1|  hypothetical protein VITISV_004139                     122   1e-28   Vitis vinifera
gb|AAU10819.1|  putative polyprotein                                    122   1e-28   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009359358.1|  PREDICTED: uncharacterized protein LOC103949948    122   1e-28   
emb|CAN79733.1|  hypothetical protein VITISV_016615                     121   1e-28   Vitis vinifera
gb|ABB47941.2|  retrotransposon protein, putative, unclassified         122   2e-28   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002489309.1|  hypothetical protein SORBIDRAFT_0010s008890        121   2e-28   Sorghum bicolor [broomcorn]
gb|AAL86510.1|AC099040_14  putative retrotransposon protein             121   2e-28   Oryza sativa Japonica Group [Japonica rice]
gb|ABB47033.2|  retrotransposon protein, putative, Ty1-copia subc...    121   2e-28   Oryza sativa Japonica Group [Japonica rice]
gb|AAM18766.1|AC099325_22  putative copia-like retrotransposon Ho...    121   2e-28   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010669336.1|  PREDICTED: copia protein isoform X2                121   2e-28   
emb|CAH67061.1|  H0112G12.6                                             120   3e-28   Oryza sativa [red rice]
ref|XP_010669333.1|  PREDICTED: copia protein isoform X1                120   3e-28   
ref|XP_002444329.1|  hypothetical protein SORBIDRAFT_07g020255          120   3e-28   Sorghum bicolor [broomcorn]
emb|CAN65942.1|  hypothetical protein VITISV_001716                     121   3e-28   Vitis vinifera
emb|CAN60844.1|  hypothetical protein VITISV_005976                     121   3e-28   Vitis vinifera
ref|XP_010315768.1|  PREDICTED: uncharacterized protein LOC104645608    117   3e-28   
ref|XP_009145096.1|  PREDICTED: uncharacterized protein LOC103868780    121   3e-28   
emb|CAB46043.1|  retrotransposon like protein                           121   4e-28   Arabidopsis thaliana [mouse-ear cress]
gb|KFK44388.1|  hypothetical protein AALP_AA1G251100                    121   4e-28   
emb|CAE05417.1|  OSJNBa0035I04.5                                        120   4e-28   Oryza sativa [red rice]
gb|AAL34933.1|AC079037_6  Putative gag-pol polyprotein                  119   4e-28   Oryza sativa [red rice]
ref|XP_010686475.1|  PREDICTED: uncharacterized protein LOC104900682    121   4e-28   
ref|XP_008365969.1|  PREDICTED: uncharacterized protein LOC103429605    120   5e-28   
gb|AIG20414.1|  RVT_2 super family protein                              119   5e-28   
emb|CAH66488.1|  OSIGBa0076I14.9                                        120   5e-28   Oryza sativa [red rice]
ref|XP_006577466.1|  PREDICTED: uncharacterized mitochondrial pro...    116   6e-28   
emb|CAN62447.1|  hypothetical protein VITISV_024007                     120   6e-28   Vitis vinifera
gb|AAA33448.1|  reverse transcriptase                                   119   7e-28   
pir||S27768  RNA-directed DNA polymerase (EC 2.7.7.49) - maize tr...    119   7e-28
gb|ABA97658.1|  retrotransposon protein, putative, Ty1-copia subc...    120   7e-28   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010065142.1|  PREDICTED: uncharacterized protein LOC104452376    120   7e-28   
gb|AAD19784.1|  putative retroelement pol polyprotein                   120   8e-28   Arabidopsis thaliana [mouse-ear cress]
emb|CAN79641.1|  hypothetical protein VITISV_017030                     117   8e-28   Vitis vinifera
gb|ABF96081.1|  retrotransposon protein, putative, Ty1-copia subc...    119   9e-28   Oryza sativa Japonica Group [Japonica rice]
emb|CAN60617.1|  hypothetical protein VITISV_003256                     116   9e-28   Vitis vinifera
emb|CAN65591.1|  hypothetical protein VITISV_042091                     119   1e-27   Vitis vinifera
emb|CAN67546.1|  hypothetical protein VITISV_027734                     119   1e-27   Vitis vinifera
gb|AAM08751.1|AC025098_18  Putative copia-type polyprotein              119   1e-27   Oryza sativa Japonica Group [Japonica rice]
emb|CAN74695.1|  hypothetical protein VITISV_024648                     119   1e-27   Vitis vinifera
gb|AAD23883.1|  putative retroelement pol polyprotein                   119   1e-27   Arabidopsis thaliana [mouse-ear cress]
gb|ABB47203.2|  retrotransposon protein, putative, unclassified         119   1e-27   Oryza sativa Japonica Group [Japonica rice]
gb|EMT21953.1|  ABC transporter C family member 10                      119   1e-27   
gb|AAD14478.1|  Strong similarity to gb|AF039376 Evelknievel retr...    119   1e-27   Arabidopsis thaliana [mouse-ear cress]
gb|AAN34944.1|  Putative retroelement                                   119   1e-27   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010684978.1|  PREDICTED: uncharacterized protein LOC104899479    119   2e-27   
ref|XP_004514187.1|  PREDICTED: uncharacterized protein LOC101501674    118   2e-27   
dbj|BAA97287.1|  retroelement pol polyprotein-like                      119   2e-27   Arabidopsis thaliana [mouse-ear cress]
gb|AAM74347.1|AC115686_14  Putative retroelement                        119   2e-27   Oryza sativa Japonica Group [Japonica rice]
gb|AAT38797.2|  Polyprotein, putative                                   119   2e-27   Solanum demissum
gb|AAX92854.1|  retrotransposon protein, putative, unclassified         114   2e-27   Oryza sativa Japonica Group [Japonica rice]
gb|AFP55537.1|  retrotransposon polyprotein                             118   2e-27   
emb|CAN65603.1|  hypothetical protein VITISV_021511                     115   2e-27   Vitis vinifera
ref|XP_008359376.1|  PREDICTED: uncharacterized protein LOC103423087    118   2e-27   
emb|CAN75478.1|  hypothetical protein VITISV_020209                     118   2e-27   Vitis vinifera
emb|CAH67640.1|  H0102C09.1                                             118   3e-27   Oryza sativa [red rice]
emb|CAN71250.1|  hypothetical protein VITISV_027849                     115   3e-27   Vitis vinifera
ref|XP_008369089.1|  PREDICTED: uncharacterized protein LOC103432662    118   3e-27   
emb|CAN69566.1|  hypothetical protein VITISV_033535                     118   3e-27   Vitis vinifera
gb|ABA97577.2|  retrotransposon protein, putative, unclassified         117   3e-27   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006662335.1|  PREDICTED: uncharacterized protein LOC102706134    116   3e-27   
emb|CAN64296.1|  hypothetical protein VITISV_022671                     114   4e-27   Vitis vinifera
gb|AEJ07956.1|  putative polyprotein                                    115   4e-27   
ref|XP_010418722.1|  PREDICTED: uncharacterized protein LOC104704304    114   5e-27   
ref|XP_004963982.1|  PREDICTED: uncharacterized protein LOC101777276    117   6e-27   
gb|ABA93940.1|  retrotransposon protein, putative, Ty1-copia subc...    117   6e-27   Oryza sativa Japonica Group [Japonica rice]
emb|CAN71173.1|  hypothetical protein VITISV_037664                     116   7e-27   Vitis vinifera
gb|AAT58770.1|  putative polyprotein                                    117   8e-27   Oryza sativa Japonica Group [Japonica rice]
gb|AAM98191.1|  unknown protein                                         116   8e-27   Arabidopsis thaliana [mouse-ear cress]
gb|ABA99152.1|  retrotransposon protein, putative, unclassified         116   9e-27   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008374297.1|  PREDICTED: uncharacterized protein LOC103437591    116   1e-26   
ref|XP_008665853.1|  PREDICTED: protein SHOOT GRAVITROPISM 6-like       117   1e-26   
emb|CAN67009.1|  hypothetical protein VITISV_004754                     116   1e-26   Vitis vinifera
ref|XP_008389883.1|  PREDICTED: uncharacterized protein LOC103452157    116   1e-26   
gb|AAC02672.1|  polyprotein                                             116   1e-26   Arabidopsis arenosa
gb|AAX96296.1|  retrotransposon protein, putative, unclassified         116   1e-26   Oryza sativa Japonica Group [Japonica rice]
gb|KHN21230.1|  Retrovirus-related Pol polyprotein from transposo...    116   1e-26   
gb|AAP50939.1|  putative gag-pol polyprotein, 3'-partial                116   1e-26   Oryza sativa Japonica Group [Japonica rice]
gb|ABA98847.1|  retrotransposon protein, putative, unclassified         116   2e-26   Oryza sativa Japonica Group [Japonica rice]
gb|AAB87099.1|  putative retroelement pol polyprotein                   116   2e-26   Arabidopsis thaliana [mouse-ear cress]
dbj|BAH79981.1|  putative unclassified retrotransposon protein          116   2e-26   Oryza sativa Indica Group [Indian rice]
gb|AAT76321.1|  putative integrase                                      115   2e-26   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008389560.1|  PREDICTED: uncharacterized protein LOC103451895    115   2e-26   
gb|AAM08523.1|AC068654_25  Putative retroelement                        115   2e-26   Oryza sativa [red rice]
ref|XP_006579236.1|  PREDICTED: uncharacterized protein LOC102665202    115   2e-26   
emb|CAN63081.1|  hypothetical protein VITISV_016842                     115   2e-26   Vitis vinifera
emb|CAN78696.1|  hypothetical protein VITISV_035269                     115   3e-26   Vitis vinifera
gb|AAR87335.1|  putative gag-pol polyprotein                            115   3e-26   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004966848.1|  PREDICTED: uncharacterized protein LOC101777861    115   3e-26   
emb|CAN76196.1|  hypothetical protein VITISV_041073                     115   3e-26   Vitis vinifera
emb|CAN67539.1|  hypothetical protein VITISV_021584                     115   3e-26   Vitis vinifera
gb|ABA97707.2|  retrotransposon protein, putative, Ty1-copia subc...    115   3e-26   Oryza sativa Japonica Group [Japonica rice]
emb|CAN64167.1|  hypothetical protein VITISV_015919                     112   3e-26   Vitis vinifera
gb|AAP53706.1|  retrotransposon protein, putative, unclassified         115   4e-26   Oryza sativa Japonica Group [Japonica rice]
emb|CAE04585.2|  OSJNBb0006N15.2                                        115   4e-26   Oryza sativa Japonica Group [Japonica rice]
emb|CAN71273.1|  hypothetical protein VITISV_019661                     115   4e-26   Vitis vinifera
emb|CAN70817.1|  hypothetical protein VITISV_029336                     114   4e-26   Vitis vinifera
emb|CAN71427.1|  hypothetical protein VITISV_027864                     115   4e-26   Vitis vinifera
gb|AAL68641.1|AF458765_1  polyprotein                                   115   4e-26   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009378848.1|  PREDICTED: uncharacterized protein LOC103967297    115   5e-26   
emb|CCH50966.1|  T4.5                                                   115   5e-26   
emb|CAA19715.1|  putative protein                                       114   5e-26   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010026635.1|  PREDICTED: uncharacterized protein LOC104417007    114   5e-26   
emb|CAD39835.2|  OSJNBb0072N21.1                                        111   5e-26   Oryza sativa Japonica Group [Japonica rice]
emb|CAD41085.2|  OSJNBb0011N17.2                                        114   6e-26   Oryza sativa Japonica Group [Japonica rice]
gb|ABA98369.1|  retrotransposon protein, putative, Ty1-copia subc...    114   6e-26   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010277971.1|  PREDICTED: uncharacterized protein LOC104612287    111   6e-26   
ref|XP_010069795.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    114   6e-26   
emb|CAN67403.1|  hypothetical protein VITISV_025614                     114   6e-26   Vitis vinifera
emb|CAR66103.1|  RT-RNaseH                                              111   7e-26   Triticum turgidum subsp. durum
gb|AAC61290.1|  putative retroelement pol polyprotein                   114   7e-26   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009378158.1|  PREDICTED: uncharacterized protein LOC103966690    114   7e-26   
gb|AAX96236.1|  retrotransposon protein, putative, Ty1-copia sub-...    114   7e-26   Oryza sativa Japonica Group [Japonica rice]
emb|CAN72277.1|  hypothetical protein VITISV_043408                     110   7e-26   Vitis vinifera
ref|XP_008387250.1|  PREDICTED: uncharacterized protein LOC103449699    114   8e-26   
ref|XP_008361163.1|  PREDICTED: uncharacterized protein LOC103424851    114   8e-26   
gb|ACA61613.1|  hypothetical protein AP2_E11.1                          111   8e-26   Arabidopsis lyrata subsp. petraea
gb|ABB46679.2|  retrotransposon protein, putative, unclassified         113   8e-26   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008665078.1|  PREDICTED: retrovirus-related Pol polyprotei...    113   8e-26   
emb|CAN71185.1|  hypothetical protein VITISV_014270                     114   8e-26   Vitis vinifera
gb|AAX96565.1|  retrotransposon protein, putative, Ty1-copia sub-...    113   9e-26   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010098067.1|  Copia protein                                      114   9e-26   
ref|XP_008349811.1|  PREDICTED: uncharacterized protein LOC103413098    114   9e-26   
gb|AAT39281.2|  Integrase core domain containing protein                114   1e-25   Solanum demissum
gb|AAT47108.1|  putative polyprotein                                    114   1e-25   Oryza sativa Japonica Group [Japonica rice]
gb|AAM23248.1|AC092553_14  Putative copia-type pol polyprotein          113   1e-25   Oryza sativa Japonica Group [Japonica rice]
emb|CAN71108.1|  hypothetical protein VITISV_001478                     114   1e-25   Vitis vinifera
ref|XP_002442174.1|  hypothetical protein SORBIDRAFT_08g015513          113   1e-25   Sorghum bicolor [broomcorn]
emb|CAN69851.1|  hypothetical protein VITISV_009554                     114   1e-25   Vitis vinifera
ref|XP_008352218.1|  PREDICTED: uncharacterized protein LOC103415694    112   1e-25   
ref|XP_008386299.1|  PREDICTED: uncharacterized protein LOC103448812    113   1e-25   
ref|XP_010531643.1|  PREDICTED: uncharacterized protein LOC104807900    113   1e-25   
emb|CAN72663.1|  hypothetical protein VITISV_031849                     113   1e-25   Vitis vinifera
emb|CAN62423.1|  hypothetical protein VITISV_020608                     113   1e-25   
emb|CAN77772.1|  hypothetical protein VITISV_037439                     113   1e-25   
emb|CAN82064.1|  hypothetical protein VITISV_022772                     113   1e-25   
emb|CAN73074.1|  hypothetical protein VITISV_032386                     113   1e-25   
emb|CAN74388.1|  hypothetical protein VITISV_041876                     112   1e-25   
emb|CAN62614.1|  hypothetical protein VITISV_028123                     113   1e-25   
emb|CAN67925.1|  hypothetical protein VITISV_021168                     113   2e-25   
emb|CAN74286.1|  hypothetical protein VITISV_036410                     113   2e-25   
emb|CAN78616.1|  hypothetical protein VITISV_003658                     113   2e-25   
emb|CAN80547.1|  hypothetical protein VITISV_010898                     113   2e-25   
gb|ABA94335.1|  retrotransposon protein, putative, Ty1-copia subc...    110   2e-25   
emb|CAN72018.1|  hypothetical protein VITISV_001841                     113   2e-25   
emb|CAN59884.1|  hypothetical protein VITISV_026166                     114   2e-25   
emb|CAN63730.1|  hypothetical protein VITISV_030286                     113   2e-25   
emb|CAN83808.1|  hypothetical protein VITISV_026963                     112   2e-25   
gb|KHN05285.1|  Retrovirus-related Pol polyprotein from transposo...    113   2e-25   
emb|CAN65410.1|  hypothetical protein VITISV_040416                     113   2e-25   
emb|CAN80753.1|  hypothetical protein VITISV_003323                     113   2e-25   
emb|CAN76679.1|  hypothetical protein VITISV_034325                     113   2e-25   
ref|XP_004514355.1|  PREDICTED: uncharacterized mitochondrial pro...    109   2e-25   
ref|XP_008651726.1|  PREDICTED: hypothetical protein isoform X1         112   2e-25   
emb|CAN80699.1|  hypothetical protein VITISV_000889                     108   2e-25   
ref|XP_009774424.1|  PREDICTED: uncharacterized protein LOC104224463    110   2e-25   
ref|XP_008647645.1|  PREDICTED: uncharacterized protein LOC100502...    113   2e-25   
emb|CAN69597.1|  hypothetical protein VITISV_038518                     113   2e-25   
gb|AAL31657.1|AC079179_12  Putative Zea mays retrotransposon Opie-2     110   2e-25   
emb|CAN70689.1|  hypothetical protein VITISV_012155                     113   2e-25   
emb|CAN69688.1|  hypothetical protein VITISV_026774                     113   2e-25   
emb|CAN61540.1|  hypothetical protein VITISV_025242                     111   2e-25   
ref|XP_010091283.1|  ABC transporter C family member 9                  113   2e-25   
ref|XP_008364001.1|  PREDICTED: uncharacterized protein LOC103427704    113   2e-25   
emb|CAN80771.1|  hypothetical protein VITISV_027574                     112   2e-25   
emb|CAN78451.1|  hypothetical protein VITISV_005945                     112   2e-25   
emb|CAN74129.1|  hypothetical protein VITISV_041770                     110   2e-25   
gb|ABA98303.2|  retrotransposon protein, putative, unclassified         112   2e-25   
emb|CAH66946.1|  B0809H07.1                                             112   2e-25   
emb|CAN71246.1|  hypothetical protein VITISV_011986                     112   3e-25   
gb|AAO20078.1|  putative polyprotein                                    112   3e-25   
ref|XP_008356535.1|  PREDICTED: uncharacterized protein LOC103420252    112   3e-25   
emb|CAN70756.1|  hypothetical protein VITISV_014702                     112   3e-25   
ref|XP_002489126.1|  hypothetical protein SORBIDRAFT_0019s003280        112   3e-25   
emb|CAN80469.1|  hypothetical protein VITISV_008623                     112   3e-25   
emb|CAN79148.1|  hypothetical protein VITISV_004343                     112   3e-25   
gb|AAC02666.1|  polyprotein                                             112   3e-25   
gb|AAC02664.1|  polyprotein                                             112   3e-25   
gb|AAC02669.1|  polyprotein                                             112   3e-25   
emb|CAN73101.1|  hypothetical protein VITISV_042890                     111   3e-25   
emb|CAN73924.1|  hypothetical protein VITISV_041509                     112   3e-25   
emb|CAN66507.1|  hypothetical protein VITISV_034008                     112   3e-25   
gb|ABA93730.1|  retrotransposon protein, putative, unclassified         111   4e-25   
gb|ABF93543.1|  retrotransposon protein, putative, unclassified         112   4e-25   
emb|CAN64489.1|  hypothetical protein VITISV_039887                     111   4e-25   
gb|ABV72583.1|  unknown                                                 108   4e-25   
emb|CAD40455.2|  OSJNBa0041M21.13                                       111   4e-25   
emb|CAN69870.1|  hypothetical protein VITISV_032283                     111   4e-25   
gb|ABA98121.1|  retrotransposon protein, putative, Ty1-copia subc...    110   4e-25   
gb|ABA97696.1|  retrotransposon protein, putative, unclassified         112   4e-25   
emb|CAN63193.1|  hypothetical protein VITISV_017130                     112   4e-25   
emb|CAN67449.1|  hypothetical protein VITISV_031400                     112   4e-25   
gb|AAW57789.1|  putative polyprotein                                    112   4e-25   
gb|AAN60494.1|  Putative Zea mays retrotransposon Opie-2                112   4e-25   
gb|AAO37957.1|  putative gag-pol polyprotein                            112   4e-25   
ref|XP_004966833.1|  PREDICTED: uncharacterized protein LOC101766505    111   5e-25   
emb|CAN81001.1|  hypothetical protein VITISV_006992                     111   5e-25   
ref|XP_010683797.1|  PREDICTED: uncharacterized protein LOC104898410    111   5e-25   
ref|XP_002445301.1|  hypothetical protein SORBIDRAFT_07g008525          110   5e-25   
gb|ABF94836.1|  retrotransposon protein, putative, unclassified         112   5e-25   
emb|CAN65356.1|  hypothetical protein VITISV_012647                     110   5e-25   
gb|ABA94321.1|  retrotransposon protein, putative, unclassified         111   5e-25   
gb|ABA94354.1|  retrotransposon protein, putative, unclassified         111   5e-25   
emb|CAE03600.2|  OSJNBb0004A17.2                                        112   5e-25   
emb|CAN82221.1|  hypothetical protein VITISV_015226                     111   5e-25   
ref|XP_010113352.1|  Retrovirus-related Pol polyprotein from tran...    112   6e-25   
emb|CAN78708.1|  hypothetical protein VITISV_019236                     109   6e-25   
emb|CAN83575.1|  hypothetical protein VITISV_025852                     111   6e-25   
emb|CAN69281.1|  hypothetical protein VITISV_023276                     108   6e-25   
emb|CAN81139.1|  hypothetical protein VITISV_018760                     111   6e-25   
gb|ABA95797.1|  retrotransposon protein, putative, unclassified         111   6e-25   
emb|CAN75900.1|  hypothetical protein VITISV_033582                     111   6e-25   
gb|ABF95048.1|  retrotransposon protein, putative, unclassified         111   6e-25   
ref|XP_004514121.1|  PREDICTED: uncharacterized protein LOC101493292    111   6e-25   
emb|CAN79492.1|  hypothetical protein VITISV_033373                     111   7e-25   
gb|AAF99727.1|AC004557_6  F17L21.7                                      111   7e-25   
emb|CAN81715.1|  hypothetical protein VITISV_032902                     110   8e-25   
dbj|BAD99221.1|  polypepetide with reverse transcriptase and RNas...    108   8e-25   
emb|CAN79175.1|  hypothetical protein VITISV_001884                     111   8e-25   
emb|CAN63874.1|  hypothetical protein VITISV_038274                     109   8e-25   
emb|CAN82769.1|  hypothetical protein VITISV_037882                     111   8e-25   
emb|CCI55368.1|  PH01B035L11.13                                         110   9e-25   
emb|CAN62535.1|  hypothetical protein VITISV_041880                     111   9e-25   
emb|CAN81016.1|  hypothetical protein VITISV_025518                     111   9e-25   
emb|CAN64288.1|  hypothetical protein VITISV_022326                     111   9e-25   
emb|CAN77085.1|  hypothetical protein VITISV_044282                     111   9e-25   
emb|CAN69836.1|  hypothetical protein VITISV_026000                     111   9e-25   
emb|CAN61179.1|  hypothetical protein VITISV_032292                     110   9e-25   
emb|CAN59964.1|  hypothetical protein VITISV_022757                     111   9e-25   
gb|ABF95666.1|  retrotransposon protein, putative, Ty1-copia subc...    110   9e-25   
ref|XP_006494841.1|  PREDICTED: uncharacterized protein LOC102608996    111   1e-24   
gb|AAR10863.1|  putative copia-type pol polyprotein                     109   1e-24   
emb|CAN84135.1|  hypothetical protein VITISV_000113                     110   1e-24   
gb|ABB47276.1|  retrotransposon protein, putative, unclassified         110   1e-24   
gb|AAN05363.1|  Putative retroelement                                   110   1e-24   
gb|AAM74419.1|AC123594_2  Putative retroelement                         110   1e-24   
emb|CAN75446.1|  hypothetical protein VITISV_030925                     110   1e-24   
emb|CAN74194.1|  hypothetical protein VITISV_040578                     110   1e-24   
gb|AAK50413.1|AC021891_14  Putative retroelement                        110   1e-24   
ref|XP_008350549.1|  PREDICTED: uncharacterized protein LOC103413885    110   1e-24   
gb|ABB47538.2|  retrotransposon protein, putative, Ty1-copia subc...    110   1e-24   
ref|XP_010430873.1|  PREDICTED: uncharacterized protein LOC104715130    110   1e-24   
emb|CAN70229.1|  hypothetical protein VITISV_024789                     110   1e-24   
gb|AAF79259.1|AC023279_8  F12K21.14                                     107   1e-24   
gb|ABF97245.1|  retrotransposon protein, putative, Ty1-copia subc...    109   1e-24   
emb|CAN72886.1|  hypothetical protein VITISV_019713                     110   1e-24   
gb|ABA96551.1|  retrotransposon protein, putative, Ty1-copia subc...    110   1e-24   
gb|AAP21414.1|  putative polyprotein                                    110   1e-24   
emb|CAN65647.1|  hypothetical protein VITISV_001300                     110   1e-24   
ref|XP_006577506.1|  PREDICTED: uncharacterized mitochondrial pro...    107   1e-24   
ref|XP_006584292.1|  PREDICTED: uncharacterized protein LOC102668041    110   2e-24   
emb|CAN78330.1|  hypothetical protein VITISV_034973                     110   2e-24   
emb|CAN71245.1|  hypothetical protein VITISV_011091                     108   2e-24   
ref|XP_009610589.1|  PREDICTED: uncharacterized protein LOC104104263    109   2e-24   
dbj|BAK64102.1|  gag-pol polyprotein                                    110   2e-24   
ref|XP_008358376.1|  PREDICTED: uncharacterized protein LOC103422119    110   2e-24   
emb|CAN77642.1|  hypothetical protein VITISV_007624                     106   2e-24   
gb|ABA95825.2|  retrotransposon protein, putative, unclassified         109   2e-24   
gb|AAV44188.1|  putative polyprotein                                    110   2e-24   
emb|CAN81385.1|  hypothetical protein VITISV_012324                     110   2e-24   
emb|CAN81712.1|  hypothetical protein VITISV_038973                     110   2e-24   
emb|CAN79780.1|  hypothetical protein VITISV_041885                     107   2e-24   
ref|XP_006605005.1|  PREDICTED: uncharacterized protein LOC102669234    109   2e-24   
emb|CAN64275.1|  hypothetical protein VITISV_013208                     108   2e-24   
emb|CAN71164.1|  hypothetical protein VITISV_031057                     110   2e-24   
ref|XP_004289307.1|  PREDICTED: uncharacterized mitochondrial pro...    105   2e-24   
emb|CAN70669.1|  hypothetical protein VITISV_037506                     110   2e-24   
gb|AAC67200.1|  putative retroelement pol polyprotein                   110   2e-24   
ref|XP_007019891.1|  Cysteine-rich RLK (RECEPTOR-like protein kin...    109   2e-24   
emb|CAN83455.1|  hypothetical protein VITISV_029958                     107   2e-24   
emb|CAN79422.1|  hypothetical protein VITISV_002126                     109   2e-24   
emb|CAE76053.1|  B1248C03.12                                            108   2e-24   
emb|CAN67992.1|  hypothetical protein VITISV_015686                     109   2e-24   
emb|CAN74064.1|  hypothetical protein VITISV_028146                     109   3e-24   
emb|CAN77046.1|  hypothetical protein VITISV_035257                     109   3e-24   
gb|ABF96035.1|  retrotransposon protein, putative, unclassified         109   3e-24   
emb|CAN72440.1|  hypothetical protein VITISV_039162                     109   3e-24   
emb|CAE05707.2|  OSJNBb0065J09.3                                        109   3e-24   
emb|CAN65230.1|  hypothetical protein VITISV_034221                     107   3e-24   
emb|CAN73102.1|  hypothetical protein VITISV_042891                     109   3e-24   
emb|CAN73272.1|  hypothetical protein VITISV_013115                     109   3e-24   
ref|XP_008342226.1|  PREDICTED: uncharacterized protein LOC103405031    109   3e-24   
emb|CAN67970.1|  hypothetical protein VITISV_025093                     109   3e-24   
emb|CAN68496.1|  hypothetical protein VITISV_010947                     109   3e-24   
emb|CAN70357.1|  hypothetical protein VITISV_013713                     109   3e-24   
emb|CAN71267.1|  hypothetical protein VITISV_017889                     109   3e-24   
emb|CAN82359.1|  hypothetical protein VITISV_027367                     109   3e-24   
emb|CAN83015.1|  hypothetical protein VITISV_041694                     109   4e-24   
emb|CAN82928.1|  hypothetical protein VITISV_025045                     109   4e-24   
gb|ABA98480.1|  retrotransposon protein, putative, Ty1-copia subc...    107   4e-24   
gb|AAN04981.1|  retrotransposon protein, putative, unclassified         107   4e-24   
ref|XP_008354245.1|  PREDICTED: LOW QUALITY PROTEIN: pentatricope...    108   4e-24   
ref|XP_009348624.1|  PREDICTED: uncharacterized protein LOC103940261    108   4e-24   
emb|CAN83839.1|  hypothetical protein VITISV_023230                     108   4e-24   
emb|CAN65540.1|  hypothetical protein VITISV_029946                     109   4e-24   
gb|ABA95230.1|  retrotransposon protein, putative, unclassified         108   4e-24   
emb|CAN82507.1|  hypothetical protein VITISV_039314                     105   4e-24   
emb|CAN76432.1|  hypothetical protein VITISV_033849                     108   4e-24   
gb|AAP20859.1|  retrotransposon protein, putative, Ty1-copia sub-...    105   4e-24   
emb|CAH67874.1|  OSIGBa0153E02-OSIGBa0093I20.3                          108   4e-24   
emb|CAN76326.1|  hypothetical protein VITISV_014220                     108   4e-24   
emb|CAN67120.1|  hypothetical protein VITISV_017484                     108   4e-24   
gb|AAX96493.1|  retrotransposon protein, putative, unclassified         108   4e-24   
gb|ABB47665.1|  retrotransposon protein, putative, unclassified, ...    109   4e-24   
ref|XP_006341907.1|  PREDICTED: uncharacterized protein LOC102606154    108   5e-24   
emb|CAN61658.1|  hypothetical protein VITISV_040310                     108   5e-24   
ref|XP_008381548.1|  PREDICTED: uncharacterized protein LOC103444402    108   5e-24   
ref|XP_002457887.1|  hypothetical protein SORBIDRAFT_03g018791          108   5e-24   
gb|AAK92658.1|AC079634_19  Putative retroelement                        108   5e-24   
ref|XP_010045758.1|  PREDICTED: uncharacterized protein LOC104434554    108   5e-24   
emb|CAH67225.1|  OSIGBa0145M07.7                                        108   5e-24   
emb|CAN62538.1|  hypothetical protein VITISV_031159                     108   5e-24   
emb|CCI55376.1|  PH01B035L11.21                                         109   5e-24   
gb|AAM08718.1|AC116601_11  Putative gag-pol polyprotein                 108   5e-24   
gb|AAN05371.1|  Putative retroelement                                   108   6e-24   
emb|CAN64765.1|  hypothetical protein VITISV_009574                     108   6e-24   
emb|CAN77529.1|  hypothetical protein VITISV_041425                     108   6e-24   
gb|ABB46643.2|  retrotransposon protein, putative, Ty1-copia subc...    108   6e-24   
emb|CAN69691.1|  hypothetical protein VITISV_026777                     108   6e-24   
emb|CAN63530.1|  hypothetical protein VITISV_038849                     108   6e-24   
gb|AFP55546.1|  gag-pol polyprotein                                     108   6e-24   
gb|AAT93986.1|  putative polyprotein                                    108   7e-24   
emb|CAN64305.1|  hypothetical protein VITISV_026331                     107   7e-24   
emb|CAH67269.1|  OSIGBa0145C12.6                                        108   7e-24   
emb|CAN80285.1|  hypothetical protein VITISV_026753                     108   7e-24   
ref|XP_008372290.1|  PREDICTED: uncharacterized protein LOC103435669    108   7e-24   
ref|XP_004152030.1|  PREDICTED: pentatricopeptide repeat-containi...    108   8e-24   
emb|CAN62328.1|  hypothetical protein VITISV_029806                     108   8e-24   
emb|CAD41183.2|  OSJNBb0002J11.7                                        108   8e-24   
ref|XP_002438333.1|  hypothetical protein SORBIDRAFT_10g012262          105   8e-24   
emb|CAN79134.1|  hypothetical protein VITISV_000843                     108   9e-24   
ref|XP_010555764.1|  PREDICTED: serine carboxypeptidase-like 18         107   9e-24   
emb|CAN75033.1|  hypothetical protein VITISV_022185                     107   1e-23   
ref|XP_004167965.1|  PREDICTED: uncharacterized mitochondrial pro...    103   1e-23   
emb|CAN65116.1|  hypothetical protein VITISV_012471                     104   1e-23   
ref|XP_008358596.1|  PREDICTED: uncharacterized protein LOC103422324    108   1e-23   
ref|XP_007021177.1|  Uncharacterized protein TCM_031224                 108   1e-23   
gb|AAC28230.1|  contains similarity to reverse transcriptases (Pf...    104   1e-23   
emb|CAN73234.1|  hypothetical protein VITISV_033857                     108   1e-23   
emb|CCI61385.1|  putative reverse transcriptase (RNA-dependent DN...    102   1e-23   
gb|ABA98071.1|  retrotransposon protein, putative, unclassified         107   1e-23   
emb|CAN83181.1|  hypothetical protein VITISV_013310                     105   1e-23   
emb|CAN79013.1|  hypothetical protein VITISV_031464                     107   1e-23   
ref|XP_006598379.1|  PREDICTED: uncharacterized mitochondrial pro...    103   1e-23   
emb|CAN62266.1|  hypothetical protein VITISV_025647                     107   1e-23   
emb|CAN63898.1|  hypothetical protein VITISV_004381                     103   1e-23   
gb|ABA97278.2|  retrotransposon protein, putative, Ty1-copia subc...    106   1e-23   
emb|CAN76032.1|  hypothetical protein VITISV_040150                     107   1e-23   
emb|CAN81940.1|  hypothetical protein VITISV_007358                     107   2e-23   
emb|CAN67362.1|  hypothetical protein VITISV_001157                     107   2e-23   
emb|CAN76494.1|  hypothetical protein VITISV_024984                     107   2e-23   
emb|CAN82171.1|  hypothetical protein VITISV_040546                     107   2e-23   
emb|CAN65716.1|  hypothetical protein VITISV_015039                     107   2e-23   
ref|XP_008385012.1|  PREDICTED: uncharacterized protein LOC103447594    107   2e-23   



>ref|XP_006574083.1| PREDICTED: uncharacterized mitochondrial protein AtMg00810-like 
[Glycine max]
Length=272

 Score =   137 bits (344),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 65/140 (46%), Positives = 91/140 (65%), Gaps = 0/140 (0%)
 Frame = -3

Query  469  DPDIPDHICPLQRSLYGLK*APRAWFKRLHDFLLLTGFIAWKTDVSLFHYSAGNSRVFLL  290
            + + PDH+C L+++LYGLK APRAW+  L  FLL  GF+    D SLF Y      ++LL
Sbjct  9    NKNFPDHVCRLKKALYGLKQAPRAWYTELRVFLLSLGFVNSTADASLFIYQKPEVTLYLL  68

Query  289  VYVDDIIMLGNDAVLVDSLLRKLATAFKIRDLGKPTFFLSIETLVVPEGMILSQRRYMRD  110
            VYVDDIIM GN +  +  L+  LA  F ++DLG  ++FL +E +    GM LSQR+Y+ D
Sbjct  69   VYVDDIIMTGNSSAELSKLIATLAARFSLKDLGCLSYFLGVEVIPSAAGMFLSQRKYIID  128

Query  109  ILHRVGMTDCKSLATPASVT  50
            +LH+ GMT+ K  +TP S +
Sbjct  129  LLHKSGMTNTKPASTPFSAS  148



>emb|CAN73071.1| hypothetical protein VITISV_032383 [Vitis vinifera]
Length=1239

 Score =   143 bits (361),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 69/152 (45%), Positives = 98/152 (64%), Gaps = 0/152 (0%)
 Frame = -3

Query  469  DPDIPDHICPLQRSLYGLK*APRAWFKRLHDFLLLTGFIAWKTDVSLFHYSAGNSRVFLL  290
            DP  P H+C L+++LYGLK APRAWF+R   FLL  GF   + D SLF +   +S ++LL
Sbjct  839  DPRFPTHVCLLKKALYGLKQAPRAWFQRFSSFLLTLGFSCSRADTSLFVFHQQSSLIYLL  898

Query  289  VYVDDIIMLGNDAVLVDSLLRKLATAFKIRDLGKPTFFLSIETLVVPEGMILSQRRYMRD  110
            +YVDDII+ GN+  L+DS  RKL + F  +DLG  ++FL +E    P+G+ +SQ +Y RD
Sbjct  899  LYVDDIIVTGNNPSLLDSFTRKLHSEFATKDLGSLSYFLGLEASPTPDGLFISQLKYARD  958

Query  109  ILHRVGMTDCKSLATPASVTQPVCQSTDSFAN  14
            IL R  + D K + TP  V+Q +  +   F+N
Sbjct  959  ILTRAQLLDSKPVHTPMVVSQHLTVAGSPFSN  990



>emb|CAN78022.1| hypothetical protein VITISV_015518 [Vitis vinifera]
Length=1501

 Score =   143 bits (361),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 69/152 (45%), Positives = 98/152 (64%), Gaps = 0/152 (0%)
 Frame = -3

Query  469   DPDIPDHICPLQRSLYGLK*APRAWFKRLHDFLLLTGFIAWKTDVSLFHYSAGNSRVFLL  290
             DP  P H+C L+++LYGLK APRAWF+R   FLL  GF   + D SLF +   +S ++LL
Sbjct  956   DPRFPTHVCLLKKALYGLKQAPRAWFQRFSSFLLTLGFSCSRADTSLFVFHQQSSLIYLL  1015

Query  289   VYVDDIIMLGNDAVLVDSLLRKLATAFKIRDLGKPTFFLSIETLVVPEGMILSQRRYMRD  110
             +YVDDII+ GN+  L+DS  RKL + F  +DLG  ++FL +E    P+G+ +SQ +Y RD
Sbjct  1016  LYVDDIIVTGNNPSLLDSFTRKLHSEFATKDLGSLSYFLGLEASPTPDGLFISQLKYARD  1075

Query  109   ILHRVGMTDCKSLATPASVTQPVCQSTDSFAN  14
             IL R  + D K + TP  V+Q +  +   F+N
Sbjct  1076  ILTRAQLLDSKPVHTPMVVSQHLTVAGSPFSN  1107



>gb|AAT85031.1| putative polyprotein [Oryza sativa Japonica Group]
 gb|ABF96679.1| retrotransposon protein, putative, Ty1-copia subclass [Oryza 
sativa Japonica Group]
Length=1437

 Score =   141 bits (356),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 66/141 (47%), Positives = 94/141 (67%), Gaps = 0/141 (0%)
 Frame = -3

Query  469   DPDIPDHICPLQRSLYGLK*APRAWFKRLHDFLLLTGFIAWKTDVSLFHYSAGNSRVFLL  290
             +P  PD++C L ++LYGLK APRAW+ RL   L   GF   K D SLF Y+ G+  +FLL
Sbjct  1055  NPSTPDYVCKLDKALYGLKQAPRAWYSRLSGKLHDLGFKGSKADTSLFFYNKGSLTIFLL  1114

Query  289   VYVDDIIMLGNDAVLVDSLLRKLATAFKIRDLGKPTFFLSIETLVVPEGMILSQRRYMRD  110
             +YVDDII++ +    V +LL+ L   F ++DLG   +FL IE   +P G+++SQ +Y  D
Sbjct  1115  IYVDDIIVVSSRKEAVSALLQDLQKEFALKDLGDLHYFLGIEVTKIPGGILMSQEKYASD  1174

Query  109   ILHRVGMTDCKSLATPASVTQ  47
             +L RV M+DCKS+ATP S ++
Sbjct  1175  LLKRVNMSDCKSVATPLSASE  1195



>emb|CAN61823.1| hypothetical protein VITISV_008493 [Vitis vinifera]
Length=414

 Score =   136 bits (342),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 65/149 (44%), Positives = 92/149 (62%), Gaps = 0/149 (0%)
 Frame = -3

Query  469  DPDIPDHICPLQRSLYGLK*APRAWFKRLHDFLLLTGFIAWKTDVSLFHYSAGNSRVFLL  290
            DP  P H+C L++S+YGLK APR W+K L D LL  GFI   TD SLF Y + +   + L
Sbjct  18   DPSQPQHVCKLKKSIYGLKQAPRQWYKALRDALLRFGFIHSATDNSLFIYKSHDILCYCL  77

Query  289  VYVDDIIMLGNDAVLVDSLLRKLATAFKIRDLGKPTFFLSIETLVVPEGMILSQRRYMRD  110
            VYVDDII+  N    V++++ KL + F ++D+G   +FL IE +  P+G+ LSQ +Y+RD
Sbjct  78   VYVDDIIVTSNTLSFVNNIINKLGSTFSVKDMGSLHYFLGIEVIPTPQGLFLSQHQYIRD  137

Query  109  ILHRVGMTDCKSLATPASVTQPVCQSTDS  23
            +L R  M + K   TP S T  +    +S
Sbjct  138  LLSRTSMENAKETLTPMSTTAKLTVQDNS  166



>ref|XP_006595350.1| PREDICTED: uncharacterized mitochondrial protein AtMg00810-like 
[Glycine max]
Length=216

 Score =   132 bits (331),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 63/135 (47%), Positives = 87/135 (64%), Gaps = 0/135 (0%)
 Frame = -3

Query  454  DHICPLQRSLYGLK*APRAWFKRLHDFLLLTGFIAWKTDVSLFHYSAGNSRVFLLVYVDD  275
            DH+C L+++LYGLK APRAW+  L  FLL  GF+    D SLF Y      ++LLVYVDD
Sbjct  14   DHVCRLKKALYGLKQAPRAWYTELRLFLLSLGFVNSTADASLFIYQKPEVTLYLLVYVDD  73

Query  274  IIMLGNDAVLVDSLLRKLATAFKIRDLGKPTFFLSIETLVVPEGMILSQRRYMRDILHRV  95
            IIM GN +  +  L+  L   F ++DLG  ++FL +E +    GM LSQR+Y+ D+LH+ 
Sbjct  74   IIMTGNSSAELSKLIATLDARFSLKDLGCLSYFLGVEVIPSAAGMFLSQRKYIIDLLHKS  133

Query  94   GMTDCKSLATPASVT  50
            GMT+ K  +TP S +
Sbjct  134  GMTNTKPASTPLSAS  148



>ref|XP_010430787.1| PREDICTED: uncharacterized protein LOC104715028 [Camelina sativa]
Length=1121

 Score =   137 bits (345),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 65/150 (43%), Positives = 89/150 (59%), Gaps = 0/150 (0%)
 Frame = -3

Query  469  DPDIPDHICPLQRSLYGLK*APRAWFKRLHDFLLLTGFIAWKTDVSLFHYSAGNSRVFLL  290
            DP  P H+C L +++YGLK APRAWF +   FLL  GF   K D SLF Y      + LL
Sbjct  228  DPQYPSHVCKLDKAIYGLKQAPRAWFDKFSTFLLEYGFTCSKADPSLFVYHHNGDTLVLL  287

Query  289  VYVDDIIMLGNDAVLVDSLLRKLATAFKIRDLGKPTFFLSIETLVVPEGMILSQRRYMRD  110
            +YVDDII+ G++  L+  L+  L   F ++DLG   +FL ++  +  EGM LSQ +Y  D
Sbjct  288  LYVDDIILTGSNKELLAHLVETLGQQFSMKDLGCLHYFLGVQVQITSEGMFLSQTKYAED  347

Query  109  ILHRVGMTDCKSLATPASVTQPVCQSTDSF  20
            ILH+ GM  C  +ATP  +  PV ++ D  
Sbjct  348  ILHQAGMAACNPMATPLPLQLPVNKTGDEL  377



>gb|KHN30958.1| Retrovirus-related Pol polyprotein from transposon TNT 1-94, 
partial [Glycine soja]
Length=1237

 Score =   136 bits (343),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 65/140 (46%), Positives = 91/140 (65%), Gaps = 0/140 (0%)
 Frame = -3

Query  469   DPDIPDHICPLQRSLYGLK*APRAWFKRLHDFLLLTGFIAWKTDVSLFHYSAGNSRVFLL  290
             + + PDH+C L+++LYGLK APRAW+  L  FLL  GF+    D SLF Y      ++LL
Sbjct  873   NKNFPDHVCRLKKALYGLKQAPRAWYTELRVFLLSLGFVNSTADASLFIYQKPEVTLYLL  932

Query  289   VYVDDIIMLGNDAVLVDSLLRKLATAFKIRDLGKPTFFLSIETLVVPEGMILSQRRYMRD  110
             VYVDDIIM GN +  +  L+  LA  F ++DLG  ++FL +E +    GM LSQR+Y+ D
Sbjct  933   VYVDDIIMTGNSSAELSKLIATLAARFSLKDLGCLSYFLGVEVIPSAAGMFLSQRKYIID  992

Query  109   ILHRVGMTDCKSLATPASVT  50
             +LH+ GMT+ K  +TP S +
Sbjct  993   LLHKSGMTNTKPASTPLSAS  1012



>gb|KHN05629.1| Retrovirus-related Pol polyprotein from transposon TNT 1-94, 
partial [Glycine soja]
Length=1248

 Score =   136 bits (343),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 65/140 (46%), Positives = 91/140 (65%), Gaps = 0/140 (0%)
 Frame = -3

Query  469   DPDIPDHICPLQRSLYGLK*APRAWFKRLHDFLLLTGFIAWKTDVSLFHYSAGNSRVFLL  290
             + + PDH+C L+++LYGLK APRAW+  L  FLL  GF+    D SLF Y      ++LL
Sbjct  873   NKNFPDHVCRLKKALYGLKQAPRAWYTELRVFLLSLGFVNSTADASLFIYQKPEVTLYLL  932

Query  289   VYVDDIIMLGNDAVLVDSLLRKLATAFKIRDLGKPTFFLSIETLVVPEGMILSQRRYMRD  110
             VYVDDIIM GN +  +  L+  LA  F ++DLG  ++FL +E +    GM LSQR+Y+ D
Sbjct  933   VYVDDIIMTGNSSAELSKLIATLAARFSLKDLGCLSYFLGVEVIPSAAGMFLSQRKYIID  992

Query  109   ILHRVGMTDCKSLATPASVT  50
             +LH+ GMT+ K  +TP S +
Sbjct  993   LLHKSGMTNTKPASTPLSAS  1012



>gb|KHN45997.1| Retrovirus-related Pol polyprotein from transposon TNT 1-94, 
partial [Glycine soja]
Length=1235

 Score =   136 bits (343),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 65/140 (46%), Positives = 91/140 (65%), Gaps = 0/140 (0%)
 Frame = -3

Query  469   DPDIPDHICPLQRSLYGLK*APRAWFKRLHDFLLLTGFIAWKTDVSLFHYSAGNSRVFLL  290
             + + PDH+C L+++LYGLK APRAW+  L  FLL  GF+    D SLF Y      ++LL
Sbjct  871   NKNFPDHVCRLKKALYGLKQAPRAWYTELRVFLLSLGFVNSTADASLFIYQKPEVTLYLL  930

Query  289   VYVDDIIMLGNDAVLVDSLLRKLATAFKIRDLGKPTFFLSIETLVVPEGMILSQRRYMRD  110
             VYVDDIIM GN +  +  L+  LA  F ++DLG  ++FL +E +    GM LSQR+Y+ D
Sbjct  931   VYVDDIIMTGNSSAELSKLIATLAARFSLKDLGCLSYFLGVEVIPSAAGMFLSQRKYIID  990

Query  109   ILHRVGMTDCKSLATPASVT  50
             +LH+ GMT+ K  +TP S +
Sbjct  991   LLHKSGMTNTKPASTPLSAS  1010



>emb|CAE05127.3| OSJNBa0079F16.14 [Oryza sativa Japonica Group]
Length=322

 Score =   131 bits (329),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 65/136 (48%), Positives = 85/136 (63%), Gaps = 0/136 (0%)
 Frame = -3

Query  469  DPDIPDHICPLQRSLYGLK*APRAWFKRLHDFLLLTGFIAWKTDVSLFHYSAGNSRVFLL  290
            DP  PD +C L +SLYGLK APRAW+ R   FLL  GF+  K+D SLF Y  G+  V+LL
Sbjct  159  DPTKPDLVCRLNKSLYGLKQAPRAWYSRFASFLLTLGFVEAKSDTSLFIYRRGSDTVYLL  218

Query  289  VYVDDIIMLGNDAVLVDSLLRKLATAFKIRDLGKPTFFLSIETLVVPEGMILSQRRYMRD  110
            +YVDDI++  +   L+   +R L + F ++DLG    FL I       G+ LSQR+Y  +
Sbjct  219  LYVDDIVLTASSDALLRWTIRALQSEFSMKDLGSLHHFLGISISRQSSGLHLSQRQYCLE  278

Query  109  ILHRVGMTDCKSLATP  62
            +L R GMTDCK  ATP
Sbjct  279  VLERAGMTDCKPCATP  294



>emb|CAN67588.1| hypothetical protein VITISV_036280 [Vitis vinifera]
Length=1379

 Score =   136 bits (342),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 64/152 (42%), Positives = 96/152 (63%), Gaps = 0/152 (0%)
 Frame = -3

Query  469  DPDIPDHICPLQRSLYGLK*APRAWFKRLHDFLLLTGFIAWKTDVSLFHYSAGNSRVFLL  290
            DP  P H+C L+++LYGLK APRAWF+R   FLL  GF   + D SLF ++  +  ++LL
Sbjct  410  DPRHPLHVCKLKKALYGLKQAPRAWFQRFSSFLLKLGFFCSRADTSLFVFTKKDDLIYLL  469

Query  289  VYVDDIIMLGNDAVLVDSLLRKLATAFKIRDLGKPTFFLSIETLVVPEGMILSQRRYMRD  110
            +YVDDII+ GN+  L++  + +L + F ++DLG  ++FL +E   +P+G  LSQ +Y  D
Sbjct  470  LYVDDIILTGNNPALINRFISQLHSEFAVKDLGPLSYFLGLEVSYIPDGFFLSQVKYATD  529

Query  109  ILHRVGMTDCKSLATPASVTQPVCQSTDSFAN  14
            IL R  + D K + TP  V+Q +      FA+
Sbjct  530  ILARAQLLDSKPVPTPMIVSQRLSSEGTPFAD  561



>emb|CAN71676.1| hypothetical protein VITISV_015838 [Vitis vinifera]
Length=1352

 Score =   135 bits (341),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 65/149 (44%), Positives = 92/149 (62%), Gaps = 0/149 (0%)
 Frame = -3

Query  469  DPDIPDHICPLQRSLYGLK*APRAWFKRLHDFLLLTGFIAWKTDVSLFHYSAGNSRVFLL  290
            DP  P H+C L++S+YGLK APR W+K L D LL  GFI   TD SLF Y + +   + L
Sbjct  34   DPSQPQHVCKLKKSIYGLKQAPRQWYKALRDALLRFGFIHSATDNSLFIYKSHDILCYCL  93

Query  289  VYVDDIIMLGNDAVLVDSLLRKLATAFKIRDLGKPTFFLSIETLVVPEGMILSQRRYMRD  110
            VYVDDII+  N    V++++ KL + F ++D+G   +FL IE +  P+G+ LSQ +Y+RD
Sbjct  94   VYVDDIIVTSNTLSFVNNIINKLGSTFSVKDMGSLHYFLGIEVIPTPQGLFLSQHQYIRD  153

Query  109  ILHRVGMTDCKSLATPASVTQPVCQSTDS  23
            +L R  M + K   TP S T  +    +S
Sbjct  154  LLSRTSMENAKETLTPMSTTAKLTVQDNS  182



>gb|AAP53968.1| retrotransposon protein, putative, Ty1-copia subclass [Oryza 
sativa Japonica Group]
Length=932

 Score =   135 bits (339),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 66/139 (47%), Positives = 91/139 (65%), Gaps = 0/139 (0%)
 Frame = -3

Query  457  PDHICPLQRSLYGLK*APRAWFKRLHDFLLLTGFIAWKTDVSLFHYSAGNSRVFLLVYVD  278
            P+++C L ++LYGLK APRAW+ RL   L   GFI+ K D SLF Y+ G   +F+LVYVD
Sbjct  562  PNYLCKLDKALYGLKQAPRAWYSRLSTKLQELGFISSKADTSLFFYNKGGCTIFILVYVD  621

Query  277  DIIMLGNDAVLVDSLLRKLATAFKIRDLGKPTFFLSIETLVVPEGMILSQRRYMRDILHR  98
            DII+  + A +V +LL+ L   F ++DLG   +FL IE   V +G++LSQ  Y  DIL R
Sbjct  622  DIIVASSSAEVVAALLKDLEKDFALKDLGDLHYFLGIEVKKVSQGLVLSQAWYASDILKR  681

Query  97   VGMTDCKSLATPASVTQPV  41
             GM+ CK  +TP S T+ +
Sbjct  682  AGMSICKPASTPLSTTEKL  700



>gb|EEC76475.1| hypothetical protein OsI_14210 [Oryza sativa Indica Group]
Length=391

 Score =   131 bits (330),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 62/138 (45%), Positives = 91/138 (66%), Gaps = 0/138 (0%)
 Frame = -3

Query  460  IPDHICPLQRSLYGLK*APRAWFKRLHDFLLLTGFIAWKTDVSLFHYSAGNSRVFLLVYV  281
            +P+++C L ++LYGLK APRAW+ RL   L   GF+  K D SLF Y  G   +FLL+YV
Sbjct  12   MPNYVCKLDKALYGLKQAPRAWYSRLSTKLSELGFVPSKADTSLFFYKKGQVSIFLLIYV  71

Query  280  DDIIMLGNDAVLVDSLLRKLATAFKIRDLGKPTFFLSIETLVVPEGMILSQRRYMRDILH  101
            DDII+  +      +LL++L+  F ++DLG   +FL IE   V +G++LSQ +Y  D+L 
Sbjct  72   DDIIVASSVPDATSTLLQELSKDFALKDLGDLHYFLGIEVHKVKDGLMLSQEKYASDLLR  131

Query  100  RVGMTDCKSLATPASVTQ  47
            RVGM +CK ++TP S ++
Sbjct  132  RVGMYECKPVSTPLSTSE  149



>gb|AAK55460.1|AC069300_15 putative gag-pol polyprotein [Oryza sativa Japonica Group]
 gb|AAP54977.1| retrotransposon protein, putative, Ty1-copia subclass [Oryza 
sativa Japonica Group]
Length=1031

 Score =   135 bits (339),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 62/137 (45%), Positives = 94/137 (69%), Gaps = 0/137 (0%)
 Frame = -3

Query  451  HICPLQRSLYGLK*APRAWFKRLHDFLLLTGFIAWKTDVSLFHYSAGNSRVFLLVYVDDI  272
            ++C L ++LYGLK APRAW+ RL   L   GF + K+D SLF YS G+  +F+LVYVDDI
Sbjct  660  YVCKLDKALYGLKQAPRAWYSRLSTKLHELGFKSSKSDTSLFFYSKGDVTIFMLVYVDDI  719

Query  271  IMLGNDAVLVDSLLRKLATAFKIRDLGKPTFFLSIETLVVPEGMILSQRRYMRDILHRVG  92
            I+  +  V  ++LL+ L   F ++DLG+  +FL IE   V +G++L+Q +Y  D+L RV 
Sbjct  720  IVASSSIVATNALLKNLNQEFALKDLGRLHYFLGIEVKEVNDGIVLTQEKYAMDVLKRVN  779

Query  91   MTDCKSLATPASVTQPV  41
            M+DCK++ TP S+++ +
Sbjct  780  MSDCKAVNTPLSISEKL  796



>gb|KHN17953.1| Retrovirus-related Pol polyprotein from transposon TNT 1-94 [Glycine 
soja]
Length=1294

 Score =   135 bits (339),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 64/140 (46%), Positives = 90/140 (64%), Gaps = 0/140 (0%)
 Frame = -3

Query  469   DPDIPDHICPLQRSLYGLK*APRAWFKRLHDFLLLTGFIAWKTDVSLFHYSAGNSRVFLL  290
             + + PDH+C L+++LYGLK APRAW+  L  FL   GF+    D SLF Y      ++LL
Sbjct  908   NKNFPDHVCRLKKALYGLKQAPRAWYTELRIFLFSLGFVNSTADASLFIYQKPEVTLYLL  967

Query  289   VYVDDIIMLGNDAVLVDSLLRKLATAFKIRDLGKPTFFLSIETLVVPEGMILSQRRYMRD  110
             VYVDDIIM GN +  +  L+  LA  F ++DLG  ++FL +E +    GM LSQR+Y+ D
Sbjct  968   VYVDDIIMTGNSSAELSKLIATLAARFSLKDLGCLSYFLGVEVIPSAAGMFLSQRKYIID  1027

Query  109   ILHRVGMTDCKSLATPASVT  50
             +LH+ GMT+ K  +TP S +
Sbjct  1028  LLHKSGMTNTKPASTPLSAS  1047



>ref|NP_001175678.1| Os08g0544300 [Oryza sativa Japonica Group]
 dbj|BAH94406.1| Os08g0544300 [Oryza sativa Japonica Group]
Length=821

 Score =   133 bits (335),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 63/138 (46%), Positives = 91/138 (66%), Gaps = 0/138 (0%)
 Frame = -3

Query  460  IPDHICPLQRSLYGLK*APRAWFKRLHDFLLLTGFIAWKTDVSLFHYSAGNSRVFLLVYV  281
            +P+++C L ++LYGLK APRAW+ RL   L   GF+  K D SLF Y  G   +FLL+YV
Sbjct  442  MPNYVCKLDKALYGLKQAPRAWYSRLSTKLSELGFVPSKADTSLFFYKKGQVSIFLLIYV  501

Query  280  DDIIMLGNDAVLVDSLLRKLATAFKIRDLGKPTFFLSIETLVVPEGMILSQRRYMRDILH  101
            DDIIM  +      +LL++L+  F ++DLG   +FL IE   V +G++LSQ +Y  D+L 
Sbjct  502  DDIIMASSVPDATSTLLQELSKDFALKDLGDLHYFLGIEVHKVKDGLMLSQEKYASDLLR  561

Query  100  RVGMTDCKSLATPASVTQ  47
            RVGM +CK ++TP S ++
Sbjct  562  RVGMYECKPVSTPLSTSE  579



>emb|CAN72527.1| hypothetical protein VITISV_009255 [Vitis vinifera]
Length=1095

 Score =   133 bits (335),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 63/152 (41%), Positives = 95/152 (63%), Gaps = 0/152 (0%)
 Frame = -3

Query  469  DPDIPDHICPLQRSLYGLK*APRAWFKRLHDFLLLTGFIAWKTDVSLFHYSAGNSRVFLL  290
            DP  P H+C L+++LYGLK APRAWF+R   FLL  GF     D SLF ++  +  ++LL
Sbjct  713  DPRHPLHVCKLKKALYGLKQAPRAWFQRFSSFLLKLGFFCNCADTSLFVFTKKDDLIYLL  772

Query  289  VYVDDIIMLGNDAVLVDSLLRKLATAFKIRDLGKPTFFLSIETLVVPEGMILSQRRYMRD  110
            +YVD+II+ GN+  L++  + +L + F ++DLG  ++FL +E   +P+G  LSQ +Y  D
Sbjct  773  LYVDNIILTGNNPALINQFISQLHSEFAVKDLGPLSYFLGLEVSYIPDGFFLSQVKYATD  832

Query  109  ILHRVGMTDCKSLATPASVTQPVCQSTDSFAN  14
            IL R  + D K + TP  V+Q +      FA+
Sbjct  833  ILARAQLLDSKPVTTPMIVSQRLSSEGTPFAD  864



>ref|XP_008665822.1| PREDICTED: uncharacterized protein LOC103644390 [Zea mays]
Length=908

 Score =   132 bits (333),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 64/141 (45%), Positives = 91/141 (65%), Gaps = 0/141 (0%)
 Frame = -3

Query  469  DPDIPDHICPLQRSLYGLK*APRAWFKRLHDFLLLTGFIAWKTDVSLFHYSAGNSRVFLL  290
            DP +P + C L ++LYGLK APRAW+ RL   L   GFI    D+SLF +  G+  +++L
Sbjct  667  DPVVPSYHCKLDKALYGLKQAPRAWYSRLSMKLQALGFIPSPADISLFIFHRGSITIYVL  726

Query  289  VYVDDIIMLGNDAVLVDSLLRKLATAFKIRDLGKPTFFLSIETLVVPEGMILSQRRYMRD  110
            VYVDDII+  +    +D+LL  L   F ++DLGK  +FL IE   VP+G+IL Q +Y  D
Sbjct  727  VYVDDIIVTSSSPQAIDALLTDLKHDFALKDLGKLHYFLGIEVTHVPDGLILQQHKYATD  786

Query  109  ILHRVGMTDCKSLATPASVTQ  47
            +L + GM+ CK +ATP S ++
Sbjct  787  LLRKFGMSQCKPMATPMSTSE  807



>gb|AAX96193.1| retrotransposon protein, putative, Ty1-copia sub-class [Oryza 
sativa Japonica Group]
Length=1621

 Score =   133 bits (335),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 65/141 (46%), Positives = 89/141 (63%), Gaps = 0/141 (0%)
 Frame = -3

Query  469  DPDIPDHICPLQRSLYGLK*APRAWFKRLHDFLLLTGFIAWKTDVSLFHYSAGNSRVFLL  290
            DP  P H+C L ++LYGLK APRAWF RL   L+  GF   K D SLF  + G+  +F+L
Sbjct  799  DPTKPHHVCKLDKALYGLKQAPRAWFSRLSKKLMDLGFKGSKADTSLFFLNKGDITMFVL  858

Query  289  VYVDDIIMLGNDAVLVDSLLRKLATAFKIRDLGKPTFFLSIETLVVPEGMILSQRRYMRD  110
            VYVDDII+  +      +LL+ L   F ++DLG+  +FL IE   V  G++L+Q +Y  D
Sbjct  859  VYVDDIIVASSSEKATAALLQNLKGEFALKDLGELHYFLGIEVSKVQNGIVLNQDKYAND  918

Query  109  ILHRVGMTDCKSLATPASVTQ  47
            +L +VGM DCK   TP SV++
Sbjct  919  LLKKVGMIDCKPANTPLSVSE  939



>emb|CAN79182.1| hypothetical protein VITISV_024133 [Vitis vinifera]
Length=555

 Score =   130 bits (327),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 63/138 (46%), Positives = 93/138 (67%), Gaps = 4/138 (3%)
 Frame = -3

Query  469  DPDIPDHICPLQRSLYGLK*APRAWFKRLHDFLLLTGFIAWKTDVSLFHYSAGNSRVFLL  290
            D D P ++C L +++YGLK APRAW+ +L  FLL +GF    +D SLF + + N  ++LL
Sbjct  391  DSDHPSYVCKLHKAIYGLKQAPRAWYHKLRQFLLTSGFKNSHSDTSLFVFRSSNHVLYLL  450

Query  289  VYVDDIIMLGNDAVLVDSLLRKLATAFKIRDLGKPTFFLSIETLVVPE--GMILSQRRYM  116
            +YVDDII+ GN   LV  L+  LA  F ++DLG+ ++FL +E  VVP   G++LSQRRY+
Sbjct  451  IYVDDIILTGNSDTLVSQLVDYLAQRFSLKDLGQLSYFLGVE--VVPHRLGILLSQRRYI  508

Query  115  RDILHRVGMTDCKSLATP  62
            +D+L +  M + K + TP
Sbjct  509  QDLLKQTNMANAKPVLTP  526



>emb|CAC37623.1| copia-like polyprotein [Arabidopsis thaliana]
Length=1466

 Score =   133 bits (334),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 63/136 (46%), Positives = 85/136 (63%), Gaps = 0/136 (0%)
 Frame = -3

Query  469   DPDIPDHICPLQRSLYGLK*APRAWFKRLHDFLLLTGFIAWKTDVSLFHYSAGNSRVFLL  290
             DP+ P+H+C L ++LYGLK APRAWF    +FLL  GF    +D SLF        + LL
Sbjct  1010  DPNKPNHVCRLTKALYGLKQAPRAWFDTFSNFLLDFGFECSTSDPSLFVCHQNGQSLILL  1069

Query  289   VYVDDIIMLGNDAVLVDSLLRKLATAFKIRDLGKPTFFLSIETLVVPEGMILSQRRYMRD  110
             +YVDDI++ G+D +L+D LL+ L   F ++DLG P +FL IE      G+ L Q  Y  D
Sbjct  1070  LYVDDILLTGSDQLLMDKLLQALNNRFSMKDLGPPRYFLGIEIESYNNGLFLHQHAYASD  1129

Query  109   ILHRVGMTDCKSLATP  62
             ILH+ GMT+C  + TP
Sbjct  1130  ILHQAGMTECNPMPTP  1145



>gb|AAD43604.1|AC005698_3 T3P18.3 [Arabidopsis thaliana]
Length=1309

 Score =   133 bits (334),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 63/136 (46%), Positives = 85/136 (63%), Gaps = 0/136 (0%)
 Frame = -3

Query  469  DPDIPDHICPLQRSLYGLK*APRAWFKRLHDFLLLTGFIAWKTDVSLFHYSAGNSRVFLL  290
            DP+ P+H+C L ++LYGLK APRAWF    +FLL  GF    +D SLF        + LL
Sbjct  853  DPNKPNHVCRLTKALYGLKQAPRAWFDTFSNFLLDFGFECSTSDPSLFVCHQNGQSLILL  912

Query  289  VYVDDIIMLGNDAVLVDSLLRKLATAFKIRDLGKPTFFLSIETLVVPEGMILSQRRYMRD  110
            +YVDDI++ G+D +L+D LL+ L   F ++DLG P +FL IE      G+ L Q  Y  D
Sbjct  913  LYVDDILLTGSDQLLMDKLLQALNNRFSMKDLGPPRYFLGIEIESYNNGLFLHQHAYASD  972

Query  109  ILHRVGMTDCKSLATP  62
            ILH+ GMT+C  + TP
Sbjct  973  ILHQAGMTECNPMPTP  988



>pir||T02087 gag/pol polyprotein - maize retrotransposon Hopscotch
 gb|AAA57005.1| copia-like retrotransposon Hopscotch polyprotein [Zea mays]
Length=1439

 Score =   132 bits (333),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 66/150 (44%), Positives = 96/150 (64%), Gaps = 0/150 (0%)
 Frame = -3

Query  469   DPDIPDHICPLQRSLYGLK*APRAWFKRLHDFLLLTGFIAWKTDVSLFHYSAGNSRVFLL  290
             D   P++ C LQ+SLYGLK  PRAW+ RL + L   GF+  K DVSLF Y+A ++ +++L
Sbjct  1057  DTTHPNYHCHLQKSLYGLKQRPRAWYSRLSEKLQSLGFVPSKADVSLFIYNAHSTAIYIL  1116

Query  289   VYVDDIIMLGNDAVLVDSLLRKLATAFKIRDLGKPTFFLSIETLVVPEGMILSQRRYMRD  110
             VYVDDII+ G+    +D++L KL   F I+DLG   +FL IE     +G++L Q +Y RD
Sbjct  1117  VYVDDIIITGSSPHAIDNVLAKLKDDFAIKDLGDLHYFLGIEVHRKGDGLLLCQEKYARD  1176

Query  109   ILHRVGMTDCKSLATPASVTQPVCQSTDSF  20
             +L RVGM  CK + TP + ++ +  S  + 
Sbjct  1177  LLKRVGMECCKPVHTPVATSEKLSASAGTL  1206



>gb|AAK51235.1|AF287471_1 polyprotein [Arabidopsis thaliana]
Length=1453

 Score =   132 bits (332),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 61/136 (45%), Positives = 87/136 (64%), Gaps = 0/136 (0%)
 Frame = -3

Query  469   DPDIPDHICPLQRSLYGLK*APRAWFKRLHDFLLLTGFIAWKTDVSLFHYSAGNSRVFLL  290
             D + P ++C L ++LYGLK APRAWF  + ++LL  GF   K+D SLF Y      + LL
Sbjct  1018  DQEKPSYVCRLTKALYGLKQAPRAWFDTISNYLLDFGFSCSKSDPSLFTYHKNGKTLVLL  1077

Query  289   VYVDDIIMLGNDAVLVDSLLRKLATAFKIRDLGKPTFFLSIETLVVPEGMILSQRRYMRD  110
             +YVDDI++ G+D  L+  LL  L   F ++DLG P++FL +E    PEG+ L Q  Y +D
Sbjct  1078  LYVDDILLTGSDHNLLQELLMSLNKRFSMKDLGAPSYFLGVEIESSPEGLFLHQTAYAKD  1137

Query  109   ILHRVGMTDCKSLATP  62
             ILH+  M++C S+ TP
Sbjct  1138  ILHQAAMSNCNSMPTP  1153



>gb|AAL66754.1|AF464738_5 putative copia-like retrotransposon Hopscotch polyprotein [Zea 
mays]
Length=1313

 Score =   132 bits (332),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 63/136 (46%), Positives = 92/136 (68%), Gaps = 0/136 (0%)
 Frame = -3

Query  454   DHICPLQRSLYGLK*APRAWFKRLHDFLLLTGFIAWKTDVSLFHYSAGNSRVFLLVYVDD  275
             +++C L ++LYGLK APRAW+ RL + LL  GF A K D SLF Y+ G+  +F+LVYVDD
Sbjct  942   NYVCKLDKALYGLKQAPRAWYSRLSNKLLSLGFQASKADTSLFFYNKGSVTIFVLVYVDD  1001

Query  274   IIMLGNDAVLVDSLLRKLATAFKIRDLGKPTFFLSIETLVVPEGMILSQRRYMRDILHRV  95
             II+  +     ++LL  L   F ++DLG   +FL IE   V +G+IL+Q +Y  D+L +V
Sbjct  1002  IIVASSTHKATEALLSDLNKEFALKDLGDLNYFLGIEVNKVRDGIILTQDKYASDLLKKV  1061

Query  94    GMTDCKSLATPASVTQ  47
             GM+DCK ++TP S ++
Sbjct  1062  GMSDCKPISTPLSTSE  1077



>emb|CAB40035.1| retrotransposon like protein [Arabidopsis thaliana]
 emb|CAB81170.1| retrotransposon like protein [Arabidopsis thaliana]
Length=1515

 Score =   132 bits (331),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 62/136 (46%), Positives = 90/136 (66%), Gaps = 0/136 (0%)
 Frame = -3

Query  469   DPDIPDHICPLQRSLYGLK*APRAWFKRLHDFLLLTGFIAWKTDVSLFHYSAGNSRVFLL  290
             DP  PD++C L++++Y LK APRAWF +   +LL  GFI   +D SLF Y  G   +FLL
Sbjct  1052  DPSRPDYVCKLKKAIYDLKQAPRAWFDKFSSYLLKYGFICSFSDPSLFVYLKGRDVMFLL  1111

Query  289   VYVDDIIMLGNDAVLVDSLLRKLATAFKIRDLGKPTFFLSIETLVVPEGMILSQRRYMRD  110
             +YVDD+I+ GN+ VL+  LL  L+T F+++D+G   +FL I+     +G+ LSQ +Y  D
Sbjct  1112  LYVDDMILTGNNDVLLQQLLNILSTEFRMKDMGALHYFLGIQAHYHNDGLFLSQEKYTSD  1171

Query  109   ILHRVGMTDCKSLATP  62
             +L   GM+DC S+ TP
Sbjct  1172  LLVNAGMSDCSSMPTP  1187



>emb|CAN61640.1| hypothetical protein VITISV_021909 [Vitis vinifera]
Length=1361

 Score =   132 bits (331),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 63/141 (45%), Positives = 88/141 (62%), Gaps = 0/141 (0%)
 Frame = -3

Query  469   DPDIPDHICPLQRSLYGLK*APRAWFKRLHDFLLLTGFIAWKTDVSLFHYSAGNSRVFLL  290
             DP  P H+C L+R+LYGLK APRAWF R   FLL  GF + + D SLF Y +    V+LL
Sbjct  972   DPQFPQHVCRLKRALYGLKQAPRAWFHRFSSFLLKHGFHSSQADSSLFFYHSSLGTVYLL  1031

Query  289   VYVDDIIMLGNDAVLVDSLLRKLATAFKIRDLGKPTFFLSIETLVVPEGMILSQRRYMRD  110
             +YVDD+I+ G+   LV + + +L+  F ++DLG   +FL +E     +G+ LSQ +Y  D
Sbjct  1032  LYVDDMIITGSTPSLVHTFITRLSNEFSMKDLGDLHYFLGVEVQANEKGLFLSQTKYALD  1091

Query  109   ILHRVGMTDCKSLATPASVTQ  47
             +L R  M D K ++TP  V Q
Sbjct  1092  LLQRASMIDAKPISTPFVVGQ  1112



>gb|ABA98286.2| retrotransposon protein, putative, Ty1-copia subclass [Oryza 
sativa Japonica Group]
Length=1478

 Score =   132 bits (331),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 65/141 (46%), Positives = 89/141 (63%), Gaps = 0/141 (0%)
 Frame = -3

Query  469   DPDIPDHICPLQRSLYGLK*APRAWFKRLHDFLLLTGFIAWKTDVSLFHYSAGNSRVFLL  290
             DP  P H+C L ++LYGLK APRAWF RL   L+  GF   K D SLF  + G+  +F+L
Sbjct  1070  DPTKPHHVCKLDKALYGLKQAPRAWFSRLSKKLMDLGFKGSKADTSLFFLNKGDITMFVL  1129

Query  289   VYVDDIIMLGNDAVLVDSLLRKLATAFKIRDLGKPTFFLSIETLVVPEGMILSQRRYMRD  110
             VYVDDII+  +      +LL+ L   F ++DLG+  +FL IE   V  G++L+Q +Y  D
Sbjct  1130  VYVDDIIVASSSERATAALLQDLKGEFALKDLGELHYFLGIEVSKVQNGIVLNQDKYAND  1189

Query  109   ILHRVGMTDCKSLATPASVTQ  47
             +L +VGM DCK   TP SV++
Sbjct  1190  LLKKVGMIDCKPANTPLSVSE  1210



>ref|XP_002466349.1| hypothetical protein SORBIDRAFT_01g006185 [Sorghum bicolor]
 gb|EER93347.1| hypothetical protein SORBIDRAFT_01g006185 [Sorghum bicolor]
Length=557

 Score =   129 bits (323),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 65/149 (44%), Positives = 93/149 (62%), Gaps = 1/149 (1%)
 Frame = -3

Query  469  DPDIPDHICPLQRSLYGLK*APRAWFKRLHDFLLLTGFIAWKTDVSLFHYSAGNSRVFLL  290
            DPD P+H+C L +SLYGLK APRAWF+RL + L   GFIA  +D SLF +  G+  V+LL
Sbjct  260  DPDCPNHVCLLVKSLYGLKQAPRAWFQRLGNHLRSMGFIASGSDSSLFIFQRGDQVVYLL  319

Query  289  VYVDDIIMLGNDAVLVDSLLRKLATAFKIRDLGKPTFFLSIETLVVPEGMILSQRRYMRD  110
            VYV DII+  +    +  ++ +L   F ++DLG+  FFL ++      G  L+Q +Y+ D
Sbjct  320  VYVGDIILTASTTTTLRRVIDQLRHVFALKDLGELRFFLGVQVCRDATGFYLNQAQYIED  379

Query  109  ILHRVGMTDCKSLATPASVTQPVCQSTDS  23
            IL R GM++CK  +TP    +P   +TD 
Sbjct  380  ILERAGMSNCKPASTPMEA-KPKLSATDG  407



>gb|ABA98049.1| retrotransposon protein, putative, Ty1-copia subclass [Oryza 
sativa Japonica Group]
Length=1460

 Score =   131 bits (330),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 65/141 (46%), Positives = 89/141 (63%), Gaps = 0/141 (0%)
 Frame = -3

Query  469   DPDIPDHICPLQRSLYGLK*APRAWFKRLHDFLLLTGFIAWKTDVSLFHYSAGNSRVFLL  290
             DP  P H+C L ++LYGLK APRAWF RL   L+  GF   K D SLF  + G+  +F+L
Sbjct  1077  DPTKPHHVCKLDKALYGLKQAPRAWFSRLSKKLMDLGFKGSKPDTSLFFLNKGDITMFVL  1136

Query  289   VYVDDIIMLGNDAVLVDSLLRKLATAFKIRDLGKPTFFLSIETLVVPEGMILSQRRYMRD  110
             VYVDDII+  +      +LL+ L   F ++DLG+  +FL IE   V  G++L+Q +Y  D
Sbjct  1137  VYVDDIIVASSSEKATAALLQDLKGEFALKDLGELHYFLGIEVSKVQNGIVLNQDKYAND  1196

Query  109   ILHRVGMTDCKSLATPASVTQ  47
             +L +VGM DCK   TP SV++
Sbjct  1197  LLKKVGMIDCKPANTPLSVSE  1217



>gb|AAC35532.1| contains similarity to proteases [Arabidopsis thaliana]
Length=1392

 Score =   131 bits (330),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 62/136 (46%), Positives = 90/136 (66%), Gaps = 0/136 (0%)
 Frame = -3

Query  469   DPDIPDHICPLQRSLYGLK*APRAWFKRLHDFLLLTGFIAWKTDVSLFHYSAGNSRVFLL  290
             DP  PD++C L++++Y LK APRAWF +   +LL  GFI   +D SLF Y  G   +FLL
Sbjct  929   DPSRPDYVCKLKKAIYDLKQAPRAWFDKFSSYLLKYGFICSFSDPSLFVYLKGRDVMFLL  988

Query  289   VYVDDIIMLGNDAVLVDSLLRKLATAFKIRDLGKPTFFLSIETLVVPEGMILSQRRYMRD  110
             +YVDD+I+ GN+ VL+  LL  L+T F+++D+G   +FL I+     +G+ LSQ +Y  D
Sbjct  989   LYVDDMILTGNNDVLLQQLLNILSTEFRMKDMGALHYFLGIQAHYHNDGLFLSQEKYTSD  1048

Query  109   ILHRVGMTDCKSLATP  62
             +L   GM+DC S+ TP
Sbjct  1049  LLVNAGMSDCSSMPTP  1064



>ref|XP_007019438.1| Cysteine-rich RLK (RECEPTOR-like protein kinase) 8 [Theobroma 
cacao]
 gb|EOY16663.1| Cysteine-rich RLK (RECEPTOR-like protein kinase) 8 [Theobroma 
cacao]
Length=579

 Score =   129 bits (323),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 62/144 (43%), Positives = 86/144 (60%), Gaps = 0/144 (0%)
 Frame = -3

Query  469  DPDIPDHICPLQRSLYGLK*APRAWFKRLHDFLLLTGFIAWKTDVSLFHYSAGNSRVFLL  290
            D   P H+C L++++ GLK APRAW++ L  F L  GF     D SLF Y       +LL
Sbjct  161  DTTKPHHVCKLKKAICGLKQAPRAWYQALSSFFLSFGFTQSVADASLFIYHCNGITAYLL  220

Query  289  VYVDDIIMLGNDAVLVDSLLRKLATAFKIRDLGKPTFFLSIETLVVPEGMILSQRRYMRD  110
            VYVDD+I+ GN    + S ++ LA+ F I+DLG   +FL IE ++  +G  LSQ RY+ D
Sbjct  221  VYVDDLILTGNHTAFLCSFIQHLASQFSIKDLGSLHYFLGIEVVLTAQGFFLSQHRYISD  280

Query  109  ILHRVGMTDCKSLATPASVTQPVC  38
            IL + GM+  K+  TP S T  +C
Sbjct  281  ILIKTGMSGAKASTTPISTTTRLC  304



>gb|AAR88589.1| putative copia-like retrotransposon protein [Oryza sativa Japonica 
Group]
Length=1399

 Score =   131 bits (330),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 62/138 (45%), Positives = 91/138 (66%), Gaps = 0/138 (0%)
 Frame = -3

Query  460   IPDHICPLQRSLYGLK*APRAWFKRLHDFLLLTGFIAWKTDVSLFHYSAGNSRVFLLVYV  281
             +P+++C L ++LYGLK APRAW+ RL   L   GF+  K D SLF Y  G   +FLL+YV
Sbjct  1020  MPNYVCKLDKALYGLKQAPRAWYSRLSTKLSELGFVPSKADTSLFFYKKGQVSIFLLIYV  1079

Query  280   DDIIMLGNDAVLVDSLLRKLATAFKIRDLGKPTFFLSIETLVVPEGMILSQRRYMRDILH  101
             DDII+  +      +LL++L+  F ++DLG   +FL IE   V +G++LSQ +Y  D+L 
Sbjct  1080  DDIIVASSVPDATSTLLQELSKDFALKDLGDLHYFLGIEVHKVKDGLMLSQEKYASDLLR  1139

Query  100   RVGMTDCKSLATPASVTQ  47
             RVGM +CK ++TP S ++
Sbjct  1140  RVGMYECKPVSTPLSTSE  1157



>gb|AID60162.1| copia-like LTR-retrotransposon [Brassica napus]
Length=643

 Score =   129 bits (325),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 61/140 (44%), Positives = 86/140 (61%), Gaps = 0/140 (0%)
 Frame = -3

Query  469  DPDIPDHICPLQRSLYGLK*APRAWFKRLHDFLLLTGFIAWKTDVSLFHYSAGNSRVFLL  290
            D + PD++C L ++LYGLK APRAWF     FL+  GF+  K+D SLF Y      + LL
Sbjct  126  DKERPDYVCKLTKALYGLKQAPRAWFDTFSGFLIQQGFVCNKSDPSLFIYHRNGKNMVLL  185

Query  289  VYVDDIIMLGNDAVLVDSLLRKLATAFKIRDLGKPTFFLSIETLVVPEGMILSQRRYMRD  110
            +YVDDI++  +D +L+D+LL  L T F ++DLG P +FL IE     EG+ + Q  Y  D
Sbjct  186  LYVDDILLAADDQMLMDNLLSTLNTRFLMKDLGFPKYFLGIEIEQTTEGLFIHQSAYAED  245

Query  109  ILHRVGMTDCKSLATPASVT  50
            +LH+  M+ C  + TP   T
Sbjct  246  VLHQANMSTCNPMPTPLPTT  265



>gb|ACY72569.1| unknown [Oryza sativa Japonica Group]
Length=1436

 Score =   130 bits (328),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 62/137 (45%), Positives = 90/137 (66%), Gaps = 0/137 (0%)
 Frame = -3

Query  457   PDHICPLQRSLYGLK*APRAWFKRLHDFLLLTGFIAWKTDVSLFHYSAGNSRVFLLVYVD  278
             P+++C L ++LYGLK APRAW+ RL   L+  GF A K D SLF  + G   +F+LVYVD
Sbjct  1064  PNYVCKLDKALYGLKQAPRAWYSRLSKKLVELGFEASKADTSLFFLNKGGIIMFVLVYVD  1123

Query  277   DIIMLGNDAVLVDSLLRKLATAFKIRDLGKPTFFLSIETLVVPEGMILSQRRYMRDILHR  98
             DII+  +      +LL+ L   F ++DLG   +FL IE   VP G++L+Q +Y  D+L R
Sbjct  1124  DIIIASSTEKATTALLKDLNKEFALKDLGDLHYFLGIEVTKVPNGIVLTQEKYANDLLKR  1183

Query  97    VGMTDCKSLATPASVTQ  47
             V M++CK ++TP SV++
Sbjct  1184  VNMSNCKPVSTPLSVSE  1200



>gb|AAT69582.1| putative polyprotein [Oryza sativa Japonica Group]
 gb|AAU44112.1| putative polyprotein [Oryza sativa Japonica Group]
Length=1256

 Score =   130 bits (328),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 63/137 (46%), Positives = 89/137 (65%), Gaps = 0/137 (0%)
 Frame = -3

Query  457   PDHICPLQRSLYGLK*APRAWFKRLHDFLLLTGFIAWKTDVSLFHYSAGNSRVFLLVYVD  278
             PD++C L ++LYGLK APRAW+ +L   L   GF   K D SLF Y+ G   +F+LVYVD
Sbjct  884   PDYVCKLDKALYGLKQAPRAWYAKLSQKLQHLGFQGSKADTSLFFYNKGGLIIFVLVYVD  943

Query  277   DIIMLGNDAVLVDSLLRKLATAFKIRDLGKPTFFLSIETLVVPEGMILSQRRYMRDILHR  98
             DII+  +    V +LL+ L   F ++DLG   +FL IE      G++L+Q +Y+ D+L R
Sbjct  944   DIIVASSRQDAVPALLKDLQKDFALKDLGDLHYFLGIEVNKASSGIVLTQEKYVTDLLRR  1003

Query  97    VGMTDCKSLATPASVTQ  47
             VGMTDCK ++TP S ++
Sbjct  1004  VGMTDCKPVSTPLSTSE  1020



>gb|ABA95721.1| retrotransposon protein, putative, Ty1-copia subclass [Oryza 
sativa Japonica Group]
Length=900

 Score =   130 bits (326),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 63/141 (45%), Positives = 90/141 (64%), Gaps = 0/141 (0%)
 Frame = -3

Query  469  DPDIPDHICPLQRSLYGLK*APRAWFKRLHDFLLLTGFIAWKTDVSLFHYSAGNSRVFLL  290
            D   P  +C L ++LYGLK APRAW+ RL   L   GF + K D SLF Y+ G+ ++F+L
Sbjct  516  DARQPHFLCKLDKALYGLKQAPRAWYSRLSKKLQELGFSSSKADTSLFFYNKGHHKMFVL  575

Query  289  VYVDDIIMLGNDAVLVDSLLRKLATAFKIRDLGKPTFFLSIETLVVPEGMILSQRRYMRD  110
            VYVDDII+  + +  V++LL+ L   F ++DLG   +FL IE    P+ ++LSQ RY  +
Sbjct  576  VYVDDIIVASSSSPAVNALLKDLEKDFALKDLGDLHYFLGIEVKRTPQTLLLSQERYTTE  635

Query  109  ILHRVGMTDCKSLATPASVTQ  47
            +L RV MT CK ++TP S  +
Sbjct  636  LLERVNMTSCKPVSTPLSTAE  656



>gb|AAD22324.1| putative retroelement pol polyprotein [Arabidopsis thaliana]
Length=387

 Score =   126 bits (317),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 64/140 (46%), Positives = 89/140 (64%), Gaps = 1/140 (1%)
 Frame = -3

Query  469  DPDIPDHICPLQRSLYGLK*APRAWFKRLHDFLLLTGFIAWKTDVSLFHYSAGNSRVFLL  290
            D D P H+C L ++LYGLK APRAW++ L ++LL  GF     D SLF Y   NS +++L
Sbjct  11   DRDRPTHVCRLNKALYGLKQAPRAWYQELRNYLLAAGFTNSLADTSLFIYKRANSYLYVL  70

Query  289  VYVDDIIMLGNDAVLVDSLLRKLATAFKIRDLGKPTFFLSIETLVVPEGMILSQRRYMRD  110
            VYVDDII+ G DA LV +    LA  F ++DLG  ++FL IE     +G+ L QR+Y+ D
Sbjct  71   VYVDDIIITG-DASLVKNFNVSLADRFSLKDLGALSYFLGIEATRTKKGLHLMQRKYITD  129

Query  109  ILHRVGMTDCKSLATPASVT  50
            +L +  M D K ++TP + T
Sbjct  130  LLAKTHMLDAKPISTPMATT  149



>gb|AID60119.1| hypothetical protein [Brassica napus]
Length=848

 Score =   129 bits (325),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 61/140 (44%), Positives = 86/140 (61%), Gaps = 0/140 (0%)
 Frame = -3

Query  469  DPDIPDHICPLQRSLYGLK*APRAWFKRLHDFLLLTGFIAWKTDVSLFHYSAGNSRVFLL  290
            D + PD++C L ++LYGLK APRAWF     FL+  GF+  K+D SLF Y      + LL
Sbjct  407  DKERPDYVCKLTKALYGLKQAPRAWFDTFSGFLIQQGFVCNKSDPSLFIYHRNGKNMVLL  466

Query  289  VYVDDIIMLGNDAVLVDSLLRKLATAFKIRDLGKPTFFLSIETLVVPEGMILSQRRYMRD  110
            +YVDDI++  +D +L+D+LL  L T F ++DLG P +FL IE     EG+ + Q  Y  D
Sbjct  467  LYVDDILLAADDQMLMDNLLSTLNTRFLMKDLGFPKYFLGIEIEQTTEGLFIHQSAYAED  526

Query  109  ILHRVGMTDCKSLATPASVT  50
            +LH+  M+ C  + TP   T
Sbjct  527  VLHQANMSTCNPMPTPLPTT  546



>emb|CAN61230.1| hypothetical protein VITISV_010115 [Vitis vinifera]
Length=478

 Score =   127 bits (319),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 62/143 (43%), Positives = 93/143 (65%), Gaps = 1/143 (1%)
 Frame = -3

Query  469  DPDIPDHICPLQRSLYGLK*APRAWFKRLHDFLLLTGFIAWKTDVSLFHYSAGNSRVFLL  290
            D D P H+C L++++YGLK APRAW+  L  FLL  GFI    D SLF ++  ++ ++LL
Sbjct  90   DRDHPHHVCKLRKAIYGLKQAPRAWYHELCQFLLQFGFINSIADTSLFIFNNHDTILYLL  149

Query  289  VYVDDIIMLGNDAVLVDSLLRKLATAFKIRDLGKPTFFLSIETLVVPEGMILSQRRYMRD  110
            VYVDDII+ GN+     + +++L+  F ++DLG  T+FL +E      G+ LSQR+Y+ D
Sbjct  150  VYVDDIIITGNNVEAAQTFIQQLSQRFSLKDLGPLTYFLGVEVTSHTNGLFLSQRKYIAD  209

Query  109  ILHRVGMTDCKSLATPASVTQPV  41
            +L+R  MT+ K   TP + T P+
Sbjct  210  LLNRTHMTEAKPAPTPLA-TSPI  231



>gb|AAT07563.1| putative polyprotein [Oryza sativa Japonica Group]
 gb|AAT07631.1| putative polyprotein [Oryza sativa Japonica Group]
Length=1431

 Score =   130 bits (327),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 61/135 (45%), Positives = 91/135 (67%), Gaps = 0/135 (0%)
 Frame = -3

Query  451   HICPLQRSLYGLK*APRAWFKRLHDFLLLTGFIAWKTDVSLFHYSAGNSRVFLLVYVDDI  272
             ++C L ++LYGLK APRAW+ RL   L   GF + K+D SLF YS G+  +F+LVYVDDI
Sbjct  1060  YVCKLDKALYGLKQAPRAWYSRLSTKLHELGFKSSKSDTSLFFYSKGDVAMFMLVYVDDI  1119

Query  271   IMLGNDAVLVDSLLRKLATAFKIRDLGKPTFFLSIETLVVPEGMILSQRRYMRDILHRVG  92
             I+  +     ++LL+ L   F ++DLG+  +FL IE   V  G++L+Q +Y  D+L RV 
Sbjct  1120  IVASSSIDATNALLKNLNQEFALKDLGRLHYFLGIEVKEVNNGIVLTQEKYAMDVLKRVN  1179

Query  91    MTDCKSLATPASVTQ  47
             M+DCK++ TP S+++
Sbjct  1180  MSDCKAVNTPLSISE  1194



>ref|XP_008390439.1| PREDICTED: uncharacterized protein LOC103452682 [Malus domestica]
Length=1098

 Score =   130 bits (326),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 62/137 (45%), Positives = 87/137 (64%), Gaps = 0/137 (0%)
 Frame = -3

Query  469  DPDIPDHICPLQRSLYGLK*APRAWFKRLHDFLLLTGFIAWKTDVSLFHYSAGNSRVFLL  290
            DP  P H+C L+RSLYGLK APRAWF+     L   GF     D SLF Y  G++R++LL
Sbjct  770  DPQFPHHVCRLRRSLYGLKQAPRAWFQCFSTHLEDLGFRPSTADHSLFTYIHGSTRIYLL  829

Query  289  VYVDDIIMLGNDAVLVDSLLRKLATAFKIRDLGKPTFFLSIETLVVPEGMILSQRRYMRD  110
            +YVDDI++ GN+   + +L++ L   F ++DLG   +FL +E +  P G+ LSQ++Y  D
Sbjct  830  IYVDDILVTGNNPSHIVTLIKNLGIRFSMKDLGPVHYFLGMEVVRTPSGLSLSQQKYATD  889

Query  109  ILHRVGMTDCKSLATPA  59
            +LHR  M   K + TPA
Sbjct  890  LLHRTKMHGAKPVPTPA  906



>emb|CAN80686.1| hypothetical protein VITISV_033813 [Vitis vinifera]
Length=370

 Score =   126 bits (316),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 62/152 (41%), Positives = 88/152 (58%), Gaps = 0/152 (0%)
 Frame = -3

Query  469  DPDIPDHICPLQRSLYGLK*APRAWFKRLHDFLLLTGFIAWKTDVSLFHYSAGNSRVFLL  290
            + D+P+H+C L  SLYGLK APRAWF R    LL  GF   K   SLF    G S V  L
Sbjct  29   NEDLPNHVCKLNHSLYGLKQAPRAWFDRPSQCLLHLGFYCGKAYSSLFILRKGQSIVLQL  88

Query  289  VYVDDIIMLGNDAVLVDSLLRKLATAFKIRDLGKPTFFLSIETLVVPEGMILSQRRYMRD  110
            +YVDDII+ GND  ++  L+  L++ F ++DLG   +FL +E   +P G+ +SQ +Y RD
Sbjct  89   IYVDDIIVTGNDNNIISDLISTLSSEFSLKDLGSLHYFLGLEVKYLPNGLFVSQTKYTRD  148

Query  109  ILHRVGMTDCKSLATPASVTQPVCQSTDSFAN  14
            +L    M +C  + TP ++   +  S +   N
Sbjct  149  LLEHTKMMECTYINTPMALKSIITPSDEQPIN  180



>gb|ABA97008.1| retrotransposon protein, putative, Ty1-copia subclass [Oryza 
sativa Japonica Group]
Length=1202

 Score =   130 bits (327),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 60/135 (44%), Positives = 91/135 (67%), Gaps = 0/135 (0%)
 Frame = -3

Query  451   HICPLQRSLYGLK*APRAWFKRLHDFLLLTGFIAWKTDVSLFHYSAGNSRVFLLVYVDDI  272
             ++C L ++LYGLK APRAW+ RL   L   GF + K+D SLF YS G+  +F+LVYVDDI
Sbjct  922   YVCKLDKALYGLKQAPRAWYSRLSTKLHELGFKSSKSDTSLFFYSKGDVTIFMLVYVDDI  981

Query  271   IMLGNDAVLVDSLLRKLATAFKIRDLGKPTFFLSIETLVVPEGMILSQRRYMRDILHRVG  92
             I+  +     ++LL+ L   F ++DLG+  +FL IE   +  G++L+Q +Y  D+L RV 
Sbjct  982   IVASSSIDATNALLKNLNQEFALKDLGRLHYFLGIEVKELNNGIVLTQEKYAMDVLKRVN  1041

Query  91    MTDCKSLATPASVTQ  47
             M+DCK++ TP S+++
Sbjct  1042  MSDCKAVNTPLSISE  1056



>gb|AAU90288.2| Polyprotein, putative [Solanum demissum]
Length=1017

 Score =   130 bits (326),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 65/138 (47%), Positives = 94/138 (68%), Gaps = 0/138 (0%)
 Frame = -3

Query  469  DPDIPDHICPLQRSLYGLK*APRAWFKRLHDFLLLTGFIAWKTDVSLFHYSAGNSRVFLL  290
            DP  PDH+C L+RSLYGLK APR W K L D LL  GF+  KTD SLF+    + ++  L
Sbjct  768  DPTRPDHVCLLKRSLYGLKQAPRMWNKCLADVLLSLGFVGSKTDSSLFYLPNVDVKLLCL  827

Query  289  VYVDDIIMLGNDAVLVDSLLRKLATAFKIRDLGKPTFFLSIETLVVPEGMILSQRRYMRD  110
             Y++DI+++G+++  + +L+  L T F +RDLGK ++FL I+    PEG+ LSQ +Y+ D
Sbjct  828  DYLEDILVVGSNSDHIAALITNLKTHFVVRDLGKLSYFLGIQANWKPEGLHLSQGKYVTD  887

Query  109  ILHRVGMTDCKSLATPAS  56
            +L+RV M  C  ++TPAS
Sbjct  888  LLNRVQMGSCGPVSTPAS  905



>gb|AAN06870.1| Putative gag-pol polyprotein [Oryza sativa Japonica Group]
 gb|ABF94109.1| retrotransposon protein, putative, Ty1-copia subclass [Oryza 
sativa Japonica Group]
Length=1247

 Score =   130 bits (326),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 63/141 (45%), Positives = 90/141 (64%), Gaps = 0/141 (0%)
 Frame = -3

Query  469   DPDIPDHICPLQRSLYGLK*APRAWFKRLHDFLLLTGFIAWKTDVSLFHYSAGNSRVFLL  290
             D  +P ++C L ++LYGLK APRAW+ RL   L   GF   K D SLF Y+ G+  +F+L
Sbjct  871   DSSLPGYVCKLDKALYGLKQAPRAWYSRLSKKLYDMGFQGSKADTSLFFYNKGDLIIFVL  930

Query  289   VYVDDIIMLGNDAVLVDSLLRKLATAFKIRDLGKPTFFLSIETLVVPEGMILSQRRYMRD  110
             +YVDDII+  +    V +LLR L   F ++DLG   +FL IE   V  G++L+Q +Y+ D
Sbjct  931   IYVDDIIVTSSRQEAVPALLRDLQKEFALKDLGDLHYFLGIEVTKVSGGIVLTQDKYVND  990

Query  109   ILHRVGMTDCKSLATPASVTQ  47
             +L RV M DCK ++TP S ++
Sbjct  991   LLRRVNMFDCKPVSTPLSTSE  1011



>gb|AAB82754.1| retrofit [Oryza longistaminata]
Length=1445

 Score =   130 bits (326),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 63/137 (46%), Positives = 89/137 (65%), Gaps = 0/137 (0%)
 Frame = -3

Query  457   PDHICPLQRSLYGLK*APRAWFKRLHDFLLLTGFIAWKTDVSLFHYSAGNSRVFLLVYVD  278
             PD++C L ++LYGLK APRAW+ RL   L+  GF A K D SLF  + G   +F+LVYVD
Sbjct  1073  PDYVCKLDKALYGLKQAPRAWYSRLSKKLVELGFEASKADTSLFFLNKGGILMFVLVYVD  1132

Query  277   DIIMLGNDAVLVDSLLRKLATAFKIRDLGKPTFFLSIETLVVPEGMILSQRRYMRDILHR  98
             DII+  +      +LL+ L   F ++DLG   +FL IE   V  G+IL+Q +Y  D+L R
Sbjct  1133  DIIVASSTEKATTALLKDLNKEFALKDLGDLHYFLGIEVTKVSNGVILTQEKYANDLLKR  1192

Query  97    VGMTDCKSLATPASVTQ  47
             V M++CK ++TP SV++
Sbjct  1193  VNMSNCKPVSTPLSVSE  1209



>emb|CAN78042.1| hypothetical protein VITISV_041808 [Vitis vinifera]
Length=595

 Score =   127 bits (319),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 60/137 (44%), Positives = 89/137 (65%), Gaps = 0/137 (0%)
 Frame = -3

Query  451  HICPLQRSLYGLK*APRAWFKRLHDFLLLTGFIAWKTDVSLFHYSAGNSRVFLLVYVDDI  272
            H+C L++++YGLK APRAW+  L  FL+ +GF     D SLF  + G + ++LLVYVDDI
Sbjct  279  HVCKLRKAIYGLKQAPRAWYHELRKFLIASGFHNSHVDTSLFVLNNGVNLLYLLVYVDDI  338

Query  271  IMLGNDAVLVDSLLRKLATAFKIRDLGKPTFFLSIETLVVPEGMILSQRRYMRDILHRVG  92
            I+ GND  +V   ++ LA  F ++DLG  ++FL +E +    G++LSQRRY+ D+L R  
Sbjct  339  ILTGNDDTMVHKFMQLLAHQFSLQDLGHLSYFLGVEVIPNDHGILLSQRRYIVDLLTRTK  398

Query  91   MTDCKSLATPASVTQPV  41
            M D K + TP   + P+
Sbjct  399  MMDAKPIHTPLPTSLPI  415



>emb|CAN69607.1| hypothetical protein VITISV_009561 [Vitis vinifera]
Length=1207

 Score =   129 bits (325),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 64/152 (42%), Positives = 94/152 (62%), Gaps = 0/152 (0%)
 Frame = -3

Query  469   DPDIPDHICPLQRSLYGLK*APRAWFKRLHDFLLLTGFIAWKTDVSLFHYSAGNSRVFLL  290
             D   P H+C L+++LYGLK APRAWF+R   F L  GF + + D SLF +   +S ++LL
Sbjct  860   DSRFPTHVCLLKKALYGLKQAPRAWFQRFSSFFLTLGFSSSRVDTSLFVFHQQSSLIYLL  919

Query  289   VYVDDIIMLGNDAVLVDSLLRKLATAFKIRDLGKPTFFLSIETLVVPEGMILSQRRYMRD  110
             +YVDDII+ GN+  L+DS   KL + F  +DLG  ++FL +E    P+G+ + Q +Y RD
Sbjct  920   LYVDDIIVTGNNPSLLDSFTCKLHSEFATKDLGSLSYFLGLEASPTPDGLFIGQLKYARD  979

Query  109   ILHRVGMTDCKSLATPASVTQPVCQSTDSFAN  14
             IL    + D K + TP  V+Q +  +   F+N
Sbjct  980   ILTLTQLLDSKPVHTPMVVSQHLTVAGFPFSN  1011



>ref|XP_008646486.1| PREDICTED: uncharacterized protein LOC103627967 [Zea mays]
Length=890

 Score =   129 bits (323),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 60/136 (44%), Positives = 86/136 (63%), Gaps = 0/136 (0%)
 Frame = -3

Query  469  DPDIPDHICPLQRSLYGLK*APRAWFKRLHDFLLLTGFIAWKTDVSLFHYSAGNSRVFLL  290
            DP  PDH+C LQ+SLYGLK APRAW++R   F+   GF+A  +D SLF    G S  +LL
Sbjct  576  DPGAPDHVCHLQKSLYGLKQAPRAWYQRFATFVRHLGFVASISDTSLFVLREGTSLAYLL  635

Query  289  VYVDDIIMLGNDAVLVDSLLRKLATAFKIRDLGKPTFFLSIETLVVPEGMILSQRRYMRD  110
            +YVDDII+  + + L+  ++ +L++ F + DLG    FL I      +G+ LSQR+Y  +
Sbjct  636  LYVDDIILTASSSALLQRIMTRLSSEFSMTDLGALHHFLGIAVTRSSDGLFLSQRQYAVE  695

Query  109  ILHRVGMTDCKSLATP  62
            +L R GM +C   +TP
Sbjct  696  LLQRAGMAECHPTSTP  711



>gb|AAW56918.1| putative polyprotein [Oryza sativa Japonica Group]
Length=1018

 Score =   129 bits (324),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 62/136 (46%), Positives = 85/136 (63%), Gaps = 0/136 (0%)
 Frame = -3

Query  469  DPDIPDHICPLQRSLYGLK*APRAWFKRLHDFLLLTGFIAWKTDVSLFHYSAGNSRVFLL  290
            +   P+HIC L +++YGLK APRAW+ RL   L   GF   K D SLF YS G+  VF+L
Sbjct  690  NSKFPNHICKLDKAIYGLKQAPRAWYSRLSTKLQALGFKPSKVDTSLFFYSKGDVTVFVL  749

Query  289  VYVDDIIMLGNDAVLVDSLLRKLATAFKIRDLGKPTFFLSIETLVVPEGMILSQRRYMRD  110
            +YVDDII+  +      +LLR L   F ++DL +  +FL IE     +G++L+Q +Y  D
Sbjct  750  IYVDDIIVASSTPSATSALLRDLTKEFALKDLRELHYFLGIEVTRTEDGILLTQAKYAYD  809

Query  109  ILHRVGMTDCKSLATP  62
            +L RVGM DCK + TP
Sbjct  810  VLRRVGMQDCKPVNTP  825



>gb|ABA99232.1| retrotransposon protein, putative, Ty1-copia subclass [Oryza 
sativa Japonica Group]
Length=308

 Score =   124 bits (311),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 64/140 (46%), Positives = 84/140 (60%), Gaps = 0/140 (0%)
 Frame = -3

Query  469  DPDIPDHICPLQRSLYGLK*APRAWFKRLHDFLLLTGFIAWKTDVSLFHYSAGNSRVFLL  290
            D    D++C L ++LYGLK APRAWF RL   L   GF   K D SLF Y  G   +F+L
Sbjct  117  DKSKLDYVCKLDKALYGLKQAPRAWFSRLSMKLQNLGFQPSKADASLFFYKKGTISIFVL  176

Query  289  VYVDDIIMLGNDAVLVDSLLRKLATAFKIRDLGKPTFFLSIETLVVPEGMILSQRRYMRD  110
            +YVDDII+  +      +LL+ L   F ++DLG   +FL IE   V +G+IL+Q +Y  D
Sbjct  177  IYVDDIIVASSCEKATSALLQDLKEEFALKDLGALHYFLGIEVNKVHDGIILTQEKYATD  236

Query  109  ILHRVGMTDCKSLATPASVT  50
            +L RVGM  CK + TP S T
Sbjct  237  LLKRVGMHGCKEINTPLSTT  256



>gb|AAT85012.1| putative reverse transcriptase [Oryza sativa Japonica Group]
 gb|ABF96664.1| retrotransposon protein, putative, unclassified [Oryza sativa 
Japonica Group]
Length=361

 Score =   125 bits (313),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 62/136 (46%), Positives = 82/136 (60%), Gaps = 0/136 (0%)
 Frame = -3

Query  469  DPDIPDHICPLQRSLYGLK*APRAWFKRLHDFLLLTGFIAWKTDVSLFHYSAGNSRVFLL  290
            D   PD +C L +SLYGLK APRAW+ R   FLL  G    K+D SLF +  G   V+LL
Sbjct  81   DASKPDFVCRLNKSLYGLKQAPRAWYNRFASFLLSIGLKEAKSDTSLFIFRRGTDMVYLL  140

Query  289  VYVDDIIMLGNDAVLVDSLLRKLATAFKIRDLGKPTFFLSIETLVVPEGMILSQRRYMRD  110
            +YVDDI++  +   L+   +R L + F ++DLG    FL I     P G+ LSQ++Y  +
Sbjct  141  LYVDDIVLTASTGDLLRWTIRALQSEFAMKDLGALHHFLGISVCRTPSGLALSQQQYSVE  200

Query  109  ILHRVGMTDCKSLATP  62
            IL R GMTDCK  +TP
Sbjct  201  ILERAGMTDCKPCSTP  216



>gb|ABF95616.1| retrotransposon protein, putative, Ty1-copia subclass [Oryza 
sativa Japonica Group]
Length=1241

 Score =   129 bits (324),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 61/138 (44%), Positives = 90/138 (65%), Gaps = 0/138 (0%)
 Frame = -3

Query  460   IPDHICPLQRSLYGLK*APRAWFKRLHDFLLLTGFIAWKTDVSLFHYSAGNSRVFLLVYV  281
             +P+++C L ++LYGLK APRAW+ RL   L   GF+  K D SLF Y  G   +FLL+YV
Sbjct  966   MPNYVCKLDKALYGLKQAPRAWYSRLSTKLSELGFVPSKADTSLFFYKKGQVSIFLLIYV  1025

Query  280   DDIIMLGNDAVLVDSLLRKLATAFKIRDLGKPTFFLSIETLVVPEGMILSQRRYMRDILH  101
             DDII+  +      +LL++L+  F ++DLG   + L IE   V +G++LSQ +Y  D+L 
Sbjct  1026  DDIIVASSVPDATSTLLQELSKDFALKDLGDLHYLLGIEVHKVKDGLMLSQEKYASDLLR  1085

Query  100   RVGMTDCKSLATPASVTQ  47
             RVGM +CK ++TP S ++
Sbjct  1086  RVGMYECKPVSTPLSTSE  1103



>dbj|BAB90546.1| putative rice retrotransposon retrofit gag/pol polyprotein [Oryza 
sativa Japonica Group]
Length=1448

 Score =   129 bits (325),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 63/137 (46%), Positives = 88/137 (64%), Gaps = 0/137 (0%)
 Frame = -3

Query  457   PDHICPLQRSLYGLK*APRAWFKRLHDFLLLTGFIAWKTDVSLFHYSAGNSRVFLLVYVD  278
             PD++C L ++LYGLK APRAW+ RL   L   GF A K D SLF  + G   +F+LVYVD
Sbjct  1076  PDYVCKLNKALYGLKQAPRAWYSRLSKKLTELGFEASKADTSLFFLNKGGIIMFVLVYVD  1135

Query  277   DIIMLGNDAVLVDSLLRKLATAFKIRDLGKPTFFLSIETLVVPEGMILSQRRYMRDILHR  98
             DII+  +      +LL+ L   F ++DLG   +FL IE   V  G+IL+Q +Y  D+L R
Sbjct  1136  DIIVASSTEKATTALLKDLNKEFTLKDLGDLHYFLGIEVTKVSNGVILTQEKYANDMLKR  1195

Query  97    VGMTDCKSLATPASVTQ  47
             V M++CK ++TP SV++
Sbjct  1196  VNMSNCKPVSTPLSVSE  1212



>gb|ABA91195.1| retrotransposon protein, putative, Ty1-copia subclass [Oryza 
sativa Japonica Group]
Length=978

 Score =   129 bits (323),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 61/136 (45%), Positives = 87/136 (64%), Gaps = 0/136 (0%)
 Frame = -3

Query  469  DPDIPDHICPLQRSLYGLK*APRAWFKRLHDFLLLTGFIAWKTDVSLFHYSAGNSRVFLL  290
            DP  P+ +C LQ+SLYGLK APRAW++R   ++   GF +  +D SLF Y  G++  +LL
Sbjct  642  DPSAPNAVCLLQKSLYGLKQAPRAWYQRFATYIRQLGFTSSASDTSLFVYKDGDNIAYLL  701

Query  289  VYVDDIIMLGNDAVLVDSLLRKLATAFKIRDLGKPTFFLSIETLVVPEGMILSQRRYMRD  110
            +YVDDII+  + A L+  +  +L + F + DLG   FFL I      +G+ LSQR+Y  D
Sbjct  702  LYVDDIILTASSATLLQHITARLHSEFAMTDLGDLHFFLGISVTRSSDGLFLSQRQYAVD  761

Query  109  ILHRVGMTDCKSLATP  62
            +L R GM++C S ATP
Sbjct  762  LLKRAGMSECHSTATP  777



>emb|CAN69370.1| hypothetical protein VITISV_010057 [Vitis vinifera]
Length=591

 Score =   126 bits (317),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 61/143 (43%), Positives = 92/143 (64%), Gaps = 1/143 (1%)
 Frame = -3

Query  469  DPDIPDHICPLQRSLYGLK*APRAWFKRLHDFLLLTGFIAWKTDVSLFHYSAGNSRVFLL  290
            D D P H+C L++++YGLK APRAW+  L  FLL  GFI    D SLF ++   + ++LL
Sbjct  203  DRDHPHHVCKLRKAIYGLKQAPRAWYHELRQFLLQFGFINSIADTSLFIFNNRGTILYLL  262

Query  289  VYVDDIIMLGNDAVLVDSLLRKLATAFKIRDLGKPTFFLSIETLVVPEGMILSQRRYMRD  110
            VYVDDII+ GN+     + +++L+  F ++DLG   +FL +E      G+ L+QR+Y+ D
Sbjct  263  VYVDDIIITGNNVEAAQTFIQQLSQRFSLKDLGPLIYFLGVEVTSHTNGLFLNQRKYIAD  322

Query  109  ILHRVGMTDCKSLATPASVTQPV  41
            +L+R  MT+ KS  TP + T P+
Sbjct  323  LLNRTHMTEAKSAPTPLA-TSPI  344



>emb|CAN79884.1| hypothetical protein VITISV_002539 [Vitis vinifera]
Length=1453

 Score =   129 bits (323),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 62/152 (41%), Positives = 94/152 (62%), Gaps = 0/152 (0%)
 Frame = -3

Query  469   DPDIPDHICPLQRSLYGLK*APRAWFKRLHDFLLLTGFIAWKTDVSLFHYSAGNSRVFLL  290
             DP  P H+C L+++LY LK APRAWF+R   FLL  GF   +   SLF ++  +  ++LL
Sbjct  957   DPRHPLHVCKLKKALYDLKQAPRAWFQRFSSFLLKLGFFCSRAYTSLFVFTMKDDLIYLL  1016

Query  289   VYVDDIIMLGNDAVLVDSLLRKLATAFKIRDLGKPTFFLSIETLVVPEGMILSQRRYMRD  110
             +YVDDII+ GN+  L++  + +L + F ++DLG  ++FL +E   +P+G  LSQ +Y  D
Sbjct  1017  LYVDDIILTGNNPTLINRFISQLHSEFAVKDLGPLSYFLGLEVSYIPDGFFLSQVKYATD  1076

Query  109   ILHRVGMTDCKSLATPASVTQPVCQSTDSFAN  14
             IL R  + D K + TP  V+Q +      FA+
Sbjct  1077  ILARAQLLDSKPVPTPMIVSQRLSSEGTPFAD  1108



>ref|XP_002445564.1| hypothetical protein SORBIDRAFT_07g021665 [Sorghum bicolor]
 gb|EES15059.1| hypothetical protein SORBIDRAFT_07g021665 [Sorghum bicolor]
Length=599

 Score =   126 bits (317),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 62/137 (45%), Positives = 83/137 (61%), Gaps = 0/137 (0%)
 Frame = -3

Query  457  PDHICPLQRSLYGLK*APRAWFKRLHDFLLLTGFIAWKTDVSLFHYSAGNSRVFLLVYVD  278
            P H+C L +SLYGLK APRAWF RL ++L   GF +  +D SLF Y  G++  +LLVYVD
Sbjct  271  PQHVCLLVKSLYGLKQAPRAWFLRLGNYLRSIGFTSTGSDTSLFVYKHGDAMAYLLVYVD  330

Query  277  DIIMLGNDAVLVDSLLRKLATAFKIRDLGKPTFFLSIETLVVPEGMILSQRRYMRDILHR  98
            DII+  +   L+  +++ L   F I+DLG   FFL ++      G  LSQ +Y  DIL R
Sbjct  331  DIILTASSTALLQRIVQSLCREFAIKDLGNLRFFLGVQVRRDAAGFSLSQAQYTEDILER  390

Query  97   VGMTDCKSLATPASVTQ  47
             GM +CK  +TP    Q
Sbjct  391  AGMANCKPASTPVDAKQ  407



>gb|AAX95666.1| Reverse transcriptase (RNA-dependent DNA polymerase), putative 
[Oryza sativa Japonica Group]
 gb|ABF98495.1| retrotransposon protein, putative, Ty1-copia subclass [Oryza 
sativa Japonica Group]
Length=757

 Score =   127 bits (320),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 63/140 (45%), Positives = 89/140 (64%), Gaps = 0/140 (0%)
 Frame = -3

Query  457  PDHICPLQRSLYGLK*APRAWFKRLHDFLLLTGFIAWKTDVSLFHYSAGNSRVFLLVYVD  278
            P +IC L +SLYGLK APRAWF RL + L+  GF A K D SLF    G+  +F+LVYVD
Sbjct  473  PHYICKLDKSLYGLKQAPRAWFARLSNKLIDLGFSASKADTSLFFLHKGDIAIFILVYVD  532

Query  277  DIIMLGNDAVLVDSLLRKLATAFKIRDLGKPTFFLSIETLVVPEGMILSQRRYMRDILHR  98
            DII++ +      +LL+ L   F ++DLG+  +FL IE      G++L+Q +Y  D+L +
Sbjct  533  DIIVVSSSERATTALLQDLKVEFALKDLGELHYFLGIEVNKTHNGIVLTQDKYATDLLKK  592

Query  97   VGMTDCKSLATPASVTQPVC  38
            VGM +CK   TP SV++ + 
Sbjct  593  VGMLNCKPATTPLSVSEKLS  612



>ref|NP_001174286.1| Os05g0235100 [Oryza sativa Japonica Group]
 dbj|BAH93014.1| Os05g0235100, partial [Oryza sativa Japonica Group]
Length=841

 Score =   127 bits (320),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 60/136 (44%), Positives = 88/136 (65%), Gaps = 0/136 (0%)
 Frame = -3

Query  469  DPDIPDHICPLQRSLYGLK*APRAWFKRLHDFLLLTGFIAWKTDVSLFHYSAGNSRVFLL  290
            DP  P+ +C LQ+SLYGLK APRAW++R   ++   GF +  ++ SLF Y  G++  +LL
Sbjct  459  DPSAPNAVCLLQKSLYGLKQAPRAWYQRFATYIRQLGFTSSASNTSLFVYKDGDNIAYLL  518

Query  289  VYVDDIIMLGNDAVLVDSLLRKLATAFKIRDLGKPTFFLSIETLVVPEGMILSQRRYMRD  110
            +YVDDII+  + A L+  +  +L + F + DLG   FFL I      +G+ LSQR+Y+ D
Sbjct  519  LYVDDIILTASSATLLHHITARLHSEFAMTDLGDLHFFLGISVTRSSDGLFLSQRQYVVD  578

Query  109  ILHRVGMTDCKSLATP  62
            +L R GM++C S ATP
Sbjct  579  LLKRAGMSECHSTATP  594



>gb|KFK30733.1| hypothetical protein AALP_AA6G020200 [Arabis alpina]
Length=3091

 Score =   129 bits (324),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 66/154 (43%), Positives = 93/154 (60%), Gaps = 3/154 (2%)
 Frame = -3

Query  469   DPDIPDHICPLQRSLYGLK*APRAWFKRLHDFLLLTGFIAWKTDVSLFHYSAGNSRVFLL  290
             D   PDH+C L +S+YGLK +PRAWF +   +LL  GF+  K D SLF YS G   + LL
Sbjct  1173  DKAHPDHVCQLHKSIYGLKQSPRAWFDKFSTYLLEFGFVCSKKDPSLFVYSKGKDIIMLL  1232

Query  289   VYVDDIIMLGNDAVLVDSLLRKLATAFKIRDLGKPTFFLSIETLVVPEGMILSQRRYMRD  110
             +YVDD+++ GN + +++ LL +L   F+++DLGK  +FL I+      G+ LSQ +Y  D
Sbjct  1233  LYVDDMLITGNSSRVLEELLVELNKHFRMKDLGKLHYFLGIQAHFHEAGLFLSQAKYAED  1292

Query  109   ILHRVGMTDCKSLATPASVTQP--VCQSTDSFAN  14
             IL   GM++C  + TP   TQP  V      F N
Sbjct  1293  ILAVAGMSNCVPMPTPLP-TQPDRVSDQEKEFEN  1325



>gb|ACP30598.1| disease resistance protein [Brassica rapa subsp. pekinensis]
Length=2301

 Score =   129 bits (323),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 59/136 (43%), Positives = 87/136 (64%), Gaps = 0/136 (0%)
 Frame = -3

Query  469   DPDIPDHICPLQRSLYGLK*APRAWFKRLHDFLLLTGFIAWKTDVSLFHYSAGNSRVFLL  290
             D   PDH+C L +SLYGLK +PRAWF +   +L+  GF+    D SLF Y  G   + LL
Sbjct  1025  DESKPDHVCLLHKSLYGLKQSPRAWFDKFSTYLIEFGFVCSIKDPSLFIYRRGKDIIMLL  1084

Query  289   VYVDDIIMLGNDAVLVDSLLRKLATAFKIRDLGKPTFFLSIETLVVPEGMILSQRRYMRD  110
             +YVDD+++ GN + ++  LL +L   F+++DLG+  +FL I+      GM LSQ RY +D
Sbjct  1085  LYVDDMLITGNSSTVLAKLLDELNKQFRMKDLGRMHYFLGIQATFHSSGMFLSQERYAKD  1144

Query  109   ILHRVGMTDCKSLATP  62
             +L   GM++C ++ATP
Sbjct  1145  LLATAGMSECTTVATP  1160



>gb|AAU10682.1| putative polyprotein [Oryza sativa Japonica Group]
Length=1210

 Score =   128 bits (321),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 64/154 (42%), Positives = 94/154 (61%), Gaps = 0/154 (0%)
 Frame = -3

Query  469   DPDIPDHICPLQRSLYGLK*APRAWFKRLHDFLLLTGFIAWKTDVSLFHYSAGNSRVFLL  290
             D + P++IC L ++LYGLK APRAW+ RL   L   GF   K D SLF Y+ GN  +F+L
Sbjct  949   DRNKPNYICKLDKALYGLKQAPRAWYSRLSMKLCDLGFQPSKADTSLFFYNKGNIVIFVL  1008

Query  289   VYVDDIIMLGNDAVLVDSLLRKLATAFKIRDLGKPTFFLSIETLVVPEGMILSQRRYMRD  110
             +YVDDII+  +     ++LLR L   F ++D G   +FL IE   + +G++++Q +Y  D
Sbjct  1009  IYVDDIIVASSTEDATNALLRDLKQEFALKDFGDLHYFLGIEVNKLSDGILVTQNKYALD  1068

Query  109   ILHRVGMTDCKSLATPASVTQPVCQSTDSFANIS  8
             +L R GM DCK + TP S T+ +   T S  + +
Sbjct  1069  LLKRAGMLDCKPVDTPLSTTEKLSAYTGSIQDAT  1102



>gb|KFK26434.1| hypothetical protein AALP_AA8G247800 [Arabis alpina]
Length=205

 Score =   120 bits (302),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 56/140 (40%), Positives = 91/140 (65%), Gaps = 4/140 (3%)
 Frame = -3

Query  469  DPDIPDHICPLQRSLYGLK*APRAWFKRLHDFLLLTGFIAWKTDVSLFHYSAGNSRVFLL  290
            D D PD++C L +++YGLK APRAW+  L +FLL +GFI  ++D SLF  + GN    + 
Sbjct  9    DKDRPDYVCKLHKAIYGLKQAPRAWYMELSNFLLQSGFINSQSDASLFICNIGN----IS  64

Query  289  VYVDDIIMLGNDAVLVDSLLRKLATAFKIRDLGKPTFFLSIETLVVPEGMILSQRRYMRD  110
            +YVDDI++ G+D   V+  +  L+  F ++DLG+ ++FL IE +   EG++L+QR+Y+ D
Sbjct  65   IYVDDIVITGSDPGKVEQFIALLSKMFSLKDLGELSYFLGIEAIRSREGLLLTQRKYITD  124

Query  109  ILHRVGMTDCKSLATPASVT  50
            +L ++ M     + TP +  
Sbjct  125  LLAKMNMLTANPVTTPMATN  144



>ref|XP_006465491.1| PREDICTED: uncharacterized protein LOC102624640 [Citrus sinensis]
Length=1682

 Score =   128 bits (322),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 62/150 (41%), Positives = 95/150 (63%), Gaps = 1/150 (1%)
 Frame = -3

Query  469  DPDIPDHICPLQRSLYGLK*APRAWFKRLHDFLLLT-GFIAWKTDVSLFHYSAGNSRVFL  293
            DP  P H+C L+++LYGLK APRAWF+RL D +++  GF   ++D SLF+   G+  +F+
Sbjct  456  DPSRPLHVCKLKKALYGLKQAPRAWFERLKDAMVVKWGFQNSRSDNSLFYKWIGDQVIFV  515

Query  292  LVYVDDIIMLGNDAVLVDSLLRKLATAFKIRDLGKPTFFLSIETLVVPEGMILSQRRYMR  113
            LVYVDDII+ G+   +V  ++  +  AF ++DLGK ++FL IE      G+ LSQ +Y+ 
Sbjct  516  LVYVDDIIITGSSDKMVQQVITNMQNAFALKDLGKLSYFLGIEVTKTASGIYLSQSKYIA  575

Query  112  DILHRVGMTDCKSLATPASVTQPVCQSTDS  23
            DIL +  M DC  + TP +    + + + S
Sbjct  576  DILAKHNMADCSPVPTPMATGHYLTKGSGS  605



>emb|CAN81355.1| hypothetical protein VITISV_039158 [Vitis vinifera]
Length=1402

 Score =   128 bits (321),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 62/144 (43%), Positives = 94/144 (65%), Gaps = 0/144 (0%)
 Frame = -3

Query  466   PDIPDHICPLQRSLYGLK*APRAWFKRLHDFLLLTGFIAWKTDVSLFHYSAGNSRVFLLV  287
             P+ P+ +C L+++LYGLK +PRAWF +L   LL  GF + +TD S+F +   +S + +LV
Sbjct  1001  PNHPNKVCKLKKALYGLKQSPRAWFTKLSSALLSXGFNSSRTDSSMFVHFGRHSTLIVLV  1060

Query  286   YVDDIIMLGNDAVLVDSLLRKLATAFKIRDLGKPTFFLSIETLVVPEGMILSQRRYMRDI  107
             YVDDII+ G+  +L+  L+ KL + F +RDLG+ ++FL IE       + LSQR+Y+ D+
Sbjct  1061  YVDDIIVTGSSPILIQQLIHKLHSLFALRDLGQLSYFLGIEVTYDGGSLHLSQRKYITDL  1120

Query  106   LHRVGMTDCKSLATPASVTQPVCQ  35
             L R  M D K+ ATP +V   + Q
Sbjct  1121  LQRTSMLDSKAAATPGTVGLSLSQ  1144



>dbj|BAA78425.1| polyprotein [Arabidopsis thaliana]
 dbj|BAK41505.1| polyprotein [Arabidopsis thaliana]
 dbj|BAK41506.1| polyprotein [Arabidopsis thaliana]
 dbj|BAK41508.1| polyprotein [Arabidopsis thaliana]
 dbj|BAK41509.1| polyprotein [Arabidopsis thaliana]
Length=1447

 Score =   128 bits (321),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 62/136 (46%), Positives = 88/136 (65%), Gaps = 0/136 (0%)
 Frame = -3

Query  469   DPDIPDHICPLQRSLYGLK*APRAWFKRLHDFLLLTGFIAWKTDVSLFHYSAGNSRVFLL  290
             D D P+++C L+++LYGLK APRAW+  L ++LL  GF+   +D SLF    G S V++L
Sbjct  1070  DKDRPNYVCKLRKALYGLKQAPRAWYVELRNYLLTIGFVNSVSDTSLFVLQRGKSIVYML  1129

Query  289   VYVDDIIMLGNDAVLVDSLLRKLATAFKIRDLGKPTFFLSIETLVVPEGMILSQRRYMRD  110
             VYVDDI++ GND  L+ + L  L+  F ++D  +  +FL IE   VP G+ LSQRRY+ D
Sbjct  1130  VYVDDILITGNDPTLLHNTLDNLSQRFSVKDHEELHYFLGIEAKRVPTGLHLSQRRYILD  1189

Query  109   ILHRVGMTDCKSLATP  62
             +L R  M   K + TP
Sbjct  1190  LLARTNMITAKPVTTP  1205



>dbj|BAK41507.1| polyprotein [Arabidopsis thaliana]
Length=1447

 Score =   128 bits (321),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 62/136 (46%), Positives = 88/136 (65%), Gaps = 0/136 (0%)
 Frame = -3

Query  469   DPDIPDHICPLQRSLYGLK*APRAWFKRLHDFLLLTGFIAWKTDVSLFHYSAGNSRVFLL  290
             D D P+++C L+++LYGLK APRAW+  L ++LL  GF+   +D SLF    G S V++L
Sbjct  1070  DKDRPNYVCKLRKALYGLKQAPRAWYVELRNYLLTIGFVNSVSDTSLFVLQRGKSIVYML  1129

Query  289   VYVDDIIMLGNDAVLVDSLLRKLATAFKIRDLGKPTFFLSIETLVVPEGMILSQRRYMRD  110
             VYVDDI++ GND  L+ + L  L+  F ++D  +  +FL IE   VP G+ LSQRRY+ D
Sbjct  1130  VYVDDILITGNDPTLLHNTLDNLSQRFSVKDHEELHYFLGIEAKRVPTGLHLSQRRYILD  1189

Query  109   ILHRVGMTDCKSLATP  62
             +L R  M   K + TP
Sbjct  1190  LLARTNMITAKPVTTP  1205



>gb|AAK62788.1|AC027036_9 polyprotein, putative [Arabidopsis thaliana]
 dbj|BAB84015.1| polyprotein [Arabidopsis thaliana]
Length=1466

 Score =   128 bits (321),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 62/136 (46%), Positives = 88/136 (65%), Gaps = 0/136 (0%)
 Frame = -3

Query  469   DPDIPDHICPLQRSLYGLK*APRAWFKRLHDFLLLTGFIAWKTDVSLFHYSAGNSRVFLL  290
             D D P+++C L+++LYGLK APRAW+  L ++LL  GF+   +D SLF    G S V++L
Sbjct  1089  DKDRPNYVCKLRKALYGLKQAPRAWYVELRNYLLTIGFVNSVSDTSLFVLQRGKSIVYML  1148

Query  289   VYVDDIIMLGNDAVLVDSLLRKLATAFKIRDLGKPTFFLSIETLVVPEGMILSQRRYMRD  110
             VYVDDI++ GND  L+ + L  L+  F ++D  +  +FL IE   VP G+ LSQRRY+ D
Sbjct  1149  VYVDDILITGNDPTLLHNTLDNLSQRFSVKDHEELHYFLGIEAKRVPTGLHLSQRRYILD  1208

Query  109   ILHRVGMTDCKSLATP  62
             +L R  M   K + TP
Sbjct  1209  LLARTNMITAKPVTTP  1224



>gb|AAK62793.1|AC027036_14 polyprotein, putative [Arabidopsis thaliana]
 dbj|BAK41510.1| polyprotein [Arabidopsis thaliana]
Length=1466

 Score =   128 bits (321),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 62/136 (46%), Positives = 88/136 (65%), Gaps = 0/136 (0%)
 Frame = -3

Query  469   DPDIPDHICPLQRSLYGLK*APRAWFKRLHDFLLLTGFIAWKTDVSLFHYSAGNSRVFLL  290
             D D P+++C L+++LYGLK APRAW+  L ++LL  GF+   +D SLF    G S V++L
Sbjct  1089  DKDRPNYVCKLRKALYGLKQAPRAWYVELRNYLLTIGFVNSVSDTSLFVLQRGKSIVYML  1148

Query  289   VYVDDIIMLGNDAVLVDSLLRKLATAFKIRDLGKPTFFLSIETLVVPEGMILSQRRYMRD  110
             VYVDDI++ GND  L+ + L  L+  F ++D  +  +FL IE   VP G+ LSQRRY+ D
Sbjct  1149  VYVDDILITGNDPTLLHNTLDNLSQRFSVKDHEELHYFLGIEAKRVPTGLHLSQRRYILD  1208

Query  109   ILHRVGMTDCKSLATP  62
             +L R  M   K + TP
Sbjct  1209  LLARTNMITAKPVTTP  1224



>dbj|BAK41511.1| polyprotein [Arabidopsis thaliana]
Length=1466

 Score =   128 bits (321),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 62/136 (46%), Positives = 88/136 (65%), Gaps = 0/136 (0%)
 Frame = -3

Query  469   DPDIPDHICPLQRSLYGLK*APRAWFKRLHDFLLLTGFIAWKTDVSLFHYSAGNSRVFLL  290
             D D P+++C L+++LYGLK APRAW+  L ++LL  GF+   +D SLF    G S V++L
Sbjct  1089  DKDRPNYVCKLRKALYGLKQAPRAWYVELRNYLLTIGFVNSVSDTSLFVLQRGKSIVYML  1148

Query  289   VYVDDIIMLGNDAVLVDSLLRKLATAFKIRDLGKPTFFLSIETLVVPEGMILSQRRYMRD  110
             VYVDDI++ GND  L+ + L  L+  F ++D  +  +FL IE   VP G+ LSQRRY+ D
Sbjct  1149  VYVDDILITGNDPTLLHNTLDNLSQRFSVKDHEELHYFLGIEAKRVPTGLHLSQRRYILD  1208

Query  109   ILHRVGMTDCKSLATP  62
             +L R  M   K + TP
Sbjct  1209  LLARTNMITAKPVTTP  1224



>emb|CAE04381.1| OSJNBa0027G07.23 [Oryza sativa Japonica Group]
 emb|CAE02562.2| OSJNBa0006M15.5 [Oryza sativa Japonica Group]
Length=472

 Score =   124 bits (312),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 59/128 (46%), Positives = 81/128 (63%), Gaps = 0/128 (0%)
 Frame = -3

Query  460  IPDHICPLQRSLYGLK*APRAWFKRLHDFLLLTGFIAWKTDVSLFHYSAGNSRVFLLVYV  281
             P+HIC L ++LYGLK APRAW+ +L   L   GF     D SLF YS G+  VF+L+YV
Sbjct  261  FPNHICKLDKALYGLKQAPRAWYSKLSTKLQALGFKPSMADTSLFFYSKGDVNVFVLIYV  320

Query  280  DDIIMLGNDAVLVDSLLRKLATAFKIRDLGKPTFFLSIETLVVPEGMILSQRRYMRDILH  101
            DDII+  +      +LL+ L   F ++DLG+  +FL IE     +G++L+Q +Y  D+L 
Sbjct  321  DDIIVASSTPSATSALLQDLTKEFALKDLGELHYFLGIEVTRTEDGILLTQAKYASDVLR  380

Query  100  RVGMTDCK  77
            RVGM DCK
Sbjct  381  RVGMQDCK  388



>dbj|BAA78423.1| polyprotein [Arabidopsis thaliana]
Length=1431

 Score =   127 bits (320),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 62/136 (46%), Positives = 88/136 (65%), Gaps = 0/136 (0%)
 Frame = -3

Query  469   DPDIPDHICPLQRSLYGLK*APRAWFKRLHDFLLLTGFIAWKTDVSLFHYSAGNSRVFLL  290
             D D P+++C L+++LYGLK APRAW+  L ++LL  GF+   +D SLF    G S V++L
Sbjct  1054  DKDRPNYVCKLRKALYGLKQAPRAWYVELRNYLLTIGFVNSVSDTSLFVLQRGKSIVYML  1113

Query  289   VYVDDIIMLGNDAVLVDSLLRKLATAFKIRDLGKPTFFLSIETLVVPEGMILSQRRYMRD  110
             VYVDDI++ GND  L+ + L  L+  F ++D  +  +FL IE   VP G+ LSQRRY+ D
Sbjct  1114  VYVDDILITGNDPTLLHNTLDNLSQRFSVKDHEELHYFLGIEAKRVPTGLHLSQRRYILD  1173

Query  109   ILHRVGMTDCKSLATP  62
             +L R  M   K + TP
Sbjct  1174  LLARTNMITAKPVTTP  1189



>gb|AAT93988.1| putative polyprotein [Oryza sativa Japonica Group]
Length=1480

 Score =   127 bits (320),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 60/136 (44%), Positives = 88/136 (65%), Gaps = 0/136 (0%)
 Frame = -3

Query  469   DPDIPDHICPLQRSLYGLK*APRAWFKRLHDFLLLTGFIAWKTDVSLFHYSAGNSRVFLL  290
             DP  P+ +C LQ+SLYGLK APRAW++R   ++   GF +  ++ SLF Y  G++  +LL
Sbjct  1098  DPSAPNAVCLLQKSLYGLKQAPRAWYQRFATYIRQLGFTSSASNTSLFVYKDGDNIAYLL  1157

Query  289   VYVDDIIMLGNDAVLVDSLLRKLATAFKIRDLGKPTFFLSIETLVVPEGMILSQRRYMRD  110
             +YVDDII+  + A L+  +  +L + F + DLG   FFL I      +G+ LSQR+Y+ D
Sbjct  1158  LYVDDIILTASSATLLHHITARLHSEFAMTDLGDLHFFLGISVTRSSDGLFLSQRQYVVD  1217

Query  109   ILHRVGMTDCKSLATP  62
             +L R GM++C S ATP
Sbjct  1218  LLKRAGMSECHSTATP  1233



>emb|CAH66819.1| OSIGBa0093K19.6 [Oryza sativa Indica Group]
Length=472

 Score =   124 bits (311),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 59/128 (46%), Positives = 81/128 (63%), Gaps = 0/128 (0%)
 Frame = -3

Query  460  IPDHICPLQRSLYGLK*APRAWFKRLHDFLLLTGFIAWKTDVSLFHYSAGNSRVFLLVYV  281
             P+HIC L ++LYGLK APRAW+ +L   L   GF     D SLF YS G+  VF+L+YV
Sbjct  261  FPNHICKLDKALYGLKQAPRAWYSKLSTKLQALGFKPSMADTSLFFYSKGDVNVFVLIYV  320

Query  280  DDIIMLGNDAVLVDSLLRKLATAFKIRDLGKPTFFLSIETLVVPEGMILSQRRYMRDILH  101
            DDII+  +      +LL+ L   F ++DLG+  +FL IE     +G++L+Q +Y  D+L 
Sbjct  321  DDIIVASSTPSATSALLQDLTKEFALKDLGELHYFLGIEVTRTEDGILLTQAKYASDVLR  380

Query  100  RVGMTDCK  77
            RVGM DCK
Sbjct  381  RVGMQDCK  388



>dbj|BAM44531.1| polyprotein [Arabidopsis thaliana]
Length=1421

 Score =   127 bits (319),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 62/140 (44%), Positives = 89/140 (64%), Gaps = 0/140 (0%)
 Frame = -3

Query  469   DPDIPDHICPLQRSLYGLK*APRAWFKRLHDFLLLTGFIAWKTDVSLFHYSAGNSRVFLL  290
             D D PD++C L++++YGLK APRAW+  L  +LL  GF+   +D SLF    G S +++L
Sbjct  1091  DKDRPDYVCRLKKAIYGLKQAPRAWYVELQTYLLTVGFVNSISDTSLFVLQRGRSIIYML  1150

Query  289   VYVDDIIMLGNDAVLVDSLLRKLATAFKIRDLGKPTFFLSIETLVVPEGMILSQRRYMRD  110
             VYVDDI++ GND VL+   L  L+  F +++     +FL IE   VP+G+ LSQRRY  D
Sbjct  1151  VYVDDILITGNDTVLLKHTLDALSQRFSVKEHEDLHYFLGIEAKRVPQGLHLSQRRYTLD  1210

Query  109   ILHRVGMTDCKSLATPASVT  50
             +L R  M   K +ATP + +
Sbjct  1211  LLARTNMLTAKPVATPMATS  1230



>ref|XP_010436786.1| PREDICTED: uncharacterized protein LOC104720600 [Camelina sativa]
Length=746

 Score =   126 bits (316),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 58/136 (43%), Positives = 86/136 (63%), Gaps = 0/136 (0%)
 Frame = -3

Query  469  DPDIPDHICPLQRSLYGLK*APRAWFKRLHDFLLLTGFIAWKTDVSLFHYSAGNSRVFLL  290
            DP  P+H+C L +S+Y LK +PRAWF +   +L   GF     D SLF Y  GN+ + LL
Sbjct  498  DPSKPEHVCLLHKSIYDLKQSPRAWFDKFSTYLFEFGFTCCIPDPSLFVYMKGNAIILLL  557

Query  289  VYVDDIIMLGNDAVLVDSLLRKLATAFKIRDLGKPTFFLSIETLVVPEGMILSQRRYMRD  110
            +YVDD+++ GN +  + SLL  L + F ++DLG+  +FL I+    P G+ LSQ++Y  D
Sbjct  558  LYVDDMLITGNSSEALTSLLTALNSQFHMKDLGQMQYFLGIQAQFHPAGLFLSQQKYAED  617

Query  109  ILHRVGMTDCKSLATP  62
            +L   GM++C  +ATP
Sbjct  618  LLVTAGMSECALVATP  633



>emb|CAN83506.1| hypothetical protein VITISV_027576 [Vitis vinifera]
Length=1172

 Score =   127 bits (319),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 61/136 (45%), Positives = 87/136 (64%), Gaps = 0/136 (0%)
 Frame = -3

Query  469  DPDIPDHICPLQRSLYGLK*APRAWFKRLHDFLLLTGFIAWKTDVSLFHYSAGNSRVFLL  290
            D D P H+C L++++YGLK APRAW++ L  FLL  GF     D SLF        V+ L
Sbjct  788  DQDSPSHVCKLKKAIYGLKQAPRAWYQELRSFLLQFGFTNSHADTSLFVLKFRGHLVYFL  847

Query  289  VYVDDIIMLGNDAVLVDSLLRKLATAFKIRDLGKPTFFLSIETLVVPEGMILSQRRYMRD  110
            VYVDD+I+ G+D  LV+  +  LA  F ++DLGK ++FL +E +   +G +LSQRRY+ D
Sbjct  848  VYVDDLIITGDDEHLVNRYIHLLANRFSLKDLGKLSYFLGVEIVPNSQGFLLSQRRYLLD  907

Query  109  ILHRVGMTDCKSLATP  62
            +L R  M++ K + TP
Sbjct  908  LLARTHMSEAKPVQTP  923



>ref|XP_010525654.1| PREDICTED: uncharacterized protein LOC104803422 [Tarenaya hassleriana]
Length=580

 Score =   125 bits (313),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 59/148 (40%), Positives = 92/148 (62%), Gaps = 0/148 (0%)
 Frame = -3

Query  469  DPDIPDHICPLQRSLYGLK*APRAWFKRLHDFLLLTGFIAWKTDVSLFHYSAGNSRVFLL  290
            D   P  +C L++++YGLK APRAW+  L  FL+  GF     D SLF      S +F+L
Sbjct  283  DSTSPGFVCKLRKAIYGLKQAPRAWYSELRSFLIARGFKNSLADTSLFILMTSTSSLFVL  342

Query  289  VYVDDIIMLGNDAVLVDSLLRKLATAFKIRDLGKPTFFLSIETLVVPEGMILSQRRYMRD  110
            VYVDD+++ G+ +  VDS++  L   F ++DLG  ++FL +E L    G++L+QR+Y+ D
Sbjct  343  VYVDDLMITGSCSTEVDSVITDLGARFSLKDLGDLSYFLGVEALRTDRGLLLTQRKYITD  402

Query  109  ILHRVGMTDCKSLATPASVTQPVCQSTD  26
            +LHR  M D K ++TP + T  +  ++D
Sbjct  403  LLHRANMADAKPVSTPMASTSRLTAASD  430



>gb|AAD21687.1| Strong similarity to gi|3600044 T12H20.12 protease homolog from 
Arabidopsis thaliana BAC gb|AF080119 and is a member of the 
reverse transcriptase family PF|00078 [Arabidopsis thaliana]
Length=1415

 Score =   127 bits (319),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 60/136 (44%), Positives = 84/136 (62%), Gaps = 0/136 (0%)
 Frame = -3

Query  469   DPDIPDHICPLQRSLYGLK*APRAWFKRLHDFLLLTGFIAWKTDVSLFHYSAGNSRVFLL  290
             DP  P H+C L +++YGLK APRAWF    +FLL  GF+  K+D SLF        ++LL
Sbjct  992   DPQKPTHVCRLTKAIYGLKQAPRAWFDTFSNFLLDYGFVCSKSDPSLFVCHQDGKILYLL  1051

Query  289   VYVDDIIMLGNDAVLVDSLLRKLATAFKIRDLGKPTFFLSIETLVVPEGMILSQRRYMRD  110
             +YVDDI++ G+D  L++ LL+ L   F ++DLG P +FL I+      G+ L Q  Y  D
Sbjct  1052  LYVDDILLTGSDQSLLEDLLQALKNRFSMKDLGPPRYFLGIQIEDYANGLFLHQTAYATD  1111

Query  109   ILHRVGMTDCKSLATP  62
             IL + GM+DC  + TP
Sbjct  1112  ILQQAGMSDCNPMPTP  1127



>ref|YP_514636.1| hypothetical protein OrsaiPp07 [Oryza sativa Indica Group]
 ref|YP_003433855.1| hypothetical protein OrrupM_p18 [Oryza rufipogon]
 gb|AAZ99275.1| hypothetical protein (mitochondrion) [Oryza sativa Indica Group]
 gb|AAZ99329.1| hypothetical protein (mitochondrion) [Oryza sativa Japonica Group]
 gb|AAZ99382.1| hypothetical protein (mitochondrion) [Oryza sativa Japonica Group]
 dbj|BAI67959.1| hypothetical protein [Oryza rufipogon]
 dbj|BAI67987.1| hypothetical protein [Oryza sativa Indica Group]
 gb|AER12982.1| hypothetical protein (mitochondrion) [Oryza sativa Indica Group]
 gb|AER13050.1| hypothetical protein (mitochondrion) [Oryza sativa Indica Group]
 gb|AEZ03755.1| hypothetical protein (mitochondrion) [Oryza sativa Indica Group]
 gb|AEZ03764.1| hypothetical protein (mitochondrion) [Oryza sativa Indica Group]
 dbj|BAN67511.1| hypothetical protein (mitochondrion) [Oryza rufipogon]
 dbj|BAN67513.1| hypothetical protein (mitochondrion) [Oryza rufipogon]
Length=490

 Score =   124 bits (310),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 63/135 (47%), Positives = 83/135 (61%), Gaps = 0/135 (0%)
 Frame = -3

Query  454  DHICPLQRSLYGLK*APRAWFKRLHDFLLLTGFIAWKTDVSLFHYSAGNSRVFLLVYVDD  275
            D++C L ++LYGLK APRAWF RL   L   GF   K D SLF Y  G   +F+L+YVDD
Sbjct  122  DYVCKLDKALYGLKQAPRAWFSRLSMKLQNLGFQPSKADASLFFYKKGTISIFVLIYVDD  181

Query  274  IIMLGNDAVLVDSLLRKLATAFKIRDLGKPTFFLSIETLVVPEGMILSQRRYMRDILHRV  95
            II+  +      +LL+ L   F ++DLG   +FL IE   V +G+IL+Q +Y  D+L RV
Sbjct  182  IIVASSCEKATSALLQDLKEEFALKDLGALHYFLGIEVNKVHDGIILTQEKYATDLLKRV  241

Query  94   GMTDCKSLATPASVT  50
            GM  CK + TP S T
Sbjct  242  GMHGCKEINTPLSTT  256



>emb|CAN61322.1| hypothetical protein VITISV_012106 [Vitis vinifera]
Length=1432

 Score =   127 bits (318),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 62/145 (43%), Positives = 92/145 (63%), Gaps = 0/145 (0%)
 Frame = -3

Query  469   DPDIPDHICPLQRSLYGLK*APRAWFKRLHDFLLLTGFIAWKTDVSLFHYSAGNSRVFLL  290
             DP  P+ +C L+++LYGLK APRAWF+RL   LL  GF   +TD S+F +    + + +L
Sbjct  1020  DPQFPNRVCRLKKALYGLKQAPRAWFQRLSSALLQWGFSMSRTDSSMFLHFGKATTLIVL  1079

Query  289   VYVDDIIMLGNDAVLVDSLLRKLATAFKIRDLGKPTFFLSIETLVVPEGMILSQRRYMRD  110
             VYVDDI++ G+ +  + SL+ KL + F +RDLG+ +FFL IE       M LSQ +Y+ D
Sbjct  1080  VYVDDILVTGSSSTQISSLIAKLDSVFALRDLGQLSFFLGIEVSYNEGSMTLSQTKYISD  1139

Query  109   ILHRVGMTDCKSLATPASVTQPVCQ  35
             +LHR  + D K   TP +V + + +
Sbjct  1140  LLHRTELFDTKPANTPGAVGKNLSK  1164



>emb|CAN61420.1| hypothetical protein VITISV_023544 [Vitis vinifera]
Length=1289

 Score =   127 bits (318),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 60/148 (41%), Positives = 89/148 (60%), Gaps = 0/148 (0%)
 Frame = -3

Query  469  DPDIPDHICPLQRSLYGLK*APRAWFKRLHDFLLLTGFIAWKTDVSLFHYSAGNSRVFLL  290
            + D+P+H+C L RSLYGLK APRAWF +L   LL  GF   K + SLF    G S V LL
Sbjct  429  NEDLPNHVCKLNRSLYGLKQAPRAWFDKLSQCLLHLGFYYGKANSSLFILRKGQSIVLLL  488

Query  289  VYVDDIIMLGNDAVLVDSLLRKLATAFKIRDLGKPTFFLSIETLVVPEGMILSQRRYMRD  110
            +YVDDII+ GND  ++  L+  L++ F ++D G   +F  +E   +P G+ +SQ +Y RD
Sbjct  489  IYVDDIIVTGNDNNIISDLISTLSSEFSLKDSGSLHYFFRLEVKYLPNGLFVSQTKYTRD  548

Query  109  ILHRVGMTDCKSLATPASVTQPVCQSTD  26
            +L    + +C  + TP ++   +  S +
Sbjct  549  LLEHTKIMECTPINTPMALKSIITPSDE  576



>dbj|BAM44534.1| polyprotein [Arabidopsis thaliana]
Length=1475

 Score =   127 bits (318),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 62/140 (44%), Positives = 89/140 (64%), Gaps = 0/140 (0%)
 Frame = -3

Query  469   DPDIPDHICPLQRSLYGLK*APRAWFKRLHDFLLLTGFIAWKTDVSLFHYSAGNSRVFLL  290
             D D PD++C L++++YGLK APRAW+  L  +LL  GF+   +D SLF    G S +++L
Sbjct  1091  DKDRPDYVCRLRKAIYGLKQAPRAWYVELRTYLLTVGFVNSISDTSLFVLQRGRSIIYML  1150

Query  289   VYVDDIIMLGNDAVLVDSLLRKLATAFKIRDLGKPTFFLSIETLVVPEGMILSQRRYMRD  110
             VYVDDI++ GND VL+   L  L+  F +++     +FL IE   VP+G+ LSQRRY  D
Sbjct  1151  VYVDDILITGNDTVLLKHTLDALSQRFSVKEHEDLHYFLGIEAKRVPQGLHLSQRRYTLD  1210

Query  109   ILHRVGMTDCKSLATPASVT  50
             +L R  M   K +ATP + +
Sbjct  1211  LLARTNMLTAKPVATPMATS  1230



>dbj|BAM44530.1| polyprotein [Arabidopsis thaliana]
Length=1421

 Score =   127 bits (318),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 62/140 (44%), Positives = 89/140 (64%), Gaps = 0/140 (0%)
 Frame = -3

Query  469   DPDIPDHICPLQRSLYGLK*APRAWFKRLHDFLLLTGFIAWKTDVSLFHYSAGNSRVFLL  290
             D D PD++C L++++YGLK APRAW+  L  +LL  GF+   +D SLF    G S +++L
Sbjct  1091  DKDRPDYVCRLRKAIYGLKQAPRAWYVELRTYLLTVGFVNSISDTSLFVLQRGRSIIYML  1150

Query  289   VYVDDIIMLGNDAVLVDSLLRKLATAFKIRDLGKPTFFLSIETLVVPEGMILSQRRYMRD  110
             VYVDDI++ GND VL+   L  L+  F +++     +FL IE   VP+G+ LSQRRY  D
Sbjct  1151  VYVDDILITGNDTVLLKHTLDALSQRFSVKEHEDLHYFLGIEAKRVPQGLHLSQRRYTLD  1210

Query  109   ILHRVGMTDCKSLATPASVT  50
             +L R  M   K +ATP + +
Sbjct  1211  LLARTNMLTAKPVATPMATS  1230



>dbj|BAA78426.1| polyprotein [Arabidopsis thaliana]
Length=1475

 Score =   127 bits (318),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 62/140 (44%), Positives = 89/140 (64%), Gaps = 0/140 (0%)
 Frame = -3

Query  469   DPDIPDHICPLQRSLYGLK*APRAWFKRLHDFLLLTGFIAWKTDVSLFHYSAGNSRVFLL  290
             D D PD++C L++++YGLK APRAW+  L  +LL  GF+   +D SLF    G S +++L
Sbjct  1091  DKDRPDYVCRLRKAIYGLKQAPRAWYVELRTYLLTVGFVNSISDTSLFVLQRGRSIIYML  1150

Query  289   VYVDDIIMLGNDAVLVDSLLRKLATAFKIRDLGKPTFFLSIETLVVPEGMILSQRRYMRD  110
             VYVDDI++ GND VL+   L  L+  F +++     +FL IE   VP+G+ LSQRRY  D
Sbjct  1151  VYVDDILITGNDTVLLKHTLDALSQRFSVKEHEDLHYFLGIEAKRVPQGLHLSQRRYTLD  1210

Query  109   ILHRVGMTDCKSLATPASVT  50
             +L R  M   K +ATP + +
Sbjct  1211  LLARTNMLTAKPVATPMATS  1230



>dbj|BAM44529.1| polyprotein [Arabidopsis thaliana]
Length=1421

 Score =   127 bits (318),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 62/140 (44%), Positives = 89/140 (64%), Gaps = 0/140 (0%)
 Frame = -3

Query  469   DPDIPDHICPLQRSLYGLK*APRAWFKRLHDFLLLTGFIAWKTDVSLFHYSAGNSRVFLL  290
             D D PD++C L++++YGLK APRAW+  L  +LL  GF+   +D SLF    G S +++L
Sbjct  1091  DKDRPDYVCRLRKAIYGLKQAPRAWYVELRTYLLTVGFVNSISDTSLFVLQRGRSIIYML  1150

Query  289   VYVDDIIMLGNDAVLVDSLLRKLATAFKIRDLGKPTFFLSIETLVVPEGMILSQRRYMRD  110
             VYVDDI++ GND VL+   L  L+  F +++     +FL IE   VP+G+ LSQRRY  D
Sbjct  1151  VYVDDILITGNDTVLLKHTLDALSQRFSVKEHEDLHYFLGIEAKRVPQGLHLSQRRYTLD  1210

Query  109   ILHRVGMTDCKSLATPASVT  50
             +L R  M   K +ATP + +
Sbjct  1211  LLARTNMLTAKPVATPMATS  1230



>ref|XP_002443133.1| hypothetical protein SORBIDRAFT_08g010840 [Sorghum bicolor]
 gb|EES16971.1| hypothetical protein SORBIDRAFT_08g010840 [Sorghum bicolor]
Length=725

 Score =   125 bits (314),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 60/136 (44%), Positives = 86/136 (63%), Gaps = 0/136 (0%)
 Frame = -3

Query  469  DPDIPDHICPLQRSLYGLK*APRAWFKRLHDFLLLTGFIAWKTDVSLFHYSAGNSRVFLL  290
            DP  PD +C LQRSLYGLK APRAW +R   ++   GF+A  TD SLF Y+ G +  +LL
Sbjct  439  DPARPDAVCLLQRSLYGLKQAPRAWDQRFATYVRQLGFVASATDTSLFVYTEGGASAYLL  498

Query  289  VYVDDIIMLGNDAVLVDSLLRKLATAFKIRDLGKPTFFLSIETLVVPEGMILSQRRYMRD  110
            +YVDDI++  +   L+  ++ +L + F + DLG+   FL I      +G+ LSQR+Y  D
Sbjct  499  LYVDDIVLTASSDALLRCIIDRLHSEFAMTDLGELHHFLGISVTRSSDGLFLSQRQYAVD  558

Query  109  ILHRVGMTDCKSLATP  62
            +L + GM +C S +TP
Sbjct  559  LLQKAGMAECHSTSTP  574



>dbj|BAM42649.1| Polyprotein [Arabidopsis thaliana]
Length=1475

 Score =   127 bits (318),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 62/140 (44%), Positives = 89/140 (64%), Gaps = 0/140 (0%)
 Frame = -3

Query  469   DPDIPDHICPLQRSLYGLK*APRAWFKRLHDFLLLTGFIAWKTDVSLFHYSAGNSRVFLL  290
             D D PD++C L++++YGLK APRAW+  L  +LL  GF+   +D SLF    G S +++L
Sbjct  1091  DKDRPDYVCRLRKAIYGLKQAPRAWYVELRTYLLTVGFVNSISDTSLFVLQRGRSIIYML  1150

Query  289   VYVDDIIMLGNDAVLVDSLLRKLATAFKIRDLGKPTFFLSIETLVVPEGMILSQRRYMRD  110
             VYVDDI++ GND VL+   L  L+  F +++     +FL IE   VP+G+ LSQRRY  D
Sbjct  1151  VYVDDILITGNDTVLLKHTLDALSQRFSVKEHEDLHYFLGIEAKRVPQGLHLSQRRYTLD  1210

Query  109   ILHRVGMTDCKSLATPASVT  50
             +L R  M   K +ATP + +
Sbjct  1211  LLARTNMLTAKPVATPMATS  1230



>dbj|BAM44532.1| polyprotein [Arabidopsis thaliana]
Length=1421

 Score =   126 bits (317),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 62/140 (44%), Positives = 89/140 (64%), Gaps = 0/140 (0%)
 Frame = -3

Query  469   DPDIPDHICPLQRSLYGLK*APRAWFKRLHDFLLLTGFIAWKTDVSLFHYSAGNSRVFLL  290
             D D PD++C L++++YGLK APRAW+  L  +LL  GF+   +D SLF    G S +++L
Sbjct  1091  DKDRPDYVCRLRKAIYGLKQAPRAWYVELRTYLLTVGFVNSISDTSLFVLQRGRSIIYML  1150

Query  289   VYVDDIIMLGNDAVLVDSLLRKLATAFKIRDLGKPTFFLSIETLVVPEGMILSQRRYMRD  110
             VYVDDI++ GND VL+   L  L+  F +++     +FL IE   VP+G+ LSQRRY  D
Sbjct  1151  VYVDDILITGNDTVLLKHTLDALSQRFSVKEHEDLHYFLGIEAKRVPQGLHLSQRRYTLD  1210

Query  109   ILHRVGMTDCKSLATPASVT  50
             +L R  M   K +ATP + +
Sbjct  1211  LLARTNMLTAKPVATPMATS  1230



>ref|XP_006577484.1| PREDICTED: uncharacterized mitochondrial protein AtMg00810-like 
[Glycine max]
Length=234

 Score =   120 bits (300),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 61/136 (45%), Positives = 79/136 (58%), Gaps = 0/136 (0%)
 Frame = -3

Query  469  DPDIPDHICPLQRSLYGLK*APRAWFKRLHDFLLLTGFIAWKTDVSLFHYSAGNSRVFLL  290
            DP   +H+C LQ++LYGLK APRAWF R   FLL  GF   K D SLF + +    + LL
Sbjct  9    DPQFSNHVCKLQKALYGLKQAPRAWFDRFSSFLLKYGFFCSKADPSLFIWHSNIGSLILL  68

Query  289  VYVDDIIMLGNDAVLVDSLLRKLATAFKIRDLGKPTFFLSIETLVVPEGMILSQRRYMRD  110
            +YVDDI++ G+   LV   ++ L + F ++DLG    FL IE L   +G  LS   Y   
Sbjct  69   LYVDDILLTGSITTLVSDFIKLLQSEFSMKDLGPLHHFLGIEILKTTDGFHLSHSHYALT  128

Query  109  ILHRVGMTDCKSLATP  62
            IL R  M DCK  +TP
Sbjct  129  ILERANMVDCKPKSTP  144



>gb|AAC79110.1| putative polyprotein of LTR transposon [Arabidopsis thaliana]
 emb|CAB77781.1| putative polyprotein of LTR transposon [Arabidopsis thaliana]
Length=1456

 Score =   126 bits (317),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 62/140 (44%), Positives = 89/140 (64%), Gaps = 0/140 (0%)
 Frame = -3

Query  469   DPDIPDHICPLQRSLYGLK*APRAWFKRLHDFLLLTGFIAWKTDVSLFHYSAGNSRVFLL  290
             D D PD++C L++++YGLK APRAW+  L  +LL  GF+   +D SLF    G S +++L
Sbjct  1072  DKDRPDYVCRLRKAIYGLKQAPRAWYVELRTYLLTVGFVNSISDTSLFVLQRGRSIIYML  1131

Query  289   VYVDDIIMLGNDAVLVDSLLRKLATAFKIRDLGKPTFFLSIETLVVPEGMILSQRRYMRD  110
             VYVDDI++ GND VL+   L  L+  F +++     +FL IE   VP+G+ LSQRRY  D
Sbjct  1132  VYVDDILITGNDTVLLKHTLDALSQRFSVKEHEDLHYFLGIEAKRVPQGLHLSQRRYTLD  1191

Query  109   ILHRVGMTDCKSLATPASVT  50
             +L R  M   K +ATP + +
Sbjct  1192  LLARTNMLTAKPVATPMATS  1211



>dbj|BAM42647.1| polyprotein [Arabidopsis thaliana]
 dbj|BAM42648.1| polyprotein [Arabidopsis thaliana]
Length=1475

 Score =   126 bits (317),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 62/140 (44%), Positives = 89/140 (64%), Gaps = 0/140 (0%)
 Frame = -3

Query  469   DPDIPDHICPLQRSLYGLK*APRAWFKRLHDFLLLTGFIAWKTDVSLFHYSAGNSRVFLL  290
             D D PD++C L++++YGLK APRAW+  L  +LL  GF+   +D SLF    G S +++L
Sbjct  1091  DKDRPDYVCRLRKAIYGLKQAPRAWYVELRTYLLTVGFVNSISDTSLFVLQRGRSIIYML  1150

Query  289   VYVDDIIMLGNDAVLVDSLLRKLATAFKIRDLGKPTFFLSIETLVVPEGMILSQRRYMRD  110
             VYVDDI++ GND VL+   L  L+  F +++     +FL IE   VP+G+ LSQRRY  D
Sbjct  1151  VYVDDILITGNDTVLLKHTLDALSQRFSVKEHEDLHYFLGIEAKRVPQGLHLSQRRYTLD  1210

Query  109   ILHRVGMTDCKSLATPASVT  50
             +L R  M   K +ATP + +
Sbjct  1211  LLARTNMLTAKPVATPMATS  1230



>ref|XP_002489074.1| hypothetical protein SORBIDRAFT_0139s002040 [Sorghum bicolor]
 gb|EES20269.1| hypothetical protein SORBIDRAFT_0139s002040 [Sorghum bicolor]
Length=1822

 Score =   127 bits (318),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 62/136 (46%), Positives = 83/136 (61%), Gaps = 0/136 (0%)
 Frame = -3

Query  469   DPDIPDHICPLQRSLYGLK*APRAWFKRLHDFLLLTGFIAWKTDVSLFHYSAGNSRVFLL  290
             D   PD +C L++SLYGLK APRAW  R   FLL  GF+  K+D SLF Y  G    +LL
Sbjct  1447  DSSCPDMVCRLKKSLYGLKQAPRAWNHRFAAFLLTLGFVEAKSDTSLFIYHYGAETAYLL  1506

Query  289   VYVDDIIMLGNDAVLVDSLLRKLATAFKIRDLGKPTFFLSIETLVVPEGMILSQRRYMRD  110
             +YVDDI++  +   L+  ++  L   F ++DLG+   FL +     P G++L QR+Y  D
Sbjct  1507  LYVDDIVLTASSESLLRRIIASLQQEFAMKDLGQLHHFLGVTVEPHPAGLLLHQRQYTLD  1566

Query  109   ILHRVGMTDCKSLATP  62
             IL R GMTDCK  +TP
Sbjct  1567  ILERAGMTDCKPCSTP  1582



>dbj|BAM42650.1| Polyprotein [Arabidopsis thaliana]
Length=1475

 Score =   126 bits (317),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 62/140 (44%), Positives = 89/140 (64%), Gaps = 0/140 (0%)
 Frame = -3

Query  469   DPDIPDHICPLQRSLYGLK*APRAWFKRLHDFLLLTGFIAWKTDVSLFHYSAGNSRVFLL  290
             D D PD++C L++++YGLK APRAW+  L  +LL  GF+   +D SLF    G S +++L
Sbjct  1091  DKDRPDYVCRLRKAIYGLKQAPRAWYVELRTYLLTVGFVNSISDTSLFVLQRGRSIIYML  1150

Query  289   VYVDDIIMLGNDAVLVDSLLRKLATAFKIRDLGKPTFFLSIETLVVPEGMILSQRRYMRD  110
             VYVDDI++ GND VL+   L  L+  F +++     +FL IE   VP+G+ LSQRRY  D
Sbjct  1151  VYVDDILITGNDTVLLKHTLDALSQRFSVKEHEDLHYFLGIEAKRVPQGLHLSQRRYTLD  1210

Query  109   ILHRVGMTDCKSLATPASVT  50
             +L R  M   K +ATP + +
Sbjct  1211  LLARTNMLTAKPVATPMATS  1230



>ref|XP_004963727.1| PREDICTED: uncharacterized protein LOC101777694 [Setaria italica]
Length=1416

 Score =   126 bits (317),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 62/148 (42%), Positives = 92/148 (62%), Gaps = 1/148 (1%)
 Frame = -3

Query  469   DPDIPDHICPLQRSLYGLK*APRAWFKRLHDFLLLTGFIAWKTDVSLFHYSAGNSRVFLL  290
             D   P ++C L RSLYGLK APRAW+ R   +L   GF+  +TD SLF +  G+   +LL
Sbjct  1032  DSAHPGYVCKLNRSLYGLKQAPRAWYSRFSTYLQQLGFVEARTDTSLFVFHRGHDTAYLL  1091

Query  289   VYVDDIIMLGNDAVLVDSLLRKLATAFKIRDLGKPTFFLSIETLVVPEGMILSQRRYMRD  110
             +YVDDI++  + ++L+  +++ L   F ++DLG+   FL +      +G++LSQR++M +
Sbjct  1092  LYVDDIVLTASSSLLLARIIQDLRQEFSMKDLGQLHHFLGMHVQRSGKGLLLSQRQFMVE  1151

Query  109   ILHRVGMTDCKSLATPASVTQPVCQSTD  26
             IL R GMTDCKS  TP   T P    +D
Sbjct  1152  ILDRAGMTDCKSCQTPVD-TNPKLSDSD  1178



>dbj|BAA78424.1| polyprotein [Arabidopsis thaliana]
 dbj|BAM44533.1| polyprotein [Arabidopsis thaliana]
Length=1330

 Score =   126 bits (317),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 62/140 (44%), Positives = 89/140 (64%), Gaps = 0/140 (0%)
 Frame = -3

Query  469   DPDIPDHICPLQRSLYGLK*APRAWFKRLHDFLLLTGFIAWKTDVSLFHYSAGNSRVFLL  290
             D D PD++C L++++YGLK APRAW+  L  +LL  GF+   +D SLF    G S +++L
Sbjct  946   DKDRPDYVCRLRKAIYGLKQAPRAWYVELRTYLLTVGFVNSISDTSLFVLQRGRSIIYML  1005

Query  289   VYVDDIIMLGNDAVLVDSLLRKLATAFKIRDLGKPTFFLSIETLVVPEGMILSQRRYMRD  110
             VYVDDI++ GND VL+   L  L+  F +++     +FL IE   VP+G+ LSQRRY  D
Sbjct  1006  VYVDDILITGNDTVLLKHTLDALSQRFSVKEHEDLHYFLGIEAKRVPQGLHLSQRRYTLD  1065

Query  109   ILHRVGMTDCKSLATPASVT  50
             +L R  M   K +ATP + +
Sbjct  1066  LLARTNMLTAKPVATPMATS  1085



>emb|CAN69753.1| hypothetical protein VITISV_024937 [Vitis vinifera]
Length=793

 Score =   125 bits (314),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 62/139 (45%), Positives = 90/139 (65%), Gaps = 0/139 (0%)
 Frame = -3

Query  469  DPDIPDHICPLQRSLYGLK*APRAWFKRLHDFLLLTGFIAWKTDVSLFHYSAGNSRVFLL  290
            D   P+ +C L+++LYGLK +PRAWF+RL+  LL  GF   +TD S+F +    + + +L
Sbjct  597  DTQFPNRVCRLKKALYGLKQSPRAWFQRLNSILLQWGFNMSRTDSSMFLHFGQATTLIVL  656

Query  289  VYVDDIIMLGNDAVLVDSLLRKLATAFKIRDLGKPTFFLSIETLVVPEGMILSQRRYMRD  110
            VYVDDII++G+ +  + SL+ KL + F +RDLG+ +FFL IE     + M LSQ +Y+ D
Sbjct  657  VYVDDIIIIGSSSTQISSLIAKLDSVFALRDLGQLSFFLGIEVSYNEDSMNLSQTKYISD  716

Query  109  ILHRVGMTDCKSLATPASV  53
            +LHR  M D K   TP  V
Sbjct  717  LLHRTEMFDTKLAKTPGVV  735



>ref|XP_002460196.1| hypothetical protein SORBIDRAFT_02g024427 [Sorghum bicolor]
 gb|EER96717.1| hypothetical protein SORBIDRAFT_02g024427 [Sorghum bicolor]
Length=1575

 Score =   126 bits (316),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 62/136 (46%), Positives = 83/136 (61%), Gaps = 0/136 (0%)
 Frame = -3

Query  469   DPDIPDHICPLQRSLYGLK*APRAWFKRLHDFLLLTGFIAWKTDVSLFHYSAGNSRVFLL  290
             D   PD +C L++SLYGLK APRAW  R   FLL  GF+  K+D SLF Y  G    +LL
Sbjct  1200  DSSCPDMVCRLKKSLYGLKQAPRAWNHRFAAFLLTLGFVEAKSDTSLFIYHYGAETAYLL  1259

Query  289   VYVDDIIMLGNDAVLVDSLLRKLATAFKIRDLGKPTFFLSIETLVVPEGMILSQRRYMRD  110
             +YVDDI++  +   L+  ++  L   F ++DLG+   FL +     P G++L QR+Y  D
Sbjct  1260  LYVDDIVLTASSESLLRRIIASLQQEFAMKDLGQLHHFLGVTVEPHPAGLLLHQRQYTLD  1319

Query  109   ILHRVGMTDCKSLATP  62
             IL R GMTDCK  +TP
Sbjct  1320  ILERAGMTDCKPCSTP  1335



>ref|XP_002455933.1| hypothetical protein SORBIDRAFT_03g027495 [Sorghum bicolor]
 gb|EES01053.1| hypothetical protein SORBIDRAFT_03g027495 [Sorghum bicolor]
Length=682

 Score =   125 bits (313),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 60/136 (44%), Positives = 84/136 (62%), Gaps = 0/136 (0%)
 Frame = -3

Query  469  DPDIPDHICPLQRSLYGLK*APRAWFKRLHDFLLLTGFIAWKTDVSLFHYSAGNSRVFLL  290
            DP +PDH+C L +SLYGLK APRAW+     FL+  GF   K+D SL  +S G   V+LL
Sbjct  301  DPTLPDHVCRLNKSLYGLKQAPRAWYSHFASFLISLGFTEAKSDTSLLAFSCGTETVYLL  360

Query  289  VYVDDIIMLGNDAVLVDSLLRKLATAFKIRDLGKPTFFLSIETLVVPEGMILSQRRYMRD  110
            +YVDDI++  +   L+  ++  L   F ++DLG    FL I      + ++LSQR+Y  D
Sbjct  361  LYVDDIVLTASSQQLLHHVIVALKKEFAMKDLGPLHHFLGIAVQCHRDSILLSQRQYTLD  420

Query  109  ILHRVGMTDCKSLATP  62
            IL R GM++CK  +TP
Sbjct  421  ILARHGMSNCKPCSTP  436



>ref|XP_002456118.1| hypothetical protein SORBIDRAFT_03g030787 [Sorghum bicolor]
 gb|EES01238.1| hypothetical protein SORBIDRAFT_03g030787 [Sorghum bicolor]
Length=1567

 Score =   126 bits (316),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 62/136 (46%), Positives = 83/136 (61%), Gaps = 0/136 (0%)
 Frame = -3

Query  469   DPDIPDHICPLQRSLYGLK*APRAWFKRLHDFLLLTGFIAWKTDVSLFHYSAGNSRVFLL  290
             D   PD +C L++SLYGLK APRAW  R   FLL  GF+  K+D SLF Y  G    +LL
Sbjct  1192  DSSCPDMVCRLKKSLYGLKQAPRAWNHRFAAFLLTLGFVEAKSDTSLFIYHYGAETAYLL  1251

Query  289   VYVDDIIMLGNDAVLVDSLLRKLATAFKIRDLGKPTFFLSIETLVVPEGMILSQRRYMRD  110
             +YVDDI++  +   L+  ++  L   F ++DLG+   FL +     P G++L QR+Y  D
Sbjct  1252  LYVDDIVLTASSESLLRRIIASLQQEFAMKDLGQLHHFLGVTVEPHPAGLLLHQRQYTLD  1311

Query  109   ILHRVGMTDCKSLATP  62
             IL R GMTDCK  +TP
Sbjct  1312  ILERAGMTDCKPCSTP  1327



>emb|CAN62863.1| hypothetical protein VITISV_030334 [Vitis vinifera]
Length=1442

 Score =   126 bits (316),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 59/140 (42%), Positives = 86/140 (61%), Gaps = 0/140 (0%)
 Frame = -3

Query  469   DPDIPDHICPLQRSLYGLK*APRAWFKRLHDFLLLTGFIAWKTDVSLFHYSAGNSRVFLL  290
             D   PDH+C L++++YGL+ APRAW+  L   L   GF   K D SLF Y+ G    + L
Sbjct  998   DTSKPDHVCRLRKAIYGLRQAPRAWYTTLRTALFQLGFKNSKADSSLFIYTHGPIICYFL  1057

Query  289   VYVDDIIMLGNDAVLVDSLLRKLATAFKIRDLGKPTFFLSIETLVVPEGMILSQRRYMRD  110
             VYVDD+++ GND   VD +++KL   F ++D+G  +FFL +E +    G+ LSQ +Y+RD
Sbjct  1058  VYVDDLVITGNDIQFVDHIIQKLGENFSLKDMGNHSFFLGVEVIPTRAGLFLSQHQYIRD  1117

Query  109   ILHRVGMTDCKSLATPASVT  50
             +L    M   K ++TP S T
Sbjct  1118  LLSTTNMLGAKDVSTPLSTT  1137



>ref|YP_002000554.1| orf490 [Oryza sativa Japonica Group]
 dbj|BAC19858.1| orf490 [Oryza sativa Japonica Group]
Length=490

 Score =   122 bits (307),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 62/135 (46%), Positives = 83/135 (61%), Gaps = 0/135 (0%)
 Frame = -3

Query  454  DHICPLQRSLYGLK*APRAWFKRLHDFLLLTGFIAWKTDVSLFHYSAGNSRVFLLVYVDD  275
            D++C L ++LYGL+ APRAWF RL   L   GF   K D SLF Y  G   +F+L+YVDD
Sbjct  122  DYVCKLDKALYGLRHAPRAWFSRLSMKLQNLGFQPSKADASLFFYKKGTISIFVLIYVDD  181

Query  274  IIMLGNDAVLVDSLLRKLATAFKIRDLGKPTFFLSIETLVVPEGMILSQRRYMRDILHRV  95
            II+  +      +LL+ L   F ++DLG   +FL IE   V +G+IL+Q +Y  D+L RV
Sbjct  182  IIVASSCEKATSALLQDLKEEFALKDLGALHYFLGIEVNKVHDGIILTQEKYATDLLKRV  241

Query  94   GMTDCKSLATPASVT  50
            GM  CK + TP S T
Sbjct  242  GMHGCKEINTPLSTT  256



>gb|KFK33814.1| hypothetical protein AALP_AA5G063400 [Arabis alpina]
Length=563

 Score =   123 bits (309),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 59/140 (42%), Positives = 89/140 (64%), Gaps = 0/140 (0%)
 Frame = -3

Query  469  DPDIPDHICPLQRSLYGLK*APRAWFKRLHDFLLLTGFIAWKTDVSLFHYSAGNSRVFLL  290
            D D P+++C L +++YGLK APRAW+  LH+FL+  GF     D SLF    GN+ V+LL
Sbjct  186  DNDHPNYVCRLHKAIYGLKQAPRAWYTELHNFLITLGFNNSLADTSLFVLQNGNTLVYLL  245

Query  289  VYVDDIIMLGNDAVLVDSLLRKLATAFKIRDLGKPTFFLSIETLVVPEGMILSQRRYMRD  110
            VYVDDI++ GN    +  +L+ LA  F I+D  +  +FL +E      G+ ++QR+Y+ D
Sbjct  246  VYVDDILITGNSTSGIQHILQLLADRFSIKDPEELHYFLGLEAHRTTLGLHINQRKYILD  305

Query  109  ILHRVGMTDCKSLATPASVT  50
            ILH+  MT+ K + TP + +
Sbjct  306  ILHKYNMTNAKPVMTPMATS  325



>gb|KFK27477.1| hypothetical protein AALP_AA8G388700 [Arabis alpina]
Length=1336

 Score =   125 bits (315),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 59/136 (43%), Positives = 83/136 (61%), Gaps = 0/136 (0%)
 Frame = -3

Query  469  DPDIPDHICPLQRSLYGLK*APRAWFKRLHDFLLLTGFIAWKTDVSLFHYSAGNSRVFLL  290
            D + PDH+  L +++YGLK APR WF +  ++LL  GF   K D SLF Y    + V LL
Sbjct  861  DSEYPDHVWKLHKAVYGLKQAPREWFNKFSNYLLEFGFKCCKKDPSLFSYQKDGNIVLLL  920

Query  289  VYVDDIIMLGNDAVLVDSLLRKLATAFKIRDLGKPTFFLSIETLVVPEGMILSQRRYMRD  110
            +YVDD+++ GN+  L+D LL  L   F+++D+G   +FL I+    P G+ LSQ RY  D
Sbjct  921  LYVDDMLLTGNNKDLIDQLLVVLKKEFRMKDMGPLHYFLGIQATYHPAGLFLSQHRYAED  980

Query  109  ILHRVGMTDCKSLATP  62
            +L   GM DC  + TP
Sbjct  981  LLFVAGMADCSLMPTP  996



>ref|XP_008671960.1| PREDICTED: uncharacterized protein LOC103649473 [Zea mays]
Length=1477

 Score =   125 bits (315),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 62/134 (46%), Positives = 83/134 (62%), Gaps = 0/134 (0%)
 Frame = -3

Query  460   IPDHICPLQRSLYGLK*APRAWFKRLHDFLLLTGFIAWKTDVSLFHYSAGNSRVFLLVYV  281
             + DH+C L +SLYGLK APRAW+      +   GFI  KTD SLF Y  G +  +LL+YV
Sbjct  1172  VSDHVCRLNKSLYGLKQAPRAWYSCFASHIRSLGFIEAKTDTSLFIYRHGTASAYLLLYV  1231

Query  280   DDIIMLGNDAVLVDSLLRKLATAFKIRDLGKPTFFLSIETLVVPEGMILSQRRYMRDILH  101
             DDII+  + + L+  ++  L  +F ++DLG    FL I       GM+LSQR+Y  +IL 
Sbjct  1232  DDIILTASTSALLRQIISSLQQSFPMKDLGPLHHFLGITVTRSATGMLLSQRQYTLEILE  1291

Query  100   RVGMTDCKSLATPA  59
             R GMT CK+ ATPA
Sbjct  1292  RAGMTGCKTCATPA  1305



>dbj|BAB10876.1| polyprotein [Arabidopsis thaliana]
Length=1429

 Score =   125 bits (315),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 64/140 (46%), Positives = 90/140 (64%), Gaps = 1/140 (1%)
 Frame = -3

Query  469   DPDIPDHICPLQRSLYGLK*APRAWFKRLHDFLLLTGFIAWKTDVSLFHYSAGNSRVFLL  290
             D D P H+C L ++LYGLK APRAW++ L  FLL  GF+    D SLF Y+  N+ +++L
Sbjct  1053  DRDRPSHVCRLNKALYGLKQAPRAWYQELRRFLLQAGFVNSLADASLFIYNRHNTFMYVL  1112

Query  289   VYVDDIIMLGNDAVLVDSLLRKLATAFKIRDLGKPTFFLSIETLVVPEGMILSQRRYMRD  110
             VYVDDII+ G +A LV +    LA+ F ++DLG  ++FL IE      G+ L QR+Y+ D
Sbjct  1113  VYVDDIIIAGENA-LVQAFNASLASRFSLKDLGPLSYFLGIEATRTSRGLHLMQRKYITD  1171

Query  109   ILHRVGMTDCKSLATPASVT  50
             +L +  M D K ++TP S T
Sbjct  1172  LLKKHNMLDTKPVSTPMSPT  1191



>emb|CAN68480.1| hypothetical protein VITISV_007280 [Vitis vinifera]
Length=619

 Score =   124 bits (310),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 61/136 (45%), Positives = 86/136 (63%), Gaps = 0/136 (0%)
 Frame = -3

Query  469  DPDIPDHICPLQRSLYGLK*APRAWFKRLHDFLLLTGFIAWKTDVSLFHYSAGNSRVFLL  290
            D D P H+C L +++YGLK APR W+  L  FL+  GF    +D SLF   AG + ++LL
Sbjct  272  DADKPTHVCKLHKAIYGLKQAPRTWYHELCQFLVDFGFKNSHSDTSLFVLHAGTNLLYLL  331

Query  289  VYVDDIIMLGNDAVLVDSLLRKLATAFKIRDLGKPTFFLSIETLVVPEGMILSQRRYMRD  110
            VYVDDII+ GN   LV  ++  LA  F ++DLG  ++FL +E +    G++LSQRRY++D
Sbjct  332  VYVDDIIITGNSDDLVSQVVECLAQRFSLKDLGPLSYFLGVEVVHHRHGLLLSQRRYIKD  391

Query  109  ILHRVGMTDCKSLATP  62
            +L R  M   K + TP
Sbjct  392  LLTRTNMQAIKPIHTP  407



>ref|XP_002446435.1| hypothetical protein SORBIDRAFT_06g016046 [Sorghum bicolor]
 gb|EES10763.1| hypothetical protein SORBIDRAFT_06g016046 [Sorghum bicolor]
Length=856

 Score =   125 bits (313),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 62/136 (46%), Positives = 82/136 (60%), Gaps = 0/136 (0%)
 Frame = -3

Query  469  DPDIPDHICPLQRSLYGLK*APRAWFKRLHDFLLLTGFIAWKTDVSLFHYSAGNSRVFLL  290
            DP +P H+C L +SLYGLK APRAW+ R   FLL  GF   K+D SLF Y  G   V+LL
Sbjct  488  DPALPGHVCKLNKSLYGLKQAPRAWYSRFASFLLSLGFSEAKSDTSLFIYRRGTETVYLL  547

Query  289  VYVDDIIMLGNDAVLVDSLLRKLATAFKIRDLGKPTFFLSIETLVVPEGMILSQRRYMRD  110
            +YVDDI++  +   L+  ++  L   F ++DLG    FL +      + + LSQR+Y  D
Sbjct  548  LYVDDIVLTASSIQLLHRVIAALKKEFAMKDLGPLHHFLGVAVQRHKDQLTLSQRQYTLD  607

Query  109  ILHRVGMTDCKSLATP  62
            IL R GM+DCK   TP
Sbjct  608  ILARHGMSDCKPCTTP  623



>ref|XP_008675247.1| PREDICTED: uncharacterized protein LOC103651388 isoform X1 [Zea 
mays]
Length=1371

 Score =   125 bits (314),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 63/154 (41%), Positives = 92/154 (60%), Gaps = 2/154 (1%)
 Frame = -3

Query  469   DPDIPDHICPLQRSLYGLK*APRAWFKRLHDFLLLTGFIAWKTDVSLFHYSAGNSRVFLL  290
             DP  PD +C L +SLYGLK APRAW+ R   +L+   F+  K+D SLF +  G+   +LL
Sbjct  1207  DPAHPDFVCRLNKSLYGLKQAPRAWYSRFATYLVSLNFVEAKSDTSLFVFHQGSDTAYLL  1266

Query  289   VYVDDIIMLGNDAVLVDSLLRKLATAFKIRDLGKPTFFLSIETLVVPEGMILSQRRYMRD  110
             +YVDDI++  +   L+  ++  L   F ++DLG    FL ++     +GM+LSQR+YM D
Sbjct  1267  LYVDDIVLTASSTHLLRKVILALQREFAMKDLGALHHFLGMQVQRTSDGMVLSQRQYMLD  1326

Query  109   ILHRVGMTDCKSLATPASVTQPVCQSTDSFANIS  8
             IL R GM +CK   TP   +  +  S DS A ++
Sbjct  1327  ILDRAGMAECKPCTTPVDTSPKI--SADSGAPVT  1358



>gb|AAF63122.1|AC009526_7 Hypothetical protein [Arabidopsis thaliana]
Length=559

 Score =   123 bits (308),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 57/136 (42%), Positives = 83/136 (61%), Gaps = 0/136 (0%)
 Frame = -3

Query  469  DPDIPDHICPLQRSLYGLK*APRAWFKRLHDFLLLTGFIAWKTDVSLFHYSAGNSRVFLL  290
            D + P H+C L ++LYGLK APRAWF +  ++LL  GF     D+SLF Y  GN  + LL
Sbjct  265  DKNKPTHVCHLHKALYGLKQAPRAWFDKFSNYLLEFGFSCSVKDLSLFIYIKGNDLILLL  324

Query  289  VYVDDIIMLGNDAVLVDSLLRKLATAFKIRDLGKPTFFLSIETLVVPEGMILSQRRYMRD  110
            +YVDD+++ GN +  +  LL  L   F+++DLG+  +FL I+      G+ LSQ++Y  D
Sbjct  325  LYVDDMVLTGNSSATLAKLLEDLNIHFRMKDLGQMHYFLGIQAHFHENGLFLSQQKYAED  384

Query  109  ILHRVGMTDCKSLATP  62
            +L    M DC  + TP
Sbjct  385  LLTIAAMEDCSPMPTP  400



>dbj|BAM44535.1| polyprotein [Arabidopsis thaliana]
Length=1475

 Score =   125 bits (314),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 61/140 (44%), Positives = 89/140 (64%), Gaps = 0/140 (0%)
 Frame = -3

Query  469   DPDIPDHICPLQRSLYGLK*APRAWFKRLHDFLLLTGFIAWKTDVSLFHYSAGNSRVFLL  290
             D + PD++C L++++YGLK APRAW+  L  +LL  GF+   +D SLF    G S +++L
Sbjct  1091  DKERPDYVCRLRKAIYGLKQAPRAWYVELRTYLLTVGFVNSISDTSLFVLQRGRSIIYML  1150

Query  289   VYVDDIIMLGNDAVLVDSLLRKLATAFKIRDLGKPTFFLSIETLVVPEGMILSQRRYMRD  110
             VYVDDI++ GND VL+   L  L+  F +++     +FL IE   VP+G+ LSQRRY  D
Sbjct  1151  VYVDDILITGNDTVLLKHTLDALSQRFSVKEHEDLHYFLGIEAKRVPQGLHLSQRRYTLD  1210

Query  109   ILHRVGMTDCKSLATPASVT  50
             +L R  M   K +ATP + +
Sbjct  1211  LLARTNMLTAKPVATPMATS  1230



>dbj|BAM42646.1| polyprotein [Arabidopsis thaliana]
Length=1475

 Score =   125 bits (313),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 61/140 (44%), Positives = 89/140 (64%), Gaps = 0/140 (0%)
 Frame = -3

Query  469   DPDIPDHICPLQRSLYGLK*APRAWFKRLHDFLLLTGFIAWKTDVSLFHYSAGNSRVFLL  290
             D + PD++C L++++YGLK APRAW+  L  +LL  GF+   +D SLF    G S +++L
Sbjct  1091  DKNRPDYVCRLRKAIYGLKQAPRAWYVELRTYLLTVGFVNSISDTSLFVLQRGRSIIYML  1150

Query  289   VYVDDIIMLGNDAVLVDSLLRKLATAFKIRDLGKPTFFLSIETLVVPEGMILSQRRYMRD  110
             VYVDDI++ GND VL+   L  L+  F +++     +FL IE   VP+G+ LSQRRY  D
Sbjct  1151  VYVDDILITGNDTVLLKHTLDALSQRFSVKEHEDLHYFLGIEAKRVPQGLHLSQRRYTLD  1210

Query  109   ILHRVGMTDCKSLATPASVT  50
             +L R  M   K +ATP + +
Sbjct  1211  LLARTNMLTAKPVATPMATS  1230



>emb|CAN67073.1| hypothetical protein VITISV_011746 [Vitis vinifera]
Length=879

 Score =   124 bits (312),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 60/139 (43%), Positives = 87/139 (63%), Gaps = 0/139 (0%)
 Frame = -3

Query  469  DPDIPDHICPLQRSLYGLK*APRAWFKRLHDFLLLTGFIAWKTDVSLFHYSAGNSRVFLL  290
            + + PD++C L +SLYGLK APRAWF RL   LL  GF++   D SLF Y  G+  +F+L
Sbjct  538  NSEFPDYVCKLNKSLYGLKQAPRAWFMRLSQTLLEFGFLSSPVDASLFVYHKGHIHLFIL  597

Query  289  VYVDDIIMLGNDAVLVDSLLRKLATAFKIRDLGKPTFFLSIETLVVPEGMILSQRRYMRD  110
            +YVDDI++ G    L+ SL++KL T FK++DLG   +FL I+      G+ L Q +Y+ D
Sbjct  598  IYVDDILVTGTXPSLIXSLIQKLQTEFKMKDLGPLGYFLGIQASRDSSGLHLXQSKYIGD  657

Query  109  ILHRVGMTDCKSLATPASV  53
            +L R  M   K  ++P + 
Sbjct  658  LLQRTKMAGAKPASSPCTT  676



>gb|ABA97652.1| retrotransposon protein, putative, Ty1-copia subclass [Oryza 
sativa Japonica Group]
Length=1145

 Score =   125 bits (313),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 63/141 (45%), Positives = 88/141 (62%), Gaps = 0/141 (0%)
 Frame = -3

Query  469   DPDIPDHICPLQRSLYGLK*APRAWFKRLHDFLLLTGFIAWKTDVSLFHYSAGNSRVFLL  290
             D   P++IC L +SLYGLK APRAWF RL   L+  GF   K D S F    G+  +F+L
Sbjct  887   DVTKPNYICKLDKSLYGLKQAPRAWFARLSKKLMELGFSGSKADTSSFFLHKGDITIFVL  946

Query  289   VYVDDIIMLGNDAVLVDSLLRKLATAFKIRDLGKPTFFLSIETLVVPEGMILSQRRYMRD  110
             VYVDDII+  +      +LL+ L   F ++DLG+  +FL IE   V  G++L+Q +Y  D
Sbjct  947   VYVDDIIVASSSERGTMALLQDLKEEFALKDLGELHYFLGIEVSKVHNGIVLTQDKYATD  1006

Query  109   ILHRVGMTDCKSLATPASVTQ  47
             +L +VGM +CK + TP SV++
Sbjct  1007  LLKKVGMMNCKPVTTPMSVSE  1027



>ref|XP_011016404.1| PREDICTED: uncharacterized protein LOC105119910 [Populus euphratica]
Length=987

 Score =   124 bits (312),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 59/140 (42%), Positives = 90/140 (64%), Gaps = 0/140 (0%)
 Frame = -3

Query  469  DPDIPDHICPLQRSLYGLK*APRAWFKRLHDFLLLTGFIAWKTDVSLFHYSAGNSRVFLL  290
            +PD PD++C L +++YGLK A RAW+  L   L   GF+  K+D SLF +  G++ V+ L
Sbjct  658  NPDHPDYVCCLTKAIYGLKQASRAWYTALKHALTEFGFLNSKSDSSLFVFHNGSTLVYCL  717

Query  289  VYVDDIIMLGNDAVLVDSLLRKLATAFKIRDLGKPTFFLSIETLVVPEGMILSQRRYMRD  110
            VYVDD+I+ GN++V V S++  L   F I+DLG   FFL +E +    G+ L+Q +Y+RD
Sbjct  718  VYVDDLIITGNNSVFVASIIDHLGQNFSIKDLGLLHFFLGVEVIPTTAGLFLTQHKYIRD  777

Query  109  ILHRVGMTDCKSLATPASVT  50
            +L +  MT  + + TP S +
Sbjct  778  LLAKTNMTGARDVTTPFSTS  797



>emb|CAN81099.1| hypothetical protein VITISV_017741 [Vitis vinifera]
Length=1455

 Score =   125 bits (313),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 59/136 (43%), Positives = 88/136 (65%), Gaps = 0/136 (0%)
 Frame = -3

Query  469   DPDIPDHICPLQRSLYGLK*APRAWFKRLHDFLLLTGFIAWKTDVSLFHYSAGNSRVFLL  290
             D   P+ +C L ++LYGLK APRAWF++LH  LL  GF++ K+D SLF     N   ++L
Sbjct  1069  DEQNPNLVCRLHKALYGLKQAPRAWFEKLHRALLSFGFVSAKSDQSLFLRFTPNHITYVL  1128

Query  289   VYVDDIIMLGNDAVLVDSLLRKLATAFKIRDLGKPTFFLSIETLVVPEGMILSQRRYMRD  110
             VYVDDI+++G+D   + SL+ +L + F ++DLG+  +FL I+      G+ LSQ +Y+RD
Sbjct  1129  VYVDDILVIGSDTAAITSLIAQLNSEFSLKDLGEVHYFLGIQVSHTNNGLHLSQTKYIRD  1188

Query  109   ILHRVGMTDCKSLATP  62
             +L +  M  CK   TP
Sbjct  1189  LLQKTKMVHCKPARTP  1204



>emb|CAN74243.1| hypothetical protein VITISV_037117 [Vitis vinifera]
Length=809

 Score =   124 bits (310),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 58/152 (38%), Positives = 91/152 (60%), Gaps = 0/152 (0%)
 Frame = -3

Query  469  DPDIPDHICPLQRSLYGLK*APRAWFKRLHDFLLLTGFIAWKTDVSLFHYSAGNSRVFLL  290
            DP  P H+C L+R+LYGLK APRAWF     FLL  GF++ + D SLF Y +    ++LL
Sbjct  476  DPQFPXHVCRLKRALYGLKQAPRAWFHXFSSFLLKLGFLSSQADSSLFVYHSLVGTIYLL  535

Query  289  VYVDDIIMLGNDAVLVDSLLRKLATAFKIRDLGKPTFFLSIETLVVPEGMILSQRRYMRD  110
             YVDD+++ G+++ +V +L+  L+  F ++DLG   +FL  E     +G+ LSQ +Y  +
Sbjct  536  FYVDDMVITGSNSSMVQTLITXLSKEFSMKDLGDLHYFLGXEVQANEKGLFLSQTKYALE  595

Query  109  ILHRVGMTDCKSLATPASVTQPVCQSTDSFAN  14
            +L R    D K ++TP  + Q +      F++
Sbjct  596  LLQRASXIDAKPISTPCVIDQHLSTEXKLFSD  627



>dbj|BAA78427.1| polyprotein [Arabidopsis thaliana]
Length=1421

 Score =   124 bits (312),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 61/140 (44%), Positives = 88/140 (63%), Gaps = 0/140 (0%)
 Frame = -3

Query  469   DPDIPDHICPLQRSLYGLK*APRAWFKRLHDFLLLTGFIAWKTDVSLFHYSAGNSRVFLL  290
             D + PD+ C L++++YGLK APRAW+  L  +LL  GF+   +D SLF    G S +++L
Sbjct  1091  DKNRPDYFCRLKKAIYGLKQAPRAWYVELQTYLLTVGFVNSISDTSLFVLQRGRSIIYML  1150

Query  289   VYVDDIIMLGNDAVLVDSLLRKLATAFKIRDLGKPTFFLSIETLVVPEGMILSQRRYMRD  110
             VYVDDI++ GND VL+   L  L+  F +++     +FL IE   VP+G+ LSQRRY  D
Sbjct  1151  VYVDDILITGNDTVLLKHTLDALSQRFSVKEHEDLHYFLGIEAKRVPQGLHLSQRRYTLD  1210

Query  109   ILHRVGMTDCKSLATPASVT  50
             +L R  M   K +ATP + +
Sbjct  1211  LLARTNMLTAKPVATPMATS  1230



>gb|ABA93844.2| retrotransposon protein, putative, unclassified [Oryza sativa 
Japonica Group]
Length=1099

 Score =   124 bits (311),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 62/136 (46%), Positives = 84/136 (62%), Gaps = 0/136 (0%)
 Frame = -3

Query  469  DPDIPDHICPLQRSLYGLK*APRAWFKRLHDFLLLTGFIAWKTDVSLFHYSAGNSRVFLL  290
            D   PD +C L +SLYGLK APRAW+ R   +LL  GF   K+D SLF Y  G+  V+LL
Sbjct  727  DTTRPDMVCRLNKSLYGLKQAPRAWYSRFASYLLTLGFTKAKSDTSLFIYHRGSDLVYLL  786

Query  289  VYVDDIIMLGNDAVLVDSLLRKLATAFKIRDLGKPTFFLSIETLVVPEGMILSQRRYMRD  110
            +YVDDI++  + A L+   ++ L   F ++DLG    FL I       G++LSQR+Y  +
Sbjct  787  LYVDDIVLTASSAGLLRWAIQALQAEFSMKDLGTLHHFLGITVTSDSSGLLLSQRQYSIE  846

Query  109  ILHRVGMTDCKSLATP  62
            IL R GM+DCK  +TP
Sbjct  847  ILERAGMSDCKPCSTP  862



>ref|XP_002438095.1| hypothetical protein SORBIDRAFT_10g007953 [Sorghum bicolor]
 gb|EER89462.1| hypothetical protein SORBIDRAFT_10g007953 [Sorghum bicolor]
Length=1330

 Score =   124 bits (311),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 62/136 (46%), Positives = 81/136 (60%), Gaps = 0/136 (0%)
 Frame = -3

Query  469   DPDIPDHICPLQRSLYGLK*APRAWFKRLHDFLLLTGFIAWKTDVSLFHYSAGNSRVFLL  290
             D   PD +C L +SLYGLK APRAW  R   FLL  GF+  K+D SLF Y  G    +LL
Sbjct  955   DSSCPDMVCRLNKSLYGLKQAPRAWNHRFAGFLLTLGFVEAKSDTSLFIYHHGAETAYLL  1014

Query  289   VYVDDIIMLGNDAVLVDSLLRKLATAFKIRDLGKPTFFLSIETLVVPEGMILSQRRYMRD  110
             +YVDDI++  +   L+  ++  L   F ++DLG    FL +     P G++L QR+Y  D
Sbjct  1015  LYVDDIVLTTSTESLLRRIIASLQQEFAMKDLGALHHFLGVTVEPHPAGLLLHQRQYTLD  1074

Query  109   ILHRVGMTDCKSLATP  62
             IL R GMTDCK  +TP
Sbjct  1075  ILERAGMTDCKPCSTP  1090



>ref|XP_002489193.1| hypothetical protein SORBIDRAFT_0013s009070 [Sorghum bicolor]
 gb|EES20288.1| hypothetical protein SORBIDRAFT_0013s009070 [Sorghum bicolor]
Length=1219

 Score =   124 bits (311),  Expect = 2e-29, Method: Composition-based stats.
 Identities = 63/148 (43%), Positives = 85/148 (57%), Gaps = 1/148 (1%)
 Frame = -3

Query  469  DPDIPDHICPLQRSLYGLK*APRAWFKRLHDFLLLTGFIAWKTDVSLFHYSAGNSRVFLL  290
            D   PDH+C LQ+SLYGLK APRAW++R   F+  +GF A  +D SLF Y  G    +LL
Sbjct  398  DSAAPDHVCLLQKSLYGLKQAPRAWYQRFGSFVQQSGFTASTSDSSLFVYKEGADTAYLL  457

Query  289  VYVDDIIMLGNDAVLVDSLLRKLATAFKIRDLGKPTFFLSIETLVVPEGMILSQRRYMRD  110
            +YVDDII+  +   L+  +   L + F + DLG    FL I       G+ LSQR+Y  +
Sbjct  458  LYVDDIILTASSPALLRRITELLHSEFAMTDLGDLHHFLGIAVTRTTGGLFLSQRQYAVE  517

Query  109  ILHRVGMTDCKSLATPASVTQPVCQSTD  26
            +L   GM +C S ATP   T+    +TD
Sbjct  518  LLQHAGMAECHSTATPVD-TRAKLSATD  544



>gb|ACV42639.1| gag/pol [Oryza sativa Japonica Group]
Length=1448

 Score =   124 bits (311),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 61/136 (45%), Positives = 86/136 (63%), Gaps = 0/136 (0%)
 Frame = -3

Query  454   DHICPLQRSLYGLK*APRAWFKRLHDFLLLTGFIAWKTDVSLFHYSAGNSRVFLLVYVDD  275
             D++C L ++LYGLK APRAW+ RL   L   GF A K D SLF  + G   +F+LVYVDD
Sbjct  1077  DYVCKLNKALYGLKQAPRAWYSRLSKKLTELGFEASKADTSLFFLNKGGIIMFVLVYVDD  1136

Query  274   IIMLGNDAVLVDSLLRKLATAFKIRDLGKPTFFLSIETLVVPEGMILSQRRYMRDILHRV  95
             II+  +      +LL+ L   F ++DLG   +FL IE   V  G+IL+Q +Y  D+L RV
Sbjct  1137  IIVASSTEKATTALLKDLNKEFTLKDLGDLHYFLGIEVTKVSNGVILTQEKYANDMLKRV  1196

Query  94    GMTDCKSLATPASVTQ  47
              M++C  ++TP SV++
Sbjct  1197  NMSNCTPVSTPLSVSE  1212



>emb|CAN83352.1| hypothetical protein VITISV_022160 [Vitis vinifera]
Length=1087

 Score =   124 bits (310),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 58/139 (42%), Positives = 85/139 (61%), Gaps = 0/139 (0%)
 Frame = -3

Query  469  DPDIPDHICPLQRSLYGLK*APRAWFKRLHDFLLLTGFIAWKTDVSLFHYSAGNSRVFLL  290
            D   PDH+C L++++YGL+ APRAW+  L   L   GF   K D SLF Y+ G    + L
Sbjct  742  DTSKPDHVCQLRKAIYGLRQAPRAWYTALRTALFQLGFKNSKADSSLFIYTHGPIICYFL  801

Query  289  VYVDDIIMLGNDAVLVDSLLRKLATAFKIRDLGKPTFFLSIETLVVPEGMILSQRRYMRD  110
            VYVDD+++ GND   VD +++KL   F ++D+G  +FFL +E +    G+ LSQ +Y+RD
Sbjct  802  VYVDDLVITGNDIQFVDHIIQKLGEIFSLKDMGNLSFFLGVEVIPTRAGLFLSQHQYIRD  861

Query  109  ILHRVGMTDCKSLATPASV  53
            +L    M   K ++TP S 
Sbjct  862  LLSTTNMLGAKDVSTPLST  880



>emb|CAE04646.2| OSJNBa0061G20.2 [Oryza sativa Japonica Group]
Length=542

 Score =   121 bits (304),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 61/147 (41%), Positives = 84/147 (57%), Gaps = 0/147 (0%)
 Frame = -3

Query  469  DPDIPDHICPLQRSLYGLK*APRAWFKRLHDFLLLTGFIAWKTDVSLFHYSAGNSRVFLL  290
            DP  PD +C L++SLYGLK APRAWF+R    L   GF++ K+D SLF    G     LL
Sbjct  158  DPSQPDAVCLLRKSLYGLKQAPRAWFQRFGTHLHHLGFVSSKSDNSLFVLRRGTDEAHLL  217

Query  289  VYVDDIIMLGNDAVLVDSLLRKLATAFKIRDLGKPTFFLSIETLVVPEGMILSQRRYMRD  110
            +YVDDI++  +   L+  ++ +L   F ++DLG   FFL I+     +G  LSQ +Y  D
Sbjct  218  LYVDDIVLAASSQRLLQHIINQLRVEFAMKDLGPVHFFLGIQVRRTADGFFLSQEQYAGD  277

Query  109  ILHRVGMTDCKSLATPASVTQPVCQST  29
            +L R G+ DCK   TP      V  +T
Sbjct  278  VLDRAGLADCKPAPTPIDTKAKVSSTT  304



>emb|CAN66863.1| hypothetical protein VITISV_013500 [Vitis vinifera]
Length=1112

 Score =   124 bits (310),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 60/143 (42%), Positives = 91/143 (64%), Gaps = 1/143 (1%)
 Frame = -3

Query  469  DPDIPDHICPLQRSLYGLK*APRAWFKRLHDFLLLTGFIAWKTDVSLFHYSAGNSRVFLL  290
            D D P H+C L++++YGLK APRAW+  L  FLL  GFI    D SLF ++   + ++LL
Sbjct  750  DRDHPHHVCKLRKAIYGLKQAPRAWYHELRQFLLQFGFINSIVDTSLFIFNNHGTILYLL  809

Query  289  VYVDDIIMLGNDAVLVDSLLRKLATAFKIRDLGKPTFFLSIETLVVPEGMILSQRRYMRD  110
            V+VDDII+ GN+     + +++L+  F ++DLG  T+FL +E      G+ LSQ +Y+ D
Sbjct  810  VHVDDIIITGNNVEAAQTFIQQLSQRFSLKDLGPLTYFLGVEVTSHTNGLFLSQHKYIAD  869

Query  109  ILHRVGMTDCKSLATPASVTQPV  41
            +L+R  MT+ K   TP + T P+
Sbjct  870  LLNRTHMTEAKPAPTPLA-TSPI  891



>emb|CAE04319.3| OSJNBb0016D16.10 [Oryza sativa Japonica Group]
Length=950

 Score =   123 bits (309),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 61/137 (45%), Positives = 88/137 (64%), Gaps = 0/137 (0%)
 Frame = -3

Query  457  PDHICPLQRSLYGLK*APRAWFKRLHDFLLLTGFIAWKTDVSLFHYSAGNSRVFLLVYVD  278
            P+++C L ++LYGLK A RAW+ RL   L+  GF A K D SLF  + G   +F+LVYVD
Sbjct  141  PNYVCKLDKALYGLKQATRAWYSRLSKKLVELGFEASKADTSLFFLNKGGIIMFVLVYVD  200

Query  277  DIIMLGNDAVLVDSLLRKLATAFKIRDLGKPTFFLSIETLVVPEGMILSQRRYMRDILHR  98
            DII+  +      +LL+ L   F ++DLG   +FL IE   V  G+IL+Q +Y  D+L R
Sbjct  201  DIIVASSTEKATTALLKDLNKEFALKDLGDLHYFLGIEVTKVSNGIILTQEKYANDLLKR  260

Query  97   VGMTDCKSLATPASVTQ  47
            V M++CK ++TP SV++
Sbjct  261  VNMSNCKPVSTPLSVSE  277



>ref|XP_010236748.1| PREDICTED: uncharacterized protein LOC104584242 [Brachypodium 
distachyon]
Length=868

 Score =   123 bits (308),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 60/145 (41%), Positives = 86/145 (59%), Gaps = 0/145 (0%)
 Frame = -3

Query  469  DPDIPDHICPLQRSLYGLK*APRAWFKRLHDFLLLTGFIAWKTDVSLFHYSAGNSRVFLL  290
            DP +P  +C L +SLYGLK +PRAW+ RL   L   GF   + D SLF Y  G   +F+L
Sbjct  667  DPTLPHFVCKLDKSLYGLKQSPRAWYSRLSSKLQELGFRLSQADTSLFVYQQGGVTIFML  726

Query  289  VYVDDIIMLGNDAVLVDSLLRKLATAFKIRDLGKPTFFLSIETLVVPEGMILSQRRYMRD  110
            +YVDDII+  + +     L+  L+ AF ++DLG   +FL IE       ++L Q +Y  D
Sbjct  727  IYVDDIIIASSCSAAAQRLVHDLSAAFALKDLGSLDYFLGIEVSRSKNAIMLRQTKYTTD  786

Query  109  ILHRVGMTDCKSLATPASVTQPVCQ  35
            +L RVGM DCK  +TP +V + + +
Sbjct  787  LLARVGMKDCKPASTPMAVAEKLSR  811



>ref|XP_008240661.1| PREDICTED: uncharacterized protein LOC103339149 [Prunus mume]
Length=934

 Score =   123 bits (308),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 61/141 (43%), Positives = 86/141 (61%), Gaps = 0/141 (0%)
 Frame = -3

Query  469  DPDIPDHICPLQRSLYGLK*APRAWFKRLHDFLLLTGFIAWKTDVSLFHYSAGNSRVFLL  290
            D   P+++C LQRS+YGLK APRAWF R  +FLL  GF A   D SLF Y+     + LL
Sbjct  708  DQQYPNYVCKLQRSIYGLKQAPRAWFHRFSEFLLQLGFEASTCDYSLFVYNHRGIYLILL  767

Query  289  VYVDDIIMLGNDAVLVDSLLRKLATAFKIRDLGKPTFFLSIETLVVPEGMILSQRRYMRD  110
            +YVDDI++ GN +  +  L++KL T F ++DLG   +FL +E   + + M L+Q +Y  D
Sbjct  768  IYVDDILLTGNSSRQMGCLIKKLGTLFSMKDLGPLHYFLGVEVQYMNDQMHLNQAKYALD  827

Query  109  ILHRVGMTDCKSLATPASVTQ  47
            +L R    D K ++TP    Q
Sbjct  828  LLKRTNFLDAKPISTPVPCGQ  848



>emb|CAN71553.1| hypothetical protein VITISV_034738 [Vitis vinifera]
Length=1312

 Score =   123 bits (309),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 56/139 (40%), Positives = 89/139 (64%), Gaps = 0/139 (0%)
 Frame = -3

Query  469   DPDIPDHICPLQRSLYGLK*APRAWFKRLHDFLLLTGFIAWKTDVSLFHYSAGNSRVFLL  290
             D   P H+C LQ++LYGLK APRAWF +L  FLL  GF   + D SLF++ + +  + LL
Sbjct  931   DNSCPTHVCRLQKALYGLKQAPRAWFHKLSSFLLQIGFQCSRADASLFYFHSASDIIILL  990

Query  289   VYVDDIIMLGNDAVLVDSLLRKLATAFKIRDLGKPTFFLSIETLVVPEGMILSQRRYMRD  110
             +YVDDI++ G++   V  ++ +L++ F +RDLG  ++FL IE       + L+Q+RY+  
Sbjct  991   IYVDDILITGSNPSRVHQIISQLSSHFALRDLGDISYFLGIEVTRRSHALHLNQQRYIHQ  1050

Query  109   ILHRVGMTDCKSLATPASV  53
             +L R  + + KS +TP ++
Sbjct  1051  LLERANLHEAKSASTPGAL  1069



>emb|CAN64816.1| hypothetical protein VITISV_010668 [Vitis vinifera]
Length=1212

 Score =   123 bits (309),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 56/141 (40%), Positives = 88/141 (62%), Gaps = 0/141 (0%)
 Frame = -3

Query  469   DPDIPDHICPLQRSLYGLK*APRAWFKRLHDFLLLTGFIAWKTDVSLFHYSAGNSRVFLL  290
             +P  P H+C L+R+LYGLK APRAWF R   FLL  GF + + D SLF Y +    ++LL
Sbjct  866   NPQFPQHVCRLKRALYGLKQAPRAWFHRFSSFLLKLGFFSNQXDSSLFVYHSSVGTIYLL  925

Query  289   VYVDDIIMLGNDAVLVDSLLRKLATAFKIRDLGKPTFFLSIETLVVPEGMILSQRRYMRD  110
             +YVDD+++  +++ +V +L+ +L+  F ++DL    +FL +E     +G+ LSQ +Y  +
Sbjct  926   LYVDDMVITXSNSSMVQTLITQLSKEFSMKDLSDLHYFLGVEVQANEKGLFLSQTKYALE  985

Query  109   ILHRVGMTDCKSLATPASVTQ  47
             +L    M D K ++TP  V Q
Sbjct  986   LLQHASMIDAKPISTPCVVGQ  1006



>gb|AAF02855.1|AC009324_4 Similar to retrotransposon proteins [Arabidopsis thaliana]
Length=1522

 Score =   123 bits (309),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 58/136 (43%), Positives = 85/136 (63%), Gaps = 0/136 (0%)
 Frame = -3

Query  469   DPDIPDHICPLQRSLYGLK*APRAWFKRLHDFLLLTGFIAWKTDVSLFHYSAGNSRVFLL  290
             D   PDH+C L +SLYGLK +PRAWF R  +FLL  GFI    D SLF YS+ N  + LL
Sbjct  1048  DKSKPDHVCLLHKSLYGLKQSPRAWFDRFSNFLLEFGFICSLFDPSLFVYSSNNDVILLL  1107

Query  289   VYVDDIIMLGNDAVLVDSLLRKLATAFKIRDLGKPTFFLSIETLVVPEGMILSQRRYMRD  110
             +YVDD+++ GN++  +  LL  L   F+++D+G+  +FL I+      G+ +SQ++Y  D
Sbjct  1108  LYVDDMVITGNNSQSLTHLLAALNKEFRMKDMGQVHYFLGIQIQTYDGGLFMSQQKYAED  1167

Query  109   ILHRVGMTDCKSLATP  62
             +L    M +C  + TP
Sbjct  1168  LLITASMANCSPMPTP  1183



>emb|CAN59952.1| hypothetical protein VITISV_006720 [Vitis vinifera]
Length=1365

 Score =   123 bits (309),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 61/144 (42%), Positives = 91/144 (63%), Gaps = 0/144 (0%)
 Frame = -3

Query  466   PDIPDHICPLQRSLYGLK*APRAWFKRLHDFLLLTGFIAWKTDVSLFHYSAGNSRVFLLV  287
             P+ P+ +C L+++LYGLK +PRAWF +    LL  GF + + D S+F +   +S + +LV
Sbjct  964   PNHPNKVCKLKKALYGLKQSPRAWFTKXSSALLSWGFNSSRXDSSMFVHFGTHSTLIVLV  1023

Query  286   YVDDIIMLGNDAVLVDSLLRKLATAFKIRDLGKPTFFLSIETLVVPEGMILSQRRYMRDI  107
             YVDDII+ G+  VL+  L+ KL + F +RDLG+ ++FL IE       M LSQ +Y+ D+
Sbjct  1024  YVDDIIVTGSSPVLIQQLIHKLHSLFALRDLGQLSYFLGIEVTYDGGSMHLSQSKYITDL  1083

Query  106   LHRVGMTDCKSLATPASVTQPVCQ  35
             L R  M D K+ ATP +V   + Q
Sbjct  1084  LQRTSMLDSKAAATPGTVGLSLSQ  1107



>ref|XP_002444548.1| hypothetical protein SORBIDRAFT_07g023610 [Sorghum bicolor]
 gb|EES14043.1| hypothetical protein SORBIDRAFT_07g023610 [Sorghum bicolor]
Length=791

 Score =   122 bits (306),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 61/136 (45%), Positives = 79/136 (58%), Gaps = 0/136 (0%)
 Frame = -3

Query  469  DPDIPDHICPLQRSLYGLK*APRAWFKRLHDFLLLTGFIAWKTDVSLFHYSAGNSRVFLL  290
            D   PD +C L +SLYGLK APRAW+ R   FL   GF   K+D SLF Y  G    +LL
Sbjct  415  DSSRPDLVCRLNKSLYGLKQAPRAWYSRFSTFLQTLGFTEAKSDTSLFIYHHGGETAYLL  474

Query  289  VYVDDIIMLGNDAVLVDSLLRKLATAFKIRDLGKPTFFLSIETLVVPEGMILSQRRYMRD  110
            +YVDDI++      L+  ++  L   F ++DLG    FL +     P G+ L QR++  D
Sbjct  475  LYVDDIVLTACSESLLQRIITTLQKEFAMKDLGVLHHFLGVTVEPRPSGLFLHQRQFTCD  534

Query  109  ILHRVGMTDCKSLATP  62
            IL R GMTDCKS +TP
Sbjct  535  ILERAGMTDCKSCSTP  550



>emb|CAN60809.1| hypothetical protein VITISV_044451 [Vitis vinifera]
Length=377

 Score =   119 bits (298),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 58/136 (43%), Positives = 84/136 (62%), Gaps = 0/136 (0%)
 Frame = -3

Query  469  DPDIPDHICPLQRSLYGLK*APRAWFKRLHDFLLLTGFIAWKTDVSLFHYSAGNSRVFLL  290
            D + P H+C LQ++LYGLK APRAWF R   FLL  GF     + SLF + +    + LL
Sbjct  117  DLEHPTHVCKLQKALYGLKQAPRAWFDRFSAFLLKYGFFCSLANPSLFIFHSNLGTLILL  176

Query  289  VYVDDIIMLGNDAVLVDSLLRKLATAFKIRDLGKPTFFLSIETLVVPEGMILSQRRYMRD  110
            +YVDD+++ G+   LV + ++ L++ F ++DLG+  +FL IE     +G+ LSQ  Y   
Sbjct  177  LYVDDMLLTGSSTALVSTFIQLLSSEFTMKDLGQIHYFLGIEISQTSDGLHLSQSHYALT  236

Query  109  ILHRVGMTDCKSLATP  62
            IL R  M DCK ++TP
Sbjct  237  ILERANMVDCKPMSTP  252



>gb|AAU43956.1| unknown protein [Oryza sativa Japonica Group]
 gb|AAU44069.1| putative polyprotein [Oryza sativa Japonica Group]
Length=1447

 Score =   123 bits (308),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 62/141 (44%), Positives = 87/141 (62%), Gaps = 0/141 (0%)
 Frame = -3

Query  469   DPDIPDHICPLQRSLYGLK*APRAWFKRLHDFLLLTGFIAWKTDVSLFHYSAGNSRVFLL  290
             D   P ++C L ++LYGLK APRAW+ RL   L   GF   K D SLF Y+ G   +F+L
Sbjct  1071  DESFPGYVCKLDKALYGLKQAPRAWYSRLSKKLYDLGFQGSKGDTSLFFYNKGGLIIFVL  1130

Query  289   VYVDDIIMLGNDAVLVDSLLRKLATAFKIRDLGKPTFFLSIETLVVPEGMILSQRRYMRD  110
             +YVDDII+  +    V +LL+ L   F ++DLG   +FL IE   V + +IL+Q +Y  D
Sbjct  1131  IYVDDIIVTSSRQEAVSALLQDLKKEFALKDLGDLHYFLGIEVNKVTDEIILTQDKYACD  1190

Query  109   ILHRVGMTDCKSLATPASVTQ  47
             +L RV M DCK ++TP S ++
Sbjct  1191  LLRRVNMFDCKPVSTPLSTSE  1211



>gb|ABA94365.1| retrotransposon protein, putative, unclassified [Oryza sativa 
Japonica Group]
Length=1064

 Score =   122 bits (307),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 58/136 (43%), Positives = 84/136 (62%), Gaps = 0/136 (0%)
 Frame = -3

Query  469  DPDIPDHICPLQRSLYGLK*APRAWFKRLHDFLLLTGFIAWKTDVSLFHYSAGNSRVFLL  290
            DP  P  +C LQ+SLYGLK APRAW++R   ++   GF +  +D SLF Y  G++  +LL
Sbjct  730  DPSAPTAVCLLQKSLYGLKQAPRAWYQRFATYICQLGFTSSASDTSLFIYKDGDNIAYLL  789

Query  289  VYVDDIIMLGNDAVLVDSLLRKLATAFKIRDLGKPTFFLSIETLVVPEGMILSQRRYMRD  110
            +YVDDI++  +   L+  +  +L + F + DLG   FFL I      +G+ LSQR+Y  D
Sbjct  790  LYVDDILLTASSTSLLQHITARLHSEFAMTDLGDLHFFLGISVTRSADGLFLSQRQYAVD  849

Query  109  ILHRVGMTDCKSLATP  62
            +L R GM++C   ATP
Sbjct  850  LLRRAGMSECHPTATP  865



>ref|XP_010666841.1| PREDICTED: uncharacterized protein LOC104883959 [Beta vulgaris 
subsp. vulgaris]
Length=929

 Score =   122 bits (306),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 60/148 (41%), Positives = 86/148 (58%), Gaps = 0/148 (0%)
 Frame = -3

Query  469  DPDIPDHICPLQRSLYGLK*APRAWFKRLHDFLLLTGFIAWKTDVSLFHYSAGNSRVFLL  290
            DP  PDH+C L++SLYGLK APRAW++R  DF+   GF+  K+D SLF Y  G    +LL
Sbjct  547  DPTYPDHVCLLKKSLYGLKQAPRAWYRRFADFVTKIGFVNSKSDHSLFIYRRGTDMAYLL  606

Query  289  VYVDDIIMLGNDAVLVDSLLRKLATAFKIRDLGKPTFFLSIETLVVPEGMILSQRRYMRD  110
            +YVDDII+  +   L  S++  L+  F ++ LG  ++FL I       G+ LS  +Y  +
Sbjct  607  LYVDDIILTASSTTLRQSIISLLSFEFAMKYLGLLSYFLGIAVSRHAGGLFLSHHKYAEE  666

Query  109  ILHRVGMTDCKSLATPASVTQPVCQSTD  26
            I+ R GM+ CK   TP      +   T+
Sbjct  667  IIERAGMSACKPSPTPVDTKPKLSAQTE  694



>ref|XP_004986808.1| PREDICTED: uncharacterized protein LOC101773259 [Setaria italica]
Length=1950

 Score =   123 bits (308),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 57/136 (42%), Positives = 84/136 (62%), Gaps = 0/136 (0%)
 Frame = -3

Query  469   DPDIPDHICPLQRSLYGLK*APRAWFKRLHDFLLLTGFIAWKTDVSLFHYSAGNSRVFLL  290
             DP  PD++C LQ+SLYGLK APRAW++R   F+   GF+   +D SLF    G S  +LL
Sbjct  1566  DPGAPDYVCRLQKSLYGLKQAPRAWYQRFATFIGQLGFVTSASDTSLFILREGTSLSYLL  1625

Query  289   VYVDDIIMLGNDAVLVDSLLRKLATAFKIRDLGKPTFFLSIETLVVPEGMILSQRRYMRD  110
             +YVDDI++  + + L+  ++ +L++ F + DLG    FL I      +G+ LSQR+Y  +
Sbjct  1626  LYVDDIVLTASSSALLQRIMARLSSEFAMTDLGALHHFLGITVTRSSDGLFLSQRQYAVE  1685

Query  109   ILHRVGMTDCKSLATP  62
             +L R GM +C    TP
Sbjct  1686  LLQRAGMAECHPTTTP  1701



>gb|AAK43485.1|AC084807_10 polyprotein, putative [Arabidopsis thaliana]
 dbj|BAH30336.1| hypothetical protein [Arabidopsis thaliana]
Length=1459

 Score =   122 bits (307),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 63/136 (46%), Positives = 84/136 (62%), Gaps = 0/136 (0%)
 Frame = -3

Query  469   DPDIPDHICPLQRSLYGLK*APRAWFKRLHDFLLLTGFIAWKTDVSLFHYSAGNSRVFLL  290
             D D P H+C L++++YGLK APRAW+  L   LL  GF+    D SLF YS G + ++LL
Sbjct  1082  DKDRPSHVCRLRKAIYGLKQAPRAWYMELKQHLLNIGFVNSLADTSLFIYSHGTTLLYLL  1141

Query  289   VYVDDIIMLGNDAVLVDSLLRKLATAFKIRDLGKPTFFLSIETLVVPEGMILSQRRYMRD  110
             VYVDDII+ G+D   V ++L  LA  F I+D     +FL IE      G+ L QR+YM D
Sbjct  1142  VYVDDIIVTGSDHKSVSAVLSSLAERFSIKDPTDLHYFLGIEATRTNTGLHLMQRKYMTD  1201

Query  109   ILHRVGMTDCKSLATP  62
             +L +  M D K +ATP
Sbjct  1202  LLAKHNMLDAKPVATP  1217



>gb|ACF87376.2| unknown [Zea mays]
Length=526

 Score =   119 bits (299),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 60/136 (44%), Positives = 79/136 (58%), Gaps = 0/136 (0%)
 Frame = -3

Query  469  DPDIPDHICPLQRSLYGLK*APRAWFKRLHDFLLLTGFIAWKTDVSLFHYSAGNSRVFLL  290
            DP +P H+C L +SLYGLK APR WF R   FL   GF   K D SLF     ++  +LL
Sbjct  147  DPSLPHHVCKLHKSLYGLKQAPRTWFLRFTTFLSSIGFTQSKCDPSLFILKTPSTTAYLL  206

Query  289  VYVDDIIMLGNDAVLVDSLLRKLATAFKIRDLGKPTFFLSIETLVVPEGMILSQRRYMRD  110
            +YVDDII+  N + L+  ++ +L + F + DLG    FL IE      G++LSQ++Y  D
Sbjct  207  LYVDDIILTANTSHLLSHIISQLCSEFSMSDLGPLRHFLGIEVTPSDTGLVLSQKQYALD  266

Query  109  ILHRVGMTDCKSLATP  62
            IL R  MT C    TP
Sbjct  267  ILARANMTHCNPCHTP  282



>emb|CAA36616.1| unnamed protein product [Solanum tuberosum]
Length=390

 Score =   119 bits (297),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 58/131 (44%), Positives = 87/131 (66%), Gaps = 3/131 (2%)
 Frame = -3

Query  448  ICPLQRSLYGLK*APRAWFKRLHDFLLLTGFIAWKTDVSLF--HYSAGNSRVFLLVYVDD  275
            IC L+RSLYGLK +PRAWF+R   F+   G++  + D ++F  H   G + V L+VYVDD
Sbjct  30   ICRLRRSLYGLKQSPRAWFERFTQFVKRQGYVQGQADHTMFTRHSLEGKTTV-LIVYVDD  88

Query  274  IIMLGNDAVLVDSLLRKLATAFKIRDLGKPTFFLSIETLVVPEGMILSQRRYMRDILHRV  95
            II+ G+D V + +L  +LA+ F+I+DLG   +FL +E     +G+I+SQR+Y+ D+L   
Sbjct  89   IILTGDDVVEIKNLKERLASEFEIKDLGPLKYFLGMEVARSKKGIIVSQRKYVLDLLKET  148

Query  94   GMTDCKSLATP  62
            GM+ C+   TP
Sbjct  149  GMSGCRPTETP  159



>emb|CAN66496.1| hypothetical protein VITISV_036886 [Vitis vinifera]
Length=1092

 Score =   122 bits (306),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 57/140 (41%), Positives = 88/140 (63%), Gaps = 0/140 (0%)
 Frame = -3

Query  469  DPDIPDHICPLQRSLYGLK*APRAWFKRLHDFLLLTGFIAWKTDVSLFHYSAGNSRVFLL  290
            D   P H+C LQ+S+YGLK A RAW+  L   L   GF   K+D SLF Y+  +   ++L
Sbjct  762  DQSHPQHVCALQKSIYGLKQAXRAWYTALRSSLFELGFFNSKSDSSLFIYNRDDILFYVL  821

Query  289  VYVDDIIMLGNDAVLVDSLLRKLATAFKIRDLGKPTFFLSIETLVVPEGMILSQRRYMRD  110
            VYVDD+I+ GN+   + ++++ L   F +++L    +FL +E + V +G+ LSQ RY+ +
Sbjct  822  VYVDDLILTGNNNQFLQNVVKSLGDKFSLKELSDLHYFLGVEVIPVKQGLFLSQNRYVHN  881

Query  109  ILHRVGMTDCKSLATPASVT  50
            ILH++ MT  K + TP SV+
Sbjct  882  ILHQLNMTGAKEVQTPMSVS  901



>ref|XP_010655804.1| PREDICTED: uncharacterized protein LOC104880556 [Vitis vinifera]
Length=1045

 Score =   122 bits (305),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 58/140 (41%), Positives = 85/140 (61%), Gaps = 0/140 (0%)
 Frame = -3

Query  469  DPDIPDHICPLQRSLYGLK*APRAWFKRLHDFLLLTGFIAWKTDVSLFHYSAGNSRVFLL  290
            D   PDH+C L++++YGL+ APRAW+  L   L   GF   K D SLF Y+ G    + L
Sbjct  685  DTSKPDHVCRLRKAIYGLRQAPRAWYTTLRTALFQLGFKNSKADSSLFIYTHGPIICYFL  744

Query  289  VYVDDIIMLGNDAVLVDSLLRKLATAFKIRDLGKPTFFLSIETLVVPEGMILSQRRYMRD  110
            VYVDD+++ GND   VD +++KL   F ++D+G  +FFL +E +    G+ LSQ +Y+ D
Sbjct  745  VYVDDLVITGNDIQFVDHIIQKLGENFSLKDMGNLSFFLGVEVIPTHAGLFLSQHQYICD  804

Query  109  ILHRVGMTDCKSLATPASVT  50
            +L    M   K ++TP S T
Sbjct  805  LLSTTNMLGAKDVSTPLSTT  824



>emb|CAN83285.1| hypothetical protein VITISV_004139 [Vitis vinifera]
Length=1556

 Score =   122 bits (306),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 60/136 (44%), Positives = 84/136 (62%), Gaps = 0/136 (0%)
 Frame = -3

Query  469   DPDIPDHICPLQRSLYGLK*APRAWFKRLHDFLLLTGFIAWKTDVSLFHYSAGNSRVFLL  290
             D + P H+C LQ++LYGLK APRAWF R   FLL  GF     D SLF + +    + LL
Sbjct  1137  DLEHPTHVCKLQKALYGLKQAPRAWFDRFSAFLLKYGFFCSLADPSLFIFHSNLGSLILL  1196

Query  289   VYVDDIIMLGNDAVLVDSLLRKLATAFKIRDLGKPTFFLSIETLVVPEGMILSQRRYMRD  110
             +YVDDI++ G+   LV + ++ L++ F ++DLG+  +FL IE     +G+ LSQ  Y   
Sbjct  1197  LYVDDILLTGSSTALVSTFIQLLSSEFAMKDLGQIHYFLGIEISQTADGLHLSQSHYAFT  1256

Query  109   ILHRVGMTDCKSLATP  62
             IL R  M DCK ++TP
Sbjct  1257  ILERANMVDCKPMSTP  1272


 Score = 52.8 bits (125),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 29/66 (44%), Positives = 41/66 (62%), Gaps = 0/66 (0%)
 Frame = -3

Query  361  GFIAWKTDVSLFHYSAGNSRVFLLVYVDDIIMLGNDAVLVDSLLRKLATAFKIRDLGKPT  182
            GF   + D SLF    GNS   +L+YVDDII+  N   ++ +L + L T F+I+DL +  
Sbjct  150  GFHQSRVDYSLFTKIFGNSFTDVLIYVDDIIITDNYENVIAALKKSLHTKFRIKDLVQLR  209

Query  181  FFLSIE  164
            +FLSIE
Sbjct  210  YFLSIE  215



>gb|AAU10819.1| putative polyprotein [Oryza sativa Japonica Group]
 gb|AAV24907.1| hypothetical protein [Oryza sativa Japonica Group]
Length=1679

 Score =   122 bits (306),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 63/146 (43%), Positives = 82/146 (56%), Gaps = 0/146 (0%)
 Frame = -3

Query  469   DPDIPDHICPLQRSLYGLK*APRAWFKRLHDFLLLTGFIAWKTDVSLFHYSAGNSRVFLL  290
             D   PD +C L +SLYGLK APRAW+ R   FL   GF+  K+D SLF    GN  V+LL
Sbjct  1307  DSAKPDMVCCLNKSLYGLKQAPRAWYSRFTTFLQSIGFVEAKSDTSLFILHRGNDTVYLL  1366

Query  289   VYVDDIIMLGNDAVLVDSLLRKLATAFKIRDLGKPTFFLSIETLVVPEGMILSQRRYMRD  110
             +YVDDI++  +   L+   +  L   F ++DLG    FL +       G++LSQR+Y  D
Sbjct  1367  LYVDDIVLTASSRTLLHWTISALQGEFSMKDLGALHHFLGVSVTRNSAGLVLSQRQYCID  1426

Query  109   ILHRVGMTDCKSLATPASVTQPVCQS  32
             IL R GM DCK   TP   T  +  S
Sbjct  1427  ILERAGMADCKPCNTPVDTTAKLSSS  1452



>ref|XP_009359358.1| PREDICTED: uncharacterized protein LOC103949948 [Pyrus x bretschneideri]
Length=1243

 Score =   122 bits (305),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 60/136 (44%), Positives = 80/136 (59%), Gaps = 0/136 (0%)
 Frame = -3

Query  469  DPDIPDHICPLQRSLYGLK*APRAWFKRLHDFLLLTGFIAWKTDVSLFHYSAGNSRVFLL  290
            D   P H+C LQRS+YGLK APRAWF+R  DFLL  GF     D SLF +      + LL
Sbjct  660  DQQFPSHVCKLQRSIYGLKQAPRAWFQRFSDFLLELGFQESSCDYSLFVFRQQGVYLILL  719

Query  289  VYVDDIIMLGNDAVLVDSLLRKLATAFKIRDLGKPTFFLSIETLVVPEGMILSQRRYMRD  110
            +YVDDI++ GN    + SL+ +L T F ++DLG   +FL +E       M L Q +Y  D
Sbjct  720  IYVDDILITGNSPHQISSLITRLGTLFSMKDLGPLHYFLGVEVKYNGTAMHLCQSKYALD  779

Query  109  ILHRVGMTDCKSLATP  62
            +L R   T+ K ++TP
Sbjct  780  LLSRTNFTEAKPISTP  795



>emb|CAN79733.1| hypothetical protein VITISV_016615 [Vitis vinifera]
Length=807

 Score =   121 bits (303),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 59/136 (43%), Positives = 87/136 (64%), Gaps = 0/136 (0%)
 Frame = -3

Query  469  DPDIPDHICPLQRSLYGLK*APRAWFKRLHDFLLLTGFIAWKTDVSLFHYSAGNSRVFLL  290
            D D P H+C L +++YGLK A RAW+  L  FL+ +GF    ++ SLF   AG + ++LL
Sbjct  520  DADKPTHVCKLHKAIYGLKQASRAWYHELRQFLVDSGFKNSHSNTSLFILHAGTNLLYLL  579

Query  289  VYVDDIIMLGNDAVLVDSLLRKLATAFKIRDLGKPTFFLSIETLVVPEGMILSQRRYMRD  110
            VYVDDII+ GN+  LV  ++  LA  F ++ LG  ++FL +E +    G++LSQRRY++D
Sbjct  580  VYVDDIIITGNNNDLVSQVVECLAQRFSLKVLGPLSYFLVVEVVPHRNGLLLSQRRYIKD  639

Query  109  ILHRVGMTDCKSLATP  62
            +L R  M   K + TP
Sbjct  640  LLTRTNMQAAKPIHTP  655



>gb|ABB47941.2| retrotransposon protein, putative, unclassified [Oryza sativa 
Japonica Group]
Length=1414

 Score =   122 bits (305),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 62/155 (40%), Positives = 93/155 (60%), Gaps = 1/155 (1%)
 Frame = -3

Query  469   DPDIPDHICPLQRSLYGLK*APRAWFKRLHDFLLLTGFIAWKTDVSLFHYSAGNSRVFLL  290
             D   P  +C L RSLYGL+ APRAWFKR  D     GF+  + D SLF    G+   +LL
Sbjct  1027  DAARPADVCLLSRSLYGLRQAPRAWFKRFADHATSLGFVQSRADPSLFVLRRGSDTAYLL  1086

Query  289   VYVDDIIMLGNDAVLVDSLLRKLATAFKIRDLGKPTFFLSIETLVVPEGMILSQRRYMRD  110
             +YVDD+I+  + + L+  ++ +L   FK++D+G   +FL IE     +G +LSQ +Y  D
Sbjct  1087  LYVDDMILSASSSSLLQRIIDRLQAEFKVKDMGPLKYFLGIEVQRTADGFVLSQSKYATD  1146

Query  109   ILHRVGMTDCKSLATPASVTQPVCQSTDSFANISP  5
             +L R GM +CK++ATPA   +P   S +  ++ +P
Sbjct  1147  VLERAGMANCKAVATPADA-KPKLSSNEGLSSRTP  1180



>ref|XP_002489309.1| hypothetical protein SORBIDRAFT_0010s008890 [Sorghum bicolor]
 gb|EES20102.1| hypothetical protein SORBIDRAFT_0010s008890 [Sorghum bicolor]
Length=1017

 Score =   121 bits (304),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 57/136 (42%), Positives = 83/136 (61%), Gaps = 0/136 (0%)
 Frame = -3

Query  469  DPDIPDHICPLQRSLYGLK*APRAWFKRLHDFLLLTGFIAWKTDVSLFHYSAGNSRVFLL  290
            DP  PD +C L RSLYGL+ APRAWF R+  FL   GF+A ++D SLF    G++  +LL
Sbjct  515  DPTQPDAVCLLSRSLYGLRQAPRAWFTRIAGFLHAIGFVATRSDSSLFVLRRGSATAYLL  574

Query  289  VYVDDIIMLGNDAVLVDSLLRKLATAFKIRDLGKPTFFLSIETLVVPEGMILSQRRYMRD  110
            +YVDD+++  +   L+  ++ KL   F ++D+G   FFL ++         LSQ +Y  +
Sbjct  575  LYVDDMVLTASSDALLRDIINKLQAEFAVKDMGPLHFFLGVDVRRCGTDFFLSQTKYAEE  634

Query  109  ILHRVGMTDCKSLATP  62
            +L R GM +CK  ATP
Sbjct  635  LLERAGMVNCKPAATP  650



>gb|AAL86510.1|AC099040_14 putative retrotransposon protein [Oryza sativa Japonica Group]
Length=1139

 Score =   121 bits (304),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 62/138 (45%), Positives = 84/138 (61%), Gaps = 1/138 (1%)
 Frame = -3

Query  457  PDHICPLQRSLYGLK*APRAWFKRLHDFLLLTGFIAWKTDVSLFHYSAGNSRVFLLVYVD  278
            P ++C L ++LYGLK APRAW+ RL   L   GF   K D SLF Y  G+  +F+LVYVD
Sbjct  659  PHYVCKLDKALYGLKQAPRAWYSRLSMKLQQLGFSPSKADTSLFFYRKGSVTIFVLVYVD  718

Query  277  DIIMLGNDAVLVDSLLRKLATAFKIRDLGKPT-FFLSIETLVVPEGMILSQRRYMRDILH  101
            DI +  +    V SLL  L   F ++DLG    +FL IE   + +G++LSQ +Y  DIL 
Sbjct  719  DITVASSSQDAVSSLLHNLKMDFALKDLGDLNYYFLGIEVKKISDGLVLSQDKYTHDILK  778

Query  100  RVGMTDCKSLATPASVTQ  47
            R+GM+ CK   TP S ++
Sbjct  779  RIGMSTCKPAPTPLSTSE  796



>gb|ABB47033.2| retrotransposon protein, putative, Ty1-copia subclass [Oryza 
sativa Japonica Group]
Length=1142

 Score =   121 bits (304),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 62/138 (45%), Positives = 84/138 (61%), Gaps = 1/138 (1%)
 Frame = -3

Query  457  PDHICPLQRSLYGLK*APRAWFKRLHDFLLLTGFIAWKTDVSLFHYSAGNSRVFLLVYVD  278
            P ++C L ++LYGLK APRAW+ RL   L   GF   K D SLF Y  G+  +F+LVYVD
Sbjct  653  PHYVCKLDKALYGLKQAPRAWYSRLSMKLQQLGFSPSKADTSLFFYRKGSVTIFVLVYVD  712

Query  277  DIIMLGNDAVLVDSLLRKLATAFKIRDLGKPT-FFLSIETLVVPEGMILSQRRYMRDILH  101
            DI +  +    V SLL  L   F ++DLG    +FL IE   + +G++LSQ +Y  DIL 
Sbjct  713  DITVASSSQDAVSSLLHNLKMDFALKDLGDLNYYFLGIEVKKISDGLVLSQDKYTHDILK  772

Query  100  RVGMTDCKSLATPASVTQ  47
            R+GM+ CK   TP S ++
Sbjct  773  RIGMSTCKPAPTPLSTSE  790



>gb|AAM18766.1|AC099325_22 putative copia-like retrotransposon Hopscotch polyprotein [Oryza 
sativa Japonica Group]
Length=1150

 Score =   121 bits (304),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 62/138 (45%), Positives = 84/138 (61%), Gaps = 1/138 (1%)
 Frame = -3

Query  457  PDHICPLQRSLYGLK*APRAWFKRLHDFLLLTGFIAWKTDVSLFHYSAGNSRVFLLVYVD  278
            P ++C L ++LYGLK APRAW+ RL   L   GF   K D SLF Y  G+  +F+LVYVD
Sbjct  691  PHYVCKLDKALYGLKQAPRAWYSRLSMKLQQLGFSPSKADTSLFFYRKGSVTIFVLVYVD  750

Query  277  DIIMLGNDAVLVDSLLRKLATAFKIRDLGKPT-FFLSIETLVVPEGMILSQRRYMRDILH  101
            DI +  +    V SLL  L   F ++DLG    +FL IE   + +G++LSQ +Y  DIL 
Sbjct  751  DITVASSSQDAVSSLLHNLKMDFALKDLGDLNYYFLGIEVKKISDGLVLSQDKYTHDILK  810

Query  100  RVGMTDCKSLATPASVTQ  47
            R+GM+ CK   TP S ++
Sbjct  811  RIGMSTCKPAPTPLSTSE  828



>ref|XP_010669336.1| PREDICTED: copia protein isoform X2 [Beta vulgaris subsp. vulgaris]
Length=953

 Score =   121 bits (303),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 62/155 (40%), Positives = 92/155 (59%), Gaps = 1/155 (1%)
 Frame = -3

Query  469  DPDIPDHICPLQRSLYGLK*APRAWFKRLHDFLLLTGFIAWKTDVSLFHYSAGNSRVFLL  290
            D   PDH+C L++SLYGLK APRAW+ R  D++   GF    +D SLF Y       +LL
Sbjct  595  DSAHPDHVCLLKKSLYGLKQAPRAWYTRFADYVSTIGFSHSISDHSLFIYRQAGHIAYLL  654

Query  289  VYVDDIIMLGNDAVLVDSLLRKLATAFKIRDLGKPTFFLSIETLVVPEGMILSQRRYMRD  110
            +YVDDII+  +   L+ S++ +L++ F ++DLG  ++FL +       G+ LSQR+Y  +
Sbjct  655  LYVDDIILTASSDTLLKSIISRLSSEFAMKDLGALSYFLGVAVTRHAGGLFLSQRQYASE  714

Query  109  ILHRVGMTDCKSLATPASVTQPVCQSTDSFANISP  5
            I+ R GM+ CK  ATP   T+P   +T +     P
Sbjct  715  IIDRAGMSTCKPSATPVD-TKPKLGATSTAPYADP  748



>emb|CAH67061.1| H0112G12.6 [Oryza sativa Indica Group]
Length=811

 Score =   120 bits (301),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 62/146 (42%), Positives = 82/146 (56%), Gaps = 0/146 (0%)
 Frame = -3

Query  469  DPDIPDHICPLQRSLYGLK*APRAWFKRLHDFLLLTGFIAWKTDVSLFHYSAGNSRVFLL  290
            D   P+ +C L +SLYGLK APRAW+ R   FL   GF+  K+D SLF    GN  V+LL
Sbjct  439  DSAKPNMVCCLNKSLYGLKQAPRAWYSRFATFLQSIGFVEAKSDTSLFILHRGNDTVYLL  498

Query  289  VYVDDIIMLGNDAVLVDSLLRKLATAFKIRDLGKPTFFLSIETLVVPEGMILSQRRYMRD  110
            +YVDDI++  +   L+   +  L   F ++DLG    FL +       G++LSQR+Y  D
Sbjct  499  LYVDDIVLTASSRTLLHWTISALQGEFSMKDLGALHHFLGVSVTRNSAGLVLSQRQYCID  558

Query  109  ILHRVGMTDCKSLATPASVTQPVCQS  32
            IL R GM DCK   TP   T  +  S
Sbjct  559  ILERAGMADCKPCNTPVDTTAKLSSS  584



>ref|XP_010669333.1| PREDICTED: copia protein isoform X1 [Beta vulgaris subsp. vulgaris]
 ref|XP_010669334.1| PREDICTED: copia protein isoform X1 [Beta vulgaris subsp. vulgaris]
 ref|XP_010669335.1| PREDICTED: copia protein isoform X1 [Beta vulgaris subsp. vulgaris]
Length=977

 Score =   120 bits (302),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 62/155 (40%), Positives = 92/155 (59%), Gaps = 1/155 (1%)
 Frame = -3

Query  469  DPDIPDHICPLQRSLYGLK*APRAWFKRLHDFLLLTGFIAWKTDVSLFHYSAGNSRVFLL  290
            D   PDH+C L++SLYGLK APRAW+ R  D++   GF    +D SLF Y       +LL
Sbjct  595  DSAHPDHVCLLKKSLYGLKQAPRAWYTRFADYVSTIGFSHSISDHSLFIYRQAGHIAYLL  654

Query  289  VYVDDIIMLGNDAVLVDSLLRKLATAFKIRDLGKPTFFLSIETLVVPEGMILSQRRYMRD  110
            +YVDDII+  +   L+ S++ +L++ F ++DLG  ++FL +       G+ LSQR+Y  +
Sbjct  655  LYVDDIILTASSDTLLKSIISRLSSEFAMKDLGALSYFLGVAVTRHAGGLFLSQRQYASE  714

Query  109  ILHRVGMTDCKSLATPASVTQPVCQSTDSFANISP  5
            I+ R GM+ CK  ATP   T+P   +T +     P
Sbjct  715  IIDRAGMSTCKPSATPVD-TKPKLGATSTAPYADP  748



>ref|XP_002444329.1| hypothetical protein SORBIDRAFT_07g020255 [Sorghum bicolor]
 gb|EES13824.1| hypothetical protein SORBIDRAFT_07g020255 [Sorghum bicolor]
Length=987

 Score =   120 bits (302),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 60/136 (44%), Positives = 80/136 (59%), Gaps = 0/136 (0%)
 Frame = -3

Query  469  DPDIPDHICPLQRSLYGLK*APRAWFKRLHDFLLLTGFIAWKTDVSLFHYSAGNSRVFLL  290
            D   PD +C L +SLYGLK APRAW  R+  FL+  GF+  K+D SLF Y  G    +LL
Sbjct  613  DSSRPDMVCRLNKSLYGLKQAPRAWHSRIAAFLVTLGFVEAKSDTSLFIYHHGAETAYLL  672

Query  289  VYVDDIIMLGNDAVLVDSLLRKLATAFKIRDLGKPTFFLSIETLVVPEGMILSQRRYMRD  110
            +YVDDI++  +   L+  ++  L   F ++DLG    FL +     P G++L QR+Y  D
Sbjct  673  LYVDDIVLTASSPSLLRRIISALQLEFPLKDLGVLHHFLGVTVEPRPTGLLLHQRQYTLD  732

Query  109  ILHRVGMTDCKSLATP  62
            IL R GMT CK   TP
Sbjct  733  ILERAGMTGCKPCPTP  748



>emb|CAN65942.1| hypothetical protein VITISV_001716 [Vitis vinifera]
Length=1319

 Score =   121 bits (303),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 61/139 (44%), Positives = 87/139 (63%), Gaps = 0/139 (0%)
 Frame = -3

Query  469   DPDIPDHICPLQRSLYGLK*APRAWFKRLHDFLLLTGFIAWKTDVSLFHYSAGNSRVFLL  290
             D   P  +C L+++LYGLK APRAWF+RL   L+  GF   +TD S+F +   ++ + +L
Sbjct  952   DTTFPTKVCRLKKALYGLKQAPRAWFQRLSSALIQWGFSNSRTDSSMFLHFGESTTLIVL  1011

Query  289   VYVDDIIMLGNDAVLVDSLLRKLATAFKIRDLGKPTFFLSIETLVVPEGMILSQRRYMRD  110
             VYVDDII+ G  +  + SL+ KL + F +RDLG+ ++FL IE       M LSQ +Y+ D
Sbjct  1012  VYVDDIIITGCSSTQISSLIAKLDSIFTLRDLGQLSYFLGIEVSYHEGSMNLSQTKYVSD  1071

Query  109   ILHRVGMTDCKSLATPASV  53
             +LHR  M D K   TP +V
Sbjct  1072  MLHRTEMFDTKPAKTPGAV  1090



>emb|CAN60844.1| hypothetical protein VITISV_005976 [Vitis vinifera]
Length=1380

 Score =   121 bits (303),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 60/141 (43%), Positives = 88/141 (62%), Gaps = 0/141 (0%)
 Frame = -3

Query  469  DPDIPDHICPLQRSLYGLK*APRAWFKRLHDFLLLTGFIAWKTDVSLFHYSAGNSRVFLL  290
            D   P+ +C L+++LYGLK APRAWF+RL   LL   F   +TD S+F +    + + +L
Sbjct  769  DTQFPNRVCRLKKALYGLKQAPRAWFQRLSSALLQWEFSMSRTDSSMFLHFGKATTLIVL  828

Query  289  VYVDDIIMLGNDAVLVDSLLRKLATAFKIRDLGKPTFFLSIETLVVPEGMILSQRRYMRD  110
            VYVDDI++ G+ +  + SL+ KL + F +RDLG+ +FFL IE       M LSQ +Y+ D
Sbjct  829  VYVDDILVTGSSSTQISSLIAKLDSVFALRDLGQLSFFLDIEVSYNEGSMTLSQTKYISD  888

Query  109  ILHRVGMTDCKSLATPASVTQ  47
            +LHR  M D K   TP ++ +
Sbjct  889  LLHRTEMFDTKPAKTPGAIGK  909



>ref|XP_010315768.1| PREDICTED: uncharacterized protein LOC104645608 [Solanum lycopersicum]
Length=429

 Score =   117 bits (294),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 59/138 (43%), Positives = 81/138 (59%), Gaps = 0/138 (0%)
 Frame = -3

Query  463  DIPDHICPLQRSLYGLK*APRAWFKRLHDFLLLTGFIAWKTDVSLFHYSAGNSRVFLLVY  284
            D    +C L +SLYGLK A R W+ +L D L   G+     D SLF+   G S VF+ VY
Sbjct  239  DTKGMVCKLNKSLYGLKQASRQWYAKLSDALKYRGYSNSLNDYSLFYRKQGPSTVFIAVY  298

Query  283  VDDIIMLGNDAVLVDSLLRKLATAFKIRDLGKPTFFLSIETLVVPEGMILSQRRYMRDIL  104
            VDD ++ GNDA  +D +   L   FKI+DLGK  +FL +E L    GM++SQR+++ D+L
Sbjct  299  VDDTLLTGNDAEEIDQVKNYLHNQFKIKDLGKLHYFLGLEMLYTEVGMLISQRKFVLDLL  358

Query  103  HRVGMTDCKSLATPASVT  50
                 T+  SLA+P   T
Sbjct  359  KEYNCTEYSSLASPLDCT  376



>ref|XP_009145096.1| PREDICTED: uncharacterized protein LOC103868780 [Brassica rapa]
Length=2690

 Score =   121 bits (303),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 59/136 (43%), Positives = 86/136 (63%), Gaps = 0/136 (0%)
 Frame = -3

Query  469   DPDIPDHICPLQRSLYGLK*APRAWFKRLHDFLLLTGFIAWKTDVSLFHYSAGNSRVFLL  290
             D D P H+C L+++LYGLK APRAW++ L   LL  GF     D SLF Y  G   V++L
Sbjct  1733  DKDRPHHVCRLRKALYGLKQAPRAWYEELKRTLLAAGFRNSVADTSLFTYCHGPHLVYIL  1792

Query  289   VYVDDIIMLGNDAVLVDSLLRKLATAFKIRDLGKPTFFLSIETLVVPEGMILSQRRYMRD  110
             VYVDDI++ G+   LV+  +  LA  F I+DLG  ++FL IE     +G+ L Q +Y++D
Sbjct  1793  VYVDDIVVTGSSIPLVNQFIAMLAQRFSIKDLGHISYFLGIEATRTSKGLHLMQNKYIQD  1852

Query  109   ILHRVGMTDCKSLATP  62
             +L +  M + K+++TP
Sbjct  1853  LLAKTNMLNAKTVSTP  1868



>emb|CAB46043.1| retrotransposon like protein [Arabidopsis thaliana]
 emb|CAB80958.1| retrotransposon like protein [Arabidopsis thaliana]
Length=1474

 Score =   121 bits (303),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 59/136 (43%), Positives = 85/136 (63%), Gaps = 0/136 (0%)
 Frame = -3

Query  469   DPDIPDHICPLQRSLYGLK*APRAWFKRLHDFLLLTGFIAWKTDVSLFHYSAGNSRVFLL  290
             D D P H+C L++++YGLK APRAW+  L   L   GF+   +D SLF Y  G + V++L
Sbjct  1097  DKDRPTHVCRLRKAIYGLKQAPRAWYMELKQHLFNIGFVNSLSDASLFIYCHGTTFVYVL  1156

Query  289   VYVDDIIMLGNDAVLVDSLLRKLATAFKIRDLGKPTFFLSIETLVVPEGMILSQRRYMRD  110
             VYVDDII+ G+D   +D++L  LA  F I+D     +FL IE     +G+ L QR+Y++D
Sbjct  1157  VYVDDIIVTGSDKSSIDAVLTSLAERFSIKDPTDLHYFLGIEATRTKQGLHLMQRKYIKD  1216

Query  109   ILHRVGMTDCKSLATP  62
             +L +  M D K + TP
Sbjct  1217  LLAKHNMADAKPVLTP  1232



>gb|KFK44388.1| hypothetical protein AALP_AA1G251100, partial [Arabis alpina]
Length=2090

 Score =   121 bits (303),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 59/140 (42%), Positives = 88/140 (63%), Gaps = 0/140 (0%)
 Frame = -3

Query  469   DPDIPDHICPLQRSLYGLK*APRAWFKRLHDFLLLTGFIAWKTDVSLFHYSAGNSRVFLL  290
             D D PDH+C L++++YGLK APRAW+  L ++L+  GF+   +D SLF    G S V++L
Sbjct  1121  DRDKPDHVCRLRKAIYGLKQAPRAWYIELRNYLISVGFVNSVSDTSLFILQQGKSIVYML  1180

Query  289   VYVDDIIMLGNDAVLVDSLLRKLATAFKIRDLGKPTFFLSIETLVVPEGMILSQRRYMRD  110
             +YVDDI++ GND  L+   L  LA+ F ++D     +FL IE     +G+ LSQR+Y+ D
Sbjct  1181  IYVDDILVTGNDNNLLQHTLDALASRFSVKDPEDLHYFLGIEARRSSQGLHLSQRKYIND  1240

Query  109   ILHRVGMTDCKSLATPASVT  50
             +L R  M   K + TP + +
Sbjct  1241  LLARTNMLLAKPVLTPMATS  1260



>emb|CAE05417.1| OSJNBa0035I04.5 [Oryza sativa Japonica Group]
 emb|CAE05956.3| OSJNBb0088C09.15 [Oryza sativa Japonica Group]
Length=1246

 Score =   120 bits (302),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 66/156 (42%), Positives = 89/156 (57%), Gaps = 8/156 (5%)
 Frame = -3

Query  469   DPDIPDHICPLQRSLYGLK*APRAWFKRLHDFLLLTGFIAWKTDVSLFHYSAGNSRVFLL  290
             DP  PD +C LQRSLYGLK APRAW++R   ++   GF    +D SLF    G+   +LL
Sbjct  864   DPAAPDAVCLLQRSLYGLKQAPRAWYQRFATYIRQLGFTPSASDTSLFILRDGDRLAYLL  923

Query  289   VYVDDIIMLGNDAVLVDSLLRKLATAFKIRDLGKPTFFLSIETLVVPEGMILSQRRYMRD  110
             +YVDDII++ + A L+  +  +L T F + DLG   FFL I     P+ + LSQR+Y  D
Sbjct  924   LYVDDIILMASSAELLCHITARLHTEFAMTDLGDLHFFLGISVRRTPDDLFLSQRQYAVD  983

Query  109   ILHRVGMTDCKSLATP--------ASVTQPVCQSTD  26
             +L R GM++    ATP        AS   PV   T+
Sbjct  984   LLQRAGMSEYHPTATPVDARAKLSASEGAPVADPTE  1019



>gb|AAL34933.1|AC079037_6 Putative gag-pol polyprotein [Oryza sativa]
 gb|AAP51877.1| retrotransposon protein, putative, unclassified [Oryza sativa 
Japonica Group]
Length=725

 Score =   119 bits (299),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 58/137 (42%), Positives = 86/137 (63%), Gaps = 0/137 (0%)
 Frame = -3

Query  469  DPDIPDHICPLQRSLYGLK*APRAWFKRLHDFLLLTGFIAWKTDVSLFHYSAGNSRVFLL  290
            D   P  +C L RSLYGL+ APRAWFKR  D +   GF+  + D SLF    G+   +LL
Sbjct  303  DAARPADVCLLSRSLYGLRQAPRAWFKRFADHVTSLGFVQSRADPSLFVLRRGSDTAYLL  362

Query  289  VYVDDIIMLGNDAVLVDSLLRKLATAFKIRDLGKPTFFLSIETLVVPEGMILSQRRYMRD  110
            +YVDD+I+  + + L+  ++ +L   FK++D+G   +FL IE     +G +LSQ +Y  +
Sbjct  363  LYVDDMILSASSSSLLQRIIDRLQAEFKVKDMGPLKYFLGIEVQRTADGFVLSQSKYATN  422

Query  109  ILHRVGMTDCKSLATPA  59
            +L R GM +CK++ATPA
Sbjct  423  VLERAGMANCKAVATPA  439



>ref|XP_010686475.1| PREDICTED: uncharacterized protein LOC104900682 [Beta vulgaris 
subsp. vulgaris]
Length=4583

 Score =   121 bits (303),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 59/136 (43%), Positives = 86/136 (63%), Gaps = 1/136 (1%)
 Frame = -3

Query  469   DPDIPDHICPLQRSLYGLK*APRAWFKRLHDFLLLTGFIAWKTDVSLFHYSAGNSRVFLL  290
             DP  P H+C L++++YGLK APRAW+  L  +LL  GF+   +D SLF ++ G   +++L
Sbjct  990   DPTRPTHVCRLRKAIYGLKQAPRAWYTELKSYLLQAGFVNCLSDTSLF-FTKGPQPLYVL  1048

Query  289   VYVDDIIMLGNDAVLVDSLLRKLATAFKIRDLGKPTFFLSIETLVVPEGMILSQRRYMRD  110
             VYVDDII+ G    LV S +  L   F ++DLG  ++FL +E      G+ LSQR+Y+ D
Sbjct  1049  VYVDDIIVTGACPTLVSSFIAALGDRFSLKDLGSLSYFLGVEVQPTTRGIFLSQRKYIMD  1108

Query  109   ILHRVGMTDCKSLATP  62
             +L R  M+D K + TP
Sbjct  1109  LLTRAHMSDAKPVTTP  1124



>ref|XP_008365969.1| PREDICTED: uncharacterized protein LOC103429605 [Malus domestica]
Length=1188

 Score =   120 bits (301),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 63/153 (41%), Positives = 86/153 (56%), Gaps = 1/153 (1%)
 Frame = -3

Query  469  DPDIPDHICPLQRSLYGLK*APRAWFKRLHDFLLLTGFIAWKTDVSLFHYSAGNSRVFLL  290
            D   P H+C LQRSLYGLK APRAWF+R  DFL   GF       SLF ++     + LL
Sbjct  796  DKQFPHHVCKLQRSLYGLKQAPRAWFQRFSDFLFQLGFDESTCXYSLFVFNKRGVYIILL  855

Query  289  VYVDDIIMLGNDAVLVDSLLRKLATAFKIRDLGKPTFFLSIETLVVPEGMILSQRRYMRD  110
            +YVDDI++ GN    +  L++KL + F ++DLG  ++FL IE     + M L Q +Y  D
Sbjct  856  IYVDDILITGNSPRQMAHLIKKLGSLFSMKDLGPLSYFLGIEVKYNGDAMHLCQSKYALD  915

Query  109  ILHRVGMTDCKSLATPASVTQPVCQST-DSFAN  14
            +  R   T  K ++TP S  Q +     D +AN
Sbjct  916  LJTRTKFTXAKPISTPVSSGQKLSAYVGDPYAN  948



>gb|AIG20414.1| RVT_2 super family protein [Brassica oleracea var. alboglabra]
Length=707

 Score =   119 bits (298),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 57/136 (42%), Positives = 82/136 (60%), Gaps = 0/136 (0%)
 Frame = -3

Query  469  DPDIPDHICPLQRSLYGLK*APRAWFKRLHDFLLLTGFIAWKTDVSLFHYSAGNSRVFLL  290
            DP  P+H+C L+RS+YGLK APRAW  R   F+   GFI  K+D SLF Y       +L+
Sbjct  353  DPTKPNHVCKLKRSIYGLKQAPRAWNTRFVKFITNNGFIQSKSDTSLFVYRKQGLVAYLI  412

Query  289  VYVDDIIMLGNDAVLVDSLLRKLATAFKIRDLGKPTFFLSIETLVVPEGMILSQRRYMRD  110
            +YVDDII+  +   L +++++ L  AF + D G+ + FL I      +G+ L+Q  Y  D
Sbjct  413  LYVDDIIVTASTETLKNTIIQVLKAAFPMSDCGRISSFLGISVKFNDKGLFLNQSHYAED  472

Query  109  ILHRVGMTDCKSLATP  62
            I++R GM+ CK   TP
Sbjct  473  IINRAGMSTCKPCTTP  488



>emb|CAH66488.1| OSIGBa0076I14.9 [Oryza sativa Indica Group]
Length=1455

 Score =   120 bits (301),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 66/156 (42%), Positives = 89/156 (57%), Gaps = 8/156 (5%)
 Frame = -3

Query  469   DPDIPDHICPLQRSLYGLK*APRAWFKRLHDFLLLTGFIAWKTDVSLFHYSAGNSRVFLL  290
             DP  PD +C LQRSLYGLK APRAW++R   ++   GF    +D SLF    G+   +LL
Sbjct  1073  DPAAPDAVCLLQRSLYGLKQAPRAWYQRFATYIRQLGFTPSASDTSLFILRDGDRLAYLL  1132

Query  289   VYVDDIIMLGNDAVLVDSLLRKLATAFKIRDLGKPTFFLSIETLVVPEGMILSQRRYMRD  110
             +YVDDII++ + A L+  +  +L T F + DLG   FFL I     P+ + LSQR+Y  D
Sbjct  1133  LYVDDIILMASSAELLCHITARLHTEFAMTDLGDLHFFLGISVRRTPDDLFLSQRQYAVD  1192

Query  109   ILHRVGMTDCKSLATP--------ASVTQPVCQSTD  26
             +L R GM++    ATP        AS   PV   T+
Sbjct  1193  LLQRAGMSEYHPTATPVDARAKLSASEGAPVADPTE  1228



>ref|XP_006577466.1| PREDICTED: uncharacterized mitochondrial protein AtMg00810-like 
[Glycine max]
Length=387

 Score =   116 bits (291),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 59/149 (40%), Positives = 89/149 (60%), Gaps = 1/149 (1%)
 Frame = -3

Query  469  DPDIPDHICPLQRSLYGLK*APRAWFKRLHDFLLLTGFIAWKTDVSLFHYSAGNSRVFLL  290
            DP  P+H+  L++SLYGLK APRAW+KR  DF+   GF    +D S F Y  G S  ++L
Sbjct  5    DPQKPNHVFLLKKSLYGLKQAPRAWYKRFSDFVYTLGFSHSTSDHSFFVYRQGTSMAYIL  64

Query  289  VYVDDIIMLGNDAVLVDSLLRKLATAFKIRDLGKPTFFLSIETLVVPEGMILSQRRYMRD  110
            +YV+DII+  +      S++  L++ F ++DLG+ ++FL I       G+ LSQ++Y   
Sbjct  65   LYVEDIILTASSDEFRQSIIILLSSEFAMKDLGQLSYFLGIAVTHHAGGLFLSQKKYAMK  124

Query  109  ILHRVGMTDCKSLATPASVTQPVCQSTDS  23
            I+   GM+ CKS  TP   T+P   +T +
Sbjct  125  IIDYAGMSSCKSSPTPVD-TKPKLSATSN  152



>emb|CAN62447.1| hypothetical protein VITISV_024007 [Vitis vinifera]
Length=1144

 Score =   120 bits (300),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 58/137 (42%), Positives = 83/137 (61%), Gaps = 0/137 (0%)
 Frame = -3

Query  457  PDHICPLQRSLYGLK*APRAWFKRLHDFLLLTGFIAWKTDVSLFHYSAGNSRVFLLVYVD  278
            PD++C L++++YGLK APRAW+  L   LL  GF   K D SLF Y   +   + LVYVD
Sbjct  817  PDYVCRLRKAIYGLKQAPRAWYSALKTALLALGFQNSKVDSSLFVYRHDSIVCYFLVYVD  876

Query  277  DIIMLGNDAVLVDSLLRKLATAFKIRDLGKPTFFLSIETLVVPEGMILSQRRYMRDILHR  98
            D+++ GND   V  ++ KL   F ++D+G   +FL +E +    G+ LSQ +Y+RDIL  
Sbjct  877  DLVITGNDKKFVAHVVTKLGDQFSLKDMGSLHYFLGVEVIPTTAGVFLSQHKYVRDILEN  936

Query  97   VGMTDCKSLATPASVTQ  47
              M   K ++TP S TQ
Sbjct  937  THMAGAKDVSTPLSTTQ  953



>gb|AAA33448.1| reverse transcriptase, partial [Zea mays]
Length=700

 Score =   119 bits (297),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 61/135 (45%), Positives = 81/135 (60%), Gaps = 0/135 (0%)
 Frame = -3

Query  469  DPDIPDHICPLQRSLYGLK*APRAWFKRLHDFLLLTGFIAWKTDVSLFHYSAGNSRVFLL  290
            D D PD +C L RSLY LK APRAW+ R   +L   GF+  K+D SLF Y  G+  V+LL
Sbjct  527  DADRPDLVCRLNRSLYDLKQAPRAWYTRFTSYLASIGFVEAKSDTSLFIYRRGDDTVYLL  586

Query  289  VYVDDIIMLGNDAVLVDSLLRKLATAFKIRDLGKPTFFLSIETLVVPEGMILSQRRYMRD  110
            +YVDDI++  + A L+   +  L   F ++DL     FL I     P+G+ L QR+Y  D
Sbjct  587  LYVDDIVLTASTADLLQRTIVALQREFAMKDLWPLHHFLGITAERRPQGLFLHQRQYAID  646

Query  109  ILHRVGMTDCKSLAT  65
            IL R GM+DCK  +T
Sbjct  647  ILERAGMSDCKPCST  661



>pir||S27768 RNA-directed DNA polymerase (EC 2.7.7.49) - maize transposon 
(fragment)
Length=699

 Score =   119 bits (297),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 61/135 (45%), Positives = 81/135 (60%), Gaps = 0/135 (0%)
 Frame = -3

Query  469  DPDIPDHICPLQRSLYGLK*APRAWFKRLHDFLLLTGFIAWKTDVSLFHYSAGNSRVFLL  290
            D D PD +C L RSLY LK APRAW+ R   +L   GF+  K+D SLF Y  G+  V+LL
Sbjct  527  DADRPDLVCRLNRSLYDLKQAPRAWYTRFTSYLASIGFVEAKSDTSLFIYRRGDDTVYLL  586

Query  289  VYVDDIIMLGNDAVLVDSLLRKLATAFKIRDLGKPTFFLSIETLVVPEGMILSQRRYMRD  110
            +YVDDI++  + A L+   +  L   F ++DL     FL I     P+G+ L QR+Y  D
Sbjct  587  LYVDDIVLTASTADLLQRTIVALQREFAMKDLWPLHHFLGITAERRPQGLFLHQRQYAID  646

Query  109  ILHRVGMTDCKSLAT  65
            IL R GM+DCK  +T
Sbjct  647  ILERAGMSDCKPCST  661



>gb|ABA97658.1| retrotransposon protein, putative, Ty1-copia subclass [Oryza 
sativa Japonica Group]
Length=1597

 Score =   120 bits (301),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 62/135 (46%), Positives = 81/135 (60%), Gaps = 0/135 (0%)
 Frame = -3

Query  469   DPDIPDHICPLQRSLYGLK*APRAWFKRLHDFLLLTGFIAWKTDVSLFHYSAGNSRVFLL  290
             DP  PD +C L +SLYGLK APRAW+ R   FLL  GF   K+D SLF     +  V+LL
Sbjct  1215  DPTRPDMVCRLNKSLYGLKQAPRAWYSRFATFLLSIGFTEAKSDTSLFVLHRDSGIVYLL  1274

Query  289   VYVDDIIMLGNDAVLVDSLLRKLATAFKIRDLGKPTFFLSIETLVVPEGMILSQRRYMRD  110
             +YVDDI++  + A L+   +  L + F ++DLG    FL +       G++L QR+Y  D
Sbjct  1275  LYVDDIVLTASSAQLLQWTISSLQSEFSMKDLGALHHFLGVTVTRRDTGLLLHQRQYSLD  1334

Query  109   ILHRVGMTDCKSLAT  65
             IL R GMTDCK  AT
Sbjct  1335  ILERPGMTDCKPCAT  1349



>ref|XP_010065142.1| PREDICTED: uncharacterized protein LOC104452376 [Eucalyptus grandis]
Length=1169

 Score =   120 bits (300),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 64/155 (41%), Positives = 92/155 (59%), Gaps = 1/155 (1%)
 Frame = -3

Query  466  PDIPDHICPLQRSLYGLK*APRAWFKRLHDFLLLTGFIAWKTDVSLFHYSAGNSRVFLLV  287
            P  P H+C L++SLYGL+ APRAWF +   FLL  GF    TD SLF +  G+  + LL+
Sbjct  527  PQKPHHVCLLKKSLYGLRQAPRAWFDKFSIFLLENGFSCSTTDPSLFVFHHGSDTILLLL  586

Query  286  YVDDIIMLGNDAVLVDSLLRKLATAFKIRDLGKPTFFLSIETLVVPEGMILSQRRYMRDI  107
            YVDDI++ G+   L+ +L+  L+  F ++DLG   +FL IE     + + LSQ +Y  D+
Sbjct  587  YVDDIVLTGSSPHLLSNLIHLLSLQFHMKDLGLLHYFLGIEVKQTTQDLFLSQTKYALDL  646

Query  106  LHRVGMTDCKSLATPASVTQPVCQSTDSFANISPL  2
            L R  M DC+ ++TP S+ +P    TD      PL
Sbjct  647  LTRANMKDCRPVSTPLSL-RPAAIITDDILLQHPL  680



>gb|AAD19784.1| putative retroelement pol polyprotein [Arabidopsis thaliana]
Length=1501

 Score =   120 bits (300),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 58/132 (44%), Positives = 81/132 (61%), Gaps = 0/132 (0%)
 Frame = -3

Query  457   PDHICPLQRSLYGLK*APRAWFKRLHDFLLLTGFIAWKTDVSLFHYSAGNSRVFLLVYVD  278
             PD +C L++SLYGLK APR WFK+L D LL  GF+    D SLF Y+  N  + +L+YVD
Sbjct  1127  PDKVCRLRKSLYGLKQAPRCWFKKLSDSLLRFGFVQSYEDYSLFSYTRNNIELRVLIYVD  1186

Query  277   DIIMLGNDAVLVDSLLRKLATAFKIRDLGKPTFFLSIETLVVPEGMILSQRRYMRDILHR  98
             D+++ GND  ++      L+  F ++DLGK  +FL IE    PEG+ LSQR+Y  D++  
Sbjct  1187  DLLICGNDGYMLQKFKDYLSRCFSMKDLGKLKYFLGIEVSRGPEGIFLSQRKYALDVIAD  1246

Query  97    VGMTDCKSLATP  62
              G    +   TP
Sbjct  1247  SGNLGSRPAHTP  1258



>emb|CAN79641.1| hypothetical protein VITISV_017030 [Vitis vinifera]
Length=542

 Score =   117 bits (294),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 56/136 (41%), Positives = 83/136 (61%), Gaps = 0/136 (0%)
 Frame = -3

Query  469  DPDIPDHICPLQRSLYGLK*APRAWFKRLHDFLLLTGFIAWKTDVSLFHYSAGNSRVFLL  290
            D D P H+C L++++YGLK AP+AW+  L  F + +GF       SLF   +G+  ++LL
Sbjct  233  DXDNPTHVCKLKKAIYGLKQAPQAWYLELCQFFIESGFTNSHAYTSLFILHSGDXTIYLL  292

Query  289  VYVDDIIMLGNDAVLVDSLLRKLATAFKIRDLGKPTFFLSIETLVVPEGMILSQRRYMRD  110
            VYVDDII+ G +  ++   +  L   F I+DLG  ++FL IE L  P  ++L+QRRY+ D
Sbjct  293  VYVDDIIITGTNTNIIQXYIDLLXQRFSIKDLGVLSYFLXIEVLTTPSXVLLTQRRYISD  352

Query  109  ILHRVGMTDCKSLATP  62
            +L    M   K +ATP
Sbjct  353  LLAXTKMFGAKPIATP  368



>gb|ABF96081.1| retrotransposon protein, putative, Ty1-copia subclass [Oryza 
sativa Japonica Group]
Length=1180

 Score =   119 bits (299),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 61/141 (43%), Positives = 84/141 (60%), Gaps = 0/141 (0%)
 Frame = -3

Query  469  DPDIPDHICPLQRSLYGLK*APRAWFKRLHDFLLLTGFIAWKTDVSLFHYSAGNSRVFLL  290
            D   P  IC L ++LYGLK APRAW+ RL   L   GF   K D SLF Y+     +F+L
Sbjct  698  DKANPGCICKLDKALYGLKQAPRAWYARLSQKLQQLGFQGSKADTSLFFYNKQGLTIFVL  757

Query  289  VYVDDIIMLGNDAVLVDSLLRKLATAFKIRDLGKPTFFLSIETLVVPEGMILSQRRYMRD  110
            +YVDDII+  +    V +LL+ L   F ++DLG   +FL IE   +  G+IL+Q +Y  D
Sbjct  758  IYVDDIIVASSRQDAVLTLLQDLQKEFALKDLGDLHYFLGIEVNKISNGIILTQEKYAND  817

Query  109  ILHRVGMTDCKSLATPASVTQ  47
            +L RVGM DCK ++   S ++
Sbjct  818  LLKRVGMIDCKPVSASLSTSE  838



>emb|CAN60617.1| hypothetical protein VITISV_003256 [Vitis vinifera]
Length=474

 Score =   116 bits (291),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 54/143 (38%), Positives = 90/143 (63%), Gaps = 0/143 (0%)
 Frame = -3

Query  469  DPDIPDHICPLQRSLYGLK*APRAWFKRLHDFLLLTGFIAWKTDVSLFHYSAGNSRVFLL  290
            DP  P+H+C L++++YGLK APRAW+  L + LL  GF   + D+SLF Y   +   + L
Sbjct  117  DPSKPNHVCRLKKAIYGLKQAPRAWYTTLENVLLELGFDNSRADLSLFIYRKHSIICYFL  176

Query  289  VYVDDIIMLGNDAVLVDSLLRKLATAFKIRDLGKPTFFLSIETLVVPEGMILSQRRYMRD  110
            VYVDD++++GN+   V S++++L   F ++D+G     L +E +     + LSQ +Y+R+
Sbjct  177  VYVDDLVIIGNNTNFVASIIKQLGDRFFLKDMGLLHCLLGVEVVPTKARLFLSQHKYIRE  236

Query  109  ILHRVGMTDCKSLATPASVTQPV  41
            +L    M+  K ++TP S+TQ +
Sbjct  237  LLSTTNMSGAKVVSTPLSITQSL  259



>emb|CAN65591.1| hypothetical protein VITISV_042091 [Vitis vinifera]
Length=1427

 Score =   119 bits (299),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 60/141 (43%), Positives = 87/141 (62%), Gaps = 1/141 (1%)
 Frame = -3

Query  469   DPDIPDHICPLQRSLYGLK*APRAWFKRLHDFLLLTGFIAWKTDVSLFHYSAGNSRVFLL  290
             D   P H+C LQ++LYGLK APRAW+  L  FLL  GFI  K D SLF Y   ++ ++ L
Sbjct  1029  DQANPTHVCRLQKALYGLKQAPRAWYMELRTFLLTFGFINSKXDTSLFIYQXRSATIYFL  1088

Query  289   VYVDDIIMLGNDAVLVDSLLRKLATAFKIRDLGKPTFFLSIETLV-VPEGMILSQRRYMR  113
             VYVDD+++ GN +  +   +  LA  F ++DLG  ++FL +E  +   +GM LSQ +Y+R
Sbjct  1089  VYVDDLLVTGNCSQSIRRFIDALAHRFSLKDLGPLSYFLGVEGAISTSDGMFLSQHQYVR  1148

Query  112   DILHRVGMTDCKSLATPASVT  50
             D+L +  +   K  +TP S T
Sbjct  1149  DLLAKFNLEGIKDSSTPMSST  1169



>emb|CAN67546.1| hypothetical protein VITISV_027734 [Vitis vinifera]
Length=1635

 Score =   119 bits (299),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 61/139 (44%), Positives = 86/139 (62%), Gaps = 0/139 (0%)
 Frame = -3

Query  469  DPDIPDHICPLQRSLYGLK*APRAWFKRLHDFLLLTGFIAWKTDVSLFHYSAGNSRVFLL  290
            D   P  +C L+++LYGLK APRAWF+RL   L+  GF   +TD S+F +   ++ + +L
Sbjct  814  DTTFPTKVCRLKKALYGLKQAPRAWFQRLSSALIQWGFSNSRTDSSMFLHFGESTTLIVL  873

Query  289  VYVDDIIMLGNDAVLVDSLLRKLATAFKIRDLGKPTFFLSIETLVVPEGMILSQRRYMRD  110
            VYVDDII+ G  +  + SL+ KL + F +RDLG+ ++FL IE       M LSQ +Y+ D
Sbjct  874  VYVDDIIIXGCSSTQISSLIXKLDSIFTLRDLGQLSYFLGIEVSYHEGSMNLSQTKYVSD  933

Query  109  ILHRVGMTDCKSLATPASV  53
            +LHR  M D K   TP  V
Sbjct  934  LLHRTEMFDTKPAKTPGVV  952



>gb|AAM08751.1|AC025098_18 Putative copia-type polyprotein [Oryza sativa Japonica Group]
Length=1803

 Score =   119 bits (299),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 59/137 (43%), Positives = 85/137 (62%), Gaps = 0/137 (0%)
 Frame = -3

Query  469   DPDIPDHICPLQRSLYGLK*APRAWFKRLHDFLLLTGFIAWKTDVSLFHYSAGNSRVFLL  290
             D   P  +C L RSLYGL+ APRAWFKR  D     GF+  + D SLF    G+   +LL
Sbjct  1027  DAARPADVCLLSRSLYGLRQAPRAWFKRFADHATSLGFVQSRADPSLFVLRRGSDTAYLL  1086

Query  289   VYVDDIIMLGNDAVLVDSLLRKLATAFKIRDLGKPTFFLSIETLVVPEGMILSQRRYMRD  110
             +YVDD+I+  + + L+  ++ +L   FK++D+G   +FL IE     +G +LSQ +Y  D
Sbjct  1087  LYVDDMILSASSSSLLQRIIDRLQAEFKVKDMGPLKYFLGIEVQRTADGFVLSQSKYATD  1146

Query  109   ILHRVGMTDCKSLATPA  59
             +L R GM +CK++ATPA
Sbjct  1147  VLERAGMANCKAVATPA  1163



>emb|CAN74695.1| hypothetical protein VITISV_024648 [Vitis vinifera]
Length=1424

 Score =   119 bits (299),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 61/153 (40%), Positives = 91/153 (59%), Gaps = 1/153 (1%)
 Frame = -3

Query  469   DPDIPDHICPLQRSLYGLK*APRAWFKRLHDFLLLTGFIAWKTDVSLFHYSAGNSRVFLL  290
             DP  P+++C L +SLYGLK APRAWF++LH  L + GF + K+D SLF         ++L
Sbjct  1015  DPVNPNYVCKLNKSLYGLKQAPRAWFEKLHQALGILGFSSTKSDQSLFINITPTHSTYIL  1074

Query  289   VYVDDIIMLGNDAVLVDSLLRKLATAFKIRDLGKPTFFLSIETLVVPEGMILSQRRYMRD  110
             VYVDDI++ GN+   V  ++ +L   F ++DLG   +FL I+      GM LSQ +Y+ +
Sbjct  1075  VYVDDILITGNNDQFVQHVITQLNNQFALKDLGDIDYFLGIQVKHTSAGMHLSQAKYISN  1134

Query  109   ILHRVGMTDCKSLATPASVTQPVCQSTDS-FAN  14
             +L +  M   KS+ TP    Q +  S  + F+N
Sbjct  1135  LLQKTKMLHVKSVPTPMVSNQSLSNSGSAPFSN  1167



>gb|AAD23883.1| putative retroelement pol polyprotein [Arabidopsis thaliana]
Length=1156

 Score =   119 bits (298),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 58/132 (44%), Positives = 78/132 (59%), Gaps = 0/132 (0%)
 Frame = -3

Query  457  PDHICPLQRSLYGLK*APRAWFKRLHDFLLLTGFIAWKTDVSLFHYSAGNSRVFLLVYVD  278
            PD +C L++SLYGLK APR WFK+L D LL  GF+    D S F Y+     + +LVYVD
Sbjct  774  PDKVCRLRKSLYGLKQAPRCWFKKLSDALLRFGFVQGHEDYSFFSYTRNGIELRVLVYVD  833

Query  277  DIIMLGNDAVLVDSLLRKLATAFKIRDLGKPTFFLSIETLVVPEGMILSQRRYMRDILHR  98
            D+++ GND  ++      L   F ++DLGK  +FL IE     EG+ LSQR+Y  DI+  
Sbjct  834  DLLICGNDGYMLQKFKEYLGRCFSMKDLGKLKYFLGIEVSRGSEGIFLSQRKYALDIITD  893

Query  97   VGMTDCKSLATP  62
             G   C+   TP
Sbjct  894  SGNLGCRPALTP  905



>gb|ABB47203.2| retrotransposon protein, putative, unclassified [Oryza sativa 
Japonica Group]
Length=1050

 Score =   119 bits (297),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 57/136 (42%), Positives = 83/136 (61%), Gaps = 0/136 (0%)
 Frame = -3

Query  469  DPDIPDHICPLQRSLYGLK*APRAWFKRLHDFLLLTGFIAWKTDVSLFHYSAGNSRVFLL  290
            DP  P  +C LQ+SLYGLK APRAW++R   ++   GF +  +D SLF Y  G++  +LL
Sbjct  768  DPSEPTAVCLLQKSLYGLKQAPRAWYQRFATYIRQLGFTSSASDTSLFIYKDGDNVAYLL  827

Query  289  VYVDDIIMLGNDAVLVDSLLRKLATAFKIRDLGKPTFFLSIETLVVPEGMILSQRRYMRD  110
            +YVDDI++  +   L+  +  +L + F + DLG   FFL I      +G+ LSQ +Y  D
Sbjct  828  LYVDDILLTASSTSLLQHITARLHSEFAMTDLGDLHFFLGISVTRSADGLFLSQWQYAVD  887

Query  109  ILHRVGMTDCKSLATP  62
            +L R GM++C   ATP
Sbjct  888  LLRRAGMSECHPTATP  903



>gb|EMT21953.1| ABC transporter C family member 10 [Aegilops tauschii]
Length=3041

 Score =   119 bits (299),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 59/141 (42%), Positives = 84/141 (60%), Gaps = 0/141 (0%)
 Frame = -3

Query  469   DPDIPDHICPLQRSLYGLK*APRAWFKRLHDFLLLTGFIAWKTDVSLFHYSAGNSRVFLL  290
             + D P H+C L  +LYGLK APRAW+  L   L   GF+  K+D SLF Y+   + +F+L
Sbjct  2407  NKDKPFHVCKLDNALYGLKQAPRAWYSHLSQKLQALGFVPSKSDTSLFIYNKLKTSIFVL  2466

Query  289   VYVDDIIMLGNDAVLVDSLLRKLATAFKIRDLGKPTFFLSIETLVVPEGMILSQRRYMRD  110
             +YVDDII+  +    V   L+ L+  F ++DLG   FFL IE     +G+ LSQ +Y  D
Sbjct  2467  IYVDDIIVTSSSNEAVTGSLKDLSAEFALKDLGDLHFFLGIEVKKTEDGLHLSQEKYAAD  2526

Query  109   ILHRVGMTDCKSLATPASVTQ  47
             ++ R G+  CK+  TP S T+
Sbjct  2527  LVRRAGLQGCKASPTPLSSTE  2547



>gb|AAD14478.1| Strong similarity to gb|AF039376 Evelknievel retrotransposon 
polyprotein from Arabidopsis arenosa [Arabidopsis thaliana]
Length=1194

 Score =   119 bits (298),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 56/140 (40%), Positives = 89/140 (64%), Gaps = 0/140 (0%)
 Frame = -3

Query  469   DPDIPDHICPLQRSLYGLK*APRAWFKRLHDFLLLTGFIAWKTDVSLFHYSAGNSRVFLL  290
             +PD P+++C L+++L+GLK APRAW++ L  FLL  GF     + SLF        +++L
Sbjct  1031  NPDRPNYVCHLKKALHGLKQAPRAWYQELRGFLLTCGFTNSVANTSLFIRQHNKDYIYIL  1090

Query  289   VYVDDIIMLGNDAVLVDSLLRKLATAFKIRDLGKPTFFLSIETLVVPEGMILSQRRYMRD  110
             VYVDD ++ G+++ L+   +  LA  F ++DLG+ ++FL IE      G+ L QRRY+ D
Sbjct  1091  VYVDDFLITGSNSNLIAQFITCLANRFSLKDLGQLSYFLEIEATRTKAGLHLMQRRYVLD  1150

Query  109   ILHRVGMTDCKSLATPASVT  50
             +L +  M D K+++TP S T
Sbjct  1151  LLTKTKMLDAKTVSTPMSPT  1170



>gb|AAN34944.1| Putative retroelement [Oryza sativa Japonica Group]
Length=1146

 Score =   119 bits (297),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 57/136 (42%), Positives = 83/136 (61%), Gaps = 0/136 (0%)
 Frame = -3

Query  469  DPDIPDHICPLQRSLYGLK*APRAWFKRLHDFLLLTGFIAWKTDVSLFHYSAGNSRVFLL  290
            DP  P  +C LQ+SLYGLK APRAW++R   ++   GF +  +D SLF Y  G++  +LL
Sbjct  864  DPSEPTAVCLLQKSLYGLKQAPRAWYQRFATYIRQLGFTSSASDTSLFIYKDGDNVAYLL  923

Query  289  VYVDDIIMLGNDAVLVDSLLRKLATAFKIRDLGKPTFFLSIETLVVPEGMILSQRRYMRD  110
            +YVDDI++  +   L+  +  +L + F + DLG   FFL I      +G+ LSQ +Y  D
Sbjct  924  LYVDDILLTASSTSLLQHITARLHSEFAMTDLGDLHFFLGISVTRSADGLFLSQWQYAVD  983

Query  109  ILHRVGMTDCKSLATP  62
            +L R GM++C   ATP
Sbjct  984  LLRRAGMSECHPTATP  999



>ref|XP_010684978.1| PREDICTED: uncharacterized protein LOC104899479 [Beta vulgaris 
subsp. vulgaris]
Length=1367

 Score =   119 bits (298),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 59/147 (40%), Positives = 85/147 (58%), Gaps = 0/147 (0%)
 Frame = -3

Query  469   DPDIPDHICPLQRSLYGLK*APRAWFKRLHDFLLLTGFIAWKTDVSLFHYSAGNSRVFLL  290
             DP  PD++C L++SLYGLK APRAW++R   +L   GF   ++D SLF Y  G    +LL
Sbjct  985   DPTHPDYVCRLRKSLYGLKQAPRAWYQRFATYLSTFGFHHSQSDHSLFIYRCGADVAYLL  1044

Query  289   VYVDDIIMLGNDAVLVDSLLRKLATAFKIRDLGKPTFFLSIETLVVPEGMILSQRRYMRD  110
             +YVDDII+  +   L  +++  L   F + DLG  ++FL I       G+ LSQ++Y  +
Sbjct  1045  LYVDDIILTASSDALRTTIMSHLNAEFAMTDLGPLSYFLGISVTKTAGGLFLSQKKYAAE  1104

Query  109   ILHRVGMTDCKSLATPASVTQPVCQST  29
             IL R  M+ CK  ATP      +  S+
Sbjct  1105  ILERANMSSCKPSATPVDTKAKLSASS  1131



>ref|XP_004514187.1| PREDICTED: uncharacterized protein LOC101501674 [Cicer arietinum]
Length=933

 Score =   118 bits (296),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 57/136 (42%), Positives = 81/136 (60%), Gaps = 0/136 (0%)
 Frame = -3

Query  469  DPDIPDHICPLQRSLYGLK*APRAWFKRLHDFLLLTGFIAWKTDVSLFHYSAGNSRVFLL  290
            D   P+H+C L +++YGLK APRAWF  L + LL  GF   K+D SLF     +   FLL
Sbjct  585  DSTKPEHVCKLSKAIYGLKQAPRAWFDSLKNVLLSWGFKNTKSDSSLFTIRGTDHITFLL  644

Query  289  VYVDDIIMLGNDAVLVDSLLRKLATAFKIRDLGKPTFFLSIETLVVPEGMILSQRRYMRD  110
            +YVDDII+ GN+   ++S +++L   F ++DLG   +FL IE      GM L Q +Y+ D
Sbjct  645  IYVDDIIVTGNNTKFLESFIKQLNVVFSLKDLGPLHYFLGIEAQRYASGMYLKQLKYIGD  704

Query  109  ILHRVGMTDCKSLATP  62
            +L +  M +  S  TP
Sbjct  705  VLRKFKMENASSCPTP  720



>dbj|BAA97287.1| retroelement pol polyprotein-like [Arabidopsis thaliana]
Length=1491

 Score =   119 bits (297),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 60/132 (45%), Positives = 77/132 (58%), Gaps = 0/132 (0%)
 Frame = -3

Query  457   PDHICPLQRSLYGLK*APRAWFKRLHDFLLLTGFIAWKTDVSLFHYSAGNSRVFLLVYVD  278
             PD +C L++SLYGLK APR WFK+L D L   GFI    D S F YS     + +LVYVD
Sbjct  1117  PDKVCRLRKSLYGLKQAPRCWFKKLSDALKRFGFIQGYEDYSFFSYSCKGIELRVLVYVD  1176

Query  277   DIIMLGNDAVLVDSLLRKLATAFKIRDLGKPTFFLSIETLVVPEGMILSQRRYMRDILHR  98
             D+I+ GND  +V      L   F ++DLGK  +FL IE    P+G+ LSQR+Y  DI+  
Sbjct  1177  DLIICGNDEYMVQKFKEYLGRCFSMKDLGKLKYFLGIEVSRGPDGIFLSQRKYALDIISD  1236

Query  97    VGMTDCKSLATP  62
              G    +   TP
Sbjct  1237  SGTLGARPAYTP  1248



>gb|AAM74347.1|AC115686_14 Putative retroelement [Oryza sativa Japonica Group]
Length=1250

 Score =   119 bits (297),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 57/136 (42%), Positives = 83/136 (61%), Gaps = 0/136 (0%)
 Frame = -3

Query  469   DPDIPDHICPLQRSLYGLK*APRAWFKRLHDFLLLTGFIAWKTDVSLFHYSAGNSRVFLL  290
             DP  P  +C LQ+SLYGLK APRAW++R   ++   GF +  +D SLF Y  G++  +LL
Sbjct  968   DPSEPTAVCLLQKSLYGLKQAPRAWYQRFATYIRQLGFTSSASDTSLFIYKDGDNVAYLL  1027

Query  289   VYVDDIIMLGNDAVLVDSLLRKLATAFKIRDLGKPTFFLSIETLVVPEGMILSQRRYMRD  110
             +YVDDI++  +   L+  +  +L + F + DLG   FFL I      +G+ LSQ +Y  D
Sbjct  1028  LYVDDILLTASSTSLLQHITARLHSEFAMTDLGDLHFFLGISVTRSADGLFLSQWQYAVD  1087

Query  109   ILHRVGMTDCKSLATP  62
             +L R GM++C   ATP
Sbjct  1088  LLRRAGMSECHPTATP  1103



>gb|AAT38797.2| Polyprotein, putative [Solanum demissum]
Length=1793

 Score =   119 bits (297),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 62/141 (44%), Positives = 87/141 (62%), Gaps = 2/141 (1%)
 Frame = -3

Query  469   DPDIPDHICPLQRSLYGLK*APRAWFKRLHDFLLLTGFIAWKTDVSLFHYSAGNSRVFLL  290
             D   P HIC L ++ Y LK APRA +  L + LLL GFI  ++D SLF     ++ V+LL
Sbjct  1518  DKTCPTHICRLHKAFYRLKQAPRACYNELKNHLLLLGFIKSESDNSLFVRHHSHAIVYLL  1577

Query  289   VYVDDIIMLGNDAVLVDSLLRKLATAFKIRDLGKPTFFLSIETLVVPEGMILSQRRYMRD  110
             VYVDDII+ GN+  +V+ ++  LA   +++DL   T+FL IE +   +G+I++Q  Y RD
Sbjct  1578  VYVDDIIVTGNNTSVVNQVISSLAA--RVKDLEALTYFLGIEVIRSVDGIIMTQSTYKRD  1635

Query  109   ILHRVGMTDCKSLATPASVTQ  47
             IL    M DCK   TP S T+
Sbjct  1636  ILREENMADCKLAKTPMSTTE  1656


 Score = 82.8 bits (203),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 44/148 (30%), Positives = 78/148 (53%), Gaps = 16/148 (11%)
 Frame = -3

Query  466   PDIPDHICPLQRSLYGLK*APRAWFKRLHDFLLLTGFIAWKTDVSLFHYSAGNSRVFLLV  287
             P   D +  L ++LYGLK +PRAW++R+ + L+  GF   +++ +L+      S++ L+ 
Sbjct  990   PGKEDQVYLLTKALYGLKQSPRAWYERMDNHLIQLGFSRSQSEATLYVKVTAGSKIELIQ  1049

Query  286   YVDDIIMLGNDAVLVDSLLRKLATAFKIRDLGKPTFFLSIETLVVPEGMILSQRRYMRDI  107
                D                ++   F++ DLG   +FL +E L   +G+ + Q++Y+ DI
Sbjct  1050  RFKD----------------EMEKIFEMTDLGVMKYFLGMEVLQSSDGIFICQQKYILDI  1093

Query  106   LHRVGMTDCKSLATPASVTQPVCQSTDS  23
             L+R  M DCK ++TP S    + +  DS
Sbjct  1094  LNRFKMQDCKPVSTPISTGVKLGKDEDS  1121



>gb|AAX92854.1| retrotransposon protein, putative, unclassified [Oryza sativa 
Japonica Group]
 gb|ABA92609.1| retrotransposon protein, putative, unclassified [Oryza sativa 
Japonica Group]
Length=336

 Score =   114 bits (286),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 57/129 (44%), Positives = 77/129 (60%), Gaps = 0/129 (0%)
 Frame = -3

Query  448  ICPLQRSLYGLK*APRAWFKRLHDFLLLTGFIAWKTDVSLFHYSAGNSRVFLLVYVDDII  269
            +C L +SLYGL  APRAW+ R  +FLL  GF     D SLF Y+ G+  V++L+YVDDI+
Sbjct  2    VCCLNKSLYGLNQAPRAWYSRFANFLLTLGFTEACFDTSLFIYTRGSDVVYILLYVDDIV  61

Query  268  MLGNDAVLVDSLLRKLATAFKIRDLGKPTFFLSIETLVVPEGMILSQRRYMRDILHRVGM  89
            +  +   L+   +  L   F ++DLG    FL I        M LSQR+Y+ DIL R GM
Sbjct  62   LTASSDSLLRWTIAALQAEFSMKDLGTLDHFLGISVCRTSASMYLSQRQYILDILDRAGM  121

Query  88   TDCKSLATP  62
            +DCK  +TP
Sbjct  122  SDCKPCSTP  130



>gb|AFP55537.1| retrotransposon polyprotein [Rosa rugosa]
Length=1384

 Score =   118 bits (296),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 54/136 (40%), Positives = 85/136 (63%), Gaps = 0/136 (0%)
 Frame = -3

Query  469   DPDIPDHICPLQRSLYGLK*APRAWFKRLHDFLLLTGFIAWKTDVSLFHYSAGNSRVFLL  290
             DP  P H+C L+RSLYGLK APRAWF+   D+L   GF+  + D S+F ++     + LL
Sbjct  1006  DPKFPQHVCKLRRSLYGLKQAPRAWFRCFSDYLEELGFLESRADYSMFTFNNRGIYIILL  1065

Query  289   VYVDDIIMLGNDAVLVDSLLRKLATAFKIRDLGKPTFFLSIETLVVPEGMILSQRRYMRD  110
             +YVDDI++ GN++  +  L+  L + F ++DLG   +FL IET+   + + L+Q +Y+ D
Sbjct  1066  IYVDDILITGNNSSHISHLIHNLNSLFSMKDLGSVHYFLGIETVYNGDHLHLTQHKYIVD  1125

Query  109   ILHRVGMTDCKSLATP  62
             +L +  + D +   TP
Sbjct  1126  LLKKTKLHDSRPYPTP  1141



>emb|CAN65603.1| hypothetical protein VITISV_021511 [Vitis vinifera]
Length=491

 Score =   115 bits (289),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 55/150 (37%), Positives = 89/150 (59%), Gaps = 1/150 (1%)
 Frame = -3

Query  469  DPDIPDHICPLQRSLYGLK*APRAWFKRLHDFLLLTGFIAWKTDVSLFHYSAGNSRV-FL  293
            D      +C L++SLYGLK +PRAWF+RL  F+   G+   ++D ++F   + + ++  L
Sbjct  112  DEHFGSKVCKLKKSLYGLKQSPRAWFERLTQFVKNQGYFQAQSDHTMFIKHSNDGKIAIL  171

Query  292  LVYVDDIIMLGNDAVLVDSLLRKLATAFKIRDLGKPTFFLSIETLVVPEGMILSQRRYMR  113
            +VYVDDII+ G+    +D L + LA  F+I+DLG   +FL +E      G+++SQR+Y+ 
Sbjct  172  IVYVDDIILTGDHVTEMDRLKKSLALEFEIKDLGSLRYFLGMEVARSKRGIVVSQRKYIL  231

Query  112  DILHRVGMTDCKSLATPASVTQPVCQSTDS  23
            D+L   GM+ C+   TP    Q +  + D 
Sbjct  232  DLLKETGMSGCRPADTPIDPNQKLGDTNDG  261



>ref|XP_008359376.1| PREDICTED: uncharacterized protein LOC103423087 [Malus domestica]
Length=916

 Score =   118 bits (295),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 53/136 (39%), Positives = 84/136 (62%), Gaps = 0/136 (0%)
 Frame = -3

Query  469  DPDIPDHICPLQRSLYGLK*APRAWFKRLHDFLLLTGFIAWKTDVSLFHYSAGNSRVFLL  290
            DPD P H+C L +++YGLK APRAWF+R   FL+  GF   + D S+F Y   +  + LL
Sbjct  599  DPDRPHHVCKLHKAIYGLKHAPRAWFQRFSSFLVQFGFCQSQADTSMFVYQDNSRVLILL  658

Query  289  VYVDDIIMLGNDAVLVDSLLRKLATAFKIRDLGKPTFFLSIETLVVPEGMILSQRRYMRD  110
            +YVDDII+ G+D+  + + +  L   F I+DLG+  +FL +E     + +  +Q +Y  D
Sbjct  659  LYVDDIILTGSDSSHIQTFISTLGAEFDIKDLGRLHYFLGVEVNYHTDSVHFTQNKYTVD  718

Query  109  ILHRVGMTDCKSLATP  62
            +L  + + +CK ++TP
Sbjct  719  LLKCINLLNCKLVSTP  734



>emb|CAN75478.1| hypothetical protein VITISV_020209 [Vitis vinifera]
Length=1074

 Score =   118 bits (296),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 52/139 (37%), Positives = 88/139 (63%), Gaps = 0/139 (0%)
 Frame = -3

Query  469  DPDIPDHICPLQRSLYGLK*APRAWFKRLHDFLLLTGFIAWKTDVSLFHYSAGNSRVFLL  290
            D   P H+C LQ++LYGLK  PRAWF +L  FLL  GF   + + SLF++ + +  + LL
Sbjct  677  DSSCPTHVCRLQKALYGLKQGPRAWFHKLSSFLLQIGFQCSRANASLFYFHSASDIIILL  736

Query  289  VYVDDIIMLGNDAVLVDSLLRKLATAFKIRDLGKPTFFLSIETLVVPEGMILSQRRYMRD  110
            +YVDDI++ G++   V  ++ +L++ F +RDLG  ++FL I+   +   + L+Q+ Y+  
Sbjct  737  IYVDDILITGSNPSRVHQIISQLSSHFALRDLGDISYFLGIKVTRLSHALHLNQQHYIHQ  796

Query  109  ILHRVGMTDCKSLATPASV  53
            +L R  + + KS +TP ++
Sbjct  797  LLERANLHEAKSASTPGAL  815



>emb|CAH67640.1| H0102C09.1 [Oryza sativa Indica Group]
Length=1825

 Score =   118 bits (296),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 59/131 (45%), Positives = 87/131 (66%), Gaps = 0/131 (0%)
 Frame = -3

Query  439   LQRSLYGLK*APRAWFKRLHDFLLLTGFIAWKTDVSLFHYSAGNSRVFLLVYVDDIIMLG  260
             L ++LYGLK APRAW+ RL   L   GF+  K D SLF YS G+  +F+L+YVDDII+  
Sbjct  966   LDKALYGLKQAPRAWYSRLSTKLQELGFMPSKADTSLFFYSKGDVIIFVLIYVDDIIVAS  1025

Query  259   NDAVLVDSLLRKLATAFKIRDLGKPTFFLSIETLVVPEGMILSQRRYMRDILHRVGMTDC  80
             +      +LL+ L  +F ++DLG+  +FL IE   V +G++LSQ +Y++D+L R+ M  C
Sbjct  1026  SMPDATTALLQDLNKSFALKDLGELHYFLGIEATKVCDGILLSQEKYVKDLLKRINMDKC  1085

Query  79    KSLATPASVTQ  47
             K ++TP S T+
Sbjct  1086  KPVSTPLSPTE  1096



>emb|CAN71250.1| hypothetical protein VITISV_027849 [Vitis vinifera]
Length=445

 Score =   115 bits (287),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 58/143 (41%), Positives = 85/143 (59%), Gaps = 0/143 (0%)
 Frame = -3

Query  469  DPDIPDHICPLQRSLYGLK*APRAWFKRLHDFLLLTGFIAWKTDVSLFHYSAGNSRVFLL  290
            D D P H+C L + +Y LK APRAW+ +L  FL+ + F     D SLF  + G + ++LL
Sbjct  130  DLDNPTHVCKLXKXIYRLKQAPRAWYHKLRKFLIASXFHNSHXDTSLFVLNTGGNLLYLL  189

Query  289  VYVDDIIMLGNDAVLVDSLLRKLATAFKIRDLGKPTFFLSIETLVVPEGMILSQRRYMRD  110
            VYVDDII+  ND  +V   ++ LA  F ++DLG  + FL +E +    G++LSQ  Y+ D
Sbjct  190  VYVDDIILTXNDDTMVHKFMQLLAHQFSLKDLGHLSXFLGVEVIPNDHGILLSQXSYIVD  249

Query  109  ILHRVGMTDCKSLATPASVTQPV  41
            +L R  M D K + TP   + P+
Sbjct  250  LLTRTKMMDAKPIHTPLPTSPPI  272



>ref|XP_008369089.1| PREDICTED: uncharacterized protein LOC103432662 [Malus domestica]
Length=1318

 Score =   118 bits (296),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 57/131 (44%), Positives = 82/131 (63%), Gaps = 0/131 (0%)
 Frame = -3

Query  457   PDHICPLQRSLYGLK*APRAWFKRLHDFLLLTGFIAWKTDVSLFHYSAGNSRVFLLVYVD  278
             P+++C L +SLYGLK APRAW  R   FL   GF +   D SLF    G+S V LL+YVD
Sbjct  1008  PEYVCKLHKSLYGLKQAPRAWNDRFTKFLFTLGFQSSYXDSSLFIKHDGHSMVVLLLYVD  1067

Query  277   DIIMLGNDAVLVDSLLRKLATAFKIRDLGKPTFFLSIETLVVPEGMILSQRRYMRDILHR  98
              II+ G+    V  ++++L T F ++DLG   +FL +E     +G+ + Q +Y++D+LH+
Sbjct  1068  XIILTGDSDEGVQXVIQRLTTEFDMKDLGLLRYFLGLEIEYHSQGLFVHQSKYVKDLLHK  1127

Query  97    VGMTDCKSLAT  65
               MTDCKS  T
Sbjct  1128  TAMTDCKSYVT  1138



>emb|CAN69566.1| hypothetical protein VITISV_033535 [Vitis vinifera]
Length=1390

 Score =   118 bits (295),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 55/140 (39%), Positives = 86/140 (61%), Gaps = 0/140 (0%)
 Frame = -3

Query  469   DPDIPDHICPLQRSLYGLK*APRAWFKRLHDFLLLTGFIAWKTDVSLFHYSAGNSRVFLL  290
             D   P H+C LQ+S+YGLK APRAW+  L   LL  GF   K+D SLF ++     +++L
Sbjct  1105  DQSHPHHVCSLQKSIYGLKQAPRAWYNELRSGLLELGFFNSKSDSSLFIFNRDGILLYVL  1164

Query  289   VYVDDIIMLGNDAVLVDSLLRKLATAFKIRDLGKPTFFLSIETLVVPEGMILSQRRYMRD  110
             VYVDD+I+ GN++  +  +++ L   F +++L    +FL +E + V +G+ LS  RY+ D
Sbjct  1165  VYVDDLILTGNNSQFLQHVIKSLGERFSLKELNDLHYFLGVEVIPVQQGLFLSHNRYVHD  1224

Query  109   ILHRVGMTDCKSLATPASVT  50
             +L R+ M   K + TP  V+
Sbjct  1225  LLTRLKMVGAKEVQTPMYVS  1244



>gb|ABA97577.2| retrotransposon protein, putative, unclassified [Oryza sativa 
Japonica Group]
Length=827

 Score =   117 bits (293),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 54/141 (38%), Positives = 86/141 (61%), Gaps = 0/141 (0%)
 Frame = -3

Query  469  DPDIPDHICPLQRSLYGLK*APRAWFKRLHDFLLLTGFIAWKTDVSLFHYSAGNSRVFLL  290
            +PD P+H+  L ++LYGLK APRAW+ RL +FLL  GF   K D +LF    G++++F+ 
Sbjct  575  NPDFPNHVFKLYKALYGLKQAPRAWYDRLKNFLLAKGFTMGKIDKTLFVLKHGDNQLFIQ  634

Query  289  VYVDDIIMLGNDAVLVDSLLRKLATAFKIRDLGKPTFFLSIETLVVPEGMILSQRRYMRD  110
            +YVDDII       LV      +   F++  +G+ ++FL ++    P+G  + Q +YM+D
Sbjct  635  IYVDDIIFGCLTHALVVEFAETMRMEFEMSMMGELSYFLGLQIKQTPQGTFVHQTKYMKD  694

Query  109  ILHRVGMTDCKSLATPASVTQ  47
            +L R  M +CK ++TP   T+
Sbjct  695  LLRRFKMENCKPISTPIGSTE  715



>ref|XP_006662335.1| PREDICTED: uncharacterized protein LOC102706134 [Oryza brachyantha]
Length=576

 Score =   116 bits (290),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 57/145 (39%), Positives = 87/145 (60%), Gaps = 3/145 (2%)
 Frame = -3

Query  469  DPDIPDHICPLQRSLYGLK*APRAWFKRLHDFLLLTGFIAWKTDVSLFHYSAGNSRVFLL  290
            +PD P+H+  L ++LYGLK APRAW+ RL +FLL  GFI  K D +LF    G+ ++F+ 
Sbjct  296  NPDFPNHVFRLSKALYGLKQAPRAWYDRLKNFLLAKGFIMGKIDKTLFVLKHGDDQLFVQ  355

Query  289  VYVDDIIMLGNDAVLVDSLLRKLATAFKIRDLGKPTFFLSIETLVVPEGMILSQRRYMRD  110
            +YVDDII   +   LV      +   F++  +G+ T+FL ++    P+G  + Q +Y +D
Sbjct  356  IYVDDIIFGCSSHPLVVEFAETMHREFEMSMMGELTYFLGLQIKQTPQGTFVHQTKYTKD  415

Query  109  ILHRVGMTDCKSLATP---ASVTQP  44
            +L R  M +CK + TP   A+V  P
Sbjct  416  LLRRFKMDNCKPMTTPIGSATVLDP  440



>emb|CAN64296.1| hypothetical protein VITISV_022671 [Vitis vinifera]
Length=357

 Score =   114 bits (285),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 53/150 (35%), Positives = 88/150 (59%), Gaps = 1/150 (1%)
 Frame = -3

Query  469  DPDIPDHICPLQRSLYGLK*APRAWFKRLHDFLLLTGFIAWKTDVSLFHYSAGNSRV-FL  293
            D      +C L++SLYGLK +PRAWF+R   F+   G++  ++D ++F   + + ++  L
Sbjct  23   DEHFGSKVCKLKKSLYGLKQSPRAWFERFTQFVKNQGYVQAQSDHTMFIKHSNDGKIAIL  82

Query  292  LVYVDDIIMLGNDAVLVDSLLRKLATAFKIRDLGKPTFFLSIETLVVPEGMILSQRRYMR  113
            +VYVDDII+ G+    +D L + LA  F+I+D G   +FL +E      G+++SQR+Y+ 
Sbjct  83   IVYVDDIILTGDHVTEMDRLKKSLALEFEIKDXGSLRYFLGMEVARSKRGIVVSQRKYIL  142

Query  112  DILHRVGMTDCKSLATPASVTQPVCQSTDS  23
            D+L   GM+ C+   TP    Q +  + D 
Sbjct  143  DLLKETGMSGCRXADTPIDPNQKLGDTKDG  172



>gb|AEJ07956.1| putative polyprotein [Sorghum propinquum]
Length=534

 Score =   115 bits (288),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 58/136 (43%), Positives = 79/136 (58%), Gaps = 0/136 (0%)
 Frame = -3

Query  469  DPDIPDHICPLQRSLYGLK*APRAWFKRLHDFLLLTGFIAWKTDVSLFHYSAGNSRVFLL  290
            D   P  +C L +SLYGLK APRAW  R   +L   GF+  K+D SLF Y  G+   +LL
Sbjct  159  DSSRPGLVCRLNKSLYGLKQAPRAWHHRFASYLSSIGFVETKSDSSLFIYRRGSDTAYLL  218

Query  289  VYVDDIIMLGNDAVLVDSLLRKLATAFKIRDLGKPTFFLSIETLVVPEGMILSQRRYMRD  110
            +YVDDI++  + A  +  ++  L   F + D+G+   FL I      +GM LSQR+Y  D
Sbjct  219  LYVDDIVLTASSAQFLRQVIVALQREFAMTDMGQLHHFLGISVTRSAKGMFLSQRQYTLD  278

Query  109  ILHRVGMTDCKSLATP  62
            IL R GM+ CK  +TP
Sbjct  279  ILERAGMSACKPCSTP  294



>ref|XP_010418722.1| PREDICTED: uncharacterized protein LOC104704304 [Camelina sativa]
Length=493

 Score =   114 bits (286),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 58/136 (43%), Positives = 78/136 (57%), Gaps = 0/136 (0%)
 Frame = -3

Query  469  DPDIPDHICPLQRSLYGLK*APRAWFKRLHDFLLLTGFIAWKTDVSLFHYSAGNSRVFLL  290
            DP  PDH+C LQRSLYGLK A RAW+ R   +    G     +D SLF    G+   +LL
Sbjct  338  DPSKPDHVCLLQRSLYGLKQASRAWYNRFATYAKTLGLKQSSSDASLFILCHGSDIAYLL  397

Query  289  VYVDDIIMLGNDAVLVDSLLRKLATAFKIRDLGKPTFFLSIETLVVPEGMILSQRRYMRD  110
            +YVDDI++  +   LV  ++  L++ F++ DLG+   FL I       G+ L Q+ Y+ D
Sbjct  398  LYVDDIVLTASTTPLVQRIITHLSSEFEMTDLGQLHHFLGISVQRDVHGLFLHQQNYVAD  457

Query  109  ILHRVGMTDCKSLATP  62
            ILHR GMT C    TP
Sbjct  458  ILHRAGMTACNLCLTP  473



>ref|XP_004963982.1| PREDICTED: uncharacterized protein LOC101777276 [Setaria italica]
Length=1188

 Score =   117 bits (293),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 63/155 (41%), Positives = 85/155 (55%), Gaps = 7/155 (5%)
 Frame = -3

Query  469  DPDIPDHICPLQRSLYGLK*APRAWFKRLHDFLLLTGFIAWKTDVSLFHYSAGNSRVFLL  290
            D   P+H+C L RSLYGLK APRAW  R   FL   GF+  K+D SLF Y  G+   +LL
Sbjct  780  DSSHPNHVCRLNRSLYGLKQAPRAWRTRFATFLTSIGFVESKSDASLFTYYRGSEVAYLL  839

Query  289  VYVDDIIMLGNDAVLVDSLLRKLATAFKIRDLGKPTFFLSIETLVVPEGMILSQRRYMRD  110
            +YVDDI++  + +  +  ++  L   F + D+G    FL I      + + LSQR+Y+ D
Sbjct  840  LYVDDIVLTASSSGFLQWIISALCQEFSMTDMGLLHHFLGISVERRGDCLFLSQRQYLLD  899

Query  109  ILHRVGMTDCKSLATPASVTQ-------PVCQSTD  26
            IL R GM DCK  +TP            PV  +TD
Sbjct  900  ILDRAGMRDCKPCSTPVETHSKLSADGTPVTDATD  934



>gb|ABA93940.1| retrotransposon protein, putative, Ty1-copia subclass [Oryza 
sativa Japonica Group]
Length=1508

 Score =   117 bits (293),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 56/151 (37%), Positives = 90/151 (60%), Gaps = 0/151 (0%)
 Frame = -3

Query  469   DPDIPDHICPLQRSLYGLK*APRAWFKRLHDFLLLTGFIAWKTDVSLFHYSAGNSRVFLL  290
             +PD P+H+  L ++LYGLK APRAW+ RL +FLL  GF   K D +LF +  G++++F+ 
Sbjct  1131  NPDFPNHVFKLSKALYGLKQAPRAWYDRLKNFLLAKGFTMGKVDKTLFVFKHGDNQLFVQ  1190

Query  289   VYVDDIIMLGNDAVLVDSLLRKLATAFKIRDLGKPTFFLSIETLVVPEGMILSQRRYMRD  110
             +YVDDII   +   LV +    +   F++  +G  ++FL ++    P+G  + Q +Y +D
Sbjct  1191  IYVDDIIFGCSTHSLVVNFAETIRREFEMSMMGDLSYFLGLQIKQTPQGTFVHQTKYTKD  1250

Query  109   ILHRVGMTDCKSLATPASVTQPVCQSTDSFA  17
             +L R  M +CK ++TP   T  +    DS A
Sbjct  1251  LLRRFKMENCKPISTPIGSTAVLDPDEDSEA  1281



>emb|CAN71173.1| hypothetical protein VITISV_037664 [Vitis vinifera]
Length=809

 Score =   116 bits (291),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 56/135 (41%), Positives = 83/135 (61%), Gaps = 0/135 (0%)
 Frame = -3

Query  454  DHICPLQRSLYGLK*APRAWFKRLHDFLLLTGFIAWKTDVSLFHYSAGNSRVFLLVYVDD  275
            DH+C L +++YGLK APRAW+  L    L  GFI  K+D SLF +  G+   + LVYV+D
Sbjct  450  DHVCCLTKAIYGLKQAPRAWYSALKRASLEFGFINAKSDSSLFVFHDGSILAYCLVYVND  509

Query  274  IIMLGNDAVLVDSLLRKLATAFKIRDLGKPTFFLSIETLVVPEGMILSQRRYMRDILHRV  95
             I+  N++  V S++ +L   F I+DLG   FFL +E +   +G+ L+Q +Y+RDIL + 
Sbjct  510  FILTDNNSTFVASIIDQLGQKFSIKDLGSLHFFLGVEVIPTKDGLFLTQHKYIRDILAKT  569

Query  94   GMTDCKSLATPASVT  50
             M   K + TP S +
Sbjct  570  SMDGAKDVTTPLSTS  584



>gb|AAT58770.1| putative polyprotein [Oryza sativa Japonica Group]
Length=1419

 Score =   117 bits (292),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 58/130 (45%), Positives = 84/130 (65%), Gaps = 0/130 (0%)
 Frame = -3

Query  451   HICPLQRSLYGLK*APRAWFKRLHDFLLLTGFIAWKTDVSLFHYSAGNSRVFLLVYVDDI  272
             H+  L+R+LYGLK +PRAWF+R    +L  GF+A + D +LF +++   R  LL+YVDD+
Sbjct  1048  HVLRLRRALYGLKQSPRAWFERFSSVVLKAGFVASEHDSALFIHTSSRGRTILLLYVDDM  1107

Query  271   IMLGNDAVLVDSLLRKLATAFKIRDLGKPTFFLSIETLVVPEGMILSQRRYMRDILHRVG  92
             I+ G+DA  V  + ++L+  F + DLG   +FL IE    P G  LSQ RY  D+L R G
Sbjct  1108  IITGDDASHVAFVKQRLSEQFMMTDLGPLKYFLGIEVASTPNGFHLSQHRYTLDLLSRSG  1167

Query  91    MTDCKSLATP  62
             ++D K+ ATP
Sbjct  1168  LSDDKTAATP  1177



>gb|AAM98191.1| unknown protein [Arabidopsis thaliana]
 gb|AAR24647.1| At2g23330 [Arabidopsis thaliana]
 dbj|BAE99183.1| putative retroelement pol polyprotein [Arabidopsis thaliana]
Length=776

 Score =   116 bits (290),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 61/153 (40%), Positives = 86/153 (56%), Gaps = 7/153 (5%)
 Frame = -3

Query  457  PDHICPLQRSLYGLK*APRAWFKRLHDFLLLTGFIAWKTDVSLFHYSAGNSRVFLLVYVD  278
            P  +C L++SLYGLK APR WF +L   L   GF     D SLF    G++ + +LVYVD
Sbjct  402  PSKVCRLRKSLYGLKQAPRCWFSKLSTALRNIGFTQSYEDYSLFSLKNGDTIIHVLVYVD  461

Query  277  DIIMLGNDAVLVDSLLRKLATAFKIRDLGKPTFFLSIETLVVPEGMILSQRRYMRDILHR  98
            D+I+ GN+   +D    +L   F ++DLGK  +FL +E    P+G  LSQR+Y  DI+  
Sbjct  462  DLIVAGNNLDAIDRFKSQLHKCFHMKDLGKLKYFLGLEVSRGPDGFCLSQRKYALDIVKE  521

Query  97   VGMTDCKSLATP-------ASVTQPVCQSTDSF  20
             G+  CK  A P       AS+T PV  + + +
Sbjct  522  TGLLGCKPSAVPIALNHKLASITGPVFTNPEQY  554



>gb|ABA99152.1| retrotransposon protein, putative, unclassified [Oryza sativa 
Japonica Group]
Length=989

 Score =   116 bits (291),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 56/136 (41%), Positives = 81/136 (60%), Gaps = 0/136 (0%)
 Frame = -3

Query  469  DPDIPDHICPLQRSLYGLK*APRAWFKRLHDFLLLTGFIAWKTDVSLFHYSAGNSRVFLL  290
            DP  P ++C L +SLYGLK  PRAW+ R   F+L  GF+  K D SLF Y  G    +LL
Sbjct  602  DPTHPGYVCRLNKSLYGLKQTPRAWYSRFATFILSLGFVNAKADTSLFVYHHGTDTAYLL  661

Query  289  VYVDDIIMLGNDAVLVDSLLRKLATAFKIRDLGKPTFFLSIETLVVPEGMILSQRRYMRD  110
            +YVDDI++  +   ++  ++  L   F ++DLGK   FL ++       + LSQ++YM +
Sbjct  662  LYVDDIVLTASFMAVLRRIISALQHEFNMKDLGKLHHFLGMQVQHRNGCLFLSQQQYMME  721

Query  109  ILHRVGMTDCKSLATP  62
            IL R GM +CK  +TP
Sbjct  722  ILDRAGMAECKPCSTP  737



>ref|XP_008374297.1| PREDICTED: uncharacterized protein LOC103437591 [Malus domestica]
Length=1210

 Score =   116 bits (291),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 56/136 (41%), Positives = 82/136 (60%), Gaps = 0/136 (0%)
 Frame = -3

Query  469  DPDIPDHICPLQRSLYGLK*APRAWFKRLHDFLLLTGFIAWKTDVSLFHYSAGNSRVFLL  290
            D   P H+C LQRSLYGLK APRAWF+     L   GF++   D SLF +  G+  ++LL
Sbjct  806  DSQRPXHVCKLQRSLYGLKQAPRAWFQCFSQHLEHLGFVSSHXDSSLFTFFDGSVXLYLL  865

Query  289  VYVDDIIMLGNDAVLVDSLLRKLATAFKIRDLGKPTFFLSIETLVVPEGMILSQRRYMRD  110
            +YVDDI++ GN    +  L+++L   F ++DLG   + L +E      G+ L+Q +Y+ D
Sbjct  866  IYVDDILITGNSTDHIARLIQQLGVLFSMKDLGPLHYXLGMEVHXTAAGLHLTQAKYITD  925

Query  109  ILHRVGMTDCKSLATP  62
            +L R  M DCK ++ P
Sbjct  926  LLKRTNMLDCKPISAP  941



>ref|XP_008665853.1| PREDICTED: protein SHOOT GRAVITROPISM 6-like [Zea mays]
Length=2204

 Score =   117 bits (292),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 59/136 (43%), Positives = 78/136 (57%), Gaps = 0/136 (0%)
 Frame = -3

Query  469  DPDIPDHICPLQRSLYGLK*APRAWFKRLHDFLLLTGFIAWKTDVSLFHYSAGNSRVFLL  290
            D   PD +C L RSLYGL   PRAW  RL  FL+  GF+  K D SLF +  G    +LL
Sbjct  666  DSSRPDMVCRLNRSLYGLNQPPRAWHSRLTTFLVTLGFVVAKLDTSLFVHHHGAETAYLL  725

Query  289  VYVDDIIMLGNDAVLVDSLLRKLATAFKIRDLGKPTFFLSIETLVVPEGMILSQRRYMRD  110
            +YVDDI++  +   L+  L+  L   F ++DLG    FL +     P G++L QR+Y  D
Sbjct  726  LYVDDIVLTASSPSLLRRLVDALQQEFPVKDLGVLHHFLGVTAEPRPSGLLLHQRQYTLD  785

Query  109  ILHRVGMTDCKSLATP  62
            IL R  M+DCK  +TP
Sbjct  786  ILERAQMSDCKPCSTP  801



>emb|CAN67009.1| hypothetical protein VITISV_004754 [Vitis vinifera]
Length=1237

 Score =   116 bits (291),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 57/137 (42%), Positives = 85/137 (62%), Gaps = 1/137 (1%)
 Frame = -3

Query  469  DPDIPDHICPLQRSLYGLK*APRAWFKRLHDFLLLTGFIAWKTDVSLF-HYSAGNSRVFL  293
            + D+ + +C LQ+SLYGLK +PRAWF R    +L  G+   +TD +LF   S       L
Sbjct  858  NGDLEEEVCKLQKSLYGLKQSPRAWFDRFTKAVLKLGYKQGQTDHTLFVKKSHAGKMAIL  917

Query  292  LVYVDDIIMLGNDAVLVDSLLRKLATAFKIRDLGKPTFFLSIETLVVPEGMILSQRRYMR  113
            +VYVDDII+ GND   + +L + L+  F+++DLG   +FL +E     +G+I+SQR+Y+ 
Sbjct  918  IVYVDDIILSGNDMEELQNLKKYLSEKFEVKDLGNLKYFLGMEMARSRKGIIVSQRKYIL  977

Query  112  DILHRVGMTDCKSLATP  62
            D+L   GM  CK + TP
Sbjct  978  DLLKETGMLGCKPIDTP  994



>ref|XP_008389883.1| PREDICTED: uncharacterized protein LOC103452157 [Malus domestica]
Length=1141

 Score =   116 bits (291),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 55/137 (40%), Positives = 88/137 (64%), Gaps = 1/137 (1%)
 Frame = -3

Query  469  DPDIPDHICPLQRSLYGLK*APRAWFKRLHDFLLLTGFIAWKTDVSLFHYSAGNSRVFLL  290
            D + P+++C L +SLYGLK APRAW  +   +L   GF   ++D SLF    G+  V LL
Sbjct  765  DSNHPEYVCKLVKSLYGLKQAPRAWNAKFTGYLPAMGFQMSQSDTSLFVKHDGSDVVVLL  824

Query  289  VYVDDIIMLGNDAVLVDSLLRKLATAFKIRDLGKPTFFLSIETLVVPEGMI-LSQRRYMR  113
            +YVDDII+ G++A  V +++++L   F+++D+G+ ++FL ++      G I +SQ +Y R
Sbjct  825  LYVDDIILTGSNASKVQTVIQELGEVFELKDMGQLSYFLGLQLTYKANGDIFISQSKYAR  884

Query  112  DILHRVGMTDCKSLATP  62
            D++H+ GM  CK   TP
Sbjct  885  DLIHKAGMDTCKPAPTP  901



>gb|AAC02672.1| polyprotein [Arabidopsis arenosa]
Length=1390

 Score =   116 bits (291),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 55/140 (39%), Positives = 85/140 (61%), Gaps = 0/140 (0%)
 Frame = -3

Query  469   DPDIPDHICPLQRSLYGLK*APRAWFKRLHDFLLLTGFIAWKTDVSLFHYSAGNSRVFLL  290
             D D P H+C L ++LYGLK APRAW++ L  +LL  GF+    D SLF      + +++L
Sbjct  1070  DKDNPHHVCRLHKALYGLKQAPRAWYQELRSYLLTQGFVNSIADTSLFTLRHKRTILYVL  1129

Query  289   VYVDDIIMLGNDAVLVDSLLRKLATAFKIRDLGKPTFFLSIETLVVPEGMILSQRRYMRD  110
             VYVDD+++ G+D  ++   +  LA  F ++DLG+ ++FL IE     +G+ L Q+RY+ D
Sbjct  1130  VYVDDMLITGSDTNIITRFIANLAARFSLKDLGEMSYFLGIEATRTSKGLHLMQKRYVLD  1189

Query  109   ILHRVGMTDCKSLATPASVT  50
             +L +  M     + TP S T
Sbjct  1190  LLEKTNMLAAHPVLTPMSPT  1209



>gb|AAX96296.1| retrotransposon protein, putative, unclassified [Oryza sativa 
Japonica Group]
 gb|ABA91784.1| retrotransposon protein, putative, unclassified [Oryza sativa 
Japonica Group]
Length=1325

 Score =   116 bits (290),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 53/140 (38%), Positives = 85/140 (61%), Gaps = 0/140 (0%)
 Frame = -3

Query  469   DPDIPDHICPLQRSLYGLK*APRAWFKRLHDFLLLTGFIAWKTDVSLFHYSAGNSRVFLL  290
             +PD P+H+  L ++LYGLK APRAW+ RL +FLL  GF   K D +LF    G++++F+ 
Sbjct  1052  NPDFPNHVFKLSKALYGLKQAPRAWYDRLKNFLLAKGFTMGKVDKTLFVLKHGDNQLFVQ  1111

Query  289   VYVDDIIMLGNDAVLVDSLLRKLATAFKIRDLGKPTFFLSIETLVVPEGMILSQRRYMRD  110
             +YVDDII   +   LV      +   F++  +G+ ++FL ++    P+G  + Q +Y +D
Sbjct  1112  IYVDDIIFGCSTHALVVDFAETMRREFEMSMMGELSYFLGLQIKQTPQGTFVHQTKYTKD  1171

Query  109   ILHRVGMTDCKSLATPASVT  50
             +L R  M +CK ++TP   T
Sbjct  1172  LLRRFKMENCKPISTPIGST  1191



>gb|KHN21230.1| Retrovirus-related Pol polyprotein from transposon TNT 1-94, 
partial [Glycine soja]
Length=1429

 Score =   116 bits (290),  Expect = 1e-26, Method: Composition-based stats.
 Identities = 58/147 (39%), Positives = 89/147 (61%), Gaps = 2/147 (1%)
 Frame = -3

Query  448   ICPLQRSLYGLK*APRAWFKRLHDFLLLTGFIAWKTDVSLFHYSAGNSRVFLLVYVDDII  269
             +C L +++YGLK APRAW++ L + L+  GF   K D SL  ++     + +L+YVDDII
Sbjct  1054  VCKLHKAIYGLKQAPRAWYESLTNTLISFGFQQSKCDPSLLIFNKHGCCLLILIYVDDII  1113

Query  268   MLGNDAVLVDSLLRKLATAFKIRDLGKPTFFLSIETLVVPEGMI-LSQRRYMRDILHRVG  92
             + G+    ++ ++ KL   F ++ LG   +FL IE  + P G + LSQ +Y+RDILHR G
Sbjct  1114  ITGSSNTAINLIVNKLNATFSLKQLGTLEYFLGIECKLTPSGALHLSQAKYIRDILHRAG  1173

Query  91    MTDCKSLATPASVTQPVCQS-TDSFAN  14
             M DCK ++TP      + ++  D F N
Sbjct  1174  MEDCKGISTPLPANLKLSKTGADPFDN  1200



>gb|AAP50939.1| putative gag-pol polyprotein, 3'-partial [Oryza sativa Japonica 
Group]
Length=1237

 Score =   116 bits (290),  Expect = 1e-26, Method: Composition-based stats.
 Identities = 52/140 (37%), Positives = 84/140 (60%), Gaps = 0/140 (0%)
 Frame = -3

Query  469   DPDIPDHICPLQRSLYGLK*APRAWFKRLHDFLLLTGFIAWKTDVSLFHYSAGNSRVFLL  290
             +PD P+H+  L ++LYGLK APRAW+ RL +FLL  GF   K D +LF    G++++F+ 
Sbjct  1061  NPDFPNHVFKLSKALYGLKQAPRAWYDRLKNFLLAKGFTMGKVDKTLFVLKHGDNQLFVK  1120

Query  289   VYVDDIIMLGNDAVLVDSLLRKLATAFKIRDLGKPTFFLSIETLVVPEGMILSQRRYMRD  110
             +Y+DDII   +   LV      +   F++  +G+ ++FL ++    P+G  + Q +Y  D
Sbjct  1121  IYMDDIIFCCSTHALVVDFAENMRREFEMSMMGELSYFLGLQIKQTPQGTFVHQTKYTND  1180

Query  109   ILHRVGMTDCKSLATPASVT  50
             +L R  M +CK ++TP   T
Sbjct  1181  LLRRFKMENCKPISTPIGST  1200



>gb|ABA98847.1| retrotransposon protein, putative, unclassified [Oryza sativa 
Japonica Group]
Length=1417

 Score =   116 bits (290),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 53/140 (38%), Positives = 86/140 (61%), Gaps = 0/140 (0%)
 Frame = -3

Query  469   DPDIPDHICPLQRSLYGLK*APRAWFKRLHDFLLLTGFIAWKTDVSLFHYSAGNSRVFLL  290
             +PD P+H+  L ++LYGLK APRAW+ RL +FLL  GF   K D +LF    G++++F+ 
Sbjct  1040  NPDFPNHVFKLSKALYGLKQAPRAWYDRLKNFLLAKGFTMGKVDKTLFVLKHGDNQLFVQ  1099

Query  289   VYVDDIIMLGNDAVLVDSLLRKLATAFKIRDLGKPTFFLSIETLVVPEGMILSQRRYMRD  110
             +YVDDII   +   LV      +   F++  +G+ ++FL ++    P+G  + Q +Y +D
Sbjct  1100  IYVDDIIFGCSTHALVVDFAETMRREFEMSMMGELSYFLRLQIKQTPQGTFVHQTKYTKD  1159

Query  109   ILHRVGMTDCKSLATPASVT  50
             +L R+ M +CK ++TP   T
Sbjct  1160  LLRRLKMENCKPISTPIGST  1179



>gb|AAB87099.1| putative retroelement pol polyprotein [Arabidopsis thaliana]
Length=1496

 Score =   116 bits (290),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 61/153 (40%), Positives = 86/153 (56%), Gaps = 7/153 (5%)
 Frame = -3

Query  457   PDHICPLQRSLYGLK*APRAWFKRLHDFLLLTGFIAWKTDVSLFHYSAGNSRVFLLVYVD  278
             P  +C L++SLYGLK APR WF +L   L   GF     D SLF    G++ + +LVYVD
Sbjct  1122  PSKVCRLRKSLYGLKQAPRCWFSKLSTALRNIGFTQSYEDYSLFSLKNGDTIIHVLVYVD  1181

Query  277   DIIMLGNDAVLVDSLLRKLATAFKIRDLGKPTFFLSIETLVVPEGMILSQRRYMRDILHR  98
             D+I+ GN+   +D    +L   F ++DLGK  +FL +E    P+G  LSQR+Y  DI+  
Sbjct  1182  DLIVAGNNLDAIDRFKSQLHKCFHMKDLGKLKYFLGLEVSRGPDGFCLSQRKYALDIVKE  1241

Query  97    VGMTDCKSLATP-------ASVTQPVCQSTDSF  20
              G+  CK  A P       AS+T PV  + + +
Sbjct  1242  TGLLGCKPSAVPIALNHKLASITGPVFTNPEQY  1274



>dbj|BAH79981.1| putative unclassified retrotransposon protein [Oryza sativa Indica 
Group]
Length=1425

 Score =   116 bits (290),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 52/140 (37%), Positives = 85/140 (61%), Gaps = 0/140 (0%)
 Frame = -3

Query  469   DPDIPDHICPLQRSLYGLK*APRAWFKRLHDFLLLTGFIAWKTDVSLFHYSAGNSRVFLL  290
             +PD P+H+  L ++LYGLK APR W+ RL +FLL  GF   K D +LF    G++++F+ 
Sbjct  1103  NPDFPNHVFKLSKALYGLKQAPRTWYDRLKNFLLAKGFTMGKVDKTLFVLKRGDNQLFVQ  1162

Query  289   VYVDDIIMLGNDAVLVDSLLRKLATAFKIRDLGKPTFFLSIETLVVPEGMILSQRRYMRD  110
             +YVDDII   +   LV      +   F++  +G+ ++FL ++    P+G  + Q++Y +D
Sbjct  1163  IYVDDIIFGCSTHALVVDFAETIRREFEMSMMGELSYFLGLQIKQTPQGTFVHQKKYTKD  1222

Query  109   ILHRVGMTDCKSLATPASVT  50
             +L R  M +CK ++TP   T
Sbjct  1223  LLRRFKMENCKPISTPIGST  1242



>gb|AAT76321.1| putative integrase [Oryza sativa Japonica Group]
 gb|ABF97341.1| retrotransposon protein, putative, unclassified [Oryza sativa 
Japonica Group]
Length=1425

 Score =   115 bits (289),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 53/140 (38%), Positives = 84/140 (60%), Gaps = 0/140 (0%)
 Frame = -3

Query  469   DPDIPDHICPLQRSLYGLK*APRAWFKRLHDFLLLTGFIAWKTDVSLFHYSAGNSRVFLL  290
             +PD P+H+  L ++LYGLK APR W+ RL +FLL  GF   K D +LF    G++++F+ 
Sbjct  1150  NPDFPNHVFKLSKALYGLKQAPRPWYDRLKNFLLAKGFTMGKVDKTLFVLKHGDNQLFIQ  1209

Query  289   VYVDDIIMLGNDAVLVDSLLRKLATAFKIRDLGKPTFFLSIETLVVPEGMILSQRRYMRD  110
             +YVDDII   +   LV      +   F++  +GK ++FL ++    P+G  + Q +Y +D
Sbjct  1210  IYVDDIIFGCSTHALVVEFAETMRREFEMSMMGKLSYFLGLQIKQTPQGTFVHQTKYTKD  1269

Query  109   ILHRVGMTDCKSLATPASVT  50
             +L R  M +CK ++TP   T
Sbjct  1270  LLRRFKMENCKPISTPIGST  1289



>ref|XP_008389560.1| PREDICTED: uncharacterized protein LOC103451895 [Malus domestica]
Length=1300

 Score =   115 bits (289),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 60/136 (44%), Positives = 81/136 (60%), Gaps = 0/136 (0%)
 Frame = -3

Query  469   DPDIPDHICPLQRSLYGLK*APRAWFKRLHDFLLLTGFIAWKTDVSLFHYSAGNSRVFLL  290
             DP  P+ +C L +SLYGLK APRAW  R   FL   GF +   D SLF    G+  V LL
Sbjct  913   DPSHPELVCHLHKSLYGLKQAPRAWNDRFTSFLPTLGFQSTYADSSLFVKIVGSDIVVLL  972

Query  289   VYVDDIIMLGNDAVLVDSLLRKLATAFKIRDLGKPTFFLSIETLVVPEGMILSQRRYMRD  110
             +YVDDII+ G+    +  ++  L + F I+DLG+  +FL I+ L    G+ LSQ +Y+ D
Sbjct  973   LYVDDIILTGSSHSGIQQVITSLTSEFDIKDLGELHYFLGIQVLHTATGLFLSQSKYILD  1032

Query  109   ILHRVGMTDCKSLATP  62
             +L +V M DCK   TP
Sbjct  1033  LLKKVEMVDCKPCDTP  1048



>gb|AAM08523.1|AC068654_25 Putative retroelement [Oryza sativa Japonica Group]
 gb|AAP51828.1| retrotransposon protein, putative, Ty1-copia subclass [Oryza 
sativa Japonica Group]
Length=1522

 Score =   115 bits (289),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 54/140 (39%), Positives = 84/140 (60%), Gaps = 0/140 (0%)
 Frame = -3

Query  469   DPDIPDHICPLQRSLYGLK*APRAWFKRLHDFLLLTGFIAWKTDVSLFHYSAGNSRVFLL  290
             +PD P H+  L ++LYGLK APRAW+ RL +FLL  GF   K D +LF    G++++F+ 
Sbjct  1145  NPDFPKHVFKLSKALYGLKQAPRAWYDRLKNFLLTKGFTIGKVDKTLFVLKHGDNQLFVQ  1204

Query  289   VYVDDIIMLGNDAVLVDSLLRKLATAFKIRDLGKPTFFLSIETLVVPEGMILSQRRYMRD  110
             +YVDDII   +   LV      +   FK+  +G+ ++FL ++    P+G  + Q +Y +D
Sbjct  1205  IYVDDIIFGCSTHALVVDFAEIMHREFKMSMMGELSYFLGLQIKQTPQGTFVHQTKYTKD  1264

Query  109   ILHRVGMTDCKSLATPASVT  50
             +L R  M +CK ++TP   T
Sbjct  1265  LLRRFKMENCKPISTPIGST  1284



>ref|XP_006579236.1| PREDICTED: uncharacterized protein LOC102665202 [Glycine max]
Length=1364

 Score =   115 bits (289),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 55/130 (42%), Positives = 83/130 (64%), Gaps = 1/130 (1%)
 Frame = -3

Query  448  ICPLQRSLYGLK*APRAWFKRLHDFLLLTGFIAWKTDVSLFHYSAGNSRVFLLVYVDDII  269
            +C L +++YGLK APRAW++ L + L+  GF   K D SL  ++     + +L+YVDDII
Sbjct  297  VCKLHKAIYGLKQAPRAWYESLTNTLISFGFQQSKCDPSLLIFNKHGCCLLILIYVDDII  356

Query  268  MLGNDAVLVDSLLRKLATAFKIRDLGKPTFFLSIETLVVPEGMI-LSQRRYMRDILHRVG  92
            + G+    ++ ++ KL   F ++ LG   +FL IE  + P G + LSQ +Y+RDILHR G
Sbjct  357  ITGSSNTAINLIVNKLNATFSLKQLGTLEYFLGIECKLTPSGALHLSQAKYIRDILHRAG  416

Query  91   MTDCKSLATP  62
            M DCK ++TP
Sbjct  417  MEDCKGISTP  426



>emb|CAN63081.1| hypothetical protein VITISV_016842 [Vitis vinifera]
Length=1179

 Score =   115 bits (288),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 58/130 (45%), Positives = 81/130 (62%), Gaps = 1/130 (1%)
 Frame = -3

Query  448   ICPLQRSLYGLK*APRAWFKRLHDFLLLTGFIAWKTDVSLF-HYSAGNSRVFLLVYVDDI  272
             +C L+RSLYGLK +PRAWF R    +   G      D S+F H+++    ++L+VYVDDI
Sbjct  893   VCRLRRSLYGLKQSPRAWFSRFSSVVQEFGMFRSTADHSVFYHHNSSGQCIYLVVYVDDI  952

Query  271   IMLGNDAVLVDSLLRKLATAFKIRDLGKPTFFLSIETLVVPEGMILSQRRYMRDILHRVG  92
             I+ G+D   +  L + L T F+ +DLGK  +FL IE      G++LSQR+Y+ DIL   G
Sbjct  953   IITGSDQNGIQKLKQHLFTHFQTKDLGKLKYFLGIEIAQSSSGVVLSQRKYVLDILEETG  1012

Query  91    MTDCKSLATP  62
             M DCK + TP
Sbjct  1013  MLDCKPVDTP  1022



>emb|CAN78696.1| hypothetical protein VITISV_035269 [Vitis vinifera]
Length=928

 Score =   115 bits (287),  Expect = 3e-26, Method: Composition-based stats.
 Identities = 57/136 (42%), Positives = 87/136 (64%), Gaps = 0/136 (0%)
 Frame = -3

Query  454  DHICPLQRSLYGLK*APRAWFKRLHDFLLLTGFIAWKTDVSLFHYSAGNSRVFLLVYVDD  275
            D IC L ++LYGLK APRAWF +L + LL  GF +  +D S+F    G   + +L+YVDD
Sbjct  131  DFICKLYKALYGLKQAPRAWFTKLKNSLLAWGFSSSLSDSSMFLLRKGTDMIIILIYVDD  190

Query  274  IIMLGNDAVLVDSLLRKLATAFKIRDLGKPTFFLSIETLVVPEGMILSQRRYMRDILHRV  95
            II++G++ VLV  ++  L + F I+DLG   +FL +E       + L Q +Y++++ +RV
Sbjct  191  IIVIGSNIVLVHQMVSSLHSQFAIKDLGILNYFLGVEVSWQGPSLHLFQTKYIQNLFNRV  250

Query  94   GMTDCKSLATPASVTQ  47
            G TDCK +ATP + + 
Sbjct  251  GFTDCKPIATPMTTSH  266



>gb|AAR87335.1| putative gag-pol polyprotein [Oryza sativa Japonica Group]
 gb|ABF99065.1| retrotransposon protein, putative, unclassified [Oryza sativa 
Japonica Group]
Length=1438

 Score =   115 bits (288),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 52/140 (37%), Positives = 84/140 (60%), Gaps = 0/140 (0%)
 Frame = -3

Query  469   DPDIPDHICPLQRSLYGLK*APRAWFKRLHDFLLLTGFIAWKTDVSLFHYSAGNSRVFLL  290
             +PD P+H+  L ++LYGLK APRAW+ RL +FLL  GF   K D +LF    G++++F+ 
Sbjct  1061  NPDFPNHVFKLSKALYGLKQAPRAWYDRLKNFLLAKGFTMGKVDKTLFVLKHGDNQLFVK  1120

Query  289   VYVDDIIMLGNDAVLVDSLLRKLATAFKIRDLGKPTFFLSIETLVVPEGMILSQRRYMRD  110
             +Y+DDII   +   LV      +   F++  +G+ ++FL ++    P+G  + Q +Y  D
Sbjct  1121  IYMDDIIFCCSTHALVVDFAENMRREFEMSMMGELSYFLGLQIKQTPQGTFVHQTKYTND  1180

Query  109   ILHRVGMTDCKSLATPASVT  50
             +L R  M +CK ++TP   T
Sbjct  1181  LLRRFKMENCKPISTPIGST  1200



>ref|XP_004966848.1| PREDICTED: uncharacterized protein LOC101777861 [Setaria italica]
Length=2179

 Score =   115 bits (289),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 57/136 (42%), Positives = 79/136 (58%), Gaps = 0/136 (0%)
 Frame = -3

Query  469   DPDIPDHICPLQRSLYGLK*APRAWFKRLHDFLLLTGFIAWKTDVSLFHYSAGNSRVFLL  290
             D   P+H+C L +SLYGLK APRAW  R    +   GF+  K+D SLF +  G    FLL
Sbjct  1163  DSSKPNHVCRLNKSLYGLKQAPRAWHSRFASHITSLGFVEAKSDTSLFIFCRGADMAFLL  1222

Query  289   VYVDDIIMLGNDAVLVDSLLRKLATAFKIRDLGKPTFFLSIETLVVPEGMILSQRRYMRD  110
             +YVDDI++  +   L+  ++  L  AF + D+G    FL +      + + LSQR+YM D
Sbjct  1223  LYVDDIVLTASSPSLLHRIIAALRRAFSMTDMGPLHHFLGVSVQRRDDSLFLSQRQYMLD  1282

Query  109   ILHRVGMTDCKSLATP  62
             IL R GM+ CK  +TP
Sbjct  1283  ILERAGMSHCKPSSTP  1298



>emb|CAN76196.1| hypothetical protein VITISV_041073 [Vitis vinifera]
Length=1505

 Score =   115 bits (288),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 54/149 (36%), Positives = 89/149 (60%), Gaps = 1/149 (1%)
 Frame = -3

Query  469   DPDIPDHICPLQRSLYGLK*APRAWFKRLHDFLLLTGFIAWKTDVSLFHYSAGNSRV-FL  293
             D      +C L++SLYGLK +PRAWF+R   F+   G++  ++D ++F   + + ++  L
Sbjct  1126  DEHFGSKVCKLKKSLYGLKQSPRAWFERFTQFVKNQGYVQAQSDHTMFIKHSNDGKIAIL  1185

Query  292   LVYVDDIIMLGNDAVLVDSLLRKLATAFKIRDLGKPTFFLSIETLVVPEGMILSQRRYMR  113
             +VYVDDII+ G+    +D L + LA  F+I+DLG   +FL +E      G+++SQR+Y+ 
Sbjct  1186  IVYVDDIILTGDHVTEMDRLKKSLALEFEIKDLGSLRYFLGMEVARSKRGIVVSQRKYIL  1245

Query  112   DILHRVGMTDCKSLATPASVTQPVCQSTD  26
             D+L   GM+ C+   TP    Q +  + D
Sbjct  1246  DLLKETGMSGCRPADTPIDPNQKLGDTND  1274



>emb|CAN67539.1| hypothetical protein VITISV_021584 [Vitis vinifera]
Length=1652

 Score =   115 bits (288),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 59/147 (40%), Positives = 84/147 (57%), Gaps = 0/147 (0%)
 Frame = -3

Query  466   PDIPDHICPLQRSLYGLK*APRAWFKRLHDFLLLTGFIAWKTDVSLFHYSAGNSRVFLLV  287
             P    H+C L+RSLYGLK APRAWF +    LL   F   K D SLF   +    V LLV
Sbjct  1049  PSPTSHVCKLRRSLYGLKQAPRAWFDKFRTTLLQFSFKQSKYDTSLFLRKSDMGIVVLLV  1108

Query  286   YVDDIIMLGNDAVLVDSLLRKLATAFKIRDLGKPTFFLSIETLVVPEGMILSQRRYMRDI  107
             YVDDI++ G+D+ L+  L   L+ +F ++DLG  T+FL +E    P G+ L+Q +Y  D+
Sbjct  1109  YVDDIVITGSDSALLGQLKTHLSKSFHMKDLGSLTYFLGLEVHHSPSGISLNQHKYASDL  1168

Query  106   LHRVGMTDCKSLATPASVTQPVCQSTD  26
             +   G+    S+ TP  +   +C+  D
Sbjct  1169  VATTGLQGATSVDTPMELNVKLCKEED  1195



>gb|ABA97707.2| retrotransposon protein, putative, Ty1-copia subclass [Oryza 
sativa Japonica Group]
Length=1001

 Score =   115 bits (287),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 57/124 (46%), Positives = 79/124 (64%), Gaps = 0/124 (0%)
 Frame = -3

Query  457  PDHICPLQRSLYGLK*APRAWFKRLHDFLLLTGFIAWKTDVSLFHYSAGNSRVFLLVYVD  278
            P ++C L ++LYGLK APRAW+ RL   L   GF   K D+ LF Y  G+  +F+LVYVD
Sbjct  780  PHYVCKLDKALYGLKQAPRAWYSRLSMKLQQLGFSPSKADILLFFYRKGSVTIFVLVYVD  839

Query  277  DIIMLGNDAVLVDSLLRKLATAFKIRDLGKPTFFLSIETLVVPEGMILSQRRYMRDILHR  98
            DII+  +   +V SLL  L   F ++DLG   +FL IE   + +G++LSQ +Y  DIL R
Sbjct  840  DIIVASSSQDVVSSLLHDLKMDFALKDLGDLNYFLGIEVKKISDGLVLSQDKYTHDILKR  899

Query  97   VGMT  86
            +GM+
Sbjct  900  MGMS  903



>emb|CAN64167.1| hypothetical protein VITISV_015919 [Vitis vinifera]
Length=383

 Score =   112 bits (279),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 57/130 (44%), Positives = 81/130 (62%), Gaps = 1/130 (1%)
 Frame = -3

Query  448  ICPLQRSLYGLK*APRAWFKRLHDFLLLTGFIAWKTDVSLF-HYSAGNSRVFLLVYVDDI  272
            +C L+RSLYGLK +PRAWF R    +   G +    D S+F H+++    ++L+VYVDDI
Sbjct  244  VCRLRRSLYGLKQSPRAWFGRFSSVVQEFGMLRSTADHSVFYHHNSLGQCIYLVVYVDDI  303

Query  271  IMLGNDAVLVDSLLRKLATAFKIRDLGKPTFFLSIETLVVPEGMILSQRRYMRDILHRVG  92
            ++ G+D   +  L + L T F+ +DLGK  +FL IE      G++LSQR+Y  DIL   G
Sbjct  304  VITGSDQDGIQKLKQHLFTHFQTKDLGKLKYFLGIEIAQSNSGVVLSQRKYALDILEETG  363

Query  91   MTDCKSLATP  62
            M DCK + TP
Sbjct  364  MLDCKPVDTP  373



>gb|AAP53706.1| retrotransposon protein, putative, unclassified [Oryza sativa 
Japonica Group]
Length=1419

 Score =   115 bits (287),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 52/140 (37%), Positives = 85/140 (61%), Gaps = 0/140 (0%)
 Frame = -3

Query  469   DPDIPDHICPLQRSLYGLK*APRAWFKRLHDFLLLTGFIAWKTDVSLFHYSAGNSRVFLL  290
             +PD P+H+  L ++LYGLK APRAW+ RL +FLL  GF   K D +LF    G++++F+ 
Sbjct  1042  NPDFPNHVFKLSKALYGLKQAPRAWYDRLKNFLLAKGFTMGKVDKTLFVLKHGDNQLFVQ  1101

Query  289   VYVDDIIMLGNDAVLVDSLLRKLATAFKIRDLGKPTFFLSIETLVVPEGMILSQRRYMRD  110
             +YVDDII   +   +V      +   F++  +G+ ++FL ++    P+G  + Q +Y +D
Sbjct  1102  IYVDDIIFGCSTHAVVVDFAETMRREFEMSMMGELSYFLGLQIKQTPQGTFVHQTKYTKD  1161

Query  109   ILHRVGMTDCKSLATPASVT  50
             +L R  M +CK ++TP   T
Sbjct  1162  LLRRFKMENCKPISTPIGST  1181



>emb|CAE04585.2| OSJNBb0006N15.2 [Oryza sativa Japonica Group]
Length=1134

 Score =   115 bits (287),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 52/140 (37%), Positives = 84/140 (60%), Gaps = 0/140 (0%)
 Frame = -3

Query  469  DPDIPDHICPLQRSLYGLK*APRAWFKRLHDFLLLTGFIAWKTDVSLFHYSAGNSRVFLL  290
            +PD P+H+  L ++LYGLK APRAW+ RL +F L  GF   K D +LF    G++++F+ 
Sbjct  816  NPDFPNHVFKLSKALYGLKQAPRAWYDRLKNFFLAKGFTMGKVDKTLFVLKHGDNQLFVQ  875

Query  289  VYVDDIIMLGNDAVLVDSLLRKLATAFKIRDLGKPTFFLSIETLVVPEGMILSQRRYMRD  110
            +YVDDII   +   LV      +   F++  +G+ ++FL ++    P+G  + Q +Y +D
Sbjct  876  IYVDDIIFGCSTHALVVDFAETMRREFEMSMMGELSYFLGLQIKQTPQGTFVHQTKYTKD  935

Query  109  ILHRVGMTDCKSLATPASVT  50
            +L R  M +CK ++TP   T
Sbjct  936  LLRRFKMENCKPISTPIGST  955



>emb|CAN71273.1| hypothetical protein VITISV_019661 [Vitis vinifera]
Length=1276

 Score =   115 bits (287),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 57/130 (44%), Positives = 81/130 (62%), Gaps = 1/130 (1%)
 Frame = -3

Query  448  ICPLQRSLYGLK*APRAWFKRLHDFLLLTGFIAWKTDVSLF-HYSAGNSRVFLLVYVDDI  272
            +C L+RSLYGLK +PRAWF R +  +   G      D S+F H+++    ++L+VYVDDI
Sbjct  468  VCRLRRSLYGLKQSPRAWFSRFNSVVQEFGMFRSTADHSVFYHHNSSGQCIYLVVYVDDI  527

Query  271  IMLGNDAVLVDSLLRKLATAFKIRDLGKPTFFLSIETLVVPEGMILSQRRYMRDILHRVG  92
            ++ G+D   +  L + L T F+ +DLGK  +FL IE      G++LSQR+Y  DIL   G
Sbjct  528  VITGSDQNGIHKLKQHLFTHFQTKDLGKLKYFLGIEIAQSSSGVVLSQRKYALDILEETG  587

Query  91   MTDCKSLATP  62
            M DCK + TP
Sbjct  588  MLDCKPVDTP  597



>emb|CAN70817.1| hypothetical protein VITISV_029336 [Vitis vinifera]
Length=1044

 Score =   114 bits (286),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 56/137 (41%), Positives = 80/137 (58%), Gaps = 0/137 (0%)
 Frame = -3

Query  457  PDHICPLQRSLYGLK*APRAWFKRLHDFLLLTGFIAWKTDVSLFHYSAGNSRVFLLVYVD  278
            PD++C L++++YGLK  PRAW+  L   LL  GF   K D SLF Y   +   + LVYVD
Sbjct  658  PDYVCRLRKAIYGLKQGPRAWYSALKTALLALGFQNSKADSSLFVYHHDSIVCYFLVYVD  717

Query  277  DIIMLGNDAVLVDSLLRKLATAFKIRDLGKPTFFLSIETLVVPEGMILSQRRYMRDILHR  98
            D+++ GND   V  ++ KL   F ++D+G   +FL +E +     + LSQ +Y RDIL  
Sbjct  718  DLVITGNDKKFVAHVVTKLGDQFSLKDMGSLHYFLGVEVIPTTAVVFLSQHKYARDILEN  777

Query  97   VGMTDCKSLATPASVTQ  47
              M   K ++TP S TQ
Sbjct  778  THMAGAKDVSTPLSTTQ  794



>emb|CAN71427.1| hypothetical protein VITISV_027864 [Vitis vinifera]
Length=1300

 Score =   115 bits (287),  Expect = 4e-26, Method: Composition-based stats.
 Identities = 51/141 (36%), Positives = 87/141 (62%), Gaps = 0/141 (0%)
 Frame = -3

Query  457   PDHICPLQRSLYGLK*APRAWFKRLHDFLLLTGFIAWKTDVSLFHYSAGNSRVFLLVYVD  278
             P+++C L+++LYGLK APRAW+ ++ +FL  +G+     D SLF  + G     +LVYVD
Sbjct  921   PEYVCKLRKALYGLKQAPRAWYGKIAEFLTQSGYSVTPADSSLFVKANGGKLAIVLVYVD  980

Query  277   DIIMLGNDAVLVDSLLRKLATAFKIRDLGKPTFFLSIETLVVPEGMILSQRRYMRDILHR  98
             D+I+ G+D   +      L+  F++++LG+   FL +E     EG+ L Q++Y +D+L +
Sbjct  981   DLIITGDDVEEIFRTKENLSVRFEMKELGQLKHFLGLEVDRTNEGIFLCQQKYAKDLLKK  1040

Query  97    VGMTDCKSLATPASVTQPVCQ  35
              GM +CK ++TP      +C+
Sbjct  1041  FGMLECKPISTPMEPNAKMCE  1061



>gb|AAL68641.1|AF458765_1 polyprotein [Oryza sativa Japonica Group]
Length=1472

 Score =   115 bits (287),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 53/142 (37%), Positives = 83/142 (58%), Gaps = 0/142 (0%)
 Frame = -3

Query  439   LQRSLYGLK*APRAWFKRLHDFLLLTGFIAWKTDVSLFHYSAGNSRVFLLVYVDDIIMLG  260
             L++SLYGLK +PRAWF R    +   G+     D ++F++ +G+    L VYVDD+I+ G
Sbjct  1105  LKKSLYGLKQSPRAWFDRFRRAMCAMGYKQCNGDHTVFYHHSGDHITILAVYVDDMIITG  1164

Query  259   NDAVLVDSLLRKLATAFKIRDLGKPTFFLSIETLVVPEGMILSQRRYMRDILHRVGMTDC  80
             ND   +  L + L+  F+++DLG+  +FL IE    P G++LSQR+Y  D+L   GM  C
Sbjct  1165  NDCSEITRLKQNLSKEFEVKDLGQLKYFLGIEIARSPRGIVLSQRKYALDLLSDTGMLGC  1224

Query  79    KSLATPASVTQPVCQSTDSFAN  14
             +  +TP      +C  + +  N
Sbjct  1225  RPASTPVDQNHKLCAESGNPVN  1246



>ref|XP_009378848.1| PREDICTED: uncharacterized protein LOC103967297 [Pyrus x bretschneideri]
Length=1903

 Score =   115 bits (287),  Expect = 5e-26, Method: Composition-based stats.
 Identities = 58/138 (42%), Positives = 81/138 (59%), Gaps = 0/138 (0%)
 Frame = -3

Query  469   DPDIPDHICPLQRSLYGLK*APRAWFKRLHDFLLLTGFIAWKTDVSLFHYSAGNSRVFLL  290
             DP  P HIC LQ+ LYGLK APRAWF+     L   GF A   D SLF    G++ ++LL
Sbjct  1045  DPQFPSHICRLQKPLYGLKQAPRAWFQCFSQHLEELGFQASVADSSLFTLFNGSTVIYLL  1104

Query  289   VYVDDIIMLGNDAVLVDSLLRKLATAFKIRDLGKPTFFLSIETLVVPEGMILSQRRYMRD  110
              YVDDI++ GN+   +   +++L   F ++DLG   +FL +E       M LSQ +Y+ D
Sbjct  1105  TYVDDILVTGNNPSHISWFIQQLGQKFSMKDLGPLHYFLGMEITRASIAMYLSQSKYILD  1164

Query  109   ILHRVGMTDCKSLATPAS  56
             +L +  M+D K L T A+
Sbjct  1165  LLKKAKMSDAKPLTTSAA  1182



>emb|CCH50966.1| T4.5 [Malus x robusta]
Length=1670

 Score =   115 bits (287),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 58/141 (41%), Positives = 84/141 (60%), Gaps = 1/141 (1%)
 Frame = -3

Query  469   DPDIPDHICPLQRSLYGLK*APRAWFKRLHDFLLLTGFIAWKTDVSLFHYSAGNSRVFLL  290
             DP  P H+C L++SLYGLK APRAW++  +  +L  GF +  +D SLF      S  F+L
Sbjct  1281  DPSKPHHVCKLRKSLYGLKQAPRAWYEAFYTAILSLGFSSSHSDTSLF-IKRDTSITFIL  1339

Query  289   VYVDDIIMLGNDAVLVDSLLRKLATAFKIRDLGKPTFFLSIETLVVPEGMILSQRRYMRD  110
             VYVDDII+ G+      S++ +L T F ++DLG   +FL IE     +G++L Q +Y  D
Sbjct  1340  VYVDDIIITGSSVTECQSIISQLQTMFPVKDLGDINYFLGIEVHKSDQGLLLHQAKYALD  1399

Query  109   ILHRVGMTDCKSLATPASVTQ  47
             +L +  M   K  ATP S ++
Sbjct  1400  LLKKTDMLGAKPCATPVSTSK  1420



>emb|CAA19715.1| putative protein [Arabidopsis thaliana]
 emb|CAB79576.1| putative protein [Arabidopsis thaliana]
Length=1318

 Score =   114 bits (286),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 59/139 (42%), Positives = 85/139 (61%), Gaps = 0/139 (0%)
 Frame = -3

Query  469  DPDIPDHICPLQRSLYGLK*APRAWFKRLHDFLLLTGFIAWKTDVSLFHYSAGNSRVFLL  290
            DP  PDH+C L +S+YGLK +PRAWF +   FLL  GF   K+D SLF Y+  N+ + LL
Sbjct  846  DPSKPDHVCLLHKSIYGLKQSPRAWFDKFSTFLLEFGFFCSKSDPSLFIYAHNNNLILLL  905

Query  289  VYVDDIIMLGNDAVLVDSLLRKLATAFKIRDLGKPTFFLSIETLVVPEGMILSQRRYMRD  110
            +YVDD+++ GN +  + SLL  L   F++ D+G+  +FL I+      G+ +SQ++Y  D
Sbjct  906  LYVDDMVITGNSSQTLTSLLAALNKEFRMTDMGQLHYFLGIQVQRQQNGLFMSQQKYAED  965

Query  109  ILHRVGMTDCKSLATPASV  53
            +L    M  C  L TP  V
Sbjct  966  LLIAASMEHCTPLPTPLPV  984



>ref|XP_010026635.1| PREDICTED: uncharacterized protein LOC104417007 [Eucalyptus grandis]
Length=957

 Score =   114 bits (285),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 51/129 (40%), Positives = 81/129 (63%), Gaps = 0/129 (0%)
 Frame = -3

Query  448  ICPLQRSLYGLK*APRAWFKRLHDFLLLTGFIAWKTDVSLFHYSAGNSRVFLLVYVDDII  269
            +C L++SLYGLK A R W+ +    L   GF   K D +LF ++ G S ++L++YVDDI+
Sbjct  575  VCRLRKSLYGLKQASRQWYAKFTSALTTIGFKQSKHDYALFSWTKGTSSIYLMIYVDDIL  634

Query  268  MLGNDAVLVDSLLRKLATAFKIRDLGKPTFFLSIETLVVPEGMILSQRRYMRDILHRVGM  89
            ++GND + +  L   L ++F+I+DLG P +FL IE      G+ LSQR+++ +I+   G+
Sbjct  635  IMGNDELGIKRLKEHLHSSFRIKDLGSPKYFLGIEIARSELGIALSQRKFVLEIISEAGL  694

Query  88   TDCKSLATP  62
            + CK    P
Sbjct  695  SGCKPAIIP  703



>emb|CAD39835.2| OSJNBb0072N21.1 [Oryza sativa Japonica Group]
Length=420

 Score =   111 bits (277),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 51/140 (36%), Positives = 84/140 (60%), Gaps = 0/140 (0%)
 Frame = -3

Query  469  DPDIPDHICPLQRSLYGLK*APRAWFKRLHDFLLLTGFIAWKTDVSLFHYSAGNSRVFLL  290
            + D P+H+  L ++LYGLK APRAW+ RL +FLL  GF   K D +LF    G++++F+ 
Sbjct  117  NSDFPNHVFKLSKTLYGLKQAPRAWYDRLKNFLLAKGFTMGKVDKTLFILKHGDNQLFVQ  176

Query  289  VYVDDIIMLGNDAVLVDSLLRKLATAFKIRDLGKPTFFLSIETLVVPEGMILSQRRYMRD  110
            +YVDDII   +   LV    + +   F++  +G+ ++FL ++    P+   + Q +Y +D
Sbjct  177  IYVDDIIFGCSTHALVVEFAKTMCREFEMSMMGELSYFLGLQIKQTPQRTFVHQTKYTKD  236

Query  109  ILHRVGMTDCKSLATPASVT  50
            +L R  M +CK ++TP   T
Sbjct  237  LLRRFKMENCKPISTPIGST  256



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 510521614908