BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c56616_g1_i1 len=271 path=[1:0-270]

Length=271
                                                                      Score     E

emb|CAN71273.1|  hypothetical protein VITISV_019661                   38.1    6e-06   Vitis vinifera
emb|CAN67123.1|  hypothetical protein VITISV_040164                   38.1    1e-05   Vitis vinifera
emb|CAN68904.1|  hypothetical protein VITISV_025822                   40.0    1e-05   Vitis vinifera
emb|CAN78715.1|  hypothetical protein VITISV_030863                   39.7    2e-05   Vitis vinifera
emb|CAN76224.1|  hypothetical protein VITISV_017232                   38.5    3e-05   Vitis vinifera
emb|CAN81940.1|  hypothetical protein VITISV_007358                   38.9    3e-05   Vitis vinifera
emb|CAN63081.1|  hypothetical protein VITISV_016842                   37.7    3e-05   Vitis vinifera
gb|AFN88207.1|  integrase core domain containing protein              37.4    4e-05   
emb|CAN76176.1|  hypothetical protein VITISV_022748                   37.7    5e-05   Vitis vinifera
emb|CAN66243.1|  hypothetical protein VITISV_015916                   36.6    5e-05   Vitis vinifera
emb|CAN80841.1|  hypothetical protein VITISV_002785                   37.4    6e-05   Vitis vinifera
gb|ABI34329.1|  Integrase core domain containing protein              39.3    6e-05   Solanum demissum
emb|CAN70260.1|  hypothetical protein VITISV_002223                   36.2    8e-05   Vitis vinifera
emb|CAN80367.1|  hypothetical protein VITISV_014719                   36.2    9e-05   Vitis vinifera
emb|CAN69747.1|  hypothetical protein VITISV_016320                   38.1    1e-04   Vitis vinifera
emb|CAN77834.1|  hypothetical protein VITISV_024733                   38.1    1e-04   Vitis vinifera
emb|CAN62423.1|  hypothetical protein VITISV_020608                   36.6    1e-04   Vitis vinifera
emb|CAN75815.1|  hypothetical protein VITISV_004636                   38.1    1e-04   Vitis vinifera
emb|CAN63193.1|  hypothetical protein VITISV_017130                   36.2    1e-04   Vitis vinifera
emb|CAN74104.1|  hypothetical protein VITISV_008952                   37.7    2e-04   Vitis vinifera
emb|CAN74310.1|  hypothetical protein VITISV_037517                   35.8    2e-04   Vitis vinifera
emb|CAN64673.1|  hypothetical protein VITISV_007430                   35.8    2e-04   Vitis vinifera
emb|CAN71931.1|  hypothetical protein VITISV_013418                   35.8    3e-04   Vitis vinifera
emb|CAN78616.1|  hypothetical protein VITISV_003658                   35.4    3e-04   Vitis vinifera
emb|CAN60057.1|  hypothetical protein VITISV_039053                   38.1    3e-04   Vitis vinifera
emb|CAN81288.1|  hypothetical protein VITISV_036901                   35.4    4e-04   Vitis vinifera
emb|CAN69819.1|  hypothetical protein VITISV_025708                   35.0    4e-04   Vitis vinifera
emb|CAN80547.1|  hypothetical protein VITISV_010898                   35.0    4e-04   Vitis vinifera
emb|CAN67119.1|  hypothetical protein VITISV_017483                   35.0    4e-04   Vitis vinifera
emb|CAN74286.1|  hypothetical protein VITISV_036410                   35.0    4e-04   Vitis vinifera
emb|CAN81139.1|  hypothetical protein VITISV_018760                   35.0    4e-04   Vitis vinifera
emb|CAN83856.1|  hypothetical protein VITISV_014673                   35.4    4e-04   Vitis vinifera
emb|CAN61179.1|  hypothetical protein VITISV_032292                   35.0    4e-04   Vitis vinifera
emb|CAN62614.1|  hypothetical protein VITISV_028123                   35.0    4e-04   Vitis vinifera
emb|CAN84135.1|  hypothetical protein VITISV_000113                   35.0    4e-04   Vitis vinifera
emb|CAN73074.1|  hypothetical protein VITISV_032386                   35.4    4e-04   Vitis vinifera
emb|CAN76032.1|  hypothetical protein VITISV_040150                   35.4    4e-04   Vitis vinifera
emb|CAN62266.1|  hypothetical protein VITISV_025647                   35.8    4e-04   Vitis vinifera
emb|CAN63185.1|  hypothetical protein VITISV_000411                   35.0    5e-04   Vitis vinifera
emb|CAN67925.1|  hypothetical protein VITISV_021168                   35.0    5e-04   Vitis vinifera
emb|CAN69688.1|  hypothetical protein VITISV_026774                   34.7    5e-04   Vitis vinifera
emb|CAN63730.1|  hypothetical protein VITISV_030286                   35.0    5e-04   Vitis vinifera
emb|CAN62074.1|  hypothetical protein VITISV_001619                   35.0    5e-04   Vitis vinifera
emb|CAN61207.1|  hypothetical protein VITISV_015446                   34.7    5e-04   Vitis vinifera
emb|CAN62535.1|  hypothetical protein VITISV_041880                   34.7    5e-04   Vitis vinifera
emb|CAN75922.1|  hypothetical protein VITISV_030752                   35.0    5e-04   Vitis vinifera
emb|CAN67317.1|  hypothetical protein VITISV_019719                   35.0    5e-04   Vitis vinifera
emb|CAN65932.1|  hypothetical protein VITISV_016257                   35.0    5e-04   Vitis vinifera
emb|CAN69307.1|  hypothetical protein VITISV_001120                   35.8    7e-04   Vitis vinifera
ref|XP_010663565.1|  PREDICTED: uncharacterized protein LOC100247...  36.6    7e-04   
emb|CAN75744.1|  hypothetical protein VITISV_040125                   34.7    8e-04   Vitis vinifera
emb|CAN77046.1|  hypothetical protein VITISV_035257                   34.7    8e-04   Vitis vinifera
emb|CAN71088.1|  hypothetical protein VITISV_033975                   35.0    9e-04   Vitis vinifera



>emb|CAN71273.1| hypothetical protein VITISV_019661 [Vitis vinifera]
Length=1276

 Score = 38.1 bits (87),  Expect(2) = 6e-06, Method: Composition-based stats.
 Identities = 18/44 (41%), Positives = 29/44 (66%), Gaps = 1/44 (2%)
 Frame = +3

Query  135  WHKAKSLYMNDIQCLYSLISNMLKFWYPIDMDIPEFPGQVEALQ  266
            W++AK LY NDIQ LY + S+++      DMD+  + GQ+ +L+
Sbjct  97   WNQAKGLYTNDIQRLYKVASSIVNVRQQ-DMDLSTYIGQIASLK  139


 Score = 37.7 bits (86),  Expect(2) = 6e-06, Method: Composition-based stats.
 Identities = 14/29 (48%), Positives = 24/29 (83%), Gaps = 0/29 (0%)
 Frame = +2

Query  44   KLDALLCNMLRQSIDSKLHIIYKAYETCY  130
            K+DA LC++L QS+D K+ + ++AY+TC+
Sbjct  66   KIDAQLCSVLWQSVDPKILLHFRAYKTCF  94



>emb|CAN67123.1| hypothetical protein VITISV_040164 [Vitis vinifera]
Length=982

 Score = 38.1 bits (87),  Expect(2) = 1e-05, Method: Compositional matrix adjust.
 Identities = 18/45 (40%), Positives = 29/45 (64%), Gaps = 1/45 (2%)
 Frame = +3

Query  135  WHKAKSLYMNDIQCLYSLISNMLKFWYPIDMDIPEFPGQVEALQH  269
            W++AK LY NDIQ LY + S+++      DMD+  + GQ+ +L+ 
Sbjct  62   WNQAKGLYTNDIQRLYKVASSIVNVKQQ-DMDLSTYIGQIASLKE  105


 Score = 37.0 bits (84),  Expect(2) = 1e-05, Method: Composition-based stats.
 Identities = 14/29 (48%), Positives = 24/29 (83%), Gaps = 0/29 (0%)
 Frame = +2

Query  44   KLDALLCNMLRQSIDSKLHIIYKAYETCY  130
            K+DA LC++L QS+D K+ + ++AY+TC+
Sbjct  31   KIDAQLCSVLWQSVDPKILLHFRAYKTCF  59



>emb|CAN68904.1| hypothetical protein VITISV_025822 [Vitis vinifera]
Length=487

 Score = 40.0 bits (92),  Expect(2) = 1e-05, Method: Compositional matrix adjust.
 Identities = 18/44 (41%), Positives = 29/44 (66%), Gaps = 1/44 (2%)
 Frame = +3

Query  135  WHKAKSLYMNDIQCLYSLISNMLKFWYPIDMDIPEFPGQVEALQ  266
            WH+AK LY NDIQ LY ++S+++      DM +  + GQ+ +L+
Sbjct  97   WHQAKGLYTNDIQHLYKVVSSIVNVRQQ-DMGLSTYIGQIASLK  139


 Score = 35.0 bits (79),  Expect(2) = 1e-05, Method: Composition-based stats.
 Identities = 14/29 (48%), Positives = 22/29 (76%), Gaps = 0/29 (0%)
 Frame = +2

Query  44   KLDALLCNMLRQSIDSKLHIIYKAYETCY  130
            K+DA LC++L QS+D K+    +AY+TC+
Sbjct  66   KIDAQLCSVLWQSVDPKILFHLRAYKTCF  94



>emb|CAN78715.1| hypothetical protein VITISV_030863 [Vitis vinifera]
Length=1228

 Score = 39.7 bits (91),  Expect(2) = 2e-05, Method: Compositional matrix adjust.
 Identities = 18/45 (40%), Positives = 28/45 (62%), Gaps = 1/45 (2%)
 Frame = +3

Query  135  WHKAKSLYMNDIQCLYSLISNMLKFWYPIDMDIPEFPGQVEALQH  269
            W +AK LY NDIQCLY + S ++      D+D+  + GQ+ +L+ 
Sbjct  97   WTQAKGLYTNDIQCLYKVASAIVHISQQ-DLDLSTYIGQIASLKE  140


 Score = 35.0 bits (79),  Expect(2) = 2e-05, Method: Composition-based stats.
 Identities = 13/29 (45%), Positives = 23/29 (79%), Gaps = 0/29 (0%)
 Frame = +2

Query  44   KLDALLCNMLRQSIDSKLHIIYKAYETCY  130
            K+DA LC++L QS+D ++ +  +AY+TC+
Sbjct  66   KIDAQLCSVLWQSVDPRILLHLRAYKTCF  94



>emb|CAN76224.1| hypothetical protein VITISV_017232 [Vitis vinifera]
Length=674

 Score = 38.5 bits (88),  Expect(2) = 3e-05, Method: Compositional matrix adjust.
 Identities = 18/45 (40%), Positives = 29/45 (64%), Gaps = 1/45 (2%)
 Frame = +3

Query  135  WHKAKSLYMNDIQCLYSLISNMLKFWYPIDMDIPEFPGQVEALQH  269
            W++AK LY NDIQ LY + S+++      DMD+  + GQ+ +L+ 
Sbjct  97   WNQAKGLYTNDIQRLYKVASSIVNVRQQ-DMDLSTYIGQIASLKE  140


 Score = 35.4 bits (80),  Expect(2) = 3e-05, Method: Composition-based stats.
 Identities = 14/29 (48%), Positives = 23/29 (79%), Gaps = 0/29 (0%)
 Frame = +2

Query  44   KLDALLCNMLRQSIDSKLHIIYKAYETCY  130
            K+DA LC++L QS+D K+ +  +AY+TC+
Sbjct  66   KIDAQLCSVLWQSVDPKILLHLRAYKTCF  94



>emb|CAN81940.1| hypothetical protein VITISV_007358 [Vitis vinifera]
Length=772

 Score = 38.9 bits (89),  Expect(2) = 3e-05, Method: Compositional matrix adjust.
 Identities = 18/45 (40%), Positives = 29/45 (64%), Gaps = 1/45 (2%)
 Frame = +3

Query  135  WHKAKSLYMNDIQCLYSLISNMLKFWYPIDMDIPEFPGQVEALQH  269
            W++AK LY NDIQ LY + S+++      DMD+  + GQ+ +L+ 
Sbjct  81   WNQAKGLYTNDIQRLYKVASSIVNVRQQ-DMDLSTYIGQIASLKE  124


 Score = 35.0 bits (79),  Expect(2) = 3e-05, Method: Composition-based stats.
 Identities = 15/29 (52%), Positives = 22/29 (76%), Gaps = 0/29 (0%)
 Frame = +2

Query  44   KLDALLCNMLRQSIDSKLHIIYKAYETCY  130
            K+DA LC++L QS+D K+    +AYETC+
Sbjct  50   KIDAQLCSVLWQSVDPKILHHLRAYETCF  78



>emb|CAN63081.1| hypothetical protein VITISV_016842 [Vitis vinifera]
Length=1179

 Score = 37.7 bits (86),  Expect(2) = 3e-05, Method: Composition-based stats.
 Identities = 18/44 (41%), Positives = 29/44 (66%), Gaps = 1/44 (2%)
 Frame = +3

Query  135  WHKAKSLYMNDIQCLYSLISNMLKFWYPIDMDIPEFPGQVEALQ  266
            W++AK LY NDIQ LY + S+++      DMD+  + GQ+ +L+
Sbjct  57   WNQAKGLYTNDIQRLYKVASSIVNVRQQ-DMDLSTYIGQIASLK  99


 Score = 35.8 bits (81),  Expect(2) = 3e-05, Method: Composition-based stats.
 Identities = 14/29 (48%), Positives = 23/29 (79%), Gaps = 0/29 (0%)
 Frame = +2

Query  44   KLDALLCNMLRQSIDSKLHIIYKAYETCY  130
            K+DA LC++L QS+D K+ +  +AY+TC+
Sbjct  26   KIDAQLCSVLWQSVDPKILLHLRAYKTCF  54



>gb|AFN88207.1| integrase core domain containing protein [Phaseolus vulgaris]
Length=1387

 Score = 37.4 bits (85),  Expect(2) = 4e-05, Method: Composition-based stats.
 Identities = 19/47 (40%), Positives = 27/47 (57%), Gaps = 2/47 (4%)
 Frame = +3

Query  135  WHKAKSLYMNDIQCLYSLISNMLKFWYP--IDMDIPEFPGQVEALQH  269
            W +AK LY ND Q LY +  N+L    P  +D  + E+ G++ AL H
Sbjct  123  WEQAKLLYTNDTQRLYGVCQNLLTIVAPKRLDGTMAEYLGKLHALLH  169


 Score = 36.2 bits (82),  Expect(2) = 4e-05, Method: Composition-based stats.
 Identities = 16/40 (40%), Positives = 26/40 (65%), Gaps = 0/40 (0%)
 Frame = +2

Query  41   VKLDALLCNMLRQSIDSKLHIIYKAYETCYDVAQGKVPLY  160
            +K+DA LC +++ +I S L  I++ YETC +V +    LY
Sbjct  91   LKVDAQLCIVIKSTIHSSLKQIFRTYETCSEVWEQAKLLY  130



>emb|CAN76176.1| hypothetical protein VITISV_022748 [Vitis vinifera]
Length=1025

 Score = 37.7 bits (86),  Expect(2) = 5e-05, Method: Compositional matrix adjust.
 Identities = 17/45 (38%), Positives = 29/45 (64%), Gaps = 1/45 (2%)
 Frame = +3

Query  135  WHKAKSLYMNDIQCLYSLISNMLKFWYPIDMDIPEFPGQVEALQH  269
            W++AK LY NDIQ LY + S+++      DM++  + GQ+ +L+ 
Sbjct  81   WNQAKGLYTNDIQRLYKVASSIVNVRQQ-DMBLXTYIGQIASLKE  124


 Score = 35.4 bits (80),  Expect(2) = 5e-05, Method: Composition-based stats.
 Identities = 15/29 (52%), Positives = 23/29 (79%), Gaps = 0/29 (0%)
 Frame = +2

Query  44   KLDALLCNMLRQSIDSKLHIIYKAYETCY  130
            K+DA LC++L QSID K+ +  +AY+TC+
Sbjct  50   KIDAHLCSVLWQSIDPKILLHLRAYKTCF  78



>emb|CAN66243.1| hypothetical protein VITISV_015916 [Vitis vinifera]
Length=1258

 Score = 36.6 bits (83),  Expect(2) = 5e-05, Method: Composition-based stats.
 Identities = 17/44 (39%), Positives = 28/44 (64%), Gaps = 1/44 (2%)
 Frame = +3

Query  135  WHKAKSLYMNDIQCLYSLISNMLKFWYPIDMDIPEFPGQVEALQ  266
            W++AK LY NDIQ LY + S+++      DMD+  + GQ+ + +
Sbjct  97   WNQAKGLYTNDIQRLYKVTSSIVNVRQQ-DMDLSTYIGQIASFK  139


 Score = 36.2 bits (82),  Expect(2) = 5e-05, Method: Composition-based stats.
 Identities = 15/29 (52%), Positives = 23/29 (79%), Gaps = 0/29 (0%)
 Frame = +2

Query  44   KLDALLCNMLRQSIDSKLHIIYKAYETCY  130
            K+DA LC++L QS+DSK+    +AY+TC+
Sbjct  66   KIDAQLCSVLWQSVDSKILHHLRAYKTCF  94



>emb|CAN80841.1| hypothetical protein VITISV_002785 [Vitis vinifera]
Length=1184

 Score = 37.4 bits (85),  Expect(2) = 6e-05, Method: Compositional matrix adjust.
 Identities = 17/44 (39%), Positives = 28/44 (64%), Gaps = 1/44 (2%)
 Frame = +3

Query  135  WHKAKSLYMNDIQCLYSLISNMLKFWYPIDMDIPEFPGQVEALQ  266
            W++ K LY NDIQCLY +  +++      DMD+  + GQ+ +L+
Sbjct  84   WNQTKRLYTNDIQCLYKVAFSIVNVRQQ-DMDLSTYFGQIVSLK  126


 Score = 35.4 bits (80),  Expect(2) = 6e-05, Method: Composition-based stats.
 Identities = 14/29 (48%), Positives = 23/29 (79%), Gaps = 0/29 (0%)
 Frame = +2

Query  44   KLDALLCNMLRQSIDSKLHIIYKAYETCY  130
            K+DA LC++L QS+D K+ +  +AY+TC+
Sbjct  53   KIDAQLCSVLWQSVDPKILLHLRAYKTCF  81



>gb|ABI34329.1| Integrase core domain containing protein [Solanum demissum]
Length=1775

 Score = 39.3 bits (90),  Expect(2) = 6e-05, Method: Composition-based stats.
 Identities = 17/39 (44%), Positives = 27/39 (69%), Gaps = 0/39 (0%)
 Frame = +2

Query  44   KLDALLCNMLRQSIDSKLHIIYKAYETCYDVAQGKVPLY  160
            K+DA LC++L +SID KL  +++ ++TCY V +    LY
Sbjct  67   KVDAQLCSLLWRSIDFKLMPLFRPFQTCYTVWEKARALY  105


 Score = 33.1 bits (74),  Expect(2) = 6e-05, Method: Composition-based stats.
 Identities = 16/43 (37%), Positives = 25/43 (58%), Gaps = 1/43 (2%)
 Frame = +3

Query  135  WHKAKSLYMNDIQCLYSLISNMLKFWYPIDMDIPEFPGQVEAL  263
            W KA++LY NDI   Y +IS +       + D+  + GQV+A+
Sbjct  98   WEKARALYTNDISRFYDVISRLTNL-KKQESDMSTYLGQVQAV  139



>emb|CAN70260.1| hypothetical protein VITISV_002223 [Vitis vinifera]
Length=956

 Score = 36.2 bits (82),  Expect(2) = 8e-05, Method: Composition-based stats.
 Identities = 14/29 (48%), Positives = 23/29 (79%), Gaps = 0/29 (0%)
 Frame = +2

Query  44   KLDALLCNMLRQSIDSKLHIIYKAYETCY  130
            K+DA LC++L QS+D K+ +  +AY+TC+
Sbjct  92   KIDAQLCSVLWQSVDPKILLHLRAYKTCF  120


 Score = 36.2 bits (82),  Expect(2) = 8e-05, Method: Composition-based stats.
 Identities = 18/44 (41%), Positives = 28/44 (64%), Gaps = 1/44 (2%)
 Frame = +3

Query  135  WHKAKSLYMNDIQCLYSLISNMLKFWYPIDMDIPEFPGQVEALQ  266
            W +AK LYMNDIQ LY + S ++      D+D+  + GQ+ +L+
Sbjct  123  WTQAKGLYMNDIQRLYKVASAIVHISQQ-DLDLFTYIGQIASLK  165



>emb|CAN80367.1| hypothetical protein VITISV_014719 [Vitis vinifera]
Length=1573

 Score = 36.2 bits (82),  Expect(2) = 9e-05, Method: Composition-based stats.
 Identities = 14/29 (48%), Positives = 23/29 (79%), Gaps = 0/29 (0%)
 Frame = +2

Query  44   KLDALLCNMLRQSIDSKLHIIYKAYETCY  130
            K+DA LC++L QS+D K+ +  +AY+TC+
Sbjct  306  KIDAQLCSVLWQSVDPKILLHLRAYKTCF  334


 Score = 35.8 bits (81),  Expect(2) = 9e-05, Method: Compositional matrix adjust.
 Identities = 17/45 (38%), Positives = 29/45 (64%), Gaps = 1/45 (2%)
 Frame = +3

Query  135  WHKAKSLYMNDIQCLYSLISNMLKFWYPIDMDIPEFPGQVEALQH  269
            W++AK LY NDIQ LY + S+++      D+D+  + GQ+ +L+ 
Sbjct  337  WNQAKGLYTNDIQRLYKVASSIVNVRQQ-DVDLSTYIGQIVSLKE  380



>emb|CAN69747.1| hypothetical protein VITISV_016320 [Vitis vinifera]
Length=634

 Score = 38.1 bits (87),  Expect(2) = 1e-04, Method: Compositional matrix adjust.
 Identities = 18/44 (41%), Positives = 29/44 (66%), Gaps = 1/44 (2%)
 Frame = +3

Query  135  WHKAKSLYMNDIQCLYSLISNMLKFWYPIDMDIPEFPGQVEALQ  266
            W++AK LY NDIQ LY + S+++      DMD+  + GQ+ +L+
Sbjct  81   WNQAKGLYTNDIQRLYKVTSSIVNVRQQ-DMDLSTYIGQIASLK  123


 Score = 33.9 bits (76),  Expect(2) = 1e-04, Method: Composition-based stats.
 Identities = 13/29 (45%), Positives = 23/29 (79%), Gaps = 0/29 (0%)
 Frame = +2

Query  44   KLDALLCNMLRQSIDSKLHIIYKAYETCY  130
            K+DA LC++L +S+D K+ +  +AY+TC+
Sbjct  50   KIDAHLCSVLWKSVDPKILLHLRAYKTCF  78



>emb|CAN77834.1| hypothetical protein VITISV_024733 [Vitis vinifera]
Length=1300

 Score = 38.1 bits (87),  Expect(2) = 1e-04, Method: Composition-based stats.
 Identities = 18/44 (41%), Positives = 29/44 (66%), Gaps = 1/44 (2%)
 Frame = +3

Query  135  WHKAKSLYMNDIQCLYSLISNMLKFWYPIDMDIPEFPGQVEALQ  266
            W++AK LY NDIQ LY + S+++      DMD+  + GQ+ +L+
Sbjct  81   WNQAKGLYTNDIQRLYKVASSIVNVRQQ-DMDLSTYIGQIASLK  123


 Score = 33.5 bits (75),  Expect(2) = 1e-04, Method: Composition-based stats.
 Identities = 13/29 (45%), Positives = 23/29 (79%), Gaps = 0/29 (0%)
 Frame = +2

Query  44   KLDALLCNMLRQSIDSKLHIIYKAYETCY  130
            K+DA LC++L QS++ K+ +  +AY+TC+
Sbjct  50   KIDAQLCSVLWQSVNPKILLHLQAYKTCF  78



>emb|CAN62423.1| hypothetical protein VITISV_020608 [Vitis vinifera]
Length=1177

 Score = 36.6 bits (83),  Expect(2) = 1e-04, Method: Composition-based stats.
 Identities = 14/29 (48%), Positives = 22/29 (76%), Gaps = 0/29 (0%)
 Frame = +2

Query  44   KLDALLCNMLRQSIDSKLHIIYKAYETCY  130
            K+D  LCN+L QS+D K+ +  +AY+TC+
Sbjct  66   KIDVQLCNVLWQSVDPKILLHLRAYKTCF  94


 Score = 35.0 bits (79),  Expect(2) = 1e-04, Method: Composition-based stats.
 Identities = 17/44 (39%), Positives = 27/44 (61%), Gaps = 1/44 (2%)
 Frame = +3

Query  135  WHKAKSLYMNDIQCLYSLISNMLKFWYPIDMDIPEFPGQVEALQ  266
            W +AK LY NDIQ LY + S ++      D+D+  + GQ+ +L+
Sbjct  97   WTQAKGLYTNDIQRLYKVASAIVHISQQ-DLDLSTYIGQIASLK  139



>emb|CAN75815.1| hypothetical protein VITISV_004636 [Vitis vinifera]
Length=1511

 Score = 38.1 bits (87),  Expect(2) = 1e-04, Method: Composition-based stats.
 Identities = 18/44 (41%), Positives = 29/44 (66%), Gaps = 1/44 (2%)
 Frame = +3

Query  135  WHKAKSLYMNDIQCLYSLISNMLKFWYPIDMDIPEFPGQVEALQ  266
            W++AK LY NDIQ LY + S+++      DMD+  + GQ+ +L+
Sbjct  637  WNQAKGLYTNDIQRLYKVASSIVNVRQQ-DMDLSTYIGQIASLK  679


 Score = 33.5 bits (75),  Expect(2) = 1e-04, Method: Composition-based stats.
 Identities = 14/29 (48%), Positives = 22/29 (76%), Gaps = 0/29 (0%)
 Frame = +2

Query  44   KLDALLCNMLRQSIDSKLHIIYKAYETCY  130
            K+DA LC++L QS+D K+    +AY+TC+
Sbjct  606  KIDAQLCSVLWQSVDLKILHHLRAYKTCF  634



>emb|CAN63193.1| hypothetical protein VITISV_017130 [Vitis vinifera]
Length=2336

 Score = 36.2 bits (82),  Expect(2) = 1e-04, Method: Composition-based stats.
 Identities = 14/29 (48%), Positives = 23/29 (79%), Gaps = 0/29 (0%)
 Frame = +2

Query  44    KLDALLCNMLRQSIDSKLHIIYKAYETCY  130
             K+DA LC++L QS+D K+ +  +AY+TC+
Sbjct  1116  KIDAQLCSVLWQSVDPKILLHLRAYKTCF  1144


 Score = 35.0 bits (79),  Expect(2) = 1e-04, Method: Composition-based stats.
 Identities = 17/44 (39%), Positives = 27/44 (61%), Gaps = 1/44 (2%)
 Frame = +3

Query  135   WHKAKSLYMNDIQCLYSLISNMLKFWYPIDMDIPEFPGQVEALQ  266
             W +AK LY NDIQ LY + S ++      D+D+  + GQ+ +L+
Sbjct  1147  WTQAKGLYTNDIQRLYKVASAIVHISQQ-DLDLSTYIGQIASLK  1189



>emb|CAN74104.1| hypothetical protein VITISV_008952 [Vitis vinifera]
Length=1211

 Score = 37.7 bits (86),  Expect(2) = 2e-04, Method: Compositional matrix adjust.
 Identities = 18/44 (41%), Positives = 29/44 (66%), Gaps = 1/44 (2%)
 Frame = +3

Query  135  WHKAKSLYMNDIQCLYSLISNMLKFWYPIDMDIPEFPGQVEALQ  266
            W++AK LY NDIQ LY + S+++      DMD+  + GQ+ +L+
Sbjct  97   WNQAKGLYTNDIQRLYKVASSIVNVRQQ-DMDLSTYIGQIASLK  139


 Score = 33.5 bits (75),  Expect(2) = 2e-04, Method: Composition-based stats.
 Identities = 14/29 (48%), Positives = 21/29 (72%), Gaps = 0/29 (0%)
 Frame = +2

Query  44   KLDALLCNMLRQSIDSKLHIIYKAYETCY  130
            K+DA LC +L QS+D K+    +AY+TC+
Sbjct  66   KIDAQLCGVLWQSVDPKILHHLRAYKTCF  94



>emb|CAN74310.1| hypothetical protein VITISV_037517 [Vitis vinifera]
Length=1266

 Score = 35.8 bits (81),  Expect(2) = 2e-04, Method: Composition-based stats.
 Identities = 14/29 (48%), Positives = 23/29 (79%), Gaps = 0/29 (0%)
 Frame = +2

Query  44   KLDALLCNMLRQSIDSKLHIIYKAYETCY  130
            K+DA LC++L QS+D K+ +  +AY+TC+
Sbjct  75   KIDAQLCSVLWQSVDPKILLHLRAYKTCF  103


 Score = 35.0 bits (79),  Expect(2) = 2e-04, Method: Compositional matrix adjust.
 Identities = 17/45 (38%), Positives = 27/45 (60%), Gaps = 1/45 (2%)
 Frame = +3

Query  135  WHKAKSLYMNDIQCLYSLISNMLKFWYPIDMDIPEFPGQVEALQH  269
            W +AK LY NDIQ LY + S ++      D+D+  + GQ+ +L+ 
Sbjct  106  WTQAKGLYTNDIQRLYKVASAIVHISQQ-DLDLSTYIGQIASLKE  149



>emb|CAN64673.1| hypothetical protein VITISV_007430 [Vitis vinifera]
Length=1079

 Score = 35.8 bits (81),  Expect(2) = 2e-04, Method: Composition-based stats.
 Identities = 14/29 (48%), Positives = 23/29 (79%), Gaps = 0/29 (0%)
 Frame = +2

Query  44   KLDALLCNMLRQSIDSKLHIIYKAYETCY  130
            K+DA LC++L QS+D K+ +  +AY+TC+
Sbjct  50   KIDAQLCSVLWQSVDPKILLHLQAYKTCF  78


 Score = 35.0 bits (79),  Expect(2) = 2e-04, Method: Composition-based stats.
 Identities = 17/44 (39%), Positives = 27/44 (61%), Gaps = 1/44 (2%)
 Frame = +3

Query  135  WHKAKSLYMNDIQCLYSLISNMLKFWYPIDMDIPEFPGQVEALQ  266
            W +AK LY NDIQ LY + S ++      D+D+  + GQ+ +L+
Sbjct  81   WTQAKGLYTNDIQRLYKVASAIVHISQQ-DLDLSTYIGQIASLK  123



>emb|CAN71931.1| hypothetical protein VITISV_013418 [Vitis vinifera]
Length=670

 Score = 35.8 bits (81),  Expect(2) = 3e-04, Method: Composition-based stats.
 Identities = 14/29 (48%), Positives = 23/29 (79%), Gaps = 0/29 (0%)
 Frame = +2

Query  44   KLDALLCNMLRQSIDSKLHIIYKAYETCY  130
            K+DA LC++L QS+D K+ +  +AY+TC+
Sbjct  66   KIDAQLCSVLWQSVDPKILLHLRAYKTCF  94


 Score = 34.7 bits (78),  Expect(2) = 3e-04, Method: Compositional matrix adjust.
 Identities = 17/45 (38%), Positives = 27/45 (60%), Gaps = 1/45 (2%)
 Frame = +3

Query  135  WHKAKSLYMNDIQCLYSLISNMLKFWYPIDMDIPEFPGQVEALQH  269
            W +AK LY NDIQ LY + S ++      D+D+  + GQ+ +L+ 
Sbjct  97   WTQAKGLYTNDIQRLYKVASAIVHISQQ-DLDLSTYIGQIASLKE  140



>emb|CAN78616.1| hypothetical protein VITISV_003658 [Vitis vinifera]
Length=2172

 Score = 35.4 bits (80),  Expect(2) = 3e-04, Method: Composition-based stats.
 Identities = 17/44 (39%), Positives = 27/44 (61%), Gaps = 1/44 (2%)
 Frame = +3

Query  135  WHKAKSLYMNDIQCLYSLISNMLKFWYPIDMDIPEFPGQVEALQ  266
            W +AK LY NDIQ LY + S ++      D+D+  + GQ+ +L+
Sbjct  811  WTQAKGLYTNDIQRLYKVASAIVHLSQQ-DLDLSTYIGQIASLK  853


 Score = 34.7 bits (78),  Expect(2) = 3e-04, Method: Composition-based stats.
 Identities = 13/29 (45%), Positives = 23/29 (79%), Gaps = 0/29 (0%)
 Frame = +2

Query  44   KLDALLCNMLRQSIDSKLHIIYKAYETCY  130
            K+DA LC++L QS+D ++ +  +AY+TC+
Sbjct  780  KIDAQLCSVLWQSVDPRILLHLQAYKTCF  808



>emb|CAN60057.1| hypothetical protein VITISV_039053 [Vitis vinifera]
Length=384

 Score = 38.1 bits (87),  Expect(2) = 3e-04, Method: Composition-based stats.
 Identities = 18/44 (41%), Positives = 29/44 (66%), Gaps = 1/44 (2%)
 Frame = +3

Query  135  WHKAKSLYMNDIQCLYSLISNMLKFWYPIDMDIPEFPGQVEALQ  266
            W++AK LY NDIQ LY + S+++      DMD+  + GQ+ +L+
Sbjct  97   WNQAKGLYTNDIQRLYKVASSIVNVRQQ-DMDLSTYIGQIASLK  139


 Score = 32.3 bits (72),  Expect(2) = 3e-04, Method: Composition-based stats.
 Identities = 13/29 (45%), Positives = 21/29 (72%), Gaps = 0/29 (0%)
 Frame = +2

Query  44   KLDALLCNMLRQSIDSKLHIIYKAYETCY  130
            K+DA LC++L QS+D K+    + Y+TC+
Sbjct  66   KIDAQLCSVLWQSVDPKILHHLRPYKTCF  94



>emb|CAN81288.1| hypothetical protein VITISV_036901 [Vitis vinifera]
Length=520

 Score = 35.4 bits (80),  Expect(2) = 4e-04, Method: Composition-based stats.
 Identities = 17/44 (39%), Positives = 27/44 (61%), Gaps = 1/44 (2%)
 Frame = +3

Query  135  WHKAKSLYMNDIQCLYSLISNMLKFWYPIDMDIPEFPGQVEALQ  266
            W +AK LY NDIQ LY + S ++      D+D+  + GQ+ +L+
Sbjct  81   WTQAKGLYTNDIQRLYKVASAIVHLSQQ-DLDLSTYIGQIASLK  123


 Score = 34.7 bits (78),  Expect(2) = 4e-04, Method: Composition-based stats.
 Identities = 13/29 (45%), Positives = 23/29 (79%), Gaps = 0/29 (0%)
 Frame = +2

Query  44   KLDALLCNMLRQSIDSKLHIIYKAYETCY  130
            K+DA LC++L QS+D ++ +  +AY+TC+
Sbjct  50   KIDAQLCSVLWQSVDPRILLHLQAYKTCF  78



>emb|CAN69819.1| hypothetical protein VITISV_025708 [Vitis vinifera]
Length=1626

 Score = 35.0 bits (79),  Expect(2) = 4e-04, Method: Composition-based stats.
 Identities = 13/29 (45%), Positives = 23/29 (79%), Gaps = 0/29 (0%)
 Frame = +2

Query  44   KLDALLCNMLRQSIDSKLHIIYKAYETCY  130
            K+DA LC++L QS+D ++ +  +AY+TC+
Sbjct  514  KIDAQLCSVLWQSVDPRILLHLRAYKTCF  542


 Score = 34.7 bits (78),  Expect(2) = 4e-04, Method: Compositional matrix adjust.
 Identities = 17/44 (39%), Positives = 27/44 (61%), Gaps = 1/44 (2%)
 Frame = +3

Query  135  WHKAKSLYMNDIQCLYSLISNMLKFWYPIDMDIPEFPGQVEALQ  266
            W +AK LY NDIQ LY + S ++      D+D+  + GQ+ +L+
Sbjct  545  WTQAKGLYTNDIQRLYKVASAIVHISQQ-DLDLSTYIGQIASLK  587



>emb|CAN80547.1| hypothetical protein VITISV_010898 [Vitis vinifera]
Length=1181

 Score = 35.0 bits (79),  Expect(2) = 4e-04, Method: Composition-based stats.
 Identities = 17/44 (39%), Positives = 27/44 (61%), Gaps = 1/44 (2%)
 Frame = +3

Query  135  WHKAKSLYMNDIQCLYSLISNMLKFWYPIDMDIPEFPGQVEALQ  266
            W +AK LY NDIQ LY + S ++      D+D+  + GQ+ +L+
Sbjct  57   WTQAKGLYTNDIQRLYKVASAIVHLSQQ-DLDLSTYIGQIASLK  99


 Score = 34.7 bits (78),  Expect(2) = 4e-04, Method: Composition-based stats.
 Identities = 13/29 (45%), Positives = 23/29 (79%), Gaps = 0/29 (0%)
 Frame = +2

Query  44   KLDALLCNMLRQSIDSKLHIIYKAYETCY  130
            K+DA LC++L QS+D ++ +  +AY+TC+
Sbjct  26   KIDAQLCSVLWQSVDPRILLHLQAYKTCF  54



>emb|CAN67119.1| hypothetical protein VITISV_017483 [Vitis vinifera]
Length=1970

 Score = 35.0 bits (79),  Expect(2) = 4e-04, Method: Composition-based stats.
 Identities = 17/44 (39%), Positives = 27/44 (61%), Gaps = 1/44 (2%)
 Frame = +3

Query  135  WHKAKSLYMNDIQCLYSLISNMLKFWYPIDMDIPEFPGQVEALQ  266
            W +AK LY NDIQ LY + S ++      D+D+  + GQ+ +L+
Sbjct  97   WTQAKGLYTNDIQRLYKVASAIVHLSQQ-DLDLSTYIGQIASLK  139


 Score = 34.7 bits (78),  Expect(2) = 4e-04, Method: Composition-based stats.
 Identities = 13/29 (45%), Positives = 23/29 (79%), Gaps = 0/29 (0%)
 Frame = +2

Query  44   KLDALLCNMLRQSIDSKLHIIYKAYETCY  130
            K+DA LC++L QS+D ++ +  +AY+TC+
Sbjct  66   KIDAQLCSVLWQSVDPRILLHLQAYKTCF  94



>emb|CAN74286.1| hypothetical protein VITISV_036410 [Vitis vinifera]
Length=1262

 Score = 35.0 bits (79),  Expect(2) = 4e-04, Method: Compositional matrix adjust.
 Identities = 17/45 (38%), Positives = 27/45 (60%), Gaps = 1/45 (2%)
 Frame = +3

Query  135  WHKAKSLYMNDIQCLYSLISNMLKFWYPIDMDIPEFPGQVEALQH  269
            W +AK LY NDIQ LY + S ++      D+D+  + GQ+ +L+ 
Sbjct  97   WTQAKGLYTNDIQRLYKVASAIVHLSQQ-DLDLSTYIGQIASLKE  140


 Score = 34.7 bits (78),  Expect(2) = 4e-04, Method: Composition-based stats.
 Identities = 13/29 (45%), Positives = 23/29 (79%), Gaps = 0/29 (0%)
 Frame = +2

Query  44   KLDALLCNMLRQSIDSKLHIIYKAYETCY  130
            K+DA LC++L QS+D ++ +  +AY+TC+
Sbjct  66   KIDAQLCSVLWQSVDPRILLHLQAYKTCF  94



>emb|CAN81139.1| hypothetical protein VITISV_018760 [Vitis vinifera]
Length=1403

 Score = 35.0 bits (79),  Expect(2) = 4e-04, Method: Composition-based stats.
 Identities = 17/44 (39%), Positives = 27/44 (61%), Gaps = 1/44 (2%)
 Frame = +3

Query  135  WHKAKSLYMNDIQCLYSLISNMLKFWYPIDMDIPEFPGQVEALQ  266
            W +AK LY NDIQ LY + S ++      D+D+  + GQ+ +L+
Sbjct  215  WTQAKGLYTNDIQRLYKVASAIVHLSQQ-DLDLSTYIGQIASLK  257


 Score = 34.7 bits (78),  Expect(2) = 4e-04, Method: Composition-based stats.
 Identities = 13/29 (45%), Positives = 23/29 (79%), Gaps = 0/29 (0%)
 Frame = +2

Query  44   KLDALLCNMLRQSIDSKLHIIYKAYETCY  130
            K+DA LC++L QS+D ++ +  +AY+TC+
Sbjct  184  KIDAQLCSVLWQSVDPRILLHLQAYKTCF  212



>emb|CAN83856.1| hypothetical protein VITISV_014673 [Vitis vinifera]
Length=352

 Score = 35.4 bits (80),  Expect(2) = 4e-04, Method: Compositional matrix adjust.
 Identities = 17/45 (38%), Positives = 27/45 (60%), Gaps = 1/45 (2%)
 Frame = +3

Query  135  WHKAKSLYMNDIQCLYSLISNMLKFWYPIDMDIPEFPGQVEALQH  269
            W +AK LY NDIQ LY + S ++      D+D+  + GQ+ +L+ 
Sbjct  97   WTQAKGLYTNDIQRLYKVASXIVHLSQQ-DLDLSTYIGQIASLKE  140


 Score = 34.7 bits (78),  Expect(2) = 4e-04, Method: Composition-based stats.
 Identities = 13/29 (45%), Positives = 23/29 (79%), Gaps = 0/29 (0%)
 Frame = +2

Query  44   KLDALLCNMLRQSIDSKLHIIYKAYETCY  130
            K+DA LC++L QS+D ++ +  +AY+TC+
Sbjct  66   KIDAQLCSVLWQSVDPRILLHLQAYKTCF  94



>emb|CAN61179.1| hypothetical protein VITISV_032292 [Vitis vinifera]
Length=1237

 Score = 35.0 bits (79),  Expect(2) = 4e-04, Method: Compositional matrix adjust.
 Identities = 17/44 (39%), Positives = 27/44 (61%), Gaps = 1/44 (2%)
 Frame = +3

Query  135  WHKAKSLYMNDIQCLYSLISNMLKFWYPIDMDIPEFPGQVEALQ  266
            W +AK LY NDIQ LY + S ++      D+D+  + GQ+ +L+
Sbjct  97   WTQAKGLYTNDIQRLYKVASAIVHLSQQ-DLDLSTYIGQIASLK  139


 Score = 34.7 bits (78),  Expect(2) = 4e-04, Method: Composition-based stats.
 Identities = 13/29 (45%), Positives = 23/29 (79%), Gaps = 0/29 (0%)
 Frame = +2

Query  44   KLDALLCNMLRQSIDSKLHIIYKAYETCY  130
            K+DA LC++L QS+D ++ +  +AY+TC+
Sbjct  66   KIDAQLCSVLWQSVDPRILLHLQAYKTCF  94



>emb|CAN62614.1| hypothetical protein VITISV_028123 [Vitis vinifera]
Length=1102

 Score = 35.0 bits (79),  Expect(2) = 4e-04, Method: Composition-based stats.
 Identities = 17/44 (39%), Positives = 27/44 (61%), Gaps = 1/44 (2%)
 Frame = +3

Query  135  WHKAKSLYMNDIQCLYSLISNMLKFWYPIDMDIPEFPGQVEALQ  266
            W +AK LY NDIQ LY + S ++      D+D+  + GQ+ +L+
Sbjct  53   WTQAKGLYTNDIQRLYKVASAIVHLSQQ-DLDLSTYIGQIASLK  95


 Score = 34.7 bits (78),  Expect(2) = 4e-04, Method: Composition-based stats.
 Identities = 13/29 (45%), Positives = 23/29 (79%), Gaps = 0/29 (0%)
 Frame = +2

Query  44   KLDALLCNMLRQSIDSKLHIIYKAYETCY  130
            K+DA LC++L QS+D ++ +  +AY+TC+
Sbjct  22   KIDAQLCSVLWQSVDPRILLHLQAYKTCF  50



>emb|CAN84135.1| hypothetical protein VITISV_000113 [Vitis vinifera]
Length=1323

 Score = 35.0 bits (79),  Expect(2) = 4e-04, Method: Composition-based stats.
 Identities = 17/44 (39%), Positives = 27/44 (61%), Gaps = 1/44 (2%)
 Frame = +3

Query  135  WHKAKSLYMNDIQCLYSLISNMLKFWYPIDMDIPEFPGQVEALQ  266
            W +AK LY NDIQ LY + S ++      D+D+  + GQ+ +L+
Sbjct  97   WTQAKGLYTNDIQRLYKVASAIVHLSQQ-DLDLSTYIGQIASLK  139


 Score = 34.7 bits (78),  Expect(2) = 4e-04, Method: Composition-based stats.
 Identities = 13/29 (45%), Positives = 23/29 (79%), Gaps = 0/29 (0%)
 Frame = +2

Query  44   KLDALLCNMLRQSIDSKLHIIYKAYETCY  130
            K+DA LC++L QS+D ++ +  +AY+TC+
Sbjct  66   KIDAQLCSVLWQSVDPRILLHLQAYKTCF  94



>emb|CAN73074.1| hypothetical protein VITISV_032386 [Vitis vinifera]
Length=1195

 Score = 35.4 bits (80),  Expect(2) = 4e-04, Method: Compositional matrix adjust.
 Identities = 17/44 (39%), Positives = 27/44 (61%), Gaps = 1/44 (2%)
 Frame = +3

Query  135  WHKAKSLYMNDIQCLYSLISNMLKFWYPIDMDIPEFPGQVEALQ  266
            W +AK LY NDIQ LY + S ++      D+D+  + GQ+ +L+
Sbjct  81   WTQAKGLYTNDIQRLYKVASAIVHLSQQ-DLDLSTYIGQIASLK  123


 Score = 34.3 bits (77),  Expect(2) = 4e-04, Method: Composition-based stats.
 Identities = 13/29 (45%), Positives = 23/29 (79%), Gaps = 0/29 (0%)
 Frame = +2

Query  44   KLDALLCNMLRQSIDSKLHIIYKAYETCY  130
            K+DA LC++L QS+D ++ +  +AY+TC+
Sbjct  50   KIDAQLCSVLWQSVDPRILLHLQAYKTCF  78



>emb|CAN76032.1| hypothetical protein VITISV_040150 [Vitis vinifera]
Length=1152

 Score = 35.4 bits (80),  Expect(2) = 4e-04, Method: Compositional matrix adjust.
 Identities = 17/45 (38%), Positives = 27/45 (60%), Gaps = 1/45 (2%)
 Frame = +3

Query  135  WHKAKSLYMNDIQCLYSLISNMLKFWYPIDMDIPEFPGQVEALQH  269
            W +AK LY NDIQ LY + S ++      D+D+  + GQ+ +L+ 
Sbjct  97   WTQAKGLYTNDIQRLYKVASAIVHLSQQ-DLDLSTYIGQIASLKE  140


 Score = 34.3 bits (77),  Expect(2) = 4e-04, Method: Composition-based stats.
 Identities = 13/29 (45%), Positives = 23/29 (79%), Gaps = 0/29 (0%)
 Frame = +2

Query  44   KLDALLCNMLRQSIDSKLHIIYKAYETCY  130
            K+DA LC++L QS+D ++ +  +AY+TC+
Sbjct  66   KIDAQLCSVLWQSVDPRILLHLQAYKTCF  94



>emb|CAN62266.1| hypothetical protein VITISV_025647 [Vitis vinifera]
Length=1254

 Score = 35.8 bits (81),  Expect(2) = 4e-04, Method: Composition-based stats.
 Identities = 16/39 (41%), Positives = 26/39 (67%), Gaps = 0/39 (0%)
 Frame = +2

Query  44   KLDALLCNMLRQSIDSKLHIIYKAYETCYDVAQGKVPLY  160
            K+DA LC++L QS+D K+ +  +AY+TC+ +      LY
Sbjct  50   KIDAQLCSVLWQSVDPKILLHLRAYKTCFKLWTQAKGLY  88


 Score = 33.9 bits (76),  Expect(2) = 4e-04, Method: Compositional matrix adjust.
 Identities = 17/44 (39%), Positives = 26/44 (59%), Gaps = 1/44 (2%)
 Frame = +3

Query  135  WHKAKSLYMNDIQCLYSLISNMLKFWYPIDMDIPEFPGQVEALQ  266
            W +AK LY NDIQ LY + S  +      D+D+  + GQ+ +L+
Sbjct  81   WTQAKGLYTNDIQRLYKVASANVHISQQ-DLDLSTYIGQIASLK  123



>emb|CAN63185.1| hypothetical protein VITISV_000411 [Vitis vinifera]
Length=577

 Score = 35.0 bits (79),  Expect(2) = 5e-04, Method: Composition-based stats.
 Identities = 14/29 (48%), Positives = 23/29 (79%), Gaps = 0/29 (0%)
 Frame = +2

Query  44   KLDALLCNMLRQSIDSKLHIIYKAYETCY  130
            K+DA LC++L QS+D K+ +  +AY+TC+
Sbjct  50   KIDAQLCSVLWQSVDLKILLHLRAYKTCF  78


 Score = 34.7 bits (78),  Expect(2) = 5e-04, Method: Composition-based stats.
 Identities = 17/44 (39%), Positives = 27/44 (61%), Gaps = 1/44 (2%)
 Frame = +3

Query  135  WHKAKSLYMNDIQCLYSLISNMLKFWYPIDMDIPEFPGQVEALQ  266
            W +AK LY NDIQ LY + S ++      D+D+  + GQ+ +L+
Sbjct  81   WTRAKGLYTNDIQRLYKVASVIVHISQQ-DLDLSTYIGQIASLK  123



>emb|CAN67925.1| hypothetical protein VITISV_021168 [Vitis vinifera]
Length=1354

 Score = 35.0 bits (79),  Expect(2) = 5e-04, Method: Composition-based stats.
 Identities = 17/44 (39%), Positives = 27/44 (61%), Gaps = 1/44 (2%)
 Frame = +3

Query  135  WHKAKSLYMNDIQCLYSLISNMLKFWYPIDMDIPEFPGQVEALQ  266
            W +AK LY NDIQ LY + S ++      D+D+  + GQ+ +L+
Sbjct  97   WTQAKGLYTNDIQRLYKVASAIVHLSQQ-DLDLSTYIGQIASLK  139


 Score = 34.7 bits (78),  Expect(2) = 5e-04, Method: Composition-based stats.
 Identities = 13/29 (45%), Positives = 23/29 (79%), Gaps = 0/29 (0%)
 Frame = +2

Query  44   KLDALLCNMLRQSIDSKLHIIYKAYETCY  130
            K+DA LC++L QS+D ++ +  +AY+TC+
Sbjct  66   KIDAQLCSVLWQSVDPRILLHLQAYKTCF  94



>emb|CAN69688.1| hypothetical protein VITISV_026774 [Vitis vinifera]
Length=1382

 Score = 34.7 bits (78),  Expect(2) = 5e-04, Method: Composition-based stats.
 Identities = 13/29 (45%), Positives = 23/29 (79%), Gaps = 0/29 (0%)
 Frame = +2

Query  44   KLDALLCNMLRQSIDSKLHIIYKAYETCY  130
            K+DA LC++L QS+D ++ +  +AY+TC+
Sbjct  262  KIDAQLCSVLWQSVDPRILLHLQAYKTCF  290


 Score = 34.7 bits (78),  Expect(2) = 5e-04, Method: Composition-based stats.
 Identities = 17/44 (39%), Positives = 27/44 (61%), Gaps = 1/44 (2%)
 Frame = +3

Query  135  WHKAKSLYMNDIQCLYSLISNMLKFWYPIDMDIPEFPGQVEALQ  266
            W +AK LY NDIQ LY + S ++      D+D+  + GQ+ +L+
Sbjct  293  WTQAKGLYTNDIQRLYKVASAIVHLSQQ-DLDLSTYIGQIASLK  335



>emb|CAN63730.1| hypothetical protein VITISV_030286 [Vitis vinifera]
Length=1205

 Score = 35.0 bits (79),  Expect(2) = 5e-04, Method: Composition-based stats.
 Identities = 17/44 (39%), Positives = 27/44 (61%), Gaps = 1/44 (2%)
 Frame = +3

Query  135  WHKAKSLYMNDIQCLYSLISNMLKFWYPIDMDIPEFPGQVEALQ  266
            W +AK LY NDIQ LY + S ++      D+D+  + GQ+ +L+
Sbjct  81   WTQAKGLYTNDIQRLYKVASAIVHLSQQ-DLDLSTYIGQIASLK  123


 Score = 34.7 bits (78),  Expect(2) = 5e-04, Method: Composition-based stats.
 Identities = 13/29 (45%), Positives = 23/29 (79%), Gaps = 0/29 (0%)
 Frame = +2

Query  44   KLDALLCNMLRQSIDSKLHIIYKAYETCY  130
            K+DA LC++L QS+D ++ +  +AY+TC+
Sbjct  50   KIDAQLCSVLWQSVDPRILLHLQAYKTCF  78



>emb|CAN62074.1| hypothetical protein VITISV_001619 [Vitis vinifera]
Length=1237

 Score = 35.0 bits (79),  Expect(2) = 5e-04, Method: Compositional matrix adjust.
 Identities = 17/45 (38%), Positives = 27/45 (60%), Gaps = 1/45 (2%)
 Frame = +3

Query  135  WHKAKSLYMNDIQCLYSLISNMLKFWYPIDMDIPEFPGQVEALQH  269
            W +AK LY NDIQ LY + S ++      D+D+  + GQ+ +L+ 
Sbjct  97   WTQAKGLYTNDIQRLYKVASAIVHLSQQ-DLDLSTYIGQIASLKE  140


 Score = 34.7 bits (78),  Expect(2) = 5e-04, Method: Composition-based stats.
 Identities = 13/29 (45%), Positives = 23/29 (79%), Gaps = 0/29 (0%)
 Frame = +2

Query  44   KLDALLCNMLRQSIDSKLHIIYKAYETCY  130
            K+DA LC++L QS+D ++ +  +AY+TC+
Sbjct  66   KIDAQLCSVLWQSVDPRILLHLQAYKTCF  94



>emb|CAN61207.1| hypothetical protein VITISV_015446 [Vitis vinifera]
Length=900

 Score = 34.7 bits (78),  Expect(2) = 5e-04, Method: Composition-based stats.
 Identities = 13/29 (45%), Positives = 23/29 (79%), Gaps = 0/29 (0%)
 Frame = +2

Query  44   KLDALLCNMLRQSIDSKLHIIYKAYETCY  130
            K+DA LC++L QS+D ++ +  +AY+TC+
Sbjct  66   KIDAQLCSVLWQSVDPRILLHLQAYKTCF  94


 Score = 34.7 bits (78),  Expect(2) = 5e-04, Method: Compositional matrix adjust.
 Identities = 17/45 (38%), Positives = 27/45 (60%), Gaps = 1/45 (2%)
 Frame = +3

Query  135  WHKAKSLYMNDIQCLYSLISNMLKFWYPIDMDIPEFPGQVEALQH  269
            W +AK LY NDIQ LY + S ++      D+D+  + GQ+ +L+ 
Sbjct  97   WTQAKGLYTNDIQRLYKVASAIVHLXQQ-DLDLSTYIGQIASLKE  140



>emb|CAN62535.1| hypothetical protein VITISV_041880 [Vitis vinifera]
Length=1314

 Score = 34.7 bits (78),  Expect(2) = 5e-04, Method: Composition-based stats.
 Identities = 13/29 (45%), Positives = 23/29 (79%), Gaps = 0/29 (0%)
 Frame = +2

Query  44   KLDALLCNMLRQSIDSKLHIIYKAYETCY  130
            K+DA LC++L QS+D ++ +  +AY+TC+
Sbjct  66   KIDAQLCSVLWQSVDPRILLHLQAYKTCF  94


 Score = 34.7 bits (78),  Expect(2) = 5e-04, Method: Compositional matrix adjust.
 Identities = 17/44 (39%), Positives = 27/44 (61%), Gaps = 1/44 (2%)
 Frame = +3

Query  135  WHKAKSLYMNDIQCLYSLISNMLKFWYPIDMDIPEFPGQVEALQ  266
            W +AK LY NDIQ LY + S ++      D+D+  + GQ+ +L+
Sbjct  97   WTQAKGLYTNDIQRLYKVASAIVHLSQQ-DLDLSTYIGQIASLK  139



>emb|CAN75922.1| hypothetical protein VITISV_030752 [Vitis vinifera]
Length=1214

 Score = 35.0 bits (79),  Expect(2) = 5e-04, Method: Composition-based stats.
 Identities = 17/44 (39%), Positives = 27/44 (61%), Gaps = 1/44 (2%)
 Frame = +3

Query  135  WHKAKSLYMNDIQCLYSLISNMLKFWYPIDMDIPEFPGQVEALQ  266
            W +AK LY NDIQ LY + S ++      D+D+  + GQ+ +L+
Sbjct  81   WTQAKGLYTNDIQRLYKVASAIVHISQQ-DLDLSTYIGQIASLK  123


 Score = 34.7 bits (78),  Expect(2) = 5e-04, Method: Composition-based stats.
 Identities = 13/29 (45%), Positives = 23/29 (79%), Gaps = 0/29 (0%)
 Frame = +2

Query  44   KLDALLCNMLRQSIDSKLHIIYKAYETCY  130
            K+DA LC++L QS+D ++ +  +AY+TC+
Sbjct  50   KIDAQLCSVLWQSVDPRILLHLQAYKTCF  78



>emb|CAN67317.1| hypothetical protein VITISV_019719 [Vitis vinifera]
Length=1240

 Score = 35.0 bits (79),  Expect(2) = 5e-04, Method: Composition-based stats.
 Identities = 17/44 (39%), Positives = 27/44 (61%), Gaps = 1/44 (2%)
 Frame = +3

Query  135  WHKAKSLYMNDIQCLYSLISNMLKFWYPIDMDIPEFPGQVEALQ  266
            W +AK LY NDIQ LY + S ++      D+D+  + GQ+ +L+
Sbjct  112  WTQAKGLYTNDIQRLYKVASAIVHLSQQ-DLDLSTYIGQIASLK  154


 Score = 34.7 bits (78),  Expect(2) = 5e-04, Method: Composition-based stats.
 Identities = 13/29 (45%), Positives = 23/29 (79%), Gaps = 0/29 (0%)
 Frame = +2

Query  44   KLDALLCNMLRQSIDSKLHIIYKAYETCY  130
            K+DA LC++L QS+D ++ +  +AY+TC+
Sbjct  81   KIDAQLCSVLWQSVDPRILLHLQAYKTCF  109



>emb|CAN65932.1| hypothetical protein VITISV_016257 [Vitis vinifera]
Length=498

 Score = 35.0 bits (79),  Expect(2) = 5e-04, Method: Compositional matrix adjust.
 Identities = 17/45 (38%), Positives = 27/45 (60%), Gaps = 1/45 (2%)
 Frame = +3

Query  135  WHKAKSLYMNDIQCLYSLISNMLKFWYPIDMDIPEFPGQVEALQH  269
            W +AK LY NDIQ LY + S ++      D+D+  + GQ+ +L+ 
Sbjct  97   WTQAKGLYTNDIQRLYKVASVIVHLSQQ-DLDLSTYIGQIASLKE  140


 Score = 34.7 bits (78),  Expect(2) = 5e-04, Method: Composition-based stats.
 Identities = 13/29 (45%), Positives = 23/29 (79%), Gaps = 0/29 (0%)
 Frame = +2

Query  44   KLDALLCNMLRQSIDSKLHIIYKAYETCY  130
            K+DA LC++L QS+D ++ +  +AY+TC+
Sbjct  66   KIDAQLCSVLWQSVDPRILLHLQAYKTCF  94



>emb|CAN69307.1| hypothetical protein VITISV_001120 [Vitis vinifera]
Length=1215

 Score = 35.8 bits (81),  Expect(2) = 7e-04, Method: Composition-based stats.
 Identities = 14/29 (48%), Positives = 23/29 (79%), Gaps = 0/29 (0%)
 Frame = +2

Query  44   KLDALLCNMLRQSIDSKLHIIYKAYETCY  130
            K+DA LC++L QS+D K+ +  +AY+TC+
Sbjct  66   KIDAQLCSVLWQSVDPKILLHLRAYKTCF  94


 Score = 33.1 bits (74),  Expect(2) = 7e-04, Method: Compositional matrix adjust.
 Identities = 16/45 (36%), Positives = 26/45 (58%), Gaps = 1/45 (2%)
 Frame = +3

Query  135  WHKAKSLYMNDIQCLYSLISNMLKFWYPIDMDIPEFPGQVEALQH  269
            W + K LY NDIQ LY + S ++      D+D+  + GQ+ +L+ 
Sbjct  97   WTQTKGLYTNDIQRLYKVASAIVHISQQ-DLDLSTYIGQIASLKE  140



>ref|XP_010663565.1| PREDICTED: uncharacterized protein LOC100247533 isoform X1 [Vitis 
vinifera]
Length=235

 Score = 36.6 bits (83),  Expect(2) = 7e-04, Method: Compositional matrix adjust.
 Identities = 16/45 (36%), Positives = 28/45 (62%), Gaps = 1/45 (2%)
 Frame = +3

Query  135  WHKAKSLYMNDIQCLYSLISNMLKFWYPIDMDIPEFPGQVEALQH  269
            W +AK LY NDIQ  Y ++S+++      DMD+  + G++ +L+ 
Sbjct  175  WTQAKGLYTNDIQRFYKMVSDIVHVRQQ-DMDLSTYIGRIASLKE  218


 Score = 32.7 bits (73),  Expect(2) = 7e-04, Method: Compositional matrix adjust.
 Identities = 14/29 (48%), Positives = 22/29 (76%), Gaps = 0/29 (0%)
 Frame = +2

Query  44   KLDALLCNMLRQSIDSKLHIIYKAYETCY  130
            K+DA LC++L QS+D K+    +AY+TC+
Sbjct  144  KIDAQLCSVLWQSVDPKILHHLRAYKTCF  172



>emb|CAN75744.1| hypothetical protein VITISV_040125 [Vitis vinifera]
Length=1257

 Score = 34.7 bits (78),  Expect(2) = 8e-04, Method: Composition-based stats.
 Identities = 13/29 (45%), Positives = 23/29 (79%), Gaps = 0/29 (0%)
 Frame = +2

Query  44   KLDALLCNMLRQSIDSKLHIIYKAYETCY  130
            K+DA LC++L QS+D ++ +  +AY+TC+
Sbjct  66   KIDAQLCSVLWQSVDPRILLHLQAYKTCF  94


 Score = 34.3 bits (77),  Expect(2) = 8e-04, Method: Composition-based stats.
 Identities = 17/44 (39%), Positives = 27/44 (61%), Gaps = 1/44 (2%)
 Frame = +3

Query  135  WHKAKSLYMNDIQCLYSLISNMLKFWYPIDMDIPEFPGQVEALQ  266
            W +AK LY NDIQ LY + S ++      D+D+  + GQ+ +L+
Sbjct  97   WTQAKGLYTNDIQRLYKVASAIVHLSQQ-DLDLSTYIGQIVSLK  139



>emb|CAN77046.1| hypothetical protein VITISV_035257 [Vitis vinifera]
Length=1478

 Score = 34.7 bits (78),  Expect(2) = 8e-04, Method: Composition-based stats.
 Identities = 17/44 (39%), Positives = 27/44 (61%), Gaps = 1/44 (2%)
 Frame = +3

Query  135  WHKAKSLYMNDIQCLYSLISNMLKFWYPIDMDIPEFPGQVEALQ  266
            W +AK LY NDIQ LY + S ++      D+D+  + GQ+ +L+
Sbjct  337  WTQAKGLYTNDIQRLYKVASAIVHISQQ-DLDLSTYIGQIASLK  379


 Score = 33.9 bits (76),  Expect(2) = 8e-04, Method: Composition-based stats.
 Identities = 13/29 (45%), Positives = 22/29 (76%), Gaps = 0/29 (0%)
 Frame = +2

Query  44   KLDALLCNMLRQSIDSKLHIIYKAYETCY  130
            K+DA LC++L QS+D  + +  +AY+TC+
Sbjct  306  KIDAQLCSVLWQSVDPXILLHLRAYKTCF  334



>emb|CAN71088.1| hypothetical protein VITISV_033975 [Vitis vinifera]
Length=285

 Score = 35.0 bits (79),  Expect(2) = 9e-04, Method: Compositional matrix adjust.
 Identities = 16/44 (36%), Positives = 27/44 (61%), Gaps = 1/44 (2%)
 Frame = +3

Query  135  WHKAKSLYMNDIQCLYSLISNMLKFWYPIDMDIPEFPGQVEALQ  266
            W +AK LY NDIQ  Y ++S+ +      DMD+  + G++ +L+
Sbjct  97   WTQAKGLYTNDIQRFYKVVSDTVHVRQQ-DMDLSAYIGRIASLK  139


 Score = 33.5 bits (75),  Expect(2) = 9e-04, Method: Composition-based stats.
 Identities = 14/29 (48%), Positives = 22/29 (76%), Gaps = 0/29 (0%)
 Frame = +2

Query  44   KLDALLCNMLRQSIDSKLHIIYKAYETCY  130
            K+DA LC++L QS+D K+    +AY+TC+
Sbjct  66   KIDAQLCSVLWQSVDPKILHHLRAYKTCF  94



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 518068334520