BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c56557_g1_i1 len=250 path=[228:0-249]

Length=250
                                                                      Score     E

emb|CDX95281.1|  BnaC09g15890D                                        49.7    1e-05   
ref|XP_010553708.1|  PREDICTED: GDSL esterase/lipase At1g09390        51.2    2e-05   
emb|CDY41697.1|  BnaA09g15250D                                        48.9    1e-04   
ref|XP_009113364.1|  PREDICTED: GDSL esterase/lipase LIP-4            48.9    1e-04   
dbj|BAJ98083.1|  predicted protein                                    47.0    5e-04   
emb|CDX94973.1|  BnaC05g06980D                                        47.0    5e-04   
ref|XP_009590850.1|  PREDICTED: GDSL esterase/lipase LIP-4-like i...  46.6    6e-04   
ref|XP_009590849.1|  PREDICTED: GDSL esterase/lipase LIP-4-like i...  46.2    9e-04   



>emb|CDX95281.1| BnaC09g15890D [Brassica napus]
Length=126

 Score = 49.7 bits (117),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 28/53 (53%), Positives = 32/53 (60%), Gaps = 1/53 (2%)
 Frame = -2

Query  165  DSKVTMFGVFFTVAILG-CHPSLASDDKCFIPPVIFNFGDSNSDTGGYAAAHG  10
            DS    F  F ++A+L   HPS  +   C  PPVIFNFGDSNSDTGG  A  G
Sbjct  9    DSFSFFFVTFISLAVLSHRHPSATAAAGCQAPPVIFNFGDSNSDTGGLVAGLG  61



>ref|XP_010553708.1| PREDICTED: GDSL esterase/lipase At1g09390 [Tarenaya hassleriana]
Length=398

 Score = 51.2 bits (121),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 24/36 (67%), Positives = 27/36 (75%), Gaps = 2/36 (6%)
 Frame = -2

Query  111  HPSLAS--DDKCFIPPVIFNFGDSNSDTGGYAAAHG  10
            HPS A+  + +C IPPVIFNFGDSNSDTGG  A  G
Sbjct  49   HPSAAATAESRCQIPPVIFNFGDSNSDTGGLVAGLG  84



>emb|CDY41697.1| BnaA09g15250D [Brassica napus]
Length=375

 Score = 48.9 bits (115),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 22/34 (65%), Positives = 23/34 (68%), Gaps = 0/34 (0%)
 Frame = -2

Query  111  HPSLASDDKCFIPPVIFNFGDSNSDTGGYAAAHG  10
            HPS  +   C  PPVIFNFGDSNSDTGG  A  G
Sbjct  28   HPSATAAAGCQAPPVIFNFGDSNSDTGGLVAGLG  61



>ref|XP_009113364.1| PREDICTED: GDSL esterase/lipase LIP-4 [Brassica rapa]
Length=375

 Score = 48.9 bits (115),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 22/34 (65%), Positives = 23/34 (68%), Gaps = 0/34 (0%)
 Frame = -2

Query  111  HPSLASDDKCFIPPVIFNFGDSNSDTGGYAAAHG  10
            HPS  +   C  PPVIFNFGDSNSDTGG  A  G
Sbjct  28   HPSATAAAGCQAPPVIFNFGDSNSDTGGLVAGLG  61



>dbj|BAJ98083.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=377

 Score = 47.0 bits (110),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 21/36 (58%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = -2

Query  108  PSLASDDKCFIPPVIFNFGDSNSDTGGYAAAHGQYF  1
            P+ A+++ C   PV+F FGDSN+DTGG AAA G YF
Sbjct  30   PAAAAEEGCTRRPVVFAFGDSNTDTGGAAAALGSYF  65



>emb|CDX94973.1| BnaC05g06980D [Brassica napus]
Length=368

 Score = 47.0 bits (110),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 25/43 (58%), Positives = 26/43 (60%), Gaps = 0/43 (0%)
 Frame = -2

Query  138  FFTVAILGCHPSLASDDKCFIPPVIFNFGDSNSDTGGYAAAHG  10
            F  +AI      LA    C  PPVIFNFGDSNSDTGG AA  G
Sbjct  12   FLLLAIFILRQHLAVAGGCQYPPVIFNFGDSNSDTGGLAAGLG  54



>ref|XP_009590850.1| PREDICTED: GDSL esterase/lipase LIP-4-like isoform X2 [Nicotiana 
tomentosiformis]
Length=341

 Score = 46.6 bits (109),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 21/23 (91%), Positives = 21/23 (91%), Gaps = 0/23 (0%)
 Frame = -2

Query  69  VIFNFGDSNSDTGGYAAAHGQYF  1
           VIFNFGDSNSDTGGYAAAHG  F
Sbjct  54  VIFNFGDSNSDTGGYAAAHGIRF  76



>ref|XP_009590849.1| PREDICTED: GDSL esterase/lipase LIP-4-like isoform X1 [Nicotiana 
tomentosiformis]
Length=382

 Score = 46.2 bits (108),  Expect = 9e-04, Method: Composition-based stats.
 Identities = 21/23 (91%), Positives = 21/23 (91%), Gaps = 0/23 (0%)
 Frame = -2

Query  69  VIFNFGDSNSDTGGYAAAHGQYF  1
           VIFNFGDSNSDTGGYAAAHG  F
Sbjct  54  VIFNFGDSNSDTGGYAAAHGIRF  76



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 510865472736