BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c56416_g1_i1 len=848 path=[1:0-847]

Length=848
                                                                      Score     E

ref|XP_009777881.1|  PREDICTED: wall-associated receptor kinase-l...    233   1e-72   
ref|XP_010659666.1|  PREDICTED: wall-associated receptor kinase-l...    228   1e-70   
ref|XP_009603830.1|  PREDICTED: wall-associated receptor kinase-l...    226   6e-70   
gb|KDP23426.1|  hypothetical protein JCGZ_23259                         225   2e-69   
ref|XP_006382434.1|  hypothetical protein POPTR_0005s02120g             224   3e-69   
ref|XP_006433489.1|  hypothetical protein CICLE_v10003862mg             224   7e-69   
ref|XP_006472158.1|  PREDICTED: wall-associated receptor kinase-l...    224   7e-69   
ref|XP_002512476.1|  hypothetical protein RCOM_1434200                  221   5e-68   Ricinus communis
ref|XP_007031083.1|  Wall-associated receptor kinase-like 20            220   2e-67   
ref|XP_011023735.1|  PREDICTED: wall-associated receptor kinase-l...    218   1e-66   
ref|XP_011036916.1|  PREDICTED: wall-associated receptor kinase-l...    218   1e-66   
ref|XP_002319494.1|  hypothetical protein POPTR_0013s01310g             217   2e-66   Populus trichocarpa [western balsam poplar]
ref|XP_010024103.1|  PREDICTED: wall-associated receptor kinase-l...    214   3e-65   
ref|XP_010024105.1|  PREDICTED: wall-associated receptor kinase-l...    213   8e-65   
gb|KGN60973.1|  hypothetical protein Csa_2G033280                       212   4e-64   
ref|XP_009759572.1|  PREDICTED: wall-associated receptor kinase-l...    211   6e-64   
ref|XP_004494561.1|  PREDICTED: wall-associated receptor kinase-l...    202   3e-60   
gb|KHN43328.1|  Wall-associated receptor kinase-like 20                 197   2e-58   
ref|XP_007208515.1|  hypothetical protein PRUPE_ppa026258mg             195   2e-57   
ref|XP_003626184.1|  Wall-associated receptor kinase-like protein       194   3e-57   
ref|XP_008245685.1|  PREDICTED: wall-associated receptor kinase-l...    191   7e-56   
ref|XP_008797226.1|  PREDICTED: wall-associated receptor kinase-l...    189   2e-55   
ref|XP_010106705.1|  Wall-associated receptor kinase-like 20            186   4e-54   
ref|XP_009338254.1|  PREDICTED: wall-associated receptor kinase-l...    184   2e-53   
ref|XP_008370615.1|  PREDICTED: wall-associated receptor kinase-l...    186   7e-53   
emb|CAN74506.1|  hypothetical protein VITISV_015890                     179   4e-52   Vitis vinifera
ref|XP_006840476.1|  hypothetical protein AMTR_s00045p00185470          180   8e-52   
ref|XP_007163343.1|  hypothetical protein PHAVU_001G226900g             172   5e-49   
ref|XP_004304876.1|  PREDICTED: wall-associated receptor kinase-l...    151   6e-41   
ref|XP_004309382.1|  PREDICTED: wall-associated receptor kinase-l...    142   2e-37   
ref|XP_011085014.1|  PREDICTED: wall-associated receptor kinase-l...    134   3e-32   
gb|KDO69182.1|  hypothetical protein CISIN_1g043291mg                   129   1e-31   
ref|XP_007026926.1|  Kinase superfamily protein, putative               131   7e-31   
ref|XP_010095005.1|  Wall-associated receptor kinase-like 20            124   1e-30   
ref|XP_009343916.1|  PREDICTED: wall-associated receptor kinase-l...    130   2e-30   
gb|EPS68579.1|  hypothetical protein M569_06189                         130   3e-30   
emb|CAN68735.1|  hypothetical protein VITISV_037016                     124   4e-30   Vitis vinifera
ref|XP_003530225.1|  PREDICTED: wall-associated receptor kinase-l...    128   1e-29   
ref|XP_006486417.1|  PREDICTED: wall-associated receptor kinase-l...    127   1e-29   
ref|XP_006435611.1|  hypothetical protein CICLE_v10030949mg             127   1e-29   
ref|XP_010273912.1|  PREDICTED: wall-associated receptor kinase-l...    127   1e-29   
ref|XP_002311189.2|  hypothetical protein POPTR_0008s06030g             127   2e-29   Populus trichocarpa [western balsam poplar]
ref|XP_010262629.1|  PREDICTED: wall-associated receptor kinase-l...    123   4e-29   
ref|XP_011034941.1|  PREDICTED: wall-associated receptor kinase-l...    126   4e-29   
ref|XP_004142196.1|  PREDICTED: wall-associated receptor kinase-l...    126   5e-29   
ref|XP_010658664.1|  PREDICTED: wall-associated receptor kinase-l...    120   1e-28   
ref|XP_002524225.1|  kinase, putative                                   124   2e-28   Ricinus communis
ref|XP_006493572.1|  PREDICTED: wall-associated receptor kinase-l...    124   2e-28   
ref|XP_006429169.1|  hypothetical protein CICLE_v10013620mg             124   2e-28   
ref|XP_010262628.1|  PREDICTED: wall-associated receptor kinase-l...    124   4e-28   
dbj|BAJ97459.1|  predicted protein                                      123   6e-28   
dbj|BAK02037.1|  predicted protein                                      123   6e-28   
dbj|BAJ96779.1|  predicted protein                                      123   6e-28   
ref|XP_008448229.1|  PREDICTED: wall-associated receptor kinase-l...    123   6e-28   
ref|XP_007009294.1|  Kinase, putative                                   122   1e-27   
ref|XP_002282445.1|  PREDICTED: wall-associated receptor kinase-l...    121   3e-27   Vitis vinifera
emb|CBI31617.3|  unnamed protein product                                120   4e-27   
ref|XP_002873036.1|  hypothetical protein ARALYDRAFT_486985             120   5e-27   
gb|KDP44885.1|  hypothetical protein JCGZ_01385                         120   6e-27   
ref|XP_007206748.1|  hypothetical protein PRUPE_ppa025090mg             119   8e-27   
ref|XP_004137276.1|  PREDICTED: wall-associated receptor kinase-l...    115   8e-27   
ref|XP_006398671.1|  hypothetical protein EUTSA_v10012908mg             119   9e-27   
ref|XP_006289936.1|  hypothetical protein CARUB_v10003558mg             119   9e-27   
gb|EYU35241.1|  hypothetical protein MIMGU_mgv1a021456mg                115   1e-26   
ref|NP_001235056.1|  protein kinase-related protein precursor           119   1e-26   
ref|NP_195827.1|  WALL-associated receptor kinase-like 20               119   1e-26   Arabidopsis thaliana [mouse-ear cress]
gb|KGN53721.1|  hypothetical protein Csa_4G110080                       115   1e-26   
gb|KDP44886.1|  hypothetical protein JCGZ_01386                         119   1e-26   
gb|KHG23448.1|  Wall-associated receptor kinase-like 20                 119   1e-26   
ref|XP_002271602.1|  PREDICTED: wall-associated receptor kinase-l...    119   2e-26   Vitis vinifera
emb|CAN69970.1|  hypothetical protein VITISV_001450                     118   3e-26   Vitis vinifera
ref|XP_006341199.1|  PREDICTED: wall-associated receptor kinase-l...    117   3e-26   
ref|XP_008242431.1|  PREDICTED: wall-associated receptor kinase-l...    117   4e-26   
ref|XP_010937552.1|  PREDICTED: wall-associated receptor kinase-l...    117   4e-26   
gb|KDP24561.1|  hypothetical protein JCGZ_25125                         117   6e-26   
ref|XP_010105421.1|  Wall-associated receptor kinase-like 20            117   6e-26   
ref|XP_007026925.1|  Kinase family protein                              117   8e-26   
ref|XP_010490623.1|  PREDICTED: wall-associated receptor kinase-l...    117   8e-26   
gb|KDO48146.1|  hypothetical protein CISIN_1g047195mg                   116   9e-26   
ref|XP_006429168.1|  hypothetical protein CICLE_v10013798mg             114   9e-26   
ref|XP_010424819.1|  PREDICTED: wall-associated receptor kinase-l...    112   1e-25   
ref|XP_007163467.1|  hypothetical protein PHAVU_001G236600g             116   2e-25   
ref|XP_008233487.1|  PREDICTED: wall-associated receptor kinase-l...    115   2e-25   
gb|KFK24607.1|  hypothetical protein AALP_AA8G001200                    115   2e-25   
ref|XP_007220545.1|  hypothetical protein PRUPE_ppa002973mg             115   2e-25   
ref|XP_009404584.1|  PREDICTED: wall-associated receptor kinase-l...    115   2e-25   
ref|XP_004252723.1|  PREDICTED: wall-associated receptor kinase-l...    114   4e-25   
ref|XP_010554928.1|  PREDICTED: wall-associated receptor kinase-l...    114   5e-25   
ref|XP_004246863.1|  PREDICTED: wall-associated receptor kinase-l...    114   5e-25   
ref|XP_002444158.1|  hypothetical protein SORBIDRAFT_07g010240          114   9e-25   Sorghum bicolor [broomcorn]
ref|XP_002524223.1|  kinase, putative                                   112   2e-24   Ricinus communis
ref|XP_002529875.1|  kinase, putative                                   112   3e-24   Ricinus communis
ref|XP_003600760.1|  Wall-associated receptor kinase-like protein       112   4e-24   
ref|XP_008441394.1|  PREDICTED: LOW QUALITY PROTEIN: wall-associa...    112   4e-24   
ref|XP_007206848.1|  hypothetical protein PRUPE_ppa027075mg             112   4e-24   
ref|XP_010046498.1|  PREDICTED: wall-associated receptor kinase-l...    111   5e-24   
ref|XP_010046500.1|  PREDICTED: wall-associated receptor kinase-l...    111   6e-24   
ref|XP_004154775.1|  PREDICTED: wall-associated receptor kinase-l...    111   7e-24   
ref|XP_010068892.1|  PREDICTED: wall-associated receptor kinase-l...    111   7e-24   
ref|XP_004962492.1|  PREDICTED: wall-associated receptor kinase-l...    111   8e-24   
ref|XP_006366426.1|  PREDICTED: wall-associated receptor kinase-l...    111   8e-24   
emb|CDY56488.1|  BnaCnng30460D                                          107   1e-23   
ref|XP_004503179.1|  PREDICTED: wall-associated receptor kinase-l...    110   1e-23   
ref|XP_010452039.1|  PREDICTED: wall-associated receptor kinase-l...    110   1e-23   
emb|CDY33837.1|  BnaCnng07550D                                          107   2e-23   
ref|XP_004308840.1|  PREDICTED: wall-associated receptor kinase-l...    110   2e-23   
ref|XP_004503197.1|  PREDICTED: wall-associated receptor kinase-l...    106   2e-23   
ref|XP_009122812.1|  PREDICTED: wall-associated receptor kinase-l...    109   3e-23   
gb|KGN46391.1|  hypothetical protein Csa_6G088680                       105   3e-23   
ref|NP_001168336.1|  uncharacterized LOC100382104 precursor             109   3e-23   Zea mays [maize]
ref|XP_004157625.1|  PREDICTED: wall-associated receptor kinase-l...    105   3e-23   
ref|XP_008794074.1|  PREDICTED: wall-associated receptor kinase-l...    109   3e-23   
gb|EAY97519.1|  hypothetical protein OsI_19447                          109   3e-23   Oryza sativa Indica Group [Indian rice]
ref|XP_002982423.1|  hypothetical protein SELMODRAFT_116212             109   3e-23   
gb|AAV44115.1|  unknown protein                                         109   3e-23   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002966586.1|  hypothetical protein SELMODRAFT_85883              109   3e-23   
ref|XP_010935377.1|  PREDICTED: LOW QUALITY PROTEIN: wall-associa...    109   4e-23   
emb|CDY10472.1|  BnaCnng03730D                                          110   4e-23   
gb|AFK34006.1|  unknown                                                 108   5e-23   
ref|XP_010682238.1|  PREDICTED: wall-associated receptor kinase-l...    108   6e-23   
gb|KGN45743.1|  hypothetical protein Csa_6G008740                       108   7e-23   
ref|XP_009791579.1|  PREDICTED: wall-associated receptor kinase-l...    108   7e-23   
gb|KDO48145.1|  hypothetical protein CISIN_1g0396811mg                  101   7e-23   
emb|CDY40328.1|  BnaA10g27400D                                          109   8e-23   
ref|XP_006403646.1|  hypothetical protein EUTSA_v10011109mg             108   8e-23   
emb|CAB88346.1|  protein kinase-like protein                            108   8e-23   Arabidopsis thaliana [mouse-ear cress]
gb|KDO36633.1|  hypothetical protein CISIN_1g042229mg                   100   9e-23   
ref|NP_190952.2|  wall-associated receptor kinase-like 15               108   1e-22   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009358868.1|  PREDICTED: wall-associated receptor kinase-l...    107   1e-22   
ref|XP_009758536.1|  PREDICTED: wall-associated receptor kinase-l...    107   1e-22   
ref|XP_007140473.1|  hypothetical protein PHAVU_008G115500g             107   2e-22   
ref|XP_010543268.1|  PREDICTED: wall-associated receptor kinase-l...    103   2e-22   
ref|XP_009594229.1|  PREDICTED: wall-associated receptor kinase-l...    107   2e-22   
ref|XP_007162825.1|  hypothetical protein PHAVU_001G184100g             106   3e-22   
ref|XP_009116082.1|  PREDICTED: wall-associated receptor kinase-l...    106   3e-22   
ref|XP_006838774.1|  hypothetical protein AMTR_s00002p00257930          106   4e-22   
emb|CDP00139.1|  unnamed protein product                                106   4e-22   
ref|XP_002308179.2|  hypothetical protein POPTR_0006s09120g             106   4e-22   Populus trichocarpa [western balsam poplar]
ref|XP_010678050.1|  PREDICTED: wall-associated receptor kinase-l...    106   4e-22   
emb|CDY54025.1|  BnaA09g54890D                                          106   5e-22   
ref|XP_009601715.1|  PREDICTED: wall-associated receptor kinase-l...    105   5e-22   
ref|XP_010504162.1|  PREDICTED: wall-associated receptor kinase-l...    105   5e-22   
ref|XP_010427044.1|  PREDICTED: wall-associated receptor kinase-l...    105   7e-22   
ref|XP_010046499.1|  PREDICTED: wall-associated receptor kinase-l...    105   7e-22   
ref|XP_008359753.1|  PREDICTED: wall-associated receptor kinase-l...    105   1e-21   
ref|XP_004491993.1|  PREDICTED: wall-associated receptor kinase-l...    104   2e-21   
ref|XP_010515888.1|  PREDICTED: wall-associated receptor kinase-l...    104   2e-21   
ref|XP_004305378.1|  PREDICTED: wall-associated receptor kinase-l...    102   6e-21   
ref|XP_006584258.1|  PREDICTED: wall-associated receptor kinase-l...    102   8e-21   
ref|XP_002519414.1|  serine-threonine protein kinase, plant-type,...    102   9e-21   Ricinus communis
ref|XP_008359616.1|  PREDICTED: wall-associated receptor kinase-l...    100   1e-20   
gb|KCW86003.1|  hypothetical protein EUGRSUZ_B02709                     101   2e-20   
ref|XP_010037107.1|  PREDICTED: wall-associated receptor kinase-l...    100   3e-20   
ref|XP_010654014.1|  PREDICTED: wall-associated receptor kinase-l...  98.6    4e-20   
ref|XP_006290735.1|  hypothetical protein CARUB_v10016831mg             100   5e-20   
ref|XP_007027545.1|  Kinase family protein                            99.8    6e-20   
ref|XP_009340964.1|  PREDICTED: wall-associated receptor kinase-l...  99.8    6e-20   
ref|XP_009375638.1|  PREDICTED: wall-associated receptor kinase-l...  99.8    6e-20   
ref|XP_008241439.1|  PREDICTED: wall-associated receptor kinase-l...  99.8    8e-20   
ref|XP_007203270.1|  hypothetical protein PRUPE_ppa019811mg           99.4    1e-19   
gb|KHN02278.1|  Wall-associated receptor kinase-like 20               99.4    1e-19   
ref|XP_003553572.2|  PREDICTED: wall-associated receptor kinase-l...  99.0    1e-19   
gb|KEH24074.1|  wall-associated receptor kinase-like protein          99.0    1e-19   
ref|XP_008351666.1|  PREDICTED: wall-associated receptor kinase-l...  99.0    1e-19   
ref|XP_008442770.1|  PREDICTED: wall-associated receptor kinase-l...  98.2    2e-19   
emb|CBI30203.3|  unnamed protein product                              98.2    2e-19   
ref|XP_010654013.1|  PREDICTED: wall-associated receptor kinase-l...  97.8    3e-19   
emb|CAN72920.1|  hypothetical protein VITISV_022322                   97.8    5e-19   Vitis vinifera
ref|XP_008803157.1|  PREDICTED: wall-associated receptor kinase-l...  97.1    5e-19   
emb|CDP10679.1|  unnamed protein product                              97.1    6e-19   
ref|XP_010654012.1|  PREDICTED: wall-associated receptor kinase-l...  96.7    9e-19   
ref|XP_009789812.1|  PREDICTED: wall-associated receptor kinase-l...  95.9    9e-19   
ref|XP_006366792.1|  PREDICTED: wall-associated receptor kinase-l...  96.3    1e-18   
ref|XP_009623508.1|  PREDICTED: wall-associated receptor kinase-l...  95.5    2e-18   
gb|KCW86002.1|  hypothetical protein EUGRSUZ_B02708                   95.1    2e-18   
ref|XP_009789810.1|  PREDICTED: wall-associated receptor kinase-l...  95.1    2e-18   
ref|XP_010098860.1|  Wall-associated receptor kinase-like 20          94.4    4e-18   
ref|XP_006446164.1|  hypothetical protein CICLE_v10017557mg           94.4    4e-18   
gb|KGN59036.1|  hypothetical protein Csa_3G748160                     93.6    5e-18   
ref|XP_006470647.1|  PREDICTED: wall-associated receptor kinase-l...  94.0    5e-18   
ref|XP_004161272.1|  PREDICTED: wall-associated receptor kinase-l...  93.6    7e-18   
ref|XP_004494110.1|  PREDICTED: wall-associated receptor kinase-l...  93.2    8e-18   
ref|XP_003520675.1|  PREDICTED: wall-associated receptor kinase-l...  93.2    1e-17   
ref|XP_004137999.1|  PREDICTED: wall-associated receptor kinase-l...  93.2    1e-17   
ref|XP_011018851.1|  PREDICTED: wall-associated receptor kinase-l...  92.0    2e-17   
ref|XP_006381343.1|  hypothetical protein POPTR_0006s12000g           89.7    1e-16   
gb|KCW65575.1|  hypothetical protein EUGRSUZ_G02969                   89.4    1e-16   
gb|KCW48772.1|  hypothetical protein EUGRSUZ_K02415                   89.4    2e-16   
ref|XP_010088590.1|  Wall-associated receptor kinase-like 20          86.3    2e-15   
ref|XP_006388356.1|  hypothetical protein POPTR_0212s00200g           79.0    3e-14   
gb|EMT22815.1|  Wall-associated receptor kinase-like 20               72.4    5e-11   
ref|XP_007222517.1|  hypothetical protein PRUPE_ppa009847mg           70.1    1e-10   
ref|XP_002311340.2|  hypothetical protein POPTR_0008s09540g           70.1    1e-10   Populus trichocarpa [western balsam poplar]
gb|KCW65584.1|  hypothetical protein EUGRSUZ_G02981                   71.6    1e-10   
ref|XP_011018654.1|  PREDICTED: wall-associated receptor kinase-l...  70.1    1e-10   
emb|CDP06572.1|  unnamed protein product                              68.6    1e-10   
ref|XP_002512078.1|  conserved hypothetical protein                   69.3    2e-10   Ricinus communis
ref|XP_011011968.1|  PREDICTED: wall-associated receptor kinase 5...  69.3    3e-10   
ref|XP_002316087.2|  hypothetical protein POPTR_0010s16600g           68.6    5e-10   Populus trichocarpa [western balsam poplar]
ref|XP_008350892.1|  PREDICTED: uncharacterized protein LOC103414277  67.8    1e-09   
ref|XP_009356404.1|  PREDICTED: uncharacterized protein LOC103947253  67.8    1e-09   
ref|XP_008243850.1|  PREDICTED: uncharacterized protein LOC103342062  67.4    1e-09   
gb|KDP41303.1|  hypothetical protein JCGZ_15710                       67.0    2e-09   
emb|CDP00435.1|  unnamed protein product                              67.0    4e-09   
gb|KHG13268.1|  Wall-associated receptor kinase-like 20               65.1    9e-09   
ref|XP_011070936.1|  PREDICTED: uncharacterized protein LOC105156489  65.1    9e-09   
ref|XP_009770609.1|  PREDICTED: uncharacterized protein LOC104221277  65.1    1e-08   
emb|CBI27289.3|  unnamed protein product                              65.9    1e-08   
ref|XP_003631197.1|  PREDICTED: wall-associated receptor kinase-l...  64.7    1e-08   
ref|XP_009768766.1|  PREDICTED: uncharacterized protein LOC104219742  63.9    2e-08   
gb|KEH20808.1|  wall-associated receptor kinase galacturonan-bind...  62.8    5e-08   
ref|XP_010091574.1|  hypothetical protein L484_026420                 62.4    7e-08   
ref|XP_007045864.1|  Wall-associated receptor kinase-like 8           62.4    8e-08   
ref|XP_006357233.1|  PREDICTED: wall-associated receptor kinase 4...  62.0    9e-08   
ref|XP_009766359.1|  PREDICTED: wall-associated receptor kinase-l...  62.0    9e-08   
gb|KDO70375.1|  hypothetical protein CISIN_1g040327mg                 62.0    1e-07   
ref|XP_006484206.1|  PREDICTED: uncharacterized protein LOC102610801  61.6    1e-07   
ref|XP_009630519.1|  PREDICTED: uncharacterized protein LOC104120471  61.2    2e-07   
ref|XP_009586745.1|  PREDICTED: wall-associated receptor kinase 3...  61.2    2e-07   
ref|XP_004297236.1|  PREDICTED: uncharacterized protein LOC101310691  60.5    3e-07   
ref|XP_004239370.1|  PREDICTED: wall-associated receptor kinase-l...  60.5    3e-07   
ref|XP_006437925.1|  hypothetical protein CICLE_v10033305mg           61.2    3e-07   
ref|XP_010657377.1|  PREDICTED: uncharacterized protein LOC100267196  61.6    3e-07   
emb|CBI17984.3|  unnamed protein product                              61.2    3e-07   
gb|KHN18711.1|  Wall-associated receptor kinase-like 20               60.5    6e-07   
ref|XP_006828783.1|  hypothetical protein AMTR_s00001p00109150        59.7    6e-07   
ref|XP_010652701.1|  PREDICTED: wall-associated receptor kinase-l...  59.3    8e-07   
ref|XP_010683305.1|  PREDICTED: uncharacterized protein LOC104898013  59.3    9e-07   
emb|CBI32047.3|  unnamed protein product                              58.9    1e-06   
ref|XP_011069388.1|  PREDICTED: wall-associated receptor kinase-l...  58.5    1e-06   
emb|CDP00260.1|  unnamed protein product                              58.2    2e-06   
ref|XP_011048518.1|  PREDICTED: G-type lectin S-receptor-like ser...  58.5    3e-06   
ref|XP_011048516.1|  PREDICTED: G-type lectin S-receptor-like ser...  58.5    3e-06   
gb|KGN43563.1|  hypothetical protein Csa_7G045520                     58.5    3e-06   
ref|XP_004144482.1|  PREDICTED: G-type lectin S-receptor-like ser...  58.5    3e-06   
ref|XP_004159218.1|  PREDICTED: G-type lectin S-receptor-like ser...  58.5    3e-06   
ref|XP_008455381.1|  PREDICTED: G-type lectin S-receptor-like ser...  58.5    3e-06   
ref|XP_008455380.1|  PREDICTED: G-type lectin S-receptor-like ser...  58.2    3e-06   
ref|XP_007043402.1|  S-locus lectin protein kinase family protein...  58.2    4e-06   
ref|XP_007043403.1|  S-locus lectin protein kinase family protein...  58.2    4e-06   
ref|XP_007043400.1|  S-locus lectin protein kinase family protein...  58.2    4e-06   
ref|XP_007043401.1|  S-locus lectin protein kinase family protein...  58.2    4e-06   
ref|XP_007043399.1|  S-locus lectin protein kinase family protein...  58.2    4e-06   
ref|XP_007043404.1|  S-locus lectin protein kinase family protein...  58.2    4e-06   
ref|XP_010678931.1|  PREDICTED: uncharacterized protein LOC104894411  58.2    4e-06   
ref|XP_010035634.1|  PREDICTED: G-type lectin S-receptor-like ser...  57.8    5e-06   
ref|XP_010035632.1|  PREDICTED: G-type lectin S-receptor-like ser...  57.8    5e-06   
gb|KCW47081.1|  hypothetical protein EUGRSUZ_K00885                   57.8    5e-06   
ref|XP_010035633.1|  PREDICTED: G-type lectin S-receptor-like ser...  57.8    5e-06   
ref|XP_009603896.1|  PREDICTED: wall-associated receptor kinase-l...  56.6    6e-06   
ref|XP_010678825.1|  PREDICTED: G-type lectin S-receptor-like ser...  57.4    7e-06   
ref|XP_008230054.1|  PREDICTED: G-type lectin S-receptor-like ser...  57.4    7e-06   
ref|XP_010678824.1|  PREDICTED: G-type lectin S-receptor-like ser...  57.4    7e-06   
ref|XP_004494112.1|  PREDICTED: wall-associated receptor kinase-l...  57.0    8e-06   
ref|XP_011086430.1|  PREDICTED: wall-associated receptor kinase-l...  56.2    9e-06   
ref|XP_010044401.1|  PREDICTED: uncharacterized protein LOC104433378  56.2    1e-05   
ref|XP_002309973.1|  hypothetical protein POPTR_0007s05260g           55.8    1e-05   Populus trichocarpa [western balsam poplar]
ref|XP_010268952.1|  PREDICTED: uncharacterized protein LOC104605764  56.6    1e-05   
ref|XP_006447432.1|  hypothetical protein CICLE_v10018413mg           54.3    1e-05   
ref|XP_007132600.1|  hypothetical protein PHAVU_011G108700g           56.2    1e-05   
ref|XP_006592403.1|  PREDICTED: G-type lectin S-receptor-like ser...  56.2    2e-05   
gb|KCW89451.1|  hypothetical protein EUGRSUZ_A01745                   56.2    2e-05   
gb|KDP29220.1|  hypothetical protein JCGZ_16609                       55.8    2e-05   
gb|KEH41621.1|  S-locus lectin kinase family protein                  56.2    2e-05   
gb|KHN22870.1|  G-type lectin S-receptor-like serine/threonine-pr...  56.2    2e-05   
ref|XP_006592404.1|  PREDICTED: G-type lectin S-receptor-like ser...  55.8    2e-05   
ref|XP_010069711.1|  PREDICTED: uncharacterized protein LOC104456586  55.8    2e-05   
ref|XP_006592402.1|  PREDICTED: G-type lectin S-receptor-like ser...  55.8    2e-05   
ref|XP_010274341.1|  PREDICTED: uncharacterized protein LOC104609...  55.8    2e-05   
ref|XP_009396937.1|  PREDICTED: uncharacterized protein LOC103981905  55.1    2e-05   
ref|XP_011015757.1|  PREDICTED: wall-associated receptor kinase-l...  54.7    3e-05   
ref|XP_011022807.1|  PREDICTED: wall-associated receptor kinase-l...  54.7    3e-05   
ref|XP_010274340.1|  PREDICTED: putative G-type lectin S-receptor...  55.5    3e-05   
ref|XP_002518443.1|  conserved hypothetical protein                   54.7    3e-05   Ricinus communis
ref|XP_004504091.1|  PREDICTED: wall-associated receptor kinase-l...  54.3    3e-05   
ref|XP_008230056.1|  PREDICTED: G-type lectin S-receptor-like ser...  55.1    4e-05   
ref|XP_004512664.1|  PREDICTED: wall-associated receptor kinase-l...  54.3    4e-05   
ref|XP_004504090.1|  PREDICTED: wall-associated receptor kinase-l...  54.3    4e-05   
emb|CDP20444.1|  unnamed protein product                              54.7    4e-05   
ref|XP_004239462.2|  PREDICTED: wall-associated receptor kinase-l...  54.3    4e-05   
gb|KCW89450.1|  hypothetical protein EUGRSUZ_A01744                   54.7    5e-05   
ref|XP_006469789.1|  PREDICTED: G-type lectin S-receptor-like ser...  54.7    5e-05   
ref|XP_006469788.1|  PREDICTED: G-type lectin S-receptor-like ser...  54.7    5e-05   
gb|KCW89448.1|  hypothetical protein EUGRSUZ_A01744                   54.3    5e-05   
gb|KCW89447.1|  hypothetical protein EUGRSUZ_A01744                   54.3    6e-05   
gb|KDO41729.1|  hypothetical protein CISIN_1g036207mg                 54.3    6e-05   
gb|KCW89449.1|  hypothetical protein EUGRSUZ_A01744                   54.3    6e-05   
gb|ABR18048.1|  unknown                                               53.9    6e-05   
ref|XP_006348689.1|  PREDICTED: uncharacterized protein LOC102596429  53.5    6e-05   
ref|XP_009400706.1|  PREDICTED: uncharacterized protein LOC103984868  53.5    8e-05   
emb|CBI17992.3|  unnamed protein product                              53.5    1e-04   
ref|XP_006580267.1|  PREDICTED: A-agglutinin anchorage subunit-li...  53.1    1e-04   
gb|KHG16192.1|  hypothetical protein F383_21500                       53.5    1e-04   
ref|XP_006580266.1|  PREDICTED: A-agglutinin anchorage subunit-li...  52.8    1e-04   
ref|XP_009350313.1|  PREDICTED: G-type lectin S-receptor-like ser...  53.5    1e-04   
ref|XP_009350320.1|  PREDICTED: G-type lectin S-receptor-like ser...  53.5    1e-04   
ref|XP_008230177.1|  PREDICTED: G-type lectin S-receptor-like ser...  53.5    1e-04   
ref|XP_010657368.1|  PREDICTED: G-type lectin S-receptor-like ser...  53.5    1e-04   
ref|XP_006847602.1|  hypothetical protein AMTR_s00014p00239440        52.8    1e-04   
gb|KDP32211.1|  hypothetical protein JCGZ_13818                       53.5    1e-04   
ref|XP_006580265.1|  PREDICTED: A-agglutinin anchorage subunit-li...  52.4    2e-04   
ref|XP_006580264.1|  PREDICTED: A-agglutinin anchorage subunit-li...  52.4    2e-04   
ref|XP_006377129.1|  hypothetical protein POPTR_0011s00260g           52.0    2e-04   
ref|XP_003613494.1|  Wall-associated receptor kinase-like protein     52.0    2e-04   
ref|XP_011007990.1|  PREDICTED: wall-associated receptor kinase 3     52.0    2e-04   
ref|XP_011008018.1|  PREDICTED: uncharacterized protein LOC105113516  52.4    2e-04   
ref|XP_008341948.1|  PREDICTED: G-type lectin S-receptor-like ser...  52.8    2e-04   
gb|KDP32208.1|  hypothetical protein JCGZ_13815                       52.8    2e-04   
ref|XP_010095190.1|  G-type lectin S-receptor-like serine/threoni...  52.8    2e-04   
ref|XP_007047912.1|  Membrane lipoprotein                             52.0    3e-04   
gb|KEH27779.1|  wall-associated receptor kinase galacturonan-bind...  52.0    3e-04   
ref|XP_010252469.1|  PREDICTED: wall-associated receptor kinase-l...  52.0    3e-04   
ref|XP_006389577.1|  hypothetical protein POPTR_0021s00270g           52.0    3e-04   
ref|XP_002314622.2|  hypothetical protein POPTR_0010s04960g           51.6    3e-04   
gb|KHN40266.1|  Wall-associated receptor kinase-like 20               52.4    3e-04   
ref|XP_010051394.1|  PREDICTED: G-type lectin S-receptor-like ser...  52.4    3e-04   
ref|XP_010051388.1|  PREDICTED: G-type lectin S-receptor-like ser...  52.4    3e-04   
gb|KHG18976.1|  Wall-associated receptor kinase-like 20               51.6    3e-04   
ref|XP_006466239.1|  PREDICTED: uncharacterized protein LOC102617021  51.2    4e-04   
ref|XP_006383884.1|  hypothetical protein POPTR_0004s00880g           51.2    4e-04   
gb|KCW89454.1|  hypothetical protein EUGRSUZ_A01749                   51.6    5e-04   
gb|EYU23967.1|  hypothetical protein MIMGU_mgv1a024985mg              50.8    5e-04   
ref|XP_010051338.1|  PREDICTED: G-type lectin S-receptor-like ser...  51.6    5e-04   
ref|XP_006426371.1|  hypothetical protein CICLE_v10026163mg           50.4    7e-04   
gb|KEH16558.1|  S-locus lectin kinase family protein                  50.8    8e-04   
ref|XP_010272179.1|  PREDICTED: uncharacterized protein LOC104608033  50.4    8e-04   
emb|CAN65701.1|  hypothetical protein VITISV_039251                   50.8    9e-04   
ref|XP_007044408.1|  Wall-associated receptor kinase-like 20          50.1    9e-04   
gb|KDP21253.1|  hypothetical protein JCGZ_21724                       50.1    0.001   
ref|XP_010096306.1|  hypothetical protein L484_021052                 50.1    0.001   
ref|XP_003517759.1|  PREDICTED: wall-associated receptor kinase-l...  50.1    0.001   
ref|XP_011046964.1|  PREDICTED: uncharacterized protein LOC105141439  50.1    0.001   



>ref|XP_009777881.1| PREDICTED: wall-associated receptor kinase-like 20 [Nicotiana 
sylvestris]
Length=206

 Score =   233 bits (595),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 132/184 (72%), Positives = 150/184 (82%), Gaps = 1/184 (1%)
 Frame = +2

Query  98   NCPKCGTMDVPYPLSTGDSCGNPSYRVYCNNGVLNFLSATGFYYKIQSIDPSASRLIISP  277
            NCPKCGTMDVPYPLST ++CGNP+Y+VYCN+  L FLS+ GFYYKI SI+PS SRL+ISP
Sbjct  22   NCPKCGTMDVPYPLSTSENCGNPNYKVYCNSYNLEFLSSVGFYYKILSINPSTSRLVISP  81

Query  278  PVILTNTCMSSDLSLGGLTIDQNSPFNISSRNTVMLLNCSEGIllsplncslsspcrvfe  457
            P I  ++C SSDLSLGGL ID+NSPFNISS+NTVML NCSE IL SPLNCS +SPCR FE
Sbjct  82   PFIQKDSCQSSDLSLGGLKIDENSPFNISSQNTVMLFNCSENILESPLNCSSTSPCRKFE  141

Query  458  rgvgegrgcgDTLCCSYLKDSSMTSHRIRARVGGCSAYTSVVDLNPGDVNFHAWHYGIEL  637
                EGR C +TLCCSYLKD+SMTSHRIR RV GC+AYTS VD    + +  AW YGIEL
Sbjct  142  ESSREGRNCKNTLCCSYLKDASMTSHRIRVRVTGCTAYTSFVDFK-AEASISAWRYGIEL  200

Query  638  QWIP  649
            QWIP
Sbjct  201  QWIP  204



>ref|XP_010659666.1| PREDICTED: wall-associated receptor kinase-like 20 [Vitis vinifera]
Length=209

 Score =   228 bits (582),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 118/187 (63%), Positives = 136/187 (73%), Gaps = 2/187 (1%)
 Frame = +2

Query  89   AYDNCPKCGTMDVPYPLSTGDSCGNPSYRVYCNNGVLNFLSATGFYYKIQSIDPSASRLI  268
            A + CP CG+M VPYPLST D+CGNP YRVYCNNG L FLSA  F+Y+I SI+PSA + I
Sbjct  23   ALEACPNCGSMQVPYPLSTNDNCGNPRYRVYCNNGSLEFLSAQNFFYQILSINPSAYKFI  82

Query  269  ISPPVILTNTCMSSDLSLGGLTIDQNSPFNISSRNTVMLLNCSEGIllsplncslsspcr  448
            I PP+I  NTC SSDL +GGL +D+NSPFNIS+ NTVML NCSE I L       S    
Sbjct  83   IRPPLIQKNTCYSSDLDVGGLLLDENSPFNISTHNTVMLFNCSETI-LLSPLNCSSVSPC  141

Query  449  vfergvgegrgcgDTLCCSYLKDSSMTSHRIRARVGGCSAYTSVVDLNPGDVNFHAWHYG  628
                 V    GC DTLCCS+LKDS+MTSHRIR RVGGC+AYTSVVD NP D    +W+YG
Sbjct  142  RQFEKVEAESGCIDTLCCSFLKDSAMTSHRIRVRVGGCTAYTSVVDFNP-DRTVESWNYG  200

Query  629  IELQWIP  649
            IELQW+P
Sbjct  201  IELQWVP  207



>ref|XP_009603830.1| PREDICTED: wall-associated receptor kinase-like 20 [Nicotiana 
tomentosiformis]
Length=201

 Score =   226 bits (577),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 120/186 (65%), Positives = 140/186 (75%), Gaps = 4/186 (2%)
 Frame = +2

Query  89   AYDNCPKCGTMDVPYPLSTGDSCGNPSYRVYCNNGVLNFLSATGFYYKIQSIDPSASRLI  268
            A   CPKCG MDVPYPLST D CGNPSYR++C NG+L FLSA G YYKI SI+P+ASRL+
Sbjct  17   AVPECPKCGNMDVPYPLSTSDECGNPSYRIHCKNGILEFLSAEGIYYKILSINPNASRLV  76

Query  269  ISPPVILTNTCMSSDLSLGGLTIDQNSPFNISSRNTVMLLNCSEGIllsplncslsspcr  448
            IS P++  +TC S DLS+GGL ID+NSPFNISSRNTVMLLNCSE I    L+    S   
Sbjct  77   ISSPLMQKDTCHSFDLSVGGLRIDENSPFNISSRNTVMLLNCSERI---LLSPLNCSLNS  133

Query  449  vfergvgegrgcgDTLCCSYLKDSSMTSHRIRARVGGCSAYTSVVDLNPGDVNFHAWHYG  628
               +   E +GC DT+CCSYLK +S  SHRIR RVGGC+AYTSVVDL  GD + +AW YG
Sbjct  134  PCRKFENEIKGCRDTVCCSYLKVASKASHRIRVRVGGCTAYTSVVDLKAGD-SINAWQYG  192

Query  629  IELQWI  646
            +ELQWI
Sbjct  193  VELQWI  198



>gb|KDP23426.1| hypothetical protein JCGZ_23259 [Jatropha curcas]
Length=204

 Score =   225 bits (574),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 126/187 (67%), Positives = 153/187 (82%), Gaps = 1/187 (1%)
 Frame = +2

Query  89   AYDNCPKCGTMDVPYPLSTGDSCGNPSYRVYCNNGVLNFLSATGFYYKIQSIDPSASRLI  268
            A++ CPKCG+M+VPYPLSTG++CGNP+YR+YCN+G L FLS+ GFYYKI SI+PS+ +L+
Sbjct  17   AFNACPKCGSMEVPYPLSTGENCGNPNYRIYCNDGALKFLSSQGFYYKILSINPSSYKLV  76

Query  269  ISPPVILTNTCMSSDLSLGGLTIDQNSPFNISSRNTVMLLNCSEGIllsplncslsspcr  448
            I PP+I  NTC SSDL +GGL +D+N PFNIS+ NTVML NCSE ILLSPLNC+ SS CR
Sbjct  77   IEPPLIQKNTCYSSDLGVGGLMLDENLPFNISTHNTVMLFNCSETILLSPLNCTSSSYCR  136

Query  449  vfergvgegrgcgDTLCCSYLKDSSMTSHRIRARVGGCSAYTSVVDLNPGDVNFHAWHYG  628
             FE G  EG GC  TLCC +LKD+SMTSHR+R RVGGC+AYTSVVD+   D    AW+YG
Sbjct  137  RFEEGNREGSGCKGTLCCHFLKDASMTSHRVRVRVGGCTAYTSVVDIKSID-PIDAWNYG  195

Query  629  IELQWIP  649
            IELQW+P
Sbjct  196  IELQWVP  202



>ref|XP_006382434.1| hypothetical protein POPTR_0005s02120g [Populus trichocarpa]
 gb|ERP60231.1| hypothetical protein POPTR_0005s02120g [Populus trichocarpa]
Length=203

 Score =   224 bits (572),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 118/187 (63%), Positives = 143/187 (76%), Gaps = 2/187 (1%)
 Frame = +2

Query  89   AYDNCPKCGTMDVPYPLSTGDSCGNPSYRVYCNNGVLNFLSATGFYYKIQSIDPSASRLI  268
            A+D CPKCG M+VPYPLST D+CGNP YR+YCN+G L FLSA GFYY+I SI+PS  +L+
Sbjct  17   AFDVCPKCGNMEVPYPLSTSDNCGNPRYRIYCNSGALEFLSAQGFYYRILSINPSVRKLV  76

Query  269  ISPPVILTNTCMSSDLSLGGLTIDQNSPFNISSRNTVMLLNCSEGIllsplncslsspcr  448
            ISPP+I+ NTC SSDLSLGGL++++NS FNIS+ NTVML NCS+ I L       S+   
Sbjct  77   ISPPLIVKNTCCSSDLSLGGLSLNENSSFNISTHNTVMLFNCSDNI-LLSPLNCSSTSFC  135

Query  449  vfergvgegrgcgDTLCCSYLKDSSMTSHRIRARVGGCSAYTSVVDLNPGDVNFHAWHYG  628
                 VGEG GC  TLCC +LKD++MTSHRIR R GGC+AYTSVVD+ PGD     W+YG
Sbjct  136  RQYEEVGEGSGCKGTLCCHFLKDTAMTSHRIRVRAGGCTAYTSVVDIKPGD-PIDRWNYG  194

Query  629  IELQWIP  649
            IELQW+P
Sbjct  195  IELQWLP  201



>ref|XP_006433489.1| hypothetical protein CICLE_v10003862mg [Citrus clementina]
 gb|ESR46729.1| hypothetical protein CICLE_v10003862mg [Citrus clementina]
Length=199

 Score =   224 bits (570),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 129/187 (69%), Positives = 153/187 (82%), Gaps = 1/187 (1%)
 Frame = +2

Query  89   AYDNCPKCGTMDVPYPLSTGDSCGNPSYRVYCNNGVLNFLSATGFYYKIQSIDPSASRLI  268
             ++ CPKCG+++VPYPLST D+CG+P YRVYC N VL  LSA GFYYKI SI+PS+ RL+
Sbjct  12   GHNACPKCGSIEVPYPLSTNDNCGDPRYRVYCENDVLQLLSAGGFYYKIISINPSSYRLV  71

Query  269  ISPPVILTNTCMSSDLSLGGLTIDQNSPFNISSRNTVMLLNCSEGIllsplncslsspcr  448
            ISPP+I  +TC SSDL+ GG T+D +SPFNIS+RNTVMLLNCSE ILLSPLNCS SS CR
Sbjct  72   ISPPLIPKDTCYSSDLTSGGFTLDDDSPFNISTRNTVMLLNCSENILLSPLNCSSSSLCR  131

Query  449  vfergvgegrgcgDTLCCSYLKDSSMTSHRIRARVGGCSAYTSVVDLNPGDVNFHAWHYG  628
            +FE  V  G GC  TLCC +LKDSSMTS RIR RVGGC+AYTSVVD+ PGD +  +W+YG
Sbjct  132  LFEEQVEAGNGCRGTLCCHFLKDSSMTSRRIRVRVGGCTAYTSVVDIRPGD-SIDSWNYG  190

Query  629  IELQWIP  649
            IELQW+P
Sbjct  191  IELQWLP  197



>ref|XP_006472158.1| PREDICTED: wall-associated receptor kinase-like 20-like [Citrus 
sinensis]
Length=204

 Score =   224 bits (570),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 129/187 (69%), Positives = 153/187 (82%), Gaps = 1/187 (1%)
 Frame = +2

Query  89   AYDNCPKCGTMDVPYPLSTGDSCGNPSYRVYCNNGVLNFLSATGFYYKIQSIDPSASRLI  268
             ++ CPKCG+++VPYPLST D+CG+P YRVYC N VL  LSA GFYYKI SI+PS+ RL+
Sbjct  17   GHNACPKCGSIEVPYPLSTNDNCGDPRYRVYCENDVLQLLSAGGFYYKIISINPSSYRLV  76

Query  269  ISPPVILTNTCMSSDLSLGGLTIDQNSPFNISSRNTVMLLNCSEGIllsplncslsspcr  448
            ISPP+I  +TC SSDL+ GG T+D +SPFNIS+RNTVMLLNCSE ILLSPLNCS SS CR
Sbjct  77   ISPPLIPKDTCYSSDLTSGGFTLDDDSPFNISTRNTVMLLNCSENILLSPLNCSSSSLCR  136

Query  449  vfergvgegrgcgDTLCCSYLKDSSMTSHRIRARVGGCSAYTSVVDLNPGDVNFHAWHYG  628
            +FE  V  G GC  TLCC +LKDSSMTS RIR RVGGC+AYTSVVD+ PGD +  +W+YG
Sbjct  137  LFEEQVEAGSGCRGTLCCHFLKDSSMTSRRIRVRVGGCTAYTSVVDIRPGD-SIDSWNYG  195

Query  629  IELQWIP  649
            IELQW+P
Sbjct  196  IELQWLP  202



>ref|XP_002512476.1| hypothetical protein RCOM_1434200 [Ricinus communis]
 gb|EEF49928.1| hypothetical protein RCOM_1434200 [Ricinus communis]
Length=203

 Score =   221 bits (564),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 123/187 (66%), Positives = 146/187 (78%), Gaps = 1/187 (1%)
 Frame = +2

Query  89   AYDNCPKCGTMDVPYPLSTGDSCGNPSYRVYCNNGVLNFLSATGFYYKIQSIDPSASRLI  268
            A + CPKCG+M+VPYPLSTGD+CG+P YR+YC N  L FLS+TGFYYKI SI+PS ++L+
Sbjct  16   ALNACPKCGSMEVPYPLSTGDTCGDPRYRIYCKNDALEFLSSTGFYYKILSINPSTNKLV  75

Query  269  ISPPVILTNTCMSSDLSLGGLTIDQNSPFNISSRNTVMLLNCSEGIllsplncslsspcr  448
            I  P++  N C SSDL+LGGL +D+N PFNIS+ NTVML NCS  IL SPLNCS +S CR
Sbjct  76   IGSPIMQKNACYSSDLALGGLMLDENLPFNISTHNTVMLFNCSMDILKSPLNCSSTSFCR  135

Query  449  vfergvgegrgcgDTLCCSYLKDSSMTSHRIRARVGGCSAYTSVVDLNPGDVNFHAWHYG  628
             FE G   G GC  TLCC +LKDS+MTSHRIR RVGGC+AYTSVVDL P +    AW YG
Sbjct  136  QFEEGDEGGNGCKGTLCCHFLKDSAMTSHRIRVRVGGCTAYTSVVDLKPAE-PIDAWKYG  194

Query  629  IELQWIP  649
            IELQW+P
Sbjct  195  IELQWLP  201



>ref|XP_007031083.1| Wall-associated receptor kinase-like 20 [Theobroma cacao]
 gb|EOY11585.1| Wall-associated receptor kinase-like 20 [Theobroma cacao]
Length=205

 Score =   220 bits (560),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 124/187 (66%), Positives = 147/187 (79%), Gaps = 1/187 (1%)
 Frame = +2

Query  89   AYDNCPKCGTMDVPYPLSTGDSCGNPSYRVYCNNGVLNFLSATGFYYKIQSIDPSASRLI  268
            A+  CPKCG M+VPYPLST ++CG+P YR+YCNNGVL F+SA GFYY I SI+P +S+L+
Sbjct  18   AFRFCPKCGKMEVPYPLSTDENCGDPRYRIYCNNGVLEFMSAQGFYYNILSINPWSSKLV  77

Query  269  ISPPVILTNTCMSSDLSLGGLTIDQNSPFNISSRNTVMLLNCSEGIllsplncslsspcr  448
            ISPP+I  NTC SSDL +GGL +D+N PFNIS+RNTVML NCS+ ILLSPLNCS SS CR
Sbjct  78   ISPPLIQENTCYSSDLGVGGLVLDENLPFNISTRNTVMLFNCSDSILLSPLNCSSSSFCR  137

Query  449  vfergvgegrgcgDTLCCSYLKDSSMTSHRIRARVGGCSAYTSVVDLNPGDVNFHAWHYG  628
             FE     G GC  TLCC +LKD+SMTSHRIR R+GGC+AYTSVV   P D     W+YG
Sbjct  138  QFEDAGKGGSGCRGTLCCHFLKDASMTSHRIRVRLGGCTAYTSVVGKKPND-PIDTWNYG  196

Query  629  IELQWIP  649
            IELQW+P
Sbjct  197  IELQWLP  203



>ref|XP_011023735.1| PREDICTED: wall-associated receptor kinase-like 20 [Populus euphratica]
Length=211

 Score =   218 bits (556),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 117/187 (63%), Positives = 137/187 (73%), Gaps = 2/187 (1%)
 Frame = +2

Query  89   AYDNCPKCGTMDVPYPLSTGDSCGNPSYRVYCNNGVLNFLSATGFYYKIQSIDPSASRLI  268
            A D CPKCG M VPYPLST D+CGNP YR+YCNNG L FLSA G YY+I SI+PSA +L+
Sbjct  25   ALDACPKCGNMLVPYPLSTSDNCGNPMYRIYCNNGALEFLSAQGLYYRILSINPSAYKLV  84

Query  269  ISPPVILTNTCMSSDLSLGGLTIDQNSPFNISSRNTVMLLNCSEGIllsplncslsspcr  448
            I PP+I  +TC SSDL++GGL +D+N PFNIS RNTVML NCS+ I L       S+   
Sbjct  85   IRPPLIGKDTCYSSDLAVGGLGLDENLPFNISVRNTVMLFNCSDNI-LLSPLNCSSTSYC  143

Query  449  vfergvgegrgcgDTLCCSYLKDSSMTSHRIRARVGGCSAYTSVVDLNPGDVNFHAWHYG  628
                 + EG GC  TLCC YLKD+SMTSHRIR RVGGC+AYTSVVD+ P D     W+YG
Sbjct  144  RQYEEIEEGSGCKGTLCCHYLKDASMTSHRIRIRVGGCTAYTSVVDIKPVD-PVDKWNYG  202

Query  629  IELQWIP  649
            IELQW+P
Sbjct  203  IELQWMP  209



>ref|XP_011036916.1| PREDICTED: wall-associated receptor kinase-like 20 [Populus euphratica]
Length=203

 Score =   218 bits (555),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 116/187 (62%), Positives = 140/187 (75%), Gaps = 2/187 (1%)
 Frame = +2

Query  89   AYDNCPKCGTMDVPYPLSTGDSCGNPSYRVYCNNGVLNFLSATGFYYKIQSIDPSASRLI  268
            A D CPKCG M+VPYPLST D+CGNP YR+YCN+G L F SA GFYY+I SI+PSA +L+
Sbjct  17   ALDVCPKCGNMEVPYPLSTSDNCGNPRYRIYCNSGALEFSSAQGFYYRILSINPSARKLV  76

Query  269  ISPPVILTNTCMSSDLSLGGLTIDQNSPFNISSRNTVMLLNCSEGIllsplncslsspcr  448
            I PP+I+ NTC SSDLSLGGL++++NS FNIS+ NTVML NCS+ I L       S+   
Sbjct  77   IRPPLIVKNTCCSSDLSLGGLSLNENSSFNISTHNTVMLFNCSDNI-LLSPLNCSSTSFC  135

Query  449  vfergvgegrgcgDTLCCSYLKDSSMTSHRIRARVGGCSAYTSVVDLNPGDVNFHAWHYG  628
                 VGEG GC  TLCC +LKD++MTSHRIR R GGC+AYTSVVD+ P D     W+YG
Sbjct  136  RQYEEVGEGSGCKGTLCCHFLKDTAMTSHRIRVRAGGCTAYTSVVDIKPDD-PIDRWNYG  194

Query  629  IELQWIP  649
            IELQW+P
Sbjct  195  IELQWLP  201



>ref|XP_002319494.1| hypothetical protein POPTR_0013s01310g [Populus trichocarpa]
 gb|EEE95417.1| hypothetical protein POPTR_0013s01310g [Populus trichocarpa]
Length=203

 Score =   217 bits (553),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 116/187 (62%), Positives = 137/187 (73%), Gaps = 2/187 (1%)
 Frame = +2

Query  89   AYDNCPKCGTMDVPYPLSTGDSCGNPSYRVYCNNGVLNFLSATGFYYKIQSIDPSASRLI  268
            A D CPKCG M VPYPLST D+CGNP YR+YCNNG L FLSA G YY+I SI+PSA +L+
Sbjct  17   ALDACPKCGNMLVPYPLSTSDNCGNPRYRIYCNNGALEFLSAQGLYYRILSINPSAYKLV  76

Query  269  ISPPVILTNTCMSSDLSLGGLTIDQNSPFNISSRNTVMLLNCSEGIllsplncslsspcr  448
            I PP+I  +TC SSDL++GGL +D+N PFNIS RNTVML NCS+ I L       S+   
Sbjct  77   IRPPLIGKDTCYSSDLAVGGLRLDENLPFNISVRNTVMLFNCSDNI-LLSPLNCSSTSYC  135

Query  449  vfergvgegrgcgDTLCCSYLKDSSMTSHRIRARVGGCSAYTSVVDLNPGDVNFHAWHYG  628
                 + EG GC  TLCC +LKD+SMTSHRIR RVGGC+AYTSVVD+ P D     W+YG
Sbjct  136  RQYEEIEEGSGCKGTLCCHFLKDASMTSHRIRVRVGGCTAYTSVVDIKPVD-PVDKWNYG  194

Query  629  IELQWIP  649
            IELQW+P
Sbjct  195  IELQWMP  201



>ref|XP_010024103.1| PREDICTED: wall-associated receptor kinase-like 15 [Eucalyptus 
grandis]
 gb|KCW60534.1| hypothetical protein EUGRSUZ_H03274 [Eucalyptus grandis]
Length=204

 Score =   214 bits (546),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 121/182 (66%), Positives = 149/182 (82%), Gaps = 1/182 (1%)
 Frame = +2

Query  101  CPKCGTMDVPYPLSTGDSCGNPSYRVYCNNGVLNFLSATGFYYKIQSIDPSASRLIISPP  280
            CPKCG+M+VPYPLST DSCG+P Y+VYC NG L FLSA G YY++ SIDPSA +L+ISPP
Sbjct  21   CPKCGSMEVPYPLSTDDSCGDPRYKVYCKNGGLEFLSAGGTYYEVLSIDPSADKLVISPP  80

Query  281  VILTNTCMSSDLSLGGLTIDQNSPFNISSRNTVMLLNCSEGIllsplncslsspcrvfer  460
            +I +NTC SSDLS+GGL++D+  PFNIS+ NTV+LLNCS+ + LSPLNCS +S CR +E 
Sbjct  81   MIRSNTCNSSDLSVGGLSLDEKLPFNISTHNTVILLNCSDSLQLSPLNCSSNSFCRAYEN  140

Query  461  gvgegrgcgDTLCCSYLKDSSMTSHRIRARVGGCSAYTSVVDLNPGDVNFHAWHYGIELQ  640
             V E RGC +TLCC YLKDS+MTSHRIR RV GC+AYTSVV++ P D    +W+YGIELQ
Sbjct  141  NVVEARGCRNTLCCHYLKDSAMTSHRIRIRVEGCTAYTSVVNIKPDDP-VGSWNYGIELQ  199

Query  641  WI  646
            W+
Sbjct  200  WV  201



>ref|XP_010024105.1| PREDICTED: wall-associated receptor kinase-like 20 [Eucalyptus 
grandis]
Length=204

 Score =   213 bits (543),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 123/182 (68%), Positives = 148/182 (81%), Gaps = 1/182 (1%)
 Frame = +2

Query  101  CPKCGTMDVPYPLSTGDSCGNPSYRVYCNNGVLNFLSATGFYYKIQSIDPSASRLIISPP  280
            CPKCG+M+VPYPLST DSCG+P Y+VYC NG L FLSA G YY++ SIDPSA +LIISPP
Sbjct  21   CPKCGSMEVPYPLSTDDSCGDPRYKVYCKNGGLEFLSAGGTYYEVLSIDPSADKLIISPP  80

Query  281  VILTNTCMSSDLSLGGLTIDQNSPFNISSRNTVMLLNCSEGIllsplncslsspcrvfer  460
            +I  NTC SSDLS+GGL++D+N PFNIS+ NTV+LLNCS  ILLSPLNCS +S CR +E 
Sbjct  81   MIQNNTCYSSDLSVGGLSLDENLPFNISTHNTVILLNCSCNILLSPLNCSSNSFCRTYED  140

Query  461  gvgegrgcgDTLCCSYLKDSSMTSHRIRARVGGCSAYTSVVDLNPGDVNFHAWHYGIELQ  640
               E RGC +TLCC YLKDS+MTSHRIR R GGC+AYTSVV++ P +    +W+YGIELQ
Sbjct  141  NAVEARGCRNTLCCHYLKDSAMTSHRIRIRDGGCTAYTSVVNIEPSN-PVGSWNYGIELQ  199

Query  641  WI  646
            W+
Sbjct  200  WV  201



>gb|KGN60973.1| hypothetical protein Csa_2G033280 [Cucumis sativus]
Length=210

 Score =   212 bits (539),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 117/188 (62%), Positives = 145/188 (77%), Gaps = 1/188 (1%)
 Frame = +2

Query  86   IAYDNCPKCGTMDVPYPLSTGDSCGNPSYRVYCNNGVLNFLSATGFYYKIQSIDPSASRL  265
            IA+  C KCG ++VPYPLST D+CG+  Y+V+CN+ +L F S+ GFYY I SIDP+A +L
Sbjct  22   IAFSACSKCGNLEVPYPLSTNDNCGDSRYKVHCNDDILQFKSSEGFYYNIHSIDPNAYKL  81

Query  266  IISPPVILTNTCMSSDLSLGGLTIDQNSPFNISSRNTVMLLNCSEGIllsplncslsspc  445
            IISPP I    C SSDLSLGGL +D+N PFN+S+ NTVMLLNCS  ++ SPLNCS++SPC
Sbjct  82   IISPPEIQNGRCFSSDLSLGGLRLDENLPFNVSTHNTVMLLNCSNNLINSPLNCSINSPC  141

Query  446  rvfergvgegrgcgDTLCCSYLKDSSMTSHRIRARVGGCSAYTSVVDLNPGDVNFHAWHY  625
            R FE  + E  GC +TLCC+YLKDS+MT+H IR R+GGC+AYTSVV+  PGD     W Y
Sbjct  142  RQFEEKMIEASGCKNTLCCTYLKDSAMTAHMIRVRIGGCTAYTSVVNFKPGDP-VETWKY  200

Query  626  GIELQWIP  649
            GIELQWIP
Sbjct  201  GIELQWIP  208



>ref|XP_009759572.1| PREDICTED: wall-associated receptor kinase-like 20 [Nicotiana 
sylvestris]
Length=200

 Score =   211 bits (537),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 117/186 (63%), Positives = 135/186 (73%), Gaps = 5/186 (3%)
 Frame = +2

Query  89   AYDNCPKCGTMDVPYPLSTGDSCGNPSYRVYCNNGVLNFLSATGFYYKIQSIDPSASRLI  268
            A   CPKCG MDVP PLST D CGNPSYR++C NG L FLSA G YYKI SI+P+A RLI
Sbjct  17   AILECPKCGIMDVPDPLSTSDKCGNPSYRIHCKNGSLEFLSAEGIYYKILSINPNAFRLI  76

Query  269  ISPPVILTNTCMSSDLSLGGLTIDQNSPFNISSRNTVMLLNCSEGIllsplncslsspcr  448
            IS  ++  +TC S DLS+GGL ID+NSPFNISSRNTVMLLNCSE I    L+    S   
Sbjct  77   IS-SLMQKDTCHSLDLSVGGLRIDENSPFNISSRNTVMLLNCSERI---LLSPLNCSLNS  132

Query  449  vfergvgegrgcgDTLCCSYLKDSSMTSHRIRARVGGCSAYTSVVDLNPGDVNFHAWHYG  628
               +   E + C DT+CCSYLK +S TSHRIR RVGGC+AYTSVVDL  GD   +AW YG
Sbjct  133  PCRKFENEFKDCRDTVCCSYLKVASKTSHRIRVRVGGCTAYTSVVDLKAGD-PINAWKYG  191

Query  629  IELQWI  646
            +ELQW+
Sbjct  192  VELQWL  197



>ref|XP_004494561.1| PREDICTED: wall-associated receptor kinase-like 20-like [Cicer 
arietinum]
Length=215

 Score =   202 bits (513),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 116/183 (63%), Positives = 139/183 (76%), Gaps = 1/183 (1%)
 Frame = +2

Query  101  CPKCGTMDVPYPLSTGDSCGNPSYRVYCNNGVLNFLSATGFYYKIQSIDPSASRLIISPP  280
            C  CG   VPYPLST D CG+  Y++YCNN  L FLS TG YYKI  IDPSA++L+I PP
Sbjct  32   CSNCGDFGVPYPLSTNDDCGDKRYKLYCNNDSLEFLSRTGTYYKILKIDPSANKLVIKPP  91

Query  281  VILTNTCMSSDLSLGGLTIDQNSPFNISSRNTVMLLNCSEGIllsplncslsspcrvfer  460
            +IL NTC SSDL+ GGL +D++SPFNIS+ NTVMLLNCS  IL SPLNCS +S CR FE 
Sbjct  92   IILKNTCYSSDLTGGGLQLDESSPFNISTLNTVMLLNCSHNILQSPLNCSSNSICRQFEE  151

Query  461  gvgegrgcgDTLCCSYLKDSSMTSHRIRARVGGCSAYTSVVDLNPGDVNFHAWHYGIELQ  640
             V EG GC  TLCC +LKDS+M SH+IR +VG C+AYTS+VD  P + +F  W+YGIELQ
Sbjct  152  KVEEGSGCMGTLCCHFLKDSAMNSHKIRLKVGSCTAYTSLVDFKPNE-SFKTWNYGIELQ  210

Query  641  WIP  649
            W+P
Sbjct  211  WLP  213



>gb|KHN43328.1| Wall-associated receptor kinase-like 20 [Glycine soja]
Length=207

 Score =   197 bits (501),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 115/186 (62%), Positives = 137/186 (74%), Gaps = 1/186 (1%)
 Frame = +2

Query  89   AYDNCPKCGTMDVPYPLSTGDSCGNPSYRVYCNNGVLNFLSATGFYYKIQSIDPSASRLI  268
             +  C  CG   VPYPLST + CG+  Y+VYCN+G L FLSATG YYKI  IDPSA++L+
Sbjct  20   TFSACSNCGDFVVPYPLSTNEDCGDNRYKVYCNDGNLEFLSATGTYYKILRIDPSANKLV  79

Query  269  ISPPVILTNTCMSSDLSLGGLTIDQNSPFNISSRNTVMLLNCSEGIllsplncslsspcr  448
            ISPP IL NTC SSDL +GGL +D++ PFNIS++NTVML NCS  IL SPLNCS +S CR
Sbjct  80   ISPPPILKNTCYSSDLYMGGLLLDESLPFNISTQNTVMLFNCSYNILQSPLNCSSNSICR  139

Query  449  vfergvgegrgcgDTLCCSYLKDSSMTSHRIRARVGGCSAYTSVVDLNPGDVNFHAWHYG  628
             FE  V EG GC DTLCC YLKDS+M SH+IR +VG C+AYT +V   P D     W+YG
Sbjct  140  QFEEKVEEGTGCMDTLCCHYLKDSAMNSHKIRVKVGSCTAYTCLVGFKPND-QLETWNYG  198

Query  629  IELQWI  646
            IELQW+
Sbjct  199  IELQWL  204



>ref|XP_007208515.1| hypothetical protein PRUPE_ppa026258mg [Prunus persica]
 gb|EMJ09714.1| hypothetical protein PRUPE_ppa026258mg [Prunus persica]
Length=207

 Score =   195 bits (495),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 111/196 (57%), Positives = 139/196 (71%), Gaps = 10/196 (5%)
 Frame = +2

Query  89   AYDNCPKCGTMDVPYPLSTGDSCGNPSYRVYCN-----NGVLNFLSATGFYYKIQSIDPS  253
            A  +CPKCG ++VPYP ST D+CG+  Y++YCN     NG+L F SA GFYYKI SIDPS
Sbjct  11   ALGSCPKCGNVEVPYPFSTDDTCGDSRYKIYCNNSNNGNGILEFKSAEGFYYKILSIDPS  70

Query  254  ASRLIISPPVILT--NTCMSSDLSLGGLTIDQNSPFNISSRNTVMLLNCSEGIllsplnc  427
            A RLIISPP ++   +TC +SD SL GL +D++ PFN+S+RNTV+LLNCS+ +L SPLNC
Sbjct  71   AQRLIISPPDLVQDGDTCQTSDFSLQGLRLDEHLPFNVSTRNTVILLNCSDNLLRSPLNC  130

Query  428  slss--pcrvfergvgegrgcgDTLCCSYLKDSSMTSHRIRARVGGCSAYTSVVDLNPGD  601
            + +S       +   G+   C   LCC YLKDS MTS+ IR RVGGC+AYTSVVD+ P D
Sbjct  131  TSNSLCRVFQDKLLEGKNNACKGGLCCHYLKDSHMTSYVIRVRVGGCTAYTSVVDIRPED  190

Query  602  VNFHAWHYGIELQWIP  649
                 W YGIELQW+P
Sbjct  191  P-VEKWSYGIELQWLP  205



>ref|XP_003626184.1| Wall-associated receptor kinase-like protein [Medicago truncatula]
 gb|AES82402.1| wall-associated receptor kinase-like protein [Medicago truncatula]
Length=205

 Score =   194 bits (492),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 115/183 (63%), Positives = 134/183 (73%), Gaps = 1/183 (1%)
 Frame = +2

Query  101  CPKCGTMDVPYPLSTGDSCGNPSYRVYCNNGVLNFLSATGFYYKIQSIDPSASRLIISPP  280
            C  CG  +VPYPLST D CG+  Y++YCNN  L FLSATG YYKI  ID SA++L+I PP
Sbjct  22   CSNCGDFEVPYPLSTNDDCGDKRYKIYCNNDSLEFLSATGTYYKILKIDTSANKLVIKPP  81

Query  281  VILTNTCMSSDLSLGGLTIDQNSPFNISSRNTVMLLNCSEGIllsplncslsspcrvfer  460
             I  +TC SSDL  GGL +D++ PFNIS+ NTVMLLNCS+ IL SPLNCS +S CR FE 
Sbjct  82   NIFKHTCYSSDLIGGGLVLDESLPFNISTLNTVMLLNCSDNILQSPLNCSSNSICRQFEE  141

Query  461  gvgegrgcgDTLCCSYLKDSSMTSHRIRARVGGCSAYTSVVDLNPGDVNFHAWHYGIELQ  640
             V EG GC +TLCC YLKDS M SH+IR RVG C+AYT +VD  P D  F  W+YGIELQ
Sbjct  142  KVEEGNGCMNTLCCHYLKDSVMNSHKIRLRVGSCTAYTCLVDFKP-DEPFKKWNYGIELQ  200

Query  641  WIP  649
            W P
Sbjct  201  WKP  203



>ref|XP_008245685.1| PREDICTED: wall-associated receptor kinase-like 20 [Prunus mume]
Length=217

 Score =   191 bits (484),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 106/196 (54%), Positives = 134/196 (68%), Gaps = 10/196 (5%)
 Frame = +2

Query  89   AYDNCPKCGTMDVPYPLSTGDSCGNPSYRVYCN-----NGVLNFLSATGFYYKIQSIDPS  253
            A  +CPKCG ++VPYP ST D+CG+  Y++YCN     NG+L F SA GFYYKI SIDPS
Sbjct  21   ALGSCPKCGNVEVPYPFSTDDTCGDSRYKIYCNNSNNGNGILEFKSAEGFYYKILSIDPS  80

Query  254  ASRLIISPPVIL--TNTCMSSDLSLGGLTIDQNSPFNISSRNTVMLLNCSEGIllspl--  421
            A RLIISPP ++  ++TC +SD  L GL +D++ PFN+S+RNTV+LLNCS+ +L SPL  
Sbjct  81   AQRLIISPPDLVQDSDTCQTSDFPLQGLRLDEHLPFNVSTRNTVILLNCSDNLLRSPLNC  140

Query  422  ncslsspcrvfergvgegrgcgDTLCCSYLKDSSMTSHRIRARVGGCSAYTSVVDLNPGD  601
              +        +   G+   C   LCC YLKDS MTS+ IR R GGC+AYTSVVD+ P D
Sbjct  141  TSNSLCRVFQDKILEGKNNACKGGLCCHYLKDSHMTSYVIRVRPGGCTAYTSVVDIRPED  200

Query  602  VNFHAWHYGIELQWIP  649
                 W YGIELQW+P
Sbjct  201  P-VEKWSYGIELQWLP  215



>ref|XP_008797226.1| PREDICTED: wall-associated receptor kinase-like 20 [Phoenix dactylifera]
Length=207

 Score =   189 bits (480),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 103/184 (56%), Positives = 126/184 (68%), Gaps = 2/184 (1%)
 Frame = +2

Query  98   NCPKCGTMDVPYPLSTGDSCGNPSYRVYCNNGVLNFLSATGFYYKIQSIDPSASRLIISP  277
            +CP CG  ++PYPLST  +CG+P Y++YCNN  L FLS  G  + + SI+P A RLII  
Sbjct  23   DCPPCGGTEIPYPLSTSSNCGDPDYKLYCNNNSLEFLSVGGTPHPVLSINPEAYRLIIHV  82

Query  278  PVILTNTCMSSDLSLGGLTIDQNSPFNISSRNTVMLLNCSEGIllsplncslsspcrvfe  457
            P I  N C SSDL  GGL ID++SPFNIS+RNTVML +C+E I L       S+      
Sbjct  83   PAIDMNVCSSSDLFEGGLKIDESSPFNISNRNTVMLFDCNETI-LFSPLNCSSNSLCRKF  141

Query  458  rgvgegrgcgDTLCCSYLKDSSMTSHRIRARVGGCSAYTSVVDLNPGDVNFHAWHYGIEL  637
                EG  C DTLCC+YLKDS MTSHRIR RVGGC+AYTSVVD++P D     W++GIEL
Sbjct  142  EETEEGSACRDTLCCTYLKDSRMTSHRIRIRVGGCTAYTSVVDIDPNDPP-SLWNFGIEL  200

Query  638  QWIP  649
            QW+P
Sbjct  201  QWLP  204



>ref|XP_010106705.1| Wall-associated receptor kinase-like 20 [Morus notabilis]
 gb|EXC11337.1| Wall-associated receptor kinase-like 20 [Morus notabilis]
Length=216

 Score =   186 bits (473),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 115/186 (62%), Positives = 137/186 (74%), Gaps = 4/186 (2%)
 Frame = +2

Query  101  CPKCGTMDVPYPLSTGDSCGNPSYRVYCNN--GVLNFLSATGFYYKIQSIDPSASRLIIS  274
            CPKCG+++VPYP ST  +CG+P Y++YCNN    L F SA GF+YKI SI+ S ++LII+
Sbjct  29   CPKCGSVEVPYPFSTDGNCGDPRYKIYCNNTTNTLEFPSAEGFHYKILSINTSTNKLIIN  88

Query  275  PPVIL-TNTCMSSDLSLGGLTIDQNSPFNISSRNTVMLLNCSEGIllsplncslsspcrv  451
            PP +  T +C SSD  L GL +D  SPFNISS NTVMLLNCS+ +L SPLNCS SS CR 
Sbjct  89   PPTLQETTSCYSSDFPLQGLRLDDRSPFNISSHNTVMLLNCSDNLLCSPLNCSSSSLCRQ  148

Query  452  fergvgegrgcgDTLCCSYLKDSSMTSHRIRARVGGCSAYTSVVDLNPGDVNFHAWHYGI  631
            FE  + EG GC  TLCC YLKDSSM SH IR R GGC+AYTSVVD+ P D     W+YGI
Sbjct  149  FEDQMEEGSGCRGTLCCHYLKDSSMNSHFIRLRYGGCTAYTSVVDVQPSDP-VDKWNYGI  207

Query  632  ELQWIP  649
            ELQW+P
Sbjct  208  ELQWLP  213



>ref|XP_009338254.1| PREDICTED: wall-associated receptor kinase-like 20 [Pyrus x bretschneideri]
Length=216

 Score =   184 bits (467),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 101/188 (54%), Positives = 128/188 (68%), Gaps = 6/188 (3%)
 Frame = +2

Query  101  CPKCGTMDVPYPLSTGDSCGNPSYRVYC-NNGVLNFLSATGFYYKIQSIDPSASRLIISP  277
            CPKCG M+VPYP ST D+CG+  Y++YC NNGVL F SA GF Y + SID +A +LII P
Sbjct  28   CPKCGNMEVPYPFSTDDTCGDSRYKLYCNNNGVLEFQSAEGFGYNVLSIDLAAQKLIIKP  87

Query  278  PVILT--NTCMSSDLSLGGLTIDQNSPFNISSRNTVMLLNCSEGIllspl--ncslsspc  445
            P ++   + C ++D S  GL +D+N PFN+S+RNTV+LLNCS+ +L SPL  + +     
Sbjct  88   PDLVQDDDMCRTTDFSSEGLRLDENLPFNVSTRNTVILLNCSDNLLRSPLNCSSNSLCRV  147

Query  446  rvfergvgegrgcgDTLCCSYLKDSSMTSHRIRARVGGCSAYTSVVDLNPGDVNFHAWHY  625
               +   G    C   LCC YLKDS MTSH IR RVGGC+AYTSVVD+ P D     W+Y
Sbjct  148  FEDKMLEGRNNACKSRLCCHYLKDSHMTSHMIRVRVGGCTAYTSVVDIQPQDPA-DKWNY  206

Query  626  GIELQWIP  649
            GIELQW+P
Sbjct  207  GIELQWMP  214



>ref|XP_008370615.1| PREDICTED: wall-associated receptor kinase-like 20 [Malus domestica]
Length=295

 Score =   186 bits (471),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 102/192 (53%), Positives = 130/192 (68%), Gaps = 6/192 (3%)
 Frame = +2

Query  89   AYDNCPKCGTMDVPYPLSTGDSCGNPSYRVYC-NNGVLNFLSATGFYYKIQSIDPSASRL  265
            A D CPKCG M+VPYP ST D+CG+ SY++YC NNGVL F SA GF YK+ SID +  +L
Sbjct  103  ALDACPKCGNMEVPYPFSTDDTCGDSSYKLYCNNNGVLEFQSAEGFGYKVLSIDLATQKL  162

Query  266  IISPPVILT--NTCMSSDLSLGGLTIDQNSPFNISSRNTVMLLNCSEGIllspl--ncsl  433
            II PP ++   + C ++D S  GL +D+N PFN+S+RNTV+LLNCS+ +L SPL  + + 
Sbjct  163  IIKPPDLVQDDDMCRTTDFSSEGLRLDENLPFNVSTRNTVILLNCSDNLLRSPLNCSSNS  222

Query  434  sspcrvfergvgegrgcgDTLCCSYLKDSSMTSHRIRARVGGCSAYTSVVDLNPGDVNFH  613
                   +   G    C   LCC YLKDS MTS+ IR RVGGC+AYT VVD+ P D    
Sbjct  223  LCRVFEDKMLEGRNNACKSRLCCHYLKDSHMTSYMIRVRVGGCTAYTCVVDIQPQDPA-D  281

Query  614  AWHYGIELQWIP  649
             W+YGIELQW+P
Sbjct  282  KWNYGIELQWMP  293



>emb|CAN74506.1| hypothetical protein VITISV_015890 [Vitis vinifera]
Length=173

 Score =   179 bits (455),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 96/187 (51%), Positives = 112/187 (60%), Gaps = 38/187 (20%)
 Frame = +2

Query  89   AYDNCPKCGTMDVPYPLSTGDSCGNPSYRVYCNNGVLNFLSATGFYYKIQSIDPSASRLI  268
            A + CP CG+M VPYPLST D+CGNP YRVYCNNG L FLSA  F+Y+I SI+PSA + I
Sbjct  23   ALEACPNCGSMQVPYPLSTNDNCGNPRYRVYCNNGSLEFLSAQNFFYQILSINPSAYKFI  82

Query  269  ISPPVILTNTCMSSDLSLGGLTIDQNSPFNISSRNTVMLLNCSEGIllsplncslsspcr  448
            I PP+I  NTC SSDL +G     Q       S                           
Sbjct  83   IRPPLIQKNTCYSSDLDVGVSPCRQFEKVEAES---------------------------  115

Query  449  vfergvgegrgcgDTLCCSYLKDSSMTSHRIRARVGGCSAYTSVVDLNPGDVNFHAWHYG  628
                      GC DTLCCS+LKDS+MTSHRIR RVGGC+AYTSVVD +P D    +W+YG
Sbjct  116  ----------GCIDTLCCSFLKDSAMTSHRIRVRVGGCTAYTSVVDFDP-DRTVESWNYG  164

Query  629  IELQWIP  649
            IELQW+P
Sbjct  165  IELQWVP  171



>ref|XP_006840476.1| hypothetical protein AMTR_s00045p00185470 [Amborella trichopoda]
 gb|ERN02151.1| hypothetical protein AMTR_s00045p00185470 [Amborella trichopoda]
Length=210

 Score =   180 bits (456),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 102/185 (55%), Positives = 120/185 (65%), Gaps = 5/185 (3%)
 Frame = +2

Query  98   NCPKCGTMDVPYPLSTGDSCGNPSYRVYCNNGVLNFLSATGFYYKIQSIDPSASRLIISP  277
             CP CG   VPYPLST  SCGNP+Y ++C+   L FLS T   Y++QSIDP   RLIISP
Sbjct  31   QCPNCGYTPVPYPLSTHPSCGNPNYPLHCSQNTLFFLSPTNNLYRVQSIDPLTQRLIISP  90

Query  278  PVILTNTCMSSDLSLGGLTIDQNSPFNISSRNTVMLLNCSEGIllsplncslsspcrvfe  457
            P    N+C S DL+ GGL +D++ PFNISSRNTVML NCS  I    L   L+   +   
Sbjct  91   PAFEPNSCRSLDLASGGLLLDESLPFNISSRNTVMLFNCSSNI----LLSPLNCSAQSPC  146

Query  458  rgvgegrgcgDTLCCSYLKDSSMTSHRIRARVGGCSAYTSVVDLNPGDVNFHAWHYGIEL  637
            R   EG  C   LCCSYLKD+SMTSHRIR R GGC+AYTSVV    G +    W +G+EL
Sbjct  147  RIFEEGGECDGLLCCSYLKDASMTSHRIRVRDGGCTAYTSVVAFREG-LGIENWEFGVEL  205

Query  638  QWIPL  652
            QW PL
Sbjct  206  QWAPL  210



>ref|XP_007163343.1| hypothetical protein PHAVU_001G226900g [Phaseolus vulgaris]
 gb|ESW35337.1| hypothetical protein PHAVU_001G226900g [Phaseolus vulgaris]
Length=206

 Score =   172 bits (437),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 107/184 (58%), Positives = 138/184 (75%), Gaps = 1/184 (1%)
 Frame = +2

Query  95   DNCPKCGTMDVPYPLSTGDSCGNPSYRVYCNNGVLNFLSATGFYYKIQSIDPSASRLIIS  274
            ++C  CG   VPYPLST ++CG+  Y++YCN+  L FLSATG YYKI  IDPSA++L+I 
Sbjct  21   NSCSNCGDFVVPYPLSTNENCGDKRYKIYCNDEELEFLSATGTYYKILRIDPSANKLVIR  80

Query  275  PPVILTNTCMSSDLSLGGLTIDQNSPFNISSRNTVMLLNCSEGIllsplncslsspcrvf  454
            PP+IL NTC SSDL +GGL +D++ PFNIS+ NTV+L NC+  IL SPLNC+ +S CR F
Sbjct  81   PPLILKNTCYSSDLLMGGLLLDESLPFNISTHNTVLLFNCTSNILQSPLNCTSNSICRQF  140

Query  455  ergvgegrgcgDTLCCSYLKDSSMTSHRIRARVGGCSAYTSVVDLNPGDVNFHAWHYGIE  634
            E+ V EG GC +TLCC YLKDS+M SH+IR R+G C++YT +V   P D     W+YGIE
Sbjct  141  EKNVEEGSGCMNTLCCHYLKDSAMNSHKIRVRIGSCTSYTCLVGFTPDDP-LETWNYGIE  199

Query  635  LQWI  646
            LQW+
Sbjct  200  LQWL  203



>ref|XP_004304876.1| PREDICTED: wall-associated receptor kinase-like 20-like [Fragaria 
vesca subsp. vesca]
Length=184

 Score =   151 bits (381),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 99/168 (59%), Positives = 118/168 (70%), Gaps = 10/168 (6%)
 Frame = +2

Query  164  PSYRVYCNNG-VLNFLSATGFYYKIQSIDPSASRLIISPPVIL-----TNTCMSSDLSLG  325
            P Y++YCNN   L F+SA GF YKI S D S ++LII PP +L     T TC SSD S  
Sbjct  16   PRYKIYCNNANELQFMSAKGFKYKILSFDLSVNKLIILPPDLLVLNDNTPTCYSSDFSSQ  75

Query  326  GLTIDQNSPFNISSRNTVMLLNCSEGIllsplncslsspcrvfergvgegrgcgDTLCCS  505
            GLT+D+  PFNIS+RNTVML NCS+ +L SPLNCS SS CR FE  +   RG   TLCC 
Sbjct  76   GLTLDEQLPFNISTRNTVMLFNCSDNLLRSPLNCSSSSFCRQFEDKIEACRG---TLCCH  132

Query  506  YLKDSSMTSHRIRARVGGCSAYTSVVDLNPGDVNFHAWHYGIELQWIP  649
            +LKDS MTS+ IR R+GGC+AYTSVVD+ P D     W+YGIELQW+P
Sbjct  133  FLKDSRMTSYMIRVRLGGCTAYTSVVDIQPDD-PVDNWNYGIELQWLP  179



>ref|XP_004309382.1| PREDICTED: wall-associated receptor kinase-like 20-like [Fragaria 
vesca subsp. vesca]
Length=192

 Score =   142 bits (358),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 80/158 (51%), Positives = 101/158 (64%), Gaps = 9/158 (6%)
 Frame = +2

Query  101  CPKCGTMDVPYPLSTGDSCGNPSYRVYCNNG-VLNFLSATGFYYKIQSIDPSASRLIISP  277
            CPKCG+++VPYP ST  SCG+P Y++YCNN   L F+SA GF YKI S D S ++LII P
Sbjct  37   CPKCGSLEVPYPFSTDASCGDPRYKIYCNNANELQFMSAKGFKYKILSFDLSVNKLIILP  96

Query  278  PVIL-----TNTCMSSDLSLGGLTIDQNSPFNISSRNTVMLLNCSEGIllsplncslssp  442
            P +L     T TC SSD S  GLT+D+  PFNIS+RNTVML NCS+ +     +    S 
Sbjct  97   PDLLVLNDNTPTCYSSDFSSQGLTLDEQLPFNISTRNTVMLFNCSDNL---LRSPLNCSS  153

Query  443  crvfergvgegrgcgDTLCCSYLKDSSMTSHRIRARVG  556
                 +   +   C  TLCC +LKDS MTS+ IR R+G
Sbjct  154  SSFCRQFEDKIEACRGTLCCHFLKDSRMTSYMIRVRLG  191



>ref|XP_011085014.1| PREDICTED: wall-associated receptor kinase-like 20 [Sesamum indicum]
Length=623

 Score =   134 bits (338),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 87/183 (48%), Positives = 118/183 (64%), Gaps = 3/183 (2%)
 Frame = +2

Query  101  CPKCGTMDVPYPLSTGDSCGNPSYRVYCNNGVLNFLSATGFYYKIQSIDPSASRLIISPP  280
            CP CG+  VPYPLST  +CG+PSYR+ C +G L F S+    Y I SI PS  RLI++P 
Sbjct  27   CPSCGSTSVPYPLSTAPNCGDPSYRIRCVSGTLLFDSSNN-SYPITSISPSNQRLIVAPS  85

Query  281  VILTNTCMSSDLSLGGLTIDQNSPFNISSRNTVMLLNCSEGIllsplncslsspcrvfer  460
              L NTC+++DL   GL ++ ++PFNI+S NT+  LNCS+ IL SPLNC+ +S C ++  
Sbjct  86   SFLPNTCIAADLPSNGLQLNSSAPFNITSSNTIFYLNCSDTILNSPLNCTSNSLCHLYVN  145

Query  461  gvgegrgcgDTLCCSYLKDSSMTSHRIRARVGGCSAYTSVVDLNPGDVNFHAW-HYGIEL  637
            G      CG+T CC++    S TS+RIR R  GC AY S V+L+ G +    W   G+EL
Sbjct  146  GTNSASDCGNTPCCAFRAGGSTTSYRIRVRQDGCRAYRSFVNLDYG-LPVSRWPQPGVEL  204

Query  638  QWI  646
            QW+
Sbjct  205  QWV  207



>gb|KDO69182.1| hypothetical protein CISIN_1g043291mg, partial [Citrus sinensis]
Length=256

 Score =   129 bits (323),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 84/184 (46%), Positives = 119/184 (65%), Gaps = 4/184 (2%)
 Frame = +2

Query  101  CPKCGTMDVPYPLSTGDSCGNPSYRVYCNN-GVLNFLSATGFYYKIQSIDPSASRLIISP  277
            CP CGT  VPYPLST  SCG+  Y++ C++ G L+F +     Y I +I+PS+ RL+I P
Sbjct  27   CPNCGTTPVPYPLSTSSSCGDQDYKIRCDSSGNLHFDTLNN-SYPITAINPSSQRLVIKP  85

Query  278  PVILTNTCMSSDLSLGGLTIDQNSPFNISSRNTVMLLNCSEGIllsplncslsspcrvfe  457
              +L NTC++SDL   G+ ++ + PFNI+S NT+M +NC+  +L SPLNC+ SS C V+ 
Sbjct  86   SSLLPNTCITSDLMSQGIRLNDSLPFNITSSNTIMYMNCTPTLLSSPLNCTSSSLCHVYI  145

Query  458  rgvgegrgcgDTLCCSYLKDSSMTSHRIRARVGGCSAYTSVVDLNPGDVNFHAW-HYGIE  634
             G      C D +CC++    S TS+ IR R  GC AYTS V+LNP ++  + W   G+E
Sbjct  146  NGTSNAAPCEDGICCTFRAGGSSTSYMIRVRQSGCRAYTSFVNLNP-NLPLNRWGEPGLE  204

Query  635  LQWI  646
            LQW+
Sbjct  205  LQWL  208



>ref|XP_007026926.1| Kinase superfamily protein, putative [Theobroma cacao]
 gb|EOY07428.1| Kinase superfamily protein, putative [Theobroma cacao]
Length=657

 Score =   131 bits (330),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 77/194 (40%), Positives = 104/194 (54%), Gaps = 10/194 (5%)
 Frame = +2

Query  86   IAYDNCPKCGTMDVPYPLSTGDSCGNPSYRVYCNNGVLNFLSATGFYYKIQSIDPSASRL  265
            +A   CP CG M VPYPLSTG  CG+P Y+V CN G L      G  Y I SI+P    L
Sbjct  19   MALKLCPNCGRMSVPYPLSTGPDCGDPWYKVRCNAGTLRLDGLNGSSYMITSINPMTQTL  78

Query  266  IISPPVILTNTCMSSDLSLGGLTIDQNSPFNISSRNTVMLLNCSEGIllsplncslsspc  445
            II PP    NTCM++D    G+ +D N PFNI+S NTVM++NCS  +L      + SS  
Sbjct  79   IIRPPGFAQNTCMAADFGSQGIQLDSNLPFNITSTNTVMIMNCSIAVLQEYAALNCSSTS  138

Query  446  rvfergvgegrgcgD----TLCCSYLKDSSMTSHRIRARVGGCSAYTSVVDLNPGDVNFH  613
               +   G            +CC ++   ++ +HRIR R   CSAY S V+L   D+N  
Sbjct  139  ICHDYIKGNQEARAKCRALPVCCWFVTGGTVHAHRIRVRPERCSAYQSFVNL---DMNLP  195

Query  614  AWHY---GIELQWI  646
               +   G+E++W+
Sbjct  196  VSKWPAPGLEIEWL  209



>ref|XP_010095005.1| Wall-associated receptor kinase-like 20 [Morus notabilis]
 gb|EXC41462.1| Wall-associated receptor kinase-like 20 [Morus notabilis]
Length=202

 Score =   124 bits (312),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 61/105 (58%), Positives = 78/105 (74%), Gaps = 3/105 (3%)
 Frame = +2

Query  101  CPKCGTMDVPYPLSTGDSCGNPSYRVYCNN--GVLNFLSATGFYYKIQSIDPSASRLIIS  274
            CPKCG+++VPYP ST  +CG+P Y++YCNN    L F SA GF+YKI SI+ S ++LII+
Sbjct  29   CPKCGSVEVPYPFSTDGNCGDPRYKIYCNNTTNTLEFPSAEGFHYKILSINTSTNKLIIN  88

Query  275  PPVIL-TNTCMSSDLSLGGLTIDQNSPFNISSRNTVMLLNCSEGI  406
            PP +  T +C SSD  L GL +D  SPFNISS NTVMLLNCS+ +
Sbjct  89   PPTLQETTSCYSSDFPLQGLRLDDRSPFNISSHNTVMLLNCSDNL  133



>ref|XP_009343916.1| PREDICTED: wall-associated receptor kinase-like 20 [Pyrus x bretschneideri]
Length=621

 Score =   130 bits (326),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 81/183 (44%), Positives = 117/183 (64%), Gaps = 3/183 (2%)
 Frame = +2

Query  98   NCPKCGTMDVPYPLSTGDSCGNPSYRVYCNNGVLNFLSATGFYYKIQSIDPSASRLIISP  277
             CP CGT  VPYPLST  +CG+ SY++ C+ G L F +     Y I+S+ P++ RL++ P
Sbjct  26   RCPDCGTTTVPYPLSTSSTCGDQSYKIRCSAGSLLFDTLNN-SYPIESVSPASQRLVLRP  84

Query  278  PVILTNTCMSSDLSLGGLTIDQNSPFNISSRNTVMLLNCSEGIllsplncslsspcrvfe  457
               L NTC+++D+   GL +  + PFN++S NT++ LNC++ +L SPLNC+ SS C  + 
Sbjct  85   SAFLPNTCIATDIIHEGLQLSNSLPFNVTSSNTILYLNCTDTLLRSPLNCTASSLCHTYI  144

Query  458  rgvgegrgcgDTLCCSYLKDSSMTSHRIRARVGGCSAYTSVVDLNPGDVNFHAW-HYGIE  634
             G G    C ++LCC++    S TS+ IR R  GCSAYTS V+L+PG +    W   G+E
Sbjct  145  NGTGSVGSCKESLCCTFRAGGSSTSYMIRVRDSGCSAYTSFVNLDPG-LPVDRWPEPGVE  203

Query  635  LQW  643
            LQW
Sbjct  204  LQW  206



>gb|EPS68579.1| hypothetical protein M569_06189 [Genlisea aurea]
Length=676

 Score =   130 bits (326),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 84/187 (45%), Positives = 112/187 (60%), Gaps = 1/187 (1%)
 Frame = +2

Query  86   IAYDNCPKCGTMDVPYPLSTGDSCGNPSYRVYCNNGVLNFLSATGFYYKIQSIDPSASRL  265
             ++  CP CG++ VPYPLST   CG+PSY + C+ G L F SA    Y I S+ P+  RL
Sbjct  57   FSFPACPSCGSVAVPYPLSTAAECGDPSYGLRCSGGNLLFDSANN-SYPITSVSPNIQRL  115

Query  266  IISPPVILTNTCMSSDLSLGGLTIDQNSPFNISSRNTVMLLNCSEGIllsplncslsspc  445
             I+P   + NTC+S+DL   GL +D  +PFNI+  NT+M LNCS+ IL SPLNC+ +S C
Sbjct  116  TIAPSNFVPNTCVSADLPFNGLQLDPAAPFNITGSNTIMYLNCSDEILNSPLNCTSTSLC  175

Query  446  rvfergvgegrgcgDTLCCSYLKDSSMTSHRIRARVGGCSAYTSVVDLNPGDVNFHAWHY  625
             V+         CG T CC++    S TS+RIR R  GC AY S V+L+ G         
Sbjct  176  HVYVNATSSASACGTTPCCAFRAGGSTTSYRIRVRPQGCKAYLSFVNLDYGAPVSQWPAP  235

Query  626  GIELQWI  646
             +EL+WI
Sbjct  236  AVELEWI  242



>emb|CAN68735.1| hypothetical protein VITISV_037016 [Vitis vinifera]
Length=254

 Score =   124 bits (312),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 77/189 (41%), Positives = 110/189 (58%), Gaps = 4/189 (2%)
 Frame = +2

Query  86   IAYDNCPKCGTMDVPYPLSTGDSCGNPSYRVYCNNGVLNFLSATGFYYKIQSIDPSASRL  265
            ++ + CP CGT  VPYPLSTG  CG+  Y++ C+ G L F S     Y I  I P   RL
Sbjct  19   MSANRCPDCGTTPVPYPLSTGADCGDQEYKIRCDEGKLIFDSVNS-SYSIAFISPETQRL  77

Query  266  IISPPVILTNTCMSSDLSLGGLTIDQNSPFNISSRNTVMLLNCSEGIllsplncslsspc  445
            +I P     +TC+++D    G+ ++ + PFN++S NT+M LNC+E +  SPLNCS  S C
Sbjct  78   VIRPASFAGDTCITTDFPKQGIQLNNSLPFNVTSSNTIMFLNCTESLFRSPLNCSSISLC  137

Query  446  rvfergvgegrgcgDT-LCCSYLKDSSMTSHRIRARVGGCSAYTSVVDLNPGDVNFHAW-  619
              +  G  +   C D  +CC++    S T++ IR R  GCSAY S V+L+P +     W 
Sbjct  138  HTYINGTQDAAACVDAPICCTFKAGGSTTAYSIRVRESGCSAYXSFVNLDP-NAPLDRWP  196

Query  620  HYGIELQWI  646
              G+ELQW+
Sbjct  197  EPGVELQWV  205



>ref|XP_003530225.1| PREDICTED: wall-associated receptor kinase-like 15-like [Glycine 
max]
Length=648

 Score =   128 bits (321),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 80/187 (43%), Positives = 105/187 (56%), Gaps = 7/187 (4%)
 Frame = +2

Query  89   AYDNCPKCGTMDVPYPLSTGDSCGNPSYRVYCNNGVLNFLSATGFYYKIQSIDPSASRLI  268
            A+  CP CG   VPYPLST  +CG+PSY++ C  G L F S  GF Y I +I+P+  R I
Sbjct  25   AFKRCPTCGQTRVPYPLSTAPNCGDPSYKIRCTGGTLFFDSINGFSYAITAINPTTQRFI  84

Query  269  ISPPVILTNTCMSSDLSLGGLTIDQNSPFNISSRNTVMLLNCSEGIllsplncslsspcr  448
            + P   L NTCMS+D    G+ +D NSPFNI+S NTV+LLNCS  +  +P NCSLSS C 
Sbjct  85   LHPSGFLNNTCMSTDFPNKGIWLDTNSPFNITSSNTVVLLNCSNNVFTTPRNCSLSSICH  144

Query  449  vfergvgegrg------cgDTLCCSYLKDSSMTSHRIRARVGGCSAYTSVVDLNPGDVNF  610
             + +                  CC      S+T++RIR R   CSAY S  +L+P  +  
Sbjct  145  KYVKENDVAAKICGPRSHAPQTCCHIKTGGSVTAYRIRVRKERCSAYFSFPNLDP-SLPV  203

Query  611  HAWHYGI  631
              W  G+
Sbjct  204  SMWRPGV  210



>ref|XP_006486417.1| PREDICTED: wall-associated receptor kinase-like 20-like [Citrus 
sinensis]
Length=631

 Score =   127 bits (320),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 83/185 (45%), Positives = 119/185 (64%), Gaps = 4/185 (2%)
 Frame = +2

Query  98   NCPKCGTMDVPYPLSTGDSCGNPSYRVYCNN-GVLNFLSATGFYYKIQSIDPSASRLIIS  274
             CP CGT  VPYPLST  SCG+  Y++ C++ G L+F +     Y I +I+PS+ RL+I 
Sbjct  26   RCPNCGTTPVPYPLSTSSSCGDQDYKIRCDSSGNLHFDTLNN-SYPITAINPSSQRLVIK  84

Query  275  PPVILTNTCMSSDLSLGGLTIDQNSPFNISSRNTVMLLNCSEGIllsplncslsspcrvf  454
            P  +L N+C++SDL   G+ ++ + PFNI+S NT+M +NC+  +L SPLNC+ SS C V+
Sbjct  85   PSSLLPNSCVTSDLMSQGIRLNDSLPFNITSSNTIMYMNCTPTLLSSPLNCTSSSLCHVY  144

Query  455  ergvgegrgcgDTLCCSYLKDSSMTSHRIRARVGGCSAYTSVVDLNPGDVNFHAW-HYGI  631
              G      C D +CC++    S TS+ IR R  GC AYTS V+LNP ++  + W   G+
Sbjct  145  INGTSNAAPCEDGICCTFRAGGSSTSYMIRVRQSGCRAYTSFVNLNP-NLPLNRWGEPGL  203

Query  632  ELQWI  646
            ELQW+
Sbjct  204  ELQWL  208



>ref|XP_006435611.1| hypothetical protein CICLE_v10030949mg [Citrus clementina]
 gb|ESR48851.1| hypothetical protein CICLE_v10030949mg [Citrus clementina]
Length=631

 Score =   127 bits (320),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 83/185 (45%), Positives = 119/185 (64%), Gaps = 4/185 (2%)
 Frame = +2

Query  98   NCPKCGTMDVPYPLSTGDSCGNPSYRVYCNN-GVLNFLSATGFYYKIQSIDPSASRLIIS  274
             CP CGT  VPYPLST  SCG+  Y++ C++ G L+F +     Y I +I+PS+ RL+I 
Sbjct  26   RCPNCGTTPVPYPLSTSSSCGDQDYKIRCDSSGNLHFDTLNN-SYPITAINPSSQRLVIK  84

Query  275  PPVILTNTCMSSDLSLGGLTIDQNSPFNISSRNTVMLLNCSEGIllsplncslsspcrvf  454
            P  +L N+C++SDL   G+ ++ + PFNI+S NT+M +NC+  +L SPLNC+ SS C V+
Sbjct  85   PSSLLPNSCVTSDLMSQGIRLNDSLPFNITSSNTIMYMNCTPTLLSSPLNCTSSSLCHVY  144

Query  455  ergvgegrgcgDTLCCSYLKDSSMTSHRIRARVGGCSAYTSVVDLNPGDVNFHAW-HYGI  631
              G      C D +CC++    S TS+ IR R  GC AYTS V+LNP ++  + W   G+
Sbjct  145  INGTSNAAPCEDGICCTFRAGGSSTSYMIRVRQSGCRAYTSFVNLNP-NLPLNRWGEPGL  203

Query  632  ELQWI  646
            ELQW+
Sbjct  204  ELQWL  208



>ref|XP_010273912.1| PREDICTED: wall-associated receptor kinase-like 20 [Nelumbo nucifera]
Length=639

 Score =   127 bits (320),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 79/187 (42%), Positives = 110/187 (59%), Gaps = 3/187 (2%)
 Frame = +2

Query  89   AYDNCPKCGTMDVPYPLSTGDSCGNPSYRVYCNNGVLNFLSATGFYYKIQSIDPSASRLI  268
            A  +C  CGT  VPYPLSTG  CG+ SY++ C++G L F +  G  Y I SI+P   R +
Sbjct  25   ASKHCGDCGTTTVPYPLSTGPDCGDQSYKIRCDSGTLRFDTLNGSSYTILSINPEVQRFV  84

Query  269  ISPPVILTNTCMSSDLSLGGLTIDQNSPFNISSRNTVMLLNCSEGIllsplncslsspcr  448
            ISPP    N+C+++D+   G+ ++ + PFNISS NTV+ LNCS+  L S LNCS  S C 
Sbjct  85   ISPPSFAGNSCVTTDIRSHGIQLNSSLPFNISSSNTVLYLNCSDLALQSTLNCSSRSLCH  144

Query  449  vfergvgegrgcgDT-LCCSYLKDSSMTSHRIRARVGGCSAYTSVVDLNPGDVNFHAW-H  622
             +         C D  +CC++    S  S+ IR R GGC AY S V+L+   ++   W  
Sbjct  145  TYINDTAAAAPCVDAPICCTFRTGGSTNSYMIRVREGGCRAYRSFVNLD-ASLSVSRWPQ  203

Query  623  YGIELQW  643
             G+E+QW
Sbjct  204  PGLEIQW  210



>ref|XP_002311189.2| hypothetical protein POPTR_0008s06030g [Populus trichocarpa]
 gb|EEE88556.2| hypothetical protein POPTR_0008s06030g [Populus trichocarpa]
Length=628

 Score =   127 bits (319),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 78/185 (42%), Positives = 110/185 (59%), Gaps = 4/185 (2%)
 Frame = +2

Query  98   NCPKCGTMDVPYPLSTGDSCGNPSYRVYCNNGVLNFLSATGFYYKIQSIDPSASRLIISP  277
            NCP CGT  VPYP ST  +CG+P Y++ CN+G L F       Y + SI+PS  RL+I P
Sbjct  27   NCPNCGTTPVPYPFSTAPACGDPQYKIRCNSGTLLF-DTLNSSYPVMSINPSIQRLVIQP  85

Query  278  PVILTNTCMSSDLSLGGLTIDQNSPFNISSRNTVMLLNCSEGIllspln-cslsspcrvf  454
              +L NTC++SD    G++++++ PFNI+S NT+M LNC+E +L SPLN  S S      
Sbjct  86   ASLLPNTCVTSDYIYEGISLNESLPFNITSDNTIMFLNCTESLLRSPLNCTSTSLCHVYV  145

Query  455  ergvgegrgcgDTLCCSYLKDSSMTSHRIRARVGGCSAYTSVVDLNPGDVNFHAW-HYGI  631
                GE       +CC++    S T+HRI  R  GC AYTS VDL+   +    W + G+
Sbjct  146  NSTKGEAPCQAAPICCTFRAGGSSTAHRIMVRDTGCRAYTSFVDLD-SVLPVDKWSNPGL  204

Query  632  ELQWI  646
             ++W+
Sbjct  205  AIEWV  209



>ref|XP_010262629.1| PREDICTED: wall-associated receptor kinase-like 20 [Nelumbo nucifera]
Length=306

 Score =   123 bits (308),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 80/188 (43%), Positives = 112/188 (60%), Gaps = 3/188 (2%)
 Frame = +2

Query  86   IAYDNCPKCGTMDVPYPLSTGDSCGNPSYRVYCNNGVLNFLSATGFYYKIQSIDPSASRL  265
            +A   CP CGT  VPYPLST   CG+ SY++ C +G L F +  G  Y I SI P   RL
Sbjct  68   MATKRCPDCGTTPVPYPLSTETDCGDQSYKIRCVSGTLLFDALNGSSYTITSISPENQRL  127

Query  266  IISPPVILTNTCMSSDLSLGGLTIDQNSPFNISSRNTVMLLNCSEGIllsplncslsspc  445
            +ISP     NTC+++D+   GL ++ + PFNI+S NT+M LNC++ +L SPL+CS +S C
Sbjct  128  VISPASFAGNTCVTTDIVSEGLHLNSSLPFNITSSNTIMYLNCTDILLRSPLDCSSTSLC  187

Query  446  rvfergvgegrgcgDT-LCCSYLKDSSMTSHRIRARVGGCSAYTSVVDLNPGDVNFHAW-  619
              +     E   C +  +CCS+    S TS+ IR R  GC AY S V+L+P  +    W 
Sbjct  188  HTYINNTAEAAPCENAPICCSFRTGGSTTSYMIRVRDAGCRAYRSFVNLDPS-LPVSRWP  246

Query  620  HYGIELQW  643
              G+E++W
Sbjct  247  QPGLEMEW  254



>ref|XP_011034941.1| PREDICTED: wall-associated receptor kinase-like 20 [Populus euphratica]
Length=630

 Score =   126 bits (316),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 78/185 (42%), Positives = 108/185 (58%), Gaps = 4/185 (2%)
 Frame = +2

Query  98   NCPKCGTMDVPYPLSTGDSCGNPSYRVYCNNGVLNFLSATGFYYKIQSIDPSASRLIISP  277
            NCP CGT  VPYP ST  +CG+P Y++ CN+G L F       Y I SI+PS  RL+I P
Sbjct  27   NCPNCGTTPVPYPFSTASTCGDPQYKIRCNSGSLLF-DTLNSSYPIMSINPSIQRLVIQP  85

Query  278  PVILTNTCMSSDLSLGGLTIDQNSPFNISSRNTVMLLNCSEGIllspln-cslsspcrvf  454
              +L NTC++SD    G++++ + PFNI+  NT+M LNC+E +L SPLN  S S      
Sbjct  86   ASLLPNTCVTSDYIYEGISLNDSLPFNITGDNTIMFLNCTESLLRSPLNCTSTSLCHVYV  145

Query  455  ergvgegrgcgDTLCCSYLKDSSMTSHRIRARVGGCSAYTSVVDLNPGDVNFHAW-HYGI  631
                G        +CC++    S T+HRIR R  GC AYTS VDL+   +    W + G+
Sbjct  146  NSTKGGAPCQAAPICCTFGAGGSSTAHRIRVRDTGCRAYTSFVDLD-SVLPVDKWSNPGL  204

Query  632  ELQWI  646
             ++W+
Sbjct  205  AIKWV  209



>ref|XP_004142196.1| PREDICTED: wall-associated receptor kinase-like 20-like [Cucumis 
sativus]
 ref|XP_004166563.1| PREDICTED: wall-associated receptor kinase-like 20-like [Cucumis 
sativus]
 gb|KGN54277.1| hypothetical protein Csa_4G296300 [Cucumis sativus]
Length=639

 Score =   126 bits (316),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 83/186 (45%), Positives = 100/186 (54%), Gaps = 4/186 (2%)
 Frame = +2

Query  101  CPKCGTMDVPYPLSTGDSCGNPSYRVYCNNGVLNFLSATGFYYKIQSIDPSASRLIISPP  280
            CP CG   VPYPLST   CG+P YRV C    L F SA G  Y I S++  A +LII PP
Sbjct  26   CPDCGRTPVPYPLSTRPDCGDPLYRVRCAAAELWFESANGSSYLITSVNSVARKLIIRPP  85

Query  281  VILTNTCMSSDLSLGGLTIDQNSPFNISSRNTVMLLNCSEGIllsplncslsspcrvfer  460
             +  NTC+SSD    G  +D   PF IS RNTV+L NCS  +L +  NCS +S C  F +
Sbjct  86   GLAKNTCVSSDFRTDGFWLDTRLPFTISDRNTVLLYNCSIEVLENNWNCSHNSVCHDFIK  145

Query  461  gvgegrgcgDTL--CCSYLKDSSMTSHRIRARVGGCSAYTSVVDLNPGDVNFHAW-HYGI  631
                      T   CC Y    S+TS+RIR R   CSAY   V+L  G      W   G+
Sbjct  146  QNPVAMAACKTAPTCCWYTSGGSLTSYRIRVRKERCSAYECFVNLG-GSAPAKKWPEPGV  204

Query  632  ELQWIP  649
            E+QW P
Sbjct  205  EIQWAP  210



>ref|XP_010658664.1| PREDICTED: wall-associated receptor kinase-like 20 [Vitis vinifera]
 emb|CBI31618.3| unnamed protein product [Vitis vinifera]
Length=254

 Score =   120 bits (301),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 76/189 (40%), Positives = 109/189 (58%), Gaps = 4/189 (2%)
 Frame = +2

Query  86   IAYDNCPKCGTMDVPYPLSTGDSCGNPSYRVYCNNGVLNFLSATGFYYKIQSIDPSASRL  265
            ++ + CP CGT  VPYPLSTG  CG+  Y++  + G L F S     Y I  I P   RL
Sbjct  19   MSANRCPDCGTTPVPYPLSTGADCGDQEYKIRFDEGKLIFDSVNS-SYSIAFISPETQRL  77

Query  266  IISPPVILTNTCMSSDLSLGGLTIDQNSPFNISSRNTVMLLNCSEGIllsplncslsspc  445
            +I P     +TC+++D    G+ ++ + PFN++S NT+M LNC+E +  SPLNCS  S C
Sbjct  78   VIRPASFAGDTCITTDFPKQGIQLNNSLPFNVTSSNTIMFLNCTESLFRSPLNCSSISLC  137

Query  446  rvfergvgegrgcgDT-LCCSYLKDSSMTSHRIRARVGGCSAYTSVVDLNPGDVNFHAW-  619
              +  G  +   C D  +CC++    S T++ IR R  GCSAY S V+L+P +     W 
Sbjct  138  HTYINGTQDAAACVDAPICCTFKAGGSTTAYSIRVRESGCSAYQSFVNLDP-NAPLDRWP  196

Query  620  HYGIELQWI  646
              G+ELQW+
Sbjct  197  EPGVELQWV  205



>ref|XP_002524225.1| kinase, putative [Ricinus communis]
 gb|EEF38149.1| kinase, putative [Ricinus communis]
Length=637

 Score =   124 bits (311),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 83/187 (44%), Positives = 111/187 (59%), Gaps = 7/187 (4%)
 Frame = +2

Query  98   NCPKCGTMDVPYPLSTGDSCGNPSYRVYCNNGVLNFLSATGFYYKIQSIDPSASRLIISP  277
             CP CG M VPYPLSTG +CG+ SY++ CN   L F +     Y I SID S  RL+I P
Sbjct  31   QCPNCGNMSVPYPLSTGPTCGDQSYKITCNASTLVFDTVNN-SYPIISIDQSTQRLVIQP  89

Query  278  PVILTNTCMSSDLSLGGLTIDQNSPFNISSRNTVMLLNCSEGIllsplncslsspcrvfe  457
              I+ NTCM SD    G+ ++ + PFNI+S NTVML+NCSE IL  PL+CS +S C ++ 
Sbjct  90   ADIIPNTCMVSDYIHQGIQLNSSLPFNITSSNTVMLMNCSESILDQPLDCSATSLCHLYA  149

Query  458  rgvgegrg---cgDTLCCSYLKDSSMTSHRIRAR-VGGCSAYTSVVDLNPGDVNFHAWHY  625
                  +       +LCC+Y    S +++RIR R  GGC AY   V+L+  D+    W  
Sbjct  150  NSTRGRQESPCADFSLCCTYKAGGSPSAYRIRIREAGGCRAYKIFVNLDT-DLPVDRWQD  208

Query  626  -GIELQW  643
             G+E+QW
Sbjct  209  PGLEIQW  215



>ref|XP_006493572.1| PREDICTED: wall-associated receptor kinase-like 20-like [Citrus 
sinensis]
Length=641

 Score =   124 bits (311),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 74/189 (39%), Positives = 107/189 (57%), Gaps = 3/189 (2%)
 Frame = +2

Query  86   IAYDNCPKCGTMDVPYPLSTGDSCGNPSYRVYCNNGVLNFLSATGFYYKIQSIDPSASRL  265
            +A   C  CG   VPYPLSTG +CG+ SY++ C  G+L F +  G  Y I SI+P + R+
Sbjct  23   LAVLRCGNCGPTPVPYPLSTGPNCGHQSYKIRCAAGILWFDARNGSSYMIASINPLSQRI  82

Query  266  IISPPVILTNTCMSSDLSLGGLTIDQNSPFNISSRNTVMLLNCSEGIllsplncslsspc  445
            II PP    +TC ++D+   G+ +D N PFNI+S NT+MLLNC++ +L   +  + SS C
Sbjct  83   IIRPPGPAGSTCTATDMRTQGIQLDDNLPFNITSSNTIMLLNCTDAMLNLQVPINCSSNC  142

Query  446  rvfergvgegr--gcgDTLCCSYLKDSSMTSHRIRARVGGCSAYTSVVDLNPGDVNFHAW  619
                    +        +LCC +    S T++ IR   GGC+AY S V+L+   V    W
Sbjct  143  ICHSYIKDKAPPCMTASSLCCVFKTGGSQTAYTIRVHNGGCTAYQSFVNLDANWVPGKTW  202

Query  620  -HYGIELQW  643
               G+EL+W
Sbjct  203  PEPGMELEW  211



>ref|XP_006429169.1| hypothetical protein CICLE_v10013620mg [Citrus clementina]
 gb|ESR42409.1| hypothetical protein CICLE_v10013620mg [Citrus clementina]
Length=641

 Score =   124 bits (311),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 74/189 (39%), Positives = 107/189 (57%), Gaps = 3/189 (2%)
 Frame = +2

Query  86   IAYDNCPKCGTMDVPYPLSTGDSCGNPSYRVYCNNGVLNFLSATGFYYKIQSIDPSASRL  265
            +A   C  CG   VPYPLSTG +CG+ SY++ C  G+L F +  G  Y I SI+P + R+
Sbjct  23   LAVLRCGNCGPTPVPYPLSTGPNCGHQSYKIRCAAGILWFDARNGSSYMIASINPLSQRI  82

Query  266  IISPPVILTNTCMSSDLSLGGLTIDQNSPFNISSRNTVMLLNCSEGIllsplncslsspc  445
            II PP    +TC ++D+   G+ +D N PFNI+S NT+MLLNC++ +L   +  + SS C
Sbjct  83   IIRPPGPAGSTCTATDMRTQGIQLDDNLPFNITSSNTIMLLNCTDAMLNLQVPINCSSNC  142

Query  446  rvfergvgegr--gcgDTLCCSYLKDSSMTSHRIRARVGGCSAYTSVVDLNPGDVNFHAW  619
                    +        +LCC +    S T++ IR   GGC+AY S V+L+   V    W
Sbjct  143  ICHSYIKDKAPPCMTASSLCCVFKTGGSQTAYTIRVHNGGCTAYQSFVNLDANWVPGKTW  202

Query  620  -HYGIELQW  643
               G+EL+W
Sbjct  203  PEPGMELEW  211



>ref|XP_010262628.1| PREDICTED: wall-associated receptor kinase-like 20 [Nelumbo nucifera]
Length=638

 Score =   124 bits (310),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 78/188 (41%), Positives = 112/188 (60%), Gaps = 3/188 (2%)
 Frame = +2

Query  86   IAYDNCPKCGTMDVPYPLSTGDSCGNPSYRVYCNNGVLNFLSATGFYYKIQSIDPSASRL  265
            +A   CP CG   VPYPLSTG  CG+ SY++ C +  L F +  G  Y I SI P   RL
Sbjct  24   MAAKRCPDCGATPVPYPLSTGTDCGDQSYKIRCASSTLRFDALNGSSYTITSISPGNQRL  83

Query  266  IISPPVILTNTCMSSDLSLGGLTIDQNSPFNISSRNTVMLLNCSEGIllsplncslsspc  445
            +ISP     NTC+++D++  GL ++ + PFN++S NT+M LNCS+ +L SPLNCS +S C
Sbjct  84   VISPASFAGNTCVTTDIASEGLQLNSSLPFNVTSSNTIMYLNCSDTLLRSPLNCSSASLC  143

Query  446  rvfergvgegrgcgDT-LCCSYLKDSSMTSHRIRARVGGCSAYTSVVDLNPGDVNFHAW-  619
              +     E   C +  +CC++    S  S+ I+ R GGC AY S V+L+   +   +W 
Sbjct  144  HTYMNNTAEAAPCENAPICCTFKTGGSTNSYMIKVRDGGCRAYRSFVNLD-ASLPVSSWP  202

Query  620  HYGIELQW  643
              G+E+QW
Sbjct  203  QPGLEMQW  210



>dbj|BAJ97459.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=652

 Score =   123 bits (308),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 84/187 (45%), Positives = 111/187 (59%), Gaps = 8/187 (4%)
 Frame = +2

Query  101  CPKCGTMDVPYPLSTGDSCGNPSYRVYCNNG--VLNFLSATGFYYKIQSIDPSASRLIIS  274
            CP CG+  VPYPLST   CG+P+Y+V C  G   L F +  G  Y I S+ P+  RL++S
Sbjct  36   CPPCGSTAVPYPLSTAAGCGDPAYKVRCAAGTSALFFDALNGTSYPITSVSPAEQRLVVS  95

Query  275  P-PVILTNTCMSSDLSLG-GLTIDQNSPFNISSRNTVMLLNCSEGIllsplncslsspcr  448
            P P++  +TC+S   + G G+ +D + PFN+SS NT+MLLNC+  +L SPLNCS SS C 
Sbjct  96   PAPLVSNDTCVSVGAAAGRGVQLDPSLPFNVSSSNTIMLLNCTSALLRSPLNCSSSSLCH  155

Query  449  vfergvgegrgcgDTLCCSYLKDSSMTSHRIRARVGGCSAYTSVVDLNPGDVNFHAW--H  622
             +             LCC+++   S TSHRIRA    CSAYTS V L+P       W   
Sbjct  156  AYADATASPCAPL-PLCCTFVAGGSSTSHRIRASPELCSAYTSFVGLDPAQPP-ATWGGR  213

Query  623  YGIELQW  643
             G+ELQW
Sbjct  214  LGLELQW  220



>dbj|BAK02037.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=652

 Score =   123 bits (308),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 84/187 (45%), Positives = 111/187 (59%), Gaps = 8/187 (4%)
 Frame = +2

Query  101  CPKCGTMDVPYPLSTGDSCGNPSYRVYCNNG--VLNFLSATGFYYKIQSIDPSASRLIIS  274
            CP CG+  VPYPLST   CG+P+Y+V C  G   L F +  G  Y I S+ P+  RL++S
Sbjct  36   CPPCGSTAVPYPLSTAAGCGDPAYKVRCAAGTSALFFDALNGTSYPITSVSPAEQRLVVS  95

Query  275  P-PVILTNTCMSSDLSLG-GLTIDQNSPFNISSRNTVMLLNCSEGIllsplncslsspcr  448
            P P++  +TC+S   + G G+ +D + PFN+SS NT+MLLNC+  +L SPLNCS SS C 
Sbjct  96   PAPLVSNDTCVSVGAAAGRGVQLDPSLPFNVSSSNTIMLLNCTSALLRSPLNCSSSSLCH  155

Query  449  vfergvgegrgcgDTLCCSYLKDSSMTSHRIRARVGGCSAYTSVVDLNPGDVNFHAW--H  622
             +             LCC+++   S TSHRIRA    CSAYTS V L+P       W   
Sbjct  156  AYADATASPCAPL-PLCCTFVAGGSSTSHRIRASPELCSAYTSFVGLDPAQPP-ATWGGR  213

Query  623  YGIELQW  643
             G+ELQW
Sbjct  214  LGLELQW  220



>dbj|BAJ96779.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=652

 Score =   123 bits (308),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 84/187 (45%), Positives = 111/187 (59%), Gaps = 8/187 (4%)
 Frame = +2

Query  101  CPKCGTMDVPYPLSTGDSCGNPSYRVYCNNG--VLNFLSATGFYYKIQSIDPSASRLIIS  274
            CP CG+  VPYPLST   CG+P+Y+V C  G   L F +  G  Y I S+ P+  RL++S
Sbjct  36   CPPCGSTAVPYPLSTAAGCGDPAYKVRCAAGTSALFFDALNGTSYPITSVSPAEQRLVVS  95

Query  275  P-PVILTNTCMSSDLSLG-GLTIDQNSPFNISSRNTVMLLNCSEGIllsplncslsspcr  448
            P P++  +TC+S   + G G+ +D + PFN+SS NT+MLLNC+  +L SPLNCS SS C 
Sbjct  96   PAPLVSNDTCVSVGAAAGRGVQLDPSLPFNVSSSNTIMLLNCTSALLRSPLNCSSSSLCH  155

Query  449  vfergvgegrgcgDTLCCSYLKDSSMTSHRIRARVGGCSAYTSVVDLNPGDVNFHAW--H  622
             +             LCC+++   S TSHRIRA    CSAYTS V L+P       W   
Sbjct  156  AYADATASPCAPL-PLCCTFVAGGSSTSHRIRASPELCSAYTSFVGLDPAQPP-ATWGGR  213

Query  623  YGIELQW  643
             G+ELQW
Sbjct  214  LGLELQW  220



>ref|XP_008448229.1| PREDICTED: wall-associated receptor kinase-like 20 [Cucumis melo]
Length=638

 Score =   123 bits (308),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 80/186 (43%), Positives = 98/186 (53%), Gaps = 4/186 (2%)
 Frame = +2

Query  101  CPKCGTMDVPYPLSTGDSCGNPSYRVYCNNGVLNFLSATGFYYKIQSIDPSASRLIISPP  280
            CP CG   VPYPLST   CG+P YRV C    L F S  G  Y I S++P A +LII PP
Sbjct  26   CPDCGRTPVPYPLSTSPDCGDPLYRVRCAAAELWFESVNGSSYLITSVNPVARKLIIRPP  85

Query  281  VILTNTCMSSDLSLGGLTIDQNSPFNISSRNTVMLLNCSEGIllsplncslsspcrvfer  460
             +  N+C+SSD    G  +D   PF IS RNTV+L NCS  +L +  NCS  S C  F +
Sbjct  86   GLAKNSCVSSDFGTHGFWLDTRLPFTISERNTVLLYNCSMEVLENNWNCSPDSVCHDFIK  145

Query  461  gvgegrgcgDTL--CCSYLKDSSMTSHRIRARVGGCSAYTSVVDLNPGDVNFHAW-HYGI  631
                          CC Y    S+T++RIR R   CSAY   V+L  G      W   G+
Sbjct  146  QNPVAMAACKAAPTCCWYTSGGSLTAYRIRVRKERCSAYECFVNLG-GSGPAKKWPEPGV  204

Query  632  ELQWIP  649
            E+QW P
Sbjct  205  EIQWAP  210



>ref|XP_007009294.1| Kinase, putative [Theobroma cacao]
 gb|EOY18104.1| Kinase, putative [Theobroma cacao]
Length=631

 Score =   122 bits (306),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 72/189 (38%), Positives = 106/189 (56%), Gaps = 4/189 (2%)
 Frame = +2

Query  86   IAYDNCPKCGTMDVPYPLSTGDSCGNPSYRVYCNNGVLNFLSATGFYYKIQSIDPSASRL  265
            ++   CP CG+  VPYPLSTG +CG+ SY++ C+ G L F +     Y I S++    RL
Sbjct  23   LSAQRCPNCGSTTVPYPLSTGPACGDQSYKIRCDAGSLIFDTLNN-SYPIMSVNHFNQRL  81

Query  266  IISPPVILTNTCMSSDLSLGGLTIDQNSPFNISSRNTVMLLNCSEGIllspln-cslssp  442
            +I P  +L NTC+++DL   G+ ++   PFN++S NT+M LNC++ +L SPL+  S    
Sbjct  82   VIEPASLLPNTCVTTDLPFEGVQLNSTLPFNVTSSNTIMFLNCTDSVLRSPLDCSSTGLC  141

Query  443  crvfergvgegrgcgDTLCCSYLKDSSMTSHRIRARVGGCSAYTSVVDLNPGDVNFHAW-  619
                             +CC++      T+H IR R  GC AYTS V L+ G +  + W 
Sbjct  142  HVYVNDSSNATACEVAPICCTFRAGGGATAHAIRVRESGCRAYTSFVSLDAG-LPVNQWP  200

Query  620  HYGIELQWI  646
              G+ELQWI
Sbjct  201  QPGMELQWI  209



>ref|XP_002282445.1| PREDICTED: wall-associated receptor kinase-like 20 [Vitis vinifera]
Length=629

 Score =   121 bits (303),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 76/189 (40%), Positives = 109/189 (58%), Gaps = 4/189 (2%)
 Frame = +2

Query  86   IAYDNCPKCGTMDVPYPLSTGDSCGNPSYRVYCNNGVLNFLSATGFYYKIQSIDPSASRL  265
            +A + CP CG   VPYPLSTG  CG+  Y++ C+ G L F       Y I SI P   R 
Sbjct  19   MAANRCPDCGNTSVPYPLSTGADCGDQEYKIRCDAGTLRF-DTLNSSYSISSITPQIQRF  77

Query  266  IISPPVILTNTCMSSDLSLGGLTIDQNSPFNISSRNTVMLLNCSEGIllsplncslsspc  445
            +I P     NTC+++DL   G+ ++++ PFN++S NT++ LNC++ +L SPLNCS  S C
Sbjct  78   VIRPASFAGNTCVTTDLPNQGIQLNESLPFNVTSSNTILYLNCTDTLLRSPLNCSSISLC  137

Query  446  rvfergvgegrgcgDT-LCCSYLKDSSMTSHRIRARVGGCSAYTSVVDLNPGDVNFHAW-  619
              +  G  +   C D  +CC++    S TSH IR R  GC AY S V+L+      + W 
Sbjct  138  HTYINGTRDAAACEDAPICCTFKAGGSTTSHSIRVRDAGCRAYRSFVNLD-ASTPVNRWP  196

Query  620  HYGIELQWI  646
              G+E+QW+
Sbjct  197  EPGVEIQWV  205



>emb|CBI31617.3| unnamed protein product [Vitis vinifera]
Length=690

 Score =   120 bits (302),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 76/189 (40%), Positives = 109/189 (58%), Gaps = 4/189 (2%)
 Frame = +2

Query  86   IAYDNCPKCGTMDVPYPLSTGDSCGNPSYRVYCNNGVLNFLSATGFYYKIQSIDPSASRL  265
            +A + CP CG   VPYPLSTG  CG+  Y++ C+ G L F       Y I SI P   R 
Sbjct  19   MAANRCPDCGNTSVPYPLSTGADCGDQEYKIRCDAGTLRF-DTLNSSYSISSITPQIQRF  77

Query  266  IISPPVILTNTCMSSDLSLGGLTIDQNSPFNISSRNTVMLLNCSEGIllsplncslsspc  445
            +I P     NTC+++DL   G+ ++++ PFN++S NT++ LNC++ +L SPLNCS  S C
Sbjct  78   VIRPASFAGNTCVTTDLPNQGIQLNESLPFNVTSSNTILYLNCTDTLLRSPLNCSSISLC  137

Query  446  rvfergvgegrgcgDT-LCCSYLKDSSMTSHRIRARVGGCSAYTSVVDLNPGDVNFHAW-  619
              +  G  +   C D  +CC++    S TSH IR R  GC AY S V+L+      + W 
Sbjct  138  HTYINGTRDAAACEDAPICCTFKAGGSTTSHSIRVRDAGCRAYRSFVNLD-ASTPVNRWP  196

Query  620  HYGIELQWI  646
              G+E+QW+
Sbjct  197  EPGVEIQWV  205



>ref|XP_002873036.1| hypothetical protein ARALYDRAFT_486985 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH49295.1| hypothetical protein ARALYDRAFT_486985 [Arabidopsis lyrata subsp. 
lyrata]
Length=657

 Score =   120 bits (301),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 77/186 (41%), Positives = 112/186 (60%), Gaps = 6/186 (3%)
 Frame = +2

Query  101  CPKCGTMDVPYPLSTGDSCGNPSYRVYCNNGVLNFLSATGFYYKIQSIDPSASRLIISPP  280
            CP CG M VPYPLSTG +CG+ +YR+ C  G L F +  G  Y I SI+    R+++SPP
Sbjct  43   CPNCGPMVVPYPLSTGPNCGDQAYRINCVGGKLYFGALHGSSYVITSINSVTQRIVLSPP  102

Query  281  VILTN-TCMSSDLSLGGLTIDQNSPFNISSRNTVMLLNCSEGIllsplncslsspcrvfe  457
             + ++ +C+S+D+S  GL +D + PF+I+S NT++LLNCS+ +L +P++CS +S C  + 
Sbjct  103  GLASSVSCISADVSKQGLELDPHLPFSITSSNTILLLNCSQAMLQAPIDCSPTSLCYSYI  162

Query  458  rgvgegrgcgDTLCCSYLKDSSMTSHRIRARVGGCSAYTSVVDLNPGDV----NFHAWHY  625
            +           LCC++  D S T++ IR   GGC AY S V LNP              
Sbjct  163  KNNASPCSKA-PLCCTFRTDGSQTAYTIRINSGGCLAYQSFVGLNPNKEVPPPGIKWPDT  221

Query  626  GIELQW  643
            G+ELQW
Sbjct  222  GLELQW  227



>gb|KDP44885.1| hypothetical protein JCGZ_01385 [Jatropha curcas]
Length=638

 Score =   120 bits (300),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 76/186 (41%), Positives = 104/186 (56%), Gaps = 5/186 (3%)
 Frame = +2

Query  95   DNCPKCGTMDVPYPLSTGDSCGNPSYRVYCNNGVLNFLSATGFYYKIQSIDPSASRLIIS  274
            + CP CG   VPYPLST  SCG+ SY++ C+ G L F +     Y I SI+ +  RL+I 
Sbjct  35   NQCPNCGNTAVPYPLSTAPSCGDQSYKIRCDAGALLFDTLNN-SYPIISINQADQRLVIK  93

Query  275  PPVILTNTCMSSDLSLGGLTIDQNSPFNISSRNTVMLLNCSEGIllspl--ncslsspcr  448
            P   L N C+SSD +  G+ ++ + PFNI+S NTV+LLNCSE IL  PL  + +      
Sbjct  94   PANPLPNICISSDFTYQGIQLNSSLPFNITSHNTVLLLNCSESILEQPLDCSPASLCRLY  153

Query  449  vfergvgegrgcgDTLCCSYLKDSSMTSHRIRARVGGCSAYTSVVDLNPGDVNFHAW-HY  625
            V      E      ++CC++    S T HRIR R  GC AY S V+L+   +    W   
Sbjct  154  VNSSRGMESTCKDASICCTFQAGGSPTKHRIRVRDAGCRAYRSFVNLD-SSLPVDKWPDP  212

Query  626  GIELQW  643
            G+E+QW
Sbjct  213  GVEIQW  218



>ref|XP_007206748.1| hypothetical protein PRUPE_ppa025090mg [Prunus persica]
 gb|EMJ07947.1| hypothetical protein PRUPE_ppa025090mg [Prunus persica]
Length=620

 Score =   119 bits (299),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 78/186 (42%), Positives = 101/186 (54%), Gaps = 4/186 (2%)
 Frame = +2

Query  98   NCPKCGTMDVPYPLSTGDSCGNPSYRVYCNNGVLNFLSATGFYYKIQSIDPSASRLIISP  277
            +CP CG M VPYPLST   CGN  Y+V CN GVL   +     Y I SI+P   RLII P
Sbjct  28   HCPDCGHMRVPYPLSTSPDCGNQQYKVRCNAGVLWLDTLNSSSYLITSINPLTQRLIIRP  87

Query  278  PVILTN-TCMSSDLSLGGLTIDQNSPFNISSRNTVMLLNCSEGIllsplncslsspcrvf  454
            P +  N TCM++D    G+ +D N PFNISS NTV+ +NCS  +L    NCS +S C  +
Sbjct  88   PGLANNVTCMAADFKSQGILLDNNLPFNISSGNTVIGMNCSNEMLTLSQNCSSNSLCHDY  147

Query  455  ergvgegrgcgDT--LCCSYLKDSSMTSHRIRARVGGCSAYTSVVDLNPGDVNFHAW-HY  625
             +             LCC Y    S  +++IR R   CSAY S V+L+       +W   
Sbjct  148  VKHNPMAASACRKFPLCCLYKTGGSNNAYKIRVRKERCSAYVSFVNLDTSSGALSSWPEP  207

Query  626  GIELQW  643
            G+E+ W
Sbjct  208  GVEIMW  213



>ref|XP_004137276.1| PREDICTED: wall-associated receptor kinase-like 20-like [Cucumis 
sativus]
Length=265

 Score =   115 bits (289),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 76/185 (41%), Positives = 112/185 (61%), Gaps = 5/185 (3%)
 Frame = +2

Query  101  CPKCGTMDVPYPLSTGDSCGNPSYRVYCNNGVLNFLSATGFYYKIQSIDPSASRLIISPP  280
            CP CG + VPYPLST  +CG+  Y++ C+ G L F +     Y I SI+P   RL+I P 
Sbjct  28   CPDCGGVAVPYPLSTSPTCGDQLYKIRCDAGSLKFDTLNN-TYPILSINPLTQRLVIRPS  86

Query  281  VILTNTCMSSDLSLGGLTIDQNSPFNISSRNTVMLLNCSEGIllsplncslsspcrvfer  460
              + NTC++ D++ GG+ ++ N PFN++S NT++  NC++ +L SPLNCS +S C  + +
Sbjct  87   NFIPNTCVTVDIAHGGIKLNSNLPFNVTSGNTILYFNCTDLLLRSPLNCSSTSLCHSYIK  146

Query  461  gvgegrgcgDT--LCCSYLKDSSMTSHRIRARVGGCSAYTSVVDLNPGDVNFHAW-HYGI  631
            G G      +   LCC++    S  S+ IR R  GC AYTS V+L+P  +    W   G+
Sbjct  147  GSGGEATACEMAPLCCTFRTGGSSNSYMIRVRESGCRAYTSFVNLDP-SLGVGQWPEPGL  205

Query  632  ELQWI  646
            ELQW+
Sbjct  206  ELQWL  210



>ref|XP_006398671.1| hypothetical protein EUTSA_v10012908mg [Eutrema salsugineum]
 gb|ESQ40124.1| hypothetical protein EUTSA_v10012908mg [Eutrema salsugineum]
Length=660

 Score =   119 bits (299),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 73/186 (39%), Positives = 110/186 (59%), Gaps = 5/186 (3%)
 Frame = +2

Query  98   NCPKCGTMDVPYPLSTGDSCGNPSYRVYCNNGVLNFLSATGFYYKIQSIDPSASRLIISP  277
             CP CG   VPYPLSTG SCG+ +Y++YC  G L   +  G  Y I+SI+P   R+++ P
Sbjct  43   RCPNCGPAVVPYPLSTGPSCGDQAYKIYCVAGKLYLGALHGSSYVIKSINPVTQRIVLRP  102

Query  278  PVIL-TNTCMSSDLSLGGLTIDQNSPFNISSRNTVMLLNCSEGIllsplncslsspcrvf  454
            P +  + +C+S+D+S  GL ++ N PF+I+S NT++LL+C E +L +P++C+ +S C  +
Sbjct  103  PGLASSESCLSADVSKAGLELNPNLPFSITSSNTILLLSCPEAMLQAPIDCTGTSLCHSY  162

Query  455  ergvgegrgcgDTLCCSYLKDSSMTSHRIRARVGGCSAYTSVVDLNPGDVNFHAWHY---  625
             +            CC++  D S T++ IR   GGC AY S V LNP         +   
Sbjct  163  VKNNASACSKA-PFCCTFRTDGSQTAYTIRINGGGCLAYQSFVGLNPNKEIPPPGKWPEP  221

Query  626  GIELQW  643
            G+ELQW
Sbjct  222  GLELQW  227



>ref|XP_006289936.1| hypothetical protein CARUB_v10003558mg [Capsella rubella]
 gb|EOA22834.1| hypothetical protein CARUB_v10003558mg [Capsella rubella]
Length=657

 Score =   119 bits (299),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 78/187 (42%), Positives = 113/187 (60%), Gaps = 6/187 (3%)
 Frame = +2

Query  98   NCPKCGTMDVPYPLSTGDSCGNPSYRVYCNNGVLNFLSATGFYYKIQSIDPSASRLIISP  277
             CP CG M VPYPLSTG +CG+ +YR+ C  G L F +  G  Y I SI+    R+I+ P
Sbjct  42   RCPNCGPMVVPYPLSTGPNCGDQTYRINCVGGKLYFGALHGSSYVITSINSVTQRIILHP  101

Query  278  PVILTN-TCMSSDLSLGGLTIDQNSPFNISSRNTVMLLNCSEGIllsplncslsspcrvf  454
            P + ++ +C+S+D+S  GL +D + PF+I+S NT++LLNCS+ +L +P++CS +S C  +
Sbjct  102  PGLASSGSCISADVSKQGLELDPHLPFSITSSNTILLLNCSQAMLQAPIDCSPTSLCYSY  161

Query  455  ergvgegrgcgDTLCCSYLKDSSMTSHRIRARVGGCSAYTSVVDLNPGDV---NFHAW-H  622
             +           LCC++  D S T++ IR   GGC AY S V LNP +        W  
Sbjct  162  IKNNASPCSKA-PLCCTFRTDGSQTAYTIRINGGGCLAYQSFVGLNPSNEIPPPGKKWPD  220

Query  623  YGIELQW  643
             G+ELQW
Sbjct  221  TGLELQW  227



>gb|EYU35241.1| hypothetical protein MIMGU_mgv1a021456mg, partial [Erythranthe 
guttata]
Length=251

 Score =   115 bits (288),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 73/182 (40%), Positives = 102/182 (56%), Gaps = 7/182 (4%)
 Frame = +2

Query  101  CPKCGTMDVPYPLSTGDSCGNPSYRVYCNNGVLNFLSATGFYYKIQSIDPSASRLIISPP  280
            CP CGT  VPYPLST  +CG+ SY++ C  G L F S+    Y I SI PS  RL I+P 
Sbjct  24   CPPCGTTAVPYPLSTAANCGDQSYKIRCVAGKLLFDSSNN-TYPITSISPSIQRLTIAPS  82

Query  281  VILTNTCMSSDLSLGGLTIDQNSPFNISSRNTVMLLNCSEGIllsplncslsspcrvfer  460
             +L N C+++DL   GL ++ + PFN+SS NT++ LNC++ I  +  + + +        
Sbjct  83   PLLPNACVAADLPSNGLQLNPDGPFNVSSGNTILYLNCTQSI--TESHLNCTQASLCHSY  140

Query  461  gvgegrgcgDTLCCSYLKDSSMTSHRIRARVGGCSAYTSVVDLNPGDVNFHAW-HYGIEL  637
                G  C +  CC     S  T  RIR R+ GC AYTS VDL+PG +  + W    + L
Sbjct  141  VNATGGACCNVPCCEL--HSGGTIRRIRMRLSGCRAYTSFVDLDPG-LPVNKWPQPAVAL  197

Query  638  QW  643
            +W
Sbjct  198  RW  199



>ref|NP_001235056.1| protein kinase-related protein precursor [Glycine max]
 gb|ACM89527.1| protein kinase-related protein [Glycine max]
Length=649

 Score =   119 bits (299),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 70/185 (38%), Positives = 106/185 (57%), Gaps = 4/185 (2%)
 Frame = +2

Query  101  CPKCGTMDVPYPLSTGDSCGNPSYRVYCNNGVLNFLSATGFYYKIQSIDPSASRLIISPP  280
            CP CG   VP+PLST  +CG+PSY++ C++            Y I+SIDP++ R +I P 
Sbjct  41   CPPCGNTTVPFPLSTTPTCGDPSYKIRCSSSNTLVFDTLNNSYPIESIDPNSQRFVIRPA  100

Query  281  VILTNTCMSSDLSLGGLTIDQNSPFNISSRNTVMLLNCSEGIllspl--ncslsspcrvf  454
             +LTNTC+S+D    G+ ++   PFNI+S NT++ LNC+  +L SPL  + + +    + 
Sbjct  101  PLLTNTCVSTDKVHQGIQLNTTLPFNITSSNTIVYLNCTTTLLQSPLNCSAASACHSYIK  160

Query  455  ergvgegrgcgDTLCCSYLKDSSMTSHRIRARVGGCSAYTSVVDLNPGDVNFHAW-HYGI  631
                         LCC+Y    S  S+ +R R  GCSAY+S V+LNP  +  + W   G+
Sbjct  161  ATASAAACQGAGPLCCTYRTGGSSNSYMLRVRDSGCSAYSSFVNLNPA-LPVNRWPEPGL  219

Query  632  ELQWI  646
            E+QW+
Sbjct  220  EIQWL  224



>ref|NP_195827.1| WALL-associated receptor kinase-like 20 [Arabidopsis thaliana]
 sp|Q9LZM4.1|WAKLQ_ARATH RecName: Full=Wall-associated receptor kinase-like 20; Flags: 
Precursor [Arabidopsis thaliana]
 emb|CAB82980.1| putative protein kinase [Arabidopsis thaliana]
 gb|AED90428.1| WALL-associated receptor kinase-like 20 [Arabidopsis thaliana]
Length=657

 Score =   119 bits (299),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 77/187 (41%), Positives = 112/187 (60%), Gaps = 6/187 (3%)
 Frame = +2

Query  98   NCPKCGTMDVPYPLSTGDSCGNPSYRVYCNNGVLNFLSATGFYYKIQSIDPSASRLIISP  277
             CP CG M VPYPLSTG +CG+ +YR+ C  G L F +  G  Y I SI+    R+++ P
Sbjct  42   RCPNCGPMVVPYPLSTGPTCGDQAYRINCVGGKLYFGALHGSSYVITSINSVTQRIVLRP  101

Query  278  PVILTN-TCMSSDLSLGGLTIDQNSPFNISSRNTVMLLNCSEGIllsplncslsspcrvf  454
            P + ++ +C+S+D+S  GL +D + PF+I+S NT++LLNCS+ +L +P++CS +S C  +
Sbjct  102  PGLASSVSCISADVSKQGLELDPHLPFSITSSNTILLLNCSQAMLQAPIDCSPTSLCYSY  161

Query  455  ergvgegrgcgDTLCCSYLKDSSMTSHRIRARVGGCSAYTSVVDLNPGDV---NFHAW-H  622
             +           LCC++  D S T++ IR   GGC AY S V LNP          W  
Sbjct  162  IKNNASPCSKA-PLCCTFRTDGSQTAYTIRINGGGCLAYQSFVGLNPNKEVPPPGKKWPD  220

Query  623  YGIELQW  643
             G+ELQW
Sbjct  221  TGLELQW  227



>gb|KGN53721.1| hypothetical protein Csa_4G110080 [Cucumis sativus]
Length=265

 Score =   115 bits (288),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 75/185 (41%), Positives = 110/185 (59%), Gaps = 5/185 (3%)
 Frame = +2

Query  101  CPKCGTMDVPYPLSTGDSCGNPSYRVYCNNGVLNFLSATGFYYKIQSIDPSASRLIISPP  280
            CP CG   VPYPLST  +CG+  Y++ C+ G L F +     Y I SI+P   RL+I P 
Sbjct  28   CPDCGGAAVPYPLSTSPTCGDQLYKIRCDAGSLKFDTLNN-TYPILSINPLTQRLVIRPS  86

Query  281  VILTNTCMSSDLSLGGLTIDQNSPFNISSRNTVMLLNCSEGIllsplncslsspcrvfer  460
              + NTC++ D++ GG+ ++ N PFN++S NT++  NC++ +L SPLNCS +S C  + +
Sbjct  87   NFIPNTCVTVDIAHGGIKLNSNLPFNVTSGNTILYFNCTDLLLRSPLNCSSTSLCHSYIK  146

Query  461  gvgegrgcgD--TLCCSYLKDSSMTSHRIRARVGGCSAYTSVVDLNPGDVNFHAW-HYGI  631
            G        +   LCC++    S  S+ IR R  GC AYTS V+L+P  +    W   G+
Sbjct  147  GSRGEATKCEMAQLCCTFRTGGSSNSYMIRVRESGCRAYTSFVNLDP-SLGVGQWPEPGL  205

Query  632  ELQWI  646
            ELQW+
Sbjct  206  ELQWL  210



>gb|KDP44886.1| hypothetical protein JCGZ_01386 [Jatropha curcas]
Length=628

 Score =   119 bits (298),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 78/184 (42%), Positives = 113/184 (61%), Gaps = 4/184 (2%)
 Frame = +2

Query  101  CPKCGTMDVPYPLSTGDSCGNPSYRVYCNNGVLNFLSATGFYYKIQSIDPSASRLIISPP  280
            CP CG+  VPYP ST  +CG+ SY++ C+ G L F +     Y I SI+PS  RL+I P 
Sbjct  28   CPNCGSTPVPYPFSTSPTCGDQSYKIRCDAGALMFDTLNN-SYPIISINPSIQRLVIRPA  86

Query  281  VILTNTCMSSDLSLGGLTIDQNSPFNISSRNTVMLLNCSEGIllsplncslsspcrvfer  460
             +L NTC++SD    G+ ++ + PFNI+  NT+M LNCS+ +L SPLNCS +S CR++  
Sbjct  87   SLLPNTCVTSDFVHQGIQMNSSLPFNITGDNTIMFLNCSDSLLRSPLNCSSNSLCRLYVN  146

Query  461  gvgegrgcgDT-LCCSYLKDSSMTSHRIRARVGGCSAYTSVVDLNPGDVNFHAW-HYGIE  634
                   C D  +CC++      T++ IR R  GC AYTS V+LNP ++  + W   G+ 
Sbjct  147  NTRAESPCQDAPICCTFGAGGGTTAYTIRVRDSGCKAYTSFVNLNP-NLPVNRWPSPGVS  205

Query  635  LQWI  646
            +QW+
Sbjct  206  VQWM  209



>gb|KHG23448.1| Wall-associated receptor kinase-like 20 [Gossypium arboreum]
Length=629

 Score =   119 bits (297),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 73/189 (39%), Positives = 108/189 (57%), Gaps = 4/189 (2%)
 Frame = +2

Query  86   IAYDNCPKCGTMDVPYPLSTGDSCGNPSYRVYCNNGVLNFLSATGFYYKIQSIDPSASRL  265
            ++ + CP CG+  VPYPLSTG SCG+ +Y++ C+   L F +     Y I SI+    RL
Sbjct  23   VSVNRCPNCGSTAVPYPLSTGPSCGDQNYKIRCDADSLVFDTLNN-TYPITSINRFNQRL  81

Query  266  IISPPVILTNTCMSSDLSLGGLTIDQNSPFNISSRNTVMLLNCSEGIllspln-cslssp  442
            +I P  ++ NTC+++DL   G+ ++ + PFNI+S NTV+ LNC++ IL SPLN  S    
Sbjct  82   VIQPASLVPNTCVTTDLRFEGVQLNSSLPFNITSSNTVLFLNCTDSILRSPLNCSSNGLC  141

Query  443  crvfergvgegrgcgDTLCCSYLKDSSMTSHRIRARVGGCSAYTSVVDLNPGDVNFHAW-  619
                             +CC++      T++ IRAR  GC AYTS V+L   D+  + W 
Sbjct  142  HEYVNESSRAAACEAAPICCTFRAGGGATAYAIRARETGCRAYTSFVNLQ-SDLPVNRWP  200

Query  620  HYGIELQWI  646
              G+ELQW+
Sbjct  201  EPGMELQWV  209



>ref|XP_002271602.1| PREDICTED: wall-associated receptor kinase-like 20 [Vitis vinifera]
 emb|CBI30502.3| unnamed protein product [Vitis vinifera]
Length=636

 Score =   119 bits (297),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 75/184 (41%), Positives = 108/184 (59%), Gaps = 3/184 (2%)
 Frame = +2

Query  98   NCPKCGTMDVPYPLSTGDSCGNPSYRVYCNNGVLNFLSATGFYYKIQSIDPSASRLIISP  277
             C  CG + VPYPLSTG  CG+ SY+V CN G L F + +   Y I SI+P   R+I+ P
Sbjct  27   RCGDCGRIPVPYPLSTGPGCGDQSYKVRCNAGTLWFDALSQSSYVITSINPGTRRMIVKP  86

Query  278  PVILTNTCMSSDLSLGGLTIDQNSPFNISSRNTVMLLNCSEGIllsplncslsspcrvfe  457
              +L NTC+++D+ +GGL +D+ SP+NI S NT+ML+NCS  +L S +NCS +S C  + 
Sbjct  87   ASLLANTCITTDIQVGGLQLDRISPYNIPSSNTIMLMNCSNAVLNSSVNCSPNSICHAYI  146

Query  458  rgvgegrgcgDTL-CCSYLKDSSMTSHRIRARVGGCSAYTSVVDLNPGDVNFHAW-HYGI  631
            R       C  T  CC +     + +++I  R  GC AY S V+L    +    W   G+
Sbjct  147  RENVVAAACRSTAKCCWFKAGGPVNAYKIGVRDEGCMAYQSFVNL-ATSLPVKRWPEPGL  205

Query  632  ELQW  643
            E++W
Sbjct  206  EIEW  209



>emb|CAN69970.1| hypothetical protein VITISV_001450 [Vitis vinifera]
Length=636

 Score =   118 bits (295),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 75/184 (41%), Positives = 107/184 (58%), Gaps = 3/184 (2%)
 Frame = +2

Query  98   NCPKCGTMDVPYPLSTGDSCGNPSYRVYCNNGVLNFLSATGFYYKIQSIDPSASRLIISP  277
             C  CG   VPYPLSTG  CG+ SY+V CN G L F + +   Y I SI+P   R+I+ P
Sbjct  27   RCGDCGRXPVPYPLSTGPGCGDQSYKVRCNAGTLWFDALSQSSYVITSINPGTRRMIVKP  86

Query  278  PVILTNTCMSSDLSLGGLTIDQNSPFNISSRNTVMLLNCSEGIllsplncslsspcrvfe  457
              +L NTC+++D+ +GGL +D+ SP+NI S NT+ML+NCS  +L S +NCS +S C  + 
Sbjct  87   ASLLANTCITTDIQVGGLQLDRISPYNIPSSNTIMLMNCSNAVLNSSVNCSPNSICHAYI  146

Query  458  rgvgegrgcgDTL-CCSYLKDSSMTSHRIRARVGGCSAYTSVVDLNPGDVNFHAW-HYGI  631
            R       C  T  CC +     + +++I  R  GC AY S V+L    +    W   G+
Sbjct  147  RENVAAAACRSTXKCCWFKTGGPVNAYKIGVRDEGCMAYQSFVNL-ATSLPVKRWPEPGL  205

Query  632  ELQW  643
            E++W
Sbjct  206  EIEW  209



>ref|XP_006341199.1| PREDICTED: wall-associated receptor kinase-like 20-like [Solanum 
tuberosum]
Length=614

 Score =   117 bits (294),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 70/185 (38%), Positives = 98/185 (53%), Gaps = 5/185 (3%)
 Frame = +2

Query  101  CPKCGTMDVPYPLSTGDSCGNPSYRVYCNNGVLNFLSATGFYYKIQSIDPSASRLIISPP  280
            C  CG + VPYPLSTG +CG+P Y++ CN G L F +     Y I S+ P   RL+I PP
Sbjct  6    CDNCGKIPVPYPLSTGPNCGDPLYKLRCNAGTLWFDTMKNSSYVISSVTPQIQRLVIKPP  65

Query  281  VILTNTCMSSDLSLGGLTIDQNSPFNISSRNTVMLLNCSEGIllsplncslssp---crv  451
                NTC+SSD    G+ +D N PFNI++ NT++LLNC++ +L      + SS       
Sbjct  66   TSYPNTCLSSDFRSEGIQLDPNLPFNITASNTILLLNCTDYMLHLQAPINCSSSCVCHPY  125

Query  452  fergvgegrgcgDTLCCSYLKDSSMTSHRIRARVGGCSAYTSVVDLNPGDVNFHAW-HYG  628
             E+ +        +LCC++    S   + IR    GC AY S V L+   +    W   G
Sbjct  126  VEKKLEWAACRKQSLCCTFRTGGSQNEYMIRVHSQGCMAYQSFVGLD-SSLPIEKWPQPG  184

Query  629  IELQW  643
            +EL W
Sbjct  185  LELMW  189



>ref|XP_008242431.1| PREDICTED: wall-associated receptor kinase-like 20 [Prunus mume]
Length=629

 Score =   117 bits (294),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 79/194 (41%), Positives = 104/194 (54%), Gaps = 5/194 (3%)
 Frame = +2

Query  98   NCPKCGTMDVPYPLSTGDSCGNPSYRVYCNNGVLNFLSATGFYYKIQSIDPSASRLIISP  277
            +CP CG   VPYPLST   CGN  Y+V CN GVL   +     Y I SI+P   RLII P
Sbjct  16   HCPDCGHTRVPYPLSTSPDCGNQQYKVRCNAGVLWLDTLNSSSYLITSINPLTQRLIIRP  75

Query  278  PVILTN-TCMSSDLSLGGLTIDQNSPFNISSRNTVMLLNCSEGIllsplncslsspcrvf  454
            P +  N TCM++D    G+ +D N PFNISS NTV+ +NCS  +L    NCS +S C  +
Sbjct  76   PGLANNVTCMAADFKSQGILLDNNLPFNISSSNTVIGMNCSNEMLTLSQNCSSNSLCHDY  135

Query  455  ergvgegrgcgDT--LCCSYLKDSSMTSHRIRARVGGCSAYTSVVDLNPGDVNFHAW-HY  625
             +             LCC Y    S  +++IR R   CSAY S V+L+       +W   
Sbjct  136  IKRNPMAASACRKFPLCCLYKTGGSNNAYKIRVRKERCSAYVSFVNLDTSSGALSSWPEP  195

Query  626  GIELQW-IPLT*DC  664
            G+E+ W +P   +C
Sbjct  196  GVEIMWELPQEPEC  209



>ref|XP_010937552.1| PREDICTED: wall-associated receptor kinase-like 20 [Elaeis guineensis]
Length=646

 Score =   117 bits (294),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 78/187 (42%), Positives = 113/187 (60%), Gaps = 6/187 (3%)
 Frame = +2

Query  101  CPKCGTMDVPYPLSTGDSCGNPSYRVYCNNGV--LNFLSATGFYYKIQSIDPSASRLIIS  274
            CP CG+  VP+PLST D CG+P Y++ C+N    L F +  G  Y + SI PS  RL+I 
Sbjct  30   CPSCGSTAVPFPLSTADGCGDPLYKIRCDNTTRSLFFDALNGSSYSVTSIHPSTQRLVIR  89

Query  275  P-PVILTNTCMSSDLSLGGLTIDQNSPFNISSRNTVMLLNCSEGIllsplncslsspcrv  451
            P P    ++C+++DL   G+ ++ + PFN+SS NT+ LLNC+  +LLSPLNCS +S C +
Sbjct  90   PAPFASASSCVTTDLHSQGIILNSSLPFNVSSSNTIFLLNCTSRLLLSPLNCSSNSLCHI  149

Query  452  fergvgegrgcgD-TLCCSYLKDSSMTSHRIRARVGGCSAYTSVVDLNPGDVNFHAW--H  622
            +     +   C   ++CC+++   S TS+ +RA   GCSAY S V+LN        W   
Sbjct  150  YVNATADAAACRPISICCTFVAGGSSTSYAVRASGVGCSAYRSFVNLNAAGTPVAQWGAS  209

Query  623  YGIELQW  643
             G+ELQW
Sbjct  210  SGVELQW  216



>gb|KDP24561.1| hypothetical protein JCGZ_25125 [Jatropha curcas]
Length=616

 Score =   117 bits (292),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 68/193 (35%), Positives = 98/193 (51%), Gaps = 8/193 (4%)
 Frame = +2

Query  86   IAYDNCPKCGTMDVPYPLSTGDSCGNPSYRVYCNNGVLNFLSATGFYYKIQSIDPSASRL  265
            +A   CP CG   VPYP ST  +CG+P Y++ C    L F +  G  Y I SI+P   RL
Sbjct  9    LANRRCPNCGQSPVPYPFSTSPACGDPLYKITCKANALWFNALNGSSYLITSINPLTQRL  68

Query  266  IISPPVILTNTCMSSDLSLGGLTIDQNSPFNISSRNTVMLLNCSEGIllsplncslsspc  445
             I PP    NTCM++D +  G  +D N PFNI+  NTV+++NCS+ +       + SS  
Sbjct  69   TIRPPGFAKNTCMAADFASQGFQLDSNLPFNITGSNTVIIMNCSQLVFEFFSALNCSSTS  128

Query  446  rvfergvgegrgcg------DTLCCSYLKDSSMTSHRIRARVGGCSAYTSVVDLNPGDVN  607
            R  +                + +CC +    S+  ++IR R   CSAY S V+L+  +  
Sbjct  129  RCHDYVKENAVAKAACGAIPEQICCWFKTGGSLNEYKIRVRTERCSAYQSFVNLDL-ESP  187

Query  608  FHAW-HYGIELQW  643
               W   G+EL+W
Sbjct  188  VSKWPEPGLELEW  200



>ref|XP_010105421.1| Wall-associated receptor kinase-like 20 [Morus notabilis]
 gb|EXC04696.1| Wall-associated receptor kinase-like 20 [Morus notabilis]
Length=626

 Score =   117 bits (292),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 76/182 (42%), Positives = 106/182 (58%), Gaps = 2/182 (1%)
 Frame = +2

Query  101  CPKCGTMDVPYPLSTGDSCGNPSYRVYCNNGVLNFLSATGFYYKIQSIDPSASRLIISPP  280
            CP CG+  VPYPLST  +CG+ SY++ CN   L F +     Y I SI     RL+ISP 
Sbjct  26   CPDCGSTTVPYPLSTSPTCGDQSYKIRCNGSKLLFDTLNN-SYPITSISGPTQRLVISPS  84

Query  281  VILTNTCMSSDLSLGGLTIDQNSPFNISSRNTVMLLNCSEGIllsplncslsspcrvfer  460
             +L N C++ D+   G+ ++ + PFN++S NT+  LNCS+ +L SPLNCS +S C  +  
Sbjct  85   PLLQNACVAEDIRHQGIQLNSSLPFNVTSSNTIFYLNCSDSLLRSPLNCSSASLCHSYIN  144

Query  461  gvgegrgcgDTLCCSYLKDSSMTSHRIRARVGGCSAYTSVVDLNPGDVNFHAWHYGIELQ  640
              G        LCC++    S TS+ IR R  GCSAYTS V+L+P          G+E+Q
Sbjct  145  ETGGACEDAQ-LCCTFRAGGSSTSYMIRVRESGCSAYTSFVNLDPARPVGQWTDPGVEIQ  203

Query  641  WI  646
            W+
Sbjct  204  WV  205



>ref|XP_007026925.1| Kinase family protein [Theobroma cacao]
 gb|EOY07427.1| Kinase family protein [Theobroma cacao]
Length=661

 Score =   117 bits (292),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 69/182 (38%), Positives = 101/182 (55%), Gaps = 2/182 (1%)
 Frame = +2

Query  101  CPKCGTMDVPYPLSTGDSCGNPSYRVYCNNGVLNFLSATGFYYKIQSIDPSASRLIISPP  280
            C  CG + VPYPLSTG +CG+ +Y++ C  G L F +  G  Y I SI+P   R+I+ PP
Sbjct  4    CSNCGRIPVPYPLSTGPNCGDQAYKIRCTAGALWFNALKG-SYTITSINPLTQRIILQPP  62

Query  281  VILTNTCMSSDLSLGGLTIDQNSPFNISSRNTVMLLNCSEGIllsplncslsspcrvfer  460
             +   TC+SSD+S  G+ +D N PFNI+S NTV+LLNC+  +L      + +S       
Sbjct  63   SLSGGTCISSDISTQGIQLDDNLPFNITSSNTVLLLNCTNAMLHLQAPINCTSTSICHNY  122

Query  461  gvgegrgcgDT-LCCSYLKDSSMTSHRIRARVGGCSAYTSVVDLNPGDVNFHAWHYGIEL  637
                   C +T LCC +    S T++ +R   GGC AY S V+ +  +        G+E+
Sbjct  123  IKDNAAACMNTPLCCVFKTGGSQTAYVVRIHDGGCLAYQSFVNFDTVNPPKKWPEPGLEI  182

Query  638  QW  643
            +W
Sbjct  183  EW  184



>ref|XP_010490623.1| PREDICTED: wall-associated receptor kinase-like 20 [Camelina 
sativa]
Length=657

 Score =   117 bits (292),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 76/187 (41%), Positives = 110/187 (59%), Gaps = 6/187 (3%)
 Frame = +2

Query  98   NCPKCGTMDVPYPLSTGDSCGNPSYRVYCNNGVLNFLSATGFYYKIQSIDPSASRLIISP  277
            +CP CGTM VPYPLST  +CG+ +YR+ C  G L F +  G  Y I SI+    R+I+ P
Sbjct  42   HCPNCGTMAVPYPLSTAPTCGDQTYRINCVAGKLYFGALHGSSYVITSINSVTQRIILRP  101

Query  278  PVILTN-TCMSSDLSLGGLTIDQNSPFNISSRNTVMLLNCSEGIllsplncslsspcrvf  454
            P + T+ +C+S D+   G  +D + PF+I++ NT++LLNCS+ +L +P++CS +S C  +
Sbjct  102  PGLATSGSCISPDVPKQGFELDPHLPFSITTSNTILLLNCSQAMLQAPIDCSPTSLCYSY  161

Query  455  ergvgegrgcgDTLCCSYLKDSSMTSHRIRARVGGCSAYTSVVDLNPGDV---NFHAW-H  622
             +           LCC++  D S T++ I+   GGC AY S V LNP          W  
Sbjct  162  IKNNASPCSKA-PLCCTFRTDGSQTAYTIKINGGGCLAYQSFVGLNPNKEIPPPGKKWPD  220

Query  623  YGIELQW  643
             GIELQW
Sbjct  221  TGIELQW  227



>gb|KDO48146.1| hypothetical protein CISIN_1g047195mg, partial [Citrus sinensis]
Length=559

 Score =   116 bits (290),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 71/190 (37%), Positives = 99/190 (52%), Gaps = 28/190 (15%)
 Frame = +2

Query  101  CPKCGTMDVPYPLSTGDSCGNPSYRVYCNNGVLNFLSATGFYYKIQSIDPSASRLIISPP  280
            C  CG + VPYPLSTG  CG+ SY+V CN G+L F    G  Y I SI+P +  LII PP
Sbjct  2    CTNCGHIPVPYPLSTGPGCGDQSYKVRCNAGMLWFDGLNGSSYMITSINPLSQSLIIRPP  61

Query  281  VILTNTCMSSDLSLGGLTIDQNSPFNISSRNTVMLLNCSEGIllsplncslsspcrvfer  460
             ++ N C+++D    GL +D N  FNISS NTVM++NCS                   E 
Sbjct  62   GLIKNKCIAADYHGQGLQLDNNLRFNISSSNTVMVMNCS------------------IEM  103

Query  461  gvgegrgcgDTLCCSYLKDS--------SMTSHRIRARVGGCSAYTSVVDLNPGDVNFHA  616
                      ++C SY++D+        S+  +RIR R   C+AY S VDL+   +    
Sbjct  104  LQKPFNCSSTSICHSYIRDNPVAKRTGGSINEYRIRVRAERCAAYQSFVDLDLS-LPVSK  162

Query  617  W-HYGIELQW  643
            W   G++++W
Sbjct  163  WPEPGVKIEW  172



>ref|XP_006429168.1| hypothetical protein CICLE_v10013798mg, partial [Citrus clementina]
 gb|ESR42408.1| hypothetical protein CICLE_v10013798mg, partial [Citrus clementina]
Length=408

 Score =   114 bits (286),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 77/189 (41%), Positives = 106/189 (56%), Gaps = 4/189 (2%)
 Frame = +2

Query  86   IAYDNCPKCGTMDVPYPLSTGDSCGNPSYRVYCNNGVLNFLSATGFYYKIQSIDPSASRL  265
            +A  +C  CG + VPYPLSTG  CG+ SY+V CN G L F +  G  Y I SI+P +  L
Sbjct  20   LALKSCTNCGHIPVPYPLSTGPGCGDQSYKVRCNAGTLWFDALNGSSYIITSINPLSQSL  79

Query  266  IISPPVILTNTCMSSDLSLGGLTIDQNSPFNISSRNTVMLLNCSEGIllsplncslsspc  445
            II PP  + N C+++D    GL +D N  FNISS NT+M++NCS  +L  P NCS +S C
Sbjct  80   IIRPPGRIKNKCIAADYQGQGLQLDNNLRFNISSSNTLMVMNCSIEMLQKPFNCSSTSIC  139

Query  446  rvfergvgegrgcgDTL--CCSYLKDSSMTSHRIRARVGGCSAYTSVVDLNPGDVNFHAW  619
              + R     +     L  CC +    S+  +RIR R   C+AY S VDL+   +    W
Sbjct  140  HSYIRDNPVAKAACGALPVCCWFKTGGSINEYRIRVRAERCAAYQSFVDLDL-SLPVSKW  198

Query  620  -HYGIELQW  643
               G++ +W
Sbjct  199  PEPGVKTEW  207



>ref|XP_010424819.1| PREDICTED: wall-associated receptor kinase-like 20 [Camelina 
sativa]
Length=278

 Score =   112 bits (281),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 74/187 (40%), Positives = 109/187 (58%), Gaps = 6/187 (3%)
 Frame = +2

Query  98   NCPKCGTMDVPYPLSTGDSCGNPSYRVYCNNGVLNFLSATGFYYKIQSIDPSASRLIISP  277
            +CP CG M VPYPLST  +CG+ +YR+ C  G L F +  G  Y I SI+    R+I+ P
Sbjct  42   HCPNCGPMAVPYPLSTAPTCGDQTYRINCVAGKLYFGALHGSSYVITSINSVTQRIILRP  101

Query  278  PVILTN-TCMSSDLSLGGLTIDQNSPFNISSRNTVMLLNCSEGIllsplncslsspcrvf  454
            P + ++ +C+S D+S  G  +D + PF+I++ NT++LLNCS+ +L +P++CS +S C  +
Sbjct  102  PGLASSGSCVSPDVSKQGFELDPHLPFSITTSNTILLLNCSQAMLQAPIDCSPTSLCYSY  161

Query  455  ergvgegrgcgDTLCCSYLKDSSMTSHRIRARVGGCSAYTSVVDLNPGD---VNFHAW-H  622
             +           LCC++    S T++ IR   GGC AY S V LNP          W  
Sbjct  162  IKNNASPCSKAP-LCCTFRTGGSQTAYTIRINGGGCLAYQSFVGLNPNKEIPPPGKKWPD  220

Query  623  YGIELQW  643
             G+ELQW
Sbjct  221  TGLELQW  227



>ref|XP_007163467.1| hypothetical protein PHAVU_001G236600g [Phaseolus vulgaris]
 gb|ESW35461.1| hypothetical protein PHAVU_001G236600g [Phaseolus vulgaris]
Length=634

 Score =   116 bits (290),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 71/183 (39%), Positives = 103/183 (56%), Gaps = 2/183 (1%)
 Frame = +2

Query  101  CPKCGTMDVPYPLSTGDSCGNPSYRVYCNNGVLNFLSATGFYYKIQSIDPSASRLIISPP  280
            CP CG   VP+PLST  +CG+ SY++ C++G L F +     Y I+SID  + RL+I P 
Sbjct  29   CPACGNTTVPFPLSTTSTCGDQSYKIRCSSGTLIFDTLNN-SYPIESIDAKSQRLVIQPA  87

Query  281  VILTNTCMSSDLSLGGLTIDQNSPFNISSRNTVMLLNCSEGIllspln-cslsspcrvfe  457
             ++ NTC+S+D    G+ ++   PFNI+S NT++ LNC+  +L SPLN  + S+      
Sbjct  88   ALVQNTCVSTDKVHQGIQLNSTLPFNITSSNTIVYLNCTLTLLQSPLNCSAASACHAYIN  147

Query  458  rgvgegrgcgDTLCCSYLKDSSMTSHRIRARVGGCSAYTSVVDLNPGDVNFHAWHYGIEL  637
                        LCC+Y    S  S+ IR R  GCSAY+S V+LN           G+E+
Sbjct  148  ATASAASCQSGPLCCTYRTGGSSNSYMIRVRDSGCSAYSSFVNLNSAQPVSRWPEPGLEI  207

Query  638  QWI  646
            QW+
Sbjct  208  QWL  210



>ref|XP_008233487.1| PREDICTED: wall-associated receptor kinase-like 20 [Prunus mume]
Length=626

 Score =   115 bits (289),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 79/188 (42%), Positives = 113/188 (60%), Gaps = 7/188 (4%)
 Frame = +2

Query  95   DNCPKCGTMDVPYPLSTGDSCGNPSYRVYCNNGVLNFLSATGFYYKIQSIDPSASRLIIS  274
              CP CG   VPYPLST  +CG+ SY++ C+ G L F +     Y I SI PS  RL+I 
Sbjct  25   QRCPGCGNTSVPYPLSTAPTCGDQSYKIRCDAGALVFDTLNN-SYPIISISPS-QRLVIQ  82

Query  275  PPVILTNTCMSSDLSLGGLTIDQNSPFNISSRNTVMLLNCSEGIllsplncslsspcrvf  454
            P   ++NTC++SD++  GL ++ + PFN++S NT++ LNC++ +L SPLNC+ SS C  +
Sbjct  83   PSGFVSNTCVTSDITHQGLQLNDSLPFNVTSSNTILYLNCTDTLLRSPLNCTSSSLCHSY  142

Query  455  ergvgegrg---cgDTLCCSYLKDSSMTSHRIRARVGGCSAYTSVVDLNPGDVNFHAW-H  622
              G             LCC++    S TS+ IR R  GCSAYTS V+L+P  +    W  
Sbjct  143  INGSSARAVGPCEAAPLCCTFRAGGSSTSYMIRVRDSGCSAYTSFVNLDP-VLPVDRWPE  201

Query  623  YGIELQWI  646
             G+E+QW+
Sbjct  202  PGVEIQWV  209



>gb|KFK24607.1| hypothetical protein AALP_AA8G001200 [Arabis alpina]
Length=661

 Score =   115 bits (289),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 72/187 (39%), Positives = 112/187 (60%), Gaps = 6/187 (3%)
 Frame = +2

Query  98   NCPKCGTMDVPYPLSTGDSCGNPSYRVYCNNGVLNFLSATGFYYKIQSIDPSASRLIISP  277
             CP CG M VPYPLSTG +CG+ +Y++ C  G L F +  G  Y I SI+P + R+++ P
Sbjct  42   RCPNCGPMIVPYPLSTGPNCGDQAYKINCVAGKLYFGALHGSSYVITSINPVSQRIVLHP  101

Query  278  PVILT-NTCMSSDLSLGGLTIDQNSPFNISSRNTVMLLNCSEGIllsplncslsspcrvf  454
            P + +  +C+S+D+S  GL +D + PF+I+S NT++LL+C E +L +P++C+++S C  +
Sbjct  102  PGLASPGSCLSADVSKAGLDLDPHLPFSITSSNTILLLSCPEAMLQAPIDCTVTSLCHSY  161

Query  455  ergvgegrgcgDTLCCSYLKDSSMTSHRIRARVGGCSAYTSVVDLNPGDV---NFHAW-H  622
             +            CC++  D S T++ I+   GGC AY S V L+P          W  
Sbjct  162  IKDNAPACSKA-PFCCTFRTDGSQTAYTIKINGGGCLAYQSFVGLDPNKEVPPPGRKWPE  220

Query  623  YGIELQW  643
             G+ELQW
Sbjct  221  PGLELQW  227



>ref|XP_007220545.1| hypothetical protein PRUPE_ppa002973mg [Prunus persica]
 gb|EMJ21744.1| hypothetical protein PRUPE_ppa002973mg [Prunus persica]
Length=616

 Score =   115 bits (288),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 76/188 (40%), Positives = 114/188 (61%), Gaps = 6/188 (3%)
 Frame = +2

Query  95   DNCPKCGTMDVPYPLSTGDSCGNPSYRVYCNNGVLNFLSATGFYYKIQSIDPSASRLIIS  274
              C  CG   VPYPLST  +CG+ SY++ C+ G L F +     Y I SI PS+ RL++ 
Sbjct  25   QRCLDCGNTSVPYPLSTAPTCGDQSYKIRCDAGSLVFDTLNN-SYPITSISPSSQRLVVQ  83

Query  275  PPVILTNTCMSSDLSLGGLTIDQNSPFNISSRNTVMLLNCSEGIllsplncslsspcrvf  454
            P   +TNTC++SD++  G+ ++ + PFN++S NT++ LNC++ +L SPLNC+ SS C  +
Sbjct  84   PSSFVTNTCVTSDITHQGIQLNDSLPFNVTSSNTILYLNCTDTLLRSPLNCTSSSLCHSY  143

Query  455  ergvgegrg---cgDTLCCSYLKDSSMTSHRIRARVGGCSAYTSVVDLNPGDVNFHAW-H  622
              G  +          LCC++    S TS+ IR +  GCSAYTS V+L+P  +    W  
Sbjct  144  VNGSSDRAVGPCEAAPLCCTFRAGGSSTSYMIRVKDSGCSAYTSFVNLDPV-LPVDRWPE  202

Query  623  YGIELQWI  646
             G+E+QW+
Sbjct  203  PGVEIQWV  210



>ref|XP_009404584.1| PREDICTED: wall-associated receptor kinase-like 20 [Musa acuminata 
subsp. malaccensis]
Length=643

 Score =   115 bits (288),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 80/187 (43%), Positives = 115/187 (61%), Gaps = 6/187 (3%)
 Frame = +2

Query  101  CPKCGTMDVPYPLSTGDSCGNPSYRVYCNNGV--LNFLSATGFYYKIQSIDPSASRLIIS  274
            CP CG+  VP+PLSTG  CG+PSY++ C+N    L F +  G  Y + SI  S  RL+I 
Sbjct  34   CPPCGSTSVPFPLSTGAGCGDPSYKIRCDNATKSLFFDALNGSSYPVTSISTSTQRLVIR  93

Query  275  PPVILT-NTCMSSDLSLGGLTIDQNSPFNISSRNTVMLLNCSEGIllsplncslsspcrv  451
            P   ++ ++C+++DLS  G+ ++ + PFN+SS NT+MLLNC+  +LLSPLNCS +S C V
Sbjct  94   PAAFVSRSSCVTTDLSSQGIQLNSSLPFNVSSSNTIMLLNCTARLLLSPLNCSSNSLCHV  153

Query  452  fergvgegrgcgDT-LCCSYLKDSSMTSHRIRARVGGCSAYTSVVDLNPGDVNFHAW--H  622
            +  G  +   C    +CC+++   S TS+ IRA   GCSA  S V+L+        W   
Sbjct  154  YANGTSDASACRSLPICCTFVAGGSSTSYSIRASGTGCSAIRSFVNLDAVGTPVAQWGER  213

Query  623  YGIELQW  643
             G+ELQW
Sbjct  214  AGVELQW  220



>ref|XP_004252723.1| PREDICTED: wall-associated receptor kinase-like 20 [Solanum lycopersicum]
Length=621

 Score =   114 bits (286),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 78/189 (41%), Positives = 107/189 (57%), Gaps = 9/189 (5%)
 Frame = +2

Query  98   NCPKCGTMDVPYPLSTGDSCGNPSYRVYCNNGVLNFLSATGFYYKIQSIDPSASRLIISP  277
             C  CG+  VPYPLSTG  CG+ SY++ C+N +  F       Y I SI P    L I P
Sbjct  22   RCSDCGSSPVPYPLSTGPDCGDQSYKIRCSNRL--FFDTLNNSYPISSISPDTQTLTIEP  79

Query  278  PVILTNTCMSSDLSLGGLTIDQNSPFNISSRNTVMLLNCSEGIllsplncslsspcrvfe  457
               L+NTC++ D+S  G+ ++ + PFNI+S NT++ LNCS+ +L SPLNC+  S C  + 
Sbjct  80   SPFLSNTCITQDISTVGVQLNSSLPFNITSSNTIVFLNCSQSLLSSPLNCTAESLCHTYL  139

Query  458  rgvgegrgcgDT-----LCCSYLKDSSMTSHRIRARVGGCSAYTSVVDLNPGDVNFHAW-  619
             G  E  G         +CC++    S TS+ IR R  GC AY S V+LNP  +    W 
Sbjct  140  NGTSENDGAIGACRNAPICCTFRAGGSSTSYMIRVRESGCRAYRSFVNLNPS-LPVSRWP  198

Query  620  HYGIELQWI  646
              G+ELQW+
Sbjct  199  EAGMELQWV  207



>ref|XP_010554928.1| PREDICTED: wall-associated receptor kinase-like 15 [Tarenaya 
hassleriana]
Length=601

 Score =   114 bits (286),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 65/177 (37%), Positives = 98/177 (55%), Gaps = 9/177 (5%)
 Frame = +2

Query  89   AYDNCPKCGTMDVPYPLSTGDSCGNPSYRVYCNNGVLNFLSATGFYYKIQSIDPSASRLI  268
            A+  CP CG+  VPYP STG  CG+P+Y++ C+   L F +  G    I+S DP+A RLI
Sbjct  34   AFKQCPACGSARVPYPFSTGPGCGDPNYKIRCSGSTLWFDTLNGSSNPIKSFDPAAQRLI  93

Query  269  ISPPVILTNTCMSSDLSLGGLTIDQNSPFNISSRNTVMLLNCS-EGIllsplncslsspc  445
            + PP    NTCM++D+   G+ +D N PFN+S RNTV++ NC+ +G+          S  
Sbjct  94   LQPPGFKPNTCMAADMQNHGIQLDPNLPFNVSDRNTVIITNCTKDGLDSYISVGFYCSES  153

Query  446  rvfergvgegrgcgDTL-------CCSYLKDSSMTSHRI-RARVGGCSAYTSVVDLN  592
             +  + + E     +         CC Y    ++ ++++ RAR   CSAY S VDL+
Sbjct  154  SLCHKFLVENLEARENCRDRKVNSCCWYKTGGTINTYKLYRAREDKCSAYQSYVDLD  210



>ref|XP_004246863.1| PREDICTED: wall-associated receptor kinase-like 20 [Solanum lycopersicum]
Length=623

 Score =   114 bits (286),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 70/185 (38%), Positives = 98/185 (53%), Gaps = 5/185 (3%)
 Frame = +2

Query  101  CPKCGTMDVPYPLSTGDSCGNPSYRVYCNNGVLNFLSATGFYYKIQSIDPSASRLIISPP  280
            C  CG + VPYPLST  +CG+P Y+V CN G L F +     Y I S+ P   RL+I PP
Sbjct  18   CENCGKIPVPYPLSTAPNCGDPLYKVSCNAGTLWFDAMKNSSYVISSVTPQIQRLVIKPP  77

Query  281  VILTNTCMSSDLSLGGLTIDQNSPFNISSRNTVMLLNCSEGIllsplncslssp---crv  451
                NTC+SSD    G+ +D N PFNI++ N ++LLNC++ +L   +  + SS       
Sbjct  78   TPYPNTCLSSDFRSEGIQLDPNLPFNITASNVILLLNCTDYMLHLQVPINCSSSCVCHPY  137

Query  452  fergvgegrgcgDTLCCSYLKDSSMTSHRIRARVGGCSAYTSVVDLNPGDVNFHAW-HYG  628
             E+ +  G     +LCC++    S   + IR    GC AY S V L+   +    W   G
Sbjct  138  VEKNLEWGACRKQSLCCTFRTGGSQNEYMIRVHSQGCMAYQSFVGLD-SSLPIEKWPQPG  196

Query  629  IELQW  643
            +EL W
Sbjct  197  LELMW  201



>ref|XP_002444158.1| hypothetical protein SORBIDRAFT_07g010240 [Sorghum bicolor]
 gb|EES13653.1| hypothetical protein SORBIDRAFT_07g010240 [Sorghum bicolor]
Length=663

 Score =   114 bits (284),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 85/191 (45%), Positives = 112/191 (59%), Gaps = 10/191 (5%)
 Frame = +2

Query  101  CPKCGTMDVPYPLSTGDSCGNPSYRVYC-NNGVLNFLSATGFYYKIQSIDPSASRLIISP  277
            CP CGT  VPYPLSTGD CG+P+Y+V C  N  L F +  G  Y I SI P+A RL++SP
Sbjct  37   CPPCGTTAVPYPLSTGDGCGDPAYKVRCAANSSLVFDALNGTSYPITSITPAAQRLVVSP  96

Query  278  PVILTNTCMSSDLSLG-----GLTIDQNSPFNISSRNTVMLLNCSEGIllsplncslssp  442
               ++    SS +S G     G+ ++ + PFN+SS NT+MLLNC++ +LLSPLNCS +S 
Sbjct  97   APFVSQPQGSSCVSEGAPAGRGVQLNASLPFNVSSSNTIMLLNCTKDLLLSPLNCSSNSL  156

Query  443  crvfergvgegrgcgD--TLCCSYLKDSSMTSHRIRARVGGCSAYTSVVDLNPGDVNFHA  616
            C V+    G          LCC+++   S TS+ IR     CSAY S V L+P       
Sbjct  157  CHVYANATGSTASACAPLPLCCTFVAGGSSTSYSIRVSPRFCSAYRSFVGLDPTTQPPDT  216

Query  617  W--HYGIELQW  643
            W    G+ELQW
Sbjct  217  WGSRLGLELQW  227



>ref|XP_002524223.1| kinase, putative [Ricinus communis]
 gb|EEF38147.1| kinase, putative [Ricinus communis]
Length=614

 Score =   112 bits (281),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 73/184 (40%), Positives = 102/184 (55%), Gaps = 4/184 (2%)
 Frame = +2

Query  101  CPKCGTMDVPYPLSTGDSCGNPSYRVYCNNGVLNFLSAT-GFYYKIQSIDPSASRLIISP  277
            CP CGT  VPYP ST  +CG+ SY++ CN      +  T    Y I SI+ +  RL I P
Sbjct  31   CPNCGTTPVPYPFSTSPTCGDQSYKITCNASTNELMFDTLNNSYPIISINTTIQRLTIQP  90

Query  278  PVILTNTCMSSDLSLGGLTIDQNSPFNISSRNTVMLLNCSEGIllspln-cslsspcrvf  454
              +L NTC++SD    G+ ++ + PFNI+  NTVM LNCSE +L SPLN    S      
Sbjct  91   ATLLQNTCVTSDFLHQGIQMNSSLPFNITGDNTVMFLNCSESLLRSPLNCSFTSLCHSYV  150

Query  455  ergvgegrgcgDTLCCSYLKDSSMTSHRIRARVGGCSAYTSVVDLNPGDVNFHAW-HYGI  631
                 +    G ++CC++      T++ IR R  GC AYTS V+L+PG +    W + G+
Sbjct  151  NNTKSDASCKGASICCTFKAGGGTTAYMIRVRDTGCKAYTSFVNLDPG-LPVDKWPNPGV  209

Query  632  ELQW  643
             +QW
Sbjct  210  SIQW  213



>ref|XP_002529875.1| kinase, putative [Ricinus communis]
 gb|EEF32525.1| kinase, putative [Ricinus communis]
Length=641

 Score =   112 bits (280),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 68/192 (35%), Positives = 98/192 (51%), Gaps = 5/192 (3%)
 Frame = +2

Query  86   IAYDNCPKCGTMDVPYPLSTGDSCGNPSYRVYCNNGVLNFLSATGFYYKIQSIDPSASRL  265
            IA   C  CG + VPYPLST   CG+  Y++ C  G L F    G  Y I++I+P   RL
Sbjct  23   IAVRPCGNCGRLLVPYPLSTRPDCGDQHYKLRCTAGTLWFDGVNGSSYTIKTINPLIRRL  82

Query  266  IISPPVILTNTCMSSDLSLGGLTIDQNSPFNISSRNTVMLLNCSEGIllsplncsls---  436
            II PP +  N+C+SSD    G+ +D N PFNISS NT++LLNC++ +    LN  +    
Sbjct  83   IIQPPNLANNSCISSDFHSQGIQLDHNLPFNISSSNTILLLNCTDSVSHLKLNPPMDCSP  142

Query  437  spcrvfergvgegrgcgDTLCCSYLKDSSMTSHRIRARVGGCSAYTSVVDLNPGDV-NFH  613
            +                  LCC++          ++  VG CSAY S V+L+   V   +
Sbjct  143  ASICHNYIKEHAAACIIAPLCCTFRTGGLQNVDALKVYVGECSAYQSFVNLDLKTVLALN  202

Query  614  AW-HYGIELQWI  646
             W    +E++W+
Sbjct  203  KWPEPEVEIEWM  214



>ref|XP_003600760.1| Wall-associated receptor kinase-like protein [Medicago truncatula]
 gb|AES71011.1| wall-associated receptor kinase-like protein [Medicago truncatula]
Length=631

 Score =   112 bits (279),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 66/184 (36%), Positives = 100/184 (54%), Gaps = 5/184 (3%)
 Frame = +2

Query  101  CPKCGTMDVPYPLSTGDSCGNPSYRVYC-NNGVLNFLSATGFYYKIQSIDPSASRLIISP  277
            CP CG   VP+PLST  +CG+ SY++ C + G L F +     Y IQSI+P   R +I P
Sbjct  28   CPPCGNTTVPFPLSTTPTCGDQSYKINCTSTGTLVFTTVNN-SYPIQSINPQTQRFVIQP  86

Query  278  PVILTNTCMSSDLSLGGLTIDQNSPFNISSRNTVMLLNCSEGIllsplncslsspcrvfe  457
              ++ NTC ++D    G+ ++   PFNI+S NT++ LNC+  + L       ++      
Sbjct  87   APLIPNTCTTTDKIYEGIILNNTLPFNITSSNTIVYLNCTRDL-LRSPLNCSAASACHAY  145

Query  458  rgvgegrgcgDTLCCSYLKDSSMTSHRIRARVGGCSAYTSVVDLNPGDVNFHAWHY-GIE  634
                        LCC+Y    S  S++IR R  GCSAY+S V+L+ G +  + W   G+E
Sbjct  146  INATVPTCQTGPLCCTYRTGGSSNSYQIRVRSSGCSAYSSFVNLDSG-LAVNRWSRPGLE  204

Query  635  LQWI  646
            +QW+
Sbjct  205  IQWM  208



>ref|XP_008441394.1| PREDICTED: LOW QUALITY PROTEIN: wall-associated receptor kinase-like 
20 [Cucumis melo]
Length=636

 Score =   112 bits (279),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 71/184 (39%), Positives = 104/184 (57%), Gaps = 2/184 (1%)
 Frame = +2

Query  98   NCPKCGTMDVPYPLSTGDSCGNPSYRVYCNNGVLNFLSATGFYYKIQSIDPSASRLIISP  277
             CP CG   VPYPLST  +CG+  Y++ C+ G L F +     Y I SI+P   RL+I P
Sbjct  38   RCPDCGGAAVPYPLSTSPTCGDQLYKIRCDAGSLKFDTLNN-TYPIISINPLIQRLVIRP  96

Query  278  PVILTNTCMSSDLSLGGLTIDQNSPFNISSRNTVMLLNCSEGIllspln-cslsspcrvf  454
               + NTC+++D++  G+ ++   PFN++S NT++  NC++ +L SPLN  S S      
Sbjct  97   SNFIPNTCVTADIAHEGVQLNSTLPFNVTSGNTILYFNCTDTLLRSPLNCSSTSLCHSYI  156

Query  455  ergvgegrgcgDTLCCSYLKDSSMTSHRIRARVGGCSAYTSVVDLNPGDVNFHAWHYGIE  634
            +   G        LCC++    S  S+ IR R  GCSAYTS V+L+P        + G+E
Sbjct  157  KGSRGAATCEVAPLCCTFRAGGSSNSYMIRVRESGCSAYTSFVNLDPSLGVVQWPNPGLE  216

Query  635  LQWI  646
            LQW+
Sbjct  217  LQWL  220



>ref|XP_007206848.1| hypothetical protein PRUPE_ppa027075mg [Prunus persica]
 gb|EMJ08047.1| hypothetical protein PRUPE_ppa027075mg [Prunus persica]
Length=635

 Score =   112 bits (279),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 72/194 (37%), Positives = 96/194 (49%), Gaps = 8/194 (4%)
 Frame = +2

Query  89   AYDNCPKCGTMDVPYPLSTGDSCGNPSYRVYCNNGVLNFLSATGFYYKIQSIDPSASRLI  268
            A   C  CGT  VPYPLSTG  CG   YR+ C  G L   +     Y I SI+    R+ 
Sbjct  23   ATRRCGNCGTTPVPYPLSTGPGCGETWYRIRCTAGTLWLDALHNSSYPITSINQETRRIT  82

Query  269  ISPPVILTNTCMSSDLSLGGLTIDQNSPFNISSRNTVMLLNCSEGIllsplncs-lsspc  445
            I P     NTC+SSD    G+ +D N PFNI+S NTV+LL C++ +L      +  S+  
Sbjct  83   IRPASFAPNTCLSSDFHSQGIQLDPNLPFNITSSNTVLLLICTDAMLNLQAPINCSSNSL  142

Query  446  rvfergvgegrgcgDTLCCSYLKDSSMTSHRIRARVGGCSAYTSVVDLN--PGD----VN  607
                          +TLCC++    S T++ IR   GGCSAY S V+ +  P      V 
Sbjct  143  CHSFIRDNAVACTRETLCCTFRTGGSQTAYIIRVHGGGCSAYQSFVNFDGPPSSAVVGVK  202

Query  608  FHAW-HYGIELQWI  646
               W   G+EL+W+
Sbjct  203  KTKWPEPGVELEWV  216



>ref|XP_010046498.1| PREDICTED: wall-associated receptor kinase-like 20 [Eucalyptus 
grandis]
 gb|KCW86001.1| hypothetical protein EUGRSUZ_B02707 [Eucalyptus grandis]
Length=607

 Score =   111 bits (278),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 72/166 (43%), Positives = 98/166 (59%), Gaps = 2/166 (1%)
 Frame = +2

Query  101  CPKCGTMDVPYPLSTGDSCGNPSYRVYCNNGVLNFLSATGFYYKIQSIDPSASRLIISPP  280
            CP CG M VPYPLSTG SCG+  Y+V C+ G L F    G  Y I SI+P + RL+I P 
Sbjct  3    CPNCGNMTVPYPLSTGPSCGDQLYKVRCSFGTLFFNPLNGSSYVITSINPQSQRLVIRPS  62

Query  281  VILTNTCMSSDLSLGGLTIDQNSPFNISSRNTVMLLNCSEGIllsplncslsspcrvfer  460
             ++ + CMS+D    G+ +D + PFNI+S NT++L+NCS  +L S L+CS +S C  + R
Sbjct  63   DLVDHACMSADYRSQGIYLDPSLPFNITSSNTLLLMNCSTEVLTSTLDCSPTSICHAYLR  122

Query  461  gvgegrgcgD--TLCCSYLKDSSMTSHRIRARVGGCSAYTSVVDLN  592
                        +LCCS     S   +RIR R   C+AY S V+L+
Sbjct  123  DNPLAAASCSNFSLCCSMKTGGSQNEYRIRIRQDRCAAYQSFVNLD  168



>ref|XP_010046500.1| PREDICTED: wall-associated receptor kinase-like 20 [Eucalyptus 
grandis]
Length=635

 Score =   111 bits (278),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 72/184 (39%), Positives = 106/184 (58%), Gaps = 3/184 (2%)
 Frame = +2

Query  101  CPKCGTMDVPYPLSTGDSCGNPSYRVYCNNGVLNFLSATGFYYKIQSIDPSASRLIISPP  280
            CP CG M VPYPLSTG SCG+ +Y+V C+ G L F +     Y + SI+P + RL+I P 
Sbjct  31   CPNCGNMTVPYPLSTGPSCGDQTYKVRCSFGKLFFDALNESSYVVTSINPQSQRLVIRPS  90

Query  281  VILTNTCMSSDLSLGGLTIDQNSPFNISSRNTVMLLNCSEGIllsplncslsspcrvfer  460
              +   C+S+D    G+ ++++ PF I+S NT++L+NCS  +L    +C+++S C V+ R
Sbjct  91   DWVDRACISADYRNQGIYLNRSLPFYITSSNTLVLMNCSTDMLSLAADCTVTSICHVYLR  150

Query  461  gvgegrgcgDT--LCCSYLKDSSMTSHRIRARVGGCSAYTSVVDLNPG-DVNFHAWHYGI  631
                      T  LCCS     S   +RIR R   C+AY S V+L+    V+  A   G+
Sbjct  151  DNPLAAASCSTFPLCCSLKTGGSQNEYRIRVRQDRCTAYQSFVNLDTSLPVSKWALFRGL  210

Query  632  ELQW  643
            EL+W
Sbjct  211  ELEW  214



>ref|XP_004154775.1| PREDICTED: wall-associated receptor kinase-like 20-like [Cucumis 
sativus]
Length=626

 Score =   111 bits (277),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 73/186 (39%), Positives = 110/186 (59%), Gaps = 5/186 (3%)
 Frame = +2

Query  98   NCPKCGTMDVPYPLSTGDSCGNPSYRVYCNNGVLNFLSATGFYYKIQSIDPSASRLIISP  277
             CP CG + VPYPLST  +CG+  Y++ C+ G L F +     Y I SI+P   RL+I P
Sbjct  27   RCPDCGGVAVPYPLSTSPTCGDQLYKIRCDAGSLKFDTLNN-SYPIISINPLTQRLVIRP  85

Query  278  PVILTNTCMSSDLSLGGLTIDQNSPFNISSRNTVMLLNCSEGIllsplncslsspcrvfe  457
               + NTC+++D++  G+ ++   PFN++S NT++  NC++ +L SPLNCS +S C  + 
Sbjct  86   SNFIPNTCVTADIAHEGIKLNSTLPFNVTSGNTILYFNCTDLLLRSPLNCSSTSLCHSYI  145

Query  458  rgvgegrgcgDT--LCCSYLKDSSMTSHRIRARVGGCSAYTSVVDLNPGDVNFHAW-HYG  628
            +G        +   LCC++    S  S+ IR R  GC AYTS V+L+P  +    W   G
Sbjct  146  KGSRGEATACEMAPLCCTFRAGGSSNSYMIRVRESGCRAYTSFVNLDP-SLGVGQWPEPG  204

Query  629  IELQWI  646
            +ELQW+
Sbjct  205  LELQWL  210



>ref|XP_010068892.1| PREDICTED: wall-associated receptor kinase-like 20 [Eucalyptus 
grandis]
Length=630

 Score =   111 bits (277),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 75/186 (40%), Positives = 106/186 (57%), Gaps = 5/186 (3%)
 Frame = +2

Query  98   NCPKCGTMDVPYPLSTGDSCGNPSYRVYCNNGVLNFLSATGFYYKIQSIDPSASRLIISP  277
             CP CG+  VPYPLST  +CG+ SY+V C+ G           Y I S+DP   RL++ P
Sbjct  30   RCPDCGSNPVPYPLSTSPTCGDQSYKVQCDAGGTLLFDTLNNSYPITSVDPENQRLVVQP  89

Query  278  PVILTNTCMSSDLSLGGLTIDQNSPFNISSRNTVMLLNCSEGIllspln-cslsspcrvf  454
              +L NTC++SDL   G+ ++ + PFN++S NT++ LNC+  +L SPLN  S S      
Sbjct  90   ASLLANTCVTSDLVHQGVQLNSSLPFNVTSSNTILYLNCNSTLLNSPLNCSSASLCHTYV  149

Query  455  ergvgegrgcgDTLCCSYLKDSSMTSHRIRARVGGCSAYTSVVDLNPGD-VNFHAW-HYG  628
                G        +CC++    S TS+ IR R  GC AYTS V+L+P + VN   W   G
Sbjct  150  NGTAGAAACGAAAICCTFRAGGSTTSYSIRVRDAGCRAYTSFVNLDPSEPVNL--WPKPG  207

Query  629  IELQWI  646
            +E+QW+
Sbjct  208  MEIQWV  213



>ref|XP_004962492.1| PREDICTED: wall-associated receptor kinase-like 20-like [Setaria 
italica]
Length=654

 Score =   111 bits (277),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 82/189 (43%), Positives = 111/189 (59%), Gaps = 9/189 (5%)
 Frame = +2

Query  101  CPKCGTMDVPYPLSTGDSCGNPSYRVYC--NNGVLNFLSATGFYYKIQSIDPSASRLIIS  274
            CP CG+  VPYPLST D CG+P+Y+V C  N+  L F +  G  Y I SI P A RL++S
Sbjct  33   CPPCGSTAVPYPLSTADGCGDPAYKVRCAANSSTLFFDALNGTSYPITSISPVAQRLVVS  92

Query  275  P-PVILTNTCMSSDLSLG-GLTIDQNSPFNISSRNTVMLLNCSEGIllsplncslsspcr  448
            P P +   +C+S    +  G+ ++ + PFN+SS NT+MLLNC++ +LLSPLNCS +S C 
Sbjct  93   PAPFVSQGSCISEGAPVARGVQLNASLPFNVSSSNTIMLLNCTQALLLSPLNCSSNSLCH  152

Query  449  vfergvgegrgcgD--TLCCSYLKDSSMTSHRIRARVGGCSAYTSVVDLNPGDVNFHAW-  619
            V+    G          LCC+++   S TS+ IR     CSAY S V L+P       W 
Sbjct  153  VYANATGSTASACAPLPLCCTFVAGGSSTSYSIRVSPQFCSAYRSFVGLDPVQPPV-TWG  211

Query  620  -HYGIELQW  643
               G+ELQW
Sbjct  212  RRLGLELQW  220



>ref|XP_006366426.1| PREDICTED: wall-associated receptor kinase-like 20-like [Solanum 
tuberosum]
Length=627

 Score =   111 bits (277),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 73/191 (38%), Positives = 106/191 (55%), Gaps = 9/191 (5%)
 Frame = +2

Query  98   NCPKCGTMDVPYPLSTGDSCGNPSYRVYCNNGVLN--FLSATGFYYKIQSIDPSASRLII  271
             C  CG+  VPYPLSTG  CG+ SY++ C++ +    F       Y I SI P + RL I
Sbjct  22   RCADCGSSPVPYPLSTGPDCGDQSYKIRCSSNIQPELFFDTLNNSYPISSISPESQRLTI  81

Query  272  SPPVILTNTCMSSDLSLGGLTIDQNSPFNISSRNTVMLLNCSEGIllsplncslsspcrv  451
             P   L+NTC++ D+S  G+ ++ + PFNI+S NT+M LNC++ +L + LNCS  S C  
Sbjct  82   EPSPFLSNTCITQDISTVGVQLNSSLPFNITSSNTIMYLNCTQTLLSTLLNCSSESLCHT  141

Query  452  fergvgegrgcgDT-----LCCSYLKDSSMTSHRIRARVGGCSAYTSVVDLNPGDVNFHA  616
            +  G               +CC++    S T++ IR R  GC AY S V+L+P  +    
Sbjct  142  YVNGSSGNGDGVGACRNAPICCTFGAGGSSTAYMIRVRESGCRAYRSFVNLDPS-LPVSR  200

Query  617  W-HYGIELQWI  646
            W   G+ELQW+
Sbjct  201  WPEAGMELQWV  211



>emb|CDY56488.1| BnaCnng30460D [Brassica napus]
Length=258

 Score =   107 bits (266),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 67/196 (34%), Positives = 106/196 (54%), Gaps = 14/196 (7%)
 Frame = +2

Query  89   AYDNCPKCGTMDVPYPLSTGDSCGNPSYRVYCN-NGVLNFLSATGFYYKIQSIDPSASRL  265
            ++  CP CG+  VPYPLSTG  CG+P Y++ C+  G L F +  G    I+ IDPS  R 
Sbjct  8    SFKRCPNCGSTRVPYPLSTGPGCGDPDYKIRCDIRGSLWFDTLNGSTNPIKLIDPSGQRF  67

Query  266  IISPPVILTNTCMSSDLSLGGLTIDQNSPFNISSRNTVMLLNCS-EGIllsplncslssp  442
            +++PP    NTC+S D+   G+ +D N PFN+SS NTV+++NC+ +G+          S 
Sbjct  68   VLAPPGFEPNTCVSVDIKSHGIQLDPNLPFNVSSSNTVIIMNCTKDGLDGYISQGFNCSD  127

Query  443  crvfergvgegrgcgD-----TLCCSYLKDSSMTSHRI-RARVGGCSAYTSVVDLNPGDV  604
              +  + + E           T CC Y   +S+ ++++ RAR   C+AY S ++L   D+
Sbjct  128  NSLCHKFLNENPEARGKCRGVTSCCWYKTGASVNTYKVYRARTEKCTAYQSFMNL---DL  184

Query  605  NFHAWHYG---IELQW  643
                  +G   +E+ W
Sbjct  185  TMPVSKWGEPAVEILW  200



>ref|XP_004503179.1| PREDICTED: wall-associated receptor kinase-like 20-like [Cicer 
arietinum]
Length=648

 Score =   110 bits (276),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 64/184 (35%), Positives = 97/184 (53%), Gaps = 3/184 (2%)
 Frame = +2

Query  101  CPKCGTMDVPYPLSTGDSCGNPSYRVYCNNGVLNFLSATGFYYKIQSIDPSASRLIISPP  280
            CP CG   VP+PLST  +CG+P Y++ C++            Y I+SI+P   R +I P 
Sbjct  41   CPPCGNTTVPFPLSTTATCGDPLYKIRCSSTGTLIFDTLNNSYPIESINPKTQRFVIQPA  100

Query  281  VILTNTCMSSDLSLGGLTIDQNSPFNISSRNTVMLLNCS-EGIllsplncslsspcrvfe  457
             ++ NTC ++D    G+ ++   PFNI+S NT++ LNC+ E +       S S       
Sbjct  101  PLIPNTCTTTDKIHQGIQLNNTLPFNITSSNTIVYLNCTVELLRSPLNCSSASLCHSYIN  160

Query  458  rgvgegrgcgDTLCCSYLKDSSMTSHRIRARVGGCSAYTSVVDLNPGDVNFHAWHY-GIE  634
                        LCC+Y    S  S+ IR R  GCSAY+S V+L+ G ++ + W   G+E
Sbjct  161  ATASISACQSGPLCCTYRTGGSSNSYMIRVRDSGCSAYSSFVNLDWG-LSVNRWSRPGLE  219

Query  635  LQWI  646
            +QW+
Sbjct  220  IQWV  223



>ref|XP_010452039.1| PREDICTED: wall-associated receptor kinase-like 20 [Camelina 
sativa]
Length=657

 Score =   110 bits (276),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 74/183 (40%), Positives = 108/183 (59%), Gaps = 6/183 (3%)
 Frame = +2

Query  110  CGTMDVPYPLSTGDSCGNPSYRVYCNNGVLNFLSATGFYYKIQSIDPSASRLIISPPVIL  289
            CG M VPYPLST  +CG+ +YR+ C  G L F +  G  Y I SI+    R+I+ PP + 
Sbjct  46   CGPMAVPYPLSTAPTCGDQTYRINCVAGKLYFGALHGSSYVITSINSVTQRIILRPPGLA  105

Query  290  TN-TCMSSDLSLGGLTIDQNSPFNISSRNTVMLLNCSEGIllsplncslsspcrvfergv  466
            ++ +C+S D+S  GL +D + PF+I++ NT++LLNCS+ +L +P++CS +S C  + +  
Sbjct  106  SSGSCISPDVSRQGLELDPHLPFSITTSNTILLLNCSQAMLQAPIDCSPTSLCYSYIKNN  165

Query  467  gegrgcgDTLCCSYLKDSSMTSHRIRARVGGCSAYTSVVDLNPGDV---NFHAW-HYGIE  634
                     LCC++  D S T++ I+   GGC AY S V LNP          W   GIE
Sbjct  166  ASPCSKA-PLCCTFRTDGSQTAYTIKINGGGCLAYQSFVGLNPNKEIPPPGKKWPDTGIE  224

Query  635  LQW  643
            LQW
Sbjct  225  LQW  227



>emb|CDY33837.1| BnaCnng07550D [Brassica napus]
 emb|CDX73522.1| BnaC08g24810D [Brassica napus]
Length=275

 Score =   107 bits (266),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 67/196 (34%), Positives = 106/196 (54%), Gaps = 14/196 (7%)
 Frame = +2

Query  89   AYDNCPKCGTMDVPYPLSTGDSCGNPSYRVYCN-NGVLNFLSATGFYYKIQSIDPSASRL  265
            ++  CP CG+  VPYPLSTG  CG+P Y++ C+  G L F +  G    I+ IDPS  R 
Sbjct  25   SFKRCPNCGSTRVPYPLSTGPGCGDPDYKIRCDIRGSLWFDTLNGSTNPIKLIDPSGQRF  84

Query  266  IISPPVILTNTCMSSDLSLGGLTIDQNSPFNISSRNTVMLLNCS-EGIllsplncslssp  442
            +++PP    NTC+S D+   G+ +D N PFN+SS NTV+++NC+ +G+          S 
Sbjct  85   VLAPPGFEPNTCVSVDIKSHGIQLDPNLPFNVSSSNTVIIMNCTKDGLDGYISQGFNCSD  144

Query  443  crvfergvgegrgcgD-----TLCCSYLKDSSMTSHRI-RARVGGCSAYTSVVDLNPGDV  604
              +  + + E           T CC Y   +S+ ++++ RAR   C+AY S ++L   D+
Sbjct  145  NSLCHKFLNENPEARGKCRGVTSCCWYKTGASVNTYKVYRARTEKCTAYQSFMNL---DL  201

Query  605  NFHAWHYG---IELQW  643
                  +G   +E+ W
Sbjct  202  TMPVSKWGEPAVEILW  217



>ref|XP_004308840.1| PREDICTED: wall-associated receptor kinase-like 20-like [Fragaria 
vesca subsp. vesca]
Length=627

 Score =   110 bits (274),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 69/185 (37%), Positives = 106/185 (57%), Gaps = 4/185 (2%)
 Frame = +2

Query  101  CPKCGTMDVPYPLSTGDSCGNPSYRVYCNNGVLNFLSATGFYYKIQSIDPSASRLIISPP  280
            CP CGT  VPYPLST  +CG+ SY++ C +            Y I SI PS+ RL++ P 
Sbjct  31   CPPCGTTSVPYPLSTSPTCGDQSYKIRCLSNSSLLFDTLNNSYPIASISPSSQRLVVRPS  90

Query  281  VILT-NTCMSSDLSLGGLTIDQNSPFNISSRNTVMLLNCSEGIllspln-cslsspcrvf  454
              L+ ++C++SD+   G+ ++++ PFN++S NT++  NC++ IL SPLN  + S      
Sbjct  91   TFLSPSSCVTSDVIHQGIQLNESLPFNVTSSNTILYFNCTDSILRSPLNCSASSLCHTYV  150

Query  455  ergvgegrgcgDTLCCSYLKDSSMTSHRIRARVGGCSAYTSVVDLNPGDVNFHAW-HYGI  631
                  G      +CC++    S TS+ +R R  GCSAYTS V+L+P  +    W   G+
Sbjct  151  NNTNSVGACRAAPICCTFRAGGSSTSYMVRVRDSGCSAYTSFVNLDPV-LPVARWPEPGV  209

Query  632  ELQWI  646
            E+QW+
Sbjct  210  EIQWV  214



>ref|XP_004503197.1| PREDICTED: wall-associated receptor kinase-like 15-like [Cicer 
arietinum]
Length=276

 Score =   106 bits (265),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 68/183 (37%), Positives = 101/183 (55%), Gaps = 3/183 (2%)
 Frame = +2

Query  101  CPKCGTMDVPYPLSTGDSCGNPSYRVYCNNGVLNFLSATGFYYKIQSIDPSASRLIISPP  280
            CP CG   VP+PLST  +CG+P Y++ C++            Y I+SIDP   RL+I P 
Sbjct  41   CPPCGNTTVPFPLSTTATCGDPLYKIRCSSTGTLIFDTLNNSYPIESIDPKTQRLVIQPA  100

Query  281  VILTNTCMSSDLSLGGLTIDQNSPFNISSRNTVMLLNCSEGIllspln-cslsspcrvfe  457
             ++ NTC+++D    G+ ++ + PFNI+S NT++ LNC+  +L SPLN  S S       
Sbjct  101  PLIPNTCITTDKVHQGIQLNNSLPFNITSSNTIVYLNCTLLLLQSPLNCSSSSLCHSYIN  160

Query  458  rgvgegrgcgDTLCCSYLKDSSMTSHRIRARVGGCSAYTSVVDLNPGDVNFHAWHY-GIE  634
                        +CC++    S TS+ IR R  GCSAY+S V+L+   +    W   G+E
Sbjct  161  ATASVSTCQSGPVCCTFRTGGSSTSYMIRVRDVGCSAYSSFVNLD-WALPVDRWSRPGLE  219

Query  635  LQW  643
            +QW
Sbjct  220  IQW  222



>ref|XP_009122812.1| PREDICTED: wall-associated receptor kinase-like 20 [Brassica 
rapa]
Length=662

 Score =   109 bits (273),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 71/183 (39%), Positives = 106/183 (58%), Gaps = 6/183 (3%)
 Frame = +2

Query  110  CGTMDVPYPLSTGDSCGNPSYRVYCNNGVLNFLSATGFYYKIQSIDPSASRLIISPPVIL  289
            CG M VPYPLSTG +CG+ +Y++ C  G L F +  G  Y I SI+P   R++I PP   
Sbjct  46   CGPMVVPYPLSTGPNCGDQAYKINCVGGKLYFGALHGSSYLITSINPVTQRIVIHPPGFA  105

Query  290  TN-TCMSSDLSLGGLTIDQNSPFNISSRNTVMLLNCSEGIllsplncslsspcrvfergv  466
            ++ +C+S+D+S  GL +D + PF+I++ NT++LL C E +L +P++C+ +S C  + +  
Sbjct  106  SSGSCLSADVSKAGLELDPHLPFSITNSNTILLLGCPEAMLQAPIDCTGTSLCHSYIKSN  165

Query  467  gegrgcgDTLCCSYLKDSSMTSHRIRARVGGCSAYTSVVDLNPGDV---NFHAW-HYGIE  634
                      CC++  D S  ++ IR   GGC AY S V LNP          W   G+E
Sbjct  166  VSACSKA-PFCCTFRTDGSQNAYTIRINGGGCLAYQSFVGLNPNKEVPPPGKKWPDPGLE  224

Query  635  LQW  643
            LQW
Sbjct  225  LQW  227



>gb|KGN46391.1| hypothetical protein Csa_6G088680 [Cucumis sativus]
Length=257

 Score =   105 bits (263),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 72/185 (39%), Positives = 106/185 (57%), Gaps = 5/185 (3%)
 Frame = +2

Query  101  CPKCGTMDVPYPLSTGDSCGNPSYRVYCNNGVLNFLSATGFYYKIQSIDPSASRLIISPP  280
            CP CG   VPYPLST  +CG+  Y++ C+ G L F +     Y I SI+P   RL+I P 
Sbjct  28   CPDCGGAAVPYPLSTSPTCGDQLYKIRCDVGSLKFDTVNN-TYPIISINPLTQRLVIRPS  86

Query  281  VILTNTCMSSDLSLGGLTIDQNSPFNISSRNTVMLLNCSEGIllsplncslsspcrvfer  460
              + N C++ D++  G+ ++   PFN++S NT++  NC+  +L SPLNCS +S C  + +
Sbjct  87   NFIPNMCVTVDIAHEGIKLNNTLPFNVTSGNTILYFNCTNLLLGSPLNCSSTSLCHSYIK  146

Query  461  gvgegrgcgD--TLCCSYLKDSSMTSHRIRARVGGCSAYTSVVDLNPGDVNFHAW-HYGI  631
            G        +   LCC++    S  S+ IR R   CSAYTS V+L+P  +    W   G+
Sbjct  147  GSRGEATKCEMAQLCCTFRTGGSSNSYMIRVRESWCSAYTSFVNLDP-SLGVGQWPEPGL  205

Query  632  ELQWI  646
            ELQW+
Sbjct  206  ELQWL  210



>ref|NP_001168336.1| uncharacterized LOC100382104 precursor [Zea mays]
 gb|ACN27858.1| unknown [Zea mays]
 gb|AFW61979.1| putative WAK-related receptor-like protein kinase family protein 
[Zea mays]
Length=651

 Score =   109 bits (273),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 79/194 (41%), Positives = 109/194 (56%), Gaps = 13/194 (7%)
 Frame = +2

Query  101  CPKCGTMDVPYPLSTGDSCGNPSYRVYCNNG--------VLNFLSATGFYYKIQSIDPSA  256
            CP CG+  VPYPLSTGD CG+P+Y+V C            L F +  G  Y+I SI  + 
Sbjct  20   CPPCGSTAVPYPLSTGDGCGDPAYKVRCAAATNSSTSSPTLMFDALNGTSYRITSISAAT  79

Query  257  SRLIISP-PVILTNTCMSSDLSLGGLTIDQNSPFNISSRNTVMLLNCSEGIllsplncsl  433
             RL+++P P++   +   S+   GG+ ++ + PFN+SS NT+MLLNC+  +LLSPLNCS 
Sbjct  80   QRLVVAPAPLVAQGSRCVSEGRGGGVQLNASLPFNVSSSNTIMLLNCTSALLLSPLNCSS  139

Query  434  sspcrvfergvgegrgcgD--TLCCSYLKDSSMTSHRIRARVGGCSAYTSVVDLNPGDVN  607
            +S C V+    G          LCC+++   S TS+ IR     CSAY S V L+P    
Sbjct  140  NSLCHVYANATGSTAAACAPLPLCCTFVAGGSSTSYSIRVSPQFCSAYRSFVGLDPAAQP  199

Query  608  FHAW--HYGIELQW  643
               W    G+ELQW
Sbjct  200  PATWGRRLGLELQW  213



>ref|XP_004157625.1| PREDICTED: wall-associated receptor kinase-like 20-like [Cucumis 
sativus]
Length=265

 Score =   105 bits (263),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 72/185 (39%), Positives = 106/185 (57%), Gaps = 5/185 (3%)
 Frame = +2

Query  101  CPKCGTMDVPYPLSTGDSCGNPSYRVYCNNGVLNFLSATGFYYKIQSIDPSASRLIISPP  280
            CP CG   VPYPLST  +CG+  Y++ C+ G L F +     Y I SI+P   RL+I P 
Sbjct  28   CPDCGGAAVPYPLSTSPTCGDQLYKIRCDVGSLKFDTVNN-TYPIISINPLTQRLVIRPS  86

Query  281  VILTNTCMSSDLSLGGLTIDQNSPFNISSRNTVMLLNCSEGIllsplncslsspcrvfer  460
              + N C++ D++  G+ ++   PFN++S NT++  NC+  +L SPLNCS +S C  + +
Sbjct  87   NFIPNMCVTVDIAHEGIKLNNTLPFNVTSGNTILYFNCTNLLLGSPLNCSSTSLCHSYIK  146

Query  461  gvgegrgcgD--TLCCSYLKDSSMTSHRIRARVGGCSAYTSVVDLNPGDVNFHAW-HYGI  631
            G        +   LCC++    S  S+ IR R   CSAYTS V+L+P  +    W   G+
Sbjct  147  GSRGEATKCEMAQLCCTFRTGGSSNSYMIRVRESWCSAYTSFVNLDP-SLGVGQWPEPGL  205

Query  632  ELQWI  646
            ELQW+
Sbjct  206  ELQWL  210



>ref|XP_008794074.1| PREDICTED: wall-associated receptor kinase-like 20 [Phoenix dactylifera]
Length=646

 Score =   109 bits (273),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 68/191 (36%), Positives = 110/191 (58%), Gaps = 11/191 (6%)
 Frame = +2

Query  101  CPKCGTMDVPYPLSTGDSCGNPSYRVYCN--NGVLNFLSATGFYYKIQSIDPSASRLIIS  274
            CP+CG+M+VPYPLST  SCG+P+Y + C+     L F +  G  Y +  I   A R+++ 
Sbjct  32   CPRCGSMEVPYPLSTNPSCGDPNYSLLCDPYKHELYFSALNGSTYLVLRIQSLARRMVVQ  91

Query  275  PPVILTNTCMSSDLSLG-GLTIDQNSPFNISSRNTVMLLNCSEGIllsplncslsspcrv  451
            P  +L  TC++ D+    GL ++Q+ PFN++S NT+ L NCS  +L+SPLNC+ +S C  
Sbjct  92   PSPLLPGTCITQDMPKSEGLWLNQSLPFNVTSSNTIFLFNCSPRLLISPLNCTTTSLCHR  151

Query  452  fergvgegrgcgDTL-------CCSYLKDSSMTSHRIRARVGGCSAYTSVVDLNPGDVNF  610
            +   +       +         CC+++     ++++IR  + GC A+ SV+ L+PG    
Sbjct  152  YLEAMRRVDPRSELECASGPGPCCTFIAGGMPSAYKIRLHISGCRAFRSVLHLDPGRPP-  210

Query  611  HAWHYGIELQW  643
              W  G+E+QW
Sbjct  211  SEWEEGLEIQW  221



>gb|EAY97519.1| hypothetical protein OsI_19447 [Oryza sativa Indica Group]
 gb|EEE63233.1| hypothetical protein OsJ_18043 [Oryza sativa Japonica Group]
Length=654

 Score =   109 bits (273),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 82/194 (42%), Positives = 108/194 (56%), Gaps = 14/194 (7%)
 Frame = +2

Query  101  CPKCGTMDVPYPLSTGDSCGNPSYRVYCNNG-------VLNFLSATGFYYKIQSIDPSAS  259
            CP CG+ +VPYPLST D CG+P Y+V C           L F +  G  Y I SI P++ 
Sbjct  34   CPPCGSTEVPYPLSTADGCGDPEYKVRCAAAAAGGTAPTLLFDALNGTSYPITSISPASQ  93

Query  260  RLIISP-PVILTNTCMSSDLSLG-GLTIDQNSPFNISSRNTVMLLNCSEGIllsplncsl  433
            RL++SP P +    C+S   +   G+ +D + PFN+SS NTVMLLNC+E +L SPLNCS 
Sbjct  94   RLVVSPAPFVSPGACVSVGAAASRGVQLDPSRPFNVSSSNTVMLLNCTELLLRSPLNCSS  153

Query  434  sspcrvfergvgegrgcgD--TLCCSYLKDSSMTSHRIRARVGGCSAYTSVVDLNPGDVN  607
            +S C  +    G          LCC+++   S TS+RIR     CSAY S V L+P    
Sbjct  154  NSLCHAYAGAAGSTASACAPLPLCCTFVAGGSSTSYRIRLGPQSCSAYRSFVGLDPSQPP  213

Query  608  FHAW--HYGIELQW  643
               W    G+ELQW
Sbjct  214  -ATWGSRLGLELQW  226



>ref|XP_002982423.1| hypothetical protein SELMODRAFT_116212 [Selaginella moellendorffii]
 gb|EFJ16668.1| hypothetical protein SELMODRAFT_116212 [Selaginella moellendorffii]
Length=621

 Score =   109 bits (272),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 77/195 (39%), Positives = 101/195 (52%), Gaps = 13/195 (7%)
 Frame = +2

Query  98   NCPKCGTMDVPYPLSTGDSCGNPSYRVYCNNGVLNFLSATGFYYKIQSIDPSASRLIISP  277
             CP CG   VP+PLST  SCG P Y + C  G L   +  G  Y IQ ID  +  ++IS 
Sbjct  22   QCPSCGNATVPFPLSTDPSCGRPDYAIMCRQGNLELQALNG-RYSIQRIDRESRNIVISS  80

Query  278  PVILTNTCMSSDL--------SLGGLTIDQNSPFNISSRNTVMLLNCSEGIllspln-cs  430
              +   +C + D           GGL ++Q+  FN++S NT++ LNCS  +L SPLN  S
Sbjct  81   MPLAPASCTTLDAINPSPASGGSGGLALNQSQAFNVTSSNTILFLNCSSILLRSPLNCSS  140

Query  431  lsspcrvfergvgegrgcgDTLCCSYLKDSSMTSHRIRARVG--GCSAYTSVVDLNPGDV  604
             S   R  +         GD LCCS+    S TSH IR R    GCSAY SVV ++   +
Sbjct  141  SSVCHRYIDSTPSASACRGDNLCCSFTAGGSSTSHTIRTRTDGLGCSAYVSVVRMDQS-L  199

Query  605  NFHAWHYGIELQWIP  649
            +   W YG+EL W P
Sbjct  200  DPRQWSYGVELGWAP  214



>gb|AAV44115.1| unknown protein [Oryza sativa Japonica Group]
Length=640

 Score =   109 bits (272),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 82/194 (42%), Positives = 108/194 (56%), Gaps = 14/194 (7%)
 Frame = +2

Query  101  CPKCGTMDVPYPLSTGDSCGNPSYRVYCNNG-------VLNFLSATGFYYKIQSIDPSAS  259
            CP CG+ +VPYPLST D CG+P Y+V C           L F +  G  Y I SI P++ 
Sbjct  34   CPPCGSTEVPYPLSTADGCGDPEYKVRCAAAAAGGTAPTLLFDALNGTSYPITSISPASQ  93

Query  260  RLIISP-PVILTNTCMSSDLSLG-GLTIDQNSPFNISSRNTVMLLNCSEGIllsplncsl  433
            RL++SP P +    C+S   +   G+ +D + PFN+SS NTVMLLNC+E +L SPLNCS 
Sbjct  94   RLVVSPAPFVSPGACVSVGAAASRGVQLDPSRPFNVSSSNTVMLLNCTELLLRSPLNCSS  153

Query  434  sspcrvfergvgegrgcgD--TLCCSYLKDSSMTSHRIRARVGGCSAYTSVVDLNPGDVN  607
            +S C  +    G          LCC+++   S TS+RIR     CSAY S V L+P    
Sbjct  154  NSLCHAYAGAAGSTASACAPLPLCCTFVAGGSSTSYRIRLGPQSCSAYRSFVGLDPSQPP  213

Query  608  FHAW--HYGIELQW  643
               W    G+ELQW
Sbjct  214  -ATWGSRLGLELQW  226



>ref|XP_002966586.1| hypothetical protein SELMODRAFT_85883 [Selaginella moellendorffii]
 gb|EFJ32613.1| hypothetical protein SELMODRAFT_85883 [Selaginella moellendorffii]
Length=621

 Score =   109 bits (272),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 77/195 (39%), Positives = 101/195 (52%), Gaps = 13/195 (7%)
 Frame = +2

Query  98   NCPKCGTMDVPYPLSTGDSCGNPSYRVYCNNGVLNFLSATGFYYKIQSIDPSASRLIISP  277
             CP CG   VP+PLST  SCG P Y + C  G L   +  G  Y IQ ID  +  ++IS 
Sbjct  22   QCPSCGNATVPFPLSTDPSCGRPDYAILCRQGNLELQALNG-RYSIQRIDRESRNIVISS  80

Query  278  PVILTNTCMSSDL--------SLGGLTIDQNSPFNISSRNTVMLLNCSEGIllspln-cs  430
              +   +C + D           GGL ++Q+  FN++S NT++ LNCS  +L SPLN  S
Sbjct  81   MPLAPASCTTLDAINPSPASGGSGGLVLNQSQAFNVTSSNTILFLNCSSILLRSPLNCSS  140

Query  431  lsspcrvfergvgegrgcgDTLCCSYLKDSSMTSHRIRARVG--GCSAYTSVVDLNPGDV  604
             S   R  +         GD LCCS+    S TSH IR R    GCSAY SVV ++   +
Sbjct  141  SSVCHRYIDSTPSASACRGDNLCCSFTAGGSSTSHTIRTRTDGLGCSAYVSVVRMDQ-SL  199

Query  605  NFHAWHYGIELQWIP  649
            +   W YG+EL W P
Sbjct  200  DPRQWSYGVELGWAP  214



>ref|XP_010935377.1| PREDICTED: LOW QUALITY PROTEIN: wall-associated receptor kinase-like 
20 [Elaeis guineensis]
Length=636

 Score =   109 bits (272),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 68/191 (36%), Positives = 110/191 (58%), Gaps = 11/191 (6%)
 Frame = +2

Query  101  CPKCGTMDVPYPLSTGDSCGNPSYRVYCN--NGVLNFLSATGFYYKIQSIDPSASRLIIS  274
            CP+CGTM+VPYPLST  SCG+P+Y + C+     L+F +  G  Y +  I P A R+++ 
Sbjct  32   CPRCGTMEVPYPLSTNPSCGDPNYSLLCDPYKHKLHFNALNGSTYLVLRIQPLAQRMVLQ  91

Query  275  PPVILTNTCMSSDLSLG-GLTIDQNSPFNISSRNTVMLLNCSEGIllsplncslsspcrv  451
            P  +L  TC++ D+    GL ++Q+ PFN++S NT+   NCS  +L+SPLNC+ +S C  
Sbjct  92   PSPLLPGTCITQDMPKSEGLWLNQSLPFNVTSSNTIFFFNCSPRLLISPLNCTTTSLCHR  151

Query  452  fergvgegrgcgDTL-------CCSYLKDSSMTSHRIRARVGGCSAYTSVVDLNPGDVNF  610
            +   +       +         CC+++     ++++IR    GC A+ SV+ L+P +   
Sbjct  152  YLEAMRRVDPKSELECASGPGPCCTFIAGGMPSAYQIRLHSSGCRAFRSVLHLDP-ERPP  210

Query  611  HAWHYGIELQW  643
              W  G+E+QW
Sbjct  211  SEWEEGLEIQW  221



>emb|CDY10472.1| BnaCnng03730D [Brassica napus]
Length=987

 Score =   110 bits (274),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 72/183 (39%), Positives = 106/183 (58%), Gaps = 6/183 (3%)
 Frame = +2

Query  110  CGTMDVPYPLSTGDSCGNPSYRVYCNNGVLNFLSATGFYYKIQSIDPSASRLIISPPVIL  289
            CG M VPYPLSTG +CG+ +Y++ C  G L F +  G  Y I SI+P   R+II PP   
Sbjct  110  CGPMVVPYPLSTGPNCGDQAYKINCVGGKLYFGALHGSSYLITSINPVTQRIIIHPPGFA  169

Query  290  TN-TCMSSDLSLGGLTIDQNSPFNISSRNTVMLLNCSEGIllsplncslsspcrvfergv  466
            ++ +C+S+D+S  GL +D + PF+I++ NT++LL C E +L +P++C+ +S C  + +  
Sbjct  170  SSGSCLSADVSKAGLELDPHLPFSITNSNTILLLGCPEAMLQAPIDCTGTSLCHSYIKSN  229

Query  467  gegrgcgDTLCCSYLKDSSMTSHRIRARVGGCSAYTSVVDLNPGDV---NFHAW-HYGIE  634
                      CC++  D S  ++ IR   GGC AY S V LNP          W   G+E
Sbjct  230  VSACSKA-PFCCTFRTDGSQNAYTIRINGGGCLAYQSFVGLNPNKEVPPPGKKWPDPGLE  288

Query  635  LQW  643
            LQW
Sbjct  289  LQW  291



>gb|AFK34006.1| unknown [Medicago truncatula]
Length=631

 Score =   108 bits (271),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 65/184 (35%), Positives = 99/184 (54%), Gaps = 5/184 (3%)
 Frame = +2

Query  101  CPKCGTMDVPYPLSTGDSCGNPSYRVYC-NNGVLNFLSATGFYYKIQSIDPSASRLIISP  277
            CP CG   VP+PLST  +CG+ SY++ C + G L F +     Y IQSI+    R +I P
Sbjct  28   CPPCGNTTVPFPLSTTPTCGDQSYKINCTSTGTLVFTTVNN-SYPIQSINSQTQRFVIQP  86

Query  278  PVILTNTCMSSDLSLGGLTIDQNSPFNISSRNTVMLLNCSEGIllsplncslsspcrvfe  457
              ++ NTC ++D    G+ ++   PFNI+S NT++ LNC+  + L       ++      
Sbjct  87   APLIPNTCTTTDKIYEGIILNNTLPFNITSSNTIVYLNCTRDL-LRSPLNCSAASACHAY  145

Query  458  rgvgegrgcgDTLCCSYLKDSSMTSHRIRARVGGCSAYTSVVDLNPGDVNFHAWHY-GIE  634
                        LCC+Y    S  S++IR R  GCSAY+S V+L+ G +  + W   G+E
Sbjct  146  INATVPTCQTGPLCCTYRTGGSSNSYQIRVRSSGCSAYSSFVNLDSG-LAVNRWSRPGLE  204

Query  635  LQWI  646
            +QW+
Sbjct  205  IQWM  208



>ref|XP_010682238.1| PREDICTED: wall-associated receptor kinase-like 20 [Beta vulgaris 
subsp. vulgaris]
Length=642

 Score =   108 bits (270),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 74/189 (39%), Positives = 97/189 (51%), Gaps = 4/189 (2%)
 Frame = +2

Query  86   IAYDNCPKCGTMDVPYPLSTGDSCGNPSYRVYCNNGVLNFLSATGFYYKIQSIDPSASRL  265
            +A   CP CG + VPYPLST  SCG+  Y+V C  G L F +     Y I SI P   +L
Sbjct  29   VATLRCPNCGKLPVPYPLSTTGSCGDQLYKVRCTAGKLWFDALNASSYIITSISPKTQQL  88

Query  266  IISPPVILTNTCMSSDLSLGGLTIDQNSPFNISSRNTVMLLNCSEGIllsplncslsspc  445
            II P  I  N+C   D+  GGL ++Q+ PFNI+S NT++  NC+   L    +   SS  
Sbjct  89   IIRPKGISRNSCRGVDIRSGGLQLNQSLPFNITSSNTILQFNCTRSWLRVSASDCSSSSL  148

Query  446  --rvfergvgegrgcgDTLCCSYLKDSSMTSHRIRARVGGCSAYTSVVDLNPGDVNFHAW  619
                     G G  C D  CCSY    S T++ I    G C+AY S V+LN   +    W
Sbjct  149  CYAYMNTSRGLGTRCSDLSCCSYTTGGSKTAYLIGIAEGRCTAYESFVNLNV-PLPVKKW  207

Query  620  -HYGIELQW  643
               GI++QW
Sbjct  208  PEPGIQIQW  216



>gb|KGN45743.1| hypothetical protein Csa_6G008740 [Cucumis sativus]
Length=626

 Score =   108 bits (270),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 72/185 (39%), Positives = 108/185 (58%), Gaps = 5/185 (3%)
 Frame = +2

Query  101  CPKCGTMDVPYPLSTGDSCGNPSYRVYCNNGVLNFLSATGFYYKIQSIDPSASRLIISPP  280
            CP CG   VPYPLST  +CG+  Y++ C+ G L F +     Y I SI+P   RL+I P 
Sbjct  28   CPDCGGAAVPYPLSTNPTCGDQLYKIRCDAGSLKFDTLNN-TYPILSINPLTQRLVIRPS  86

Query  281  VILTNTCMSSDLSLGGLTIDQNSPFNISSRNTVMLLNCSEGIllsplncslsspcrvfer  460
              + NTC+++D++   + ++   PFN++S NT++  NC++ +L SPLNCS +S C  + +
Sbjct  87   NFIPNTCVTADIAHEEIKLNNTLPFNVTSGNTILYFNCTDLLLRSPLNCSSTSLCHSYIK  146

Query  461  gvgegrgcgDT--LCCSYLKDSSMTSHRIRARVGGCSAYTSVVDLNPGDVNFHAW-HYGI  631
            G        +   LCC++    S  S+ IR R  GC AYTS V+L+P  +    W   G+
Sbjct  147  GSRGEATACEMAPLCCTFRAGGSSNSYMIRVRESGCRAYTSFVNLDP-SLGVGQWPEPGL  205

Query  632  ELQWI  646
            ELQW+
Sbjct  206  ELQWL  210



>ref|XP_009791579.1| PREDICTED: wall-associated receptor kinase-like 20 [Nicotiana 
sylvestris]
Length=636

 Score =   108 bits (270),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 67/185 (36%), Positives = 93/185 (50%), Gaps = 5/185 (3%)
 Frame = +2

Query  101  CPKCGTMDVPYPLSTGDSCGNPSYRVYCNNGVLNFLSATGFYYKIQSIDPSASRLIISPP  280
            C  CG   VPYPLSTG +CG+ SY+V C+ G L F +     Y I SI P   R+++  P
Sbjct  31   CGNCGKTPVPYPLSTGPNCGDQSYKVRCSAGTLWFDTKGNSSYIITSISPQIQRMVVKTP  90

Query  281  VILTNTCMSSDLSLGGLTIDQNSPFNISSRNTVMLLNCSEGIllsplncslssp---crv  451
             +  NTC+SSD    G+ +D N PFNI+  NT++LLNC++ +L      + SS       
Sbjct  91   TLYPNTCLSSDFYSEGIQLDPNLPFNITGSNTILLLNCTDNMLHLQAPINCSSTCICHPY  150

Query  452  fergvgegrgcgDTLCCSYLKDSSMTSHRIRARVGGCSAYTSVVDLNPGDVNFHAW-HYG  628
              +          +LCC +    S   + IR    GC AY S V L+   +    W   G
Sbjct  151  VNKIQEWAACRRQSLCCIFRTGGSQNEYMIRLNSNGCMAYQSFVGLDT-SLPVEKWPQPG  209

Query  629  IELQW  643
            +EL W
Sbjct  210  LELMW  214



>gb|KDO48145.1| hypothetical protein CISIN_1g0396811mg, partial [Citrus sinensis]
Length=128

 Score =   101 bits (252),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 49/106 (46%), Positives = 69/106 (65%), Gaps = 0/106 (0%)
 Frame = +2

Query  86   IAYDNCPKCGTMDVPYPLSTGDSCGNPSYRVYCNNGVLNFLSATGFYYKIQSIDPSASRL  265
            +A   C  CG   VPYPLSTG +CG+ SY++ C  G+L F +  G  Y I SI+P + R+
Sbjct  23   LAVLRCGNCGPTPVPYPLSTGPNCGHQSYKIRCAAGILWFDARNGSSYMIASINPLSQRI  82

Query  266  IISPPVILTNTCMSSDLSLGGLTIDQNSPFNISSRNTVMLLNCSEG  403
            II PP    +TC ++D+   G+ +D N PFNI+S NT+MLLNC++ 
Sbjct  83   IIRPPGPAGSTCTATDMRTQGIQLDDNLPFNITSSNTIMLLNCTDA  128



>emb|CDY40328.1| BnaA10g27400D [Brassica napus]
Length=992

 Score =   109 bits (272),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 71/183 (39%), Positives = 106/183 (58%), Gaps = 6/183 (3%)
 Frame = +2

Query  110  CGTMDVPYPLSTGDSCGNPSYRVYCNNGVLNFLSATGFYYKIQSIDPSASRLIISPPVIL  289
            CG M VPYPLSTG +CG+ +Y++ C  G L F +  G  Y I SI+P   R++I PP   
Sbjct  113  CGPMVVPYPLSTGPNCGDQAYKINCVGGKLYFGALHGSSYLITSINPVTQRIVIHPPGFA  172

Query  290  TN-TCMSSDLSLGGLTIDQNSPFNISSRNTVMLLNCSEGIllsplncslsspcrvfergv  466
            ++ +C+S+D+S  GL +D + PF+I++ NT++LL C E +L +P++C+ +S C  + +  
Sbjct  173  SSGSCLSADVSKAGLELDPHLPFSITNSNTILLLGCPEAMLQAPIDCTGTSLCHSYIKSN  232

Query  467  gegrgcgDTLCCSYLKDSSMTSHRIRARVGGCSAYTSVVDLNPGDV---NFHAW-HYGIE  634
                      CC++  D S  ++ IR   GGC AY S V LNP          W   G+E
Sbjct  233  VSACSKA-PFCCTFRTDGSQNAYTIRINGGGCLAYQSFVGLNPNKEVPPPGKKWPDPGLE  291

Query  635  LQW  643
            LQW
Sbjct  292  LQW  294



>ref|XP_006403646.1| hypothetical protein EUTSA_v10011109mg [Eutrema salsugineum]
 gb|ESQ45099.1| hypothetical protein EUTSA_v10011109mg [Eutrema salsugineum]
Length=645

 Score =   108 bits (269),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 69/196 (35%), Positives = 106/196 (54%), Gaps = 14/196 (7%)
 Frame = +2

Query  89   AYDNCPKCGTMDVPYPLSTGDSCGNPSYRVYCNN--GVLNFLSATGFYYKIQSIDPSASR  262
            A+  CP CG+  VPYPLST   CG+P Y++ C+   G L F +  G    I++IDPS  R
Sbjct  29   AFKRCPNCGSTQVPYPLSTRRDCGDPDYKIRCDEDRGSLWFDTLNGSTNPIKTIDPSGQR  88

Query  263  LIISPPVILTNTCMSSDLSLGGLTIDQNSPFNISSRNTVMLLNCSEG-----Illsplnc  427
             +++PP I  NTC+S D+   G+ +D N PFN+SS NTV+++NC++      I       
Sbjct  89   FVLTPPGIKPNTCVSVDIKSHGIQLDPNLPFNVSSSNTVIIMNCTKDGLDKYISQGFNCS  148

Query  428  slsspcrvfergvgegrgcgDTLCCSYLKDSSMTSHRI-RARVGGCSAYTSVVDLNPGDV  604
              S   +        G+  G + CC Y   +S+ ++++ RAR   CSAY S ++L   D+
Sbjct  149  HNSFCHKFLNLEARGGKCRGVSSCCWYKTGASVNTYKVYRAREDMCSAYQSYMNL---DL  205

Query  605  NFHAWHYG---IELQW  643
                  +G   +E+ W
Sbjct  206  TLPVSKWGEPAVEILW  221



>emb|CAB88346.1| protein kinase-like protein [Arabidopsis thaliana]
Length=640

 Score =   108 bits (269),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 68/196 (35%), Positives = 104/196 (53%), Gaps = 14/196 (7%)
 Frame = +2

Query  89   AYDNCPKCGTMDVPYPLSTGDSCGNPSYRVYCNN-GVLNFLSATGFYYKIQSIDPSASRL  265
            A+  CP CG+  VPYPLSTG  CG+P YR+ C+N G L F +  G    I++IDPS  R 
Sbjct  25   AFKRCPNCGSTRVPYPLSTGLDCGDPGYRIRCDNYGSLWFDTLNGSTNPIKTIDPSGQRF  84

Query  266  IISPPVILTNTCMSSDLSLGGLTIDQNSPFNISSRNTVMLLNCS-EGIllsplncslssp  442
            ++ PP    N C+S D+   G+ +D N PFN+S  NTV+++NC+ +G+          S 
Sbjct  85   VLRPPGFEQNKCVSVDIKYHGIQLDLNLPFNVSCSNTVIIMNCTKDGLDAYSSQGFNCSD  144

Query  443  crvfergvgegrgcgD-----TLCCSYLKDSSMTSHRI-RARVGGCSAYTSVVDLNPGDV  604
              +  + +             T CC Y   +S+ ++++ RAR   CSAY S ++L   D+
Sbjct  145  NSLCHKFLNANLEARGNCRGVTSCCWYKTGASVNTYKVYRARPDMCSAYQSFMNL---DL  201

Query  605  NFHAWHYG---IELQW  643
                  +G   +E+ W
Sbjct  202  TIPVSKWGEPAVEILW  217



>gb|KDO36633.1| hypothetical protein CISIN_1g042229mg, partial [Citrus sinensis]
Length=86

 Score =   100 bits (248),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 45/70 (64%), Positives = 57/70 (81%), Gaps = 0/70 (0%)
 Frame = +2

Query  89   AYDNCPKCGTMDVPYPLSTGDSCGNPSYRVYCNNGVLNFLSATGFYYKIQSIDPSASRLI  268
             ++ CPKCG+++VPYPLST D+CG+P YRVYC N VL  LSA GFYYKI SI+PS+ RL+
Sbjct  17   GHNACPKCGSIEVPYPLSTNDNCGDPRYRVYCENDVLQLLSAGGFYYKIISINPSSYRLV  76

Query  269  ISPPVILTNT  298
            ISPP+I  +T
Sbjct  77   ISPPLIPKDT  86



>ref|NP_190952.2| wall-associated receptor kinase-like 15 [Arabidopsis thaliana]
 sp|Q9M342.2|WAKLP_ARATH RecName: Full=Wall-associated receptor kinase-like 15; Flags: 
Precursor [Arabidopsis thaliana]
 gb|AEE79149.1| wall-associated receptor kinase-like 15 [Arabidopsis thaliana]
Length=639

 Score =   108 bits (269),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 68/196 (35%), Positives = 104/196 (53%), Gaps = 14/196 (7%)
 Frame = +2

Query  89   AYDNCPKCGTMDVPYPLSTGDSCGNPSYRVYCNN-GVLNFLSATGFYYKIQSIDPSASRL  265
            A+  CP CG+  VPYPLSTG  CG+P YR+ C+N G L F +  G    I++IDPS  R 
Sbjct  25   AFKRCPNCGSTRVPYPLSTGLDCGDPGYRIRCDNYGSLWFDTLNGSTNPIKTIDPSGQRF  84

Query  266  IISPPVILTNTCMSSDLSLGGLTIDQNSPFNISSRNTVMLLNCS-EGIllsplncslssp  442
            ++ PP    N C+S D+   G+ +D N PFN+S  NTV+++NC+ +G+          S 
Sbjct  85   VLRPPGFEQNKCVSVDIKYHGIQLDLNLPFNVSCSNTVIIMNCTKDGLDAYSSQGFNCSD  144

Query  443  crvfergvgegrgcgD-----TLCCSYLKDSSMTSHRI-RARVGGCSAYTSVVDLNPGDV  604
              +  + +             T CC Y   +S+ ++++ RAR   CSAY S ++L   D+
Sbjct  145  NSLCHKFLNANLEARGNCRGVTSCCWYKTGASVNTYKVYRARPDMCSAYQSFMNL---DL  201

Query  605  NFHAWHYG---IELQW  643
                  +G   +E+ W
Sbjct  202  TIPVSKWGEPAVEILW  217



>ref|XP_009358868.1| PREDICTED: wall-associated receptor kinase-like 20 [Pyrus x bretschneideri]
Length=645

 Score =   107 bits (268),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 73/185 (39%), Positives = 99/185 (54%), Gaps = 4/185 (2%)
 Frame = +2

Query  101  CPKCGTMDVPYPLSTGDSCGNPSYRVYCNNGVLNFLSATGFYYKIQSIDPSASRLIISPP  280
            C  CG   VPYPLST   CGN  Y+V C+ G L F +     Y I SI+P   RLII PP
Sbjct  29   CQDCGHTPVPYPLSTAPDCGNQHYKVRCHAGSLWFDALNSSSYLITSINPLTRRLIIQPP  88

Query  281  VILTN-TCMSSDLSLGGLTIDQNSPFNISSRNTVMLLNCSEGIllsplncslsspcrvfe  457
             +  N TCMS+D    GL ++ N PFNI+S NTV+ +NCS  +L    NCS +S C  + 
Sbjct  89   GLANNVTCMSADFKSQGLILEDNLPFNITSSNTVIGMNCSYEMLTLSKNCSSNSLCHDYI  148

Query  458  rgvgegrgcgD--TLCCSYLKDSSMTSHRIRARVGGCSAYTSVVDLNPGDVNFHAW-HYG  628
            +             +CC +    S  +++IRA    CSAY S V+L+      ++W   G
Sbjct  149  KHNAMAASACGCFRICCLFKTGGSTNAYKIRAMKERCSAYESFVNLDSFSGPLNSWPEPG  208

Query  629  IELQW  643
            +E+ W
Sbjct  209  VEIMW  213



>ref|XP_009758536.1| PREDICTED: wall-associated receptor kinase-like 20 [Nicotiana 
sylvestris]
 dbj|BAF45465.1| hypothetical protein [Nicotiana tabacum]
Length=630

 Score =   107 bits (267),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 72/190 (38%), Positives = 98/190 (52%), Gaps = 9/190 (5%)
 Frame = +2

Query  98   NCPKCGTMDVPYPLSTGDSCGNPSYRVYCNNGVLNFLSATGFYYKIQSIDPSASRLIISP  277
             C  CG+  VPYPLSTG  CG+ SY++ C +  L F +     Y I SI P   RL I P
Sbjct  28   RCADCGSSPVPYPLSTGPDCGDQSYKIRCTSTQLLFDTLNN-SYPITSISPETQRLTIQP  86

Query  278  PVILTNTCMSSDLSLGGLTIDQNSPFNISSRNTVMLLNCSEGIll------splncslss  439
               L NTC++ D+S  G+ ++ + PFNI+S NT++ LNCSE +L       S   C    
Sbjct  87   SPFLPNTCITQDISTIGVQLNSSLPFNITSSNTIVYLNCSETLLTSPLNCSSASLCHAYV  146

Query  440  pcrvfergvgegrgcgDTLCCSYLKDSSMTSHRIRARVGGCSAYTSVVDLNPGDVNFHAW  619
                   G   G      +CC++    S TS+ IR R  GC AY S V+L+   +    W
Sbjct  147  NGSSSGNGGAVGACRSAPICCTFRAGGSSTSYMIRVRESGCRAYRSFVNLD-SSLPVSRW  205

Query  620  -HYGIELQWI  646
               G+ELQW+
Sbjct  206  PQPGLELQWV  215



>ref|XP_007140473.1| hypothetical protein PHAVU_008G115500g [Phaseolus vulgaris]
 gb|ESW12467.1| hypothetical protein PHAVU_008G115500g [Phaseolus vulgaris]
Length=655

 Score =   107 bits (266),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 63/188 (34%), Positives = 91/188 (48%), Gaps = 3/188 (2%)
 Frame = +2

Query  89   AYDNCPKCGTMDVPYPLSTGDSCGNPSYRVYCNNGVLNFLSATGFYYKIQSIDPSASRLI  268
            A   C  CG   VPYPLSTG  CG+P Y++ C  G L F +  G  Y I+SIDPS  R+I
Sbjct  31   AMRKCGNCGPNPVPYPLSTGPDCGDPWYKIRCTAGTLWFDALAGSSYAIKSIDPSTRRII  90

Query  269  ISPPVILTNTCMSSDLSLGGLTIDQNSPFNISSRNTVMLLNCSEGIllsplncslsspcr  448
              PP +   TC+S+D    G+ +++  PF+++S N + L NC+        + S +    
Sbjct  91   TRPPTLAPKTCVSTDFRSEGMHLNETLPFSVASGNAIFLFNCTAHAPSMNCSASSACHSY  150

Query  449  vfergvgegrgcgDTLCCSYLKDSSMTSHRIRARVGGCSAYTSVVDLN--PGDVNFHAWH  622
            + E       G   + CC Y    +     IR   G C+AY   VDLN     V      
Sbjct  151  IKEHADFGACGSAGS-CCEYRSGGARKEFAIRLHGGECAAYAGFVDLNGTAATVGKRWPE  209

Query  623  YGIELQWI  646
             G+ ++W+
Sbjct  210  SGVGIEWV  217



>ref|XP_010543268.1| PREDICTED: wall-associated receptor kinase-like 20 [Tarenaya 
hassleriana]
Length=278

 Score =   103 bits (258),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 72/186 (39%), Positives = 102/186 (55%), Gaps = 5/186 (3%)
 Frame = +2

Query  98   NCPKCGTMDVPYPLSTGDSCGNPSYRVYCNNGVLNFLSATGFYYKIQSIDPSASRLIISP  277
             C  CG M VPYPLST  +CG+ SY++ C  G L   +  G  Y + SI+P   R+I+ P
Sbjct  43   RCLNCGPMVVPYPLSTAPNCGDQSYKIRCVLGKLYLDTLHGSSYIVTSINPLTQRVILQP  102

Query  278  PVIL-TNTCMSSDLSLGGLTIDQNSPFNISSRNTVMLLNCSEGIllsplncslsspcrvf  454
            P +     C S D S  GL +D   PF+I+S NTV+L +C + +L +P++C+  S C V+
Sbjct  103  PGLANPAVCASVDASKQGLELDPKLPFSITSSNTVLLFSCPDAMLQAPMDCTADSICHVY  162

Query  455  ergvgegrgcgDTLCCSYLKDSSMTSHRIRARVGGCSAYTSVVDLNP--GDVNFHAW-HY  625
             +           LCC++    + T++ IR   GGCSAY S V L+P  G      W   
Sbjct  163  AKDNAPACSKA-PLCCTFKTGGTQTAYTIRINGGGCSAYQSFVGLDPSKGVPPGKKWPEP  221

Query  626  GIELQW  643
            G+ELQW
Sbjct  222  GLELQW  227



>ref|XP_009594229.1| PREDICTED: wall-associated receptor kinase-like 20 [Nicotiana 
tomentosiformis]
Length=630

 Score =   107 bits (266),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 71/190 (37%), Positives = 97/190 (51%), Gaps = 9/190 (5%)
 Frame = +2

Query  98   NCPKCGTMDVPYPLSTGDSCGNPSYRVYCNNGVLNFLSATGFYYKIQSIDPSASRLIISP  277
             C  CG+  VPYPLSTG  CG+ SY++ C +  L F +     Y I SI P   RL I P
Sbjct  28   RCADCGSSPVPYPLSTGPDCGDQSYKIRCTSTQLLFDTLNN-SYPITSISPETQRLTIQP  86

Query  278  PVILTNTCMSSDLSLGGLTIDQNSPFNISSRNTVMLLNCSEGIl------lsplncslss  439
               L NTC++ D+S  G+ ++ + PFNI+S NT++ LNCSE +L       S   C    
Sbjct  87   SPFLPNTCITQDISTIGVQLNSSLPFNITSSNTIVFLNCSETLLRSPLNCSSASLCHAYV  146

Query  440  pcrvfergvgegrgcgDTLCCSYLKDSSMTSHRIRARVGGCSAYTSVVDLNPGDVNFHAW  619
                   G          +CC++    S TS+ IR R  GC AY S V+L+   +    W
Sbjct  147  NGSSSGNGGAVDACRNAPICCTFRAGGSSTSYMIRVRESGCRAYRSFVNLD-SLLPVSRW  205

Query  620  -HYGIELQWI  646
               G+ELQW+
Sbjct  206  PQPGLELQWV  215



>ref|XP_007162825.1| hypothetical protein PHAVU_001G184100g [Phaseolus vulgaris]
 gb|ESW34819.1| hypothetical protein PHAVU_001G184100g [Phaseolus vulgaris]
Length=636

 Score =   106 bits (265),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 74/193 (38%), Positives = 109/193 (56%), Gaps = 11/193 (6%)
 Frame = +2

Query  101  CPKCGTMDVPYPLSTGDSCGNPSYRVYC--NNGVLNFLSATGFYYKIQSIDPSASRLIIS  274
            CP CG+M VPYPLST  SCG+P Y++ C  ++  L F +  G  Y +  I PS  R+++ 
Sbjct  38   CPNCGSMQVPYPLSTHPSCGDPYYKLRCDSHSQRLYFDTLNGSSYLLLRIMPSIQRMVVE  97

Query  275  PPVILTNTCMSSDLSLG-GLTIDQNSPFNISSRNTVMLLNCSEGIllsplncslsspcrv  451
            P   L  +C++ D+    G+ ++Q+ PFNI+S NTV LLNCS  +L+SPLNC+ SS C  
Sbjct  98   PSPWLPGSCVTQDMQRSNGIWLNQSLPFNITSSNTVFLLNCSPRLLVSPLNCTSSSVCHR  157

Query  452  fergvgegrgcgDTL-------CCSYLKDSSMTSHRIRARVGGCSAYTSVVDLNPGDVNF  610
            +    G                CC++L     +++RIR    GC A+ S++ LN  D   
Sbjct  158  YLGSSGHVDTKRALECASGLHPCCTFLAGGIPSAYRIRLHDSGCKAFRSILHLNQ-DKPP  216

Query  611  HAWHYGIELQWIP  649
            + W  G+E+QW P
Sbjct  217  NQWEEGLEIQWAP  229



>ref|XP_009116082.1| PREDICTED: wall-associated receptor kinase-like 15 [Brassica 
rapa]
Length=638

 Score =   106 bits (265),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 67/196 (34%), Positives = 106/196 (54%), Gaps = 14/196 (7%)
 Frame = +2

Query  89   AYDNCPKCGTMDVPYPLSTGDSCGNPSYRVYCN-NGVLNFLSATGFYYKIQSIDPSASRL  265
            ++  CP CG+  VPYPLSTG  CG+P Y++ C+  G L F +  G    I+ IDPS  R 
Sbjct  25   SFKRCPNCGSTRVPYPLSTGPGCGDPDYKIRCDIRGSLWFDTLNGSTNPIKLIDPSGQRF  84

Query  266  IISPPVILTNTCMSSDLSLGGLTIDQNSPFNISSRNTVMLLNCS-EGIllsplncslssp  442
            +++PP    NTC+S D+   G+ +D N PFN+SS NTV+++NC+ +G+          S 
Sbjct  85   VLAPPGFEPNTCVSVDIKSHGIQLDPNLPFNVSSSNTVIIMNCTKDGLDGYISQGFNCSD  144

Query  443  crvfergvgegrgcgD-----TLCCSYLKDSSMTSHRI-RARVGGCSAYTSVVDLNPGDV  604
              +  + + E           T CC Y   +S+ ++++ RAR   C+AY S ++L   D+
Sbjct  145  NSLCHKFLNENLEARGKCRGVTSCCWYKTGASVNTYKVYRARTDKCTAYQSYMNL---DL  201

Query  605  NFHAWHYG---IELQW  643
                  +G   +E+ W
Sbjct  202  TMPVSKWGEPAVEILW  217



>ref|XP_006838774.1| hypothetical protein AMTR_s00002p00257930 [Amborella trichopoda]
 gb|ERN01343.1| hypothetical protein AMTR_s00002p00257930 [Amborella trichopoda]
Length=666

 Score =   106 bits (265),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 63/195 (32%), Positives = 107/195 (55%), Gaps = 13/195 (7%)
 Frame = +2

Query  95   DNCPKCGTMDVPYPLSTGDSCGNPSYRVYCN--NGVLNFLSATGFYYKIQSIDPSASRLI  268
             +CP CG M+VPYPLSTG +CG+P Y+++C+     L F S     Y++  ID +  R++
Sbjct  28   KSCPNCGAMEVPYPLSTGPNCGDPDYKLFCDPSKQQLFFESLNRSSYRVLRIDRTMQRMV  87

Query  269  ISPPVILTNTCMSSDL-SLGGLTIDQNSPFNISSRNTVMLLNCSEGIllsp---------  418
            +     +  TC++ D+ +  G+ ++Q+ PFNI++ NT+ L NCS  +L+SP         
Sbjct  88   VQASPWVPGTCVTRDMVASEGVWLNQSLPFNITTTNTIFLFNCSPRLLISPLNCTPSSLC  147

Query  419  lncslsspcrvfergvgegrgcgDTLCCSYLKDSSMTSHRIRARVGGCSAYTSVVDLNPG  598
                 SS      R +       +  CC+++   S ++++IR   GGC  Y S+++L+P 
Sbjct  148  HRYLASSGRVDPRRALQCSDEAVNVPCCTFVAGGSPSAYKIRLHNGGCRGYRSILNLDPS  207

Query  599  DVNFHAWHYGIELQW  643
            +     W  G+E+QW
Sbjct  208  EPA-SEWEEGMEIQW  221



>emb|CDP00139.1| unnamed protein product [Coffea canephora]
Length=680

 Score =   106 bits (265),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 65/192 (34%), Positives = 102/192 (53%), Gaps = 7/192 (4%)
 Frame = +2

Query  86   IAYDNCPKCGTMDVPYPLSTGDSCGNPSYRVYCNNGVLNFLSATGFYYKIQSIDPSASRL  265
            ++   CP CG   VPYPLSTG +CG+  Y++ C+ G L F +     Y + S+ P   RL
Sbjct  72   LSAQRCPDCGATPVPYPLSTGPTCGDRLYKLRCSAGSLLFDTLNN-TYPVTSVSPQLQRL  130

Query  266  IISPPVILTNTCMSSDLSLGGLTIDQNSPFNISSRNTVMLLNCSEGIlls----plncsl  433
             I P   L +TC+++D+S  G+ ++ + PFNI+S NT++ LNC++ +L S      +   
Sbjct  131  TIQPSPFLPSTCITADISTQGVQLNSSLPFNITSSNTILYLNCTQTLLSSPLDCTSSSLC  190

Query  434  sspcrvfergvgegrgcgDTLCCSYLKDSSMTSHRIRARVGGCSAYTSVVDLNPGDVNFH  613
             +           G      +CC++    S TS+ IR R  GC AY + V+L+   +   
Sbjct  191  HTFINGTRNVSDGGACENSEICCTFRAGGSSTSYSIRVRDAGCRAYRAFVNLD-YSLPVS  249

Query  614  AW-HYGIELQWI  646
             W   G+ELQW+
Sbjct  250  RWPQPGLELQWV  261



>ref|XP_002308179.2| hypothetical protein POPTR_0006s09120g [Populus trichocarpa]
 gb|EEE91702.2| hypothetical protein POPTR_0006s09120g [Populus trichocarpa]
Length=631

 Score =   106 bits (264),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 66/189 (35%), Positives = 98/189 (52%), Gaps = 4/189 (2%)
 Frame = +2

Query  89   AYDNCPKCGTMDVPYPLSTGDSCGNPSYRVYCNNGVLNFLSATGFYYKIQSIDPSASRLI  268
            A  +C  CG   VP+PLSTG  CGN  Y++ C+ G L F +  G  Y I SI+P   R++
Sbjct  24   ALQHCGNCGLTPVPFPLSTGPDCGNQQYKLRCSFGKLWFDALNGSSYLIASINPVLRRIV  83

Query  269  ISPPVILTNTCMSSDLSLGGLTIDQNSPFNISSRNTVMLLNCSEGIllsplncslsspcr  448
            I P  +    C+SSD    G+ ++QN PF+I++ NT++LLNC   IL        +    
Sbjct  84   IRPASLANKICISSDFHSQGIQLNQNLPFSITNSNTILLLNCKNEILHLKPPIDCAPGSI  143

Query  449  vfergvgegrgcgDT-LCCSYLKDSSMTS-HRIRARVGGCSAYTSVVDLNPGDVNF-HAW  619
                  G    C    LCC++   + + S + I+   GGC+AY S V+L+   V     W
Sbjct  144  CHNYIQGNAAACASAPLCCTFKSSTGLQSAYMIKVYDGGCAAYQSFVNLDVKKVGMIKKW  203

Query  620  -HYGIELQW  643
               G+E++W
Sbjct  204  PEPGVEIEW  212



>ref|XP_010678050.1| PREDICTED: wall-associated receptor kinase-like 20 [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010678051.1| PREDICTED: wall-associated receptor kinase-like 20 [Beta vulgaris 
subsp. vulgaris]
Length=666

 Score =   106 bits (264),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 48/104 (46%), Positives = 67/104 (64%), Gaps = 0/104 (0%)
 Frame = +2

Query  86   IAYDNCPKCGTMDVPYPLSTGDSCGNPSYRVYCNNGVLNFLSATGFYYKIQSIDPSASRL  265
            IA   CP CG   VP+PLST  +CG+P Y+V C  G L F +  G  Y  +SI+P   +L
Sbjct  24   IANLGCPNCGATHVPFPLSTSPTCGHPLYKVRCTKGTLWFDTLNGSSYVAKSINPQMQQL  83

Query  266  IISPPVILTNTCMSSDLSLGGLTIDQNSPFNISSRNTVMLLNCS  397
            +I P  +  NTC++SD   GG+ +D+  PFNISSRNT++ +NC+
Sbjct  84   VIRPQTVDGNTCINSDFHAGGIWLDEKLPFNISSRNTILKINCT  127



>emb|CDY54025.1| BnaA09g54890D [Brassica napus]
Length=657

 Score =   106 bits (264),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 67/196 (34%), Positives = 106/196 (54%), Gaps = 14/196 (7%)
 Frame = +2

Query  89   AYDNCPKCGTMDVPYPLSTGDSCGNPSYRVYCN-NGVLNFLSATGFYYKIQSIDPSASRL  265
            ++  CP CG+  VPYPLSTG  CG+P Y++ C+  G L F +  G    I+ IDPS  R 
Sbjct  25   SFKRCPNCGSTRVPYPLSTGPGCGDPDYKIRCDIRGSLWFDTLNGSTNPIKLIDPSGQRF  84

Query  266  IISPPVILTNTCMSSDLSLGGLTIDQNSPFNISSRNTVMLLNCS-EGIllsplncslssp  442
            +++PP    NTC+S D+   G+ +D N PFN+SS NTV+++NC+ +G+          S 
Sbjct  85   VLAPPGFEPNTCVSVDIKSHGIQLDPNLPFNVSSSNTVIIMNCTKDGLDGYISQGFNCSD  144

Query  443  crvfergvgegrgcgD-----TLCCSYLKDSSMTSHRI-RARVGGCSAYTSVVDLNPGDV  604
              +  + + E           T CC Y   +S+ ++++ RAR   C+AY S ++L   D+
Sbjct  145  NSLCHKFLNENLEARGKCRGVTSCCWYKTGASVNTYKVYRARTDKCTAYQSYMNL---DL  201

Query  605  NFHAWHYG---IELQW  643
                  +G   +E+ W
Sbjct  202  TMPVSKWGEPAVEILW  217



>ref|XP_009601715.1| PREDICTED: wall-associated receptor kinase-like 20 [Nicotiana 
tomentosiformis]
Length=636

 Score =   105 bits (263),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 66/185 (36%), Positives = 92/185 (50%), Gaps = 5/185 (3%)
 Frame = +2

Query  101  CPKCGTMDVPYPLSTGDSCGNPSYRVYCNNGVLNFLSATGFYYKIQSIDPSASRLIISPP  280
            C  CG   VPYPLSTG +CG+ SY+V C+ G L F +     Y I SI P   ++++  P
Sbjct  31   CGNCGKTPVPYPLSTGPNCGDQSYKVRCSAGTLWFDTKGNSSYVITSISPQIQKMVVKTP  90

Query  281  VILTNTCMSSDLSLGGLTIDQNSPFNISSRNTVMLLNCSEGIllsplncslssp---crv  451
             +  NTC+SSD    G+ +D N PFNI+  NT++LLNC+  +L      + SS       
Sbjct  91   TLYPNTCLSSDFYSEGIQLDPNLPFNITGSNTILLLNCTYNMLHLQAPINCSSTCICHPY  150

Query  452  fergvgegrgcgDTLCCSYLKDSSMTSHRIRARVGGCSAYTSVVDLNPGDVNFHAW-HYG  628
              +          +LCC +    S   + IR    GC AY S V L+   +    W   G
Sbjct  151  VNKIQEFAACRRQSLCCIFRTGGSQNEYMIRLNSNGCMAYQSFVGLDT-SLPVEKWPQPG  209

Query  629  IELQW  643
            +EL W
Sbjct  210  LELMW  214



>ref|XP_010504162.1| PREDICTED: wall-associated receptor kinase-like 15 [Camelina 
sativa]
Length=641

 Score =   105 bits (263),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 62/176 (35%), Positives = 98/176 (56%), Gaps = 8/176 (5%)
 Frame = +2

Query  89   AYDNCPKCGTMDVPYPLSTGDSCGNPSYRVYCNN-GVLNFLSATGFYYKIQSIDPSASRL  265
            A+  CP CG+  VPYPLSTG  CG+P Y++ C+  G L F +  G    I++IDPS  R 
Sbjct  27   AFKRCPNCGSTQVPYPLSTGLDCGDPDYKIRCDERGSLWFDTLNGSTNPIKTIDPSGQRF  86

Query  266  IISPPVILTNTCMSSDLSLGGLTIDQNSPFNISSRNTVMLLNCS-EGIllsplncslssp  442
            ++ PP    N C+S D+   G+ +D N PFN+SS NTV+++NC+ +G+          S 
Sbjct  87   VLRPPGFEPNKCVSVDIKYHGIQLDPNLPFNVSSSNTVIIMNCTKDGLDSYSSQGFNCSD  146

Query  443  crvfergvgegrgcgD-----TLCCSYLKDSSMTSHRI-RARVGGCSAYTSVVDLN  592
              +  + + +           + CC Y   +S+ ++++ RAR   CSAY S ++L+
Sbjct  147  NSLCHKFLNQNLEVRSKCRGVSSCCWYKTGASVNTYKVYRARTDMCSAYQSYMNLD  202



>ref|XP_010427044.1| PREDICTED: wall-associated receptor kinase-like 15 [Camelina 
sativa]
Length=640

 Score =   105 bits (262),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 62/176 (35%), Positives = 98/176 (56%), Gaps = 8/176 (5%)
 Frame = +2

Query  89   AYDNCPKCGTMDVPYPLSTGDSCGNPSYRVYCNN-GVLNFLSATGFYYKIQSIDPSASRL  265
            A+  CP CG+  VPYPLSTG  CG+P Y++ C+  G L F +  G    I++IDPS  R 
Sbjct  27   AFKRCPNCGSTQVPYPLSTGLDCGDPDYKIRCDERGSLWFDTLNGSTNPIKTIDPSGQRF  86

Query  266  IISPPVILTNTCMSSDLSLGGLTIDQNSPFNISSRNTVMLLNCS-EGIllsplncslssp  442
            ++ PP    N C+S D+   G+ +D N PFN+SS NTV+++NC+ +G+          S 
Sbjct  87   VLRPPGFEPNRCVSVDIKYHGIQLDPNLPFNVSSSNTVIIMNCTKDGLDSYSSQGFNCSD  146

Query  443  crvfergvgegrgcgD-----TLCCSYLKDSSMTSHRI-RARVGGCSAYTSVVDLN  592
              +  + + +           + CC Y   +S+ ++++ RAR   CSAY S ++L+
Sbjct  147  NSLCHKFLNQNLEARGKCRGVSSCCWYKTGASVNTYKVYRARTDMCSAYQSYMNLD  202



>ref|XP_010046499.1| PREDICTED: wall-associated receptor kinase-like 20 [Eucalyptus 
grandis]
Length=640

 Score =   105 bits (262),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 71/184 (39%), Positives = 101/184 (55%), Gaps = 3/184 (2%)
 Frame = +2

Query  101  CPKCGTMDVPYPLSTGDSCGNPSYRVYCNNGVLNFLSATGFYYKIQSIDPSASRLIISPP  280
            CP CG M VPYPLST  SCG+  Y+V C+ G L F    G  Y I SI+P + RL+I P 
Sbjct  29   CPNCGNMTVPYPLSTRSSCGDQLYKVRCSFGTLFFDVLNGSSYIIMSINPQSQRLVIRPS  88

Query  281  VILTNTCMSSDLSLGGLTIDQNSPFNISSRNTVMLLNCSEGIllsplncslsspcrvfer  460
              + + CMS+D    G+ +D + PFNI+S NT++L+NCS  +L   ++C+ +S C  + R
Sbjct  89   DWVDHACMSADYRSQGIYLDPSLPFNITSSNTLVLMNCSTEMLSLTIDCTTTSICHAYLR  148

Query  461  gvgegrgcgD--TLCCSYLKDSSMTSHRIRARVGGCSAYTSVVDLNPG-DVNFHAWHYGI  631
                        +LCCS     S   + I+ R   C+AY S V+L+    V+      G+
Sbjct  149  DNPLAAASCGNFSLCCSLKTGGSQNEYIIKIRQNRCAAYQSFVNLDTSLPVSKWVAFTGL  208

Query  632  ELQW  643
            EL W
Sbjct  209  ELAW  212



>ref|XP_008359753.1| PREDICTED: wall-associated receptor kinase-like 20 [Malus domestica]
Length=641

 Score =   105 bits (261),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 72/185 (39%), Positives = 97/185 (52%), Gaps = 4/185 (2%)
 Frame = +2

Query  101  CPKCGTMDVPYPLSTGDSCGNPSYRVYCNNGVLNFLSATGFYYKIQSIDPSASRLIISPP  280
            C  CG   VPYPLST   CGN  Y+V C+ G L F +     Y I SI+P   RLII PP
Sbjct  29   CQDCGHTPVPYPLSTSPDCGNQHYKVRCHAGSLWFDALNSSSYLITSINPLTRRLIIRPP  88

Query  281  VILTN-TCMSSDLSLGGLTIDQNSPFNISSRNTVMLLNCSEGIllsplncslsspcrvfe  457
             +  N TCMS+D    GL +D N PFNI+S NTV+ +NCS  +L    NCS +S C  + 
Sbjct  89   GLANNVTCMSADFKSQGLILDDNLPFNITSSNTVIGMNCSYEMLTLSKNCSSNSLCHDYI  148

Query  458  rgvgegrgcgD--TLCCSYLKDSSMTSHRIRARVGGCSAYTSVVDLNPGDVNFHAW-HYG  628
            +             +CC +    S  +++I      CSAY S V+L+      ++W   G
Sbjct  149  KHNAMAASACGCFQICCLFKTGGSTNAYKIXVMKERCSAYESFVNLDSFSGPLNSWPESG  208

Query  629  IELQW  643
            +E+ W
Sbjct  209  VEMMW  213



>ref|XP_004491993.1| PREDICTED: wall-associated receptor kinase-like 20-like [Cicer 
arietinum]
Length=637

 Score =   104 bits (259),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 60/192 (31%), Positives = 94/192 (49%), Gaps = 5/192 (3%)
 Frame = +2

Query  86   IAYDNCPKCGTMDVPYPLSTGDSCGNPSYRVYCNNGVLNFLSATGFYYKIQSIDPSASRL  265
            +   +C  CG+  VPYPLSTG +CG+P Y++ C  G L   +  G  Y I SID    R+
Sbjct  7    VTLQHCGNCGSNPVPYPLSTGPNCGDPHYKIRCTAGTLWLDALAGSSYMIVSIDQKIRRI  66

Query  266  IISPPVILTNTCMSSDLSLGGLTIDQNSPFNISSRNTVMLLNCSEGIlls---plncsls  436
            I  P     N C+S+DL   G+ +++  PF++++ NTV L NC+  +  +          
Sbjct  67   ITRPATFERNKCVSTDLRSEGMHLNETLPFSLAAGNTVFLFNCTVKVQHAPPMDCTVRSL  126

Query  437  spcrvfergvgegrgcgDTLCCSYLKDSSMTSHRIRARVGGCSAYTSVVDLNP--GDVNF  610
                + +            +CCSY+  S    + +R   GGC+AY S +DLN   G V  
Sbjct  127  CHSYIKDHIDNASACGRVGMCCSYVTGSGRKDYVVRVYGGGCAAYMSFLDLNGAVGTVGK  186

Query  611  HAWHYGIELQWI  646
                 G+ ++W+
Sbjct  187  RWPEPGVGIEWV  198



>ref|XP_010515888.1| PREDICTED: wall-associated receptor kinase-like 15 [Camelina 
sativa]
Length=667

 Score =   104 bits (259),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 61/176 (35%), Positives = 97/176 (55%), Gaps = 8/176 (5%)
 Frame = +2

Query  89   AYDNCPKCGTMDVPYPLSTGDSCGNPSYRVYCNN-GVLNFLSATGFYYKIQSIDPSASRL  265
            A+  CP CG+  VPYPLSTG  CG+P Y++ C+  G L F +  G    I++IDP   R 
Sbjct  54   AFKRCPNCGSTQVPYPLSTGLDCGDPDYKIRCDERGSLWFDTLNGSTNPIKTIDPLGQRF  113

Query  266  IISPPVILTNTCMSSDLSLGGLTIDQNSPFNISSRNTVMLLNCS-EGIllsplncslssp  442
            ++ PP    N C+S D+   G+ +D N PFN+SS NTV+++NC+ +G+          S 
Sbjct  114  VLRPPGFEPNRCVSVDIKYHGIQLDPNLPFNVSSSNTVIIMNCTKDGLDSYSSQGFNCSD  173

Query  443  crvfergvgegrgcgD-----TLCCSYLKDSSMTSHRI-RARVGGCSAYTSVVDLN  592
              +  + + +           + CC Y   +S+ ++++ RAR   CSAY S ++L+
Sbjct  174  NSLCHKFLNQNLEARSKCRGVSSCCWYKTGASVNTYKVYRARTDMCSAYQSFMNLD  229



>ref|XP_004305378.1| PREDICTED: wall-associated receptor kinase-like 20-like [Fragaria 
vesca subsp. vesca]
Length=633

 Score =   102 bits (255),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 65/197 (33%), Positives = 102/197 (52%), Gaps = 18/197 (9%)
 Frame = +2

Query  101  CPKCGTMDVPYPLSTGDSCGNPSYRVYCN--NGVLNFLSATGFYYKIQSIDPSASRLIIS  274
            CP CG++ VPYPLST   CG+P Y + C+  +  L   +  G YY +  I PS  R+++ 
Sbjct  32   CPDCGSLKVPYPLSTNPGCGDPDYSLTCDPSSKKLYVQALNGSYYLVLHIMPSYQRMVVQ  91

Query  275  P-PVILTNTCMSSDLSLG-GLTIDQNSPFNISSRNTVMLLNCSEGIll-------splnc  427
            P P +  N C++ DL +  GL ++Q+ PFNI+S NT+ L NCS  +L+       S L  
Sbjct  92   PSPWLPGNECVTRDLVVSEGLWLNQSLPFNITSSNTIFLFNCSPRLLVSPLNCTPSSLCH  151

Query  428  slsspcrvfergvgegrgcgDTLCCSYLKDSSMTSHRIRARVGGCSAYTSVVDLN---PG  598
                     +            LCC+++   + ++++IR    GC A+ S++ L+   P 
Sbjct  152  RYLESSGHVDTQRALKCNRNLNLCCTFVAGGTPSAYKIRLHSSGCKAFRSILHLDTNKPV  211

Query  599  DVNFHAWHYGIELQWIP  649
            D     W  G+E+QW P
Sbjct  212  D----QWEEGLEIQWAP  224



>ref|XP_006584258.1| PREDICTED: wall-associated receptor kinase-like 20-like [Glycine 
max]
Length=588

 Score =   102 bits (253),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 64/184 (35%), Positives = 89/184 (48%), Gaps = 3/184 (2%)
 Frame = +2

Query  98   NCPKCGTMDVPYPLSTGDSCGNPSYRVYCNNGVLNFLSATGFYYKIQSIDPSASRLIISP  277
             C  CG   VPYPLSTG  CG+P Y++ C  G L   +  G  Y I SIDP    +I  P
Sbjct  3    KCGNCGLNPVPYPLSTGPDCGDPWYKIRCTAGTLWLDALAGSAYLISSIDPLTRSIITRP  62

Query  278  PVILTNTCMSSDLSLGGLTIDQNSPFNISSRNTVMLLNCSEGIllsplncslsspcrvfe  457
              I   TC+S+D    G+ +++  PF+++S NTV L NC+          S +    V E
Sbjct  63   ASITPKTCVSTDFHSEGMHLNETLPFSVASGNTVFLFNCTTHAPSMNCAASGTCHRYVKE  122

Query  458  rgvgegrgcgDTLCCSYLKDSSMTSHRIRARVGGCSAYTSVVDLNPGDVNFHAW-HYGIE  634
                   G    +CC Y    S+  + +R   GGC+AY S VD N G      W   G+ 
Sbjct  123  HADFGACGRVG-VCCEYKSAGSLKEYVVRVHGGGCAAYQSFVDFN-GTAAGKRWPEPGVG  180

Query  635  LQWI  646
            ++W+
Sbjct  181  IKWV  184



>ref|XP_002519414.1| serine-threonine protein kinase, plant-type, putative [Ricinus 
communis]
 gb|EEF42828.1| serine-threonine protein kinase, plant-type, putative [Ricinus 
communis]
Length=669

 Score =   102 bits (254),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 63/193 (33%), Positives = 104/193 (54%), Gaps = 11/193 (6%)
 Frame = +2

Query  95   DNCPKCGTMDVPYPLSTGDSCGNPSYRVYCN--NGVLNFLSATGFYYKIQSIDPSASRLI  268
              CP CG M+VPYPLST  SCG+P+Y + C+  +  L F +  G  Y +  I  S  R++
Sbjct  60   KTCPNCGFMEVPYPLSTNPSCGDPNYHLRCDSHSQKLYFDAMNGSSYLVLRIMASFHRMV  119

Query  269  ISPPVILTNTCMSSDLSL-GGLTIDQNSPFNISSRNTVMLLNCSEGIll-------spln  424
            + P   +++TC++ D+ + GGL ++Q  PFN++S NTV L NCS  +L+       S L 
Sbjct  120  VKPSPWVSSTCVTQDMLVSGGLWLNQTLPFNVTSSNTVFLFNCSPRLLVSPLNCTPSSLC  179

Query  425  cslsspcrvfergvgegrgcgDTLCCSYLKDSSMTSHRIRARVGGCSAYTSVVDLNPGDV  604
             S      + ++            CC+++     ++++IR    GC A+ S+++L+P   
Sbjct  180  HSYLESSGLVDKNRSLQCASSLKPCCTFIAGGMPSAYKIRLHSSGCKAFRSILNLDPKRP  239

Query  605  NFHAWHYGIELQW  643
                W  G+E+QW
Sbjct  240  A-SQWEEGLEIQW  251



>ref|XP_008359616.1| PREDICTED: wall-associated receptor kinase-like 20 [Malus domestica]
Length=492

 Score =   100 bits (250),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 65/195 (33%), Positives = 101/195 (52%), Gaps = 15/195 (8%)
 Frame = +2

Query  101  CPKCGTMDVPYPLSTGDSCGNPSYRVYCN--NGVLNFLSATGFYYKIQSIDPSASRLIIS  274
            CP CG+M VPYPLST   CG+P+Y ++C+  +  L F +  G YY +  I     R+++ 
Sbjct  32   CPGCGSMKVPYPLSTNPDCGDPNYSLHCDPSSKKLYFDALNGSYYLVLQIMALYQRMVVQ  91

Query  275  PPVILTNTCMSSDLSLG-GLTIDQNSPFNISSRNTVMLLNCSEGIll-------splncs  430
            P   L   C++ DL +  GL ++Q+ PFNI+S NT+ L NCS  +L+       S L   
Sbjct  92   PSPWLPGKCVTQDLVVSEGLWLNQSLPFNITSSNTIFLYNCSPRLLVSPLNCTPSSLCHR  151

Query  431  lsspcrvfergvgegrgcgDTLCCSYLKDSSMTSHRIRARVGGCSAYTSVVDLNPGDVNF  610
                 R  +            LCC+++     ++++IR    GC A+ S++ L   D+N 
Sbjct  152  YLESSRHIDTNRALQCKNRLNLCCTFVAGGMPSAYKIRLHNSGCKAFRSILHL---DINK  208

Query  611  --HAWHYGIELQWIP  649
                W  G+E+QW P
Sbjct  209  PPSQWEEGLEIQWSP  223



>gb|KCW86003.1| hypothetical protein EUGRSUZ_B02709 [Eucalyptus grandis]
Length=585

 Score =   101 bits (251),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 68/178 (38%), Positives = 102/178 (57%), Gaps = 3/178 (2%)
 Frame = +2

Query  119  MDVPYPLSTGDSCGNPSYRVYCNNGVLNFLSATGFYYKIQSIDPSASRLIISPPVILTNT  298
            M VPYPLSTG SCG+ +Y+V C+ G L F +     Y + SI+P + RL+I P   +   
Sbjct  1    MTVPYPLSTGPSCGDQTYKVRCSFGKLFFDALNESSYVVTSINPQSQRLVIRPSDWVDRA  60

Query  299  CMSSDLSLGGLTIDQNSPFNISSRNTVMLLNCSEGIllsplncslsspcrvfergvgegr  478
            C+S+D    G+ ++++ PF I+S NT++L+NCS  +L    +C+++S C V+ R      
Sbjct  61   CISADYRNQGIYLNRSLPFYITSSNTLVLMNCSTDMLSLAADCTVTSICHVYLRDNPLAA  120

Query  479  gcgDT--LCCSYLKDSSMTSHRIRARVGGCSAYTSVVDLNPG-DVNFHAWHYGIELQW  643
                T  LCCS     S   +RIR R   C+AY S V+L+    V+  A   G+EL+W
Sbjct  121  ASCSTFPLCCSLKTGGSQNEYRIRVRQDRCTAYQSFVNLDTSLPVSKWALFRGLELEW  178



>ref|XP_010037107.1| PREDICTED: wall-associated receptor kinase-like 20 [Eucalyptus 
grandis]
Length=648

 Score =   100 bits (249),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 67/191 (35%), Positives = 107/191 (56%), Gaps = 11/191 (6%)
 Frame = +2

Query  101  CPKCGTMDVPYPLSTGDSCGNPSYRVYCNNG--VLNFLSATGFYYKIQSIDPSASRLIIS  274
            CP CG+M +PYPLST  +CGNP Y ++C+ G   L F +  G  Y +  I  S+ R+++ 
Sbjct  35   CPSCGSMSIPYPLSTSPACGNPDYSLHCDAGSQKLFFNALNGSSYLVIRIIASSQRMVVQ  94

Query  275  PPVILTNTCMSSD-LSLGGLTIDQNSPFNISSRNTVMLLNCSEGIllsplncslsspcrv  451
            P   ++N+C++ D L   GL ++Q  PFN++S NT+   NCS  +L+SPLNC+ SS C  
Sbjct  95   PSPWISNSCVTRDALVSEGLWLNQTLPFNVTSSNTIFFFNCSPRLLVSPLNCTSSSLCHR  154

Query  452  fergvgegrgcgDTL-------CCSYLKDSSMTSHRIRARVGGCSAYTSVVDLNPGDVNF  610
            +    G                CC+++     ++++IR    GC A+ S++ L+P     
Sbjct  155  YLESSGRMDKARAAQCASDLDPCCTFVAGGMPSAYKIRLHSSGCRAFRSILHLDPLKPP-  213

Query  611  HAWHYGIELQW  643
            + W  G+E+QW
Sbjct  214  NQWEEGLEVQW  224



>ref|XP_010654014.1| PREDICTED: wall-associated receptor kinase-like 20 isoform X3 
[Vitis vinifera]
Length=433

 Score = 98.6 bits (244),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 67/197 (34%), Positives = 107/197 (54%), Gaps = 11/197 (6%)
 Frame = +2

Query  89   AYDNCPKCGTMDVPYPLSTGDSCGNPSYRVYC--NNGVLNFLSATGFYYKIQSIDPSASR  262
            +  +CP CG++ VPYPLST  +CG+P Y + C  ++  L F    G  Y +  I  S+ R
Sbjct  28   SQKDCPNCGSIQVPYPLSTNPNCGDPDYSLRCDGDSQKLYFDGLNGSSYLVLRIMASSQR  87

Query  263  LIISPPVILTNTCMSSDLSLG-GLTIDQNSPFNISSRNTVMLLNCSEGIllsplncslss  439
            +++ P   L  TC++ D+ +  GL ++Q  PF I+S NT+ L NCS  +L+SPLNC+ SS
Sbjct  88   MVVQPSPWLPGTCVTQDMPVSEGLWLNQTRPFKITSSNTIFLFNCSPRLLVSPLNCTPSS  147

Query  440  pcrvfergvgegrgcgDTL-------CCSYLKDSSMTSHRIRARVGGCSAYTSVVDLNPG  598
             C  +    G                CC+++     ++++IR    GC A+ S++ L+P 
Sbjct  148  LCHHYLESSGHVDRKRALQCASGLDPCCTFVAGGMPSAYKIRLHSSGCRAFRSILGLDP-  206

Query  599  DVNFHAWHYGIELQWIP  649
            +     W  G+E+QW P
Sbjct  207  EKPPSQWEEGLEIQWAP  223



>ref|XP_006290735.1| hypothetical protein CARUB_v10016831mg [Capsella rubella]
 gb|EOA23633.1| hypothetical protein CARUB_v10016831mg [Capsella rubella]
Length=638

 Score =   100 bits (248),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 62/176 (35%), Positives = 96/176 (55%), Gaps = 8/176 (5%)
 Frame = +2

Query  89   AYDNCPKCGTMDVPYPLSTGDSCGNPSYRVYCNN-GVLNFLSATGFYYKIQSIDPSASRL  265
            A+  CP CGT  VPYPLST   CG+  Y++ C+  G L F +  G    I++IDPS  R 
Sbjct  26   AFKRCPNCGTTPVPYPLSTRLDCGDQDYKIRCDQRGSLWFDTLNGSSNPIKTIDPSGQRF  85

Query  266  IISPPVILTNTCMSSDLSLGGLTIDQNSPFNISSRNTVMLLNCS-EGIllsplncslssp  442
            ++ PP    N C+S D+   G+ +D N PFN+SS NTV+++NC+ +G+          S 
Sbjct  86   VLRPPGFEPNKCVSVDIKYHGIQLDLNLPFNVSSSNTVIIMNCTKDGLDSYSSQGFNCSD  145

Query  443  crvfergvgegrgcgD-----TLCCSYLKDSSMTSHRI-RARVGGCSAYTSVVDLN  592
              +  + + E           + CC Y   +S+ ++++ RAR   CSAY S ++L+
Sbjct  146  NSLCHKFLNENLEARGKCRGVSSCCWYKTGASVNTYKVYRARTEMCSAYQSYMNLD  201



>ref|XP_007027545.1| Kinase family protein [Theobroma cacao]
 gb|EOY08047.1| Kinase family protein [Theobroma cacao]
Length=640

 Score = 99.8 bits (247),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 60/193 (31%), Positives = 100/193 (52%), Gaps = 11/193 (6%)
 Frame = +2

Query  101  CPKCGTMDVPYPLSTGDSCGNPSYRVYCN--NGVLNFLSATGFYYKIQSIDPSASRLIIS  274
            CP CG++++PYPLST  +CG+P Y + C+  +  L F +  G  Y +  I  S  R+++ 
Sbjct  33   CPSCGSIEIPYPLSTHPNCGDPGYSLRCDSQSQKLFFDALNGSSYLVTRIMASFHRMVVQ  92

Query  275  PPVILTNTCMSSDLSLG-GLTIDQNSPFNISSRNTVMLLNCSEGIll-------splncs  430
            P   L + C++ D+ +  GL ++Q  PFNI+S NT+ L NCS  +L+       + L   
Sbjct  93   PSPWLPSKCVTQDMPVSEGLWLNQTLPFNITSSNTIFLFNCSPRLLVSPLNCTPTSLCHR  152

Query  431  lsspcrvfergvgegrgcgDTLCCSYLKDSSMTSHRIRARVGGCSAYTSVVDLNPGDVNF  610
                    E         G  LCC++      ++++IR    GC  + S++ L+P +   
Sbjct  153  YLESSGHVEAKRALQCASGLDLCCTFTAGGMPSAYKIRLHSSGCKGFRSILHLDP-EKPA  211

Query  611  HAWHYGIELQWIP  649
            + W  G+E+QW P
Sbjct  212  NEWEEGLEIQWAP  224



>ref|XP_009340964.1| PREDICTED: wall-associated receptor kinase-like 20 [Pyrus x bretschneideri]
Length=632

 Score = 99.8 bits (247),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 63/197 (32%), Positives = 101/197 (51%), Gaps = 15/197 (8%)
 Frame = +2

Query  95   DNCPKCGTMDVPYPLSTGDSCGNPSYRVYCN--NGVLNFLSATGFYYKIQSIDPSASRLI  268
            + CP CG+M VPYPLST   CG+P+Y ++C+  +  L F +  G YY +  I     R++
Sbjct  30   NTCPGCGSMKVPYPLSTNPDCGDPNYSLHCDPSSKKLYFDALNGSYYLVLQIMAPYQRMV  89

Query  269  ISPPVILTNTCMSSDLSLG-GLTIDQNSPFNISSRNTVMLLNCSEGIll-------spln  424
            + P   L   C++ DL +  G+ ++Q+ PFNI+S NT+ L NCS  +L+       S L 
Sbjct  90   VQPSPWLPGKCVTQDLVVSEGIWLNQSLPFNITSSNTIFLYNCSPRLLVSPLNCTPSSLC  149

Query  425  cslsspcrvfergvgegrgcgDTLCCSYLKDSSMTSHRIRARVGGCSAYTSVVDLNPGDV  604
                      +            LCC+++     ++++IR    GC A+ S++ L   D+
Sbjct  150  HRYLESSGHIDTNRALQCKNRLNLCCTFVAGGMPSAYKIRLHNSGCKAFRSILHL---DI  206

Query  605  NF--HAWHYGIELQWIP  649
            N     W  G+E+QW P
Sbjct  207  NKPPSQWGEGLEIQWAP  223



>ref|XP_009375638.1| PREDICTED: wall-associated receptor kinase-like 20 [Pyrus x bretschneideri]
Length=632

 Score = 99.8 bits (247),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 69/193 (36%), Positives = 105/193 (54%), Gaps = 15/193 (8%)
 Frame = +2

Query  101  CPKCGTMDVPYPLSTGDSCGNPSYRVYCN--NGVLNFLSATGFYYKIQSIDPSASRLIIS  274
            CP CG M VPYPLST   CG+P Y ++C+  +  L   +  G YY +  I  +  R+++ 
Sbjct  32   CPDCGFMKVPYPLSTSPDCGDPDYSLHCDPSSKKLYVHALNGSYYLVLQIMATYQRMVVQ  91

Query  275  PPVILTNTCMSSDLSLG-GLTIDQNSPFNISSRNTVMLLNCSEGIllsplncslsspcrv  451
            P   L   C++ DL +  GL ++Q+ PFNI+S NT+ L NCS  +L+S LNC+ SS C  
Sbjct  92   PSPWLPGKCVTQDLVVSEGLWLNQSLPFNITSSNTIFLFNCSPRLLVSRLNCTSSSLCHR  151

Query  452  fergvgegrgcgD-------TLCCSYLKDSSMTSHRIRARVGGCSAYTSVVDLNPGDVNF  610
            +    G               LCC+++     ++++IR    GC A+ S++ L   D+N 
Sbjct  152  YLESSGHIDTNRALQCENRLNLCCTFVAGGMPSAYKIRLHSSGCKAFRSILHL---DINK  208

Query  611  HA--WHYGIELQW  643
             A  W  G+E+QW
Sbjct  209  PASEWEEGLEIQW  221



>ref|XP_008241439.1| PREDICTED: wall-associated receptor kinase-like 20 [Prunus mume]
Length=699

 Score = 99.8 bits (247),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 62/195 (32%), Positives = 102/195 (52%), Gaps = 15/195 (8%)
 Frame = +2

Query  101  CPKCGTMDVPYPLSTGDSCGNPSYRVYCN--NGVLNFLSATGFYYKIQSIDPSASRLIIS  274
            CP+CG++ VPYPLST   CG+P Y ++C+  +  L   +  G YY +  I     R+++ 
Sbjct  100  CPECGSIKVPYPLSTNPDCGDPDYSLHCDPSSKKLYVDALNGSYYLVLQIMALNQRMLVQ  159

Query  275  PPVILTNTCMSSDLSLG-GLTIDQNSPFNISSRNTVMLLNCSEGIll-------splncs  430
            P   L + C++ D+ +  GL ++Q+ PFNI+S NT+ L NCS  +L+       S L   
Sbjct  160  PSPWLPDKCVTQDMVVSEGLWLNQSLPFNITSSNTIFLFNCSPRLLVSPLNCTPSSLCHR  219

Query  431  lsspcrvfergvgegrgcgDTLCCSYLKDSSMTSHRIRARVGGCSAYTSVVDLNPGDVNF  610
                    +            LCC+++   + ++++IR    GC A+ S++ L   D+N 
Sbjct  220  YLESSGHVDTNRALQCAGKLKLCCTFVAGGTPSAYKIRLHSSGCKAFRSILHL---DINQ  276

Query  611  HA--WHYGIELQWIP  649
             A  W  G+E+QW P
Sbjct  277  PANQWEEGLEIQWAP  291



>ref|XP_007203270.1| hypothetical protein PRUPE_ppa019811mg, partial [Prunus persica]
 gb|EMJ04469.1| hypothetical protein PRUPE_ppa019811mg, partial [Prunus persica]
Length=627

 Score = 99.4 bits (246),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 62/195 (32%), Positives = 101/195 (52%), Gaps = 15/195 (8%)
 Frame = +2

Query  101  CPKCGTMDVPYPLSTGDSCGNPSYRVYCN--NGVLNFLSATGFYYKIQSIDPSASRLIIS  274
            CP+CG++ VPYPLST   CG+P Y ++C+  +  L   +  G YY +  I     R+++ 
Sbjct  32   CPECGSIKVPYPLSTNPHCGDPDYSLHCDPSSKKLYVDALNGSYYLVLQIMAPNQRMLVQ  91

Query  275  PPVILTNTCMSSDLSLG-GLTIDQNSPFNISSRNTVMLLNCSEGIll-------splncs  430
            P   L   C++ D+ +  GL ++Q+ PFNI+S NT+ L NCS  +L+       S L   
Sbjct  92   PSPWLPGQCVTQDMVVSEGLWLNQSLPFNITSSNTIFLFNCSPRLLVSPLNCTPSSLCHR  151

Query  431  lsspcrvfergvgegrgcgDTLCCSYLKDSSMTSHRIRARVGGCSAYTSVVDLNPGDVNF  610
                    +            LCC+++   + ++++IR    GC A+ S++ L   D+N 
Sbjct  152  YLESSGHVDTNRALQCAGKLKLCCTFVAGGTPSAYKIRLHSSGCKAFRSILHL---DINQ  208

Query  611  HA--WHYGIELQWIP  649
             A  W  G+E+QW P
Sbjct  209  PANQWEEGLEIQWAP  223



>gb|KHN02278.1| Wall-associated receptor kinase-like 20 [Glycine soja]
Length=633

 Score = 99.4 bits (246),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 63/193 (33%), Positives = 100/193 (52%), Gaps = 11/193 (6%)
 Frame = +2

Query  101  CPKCGTMDVPYPLSTGDSCGNPSYRVYC--NNGVLNFLSATGFYYKIQSIDPSASRLIIS  274
            C  CG+M VPYPLST  +CG+P Y++ C  ++  L F +  G  Y +  I  S  R+++ 
Sbjct  33   CTNCGSMQVPYPLSTDSTCGDPHYKLRCDPHSQRLFFDTLNGSSYLVLRIMSSNQRMVVE  92

Query  275  PPVILTNTCMSSDLSLG-GLTIDQNSPFNISSRNTVMLLNCSEGIll-----splncsls  436
            P   L  +C++ D+    G+ ++Q+ PFNI+S NTV L NCS  +L+     +  +    
Sbjct  93   PSPWLPGSCVTQDMPRSNGIWLNQSLPFNITSSNTVFLFNCSPRLLVSPLNCTSSSICHR  152

Query  437  spcrvfergvgegrgcgDTL--CCSYLKDSSMTSHRIRARVGGCSAYTSVVDLNPGDVNF  610
                           C + L  CC++L     +++RIR    GC A+ S++ LN  D   
Sbjct  153  YLENSGHVDTKRALECANDLHPCCTFLAGGIPSAYRIRLHDSGCKAFRSIIHLNQ-DKPP  211

Query  611  HAWHYGIELQWIP  649
            + W  G+E+QW P
Sbjct  212  NQWEEGLEIQWAP  224



>ref|XP_003553572.2| PREDICTED: wall-associated receptor kinase-like 20-like [Glycine 
max]
Length=643

 Score = 99.0 bits (245),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 63/193 (33%), Positives = 100/193 (52%), Gaps = 11/193 (6%)
 Frame = +2

Query  101  CPKCGTMDVPYPLSTGDSCGNPSYRVYC--NNGVLNFLSATGFYYKIQSIDPSASRLIIS  274
            C  CG+M VPYPLST  +CG+P Y++ C  ++  L F +  G  Y +  I  S  R+++ 
Sbjct  43   CTNCGSMQVPYPLSTDSTCGDPHYKLRCDPHSQRLFFDTLNGSSYLVLRIMSSNQRMVVE  102

Query  275  PPVILTNTCMSSDLSLG-GLTIDQNSPFNISSRNTVMLLNCSEGIll-----splncsls  436
            P   L  +C++ D+    G+ ++Q+ PFNI+S NTV L NCS  +L+     +  +    
Sbjct  103  PSPWLPGSCVTQDMPRSNGIWLNQSLPFNITSSNTVFLFNCSPRLLVSPLNCTSSSICHR  162

Query  437  spcrvfergvgegrgcgDTL--CCSYLKDSSMTSHRIRARVGGCSAYTSVVDLNPGDVNF  610
                           C + L  CC++L     +++RIR    GC A+ S++ LN  D   
Sbjct  163  YLENSGHVDTKRALECANDLHPCCTFLAGGIPSAYRIRLHDSGCKAFRSIIHLNQ-DKPP  221

Query  611  HAWHYGIELQWIP  649
            + W  G+E+QW P
Sbjct  222  NQWEEGLEIQWAP  234



>gb|KEH24074.1| wall-associated receptor kinase-like protein [Medicago truncatula]
Length=701

 Score = 99.0 bits (245),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 68/191 (36%), Positives = 109/191 (57%), Gaps = 11/191 (6%)
 Frame = +2

Query  101  CPKCGTMDVPYPLSTGDSCGNPSYRVYC--NNGVLNFLSATGFYYKIQSIDPSASRLIIS  274
            CP CG+M VPYPLST  +CG+P YR+ C  ++  L F +  G  Y +  +  S  R+++ 
Sbjct  33   CPNCGSMKVPYPLSTEPNCGDPFYRLRCDPHSQKLYFDTLNGSSYVVLRVMSSIQRMVLQ  92

Query  275  PPVILTNTCMSSDLSLG-GLTIDQNSPFNISSRNTVMLLNCSEGIllsplncslsspcrv  451
            PP  L  +C++ D+ +  G+ ++Q+ PFNI+S NTV + NCS  +L+SPLNCS SS C  
Sbjct  93   PPPWLPGSCVTQDMPVSNGIWLNQSLPFNITSSNTVFIFNCSPRLLVSPLNCSSSSICHR  152

Query  452  fergvgegrgcgDTL-------CCSYLKDSSMTSHRIRARVGGCSAYTSVVDLNPGDVNF  610
            +    G+               CC+++     ++++IR    GC A+ S++ L+  D   
Sbjct  153  YLENSGQVDTNRALECASGLHPCCTFVAGGMPSAYKIRLHSSGCKAFRSILHLD-QDKPP  211

Query  611  HAWHYGIELQW  643
            + W  G+E+QW
Sbjct  212  NQWEEGLEIQW  222



>ref|XP_008351666.1| PREDICTED: wall-associated receptor kinase-like 20 [Malus domestica]
Length=633

 Score = 99.0 bits (245),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 61/193 (32%), Positives = 93/193 (48%), Gaps = 15/193 (8%)
 Frame = +2

Query  101  CPKCGTMDVPYPLSTGDSCGNPSYRVYCNNGVLNFL--SATGFYYKIQSIDPSASRLIIS  274
            CP CG M VPYPLST   CG+P Y ++C+         +  G YY +  I     R+++ 
Sbjct  32   CPDCGXMKVPYPLSTSPDCGDPDYSLHCDPSTKKLFVHALNGSYYLVLQIMAPYQRMVVQ  91

Query  275  PPVILTNTCMSSDLSLG-GLTIDQNSPFNISSRNTVMLLNCSEGI-------llsplncs  430
            P   L   C++ DL +  GL ++Q+ PFNI+S NT+ L NCS  +         S L   
Sbjct  92   PSPWLPGKCVTQDLVVSEGLWLNQSLPFNITSSNTIFLFNCSPRLLVSPLNCTSSSLCHR  151

Query  431  lsspcrvfergvgegrgcgDTLCCSYLKDSSMTSHRIRARVGGCSAYTSVVDLNPGDVNF  610
                    +            LCC+++     ++++IR    GC A+ S++ L   D+N 
Sbjct  152  YLESSGHIDTNRALQCENRLNLCCTFVAGGMPSAYKIRLHSSGCKAFRSILHL---DINK  208

Query  611  HA--WHYGIELQW  643
             A  W  G+E+QW
Sbjct  209  PASQWEEGLEIQW  221



>ref|XP_008442770.1| PREDICTED: wall-associated receptor kinase-like 20 [Cucumis melo]
Length=638

 Score = 98.2 bits (243),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 68/194 (35%), Positives = 110/194 (57%), Gaps = 17/194 (9%)
 Frame = +2

Query  101  CPKCGTMDVPYPLSTGDSCGNPSYRVYC--NNGVLNFLSATGFYYKIQSIDPSASRLIIS  274
            CP+CG+ +VPYPLST  +CGN  Y + C  ++  L F +  G  Y I  I+ S+ R++I 
Sbjct  32   CPRCGSFEVPYPLSTNPNCGNLDYALRCDSHSKKLYFDALNGSSYPILKINASSQRMVIQ  91

Query  275  PPVILTNTCMSSDLSLG-GLTIDQNSPFNISSRNTVMLLNCSEGIllspl--------nc  427
            P   +  +C++ D+ +G GL ++Q+ PFNI+S NT+ LLNCS  +L+SPL        + 
Sbjct  92   PSPWVAGSCVTQDMLVGEGLWLNQSLPFNITSSNTIFLLNCSPRLLVSPLNCTPSSLCHH  151

Query  428  slsspcrvfergvgegrgcgDTLCCSYLKDSSMTSHRIRARVGGCSAYTSVVDLNPGDVN  607
             L++  RV      +     D  CC+++     ++++IR    GC A+ S++ L   DV 
Sbjct  152  YLANSGRVDGERAFQCASVLDP-CCTFIAGGMPSAYKIRLHNSGCRAFRSILHL---DVE  207

Query  608  F--HAWHYGIELQW  643
               + W  G+E+QW
Sbjct  208  KPPNQWEEGLEIQW  221



>emb|CBI30203.3| unnamed protein product [Vitis vinifera]
Length=605

 Score = 98.2 bits (243),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 67/194 (35%), Positives = 106/194 (55%), Gaps = 11/194 (6%)
 Frame = +2

Query  98   NCPKCGTMDVPYPLSTGDSCGNPSYRVYC--NNGVLNFLSATGFYYKIQSIDPSASRLII  271
            +CP CG++ VPYPLST  +CG+P Y + C  ++  L F    G  Y +  I  S+ R+++
Sbjct  31   DCPNCGSIQVPYPLSTNPNCGDPDYSLRCDGDSQKLYFDGLNGSSYLVLRIMASSQRMVV  90

Query  272  SPPVILTNTCMSSDLSLG-GLTIDQNSPFNISSRNTVMLLNCSEGIllsplncslsspcr  448
             P   L  TC++ D+ +  GL ++Q  PF I+S NT+ L NCS  +L+SPLNC+ SS C 
Sbjct  91   QPSPWLPGTCVTQDMPVSEGLWLNQTRPFKITSSNTIFLFNCSPRLLVSPLNCTPSSLCH  150

Query  449  vfergvgegrgcgDTL-------CCSYLKDSSMTSHRIRARVGGCSAYTSVVDLNPGDVN  607
             +    G                CC+++     ++++IR    GC A+ S++ L+P +  
Sbjct  151  HYLESSGHVDRKRALQCASGLDPCCTFVAGGMPSAYKIRLHSSGCRAFRSILGLDP-EKP  209

Query  608  FHAWHYGIELQWIP  649
               W  G+E+QW P
Sbjct  210  PSQWEEGLEIQWAP  223



>ref|XP_010654013.1| PREDICTED: wall-associated receptor kinase-like 20 isoform X2 
[Vitis vinifera]
Length=653

 Score = 97.8 bits (242),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 67/195 (34%), Positives = 106/195 (54%), Gaps = 11/195 (6%)
 Frame = +2

Query  95   DNCPKCGTMDVPYPLSTGDSCGNPSYRVYC--NNGVLNFLSATGFYYKIQSIDPSASRLI  268
             +CP CG++ VPYPLST  +CG+P Y + C  ++  L F    G  Y +  I  S+ R++
Sbjct  30   KDCPNCGSIQVPYPLSTNPNCGDPDYSLRCDGDSQKLYFDGLNGSSYLVLRIMASSQRMV  89

Query  269  ISPPVILTNTCMSSDLSLG-GLTIDQNSPFNISSRNTVMLLNCSEGIllsplncslsspc  445
            + P   L  TC++ D+ +  GL ++Q  PF I+S NT+ L NCS  +L+SPLNC+ SS C
Sbjct  90   VQPSPWLPGTCVTQDMPVSEGLWLNQTRPFKITSSNTIFLFNCSPRLLVSPLNCTPSSLC  149

Query  446  rvfergvgegrgcgDTL-------CCSYLKDSSMTSHRIRARVGGCSAYTSVVDLNPGDV  604
              +    G                CC+++     ++++IR    GC A+ S++ L+P + 
Sbjct  150  HHYLESSGHVDRKRALQCASGLDPCCTFVAGGMPSAYKIRLHSSGCRAFRSILGLDP-EK  208

Query  605  NFHAWHYGIELQWIP  649
                W  G+E+QW P
Sbjct  209  PPSQWEEGLEIQWAP  223



>emb|CAN72920.1| hypothetical protein VITISV_022322 [Vitis vinifera]
Length=1303

 Score = 97.8 bits (242),  Expect = 5e-19, Method: Composition-based stats.
 Identities = 65/192 (34%), Positives = 102/192 (53%), Gaps = 11/192 (6%)
 Frame = +2

Query  104  PKCGTMDVPYPLSTGDSCGNPSYRVYCNNGV--LNFLSATGFYYKIQSIDPSASRLIISP  277
            P   T++VPYPLST  +CG+P Y + C+     L F    G  Y +  I  S+ R+++ P
Sbjct  634  PPNATIEVPYPLSTNPNCGDPDYSLRCDGDSQKLYFDGLNGSSYLVLRIMASSQRMVVQP  693

Query  278  PVILTNTCMSSDLSLG-GLTIDQNSPFNISSRNTVMLLNCSEGIllsplncslss-----  439
               L  TC++ D+ +  GL ++Q  PF I+S NT+ L NCS  +L+SPLNC+ SS     
Sbjct  694  SPWLPGTCVTQDMPVSEGLWLNQTRPFKITSSNTIFLFNCSPRLLVSPLNCTPSSLCHHY  753

Query  440  --pcrvfergvgegrgcgDTLCCSYLKDSSMTSHRIRARVGGCSAYTSVVDLNPGDVNFH  613
                   +R        G   CC+++     ++++IR    GC A+ S++ L+P +    
Sbjct  754  LESSGHVDRKRALQCASGLDPCCTFVAGGMPSAYKIRLHSSGCRAFRSILGLDP-EKPPS  812

Query  614  AWHYGIELQWIP  649
             W  G+E+QW P
Sbjct  813  QWEEGLEIQWAP  824



>ref|XP_008803157.1| PREDICTED: wall-associated receptor kinase-like 20, partial [Phoenix 
dactylifera]
Length=606

 Score = 97.1 bits (240),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 71/176 (40%), Positives = 104/176 (59%), Gaps = 6/176 (3%)
 Frame = +2

Query  134  PLSTGDSCGNPSYRVYCNNGV--LNFLSATGFYYKIQSIDPSASRLIISP-PVILTNTCM  304
            PLST + CG+P Y++ C+N    L F +  G  Y I SI PS  RL+I P P    + C+
Sbjct  1    PLSTAEGCGDPLYKIRCDNTTRSLFFDALNGSSYPITSIHPSIQRLVIRPAPFASASACV  60

Query  305  SSDLSLGGLTIDQNSPFNISSRNTVMLLNCSEGIllsplncslsspcrvfergvgegrgc  484
            ++DL   G+ ++ + PFN+SS NT+MLLNC+  +LLSPLNCS +S C ++     +   C
Sbjct  61   TTDLHSQGIMLNSSLPFNVSSSNTIMLLNCTSRLLLSPLNCSSNSLCHIYVNATADAAAC  120

Query  485  gD-TLCCSYLKDSSMTSHRIRARVGGCSAYTSVVDLNPGDVNFHAW--HYGIELQW  643
               ++CC+++   S TS+ +RA   GCSAY S V+L+        W    G+EL W
Sbjct  121  RPISICCTFVAGGSSTSYAVRASGVGCSAYRSFVNLDAAGTPVARWGDSSGVELLW  176



>emb|CDP10679.1| unnamed protein product [Coffea canephora]
Length=637

 Score = 97.1 bits (240),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 59/193 (31%), Positives = 96/193 (50%), Gaps = 11/193 (6%)
 Frame = +2

Query  101  CPKCGTMDVPYPLSTGDSCGNPSYRVYC--NNGVLNFLSATGFYYKIQSIDPSASRLIIS  274
            CP CG++ +PYPLST  +CG+  Y V C  N+  L F S  G  Y +  + PS  R+++ 
Sbjct  32   CPSCGSLQIPYPLSTNPTCGDSDYHVRCDPNSQKLYFDSLNGSSYLVLRVMPSLQRMVLQ  91

Query  275  PPVILTNTCMSSDLSLG-GLTIDQNSPFNISSRNTVMLLNCSEGIll-------splncs  430
            P   +  TC++ D+    G  ++Q  PFN++S NT+ L NCS  +++       S L   
Sbjct  92   PSPWVPGTCITQDMPRSEGFWLNQTLPFNLTSSNTIFLFNCSPRLMVSPLNCTPSSLCHR  151

Query  431  lsspcrvfergvgegrgcgDTLCCSYLKDSSMTSHRIRARVGGCSAYTSVVDLNPGDVNF  610
                    +         G   CC+++     ++++IR    GC A+ S++ L+  +   
Sbjct  152  YLESSGHVDEERAPKCASGPKPCCTFIAGGMPSAYKIRLHSSGCQAFRSILHLD-AEKPA  210

Query  611  HAWHYGIELQWIP  649
              W  G+ELQW P
Sbjct  211  SEWEEGLELQWAP  223



>ref|XP_010654012.1| PREDICTED: wall-associated receptor kinase-like 20 isoform X1 
[Vitis vinifera]
Length=714

 Score = 96.7 bits (239),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 65/196 (33%), Positives = 105/196 (54%), Gaps = 13/196 (7%)
 Frame = +2

Query  95   DNCPKCGTMDVPYPLSTGDSCGNPSYRVYC--NNGVLNFLSATGFYYKIQSIDPSASRLI  268
             +CP CG++ VPYPLST  +CG+P Y + C  ++  L F    G  Y +  I  S+ R++
Sbjct  30   KDCPNCGSIQVPYPLSTNPNCGDPDYSLRCDGDSQKLYFDGLNGSSYLVLRIMASSQRMV  89

Query  269  ISPPVILTNTCMSSDLSLG-GLTIDQNSPFNISSRNTVMLLNCSEGIllspl--------  421
            + P   L  TC++ D+ +  GL ++Q  PF I+S NT+ L NCS  +L+SPL        
Sbjct  90   VQPSPWLPGTCVTQDMPVSEGLWLNQTRPFKITSSNTIFLFNCSPRLLVSPLNCTPSSLC  149

Query  422  ncslsspcrvfergvgegrgcgDTLCCSYLKDSSMTSHRIRARVGGCSAYTSVVDLNPGD  601
            +  L S   V  +   +     D  CC+++     ++++IR    GC A+ S++ L+P +
Sbjct  150  HHYLESSGHVDRKRALQCASGLDP-CCTFVAGGMPSAYKIRLHSSGCRAFRSILGLDP-E  207

Query  602  VNFHAWHYGIELQWIP  649
                 W  G+E+QW P
Sbjct  208  KPPSQWEEGLEIQWAP  223



>ref|XP_009789812.1| PREDICTED: wall-associated receptor kinase-like 20 isoform X2 
[Nicotiana sylvestris]
Length=580

 Score = 95.9 bits (237),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 65/193 (34%), Positives = 105/193 (54%), Gaps = 11/193 (6%)
 Frame = +2

Query  101  CPKCGTMDVPYPLSTGDSCGNPSYRVYCN--NGVLNFLSATGFYYKIQSIDPSASRLIIS  274
            CP CG+++VPYPLS    CGNP Y + C+  +  L   +  G  Y +  +  S  R+++ 
Sbjct  33   CPNCGSLEVPYPLSINPDCGNPDYSIRCDPHSQKLYLDTLNGSSYVVLRVMASFRRMVVQ  92

Query  275  PPVILTNTCMSSDLSLG-GLTIDQNSPFNISSRNTVMLLNCSEGIllsplncslsspcrv  451
            P   L  TC++ D+ +  GL ++Q  PFN++S NT+ L NCS  +L+SPLNC+ SS C  
Sbjct  93   PSPWLPGTCVTQDMPISEGLWLNQTLPFNVTSSNTIFLFNCSPRLLISPLNCTPSSLCHK  152

Query  452  fergvgegrgcgDTL-------CCSYLKDSSMTSHRIRARVGGCSAYTSVVDLNPGDVNF  610
            +    G      +         CC+++     ++++IR    GC A+ S++ LN  +   
Sbjct  153  YLHSSGHVDPKRELQCASGLDPCCTFVAGGMPSAYKIRLHNSGCRAFRSILHLN-AEKPA  211

Query  611  HAWHYGIELQWIP  649
            + W  G+E+QW P
Sbjct  212  NEWEEGLEIQWSP  224



>ref|XP_006366792.1| PREDICTED: wall-associated receptor kinase-like 20-like [Solanum 
tuberosum]
Length=628

 Score = 96.3 bits (238),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 66/193 (34%), Positives = 107/193 (55%), Gaps = 11/193 (6%)
 Frame = +2

Query  101  CPKCGTMDVPYPLSTGDSCGNPSYRVYCN--NGVLNFLSATGFYYKIQSIDPSASRLIIS  274
            CP CG+++VPYPLST  +CGNP Y + C+  +  L   +  G  Y I  I  S  R+++ 
Sbjct  29   CPNCGSLEVPYPLSTNPNCGNPDYSIRCDPHSHKLYLDTLNGSSYVILRIMASFQRMVVQ  88

Query  275  PPVILTNTCMSSDLSLG-GLTIDQNSPFNISSRNTVMLLNCSEGIllsplncslsspcrv  451
                +  TC++ D+S+  GL ++Q  PFN++S NT+ L NCS  +L+SPLNC+ SS C  
Sbjct  89   SSPWMPGTCVTQDMSVSEGLWLNQTLPFNVTSSNTIFLFNCSPRLLVSPLNCTPSSLCHK  148

Query  452  fergvgegrgcgDTL-------CCSYLKDSSMTSHRIRARVGGCSAYTSVVDLNPGDVNF  610
            +    G      +         CC+++     ++++IR  + GC A+ S++ L+      
Sbjct  149  YLLSSGHVDAKRELQCASGVYPCCTFIAGGMPSAYKIRLHISGCQAFRSILHLDAMKPA-  207

Query  611  HAWHYGIELQWIP  649
            + W  G+E+QW P
Sbjct  208  NEWEEGLEIQWSP  220



>ref|XP_009623508.1| PREDICTED: wall-associated receptor kinase-like 20 [Nicotiana 
tomentosiformis]
Length=623

 Score = 95.5 bits (236),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 75/223 (34%), Positives = 114/223 (51%), Gaps = 16/223 (7%)
 Frame = +2

Query  101  CPKCGTMDVPYPLSTGDSCGNPSYRVYCN--NGVLNFLSATGFYYKIQSIDPSASRLIIS  274
            CP CG+++VPYPLST   CGN  Y + CN  +  L   +  G  Y I     S  R+++ 
Sbjct  31   CPNCGSLEVPYPLSTNPDCGNRDYSIRCNPHSQKLYLDTLNGSSYVILRFMASFRRMVVQ  90

Query  275  PPVILTNTCMSSDLSLG-GLTIDQNSPFNISSRNTVMLLNCSEGIllsplncslsspcrv  451
            P   L  TC++ D+ +  GL ++Q  PFN++S NT+ L NCS  +L+SPLNC+ SS C  
Sbjct  91   PSPWLPGTCVTQDMPISEGLWLNQTLPFNVTSSNTIFLFNCSPRLLISPLNCTPSSLCHK  150

Query  452  fergvgegrgcgDTL-------CCSYLKDSSMTSHRIRARVGGCSAYTSVVDLNPGDVNF  610
            +    G      +         CC+++     ++++IR    GC A+ S++ L+  +   
Sbjct  151  YLHSSGHVDAKRELQCASGLDPCCTFVAGGMPSAYKIRLHSSGCRAFRSILHLD-AEKPA  209

Query  611  HAWHYGIELQWIPLT*DCHCF*LQLCG----CVLLAKLNVFCC  727
            + W  G+E+QW P   + HC     C     C    K  VFCC
Sbjct  210  NEWEEGLEIQWSPPP-EPHCRSQSDCSGASTCSPSGKNGVFCC  251



>gb|KCW86002.1| hypothetical protein EUGRSUZ_B02708 [Eucalyptus grandis]
Length=599

 Score = 95.1 bits (235),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 67/178 (38%), Positives = 97/178 (54%), Gaps = 3/178 (2%)
 Frame = +2

Query  119  MDVPYPLSTGDSCGNPSYRVYCNNGVLNFLSATGFYYKIQSIDPSASRLIISPPVILTNT  298
            M VPYPLST  SCG+  Y+V C+ G L F    G  Y I SI+P + RL+I P   + + 
Sbjct  1    MTVPYPLSTRSSCGDQLYKVRCSFGTLFFDVLNGSSYIIMSINPQSQRLVIRPSDWVDHA  60

Query  299  CMSSDLSLGGLTIDQNSPFNISSRNTVMLLNCSEGIllsplncslsspcrvfergvgegr  478
            CMS+D    G+ +D + PFNI+S NT++L+NCS  +L   ++C+ +S C  + R      
Sbjct  61   CMSADYRSQGIYLDPSLPFNITSSNTLVLMNCSTEMLSLTIDCTTTSICHAYLRDNPLAA  120

Query  479  gcgD--TLCCSYLKDSSMTSHRIRARVGGCSAYTSVVDLNPG-DVNFHAWHYGIELQW  643
                  +LCCS     S   + I+ R   C+AY S V+L+    V+      G+EL W
Sbjct  121  ASCGNFSLCCSLKTGGSQNEYIIKIRQNRCAAYQSFVNLDTSLPVSKWVAFTGLELAW  178



>ref|XP_009789810.1| PREDICTED: wall-associated receptor kinase-like 20 isoform X1 
[Nicotiana sylvestris]
Length=632

 Score = 95.1 bits (235),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 65/193 (34%), Positives = 105/193 (54%), Gaps = 11/193 (6%)
 Frame = +2

Query  101  CPKCGTMDVPYPLSTGDSCGNPSYRVYCN--NGVLNFLSATGFYYKIQSIDPSASRLIIS  274
            CP CG+++VPYPLS    CGNP Y + C+  +  L   +  G  Y +  +  S  R+++ 
Sbjct  33   CPNCGSLEVPYPLSINPDCGNPDYSIRCDPHSQKLYLDTLNGSSYVVLRVMASFRRMVVQ  92

Query  275  PPVILTNTCMSSDLSLG-GLTIDQNSPFNISSRNTVMLLNCSEGIllsplncslsspcrv  451
            P   L  TC++ D+ +  GL ++Q  PFN++S NT+ L NCS  +L+SPLNC+ SS C  
Sbjct  93   PSPWLPGTCVTQDMPISEGLWLNQTLPFNVTSSNTIFLFNCSPRLLISPLNCTPSSLCHK  152

Query  452  fergvgegrgcgDTL-------CCSYLKDSSMTSHRIRARVGGCSAYTSVVDLNPGDVNF  610
            +    G      +         CC+++     ++++IR    GC A+ S++ LN  +   
Sbjct  153  YLHSSGHVDPKRELQCASGLDPCCTFVAGGMPSAYKIRLHNSGCRAFRSILHLN-AEKPA  211

Query  611  HAWHYGIELQWIP  649
            + W  G+E+QW P
Sbjct  212  NEWEEGLEIQWSP  224



>ref|XP_010098860.1| Wall-associated receptor kinase-like 20 [Morus notabilis]
 gb|EXB75948.1| Wall-associated receptor kinase-like 20 [Morus notabilis]
Length=631

 Score = 94.4 bits (233),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 66/197 (34%), Positives = 105/197 (53%), Gaps = 19/197 (10%)
 Frame = +2

Query  101  CPKCGTMDVPYPLSTGDSCGNPSYRVYCN--NGVLNFLSATGFYYKIQSIDPSASRLIIS  274
            CP CG + VPYPLST  +CG+  Y + C+  +  L F +  G  Y +  I     RL++ 
Sbjct  31   CPPCGPIQVPYPLSTNPNCGDKDYTLRCDPFSKKLYFDALNGTTYVVLRIMAQLQRLVVR  90

Query  275  PPVILTNTCMSSDLSLG-GLTIDQNSPFNISSRNTVMLLNCSEGIllspl--------nc  427
            P   L   C++ D+ +G GL ++Q+ PFNI+S NT+ LLNCS  +L+SPL        + 
Sbjct  91   PSPWLPGKCVTRDMEVGEGLWLNQSLPFNITSSNTIFLLNCSPRLLVSPLNCTPSSLCHR  150

Query  428  slsspcrvfergvgegrgcgDTLCCSYLKDSSMTSHRIRARVGGCSAYTSVVDLN---PG  598
             L S   V  +   +     D  CC+++     ++++IR    GC A+ S++ L+   P 
Sbjct  151  YLESSGHVDSKRAFQCASDLDP-CCTFIAGGMPSAYKIRLHSSGCRAFRSILHLDMEKPA  209

Query  599  DVNFHAWHYGIELQWIP  649
            ++    W  G+E+QW P
Sbjct  210  NL----WEEGLEIQWAP  222



>ref|XP_006446164.1| hypothetical protein CICLE_v10017557mg [Citrus clementina]
 gb|ESR59404.1| hypothetical protein CICLE_v10017557mg [Citrus clementina]
Length=646

 Score = 94.4 bits (233),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 56/193 (29%), Positives = 99/193 (51%), Gaps = 11/193 (6%)
 Frame = +2

Query  101  CPKCGTMDVPYPLSTGDSCGNPSYRVYCN--NGVLNFLSATGFYYKIQSIDPSASRLIIS  274
            CP CG + VPYPLST   CG+P+Y + C+  +  L F +  G  Y +     S+ R+++ 
Sbjct  34   CPSCGPIQVPYPLSTNPKCGDPNYLLRCDLHSHKLYFDALNGSSYLVLRTMASSQRIVMQ  93

Query  275  PPVILTNTCMSSDL-SLGGLTIDQNSPFNISSRNTVMLLNCSEGI-------llsplncs  430
            P   + ++C++ D+ +  GL ++Q+ PFN++S NT+ L NCS  +         S L  +
Sbjct  94   PASWINDSCVTHDMVTSEGLWLNQSLPFNVTSSNTIFLFNCSPRLLISPLNCSSSSLCHN  153

Query  431  lsspcrvfergvgegrgcgDTLCCSYLKDSSMTSHRIRARVGGCSAYTSVVDLNPGDVNF  610
                    ++            CC+++     ++++IR    GC A+ S++ L+P     
Sbjct  154  FLESPEHVDKKRALQCASELEPCCTFIAGGMPSAYKIRLHSSGCKAFRSILHLDPNK-PA  212

Query  611  HAWHYGIELQWIP  649
            + W  G+E+QW P
Sbjct  213  NQWEEGLEIQWAP  225



>gb|KGN59036.1| hypothetical protein Csa_3G748160 [Cucumis sativus]
Length=524

 Score = 93.6 bits (231),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 64/193 (33%), Positives = 104/193 (54%), Gaps = 15/193 (8%)
 Frame = +2

Query  101  CPKCGTMDVPYPLSTGDSCGNPSYRVYC--NNGVLNFLSATGFYYKIQSIDPSASRLIIS  274
            CP+CG+ +VPYPLST  +CG+  Y + C  ++  L F +  G  Y I  I+ S+ RL+I 
Sbjct  29   CPRCGSFEVPYPLSTNPNCGDLDYALRCDSHSKKLYFDALNGSSYPILKINASSQRLVIL  88

Query  275  PPVILTNTCMSSDLSLG-GLTIDQNSPFNISSRNTVMLLNCSEGIllspln-------cs  430
            P   +  +C++ D+ +  GL ++Q+ PFNI+S NT+ LLNCS  +L+SPLN         
Sbjct  89   PSPWVAGSCVTQDMLVSEGLWLNQSLPFNITSSNTIFLLNCSPRLLVSPLNCTPSSLCHH  148

Query  431  lsspcrvfergvgegrgcgDTLCCSYLKDSSMTSHRIRARVGGCSAYTSVVDLNPGDVNF  610
              +     +             CC+++     ++++IR    GC A+ S++ L   DV  
Sbjct  149  YLANSGRVDGERAFQCASVLDPCCTFIPGGMPSAYKIRLHNSGCRAFRSILHL---DVEK  205

Query  611  --HAWHYGIELQW  643
              + W  G+E+QW
Sbjct  206  PPNQWEEGLEIQW  218



>ref|XP_006470647.1| PREDICTED: wall-associated receptor kinase-like 20-like [Citrus 
sinensis]
 gb|KDO61204.1| hypothetical protein CISIN_1g006402mg [Citrus sinensis]
Length=646

 Score = 94.0 bits (232),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 56/193 (29%), Positives = 99/193 (51%), Gaps = 11/193 (6%)
 Frame = +2

Query  101  CPKCGTMDVPYPLSTGDSCGNPSYRVYCN--NGVLNFLSATGFYYKIQSIDPSASRLIIS  274
            CP CG + VPYPLST   CG+P+Y + C+  +  L F +  G  Y +     S+ R+++ 
Sbjct  34   CPSCGPIQVPYPLSTNPKCGDPNYLLRCDLHSHKLYFDALNGSSYLVLRTMASSQRIVMQ  93

Query  275  PPVILTNTCMSSDL-SLGGLTIDQNSPFNISSRNTVMLLNCSEGI-------llsplncs  430
            P   + ++C++ D+ +  GL ++Q+ PFN++S NT+ L NCS  +         S L  +
Sbjct  94   PASWINDSCVTHDMVTSEGLWLNQSLPFNVTSSNTIFLFNCSPRLLISPLNCSSSSLCHN  153

Query  431  lsspcrvfergvgegrgcgDTLCCSYLKDSSMTSHRIRARVGGCSAYTSVVDLNPGDVNF  610
                    ++            CC+++     ++++IR    GC A+ S++ L+P     
Sbjct  154  FLESPEHVDKKRALQCASELEPCCTFIAGGMPSAYKIRLHSSGCKAFRSILHLDPNK-PA  212

Query  611  HAWHYGIELQWIP  649
            + W  G+E+QW P
Sbjct  213  NQWEEGLEIQWAP  225



>ref|XP_004161272.1| PREDICTED: wall-associated receptor kinase-like 20-like [Cucumis 
sativus]
Length=635

 Score = 93.6 bits (231),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 67/194 (35%), Positives = 109/194 (56%), Gaps = 17/194 (9%)
 Frame = +2

Query  101  CPKCGTMDVPYPLSTGDSCGNPSYRVYC--NNGVLNFLSATGFYYKIQSIDPSASRLIIS  274
            CP+CG+ +VPYPLST  +CG+  Y + C  ++  L F +  G  Y I  I+ S+ RL+I 
Sbjct  29   CPRCGSFEVPYPLSTNPNCGDLDYALRCDSHSKKLYFDALNGSSYPILKINASSQRLVIL  88

Query  275  PPVILTNTCMSSDLSLG-GLTIDQNSPFNISSRNTVMLLNCSEGIllspl--------nc  427
            P   +  +C++ D+ +  GL ++Q+ PFNI+S NT+ LLNCS  +L+SPL        + 
Sbjct  89   PSPWVAGSCVTQDMLVSEGLWLNQSLPFNITSSNTIFLLNCSPRLLVSPLNCTPSSLCHH  148

Query  428  slsspcrvfergvgegrgcgDTLCCSYLKDSSMTSHRIRARVGGCSAYTSVVDLNPGDVN  607
             L++  RV      +     D  CC+++     ++++IR    GC A+ S++ L   DV 
Sbjct  149  YLANSGRVDGERAFQCASVLDP-CCTFIPGGMPSAYKIRLHNSGCRAFRSILHL---DVE  204

Query  608  F--HAWHYGIELQW  643
               + W  G+E+QW
Sbjct  205  KPPNQWEEGLEIQW  218



>ref|XP_004494110.1| PREDICTED: wall-associated receptor kinase-like 20-like isoform 
X1 [Cicer arietinum]
 ref|XP_004494111.1| PREDICTED: wall-associated receptor kinase-like 20-like isoform 
X2 [Cicer arietinum]
Length=633

 Score = 93.2 bits (230),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 67/191 (35%), Positives = 106/191 (55%), Gaps = 11/191 (6%)
 Frame = +2

Query  101  CPKCGTMDVPYPLSTGDSCGNPSYRVYC--NNGVLNFLSATGFYYKIQSIDPSASRLIIS  274
            CP CG M+VPYPLST  +CG+  YR+ C  ++  L F +  G  Y +  I  S  R+++ 
Sbjct  33   CPNCGFMNVPYPLSTDPNCGDSYYRLRCDPHSQKLYFDTLNGSSYVVLRIMSSIQRIVVQ  92

Query  275  PPVILTNTCMSSDLSLG-GLTIDQNSPFNISSRNTVMLLNCSEGIllsplncslsspcrv  451
            PP  L  +C++ D+ +  G+ ++Q+ PF I+S NTV L NCS  +L+SPLNC+ SS C  
Sbjct  93   PPPWLPGSCVTQDMPVSNGIWLNQSLPFKITSSNTVFLFNCSPRLLVSPLNCTSSSTCHR  152

Query  452  fergvgegrgcgDTL-------CCSYLKDSSMTSHRIRARVGGCSAYTSVVDLNPGDVNF  610
            +    G                CC+++     ++++IR    GC A+ S++ L+  D   
Sbjct  153  YLENSGHVDTKRALECASGLHPCCTFVAGGMPSAYKIRLHDSGCRAFRSILHLDQ-DKPP  211

Query  611  HAWHYGIELQW  643
            + W  G+E+QW
Sbjct  212  NQWEEGLEIQW  222



>ref|XP_003520675.1| PREDICTED: wall-associated receptor kinase-like 20-like [Glycine 
max]
Length=627

 Score = 93.2 bits (230),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 69/193 (36%), Positives = 105/193 (54%), Gaps = 11/193 (6%)
 Frame = +2

Query  101  CPKCGTMDVPYPLSTGDSCGNPSYRVYCN--NGVLNFLSATGFYYKIQSIDPSASRLIIS  274
            CP CGT+ VPYPLST  +CG+ +Y++ C+  +  L F    G  Y +  I  S  R+++ 
Sbjct  27   CPNCGTIQVPYPLSTDSTCGDQNYKLRCDPHSQRLLFDILNGSSYLVLRIMSSNQRMVVQ  86

Query  275  PPVILTNTCMSSDLSLG-GLTIDQNSPFNISSRNTVMLLNCSEGIllsplncslsspcrv  451
            P   L  +C++ D+    G+ ++Q+ PFNI+S NTV L NCS  +L+SPLNC+ SS C  
Sbjct  87   PSPWLPGSCVTQDMPRSNGIWLNQSLPFNITSSNTVFLFNCSPRLLVSPLNCTSSSICHR  146

Query  452  fergvgegrgcgDTL-------CCSYLKDSSMTSHRIRARVGGCSAYTSVVDLNPGDVNF  610
            +    G                CC++L     +++RIR    GC A+ S++ LN  D   
Sbjct  147  YLENSGHVDTKLSLECASGLHPCCTFLAGGIPSAYRIRLHDSGCKAFRSIIHLNQ-DKPP  205

Query  611  HAWHYGIELQWIP  649
            + W   +E+QW P
Sbjct  206  NQWEEVLEIQWSP  218



>ref|XP_004137999.1| PREDICTED: wall-associated receptor kinase-like 20-like [Cucumis 
sativus]
Length=641

 Score = 93.2 bits (230),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 67/194 (35%), Positives = 109/194 (56%), Gaps = 17/194 (9%)
 Frame = +2

Query  101  CPKCGTMDVPYPLSTGDSCGNPSYRVYC--NNGVLNFLSATGFYYKIQSIDPSASRLIIS  274
            CP+CG+ +VPYPLST  +CG+  Y + C  ++  L F +  G  Y I  I+ S+ RL+I 
Sbjct  29   CPRCGSFEVPYPLSTNPNCGDLDYALRCDSHSKKLYFDALNGSSYPILKINASSQRLVIL  88

Query  275  PPVILTNTCMSSDLSLG-GLTIDQNSPFNISSRNTVMLLNCSEGIllspl--------nc  427
            P   +  +C++ D+ +  GL ++Q+ PFNI+S NT+ LLNCS  +L+SPL        + 
Sbjct  89   PSPWVAGSCVTQDMLVSEGLWLNQSLPFNITSSNTIFLLNCSPRLLVSPLNCTPSSLCHH  148

Query  428  slsspcrvfergvgegrgcgDTLCCSYLKDSSMTSHRIRARVGGCSAYTSVVDLNPGDVN  607
             L++  RV      +     D  CC+++     ++++IR    GC A+ S++ L   DV 
Sbjct  149  YLANSGRVDGERAFQCASVLDP-CCTFIPGGMPSAYKIRLHNSGCRAFRSILHL---DVE  204

Query  608  F--HAWHYGIELQW  643
               + W  G+E+QW
Sbjct  205  KPPNQWEEGLEIQW  218



>ref|XP_011018851.1| PREDICTED: wall-associated receptor kinase-like 20 [Populus euphratica]
Length=645

 Score = 92.0 bits (227),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 67/195 (34%), Positives = 107/195 (55%), Gaps = 15/195 (8%)
 Frame = +2

Query  101  CPKCGTMDVPYPLSTGDSCGNPSYRVYC--NNGVLNFLSATGFYYKIQSIDPSASRLII-  271
            CP CG+M VPYPLST  +CG+P+Y + C  ++  L F +  G  Y +  I  S  R+++ 
Sbjct  35   CPNCGSMQVPYPLSTKSTCGDPNYHLRCDSHSQKLYFDAMNGSSYLVLRIMASFQRMVVQ  94

Query  272  -SPPVILTNTCMSSDLSLG-GLTIDQNSPFNISSRNTVMLLNCSEGIllsplncslsspc  445
             SP V  ++ C++ D+ +  GL ++Q  PFN++  NT+ L NCS  +LL+PLNC+ SS C
Sbjct  95   PSPWVSASSACVTQDMVVSEGLRLNQTLPFNLTFSNTIFLYNCSPRLLLTPLNCTPSSLC  154

Query  446  rvfergvgegrgcgDTL---------CCSYLKDSSMTSHRIRARVGGCSAYTSVVDLNPG  598
              +    G                  CC+++     +++RIR    GC A+ S++ L+P 
Sbjct  155  HRYLESSGHVDKNRALKCAGSPDLRPCCTFVAGGMPSAYRIRLHNSGCKAFRSILSLDP-  213

Query  599  DVNFHAWHYGIELQW  643
            +     W  G+E+QW
Sbjct  214  EKPASQWEEGVEIQW  228



>ref|XP_006381343.1| hypothetical protein POPTR_0006s12000g [Populus trichocarpa]
 gb|ERP59140.1| hypothetical protein POPTR_0006s12000g [Populus trichocarpa]
Length=645

 Score = 89.7 bits (221),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 62/195 (32%), Positives = 103/195 (53%), Gaps = 15/195 (8%)
 Frame = +2

Query  101  CPKCGTMDVPYPLSTGDSCGNPSYRVYC--NNGVLNFLSATGFYYKIQSIDPSASRLII-  271
            CP CG++ VPYPLST  +CG+P+Y + C  ++  L F +  G  Y +  I  S  R+++ 
Sbjct  35   CPNCGSIQVPYPLSTYSTCGDPNYHLRCDSHSQKLYFDAMNGSSYLVLRIMASFQRMVVQ  94

Query  272  -SPPVILTNTCMSSDLSLG-GLTIDQNSPFNISSRNTVMLLNCSEGIllsp---------  418
             SP V  ++ C++ D+ +  GL ++Q  PFN++  NT+ L NCS  +LL+P         
Sbjct  95   PSPWVSASSACVTQDMVVSEGLRLNQTLPFNLTFSNTIFLYNCSPRLLLTPLNCTPSSLC  154

Query  419  lncslsspcrvfergvgegrgcgDTLCCSYLKDSSMTSHRIRARVGGCSAYTSVVDLNPG  598
                 SS      R +        + CC+++     +++RIR    GC A+ S++ L+P 
Sbjct  155  HRYLESSGHVDKNRALKCAGSPDLSPCCTFVAGGMPSAYRIRLHNSGCKAFRSILSLDP-  213

Query  599  DVNFHAWHYGIELQW  643
            +     W  G+E+QW
Sbjct  214  EKPASQWEEGVEIQW  228



>gb|KCW65575.1| hypothetical protein EUGRSUZ_G02969, partial [Eucalyptus grandis]
Length=563

 Score = 89.4 bits (220),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 65/171 (38%), Positives = 95/171 (56%), Gaps = 5/171 (3%)
 Frame = +2

Query  143  TGDSCGNPSYRVYCNNGVLNFLSATGFYYKIQSIDPSASRLIISPPVILTNTCMSSDLSL  322
            T  +CG+ SY+V C+ G           Y I S+DP   RL++ P  +L NTC++SDL  
Sbjct  1    TSPTCGDQSYKVQCDAGGTLLFDTLNNSYPITSVDPENQRLVVQPASLLANTCVTSDLVH  60

Query  323  GGLTIDQNSPFNISSRNTVMLLNCSEGIllspln-cslsspcrvfergvgegrgcgDTLC  499
             G+ ++ + PFN++S NT++ LNC+  +L SPLN  S S          G        +C
Sbjct  61   QGVQLNSSLPFNVTSSNTILYLNCNSTLLNSPLNCSSASLCHTYVNGTAGAAACGAAAIC  120

Query  500  CSYLKDSSMTSHRIRARVGGCSAYTSVVDLNPGD-VNFHAW-HYGIELQWI  646
            C++    S TS+ IR R  GC AYTS V+L+P + VN   W   G+E+QW+
Sbjct  121  CTFRAGGSTTSYSIRVRDAGCRAYTSFVNLDPSEPVNL--WPKPGMEIQWV  169



>gb|KCW48772.1| hypothetical protein EUGRSUZ_K02415 [Eucalyptus grandis]
Length=608

 Score = 89.4 bits (220),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 63/185 (34%), Positives = 102/185 (55%), Gaps = 11/185 (6%)
 Frame = +2

Query  119  MDVPYPLSTGDSCGNPSYRVYCNNG--VLNFLSATGFYYKIQSIDPSASRLIISPPVILT  292
            M +PYPLST  +CGNP Y ++C+ G   L F +  G  Y +  I  S+ R+++ P   ++
Sbjct  1    MSIPYPLSTSPACGNPDYSLHCDAGSQKLFFNALNGSSYLVIRIIASSQRMVVQPSPWIS  60

Query  293  NTCMSSD-LSLGGLTIDQNSPFNISSRNTVMLLNCSEGIllsplncslsspcrvfergvg  469
            N+C++ D L   GL ++Q  PFN++S NT+   NCS  +L+SPLNC+ SS C  +    G
Sbjct  61   NSCVTRDALVSEGLWLNQTLPFNVTSSNTIFFFNCSPRLLVSPLNCTSSSLCHRYLESSG  120

Query  470  egrgcgDTL-------CCSYLKDSSMTSHRIRARVGGCSAYTSVVDLNPGDVNFHAWHYG  628
                            CC+++     ++++IR    GC A+ S++ L+P     + W  G
Sbjct  121  RMDKARAAQCASDLDPCCTFVAGGMPSAYKIRLHSSGCRAFRSILHLDPLKPP-NQWEEG  179

Query  629  IELQW  643
            +E+QW
Sbjct  180  LEVQW  184



>ref|XP_010088590.1| Wall-associated receptor kinase-like 20 [Morus notabilis]
 gb|EXB36731.1| Wall-associated receptor kinase-like 20 [Morus notabilis]
Length=657

 Score = 86.3 bits (212),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 44/106 (42%), Positives = 60/106 (57%), Gaps = 1/106 (1%)
 Frame = +2

Query  89   AYDNCPKCGTMDVPYPLSTGDSCGN-PSYRVYCNNGVLNFLSATGFYYKIQSIDPSASRL  265
            A   C  CG   VPYPLSTG  CG  P Y++ C  G L F +  G  Y I +I+P   R+
Sbjct  26   AVQPCLNCGRTLVPYPLSTGPGCGEYPLYKIRCTAGTLFFDALNGSSYPIIAINPVTQRI  85

Query  266  IISPPVILTNTCMSSDLSLGGLTIDQNSPFNISSRNTVMLLNCSEG  403
             I P  I  N C++ D    G+ +D+N PF I++ NT+ LLNC++ 
Sbjct  86   TIRPTGISANACIAGDYHSRGIQLDRNLPFRIAAGNTIFLLNCTDA  131



>ref|XP_006388356.1| hypothetical protein POPTR_0212s00200g [Populus trichocarpa]
 gb|ERP47270.1| hypothetical protein POPTR_0212s00200g [Populus trichocarpa]
Length=202

 Score = 79.0 bits (193),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 61/179 (34%), Positives = 100/179 (56%), Gaps = 14/179 (8%)
 Frame = +2

Query  101  CPKCGTMDVPYPLSTGDSCGNPSYRVYC--NNGVLNFLSATGFYYKIQSIDPSASRLII-  271
            CP CG++ VPYPLST  +CG+P+Y + C  ++  L F +  G  Y +  I  S  R+++ 
Sbjct  18   CPNCGSIQVPYPLSTYSTCGDPNYHLRCDSHSQKLYFDAMNGSSYLVLRIMASFQRMVVQ  77

Query  272  -SPPVILTNTCMSSDLSLG-GLTIDQNSPFNISSRNTVMLLNCSEGIllsplncslsspc  445
             SP V  ++ C++ D+ +  GL ++Q  PFN++  NT+ L NCS  +LL+PLNC+ SS C
Sbjct  78   PSPWVSASSACVTQDMVVSEGLRLNQTLPFNLTFSNTIFLYNCSPRLLLTPLNCTPSSLC  137

Query  446  rvfergvgegrgcgD---------TLCCSYLKDSSMTSHRIRARVGGCSAYTSVVDLNP  595
              +    G                + CC+++     +++RIR    GC A+ S++ L+P
Sbjct  138  HRYLESSGHVDKNRALKCAGSPDLSPCCTFVAGGMPSAYRIRLHNSGCKAFRSILSLDP  196



>gb|EMT22815.1| Wall-associated receptor kinase-like 20 [Aegilops tauschii]
Length=555

 Score = 72.4 bits (176),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 35/81 (43%), Positives = 51/81 (63%), Gaps = 5/81 (6%)
 Frame = +2

Query  101  CPKCGTMDVPYPLSTGDSCGNPSYRVYCNNGV----LNFLSATGFYYKIQSIDPSASRLI  268
            CP CG+  VPYPLST D CG+P+Y+V C  G     L F +  G  Y I S+ P+A RL+
Sbjct  36   CPPCGSTAVPYPLSTADGCGDPAYKVRCAAGASTSTLFFDALNGTSYPITSVSPAAQRLV  95

Query  269  ISP-PVILTNTCMSSDLSLGG  328
            ++P P++  ++C+S   + GG
Sbjct  96   VAPAPLVSNDSCVSPPATWGG  116



>ref|XP_007222517.1| hypothetical protein PRUPE_ppa009847mg [Prunus persica]
 gb|EMJ23716.1| hypothetical protein PRUPE_ppa009847mg [Prunus persica]
Length=274

 Score = 70.1 bits (170),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 38/98 (39%), Positives = 59/98 (60%), Gaps = 6/98 (6%)
 Frame = +2

Query  110  CGTMDVPYPLSTGDSCGNPSYRVY--CNNGVLNFLSATGFYYKIQSIDPSASRLIISPPV  283
            CGT+ V +P  TG  CG+P +  Y  C++G L F + TG Y  I SID ++S ++++ P+
Sbjct  42   CGTIPVKFPFGTGFGCGHPDFVRYIKCSSGTLQFSTGTGIY-TISSIDYNSSTIVVTDPL  100

Query  284  ILTNTCMSSDLSLGGLTIDQNSPFNISSRNTVMLLNCS  397
            + T + M +    GG ++D+ SPF I   N  +LL CS
Sbjct  101  MSTCSSMQNS---GGFSLDRTSPFTIREENIFVLLGCS  135



>ref|XP_002311340.2| hypothetical protein POPTR_0008s09540g, partial [Populus trichocarpa]
 gb|EEE88707.2| hypothetical protein POPTR_0008s09540g, partial [Populus trichocarpa]
Length=290

 Score = 70.1 bits (170),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 55/191 (29%), Positives = 83/191 (43%), Gaps = 17/191 (9%)
 Frame = +2

Query  110  CGTMDVPYPLSTGDSCGNPSYRVY--CNNGVLNFLSATGFYYKIQSIDPSASRLIISPPV  283
            CGT+ V YP  +G  CG+P +  Y  CN G L F + TG  Y +  ID S+  LII  P 
Sbjct  40   CGTISVKYPFGSGFGCGHPDFARYVRCNAGTLEFSTGTGI-YNVSDIDYSSGTLIIRDPF  98

Query  284  ILTNTCMSSDLSLGGLTIDQNSPFNISSRNTVMLLNCSEG-----------Illsplncs  430
            + T + M +    G  ++D+ SPF ++  N  +LL CS              + S     
Sbjct  99   MSTCSSMQNS---GSFSLDRASPFTLTGENIFVLLGCSTNSPLFDPAEDLCAMGSRSRVC  155

Query  431  lsspcrvfergvgegrgcgDTLCCSYLKDSSMTSHRIRARVGGCSAYTSVVDLNPGDVNF  610
                      G+G  +    + CC Y     +  + +      CS+YTSV      + + 
Sbjct  156  RGLYSCKGVTGIGLPQNAPPSTCCVYESPIQLAGYTLDLPKLQCSSYTSVYSFGGSEGDP  215

Query  611  HAWHYGIELQW  643
              W +GI LQ+
Sbjct  216  MKWKFGISLQY  226



>gb|KCW65584.1| hypothetical protein EUGRSUZ_G02981 [Eucalyptus grandis]
Length=564

 Score = 71.6 bits (174),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 32/80 (40%), Positives = 48/80 (60%), Gaps = 0/80 (0%)
 Frame = +2

Query  155  CGNPSYRVYCNNGVLNFLSATGFYYKIQSIDPSASRLIISPPVILTNTCMSSDLSLGGLT  334
            CG+ SY+V C+ G   F       Y I S+DP + RL+I P  +L N C++SDL   G+ 
Sbjct  45   CGDQSYKVRCDAGRTLFFDTLNNSYPITSVDPESQRLVIKPASLLANACVTSDLVHQGVQ  104

Query  335  IDQNSPFNISSRNTVMLLNC  394
             + + PFN++  NT++ LNC
Sbjct  105  RNSSLPFNVTGNNTILYLNC  124



>ref|XP_011018654.1| PREDICTED: wall-associated receptor kinase-like 15, partial [Populus 
euphratica]
Length=302

 Score = 70.1 bits (170),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 55/191 (29%), Positives = 83/191 (43%), Gaps = 17/191 (9%)
 Frame = +2

Query  110  CGTMDVPYPLSTGDSCGNPSYRVY--CNNGVLNFLSATGFYYKIQSIDPSASRLIISPPV  283
            CGT+ V YP  +G  CG+P +  Y  CN G L F + TG  Y +  ID S+S LII  P 
Sbjct  41   CGTISVKYPFGSGFGCGHPDFARYVRCNAGTLEFSTGTGI-YNVSDIDYSSSTLIIRDPF  99

Query  284  ILTNTCMSSDLSLGGLTIDQNSPFNISSRNTVMLLNCSEG-----------Illsplncs  430
            +   + M +    G  ++D+ SPF ++  N  +LL CS              + S     
Sbjct  100  MSACSSMQNS---GSFSLDRASPFTLTGENIFVLLGCSTNSPLFDPAEDLCAMGSRSRVC  156

Query  431  lsspcrvfergvgegrgcgDTLCCSYLKDSSMTSHRIRARVGGCSAYTSVVDLNPGDVNF  610
                      G+G  +    + CC Y     +  + +      CS+YTSV      + + 
Sbjct  157  RGLYSCKGVTGIGLLQNAPPSTCCVYESPIQLAGYTLDLPKLQCSSYTSVYSFGGSEGDP  216

Query  611  HAWHYGIELQW  643
              W +GI LQ+
Sbjct  217  MKWKFGISLQY  227



>emb|CDP06572.1| unnamed protein product [Coffea canephora]
Length=199

 Score = 68.6 bits (166),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 52/168 (31%), Positives = 74/168 (44%), Gaps = 47/168 (28%)
 Frame = +2

Query  233  IQSIDPSASRLIISPPVILTNTCMSSDLSLGGLTIDQNSPFNISSRNTVMLLNCSEGIll  412
            + SIDP   R+II PP  + +TC+S+DL+  G+ +    PFNI+S NTV+LLNC++    
Sbjct  2    VTSIDPQNQRMIIRPPSFIPSTCLSTDLNSEGIHL--ALPFNITSSNTVLLLNCTD----  55

Query  413  splncslsspcrvfergvgegrgcgDTLCCSYLKDSSMTSHRIRARVGGCSAYTSVVDLN  592
                                                S T+H +R   GGC AY S V+L+
Sbjct  56   ----------------------------------RGSQTAHFVRVHEGGCLAYQSFVNLD  81

Query  593  PGDVNFHAWHY-GIELQWI-----PLT*DCHCF*LQLCGCVLLAKLNV  718
            P  +    W   G+EL W+     P   D  C  L    C+   + NV
Sbjct  82   PS-LPVADWPAPGMELMWVTPKEPPCKSDVDCVQLPYSRCLAPDRANV  128



>ref|XP_002512078.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF50747.1| conserved hypothetical protein [Ricinus communis]
Length=296

 Score = 69.3 bits (168),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 55/191 (29%), Positives = 86/191 (45%), Gaps = 17/191 (9%)
 Frame = +2

Query  110  CGTMDVPYPLSTGDSCGNPSYRVY--CNNGVLNFLSATGFYYKIQSIDPSASRLIISPPV  283
            CGT+ V +P  TG  CG+P +  Y  CN+G L F + TG  Y I SID  ++ LI+  P+
Sbjct  40   CGTIPVKFPFGTGFGCGHPEFARYVRCNSGALEFSTGTGI-YTISSIDYPSNTLIVEDPL  98

Query  284  ILTNTCMSSDLSLGGLTIDQNSPFNISSRNTVMLLNCS---------EGIllsplncsls  436
            + T + M +    G  ++D+ SPF ++  N  +LL CS         E +        + 
Sbjct  99   MSTCSSMQNS---GSFSLDRASPFTLTGDNIFVLLGCSTTSPVFDPNEDLCDRGSVTRVC  155

Query  437  spcrvfergvgegrgcgDTL--CCSYLKDSSMTSHRIRARVGGCSAYTSVVDLNPGDVNF  610
                  +   G G      +  CC Y     +  + +      CS+YTSV      + + 
Sbjct  156  RGLYSCKGVSGIGLPQNAPIATCCVYESPIQLAGYTLDLPKLQCSSYTSVYSFGGNEGDP  215

Query  611  HAWHYGIELQW  643
              W +GI LQ+
Sbjct  216  MKWKFGISLQY  226



>ref|XP_011011968.1| PREDICTED: wall-associated receptor kinase 5-like [Populus euphratica]
Length=301

 Score = 69.3 bits (168),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 54/191 (28%), Positives = 85/191 (45%), Gaps = 17/191 (9%)
 Frame = +2

Query  110  CGTMDVPYPLSTGDSCGNPSYRVY--CNNGVLNFLSATGFYYKIQSIDPSASRLIISPPV  283
            CGTM V YP  +G  CG+P +  Y  CN+ +L F + TG  Y I  ID +   LII+ P 
Sbjct  40   CGTMPVKYPFGSGFGCGHPDFSRYVRCNSDILEFSTGTGI-YNISEIDYTTGSLIITDPF  98

Query  284  ILTNTCMSSDLSLGGLTIDQNSPFNISSRNTVMLLNCSEG-----------Illsplncs  430
            + T + M +    G  ++D+ SPF+++  N  +LL CS              ++S     
Sbjct  99   MSTCSSMQNS---GSFSLDRASPFSLTGENIFVLLGCSTNSPLFDPAEDLCAMVSRSRVC  155

Query  431  lsspcrvfergvgegrgcgDTLCCSYLKDSSMTSHRIRARVGGCSAYTSVVDLNPGDVNF  610
                      G G  +    + CC Y     +  + +      CS+YTS+      + + 
Sbjct  156  RGLYSCKGVTGTGLPQNAPPSTCCVYESPIQLAGYPLDLPKLQCSSYTSIYSFGGSEGDP  215

Query  611  HAWHYGIELQW  643
              W +GI LQ+
Sbjct  216  VKWKFGISLQY  226



>ref|XP_002316087.2| hypothetical protein POPTR_0010s16600g [Populus trichocarpa]
 gb|EEF02258.2| hypothetical protein POPTR_0010s16600g [Populus trichocarpa]
Length=301

 Score = 68.6 bits (166),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 55/191 (29%), Positives = 84/191 (44%), Gaps = 17/191 (9%)
 Frame = +2

Query  110  CGTMDVPYPLSTGDSCGNPSYRVY--CNNGVLNFLSATGFYYKIQSIDPSASRLIISPPV  283
            CGTM V YP  +G  CG+P +  Y  CN+  L F + TG  Y I  ID +   LII+ P 
Sbjct  40   CGTMPVKYPFGSGFGCGHPDFSRYVRCNSDTLEFSTGTGI-YNISEIDYTTGSLIITDPF  98

Query  284  ILTNTCMSSDLSLGGLTIDQNSPFNISSRNTVMLLNCSEG-----------Illsplncs  430
            + T + M +    G  ++D+ SPF+++  N  +LL CS              + S     
Sbjct  99   MSTCSSMQNS---GSFSLDRASPFSLTGENIFVLLGCSTNSPLFDPAEDLCAMGSRSRVC  155

Query  431  lsspcrvfergvgegrgcgDTLCCSYLKDSSMTSHRIRARVGGCSAYTSVVDLNPGDVNF  610
                      G+G  +    + CC Y     +  + +      CS+YTSV      + + 
Sbjct  156  RGLYSCKGVTGIGLPQNAPPSTCCVYESPIQLAGYTLDLPKLQCSSYTSVYSFGGSEGDP  215

Query  611  HAWHYGIELQW  643
              W +GI LQ+
Sbjct  216  VKWKFGISLQY  226



>ref|XP_008350892.1| PREDICTED: uncharacterized protein LOC103414277 [Malus domestica]
Length=315

 Score = 67.8 bits (164),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 37/98 (38%), Positives = 59/98 (60%), Gaps = 6/98 (6%)
 Frame = +2

Query  110  CGTMDVPYPLSTGDSCGNPSYRVY--CNNGVLNFLSATGFYYKIQSIDPSASRLIISPPV  283
            CG + V +P  TG  CG+P +  Y  C++G L F + TG Y  I SID ++S +I++ P+
Sbjct  43   CGAIPVKFPFGTGFGCGHPEFXRYIKCSSGTLQFSTGTGIY-TISSIDYNSSTIIVTDPL  101

Query  284  ILTNTCMSSDLSLGGLTIDQNSPFNISSRNTVMLLNCS  397
            + T + M +    G  ++D++SPF I  +N  +LL CS
Sbjct  102  MSTCSSMQNS---GSFSLDKSSPFTIGEQNIFVLLGCS  136



>ref|XP_009356404.1| PREDICTED: uncharacterized protein LOC103947253 [Pyrus x bretschneideri]
Length=315

 Score = 67.8 bits (164),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 37/98 (38%), Positives = 59/98 (60%), Gaps = 6/98 (6%)
 Frame = +2

Query  110  CGTMDVPYPLSTGDSCGNPSYRVY--CNNGVLNFLSATGFYYKIQSIDPSASRLIISPPV  283
            CG + V +P  TG  CG+P +  Y  C++G L F + TG Y  I SID ++S +I++ P+
Sbjct  43   CGAIPVKFPFGTGFGCGHPEFVRYIKCSSGTLQFSTGTGIY-TISSIDYNSSTIIVTDPL  101

Query  284  ILTNTCMSSDLSLGGLTIDQNSPFNISSRNTVMLLNCS  397
            + T + M +    G  ++D++SPF I  +N  +LL CS
Sbjct  102  MSTCSSMQNS---GSFSLDKSSPFTIGEQNIFVLLGCS  136



>ref|XP_008243850.1| PREDICTED: uncharacterized protein LOC103342062 [Prunus mume]
Length=306

 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 37/98 (38%), Positives = 58/98 (59%), Gaps = 6/98 (6%)
 Frame = +2

Query  110  CGTMDVPYPLSTGDSCGNPSYRVY--CNNGVLNFLSATGFYYKIQSIDPSASRLIISPPV  283
            CGT+ V +P  TG  CG+P +  Y  C++  L F + TG Y  I SID ++S ++++ P+
Sbjct  42   CGTIPVKFPFGTGFGCGHPDFVRYIKCSSETLQFSTGTGIY-TISSIDYNSSTIVVTDPL  100

Query  284  ILTNTCMSSDLSLGGLTIDQNSPFNISSRNTVMLLNCS  397
            + T + M +    GG ++D+ SPF I   N  +LL CS
Sbjct  101  MSTCSSMQNS---GGFSLDRTSPFTIREENIFVLLGCS  135



>gb|KDP41303.1| hypothetical protein JCGZ_15710 [Jatropha curcas]
Length=301

 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 53/191 (28%), Positives = 88/191 (46%), Gaps = 17/191 (9%)
 Frame = +2

Query  110  CGTMDVPYPLSTGDSCGNPSYRVY--CNNGVLNFLSATGFYYKIQSIDPSASRLIISPPV  283
            CGT+ V +P  TG  CG+P +  Y  CN+  L F + TG  Y I SID  ++ LI++ P+
Sbjct  40   CGTIPVKFPFGTGFGCGHPEFARYVRCNSATLEFSTGTGI-YTITSIDYPSNTLIVTDPL  98

Query  284  ILTNTCMSSDLSLGGLTIDQNSPFNISSRNTVMLLNCS---------EGIllsplncsls  436
            + + + M +    G  ++D+ SPF+++  N  +LL CS         E +        + 
Sbjct  99   MSSCSSMQNS---GSFSLDRASPFSLTGDNIFVLLGCSTTSPVFDPNEDLCDKGSVSRVC  155

Query  437  spcrvfergvgegrgcgDTL--CCSYLKDSSMTSHRIRARVGGCSAYTSVVDLNPGDVNF  610
                  +   G G      +  CC Y     +  + +      CS+YTSV +    + + 
Sbjct  156  RGLYSCKGVSGIGLPQNAPISTCCVYESPIQLAGYALDLPKLQCSSYTSVYNFGGNEGDP  215

Query  611  HAWHYGIELQW  643
              W +GI LQ+
Sbjct  216  MKWKFGISLQY  226



>emb|CDP00435.1| unnamed protein product [Coffea canephora]
Length=969

 Score = 67.0 bits (162),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 37/98 (38%), Positives = 61/98 (62%), Gaps = 6/98 (6%)
 Frame = +2

Query  110  CGTMDVPYPLSTGDSCGNPSYRVY--CNNGVLNFLSATGFYYKIQSIDPSASRLIISPPV  283
            CG++ + +P  +G  CG+P +  Y  C++GVL F + TG Y  + SID S++ ++++ P 
Sbjct  707  CGSVPIKFPFGSGFGCGHPHFARYIRCSSGVLQFTTGTGIY-TVSSIDYSSNTILVTDP-  764

Query  284  ILTNTCMSSDLSLGGLTIDQNSPFNISSRNTVMLLNCS  397
             L +TC S   S G   +D+ SPF+I++ N  +LL CS
Sbjct  765  -LMSTCSSMQNS-GSFILDRESPFSITTDNVFVLLGCS  800



>gb|KHG13268.1| Wall-associated receptor kinase-like 20 [Gossypium arboreum]
Length=304

 Score = 65.1 bits (157),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 36/98 (37%), Positives = 55/98 (56%), Gaps = 6/98 (6%)
 Frame = +2

Query  110  CGTMDVPYPLSTGDSCGNPSYRVY--CNNGVLNFLSATGFYYKIQSIDPSASRLIISPPV  283
            CGT+ V +P  TG  CG+P +  Y  CN G L F + TG  Y + SID   S ++++ P 
Sbjct  43   CGTIPVMFPFGTGFGCGHPYFARYVKCNAGTLQFSTGTGI-YTVSSIDYPTSTIVVADPF  101

Query  284  ILTNTCMSSDLSLGGLTIDQNSPFNISSRNTVMLLNCS  397
            + T + M +    G  ++D+ SPF ++  N  +LL CS
Sbjct  102  MSTCSSMQNS---GSFSLDRTSPFTLTGSNIFVLLGCS  136



>ref|XP_011070936.1| PREDICTED: uncharacterized protein LOC105156489 [Sesamum indicum]
Length=318

 Score = 65.1 bits (157),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 36/99 (36%), Positives = 61/99 (62%), Gaps = 6/99 (6%)
 Frame = +2

Query  107  KCGTMDVPYPLSTGDSCGNPSYRVY--CNNGVLNFLSATGFYYKIQSIDPSASRLIISPP  280
            KCG++ + +P  +G  CG+P +  Y  C++G+L F + TG  Y I SID +++ L+I+ P
Sbjct  54   KCGSIPISFPFGSGFGCGHPDFSRYINCSSGILQFSTGTG-SYTISSIDYASNTLVIADP  112

Query  281  VILTNTCMSSDLSLGGLTIDQNSPFNISSRNTVMLLNCS  397
            ++ T + M +    G  T+D+ SPF+I   N  +L+ CS
Sbjct  113  LMSTCSSMQNS---GSFTLDRASPFSIMPNNIFVLVGCS  148



>ref|XP_009770609.1| PREDICTED: uncharacterized protein LOC104221277 [Nicotiana sylvestris]
Length=300

 Score = 65.1 bits (157),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 35/99 (35%), Positives = 60/99 (61%), Gaps = 6/99 (6%)
 Frame = +2

Query  107  KCGTMDVPYPLSTGDSCGNPSYRVY--CNNGVLNFLSATGFYYKIQSIDPSASRLIISPP  280
            KCG++ + YP  +G  CG+P++  +  C +GVL F + TG Y  I ++D + + LI++ P
Sbjct  36   KCGSIVLKYPFGSGFGCGHPTFSRFIKCTSGVLQFSTGTGIY-TISTLDYTTNTLILTDP  94

Query  281  VILTNTCMSSDLSLGGLTIDQNSPFNISSRNTVMLLNCS  397
             + T + M +    G  T+D+++PF+I   N  +LL CS
Sbjct  95   FMSTCSSMQNS---GSFTLDRSTPFSIMKENIFVLLGCS  130



>emb|CBI27289.3| unnamed protein product [Vitis vinifera]
Length=967

 Score = 65.9 bits (159),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 37/98 (38%), Positives = 58/98 (59%), Gaps = 6/98 (6%)
 Frame = +2

Query  110  CGTMDVPYPLSTGDSCGNPSYRVY--CNNGVLNFLSATGFYYKIQSIDPSASRLIISPPV  283
            CG + V +P  TG  CG+P +  Y  C++G L F + TG  Y + SID S+S +I++ P+
Sbjct  706  CGNITVKFPFGTGFGCGHPDFARYVKCSSGTLQFSTLTGI-YTVASIDYSSSTIIVNDPL  764

Query  284  ILTNTCMSSDLSLGGLTIDQNSPFNISSRNTVMLLNCS  397
            + T T M +    G  ++D+ SPF I + +  +LL CS
Sbjct  765  MSTCTSMQNS---GSFSLDRASPFTIMADDVFVLLGCS  799



>ref|XP_003631197.1| PREDICTED: wall-associated receptor kinase-like 8 isoform X1 
[Vitis vinifera]
Length=301

 Score = 64.7 bits (156),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 37/98 (38%), Positives = 58/98 (59%), Gaps = 6/98 (6%)
 Frame = +2

Query  110  CGTMDVPYPLSTGDSCGNPSYRVY--CNNGVLNFLSATGFYYKIQSIDPSASRLIISPPV  283
            CG + V +P  TG  CG+P +  Y  C++G L F + TG  Y + SID S+S +I++ P+
Sbjct  40   CGNITVKFPFGTGFGCGHPDFARYVKCSSGTLQFSTLTGI-YTVASIDYSSSTIIVNDPL  98

Query  284  ILTNTCMSSDLSLGGLTIDQNSPFNISSRNTVMLLNCS  397
            + T T M +    G  ++D+ SPF I + +  +LL CS
Sbjct  99   MSTCTSMQNS---GSFSLDRASPFTIMADDVFVLLGCS  133



>ref|XP_009768766.1| PREDICTED: uncharacterized protein LOC104219742 [Nicotiana sylvestris]
Length=300

 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 54/194 (28%), Positives = 80/194 (41%), Gaps = 20/194 (10%)
 Frame = +2

Query  110  CGTMDVPYPLSTGDSCGNPSYRVY--CNNGVLNFLSATGFYYKIQSIDPSASRLIISPPV  283
            CG + + YP  TG  CG+P ++ +  CNN  L F + TG  Y + SID ++  L IS P 
Sbjct  32   CGNIPMKYPFGTGPGCGDPRFQPFITCNNQQLTFKTHTG-CYPVTSIDYNSQVLYISDPS  90

Query  284  ILTNTCMSSDLSLGGLTIDQNSPFNISSRNTVMLLNCSE----------GIllsplncsl  433
            + T  C        G ++D  +PFN        LL+CS           G+  +   C  
Sbjct  91   MSTCACTQPS---KGFSLDWKAPFNFHDETVFALLDCSTDSSPIYQSNGGMNSTFPLCDS  147

Query  434  sspcrvfergvgegrgcgDTL----CCSYLKDSSMTSHRIRARVGGCSAYTSVVDLNPGD  601
            S    V              L    CC Y       S  +      C++Y+++   N  D
Sbjct  148  SQGDPVCSLLYSCEAMSRLNLPTSTCCVYTPVDLGPSFEMDLEKLHCTSYSALYGFNGQD  207

Query  602  VNFHAWHYGIELQW  643
             N  AW YG+ L++
Sbjct  208  ANPQAWKYGVALKY  221



>gb|KEH20808.1| wall-associated receptor kinase galacturonan-binding protein 
[Medicago truncatula]
Length=300

 Score = 62.8 bits (151),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 60/187 (32%), Positives = 85/187 (45%), Gaps = 13/187 (7%)
 Frame = +2

Query  110  CGTMDVPYPLSTGDSCGNPSYRVYC---NNGVLN--FLSATGFYYKIQSIDPSASRLIIS  274
            CG++ V YP  TG  CG+P +  Y    +NG L+   L      Y I SI  + S LI++
Sbjct  34   CGSIQVKYPFGTGPGCGSPLFNPYITCTSNGTLDQLILKTHTSSYPITSISYTTSTLILT  93

Query  275  PPVILTNTCMSSDLSLGGLTIDQNSPFNISSRNTVMLLNC---SEGIllsplncslsspc  445
            PP + T T M +  + G   ID  +PF ISS +T +LL+C   S  I  +  +   +S  
Sbjct  94   PPYMSTCTTMQTSPNFG---IDLTAPFQISS-STFILLHCQVKSSTICDTSFDYLCASLY  149

Query  446  rvfergvgegrgcgDT-LCCSYLKDSSMTSHRIRARVGGCSAYTSVVDLNPGDVNFHAWH  622
               E           T  CC Y   +      +  R   CS YTSVV L     +   W 
Sbjct  150  SCPEVVSLGMPLFSPTNTCCVYSPGNLDGKGELNLRENDCSGYTSVVSLGDNPTDPTHWV  209

Query  623  YGIELQW  643
            YG+ L++
Sbjct  210  YGVALKY  216



>ref|XP_010091574.1| hypothetical protein L484_026420 [Morus notabilis]
 gb|EXB44840.1| hypothetical protein L484_026420 [Morus notabilis]
Length=301

 Score = 62.4 bits (150),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 38/98 (39%), Positives = 54/98 (55%), Gaps = 6/98 (6%)
 Frame = +2

Query  110  CGTMDVPYPLSTGDSCGNPSYRVY--CNNGVLNFLSATGFYYKIQSIDPSASRLIISPPV  283
            CGT+ V YP  +   CG+P +  Y  CN   L   +ATG Y  I SID  ++ +II+ P+
Sbjct  37   CGTIPVKYPFGSAFGCGHPDFSRYIKCNANTLQLSTATGIY-TISSIDYPSNTIIITDPL  95

Query  284  ILTNTCMSSDLSLGGLTIDQNSPFNISSRNTVMLLNCS  397
            + T + M +    G  ++D+ SPF IS  N   LL CS
Sbjct  96   MSTCSSMQNS---GSFSLDKASPFTISDENIFALLGCS  130



>ref|XP_007045864.1| Wall-associated receptor kinase-like 8 [Theobroma cacao]
 gb|EOY01696.1| Wall-associated receptor kinase-like 8 [Theobroma cacao]
Length=357

 Score = 62.4 bits (150),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 34/98 (35%), Positives = 55/98 (56%), Gaps = 6/98 (6%)
 Frame = +2

Query  110  CGTMDVPYPLSTGDSCGNPSYRVY--CNNGVLNFLSATGFYYKIQSIDPSASRLIISPPV  283
            CG++ V +P  TG  CG+P +  Y  C+ G L F + TG  Y + SID   S ++++ P 
Sbjct  96   CGSIPVKFPFGTGFGCGHPYFARYVKCSGGALQFSTGTGI-YTVSSIDYPTSSIVVADPF  154

Query  284  ILTNTCMSSDLSLGGLTIDQNSPFNISSRNTVMLLNCS  397
            + T + M +    G  ++D+ SPF ++  N  +LL CS
Sbjct  155  MSTCSSMQNS---GSFSLDRASPFTLTGDNIFVLLGCS  189



>ref|XP_006357233.1| PREDICTED: wall-associated receptor kinase 4-like [Solanum tuberosum]
Length=299

 Score = 62.0 bits (149),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 50/194 (26%), Positives = 81/194 (42%), Gaps = 20/194 (10%)
 Frame = +2

Query  110  CGTMDVPYPLSTGDSCGNPSYRVY--CNNGVLNFLSATGFYYKIQSIDPSASRLIISPPV  283
            CG + + YP  TG  CG+P ++ Y  CNN  L+F + TG  Y + SID +   + IS P 
Sbjct  31   CGNVPIKYPFGTGPGCGDPRFQPYVMCNNQQLSFKTHTG-CYPVTSIDYNYQIMYISDPS  89

Query  284  ILTNTCMSSDLSLGGLTIDQNSPFNISSRNTVMLLNCS-----------EGIllsplncs  430
            + T  C        G ++D N+PF         LL+C+           EG   +   C 
Sbjct  90   MSTCACTQPS---KGFSLDANAPFTFHDETVFALLDCATDSSPIYKSNNEGTNSTFPMCD  146

Query  431  lsspcrvfergvgegrgcgD---TLCCSYLKDSSMTSHRIRARVGGCSAYTSVVDLNPGD  601
                         +     +   + CC Y       +  +      CS+Y+++   +  +
Sbjct  147  SQGAPVCSLLYSCQAISRLNLPISTCCVYTPVDLGPAFEMDLTKLQCSSYSALYGFSGEE  206

Query  602  VNFHAWHYGIELQW  643
            +N  AW YGI L++
Sbjct  207  LNPQAWKYGIALKY  220



>ref|XP_009766359.1| PREDICTED: wall-associated receptor kinase-like 20 [Nicotiana 
sylvestris]
Length=298

 Score = 62.0 bits (149),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 52/202 (26%), Positives = 86/202 (43%), Gaps = 20/202 (10%)
 Frame = +2

Query  86   IAYDNCPK-CGTMDVPYPLSTGDSCGNPSYRVY--CNNGVLNFLSATGFYYKIQSIDPSA  256
            I    C K CG + + YP  TG  CG+P ++ Y  CNN  L+F + TG  Y + SID + 
Sbjct  22   ITSQTCQKSCGNIPIKYPFGTGPGCGDPRFQPYVICNNQQLSFKTHTG-CYPVTSIDYNN  80

Query  257  SRLIISPPVILTNTCMSSDLSLGGLTIDQNSPFNISSRNTVMLLNCSE----------GI  406
              L I+ P + T  C        G ++D N+PF+ +      LL+C+           G+
Sbjct  81   QVLYINDPSMSTCACTQPS---KGFSLDGNAPFSFNDDTVFALLDCATDSSPIYKSNGGV  137

Query  407  llsplncslsspcrvfergvgegrgcgD---TLCCSYLKDSSMTSHRIRARVGGCSAYTS  577
              +   C              +     +   + CC Y       +  +      CS+Y++
Sbjct  138  NSTFPMCDSQGAPVCSLLYSCQAISRLNLPISTCCVYTPVDLGPAFEMDLEKLHCSSYSA  197

Query  578  VVDLNPGDVNFHAWHYGIELQW  643
            +   N  ++N  AW YG+ L++
Sbjct  198  LYGFNGQELNPQAWKYGVGLKY  219



>gb|KDO70375.1| hypothetical protein CISIN_1g040327mg [Citrus sinensis]
Length=315

 Score = 62.0 bits (149),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 53/192 (28%), Positives = 86/192 (45%), Gaps = 18/192 (9%)
 Frame = +2

Query  110  CGTMDVPYPLSTGDSCGNPSYRVY--CNNGVLNFLSATGFYYKIQSIDPSASRLIISPPV  283
            CGT+ V YP      CG+P +  Y  C +G L F + +G  Y I SID  ++ ++++ P 
Sbjct  40   CGTISVKYPFGAEPGCGHPDFARYIKCVSGTLEFSTGSGI-YNISSIDYPSNTIVVTDPF  98

Query  284  ILTNTCMSSDLSLGGLTIDQNSPFNISSRNTVMLLNCSEG-----------Illsplncs  430
            + T + M +    G   +D+ SPF I+  N ++LL CS                S L   
Sbjct  99   MSTCSLMQNS---GSFILDKASPFTITQDNIIVLLGCSSTSPVFDPYEDLCATGSRLRVC  155

Query  431  lsspcrvfergvgegrgcgDTLCCSYLKDSSMTS-HRIRARVGGCSAYTSVVDLNPGDVN  607
                      G+G  +    + CC Y   + + S + +      CS+YTS+      + +
Sbjct  156  RGMYSCKGVSGIGLRQKGPASTCCVYESPTGLGSGYALDVPRLQCSSYTSIYGFGGNEGD  215

Query  608  FHAWHYGIELQW  643
               W+YGI LQ+
Sbjct  216  PMKWNYGISLQY  227



>ref|XP_006484206.1| PREDICTED: uncharacterized protein LOC102610801 [Citrus sinensis]
Length=302

 Score = 61.6 bits (148),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 53/192 (28%), Positives = 86/192 (45%), Gaps = 18/192 (9%)
 Frame = +2

Query  110  CGTMDVPYPLSTGDSCGNPSYRVY--CNNGVLNFLSATGFYYKIQSIDPSASRLIISPPV  283
            CGT+ V YP      CG+P +  Y  C +G L F + +G  Y I SID  ++ ++++ P 
Sbjct  40   CGTISVKYPFGAEPGCGHPDFARYIKCVSGTLEFSTGSGI-YNISSIDYPSNTIVVTDPF  98

Query  284  ILTNTCMSSDLSLGGLTIDQNSPFNISSRNTVMLLNCSEG-----------Illsplncs  430
            + T + M +    G   +D+ SPF I+  N ++LL CS                S L   
Sbjct  99   MSTCSLMQNS---GSFILDKASPFTITQDNIIVLLGCSSTSPVFDPYEDLCATGSRLRVC  155

Query  431  lsspcrvfergvgegrgcgDTLCCSYLKDSSMTS-HRIRARVGGCSAYTSVVDLNPGDVN  607
                      G+G  +    + CC Y   + + S + +      CS+YTS+      + +
Sbjct  156  RGMYSCKGVSGIGLRQKGPASTCCVYESPTGLGSGYALDVPRLQCSSYTSIYGFGGNEGD  215

Query  608  FHAWHYGIELQW  643
               W+YGI LQ+
Sbjct  216  PMKWNYGISLQY  227



>ref|XP_009630519.1| PREDICTED: uncharacterized protein LOC104120471 [Nicotiana tomentosiformis]
Length=299

 Score = 61.2 bits (147),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 53/194 (27%), Positives = 79/194 (41%), Gaps = 20/194 (10%)
 Frame = +2

Query  110  CGTMDVPYPLSTGDSCGNPSYRVY--CNNGVLNFLSATGFYYKIQSIDPSASRLIISPPV  283
            CG + + YP  TG  CG+P ++ +  CNN  L F + TG  Y + SID +   L IS P 
Sbjct  31   CGNIPMKYPFGTGPGCGDPRFQPFITCNNQQLTFKTHTG-CYPVTSIDYNNQLLYISDPS  89

Query  284  ILTNTCMSSDLSLGGLTIDQNSPFNISSRNTVMLLNCSE----------GIllsplncsl  433
            + T  C        G ++D  +PF+        LL+CS           G+  +   C  
Sbjct  90   MSTCACTQPS---KGFSLDWKAPFSFHDETVFALLDCSTDSSPIYKSNGGMNSTFPLCDS  146

Query  434  sspcrvfergvgegrgcgDTL----CCSYLKDSSMTSHRIRARVGGCSAYTSVVDLNPGD  601
            S    V              L    CC Y       S  +      C++Y+++   N  D
Sbjct  147  SQGDPVCSLLYSCQAMTRLNLPTSTCCVYTPVDLGPSFEMDLEKLHCTSYSALYGFNGQD  206

Query  602  VNFHAWHYGIELQW  643
             N  AW YG+ L++
Sbjct  207  ANPQAWKYGVALKY  220



>ref|XP_009586745.1| PREDICTED: wall-associated receptor kinase 3-like [Nicotiana 
tomentosiformis]
Length=300

 Score = 61.2 bits (147),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 33/99 (33%), Positives = 58/99 (59%), Gaps = 6/99 (6%)
 Frame = +2

Query  107  KCGTMDVPYPLSTGDSCGNPSYRVY--CNNGVLNFLSATGFYYKIQSIDPSASRLIISPP  280
            KCG++ + YP  +G  CG+P++  +  C  GVL F + TG  Y I ++D + + L+++ P
Sbjct  36   KCGSIVLKYPFGSGFGCGHPTFSRFINCTYGVLQFSTGTGI-YTISTLDYTTNTLVLTDP  94

Query  281  VILTNTCMSSDLSLGGLTIDQNSPFNISSRNTVMLLNCS  397
             + T + M +    G   +D+++PF+I   N  +LL CS
Sbjct  95   FMSTCSSMQNS---GSFNLDRSTPFSIMKENIFVLLGCS  130



>ref|XP_004297236.1| PREDICTED: uncharacterized protein LOC101310691 [Fragaria vesca 
subsp. vesca]
Length=297

 Score = 60.5 bits (145),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 37/99 (37%), Positives = 56/99 (57%), Gaps = 7/99 (7%)
 Frame = +2

Query  110  CGTMDVPYPLSTGDSCGNPSYRVY--CNN-GVLNFLSATGFYYKIQSIDPSASRLIISPP  280
            CGT+ V +P  TG  CG+P +  Y  C N   L F + TG  Y I SID +++ +I++ P
Sbjct  36   CGTIPVKFPFGTGFGCGHPDFTRYIKCTNLDTLLFTTGTGI-YTISSIDYTSNTIIVADP  94

Query  281  VILTNTCMSSDLSLGGLTIDQNSPFNISSRNTVMLLNCS  397
            ++ T + M +    G  ++D+ SPF I   N  +LL CS
Sbjct  95   LMSTCSSMQNS---GSFSLDKASPFTIREENIFVLLGCS  130



>ref|XP_004239370.1| PREDICTED: wall-associated receptor kinase-like 15 [Solanum lycopersicum]
Length=292

 Score = 60.5 bits (145),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 51/203 (25%), Positives = 84/203 (41%), Gaps = 21/203 (10%)
 Frame = +2

Query  86   IAYDNCPK-CGTMDVPYPLSTGDSCGNPSYRVY--CNNGVLNFLSATGFYYKIQSIDPSA  256
            I    C K CG + + YP  TG  CG+P ++ Y  CNN  L+F + TG  Y + SID + 
Sbjct  18   ITSQTCQKSCGNIPIKYPFGTGPGCGDPRFQPYVICNNQQLSFKTHTG-CYPVTSIDYNH  76

Query  257  SRLIISPPVILTNTCMSSDLSLGGLTIDQNSPFNISSRNTVMLLNCS-----------EG  403
              + I+ P + T  C        G ++D N+PF+        LL+C+           EG
Sbjct  77   QIMYITDPSMSTCACTQPS---KGFSLDANAPFSFHDETVFALLDCATDSSSIYKSNNEG  133

Query  404  IllsplncslsspcrvfergvgegrgcgD---TLCCSYLKDSSMTSHRIRARVGGCSAYT  574
               +   C              +     +   + CC Y       +  +      CS+Y+
Sbjct  134  TNSTFPMCDSQGAPVCSLLYSCQAISRLNLPISTCCVYTPVDLGPAFEMDLNKLQCSSYS  193

Query  575  SVVDLNPGDVNFHAWHYGIELQW  643
            ++   +  ++N   W YGI L++
Sbjct  194  ALYGFSGEELNPQVWKYGIALKY  216



>ref|XP_006437925.1| hypothetical protein CICLE_v10033305mg [Citrus clementina]
 gb|ESR51165.1| hypothetical protein CICLE_v10033305mg [Citrus clementina]
Length=948

 Score = 61.2 bits (147),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 34/98 (35%), Positives = 54/98 (55%), Gaps = 6/98 (6%)
 Frame = +2

Query  110  CGTMDVPYPLSTGDSCGNPSYRVY--CNNGVLNFLSATGFYYKIQSIDPSASRLIISPPV  283
            CGT+ V YP      CG+P +  Y  C +G L F + +G  Y I SID  ++ ++++ P 
Sbjct  686  CGTISVKYPFGAEPGCGHPDFARYIKCVSGTLEFSTGSGI-YNISSIDYPSNTIVVTDPF  744

Query  284  ILTNTCMSSDLSLGGLTIDQNSPFNISSRNTVMLLNCS  397
            + T + M +    G   +D+ SPF I+  N ++LL CS
Sbjct  745  MSTCSLMQNS---GSFILDKASPFTITQDNIIVLLGCS  779



>ref|XP_010657377.1| PREDICTED: uncharacterized protein LOC100267196 [Vitis vinifera]
Length=2027

 Score = 61.6 bits (148),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 38/93 (41%), Positives = 48/93 (52%), Gaps = 5/93 (5%)
 Frame = +2

Query  98   NCPKCGTMDVPYPLSTGDSCGNPSY-RVYCNN--GVLNFLSATGFYYKIQSIDPSASRLI  268
            NC  CGT  +PYPLSTG  CG+P Y   YC N  G + F+     YY++ SI P A    
Sbjct  467  NCKICGTNIIPYPLSTGTDCGDPKYLSFYCENSTGQVIFMRPNNTYYQVTSIRPEAKEFS  526

Query  269  ISPPVILTNTCMSSDLSLGGLTIDQNSPFNISS  367
            I   +   N   SSD     L  +Q+SPF + S
Sbjct  527  IQ--LGEDNCIASSDAMKKLLEFNQDSPFLVKS  557



>emb|CBI17984.3| unnamed protein product [Vitis vinifera]
Length=1004

 Score = 61.2 bits (147),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 38/93 (41%), Positives = 48/93 (52%), Gaps = 5/93 (5%)
 Frame = +2

Query  98   NCPKCGTMDVPYPLSTGDSCGNPSY-RVYCNN--GVLNFLSATGFYYKIQSIDPSASRLI  268
            NC  CGT  +PYPLSTG  CG+P Y   YC N  G + F+     YY++ SI P A    
Sbjct  490  NCKICGTNIIPYPLSTGTDCGDPKYLSFYCENSTGQVIFMRPNNTYYQVTSIRPEAKEFS  549

Query  269  ISPPVILTNTCMSSDLSLGGLTIDQNSPFNISS  367
            I   +   N   SSD     L  +Q+SPF + S
Sbjct  550  IQ--LGEDNCIASSDAMKKLLEFNQDSPFLVKS  580



>gb|KHN18711.1| Wall-associated receptor kinase-like 20 [Glycine soja]
Length=551

 Score = 60.5 bits (145),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 49/141 (35%), Positives = 76/141 (54%), Gaps = 9/141 (6%)
 Frame = +2

Query  251  SASRLIISPPVILTNTCMSSDLSLG-GLTIDQNSPFNISSRNTVMLLNCSEGIllsplnc  427
            S  R+++ P   L  +C++ D+    G+ ++Q+ PFNI+S NTV L NCS  +L+SPLNC
Sbjct  3    SNQRMVVQPSPWLPGSCVTQDMPRSNGIWLNQSLPFNITSSNTVFLFNCSPRLLVSPLNC  62

Query  428  slsspcrvfergvgegrgcgDTL-------CCSYLKDSSMTSHRIRARVGGCSAYTSVVD  586
            + SS C  +    G                CC++L     +++RIR    GC A+ S++ 
Sbjct  63   TSSSICHRYLENSGHVDTKLSLECASGLHPCCTFLAGGIPSAYRIRLHDSGCKAFRSIIH  122

Query  587  LNPGDVNFHAWHYGIELQWIP  649
            LN  D   + W  G+E+QW P
Sbjct  123  LNQ-DKPPNQWEEGLEIQWSP  142



>ref|XP_006828783.1| hypothetical protein AMTR_s00001p00109150 [Amborella trichopoda]
 gb|ERM96199.1| hypothetical protein AMTR_s00001p00109150 [Amborella trichopoda]
Length=306

 Score = 59.7 bits (143),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 55/193 (28%), Positives = 80/193 (41%), Gaps = 19/193 (10%)
 Frame = +2

Query  107  KCGTMDVPYPLSTGDSCGNPSYR--VYCNNGVLNFLSATGFYYKIQSIDPSASRLIISPP  280
             CG++ V YPL TG  CG+P +   V C N    F + TG  Y I SID + SR+++S P
Sbjct  36   HCGSLPVRYPLGTGPGCGDPRFAASVSCKNNQFLFTTHTG-SYPILSIDYAQSRMLVSDP  94

Query  281  VILTNTCMSSDLSLGGLTIDQNSPFNISSRNTVMLLNCSEGIllsplncslsspcrvfer  460
             +  +TCM+   S  G  +D  +PF +   +   LL C++   L     SL         
Sbjct  95   RM--STCMAMQ-SSSGFALDWAAPFQLDG-SVFALLACNDPSRLVHDGSSLCDMASSHIC  150

Query  461  gvgegrgcgDTL------------CCSYLKDSSMTSHRIRARVGGCSAYTSVVDLNPGDV  604
                G     TL            CC Y   +   +H +     GC  Y +V        
Sbjct  151  SSLGGCAAMSTLGVQPFSPEAASTCCVYAPINLGPAHEVNLTQLGCKGYAAVAGFGDTPT  210

Query  605  NFHAWHYGIELQW  643
            +   W YG+ L +
Sbjct  211  DPARWSYGVALHY  223



>ref|XP_010652701.1| PREDICTED: wall-associated receptor kinase-like 10 [Vitis vinifera]
Length=300

 Score = 59.3 bits (142),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 49/197 (25%), Positives = 81/197 (41%), Gaps = 23/197 (12%)
 Frame = +2

Query  110  CGTMDVPYPLSTGDSCGNPSYRVY--CNNGVLNFLSATGFYYKIQSIDPSASRLIISPPV  283
            CG   + YP  +G  CG+P ++ Y  C+   L F++ TG YY I +ID ++  L I+ P 
Sbjct  31   CGNQHLKYPFGSGPGCGDPRFQPYVTCSQEKLTFITHTG-YYTITNIDYNSQVLCITDPS  89

Query  284  ILTNTCMSSDLSLGGLTIDQNSPFNISSRNTVMLLNCS---------EGIllsplncsls  436
            + T +C       G   +D N+PF+    N   LL+CS         +G+     +  + 
Sbjct  90   MSTCSCAQPSKGFG---LDWNAPFSFHDGNVFALLDCSITSSPIYKPDGLYGGGNSTLVP  146

Query  437  spcrvfergvgegrgcgDTL--------CCSYLKDSSMTSHRIRARVGGCSAYTSVVDLN  592
                           C   +        CC Y       S  +  +   C++Y+     N
Sbjct  147  LCDSEGAPICSLLYSCRPIIVLNIPISTCCVYTPVDLGPSFEMDLQKLKCTSYSGFYSYN  206

Query  593  PGDVNFHAWHYGIELQW  643
              D N  +W YG+ L++
Sbjct  207  GQDSNPQSWKYGVALKY  223



>ref|XP_010683305.1| PREDICTED: uncharacterized protein LOC104898013 [Beta vulgaris 
subsp. vulgaris]
Length=297

 Score = 59.3 bits (142),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 51/194 (26%), Positives = 78/194 (40%), Gaps = 20/194 (10%)
 Frame = +2

Query  110  CGTMDVPYPLSTGDSCGNPSY--RVYCNNGVLNFLSATGFYYKIQSIDPSASRLIISPPV  283
            CG + + YP   G  CG+P +   V CN   L F++ TG  Y I +ID     L +S P 
Sbjct  29   CGDIQLRYPFGGGPGCGDPRFVKHVTCNQRQLTFITHTG-SYPITNIDYDNEILYVSDPT  87

Query  284  ILTNTCMSSDLSLGGLTIDQNSPFNISSRNTVMLLNCS--------EGIllsplncslss  439
            +  +TC  +  S  G ++D ++PF+    +   LL+CS          I  +  N     
Sbjct  88   M--STCFCTQPS-KGFSLDWDAPFSFHDSSVFALLDCSLDSSPIYKGAINGNITNVPQCD  144

Query  440  pcrvfergvgegrgcgDTL------CCSYLKDSSMTSHRIRARVGGCSAYTSVVDLNPGD  601
                              L      CC Y       +  +  +   C AYT+V   N  +
Sbjct  145  NTGTTLCSSIYSCQPISQLNVPISTCCVYAPVDLGPAFEMDLQKAQCKAYTAVYSFNDQE  204

Query  602  VNFHAWHYGIELQW  643
             N  AW YG+ L++
Sbjct  205  TNPEAWKYGVALKY  218



>emb|CBI32047.3| unnamed protein product [Vitis vinifera]
Length=369

 Score = 58.9 bits (141),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 49/197 (25%), Positives = 81/197 (41%), Gaps = 23/197 (12%)
 Frame = +2

Query  110  CGTMDVPYPLSTGDSCGNPSYRVY--CNNGVLNFLSATGFYYKIQSIDPSASRLIISPPV  283
            CG   + YP  +G  CG+P ++ Y  C+   L F++ TG YY I +ID ++  L I+ P 
Sbjct  100  CGNQHLKYPFGSGPGCGDPRFQPYVTCSQEKLTFITHTG-YYTITNIDYNSQVLCITDPS  158

Query  284  ILTNTCMSSDLSLGGLTIDQNSPFNISSRNTVMLLNCS---------EGIllsplncsls  436
            + T +C       G   +D N+PF+    N   LL+CS         +G+     +  + 
Sbjct  159  MSTCSCAQPSKGFG---LDWNAPFSFHDGNVFALLDCSITSSPIYKPDGLYGGGNSTLVP  215

Query  437  spcrvfergvgegrgcgDTL--------CCSYLKDSSMTSHRIRARVGGCSAYTSVVDLN  592
                           C   +        CC Y       S  +  +   C++Y+     N
Sbjct  216  LCDSEGAPICSLLYSCRPIIVLNIPISTCCVYTPVDLGPSFEMDLQKLKCTSYSGFYSYN  275

Query  593  PGDVNFHAWHYGIELQW  643
              D N  +W YG+ L++
Sbjct  276  GQDSNPQSWKYGVALKY  292



>ref|XP_011069388.1| PREDICTED: wall-associated receptor kinase-like 20 [Sesamum indicum]
Length=286

 Score = 58.5 bits (140),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 54/188 (29%), Positives = 79/188 (42%), Gaps = 11/188 (6%)
 Frame = +2

Query  107  KCGTMDVPYPLSTGDSCGNPSYRVYCN---NGVLNFLSATGFYYKIQSIDPSASRLIISP  277
            +CGT+DV YP  TG  CG+P +  Y     +G    L+     Y I SI  + S L ISP
Sbjct  33   RCGTLDVKYPFGTGPGCGSPRFHPYVACSPDGTQLLLTTHTGSYPITSISYADSTLTISP  92

Query  278  PVILTNTCMSSDLSLGGLTIDQNSPFNISSRNTVMLLNCSEGIllsplncslsspcrvfe  457
            P +  + C S   +     +D   PF + S   ++L   S  I  +P+    S+      
Sbjct  93   PCM--SNCTSMQPAPPKFGLDWAGPFQLGSSTFILLACSSSTIKGNPICDPSSAYLCPSI  150

Query  458  rgvgegrgcgDTL------CCSYLKDSSMTSHRIRARVGGCSAYTSVVDLNPGDVNFHAW  619
                     G  L      CC Y   +  ++  +  R   C+ YTSVV L     N   W
Sbjct  151  YTCPGVVSLGLPLFPPTNSCCVYSPANLNSNVELDIRELKCAGYTSVVSLGDLPTNPGQW  210

Query  620  HYGIELQW  643
             YG+ L++
Sbjct  211  LYGVALKY  218



>emb|CDP00260.1| unnamed protein product [Coffea canephora]
Length=301

 Score = 58.2 bits (139),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 49/194 (25%), Positives = 78/194 (40%), Gaps = 20/194 (10%)
 Frame = +2

Query  110  CGTMDVPYPLSTGDSCGNPSYRVY--CNNGVLNFLSATGFYYKIQSIDPSASRLIISPPV  283
            CG++ + YP  TG  CG+P ++ Y  CN   L F + TG  Y + SID +   L I+ P 
Sbjct  33   CGSIPIKYPFGTGPGCGDPRFQSYVTCNQQQLTFSTHTGC-YPVTSIDYNNQVLYITDPS  91

Query  284  ILTNTCMSSDLSLGGLTIDQNSPFNISSRNTVMLLNCSEGIllsplncslsspcrv----  451
            + T +C        G ++D N+PF+        LL+CS        +   S+        
Sbjct  92   MSTCSCSQPS---KGFSLDWNAPFSFRDDVVFALLDCSTSASPIYKSIRASNSTTFPLCD  148

Query  452  ----------fergvgegrgcgDTLCCSYLKDSSMTSHRIRARVGGCSAYTSVVDLNPGD  601
                      +            + CC Y       S  +  +   C+AY+ +   N  +
Sbjct  149  PQGASVCSVLYSCQAISRLNIPVSTCCVYTPVDLGPSFEMDLQKLQCTAYSGLYGFNGQE  208

Query  602  VNFHAWHYGIELQW  643
             N  AW YG+ L +
Sbjct  209  SNPDAWKYGVALNY  222



>ref|XP_011048518.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g03230 isoform X2 [Populus euphratica]
Length=1021

 Score = 58.5 bits (140),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 41/109 (38%), Positives = 57/109 (52%), Gaps = 6/109 (6%)
 Frame = +2

Query  89   AYDNCPKCGTMDVPYPLSTGDSCGNPSY-RVYCN--NGVLNFLSATGFYYKIQSIDPSAS  259
            A   C  CGT  +PYPLSTG  CG+P+Y   YCN  +G LNF  A G  Y++  I+P   
Sbjct  430  AATTCGTCGTNMIPYPLSTGPKCGDPAYLNFYCNLSSGQLNF-KARGDTYRVTKINPGMH  488

Query  260  RLIISPPVILTNTCMSSDLSLGGLTIDQNSPFNISSRNTVMLLNCSEGI  406
              +I       ++C S   +   L ++Q+SPF++     V L N S  I
Sbjct  489  SFVIQTET--ADSCKSIKSNGNLLQLNQSSPFHVIRFCNVDLGNISSTI  535



>ref|XP_011048516.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g03230 isoform X1 [Populus euphratica]
Length=1022

 Score = 58.5 bits (140),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 41/109 (38%), Positives = 57/109 (52%), Gaps = 6/109 (6%)
 Frame = +2

Query  89   AYDNCPKCGTMDVPYPLSTGDSCGNPSY-RVYCN--NGVLNFLSATGFYYKIQSIDPSAS  259
            A   C  CGT  +PYPLSTG  CG+P+Y   YCN  +G LNF  A G  Y++  I+P   
Sbjct  430  AATTCGTCGTNMIPYPLSTGPKCGDPAYLNFYCNLSSGQLNF-KARGDTYRVTKINPGMH  488

Query  260  RLIISPPVILTNTCMSSDLSLGGLTIDQNSPFNISSRNTVMLLNCSEGI  406
              +I       ++C S   +   L ++Q+SPF++     V L N S  I
Sbjct  489  SFVIQTET--ADSCKSIKSNGNLLQLNQSSPFHVIRFCNVDLGNISSTI  535



>gb|KGN43563.1| hypothetical protein Csa_7G045520 [Cucumis sativus]
Length=831

 Score = 58.5 bits (140),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 38/106 (36%), Positives = 53/106 (50%), Gaps = 6/106 (6%)
 Frame = +2

Query  98   NCPKCGTMDVPYPLSTGDSCGNPSYRVY-CN--NGVLNFLSATGFYYKIQSIDPSASRLI  268
            NC  CGT  +PYPLSTG  CG+P Y  + CN  +G +NF +A G  YK++ ID  A +  
Sbjct  472  NCGTCGTNLIPYPLSTGPKCGDPMYFNFNCNLASGQVNFEAAGG-TYKVKFIDSEARKFY  530

Query  269  ISPPVILTNTCMSSDLSLGGLTIDQNSPFNISSRNTVMLLNCSEGI  406
            I         C   +     L ++Q+SPF ++S       N  E  
Sbjct  531  IQTKE--PGDCGDKNWITKALQLNQSSPFRVTSWCNFKETNLEENF  574



>ref|XP_004144482.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g03230-like [Cucumis sativus]
Length=1030

 Score = 58.5 bits (140),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 38/104 (37%), Positives = 53/104 (51%), Gaps = 6/104 (6%)
 Frame = +2

Query  98   NCPKCGTMDVPYPLSTGDSCGNPSYRVY-CN--NGVLNFLSATGFYYKIQSIDPSASRLI  268
            NC  CGT  +PYPLSTG  CG+P Y  + CN  +G +NF +A G  YK++ ID  A +  
Sbjct  452  NCGTCGTNLIPYPLSTGPKCGDPMYFNFNCNLASGQVNFEAAGG-TYKVKFIDSEARKFY  510

Query  269  ISPPVILTNTCMSSDLSLGGLTIDQNSPFNISSRNTVMLLNCSE  400
            I         C   +     L ++Q+SPF ++S       N  E
Sbjct  511  IQTKE--PGDCGDKNWITKALQLNQSSPFRVTSWCNFKETNLEE  552



>ref|XP_004159218.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g03230-like, partial [Cucumis sativus]
Length=1010

 Score = 58.5 bits (140),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 38/104 (37%), Positives = 53/104 (51%), Gaps = 6/104 (6%)
 Frame = +2

Query  98   NCPKCGTMDVPYPLSTGDSCGNPSYRVY-CN--NGVLNFLSATGFYYKIQSIDPSASRLI  268
            NC  CGT  +PYPLSTG  CG+P Y  + CN  +G +NF +A G  YK++ ID  A +  
Sbjct  452  NCGTCGTNLIPYPLSTGPKCGDPMYFNFNCNLASGQVNFEAAGG-TYKVKFIDSEARKFY  510

Query  269  ISPPVILTNTCMSSDLSLGGLTIDQNSPFNISSRNTVMLLNCSE  400
            I         C   +     L ++Q+SPF ++S       N  E
Sbjct  511  IQTKE--PGDCGDKNWITKALQLNQSSPFRVTSWCNFKETNLEE  552



>ref|XP_008455381.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g03230 isoform X2 [Cucumis melo]
Length=1009

 Score = 58.5 bits (140),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 36/93 (39%), Positives = 51/93 (55%), Gaps = 6/93 (6%)
 Frame = +2

Query  98   NCPKCGTMDVPYPLSTGDSCGNPSYRVY-CN--NGVLNFLSATGFYYKIQSIDPSASRLI  268
            NC  CGT  +PYPLSTG  CG+P Y  + CN  +G +NF +A G  YK++ ID  A +  
Sbjct  424  NCGTCGTNLIPYPLSTGPKCGDPMYFNFNCNLASGQVNFEAAGG-TYKVKFIDSEARKFY  482

Query  269  ISPPVILTNTCMSSDLSLGGLTIDQNSPFNISS  367
            I         C   +     L ++Q+SPF ++S
Sbjct  483  IQTKE--PGDCGDKNWITKALRLNQSSPFRVTS  513



>ref|XP_008455380.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g03230 isoform X1 [Cucumis melo]
Length=1057

 Score = 58.2 bits (139),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 36/93 (39%), Positives = 51/93 (55%), Gaps = 6/93 (6%)
 Frame = +2

Query  98   NCPKCGTMDVPYPLSTGDSCGNPSYRVY-CN--NGVLNFLSATGFYYKIQSIDPSASRLI  268
            NC  CGT  +PYPLSTG  CG+P Y  + CN  +G +NF +A G  YK++ ID  A +  
Sbjct  472  NCGTCGTNLIPYPLSTGPKCGDPMYFNFNCNLASGQVNFEAAGG-TYKVKFIDSEARKFY  530

Query  269  ISPPVILTNTCMSSDLSLGGLTIDQNSPFNISS  367
            I         C   +     L ++Q+SPF ++S
Sbjct  531  IQTKE--PGDCGDKNWITKALRLNQSSPFRVTS  561



>ref|XP_007043402.1| S-locus lectin protein kinase family protein, putative isoform 
4 [Theobroma cacao]
 gb|EOX99233.1| S-locus lectin protein kinase family protein, putative isoform 
4 [Theobroma cacao]
Length=775

 Score = 58.2 bits (139),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 38/94 (40%), Positives = 52/94 (55%), Gaps = 5/94 (5%)
 Frame = +2

Query  98   NCPKCGTMDVPYPLSTGDSCGNPSY-RVYCNNGV--LNFLSATGFYYKIQSIDPSASRLI  268
            NC  CGT  VPYPLSTG  CG+P Y R YCNN    L+F + +G  Y + S+DP A   +
Sbjct  416  NCETCGTNLVPYPLSTGPKCGDPMYARFYCNNDTDHLSFNAPSG-SYNVISVDPEARIFV  474

Query  269  ISPPVILTNTCMSSDLSLGG-LTIDQNSPFNISS  367
            I       + C     S    L ++++S FN++S
Sbjct  475  IQMQSEKPDNCFFMKSSGSRILQLNESSQFNVTS  508



>ref|XP_007043403.1| S-locus lectin protein kinase family protein, putative isoform 
5 [Theobroma cacao]
 gb|EOX99234.1| S-locus lectin protein kinase family protein, putative isoform 
5 [Theobroma cacao]
Length=701

 Score = 58.2 bits (139),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 38/94 (40%), Positives = 52/94 (55%), Gaps = 5/94 (5%)
 Frame = +2

Query  98   NCPKCGTMDVPYPLSTGDSCGNPSY-RVYCNNGV--LNFLSATGFYYKIQSIDPSASRLI  268
            NC  CGT  VPYPLSTG  CG+P Y R YCNN    L+F + +G  Y + S+DP A   +
Sbjct  416  NCETCGTNLVPYPLSTGPKCGDPMYARFYCNNDTDHLSFNAPSG-SYNVISVDPEARIFV  474

Query  269  ISPPVILTNTCMSSDLSLGG-LTIDQNSPFNISS  367
            I       + C     S    L ++++S FN++S
Sbjct  475  IQMQSEKPDNCFFMKSSGSRILQLNESSQFNVTS  508



>ref|XP_007043400.1| S-locus lectin protein kinase family protein, putative isoform 
2 [Theobroma cacao]
 gb|EOX99231.1| S-locus lectin protein kinase family protein, putative isoform 
2 [Theobroma cacao]
Length=1025

 Score = 58.2 bits (139),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 38/94 (40%), Positives = 52/94 (55%), Gaps = 5/94 (5%)
 Frame = +2

Query  98   NCPKCGTMDVPYPLSTGDSCGNPSY-RVYCNNGV--LNFLSATGFYYKIQSIDPSASRLI  268
            NC  CGT  VPYPLSTG  CG+P Y R YCNN    L+F + +G  Y + S+DP A   +
Sbjct  416  NCETCGTNLVPYPLSTGPKCGDPMYARFYCNNDTDHLSFNAPSG-SYNVISVDPEARIFV  474

Query  269  ISPPVILTNTCMSSDLSLGG-LTIDQNSPFNISS  367
            I       + C     S    L ++++S FN++S
Sbjct  475  IQMQSEKPDNCFFMKSSGSRILQLNESSQFNVTS  508



>ref|XP_007043401.1| S-locus lectin protein kinase family protein, putative isoform 
3 [Theobroma cacao]
 gb|EOX99232.1| S-locus lectin protein kinase family protein, putative isoform 
3 [Theobroma cacao]
Length=767

 Score = 58.2 bits (139),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 38/94 (40%), Positives = 52/94 (55%), Gaps = 5/94 (5%)
 Frame = +2

Query  98   NCPKCGTMDVPYPLSTGDSCGNPSY-RVYCNNGV--LNFLSATGFYYKIQSIDPSASRLI  268
            NC  CGT  VPYPLSTG  CG+P Y R YCNN    L+F + +G  Y + S+DP A   +
Sbjct  416  NCETCGTNLVPYPLSTGPKCGDPMYARFYCNNDTDHLSFNAPSG-SYNVISVDPEARIFV  474

Query  269  ISPPVILTNTCMSSDLSLGG-LTIDQNSPFNISS  367
            I       + C     S    L ++++S FN++S
Sbjct  475  IQMQSEKPDNCFFMKSSGSRILQLNESSQFNVTS  508



>ref|XP_007043399.1| S-locus lectin protein kinase family protein, putative isoform 
1 [Theobroma cacao]
 gb|EOX99230.1| S-locus lectin protein kinase family protein, putative isoform 
1 [Theobroma cacao]
Length=996

 Score = 58.2 bits (139),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 38/94 (40%), Positives = 52/94 (55%), Gaps = 5/94 (5%)
 Frame = +2

Query  98   NCPKCGTMDVPYPLSTGDSCGNPSY-RVYCNNGV--LNFLSATGFYYKIQSIDPSASRLI  268
            NC  CGT  VPYPLSTG  CG+P Y R YCNN    L+F + +G  Y + S+DP A   +
Sbjct  416  NCETCGTNLVPYPLSTGPKCGDPMYARFYCNNDTDHLSFNAPSG-SYNVISVDPEARIFV  474

Query  269  ISPPVILTNTCMSSDLSLGG-LTIDQNSPFNISS  367
            I       + C     S    L ++++S FN++S
Sbjct  475  IQMQSEKPDNCFFMKSSGSRILQLNESSQFNVTS  508



>ref|XP_007043404.1| S-locus lectin protein kinase family protein, putative isoform 
6 [Theobroma cacao]
 gb|EOX99235.1| S-locus lectin protein kinase family protein, putative isoform 
6 [Theobroma cacao]
Length=720

 Score = 58.2 bits (139),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 38/94 (40%), Positives = 52/94 (55%), Gaps = 5/94 (5%)
 Frame = +2

Query  98   NCPKCGTMDVPYPLSTGDSCGNPSY-RVYCNNGV--LNFLSATGFYYKIQSIDPSASRLI  268
            NC  CGT  VPYPLSTG  CG+P Y R YCNN    L+F + +G  Y + S+DP A   +
Sbjct  416  NCETCGTNLVPYPLSTGPKCGDPMYARFYCNNDTDHLSFNAPSG-SYNVISVDPEARIFV  474

Query  269  ISPPVILTNTCMSSDLSLGG-LTIDQNSPFNISS  367
            I       + C     S    L ++++S FN++S
Sbjct  475  IQMQSEKPDNCFFMKSSGSRILQLNESSQFNVTS  508



>ref|XP_010678931.1| PREDICTED: uncharacterized protein LOC104894411 [Beta vulgaris 
subsp. vulgaris]
Length=1995

 Score = 58.2 bits (139),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 35/96 (36%), Positives = 53/96 (55%), Gaps = 7/96 (7%)
 Frame = +2

Query  101   CPKCGTMDVPYPLSTGDSCGNPSY-RVYCNN--GVLNFLSATGFYYKIQSIDPSASRLII  271
             C  CGT  +PYPLSTG +CG+PSY   +CN   G ++F + +G  +++ SIDP      I
Sbjct  1451  CTPCGTYIIPYPLSTGGNCGDPSYSHFHCNKQTGQVHFSTPSG-NFRVNSIDPDKKLFSI  1509

Query  272   SPPVILTNTCMSSDLSLGGLTIDQNSPFNISSRNTV  379
                 ++ N C    + L  L++D + PF   + N V
Sbjct  1510  Q---VMHNICDDKYIHLSVLSLDNSLPFTFRNCNVV  1542



>ref|XP_010035634.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g03230 isoform X3 [Eucalyptus grandis]
Length=924

 Score = 57.8 bits (138),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 39/93 (42%), Positives = 50/93 (54%), Gaps = 13/93 (14%)
 Frame = +2

Query  98   NCPKCGTMDVPYPLSTGDSCGNPSYR-VYCN--NGVLNFLSATGFYYKIQSIDPSASRLI  268
            NC  CGT  +PYPLSTG  CG+P YR  YCN   G +NF S +G Y   Q I  S   LI
Sbjct  446  NCEICGTNLIPYPLSTGSQCGDPMYRSFYCNTSTGTVNFKSPSGTYQVTQIIPESRKFLI  505

Query  269  ISPPVILTNTCMSSDLSLGGLTIDQNSPFNISS  367
             S     T++C         L  +++ PF++SS
Sbjct  506  RSKQ---TDSCKV-------LAFNRSLPFHLSS  528



>ref|XP_010035632.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g03230 isoform X1 [Eucalyptus grandis]
 gb|KCW47080.1| hypothetical protein EUGRSUZ_K00885 [Eucalyptus grandis]
Length=1014

 Score = 57.8 bits (138),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 39/93 (42%), Positives = 50/93 (54%), Gaps = 13/93 (14%)
 Frame = +2

Query  98   NCPKCGTMDVPYPLSTGDSCGNPSYR-VYCN--NGVLNFLSATGFYYKIQSIDPSASRLI  268
            NC  CGT  +PYPLSTG  CG+P YR  YCN   G +NF S +G Y   Q I  S   LI
Sbjct  446  NCEICGTNLIPYPLSTGSQCGDPMYRSFYCNTSTGTVNFKSPSGTYQVTQIIPESRKFLI  505

Query  269  ISPPVILTNTCMSSDLSLGGLTIDQNSPFNISS  367
             S     T++C         L  +++ PF++SS
Sbjct  506  RSKQ---TDSCKV-------LAFNRSLPFHLSS  528



>gb|KCW47081.1| hypothetical protein EUGRSUZ_K00885 [Eucalyptus grandis]
Length=932

 Score = 57.8 bits (138),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 39/93 (42%), Positives = 50/93 (54%), Gaps = 13/93 (14%)
 Frame = +2

Query  98   NCPKCGTMDVPYPLSTGDSCGNPSYR-VYCN--NGVLNFLSATGFYYKIQSIDPSASRLI  268
            NC  CGT  +PYPLSTG  CG+P YR  YCN   G +NF S +G Y   Q I  S   LI
Sbjct  446  NCEICGTNLIPYPLSTGSQCGDPMYRSFYCNTSTGTVNFKSPSGTYQVTQIIPESRKFLI  505

Query  269  ISPPVILTNTCMSSDLSLGGLTIDQNSPFNISS  367
             S     T++C         L  +++ PF++SS
Sbjct  506  RSKQ---TDSCKV-------LAFNRSLPFHLSS  528



>ref|XP_010035633.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g03230 isoform X2 [Eucalyptus grandis]
Length=984

 Score = 57.8 bits (138),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 39/93 (42%), Positives = 50/93 (54%), Gaps = 13/93 (14%)
 Frame = +2

Query  98   NCPKCGTMDVPYPLSTGDSCGNPSYR-VYCN--NGVLNFLSATGFYYKIQSIDPSASRLI  268
            NC  CGT  +PYPLSTG  CG+P YR  YCN   G +NF S +G Y   Q I  S   LI
Sbjct  446  NCEICGTNLIPYPLSTGSQCGDPMYRSFYCNTSTGTVNFKSPSGTYQVTQIIPESRKFLI  505

Query  269  ISPPVILTNTCMSSDLSLGGLTIDQNSPFNISS  367
             S     T++C         L  +++ PF++SS
Sbjct  506  RSKQ---TDSCKV-------LAFNRSLPFHLSS  528



>ref|XP_009603896.1| PREDICTED: wall-associated receptor kinase-like 15 [Nicotiana 
tomentosiformis]
Length=297

 Score = 56.6 bits (135),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 37/107 (35%), Positives = 55/107 (51%), Gaps = 7/107 (7%)
 Frame = +2

Query  86   IAYDNCPK-CGTMDVPYPLSTGDSCGNPSYRVY--CNNGVLNFLSATGFYYKIQSIDPSA  256
            I    C K CG + + YP  TG  CG+P ++ Y  CNN  L+F + TG  Y + SID + 
Sbjct  22   ITSQTCQKSCGNIPIKYPFGTGPGCGDPRFQPYVICNNQQLSFKTHTG-CYPVTSIDYNN  80

Query  257  SRLIISPPVILTNTCMSSDLSLGGLTIDQNSPFNISSRNTVMLLNCS  397
              L I+ P + T  C        G ++D N+PF+ +      LL+C+
Sbjct  81   QVLYINDPSMSTCACTQPS---KGFSLDGNAPFSFNDDTVFALLDCA  124



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1690861144275