BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c5633_g2_i1 len=843 path=[1079:0-842]

Length=843
                                                                      Score     E

ref|XP_009801439.1|  PREDICTED: probable membrane-associated kina...    126   1e-30   
ref|XP_009612635.1|  PREDICTED: probable membrane-associated kina...    121   9e-29   
ref|XP_004248443.1|  PREDICTED: probable membrane-associated kina...    104   2e-23   
emb|CDP08744.1|  unnamed protein product                                102   3e-22   
ref|XP_006358676.1|  PREDICTED: probable membrane-associated kina...  99.4    2e-21   
ref|XP_002511933.1|  conserved hypothetical protein                   96.7    3e-20   Ricinus communis
ref|XP_004231196.1|  PREDICTED: probable membrane-associated kina...  91.3    5e-18   
gb|KDP28549.1|  hypothetical protein JCGZ_14320                       85.9    1e-16   
ref|XP_007152104.1|  hypothetical protein PHAVU_004G102700g           85.1    3e-16   
gb|KHN47270.1|  Putative membrane-associated kinase regulator 6       80.9    9e-15   
ref|XP_010661858.1|  PREDICTED: probable membrane-associated kina...  79.0    3e-14   
ref|XP_010035187.1|  PREDICTED: probable membrane-associated kina...  78.6    5e-14   
ref|XP_006444929.1|  hypothetical protein CICLE_v10023540mg           77.0    2e-13   
ref|XP_002320831.1|  hypothetical protein POPTR_0014s08720g           77.0    2e-13   Populus trichocarpa [western balsam poplar]
ref|XP_003533963.1|  PREDICTED: probable membrane-associated kina...  77.0    2e-13   
ref|XP_006375355.1|  hypothetical protein POPTR_0014s08720g           76.3    3e-13   
ref|XP_003548132.1|  PREDICTED: probable membrane-associated kina...  76.6    3e-13   
ref|XP_002513621.1|  conserved hypothetical protein                   75.9    4e-13   Ricinus communis
ref|XP_011001963.1|  PREDICTED: probable membrane-associated kina...  75.9    5e-13   
gb|KDP22197.1|  hypothetical protein JCGZ_26028                       75.1    7e-13   
ref|XP_011003669.1|  PREDICTED: probable membrane-associated kina...  75.1    9e-13   
gb|EYU32186.1|  hypothetical protein MIMGU_mgv1a0234681mg             73.9    1e-12   
ref|XP_007038880.1|  Uncharacterized protein TCM_015294               74.3    2e-12   
gb|ACU19215.1|  unknown                                               73.9    2e-12   Glycine max [soybeans]
ref|XP_011047743.1|  PREDICTED: probable membrane-associated kina...  73.6    3e-12   
ref|XP_011037227.1|  PREDICTED: probable membrane-associated kina...  72.8    4e-12   
ref|XP_006491203.1|  PREDICTED: probable membrane-associated kina...  72.8    5e-12   
ref|XP_002278076.1|  PREDICTED: probable membrane-associated kina...  72.8    5e-12   Vitis vinifera
ref|XP_006490607.1|  PREDICTED: probable membrane-associated kina...  71.6    1e-11   
ref|XP_006374294.1|  hypothetical protein POPTR_0015s05750g           68.6    2e-10   
ref|XP_007143505.1|  hypothetical protein PHAVU_007G077100g           68.6    2e-10   
ref|XP_004515108.1|  PREDICTED: probable membrane-associated kina...  68.2    2e-10   
ref|XP_002318354.1|  hypothetical protein POPTR_0012s01020g           67.8    4e-10   Populus trichocarpa [western balsam poplar]
ref|XP_007051680.1|  Uncharacterized protein isoform 2                67.4    5e-10   
ref|XP_003592167.1|  hypothetical protein MTR_1g099440                67.4    6e-10   
ref|XP_007051679.1|  Uncharacterized protein isoform 1                67.0    7e-10   
emb|CBI22601.3|  unnamed protein product                              68.2    1e-09   
ref|NP_001240994.1|  uncharacterized protein LOC100807566             65.9    1e-09   
gb|KEH25758.1|  membrane-associated kinase regulator-like protein...  65.9    2e-09   
gb|AFK39128.1|  unknown                                               65.9    2e-09   
ref|XP_003520072.1|  PREDICTED: probable membrane-associated kina...  65.5    2e-09   
ref|NP_001239958.1|  uncharacterized protein LOC100776507             65.5    2e-09   
gb|KHG04886.1|  putative membrane-associated kinase regulator 6 -...  65.1    2e-09   
ref|XP_010251590.1|  PREDICTED: probable membrane-associated kina...  66.2    2e-09   
gb|AES62418.2|  membrane-associated kinase regulator-like protein...  65.5    3e-09   
ref|XP_004496506.1|  PREDICTED: probable membrane-associated kina...  65.1    3e-09   
ref|XP_007218214.1|  hypothetical protein PRUPE_ppa010648mg           65.5    3e-09   
ref|XP_010261426.1|  PREDICTED: probable membrane-associated kina...  65.1    4e-09   
ref|XP_009368709.1|  PREDICTED: probable membrane-associated kina...  65.1    4e-09   
gb|KEH25757.1|  membrane-associated kinase regulator-like protein...  64.7    5e-09   
ref|XP_009375561.1|  PREDICTED: probable membrane-associated kina...  63.9    1e-08   
ref|XP_008380338.1|  PREDICTED: probable membrane-associated kina...  63.5    1e-08   
ref|XP_008234807.1|  PREDICTED: probable membrane-associated kina...  63.5    2e-08   
gb|KHN12219.1|  Putative membrane-associated kinase regulator 6       62.4    2e-08   
ref|XP_006573105.1|  PREDICTED: probable membrane-associated kina...  62.4    3e-08   
ref|XP_010105712.1|  hypothetical protein L484_014200                 62.4    3e-08   
ref|XP_007153595.1|  hypothetical protein PHAVU_003G048900g           62.0    3e-08   
ref|XP_010060057.1|  PREDICTED: probable membrane-associated kina...  62.8    4e-08   
dbj|BAB10438.1|  unnamed protein product                              62.4    4e-08   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008376665.1|  PREDICTED: probable membrane-associated kina...  62.0    4e-08   
ref|XP_004234209.1|  PREDICTED: probable membrane-associated kina...  61.2    7e-08   
ref|XP_008439312.1|  PREDICTED: probable membrane-associated kina...  61.2    7e-08   
gb|KGN57882.1|  hypothetical protein Csa_3G363150                     59.7    2e-07   
ref|XP_009772891.1|  PREDICTED: probable membrane-associated kina...  59.3    3e-07   
ref|XP_009772890.1|  PREDICTED: probable membrane-associated kina...  59.3    4e-07   
ref|NP_568780.1|  membrane-associated kinase regulator family pro...  59.3    4e-07   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006366645.1|  PREDICTED: probable membrane-associated kina...  58.9    5e-07   
ref|XP_004490054.1|  PREDICTED: probable membrane-associated kina...  58.9    5e-07   
gb|AAM62601.1|  unknown                                               58.5    7e-07   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009602013.1|  PREDICTED: probable membrane-associated kina...  58.2    9e-07   
ref|XP_003613709.1|  hypothetical protein MTR_5g039840                58.2    1e-06   
ref|XP_009602012.1|  PREDICTED: probable membrane-associated kina...  57.8    1e-06   
gb|AFK36494.1|  unknown                                               57.8    1e-06   
ref|XP_004308032.1|  PREDICTED: probable membrane-associated kina...  57.4    2e-06   
ref|XP_010537127.1|  PREDICTED: probable membrane-associated kina...  57.0    2e-06   
ref|XP_006491204.1|  PREDICTED: probable membrane-associated kina...  55.8    3e-06   
ref|XP_010055073.1|  PREDICTED: probable membrane-associated kina...  55.5    3e-06   
gb|KHN17391.1|  Putative membrane-associated kinase regulator 6       56.2    3e-06   
ref|XP_010555704.1|  PREDICTED: probable membrane-associated kina...  56.6    4e-06   
ref|XP_002865938.1|  hypothetical protein ARALYDRAFT_495355           56.2    5e-06   
ref|XP_004134316.1|  PREDICTED: probable membrane-associated kina...  55.5    6e-06   
ref|XP_010445387.1|  PREDICTED: probable membrane-associated kina...  55.8    8e-06   
emb|CDY50490.1|  BnaA10g06310D                                        55.1    1e-05   
ref|XP_010482671.1|  PREDICTED: probable membrane-associated kina...  55.1    1e-05   
ref|XP_010537126.1|  PREDICTED: probable membrane-associated kina...  54.7    2e-05   
ref|XP_006422072.1|  hypothetical protein CICLE_v10005884mg           54.3    2e-05   
ref|XP_003532057.2|  PREDICTED: probable membrane-associated kina...  54.3    2e-05   
ref|XP_010092885.1|  hypothetical protein L484_022480                 55.1    2e-05   
gb|KGN56472.1|  hypothetical protein Csa_3G120510                     54.3    2e-05   
gb|KHN06845.1|  Putative membrane-associated kinase regulator 6       53.9    2e-05   
gb|KCW71550.1|  hypothetical protein EUGRSUZ_E00092                   53.5    3e-05   
emb|CDY38718.1|  BnaC03g15310D                                        53.9    4e-05   
emb|CDY19642.1|  BnaC09g28980D                                        53.1    6e-05   
gb|KEH25756.1|  membrane-associated kinase regulator-like protein...  52.8    7e-05   
gb|KFK26890.1|  hypothetical protein AALP_AA8G306900                  52.8    8e-05   
ref|XP_009119831.1|  PREDICTED: probable membrane-associated kina...  50.8    3e-04   
ref|XP_008437977.1|  PREDICTED: probable membrane-associated kina...  50.4    4e-04   
ref|XP_008802036.1|  PREDICTED: probable membrane-associated kina...  50.8    6e-04   
ref|XP_009599456.1|  PREDICTED: probable membrane-associated kina...  49.7    7e-04   
ref|XP_008802037.1|  PREDICTED: probable membrane-associated kina...  50.4    7e-04   



>ref|XP_009801439.1| PREDICTED: probable membrane-associated kinase regulator 6 [Nicotiana 
sylvestris]
Length=276

 Score =   126 bits (317),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 95/272 (35%), Positives = 136/272 (50%), Gaps = 59/272 (22%)
 Frame = -1

Query  798  ATHPLAIESFSYSWLLNARppsldslsdSESKH--QDQDIAFSVVHSMRFSEADEAKNFR  625
            +  PLA ESFSYSWLLN +P            +   ++DI F + +S RF E  EA+NF 
Sbjct  4    SQQPLATESFSYSWLLNRKPSIDSLTESLTPSYITDEEDIMF-IAYSKRFLE--EAQNFN  60

Query  624  FDINASSESGLLVDADEIFSDGHMIPVYLHRPK-PPVEQAV----------SAPATPANN  478
            FD+  S ES   V ADEIFSDGH++P+Y  R K    E+A+          S P TP   
Sbjct  61   FDVRPSVES---VPADEIFSDGHIMPLYFDRSKIESFEEALNNSNTCSISSSTPPTP---  114

Query  477  FWVSVRGKKEPQDYISQKWKKLLGTRILGKWFGFCKRLGGSSRSRKNCAKVDDLNRKAME  298
              +S    +  Q    +KW+K  G R+L KWFGF +       S +  AKVDDL RK  E
Sbjct  115  --ISTLSSRTSQAEFLEKWRKFSG-RVLVKWFGFFRPFAKRIASSRKSAKVDDLQRKESE  171

Query  297  VQINCKASSSD-SDDP----------------------------RKTKSCSNTPQESPLH  205
            +Q +CK+++S   + P                            RK KS SN+   SP+ 
Sbjct  172  IQ-SCKSTNSLFQESPRRMVKSYSVVDWAGNENNQRNTSRIKRLRKVKSWSNSAHASPIR  230

Query  204  YTTAYHSSPDA----QTSITEAIIHCRKSFGL  121
              ++ H+S D     + ++++AI+HC++SF +
Sbjct  231  NPSSDHNSTDVWRDMENAVSDAILHCKRSFAM  262



>ref|XP_009612635.1| PREDICTED: probable membrane-associated kinase regulator 6 [Nicotiana 
tomentosiformis]
Length=279

 Score =   121 bits (303),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 94/277 (34%), Positives = 134/277 (48%), Gaps = 66/277 (24%)
 Frame = -1

Query  798  ATHPLAIESFSYSWLLNARppsldslsdSESKH---QDQDIAFSVVHSMRFSEADEAKNF  628
            +  PLA ESFSYSWLLN +P            +    ++DI F + +S RF E  EA+NF
Sbjct  4    SQQPLATESFSYSWLLNRKPSIDSLTETLRPSYITDDEEDIMF-IAYSKRFLE--EAQNF  60

Query  627  RFDINASSESGLLVDADEIFSDGHMIPVYLHRPK-PPVEQAVSAPATPANNF--------  475
             FD+  S ES   V ADEIFSDGH++P+Y  R K    EQ +       NNF        
Sbjct  61   NFDVRPSVES---VPADEIFSDGHIMPLYFDRSKIESFEQVL-------NNFNTSSISSS  110

Query  474  ----WVSVRGKKEPQDYISQKWKKLLGTRILGKWFGFCKRLGGSSRSRKNCAKVDDLNRK  307
                  S    +  Q    +KW+K  G R+L KWFGF +       S +  AKVDDL RK
Sbjct  111  TPPTPASTLSSRTSQADFLEKWRKFSG-RVLVKWFGFLRPFSQRFGSSRKSAKVDDLQRK  169

Query  306  AMEVQINCKASSSDS---DDP----------------------------RKTKSCSNTPQ  220
              E+Q +CK+++++S     P                            RK KS SN+  
Sbjct  170  ESEIQ-SCKSTTTNSLFQGSPRRMVKSYSVVDWTGNEKNQRSSSRIKRLRKVKSWSNSAH  228

Query  219  ESPLHYTTAYHSSPDA----QTSITEAIIHCRKSFGL  121
             SP+   ++ H+S D     + ++++AI+HC++SF +
Sbjct  229  ASPIRSPSSDHNSTDVWRDMENAVSDAILHCKRSFAM  265



>ref|XP_004248443.1| PREDICTED: probable membrane-associated kinase regulator 6 [Solanum 
lycopersicum]
Length=190

 Score =   104 bits (260),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 85/224 (38%), Positives = 114/224 (51%), Gaps = 49/224 (22%)
 Frame = -1

Query  786  LAIESFSYSWLLNARppsldslsdSESKHQDQDIAFSVVHSMRFSEADEAKNFRFDINAS  607
            LA ESFSYSWLLN   PS +S         DQD  F +  S RF E  E++NF FDIN +
Sbjct  8    LASESFSYSWLLNETTPSHESTIL-----DDQDTTF-LNFSKRFLEL-ESQNFNFDINPT  60

Query  606  SESGLLVDADEIFSDGHMIPVYLHRPKPPVEQAVS--APATPANNFWVSVRGKKEPQDYI  433
                 LV ADEIFSDGH++P+YL      +E+  +    +TP   F  + RGK+      
Sbjct  61   FS---LVHADEIFSDGHIMPLYLDN-MSKIEKVCNFDTCSTPLTPFCATNRGKQR-----  111

Query  432  SQKWKKLLGTRILGKWFGFCKRLGGSSRSRKNCAKVDDLNRKAMEVQINCKASSSDSDDP  253
             +   K+L  R+   W  FCK LG S +     +KVDD  RK +E+            D 
Sbjct  112  -KSCGKILVKRLKFLWL-FCKSLGNSRKG----SKVDDFERKVLEI------------DS  153

Query  252  RKTKSCSNTPQESPLHYTTAYHSSPDAQTSITEAIIHCRKSFGL  121
            R      N+P  SP H         D + +I+EAI+HC++SFG+
Sbjct  154  R------NSPMRSPSHCI-------DMENTISEAILHCKRSFGM  184



>emb|CDP08744.1| unnamed protein product [Coffea canephora]
Length=260

 Score =   102 bits (255),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 87/265 (33%), Positives = 132/265 (50%), Gaps = 47/265 (18%)
 Frame = -1

Query  804  MEATHPLAIESFSYSWLLNARppsldslsdSESKHQDQDIAFSVVHSMRFSEADEAKNFR  625
            M+ + PLA +SFSYSWL+N  P     L          +    +VH +     D+ + F 
Sbjct  1    MDNSQPLATDSFSYSWLINQEPSLDGLLESLRPSVDFSNETVPMVHHLNKIFKDD-QEFD  59

Query  624  FDINASSESGL-LVDADEIFSDGHMIPVYLHRPKPPVEQAVSAPATPANNF---WVSVRG  457
            F++   S S L LVDADEIF++G + P++ +R +  ++ ++S PATP ++     +SV  
Sbjct  60   FNVTPGSRSSLALVDADEIFAEGCIKPIFPNRNRTKMQPSLSVPATPLSSVSSRTLSVSS  119

Query  456  KKEPQDYISQKWKKLLGTRILGKWFG----FCKRLGGSSRSRKNCAKVDDLNRKAMEVQI  289
              + + Y S+KW K    ++L + F     FC+  G S +S     +VDDL+RK +EVQ 
Sbjct  120  AYQGKYYSSRKWTK-SSNKVLQRCFSLLKPFCQGFGWSRKS----IRVDDLDRKVLEVQS  174

Query  288  N---------------------CKASSSDSDDPRK-----TKSCSNTPQ----ESPLHYT  199
                                   K +S+  D  R+     TK  SN+PQ     SP HYT
Sbjct  175  RSNSQQASPDRRTAYSAANWAAVKQTSNTLDACRRLQNSETKILSNSPQASTPRSPSHYT  234

Query  198  TAYHSSPDAQTSITEAIIHCRKSFG  124
                S  D ++SI EAI+HC++SF 
Sbjct  235  ---DSRLDIESSIHEAILHCKRSFA  256



>ref|XP_006358676.1| PREDICTED: probable membrane-associated kinase regulator 6-like 
[Solanum tuberosum]
Length=193

 Score = 99.4 bits (246),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 84/227 (37%), Positives = 113/227 (50%), Gaps = 52/227 (23%)
 Frame = -1

Query  786  LAIESFSYSWLLNARppsldslsdSESKHQDQDIAFSVVHSMRFSEADEAKNFRFDINAS  607
            +A ESFSYSWLLN  PPSL S         DQD  F +  S RF E  E++NF FDIN +
Sbjct  8    VASESFSYSWLLNETPPSLKSTIL-----DDQDTTF-LNLSKRFLEL-ESQNFNFDINPT  60

Query  606  SESGLLVDADEIFSDGHMIPVYLHRPKPPVE-----QAVSAPATPANNFWVSVRGKKEPQ  442
                  V ADEIFSDGH++P+Y       +E        S  +TP   F+ + RGK+   
Sbjct  61   FS---FVHADEIFSDGHIMPLYFDNIS-KIETICNFDTCSISSTPLTPFYATNRGKQR--  114

Query  441  DYISQKWKKLLGTRILGKWFGFCKRLGGSSRSRKNCAKVDDLNRKAMEVQINCKASSSDS  262
                +   K+L  R+   W  FCK LG S +     +KVDD  RK +E+           
Sbjct  115  ----KSCCKILAKRLNFLWL-FCKSLGNSRKG----SKVDDFERKVLEI-----------  154

Query  261  DDPRKTKSCSNTPQESPLHYTTAYHSSPDAQTSITEAIIHCRKSFGL  121
             D R      N+P  SP H         D + +I++AI+HC++SFG+
Sbjct  155  -DSR------NSPMRSPSHCI-------DMENTISDAILHCKRSFGM  187



>ref|XP_002511933.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF50602.1| conserved hypothetical protein [Ricinus communis]
Length=214

 Score = 96.7 bits (239),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 71/232 (31%), Positives = 115/232 (50%), Gaps = 28/232 (12%)
 Frame = -1

Query  804  MEATHPLAIESFSYSWLLNARppsldslsdSES------KHQDQDIAFSVVHSMRFSEAD  643
            ME + PLAIESFS SWL +A            +      +   +++ + ++ S R    +
Sbjct  1    MEFSQPLAIESFSRSWLTSASSHLYGLEEPLRASLDSSYEASGEELEYKILKSER--SLE  58

Query  642  EAKNFRFDINASSESGLLVDADEIFSDGHMIPVYLHRPKPPVEQAVSAPATPANNFWV-S  466
            + +NF FD+  S     LV AD++FSDG + PV++++ K      +     P ++F   +
Sbjct  59   DVQNFNFDVPISEHPERLVHADQLFSDGLIKPVFVNQSKIEASDPLDLVPIPCSSFSSRN  118

Query  465  VRGKKEPQDYISQKWKKLLGTRILGKWFGFCKRLGGSSRSRKNCAKVDDLNRKAMEVQIN  286
            V      Q +I ++WKK    RIL K FG+ K L       + C +VDD++ +A      
Sbjct  119  VVSTGHIQCHILKRWKK-SSERILRKCFGYLKPLCHKITGARKCTRVDDIDERA------  171

Query  285  CKASSSDSDDPRKTKSCSNTPQESPLHYTTAYHSSPDAQTSITEAIIHCRKS  130
                       R+ KS S+ PQ SP H   + +S  D ++SI EA++HC++S
Sbjct  172  -----------RQVKSWSSLPQASP-HRIYSTNSWCDIESSIYEAVLHCKRS  211



>ref|XP_004231196.1| PREDICTED: probable membrane-associated kinase regulator 6 [Solanum 
lycopersicum]
Length=272

 Score = 91.3 bits (225),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 91/271 (34%), Positives = 127/271 (47%), Gaps = 61/271 (23%)
 Frame = -1

Query  789  PLAIESFSYSWLLNARppsldslsdSESKHQDQDIAFS--------VVHSMRFSEADEAK  634
            PLA ESFSYSWLL+ +P            + D D            + +S RF E  EA+
Sbjct  7    PLATESFSYSWLLSRKPSIDGLTESPRPSYSDDDHDNDDEEEDMKFIAYSKRFLE--EAQ  64

Query  633  NFRFDINASSESGLLVDADEIFSDGHMIPVYLHRPKPPVEQAVSAPATPANNF-------  475
            NF FD++  SES   V ADEIFS GH++P YL + K  +E    A     NNF       
Sbjct  65   NFNFDVHPVSES---VHADEIFSHGHIMPRYLDKSK--IESFREA----LNNFNIISSVP  115

Query  474  ---------WVSVRGKKEPQDYISQKWKKLLGTRILGKWFGFCK-RLGGSSRSRKNCAKV  325
                      VS        D   +KW++    R+L KWFGF +      S SRK+ AKV
Sbjct  116  SSSSFHPTPRVSDSTTSTQADDFLKKWRRF-SRRVLVKWFGFIRPISKRISSSRKSTAKV  174

Query  324  DDLNRKAMEVQINCKASSS----------------DSDDPR-KTKSCSNTPQESPLHYTT  196
            DDL RK  E+Q +CKA+ S                + +D R + K+       S +    
Sbjct  175  DDLQRKVSEIQ-SCKATDSPPHRIMKSHSVVDWAGNRNDQRSRVKTLRKVKSWSSIKSPQ  233

Query  195  AYHSSP------DAQTSITEAIIHCRKSFGL  121
            A ++SP      D   ++++AI+HC++SFG+
Sbjct  234  AAYNSPVKTPSYDHSAAVSDAILHCKRSFGM  264



>gb|KDP28549.1| hypothetical protein JCGZ_14320 [Jatropha curcas]
Length=215

 Score = 85.9 bits (211),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 72/235 (31%), Positives = 123/235 (52%), Gaps = 31/235 (13%)
 Frame = -1

Query  804  MEATHPLAIESFSYSWL--LNARpp-sldslsdSESKHQ--DQDIAFSVVHSMRFSEADE  640
            M+++ PLAIESFSY+WL  +N+R     +  +  +S H+   +++ + ++ S R    +E
Sbjct  1    MDSSQPLAIESFSYTWLTSINSRLDGLEELRASLDSYHEATSEELDYKILKSKR--SLEE  58

Query  639  AKNFRFDINASSESGLLVDADEIFSDGHMIPVYLHRPKPPVEQAVSAPATPANNFWVSVR  460
             +NF FD+  S  S  LV AD++FSDG + PV++++ K  V  ++    T ++ F  +V 
Sbjct  59   VQNFDFDVPISQYSDALVHADQLFSDGLIKPVFINQSKKEVSGSLDLDPT-SSLFSRTVV  117

Query  459  GKKEPQDYISQKWKKLLGTRILGKWFGF----CKRLGGSSRSRKNCAKVDDLNRKAMEVQ  292
                 Q +I ++W+K    RIL K FG+    C ++ GS  S         ++R+     
Sbjct  118  PTVHVQCHIFKRWRK-SSERILLKCFGYLRPLCYKITGSRNSTSVDDIDRRVDRRVR---  173

Query  291  INCKASSSDSDDPRKTKSCSNTPQESPLHYTTAYHSSPDAQTSITEAIIHCRKSF  127
                          + KS SN+PQESP   + +     D ++SI EA++HC++S 
Sbjct  174  --------------QVKSWSNSPQESP-GISNSRTDWCDIESSIYEAVLHCKRSI  213



>ref|XP_007152104.1| hypothetical protein PHAVU_004G102700g [Phaseolus vulgaris]
 gb|ESW24098.1| hypothetical protein PHAVU_004G102700g [Phaseolus vulgaris]
Length=222

 Score = 85.1 bits (209),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 65/233 (28%), Positives = 111/233 (48%), Gaps = 22/233 (9%)
 Frame = -1

Query  804  MEATHPLAIESFSYSWLLNARppsldslsdSESKHQDQDIAFSVVHSMRFSEADE----A  637
            MEA+HPL+IESFSYSWL+N +P          +     D A  +    R   +      +
Sbjct  1    MEASHPLSIESFSYSWLVNLKPSIESLDGSLRASLDASDEASFIEMDPRMPPSKRFFRNS  60

Query  636  KNFRFDINASSESGLLVDADEIFSDGHMIPVYLHRPKPPVEQAVSA-PATPANNFWVSVR  460
            ++F+FD  AS     LVDADE+FS+G+++P+++   K    +A  A P+ P+++    + 
Sbjct  61   QDFKFDFPASQSPLTLVDADELFSNGYLMPLFVESLKMEAYEASDANPSLPSSSHVPKIA  120

Query  459  GKKEPQDYISQKWKKLLGTRILGKWFGFCKRLGGSSRSRKNCAKVDDLNRKAMEVQINCK  280
                     S K  + L  RI  K+  F + L    RS K+ +K + + ++         
Sbjct  121  VPNAHSRCPSLKRCRTLSRRIFQKYLNFLRPLCRRLRSGKSGSKPESVIKRTESA-----  175

Query  279  ASSSDSDDPRKTKSC--SNTPQESPLHYTTAYHSSPDAQTSITEAIIHCRKSF  127
                      K + C    +P+ S  +    +  S D+++SI EA++HC++S 
Sbjct  176  ----------KNRGCYSETSPRISVAYSADDWRKSCDSESSIYEAVLHCKRSI  218



>gb|KHN47270.1| Putative membrane-associated kinase regulator 6 [Glycine soja]
Length=229

 Score = 80.9 bits (198),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 67/239 (28%), Positives = 114/239 (48%), Gaps = 29/239 (12%)
 Frame = -1

Query  804  MEATHPLAIESFSYSWLLNARppsldslsdSESKHQDQDIAFSVVH-------SMRFSEA  646
            M+ +HPL+IESFSYSWL+N +P          +     D A S +        S RF   
Sbjct  1    MDTSHPLSIESFSYSWLVNLKPSLESLDGSLRTSLDASDEASSFIEMDPRMPPSKRFFR-  59

Query  645  DEAKNFRFDINASSESGLLVDADEIFSDGHMIPVYLHRPKPPVEQAVSA-PATPANNFWV  469
              +++F+FD   S     LVDADE+FS+G+++P+++   K    +A  A P  P+++   
Sbjct  60   -NSQDFKFDFPISQSPLTLVDADELFSNGYLMPLFVESLKMEAFEASDANPTLPSSSH--  116

Query  468  SVRGKKEPQDY---ISQKWKKLLGTRILGKWFGFCKRLGGSSRSRKNCAKVDDLNRKAME  298
             V     P  +    S K  + L  RI  K+  F + L    RS K+ +K + + ++   
Sbjct  117  -VPKSAVPNGHSRCPSLKRCRTLSRRIFRKYLNFLRPLCRRLRSGKSGSKPESVVKRTES  175

Query  297  VQINCKASSSDSDDPRKTKSCSNTPQESPLHYTTAYHSSPDAQTSITEAIIHCRKSFGL  121
             +     S +             +P+ S  +    +  S D+++SI EA++HC++S G+
Sbjct  176  AKNRGYYSET-------------SPRISVAYSADDWRKSCDSESSIYEAVLHCKRSIGM  221



>ref|XP_010661858.1| PREDICTED: probable membrane-associated kinase regulator 6 [Vitis 
vinifera]
Length=216

 Score = 79.0 bits (193),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 72/244 (30%), Positives = 106/244 (43%), Gaps = 53/244 (22%)
 Frame = -1

Query  795  THPLAIESFSYSWLLNARppsldslsdSESKHQDQDIA------FSVVHSMRFSEADEAK  634
            T PLA+ESFSYSWL+N +       S   +     D A      ++V+ S R    DEA+
Sbjct  3    TSPLAVESFSYSWLINVKSSLDGLGSPLRTSLDISDEATSKGKDYNVLKSQRL--MDEAQ  60

Query  633  NFRFDINASSESGLLVDADEIFSDGHMIPVYLHRPKPPV------------EQAVSAPAT  490
            NF FD+  S  S  L+ ADE+FS+G ++P+++   K  V                S P  
Sbjct  61   NFNFDVPTSQSSVALIHADEVFSNGFIVPMFIDPSKKEVLDTSHSLSSVPVSSLPSKPGI  120

Query  489  PANNFWVSVRGKKEPQDYISQKWKKLLGTRILGKWFGFCKRLGGSSRSRKNCAKVDDLNR  310
            PA     S            +KW+K      L K FGF + L G     +   +VDD++R
Sbjct  121  PAVGIHCS----------FFRKWQK-SSKSALYKCFGFFRPLRGKIGGSRKSIRVDDIDR  169

Query  309  KAMEVQINCKASSSDSDDPRKTKSCSNTPQESPLHYTTAYHSSPD---AQTSITEAIIHC  139
            +  E                  KS   +PQ  P    +A  S  D    ++SI EA+++C
Sbjct  170  RLWE-----------------AKSWRGSPQ--PSLQQSASSSVGDWCHMESSIHEAVLYC  210

Query  138  RKSF  127
            ++S 
Sbjct  211  KRSI  214



>ref|XP_010035187.1| PREDICTED: probable membrane-associated kinase regulator 6 [Eucalyptus 
grandis]
 ref|XP_010035188.1| PREDICTED: probable membrane-associated kinase regulator 6 [Eucalyptus 
grandis]
 ref|XP_010035189.1| PREDICTED: probable membrane-associated kinase regulator 6 [Eucalyptus 
grandis]
 gb|KCW46481.1| hypothetical protein EUGRSUZ_K00306 [Eucalyptus grandis]
Length=226

 Score = 78.6 bits (192),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 67/238 (28%), Positives = 111/238 (47%), Gaps = 26/238 (11%)
 Frame = -1

Query  804  MEATHPLAIESFSYSWLLNARppsldslsdSESKHQDQDIAFSVVH-------SMRFSEA  646
            ME++ PL++ESFSY WL+N +P        S     D     S +        S RFS+ 
Sbjct  1    MESSEPLSVESFSYRWLVNLKPARESFDGSSVRTSLDVSDEASFIEMDPRMPPSRRFSQN  60

Query  645  ---DEAKNFRFDINASSESGLLVDADEIFSDGHMIPVYL-HRPKPPVEQAVSAPATPANN  478
                 +++F+FD      S  LV ADE+FSDG+M+P++L H      E + S P  P + 
Sbjct  61   RGNSASQDFKFDFPGVPSSPALVHADELFSDGYMLPLFLEHSKMKAYEPSNSTPTQPGSL  120

Query  477  FWVSVRGKKEPQDYISQKWKKLLGTRILGKWFGFCKRLGGSSRSRKNCAKVDDLNRKAME  298
              +       P    S+   + L  R+  K+  F + L    R+ ++  + +  ++K   
Sbjct  121  KLIMSTSCSPPS---SKTRCRKLSKRMFRKYMDFLRPLYRIFRAGRSSFRAEFGDKKGPG  177

Query  297  VQINCKASSSDSDDPRKTKSCSNTPQESPLHYTTAYHSSPDAQTSITEAIIHCRKSFG  124
            ++       + S  PR +++CS                S D+++SI EA++HC+KSFG
Sbjct  178  IRNWVYPEEASS--PRISEACS----------ANDLRRSFDSESSIYEAVLHCKKSFG  223



>ref|XP_006444929.1| hypothetical protein CICLE_v10023540mg [Citrus clementina]
 gb|ESR58169.1| hypothetical protein CICLE_v10023540mg [Citrus clementina]
Length=211

 Score = 77.0 bits (188),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 71/238 (30%), Positives = 105/238 (44%), Gaps = 41/238 (17%)
 Frame = -1

Query  804  MEATHPLAIESFSYSWLLNARppsldslsdSESKHQDQDIAFSVVHSMRFSEADEAKNFR  625
            ME + PLAIESFSYSWL N                 D+ +  S+  S      + A+NF 
Sbjct  1    METSSPLAIESFSYSWLSNVETLLDGI---------DEPLRTSLDSSSEAISKELAENFN  51

Query  624  FDINASSESGLLVDADEIFSDGHMIPVYLHRPKPPVEQAVSAPAT--PANNFWVSVRGKK  451
            FDI  S  S  L+ ADE+FSDG + P ++  P   ++ + S   T  P ++F     G  
Sbjct  52   FDIPTSQSSAALLHADELFSDGLIKPEFVD-PSKILDASTSGLITVLPGSSF---SSGNV  107

Query  450  EP----QDYISQKWKKLLGTRILGKWFGF----CKRLGGSSRSRKNCAKVDDLNRKAMEV  295
             P       +  KW+       L K FG+    C  +G    S K  ++VDD++R+  EV
Sbjct  108  IPVFQGHYRLFSKWRISFKKNFL-KCFGYLRPHCHNIGS---SWKRSSRVDDIDRREREV  163

Query  294  QINCKASSSDSDDPRKTKSCSNTPQESPLHYTTAYHSSPDAQTSITEAIIHCRKSFGL  121
            + +  +  +      K              Y+       D + SI EAI+HC++S GL
Sbjct  164  KSSSSSPQASPPPSAK--------------YSVGVGDWYDIENSIYEAILHCKRSIGL  207



>ref|XP_002320831.1| hypothetical protein POPTR_0014s08720g [Populus trichocarpa]
 gb|EEE99146.1| hypothetical protein POPTR_0014s08720g [Populus trichocarpa]
Length=219

 Score = 77.0 bits (188),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 66/237 (28%), Positives = 118/237 (50%), Gaps = 33/237 (14%)
 Frame = -1

Query  804  MEATHPLAIESFSYSWLLNA----RppsldslsdSESKHQ--DQDIAFSVVHSMRFSEAD  643
            ME+   LAIESFS SWL +     +       +  +S H+   +++ + + +S R  E D
Sbjct  1    MESPETLAIESFSRSWLTSVNPSLQGLETALRASLDSSHEAISEELDYRMQNSRRSLEED  60

Query  642  EAKNFRFDINASSESGLLVDADEIFSDGHMIPVYLHRPKPPVEQAVS-APATPANNFWVS  466
            +  NF F I+ S ++  L+ AD++FSDG + P+++++ K     +++ AP  P++    +
Sbjct  61   QNFNFYFPISQSPDA--LLHADQLFSDGLIRPIFINQSKSEASSSLNLAPTVPSSLSSKT  118

Query  465  VRGKKEPQDYISQKWKKLLGTRILGKWFGFCKRLGGSSRSRKNCAKVDDLNRKAMEVQIN  286
            V   +    ++  +WK     RIL K FG+ + L    R  +   +VD++ R A EV   
Sbjct  119  VSAVQILCRFLG-RWK-----RILPKCFGYVRPLSHRVRDSRISTRVDNVERIAWEV---  169

Query  285  CKASSSDSDDPRKTKSCSNTPQESPLHYTT-AYHSSPDAQTSITEAIIHCRKSFGLQ  118
                          KS SN+ + SP      +     D+++SI +A++HC++S   Q
Sbjct  170  --------------KSQSNSREASPSRRVAYSLDGCHDSESSIHDAVLHCKRSMRWQ  212



>ref|XP_003533963.1| PREDICTED: probable membrane-associated kinase regulator 6-like 
[Glycine max]
Length=223

 Score = 77.0 bits (188),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 64/234 (27%), Positives = 109/234 (47%), Gaps = 23/234 (10%)
 Frame = -1

Query  804  MEATHPLAIESFSYSWLLNARppsldslsdSESKHQDQDIAFSVVH-------SMRFSEA  646
            M+ +HPL+IESFSYSWL+N +P          +     D A S +        S RF   
Sbjct  1    MDTSHPLSIESFSYSWLVNLKPSLESLDGSLRTSLDASDEASSFIEMDPRMPPSKRFFR-  59

Query  645  DEAKNFRFDINASSESGLLVDADEIFSDGHMIPVYLHRPKPPVEQAVSA-PATPANNFWV  469
              +++F+FD   S     LVDADE+FS+G+++P+++   K    +A  A P  P+++   
Sbjct  60   -NSQDFKFDFPISQSPLTLVDADELFSNGYLMPLFVESLKMEAFEASDANPTLPSSSHVP  118

Query  468  SVRGKKEPQDYISQKWKKLLGTRILGKWFGFCKRLGGSSRSRKNCAKVDDLNRKAMEVQI  289
                        S K  + L  RI  K+  F + L    RS K+ +K + + ++    + 
Sbjct  119  KSAVPNGHSRCPSLKRCRTLSRRIFRKYLNFLRPLCRRLRSGKSGSKPESVVKRTESAKN  178

Query  288  NCKASSSDSDDPRKTKSCSNTPQESPLHYTTAYHSSPDAQTSITEAIIHCRKSF  127
                S +             +P+ S  +    +  S D+++SI EA++HC++S 
Sbjct  179  RGYYSET-------------SPRISVAYSADDWRKSCDSESSIYEAVLHCKRSI  219



>ref|XP_006375355.1| hypothetical protein POPTR_0014s08720g [Populus trichocarpa]
 gb|ERP53152.1| hypothetical protein POPTR_0014s08720g [Populus trichocarpa]
Length=211

 Score = 76.3 bits (186),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 65/234 (28%), Positives = 117/234 (50%), Gaps = 33/234 (14%)
 Frame = -1

Query  804  MEATHPLAIESFSYSWLLNA----RppsldslsdSESKHQ--DQDIAFSVVHSMRFSEAD  643
            ME+   LAIESFS SWL +     +       +  +S H+   +++ + + +S R  E D
Sbjct  1    MESPETLAIESFSRSWLTSVNPSLQGLETALRASLDSSHEAISEELDYRMQNSRRSLEED  60

Query  642  EAKNFRFDINASSESGLLVDADEIFSDGHMIPVYLHRPKPPVEQAVS-APATPANNFWVS  466
            +  NF F I+ S ++  L+ AD++FSDG + P+++++ K     +++ AP  P++    +
Sbjct  61   QNFNFYFPISQSPDA--LLHADQLFSDGLIRPIFINQSKSEASSSLNLAPTVPSSLSSKT  118

Query  465  VRGKKEPQDYISQKWKKLLGTRILGKWFGFCKRLGGSSRSRKNCAKVDDLNRKAMEVQIN  286
            V   +    ++  +WK     RIL K FG+ + L    R  +   +VD++ R A EV   
Sbjct  119  VSAVQILCRFLG-RWK-----RILPKCFGYVRPLSHRVRDSRISTRVDNVERIAWEV---  169

Query  285  CKASSSDSDDPRKTKSCSNTPQESPLHYTT-AYHSSPDAQTSITEAIIHCRKSF  127
                          KS SN+ + SP      +     D+++SI +A++HC++S 
Sbjct  170  --------------KSQSNSREASPSRRVAYSLDGCHDSESSIHDAVLHCKRSM  209



>ref|XP_003548132.1| PREDICTED: probable membrane-associated kinase regulator 6-like 
[Glycine max]
 gb|KHN19951.1| Putative membrane-associated kinase regulator 6 [Glycine soja]
Length=223

 Score = 76.6 bits (187),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 63/234 (27%), Positives = 108/234 (46%), Gaps = 23/234 (10%)
 Frame = -1

Query  804  MEATHPLAIESFSYSWLLNARppsldslsdSESKHQDQDIAFSVVH-------SMRFSEA  646
            ME +HPL+IESFSYSWL+N +P          +     D   S +        S RF   
Sbjct  1    METSHPLSIESFSYSWLVNLKPSLESLDGSLRTSLDASDETSSFIEMDPRMTPSKRFFR-  59

Query  645  DEAKNFRFDINASSESGLLVDADEIFSDGHMIPVYLHRPKPPVEQAVSA-PATPANNFWV  469
              +++F+FD   S     LVDADE+FS+G+++P+++   K    +A    P+ P+++   
Sbjct  60   -NSQDFKFDFPISQSPRTLVDADELFSNGYLMPLFVESLKMEAFEASDVIPSLPSSSHVP  118

Query  468  SVRGKKEPQDYISQKWKKLLGTRILGKWFGFCKRLGGSSRSRKNCAKVDDLNRKAMEVQI  289
                        S K  K L  RI  K+  F + L    R  K+ +K + + ++ +  + 
Sbjct  119  KSVVPNSHSRCPSLKRCKTLSRRIFLKYLNFLRPLYRRLRGGKSGSKPESVVKRTVSAKN  178

Query  288  NCKASSSDSDDPRKTKSCSNTPQESPLHYTTAYHSSPDAQTSITEAIIHCRKSF  127
                S +             +P+ S  +    +  S D+++SI EA++HC++S 
Sbjct  179  RGYYSET-------------SPRISVAYSADDWRKSCDSESSIYEAVLHCKRSI  219



>ref|XP_002513621.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF49024.1| conserved hypothetical protein [Ricinus communis]
Length=220

 Score = 75.9 bits (185),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 64/232 (28%), Positives = 112/232 (48%), Gaps = 22/232 (9%)
 Frame = -1

Query  804  MEATHPLAIESFSYSWLLNARppsldslsdSESKHQDQDIAFSVVHSMRFSEADE----A  637
            ME + PL+IESFSYSWL+N +P      S   +     D A  +    R   +      +
Sbjct  1    METSQPLSIESFSYSWLVNLKPSLESLDSSLRASLDASDEASFIEMDPRMPPSKRFFRNS  60

Query  636  KNFRFDINASSESGLLVDADEIFSDGHMIPVYLHRPK-PPVEQAVSAPATPANNFW--VS  466
            ++F+FD   S     +V ADE+FS+G+++P+++   K    E + SA A PA++    V 
Sbjct  61   QDFKFDFPTSQSPLTVVHADELFSNGYVMPIFVDPLKIESYEVSDSASALPASSHAPKVV  120

Query  465  VRGKKEPQDYISQKWKKLLGTRILGKWFGFCKRLGGSSRSRKNCAKVDDLNRKAMEVQIN  286
            V G+K      S +  + L  ++  K+F F + L    R  ++  + + ++ K   ++  
Sbjct  121  VSGRKTRCS--SLRRCRTLSKQMFQKYFDFLRPLYRRIRGHRSSTRAEKMDTKVQVMK--  176

Query  285  CKASSSDSDDPRKTKSCSNTPQESPLHYTTAYHSSPDAQTSITEAIIHCRKS  130
                       R   S   +P+ S  +    +  S D+++SI EA++HC+KS
Sbjct  177  -----------RWMYSAEASPRISVAYSVDDWRRSCDSESSIYEAVLHCKKS  217



>ref|XP_011001963.1| PREDICTED: probable membrane-associated kinase regulator 6 [Populus 
euphratica]
Length=222

 Score = 75.9 bits (185),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 65/234 (28%), Positives = 112/234 (48%), Gaps = 20/234 (9%)
 Frame = -1

Query  804  MEATHPLAIESFSYSWLLNARppsldslsdSESKHQDQDIAFSVVHSMRFSEADE----A  637
            ME + PL+IESFSYSWL+N +P      +   +     D A  +    R   +      +
Sbjct  1    METSQPLSIESFSYSWLVNLKPSLESLDNSLRASLDASDEASFIEMDPRMPPSKRFFRNS  60

Query  636  KNFRFDINASSESGLLVDADEIFSDGHMIPVYLHRPKPP---VEQAVSAPATPANNFWVS  466
            ++F+FD   S     LV ADE+FSDGH++P+++   K     V  + SA  T ++     
Sbjct  61   QDFKFDFPISQSPLTLVHADELFSDGHVMPLFVDPLKMKAYDVSDSTSALPTSSHAPKTV  120

Query  465  VRGKKEPQDYISQKWKKLLGTRILGKWFGFCKRLGGSSRSRKNCAKVDDLNRKAMEVQIN  286
            V   K PQ   S +  + +  +I+ K+  F + L    R  ++ ++ ++++ K   VQ+ 
Sbjct  121  VSACK-PQRCSSLRRCRRMSKQIVQKYLDFLRPLYRRIRGHRSSSRAENIDSK---VQVM  176

Query  285  CKASSSDSDDPRKTKSCSNTPQESPLHYTTAYHSSPDAQTSITEAIIHCRKSFG  124
                 S    PR + + S             +  S D+++SI EA++HC++S G
Sbjct  177  KNRVYSAETSPRISVAYS---------VDDCWRRSCDSESSIYEAVLHCKRSNG  221



>gb|KDP22197.1| hypothetical protein JCGZ_26028 [Jatropha curcas]
Length=219

 Score = 75.1 bits (183),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 59/232 (25%), Positives = 114/232 (49%), Gaps = 19/232 (8%)
 Frame = -1

Query  804  MEATHPLAIESFSYSWLLNARppsldslsdSESKHQDQDIAFSVVHSMRFSEADE----A  637
            ME + PL+IESFSYSWL+N +P      +   +     D A  +    + + +      +
Sbjct  1    METSQPLSIESFSYSWLVNLKPSLESLDNSLRASLDASDEASFIEMDPKMTPSKRFFRNS  60

Query  636  KNFRFDINASSESGLLVDADEIFSDGHMIPVYLHRPK-PPVEQAVSAPATPANNFWVSVR  460
            ++F+FD   S     +V ADE+FS+G+++P+++   K    E + S+PA P ++    V 
Sbjct  61   QDFKFDFPISQSPLTVVHADELFSNGYVMPLFVDPLKIESYEVSDSSPALPPSSNTPKVV  120

Query  459  GKKEPQDYISQKWKKLLGTRILGKWFGFCKRLGGSSRSRKNCAKVDDLNRKAMEVQINCK  280
               + +   S +  + L  +I  K+F F + L    R  ++ ++ ++ + K   V+    
Sbjct  121  SAMQTRSS-SLRRCRTLSKKIFHKYFDFLRPLYRRIRGHRSSSRAENTDTKVQVVKSWLY  179

Query  279  ASSSDSDDPRKTKSCSNTPQESPLHYTTAYHSSPDAQTSITEAIIHCRKSFG  124
            ++ S             +P+ S  +    +  S D+++SI EA++HC++S G
Sbjct  180  STES-------------SPRISVAYSVDDWRRSCDSESSIYEAVLHCKRSIG  218



>ref|XP_011003669.1| PREDICTED: probable membrane-associated kinase regulator 6 [Populus 
euphratica]
Length=222

 Score = 75.1 bits (183),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 64/234 (27%), Positives = 114/234 (49%), Gaps = 20/234 (9%)
 Frame = -1

Query  804  MEATHPLAIESFSYSWLLNARppsldslsdSESKHQDQDIAFSVVHSMRFSEADE----A  637
            ME + PL+IESFSYSWL+N +P      +   +     D A  +    R   +      +
Sbjct  1    METSQPLSIESFSYSWLVNLKPSLESLDNSLRASLDASDEASFIEMDPRMPPSKRFFRNS  60

Query  636  KNFRFDINASSESGLLVDADEIFSDGHMIPVYLHRPKPP---VEQAVSAPATPANNFWVS  466
            ++F+FD   S     LV ADE+FSDGH++P+++   K     V  + SA  T +++   +
Sbjct  61   QDFKFDFPISQSPLTLVHADELFSDGHVMPLFVDPLKMKAYDVSDSTSALPT-SSHAPKN  119

Query  465  VRGKKEPQDYISQKWKKLLGTRILGKWFGFCKRLGGSSRSRKNCAKVDDLNRKAMEVQIN  286
            V    +PQ   S +  + +  +I+ K+  F + L    R  ++ ++ ++++ K   VQ+ 
Sbjct  120  VVSACKPQRCSSLRRCRRMSKQIVQKYLDFLRPLYRRIRGHRSSSRAENIDSK---VQVM  176

Query  285  CKASSSDSDDPRKTKSCSNTPQESPLHYTTAYHSSPDAQTSITEAIIHCRKSFG  124
                 S    PR + + S             +  S D+++SI EA++HC++S G
Sbjct  177  KNRVYSAETSPRISVAYS---------VDDCWRRSCDSESSIYEAVLHCKRSNG  221



>gb|EYU32186.1| hypothetical protein MIMGU_mgv1a0234681mg, partial [Erythranthe 
guttata]
Length=173

 Score = 73.9 bits (180),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 57/187 (30%), Positives = 88/187 (47%), Gaps = 43/187 (23%)
 Frame = -1

Query  804  MEATHPLAIESFSYSWLLNARppsldslsdSESKHQDQDIAFSVVHSMRFSEADEAKNFR  625
            ME +  LA ESFSYSWL + +                    +S++      + D+  NF+
Sbjct  1    MENSQQLATESFSYSWLTDRQ-------------------LYSILSENSIDQKDQ--NFK  39

Query  624  FDINASSESGLLVDADEIFSDGHMIPVYLHRPKPP--------VEQAVSAPATPANNFWV  469
            FD+  +  S   V ADEIFSDGH++P+Y+ RP  P          +AV +P    +  + 
Sbjct  40   FDVPLTEYSST-VHADEIFSDGHIMPLYIDRPSKPEAALRRTTTSEAVLSPPPAVSPIYY  98

Query  468  S--------VRGKKEPQDYISQKWKKLLGTRILGKWFGFCKRLGGSSRSRKNCAKVDDLN  313
            S        +  K+  + ++ +KW+K    RI  + F F K +  S +S     +VDDL 
Sbjct  99   SCDSLSKTPLLAKRITECFLFEKWRK-STKRIFLRCFAFVKPVCKSRKSN----RVDDLE  153

Query  312  RKAMEVQ  292
            RK  EV+
Sbjct  154  RKVWEVR  160



>ref|XP_007038880.1| Uncharacterized protein TCM_015294 [Theobroma cacao]
 gb|EOY23381.1| Uncharacterized protein TCM_015294 [Theobroma cacao]
Length=220

 Score = 74.3 bits (181),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 61/232 (26%), Positives = 111/232 (48%), Gaps = 18/232 (8%)
 Frame = -1

Query  804  MEATHPLAIESFSYSWLLNARppsldslsdSESKHQDQDIAFSVVHSMRFSEADE----A  637
            ME + PL+IESFSYSWL+N +P      S   +     D A  +    R   +      +
Sbjct  1    METSQPLSIESFSYSWLVNLKPSLESLDSSLRASLDACDEASFIEMDPRMPPSRRFFRNS  60

Query  636  KNFRFDINASSESGLLVDADEIFSDGHMIPVYLHRPKPPVEQAVSAPAT-PANNFWVSVR  460
            ++F+FD   S     LV ADE+FS+G+++P +++  K    +  ++ +T P ++   ++ 
Sbjct  61   QDFKFDFPISQTPLTLVHADELFSNGYVMPFFVNPLKMEAYEVSNSTSTLPTSSHAPNLV  120

Query  459  GKKEPQDYISQKWKKLLGTRILGKWFGFCKRLGGSSRSRKNCAKVDDLNRKAMEVQINCK  280
                   + S +  + L  RI  K+  F + L    R RK+  + + ++ +   VQ+  K
Sbjct  121  VPACKTSHPSLRRCRRLSKRIFLKYLDFLRPLYRRIRGRKSSGRAESVDAR---VQVMKK  177

Query  279  ASSSDSDDPRKTKSCSNTPQESPLHYTTAYHSSPDAQTSITEAIIHCRKSFG  124
                         S   +P+ S  +    +  S D+++SI EA++HC++S G
Sbjct  178  W----------VYSAETSPRVSVAYSADEWRKSCDSESSIYEAVLHCKRSIG  219



>gb|ACU19215.1| unknown [Glycine max]
Length=223

 Score = 73.9 bits (180),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 62/234 (26%), Positives = 107/234 (46%), Gaps = 23/234 (10%)
 Frame = -1

Query  804  MEATHPLAIESFSYSWLLNARppsldslsdSESKHQDQDIAFSVVH-------SMRFSEA  646
            M  +HPL+IESFSYSWL+N +P          +     D   S +        S RF   
Sbjct  1    MGTSHPLSIESFSYSWLVNLKPSLESLDGSLRTSLDASDETSSFIEMDPRMTPSKRFFR-  59

Query  645  DEAKNFRFDINASSESGLLVDADEIFSDGHMIPVYLHRPKPPVEQAVSA-PATPANNFWV  469
              +++F+FD   S     LVDADE+FS+G+++P+++   K    +A    P+ P+++   
Sbjct  60   -NSQDFKFDFPISQSPRTLVDADELFSNGYLMPLFVESLKMEAFEASDVIPSLPSSSHVP  118

Query  468  SVRGKKEPQDYISQKWKKLLGTRILGKWFGFCKRLGGSSRSRKNCAKVDDLNRKAMEVQI  289
                        S K  K L  RI  K+  F + L    R  K+ +K + + ++ +  + 
Sbjct  119  KSVVPNSHSRCPSLKRCKTLSRRIFLKYLNFLRPLYRRLRGGKSGSKPESVVKRTVSAKN  178

Query  288  NCKASSSDSDDPRKTKSCSNTPQESPLHYTTAYHSSPDAQTSITEAIIHCRKSF  127
                S +             +P+ S  +    +  S D+++SI EA++HC++S 
Sbjct  179  RGYYSET-------------SPRISVAYSADDWRKSCDSESSIYEAVLHCKRSI  219



>ref|XP_011047743.1| PREDICTED: probable membrane-associated kinase regulator 6 [Populus 
euphratica]
Length=222

 Score = 73.6 bits (179),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 62/233 (27%), Positives = 116/233 (50%), Gaps = 18/233 (8%)
 Frame = -1

Query  804  MEATHPLAIESFSYSWLLNARppsldslsdSESKHQDQDIAFSVVHSMRFSEADE----A  637
            ME + PL+IESFSYSWL+N +P      S   +     D A  +    R   +      +
Sbjct  1    METSQPLSIESFSYSWLVNLKPSLESLDSSFRASLDASDEALFIEMDPRMPPSKRFFRNS  60

Query  636  KNFRFDINASSESGLLVDADEIFSDGHMIPVYLHRPK-PPVEQAVSAPATP-ANNFWVSV  463
            ++F+FD   S     LV ADE+FS+G+++P+++      P E + S  A P +++   +V
Sbjct  61   QDFKFDFPVSQSPLTLVHADELFSNGYVMPLFVDPLTIEPYEVSDSTAALPTSSHLPKTV  120

Query  462  RGKKEPQDYISQKWKKLLGTRILGKWFGFCKRLGGSSRSRKNCAKVDDLNRKAMEVQINC  283
                +P+   S +  + +  +I+ K+  F +      R  ++ ++ ++++ K   VQ+  
Sbjct  121  VSACKPRRCSSLRRCRTVSKQIIQKYLDFLRPFYRRFRGHRSSSRAENIDSK---VQVMK  177

Query  282  KASSSDSDDPRKTKSCSNTPQESPLHYTTAYHSSPDAQTSITEAIIHCRKSFG  124
              + S    PR   S +N+  +        +  S D+++SI EA++HC++S G
Sbjct  178  SWAYSTETSPR--ISVANSVDD-------CWRRSCDSESSIYEAVLHCKRSNG  221



>ref|XP_011037227.1| PREDICTED: probable membrane-associated kinase regulator 6 [Populus 
euphratica]
Length=211

 Score = 72.8 bits (177),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 63/234 (27%), Positives = 117/234 (50%), Gaps = 33/234 (14%)
 Frame = -1

Query  804  MEATHPLAIESFSYSWLLNA----RppsldslsdSESKHQ--DQDIAFSVVHSMRFSEAD  643
            ME+   LAIESFS SWL +     +       +  +S ++   +++ + + +S R  E D
Sbjct  1    MESPETLAIESFSRSWLTSVNPSLQGLETALRASLDSSYEAISEEVDYRMQNSRRSLEED  60

Query  642  EAKNFRFDINASSESGLLVDADEIFSDGHMIPVYLHRPKPPVEQAVS-APATPANNFWVS  466
            +  NF F I+ S ++  L+ AD++FSDG + P+++++ K     +++ AP  P++    +
Sbjct  61   QNFNFYFPISQSPDA--LLHADQLFSDGLIRPIFINQSKSEASSSLNLAPTVPSSLSSKT  118

Query  465  VRGKKEPQDYISQKWKKLLGTRILGKWFGFCKRLGGSSRSRKNCAKVDDLNRKAMEVQIN  286
            V   +    ++  +WK     RIL K FG+ + L    R  +   +VD++ R A +V   
Sbjct  119  VSAVQILCRFLG-RWK-----RILPKCFGYVRPLSHRVRDSRISTRVDNVERIAWKV---  169

Query  285  CKASSSDSDDPRKTKSCSNTPQESP-LHYTTAYHSSPDAQTSITEAIIHCRKSF  127
                          KS SN+ + SP     ++     D ++SI +A++HC++S 
Sbjct  170  --------------KSQSNSREASPSRRAASSLDGCHDTESSIHDAVLHCKRSM  209



>ref|XP_006491203.1| PREDICTED: probable membrane-associated kinase regulator 6-like 
isoform X1 [Citrus sinensis]
 gb|KDO86339.1| hypothetical protein CISIN_1g042015mg [Citrus sinensis]
Length=207

 Score = 72.8 bits (177),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 69/235 (29%), Positives = 103/235 (44%), Gaps = 41/235 (17%)
 Frame = -1

Query  804  MEATHPLAIESFSYSWLLNARppsldslsdSESKHQDQDIAFSVVHSMRFSEADEAKNFR  625
            ME + PLAIESFSYSWL N                 D+ +  S+  S      + A+NF 
Sbjct  1    METSSPLAIESFSYSWLSNVETLLDGI---------DEPLRTSLDSSSEAISKELAENFN  51

Query  624  FDINASSESGLLVDADEIFSDGHMIPVYLHRPKPPVEQAVSAPAT--PANNFWVSVRGKK  451
            FDI  S  S  L+ ADE+FSDG + P ++  P   ++ + S   T  P ++F     G  
Sbjct  52   FDIPTSQSSAALLHADELFSDGLIKPEFVD-PSKILDASTSGLITVLPGSSF---SSGNV  107

Query  450  EP----QDYISQKWKKLLGTRILGKWFGF----CKRLGGSSRSRKNCAKVDDLNRKAMEV  295
             P       +  KW+       L K FG+    C  +G    S K  ++VDD++R+  EV
Sbjct  108  IPVFQGHYRLFSKWRISFKKNFL-KCFGYLRPHCHNIGS---SWKRSSRVDDIDRREREV  163

Query  294  QINCKASSSDSDDPRKTKSCSNTPQESPLHYTTAYHSSPDAQTSITEAIIHCRKS  130
            + +  +  +      K              Y+       D + SI EAI+HC++S
Sbjct  164  KSSSSSPQASPPPSAK--------------YSVGVGDWYDIENSIYEAILHCKRS  204



>ref|XP_002278076.1| PREDICTED: probable membrane-associated kinase regulator 6 [Vitis 
vinifera]
Length=221

 Score = 72.8 bits (177),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 69/245 (28%), Positives = 111/245 (45%), Gaps = 43/245 (18%)
 Frame = -1

Query  804  MEATHPLAIESFSYSWLLNARppsldslsdSESKHQDQDIAFSVVHSMRFSEAD------  643
            MEA+ PL+IESFSYSWL+N +          ES       +  V     F E D      
Sbjct  1    MEASQPLSIESFSYSWLINLK-------PSFESLDDSLRTSLDVSDEASFIEMDPRMPPS  53

Query  642  -----EAKNFRFDINASSESGLLVDADEIFSDGHMIPVYLHRPK-PPVEQAVSAPATPAN  481
                  +++F FD   S     LV ADE+FS+G ++P+++   K    + + S PATP +
Sbjct  54   KRFFRNSQDFNFDFPISQPPLSLVHADELFSNGLIMPIFMEPLKMEAYDGSYSLPATPIS  113

Query  480  NFWVSVRGKKEPQDYISQKWK-KLLGTRILGKWFGFCKRLGGSSRSRKNCAKVDDLNRKA  304
            +             + S   + + L  +IL K+  F + L    R R+  ++ + +N + 
Sbjct  114  SSHAPKHVLSATNTHCSSLRRCRRLSKQILQKYLDFLRPLYRRIRGRRIGSRAESVNSRM  173

Query  303  MEVQINCKASSSDSDDPRKTKSCSNTPQESPLHYTTAYHS-----SPDAQTSITEAIIHC  139
             E                  KS   +P+ SP   +TAY +     S D+++SI EA++HC
Sbjct  174  QE-----------------GKSWVYSPEASP-RTSTAYSTGDWRKSCDSESSIYEAVLHC  215

Query  138  RKSFG  124
            ++S G
Sbjct  216  KRSIG  220



>ref|XP_006490607.1| PREDICTED: probable membrane-associated kinase regulator 6-like 
[Citrus sinensis]
 gb|KDO56843.1| hypothetical protein CISIN_1g027384mg [Citrus sinensis]
Length=224

 Score = 71.6 bits (174),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 67/244 (27%), Positives = 113/244 (46%), Gaps = 38/244 (16%)
 Frame = -1

Query  804  MEATH--PLAIESFSYSWLLNARppsldslsdSESKHQDQDIAFSVVHSMRFSEADE---  640
            ME +H  PL+IESFSYSWL+N +P      S   +     D A  +    R   +     
Sbjct  1    METSHSQPLSIESFSYSWLVNLKPSLESLDSSLRASLDACDEASFIEMDPRLPPSKRFIR  60

Query  639  -AKNFRFDINASSESGLLVDADEIFSDGHMIPVYLHRPKPPV----EQAVSAPATPANNF  475
             +++F+FD   S     LV ADE+FS+G+++P+++ + K       + A+  P++   + 
Sbjct  61   NSQDFKFDFPVSQSPLALVHADELFSNGYVMPLFVDQMKMEAFDAPDSALPLPSSLHGSK  120

Query  474  WVSVRGKKEPQDYISQKWKKLLGTRILGKWFGFCKRL-------GGSSRSRKNCAKVDDL  316
             V V+G K+      ++ +K L  RI  K+  F + L         SSR+    ++V  +
Sbjct  121  LV-VQGSKQTNRTSLRRCRK-LSKRIFQKYLDFLRPLYQKIRGKRSSSRAEGGNSRVHVM  178

Query  315  NRKAMEVQINCKASSSDSDDPRKTKSCSNTPQESPLHYTTAYHSSPDAQTSITEAIIHCR  136
            N      + + + S + S D    KSC                   D+ +SI EA++HC+
Sbjct  179  NSWVYSAETSPRTSVAYSVDDNWRKSC-------------------DSDSSIYEAVLHCK  219

Query  135  KSFG  124
            +S G
Sbjct  220  RSIG  223



>ref|XP_006374294.1| hypothetical protein POPTR_0015s05750g [Populus trichocarpa]
 gb|ERP52091.1| hypothetical protein POPTR_0015s05750g [Populus trichocarpa]
Length=222

 Score = 68.6 bits (166),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 62/233 (27%), Positives = 113/233 (48%), Gaps = 18/233 (8%)
 Frame = -1

Query  804  MEATHPLAIESFSYSWLLNARppsldslsdSESKHQDQDIAFSVVHSMRFSEADE----A  637
            ME + PL+IESFSYSWL+N +P      S   +     D A  +    R   +      +
Sbjct  1    METSQPLSIESFSYSWLVNLQPSLESLDSSFRASLDASDEASFIEMDPRMPPSKRFFRNS  60

Query  636  KNFRFDINASSESGLLVDADEIFSDGHMIPVYLHRPK-PPVEQAVSAPATPANNFWV-SV  463
            + F+FD   S     LV ADE+FS+G+++P+++      P E + S  A P ++    +V
Sbjct  61   QEFKFDFPVSQSPLTLVHADELFSNGYVMPLFVDPLTIEPYEVSDSTAALPTSSHPPKTV  120

Query  462  RGKKEPQDYISQKWKKLLGTRILGKWFGFCKRLGGSSRSRKNCAKVDDLNRKAMEVQINC  283
                +P+   S +  + +  +I+ K+  F +      R  ++ ++ ++++ K   VQ+  
Sbjct  121  VSACKPRRCSSLRRCRRVSKQIIQKYLDFLRPFYRRFRGHRSSSRAENIDSK---VQVMK  177

Query  282  KASSSDSDDPRKTKSCSNTPQESPLHYTTAYHSSPDAQTSITEAIIHCRKSFG  124
                S    PR   S +N+  +        +  S D+++SI EA++HC++S G
Sbjct  178  SWEYSAETSPR--ISVANSVDD-------CWRRSCDSESSIYEAVLHCKRSNG  221



>ref|XP_007143505.1| hypothetical protein PHAVU_007G077100g [Phaseolus vulgaris]
 gb|ESW15499.1| hypothetical protein PHAVU_007G077100g [Phaseolus vulgaris]
Length=233

 Score = 68.6 bits (166),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 70/242 (29%), Positives = 113/242 (47%), Gaps = 39/242 (16%)
 Frame = -1

Query  804  MEATHPLAIESFSYSWLLNARppsldslsdSESKHQDQDIAFSVVH-------SMRFSEA  646
            ME + PL+IESFSYSWL+N RP  L+SL  S     D     S +        S RF + 
Sbjct  1    METSQPLSIESFSYSWLVNLRPSLLESLESSLRTSLDASDEASFIEMDPKKPPSKRFFKN  60

Query  645  DEAKNFRFDINASSESGLLVDADEIFSDGHMIPVYLHRPKPPVEQAVSAPATPANNFWVS  466
             +   F F I+ S  +  LV ADE+FS+G+++P++    +    ++  +  +P ++   S
Sbjct  61   SQDSKFDFPISQSPLT--LVHADELFSNGYLMPLFAESLQMEEYESSDSNTSPVSS---S  115

Query  465  VRGKKE----PQDYISQKWKKLLGTRILGKWFGF----CKRLGGSSRSRKNCAKVDDLNR  310
               K E    P   +S K  + L  R+  K+  F    C+RL G   S +  AK      
Sbjct  116  HAPKSEAPTCPSRCLSLKRCRTLSRRVFQKYLDFLRPLCRRLRGHKSSTETAAKRG----  171

Query  309  KAMEVQINCKASSSDSDDPRKTKSCSNTPQESPLHYTTAYHSSPDAQTSITEAIIHCRKS  130
                + +  +   SD+           +P+ S       +  S D+++SI EA++HC++S
Sbjct  172  ----LSVKNRRYYSDT-----------SPRISVALSADDWRYSCDSESSIYEAVLHCKRS  216

Query  129  FG  124
             G
Sbjct  217  IG  218



>ref|XP_004515108.1| PREDICTED: probable membrane-associated kinase regulator 6-like 
[Cicer arietinum]
Length=229

 Score = 68.2 bits (165),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 67/249 (27%), Positives = 115/249 (46%), Gaps = 49/249 (20%)
 Frame = -1

Query  804  MEATHPLAIESFSYSWLLNARppsldslsdSESKHQDQDIAFSVVHSMRFSEAD------  643
            ME +HPL+IESFSYSWL+N +       S  ++ H+     +   +S  F E D      
Sbjct  1    METSHPLSIESFSYSWLVNIK-----PSSSLDNSHRTSFDTYDATNS--FIEMDPTMPPS  53

Query  642  -----EAKNFRFDINASSESG--LLVDADEIFSDGHMIPVYLHRP--KPPVEQAVSAPA-  493
                  +++F+FD   SS+S    LV AD+IFS+G+++P ++       P + +  + + 
Sbjct  54   KRFFTNSQDFKFDFPTSSQSPPLTLVHADQIFSNGYLMPFFVESSFNMEPYDSSSKSNSN  113

Query  492  --------TPANNFWVSVRGKKEPQDYISQKWKKLLGTRILGKWFGFCKRLGGSSRSRKN  337
                     P N   V +   K P    S K  + L  RI  K+  F K L    RS+ +
Sbjct  114  LPSSSLSHVPKN--VVPIGNSKCP----SLKRCRTLSRRIFLKYLNFLKPLCRRLRSQNS  167

Query  336  CAKVDDLNRKAMEVQINCKASSSDSDDPRKTKSCSNTPQESPLHYTTAYHSSPDAQTSIT  157
             +K +++ ++   V+ +            +   C ++P+ S  +       S D+  SI 
Sbjct  168  GSKHENVVKRTQSVKNS------------RGHYCQSSPRISVAYSADDSRVSCDSDISIY  215

Query  156  EAIIHCRKS  130
            EA++HC++S
Sbjct  216  EAVLHCKRS  224



>ref|XP_002318354.1| hypothetical protein POPTR_0012s01020g [Populus trichocarpa]
 gb|EEE96574.1| hypothetical protein POPTR_0012s01020g [Populus trichocarpa]
Length=222

 Score = 67.8 bits (164),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 64/234 (27%), Positives = 112/234 (48%), Gaps = 20/234 (9%)
 Frame = -1

Query  804  MEATHPLAIESFSYSWLLNARppsldslsdSESKHQDQDIAFSVVHSMRFSEADE----A  637
            ME + PL+IESFSYSWL+N +P      +   +     D A  +    R   +      +
Sbjct  1    METSQPLSIESFSYSWLVNLKPSLESLDNSLRASLDASDEASFIEMDPRMPPSKRFFRNS  60

Query  636  KNFRFDINASSESGLLVDADEIFSDGHMIPVYLHRPKPP---VEQAVSAPATPANNFWVS  466
            ++F+FD   S     LV ADE+FS+G+++P+++   K     V  + SA  T ++     
Sbjct  61   QDFKFDFPISQSPLTLVHADELFSNGYVMPLFVDPLKMEAYDVSDSTSALPTSSHAPKTV  120

Query  465  VRGKKEPQDYISQKWKKLLGTRILGKWFGFCKRLGGSSRSRKNCAKVDDLNRKAMEVQIN  286
            V   K PQ   S +  + L  +I+ K+  F + L    R  ++ ++ ++++ K   VQ+ 
Sbjct  121  VSACK-PQRCSSLRRCRRLSKQIVQKYMDFLRPLYRRIRGHRSSSRDENIDSK---VQVM  176

Query  285  CKASSSDSDDPRKTKSCSNTPQESPLHYTTAYHSSPDAQTSITEAIIHCRKSFG  124
                 S    PR + + S             +  S D+++SI EA++HC++S G
Sbjct  177  KNWVYSAETSPRISVAYS---------VDDCWRRSCDSESSIYEAVLHCKRSNG  221



>ref|XP_007051680.1| Uncharacterized protein isoform 2 [Theobroma cacao]
 gb|EOX95837.1| Uncharacterized protein isoform 2 [Theobroma cacao]
Length=211

 Score = 67.4 bits (163),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 67/235 (29%), Positives = 106/235 (45%), Gaps = 35/235 (15%)
 Frame = -1

Query  804  MEATHPLAIESFSYSWLLNARppsldslsdSESKHQDQDIAF--SVVHSMRFSEADEAKN  631
            ME + PLAIESFSYSWL + +P            +      F   +V S RF      +N
Sbjct  1    METSQPLAIESFSYSWLSDHKPSLDGLSEPPGVYYGGTPGEFDDEMVESNRFL---TDQN  57

Query  630  FRFDINASSESGLLVDADEIFSDGHMIPVYLHRPKPPVEQAV-SAPATPANNF-----WV  469
            F FD  A S +   + ADE+F++G + P+Y+H  +      + S   TP+++F       
Sbjct  58   FNFDAIAQSPAA-FIHADELFTNGFIRPIYIHPSRRESCNTLDSIQTTPSSSFSSRTEIP  116

Query  468  SVRGKKEPQDYISQKWKKLLGTRILGKWFGFCKRLGGSSRSRKNCAKVDDLNRKAMEVQI  289
            +VR K        ++W+K    +IL   FG  +         +   +VDD++R+  +V  
Sbjct  117  TVRIKCR----FLRRWRKSTW-QILRNLFGHLRPSCHKGGCLRTSTRVDDIDRRTWKV--  169

Query  288  NCKASSSDSDDPRKTKSCSNTPQESPLHYTT-AYHSSPDAQTSITEAIIHCRKSF  127
                           KS  ++PQ SPL  T  +   S   +  I EA++HC++S 
Sbjct  170  ---------------KSWKSSPQASPLQSTACSMGDSCHLENPIYEAVLHCKRSI  209



>ref|XP_003592167.1| hypothetical protein MTR_1g099440 [Medicago truncatula]
Length=246

 Score = 67.4 bits (163),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 68/234 (29%), Positives = 111/234 (47%), Gaps = 21/234 (9%)
 Frame = -1

Query  804  MEATHPLAIESFSYSWLLNARppsldslsdSESKHQDQD-IAF-----SVVHSMRFSEAD  643
            ME + PL+IESFSYSWL+N +P      S   S     D  +F      +  S RF    
Sbjct  1    MEISQPLSIESFSYSWLVNLKPSLESLDSSFRSTLDAYDETSFIEMDPRMPPSKRFFMNS  60

Query  642  EAKNFRFDINASSESGLLVDADEIFSDGHMIPVYLHRPKPPVEQAVSAPATPANNFWVSV  463
               N +FD   S     LV ADE+FSDG+++P  +   K    +A+ +  T  N+   + 
Sbjct  61   HDSN-KFDFPTSQSPLTLVHADELFSDGYLMPFVVESLKMEEYEALDSNNTSPNSSSHAP  119

Query  462  RGKKEPQDYISQKWKKLLGTRILGKWFGFCKRLGGSSRSRKNCAKVDDLNRKAMEVQINC  283
            +G   P+ + S K  + L  RI  K+  F + L    R  K+ + +  + ++  E  +N 
Sbjct  120  KGVV-PRCH-SLKRCRTLSRRIFLKYLNFLRPLYRKLRGHKSGSNIPTVFKRG-EASMNR  176

Query  282  KASSSDSDDPRKTKSCSNTPQESPLHYTTAYHSSPDAQTSITEAIIHCRKSFGL  121
            +  +S+S           +P+ S       +  S D+++SI EA++HC++S G 
Sbjct  177  RYHNSES-----------SPRISGAFSADGWRKSCDSESSIHEAVLHCKRSIGF  219



>ref|XP_007051679.1| Uncharacterized protein isoform 1 [Theobroma cacao]
 gb|EOX95836.1| Uncharacterized protein isoform 1 [Theobroma cacao]
Length=228

 Score = 67.0 bits (162),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 68/234 (29%), Positives = 107/234 (46%), Gaps = 33/234 (14%)
 Frame = -1

Query  804  MEATHPLAIESFSYSWLLNARppsldslsdSESKHQDQDIAF--SVVHSMRFSEADEAKN  631
            ME + PLAIESFSYSWL + +P            +      F   +V S RF      +N
Sbjct  1    METSQPLAIESFSYSWLSDHKPSLDGLSEPPGVYYGGTPGEFDDEMVESNRFL---TDQN  57

Query  630  FRFDINASSESGLLVDADEIFSDGHMIPVYLHRPKPPVEQAV-SAPATPANNFWVSVRGK  454
            F FD  A S +   + ADE+F++G + P+Y+H  +      + S   TP+++F  S R +
Sbjct  58   FNFDAIAQSPAA-FIHADELFTNGFIRPIYIHPSRRESCNTLDSIQTTPSSSF--SSRTE  114

Query  453  KEPQDYIS----QKWKKLLGTRILGKWFGFCKRLGGSSRSRKNCAKVDDLNRKAMEVQIN  286
              P   I     ++W+K    +IL   FG  +         +   +VDD++R+  +V   
Sbjct  115  I-PTVRIKCRFLRRWRKSTW-QILRNLFGHLRPSCHKGGCLRTSTRVDDIDRRTWKV---  169

Query  285  CKASSSDSDDPRKTKSCSNTPQESPLHYTT-AYHSSPDAQTSITEAIIHCRKSF  127
                          KS  ++PQ SPL  T  +   S   +  I EA++HC++S 
Sbjct  170  --------------KSWKSSPQASPLQSTACSMGDSCHLENPIYEAVLHCKRSI  209



>emb|CBI22601.3| unnamed protein product [Vitis vinifera]
Length=601

 Score = 68.2 bits (165),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 68/250 (27%), Positives = 110/250 (44%), Gaps = 57/250 (23%)
 Frame = -1

Query  798  ATHPLAIESFSYSWLLNARppsldslsdSESKHQDQDIAFSVVHSMRFSEAD--------  643
            A+ PL+IESFSYSWL+N +          ES       +  V     F E D        
Sbjct  383  ASQPLSIESFSYSWLINLK-------PSFESLDDSLRTSLDVSDEASFIEMDPRMPPSKR  435

Query  642  ---EAKNFRFDINASSESGLLVDADEIFSDGHMIPVYLHRPK-PPVEQAVSAPATPANNF  475
                +++F FD   S     LV ADE+FS+G ++P+++   K    + + S PATP    
Sbjct  436  FFRNSQDFNFDFPISQPPLSLVHADELFSNGLIMPIFMEPLKMEAYDGSYSLPATP----  491

Query  474  WVSVRGKKEPQDYISQ--------KWKKLLGTRILGKWFGFCKRLGGSSRSRKNCAKVDD  319
               +     P+  +S         +  + L  +IL K+  F + L    R R+  ++ + 
Sbjct  492  ---ISSSHAPKHVLSATNTHCSSLRRCRRLSKQILQKYLDFLRPLYRRIRGRRIGSRAES  548

Query  318  LNRKAMEVQINCKASSSDSDDPRKTKSCSNTPQESPLHYTTAYHS-----SPDAQTSITE  154
            +N +  E                  KS   +P+ SP   +TAY +     S D+++SI E
Sbjct  549  VNSRMQE-----------------GKSWVYSPEASP-RTSTAYSTGDWRKSCDSESSIYE  590

Query  153  AIIHCRKSFG  124
            A++HC++S G
Sbjct  591  AVLHCKRSIG  600



>ref|NP_001240994.1| uncharacterized protein LOC100807566 [Glycine max]
 gb|ACU19975.1| unknown [Glycine max]
 gb|KHN12923.1| Putative membrane-associated kinase regulator 6 [Glycine soja]
Length=221

 Score = 65.9 bits (159),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 68/238 (29%), Positives = 113/238 (47%), Gaps = 29/238 (12%)
 Frame = -1

Query  804  MEATHPLAIESFSYSWLLNARppsldslsdSESKHQDQDIAFSVVH-------SMRFSEA  646
            ME + PL+IESFSYSWL+N RP SL+SL  S     D     S +        S RF + 
Sbjct  1    METSQPLSIESFSYSWLVNLRPSSLESLESSLRTSLDASDEASFIEMDPRMPPSKRFFKN  60

Query  645  DEAKNFRFDINASSESGLLVDADEIFSDGHMIPVYLHRPKPPVEQAVSAPATPANNFWVS  466
             +   F F I+ S  +  LV ADE+FS+G+++P+++   +  +E+  S+ +  +     S
Sbjct  61   SQDSKFDFPISQSPLT--LVHADELFSNGYLMPLFVESLQ--MEEYESSDSNTSLVSSSS  116

Query  465  VRGKKE----PQDYISQKWKKLLGTRILGKWFGFCKRLGGSSRSRKNCAKVDDLNRKAME  298
                 E    P   +S K  + L  R+  K+  F + L         C K+     +  +
Sbjct  117  HAPTSEAPTGPSRCLSLKRCRTLSRRVFQKYLNFLRPL---------CRKL-----RVHK  162

Query  297  VQINCKASSSDSDDPRKTKSCSNTPQESPLHYTTAYHSSPDAQTSITEAIIHCRKSFG  124
                  A   ++   R+  S + +P+ S       +  S D+++SI EA++HC++S G
Sbjct  163  SSTEAVAKRGEAVKNRRYYSDTTSPRTSVAFSADDWRYSCDSESSIYEAVLHCKRSIG  220



>gb|KEH25758.1| membrane-associated kinase regulator-like protein, putative [Medicago 
truncatula]
Length=238

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 69/255 (27%), Positives = 118/255 (46%), Gaps = 45/255 (18%)
 Frame = -1

Query  804  MEATHPLAIESFSYSWLLNARppsldslsdSESKHQDQDIAFSVVHSMRFSEAD------  643
            ME +HPL+IESFSYSWL+N +P SL    D  S     D +     +  F E D      
Sbjct  1    METSHPLSIESFSYSWLVNLKPSSLVESLDGSSFRTYLDAS---DEASSFIEMDPRMPSS  57

Query  642  -----EAKNFRFDINASSESGL--LVDADEIFSDGHMIPVYLHRPK-PPVE---------  514
                  +++F+FD     ES L  LVDAD++FS+G+++P+++      P E         
Sbjct  58   RRFFINSQDFKFDFPTLQESPLTTLVDADQLFSNGYLMPLFVESLNIEPYEYDSSNSNSN  117

Query  513  ----QAVSAPATPANNFWVSVRGKKEPQDYISQKWKKLLGTRILGKWFGFCKRLGGSSRS  346
                  +++  +   N  V +   + P    S K  + L   +  K+  F + L    R 
Sbjct  118  SDSNSTLASSISHVTNKVVPLENSRTP----SLKRCRTLSRSMFQKYLKFLRPLCRRLRG  173

Query  345  RKNCAKVDDLNRKAMEVQINCKASSSDSDDPRKTKSCSNTPQESPLHYTTAYHSSPDAQT  166
            +K+ +K +++ ++   V+ N + +  DS  PR + + S                S D+ +
Sbjct  174  QKSGSKHENVVKRTQSVK-NIRGNYGDS-SPRISVAYSADDWR---------RVSCDSDS  222

Query  165  SITEAIIHCRKSFGL  121
            SI EA++HC++S  +
Sbjct  223  SIYEAVLHCKRSIEM  237



>gb|AFK39128.1| unknown [Medicago truncatula]
Length=238

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 69/255 (27%), Positives = 118/255 (46%), Gaps = 45/255 (18%)
 Frame = -1

Query  804  MEATHPLAIESFSYSWLLNARppsldslsdSESKHQDQDIAFSVVHSMRFSEAD------  643
            ME +HPL+IESFSYSWL+N +P SL    D  S     D +     +  F E D      
Sbjct  1    METSHPLSIESFSYSWLVNLKPSSLVESLDGSSFRTYLDAS---DEASSFIEMDPRMPSS  57

Query  642  -----EAKNFRFDINASSESGL--LVDADEIFSDGHMIPVYLHRPK-PPVEQ--------  511
                  +++F+FD     ES L  LVDAD++FS+G+++P+++      P E         
Sbjct  58   RRFFINSQDFKFDFPTLQESPLTTLVDADQLFSNGYLMPLFVESLNIEPYEHDSSNSNSN  117

Query  510  -----AVSAPATPANNFWVSVRGKKEPQDYISQKWKKLLGTRILGKWFGFCKRLGGSSRS  346
                  +++  +   N  V +   + P    S K  + L   +  K+  F + L    R 
Sbjct  118  SDSNSTLASSISHVTNKVVPLENSRTP----SLKRCRTLSRSMFQKYLKFLRPLCRRLRG  173

Query  345  RKNCAKVDDLNRKAMEVQINCKASSSDSDDPRKTKSCSNTPQESPLHYTTAYHSSPDAQT  166
            +K+ +K +++ ++   V+ N + +  DS  PR + + S                S D+ +
Sbjct  174  QKSGSKHENVVKRTQSVK-NIRGNYGDS-SPRISVAYSADDWR---------RVSCDSDS  222

Query  165  SITEAIIHCRKSFGL  121
            SI EA++HC++S  +
Sbjct  223  SIYEAVLHCKRSIEM  237



>ref|XP_003520072.1| PREDICTED: probable membrane-associated kinase regulator 6-like 
[Glycine max]
Length=210

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 67/229 (29%), Positives = 100/229 (44%), Gaps = 34/229 (15%)
 Frame = -1

Query  789  PLAIESFSYSWLLNARppsldslsdSESKHQDQDIAFSVVHSMRFSEADEAKNFRFDINA  610
            PLA ESFSYSWL N         S   +   +++  FSV  S       E  NF FDI+ 
Sbjct  8    PLASESFSYSWLSNCNKSPPTYSSYGGT--SEEEFNFSVKKSC------EEFNFNFDISV  59

Query  609  SSESGLLVDADEIFSDGHMIPVYLHRPKPPVEQAVSAPATPANNFWVSVRGKKEPQDYIS  430
                 +LV ADEIFSDG + P+++    P   +  + P         S   +   Q  + 
Sbjct  60   PHSPLVLVPADEIFSDGLLRPMFV---DPSKVEFCNTPDPTQTKLSSSFSSRTFSQRAME  116

Query  429  ------QKWKKLLGTRILGKWFGFCKRLGGS-SRSRKNCAKVDDLNRKAMEVQINCKASS  271
                   KW+K    R    +F +  +L     RSRK+  +VDD+++   + Q+ C  S 
Sbjct  117  IHHGLLTKWRKST-RRTFVDFFRYVNQLRQRVGRSRKSI-RVDDIDK--TDWQVKCLTSP  172

Query  270  SDSDDPRKTKSCSNTPQESPLHYTTAYHSSPDAQTSITEAIIHCRKSFG  124
                 P+ T + +       LH         D + SI EA++HC++S G
Sbjct  173  QKGSSPKPTIAATGI---GDLH---------DHENSIYEAVLHCKRSIG  209



>ref|NP_001239958.1| uncharacterized protein LOC100776507 [Glycine max]
 gb|ACU19227.1| unknown [Glycine max]
Length=223

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 71/239 (30%), Positives = 117/239 (49%), Gaps = 29/239 (12%)
 Frame = -1

Query  804  MEATHPLAIESFSYSWLLNARppsldslsdSESKHQD-QDIAFSVVH-------SMRFSE  649
            ME + PL+IESFSYSWL+N RP +L+SL  S     D  D   S +        S RF +
Sbjct  1    METSQPLSIESFSYSWLVNLRPSALESLESSLRTPLDASDETSSFIEMDPRMPPSKRFFK  60

Query  648  ADEAKNFRFDINASSESGLLVDADEIFSDGHMIPVYLHRPKPPVEQAVSAPATPANNFWV  469
              +   F F I+ S  +  LV ADE+FS+G+++P+++   +  +E+  S+ +  +     
Sbjct  61   NSQDSKFDFPISQSPLT--LVHADELFSNGYLMPLFVESLQ--MEEYESSDSNTSLVSSS  116

Query  468  SVRGKKE----PQDYISQKWKKLLGTRILGKWFGFCKRLGGSSRSRKNCAKVDDLNRKAM  301
            S   K E    P   +S K  + L  R+  K+  F + L    R  K    +D + ++  
Sbjct  117  SHAPKSEAPTGPSRCLSLKKCRTLSRRVFQKYLNFLRPLCRKLRVHK--PSIDAVAKRGE  174

Query  300  EVQINCKASSSDSDDPRKTKSCSNTPQESPLHYTTAYHSSPDAQTSITEAIIHCRKSFG  124
             V+ N +  S  +  PR + + S             +  S D+++SI EA++HC++S G
Sbjct  175  AVK-NRRYYSDTATSPRISVAFS----------ADDWRYSCDSESSIYEAVLHCKRSIG  222



>gb|KHG04886.1| putative membrane-associated kinase regulator 6 -like protein 
[Gossypium arboreum]
Length=207

 Score = 65.1 bits (157),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 61/235 (26%), Positives = 108/235 (46%), Gaps = 39/235 (17%)
 Frame = -1

Query  804  MEATHPLAIESFSYSWLLNARppsldslsdSESKHQDQDIAFSVVHSMRFSEADEAKNFR  625
            ME++ PLAIESFS SWL + +      +   ES  +    +F   +    +     +NF 
Sbjct  1    MESSQPLAIESFSSSWLSDHKTSLDGLV---ESPRE----SFGYYYGESSNRFLTDQNFN  53

Query  624  FDINASSESGLLVDADEIFSDGHMIPVYL---HRPKPPVEQAVSAPATPANNFWVSVRGK  454
            FD  A +   +++ ADE+F++G + P+Y+    R       ++S    P  +   + +G+
Sbjct  54   FDATAQTPEPVIIHADELFTNGFIRPIYIDPSKRDSCNTLDSISIQTPPFTSRTENPKGR  113

Query  453  KEPQDYISQKWKKLLGTRILGKWF----GFCKRLGGSSRSRKNCAKVDDLNRKAMEVQIN  286
                    +K++K    ++L   F      C +LG S +S     +VDD+ R+ M     
Sbjct  114  S--GCCFVRKYRKST-KKVLRSLFEHLRPLCHKLGCSRKS----TRVDDIERRMMG----  162

Query  285  CKASSSDSDDPRKTKSCSNTPQESPLHYT--TAYHSSPDAQTSITEAIIHCRKSF  127
                        + KS + +PQ SP  +T   +  +S   + SI EA++HC++S 
Sbjct  163  ------------RAKSWNGSPQASPQQFTPCASMGASCHLENSIYEAVLHCKRSI  205



>ref|XP_010251590.1| PREDICTED: probable membrane-associated kinase regulator 6 [Nelumbo 
nucifera]
Length=269

 Score = 66.2 bits (160),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 65/236 (28%), Positives = 106/236 (45%), Gaps = 30/236 (13%)
 Frame = -1

Query  807  AMEATHPLAIESFSYSWLLNARppsldslsdSESKHQDQDIAFSVVH-------SMRFSE  649
            AME++ PL+ ESFSYSWL+N RP          +     D   S +        S RF  
Sbjct  51   AMESSKPLSTESFSYSWLINLRPSFESLGDSFRASLDASDETSSFIEMDPWLTPSKRF--  108

Query  648  ADEAKNFRFDINAS-SESGLLVDADEIFSDGHMIPVYLHRPKPPVEQAVSAPATPANNFW  472
              +A++F FD   S S    LVDADE+FS+G ++P +   P     +A  +  TP     
Sbjct  109  LGDAQDFSFDFPVSKSPLSDLVDADELFSNGLLMPFFHDNPA----KASDSVPTP-----  159

Query  471  VSVRGKKEPQDYISQKWKKLLGTRILGKWFGFCKRLGGSSRSRKNCAKVDDLNRKAMEVQ  292
              +R   E    +    +       LG+W    KR+      +K    +  L +K   ++
Sbjct  160  --LRSSSESSKLVLSTSRS--ACPFLGRWQRSSKRIF-----QKYMGFLRPLYKKLRVLR  210

Query  291  INCKASSSDSDDPRKTKSCSNTPQESPLHYTTAYHSSP--DAQTSITEAIIHCRKS  130
            +  +   +D+      KS   +P ++    ++AY +      ++SI EA++HC+KS
Sbjct  211  LGARGEITDARVRPFVKSWDESPLQTSPRASSAYPTGDWCAIESSIHEAVLHCKKS  266



>gb|AES62418.2| membrane-associated kinase regulator-like protein, putative [Medicago 
truncatula]
Length=235

 Score = 65.5 bits (158),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 67/231 (29%), Positives = 110/231 (48%), Gaps = 21/231 (9%)
 Frame = -1

Query  804  MEATHPLAIESFSYSWLLNARppsldslsdSESKHQDQD-IAF-----SVVHSMRFSEAD  643
            ME + PL+IESFSYSWL+N +P      S   S     D  +F      +  S RF    
Sbjct  1    MEISQPLSIESFSYSWLVNLKPSLESLDSSFRSTLDAYDETSFIEMDPRMPPSKRFFMNS  60

Query  642  EAKNFRFDINASSESGLLVDADEIFSDGHMIPVYLHRPKPPVEQAVSAPATPANNFWVSV  463
               N +FD   S     LV ADE+FSDG+++P  +   K    +A+ +  T  N+   + 
Sbjct  61   HDSN-KFDFPTSQSPLTLVHADELFSDGYLMPFVVESLKMEEYEALDSNNTSPNSSSHAP  119

Query  462  RGKKEPQDYISQKWKKLLGTRILGKWFGFCKRLGGSSRSRKNCAKVDDLNRKAMEVQINC  283
            +G   P+ + S K  + L  RI  K+  F + L    R  K+ + +  + ++  E  +N 
Sbjct  120  KGVV-PRCH-SLKRCRTLSRRIFLKYLNFLRPLYRKLRGHKSGSNIPTVFKRG-EASMNR  176

Query  282  KASSSDSDDPRKTKSCSNTPQESPLHYTTAYHSSPDAQTSITEAIIHCRKS  130
            +  +S+S           +P+ S       +  S D+++SI EA++HC++S
Sbjct  177  RYHNSES-----------SPRISGAFSADGWRKSCDSESSIHEAVLHCKRS  216



>ref|XP_004496506.1| PREDICTED: probable membrane-associated kinase regulator 6-like 
[Cicer arietinum]
Length=226

 Score = 65.1 bits (157),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 63/241 (26%), Positives = 110/241 (46%), Gaps = 36/241 (15%)
 Frame = -1

Query  804  MEATHPLAIESFSYSWLLNARppsldslsdSESKHQDQDIAFSVVHSMRFSEAD----EA  637
            ME + PL+IESFSYSWL+N +          ES      I+        F E D     +
Sbjct  1    METSQPLSIESFSYSWLVNLK-------PSLESLDSSFRISLDASDEASFIEMDPRMPPS  53

Query  636  KNF---------RFDINASSESGLLVDADEIFSDGHMIPVYLHRPKPPVEQAVSAPATPA  484
            K F         +FD   S     LV ADE+FS+G+++P ++   K    +A+ +  T  
Sbjct  54   KRFFKNISHDSNKFDFPTSQSPLTLVHADELFSNGYLMPFFVESLKMEEYEALDS-NTSL  112

Query  483  NNFWVSVRGKKEPQDY---ISQKWKKLLGTRILGKWFGFCKRLGGSSRSRKNCAKVDDLN  313
            N+   + +    P  +    S K  + L  RI  K+  F + L    R +K  + ++ + 
Sbjct  113  NSSSHATKSVVVPLGHSRCSSLKRCRTLSRRIFLKYLNFLRPLCRRLRGQKPSSNIETVA  172

Query  312  RKAMEVQINCKASSSDSDDPRKTKSCSNTPQESPLHYTTAYHSSPDAQTSITEAIIHCRK  133
            ++  E  +N +  +S++           +P+ S    +  +  S D+++SI EA++HC++
Sbjct  173  KRG-EGVMNWRYYNSET-----------SPRISVAFSSDDWRKSCDSESSIHEAVLHCKR  220

Query  132  S  130
            S
Sbjct  221  S  221



>ref|XP_007218214.1| hypothetical protein PRUPE_ppa010648mg [Prunus persica]
 gb|EMJ19413.1| hypothetical protein PRUPE_ppa010648mg [Prunus persica]
Length=241

 Score = 65.5 bits (158),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 74/252 (29%), Positives = 112/252 (44%), Gaps = 37/252 (15%)
 Frame = -1

Query  804  MEATHPLAIESFSYSWLLNAR--------ppsldslsdSESKHQDQDIAFSVVHSMRFSE  649
            MEA+ PL+IESFSYSWL+N +               +  ES   + D   S   S RF  
Sbjct  1    MEASQPLSIESFSYSWLVNLKPSLESLDNSLRTSLDASDESSFIEMDPTMSP--SKRFF-  57

Query  648  ADEAKNFRFDINASSESGL--LVDADEIFSDGHMIPVYLHRPKPPVEQAVSAPATPANNF  475
             +  ++F+FD  A S+S L  LV ADE+ S+G+++P+ +   K        A  +   NF
Sbjct  58   MNSQQDFKFDFPAVSQSPLTTLVHADELISNGYLLPLSVDSLKNMEAYDHEASKSTGANF  117

Query  474  WVSVRGKK---EPQDYI-----SQKWKKLLGTRILGKWFGFCKRLGGSSRSRKNCAKVDD  319
              S        +P D       S +  + L  RIL K+  F + L    R   +      
Sbjct  118  PASASHSARDVDPTDNSRDSSNSLRRCRRLSRRILEKYLNFLRPLYKKIRGDHHHHHHHK  177

Query  318  LNRKA-------MEVQINCKASSSDSDDPRKTKSCSNTPQESPLHYTTAYHSSPDAQTSI  160
             N KA            NC+  SSD+         S +P+ S  +    +  S D+++SI
Sbjct  178  ANPKAGFSADKRSHSVKNCRVHSSDT---------SQSPRISVAYSADDWRRSCDSESSI  228

Query  159  TEAIIHCRKSFG  124
             EA++HC++S G
Sbjct  229  YEAVLHCKRSIG  240



>ref|XP_010261426.1| PREDICTED: probable membrane-associated kinase regulator 6 [Nelumbo 
nucifera]
Length=233

 Score = 65.1 bits (157),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 65/240 (27%), Positives = 112/240 (47%), Gaps = 31/240 (13%)
 Frame = -1

Query  807  AMEATHPLAIESFSYSWLLNARppsldslsdSESKHQDQDIAFSVVH-------SMRFSE  649
             ME + PL+I+SFSYSWL+N +P          +     D A S +        S RF  
Sbjct  8    TMEGSQPLSIDSFSYSWLINLKPSYESLGDSFRAYLDASDEASSFIEMDPKLTPSKRFLG  67

Query  648  ADEAKNFRFDINASSESGLLVDADEIFSDGHMIPVYLHRPKPPVEQA-VSAPATP-----  487
              +  NF F ++ S   G LVDADE+FS+G ++P++ +  K     A V +  TP     
Sbjct  68   DAQDFNFGFPVSQSPH-GDLVDADELFSNGLLLPLFRNSFKTEAFAASVDSAPTPLISSS  126

Query  486  -ANNFWVSVRGKKEPQDYISQKWKKLLGTRILGKWFGFCKRLGGSSRSRKNCAKVDDLNR  310
              +   +S    + P   + ++W++   T I  K+ GF + L    R  +  A+  + N 
Sbjct  127  EPSKLLISSNRSRSP---LFRRWRRSSRT-IFQKYMGFLRPLYKKLRVLRLDARRPETN-  181

Query  309  KAMEVQINCKASSSDSDDPRKTKSCSNTPQESPLHYTTAYHSSPDAQTSITEAIIHCRKS  130
               + ++     S D     ++   + +P+ S  + T  + +    ++SI EA++HC+KS
Sbjct  182  ---DARVRPFVRSWD-----ESSQLTTSPRASTAYSTGDWCA---IESSIHEAVLHCKKS  230



>ref|XP_009368709.1| PREDICTED: probable membrane-associated kinase regulator 6 [Pyrus 
x bretschneideri]
Length=238

 Score = 65.1 bits (157),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 76/252 (30%), Positives = 126/252 (50%), Gaps = 40/252 (16%)
 Frame = -1

Query  804  MEATHPLAIESFSYSWLLNARppsldslsdSESKHQDQDIAFSVVH-------SMRFSEA  646
            MEA+ PL+IESFSYSWL+N +P SL+SL +S     D     S +        S RF   
Sbjct  1    MEASQPLSIESFSYSWLVNLKPASLESLDNSLRTSLDASDESSFIEMDPTMPPSQRFF-M  59

Query  645  DEAKNFRFDINAS-SESGL--LVDADEIFSDGHMIPVYLHRPKPPVEQAVSAPATPANNF  475
            +  ++F+FD  A+ S+S L  LV ADE+ S+G+++P+ L      + +  +     A+NF
Sbjct  60   NSQQDFKFDFPAAISQSPLTTLVHADELISNGYLLPLSLES----LMKMEAYHCDEASNF  115

Query  474  W---VSVRGKKEPQDYISQK-------WKKLLGTRILGKWFGFCKRL-----GGSSRSRK  340
                  ++    P D  S +         + L  RI  K+  F + L     G  +   K
Sbjct  116  TPVPSHLQKDAAPTDNHSSRDCSKSLRRCRRLSRRIFEKYLNFLRPLYRRIRGDHNHHHK  175

Query  339  NCAKVDDLNRKAMEVQINCKASSSDSDDPRKTKSCSNTPQESPLHYTTAYHSSPDAQTSI  160
               K  +L++++  V+ NC+  SS++         S +P+ S  +    +  S D+++SI
Sbjct  176  ANPKGGNLDKRSHSVK-NCRVHSSET---------SQSPRISVAYSADDWRMSCDSESSI  225

Query  159  TEAIIHCRKSFG  124
             EA++HC++S G
Sbjct  226  YEAVLHCKRSIG  237



>gb|KEH25757.1| membrane-associated kinase regulator-like protein, putative [Medicago 
truncatula]
Length=242

 Score = 64.7 bits (156),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 66/247 (27%), Positives = 110/247 (45%), Gaps = 52/247 (21%)
 Frame = -1

Query  804  MEATHPLAIESFSYSWLLNARppsldslsdSESKHQDQDIAFSVVH-------SMRFSEA  646
            ME +HPL +ESFSYSWL+N         S  E    D D   S +        S RF   
Sbjct  1    METSHPLLVESFSYSWLVNLE------PSSLEESLDDDDEGSSFIEMDPRMPPSRRF--F  52

Query  645  DEAKNFRFDINASSESGL--LVDADEIFSDGHMIPVYLHRPK-PPVE-----------QA  508
              +++ +FD   S  S L  LVDAD++FS+G++IP+++      P E             
Sbjct  53   INSQDLKFDFPTSQHSPLTTLVDADQLFSNGYLIPLFVESLNIEPYEYDSFNSNSNSNST  112

Query  507  VSAPATPANNFWVSVRGKKEPQDYISQKWKKLLGTRILGKWFGFCKRLGGSSRSRKNCAK  328
            +   ++      V +   + P    S K  + L  ++  K+  F   L    R + +  K
Sbjct  113  LPCSSSHVPKKLVPIENPRTP----SLKRCRTLSRKMFQKYLNFLSPLCRRLRGQNSGTK  168

Query  327  VDDLNRKAMEVQINCKASSSDSDDPRKTKSCSNTPQESPLHYTTAYHSSPDAQTSITEAI  148
             +++ ++   V+ N + +            C ++P+ S     TAY  S D+ +SI EA+
Sbjct  169  HENVVKRTQSVK-NIRRN-----------YCESSPRMS-----TAY--SCDSDSSIYEAV  209

Query  147  IHCRKSF  127
            +HC++S 
Sbjct  210  LHCKRSI  216



>ref|XP_009375561.1| PREDICTED: probable membrane-associated kinase regulator 6 [Pyrus 
x bretschneideri]
Length=238

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 77/255 (30%), Positives = 124/255 (49%), Gaps = 46/255 (18%)
 Frame = -1

Query  804  MEATHPLAIESFSYSWLLNARppsldslsdSESKHQDQDIAFSVVH-------SMRFSEA  646
            MEA+ PL+IESFSYSWL+N +P SL+SL +S     D     S +        S RF   
Sbjct  1    MEASQPLSIESFSYSWLVNLKPASLESLDNSVRTSLDAYDEASFIEMDPTMPPSQRFF-M  59

Query  645  DEAKNFRFDINAS-SESGL--LVDADEIFSDGHMIPVYL---------HRPKP----PVE  514
            +  ++F+FD  A+ S+S L  LV ADE+ S+G+++P+ +         HR +     P+ 
Sbjct  60   NSQQDFKFDFPAAISQSPLTTLVHADELISNGYVLPLSVESLMKMEAYHRDEASNSSPLP  119

Query  513  QAVSAPATPANNFWVSVRGKKEPQDYISQKWKKLLGTRILGKWFGFCKRL-----GGSSR  349
              +   A P  N       K         +  + L  RI  K+  F + L     G  + 
Sbjct  120  SHLQKDAAPTGNHNSRDCSKS-------LRRCRRLSRRIFEKYLNFLRPLYKRIRGDHNH  172

Query  348  SRKNCAKVDDLNRKAMEVQINCKASSSDSDDPRKTKSCSNTPQESPLHYTTAYHSSPDAQ  169
              K   K  +L++++  V+ NC+  SS++         S +P+ S  +    +  S D++
Sbjct  173  QHKANPKGGNLDKRSHSVK-NCRVRSSET---------SQSPRISIAYSADDWRMSCDSE  222

Query  168  TSITEAIIHCRKSFG  124
            +SI EA+IHC++S G
Sbjct  223  SSIYEAVIHCKRSIG  237



>ref|XP_008380338.1| PREDICTED: probable membrane-associated kinase regulator 6 [Malus 
domestica]
Length=238

 Score = 63.5 bits (153),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 77/255 (30%), Positives = 123/255 (48%), Gaps = 46/255 (18%)
 Frame = -1

Query  804  MEATHPLAIESFSYSWLLNARppsldslsdSESKHQDQDIAFSVVH-------SMRFSEA  646
            MEA+ PL+IESFSYSWL+N +P SL+SL +S     D     S +        S RF   
Sbjct  1    MEASQPLSIESFSYSWLVNLKPASLESLDNSVRTSLDAYDEASFIEMDPTMPPSQRFF-M  59

Query  645  DEAKNFRFDINAS-SESGL--LVDADEIFSDGHMIPVYL---------HRPKP----PVE  514
            +  ++F+FD  A+ S+S L  LV ADE+ S+G+++P+ +         HR +     P+ 
Sbjct  60   NSQQDFKFDFPAAISQSPLTTLVHADELISNGYVLPLSVESLMKMEAYHRDEASNSSPLP  119

Query  513  QAVSAPATPANNFWVSVRGKKEPQDYISQKWKKLLGTRILGKWFGFCKRL-----GGSSR  349
              +   A P  N       K         +  + L  RI  K+  F + L     G  + 
Sbjct  120  SHLQKDAAPTGNHNSRDCSKS-------LRRCRRLSRRIFEKYLNFLRPLYKRIRGDHNH  172

Query  348  SRKNCAKVDDLNRKAMEVQINCKASSSDSDDPRKTKSCSNTPQESPLHYTTAYHSSPDAQ  169
              K   K  +L++++  V+ NC+  SS+          S +P+ S  +    +  S D++
Sbjct  173  QHKANPKGGNLDKRSHSVK-NCRVRSSE---------ISQSPRISVAYSADDWRMSCDSE  222

Query  168  TSITEAIIHCRKSFG  124
            +SI EA+IHC++S G
Sbjct  223  SSIYEAVIHCKRSIG  237



>ref|XP_008234807.1| PREDICTED: probable membrane-associated kinase regulator 6 [Prunus 
mume]
Length=241

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 73/252 (29%), Positives = 113/252 (45%), Gaps = 37/252 (15%)
 Frame = -1

Query  804  MEATHPLAIESFSYSWLLNAR--------ppsldslsdSESKHQDQDIAFSVVHSMRFSE  649
            MEA+ PL+IESFSYSWL+N +               +  ES   + D   S   S RF  
Sbjct  1    MEASQPLSIESFSYSWLVNLKPSLESLDNSLRTSLDASDESSFIEMDPTMSP--SKRFF-  57

Query  648  ADEAKNFRFDINASSESGL--LVDADEIFSDGHMIPVYLHRPKPPVEQAVSAPATPANNF  475
             +  ++F+FD  A S+S L  LV ADE+ S+G+++P+ +   K        A  + + NF
Sbjct  58   MNSQQDFKFDFPAVSQSPLTTLVHADELISNGYLLPLSVDSLKNMEAYDHEASKSTSANF  117

Query  474  WVSVRGKK---EPQDYI-----SQKWKKLLGTRILGKWFGFCKRLGGSSRSRKNCAKVDD  319
              S        +P D       S +  + L  RIL K+  F + L    R   +      
Sbjct  118  AASSSHSARDVDPTDNSRDSSNSLRRCRRLSRRILEKYLNFLRPLYKKIRGDHHHHHHHK  177

Query  318  LNRKA-------MEVQINCKASSSDSDDPRKTKSCSNTPQESPLHYTTAYHSSPDAQTSI  160
             N KA            NC+  SS++         S +P+ S  +    +  S D+++SI
Sbjct  178  ANPKAGFSADKRSHSVKNCRVHSSET---------SQSPRISVAYSADDWRRSCDSESSI  228

Query  159  TEAIIHCRKSFG  124
             EA++HC++S G
Sbjct  229  YEAVLHCKRSIG  240



>gb|KHN12219.1| Putative membrane-associated kinase regulator 6 [Glycine soja]
Length=223

 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 66/228 (29%), Positives = 99/228 (43%), Gaps = 34/228 (15%)
 Frame = -1

Query  789  PLAIESFSYSWLLNARppsldslsdSESKHQDQDIAFSVVHSMRFSEADEAKNFRFDINA  610
            PLA ESFSYSWL N         S   +   +++  FSV  S       E  NF FDI+ 
Sbjct  8    PLASESFSYSWLSNCNKSPPTYSSYGGT--SEEEFNFSVKKSC------EEFNFNFDISV  59

Query  609  SSESGLLVDADEIFSDGHMIPVYLHRPKPPVEQAVSAPATPANNFWVSVRGKKEPQDYIS  430
                 +LV ADEIFSDG + P+++    P   +  + P         S   +   Q  + 
Sbjct  60   PHSPLVLVPADEIFSDGLLRPMFV---DPSKVEFCNTPDPTQTKLSSSFSSRTFSQRAME  116

Query  429  ------QKWKKLLGTRILGKWFGFCKRLGGS-SRSRKNCAKVDDLNRKAMEVQINCKASS  271
                   KW+K    R    +F +  +L     RSRK+  +VDD+++   + Q+ C  S 
Sbjct  117  IHHGLLTKWRKST-RRTFVDFFRYVNQLRQRVGRSRKSI-RVDDIDK--TDWQVKCLTSP  172

Query  270  SDSDDPRKTKSCSNTPQESPLHYTTAYHSSPDAQTSITEAIIHCRKSF  127
                 P+ T + +       LH         D + SI EA++HC++S 
Sbjct  173  QKGSSPKPTIAATGI---GDLH---------DHENSIYEAVLHCKRSI  208



>ref|XP_006573105.1| PREDICTED: probable membrane-associated kinase regulator 6-like 
[Glycine max]
Length=207

 Score = 62.4 bits (150),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 70/231 (30%), Positives = 106/231 (46%), Gaps = 35/231 (15%)
 Frame = -1

Query  798  ATHPLAIESFSYSWLLNARppsldslsdSESKHQDQDIAFSVVHSMRFSEADEAKNFRFD  619
            ++ PLA +SFSYSWL N   P   S     S   +++  FSV  S       E  NF FD
Sbjct  5    SSEPLASDSFSYSWLSNCNKPPYYSSYGGTS---EEEFNFSVQKSC------EEFNFNFD  55

Query  618  INASSESGLLVDADEIFSDGHMIPVYLHRPKPPVEQAVSAPAT-----PANNFWVSVRGK  454
            I+      +LV ADEIFSDG + P+++   K  VE   +   T      + +     +  
Sbjct  56   ISVPHSPLVLVPADEIFSDGLLRPMFVDPSK--VEFCNTPDPTQTKLSSSFSSKTFSQRA  113

Query  453  KEPQDYISQKWKKLLGTRILGKWFGFCKRLGGS-SRSRKNCAKVDDLNRKAMEVQINCKA  277
             E    +  KW+K    R L  +F +  +L     RSRK+  +VDD+++   +V+   + 
Sbjct  114  MEIHHGLLTKWRKST-RRTLVDFFRYVNQLRQKVGRSRKSI-RVDDIDKTDWQVKCLTQK  171

Query  276  SSSDSDDPRKTKSCSNTPQESPLHYTTAYHSSPDAQTSITEAIIHCRKSFG  124
             SS    P+ T +          H     H   D + SI EA++HC++S G
Sbjct  172  GSS----PKPTLAT---------HPIGDLH---DHENSIYEAVLHCKRSIG  206



>ref|XP_010105712.1| hypothetical protein L484_014200 [Morus notabilis]
 gb|EXC05932.1| hypothetical protein L484_014200 [Morus notabilis]
Length=235

 Score = 62.4 bits (150),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 66/237 (28%), Positives = 109/237 (46%), Gaps = 18/237 (8%)
 Frame = -1

Query  804  MEATHPLAIESFSYSWLLNARppsldslsdSESKHQDQDIAFSVVHSMRFSEADE----A  637
            ME + PL+IESFSYSWL+N +P      +   +     D A  +    R   +      +
Sbjct  1    METSQPLSIESFSYSWLVNLKPSLESLDNSLRTSLDASDEASFIEMDPRMPPSKRFLRIS  60

Query  636  KNFRFDINASSESGLLVDADEIFSDGHMIPVYLHRPKPPVEQAVSAPATP--ANNFWVSV  463
            ++F+FD   S     LV ADE+ S+G+++P++L   K    +A S  +T    N+    +
Sbjct  61   QDFKFDFPTSPSPLSLVHADELISNGYLMPLFLDPLKMEAYEASSTTSTQNLPNSSHSPI  120

Query  462  RGKKEPQ-DYISQKWKKLLGTRILGKWFGFCKRLGGSSRS-RKNCAKVDDLNRKAMEVQI  289
             G      D  S +  + L  RI+ K+  F + L    R   K  +K      K ++   
Sbjct  121  TGVPAGNSDCSSLRRCRRLSRRIIQKYLNFLRPLYRKIRGHNKAGSKAAGHVEKRVQGGK  180

Query  288  NCKASSSDSDDPRKTKSCSNTPQESPLHYTTAYHSSPDAQTSITEAIIHCRKSFGLQ  118
            N +  SS+S  PR + + S             +  S D+ +SI EA++HC++S G+ 
Sbjct  181  N-RVYSSESASPRISVAYSA---------DDYWRKSCDSDSSIYEAVLHCKRSIGIH  227



>ref|XP_007153595.1| hypothetical protein PHAVU_003G048900g [Phaseolus vulgaris]
 gb|ESW25589.1| hypothetical protein PHAVU_003G048900g [Phaseolus vulgaris]
Length=201

 Score = 62.0 bits (149),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 67/235 (29%), Positives = 111/235 (47%), Gaps = 45/235 (19%)
 Frame = -1

Query  804  MEATHPLAIESFSYSWLLNARppsldslsdSESKHQDQDIAFSVVHSMRFSEADEAKNFR  625
            ME + PLA +SFSY WL N +P + + L   ES H                  +E +NF 
Sbjct  1    METSLPLATDSFSYGWLSNCKPFANEPLR--ESTHNSP-------------LKEEWENFN  45

Query  624  FDINASSESGLLVDADEIFSDGHMIPVYLHRPKPPVEQAV---SAPATPANNFW---VSV  463
            FDI+ +    +L  ADE+FS+G + P ++   K    +     +  + P ++F    VS 
Sbjct  46   FDISFTHSPSVLAHADELFSNGLIKPFFVGPSKLDSCRTTLDSTCQSKPISSFLSRIVSP  105

Query  462  RGKKEPQDYISQKWKKLL--GTRILGKWFG-FCKRLGGSSRSRKNCAKVDDLNRKAMEVQ  292
            R  +    +++ KWK       R L ++    C+R+G S +S     KVDD +++  E  
Sbjct  106  RTVQIHHGFLT-KWKSSTCRTLRSLSRYVNQLCQRVGSSRKS----TKVDDFDKE--EWL  158

Query  291  INCKASSSDSDDPRKTKSCSNTPQESPLHYTTAYHSSPDAQTSITEAIIHCRKSF  127
            +N  +SS  +           +P+ S ++   A H   D + SI EA++HC++S 
Sbjct  159  VNSWSSSHQA-----------SPKSSTVNPIGALH---DHENSIYEAVLHCKRSI  199



>ref|XP_010060057.1| PREDICTED: probable membrane-associated kinase regulator 6 [Eucalyptus 
grandis]
 gb|KCW90580.1| hypothetical protein EUGRSUZ_A02685 [Eucalyptus grandis]
Length=255

 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 64/242 (26%), Positives = 115/242 (48%), Gaps = 35/242 (14%)
 Frame = -1

Query  804  MEATHPLAIESFSYSWLLNARppsldslsdSESKHQDQDIAFSVVHSMRFSEADE-----  640
            MEA+ PL+IESFSYSWL+N  P +  +     +     + A+ +    RF  +       
Sbjct  1    MEASQPLSIESFSYSWLVNRNPSAEITDGSIRTSLDASEEAYFIEMDPRFPSSKSFRRNS  60

Query  639  -AKNFRFDINASSESGLLVDADEIFSDGHMIPVYLHRPKPPVEQAVSAPATPANNFWVSV  463
             + +F+FD   S  S   V ADE+F +G+++P+++   K  ++   ++  TP+    V V
Sbjct  61   ISHDFKFDFPTSQPSLPCVHADEVFRNGYVLPLFVDPLK--LKSCEASNPTPSPPPPVHV  118

Query  462  RGKKEPQDYISQKWKKLLGTRILGKWFGFCKRLGGSSRSRKNCAKVDDLNRKAMEVQINC  283
            +    P+            +++       C+RL     SR+   K   L R  +++ +  
Sbjct  119  KRTAMPE------------SKLRSPSLRQCRRL-----SRRIFRKYLHLFRPLVQI-MRG  160

Query  282  KASSSDSDDPRKTKS----CSNTPQESPLHYTTAYHS-----SPDAQTSITEAIIHCRKS  130
              +   +++ R TKS     S  P E     ++AY +     S D+++SI EA++HC++S
Sbjct  161  HGTGPRAEETRSTKSQAIKNSVYPVECSPRISSAYSADEWRRSCDSESSIYEAVLHCKRS  220

Query  129  FG  124
             G
Sbjct  221  IG  222



>dbj|BAB10438.1| unnamed protein product [Arabidopsis thaliana]
Length=236

 Score = 62.4 bits (150),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 66/246 (27%), Positives = 109/246 (44%), Gaps = 34/246 (14%)
 Frame = -1

Query  801  EATHPLA-IESFSYSWLLNARppsldslsdSESKHQDQDIAFSVVH-------SMRF-SE  649
            EA+ PL  I+SFSYSWL+N            ++ ++D   + S +        S RF  +
Sbjct  7    EASMPLVPIDSFSYSWLVNFPSLEATIDDHHQT-YEDSSSSSSFIEMDPRLPPSRRFFIK  65

Query  648  ADEAKNFRFD--INASSESGLLVDADEIFSDGHMIPVYLHRPKPPVEQAVSAPATPANNF  475
                 +F+FD  ++ S E   LV ADE+F DG+++P Y  +P     +  S P     + 
Sbjct  66   TSHESSFKFDNFVSFSDEDHSLVHADELFRDGYVMP-YRLKPTSAATEEESEPLDTTTSE  124

Query  474  WVSVRGKKEPQDYISQKWKKLLGTRILGKWFGF----CKRLGGSSRSRKNCAKVDDLNRK  307
             +  RG        S +  + +   +L K+  F    CKRL       + C         
Sbjct  125  KIDTRGLNSKPSPTSSRKLRRVSKWVLLKYLDFLTPLCKRL-------RRCRSAVTTGSI  177

Query  306  AMEVQINCKASSSDSDDPRKTKSCSNTPQESP-LHYTTAYH--SSPDAQTSITEAIIHCR  136
             M+ +I    S        +++  S+    SP +     Y+   S D+++SI EA++HC+
Sbjct  178  GMDSRIRVTTSC-------RSRVYSDEMTSSPRISVADDYYWRRSCDSESSIYEAVLHCK  230

Query  135  KSFGLQ  118
            KSFG +
Sbjct  231  KSFGTK  236



>ref|XP_008376665.1| PREDICTED: probable membrane-associated kinase regulator 6 [Malus 
domestica]
Length=238

 Score = 62.0 bits (149),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 74/255 (29%), Positives = 122/255 (48%), Gaps = 46/255 (18%)
 Frame = -1

Query  804  MEATHPLAIESFSYSWLLNARppsldslsdSESKHQDQDIAFSVVH-------SMRFSEA  646
            ME + PL+IESFSYSWL+N +P SL+SL++S     D     S +        S RF   
Sbjct  1    METSQPLSIESFSYSWLVNLKPASLESLNNSLRTSLDASDESSFIEMDPTMPPSQRFF-M  59

Query  645  DEAKNFRFDINAS-SESGL--LVDADEIFSDGHMIPVYLHRPK-------------PPVE  514
            +  ++F+FD  A+ S+S L  LV ADE+ S+G+++P+ +                  PV 
Sbjct  60   NSQQDFKFDFPAAISQSPLTTLVHADELISNGYLLPLSVESLMKMEAYHCDEASNFTPVP  119

Query  513  QAVSAPATPANNFWVSVRGKKEPQDYISQKWKKLLGTRILGKWFGFCKRL-----GGSSR  349
              +   A P +N       K         +  + L  RI  K+  F + L     G  + 
Sbjct  120  SHLQKDAAPTDNHNSRDCSKS-------LRRCRRLSRRIFEKYLNFLRPLYRRIRGDRNH  172

Query  348  SRKNCAKVDDLNRKAMEVQINCKASSSDSDDPRKTKSCSNTPQESPLHYTTAYHSSPDAQ  169
              K   K  +L++++  V+ NC+  SS++         S +P+ S  +    +  S D++
Sbjct  173  HHKANPKGGNLDKRSHSVK-NCRVHSSET---------SQSPRISVAYSADDWRMSCDSE  222

Query  168  TSITEAIIHCRKSFG  124
            +SI EA++HC++S G
Sbjct  223  SSIYEAVLHCKRSIG  237



>ref|XP_004234209.1| PREDICTED: probable membrane-associated kinase regulator 6 [Solanum 
lycopersicum]
Length=217

 Score = 61.2 bits (147),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 66/237 (28%), Positives = 114/237 (48%), Gaps = 33/237 (14%)
 Frame = -1

Query  804  MEATHPLAIESFSYSWLLNARppsldslsdSESKHQDQDIAFSVVHSMRFSEAD-EAKNF  628
            ME +  L+IESFSYSWL++       S+ D E+   + D A     S RF   + +  NF
Sbjct  1    METSQSLSIESFSYSWLVDLGDSFRASMDDYETAFIEMDPALP--PSKRFFNVNPQDLNF  58

Query  627  RFDINASSESGLLVDADEIFSDGHMIPVYLHRP-KPPVEQAVSAPATPANNFWVSVRGKK  451
             F  + S+    LV ADE+ S+G ++P+++ +P K   +  V+   +  N+   S   ++
Sbjct  59   NFPTSDST----LVHADELISNGLLMPLFIKKPMKMESDYDVTESDSIVNSPACSAAAQQ  114

Query  450  EPQDYISQKWKKLL--------GTRILGKWFGFCKRLGGSSRSRKNCAKVDDLNRKAMEV  295
            E +   S +  + +          RIL K+F F          R  C K+   +R     
Sbjct  115  EDESRCSSRVNRCVSLRRCRSLSRRILVKYFDFL---------RPFCQKIRRCSRIG---  162

Query  294  QINCKASSSDSDDPRKTKSCS--NTPQESPLHYTTAYHSSPDAQTSITEAIIHCRKS  130
               C+ SSS  +  +K + CS   +P+ S  +    +  S D+++SI EA++HC+++
Sbjct  163  --RCR-SSSGKEVMKKWEYCSAATSPRISVAYSVDNWRRSCDSESSIYEAVLHCKRN  216



>ref|XP_008439312.1| PREDICTED: probable membrane-associated kinase regulator 6 [Cucumis 
melo]
Length=224

 Score = 61.2 bits (147),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 64/249 (26%), Positives = 109/249 (44%), Gaps = 48/249 (19%)
 Frame = -1

Query  804  MEATHPLAIESFSYSWLLNARppsldslsdSESKHQD--QDIAFSVVH-------SMRFS  652
            ME + PL+I+SFSYSWL+N +P    S ++S     D   + A S +        S RF 
Sbjct  1    METSQPLSIDSFSYSWLVNIKPSLESSGNNSFRTSLDASDEAASSFIEMDPRMPPSKRFF  60

Query  651  EADEAKNFRFDINASSESGLLVDADEIFSDGHMIPVYLH------------RPKPPVEQA  508
                +++F+FD   S  S   V AD++ S+G ++P ++              P  P    
Sbjct  61   R--NSQDFKFDFPVSPPSLTFVHADQLISNGCLVPFFIDPVKVQKYEDEDFNPNLPKSSH  118

Query  507  VSAPATPANNFWVSVRGKKEPQDYISQKWKKLLGTRILGKWFGFCKRLGGSSRS-RKNCA  331
            +     PAN             D  S +  + L  ++L K+  F K L    R  R + +
Sbjct  119  IENDVHPANT-----------SDCSSMRKCRKLSKKVLQKYLSFFKPLYQRIRGHRASSS  167

Query  330  KVDDLNRKAMEVQINCKASSSDSDDPRKTKSCSNTPQESPLHYTTAYHSSPDAQTSITEA  151
            K +++ R++  ++                 S   +P+ S  +    +  S D+++SI EA
Sbjct  168  KPENVGRRSKSMK-------------NWEYSYEASPRISVAYSADDWRRSCDSESSIYEA  214

Query  150  IIHCRKSFG  124
            ++HC+KS G
Sbjct  215  VLHCKKSIG  223



>gb|KGN57882.1| hypothetical protein Csa_3G363150 [Cucumis sativus]
Length=224

 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 64/249 (26%), Positives = 110/249 (44%), Gaps = 48/249 (19%)
 Frame = -1

Query  804  MEATHPLAIESFSYSWLLNARppsldslsdSESKHQD--QDIAFSVVH-------SMRFS  652
            ME + PL+I+SFSYSWL+N +P    S ++S     D   + A S +        S RF 
Sbjct  1    METSQPLSIDSFSYSWLVNIKPSLESSGNNSFRTSLDASDEPASSFIEMDPRMPPSKRFF  60

Query  651  EADEAKNFRFDINASSESGLLVDADEIFSDGHMIPVYLH------------RPKPPVEQA  508
                +++F+FD   S  S   V AD++ S+G ++P ++              P  P    
Sbjct  61   R--NSQDFKFDFPVSPPSLTFVHADQLISNGCLVPFFIDPVKVQKYEDEDFNPNFPKSSH  118

Query  507  VSAPATPANNFWVSVRGKKEPQDYISQKWKKLLGTRILGKWFGFCKRLGGSSRS-RKNCA  331
            +     PAN             D  S +  + L  ++L K+  F K L    R  R + +
Sbjct  119  IENDVHPANT-----------SDCSSMRKCRKLSKKVLQKYLSFFKPLYQRIRGHRTSSS  167

Query  330  KVDDLNRKAMEVQINCKASSSDSDDPRKTKSCSNTPQESPLHYTTAYHSSPDAQTSITEA  151
            K +++ R++  ++    A  +             +P+ S  +    +  S D+++SI EA
Sbjct  168  KPENVGRRSKSMKNWEYAYEA-------------SPRISVAYSADDWRRSCDSESSIYEA  214

Query  150  IIHCRKSFG  124
            ++HC+KS G
Sbjct  215  VLHCKKSIG  223



>ref|XP_009772891.1| PREDICTED: probable membrane-associated kinase regulator 6 isoform 
X2 [Nicotiana sylvestris]
 ref|XP_009772892.1| PREDICTED: probable membrane-associated kinase regulator 6 isoform 
X3 [Nicotiana sylvestris]
Length=216

 Score = 59.3 bits (142),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 64/244 (26%), Positives = 108/244 (44%), Gaps = 46/244 (19%)
 Frame = -1

Query  804  MEATHPLAIESFSYSWLLNARppsldslsdSESKHQDQDIAF-----SVVHSMRFSEADE  640
            ME +  L+IESFSYSWL++       S+  S+    D + AF     ++  S RF   + 
Sbjct  1    METSQSLSIESFSYSWLVDLGDSFRASMDASD----DYETAFIEMDPTLPPSKRFFNVN-  55

Query  639  AKNFRFDINASSESGLLVDADEIFSDGHMIPVYLHRPKP-----PVEQAVSAPATPA---  484
             ++  FD   S     LV ADE+ S+G ++P+++ +P        V  + S P +P    
Sbjct  56   PQDLNFDFPTSESPLTLVHADELISNGFLMPLFVKKPMKLESDYDVISSDSIPNSPTSSV  115

Query  483  --NNFWVSVRGKKEPQDYISQKWKKLLGTRILGKWFGFCKRLGGSSRSRKNCAKVDDLNR  310
              N+   S R  +     +S +  + L  RIL K+  F          R  C K+     
Sbjct  116  TQNDSLSSRRVNR----CVSLRRCRTLSRRILLKYLDFL---------RPFCQKIR----  158

Query  309  KAMEVQINCKASSSDSDDPRKT--KSCSNTPQESPLHYTTAYHSSPDAQTSITEAIIHCR  136
                    C+     S+   K    S + +P+ S  +    +  S D+++SI EA++HC+
Sbjct  159  -------RCRLGRCRSEKEVKKWEYSPATSPRTSVAYSVDNWRRSCDSESSIYEAVLHCK  211

Query  135  KSFG  124
            ++ G
Sbjct  212  RTIG  215



>ref|XP_009772890.1| PREDICTED: probable membrane-associated kinase regulator 6 isoform 
X1 [Nicotiana sylvestris]
Length=219

 Score = 59.3 bits (142),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 64/244 (26%), Positives = 108/244 (44%), Gaps = 46/244 (19%)
 Frame = -1

Query  804  MEATHPLAIESFSYSWLLNARppsldslsdSESKHQDQDIAF-----SVVHSMRFSEADE  640
            ME +  L+IESFSYSWL++       S+  S+    D + AF     ++  S RF   + 
Sbjct  1    METSQSLSIESFSYSWLVDLGDSFRASMDASD----DYETAFIEMDPTLPPSKRFFNVN-  55

Query  639  AKNFRFDINASSESGLLVDADEIFSDGHMIPVYLHRPKP-----PVEQAVSAPATPA---  484
             ++  FD   S     LV ADE+ S+G ++P+++ +P        V  + S P +P    
Sbjct  56   PQDLNFDFPTSESPLTLVHADELISNGFLMPLFVKKPMKLESDYDVISSDSIPNSPTSSV  115

Query  483  --NNFWVSVRGKKEPQDYISQKWKKLLGTRILGKWFGFCKRLGGSSRSRKNCAKVDDLNR  310
              N+   S R  +     +S +  + L  RIL K+  F          R  C K+     
Sbjct  116  TQNDSLSSRRVNR----CVSLRRCRTLSRRILLKYLDFL---------RPFCQKIR----  158

Query  309  KAMEVQINCKASSSDSDDPRKT--KSCSNTPQESPLHYTTAYHSSPDAQTSITEAIIHCR  136
                    C+     S+   K    S + +P+ S  +    +  S D+++SI EA++HC+
Sbjct  159  -------RCRLGRCRSEKEVKKWEYSPATSPRTSVAYSVDNWRRSCDSESSIYEAVLHCK  211

Query  135  KSFG  124
            ++ G
Sbjct  212  RTIG  215



>ref|NP_568780.1| membrane-associated kinase regulator family protein [Arabidopsis 
thaliana]
 sp|Q84JK8.1|MAKR6_ARATH RecName: Full=Probable membrane-associated kinase regulator 6 
[Arabidopsis thaliana]
 gb|AAO64170.1| unknown protein [Arabidopsis thaliana]
 gb|AAP04074.1| unknown protein [Arabidopsis thaliana]
 dbj|BAF00476.1| hypothetical protein [Arabidopsis thaliana]
 gb|AED96275.1| uncharacterized protein AT5G52900 [Arabidopsis thaliana]
Length=235

 Score = 59.3 bits (142),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 65/243 (27%), Positives = 107/243 (44%), Gaps = 34/243 (14%)
 Frame = -1

Query  801  EATHPLA-IESFSYSWLLNARppsldslsdSESKHQDQDIAFSVVH-------SMRF-SE  649
            EA+ PL  I+SFSYSWL+N            ++ ++D   + S +        S RF  +
Sbjct  7    EASMPLVPIDSFSYSWLVNFPSLEATIDDHHQT-YEDSSSSSSFIEMDPRLPPSRRFFIK  65

Query  648  ADEAKNFRFD--INASSESGLLVDADEIFSDGHMIPVYLHRPKPPVEQAVSAPATPANNF  475
                 +F+FD  ++ S E   LV ADE+F DG+++P Y  +P     +  S P     + 
Sbjct  66   TSHESSFKFDNFVSFSDEDHSLVHADELFRDGYVMP-YRLKPTSAATEEESEPLDTTTSE  124

Query  474  WVSVRGKKEPQDYISQKWKKLLGTRILGKWFGF----CKRLGGSSRSRKNCAKVDDLNRK  307
             +  RG        S +  + +   +L K+  F    CKRL       + C         
Sbjct  125  KIDTRGLNSKPSPTSSRKLRRVSKWVLLKYLDFLTPLCKRL-------RRCRSAVTTGSI  177

Query  306  AMEVQINCKASSSDSDDPRKTKSCSNTPQESP-LHYTTAYH--SSPDAQTSITEAIIHCR  136
             M+ +I    S        +++  S+    SP +     Y+   S D+++SI EA++HC+
Sbjct  178  GMDSRIRVTTSC-------RSRVYSDEMTSSPRISVADDYYWRRSCDSESSIYEAVLHCK  230

Query  135  KSF  127
            KSF
Sbjct  231  KSF  233



>ref|XP_006366645.1| PREDICTED: probable membrane-associated kinase regulator 6-like 
[Solanum tuberosum]
Length=221

 Score = 58.9 bits (141),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 67/241 (28%), Positives = 113/241 (47%), Gaps = 37/241 (15%)
 Frame = -1

Query  804  MEATHPLAIESFSYSWLLNA----RppsldslsdSESKHQDQDIAFSVVHSMRFSEADEA  637
            ME +  L+IESFSYSWL++     R    DS  D E+   + D A     S RF   +  
Sbjct  1    METSQSLSIESFSYSWLVDLGDSFRAAMDDSGDDYETAFIEMDPALP--PSKRFFNVN-P  57

Query  636  KNFRFDINASSESGLLVDADEIFSDGHMIPVYLHRPKPPVEQAVSAPATPANNFWVSVRG  457
            ++  FD   S  S  LV ADE+ S+G ++P+++   K P++  +      +++   S   
Sbjct  58   QDLNFDFPTSDSSSTLVHADELISNGFLMPLFI---KKPMKMELDYDVIESDSIVNSPDA  114

Query  456  KKEPQDY----------ISQKWKKLLGTRILGKWFGFCKRLGGSSRSRKNCAKVDDLNRK  307
            ++E +            +S +  + L  RIL K+F F          R  C K+   +R 
Sbjct  115  QQEDESRSSSCRRVNRCVSLRRCRSLSRRILLKYFDFL---------RPFCQKIRRCSRI  165

Query  306  AMEVQINCKASSSDSDDPRKTKSCS--NTPQESPLHYTTAYHSSPDAQTSITEAIIHCRK  133
                   C+ SSS  +  +K   CS   +P+ S  +    +  S D+++SI EA++HC++
Sbjct  166  G-----RCR-SSSGKEVMKKWDYCSAATSPRTSVAYSVDNWRRSCDSESSIYEAVLHCKR  219

Query  132  S  130
            +
Sbjct  220  N  220



>ref|XP_004490054.1| PREDICTED: probable membrane-associated kinase regulator 6-like 
[Cicer arietinum]
Length=230

 Score = 58.9 bits (141),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 65/247 (26%), Positives = 118/247 (48%), Gaps = 57/247 (23%)
 Frame = -1

Query  819  ICI--FAMEATHPLAIESFSYSWLLNARppsldslsdSESKHQDQDIAFSVVHSMR-FSE  649
            +CI  F  E + PLA +SFSYSWL N+    +D L   E  H++   +F    ++  F+ 
Sbjct  25   LCIKHFKKETSLPLASDSFSYSWLSNSNNSPVDFLD--EEPHRESFSSFYGDTTLEEFNT  82

Query  648  ADEAKNFRFDINASSESGLLVDADEIFSDGHMIPVYLHRPK--------PPVEQAVSAPA  493
            ++  +NF FD   +  + +LV ADEIFS+G + PV++   K         P++  + A  
Sbjct  83   SNNVQNFNFDTCITQSNFVLVHADEIFSNGILTPVFVDSSKIELLCNTQDPIQTNIGASF  142

Query  492  TPANNFWVSVRGKKEPQDYISQKWKKLLGTRILGKWFGFC----KRLGGSSRSRKNCAKV  325
            +      ++ +  +    +++ +W+K    R L ++F +     ++LG S+++     KV
Sbjct  143  STRR---LTSKNMEIHHGFLT-RWRKSTW-RTLLQFFRYFNPLRQKLGKSTKNN----KV  193

Query  324  DDLNRKAMEVQINCKASSSDSDDPRKTKSCSNTPQESPLHYTTAYHSSPDAQTSITEAII  145
            DD+++      I+ KA                    SP+     +H   D   SI +A++
Sbjct  194  DDVDK------IDWKA--------------------SPI---GDFH--IDHDNSIYDAVL  222

Query  144  HCRKSFG  124
            HC++S G
Sbjct  223  HCKRSIG  229



>gb|AAM62601.1| unknown [Arabidopsis thaliana]
Length=235

 Score = 58.5 bits (140),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 62/242 (26%), Positives = 102/242 (42%), Gaps = 32/242 (13%)
 Frame = -1

Query  801  EATHPLA-IESFSYSWLLNARppsldslsdSESKHQDQDIAFSVVHSMR-------FSEA  646
            EA+ PL  I+SFSYSWL+N            ++       +  +    R       F + 
Sbjct  7    EASMPLVPIDSFSYSWLVNFPSLEATIDDHHQTFEDSSSSSSFIEMDPRLPPSRRFFIKT  66

Query  645  DEAKNFRFD--INASSESGLLVDADEIFSDGHMIPVYLHRPKPPVEQAVSAPATPANNFW  472
                +F+FD  ++ S E   LV ADE+F DG+++P Y  +P     +  S P     +  
Sbjct  67   SHESSFKFDNFVSFSDEDHSLVHADELFRDGYVMP-YRLKPTSAATEEESEPLDTTTSEK  125

Query  471  VSVRGKKEPQDYISQKWKKLLGTRILGKWFGF----CKRLGGSSRSRKNCAKVDDLNRKA  304
            +  RG        S +  + +   +L K+  F    CKRL       + C          
Sbjct  126  IDTRGLNSKPSPTSSRKLRRVSKWVLLKYLDFLTPLCKRL-------RRCRSAVTTGSIG  178

Query  303  MEVQINCKASSSDSDDPRKTKSCSNTPQESP-LHYTTAYH--SSPDAQTSITEAIIHCRK  133
            M+ +I    S        +++  S+    SP +     Y+   S D+++SI EA++HC+K
Sbjct  179  MDSRIRVTTSC-------RSRVYSDEMTSSPRISVADDYYWRRSCDSESSIYEAVLHCKK  231

Query  132  SF  127
            SF
Sbjct  232  SF  233



>ref|XP_009602013.1| PREDICTED: probable membrane-associated kinase regulator 6 isoform 
X2 [Nicotiana tomentosiformis]
Length=216

 Score = 58.2 bits (139),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 60/242 (25%), Positives = 107/242 (44%), Gaps = 42/242 (17%)
 Frame = -1

Query  804  MEATHPLAIESFSYSWLLNARppsldslsdSESKHQDQDIAF-----SVVHSMRFSEADE  640
            ME +  L+IESFSYSWL++       S+  S+    D + AF     ++  S RF   + 
Sbjct  1    METSQSLSIESFSYSWLVDLGDSFRASMDASD----DYETAFIEMDPTLPPSKRFFNVN-  55

Query  639  AKNFRFDINASSESGLLVDADEIFSDGHMIPVYLHRPKP-----PVEQAVSAPATPANNF  475
             ++  FD   S     LV ADE+ S+G ++P+++ +P        V  + S P +P ++ 
Sbjct  56   PQDLNFDFPTSESPLTLVHADELISNGFLMPLFVKKPMKLESDYDVISSDSIPNSPTSSV  115

Query  474  WVS-VRGKKEPQDYISQKWKKLLGTRILGKWFGFCKRLGGSSRSRKNCAKVDDLN----R  310
              +     +     +S +  + L  R+L K+  F          R  C K+        R
Sbjct  116  TQNDSHSSRRVNRCVSLRRCRTLSRRVLLKYLDFL---------RPFCQKIRRCRLGRCR  166

Query  309  KAMEVQINCKASSSDSDDPRKTKSCSNTPQESPLHYTTAYHSSPDAQTSITEAIIHCRKS  130
               EV+             +   S + +P+ S  +    +  S D+++SI EA++HC+++
Sbjct  167  SGKEVK-------------KWEYSPATSPRTSVAYSVDNWRRSCDSESSIYEAVLHCKRT  213

Query  129  FG  124
             G
Sbjct  214  IG  215



>ref|XP_003613709.1| hypothetical protein MTR_5g039840 [Medicago truncatula]
 gb|AES96667.1| membrane-associated kinase regulator-like protein, putative [Medicago 
truncatula]
Length=222

 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 68/231 (29%), Positives = 100/231 (43%), Gaps = 33/231 (14%)
 Frame = -1

Query  804  MEATHPLAIESFSYSWLLNARppsldslsdSESKHQDQDIAFSVVHSMRFSEADEAKNFR  625
            ME + PLA +SFSYSWL N+           +  H+D   +F+  +    S ++  +NF 
Sbjct  1    METSLPLASDSFSYSWLSNS--NKSHVSYLDDEPHRD---SFNSFYGD--STSNNTQNFN  53

Query  624  FDINASSESGLLVDADEIFSDGHMIPVYLHRPKPPVEQAVSAPATPANNFWVSVRGKKEP  445
            FD + S  + +LV ADEIFSDG + P Y    K  +    S P     +   S R     
Sbjct  54   FD-SISQSNAVLVHADEIFSDGFLKPFYNDSSKVELFCNTSEPIQTMFDATFSSR-----  107

Query  444  QDYISQKWKKLLGTRILGKWFGFCKRLGGSSRSRKNCAKVDDLNRKAMEVQINCKASSSD  265
                         +R +    GF  RL  S+  R        LN    +++   +  S D
Sbjct  108  ----------TFSSRNMEIRHGFLTRLRKSTW-RTLVQFFRSLNTLRHKMERPSRKMSRD  156

Query  264  SD---DPRKTKSCSNTPQE-SPLHYTTAYHSSPDAQTSITEAIIHCRKSFG  124
            +D     R  KS S   Q+ SP+     +H   D Q  I EA++HC++S G
Sbjct  157  NDIYKTNRLVKSLSRGSQKSSPI---GNFHLDHDDQ--IFEAVLHCKRSIG  202



>ref|XP_009602012.1| PREDICTED: probable membrane-associated kinase regulator 6 isoform 
X1 [Nicotiana tomentosiformis]
Length=219

 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 60/242 (25%), Positives = 107/242 (44%), Gaps = 42/242 (17%)
 Frame = -1

Query  804  MEATHPLAIESFSYSWLLNARppsldslsdSESKHQDQDIAF-----SVVHSMRFSEADE  640
            ME +  L+IESFSYSWL++       S+  S+    D + AF     ++  S RF   + 
Sbjct  1    METSQSLSIESFSYSWLVDLGDSFRASMDASD----DYETAFIEMDPTLPPSKRFFNVN-  55

Query  639  AKNFRFDINASSESGLLVDADEIFSDGHMIPVYLHRPKP-----PVEQAVSAPATPANNF  475
             ++  FD   S     LV ADE+ S+G ++P+++ +P        V  + S P +P ++ 
Sbjct  56   PQDLNFDFPTSESPLTLVHADELISNGFLMPLFVKKPMKLESDYDVISSDSIPNSPTSSV  115

Query  474  WVS-VRGKKEPQDYISQKWKKLLGTRILGKWFGFCKRLGGSSRSRKNCAKVDDLN----R  310
              +     +     +S +  + L  R+L K+  F          R  C K+        R
Sbjct  116  TQNDSHSSRRVNRCVSLRRCRTLSRRVLLKYLDFL---------RPFCQKIRRCRLGRCR  166

Query  309  KAMEVQINCKASSSDSDDPRKTKSCSNTPQESPLHYTTAYHSSPDAQTSITEAIIHCRKS  130
               EV+             +   S + +P+ S  +    +  S D+++SI EA++HC+++
Sbjct  167  SGKEVK-------------KWEYSPATSPRTSVAYSVDNWRRSCDSESSIYEAVLHCKRT  213

Query  129  FG  124
             G
Sbjct  214  IG  215



>gb|AFK36494.1| unknown [Lotus japonicus]
Length=219

 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 64/232 (28%), Positives = 104/232 (45%), Gaps = 24/232 (10%)
 Frame = -1

Query  804  MEATHPLAIESFSYSWLLNARppsldslsdSESKHQDQDIAFSVVH------SMRFSEAD  643
            ME + PL+IESFSYSWL+N +P      S   +     D A  +        S RF +  
Sbjct  1    METSQPLSIESFSYSWLVNLKPTLESLDSSLRTSLDAYDEASFIQMDPRMPPSKRFFKNS  60

Query  642  EAKNFRFDINASSESGLLVDADEIFSDGHMIPVYLHRPKPPVEQAVSAPATPANNFWVSV  463
            +   F F I+ S  S  LV ADE+FS+G++  ++    K    +   + +  + +  +  
Sbjct  61   QDCKFDFPISQSPLS--LVHADELFSNGYLTTLFDESLKMEEFETSDSSSHASQSTVLPA  118

Query  462  RGKKEPQDYISQKWKKLLGTRILGKWFGFCKRLGGSSRSRKNCAKVDDLNRKAMEVQINC  283
               + P    S K  + L   +  K+  F K L    R  K+ +K  +   K  E   N 
Sbjct  119  GHSRCP----SLKRCRTLSRTVYHKYLNFLKSLSRRLRGHKSGSKKTETVAKRGEAVRNR  174

Query  282  KASSSDSDDPRKTKSCSNTPQESPLHYTTAYHSSPDAQTSITEAIIHCRKSF  127
            +  S  S  PR +++ S             +  S D+++SI EA++HC++SF
Sbjct  175  RYYSETS--PRISEAFS----------ADNWRKSCDSESSIYEAVLHCKRSF  214



>ref|XP_004308032.1| PREDICTED: probable membrane-associated kinase regulator 6-like 
[Fragaria vesca subsp. vesca]
Length=238

 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 77/253 (30%), Positives = 119/253 (47%), Gaps = 44/253 (17%)
 Frame = -1

Query  804  MEATH-PLAIESFSYSWLLNARppsldslsdSESKHQDQDIAFSVVH-------SMRFSE  649
            ME +  PL+IESFSYSWL+N +PPS +SL +S     D     S +        S RF  
Sbjct  1    METSQQPLSIESFSYSWLVNLKPPSFESLDNSLRTSLDASDEASFIEMDPTMPPSQRFFR  60

Query  648  ADEAKNFRFDINASSESGL--LVDADEIFSDGHMIPVYLHRPKPPVEQAVS----APATP  487
              + ++F+FD   SS+S L  LV ADE+ S+G+++P+ +  P   +E        A  + 
Sbjct  61   ISQ-QDFKFD---SSQSPLSSLVHADELISNGYLLPLSVDDPLKNMESYDDYYDQASDSS  116

Query  486  ANNFWVSVRGKKEPQDYI-------SQKWKKLLGTRILGKWFGFC----KRLGGSSRSRK  340
              N  VS   +  P D         S +  + L  RI  K+  F     KR+ G  ++  
Sbjct  117  TANLPVSSSKEASPTDKSTDADCSNSMRRCRRLSKRIFEKYLDFLKPLYKRIRGGHKANP  176

Query  339  NCA--KVDDLNRKAMEVQINCKASSSDSDDPRKTKSCSNTPQESPLHYTTAYHSSPDAQT  166
              A   VD    K      N +  SS++  PR + + S  P +        +  S D+++
Sbjct  177  KAAGNHVD----KRFHSAKNSRVYSSETASPRISVAYS-APDD--------WRRSCDSES  223

Query  165  SITEAIIHCRKSF  127
            SI EA++HC++S 
Sbjct  224  SIYEAVLHCKRSI  236



>ref|XP_010537127.1| PREDICTED: probable membrane-associated kinase regulator 6 isoform 
X2 [Tarenaya hassleriana]
Length=227

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 64/236 (27%), Positives = 109/236 (46%), Gaps = 28/236 (12%)
 Frame = -1

Query  798  ATHPLAIESFSYSWLLNARppsldslsdSESKHQDQD------IAFSVVHSMRFSEADEA  637
            A  PL IESFS SWL+N         S   S     D      +   +  S RF  + + 
Sbjct  8    ACKPLPIESFSCSWLVNFPSLENIGNSTRTSVDTYDDSCSYIEMDPRLPPSRRFFVSPKD  67

Query  636  KNFRFDINASSESGLLVDADEIFSDGHMIPVYLHRPKPPVEQAVSAPATPANNFWVSVRG  457
            ++F+FD  ++SES  L  ADE+F DG+++P+  +  +    Q + +P+        +VR 
Sbjct  68   RSFKFDNFSNSES--LAHADELFCDGYVMPLSTNSAE--ESQPLDSPSERPETMMRTVRL  123

Query  456  KKEPQDYISQKWKKLLGTRILGKWFGF----CKRLGGSSRSRKNCAKVDDLNRKAMEVQI  289
             K      S++++ +    +L K+  F    C+R+     SR N +   +  +   + +I
Sbjct  124  TKSKSSSCSRRFRSVSKC-VLLKYIDFLTPLCRRIRNCKASRPNGS---NGTKDGYDSRI  179

Query  288  NCKASSSDSDDPRKTKSCSNTPQESP-LHYTTAYHSSPDAQTSITEAIIHCRKSFG  124
                +   SD+         T   SP +     +  S D+++SI EA++HC+KSFG
Sbjct  180  RVTRNRVYSDE---------TTTASPRMSVAEDWRRSCDSESSIYEAVLHCKKSFG  226



>ref|XP_006491204.1| PREDICTED: probable membrane-associated kinase regulator 6-like 
isoform X2 [Citrus sinensis]
Length=159

 Score = 55.8 bits (133),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 35/89 (39%), Positives = 46/89 (52%), Gaps = 9/89 (10%)
 Frame = -1

Query  804  MEATHPLAIESFSYSWLLNARppsldslsdSESKHQDQDIAFSVVHSMRFSEADEAKNFR  625
            ME + PLAIESFSYSWL N                 D+ +  S+  S      + A+NF 
Sbjct  1    METSSPLAIESFSYSWLSNVETLLDGI---------DEPLRTSLDSSSEAISKELAENFN  51

Query  624  FDINASSESGLLVDADEIFSDGHMIPVYL  538
            FDI  S  S  L+ ADE+FSDG + P ++
Sbjct  52   FDIPTSQSSAALLHADELFSDGLIKPEFV  80



>ref|XP_010055073.1| PREDICTED: probable membrane-associated kinase regulator 6 [Eucalyptus 
grandis]
Length=153

 Score = 55.5 bits (132),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 33/88 (38%), Positives = 51/88 (58%), Gaps = 11/88 (13%)
 Frame = -1

Query  804  MEATHPLAIESFSYSWLLNARppsldslsdSESKHQDQDIAFSVVHSMRFSEADEAKNFR  625
            ME+T PLAI+SFSYSWL N R               D+ +  S V S  ++E  ++++F 
Sbjct  1    MESTKPLAIDSFSYSWLSNVRTSFDGL---------DESLRPSSVDSESYTE--KSQSFN  49

Query  624  FDINASSESGLLVDADEIFSDGHMIPVY  541
            F+++ S  S  L+ ADE+F+DG + P +
Sbjct  50   FNVSLSQLSPTLLHADELFADGIVKPFF  77



>gb|KHN17391.1| Putative membrane-associated kinase regulator 6 [Glycine soja]
Length=211

 Score = 56.2 bits (134),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 64/235 (27%), Positives = 106/235 (45%), Gaps = 35/235 (15%)
 Frame = -1

Query  804  MEATHPLAIESFSYSWLLNARppsldsls-dSESKHQDQDIAFSVVHSMRFSEADEAKNF  628
            ME + PLA +SFSYSWL N +P + D      ES +       S   +  +   +E +NF
Sbjct  1    METSPPLATDSFSYSWLPNCKPLANDLKEPLRESTYN------SCEGTTNYPLMEEWQNF  54

Query  627  RFDINASSESGLLVDADEIFSDGHMIPVY-----LHRPKPPVEQAVSAPATPANNFWVSV  463
             FDI+ +    +L  ADE+FS+G + P++     L           S P +  ++  VS 
Sbjct  55   NFDISITQSPAVLSHADELFSNGLIKPLFAGPSTLESCDTTRNSTQSKPISSFSSRIVSP  114

Query  462  RGKKEPQDYISQKWKKLL--GTRILGKWFG-FCKRLGGSSRSRKNCAKVDDLNRKAMEVQ  292
            R  +    +++ KWK       R L ++    C+++G S +S     KVDD++++   V 
Sbjct  115  RTVQIHHGFLT-KWKTSTCRTLRNLSRYVNQLCQKVGSSRKS----TKVDDIDKEEWLVN  169

Query  291  INCKASSSDSDDPRKTKSCSNTPQESPLHYTTAYHSSPDAQTSITEAIIHCRKSF  127
             +  +S   S            P  + L          D + SI EA++HC++S 
Sbjct  170  SSWSSSQQPSPKSNTVN-----PVGALL----------DHENSIYEAVLHCKRSI  209



>ref|XP_010555704.1| PREDICTED: probable membrane-associated kinase regulator 6 [Tarenaya 
hassleriana]
Length=225

 Score = 56.6 bits (135),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 68/243 (28%), Positives = 108/243 (44%), Gaps = 42/243 (17%)
 Frame = -1

Query  801  EATHPLAIESFSYSWLLNARppsldslsdSES-KHQDQDIAF-----SVVHSMRFSEADE  640
            +A +PL IESFSY WL+N         S   S    D   +F      +  S RF  + +
Sbjct  7    QACNPLPIESFSYGWLVNFPSLENIENSTRTSVDTYDDSSSFIEMDPRLPPSRRFFISPK  66

Query  639  AKNFRFDINASSESGLLVDADEIFSDGHMIPVYLH---RPKPPVEQAVSAPATPANNFWV  469
             ++F+FD  + SES  L  ADE+F DG+++P++ +     +P    +V      A     
Sbjct  67   DRSFKFDSFSKSES--LAHADELFYDGYVMPLFANSAEESQPLDSSSVRPEKMRAVGLTK  124

Query  468  SVRGKKEPQDYISQKWKKLLGTRILGKWFGFC----KRLGGSSRSRK---NCAKVDDLNR  310
            S       +   + KW       +L K+  F     +R+ GS  SR    N AK  + +R
Sbjct  125  SKSSSCSRRFQRASKW-------VLLKYIDFLTPLYRRIRGSKASRSSGSNGAKSGNESR  177

Query  309  -KAMEVQINCKASSSDSDDPRKTKSCSNTPQESPLHYTTAYHSSPDAQTSITEAIIHCRK  133
             +A   Q+    ++S    PR             +     +  S D+++SI EA++HC+K
Sbjct  178  IRATRKQVYSHETTSS---PR-------------VSVADDWRRSCDSESSIYEAVLHCKK  221

Query  132  SFG  124
            SFG
Sbjct  222  SFG  224



>ref|XP_002865938.1| hypothetical protein ARALYDRAFT_495355 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH42197.1| hypothetical protein ARALYDRAFT_495355 [Arabidopsis lyrata subsp. 
lyrata]
Length=235

 Score = 56.2 bits (134),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 67/245 (27%), Positives = 110/245 (45%), Gaps = 37/245 (15%)
 Frame = -1

Query  801  EATHPLA-IESFSYSWLLNARppsldslsdSESKHQDQDIAFSVVH-------SMRF-SE  649
            EA+ PL  I+SFSYSWL+N       S    ++ ++D   + S +        S RF  +
Sbjct  7    EASMPLVPIDSFSYSWLVNFPSLEASSDDHHQT-YEDSSSSSSFIEMDPRLPPSRRFFIK  65

Query  648  ADEAKNFRFD--INASSESGLLVDADEIFSDGHMIPVYLHRPKPPVEQAVSAPATPANNF  475
                 +F+FD  ++ S E   LV ADE+F DG+++P  L       E+      T     
Sbjct  66   TSHETSFKFDNFVSFSDEDHSLVHADELFRDGYVMPYRLKATSAATEEESEPLDTTTTTG  125

Query  474  WV-SVRGKKEPQDYISQKWKKLLGTRILGKWFGF----CKRLGGSSRSRKNCAKVDDLNR  310
             +  V+ K  P    S+K +++    +L K+  F    CKRL       + C        
Sbjct  126  KIDGVKSKSSPTS--SRKLRRV-SKWVLLKYLDFLTPLCKRL-------RRCRSAGPTRS  175

Query  309  KAMEVQINCKASSSDSDDPRKTKSCSNTPQESP-LHYTTAYH--SSPDAQTSITEAIIHC  139
              M+ +I    S        +++  S+    SP +     Y+   S D+++SI EA++HC
Sbjct  176  IGMDSRIRVTTSC-------RSRVYSDEMTSSPRISVADDYYWRRSCDSESSIYEAVLHC  228

Query  138  RKSFG  124
            ++SFG
Sbjct  229  KQSFG  233



>ref|XP_004134316.1| PREDICTED: probable membrane-associated kinase regulator 6-like 
[Cucumis sativus]
Length=211

 Score = 55.5 bits (132),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 68/235 (29%), Positives = 99/235 (42%), Gaps = 37/235 (16%)
 Frame = -1

Query  816  CIFAMEATHPLAIESFSYSWLLNARppsldslsdSESKHQDQDIAFSVVHSMRFSEADEA  637
            C   M+   PLA+ESFS SWLLN +     +     SK  D    + +V   R    DE 
Sbjct  3    CKGLMDDPRPLAVESFSTSWLLNVKQSYDAT-----SKVMD----YKIVKPSRL--LDET  51

Query  636  KNFRFDINASSESGLLVDADEIFSDGHMIPVYLHRPKPPVEQAVSAPATPANNFWVSVRG  457
            ++F+F+ +    S LL  ADE+F DG + PV ++        +   P    ++       
Sbjct  52   QSFKFNTSI-HPSVLLSHADELFFDGSVRPVNINHITGASNTSDFVPVELNSSLSSLTSS  110

Query  456  KKEPQDYISQKWKKLLGTRILGKWFGFCKRLGGSSRSRKNCAKVDDLNRKAMEVQINCKA  277
                    S +W+K L   +L K  G    +         C KVD       EV ++   
Sbjct  111  PAIENRCHSGRWRKTLC--MLQKSLGCLSPI---------CHKVD-----PAEVNLDDDI  154

Query  276  SSSDSDDPRKTKSCSNTPQESPLHYTTAYHSSPD---AQTSITEAIIHCRKSFGL  121
                SD     +S   +P+ SP   +    SS D    + SI EAI+HC+KS GL
Sbjct  155  KQKSSD----VRSQRQSPRVSP--QSNIGPSSGDWCHLENSIYEAILHCKKSIGL  203



>ref|XP_010445387.1| PREDICTED: probable membrane-associated kinase regulator 6 [Camelina 
sativa]
Length=236

 Score = 55.8 bits (133),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 68/246 (28%), Positives = 110/246 (45%), Gaps = 39/246 (16%)
 Frame = -1

Query  801  EATHPLA-IESFSYSWLLNARppsldslsdSESKHQDQDIAFSVVH-------SMRF-SE  649
            EA+ PL  I+SFSYSWL+N            ++ ++D   + S +        S RF  +
Sbjct  7    EASMPLVPIDSFSYSWLVNYPSLEPSIDDHHQT-YEDSSSSSSFIEMDPRLPPSRRFFIK  65

Query  648  ADEAKNFRFD--INASSESGLLVDADEIFSDGHMIPVYLHRPKPPVEQAVSAP---ATPA  484
                 +F+FD  ++ S E   LV ADE+F DG+++P Y  +    V +  S P    T  
Sbjct  66   TSHESSFKFDNFVSFSDEDHSLVHADELFRDGYVVP-YRLKATSVVTEEESEPLDTTTTG  124

Query  483  NNFWVSVRGKKEPQDYISQKWKKLLGTRILGKWFGF----CKRLGGSSRSRKNCAKVDDL  316
                + V+ K  P    S +  + +   +L K+  F    C+RL       K C      
Sbjct  125  KIETLGVKSKSSPT--TSCRKLRRVSKWVLLKYLDFLTPLCRRL-------KRCRSAGIT  175

Query  315  NRKAMEVQINCKASSSDSDDPRKTKSCSNTPQESP-LHYTTAYH--SSPDAQTSITEAII  145
                M+ +I    SS       +++  S+    SP +     Y+   S D+++SI EA++
Sbjct  176  GGIGMDSRIRVTTSS-------RSRVYSDETTSSPRISVADDYYWRRSCDSESSIYEAVL  228

Query  144  HCRKSF  127
            HC+KSF
Sbjct  229  HCKKSF  234



>emb|CDY50490.1| BnaA10g06310D [Brassica napus]
Length=231

 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 61/240 (25%), Positives = 104/240 (43%), Gaps = 29/240 (12%)
 Frame = -1

Query  801  EATHPLA-IESFSYSWLLNARppsldslsdSESKHQDQDIAF-----SVVHSMRF--SEA  646
            EA+  L  ++SFSYSWL+N            ++       +F      +  S RF  ++A
Sbjct  7    EASMALVPVDSFSYSWLVNFPSLEASIDDYHQTYEDSSSSSFIEMDPRLPPSRRFFINKA  66

Query  645  DEAKNFRFD--INASSESGLLVDADEIFSDGHMIPVYLHRPKPPVEQAVSAPATPANNFW  472
             E+ +F+FD  ++ S +   LV ADE+  DG+++P Y+ +      +    P        
Sbjct  67   HES-SFKFDNFVSFSDQDHSLVHADELIRDGYVVP-YISKATSAATEEEYKPLDTKKEKK  124

Query  471  VSVRGKKEPQDYISQKWKKLLGTRILGKWFGFCKRLGGSSRSRKNCAKVDDLNRKAMEVQ  292
            +  R  K    YI  K  K +  + L      CKRL       + C           + +
Sbjct  125  IETRDIKNKSPYIKLKVSKWVLFKYLDFLTPLCKRL-------RRCRSARSPGGIGSDTR  177

Query  291  INCKASSSDSDDPRKTKSCSNTPQESP-LHYTTAYH--SSPDAQTSITEAIIHCRKSFGL  121
            I  +  S       +++  S+    SP +     Y+   S D+++SI EA++HC+KSFG+
Sbjct  178  IRVRTLS-------RSRVYSDETTSSPRISVADDYYWRRSCDSESSIYEAVLHCKKSFGM  230



>ref|XP_010482671.1| PREDICTED: probable membrane-associated kinase regulator 6 [Camelina 
sativa]
Length=236

 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 64/241 (27%), Positives = 103/241 (43%), Gaps = 29/241 (12%)
 Frame = -1

Query  801  EATHPLA-IESFSYSWLLNARppsldslsdSESKHQDQDIAFSVVH-------SMRF-SE  649
            EA+ PL  I+SFSYSWL+N            ++ ++D   + S +        S RF  +
Sbjct  7    EASMPLVPIDSFSYSWLVNYPSLEPSIDDHHQT-YEDSSSSSSFIEMDPRLPPSRRFFIK  65

Query  648  ADEAKNFRFD--INASSESGLLVDADEIFSDGHMIPVYLHRPKPPVEQAVSAPATPANNF  475
                 +F+FD  ++ S E   LV ADE+F DG+++P  L       E+    P       
Sbjct  66   TSHESSFKFDNFVSFSDEDHSLVHADELFRDGYVVPYRLKATSVVTEEEF-EPLDTTTTG  124

Query  474  WVSVRG-KKEPQDYISQKWKKLLGTRILGKWFGF----CKRLGGSSRSRKNCAKVDDLNR  310
             +  RG K +     S +  + +   +L K+  F    C+RL       K C        
Sbjct  125  KIETRGVKSKSSPTTSCRKLRSVSRWVLLKYLDFLTPLCRRL-------KRCRSAGITGG  177

Query  309  KAMEVQINCKASSSDSDDPRKTKSCSNTPQESPLHYTTAYHSSPDAQTSITEAIIHCRKS  130
              M+ +I    SS       +T S +        ++      S D+++SI EA++HC+KS
Sbjct  178  IGMDSRIRVTTSSRSKVYSDETTSSARISVADDYYW----RRSCDSESSIYEAVLHCKKS  233

Query  129  F  127
            F
Sbjct  234  F  234



>ref|XP_010537126.1| PREDICTED: probable membrane-associated kinase regulator 6 isoform 
X1 [Tarenaya hassleriana]
Length=228

 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 63/236 (27%), Positives = 108/236 (46%), Gaps = 28/236 (12%)
 Frame = -1

Query  798  ATHPLAIESFSYSWLLNARppsldslsdSESKHQDQD------IAFSVVHSMRFSEADEA  637
            A  PL IESFS SWL+N         S   S     D      +   +  S RF  + + 
Sbjct  8    ACKPLPIESFSCSWLVNFPSLENIGNSTRTSVDTYDDSCSYIEMDPRLPPSRRFFVSPKD  67

Query  636  KNFRFDINASSESGLLVDADEIFSDGHMIPVYLHRPKPPVEQAVSAPATPANNFWVSVRG  457
            ++F+FD  ++SES  L  ADE+F DG+++P+  +  +    Q + +P+        +VR 
Sbjct  68   RSFKFDNFSNSES--LAHADELFCDGYVMPLSTNSAE--ESQPLDSPSERPETMMRTVRL  123

Query  456  KKEPQDYISQKWKKLLGTRILGKWFGF----CKRLGGSSRSRKNCAKVDDLNRKAMEVQI  289
             K      S++++ +    +L K+  F    C+R+     SR N +   +  +   + +I
Sbjct  124  TKSKSSSCSRRFRSVSKC-VLLKYIDFLTPLCRRIRNCKASRPNGS---NGTKDGYDSRI  179

Query  288  NCKASSSDSDDPRKTKSCSNTPQESP-LHYTTAYHSSPDAQTSITEAIIHCRKSFG  124
                +   SD+         T   SP +     +  S D+++SI EA++HC+KSF 
Sbjct  180  RVTRNRVYSDE---------TTTASPRMSVAEDWRRSCDSESSIYEAVLHCKKSFA  226



>ref|XP_006422072.1| hypothetical protein CICLE_v10005884mg [Citrus clementina]
 gb|ESR35312.1| hypothetical protein CICLE_v10005884mg [Citrus clementina]
Length=210

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 47/183 (26%), Positives = 86/183 (47%), Gaps = 32/183 (17%)
 Frame = -1

Query  639  AKNFRFDINASSESGLLVDADEIFSDGHMIPVYLHRPKPPV----EQAVSAPATPANNFW  472
            +++F+FD   S     LV ADE+FS+G+++P+++ + K       + A+  P++   +  
Sbjct  48   SQDFKFDFPVSQSPLALVHADELFSNGYVMPLFVDQMKMEAFDAPDSALPLPSSLHGSKL  107

Query  471  VSVRGKKEPQDYISQKWKKLLGTRILGKWFGFCKRL-------GGSSRSRKNCAKVDDLN  313
            V V+G K+      ++ +K L  RI  K+  F + L         SSR+    ++V  +N
Sbjct  108  V-VQGSKQTNRTSLRRCRK-LSKRIFQKYLDFLRPLYQKIRGKRSSSRAEGGNSRVHVMN  165

Query  312  RKAMEVQINCKASSSDSDDPRKTKSCSNTPQESPLHYTTAYHSSPDAQTSITEAIIHCRK  133
                  + + + S + S D    KSC                   D+ +SI EA++HC++
Sbjct  166  SWVYSAETSPRTSVAYSVDDNWRKSC-------------------DSDSSIYEAVLHCKR  206

Query  132  SFG  124
            S G
Sbjct  207  SIG  209



>ref|XP_003532057.2| PREDICTED: probable membrane-associated kinase regulator 6-like 
[Glycine max]
Length=208

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 60/234 (26%), Positives = 111/234 (47%), Gaps = 38/234 (16%)
 Frame = -1

Query  804  MEATHPLAIESFSYSWLLNARppsldslsdSESKHQDQDIAFSVVH-SMRFSEADEAKNF  628
            ME + PLA +SFSYSWL N +P +       + K   ++  ++    ++ +   ++ +NF
Sbjct  1    METSLPLATDSFSYSWLPNYKPLAN------DLKEPLREPTYNFCDGTINYPFMEDWQNF  54

Query  627  RFDINASSESGLLVDADEIFSDGHMIPVYLHRPK-----PPVEQAVSAPATPANNFWVSV  463
             FDI+ +    +   ADE+FS+G + P+++   K        +   S P +  N   VS 
Sbjct  55   NFDISITQSPAVFSHADELFSNGLIKPLFVGPSKVEFCNTTTDSTQSKPVSSRN---VSP  111

Query  462  RGKKEPQDYISQKWKKLL--GTRILGKWFG-FCKRLGGSSRSRKNCAKVDDLNRKAMEVQ  292
            R  +    +++ KWK       R L ++    C+++G S +S     KVDD +++   V 
Sbjct  112  RTVQIHHGFLT-KWKTSTCRTLRSLSRYVNQLCQKVGSSRKS----TKVDDFDKEEWLV-  165

Query  291  INCKASSSDSDDPRKTKSCSNTPQESPLHYTTAYHSSPDAQTSITEAIIHCRKS  130
                  ++     ++    SNT     +++  A     D + SI EA++HC++S
Sbjct  166  ------NNSWSSSQQPSPKSNT-----VNHIGALL---DYENSIYEAVLHCKRS  205



>ref|XP_010092885.1| hypothetical protein L484_022480 [Morus notabilis]
 gb|EXB52703.1| hypothetical protein L484_022480 [Morus notabilis]
Length=255

 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 63/252 (25%), Positives = 110/252 (44%), Gaps = 73/252 (29%)
 Frame = -1

Query  804  MEAT-HPLAIESFSYSWLLNARppsldslsdSESKHQDQDIAFSVVHSMRFSEADEAKNF  628
            ME T  PLA+ESFS SWL N RP                         ++  +     +F
Sbjct  1    METTSRPLAVESFSDSWLSNTRPSL-----------------------IKVLDKSNTNSF  37

Query  627  RFDINASSESGL-LVDADEIFSDGHMIPVYLHRPKPPVEQAVSAPATPANNFWV-SVRGK  454
             FD + S +S +  V ADE+FSDG + PV++      V  + S+ +    +  + ++   
Sbjct  38   DFDTSISDKSPVNFVHADELFSDGLIKPVFVDPINGGVSSSTSSSSKSTTDSDIFALSSL  97

Query  453  KEPQDYISQKWKKL-------------LGTRILGKWFGFCKR------LGGSSRSRKNCA  331
             +P+  ++ +  ++             L  ++L K FG+  R      +GGS +S     
Sbjct  98   SDPRTSVTDQDVQMGCSCCFFRRRRRLLSEQVLRKIFGYLIRTRRAKVVGGSKKS----T  153

Query  330  KVDDLNRKAMEVQINCKASSSDSDDPRKTKSCSNTPQESPLHYTTAYHSSPDAQTSITEA  151
            KVDD++R+ +EV               K+ S  ++P  S ++         D ++SI EA
Sbjct  154  KVDDIDRRTLEV---------------KSWSSCSSPGPSTVY---------DIESSIYEA  189

Query  150  IIHCRKSFGLQA  115
            ++HC++S  +  
Sbjct  190  VLHCKRSIEISV  201



>gb|KGN56472.1| hypothetical protein Csa_3G120510 [Cucumis sativus]
Length=209

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 67/234 (29%), Positives = 98/234 (42%), Gaps = 37/234 (16%)
 Frame = -1

Query  816  CIFAMEATHPLAIESFSYSWLLNARppsldslsdSESKHQDQDIAFSVVHSMRFSEADEA  637
            C   M+   PLA+ESFS SWLLN +     +     SK  D    + +V   R    DE 
Sbjct  3    CKGLMDDPRPLAVESFSTSWLLNVKQSYDAT-----SKVMD----YKIVKPSRL--LDET  51

Query  636  KNFRFDINASSESGLLVDADEIFSDGHMIPVYLHRPKPPVEQAVSAPATPANNFWVSVRG  457
            ++F+F+ +    S LL  ADE+F DG + PV ++        +   P    ++       
Sbjct  52   QSFKFNTSI-HPSVLLSHADELFFDGSVRPVNINHITGASNTSDFVPVELNSSLSSLTSS  110

Query  456  KKEPQDYISQKWKKLLGTRILGKWFGFCKRLGGSSRSRKNCAKVDDLNRKAMEVQINCKA  277
                    S +W+K L   +L K  G    +         C KVD       EV ++   
Sbjct  111  PAIENRCHSGRWRKTLC--MLQKSLGCLSPI---------CHKVD-----PAEVNLDDDI  154

Query  276  SSSDSDDPRKTKSCSNTPQESPLHYTTAYHSSPD---AQTSITEAIIHCRKSFG  124
                SD     +S   +P+ SP   +    SS D    + SI EAI+HC+KS G
Sbjct  155  KQKSSD----VRSQRQSPRVSP--QSNIGPSSGDWCHLENSIYEAILHCKKSIG  202



>gb|KHN06845.1| Putative membrane-associated kinase regulator 6 [Glycine soja]
Length=208

 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 58/234 (25%), Positives = 104/234 (44%), Gaps = 38/234 (16%)
 Frame = -1

Query  804  MEATHPLAIESFSYSWLLNARppsldslsdSESKHQDQDIAFSVVH-SMRFSEADEAKNF  628
            ME + PLA +SFSYSWL N +P +       + K   ++  ++    ++ +   ++ +NF
Sbjct  1    METSLPLATDSFSYSWLPNYKPLAN------DLKEPLREPTYNFCDGTINYPFMEDWQNF  54

Query  627  RFDINASSESGLLVDADEIFSDGHMIPVYLHRPK-----PPVEQAVSAPATPANNFWVSV  463
             FDI+ +    +   ADE+FS+G + P+++   K        +   S P +  N   VS 
Sbjct  55   NFDISITQSPAVFSHADELFSNGLIKPLFVGPSKVEFCNTTTDSTQSKPVSSRN---VSP  111

Query  462  RGKKEPQDYISQKWKKLL--GTRILGKWFG-FCKRLGGSSRSRKNCAKVDDLNRKAMEVQ  292
            R  +    +++ KWK       R L ++    C+++G S +S     KVDD +++   V 
Sbjct  112  RTVQIHHGFLT-KWKTSTCRTLRSLSRYVNQLCQKVGSSRKS----TKVDDFDKEEWLVN  166

Query  291  INCKASSSDSDDPRKTKSCSNTPQESPLHYTTAYHSSPDAQTSITEAIIHCRKS  130
                +S   S                         +  D + SI EA++HC++S
Sbjct  167  NTWSSSQQPSPKSNTVNHIG---------------ALLDYENSIYEAVLHCKRS  205



>gb|KCW71550.1| hypothetical protein EUGRSUZ_E00092 [Eucalyptus grandis]
Length=194

 Score = 53.5 bits (127),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 48/82 (59%), Gaps = 11/82 (13%)
 Frame = -1

Query  804  MEATHPLAIESFSYSWLLNARppsldslsdSESKHQDQDIAFSVVHSMRFSEADEAKNFR  625
            ME+T PLAI+SFSYSWL N R               D+ +  S V S  ++E  ++++F 
Sbjct  1    MESTKPLAIDSFSYSWLSNVRTSFDGL---------DESLRPSSVDSESYTE--KSQSFN  49

Query  624  FDINASSESGLLVDADEIFSDG  559
            F+++ S  S  L+ ADE+F+DG
Sbjct  50   FNVSLSQLSPTLLHADELFADG  71



>emb|CDY38718.1| BnaC03g15310D [Brassica napus]
Length=240

 Score = 53.9 bits (128),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 65/243 (27%), Positives = 103/243 (42%), Gaps = 48/243 (20%)
 Frame = -1

Query  786  LAIESFSYSWLLNARppsldslsdSESKHQDQDIAFSVVH-----SMRF--SEADEAKNF  628
            + IESFSYSWL+N            ++       +F  +      S RF  ++A E+ +F
Sbjct  13   VPIESFSYSWLVNFPSLEASIDDYHQTYEDSSSSSFIEMDPRLPPSRRFFINKAHES-SF  71

Query  627  RFD--INASSESGLLVDADEIFSDGHMIPVYLHRPKPPVEQAVSAPATPANNFWVSVRGK  454
            +FD  ++ + +   LV ADEIF DG+++P YL +      +    P           + K
Sbjct  72   KFDTYVSFADDDHSLVHADEIFRDGYVMP-YLSKATSVTTEKDYEPLDTKTE-----KKK  125

Query  453  KEPQDYISQ-------KWKKLLGTRILGKWFGFCKRL-----GGSSRSRKNCAKVDDLNR  310
             E +D  S+       +  K +  R L      CKRL      GSS      A++  L+R
Sbjct  126  METRDIQSKSPCRKLRRVSKCVLLRYLDFLTPLCKRLRRCRSAGSSGGTGFDARITTLSR  185

Query  309  -KAMEVQINCKASSSDSDDPRKTKSCSNTPQESPLHYTTAYHSSPDAQTSITEAIIHCRK  133
             +    +       S +DD    +SC                   D+++SI EA++HC+K
Sbjct  186  SRVYSEETTSSPRVSVADDCYWRRSC-------------------DSESSIYEAVLHCKK  226

Query  132  SFG  124
            SFG
Sbjct  227  SFG  229



>emb|CDY19642.1| BnaC09g28980D [Brassica napus]
Length=231

 Score = 53.1 bits (126),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 59/240 (25%), Positives = 105/240 (44%), Gaps = 29/240 (12%)
 Frame = -1

Query  801  EATHPLA-IESFSYSWLLNARppsldslsdSESKHQDQDIAF-----SVVHSMRF--SEA  646
            EA+  L  ++SFSYSWL+N     +      ++       +F      +  S RF  ++A
Sbjct  7    EASMALVPVDSFSYSWLVNFPSLEVSIDDYHQTYEDSSSSSFIEMDPRLPPSRRFFINKA  66

Query  645  DEAKNFRFD--INASSESGLLVDADEIFSDGHMIPVYLHRPKPPVEQAVSAPATPANNFW  472
             E+ +F+FD  ++ S +   LV ADE+  DG+++P Y+ +      +    P        
Sbjct  67   HES-SFKFDNFVSFSDQDHSLVHADELIRDGYVVP-YISKATSAATEEEYTPLDTKKEKK  124

Query  471  VSVRGKKEPQDYISQKWKKLLGTRILGKWFGFCKRLGGSSRSRKNCAKVDDLNRKAMEVQ  292
            +  R  K    Y   +  K +  + L      CKRL       + C           + +
Sbjct  125  IETRDIKNKSPYRKLRVSKWVLFKYLDFLTPLCKRL-------RRCRSARSPGGIGSDTR  177

Query  291  INCKASSSDSDDPRKTKSCSNTPQESP-LHYTTAYH--SSPDAQTSITEAIIHCRKSFGL  121
            I  +  S       +++  S+    SP + +   Y+   S D+++SI EA++HC+KSFG+
Sbjct  178  IRVRTLS-------RSRVYSDETTSSPRISFADDYYWRRSCDSESSIYEAVLHCKKSFGI  230



>gb|KEH25756.1| membrane-associated kinase regulator-like protein, putative [Medicago 
truncatula]
Length=209

 Score = 52.8 bits (125),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 59/234 (25%), Positives = 104/234 (44%), Gaps = 39/234 (17%)
 Frame = -1

Query  804  MEATHPLAIESFSYSWLLNARppsldslsdSESKHQ----DQDIAFSVVH-----SMRFS  652
            ME +HP++IESFS SWL+N +P SL    D   +      D+  +F  ++     S RF 
Sbjct  1    METSHPISIESFSNSWLVNPKPNSLVESLDDSFRTSLDAYDEASSFIEMNPKMPPSKRF-  59

Query  651  EADEAKNFRFDINASSESGLLVDADEIFSDGHMIPVYLHRPKPPVEQAVSAPATPANNFW  472
                +++F+F    S  S  LVDAD++FS+                  +     P  N  
Sbjct  60   -FINSQDFKFHFPTSHSSLNLVDADQLFSNDSNSTSASS-----SSSHIPQKVVPLENSG  113

Query  471  VSVRGKKEPQDYISQKWKKLLGTRILGKWFGFCKRLGGSSRSRKNCAKVDDLNRKAMEVQ  292
            +++            K  + L  R+  K+F F + LG   R  K+  + +++ ++   V+
Sbjct  114  ITI-----------MKMCRTLSRRMFQKYFNFFRHLGSKLRGHKSGPRHENVGKRTQSVK  162

Query  291  INCKASSSDSDDPRKTKSCSNTPQESPLHYTTAYHSSPDAQTSITEAIIHCRKS  130
             N K +  +S           +P+ S  +    +  S D++ SI  A++HC++S
Sbjct  163  -NKKGNYRES-----------SPRISVSYSKEDWRVSCDSEISIYNAVLHCKRS  204



>gb|KFK26890.1| hypothetical protein AALP_AA8G306900 [Arabis alpina]
Length=231

 Score = 52.8 bits (125),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 68/247 (28%), Positives = 111/247 (45%), Gaps = 46/247 (19%)
 Frame = -1

Query  801  EATHPLA-IESFSYSWLLNARppsldslsdSESKHQDQDIAF-----SVVHSMRF--SEA  646
            EA+ PL  I+SFSYSWL+N            ++ ++D   +F      +  S RF  ++A
Sbjct  7    EASMPLVPIDSFSYSWLVNFPSLEASIDDHYQT-YEDSSSSFIEMDPRLPPSRRFFINKA  65

Query  645  DEAKNFRFD--INASSESGLLVDADEIFSDGHMIPVYLHRPKPPVEQAVSAPATPANNFW  472
             E+ +F+FD  ++ S E   LV ADE+F DG+++P   +R K     A SA AT  +   
Sbjct  66   HES-SFKFDNLVSFSDEDHSLVHADELFRDGYVVP---YRSK-----ATSAEATEEDEQS  116

Query  471  VSVRGKKEPQDYISQKWKKLLGTRILGKWF---------GFCKRLGGSSRSRKNCAKVDD  319
              ++ +       S         R + KW            C+RL       + C+    
Sbjct  117  EPMKIETHGLKSKSSSSSSCRKLRRVSKWVLLKYLDFFTPLCRRL-------RRCSSAGS  169

Query  318  LNRKAMEVQINCKASSSDSDDPRKTKSCSNTPQESP-LHYTTAYH--SSPDAQTSITEAI  148
                 M+ +I    SS       +++  S+    SP +     Y+   S D+++SI EA+
Sbjct  170  PGSIGMDTRIRVTTSS-------RSRVYSDETTLSPRISVADDYYWRRSCDSESSIYEAV  222

Query  147  IHCRKSF  127
            +HC+KSF
Sbjct  223  LHCKKSF  229



>ref|XP_009119831.1| PREDICTED: probable membrane-associated kinase regulator 6 [Brassica 
rapa]
Length=230

 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 57/232 (25%), Positives = 99/232 (43%), Gaps = 28/232 (12%)
 Frame = -1

Query  786  LAIESFSYSWLLNARppsldslsdSESKHQDQDIAF-----SVVHSMRF--SEADEAKNF  628
            + ++SFSYSWL+N            ++       +F      +  S RF  ++A E+ +F
Sbjct  13   VPVDSFSYSWLVNFPSLEASIDDYHQTYEDSSSSSFIEMDPRLPPSRRFFINKAHES-SF  71

Query  627  RFD--INASSESGLLVDADEIFSDGHMIPVYLHRPKPPVEQAVSAPATPANNFWVSVRGK  454
            +FD  ++ S +   LV ADE+  DG+++P Y+ +      +    P        +  R  
Sbjct  72   KFDNFVSFSDQDHSLVHADELIRDGYVVP-YISKATSAATEEEYKPLDTKKEKKIETRDI  130

Query  453  KEPQDYISQKWKKLLGTRILGKWFGFCKRLGGSSRSRKNCAKVDDLNRKAMEVQINCKAS  274
            K    YI  K  K +  + L      CKRL       + C           + +I  +  
Sbjct  131  KNKSPYIKLKVSKWVLFKYLDFLTPLCKRL-------RRCRSARSPGGIGSDTRIRVRTL  183

Query  273  SSDSDDPRKTKSCSNTPQESP-LHYTTAYH--SSPDAQTSITEAIIHCRKSF  127
            S       +++  S+    SP +     Y+   S D+++SI EA++HC+KSF
Sbjct  184  S-------RSRVYSDETTSSPRISVADDYYWRRSCDSESSIYEAVLHCKKSF  228



>ref|XP_008437977.1| PREDICTED: probable membrane-associated kinase regulator 6 [Cucumis 
melo]
Length=203

 Score = 50.4 bits (119),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 61/230 (27%), Positives = 96/230 (42%), Gaps = 37/230 (16%)
 Frame = -1

Query  804  MEATHPLAIESFSYSWLLNARppsldslsdSESKHQDQDIAFSVVHSMRFSEADEAKNFR  625
            M+   PLA+ESFS SWLLN +     +     SK  D    + +V   R    DE ++F+
Sbjct  1    MDDPRPLAVESFSTSWLLNVKQSYDAT-----SKVMD----YKIVKPSRL--LDETQSFK  49

Query  624  FDINASSESGLLVD-ADEIFSDGHMIPVYLHRPKPPVEQAVSAPATPANNFWVSVRGKKE  448
            F  N S    +LV  ADE+F DG + PVY+         +    A   ++          
Sbjct  50   F--NTSIHPSVLVSHADELFFDGSVRPVYISHTTGASNTSDFVSAELDSSLSSLTSSPAI  107

Query  447  PQDYISQKWKKLLGT--RILGKWFGFCKRLGGSSRSRKNCAKVDDLNRKAMEVQINCKAS  274
                 S KW+K L    + LG     C ++  +  +      VDD+ +K+ +++      
Sbjct  108  ENRCHSGKWRKTLCMLQKSLGCLSPICHKVDPAEVNW-----VDDIKQKSCDIR------  156

Query  273  SSDSDDPRKTKSCSNTPQESPLHYTTAYHSSPDAQTSITEAIIHCRKSFG  124
             +    PR +   +  P      +          + SI EAI+HC+KS G
Sbjct  157  -NQRQSPRVSPQSNIGPSSGDWCH---------LENSIYEAILHCKKSIG  196



>ref|XP_008802036.1| PREDICTED: probable membrane-associated kinase regulator 6 isoform 
X1 [Phoenix dactylifera]
Length=300

 Score = 50.8 bits (120),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 37/94 (39%), Positives = 52/94 (55%), Gaps = 8/94 (9%)
 Frame = -1

Query  792  HPLAIESFSYSWLLNARppsldslsdSESKHQDQDIAFSV-----VHSMRFSEADEAKNF  628
            H L+I+SFSYSWLLN                  QD    +     + SMR+ +AD + +F
Sbjct  19   HQLSIDSFSYSWLLNINSSFDSLDDGLRFSLDAQDAGSFIEMDPKLISMRW-KAD-SLDF  76

Query  627  RFDINASSESGLLVDADEIFSDGHMIPVYLHRPK  526
             F +  SS+S LLV AD+IFSDG ++P +L  P+
Sbjct  77   GFSL-PSSQSPLLVHADQIFSDGLLLPRHLITPR  109



>ref|XP_009599456.1| PREDICTED: probable membrane-associated kinase regulator 6 [Nicotiana 
tomentosiformis]
Length=212

 Score = 49.7 bits (117),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 53/189 (28%), Positives = 87/189 (46%), Gaps = 25/189 (13%)
 Frame = -1

Query  666  SMRFSEADEAKNFRFDINASSESGL-LVDADEIFSDGHMIPVYLHRPKPPVEQAVSAPAT  490
            S  FS  +      F+   S+ES L LV ADE+ S G ++P+ ++    P++        
Sbjct  32   SKSFSNVNPHDLMNFNFPTSAESPLTLVQADELISKGSLMPLLIN----PMKME------  81

Query  489  PANNFWVSVRGKKEPQDYISQKWKKLL--GTRILGKWFGFCKRLGGSSRSRKNCAKVDDL  316
             + N++ S    K PQ   S K K+ L   +R+L   F   +R GGS  SR    K+ D 
Sbjct  82   -STNYYPSSSVPKYPQ---SLKTKQELHSSSRVLCISF---RRCGGSLSSRNVMQKLFDF  134

Query  315  NR---KAMEVQINCKASSSDSDDPRKTKSCS--NTPQESPLHYTTAYHSSPDAQTSITEA  151
             +   + +     CK+  S S        CS   +P+ S       +  S D+++SI EA
Sbjct  135  LKPLCQKIRCDFGCKSGISTSTIEGVNIYCSQGTSPRTSLTCSVDDWRRSCDSESSIYEA  194

Query  150  IIHCRKSFG  124
            ++HC+++  
Sbjct  195  VLHCKRTIA  203



>ref|XP_008802037.1| PREDICTED: probable membrane-associated kinase regulator 6 isoform 
X2 [Phoenix dactylifera]
Length=290

 Score = 50.4 bits (119),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 35/94 (37%), Positives = 50/94 (53%), Gaps = 8/94 (9%)
 Frame = -1

Query  792  HPLAIESFSYSWLLNARppsldslsdSESKHQDQDIAFSV-----VHSMRFSEADEAKNF  628
            H L+I+SFSYSWLLN                  QD    +     + SMR+    ++ +F
Sbjct  19   HQLSIDSFSYSWLLNINSSFDSLDDGLRFSLDAQDAGSFIEMDPKLISMRWKA--DSLDF  76

Query  627  RFDINASSESGLLVDADEIFSDGHMIPVYLHRPK  526
             F +  SS+S LLV AD+IFSDG ++P +L  P+
Sbjct  77   GFSL-PSSQSPLLVHADQIFSDGLLLPRHLITPR  109



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1639611019956