BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c56086_g1_i1 len=125 path=[103:0-124]

Length=125
                                                                      Score     E

dbj|BAG64563.1|  unnamed protein product                              84.3    1e-18   Homo sapiens [man]
dbj|BAG64193.1|  unnamed protein product                              81.6    4e-17   Homo sapiens [man]



>dbj|BAG64563.1| unnamed protein product [Homo sapiens]
Length=216

 Score = 84.3 bits (207),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 39/40 (98%), Positives = 40/40 (100%), Gaps = 0/40 (0%)
 Frame = -2

Query  121  DEKEALGQNEESPKQGLITIWQLSDLSFCPKNAVANSLLS  2
            DEKEALGQNEESPKQGLITIWQLSDLSFCPKNA+ANSLLS
Sbjct  177  DEKEALGQNEESPKQGLITIWQLSDLSFCPKNALANSLLS  216



>dbj|BAG64193.1| unnamed protein product [Homo sapiens]
Length=370

 Score = 81.6 bits (200),  Expect = 4e-17, Method: Composition-based stats.
 Identities = 39/40 (98%), Positives = 40/40 (100%), Gaps = 0/40 (0%)
 Frame = -2

Query  121  DEKEALGQNEESPKQGLITIWQLSDLSFCPKNAVANSLLS  2
            DEKEALGQNEESPKQGLITIWQLSDLSFCPKNA+ANSLLS
Sbjct  331  DEKEALGQNEESPKQGLITIWQLSDLSFCPKNALANSLLS  370



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 516678285084