BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c55884_g1_i1 len=684 path=[1:0-683]

Length=684
                                                                      Score     E

ref|XP_011024217.1|  PREDICTED: uncharacterized protein LOC105125...    122   1e-30   
ref|XP_002312467.1|  hypothetical protein POPTR_0008s13480g             120   4e-30   Populus trichocarpa [western balsam poplar]
emb|CDP16252.1|  unnamed protein product                                120   6e-30   
ref|XP_010279634.1|  PREDICTED: uncharacterized protein LOC104613498    119   1e-29   
ref|XP_002285010.1|  PREDICTED: uncharacterized protein LOC100255936    117   5e-29   Vitis vinifera
ref|XP_008389168.1|  PREDICTED: uncharacterized protein LOC103451535    117   1e-28   
ref|XP_008366983.1|  PREDICTED: uncharacterized protein LOC103430615    116   2e-28   
gb|KEH40634.1|  hypothetical protein MTR_1g032560                       115   3e-28   
ref|XP_007045289.1|  Uncharacterized protein TCM_011065                 115   4e-28   
ref|XP_010066566.1|  PREDICTED: uncharacterized protein LOC104453654    115   5e-28   
ref|XP_006448150.1|  hypothetical protein CICLE_v10016899mg             114   1e-27   
ref|XP_006469255.1|  PREDICTED: uncharacterized protein LOC102631...    114   2e-27   
ref|XP_002533197.1|  conserved hypothetical protein                     113   2e-27   Ricinus communis
gb|KDP38122.1|  hypothetical protein JCGZ_04765                         113   3e-27   
ref|XP_010687806.1|  PREDICTED: uncharacterized protein LOC104901877    111   2e-26   
ref|XP_011024235.1|  PREDICTED: uncharacterized protein LOC105125...    110   3e-26   
ref|XP_010088185.1|  hypothetical protein L484_005529                   110   5e-26   
ref|XP_007226251.1|  hypothetical protein PRUPE_ppa018074mg             108   6e-26   
ref|XP_010916227.1|  PREDICTED: uncharacterized protein LOC105041114    109   7e-26   
ref|XP_004298502.1|  PREDICTED: uncharacterized protein LOC101303511    108   1e-25   
ref|XP_008220911.1|  PREDICTED: uncharacterized protein LOC103320950    108   2e-25   
ref|XP_003518617.2|  PREDICTED: uncharacterized protein LOC100810515    108   2e-25   
ref|XP_009791395.1|  PREDICTED: uncharacterized protein LOC104238666    108   3e-25   
ref|XP_009597994.1|  PREDICTED: uncharacterized protein LOC104093866    107   4e-25   
gb|KGN49598.1|  hypothetical protein Csa_5G021310                       105   2e-24   
ref|XP_004142303.1|  PREDICTED: uncharacterized protein LOC101213440    106   4e-24   
ref|XP_007153233.1|  hypothetical protein PHAVU_003G017900g             104   7e-24   
ref|XP_004498245.1|  PREDICTED: uncharacterized protein LOC101511657    104   7e-24   
ref|XP_006343250.1|  PREDICTED: uncharacterized protein LOC102605488    104   9e-24   
ref|XP_008452414.1|  PREDICTED: uncharacterized protein LOC103493452    103   2e-23   
ref|XP_008777817.1|  PREDICTED: uncharacterized protein LOC103697684    102   4e-23   
ref|XP_006395853.1|  hypothetical protein EUTSA_v10004999mg             101   1e-22   
ref|XP_009409098.1|  PREDICTED: uncharacterized protein LOC103991...    100   1e-22   
ref|XP_011070717.1|  PREDICTED: uncharacterized protein LOC105156318    100   2e-22   
ref|XP_003559532.1|  PREDICTED: uncharacterized protein LOC100838339    100   2e-22   
dbj|BAJ95446.1|  predicted protein                                    99.8    3e-22   
ref|XP_004234127.1|  PREDICTED: uncharacterized protein LOC101262182  99.8    5e-22   
gb|EMS48684.1|  hypothetical protein TRIUR3_05970                     99.8    8e-22   
ref|XP_006651746.1|  PREDICTED: uncharacterized protein LOC102714820  98.2    1e-21   
ref|NP_671765.2|  uncharacterized protein                             97.8    2e-21   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001051071.1|  Os03g0713200                                     97.4    2e-21   Oryza sativa Japonica Group [Japonica rice]
gb|EMT16671.1|  NADH-ubiquinone oxidoreductase 75 kDa subunit, mi...    102   3e-21   
ref|XP_009101313.1|  PREDICTED: uncharacterized protein LOC103827552  96.3    6e-21   
emb|CDY36258.1|  BnaC07g21120D                                        96.3    6e-21   
gb|AAS49092.1|  At2g01755                                             95.9    6e-21   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002876776.1|  hypothetical protein ARALYDRAFT_484093           95.1    2e-20   
ref|XP_010554394.1|  PREDICTED: uncharacterized protein LOC104824124  94.4    3e-20   
ref|XP_010502168.1|  PREDICTED: uncharacterized protein LOC104779499  93.6    8e-20   
ref|XP_006849800.1|  hypothetical protein AMTR_s00176p00047500        92.8    1e-19   
ref|XP_010513905.1|  PREDICTED: uncharacterized protein LOC104789938  92.8    2e-19   
ref|XP_010424950.1|  PREDICTED: uncharacterized protein LOC104710107  92.4    2e-19   
ref|XP_002463996.1|  hypothetical protein SORBIDRAFT_01g010220        92.0    5e-19   Sorghum bicolor [broomcorn]
ref|XP_004981991.1|  PREDICTED: uncharacterized protein LOC101753647  90.9    7e-19   
ref|XP_008644573.1|  PREDICTED: uncharacterized protein LOC103625946  90.5    9e-19   
gb|KFK33399.1|  hypothetical protein AALP_AA5G007800                  86.7    3e-17   
gb|EYU30137.1|  hypothetical protein MIMGU_mgv1a014872mg              84.3    2e-16   
gb|KHN34542.1|  hypothetical protein glysoja_045104                   81.3    2e-16   
ref|XP_010513977.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  84.0    2e-16   
ref|XP_001752457.1|  predicted protein                                68.9    9e-12   
ref|WP_015175393.1|  hypothetical protein                             67.4    3e-11   
ref|WP_015149965.1|  hypothetical protein                             67.0    4e-11   
ref|WP_006635886.1|  hypothetical protein                             66.6    7e-11   
ref|WP_008316700.1|  hypothetical protein                             66.2    8e-11   
ref|WP_015137819.1|  hypothetical protein                             65.1    2e-10   
ref|WP_015956033.1|  hypothetical protein                             65.1    2e-10   
ref|WP_011317900.1|  hypothetical protein                             64.7    3e-10   
ref|WP_012629280.1|  hypothetical protein                             64.3    4e-10   
ref|WP_017716569.1|  hypothetical protein                             64.3    4e-10   
ref|WP_017654023.1|  hypothetical protein                             63.9    6e-10   
ref|WP_006453966.1|  hypothetical protein                             63.5    7e-10   
ref|WP_023065943.1|  hypothetical protein                             63.5    9e-10   
ref|WP_016953177.1|  hypothetical protein                             63.2    9e-10   
ref|WP_013190764.1|  hypothetical protein                             63.2    1e-09   
ref|WP_009784784.1|  hypothetical protein                             62.8    2e-09   
ref|WP_006618040.1|  hypothetical protein                             62.4    2e-09   
ref|WP_015166200.1|  hypothetical protein                             62.4    2e-09   
ref|WP_011058081.1|  hypothetical protein                             62.4    2e-09   
ref|WP_006621822.1|  hypothetical protein                             62.4    2e-09   
ref|WP_039725434.1|  hypothetical protein                             62.4    2e-09   
ref|WP_029636731.1|  hypothetical protein [                           62.0    3e-09   
ref|WP_039754819.1|  hypothetical protein                             62.0    3e-09   
ref|WP_008056743.1|  hypothetical protein                             61.6    3e-09   
ref|WP_015125882.1|  hypothetical protein                             61.6    4e-09   
ref|WP_010996999.1|  hypothetical protein                             61.2    5e-09   
ref|WP_036053294.1|  hypothetical protein                             61.2    5e-09   
gb|ESA36247.1|  hypothetical protein N836_07860                       61.2    6e-09   
ref|WP_019501534.1|  hypothetical protein                             60.8    7e-09   
ref|XP_002970183.1|  hypothetical protein SELMODRAFT_410994           60.8    7e-09   
ref|WP_015187451.1|  hypothetical protein                             60.8    7e-09   
ref|WP_015207785.1|  hypothetical protein                             60.5    1e-08   
ref|WP_017659024.1|  hypothetical protein                             60.1    1e-08   
ref|WP_039717135.1|  hypothetical protein                             60.1    1e-08   
ref|WP_024125238.1|  hypothetical protein                             60.1    1e-08   
ref|WP_015155545.1|  hypothetical protein                             60.1    1e-08   
ref|WP_015081467.1|  hypothetical protein                             60.1    2e-08   
ref|WP_009626744.1|  hypothetical protein                             59.7    2e-08   
ref|WP_026786137.1|  hypothetical protein                             59.7    2e-08   
ref|WP_015216102.1|  hypothetical protein                             59.7    2e-08   
ref|WP_013190775.1|  hypothetical protein                             58.9    2e-08   
ref|WP_015167205.1|  hypothetical protein                             59.3    3e-08   
ref|WP_008185317.1|  hypothetical protein                             58.9    3e-08   
ref|WP_010475320.1|  hypothetical protein                             58.9    3e-08   
ref|WP_015134086.1|  hypothetical protein                             58.9    4e-08   
ref|WP_009341839.1|  hypothetical protein                             58.9    4e-08   
ref|WP_028082846.1|  hypothetical protein                             58.5    5e-08   
ref|WP_026734554.1|  hypothetical protein                             58.5    5e-08   
ref|WP_039204792.1|  hypothetical protein                             58.5    5e-08   
ref|WP_017749886.1|  hypothetical protein                             58.5    6e-08   
ref|WP_006527740.1|  hypothetical protein                             58.2    6e-08   
ref|WP_017321586.1|  hypothetical protein                             58.2    7e-08   
ref|WP_009544038.1|  MULTISPECIES: hypothetical protein               57.8    8e-08   
ref|WP_017291070.1|  hypothetical protein                             57.8    8e-08   
ref|WP_038072413.1|  hypothetical protein                             57.8    9e-08   
ref|WP_026798040.1|  hypothetical protein                             57.8    9e-08   
ref|WP_015126622.1|  hypothetical protein                             58.2    9e-08   
ref|WP_017298869.1|  hypothetical protein                             57.8    9e-08   
gb|KEI68362.1|  hypothetical protein A19Y_3607                        57.4    1e-07   
ref|WP_026794694.1|  MULTISPECIES: hypothetical protein               57.4    1e-07   
ref|WP_027404705.1|  hypothetical protein                             57.4    1e-07   
ref|WP_036834509.1|  hypothetical protein                             57.4    1e-07   
ref|WP_035987726.1|  hypothetical protein                             57.4    1e-07   
ref|WP_009633047.1|  hypothetical protein                             57.0    2e-07   
ref|WP_006276769.1|  hypothetical protein                             57.4    2e-07   
ref|WP_028090312.1|  hypothetical protein                             57.0    2e-07   
ref|WP_009556281.1|  hypothetical protein                             57.0    2e-07   
ref|WP_027254932.1|  hypothetical protein                             57.0    2e-07   
ref|WP_012164699.1|  hypothetical protein                             57.0    2e-07   
ref|WP_015225572.1|  hypothetical protein                             57.0    2e-07   
ref|WP_036843313.1|  hypothetical protein                             56.6    2e-07   
ref|WP_017319221.1|  hypothetical protein                             56.6    3e-07   
ref|WP_006516334.1|  hypothetical protein                             56.2    3e-07   
ref|WP_015202343.1|  hypothetical protein                             56.2    4e-07   
ref|WP_015115883.1|  hypothetical protein                             56.2    4e-07   
ref|WP_012407490.1|  hypothetical protein                             55.8    4e-07   
ref|WP_015173767.1|  hypothetical protein                             55.8    6e-07   
ref|WP_012594268.1|  MULTISPECIES: hypothetical protein               55.5    6e-07   
ref|WP_008274178.1|  hypothetical protein                             55.5    7e-07   
ref|WP_026093356.1|  hypothetical protein                             55.1    1e-06   
ref|WP_006100502.1|  hypothetical protein                             55.1    1e-06   
ref|WP_015120208.1|  hypothetical protein                             55.1    1e-06   
ref|WP_015227940.1|  hypothetical protein                             54.7    1e-06   
ref|WP_006198108.1|  hypothetical protein                             54.7    1e-06   
ref|WP_036530788.1|  hypothetical protein                             54.3    2e-06   
ref|WP_015182392.1|  hypothetical protein                             54.3    2e-06   
ref|WP_038026554.1|  hypothetical protein                             53.9    3e-06   
ref|WP_009457211.1|  MULTISPECIES: hypothetical protein               53.9    3e-06   
ref|WP_004159286.1|  hypothetical protein                             53.9    3e-06   
ref|WP_017293082.1|  hypothetical protein                             53.5    3e-06   
ref|WP_015200791.1|  hypothetical protein                             53.5    4e-06   
ref|WP_022607677.1|  hypothetical protein                             53.5    4e-06   
ref|WP_008197515.1|  hypothetical protein                             53.1    4e-06   
ref|WP_011612833.1|  hypothetical protein                             53.1    4e-06   
ref|WP_037217597.1|  hypothetical protein                             53.1    4e-06   
ref|WP_016878692.1|  hypothetical protein                             53.1    4e-06   
ref|WP_004163598.1|  hypothetical protein                             53.1    4e-06   
ref|WP_002781197.1|  hypothetical protein                             53.1    5e-06   
ref|WP_027842242.1|  hypothetical protein                             53.1    5e-06   
ref|WP_016879525.1|  hypothetical protein                             52.4    6e-06   
ref|WP_026719712.1|  hypothetical protein                             52.8    7e-06   
ref|WP_016869501.1|  hypothetical protein                             52.8    7e-06   
ref|WP_004162902.1|  hypothetical protein                             52.4    8e-06   
ref|WP_015142371.1|  hypothetical protein                             52.4    1e-05   
ref|WP_016858983.1|  hypothetical protein                             52.4    1e-05   
ref|WP_017312305.1|  hypothetical protein                             52.0    1e-05   
ref|WP_002788842.1|  hypothetical protein                             51.6    1e-05   
dbj|GAL91702.1|  pyruvate dehydrogenase complex, dehydrogenase (E...  51.6    2e-05   
ref|WP_017305885.1|  hypothetical protein                             51.6    2e-05   
ref|WP_002770137.1|  hypothetical protein                             51.2    3e-05   
ref|WP_011127162.1|  hypothetical protein                             51.2    3e-05   
ref|WP_002743915.1|  hypothetical protein                             50.1    5e-05   
ref|WP_002739558.1|  hypothetical protein                             50.1    5e-05   
ref|WP_016516547.1|  hypothetical protein                             50.1    6e-05   
ref|WP_024969053.1|  hypothetical protein                             50.1    6e-05   
ref|WP_019505122.1|  hypothetical protein                             50.1    6e-05   
ref|WP_013323108.1|  hypothetical protein                             50.1    7e-05   
ref|WP_007305124.1|  hypothetical protein                             49.3    1e-04   
ref|WP_015219976.1|  hypothetical protein                             49.3    1e-04   
ref|WP_036009008.1|  hypothetical protein                             48.1    3e-04   
ref|WP_011377546.1|  hypothetical protein                             47.8    4e-04   
ref|WP_011243462.1|  hypothetical protein                             47.8    4e-04   
ref|WP_021836526.1|  hypothetical protein                             47.8    5e-04   
ref|WP_007310406.1|  hypothetical protein                             47.4    5e-04   
gb|AII46845.1|  hypothetical protein KR49_10395                       47.4    6e-04   
ref|WP_011430936.1|  hypothetical protein                             47.0    0.001   



>ref|XP_011024217.1| PREDICTED: uncharacterized protein LOC105125458 isoform X1 [Populus 
euphratica]
 ref|XP_011024226.1| PREDICTED: uncharacterized protein LOC105125458 isoform X1 [Populus 
euphratica]
Length=173

 Score =   122 bits (305),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 73/94 (78%), Positives = 84/94 (89%), Gaps = 0/94 (0%)
 Frame = -2

Query  434  GYNAEIAMLEVYSQSVKDeallvkavvdeeeveVIIFKGFSSSLSYGTSPDPTKSVLPAK  255
            GYN EIAMLE YSQS   EALLV+AVVDE+EVEV+IFKGFSS LSYGTSPDP++SVLPA+
Sbjct  77   GYNLEIAMLEFYSQSAIGEALLVRAVVDEQEVEVLIFKGFSSCLSYGTSPDPSRSVLPAR  136

Query  254  AKIKYIDRIKGPFNPSNIDYIERDIPWDAFKSLL  153
            A IK IDRIKGPFNPSNI+Y+E+D+ W+AFKS L
Sbjct  137  AVIKSIDRIKGPFNPSNIEYLEKDLTWEAFKSRL  170



>ref|XP_002312467.1| hypothetical protein POPTR_0008s13480g [Populus trichocarpa]
 gb|EEE89834.1| hypothetical protein POPTR_0008s13480g [Populus trichocarpa]
Length=173

 Score =   120 bits (302),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 71/94 (76%), Positives = 83/94 (88%), Gaps = 0/94 (0%)
 Frame = -2

Query  434  GYNAEIAMLEVYSQSVKDeallvkavvdeeeveVIIFKGFSSSLSYGTSPDPTKSVLPAK  255
            G+N EIAMLE YSQS   EALLV A+VDE+EVEV+IFKGFSS LSYGTSPDP++SVLPA+
Sbjct  77   GHNLEIAMLEFYSQSAIGEALLVHAIVDEQEVEVLIFKGFSSCLSYGTSPDPSRSVLPAR  136

Query  254  AKIKYIDRIKGPFNPSNIDYIERDIPWDAFKSLL  153
            A IK IDRIKGPFNPSNI+Y+E+D+ W+AFKS L
Sbjct  137  AVIKSIDRIKGPFNPSNIEYLEKDLTWEAFKSRL  170



>emb|CDP16252.1| unnamed protein product [Coffea canephora]
Length=168

 Score =   120 bits (300),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 70/94 (74%), Positives = 84/94 (89%), Gaps = 0/94 (0%)
 Frame = -2

Query  434  GYNAEIAMLEVYSQSVKDeallvkavvdeeeveVIIFKGFSSSLSYGTSPDPTKSVLPAK  255
            GYNAEIAMLE Y+QS ++EALLVKA+VDEEEVEV+IFKGFSS LSYGTSPDP++SVLP +
Sbjct  72   GYNAEIAMLETYTQSARNEALLVKAMVDEEEVEVLIFKGFSSCLSYGTSPDPSRSVLPTR  131

Query  254  AKIKYIDRIKGPFNPSNIDYIERDIPWDAFKSLL  153
            A+IK IDR+KGPF PSNI+YIE+ + W+ FKS L
Sbjct  132  AEIKSIDRVKGPFEPSNIEYIEKGLTWEIFKSRL  165



>ref|XP_010279634.1| PREDICTED: uncharacterized protein LOC104613498 [Nelumbo nucifera]
Length=167

 Score =   119 bits (298),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 67/94 (71%), Positives = 84/94 (89%), Gaps = 0/94 (0%)
 Frame = -2

Query  434  GYNAEIAMLEVYSQSVKDeallvkavvdeeeveVIIFKGFSSSLSYGTSPDPTKSVLPAK  255
            G+N+EIAMLE YS+S ++EALLV+AVVD +E EV+IFKGFSS LSY TSP+P++SVLPA+
Sbjct  71   GHNSEIAMLESYSESARNEALLVRAVVDNQEEEVLIFKGFSSCLSYRTSPNPSRSVLPAR  130

Query  254  AKIKYIDRIKGPFNPSNIDYIERDIPWDAFKSLL  153
            A IK IDRIKGPFNP+NI+YIE+D+ W+AFKS L
Sbjct  131  AVIKSIDRIKGPFNPANIEYIEKDLTWEAFKSRL  164



>ref|XP_002285010.1| PREDICTED: uncharacterized protein LOC100255936 [Vitis vinifera]
 emb|CBI26825.3| unnamed protein product [Vitis vinifera]
Length=168

 Score =   117 bits (294),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 68/93 (73%), Positives = 83/93 (89%), Gaps = 0/93 (0%)
 Frame = -2

Query  431  YNAEIAMLEVYSQSVKDeallvkavvdeeeveVIIFKGFSSSLSYGTSPDPTKSVLPAKA  252
            +NAEIAMLE+YSQS + EALLV A+VD+++VEV+IFKGFSS LSY TSPDP+KS+LPA+A
Sbjct  73   HNAEIAMLELYSQSARGEALLVHAMVDDQDVEVLIFKGFSSCLSYRTSPDPSKSILPARA  132

Query  251  KIKYIDRIKGPFNPSNIDYIERDIPWDAFKSLL  153
             IK IDRIKGPFNPS+I+YIE+ + WDAFKS L
Sbjct  133  VIKSIDRIKGPFNPSDIEYIEKGLAWDAFKSRL  165



>ref|XP_008389168.1| PREDICTED: uncharacterized protein LOC103451535 [Malus domestica]
Length=188

 Score =   117 bits (292),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 64/92 (70%), Positives = 85/92 (92%), Gaps = 0/92 (0%)
 Frame = -2

Query  434  GYNAEIAMLEVYSQSVKDeallvkavvdeeeveVIIFKGFSSSLSYGTSPDPTKSVLPAK  255
            G+N EIA+LE+YSQSV+ EAL+V A+VD+++VEV+IFKGFSSSLSYGTSPDP+KS+LPA+
Sbjct  86   GHNKEIAVLELYSQSVRGEALIVHALVDDQDVEVLIFKGFSSSLSYGTSPDPSKSILPAR  145

Query  254  AKIKYIDRIKGPFNPSNIDYIERDIPWDAFKS  159
            A IK IDR+KGPF+PSNI+Y+++ + W+AFKS
Sbjct  146  AVIKAIDRVKGPFDPSNIEYLQKGLTWEAFKS  177



>ref|XP_008366983.1| PREDICTED: uncharacterized protein LOC103430615 [Malus domestica]
Length=188

 Score =   116 bits (291),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 64/92 (70%), Positives = 85/92 (92%), Gaps = 0/92 (0%)
 Frame = -2

Query  434  GYNAEIAMLEVYSQSVKDeallvkavvdeeeveVIIFKGFSSSLSYGTSPDPTKSVLPAK  255
            G+N EIA+LE+YSQSV+ EAL+V A+VD+++VEV+IFKGFSSSLSYGTSPDP+KS+LPA+
Sbjct  86   GHNKEIAVLELYSQSVRGEALIVHALVDDQDVEVLIFKGFSSSLSYGTSPDPSKSILPAR  145

Query  254  AKIKYIDRIKGPFNPSNIDYIERDIPWDAFKS  159
            A IK IDR+KGPF+PSNI+Y+++ + W+AFKS
Sbjct  146  AVIKAIDRVKGPFDPSNIEYLQKGLTWEAFKS  177



>gb|KEH40634.1| hypothetical protein MTR_1g032560 [Medicago truncatula]
Length=172

 Score =   115 bits (289),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 64/94 (68%), Positives = 83/94 (88%), Gaps = 0/94 (0%)
 Frame = -2

Query  434  GYNAEIAMLEVYSQSVKDeallvkavvdeeeveVIIFKGFSSSLSYGTSPDPTKSVLPAK  255
            G+N EI+ LE YSQS + EAL+V A+VD+ EVEV+IFKGFSSSLSYGTSPDPT+S+LPA+
Sbjct  76   GHNEEISKLEFYSQSARGEALIVHALVDQNEVEVLIFKGFSSSLSYGTSPDPTRSILPAR  135

Query  254  AKIKYIDRIKGPFNPSNIDYIERDIPWDAFKSLL  153
            A IK IDRIKGPF+P+NI+Y+++D+PW+ FK+ L
Sbjct  136  AVIKSIDRIKGPFDPANIEYLQKDVPWEEFKTNL  169



>ref|XP_007045289.1| Uncharacterized protein TCM_011065 [Theobroma cacao]
 gb|EOY01121.1| Uncharacterized protein TCM_011065 [Theobroma cacao]
Length=173

 Score =   115 bits (289),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 65/94 (69%), Positives = 84/94 (89%), Gaps = 0/94 (0%)
 Frame = -2

Query  434  GYNAEIAMLEVYSQSVKDeallvkavvdeeeveVIIFKGFSSSLSYGTSPDPTKSVLPAK  255
            GYN EIA+LE+YSQSV+ EA LV A+VDE+EVEV+IFKGFSS LSYGTSPDP++SV+PA+
Sbjct  77   GYNEEIAILELYSQSVRGEAFLVHALVDEQEVEVLIFKGFSSCLSYGTSPDPSRSVIPAR  136

Query  254  AKIKYIDRIKGPFNPSNIDYIERDIPWDAFKSLL  153
            A IK IDRIKGPF+PS+++YIE+ + W++FK+ L
Sbjct  137  AVIKSIDRIKGPFDPSSMEYIEKGLEWESFKTRL  170



>ref|XP_010066566.1| PREDICTED: uncharacterized protein LOC104453654 [Eucalyptus grandis]
 gb|KCW64490.1| hypothetical protein EUGRSUZ_G02097 [Eucalyptus grandis]
Length=174

 Score =   115 bits (288),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 65/92 (71%), Positives = 80/92 (87%), Gaps = 0/92 (0%)
 Frame = -2

Query  428  NAEIAMLEVYSQSVKDeallvkavvdeeeveVIIFKGFSSSLSYGTSPDPTKSVLPAKAK  249
            N EIAMLE+YSQS + EAL+V A V  EEVEV+I+KGFSSSLSYGT+PDP+KSVLPAKA+
Sbjct  80   NKEIAMLELYSQSARGEALVVHADVGGEEVEVLIYKGFSSSLSYGTAPDPSKSVLPAKAQ  139

Query  248  IKYIDRIKGPFNPSNIDYIERDIPWDAFKSLL  153
            IK+IDRIKGPF+PSNI+YIE+ + W+ F+  L
Sbjct  140  IKWIDRIKGPFDPSNIEYIEQGLTWENFEQFL  171



>ref|XP_006448150.1| hypothetical protein CICLE_v10016899mg [Citrus clementina]
 gb|ESR61390.1| hypothetical protein CICLE_v10016899mg [Citrus clementina]
Length=178

 Score =   114 bits (285),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 65/94 (69%), Positives = 81/94 (86%), Gaps = 0/94 (0%)
 Frame = -2

Query  434  GYNAEIAMLEVYSQSVKDeallvkavvdeeeveVIIFKGFSSSLSYGTSPDPTKSVLPAK  255
            G+N EI  LE YS S + EALLV+AV+D+ + EV++FKGFSSSLS+GTSPDP+KSVLPA+
Sbjct  82   GHNEEIVALESYSLSARGEALLVRAVLDDRDFEVLVFKGFSSSLSHGTSPDPSKSVLPAR  141

Query  254  AKIKYIDRIKGPFNPSNIDYIERDIPWDAFKSLL  153
            A IK IDRIKGPF+PSNI+YIE+D+ W+AFKS L
Sbjct  142  AVIKAIDRIKGPFDPSNIEYIEKDLQWEAFKSRL  175



>ref|XP_006469255.1| PREDICTED: uncharacterized protein LOC102631006 isoform X1 [Citrus 
sinensis]
Length=178

 Score =   114 bits (284),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 65/94 (69%), Positives = 81/94 (86%), Gaps = 0/94 (0%)
 Frame = -2

Query  434  GYNAEIAMLEVYSQSVKDeallvkavvdeeeveVIIFKGFSSSLSYGTSPDPTKSVLPAK  255
            G+N EI  LE YS S + EALLV+AV+D+ + EV++FKGFSSSLS+GTSPDP+KSVLPA+
Sbjct  82   GHNEEIVALESYSLSARGEALLVRAVLDDRDFEVLVFKGFSSSLSHGTSPDPSKSVLPAR  141

Query  254  AKIKYIDRIKGPFNPSNIDYIERDIPWDAFKSLL  153
            A IK IDRIKGPF+PSNI+YIE+D+ W+AFKS L
Sbjct  142  AVIKAIDRIKGPFDPSNIEYIEKDLQWEAFKSRL  175



>ref|XP_002533197.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF29189.1| conserved hypothetical protein [Ricinus communis]
Length=156

 Score =   113 bits (282),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 65/92 (71%), Positives = 79/92 (86%), Gaps = 0/92 (0%)
 Frame = -2

Query  434  GYNAEIAMLEVYSQSVKDeallvkavvdeeeveVIIFKGFSSSLSYGTSPDPTKSVLPAK  255
            G+N EIA+LE YSQS ++EALLV A VDE+E EV+IFKGFSS LSY TSPDP+KSVLPA+
Sbjct  60   GHNEEIAILEFYSQSAREEALLVHAAVDEQEAEVLIFKGFSSCLSYKTSPDPSKSVLPAR  119

Query  254  AKIKYIDRIKGPFNPSNIDYIERDIPWDAFKS  159
            A IK IDRIKGPF+PSNI+Y+E+ + W AFK+
Sbjct  120  AVIKSIDRIKGPFDPSNIEYLEKGLTWQAFKA  151



>gb|KDP38122.1| hypothetical protein JCGZ_04765 [Jatropha curcas]
Length=167

 Score =   113 bits (282),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 65/93 (70%), Positives = 82/93 (88%), Gaps = 0/93 (0%)
 Frame = -2

Query  431  YNAEIAMLEVYSQSVKDeallvkavvdeeeveVIIFKGFSSSLSYGTSPDPTKSVLPAKA  252
            +N EIAMLE+YSQS ++EALLV A VD++EVEV+IFKGFSS LSY TSPDP++SVLPA+A
Sbjct  72   HNEEIAMLELYSQSSREEALLVHAFVDDQEVEVLIFKGFSSCLSYKTSPDPSRSVLPARA  131

Query  251  KIKYIDRIKGPFNPSNIDYIERDIPWDAFKSLL  153
             IK IDRIKGPF+PSNI+Y+E+ + W+AFK+ L
Sbjct  132  VIKSIDRIKGPFDPSNIEYLEKGLTWEAFKTRL  164



>ref|XP_010687806.1| PREDICTED: uncharacterized protein LOC104901877 [Beta vulgaris 
subsp. vulgaris]
Length=176

 Score =   111 bits (277),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 65/92 (71%), Positives = 79/92 (86%), Gaps = 0/92 (0%)
 Frame = -2

Query  434  GYNAEIAMLEVYSQSVKDeallvkavvdeeeveVIIFKGFSSSLSYGTSPDPTKSVLPAK  255
            GYN EIAMLE YSQS + EALLV A+VD++EVEV+IFKGFSS LSYGTSPD +KSV+P +
Sbjct  80   GYNEEIAMLETYSQSARGEALLVTAMVDDQEVEVLIFKGFSSCLSYGTSPDASKSVIPQR  139

Query  254  AKIKYIDRIKGPFNPSNIDYIERDIPWDAFKS  159
            A IK+IDRIKGPFNP+NI+YIE+ +  + FKS
Sbjct  140  AIIKFIDRIKGPFNPANIEYIEKGLTLETFKS  171



>ref|XP_011024235.1| PREDICTED: uncharacterized protein LOC105125458 isoform X2 [Populus 
euphratica]
Length=168

 Score =   110 bits (275),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 67/94 (71%), Positives = 78/94 (83%), Gaps = 5/94 (5%)
 Frame = -2

Query  434  GYNAEIAMLEVYSQSVKDeallvkavvdeeeveVIIFKGFSSSLSYGTSPDPTKSVLPAK  255
            GYN EIAMLE YSQS   EALLV+AVVDE+E      +GFSS LSYGTSPDP++SVLPA+
Sbjct  77   GYNLEIAMLEFYSQSAIGEALLVRAVVDEQE-----VEGFSSCLSYGTSPDPSRSVLPAR  131

Query  254  AKIKYIDRIKGPFNPSNIDYIERDIPWDAFKSLL  153
            A IK IDRIKGPFNPSNI+Y+E+D+ W+AFKS L
Sbjct  132  AVIKSIDRIKGPFNPSNIEYLEKDLTWEAFKSRL  165



>ref|XP_010088185.1| hypothetical protein L484_005529 [Morus notabilis]
 gb|EXB32325.1| hypothetical protein L484_005529 [Morus notabilis]
Length=183

 Score =   110 bits (275),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 61/92 (66%), Positives = 80/92 (87%), Gaps = 0/92 (0%)
 Frame = -2

Query  434  GYNAEIAMLEVYSQSVKDeallvkavvdeeeveVIIFKGFSSSLSYGTSPDPTKSVLPAK  255
            G+N EI MLE YSQS ++EALLVKA VD +EVE++IFKGFSSSLSYGTSPDP+KS+LPA+
Sbjct  86   GHNEEILMLEAYSQSSREEALLVKAEVDAQEVELLIFKGFSSSLSYGTSPDPSKSILPAR  145

Query  254  AKIKYIDRIKGPFNPSNIDYIERDIPWDAFKS  159
            A IK +D +KGPF+PSNI+Y+++ + W+ FK+
Sbjct  146  AVIKTVDIVKGPFDPSNIEYLQKGLSWEKFKT  177



>ref|XP_007226251.1| hypothetical protein PRUPE_ppa018074mg, partial [Prunus persica]
 gb|EMJ27450.1| hypothetical protein PRUPE_ppa018074mg, partial [Prunus persica]
Length=136

 Score =   108 bits (271),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 60/91 (66%), Positives = 82/91 (90%), Gaps = 0/91 (0%)
 Frame = -2

Query  431  YNAEIAMLEVYSQSVKDeallvkavvdeeeveVIIFKGFSSSLSYGTSPDPTKSVLPAKA  252
            ++ EIA+LE+YSQSV+ EAL+V AVVD+++V+V+IFKGFSS LSY TSPDP+KS+LPA+A
Sbjct  35   HHKEIAVLELYSQSVRGEALIVHAVVDDQDVQVLIFKGFSSCLSYRTSPDPSKSILPARA  94

Query  251  KIKYIDRIKGPFNPSNIDYIERDIPWDAFKS  159
             IK IDR+KGPF+PSNI+Y+++ + W+AFKS
Sbjct  95   VIKSIDRVKGPFDPSNIEYLQKGLTWEAFKS  125



>ref|XP_010916227.1| PREDICTED: uncharacterized protein LOC105041114 [Elaeis guineensis]
Length=168

 Score =   109 bits (273),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 63/94 (67%), Positives = 79/94 (84%), Gaps = 0/94 (0%)
 Frame = -2

Query  434  GYNAEIAMLEVYSQSVKDeallvkavvdeeeveVIIFKGFSSSLSYGTSPDPTKSVLPAK  255
            G+N+EI MLE YSQS ++EALLV+A VD EE  V+IFKGFSS LS  T+ DP+KSVLPAK
Sbjct  72   GHNSEIEMLESYSQSARNEALLVRATVDGEEELVLIFKGFSSCLSSRTTSDPSKSVLPAK  131

Query  254  AKIKYIDRIKGPFNPSNIDYIERDIPWDAFKSLL  153
            A I++ID IKGPF+PSNI+YIE+D+ W+AFK+ L
Sbjct  132  AVIQFIDVIKGPFDPSNIEYIEKDLTWEAFKARL  165



>ref|XP_004298502.1| PREDICTED: uncharacterized protein LOC101303511 [Fragaria vesca 
subsp. vesca]
Length=174

 Score =   108 bits (271),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 61/93 (66%), Positives = 82/93 (88%), Gaps = 0/93 (0%)
 Frame = -2

Query  431  YNAEIAMLEVYSQSVKDeallvkavvdeeeveVIIFKGFSSSLSYGTSPDPTKSVLPAKA  252
            +N EIA+LE+YSQSV+ EAL+V A+VD++ VEVIIFKGFSS LSY TSPDP+KS+LPA+A
Sbjct  74   HNKEIALLELYSQSVRGEALIVHAMVDDQPVEVIIFKGFSSCLSYRTSPDPSKSILPARA  133

Query  251  KIKYIDRIKGPFNPSNIDYIERDIPWDAFKSLL  153
             I+ IDR+KGPF+PSNI+Y+++++ W+ FKS L
Sbjct  134  VIESIDRVKGPFDPSNIEYLQKNLSWEVFKSNL  166



>ref|XP_008220911.1| PREDICTED: uncharacterized protein LOC103320950 [Prunus mume]
Length=174

 Score =   108 bits (270),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 60/91 (66%), Positives = 82/91 (90%), Gaps = 0/91 (0%)
 Frame = -2

Query  431  YNAEIAMLEVYSQSVKDeallvkavvdeeeveVIIFKGFSSSLSYGTSPDPTKSVLPAKA  252
            ++ EIA+LE+YSQSV+ EAL+V AVVD+++V+V+IFKGFSS LSY TSPDP+KS+LPA+A
Sbjct  73   HHKEIAVLELYSQSVRGEALIVHAVVDDQDVQVLIFKGFSSCLSYRTSPDPSKSILPARA  132

Query  251  KIKYIDRIKGPFNPSNIDYIERDIPWDAFKS  159
             IK IDR+KGPF+PSNI+Y+++ + W+AFKS
Sbjct  133  VIKSIDRVKGPFDPSNIEYLQKGLTWEAFKS  163



>ref|XP_003518617.2| PREDICTED: uncharacterized protein LOC100810515 [Glycine max]
 gb|KHN15458.1| hypothetical protein glysoja_036326 [Glycine soja]
Length=180

 Score =   108 bits (270),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 62/94 (66%), Positives = 78/94 (83%), Gaps = 0/94 (0%)
 Frame = -2

Query  434  GYNAEIAMLEVYSQSVKDeallvkavvdeeeveVIIFKGFSSSLSYGTSPDPTKSVLPAK  255
            G+N EIA LE YSQS K E LLV A+VD+EEV+V+IFKGFSS LSY TSPDPT+S+LPA+
Sbjct  84   GHNEEIAKLESYSQSAKGEVLLVHALVDQEEVDVLIFKGFSSCLSYSTSPDPTRSILPAR  143

Query  254  AKIKYIDRIKGPFNPSNIDYIERDIPWDAFKSLL  153
            A I  IDRIKGPFNP+NI+Y+++ + W+ FK+ L
Sbjct  144  AVIVSIDRIKGPFNPANIEYLQKGVTWEEFKTNL  177



>ref|XP_009791395.1| PREDICTED: uncharacterized protein LOC104238666 [Nicotiana sylvestris]
Length=174

 Score =   108 bits (269),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 64/92 (70%), Positives = 81/92 (88%), Gaps = 0/92 (0%)
 Frame = -2

Query  434  GYNAEIAMLEVYSQSVKDeallvkavvdeeeveVIIFKGFSSSLSYGTSPDPTKSVLPAK  255
            G+N EIAMLE YSQSV++EALLVKA+V+EEEVEV+IFKGFSS LSYGT PDP+KSV+PA+
Sbjct  76   GHNEEIAMLEFYSQSVRNEALLVKAIVNEEEVEVLIFKGFSSCLSYGTCPDPSKSVIPAR  135

Query  254  AKIKYIDRIKGPFNPSNIDYIERDIPWDAFKS  159
            A IK +DRIKGPF+PSNI+Y+E+ +  +  K+
Sbjct  136  AVIKCVDRIKGPFDPSNIEYLEKGLTMEDIKA  167



>ref|XP_009597994.1| PREDICTED: uncharacterized protein LOC104093866 [Nicotiana tomentosiformis]
Length=176

 Score =   107 bits (268),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 67/92 (73%), Positives = 80/92 (87%), Gaps = 0/92 (0%)
 Frame = -2

Query  434  GYNAEIAMLEVYSQSVKDeallvkavvdeeeveVIIFKGFSSSLSYGTSPDPTKSVLPAK  255
            G+N EIAMLE YSQSV++EALLVKAVV+EEEVEV+IFKGFSS LSYGT PDP+KSVLPA+
Sbjct  78   GHNTEIAMLEFYSQSVRNEALLVKAVVNEEEVEVLIFKGFSSCLSYGTCPDPSKSVLPAR  137

Query  254  AKIKYIDRIKGPFNPSNIDYIERDIPWDAFKS  159
            A IK IDRIKGPF+PSNI+Y E+ +  +  K+
Sbjct  138  AVIKCIDRIKGPFDPSNIEYFEKGLTVEDIKA  169



>gb|KGN49598.1| hypothetical protein Csa_5G021310 [Cucumis sativus]
Length=172

 Score =   105 bits (263),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 59/93 (63%), Positives = 78/93 (84%), Gaps = 0/93 (0%)
 Frame = -2

Query  434  GYNAEIAMLEVYSQSVKDeallvkavvdeeeveVIIFKGFSSSLSYGTSPDPTKSVLPAK  255
            G+N +IA+LE Y+Q+   EAL+V A+VD + VEV++FKGFSSSLSYGTSPDP++SVLP +
Sbjct  79   GHNHQIALLESYTQAATGEALIVHAMVDGDHVEVLVFKGFSSSLSYGTSPDPSRSVLPER  138

Query  254  AKIKYIDRIKGPFNPSNIDYIERDIPWDAFKSL  156
            A IK+IDRIKGPF+PSNI YI++ I W++F  L
Sbjct  139  AIIKFIDRIKGPFDPSNIQYIQKGITWNSFNFL  171



>ref|XP_004142303.1| PREDICTED: uncharacterized protein LOC101213440 [Cucumis sativus]
 ref|XP_004169784.1| PREDICTED: uncharacterized LOC101213440 [Cucumis sativus]
Length=222

 Score =   106 bits (264),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 59/93 (63%), Positives = 78/93 (84%), Gaps = 0/93 (0%)
 Frame = -2

Query  434  GYNAEIAMLEVYSQSVKDeallvkavvdeeeveVIIFKGFSSSLSYGTSPDPTKSVLPAK  255
            G+N +IA+LE Y+Q+   EAL+V A+VD + VEV++FKGFSSSLSYGTSPDP++SVLP +
Sbjct  129  GHNHQIALLESYTQAATGEALIVHAMVDGDHVEVLVFKGFSSSLSYGTSPDPSRSVLPER  188

Query  254  AKIKYIDRIKGPFNPSNIDYIERDIPWDAFKSL  156
            A IK+IDRIKGPF+PSNI YI++ I W++F  L
Sbjct  189  AIIKFIDRIKGPFDPSNIQYIQKGITWNSFNFL  221



>ref|XP_007153233.1| hypothetical protein PHAVU_003G017900g [Phaseolus vulgaris]
 gb|ESW25227.1| hypothetical protein PHAVU_003G017900g [Phaseolus vulgaris]
Length=176

 Score =   104 bits (259),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 58/94 (62%), Positives = 78/94 (83%), Gaps = 0/94 (0%)
 Frame = -2

Query  434  GYNAEIAMLEVYSQSVKDeallvkavvdeeeveVIIFKGFSSSLSYGTSPDPTKSVLPAK  255
            G+N EI  LE+YSQS K EALLV A++D+EEVE++IFKGFSS LSY TSPDPT+S+LPA+
Sbjct  80   GHNEEITKLEIYSQSAKGEALLVHALLDQEEVELLIFKGFSSCLSYSTSPDPTRSILPAR  139

Query  254  AKIKYIDRIKGPFNPSNIDYIERDIPWDAFKSLL  153
            A I  IDR+KGP +P+NI+Y+++ + W+ FK+ L
Sbjct  140  AVIVSIDRVKGPLDPANIEYLQKGVTWEEFKTKL  173



>ref|XP_004498245.1| PREDICTED: uncharacterized protein LOC101511657 [Cicer arietinum]
Length=172

 Score =   104 bits (259),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 59/94 (63%), Positives = 79/94 (84%), Gaps = 0/94 (0%)
 Frame = -2

Query  434  GYNAEIAMLEVYSQSVKDeallvkavvdeeeveVIIFKGFSSSLSYGTSPDPTKSVLPAK  255
            G+N +I+ LE YSQS + EAL+V A+VD+ EVEV+IFKGFSS LSY TSPDPTKS+LPA+
Sbjct  76   GHNEKISKLEFYSQSARGEALIVHALVDQNEVEVLIFKGFSSCLSYSTSPDPTKSILPAR  135

Query  254  AKIKYIDRIKGPFNPSNIDYIERDIPWDAFKSLL  153
            A I  IDRIKGPF+P+NI+Y+++++ W+ FK+ L
Sbjct  136  AVITSIDRIKGPFDPANIEYLQKNVAWEEFKTNL  169



>ref|XP_006343250.1| PREDICTED: uncharacterized protein LOC102605488 [Solanum tuberosum]
Length=179

 Score =   104 bits (259),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 64/88 (73%), Positives = 80/88 (91%), Gaps = 0/88 (0%)
 Frame = -2

Query  425  AEIAMLEVYSQSVKDeallvkavvdeeeveVIIFKGFSSSLSYGTSPDPTKSVLPAKAKI  246
            +E+AMLE YSQS+++EALLVKA+VDEE+VEV+IFKGFSS LSYGTSPDP+KS+LPA+A I
Sbjct  84   SELAMLEFYSQSMRNEALLVKALVDEEDVEVLIFKGFSSCLSYGTSPDPSKSLLPARAVI  143

Query  245  KYIDRIKGPFNPSNIDYIERDIPWDAFK  162
            K IDRIKGPF+PSNI Y+E+ +  +AFK
Sbjct  144  KCIDRIKGPFDPSNIVYLEKGLTVEAFK  171



>ref|XP_008452414.1| PREDICTED: uncharacterized protein LOC103493452 [Cucumis melo]
Length=169

 Score =   103 bits (256),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 58/91 (64%), Positives = 75/91 (82%), Gaps = 0/91 (0%)
 Frame = -2

Query  434  GYNAEIAMLEVYSQSVKDeallvkavvdeeeveVIIFKGFSSSLSYGTSPDPTKSVLPAK  255
            G+N +IA+LE Y+Q+   EAL+V A+VD E VEV++FKGFSS LSYGTSPDP++SV+P +
Sbjct  76   GHNDQIALLESYTQAATGEALIVHAMVDGEHVEVLVFKGFSSCLSYGTSPDPSRSVVPER  135

Query  254  AKIKYIDRIKGPFNPSNIDYIERDIPWDAFK  162
            A IK IDRIKGPF+PSNI YIE+ I W++F 
Sbjct  136  ATIKSIDRIKGPFDPSNIQYIEKGITWNSFN  166



>ref|XP_008777817.1| PREDICTED: uncharacterized protein LOC103697684 [Phoenix dactylifera]
Length=169

 Score =   102 bits (253),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 58/94 (62%), Positives = 75/94 (80%), Gaps = 0/94 (0%)
 Frame = -2

Query  434  GYNAEIAMLEVYSQSVKDeallvkavvdeeeveVIIFKGFSSSLSYGTSPDPTKSVLPAK  255
            G N+EI MLE YSQS +++ALLV+A VD EE  V+IFKGFSS LS  T+ DP+KSVLP K
Sbjct  73   GRNSEIEMLETYSQSARNQALLVRATVDGEEEVVLIFKGFSSCLSSRTASDPSKSVLPGK  132

Query  254  AKIKYIDRIKGPFNPSNIDYIERDIPWDAFKSLL  153
            A I+ ID IKGPF+P NI+Y+E+++ W+AFK+ L
Sbjct  133  AVIQSIDVIKGPFDPCNIEYLEKNLTWEAFKARL  166



>ref|XP_006395853.1| hypothetical protein EUTSA_v10004999mg [Eutrema salsugineum]
 gb|ESQ33139.1| hypothetical protein EUTSA_v10004999mg [Eutrema salsugineum]
Length=179

 Score =   101 bits (251),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 60/94 (64%), Positives = 76/94 (81%), Gaps = 0/94 (0%)
 Frame = -2

Query  434  GYNAEIAMLEVYSQSVKDeallvkavvdeeeveVIIFKGFSSSLSYGTSPDPTKSVLPAK  255
            GYN EIAMLE+YSQS ++EAL+V A+VD+EEVEV+IFKGFSS LS  T+ DP +SVLP +
Sbjct  82   GYNEEIAMLELYSQSCREEALIVTAIVDDEEVEVLIFKGFSSCLSGETAVDPARSVLPER  141

Query  254  AKIKYIDRIKGPFNPSNIDYIERDIPWDAFKSLL  153
            A IK IDR+KGPF+PS I YI + + +DAFK  +
Sbjct  142  AVIKQIDRVKGPFDPSQIHYIRKGLSFDAFKETM  175



>ref|XP_009409098.1| PREDICTED: uncharacterized protein LOC103991383 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=172

 Score =   100 bits (250),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 53/94 (56%), Positives = 77/94 (82%), Gaps = 0/94 (0%)
 Frame = -2

Query  434  GYNAEIAMLEVYSQSVKDeallvkavvdeeeveVIIFKGFSSSLSYGTSPDPTKSVLPAK  255
              N+EI+++E YS++V+D AL+V+A VD EE  V++FKGFSS LS  TS DP+KSVLPA+
Sbjct  74   AQNSEISLMEAYSEAVRDVALVVRATVDGEEETVLVFKGFSSCLSSRTSYDPSKSVLPAR  133

Query  254  AKIKYIDRIKGPFNPSNIDYIERDIPWDAFKSLL  153
            A I+ ID ++GPF+PSN++Y+E+D+ W+AFK+ L
Sbjct  134  AVIECIDVVRGPFDPSNVEYLEKDLTWEAFKTRL  167



>ref|XP_011070717.1| PREDICTED: uncharacterized protein LOC105156318 [Sesamum indicum]
Length=171

 Score =   100 bits (248),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 60/87 (69%), Positives = 76/87 (87%), Gaps = 0/87 (0%)
 Frame = -2

Query  419  IAMLEVYSQSVKDeallvkavvdeeeveVIIFKGFSSSLSYGTSPDPTKSVLPAKAKIKY  240
            IAMLE+Y+QS+KDE LLV+  VDEE+VEV+IFKGFSS LSY TS DP++SV+P+KA I+ 
Sbjct  79   IAMLEMYTQSMKDEILLVQTWVDEEQVEVLIFKGFSSCLSYKTSADPSRSVVPSKAVIRS  138

Query  239  IDRIKGPFNPSNIDYIERDIPWDAFKS  159
            IDRIKGPF+PSNI YIE+ + +DAFK+
Sbjct  139  IDRIKGPFDPSNIHYIEKGLTFDAFKT  165



>ref|XP_003559532.1| PREDICTED: uncharacterized protein LOC100838339 [Brachypodium 
distachyon]
Length=166

 Score =   100 bits (248),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 55/94 (59%), Positives = 73/94 (78%), Gaps = 0/94 (0%)
 Frame = -2

Query  434  GYNAEIAMLEVYSQSVKDeallvkavvdeeeveVIIFKGFSSSLSYGTSPDPTKSVLPAK  255
            G+N E+A LE YS+  +D+ALLVKA VD E   V++FKGFSSSLS  T+PDP  SVLP +
Sbjct  72   GHNEEMARLEAYSEGARDQALLVKASVDGELEVVLVFKGFSSSLSGRTAPDPAMSVLPER  131

Query  254  AKIKYIDRIKGPFNPSNIDYIERDIPWDAFKSLL  153
            A I+ +D +KGPF+P+NI+Y+E+D+ WD FKS L
Sbjct  132  AVIQSVDVVKGPFDPTNIEYLEKDLSWDDFKSRL  165



>dbj|BAJ95446.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=161

 Score = 99.8 bits (247),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 51/94 (54%), Positives = 70/94 (74%), Gaps = 0/94 (0%)
 Frame = -2

Query  434  GYNAEIAMLEVYSQSVKDeallvkavvdeeeveVIIFKGFSSSLSYGTSPDPTKSVLPAK  255
            G+N E+A LE YS+  +D ALLV A VD +   V++FKGFSS LS  T+PDP  SVLP +
Sbjct  67   GHNEEMARLEAYSEGARDLALLVTAAVDGDLESVLVFKGFSSRLSGRTAPDPAMSVLPER  126

Query  254  AKIKYIDRIKGPFNPSNIDYIERDIPWDAFKSLL  153
            A I+ +D ++GPF+P+NIDY+E+ +PW+ FKS L
Sbjct  127  AVIRSVDVVRGPFDPTNIDYLEKGLPWEEFKSRL  160



>ref|XP_004234127.1| PREDICTED: uncharacterized protein LOC101262182 [Solanum lycopersicum]
Length=180

 Score = 99.8 bits (247),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 62/88 (70%), Positives = 78/88 (89%), Gaps = 0/88 (0%)
 Frame = -2

Query  425  AEIAMLEVYSQSVKDeallvkavvdeeeveVIIFKGFSSSLSYGTSPDPTKSVLPAKAKI  246
            +E+AMLE YSQ++++EALLVKA+VDEE+VEV+IFKGFSS LS  TSPDP+KSVLPA+A I
Sbjct  85   SELAMLEFYSQTMRNEALLVKALVDEEDVEVLIFKGFSSCLSCRTSPDPSKSVLPARAVI  144

Query  245  KYIDRIKGPFNPSNIDYIERDIPWDAFK  162
            K IDRIKGPF+PSNI Y+E+ +  +AFK
Sbjct  145  KCIDRIKGPFDPSNIVYLEKGLTLEAFK  172



>gb|EMS48684.1| hypothetical protein TRIUR3_05970 [Triticum urartu]
Length=203

 Score = 99.8 bits (247),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 53/94 (56%), Positives = 70/94 (74%), Gaps = 0/94 (0%)
 Frame = -2

Query  434  GYNAEIAMLEVYSQSVKDeallvkavvdeeeveVIIFKGFSSSLSYGTSPDPTKSVLPAK  255
            G+N E+A LE YS+  +D ALLV A VD E   V++FKGFSSSLS  T+PDP  SVLP +
Sbjct  109  GHNEEMARLETYSEGARDVALLVTAAVDGELESVLVFKGFSSSLSGRTAPDPAMSVLPER  168

Query  254  AKIKYIDRIKGPFNPSNIDYIERDIPWDAFKSLL  153
            A I+ +D +KGPF+P NI+Y+E+D+ W+ FKS L
Sbjct  169  AVIQSVDVVKGPFDPDNIEYLEKDLSWEEFKSRL  202



>ref|XP_006651746.1| PREDICTED: uncharacterized protein LOC102714820 [Oryza brachyantha]
Length=171

 Score = 98.2 bits (243),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 55/94 (59%), Positives = 75/94 (80%), Gaps = 0/94 (0%)
 Frame = -2

Query  434  GYNAEIAMLEVYSQSVKDeallvkavvdeeeveVIIFKGFSSSLSYGTSPDPTKSVLPAK  255
            G+N E+A LE YS+  +D+ALLVKA+VD+E   V++FKGFSS LS  T+PDP  SVLP +
Sbjct  77   GHNEEMAELERYSEGARDQALLVKAMVDDEVEVVLVFKGFSSRLSGRTAPDPAMSVLPER  136

Query  254  AKIKYIDRIKGPFNPSNIDYIERDIPWDAFKSLL  153
            A I+ +D +KGPF+P+NI+Y+E+D+PWD FKS L
Sbjct  137  AIIQSVDVVKGPFDPTNIEYVEKDLPWDDFKSRL  170



>ref|NP_671765.2| uncharacterized protein [Arabidopsis thaliana]
 dbj|BAD93828.1| putative protein [Arabidopsis thaliana]
 gb|AEC05494.1| uncharacterized protein AT2G01755 [Arabidopsis thaliana]
Length=173

 Score = 97.8 bits (242),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 58/92 (63%), Positives = 74/92 (80%), Gaps = 0/92 (0%)
 Frame = -2

Query  434  GYNAEIAMLEVYSQSVKDeallvkavvdeeeveVIIFKGFSSSLSYGTSPDPTKSVLPAK  255
            GYN E+AMLE+YSQS ++EAL+V A+VD+EEVEV+IFKG SS LS  T+ DP +SVLP +
Sbjct  78   GYNEEMAMLEIYSQSCREEALIVTAIVDDEEVEVVIFKGVSSCLSGETAVDPARSVLPER  137

Query  254  AKIKYIDRIKGPFNPSNIDYIERDIPWDAFKS  159
            A I  IDR++GPF+PS I YI+RDI + AFK 
Sbjct  138  AVITKIDRVRGPFDPSQIHYIQRDISFQAFKE  169



>ref|NP_001051071.1| Os03g0713200 [Oryza sativa Japonica Group]
 gb|AAL58203.1|AC090882_6 hypothetical protein [Oryza sativa Japonica Group]
 gb|ABF98533.1| expressed protein [Oryza sativa Japonica Group]
 dbj|BAF12985.1| Os03g0713200 [Oryza sativa Japonica Group]
 gb|EAY91632.1| hypothetical protein OsI_13268 [Oryza sativa Indica Group]
 gb|EAZ28356.1| hypothetical protein OsJ_12334 [Oryza sativa Japonica Group]
Length=170

 Score = 97.4 bits (241),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 54/94 (57%), Positives = 73/94 (78%), Gaps = 0/94 (0%)
 Frame = -2

Query  434  GYNAEIAMLEVYSQSVKDeallvkavvdeeeveVIIFKGFSSSLSYGTSPDPTKSVLPAK  255
            G+N E+A LE YS+  +D+ALLVKA VD+E   V++FKGFSS LS  T+ DP  SVLP +
Sbjct  76   GHNEEMARLERYSEGARDQALLVKARVDDEVEVVLVFKGFSSRLSGRTAADPAMSVLPER  135

Query  254  AKIKYIDRIKGPFNPSNIDYIERDIPWDAFKSLL  153
            A I+ +D ++GPFNP+NI+Y+E+D+PWD FKS L
Sbjct  136  AIIQTVDVVRGPFNPTNIEYLEKDLPWDDFKSRL  169



>gb|EMT16671.1| NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial 
[Aegilops tauschii]
Length=697

 Score =   102 bits (254),  Expect = 3e-21, Method: Composition-based stats.
 Identities = 55/94 (59%), Positives = 72/94 (77%), Gaps = 0/94 (0%)
 Frame = -2

Query  434  GYNAEIAMLEVYSQSVKDeallvkavvdeeeveVIIFKGFSSSLSYGTSPDPTKSVLPAK  255
            G+N E+A LE YS+  +D ALLV A VD E   V++FKGFSSSLS  T+PDP  SVLP +
Sbjct  603  GHNEEMARLEAYSEGARDVALLVTAAVDGELESVLVFKGFSSSLSGRTAPDPAMSVLPER  662

Query  254  AKIKYIDRIKGPFNPSNIDYIERDIPWDAFKSLL  153
            A I+ +D +KGPF+PSNI+Y+E+D+PW+ FKS L
Sbjct  663  AVIQRVDVVKGPFDPSNIEYLEKDLPWEEFKSRL  696



>ref|XP_009101313.1| PREDICTED: uncharacterized protein LOC103827552 [Brassica rapa]
 emb|CDY17640.1| BnaA06g34590D [Brassica napus]
 emb|CDY17641.1| BnaA06g34600D [Brassica napus]
Length=171

 Score = 96.3 bits (238),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 57/94 (61%), Positives = 72/94 (77%), Gaps = 0/94 (0%)
 Frame = -2

Query  434  GYNAEIAMLEVYSQSVKDeallvkavvdeeeveVIIFKGFSSSLSYGTSPDPTKSVLPAK  255
            GYN EIAMLE YSQ+ +DEAL+V A VD EEVEV+IFKGFSS LS  T+ DP +SVLP +
Sbjct  76   GYNEEIAMLETYSQTCRDEALIVTAKVDGEEVEVLIFKGFSSCLSGETAVDPARSVLPER  135

Query  254  AKIKYIDRIKGPFNPSNIDYIERDIPWDAFKSLL  153
            A I  IDR++GPF+PS I YI++ + + AFK  +
Sbjct  136  AVITKIDRVRGPFDPSQIHYIQKGLSFQAFKETM  169



>emb|CDY36258.1| BnaC07g21120D [Brassica napus]
Length=171

 Score = 96.3 bits (238),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 57/94 (61%), Positives = 73/94 (78%), Gaps = 0/94 (0%)
 Frame = -2

Query  434  GYNAEIAMLEVYSQSVKDeallvkavvdeeeveVIIFKGFSSSLSYGTSPDPTKSVLPAK  255
            GYN EIAMLE YSQ+ +DEAL+V A+VD EEVEV+IFKGFSS LS  T+ DP +SVLP +
Sbjct  76   GYNEEIAMLETYSQTCRDEALIVTAIVDGEEVEVLIFKGFSSCLSGDTAVDPARSVLPER  135

Query  254  AKIKYIDRIKGPFNPSNIDYIERDIPWDAFKSLL  153
            A I  IDR++GPF+PS I YI++ + + AFK  +
Sbjct  136  AVITKIDRVRGPFDPSQIHYIQKGLSFQAFKETM  169



>gb|AAS49092.1| At2g01755 [Arabidopsis thaliana]
Length=150

 Score = 95.9 bits (237),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 57/92 (62%), Positives = 73/92 (79%), Gaps = 0/92 (0%)
 Frame = -2

Query  434  GYNAEIAMLEVYSQSVKDeallvkavvdeeeveVIIFKGFSSSLSYGTSPDPTKSVLPAK  255
            GYN E+AMLE+YSQS ++EAL+V A+VD+EEVEV+IFKG SS LS  T+ DP +SVLP +
Sbjct  55   GYNEEMAMLEIYSQSCREEALIVTAIVDDEEVEVVIFKGVSSCLSGETAVDPARSVLPER  114

Query  254  AKIKYIDRIKGPFNPSNIDYIERDIPWDAFKS  159
            A I   DR++GPF+PS I YI+RDI + AFK 
Sbjct  115  AVITKTDRVRGPFDPSQIHYIQRDISFQAFKE  146



>ref|XP_002876776.1| hypothetical protein ARALYDRAFT_484093 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH53035.1| hypothetical protein ARALYDRAFT_484093 [Arabidopsis lyrata subsp. 
lyrata]
Length=166

 Score = 95.1 bits (235),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 55/91 (60%), Positives = 74/91 (81%), Gaps = 0/91 (0%)
 Frame = -2

Query  434  GYNAEIAMLEVYSQSVKDeallvkavvdeeeveVIIFKGFSSSLSYGTSPDPTKSVLPAK  255
            GYN E+AMLE+YSQS ++EAL+V A+VD+EE+EV+IFKG S+ LS  T+ DP +SVLP +
Sbjct  72   GYNEEMAMLEIYSQSCREEALIVTAIVDDEEMEVVIFKGVSACLSGETAVDPARSVLPER  131

Query  254  AKIKYIDRIKGPFNPSNIDYIERDIPWDAFK  162
            A I  IDR++GPF+PS I YI++DI + AFK
Sbjct  132  AVITKIDRVRGPFDPSQIHYIQKDISFQAFK  162



>ref|XP_010554394.1| PREDICTED: uncharacterized protein LOC104824124 [Tarenaya hassleriana]
Length=173

 Score = 94.4 bits (233),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 58/92 (63%), Positives = 76/92 (83%), Gaps = 0/92 (0%)
 Frame = -2

Query  434  GYNAEIAMLEVYSQSVKDeallvkavvdeeeveVIIFKGFSSSLSYGTSPDPTKSVLPAK  255
            GYN EIAMLE+YSQS +DEAL+V A+VD+EEVEV+IFKGFSS LS  T+ DP++SV+P  
Sbjct  77   GYNEEIAMLEMYSQSCRDEALIVNAIVDDEEVEVLIFKGFSSCLSQETAADPSRSVVPEG  136

Query  254  AKIKYIDRIKGPFNPSNIDYIERDIPWDAFKS  159
            A IK IDR++ PF+PSN+ YIE+ + + +FKS
Sbjct  137  AVIKSIDRVRCPFDPSNLLYIEKGLSFHSFKS  168



>ref|XP_010502168.1| PREDICTED: uncharacterized protein LOC104779499 [Camelina sativa]
Length=177

 Score = 93.6 bits (231),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 56/92 (61%), Positives = 73/92 (79%), Gaps = 0/92 (0%)
 Frame = -2

Query  434  GYNAEIAMLEVYSQSVKDeallvkavvdeeeveVIIFKGFSSSLSYGTSPDPTKSVLPAK  255
            GYN E+AMLEVYSQS ++EAL+V A+VD++EVEVIIFKG SS LS  T+ DP +SVLP +
Sbjct  81   GYNEEMAMLEVYSQSCREEALIVTAIVDDDEVEVIIFKGVSSCLSGETAVDPARSVLPER  140

Query  254  AKIKYIDRIKGPFNPSNIDYIERDIPWDAFKS  159
            A I  IDR++GPF+PS I YI++ + + AFK 
Sbjct  141  AVITKIDRVRGPFDPSQIHYIQKGLSFQAFKE  172



>ref|XP_006849800.1| hypothetical protein AMTR_s00176p00047500 [Amborella trichopoda]
 gb|ERN11381.1| hypothetical protein AMTR_s00176p00047500 [Amborella trichopoda]
Length=174

 Score = 92.8 bits (229),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 58/94 (62%), Positives = 73/94 (78%), Gaps = 0/94 (0%)
 Frame = -2

Query  434  GYNAEIAMLEVYSQSVKDeallvkavvdeeeveVIIFKGFSSSLSYGTSPDPTKSVLPAK  255
            G N EI MLE YS+S + E LLV+A+VD++E EV+IFKGFSS LS  TS D +K VLPA+
Sbjct  77   GQNTEIGMLETYSESERSEVLLVRALVDDQEEEVLIFKGFSSLLSGRTSYDLSKCVLPAR  136

Query  254  AKIKYIDRIKGPFNPSNIDYIERDIPWDAFKSLL  153
            A IK ID IKGPF+PSNI+Y+E+D+ W+ FK  L
Sbjct  137  AIIKSIDIIKGPFDPSNIEYLEKDLKWEDFKHRL  170



>ref|XP_010513905.1| PREDICTED: uncharacterized protein LOC104789938 [Camelina sativa]
Length=183

 Score = 92.8 bits (229),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 57/92 (62%), Positives = 73/92 (79%), Gaps = 0/92 (0%)
 Frame = -2

Query  434  GYNAEIAMLEVYSQSVKDeallvkavvdeeeveVIIFKGFSSSLSYGTSPDPTKSVLPAK  255
            GYN E+AMLEVYSQS ++EAL+V A+VD+EEVEVIIFKG SS LS  T+ DP +SVLP +
Sbjct  86   GYNEEMAMLEVYSQSCREEALIVTAIVDDEEVEVIIFKGVSSCLSGETAVDPARSVLPER  145

Query  254  AKIKYIDRIKGPFNPSNIDYIERDIPWDAFKS  159
            A I  IDR++GPF+PS I YI++ + + AFK 
Sbjct  146  AVIIKIDRVRGPFDPSQIHYIQKGLSFQAFKE  177



>ref|XP_010424950.1| PREDICTED: uncharacterized protein LOC104710107 [Camelina sativa]
Length=182

 Score = 92.4 bits (228),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 57/92 (62%), Positives = 72/92 (78%), Gaps = 0/92 (0%)
 Frame = -2

Query  434  GYNAEIAMLEVYSQSVKDeallvkavvdeeeveVIIFKGFSSSLSYGTSPDPTKSVLPAK  255
            GYN E+AMLEVYSQS ++EAL+V A+VD+EEVEVIIFKG SS LS  T+ DP +SVLP +
Sbjct  86   GYNEEMAMLEVYSQSCREEALIVTAIVDDEEVEVIIFKGVSSCLSGETAVDPARSVLPER  145

Query  254  AKIKYIDRIKGPFNPSNIDYIERDIPWDAFKS  159
            A I  IDR +GPF+PS I YI++ + + AFK 
Sbjct  146  AVITKIDRARGPFDPSQIHYIQKGLSFQAFKE  177



>ref|XP_002463996.1| hypothetical protein SORBIDRAFT_01g010220 [Sorghum bicolor]
 gb|EER90994.1| hypothetical protein SORBIDRAFT_01g010220 [Sorghum bicolor]
Length=218

 Score = 92.0 bits (227),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 49/94 (52%), Positives = 75/94 (80%), Gaps = 0/94 (0%)
 Frame = -2

Query  434  GYNAEIAMLEVYSQSVKDeallvkavvdeeeveVIIFKGFSSSLSYGTSPDPTKSVLPAK  255
            G+N ++A +E Y++  +D+ALLVKA VD+E   V++F+GFSS+LS GT+ DP++SVLP +
Sbjct  125  GHNEDVARMERYTEDARDQALLVKARVDDEVEVVLVFRGFSSNLSGGTAADPSRSVLPER  184

Query  254  AKIKYIDRIKGPFNPSNIDYIERDIPWDAFKSLL  153
            A I+ +D ++GPF+PSNI+Y+E+ + WD FKS L
Sbjct  185  AIIQSVDVVRGPFDPSNIEYLEKGVQWDDFKSRL  218



>ref|XP_004981991.1| PREDICTED: uncharacterized protein LOC101753647 [Setaria italica]
Length=175

 Score = 90.9 bits (224),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 48/94 (51%), Positives = 74/94 (79%), Gaps = 0/94 (0%)
 Frame = -2

Query  434  GYNAEIAMLEVYSQSVKDeallvkavvdeeeveVIIFKGFSSSLSYGTSPDPTKSVLPAK  255
            G+N ++A +E Y++  +D+ALLVKA VD+E   V++F+GFSSSLS GT+ DP +S+LP +
Sbjct  81   GHNEDVARMERYTEDARDQALLVKARVDDEVEVVLVFRGFSSSLSGGTATDPARSILPER  140

Query  254  AKIKYIDRIKGPFNPSNIDYIERDIPWDAFKSLL  153
            A ++ +D +KGPF+P+NI+Y+E+ + WD FKS L
Sbjct  141  AIVQSVDVVKGPFDPNNIEYLEKGVEWDDFKSRL  174



>ref|XP_008644573.1| PREDICTED: uncharacterized protein LOC103625946 [Zea mays]
 gb|AFW67819.1| hypothetical protein ZEAMMB73_289548 [Zea mays]
Length=178

 Score = 90.5 bits (223),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 49/94 (52%), Positives = 74/94 (79%), Gaps = 0/94 (0%)
 Frame = -2

Query  434  GYNAEIAMLEVYSQSVKDeallvkavvdeeeveVIIFKGFSSSLSYGTSPDPTKSVLPAK  255
            G+N ++A +E YS+  +D+ALLVKA VD+E   V++F+GFSSSLS GT+ DP +SVLP +
Sbjct  84   GHNEDVARMERYSEDARDQALLVKARVDDEVEVVLVFRGFSSSLSGGTAADPARSVLPER  143

Query  254  AKIKYIDRIKGPFNPSNIDYIERDIPWDAFKSLL  153
            A I+ +D +KGPF+P+NI+Y+E+ + W+ F+S L
Sbjct  144  AIIQSVDVVKGPFDPNNIEYLEKGVGWEDFRSRL  177



>gb|KFK33399.1| hypothetical protein AALP_AA5G007800 [Arabis alpina]
Length=177

 Score = 86.7 bits (213),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 55/90 (61%), Positives = 71/90 (79%), Gaps = 0/90 (0%)
 Frame = -2

Query  434  GYNAEIAMLEVYSQSVKDeallvkavvdeeeveVIIFKGFSSSLSYGTSPDPTKSVLPAK  255
            GYN EIAMLE+YSQ+ ++EAL+V A+VDEEEVEV++FKG SS LS  T+ DP +SVLP +
Sbjct  78   GYNEEIAMLEIYSQTCREEALIVTAIVDEEEVEVLVFKGVSSCLSGETAVDPARSVLPER  137

Query  254  AKIKYIDRIKGPFNPSNIDYIERDIPWDAF  165
            A I  IDR+KGPFNPS I YI++ + +  F
Sbjct  138  ALITKIDRVKGPFNPSQIIYIQKGLSFQEF  167



>gb|EYU30137.1| hypothetical protein MIMGU_mgv1a014872mg [Erythranthe guttata]
Length=175

 Score = 84.3 bits (207),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 54/89 (61%), Positives = 69/89 (78%), Gaps = 0/89 (0%)
 Frame = -2

Query  419  IAMLEVYSQSVKDeallvkavvdeeeveVIIFKGFSSSLSYGTSPDPTKSVLPAKAKIKY  240
            IA+LE YSQ +KDE LLV+A+VD+E V+V+IFKGFSS LS  T  D ++SVLP +A IK 
Sbjct  83   IAVLESYSQLMKDEILLVQAMVDQELVQVLIFKGFSSCLSSRTYSDLSRSVLPTRAVIKS  142

Query  239  IDRIKGPFNPSNIDYIERDIPWDAFKSLL  153
            IDR KGPF+PSNI YIE+ + +  FK+ L
Sbjct  143  IDRAKGPFDPSNIQYIEKGLTFHVFKTRL  171



>gb|KHN34542.1| hypothetical protein glysoja_045104 [Glycine soja]
Length=69

 Score = 81.3 bits (199),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 35/57 (61%), Positives = 46/57 (81%), Gaps = 0/57 (0%)
 Frame = -2

Query  329  IFKGFSSSLSYGTSPDPTKSVLPAKAKIKYIDRIKGPFNPSNIDYIERDIPWDAFKS  159
            +F GFSS LSY TSPDPT+ +LPA+A I  IDRIKGPFNP+NI Y+++ + W+ FK+
Sbjct  8    MFPGFSSCLSYSTSPDPTRCILPARAVIVSIDRIKGPFNPANIVYLQKGVTWEKFKT  64



>ref|XP_010513977.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC104789992 
[Camelina sativa]
Length=178

 Score = 84.0 bits (206),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 51/92 (55%), Positives = 70/92 (76%), Gaps = 0/92 (0%)
 Frame = -2

Query  434  GYNAEIAMLEVYSQSVKDeallvkavvdeeeveVIIFKGFSSSLSYGTSPDPTKSVLPAK  255
            G N E+AMLE+YSQS ++EAL+V A+V++EEVEVIIFKG  S LS  T+ DP +SVLP +
Sbjct  82   GNNEEMAMLEIYSQSXREEALIVTAIVNDEEVEVIIFKGVPSCLSGETAVDPARSVLPER  141

Query  254  AKIKYIDRIKGPFNPSNIDYIERDIPWDAFKS  159
            A I  IDR++GPF+P  I +I++ + + AFK 
Sbjct  142  AVITKIDRVRGPFDPIQIHHIQKGLSFQAFKE  173



>ref|XP_001752457.1| predicted protein [Physcomitrella patens]
 gb|EDQ82696.1| predicted protein [Physcomitrella patens]
Length=92

 Score = 68.9 bits (167),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 46/92 (50%), Positives = 62/92 (67%), Gaps = 2/92 (2%)
 Frame = -2

Query  422  EIAMLEVYSQSVKDeallvkavvdeeeveVIIFKGFSSSLSYGTSPDPTKSVLPAKAKIK  243
            ++  +E Y++ V +E L V AVVD EE +VIIFKGFSSSL   T  DP + VLPA A I+
Sbjct  1    DVTRMERYTERVPNEVLRVHAVVDGEEDQVIIFKGFSSSLMRPTPDDPAELVLPATATIR  60

Query  242  YIDRIKGPFNPSNIDYIE--RDIPWDAFKSLL  153
             IDRI+GPFNP+ +  I   + + W  F++LL
Sbjct  61   GIDRIRGPFNPTKVLLIRGGKGLTWQQFQTLL  92



>ref|WP_015175393.1| hypothetical protein [Oscillatoria nigro-viridis]
 ref|YP_007114491.1| hypothetical protein Osc7112_1557 [Oscillatoria nigro-viridis 
PCC 7112]
 gb|AFZ06075.1| hypothetical protein Osc7112_1557 [Oscillatoria nigro-viridis 
PCC 7112]
Length=99

 Score = 67.4 bits (163),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 29/59 (49%), Positives = 43/59 (73%), Gaps = 0/59 (0%)
 Frame = -2

Query  329  IFKGFSSSLSYGTSPDPTKSVLPAKAKIKYIDRIKGPFNPSNIDYIERDIPWDAFKSLL  153
            IFKGFSSSL+  T+ DP   VLP +AKI  +DR++ P+NP+N  Y+++ + W+  +SLL
Sbjct  36   IFKGFSSSLTRSTASDPEVPVLPEEAKIVSVDRLESPYNPNNPRYLQQGLSWETMQSLL  94



>ref|WP_015149965.1| hypothetical protein [Oscillatoria acuminata]
 ref|YP_007087258.1| hypothetical protein Oscil6304_3780 [Oscillatoria acuminata PCC 
6304]
 gb|AFY83338.1| hypothetical protein Oscil6304_3780 [Oscillatoria acuminata PCC 
6304]
Length=101

 Score = 67.0 bits (162),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 44/86 (51%), Positives = 55/86 (64%), Gaps = 0/86 (0%)
 Frame = -2

Query  410  LEVYSQSVKDeallvkavvdeeeveVIIFKGFSSSLSYGTSPDPTKSVLPAKAKIKYIDR  231
            LE Y+Q    E LLV A +D+E  E+ IFKGFSSSL+  T+ DP   +LP   KI  IDR
Sbjct  11   LEKYTQKCPQEVLLVTAEIDQELDEITIFKGFSSSLTRPTAFDPDVPILPESGKIIKIDR  70

Query  230  IKGPFNPSNIDYIERDIPWDAFKSLL  153
            IK P NP N DYIE+ + W+  + LL
Sbjct  71   IKSPLNPENPDYIEQGLTWETIQPLL  96



>ref|WP_006635886.1| hypothetical protein [Microcoleus vaginatus]
 gb|EGK83621.1| hypothetical protein MicvaDRAFT_0124 [Microcoleus vaginatus FGP-2]
Length=99

 Score = 66.6 bits (161),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 29/59 (49%), Positives = 43/59 (73%), Gaps = 0/59 (0%)
 Frame = -2

Query  329  IFKGFSSSLSYGTSPDPTKSVLPAKAKIKYIDRIKGPFNPSNIDYIERDIPWDAFKSLL  153
            IFKGFSSSL+  T+ DP   VLP +AKI  +DR++ P+NP+N  Y+++ + W+  +SLL
Sbjct  36   IFKGFSSSLTRSTAFDPEVPVLPEEAKIVSVDRVESPYNPNNPRYLQQGLSWETMQSLL  94



>ref|WP_008316700.1| hypothetical protein [Leptolyngbya sp. PCC 6406]
Length=100

 Score = 66.2 bits (160),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 41/89 (46%), Positives = 54/89 (61%), Gaps = 0/89 (0%)
 Frame = -2

Query  419  IAMLEVYSQSVKDeallvkavvdeeeveVIIFKGFSSSLSYGTSPDPTKSVLPAKAKIKY  240
            I  LE YSQ    E LLV A +  +  +V+IF+GFSSSL   T+ DP   VLP +A I  
Sbjct  7    IQRLEAYSQQYPQEVLLVNATIGADADQVVIFRGFSSSLMRPTAFDPEVPVLPEEATITS  66

Query  239  IDRIKGPFNPSNIDYIERDIPWDAFKSLL  153
            +DR++GP+ P N  Y+ER I W  F + L
Sbjct  67   LDRLQGPYTPDNPQYLERAISWLTFATRL  95



>ref|WP_015137819.1| hypothetical protein [Nostoc sp. PCC 7524]
 ref|YP_007074963.1| hypothetical protein Nos7524_1490 [Nostoc sp. PCC 7524]
 gb|AFY47366.1| hypothetical protein Nos7524_1490 [Nostoc sp. PCC 7524]
Length=98

 Score = 65.1 bits (157),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 33/59 (56%), Positives = 39/59 (66%), Gaps = 0/59 (0%)
 Frame = -2

Query  329  IFKGFSSSLSYGTSPDPTKSVLPAKAKIKYIDRIKGPFNPSNIDYIERDIPWDAFKSLL  153
            IFKGFSSSL   T+ DP   V+P +A I  IDRI  P+NP N  YIER I W+A + LL
Sbjct  35   IFKGFSSSLMRPTAFDPEVPVIPDEATILGIDRIASPYNPENPRYIERQISWEAMQVLL  93



>ref|WP_015956033.1| hypothetical protein [Cyanothece sp. PCC 7424]
 ref|YP_002379316.1| hypothetical protein PCC7424_4075 [Cyanothece sp. PCC 7424]
 gb|ACK72448.1| conserved hypothetical protein [Cyanothece sp. PCC 7424]
Length=99

 Score = 65.1 bits (157),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 31/60 (52%), Positives = 40/60 (67%), Gaps = 0/60 (0%)
 Frame = -2

Query  332  IIFKGFSSSLSYGTSPDPTKSVLPAKAKIKYIDRIKGPFNPSNIDYIERDIPWDAFKSLL  153
            +IFKGFSSSL   T+ DP  +VLP  AKI  IDR++ P+NPSN  YI+  + W   + LL
Sbjct  35   LIFKGFSSSLMRPTAFDPEVAVLPETAKIMTIDRLESPYNPSNPRYIQTGLTWQEMEELL  94



>ref|WP_011317900.1| hypothetical protein [Anabaena variabilis]
 ref|YP_321571.1| hypothetical protein Ava_1052 [Anabaena variabilis ATCC 29413]
 gb|ABA20676.1| conserved hypothetical protein [Anabaena variabilis ATCC 29413]
Length=98

 Score = 64.7 bits (156),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 30/59 (51%), Positives = 42/59 (71%), Gaps = 0/59 (0%)
 Frame = -2

Query  329  IFKGFSSSLSYGTSPDPTKSVLPAKAKIKYIDRIKGPFNPSNIDYIERDIPWDAFKSLL  153
            IFKGFSSSL   T+ DP   V+P +A++  +DRI  P+NP +  YI+RDI W+A +S+L
Sbjct  35   IFKGFSSSLMRPTAFDPDVPVIPDEARVISVDRIASPYNPESPRYIQRDISWEAMESVL  93



>ref|WP_012629280.1| hypothetical protein [Cyanothece sp. PCC 7425]
 ref|YP_002484587.1| hypothetical protein Cyan7425_3909 [Cyanothece sp. PCC 7425]
 gb|ACL46226.1| conserved hypothetical protein [Cyanothece sp. PCC 7425]
Length=99

 Score = 64.3 bits (155),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 26/60 (43%), Positives = 42/60 (70%), Gaps = 0/60 (0%)
 Frame = -2

Query  332  IIFKGFSSSLSYGTSPDPTKSVLPAKAKIKYIDRIKGPFNPSNIDYIERDIPWDAFKSLL  153
            +IF+GFSSSL   T+ DP   +LP  A+I  +DR++GP+NP+   YI++ + W+ F+ +L
Sbjct  35   VIFRGFSSSLVRSTAADPDVPILPDTAQILSLDRLRGPYNPAQPQYIQQGLTWEDFQPIL  94



>ref|WP_017716569.1| hypothetical protein [Oscillatoria sp. PCC 10802]
Length=99

 Score = 64.3 bits (155),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 30/60 (50%), Positives = 44/60 (73%), Gaps = 0/60 (0%)
 Frame = -2

Query  332  IIFKGFSSSLSYGTSPDPTKSVLPAKAKIKYIDRIKGPFNPSNIDYIERDIPWDAFKSLL  153
            +IFKG+SSSL   T+ DP   VLPA+AKI  IDR +GP+N +N  Y+++ + W+A ++LL
Sbjct  35   MIFKGYSSSLMRPTAFDPDVPVLPAEAKIIAIDRAQGPYNQANPRYLQQGLTWEAMQALL  94



>ref|WP_017654023.1| hypothetical protein [Microchaete sp. PCC 7126]
Length=98

 Score = 63.9 bits (154),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 29/59 (49%), Positives = 43/59 (73%), Gaps = 0/59 (0%)
 Frame = -2

Query  329  IFKGFSSSLSYGTSPDPTKSVLPAKAKIKYIDRIKGPFNPSNIDYIERDIPWDAFKSLL  153
            IFKGFSSSL + T+ DP   VLP +AKI  IDR+  P++P++  YI++ + W+A ++LL
Sbjct  35   IFKGFSSSLMHSTAFDPDVPVLPDEAKILTIDRVASPYHPTSPSYIQQGLSWEAMEALL  93



>ref|WP_006453966.1| hypothetical protein [Synechococcus sp. PCC 7335]
 gb|EDX84221.1| hypothetical protein S7335_1918 [Synechococcus sp. PCC 7335]
Length=96

 Score = 63.5 bits (153),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 32/60 (53%), Positives = 39/60 (65%), Gaps = 0/60 (0%)
 Frame = -2

Query  332  IIFKGFSSSLSYGTSPDPTKSVLPAKAKIKYIDRIKGPFNPSNIDYIERDIPWDAFKSLL  153
            IIF+GFSSSL   T  DP   VLP +A I YIDR+KGP+ P    YIE++I  + F S L
Sbjct  36   IIFRGFSSSLMRPTDFDPEVPVLPREADISYIDRLKGPYQPQAPQYIEKEISLEEFISRL  95



>ref|WP_023065943.1| hypothetical protein [Lyngbya aestuarii]
 gb|ERT07787.1| hypothetical protein M595_2173 [Lyngbya aestuarii BL J]
Length=99

 Score = 63.5 bits (153),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 30/59 (51%), Positives = 41/59 (69%), Gaps = 0/59 (0%)
 Frame = -2

Query  329  IFKGFSSSLSYGTSPDPTKSVLPAKAKIKYIDRIKGPFNPSNIDYIERDIPWDAFKSLL  153
            IFKGFSSSL   T+ DP   VLP +AKI  IDR+  P+NP+  DY+++ + WD+ + LL
Sbjct  36   IFKGFSSSLMRPTAFDPDVPVLPNEAKIIKIDRVASPYNPTQPDYLQQGLTWDSIQPLL  94



>ref|WP_016953177.1| hypothetical protein [Anabaena sp. PCC 7108]
Length=99

 Score = 63.2 bits (152),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 33/59 (56%), Positives = 39/59 (66%), Gaps = 0/59 (0%)
 Frame = -2

Query  329  IFKGFSSSLSYGTSPDPTKSVLPAKAKIKYIDRIKGPFNPSNIDYIERDIPWDAFKSLL  153
            IFKGFSSSL   T+ DP   VLP +A I  IDRI  P+NP +  YIER I W+A + LL
Sbjct  36   IFKGFSSSLMRSTAFDPDVPVLPDEATIISIDRIGSPYNPESPRYIERGISWEAMQLLL  94



>ref|WP_013190764.1| hypothetical protein [Trichormus azollae]
 ref|YP_003720869.1| hypothetical protein Aazo_1558 ['Nostoc azollae' 0708]
 gb|ADI63746.1| conserved hypothetical protein ['Nostoc azollae' 0708]
Length=99

 Score = 63.2 bits (152),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 31/59 (53%), Positives = 41/59 (69%), Gaps = 0/59 (0%)
 Frame = -2

Query  329  IFKGFSSSLSYGTSPDPTKSVLPAKAKIKYIDRIKGPFNPSNIDYIERDIPWDAFKSLL  153
            +FKGFSSSL   T+ DP   VLP +AKI  IDRI  P+NP +  YI++ I W+A ++LL
Sbjct  36   VFKGFSSSLMQSTAFDPDVPVLPDEAKIISIDRIASPYNPESPRYIQQGISWEAMEALL  94



>ref|WP_009784784.1| hypothetical protein [Lyngbya sp. PCC 8106]
 gb|EAW36571.1| hypothetical protein L8106_28376 [Lyngbya sp. PCC 8106]
Length=99

 Score = 62.8 bits (151),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 30/59 (51%), Positives = 40/59 (68%), Gaps = 0/59 (0%)
 Frame = -2

Query  329  IFKGFSSSLSYGTSPDPTKSVLPAKAKIKYIDRIKGPFNPSNIDYIERDIPWDAFKSLL  153
            IFKGFSSSL   T+ DP   VLP  AKI  IDR+  P+NP+  DY+++ + WD+ + LL
Sbjct  36   IFKGFSSSLMRPTAFDPDVPVLPNTAKILKIDRVASPYNPTQPDYLQQGLTWDSIQPLL  94



>ref|WP_006618040.1| hypothetical protein [Arthrospira platensis]
 ref|YP_005072572.1| hypothetical protein [Arthrospira platensis NIES-39]
 dbj|BAI94034.1| hypothetical protein [Arthrospira platensis NIES-39]
 gb|KDR58505.1| hypothetical protein APPUASWS_004830 [Arthrospira platensis str. 
Paraca]
Length=90

 Score = 62.4 bits (150),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 31/59 (53%), Positives = 40/59 (68%), Gaps = 0/59 (0%)
 Frame = -2

Query  329  IFKGFSSSLSYGTSPDPTKSVLPAKAKIKYIDRIKGPFNPSNIDYIERDIPWDAFKSLL  153
            IFKGFSSSL   T+ DP   VLP  A+I  IDR+  P++P+N  YI+R + WD  +SLL
Sbjct  32   IFKGFSSSLMRPTAFDPDIPVLPDHAQILEIDRLLSPYDPANPKYIQRGLTWDTMQSLL  90



>ref|WP_015166200.1| hypothetical protein [Pseudanabaena sp. PCC 7367]
 ref|YP_007103672.1| hypothetical protein Pse7367_2994 [Pseudanabaena sp. PCC 7367]
 gb|AFY71244.1| hypothetical protein Pse7367_2994 [Pseudanabaena sp. PCC 7367]
Length=101

 Score = 62.4 bits (150),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 31/59 (53%), Positives = 39/59 (66%), Gaps = 0/59 (0%)
 Frame = -2

Query  329  IFKGFSSSLSYGTSPDPTKSVLPAKAKIKYIDRIKGPFNPSNIDYIERDIPWDAFKSLL  153
            IFKGFSSSL + T+ DP   V+P  AKI  +DR K P+NP   +YIER+I W  FK  +
Sbjct  36   IFKGFSSSLMHPTAFDPDMPVIPDDAKILEVDRAKAPYNPKVPEYIERNITWAQFKKKM  94



>ref|WP_011058081.1| hypothetical protein [Thermosynechococcus elongatus]
 ref|NP_683038.1| hypothetical protein tsr2248 [Thermosynechococcus elongatus BP-1]
 dbj|BAC09800.1| tsr2248 [Thermosynechococcus elongatus BP-1]
Length=98

 Score = 62.4 bits (150),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 39/86 (45%), Positives = 57/86 (66%), Gaps = 0/86 (0%)
 Frame = -2

Query  419  IAMLEVYSQSVKDeallvkavvdeeeveVIIFKGFSSSLSYGTSPDPTKSVLPAKAKIKY  240
            +A+LE YS++   E LLV+  V E+E  V+IFKG SSSL+  T  D    +LP +A I  
Sbjct  6    LALLEAYSRAHPQEVLLVEVQVGEQEEVVLIFKGVSSSLTAATVVDADVPLLPEEAVIVA  65

Query  239  IDRIKGPFNPSNIDYIERDIPWDAFK  162
            +DR++ P+NPS   Y+E+ IPW+ F+
Sbjct  66   VDRLRSPYNPSAPLYLEQGIPWEDFQ  91



>ref|WP_006621822.1| hypothetical protein [Arthrospira platensis]
 gb|EKD10009.1| hypothetical protein SPLC1_S100390 [Arthrospira platensis C1]
Length=90

 Score = 62.4 bits (150),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 31/59 (53%), Positives = 40/59 (68%), Gaps = 0/59 (0%)
 Frame = -2

Query  329  IFKGFSSSLSYGTSPDPTKSVLPAKAKIKYIDRIKGPFNPSNIDYIERDIPWDAFKSLL  153
            IFKGFSSSL   T+ DP   VLP  A+I  IDR+  P++P+N  YI+R + WD  +SLL
Sbjct  32   IFKGFSSSLMRPTAFDPDIPVLPDHAEILEIDRLVSPYDPANPKYIQRGLTWDTMQSLL  90



>ref|WP_039725434.1| hypothetical protein [Lyngbya confervoides]
 gb|KIF13766.1| hypothetical protein QP59_22515 [Aphanocapsa montana BDHKU210001]
 gb|KIF38701.1| hypothetical protein QQ91_15515 [Lyngbya confervoides BDU141951]
Length=97

 Score = 62.4 bits (150),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 42/89 (47%), Positives = 53/89 (60%), Gaps = 0/89 (0%)
 Frame = -2

Query  419  IAMLEVYSQSVKDeallvkavvdeeeveVIIFKGFSSSLSYGTSPDPTKSVLPAKAKIKY  240
            I  LE Y+    DE L+V A VD +E  V++F+GFSSSL   T+ DP   VL   A I  
Sbjct  4    IQRLEQYTFRFPDEVLMVNAQVDGDEDFVVVFRGFSSSLVKPTAADPEVPVLSEAAIIDT  63

Query  239  IDRIKGPFNPSNIDYIERDIPWDAFKSLL  153
            IDR++ P+ P N  Y+ERDIPW  F   L
Sbjct  64   IDRLQSPYTPDNPQYLERDIPWADFSDRL  92



>ref|WP_029636731.1| hypothetical protein [[Scytonema hofmanni] UTEX B 1581]
Length=99

 Score = 62.0 bits (149),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 28/60 (47%), Positives = 41/60 (68%), Gaps = 0/60 (0%)
 Frame = -2

Query  332  IIFKGFSSSLSYGTSPDPTKSVLPAKAKIKYIDRIKGPFNPSNIDYIERDIPWDAFKSLL  153
            +IFKGFSSSL+  T+ DP   VLP +AKI+ IDR+  P+NP   +YI++ + W+  +  L
Sbjct  35   VIFKGFSSSLTRSTAFDPDVPVLPDEAKIESIDRVASPYNPQMPNYIQQGLSWEVMQIFL  94



>ref|WP_039754819.1| hypothetical protein [Hassallia byssoidea]
 gb|KIF28427.1| hypothetical protein PI95_57600 [Hassallia byssoidea VB512170]
Length=99

 Score = 62.0 bits (149),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 29/60 (48%), Positives = 39/60 (65%), Gaps = 0/60 (0%)
 Frame = -2

Query  332  IIFKGFSSSLSYGTSPDPTKSVLPAKAKIKYIDRIKGPFNPSNIDYIERDIPWDAFKSLL  153
            +IFKGFSSSL   T+ DP   VLP +A I+ IDR+  P+NP    YI++ + W A + LL
Sbjct  35   VIFKGFSSSLMRSTAFDPDVPVLPDEANIESIDRVASPYNPQTPRYIQQGLSWSAMQVLL  94



>ref|WP_008056743.1| hypothetical protein [Arthrospira sp. PCC 8005]
 emb|CCE20289.1| conserved hypothetical protein [Arthrospira sp. PCC 8005]
 emb|CDM92803.1| conserved hypothetical protein [Arthrospira sp. PCC 8005]
Length=90

 Score = 61.6 bits (148),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 31/59 (53%), Positives = 39/59 (66%), Gaps = 0/59 (0%)
 Frame = -2

Query  329  IFKGFSSSLSYGTSPDPTKSVLPAKAKIKYIDRIKGPFNPSNIDYIERDIPWDAFKSLL  153
            IFKGFSSSL   T+ DP   VLP  A+I  IDR+  P++P+N  YI+R + WD   SLL
Sbjct  32   IFKGFSSSLMRPTAFDPDIPVLPDHAEILEIDRLVSPYDPANPKYIQRGLTWDTMHSLL  90



>ref|WP_015125882.1| hypothetical protein [Synechococcus sp. PCC 6312]
 ref|YP_007062885.1| hypothetical protein Syn6312_3300 [Synechococcus sp. PCC 6312]
 gb|AFY62342.1| hypothetical protein Syn6312_3300 [Synechococcus sp. PCC 6312]
Length=101

 Score = 61.6 bits (148),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 25/56 (45%), Positives = 39/56 (70%), Gaps = 0/56 (0%)
 Frame = -2

Query  332  IIFKGFSSSLSYGTSPDPTKSVLPAKAKIKYIDRIKGPFNPSNIDYIERDIPWDAF  165
            ++FKGFSSSL + T+ DP   VLP +A+I  IDR+  P++P    Y+E+++ W+ F
Sbjct  38   MVFKGFSSSLMHSTAVDPDLPVLPTQAEILTIDRLASPYHPDQPQYLEQNLTWEGF  93



>ref|WP_010996999.1| hypothetical protein [Nostoc sp. PCC 7120]
 ref|NP_486888.1| hypothetical protein asl2848 [Nostoc sp. PCC 7120]
 dbj|BAB74547.1| asl2848 [Nostoc sp. PCC 7120]
Length=98

 Score = 61.2 bits (147),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 28/59 (47%), Positives = 42/59 (71%), Gaps = 0/59 (0%)
 Frame = -2

Query  329  IFKGFSSSLSYGTSPDPTKSVLPAKAKIKYIDRIKGPFNPSNIDYIERDIPWDAFKSLL  153
            IFKGFSSSL   T+ DP   V+P +A++  +DRI  P++P +  YI+RDI W+A +++L
Sbjct  35   IFKGFSSSLMRPTAFDPDVPVIPDEARVISVDRIASPYSPESPRYIQRDISWEAMENVL  93



>ref|WP_036053294.1| hypothetical protein [Leptolyngbya sp. Heron Island J]
Length=95

 Score = 61.2 bits (147),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 30/60 (50%), Positives = 36/60 (60%), Gaps = 0/60 (0%)
 Frame = -2

Query  332  IIFKGFSSSLSYGTSPDPTKSVLPAKAKIKYIDRIKGPFNPSNIDYIERDIPWDAFKSLL  153
            +IF+GFSSSL   TS DP   VLP  A I  IDR+ GP+ P   +YIER + W  F   L
Sbjct  33   LIFRGFSSSLMRPTSSDPDVPVLPDSAVITGIDRLLGPYQPEQPNYIERQLSWAEFSQRL  92



>gb|ESA36247.1| hypothetical protein N836_07860 [Leptolyngbya sp. Heron Island 
J]
Length=97

 Score = 61.2 bits (147),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 30/60 (50%), Positives = 36/60 (60%), Gaps = 0/60 (0%)
 Frame = -2

Query  332  IIFKGFSSSLSYGTSPDPTKSVLPAKAKIKYIDRIKGPFNPSNIDYIERDIPWDAFKSLL  153
            +IF+GFSSSL   TS DP   VLP  A I  IDR+ GP+ P   +YIER + W  F   L
Sbjct  35   LIFRGFSSSLMRPTSSDPDVPVLPDSAVITGIDRLLGPYQPEQPNYIERQLSWAEFSQRL  94



>ref|WP_019501534.1| hypothetical protein [Pseudanabaena sp. PCC 6802]
Length=95

 Score = 60.8 bits (146),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 29/60 (48%), Positives = 41/60 (68%), Gaps = 0/60 (0%)
 Frame = -2

Query  332  IIFKGFSSSLSYGTSPDPTKSVLPAKAKIKYIDRIKGPFNPSNIDYIERDIPWDAFKSLL  153
            +IFKGFSSSL   T+ DP   V+P  AKI  IDR+  P+N  + +YIE++I W+ F++ L
Sbjct  35   MIFKGFSSSLVRATAFDPDVPVIPDNAKIVGIDRLAAPYNSRSPNYIEQNISWEKFQAAL  94



>ref|XP_002970183.1| hypothetical protein SELMODRAFT_410994 [Selaginella moellendorffii]
 ref|XP_002978350.1| hypothetical protein SELMODRAFT_418162 [Selaginella moellendorffii]
 gb|EFJ20336.1| hypothetical protein SELMODRAFT_418162 [Selaginella moellendorffii]
 gb|EFJ28313.1| hypothetical protein SELMODRAFT_410994 [Selaginella moellendorffii]
Length=103

 Score = 60.8 bits (146),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 26/57 (46%), Positives = 40/57 (70%), Gaps = 1/57 (2%)
 Frame = -2

Query  332  IIFKGFSSSLSYGTSPDPTKSVLPAK-AKIKYIDRIKGPFNPSNIDYIERDIPWDAF  165
            +++KG SSSL   T+ D + SVL  +   IK+IDR++ P+NPSN +YI +++ WD F
Sbjct  35   LVYKGVSSSLLKATALDLSDSVLDEENTTIKHIDRVRAPYNPSNTEYISQEMSWDDF  91



>ref|WP_015187451.1| hypothetical protein [Gloeocapsa sp. PCC 7428]
 ref|YP_007126735.1| hypothetical protein Glo7428_0997 [Gloeocapsa sp. PCC 7428]
 gb|AFZ29575.1| hypothetical protein Glo7428_0997 [Gloeocapsa sp. PCC 7428]
Length=99

 Score = 60.8 bits (146),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 30/59 (51%), Positives = 39/59 (66%), Gaps = 0/59 (0%)
 Frame = -2

Query  329  IFKGFSSSLSYGTSPDPTKSVLPAKAKIKYIDRIKGPFNPSNIDYIERDIPWDAFKSLL  153
            IFKGFSSSL   T+ DP   VL   AKI  IDR+  P+NP +  YIE+++ WD+ + LL
Sbjct  36   IFKGFSSSLMRPTAFDPEVPVLSDNAKILTIDRVASPYNPQSPRYIEQELTWDSMQVLL  94



>ref|WP_015207785.1| hypothetical protein [Cylindrospermum stagnale]
 ref|YP_007147211.1| hypothetical protein Cylst_2301 [Cylindrospermum stagnale PCC 
7417]
 gb|AFZ24531.1| hypothetical protein Cylst_2301 [Cylindrospermum stagnale PCC 
7417]
Length=98

 Score = 60.5 bits (145),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 31/59 (53%), Positives = 39/59 (66%), Gaps = 0/59 (0%)
 Frame = -2

Query  329  IFKGFSSSLSYGTSPDPTKSVLPAKAKIKYIDRIKGPFNPSNIDYIERDIPWDAFKSLL  153
            IFKGFSSSL   T+ DP   VLP + KI  IDRI  P+NP    YI++ I W+A ++LL
Sbjct  35   IFKGFSSSLMRPTAFDPDVPVLPDEVKILSIDRIASPYNPEAPCYIQQGISWEAMQALL  93



>ref|WP_017659024.1| hypothetical protein [Geitlerinema sp. PCC 7105]
Length=98

 Score = 60.1 bits (144),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 29/60 (48%), Positives = 39/60 (65%), Gaps = 0/60 (0%)
 Frame = -2

Query  332  IIFKGFSSSLSYGTSPDPTKSVLPAKAKIKYIDRIKGPFNPSNIDYIERDIPWDAFKSLL  153
            +IFKGFSSSL   T+ DP  SVLP  A I+ IDR++ P+ P N  YIE+ + W+  +  L
Sbjct  34   VIFKGFSSSLMRPTAFDPDVSVLPDDATIEKIDRLQSPYVPENPQYIEQGLTWETMQPYL  93



>ref|WP_039717135.1| hypothetical protein [Scytonema millei]
 gb|KIF19662.1| hypothetical protein QH73_42625 [Scytonema millei VB511283]
Length=99

 Score = 60.1 bits (144),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 37/86 (43%), Positives = 52/86 (60%), Gaps = 0/86 (0%)
 Frame = -2

Query  410  LEVYSQSVKDeallvkavvdeeeveVIIFKGFSSSLSYGTSPDPTKSVLPAKAKIKYIDR  231
            LE YS   K E L+V   +D     + IFKGFSSSL+  T+ DP   V+P  A+I  IDR
Sbjct  9    LEKYSAIAKQEVLIVTVEIDGASDRIAIFKGFSSSLTSPTAFDPDVPVIPDTARIVAIDR  68

Query  230  IKGPFNPSNIDYIERDIPWDAFKSLL  153
            +  P+NP +  YI++ + W+ F+ LL
Sbjct  69   VASPYNPQSPQYIQQGLTWEEFQPLL  94



>ref|WP_024125238.1| hypothetical protein [Thermosynechococcus sp. NK55a]
 ref|YP_008900362.1| hypothetical protein NK55_07835 [Thermosynechococcus sp. NK55a]
 gb|AHB88849.1| hypothetical protein NK55_07835 [Thermosynechococcus sp. NK55a]
Length=96

 Score = 60.1 bits (144),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 38/86 (44%), Positives = 56/86 (65%), Gaps = 0/86 (0%)
 Frame = -2

Query  419  IAMLEVYSQSVKDeallvkavvdeeeveVIIFKGFSSSLSYGTSPDPTKSVLPAKAKIKY  240
            +A+LE YS++   E LLV+  V E+E  ++IFKG SSSL+  T  D    +LP +A I  
Sbjct  4    LALLEAYSRAHPQEVLLVEVRVGEQEEGILIFKGVSSSLTGATVVDADVPLLPEEAMIVA  63

Query  239  IDRIKGPFNPSNIDYIERDIPWDAFK  162
            +DR++ P+NPS   Y+ER I W+ F+
Sbjct  64   VDRLRSPYNPSAPVYLERGILWEDFQ  89



>ref|WP_015155545.1| hypothetical protein [Chroococcidiopsis thermalis]
 ref|YP_007092869.1| hypothetical protein Chro_3543 [Chroococcidiopsis thermalis PCC 
7203]
 gb|AFY89000.1| hypothetical protein Chro_3543 [Chroococcidiopsis thermalis PCC 
7203]
Length=99

 Score = 60.1 bits (144),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 28/59 (47%), Positives = 40/59 (68%), Gaps = 0/59 (0%)
 Frame = -2

Query  329  IFKGFSSSLSYGTSPDPTKSVLPAKAKIKYIDRIKGPFNPSNIDYIERDIPWDAFKSLL  153
            IFKGFSSSL+  T+ DP   V+P  A+I  IDR+  P+NP +  YI++ + W+ F+ LL
Sbjct  36   IFKGFSSSLTSPTAFDPDVPVIPDTARIVAIDRVASPYNPQSPQYIQQGLTWEEFQPLL  94



>ref|WP_015081467.1| hypothetical protein [Anabaena sp. 90]
 ref|YP_006998148.1| hypothetical protein ANA_C13682 [Anabaena sp. 90]
 gb|AFW96335.1| hypothetical protein ANA_C13682 [Anabaena sp. 90]
Length=99

 Score = 60.1 bits (144),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/59 (51%), Positives = 39/59 (66%), Gaps = 0/59 (0%)
 Frame = -2

Query  329  IFKGFSSSLSYGTSPDPTKSVLPAKAKIKYIDRIKGPFNPSNIDYIERDIPWDAFKSLL  153
            +FKGFSSSL   T+ DP   VLP KA I  IDRI  P+NP +  Y+++DI W+  + LL
Sbjct  36   VFKGFSSSLMRPTAYDPDVPVLPDKATIIAIDRIASPYNPDSPRYLQQDISWEDMQVLL  94



>ref|WP_009626744.1| hypothetical protein [Pseudanabaena biceps]
 gb|ELS33138.1| hypothetical protein Pse7429DRAFT_1668 [Pseudanabaena biceps 
PCC 7429]
Length=94

 Score = 59.7 bits (143),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 28/60 (47%), Positives = 40/60 (67%), Gaps = 0/60 (0%)
 Frame = -2

Query  332  IIFKGFSSSLSYGTSPDPTKSVLPAKAKIKYIDRIKGPFNPSNIDYIERDIPWDAFKSLL  153
            +IFKGFSSSL   T+ DP   V+P +A+I  IDR+  P+ P+  +YI++ I W+ FK  L
Sbjct  35   MIFKGFSSSLMRSTAFDPDVPVIPDRAEILTIDRLTAPYRPNQPNYIQQGITWERFKDYL  94



>ref|WP_026786137.1| hypothetical protein [Planktothrix rubescens]
Length=97

 Score = 59.7 bits (143),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 29/59 (49%), Positives = 39/59 (66%), Gaps = 0/59 (0%)
 Frame = -2

Query  329  IFKGFSSSLSYGTSPDPTKSVLPAKAKIKYIDRIKGPFNPSNIDYIERDIPWDAFKSLL  153
            IFKGFSSSL   T+ DP  SV+P  AKI  IDR+  P+NP+   YI++ + W+  + LL
Sbjct  34   IFKGFSSSLMRPTAFDPDISVIPNTAKILEIDRLLSPYNPTEPHYIQQGLTWEIMQELL  92



>ref|WP_015216102.1| hypothetical protein [Anabaena cylindrica]
 ref|YP_007158394.1| hypothetical protein Anacy_4116 [Anabaena cylindrica PCC 7122]
 gb|AFZ59484.1| hypothetical protein Anacy_4116 [Anabaena cylindrica PCC 7122]
Length=99

 Score = 59.7 bits (143),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 29/59 (49%), Positives = 39/59 (66%), Gaps = 0/59 (0%)
 Frame = -2

Query  329  IFKGFSSSLSYGTSPDPTKSVLPAKAKIKYIDRIKGPFNPSNIDYIERDIPWDAFKSLL  153
            +FKGFSSSL   T+ DP   VLP +A I+ IDRI  P+NP +  YI++ I W+  + LL
Sbjct  36   VFKGFSSSLMRPTASDPDVPVLPDEAIIRSIDRIASPYNPESPRYIQQGISWEDMQVLL  94



>ref|WP_013190775.1| hypothetical protein [Trichormus azollae]
 ref|YP_003720880.1| hypothetical protein Aazo_1574 ['Nostoc azollae' 0708]
 gb|ADI63757.1| conserved hypothetical protein ['Nostoc azollae' 0708]
Length=77

 Score = 58.9 bits (141),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 29/59 (49%), Positives = 39/59 (66%), Gaps = 0/59 (0%)
 Frame = -2

Query  329  IFKGFSSSLSYGTSPDPTKSVLPAKAKIKYIDRIKGPFNPSNIDYIERDIPWDAFKSLL  153
            +FKGFSSSL   T+ DP   VLP +A    IDRI  P+NP +  YI++ I W+A ++LL
Sbjct  14   VFKGFSSSLMQSTAFDPDVPVLPDEATTISIDRIGSPYNPESPRYIQQGISWEAMEALL  72



>ref|WP_015167205.1| hypothetical protein [Synechococcus sp. PCC 7502]
 ref|YP_007104681.1| hypothetical protein Syn7502_00382 [Synechococcus sp. PCC 7502]
 gb|AFY72546.1| hypothetical protein Syn7502_00382 [Synechococcus sp. PCC 7502]
Length=94

 Score = 59.3 bits (142),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 37/78 (47%), Positives = 49/78 (63%), Gaps = 0/78 (0%)
 Frame = -2

Query  413  MLEVYSQSVKDeallvkavvdeeeveVIIFKGFSSSLSYGTSPDPTKSVLPAKAKIKYID  234
             LE Y+Q    E LLV   +D    EV++FKGFSS LS  T+ DP   V+P  A+I  ID
Sbjct  7    QLEQYTQRRSQEVLLVTLDIDGTTEEVVVFKGFSSCLSRATAYDPDVPVIPENAQIITID  66

Query  233  RIKGPFNPSNIDYIERDI  180
            R++ P+NPS  +YIER +
Sbjct  67   RLQAPYNPSQPNYIERSL  84



>ref|WP_008185317.1| hypothetical protein [Moorea producens]
 gb|EGJ32268.1| hypothetical protein LYNGBM3L_27290 [Moorea producens 3L]
Length=98

 Score = 58.9 bits (141),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 29/59 (49%), Positives = 40/59 (68%), Gaps = 0/59 (0%)
 Frame = -2

Query  329  IFKGFSSSLSYGTSPDPTKSVLPAKAKIKYIDRIKGPFNPSNIDYIERDIPWDAFKSLL  153
            IFKGFSSSL   TS DP  +VLPA+AKI  IDR+  P+NP +  Y+++ +  +  + LL
Sbjct  35   IFKGFSSSLMRPTSFDPDVAVLPAQAKIISIDRVAAPYNPQSPRYLQQGLTLETMEKLL  93



>ref|WP_010475320.1| hypothetical protein [Acaryochloris sp. CCMEE 5410]
Length=97

 Score = 58.9 bits (141),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 27/55 (49%), Positives = 39/55 (71%), Gaps = 0/55 (0%)
 Frame = -2

Query  329  IFKGFSSSLSYGTSPDPTKSVLPAKAKIKYIDRIKGPFNPSNIDYIERDIPWDAF  165
            IF+GFSSSL   T+ D    VLPA A I  IDR++GP++P+N  Y+++D+ W+ F
Sbjct  34   IFRGFSSSLMRPTAFDIDIPVLPADANILSIDRLQGPYDPANPQYLQQDLSWEDF  88



>ref|WP_015134086.1| hypothetical protein [Leptolyngbya sp. PCC 7376]
 ref|YP_007071155.1| hypothetical protein Lepto7376_2019 [Leptolyngbya sp. PCC 7376]
 gb|AFY38321.1| hypothetical protein Lepto7376_2019 [Leptolyngbya sp. PCC 7376]
Length=101

 Score = 58.9 bits (141),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 35/86 (41%), Positives = 56/86 (65%), Gaps = 0/86 (0%)
 Frame = -2

Query  410  LEVYSQSVKDeallvkavvdeeeveVIIFKGFSSSLSYGTSPDPTKSVLPAKAKIKYIDR  231
            LE YS++  +E LL+     + E +V+IFKGFSSSL   T  +P  SV  A A+   +DR
Sbjct  11   LEAYSRNHPEEVLLITTTEADIEDQVMIFKGFSSSLMRPTDSNPDNSVFTANAEFVCLDR  70

Query  230  IKGPFNPSNIDYIERDIPWDAFKSLL  153
            ++ P+ P++  YIE+++ W+A ++LL
Sbjct  71   LQSPYLPNDPTYIEQNMFWEAMQNLL  96



>ref|WP_009341839.1| hypothetical protein [Raphidiopsis brookii]
 gb|EFA74045.1| conserved hypothetical protein [Raphidiopsis brookii D9]
Length=103

 Score = 58.9 bits (141),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 31/66 (47%), Positives = 40/66 (61%), Gaps = 0/66 (0%)
 Frame = -2

Query  329  IFKGFSSSLSYGTSPDPTKSVLPAKAKIKYIDRIKGPFNPSNIDYIERDIPWDAFKSLL*  150
            +FKGFSSSL   T+ DP  +VLP  A I  IDRI  P+NP +  YI++ I W+    LL 
Sbjct  36   VFKGFSSSLMRPTAFDPDVAVLPEGATIVTIDRIASPYNPESPRYIQQGISWETMAVLLS  95

Query  149  LIFYFV  132
             +  FV
Sbjct  96   EVGIFV  101



>ref|WP_028082846.1| hypothetical protein [Dolichospermum circinale]
Length=99

 Score = 58.5 bits (140),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 29/59 (49%), Positives = 38/59 (64%), Gaps = 0/59 (0%)
 Frame = -2

Query  329  IFKGFSSSLSYGTSPDPTKSVLPAKAKIKYIDRIKGPFNPSNIDYIERDIPWDAFKSLL  153
            +FKGFSSSL   T+ DP   VL   AKI  IDRI  P++P +  Y+E+DI W+  + LL
Sbjct  36   VFKGFSSSLMRATAFDPDVPVLSEAAKIITIDRIASPYHPESPRYLEKDISWENMQVLL  94



>ref|WP_026734554.1| hypothetical protein [Fischerella sp. PCC 9605]
Length=99

 Score = 58.5 bits (140),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 28/59 (47%), Positives = 38/59 (64%), Gaps = 0/59 (0%)
 Frame = -2

Query  329  IFKGFSSSLSYGTSPDPTKSVLPAKAKIKYIDRIKGPFNPSNIDYIERDIPWDAFKSLL  153
            IFKGFSSSL   T  DP   VLP +AK+  IDR+  P+NP    YI++++ W+  + LL
Sbjct  36   IFKGFSSSLMRPTCFDPDVPVLPEEAKLLKIDRVASPYNPEAPRYIQQELTWEDMQVLL  94



>ref|WP_039204792.1| hypothetical protein [Aphanizomenon flos-aquae]
 gb|KHG39182.1| hypothetical protein OA07_25205 [Aphanizomenon flos-aquae 2012/KM/D3]
Length=99

 Score = 58.5 bits (140),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 29/59 (49%), Positives = 38/59 (64%), Gaps = 0/59 (0%)
 Frame = -2

Query  329  IFKGFSSSLSYGTSPDPTKSVLPAKAKIKYIDRIKGPFNPSNIDYIERDIPWDAFKSLL  153
            +FKGFSSSL   T+ DP   VLP  A I  IDRI  P+NP +  Y+++DI W+  + LL
Sbjct  36   VFKGFSSSLMRPTAYDPDVPVLPDTATIITIDRIASPYNPDSPHYLQQDISWEDMQVLL  94



>ref|WP_017749886.1| hypothetical protein [Scytonema hofmanni]
Length=97

 Score = 58.5 bits (140),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 28/59 (47%), Positives = 39/59 (66%), Gaps = 0/59 (0%)
 Frame = -2

Query  329  IFKGFSSSLSYGTSPDPTKSVLPAKAKIKYIDRIKGPFNPSNIDYIERDIPWDAFKSLL  153
            IFKGFSSSL   T+ DP   V+P +AKI  IDR+  P+NP    YI++DI W+  + ++
Sbjct  36   IFKGFSSSLMRPTAFDPDIPVIPDEAKIIKIDRVASPYNPEAPRYIQQDISWENMQKIM  94



>ref|WP_006527740.1| hypothetical protein [Gloeocapsa sp. PCC 73106]
 gb|ELR99439.1| hypothetical protein GLO73106DRAFT_00032900 [Gloeocapsa sp. PCC 
73106]
Length=94

 Score = 58.2 bits (139),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 34/93 (37%), Positives = 54/93 (58%), Gaps = 0/93 (0%)
 Frame = -2

Query  431  YNAEIAMLEVYSQSVKDeallvkavvdeeeveVIIFKGFSSSLSYGTSPDPTKSVLPAKA  252
            +N+    LE YS    +E L+V    +    ++II+KGFSSSL+  T+ DP   ++P +A
Sbjct  2    FNSPGQKLEQYSSKHPEEVLIVTIDREGMSEQIIIYKGFSSSLTNSTAFDPEIPLIPPEA  61

Query  251  KIKYIDRIKGPFNPSNIDYIERDIPWDAFKSLL  153
            KI  IDR+K P+ P +  Y+++D+ W     L 
Sbjct  62   KIIKIDRVKSPYQPDSPKYLQQDVSWQEMTELF  94



>ref|WP_017321586.1| hypothetical protein [cyanobacterium PCC 7702]
Length=99

 Score = 58.2 bits (139),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 28/59 (47%), Positives = 37/59 (63%), Gaps = 0/59 (0%)
 Frame = -2

Query  329  IFKGFSSSLSYGTSPDPTKSVLPAKAKIKYIDRIKGPFNPSNIDYIERDIPWDAFKSLL  153
            IFKGFSSSL   T+ DP   VLP +A I  IDR+  P++P    YI+R + W+  + LL
Sbjct  36   IFKGFSSSLMRPTAFDPDVPVLPEEANILQIDRVASPYDPKTPRYIQRGLSWEQMQVLL  94



>ref|WP_009544038.1| MULTISPECIES: hypothetical protein [Cyanothece]
 ref|YP_001802625.1| hypothetical protein cce_1209 [Cyanothece sp. ATCC 51142]
 gb|ACB50559.1| conserved hypothetical protein [Cyanothece sp. ATCC 51142]
Length=94

 Score = 57.8 bits (138),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 28/60 (47%), Positives = 40/60 (67%), Gaps = 0/60 (0%)
 Frame = -2

Query  332  IIFKGFSSSLSYGTSPDPTKSVLPAKAKIKYIDRIKGPFNPSNIDYIERDIPWDAFKSLL  153
            +IFKGFSSS+   T  +P   +L   A I  IDRIK P+NP+N +YI++++ W   +SLL
Sbjct  35   MIFKGFSSSIMKPTEFNPDVPMLSDTANIISIDRIKSPYNPNNPNYIQKELTWKEMESLL  94



>ref|WP_017291070.1| hypothetical protein [Leptolyngbya boryana]
Length=99

 Score = 57.8 bits (138),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 27/59 (46%), Positives = 40/59 (68%), Gaps = 0/59 (0%)
 Frame = -2

Query  329  IFKGFSSSLSYGTSPDPTKSVLPAKAKIKYIDRIKGPFNPSNIDYIERDIPWDAFKSLL  153
            IFKGFSSSL   TS DP   VLP  A ++ +DR++ P+NP++  ++E+ + W  F+ LL
Sbjct  36   IFKGFSSSLMNPTSFDPDMPVLPDDAIVQSVDRLESPYNPNHPRFVEQGLSWLEFQRLL  94



>ref|WP_038072413.1| hypothetical protein [Tolypothrix bouteillei]
 gb|KIE08860.1| hypothetical protein DA73_0230635 [Tolypothrix bouteillei VB521301]
Length=98

 Score = 57.8 bits (138),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 28/59 (47%), Positives = 37/59 (63%), Gaps = 0/59 (0%)
 Frame = -2

Query  329  IFKGFSSSLSYGTSPDPTKSVLPAKAKIKYIDRIKGPFNPSNIDYIERDIPWDAFKSLL  153
            IFKGFSSSL   T+ DP   V+P  AKI  IDR+  P+NP    YI++DI W   + ++
Sbjct  36   IFKGFSSSLMRPTAFDPDIPVIPNDAKIIKIDRVASPYNPEAPRYIQQDISWQNMEEIM  94



>ref|WP_026798040.1| hypothetical protein [Planktothrix prolifica]
Length=97

 Score = 57.8 bits (138),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 27/59 (46%), Positives = 38/59 (64%), Gaps = 0/59 (0%)
 Frame = -2

Query  329  IFKGFSSSLSYGTSPDPTKSVLPAKAKIKYIDRIKGPFNPSNIDYIERDIPWDAFKSLL  153
            IFKGFSSSL   T+ DP   ++P  AKI  IDR+  P+NP+   YI++ + W+  + LL
Sbjct  34   IFKGFSSSLMRPTAFDPDIPIIPNTAKILEIDRLSSPYNPTEPHYIQQGLTWEMMQELL  92



>ref|WP_015126622.1| hypothetical protein [Calothrix sp. PCC 7507]
 ref|YP_007063628.1| hypothetical protein Cal7507_0295 [Calothrix sp. PCC 7507]
 gb|AFY30794.1| hypothetical protein Cal7507_0295 [Calothrix sp. PCC 7507]
Length=107

 Score = 58.2 bits (139),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 27/59 (46%), Positives = 39/59 (66%), Gaps = 0/59 (0%)
 Frame = -2

Query  329  IFKGFSSSLSYGTSPDPTKSVLPAKAKIKYIDRIKGPFNPSNIDYIERDIPWDAFKSLL  153
            +FKGFSSSL   T+ DP   VLP +A I  IDR+  P+NP    YI++ + W++ ++LL
Sbjct  44   VFKGFSSSLMRPTAFDPDVPVLPDEANILSIDRVASPYNPEAPRYIQQGLSWESMQALL  102



>ref|WP_017298869.1| hypothetical protein [Nodosilinea nodulosa]
Length=97

 Score = 57.8 bits (138),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 28/60 (47%), Positives = 37/60 (62%), Gaps = 0/60 (0%)
 Frame = -2

Query  332  IIFKGFSSSLSYGTSPDPTKSVLPAKAKIKYIDRIKGPFNPSNIDYIERDIPWDAFKSLL  153
            +IF+GFSSSL + T+ DP   VLP  A IK ID + GP+NP+   Y+ R + W     LL
Sbjct  33   LIFRGFSSSLMHPTAADPEVPVLPETADIKAIDIMAGPYNPAAPQYLHRGLSWADMIPLL  92



>gb|KEI68362.1| hypothetical protein A19Y_3607 [Planktothrix agardhii NIVA-CYA 
126/8]
Length=94

 Score = 57.4 bits (137),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 27/59 (46%), Positives = 38/59 (64%), Gaps = 0/59 (0%)
 Frame = -2

Query  329  IFKGFSSSLSYGTSPDPTKSVLPAKAKIKYIDRIKGPFNPSNIDYIERDIPWDAFKSLL  153
            IFKGFSSSL   T+ DP   ++P  AKI  IDR+  P+NP+   YI++ + W+  + LL
Sbjct  31   IFKGFSSSLMRPTAFDPDIPIIPNTAKILEIDRLSSPYNPTEPHYIQQGLTWEMMQELL  89



>ref|WP_026794694.1| MULTISPECIES: hypothetical protein [Planktothrix]
Length=97

 Score = 57.4 bits (137),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 28/59 (47%), Positives = 38/59 (64%), Gaps = 0/59 (0%)
 Frame = -2

Query  329  IFKGFSSSLSYGTSPDPTKSVLPAKAKIKYIDRIKGPFNPSNIDYIERDIPWDAFKSLL  153
            IFKGFSSSL   T+ DP   V+P  AKI  IDR+  P+NP+   YI++ + W+  + LL
Sbjct  34   IFKGFSSSLMRPTAFDPDIPVIPNTAKILEIDRLLSPYNPTEPHYIQQGLTWEIMQELL  92



>ref|WP_027404705.1| hypothetical protein [Aphanizomenon flos-aquae]
Length=99

 Score = 57.4 bits (137),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 29/59 (49%), Positives = 37/59 (63%), Gaps = 0/59 (0%)
 Frame = -2

Query  329  IFKGFSSSLSYGTSPDPTKSVLPAKAKIKYIDRIKGPFNPSNIDYIERDIPWDAFKSLL  153
            +FKGFSSSL   T+ DP   VLP  A I  IDRI  P+NP +  Y ++DI W+  + LL
Sbjct  36   VFKGFSSSLMRPTAYDPDVPVLPDTATIITIDRIASPYNPDSPHYFQQDISWEDMQVLL  94



>ref|WP_036834509.1| hypothetical protein [Planktothrix agardhii]
Length=94

 Score = 57.4 bits (137),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 28/59 (47%), Positives = 38/59 (64%), Gaps = 0/59 (0%)
 Frame = -2

Query  329  IFKGFSSSLSYGTSPDPTKSVLPAKAKIKYIDRIKGPFNPSNIDYIERDIPWDAFKSLL  153
            IFKGFSSSL   T+ DP   V+P  AKI  IDR+  P+NP+   YI++ + W+  + LL
Sbjct  31   IFKGFSSSLMRPTAFDPDIPVIPNTAKILEIDRLLSPYNPTEPHYIQQGLTWEIMQELL  89



>ref|WP_035987726.1| hypothetical protein [Leptolyngbya sp. KIOST-1]
Length=99

 Score = 57.4 bits (137),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 27/60 (45%), Positives = 39/60 (65%), Gaps = 0/60 (0%)
 Frame = -2

Query  332  IIFKGFSSSLSYGTSPDPTKSVLPAKAKIKYIDRIKGPFNPSNIDYIERDIPWDAFKSLL  153
            +IF+GFSSSL + T+ DP   VLP  A+I+ ID + GP+NP +  Y++R + W     LL
Sbjct  35   LIFRGFSSSLMHPTAADPEVPVLPEAAEIQAIDIMAGPYNPISPRYLQRGLAWADMLPLL  94



>ref|WP_009633047.1| hypothetical protein [Synechocystis sp. PCC 7509]
Length=99

 Score = 57.0 bits (136),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 27/60 (45%), Positives = 42/60 (70%), Gaps = 0/60 (0%)
 Frame = -2

Query  332  IIFKGFSSSLSYGTSPDPTKSVLPAKAKIKYIDRIKGPFNPSNIDYIERDIPWDAFKSLL  153
            IIFKGFSSSL+  T+ DP   ++P +AKI  IDR+  P+NP +  Y+++ + W++ + LL
Sbjct  35   IIFKGFSSSLTRPTAFDPDVPMIPKQAKIISIDRLSSPYNPDSPCYLQQGLTWESMEFLL  94



>ref|WP_006276769.1| hypothetical protein [Cylindrospermopsis raciborskii]
 gb|EFA70318.1| conserved hypothetical protein [Cylindrospermopsis raciborskii 
CS-505]
Length=103

 Score = 57.4 bits (137),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 29/59 (49%), Positives = 37/59 (63%), Gaps = 0/59 (0%)
 Frame = -2

Query  329  IFKGFSSSLSYGTSPDPTKSVLPAKAKIKYIDRIKGPFNPSNIDYIERDIPWDAFKSLL  153
            +FKGFSSSL   T+ DP  +VLP  A I  IDRI  P+NP +  YI++ I W+    LL
Sbjct  36   VFKGFSSSLMRPTAFDPDVAVLPEGAIIVTIDRIASPYNPESPRYIQQGISWETMAVLL  94



>ref|WP_028090312.1| hypothetical protein [Dolichospermum circinale]
Length=99

 Score = 57.0 bits (136),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 28/58 (48%), Positives = 37/58 (64%), Gaps = 0/58 (0%)
 Frame = -2

Query  329  IFKGFSSSLSYGTSPDPTKSVLPAKAKIKYIDRIKGPFNPSNIDYIERDIPWDAFKSL  156
            +FKGFSSSL   T+ DP   VL   AKI  IDRI  P++P +  Y+E+DI W+  + L
Sbjct  36   VFKGFSSSLMRSTAFDPDVPVLSESAKIITIDRIASPYHPESPSYLEKDISWENMQVL  93



>ref|WP_009556281.1| hypothetical protein [Oscillatoriales cyanobacterium JSC-12]
 gb|EKQ69372.1| hypothetical protein OsccyDRAFT_1999 [Oscillatoriales cyanobacterium 
JSC-12]
Length=97

 Score = 57.0 bits (136),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 27/60 (45%), Positives = 39/60 (65%), Gaps = 0/60 (0%)
 Frame = -2

Query  332  IIFKGFSSSLSYGTSPDPTKSVLPAKAKIKYIDRIKGPFNPSNIDYIERDIPWDAFKSLL  153
            +IFKGFSSSL + T+ DP   VLP  A I  IDR++ P+ P +  YI++ + W+  + LL
Sbjct  33   LIFKGFSSSLMHPTAFDPDIPVLPENAVIIQIDRLESPYTPDSPRYIQQKLTWETMEPLL  92



>ref|WP_027254932.1| hypothetical protein [Planktothrix agardhii]
Length=97

 Score = 57.0 bits (136),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 27/59 (46%), Positives = 38/59 (64%), Gaps = 0/59 (0%)
 Frame = -2

Query  329  IFKGFSSSLSYGTSPDPTKSVLPAKAKIKYIDRIKGPFNPSNIDYIERDIPWDAFKSLL  153
            IFKGFSSSL   T+ DP   ++P  AKI  IDR+  P+NP+   YI++ + W+  + LL
Sbjct  34   IFKGFSSSLMRPTAFDPDIPIIPNTAKILEIDRLLSPYNPTEPHYIQKGLTWEIMQELL  92



>ref|WP_012164699.1| hypothetical protein [Acaryochloris marina]
 ref|YP_001518691.1| hypothetical protein AM1_4395 [Acaryochloris marina MBIC11017]
 gb|ABW29374.1| conserved hypothetical protein [Acaryochloris marina MBIC11017]
Length=97

 Score = 57.0 bits (136),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 26/59 (44%), Positives = 40/59 (68%), Gaps = 0/59 (0%)
 Frame = -2

Query  329  IFKGFSSSLSYGTSPDPTKSVLPAKAKIKYIDRIKGPFNPSNIDYIERDIPWDAFKSLL  153
            IF+GFSSSL   T+ D    +LP  A I  IDR++GP++P+N  Y+++D+ W+ F + L
Sbjct  34   IFRGFSSSLMRPTAFDIDIPILPEDANILSIDRLQGPYDPANPQYLQQDLSWEDFLTHL  92



>ref|WP_015225572.1| hypothetical protein [Halothece sp. PCC 7418]
 ref|YP_007167910.1| hypothetical protein PCC7418_1507 [Halothece sp. PCC 7418]
 gb|AFZ43696.1| hypothetical protein PCC7418_1507 [Halothece sp. PCC 7418]
Length=98

 Score = 57.0 bits (136),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 31/90 (34%), Positives = 48/90 (53%), Gaps = 14/90 (16%)
 Frame = -2

Query  422  EIAMLEVYSQSVKDeallvkavvdeeeveVIIFKGFSSSLSYGTSPDPTKSVLPAKAKIK  243
            E+ +LEV ++   D+               +IFKGFSSSL+  T+ DP   +L  +A I 
Sbjct  18   EVLLLEVETEGETDQI--------------LIFKGFSSSLTGATAYDPDVPLLAEEATIL  63

Query  242  YIDRIKGPFNPSNIDYIERDIPWDAFKSLL  153
             IDR + P++P N  Y+E+ I W+  +  L
Sbjct  64   SIDRAQSPYSPENPQYLEQGISWETMEQRL  93



>ref|WP_036843313.1| hypothetical protein [Planktothrix agardhii]
Length=94

 Score = 56.6 bits (135),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 27/59 (46%), Positives = 38/59 (64%), Gaps = 0/59 (0%)
 Frame = -2

Query  329  IFKGFSSSLSYGTSPDPTKSVLPAKAKIKYIDRIKGPFNPSNIDYIERDIPWDAFKSLL  153
            IFKGFSSSL   T+ DP   ++P  AKI  IDR+  P+NP+   YI++ + W+  + LL
Sbjct  31   IFKGFSSSLMRPTAFDPDIPIIPNTAKILEIDRLLSPYNPTEPHYIQQGLTWEIMQELL  89



>ref|WP_017319221.1| hypothetical protein [Mastigocladopsis repens]
Length=99

 Score = 56.6 bits (135),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 28/59 (47%), Positives = 37/59 (63%), Gaps = 0/59 (0%)
 Frame = -2

Query  329  IFKGFSSSLSYGTSPDPTKSVLPAKAKIKYIDRIKGPFNPSNIDYIERDIPWDAFKSLL  153
            IF+GFSSSL   T+ DP   VLP +AKI  ID +  P+NP    YI++ + WD  + LL
Sbjct  36   IFRGFSSSLMRSTAFDPDVPVLPDEAKILTIDLVASPYNPEAPRYIQQGLSWDDMQVLL  94



>ref|WP_006516334.1| hypothetical protein [Leptolyngbya sp. PCC 7375]
 gb|EKV01946.1| hypothetical protein Lepto7375DRAFT_4141 [Leptolyngbya sp. PCC 
7375]
Length=96

 Score = 56.2 bits (134),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 27/60 (45%), Positives = 35/60 (58%), Gaps = 0/60 (0%)
 Frame = -2

Query  332  IIFKGFSSSLSYGTSPDPTKSVLPAKAKIKYIDRIKGPFNPSNIDYIERDIPWDAFKSLL  153
            ++F+GFSSSL   T+ DP   VLP  A I  IDR+  P+ P   +Y+ER I W  F   L
Sbjct  35   LVFRGFSSSLMRPTAADPDVPVLPDDAVITTIDRLASPYQPDCPNYLERQISWADFSQRL  94



>ref|WP_015202343.1| hypothetical protein [Crinalium epipsammum]
 ref|YP_007141731.1| hypothetical protein Cri9333_1323 [Crinalium epipsammum PCC 9333]
 gb|AFZ12221.1| hypothetical protein Cri9333_1323 [Crinalium epipsammum PCC 9333]
Length=94

 Score = 56.2 bits (134),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 27/59 (46%), Positives = 38/59 (64%), Gaps = 0/59 (0%)
 Frame = -2

Query  329  IFKGFSSSLSYGTSPDPTKSVLPAKAKIKYIDRIKGPFNPSNIDYIERDIPWDAFKSLL  153
            IFKG+SSSL   T+ DP   VLP  AKI  ID ++ P+NP +  YI++ + W+  + LL
Sbjct  36   IFKGYSSSLMQATAFDPDVPVLPDDAKILCIDIVRSPYNPESPVYIQQGLTWETIQHLL  94



>ref|WP_015115883.1| hypothetical protein [Nostoc sp. PCC 7107]
 ref|YP_007052845.1| hypothetical protein Nos7107_5185 [Nostoc sp. PCC 7107]
 gb|AFY45695.1| hypothetical protein Nos7107_5185 [Nostoc sp. PCC 7107]
Length=99

 Score = 56.2 bits (134),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 29/59 (49%), Positives = 37/59 (63%), Gaps = 0/59 (0%)
 Frame = -2

Query  329  IFKGFSSSLSYGTSPDPTKSVLPAKAKIKYIDRIKGPFNPSNIDYIERDIPWDAFKSLL  153
            +FKGFSSSL   T+ DP   VL  +A I  IDRI  P+NP    YIE+ I W+  ++LL
Sbjct  36   VFKGFSSSLMRPTAFDPDVPVLLDEATILSIDRIASPYNPEAPRYIEKGISWEVMQALL  94



>ref|WP_012407490.1| hypothetical protein [Nostoc punctiforme]
 ref|YP_001864408.1| hypothetical protein Npun_R0713 [Nostoc punctiforme PCC 73102]
 gb|ACC79465.1| conserved hypothetical protein [Nostoc punctiforme PCC 73102]
Length=98

 Score = 55.8 bits (133),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 29/59 (49%), Positives = 38/59 (64%), Gaps = 0/59 (0%)
 Frame = -2

Query  329  IFKGFSSSLSYGTSPDPTKSVLPAKAKIKYIDRIKGPFNPSNIDYIERDIPWDAFKSLL  153
            IFKGFSSSL   T+ D    VLP +A I  IDR+  P+NP    YI++ I W+A ++LL
Sbjct  35   IFKGFSSSLMRPTAFDADVPVLPDEAIILNIDRVASPYNPEAPRYIQQGISWEAMEALL  93



>ref|WP_015173767.1| hypothetical protein [Geitlerinema sp. PCC 7407]
 ref|YP_007111255.1| hypothetical protein GEI7407_3736 [Geitlerinema sp. PCC 7407]
 gb|AFY68203.1| hypothetical protein GEI7407_3736 [Geitlerinema sp. PCC 7407]
Length=99

 Score = 55.8 bits (133),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 27/60 (45%), Positives = 38/60 (63%), Gaps = 0/60 (0%)
 Frame = -2

Query  332  IIFKGFSSSLSYGTSPDPTKSVLPAKAKIKYIDRIKGPFNPSNIDYIERDIPWDAFKSLL  153
            +IF+GFSSSL   T+ DP   VLP +A I  IDR++GP++P    YI + + W    +LL
Sbjct  35   MIFRGFSSSLVRPTAFDPDVPVLPDEAVIVQIDRVEGPYDPQQPRYIAQGLSWPEMAALL  94



>ref|WP_012594268.1| MULTISPECIES: hypothetical protein [Cyanothece]
 ref|YP_002371149.1| hypothetical protein PCC8801_0916 [Cyanothece sp. PCC 8801]
 ref|YP_003136712.1| hypothetical protein Cyan8802_0943 [Cyanothece sp. PCC 8802]
 gb|ACK64993.1| conserved hypothetical protein [Cyanothece sp. PCC 8801]
 gb|ACU99876.1| conserved hypothetical protein [Cyanothece sp. PCC 8802]
Length=94

 Score = 55.5 bits (132),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 26/60 (43%), Positives = 38/60 (63%), Gaps = 0/60 (0%)
 Frame = -2

Query  332  IIFKGFSSSLSYGTSPDPTKSVLPAKAKIKYIDRIKGPFNPSNIDYIERDIPWDAFKSLL  153
            +IFKGFSSSL   T  DP   +L  +A I  IDR+K P+NP+   Y+E+ + W   +++L
Sbjct  33   MIFKGFSSSLIKPTDFDPDVPILSEEATIISIDRLKSPYNPNKPQYLEKGLSWQQMQAML  92



>ref|WP_008274178.1| hypothetical protein [Cyanothece sp. CCY0110]
 gb|EAZ92610.1| hypothetical protein CY0110_23626 [Cyanothece sp. CCY0110]
Length=94

 Score = 55.5 bits (132),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 29/60 (48%), Positives = 39/60 (65%), Gaps = 0/60 (0%)
 Frame = -2

Query  332  IIFKGFSSSLSYGTSPDPTKSVLPAKAKIKYIDRIKGPFNPSNIDYIERDIPWDAFKSLL  153
            +IFKGFSSS+   T  +P   VL   A I  IDRIK P+NP++ +YIE+ + W   +SLL
Sbjct  35   MIFKGFSSSIMKPTEFNPDIPVLSDIANIISIDRIKSPYNPNDPNYIEQGLTWKQMESLL  94



>ref|WP_026093356.1| hypothetical protein [Calothrix sp. PCC 7103]
Length=99

 Score = 55.1 bits (131),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 27/59 (46%), Positives = 35/59 (59%), Gaps = 0/59 (0%)
 Frame = -2

Query  329  IFKGFSSSLSYGTSPDPTKSVLPAKAKIKYIDRIKGPFNPSNIDYIERDIPWDAFKSLL  153
            +FKGFSSSL  GT  DP   VLP  A I  ID +  P+NP    YIE+++ W   ++ L
Sbjct  36   VFKGFSSSLVRGTPSDPDVPVLPDDANILSIDIVASPYNPEAPRYIEQNLSWSVMETRL  94



>ref|WP_006100502.1| hypothetical protein [Coleofasciculus chthonoplastes]
 gb|EDX76018.1| hypothetical protein MC7420_5452 [Coleofasciculus chthonoplastes 
PCC 7420]
Length=101

 Score = 55.1 bits (131),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 27/59 (46%), Positives = 38/59 (64%), Gaps = 0/59 (0%)
 Frame = -2

Query  329  IFKGFSSSLSYGTSPDPTKSVLPAKAKIKYIDRIKGPFNPSNIDYIERDIPWDAFKSLL  153
            I+KGFSSSL   T+ DP   V+P +A+I  IDR+  P+NP    YI++ + W A + LL
Sbjct  38   IYKGFSSSLMRPTAFDPDVPVIPPEAEIVKIDRVASPYNPDAPRYIQQGLTWKAIQPLL  96



>ref|WP_015120208.1| hypothetical protein [Rivularia sp. PCC 7116]
 ref|YP_007057193.1| hypothetical protein Riv7116_4215 [Rivularia sp. PCC 7116]
 gb|AFY56646.1| hypothetical protein Riv7116_4215 [Rivularia sp. PCC 7116]
Length=99

 Score = 55.1 bits (131),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 27/59 (46%), Positives = 39/59 (66%), Gaps = 0/59 (0%)
 Frame = -2

Query  329  IFKGFSSSLSYGTSPDPTKSVLPAKAKIKYIDRIKGPFNPSNIDYIERDIPWDAFKSLL  153
            IF+GFSSSL   T+ DP   V+P +A I  +DR+K PF P +  YIE+ +  +A ++LL
Sbjct  36   IFRGFSSSLMRPTAFDPDIPVIPQEATIISVDRLKAPFVPESPQYIEQGLSVEAIQTLL  94



>ref|WP_015227940.1| hypothetical protein [Dactylococcopsis salina]
 ref|YP_007170284.1| hypothetical protein Dacsa_0112 [Dactylococcopsis salina PCC 
8305]
 gb|AFZ48927.1| hypothetical protein Dacsa_0112 [Dactylococcopsis salina PCC 
8305]
Length=97

 Score = 54.7 bits (130),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 27/60 (45%), Positives = 36/60 (60%), Gaps = 0/60 (0%)
 Frame = -2

Query  332  IIFKGFSSSLSYGTSPDPTKSVLPAKAKIKYIDRIKGPFNPSNIDYIERDIPWDAFKSLL  153
            +IFKGFSSSL+  T+ DP   VL  +A I  IDR   P++P N  Y+E+ I W+     L
Sbjct  33   LIFKGFSSSLTGATAYDPDVPVLSEEATILSIDRAVSPYSPENPQYLEQGISWETMAQRL  92



>ref|WP_006198108.1| hypothetical protein [Nodularia spumigena]
 gb|EAW43736.1| hypothetical protein N9414_22233 [Nodularia spumigena CCY9414]
 gb|AHJ31163.1| Pyruvate dehydrogenase complex, dehydrogenase (E1) component 
[Nodularia spumigena CCY9414]
Length=100

 Score = 54.7 bits (130),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 29/59 (49%), Positives = 39/59 (66%), Gaps = 0/59 (0%)
 Frame = -2

Query  329  IFKGFSSSLSYGTSPDPTKSVLPAKAKIKYIDRIKGPFNPSNIDYIERDIPWDAFKSLL  153
            IFKGFSSSL   T+ DP   V+P +A I  +DRIK P+NP    YI++ I  +A ++LL
Sbjct  36   IFKGFSSSLMRPTAFDPDVPVIPDEAIILSVDRIKSPYNPEAPRYIQQGISGEAMENLL  94



>ref|WP_036530788.1| hypothetical protein [Neosynechococcus sphagnicola]
 gb|KGF73814.1| hypothetical protein DO97_10445 [Neosynechococcus sphagnicola 
sy1]
Length=98

 Score = 54.3 bits (129),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 24/60 (40%), Positives = 41/60 (68%), Gaps = 0/60 (0%)
 Frame = -2

Query  332  IIFKGFSSSLSYGTSPDPTKSVLPAKAKIKYIDRIKGPFNPSNIDYIERDIPWDAFKSLL  153
            +IF+G+SSSL+  T+ DP   VLP +A+I  IDR++ P++P    Y+++ + W+  + LL
Sbjct  35   VIFRGYSSSLTRPTAFDPDVPVLPLEAEILKIDRLQSPYDPQAPRYLQQGLIWEEMELLL  94



>ref|WP_015182392.1| hypothetical protein [Microcoleus sp. PCC 7113]
 ref|YP_007121649.1| hypothetical protein Mic7113_2441 [Microcoleus sp. PCC 7113]
 gb|AFZ18243.1| hypothetical protein Mic7113_2441 [Microcoleus sp. PCC 7113]
Length=99

 Score = 54.3 bits (129),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 27/59 (46%), Positives = 37/59 (63%), Gaps = 0/59 (0%)
 Frame = -2

Query  329  IFKGFSSSLSYGTSPDPTKSVLPAKAKIKYIDRIKGPFNPSNIDYIERDIPWDAFKSLL  153
            IFKGFSSSL   T+ DP   VLP +A I  IDR+  P+NP    Y+++ + W+  + LL
Sbjct  36   IFKGFSSSLMRPTAFDPDIPVLPPEAHIISIDRVASPYNPDAPRYLQQGLTWNTMQLLL  94



>ref|WP_038026554.1| hypothetical protein [Synechococcus sp. PCC 7336]
Length=99

 Score = 53.9 bits (128),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 37/89 (42%), Positives = 54/89 (61%), Gaps = 0/89 (0%)
 Frame = -2

Query  419  IAMLEVYSQSVKDeallvkavvdeeeveVIIFKGFSSSLSYGTSPDPTKSVLPAKAKIKY  240
            IA LE+YS +   E LLV+A ++ E  EV+++KG+SSSL   T+ D    VLP    I+ 
Sbjct  6    IARLELYSLAHPQEVLLVEATIEAERDEVLVYKGYSSSLMRPTAADLDIPVLPEGTTIEA  65

Query  239  IDRIKGPFNPSNIDYIERDIPWDAFKSLL  153
            I R++ P+ P +  Y+ER I W  F+  L
Sbjct  66   ISRLRAPYTPRSPQYLERSILWHQFEQRL  94



>ref|WP_009457211.1| MULTISPECIES: hypothetical protein [Fischerella]
 gb|EHC12915.1| hypothetical protein FJSC11DRAFT_2532 [Fischerella sp. JSC-11]
Length=99

 Score = 53.9 bits (128),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 28/59 (47%), Positives = 36/59 (61%), Gaps = 0/59 (0%)
 Frame = -2

Query  329  IFKGFSSSLSYGTSPDPTKSVLPAKAKIKYIDRIKGPFNPSNIDYIERDIPWDAFKSLL  153
            IFKGFSSSL   T+ DP   VLP +A I  ID +  P+NP    YI++ + W   +SLL
Sbjct  36   IFKGFSSSLMRPTAFDPDVPVLPEEANILRIDIVASPYNPEAPRYIQQGLTWKDMESLL  94



>ref|WP_004159286.1| hypothetical protein [Microcystis aeruginosa]
 ref|YP_001659245.1| hypothetical protein MAE_42310 [Microcystis aeruginosa NIES-843]
 dbj|BAG04053.1| hypothetical protein MAE_42310 [Microcystis aeruginosa NIES-843]
 emb|CCH96078.1| conserved hypothetical protein [Microcystis aeruginosa PCC 9717]
Length=94

 Score = 53.9 bits (128),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 25/59 (42%), Positives = 38/59 (64%), Gaps = 0/59 (0%)
 Frame = -2

Query  329  IFKGFSSSLSYGTSPDPTKSVLPAKAKIKYIDRIKGPFNPSNIDYIERDIPWDAFKSLL  153
            IFKGFSSSL+  T  DP   ++P  A++  IDR+  P++P N  YI+ ++  +  +SLL
Sbjct  34   IFKGFSSSLTRSTPYDPDIPIIPETARVIKIDRLASPYHPLNPRYIQENLTLEEMQSLL  92



>ref|WP_017293082.1| hypothetical protein [Geminocystis herdmanii]
Length=94

 Score = 53.5 bits (127),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 39/81 (48%), Positives = 53/81 (65%), Gaps = 0/81 (0%)
 Frame = -2

Query  428  NAEIAMLEVYSQSVKDeallvkavvdeeeveVIIFKGFSSSLSYGTSPDPTKSVLPAKAK  249
            N  I +LE YSQ    E L+V A  ++EEVE++IFKGFSS+LS  T+ DP   +L   A+
Sbjct  2    NINIQVLETYSQQHPQEVLIVTAKDNDEEVEIMIFKGFSSNLSGSTAFDPDLPILSPNAQ  61

Query  248  IKYIDRIKGPFNPSNIDYIER  186
            I  +DR   P+NPSN  YI++
Sbjct  62   IIKLDRAYSPYNPSNPQYIQK  82



>ref|WP_015200791.1| hypothetical protein [Calothrix parietina]
 ref|YP_007140153.1| hypothetical protein Cal6303_5295 [Calothrix sp. PCC 6303]
 gb|AFZ04181.1| hypothetical protein Cal6303_5295 [Calothrix sp. PCC 6303]
Length=99

 Score = 53.5 bits (127),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 25/59 (42%), Positives = 37/59 (63%), Gaps = 0/59 (0%)
 Frame = -2

Query  329  IFKGFSSSLSYGTSPDPTKSVLPAKAKIKYIDRIKGPFNPSNIDYIERDIPWDAFKSLL  153
            IFKGFSSSL   T+ DP   +    A I  IDR+  P+NP  + Y+++ + W++ +SLL
Sbjct  36   IFKGFSSSLMRPTNFDPDVPIFSDDAVIISIDRVASPYNPDAVKYLQQGLSWESMRSLL  94



>ref|WP_022607677.1| hypothetical protein [Rubidibacter lacunae]
 gb|ERN41020.1| hypothetical protein KR51_00024400 [Rubidibacter lacunae KORDI 
51-2]
Length=99

 Score = 53.5 bits (127),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 27/59 (46%), Positives = 36/59 (61%), Gaps = 0/59 (0%)
 Frame = -2

Query  329  IFKGFSSSLSYGTSPDPTKSVLPAKAKIKYIDRIKGPFNPSNIDYIERDIPWDAFKSLL  153
            +FKGFSSSL   T+ DP   VLP  A+I  IDR+  P+ P+N  YIER +     ++ L
Sbjct  36   VFKGFSSSLVRSTAFDPDVPVLPESAEILSIDRVASPYVPANPHYIERGLSLSQMEARL  94



>ref|WP_008197515.1| hypothetical protein [Microcystis sp. T1-4]
 emb|CCI30859.1| conserved hypothetical protein [Microcystis sp. T1-4]
Length=94

 Score = 53.1 bits (126),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 26/59 (44%), Positives = 37/59 (63%), Gaps = 0/59 (0%)
 Frame = -2

Query  329  IFKGFSSSLSYGTSPDPTKSVLPAKAKIKYIDRIKGPFNPSNIDYIERDIPWDAFKSLL  153
            IFKGFSSSL+  T  DP   ++P  A I  IDR+  P++P N  YI+ ++  +  +SLL
Sbjct  34   IFKGFSSSLTRSTPYDPDIPIIPETATIIRIDRLASPYHPLNPRYIQENLTLEEIQSLL  92



>ref|WP_011612833.1| hypothetical protein [Trichodesmium erythraeum]
 ref|YP_722961.1| hypothetical protein Tery_3387 [Trichodesmium erythraeum IMS101]
 gb|ABG52488.1| conserved hypothetical protein [Trichodesmium erythraeum IMS101]
Length=99

 Score = 53.1 bits (126),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 27/59 (46%), Positives = 38/59 (64%), Gaps = 0/59 (0%)
 Frame = -2

Query  329  IFKGFSSSLSYGTSPDPTKSVLPAKAKIKYIDRIKGPFNPSNIDYIERDIPWDAFKSLL  153
            IFKGFSSSL   T+ +P   VLP  AKI  +D ++ P+NP    YI++ + W+  +SLL
Sbjct  36   IFKGFSSSLMQPTAFNPDVPVLPETAKIISLDILESPYNPEAPVYIKQGLTWEQMQSLL  94



>ref|WP_037217597.1| hypothetical protein [Richelia intracellularis]
 emb|CDN11322.1| Pyruvate dehydrogenase complex, dehydrogenase (E1) component 
[Richelia intracellularis]
Length=99

 Score = 53.1 bits (126),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 28/59 (47%), Positives = 36/59 (61%), Gaps = 0/59 (0%)
 Frame = -2

Query  329  IFKGFSSSLSYGTSPDPTKSVLPAKAKIKYIDRIKGPFNPSNIDYIERDIPWDAFKSLL  153
            IFKGFSSSL   T+ D    V+P  AKI  IDRI  P+NP    YI++ + W+  + LL
Sbjct  36   IFKGFSSSLMRPTAFDADVPVIPDGAKITTIDRIASPYNPEVPSYIQQGLTWEDMQVLL  94



>ref|WP_016878692.1| hypothetical protein [Chlorogloeopsis fritschii]
Length=99

 Score = 53.1 bits (126),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 25/59 (42%), Positives = 38/59 (64%), Gaps = 0/59 (0%)
 Frame = -2

Query  329  IFKGFSSSLSYGTSPDPTKSVLPAKAKIKYIDRIKGPFNPSNIDYIERDIPWDAFKSLL  153
            IF+GFSSSL   T+ DP   +LP +A I  +DR+  P+NP    YI++ + W+  ++LL
Sbjct  36   IFRGFSSSLMRPTAFDPDVPILPDEAIILKVDRVYSPYNPEAPRYIQQGLTWEDMQALL  94



>ref|WP_004163598.1| hypothetical protein [Microcystis aeruginosa]
 emb|CCI35155.1| conserved hypothetical protein [Microcystis aeruginosa PCC 9701]
Length=94

 Score = 53.1 bits (126),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 26/59 (44%), Positives = 37/59 (63%), Gaps = 0/59 (0%)
 Frame = -2

Query  329  IFKGFSSSLSYGTSPDPTKSVLPAKAKIKYIDRIKGPFNPSNIDYIERDIPWDAFKSLL  153
            IFKGFSSSL+  T  DP   ++P  A I  IDR+  P++P N  YI+ ++  +  +SLL
Sbjct  34   IFKGFSSSLTRSTPYDPDIPIIPETATIIKIDRLASPYHPLNPRYIQENLTLEEMQSLL  92



>ref|WP_002781197.1| hypothetical protein [Microcystis aeruginosa]
 emb|CCI15195.1| conserved hypothetical protein [Microcystis aeruginosa PCC 9806]
Length=94

 Score = 53.1 bits (126),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 26/59 (44%), Positives = 37/59 (63%), Gaps = 0/59 (0%)
 Frame = -2

Query  329  IFKGFSSSLSYGTSPDPTKSVLPAKAKIKYIDRIKGPFNPSNIDYIERDIPWDAFKSLL  153
            IFKGFSSSL+  T  DP   ++P  A I  IDR+  P++P N  YI+ ++  +  +SLL
Sbjct  34   IFKGFSSSLTRSTPYDPDIPIIPETATIIKIDRLASPYHPLNPRYIQENLTLEEMQSLL  92



>ref|WP_027842242.1| hypothetical protein [Mastigocoleus testarum]
Length=99

 Score = 53.1 bits (126),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 28/59 (47%), Positives = 37/59 (63%), Gaps = 0/59 (0%)
 Frame = -2

Query  329  IFKGFSSSLSYGTSPDPTKSVLPAKAKIKYIDRIKGPFNPSNIDYIERDIPWDAFKSLL  153
            IF+GF+SSL   TS DP   VLP  A I  IDR++ P+NP    YIE+ +  +  +SLL
Sbjct  36   IFRGFASSLMRPTSFDPDIPVLPDNATIITIDRLESPYNPETPRYIEQGMSRENMESLL  94



>ref|WP_016879525.1| hypothetical protein, partial [Chlorogloeopsis fritschii]
Length=74

 Score = 52.4 bits (124),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 25/59 (42%), Positives = 38/59 (64%), Gaps = 0/59 (0%)
 Frame = -2

Query  329  IFKGFSSSLSYGTSPDPTKSVLPAKAKIKYIDRIKGPFNPSNIDYIERDIPWDAFKSLL  153
            IF+GFSSSL   T+ DP   +LP +A I  +DR+  P+NP    YI++ + W+  ++LL
Sbjct  11   IFRGFSSSLMRPTAFDPDVPILPDEAIILKVDRVYSPYNPEAPRYIQQGLTWEDMQALL  69



>ref|WP_026719712.1| hypothetical protein [Fischerella sp. PCC 9431]
Length=99

 Score = 52.8 bits (125),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 27/59 (46%), Positives = 36/59 (61%), Gaps = 0/59 (0%)
 Frame = -2

Query  329  IFKGFSSSLSYGTSPDPTKSVLPAKAKIKYIDRIKGPFNPSNIDYIERDIPWDAFKSLL  153
            IFKGFSSSL   T+ DP   VLP +A I  ID +  P+NP    YI++ + W   ++LL
Sbjct  36   IFKGFSSSLMRPTAFDPDVPVLPEEANIVSIDIVASPYNPEAPRYIQQGLTWKDMETLL  94



>ref|WP_016869501.1| hypothetical protein [Fischerella muscicola]
Length=99

 Score = 52.8 bits (125),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 27/59 (46%), Positives = 36/59 (61%), Gaps = 0/59 (0%)
 Frame = -2

Query  329  IFKGFSSSLSYGTSPDPTKSVLPAKAKIKYIDRIKGPFNPSNIDYIERDIPWDAFKSLL  153
            I+KGFSSSL   T+ DP   VLP +A I  ID +  P+NP    YI++ + W   +SLL
Sbjct  36   IYKGFSSSLMRPTAFDPDVPVLPEQANILRIDIVASPYNPEAPRYIQQALTWKDMESLL  94



>ref|WP_004162902.1| hypothetical protein [Microcystis aeruginosa]
 emb|CCI30117.1| conserved hypothetical protein [Microcystis aeruginosa PCC 9809]
Length=94

 Score = 52.4 bits (124),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 26/59 (44%), Positives = 37/59 (63%), Gaps = 0/59 (0%)
 Frame = -2

Query  329  IFKGFSSSLSYGTSPDPTKSVLPAKAKIKYIDRIKGPFNPSNIDYIERDIPWDAFKSLL  153
            IFKGFSSSL+  T  DP   ++P  A I  IDR+  P++P N  YI+ ++  +  +SLL
Sbjct  34   IFKGFSSSLTRSTPYDPDIPIIPETATIIKIDRLVSPYHPLNPRYIQENLSLEEMQSLL  92



>ref|WP_015142371.1| hypothetical protein [Pleurocapsa minor]
 ref|YP_007079620.1| hypothetical protein Ple7327_0630 [Pleurocapsa sp. PCC 7327]
 gb|AFY76063.1| hypothetical protein Ple7327_0630 [Pleurocapsa sp. PCC 7327]
Length=99

 Score = 52.4 bits (124),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 26/60 (43%), Positives = 38/60 (63%), Gaps = 0/60 (0%)
 Frame = -2

Query  332  IIFKGFSSSLSYGTSPDPTKSVLPAKAKIKYIDRIKGPFNPSNIDYIERDIPWDAFKSLL  153
            +IFKGFSSSL   T+ DP   +L   AKI  IDR+  P+NP+   YI++ +  +  ++LL
Sbjct  35   VIFKGFSSSLMRPTAFDPDVPILSEDAKIIRIDRLASPYNPAEPRYIQQGLTLEQMEALL  94



>ref|WP_016858983.1| hypothetical protein [Fischerella muscicola]
Length=99

 Score = 52.4 bits (124),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 27/59 (46%), Positives = 36/59 (61%), Gaps = 0/59 (0%)
 Frame = -2

Query  329  IFKGFSSSLSYGTSPDPTKSVLPAKAKIKYIDRIKGPFNPSNIDYIERDIPWDAFKSLL  153
            IFKGFSSSL   T+ DP   VLP +A I  ID +  P+NP    YI++ + W   ++LL
Sbjct  36   IFKGFSSSLMRPTAFDPDVPVLPEEANILKIDIVASPYNPKAPRYIQQGLTWKDMETLL  94



>ref|WP_017312305.1| hypothetical protein [Fischerella sp. PCC 9339]
Length=99

 Score = 52.0 bits (123),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 27/59 (46%), Positives = 36/59 (61%), Gaps = 0/59 (0%)
 Frame = -2

Query  329  IFKGFSSSLSYGTSPDPTKSVLPAKAKIKYIDRIKGPFNPSNIDYIERDIPWDAFKSLL  153
            IFKGFSSSL   T+ DP   VLP +A I  ID +  P+NP    YI++ + W   ++LL
Sbjct  36   IFKGFSSSLMRPTAFDPDVPVLPEEADILKIDIVASPYNPEAPRYIQQGLSWKDMETLL  94



>ref|WP_002788842.1| hypothetical protein [Microcystis aeruginosa]
 emb|CCI18801.1| conserved hypothetical protein [Microcystis aeruginosa PCC 9807]
Length=94

 Score = 51.6 bits (122),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 25/59 (42%), Positives = 37/59 (63%), Gaps = 0/59 (0%)
 Frame = -2

Query  329  IFKGFSSSLSYGTSPDPTKSVLPAKAKIKYIDRIKGPFNPSNIDYIERDIPWDAFKSLL  153
            IFKGFSSSL+  T  DP   ++P  A+I  IDR+  P++P    YI+ ++  +  +SLL
Sbjct  34   IFKGFSSSLTRSTPYDPDIPIIPETARIIKIDRLASPYHPLKPRYIQENLTLEEMQSLL  92



>dbj|GAL91702.1| pyruvate dehydrogenase complex, dehydrogenase (E1) component 
[Microcystis aeruginosa NIES-44]
Length=94

 Score = 51.6 bits (122),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/59 (42%), Positives = 37/59 (63%), Gaps = 0/59 (0%)
 Frame = -2

Query  329  IFKGFSSSLSYGTSPDPTKSVLPAKAKIKYIDRIKGPFNPSNIDYIERDIPWDAFKSLL  153
            IFKGFSSSL+  T  DP   ++P  A+I  IDR+  P++P    YI+ ++  +  +SLL
Sbjct  34   IFKGFSSSLTRSTPYDPDIPLIPETARIIRIDRLASPYHPLKPRYIQENLTLEEMQSLL  92



>ref|WP_017305885.1| hypothetical protein [Spirulina subsalsa]
Length=99

 Score = 51.6 bits (122),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 26/46 (57%), Positives = 30/46 (65%), Gaps = 0/46 (0%)
 Frame = -2

Query  329  IFKGFSSSLSYGTSPDPTKSVLPAKAKIKYIDRIKGPFNPSNIDYI  192
            IFKG SSSL   T+ DP   VLP +A I  IDRI+ P+NP   DYI
Sbjct  38   IFKGVSSSLMRPTAFDPDVPVLPQQAMILSIDRIRSPYNPEQPDYI  83



>ref|WP_002770137.1| hypothetical protein [Microcystis aeruginosa]
 emb|CCI03839.1| conserved hypothetical protein [Microcystis aeruginosa PCC 9443]
Length=94

 Score = 51.2 bits (121),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 25/59 (42%), Positives = 37/59 (63%), Gaps = 0/59 (0%)
 Frame = -2

Query  329  IFKGFSSSLSYGTSPDPTKSVLPAKAKIKYIDRIKGPFNPSNIDYIERDIPWDAFKSLL  153
            IFKGFSSSL+  T  DP   ++P  A+I  IDR+  P++P    YI+ ++  +  +SLL
Sbjct  34   IFKGFSSSLTRSTPYDPDIPLIPETARIIKIDRLASPYHPLKPRYIQENLTLEEMQSLL  92



>ref|WP_011127162.1| hypothetical protein [Synechococcus sp. WH 8102]
 ref|NP_896383.1| hypothetical protein SYNW0288 [Synechococcus sp. WH 8102]
 emb|CAE06803.1| conserved hypothetical protein [Synechococcus sp. WH 8102]
Length=97

 Score = 51.2 bits (121),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 20/43 (47%), Positives = 33/43 (77%), Gaps = 0/43 (0%)
 Frame = -2

Query  332  IIFKGFSSSLSYGTSPDPTKSVLPAKAKIKYIDRIKGPFNPSN  204
            +IF+GFSSS ++ T+ DP  SVLP + +++ ++ ++GP NPSN
Sbjct  36   LIFRGFSSSTTHPTAFDPDASVLPPETRLEQVELLQGPLNPSN  78



>ref|WP_002743915.1| hypothetical protein [Microcystis aeruginosa]
 emb|CAO87251.1| unnamed protein product [Microcystis aeruginosa PCC 7806]
 emb|CCH95171.1| conserved hypothetical protein [Microcystis aeruginosa PCC 9432]
 emb|CCI07061.1| conserved hypothetical protein [Microcystis aeruginosa PCC 7941]
 emb|CCI23404.1| conserved hypothetical protein [Microcystis aeruginosa PCC 9808]
 gb|ELS47965.1| hypothetical protein C789_2266 [Microcystis aeruginosa DIANCHI905]
Length=94

 Score = 50.1 bits (118),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 25/59 (42%), Positives = 36/59 (61%), Gaps = 0/59 (0%)
 Frame = -2

Query  329  IFKGFSSSLSYGTSPDPTKSVLPAKAKIKYIDRIKGPFNPSNIDYIERDIPWDAFKSLL  153
            IFKGFSSSL+  T  DP   ++P  A I  IDR+  P++P N  YI+ ++  +  + LL
Sbjct  34   IFKGFSSSLTRSTPYDPDIPIIPETATIIKIDRLASPYHPLNPRYIQENLSLEEMQFLL  92



>ref|WP_002739558.1| hypothetical protein [Microcystis aeruginosa]
 gb|ELP52075.1| hypothetical protein O53_4970 [Microcystis aeruginosa TAIHU98]
 gb|EPF21100.1| hypothetical protein MAESPC_03046 [Microcystis aeruginosa SPC777]
Length=94

 Score = 50.1 bits (118),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 25/59 (42%), Positives = 36/59 (61%), Gaps = 0/59 (0%)
 Frame = -2

Query  329  IFKGFSSSLSYGTSPDPTKSVLPAKAKIKYIDRIKGPFNPSNIDYIERDIPWDAFKSLL  153
            IFKGFSSSL+  T  DP   ++P  A I  IDR+  P++P N  YI+ ++  +  + LL
Sbjct  34   IFKGFSSSLTRSTPYDPDIPIIPETATIIKIDRLASPYHPLNPRYIQENLSLEEMQFLL  92



>ref|WP_016516547.1| hypothetical protein [Microcystis aeruginosa]
 gb|EPF19565.1| hypothetical protein MAESPC_03846 [Microcystis aeruginosa SPC777]
Length=94

 Score = 50.1 bits (118),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 25/59 (42%), Positives = 36/59 (61%), Gaps = 0/59 (0%)
 Frame = -2

Query  329  IFKGFSSSLSYGTSPDPTKSVLPAKAKIKYIDRIKGPFNPSNIDYIERDIPWDAFKSLL  153
            IFKGFSSSL+  T  DP   ++P  A I  IDR+  P++P N  YI+ ++  +  + LL
Sbjct  34   IFKGFSSSLTRSTPYDPDIPIIPETATIIKIDRLASPYHPLNPRYIQENLSLEEMQFLL  92



>ref|WP_024969053.1| hypothetical protein [Microcystis aeruginosa]
Length=94

 Score = 50.1 bits (118),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 25/59 (42%), Positives = 36/59 (61%), Gaps = 0/59 (0%)
 Frame = -2

Query  329  IFKGFSSSLSYGTSPDPTKSVLPAKAKIKYIDRIKGPFNPSNIDYIERDIPWDAFKSLL  153
            IFKGFSSSL+  T  DP   ++P  A I  IDR+  P++P N  YI+ ++  +  + LL
Sbjct  34   IFKGFSSSLTRSTPYDPDIPIIPETATIIKIDRLASPYHPLNPRYIQENLSLEEMQFLL  92



>ref|WP_019505122.1| hypothetical protein [Pleurocapsa sp. PCC 7319]
Length=100

 Score = 50.1 bits (118),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 25/60 (42%), Positives = 38/60 (63%), Gaps = 0/60 (0%)
 Frame = -2

Query  332  IIFKGFSSSLSYGTSPDPTKSVLPAKAKIKYIDRIKGPFNPSNIDYIERDIPWDAFKSLL  153
            +I+ GFSSSL   T+ DP   V+   +KI  IDR+  P+NP N +YIE  +  +A +++L
Sbjct  36   MIYGGFSSSLMTATAFDPDIPVIAPDSKIISIDRLASPYNPDNPEYIEPGLTLEAMETIL  95



>ref|WP_013323108.1| hypothetical protein [Cyanothece sp. PCC 7822]
 ref|YP_003888290.1| hypothetical protein Cyan7822_3060 [Cyanothece sp. PCC 7822]
 gb|ADN15015.1| conserved hypothetical protein [Cyanothece sp. PCC 7822]
Length=99

 Score = 50.1 bits (118),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 25/60 (42%), Positives = 36/60 (60%), Gaps = 0/60 (0%)
 Frame = -2

Query  332  IIFKGFSSSLSYGTSPDPTKSVLPAKAKIKYIDRIKGPFNPSNIDYIERDIPWDAFKSLL  153
            +IFKGFSSSL   T+ D    ++P  A+I  IDR+  P+NP+N  YI+  +     + LL
Sbjct  35   LIFKGFSSSLMGATAADADVPLIPETAEIISIDRLLSPYNPNNPRYIQAGLSLAQMEELL  94



>ref|WP_007305124.1| hypothetical protein [Crocosphaera watsonii]
 gb|EAM51313.1| hypothetical protein CwatDRAFT_4390 [Crocosphaera watsonii WH 
8501]
Length=94

 Score = 49.3 bits (116),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/59 (39%), Positives = 36/59 (61%), Gaps = 0/59 (0%)
 Frame = -2

Query  332  IIFKGFSSSLSYGTSPDPTKSVLPAKAKIKYIDRIKGPFNPSNIDYIERDIPWDAFKSL  156
            +IFKGFSSSL   T  +    ++   A+I  IDR++ P+NP    YIE+ + W+  ++L
Sbjct  35   MIFKGFSSSLMGSTEFNAEIPLISETAEIISIDRLQSPYNPQEPKYIEKGLTWEKMENL  93



>ref|WP_015219976.1| hypothetical protein [Cyanobacterium aponinum]
 ref|YP_007162295.1| hypothetical protein Cyan10605_2165 [Cyanobacterium aponinum 
PCC 10605]
 gb|AFZ54251.1| hypothetical protein Cyan10605_2165 [Cyanobacterium aponinum 
PCC 10605]
Length=98

 Score = 49.3 bits (116),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 38/89 (43%), Positives = 58/89 (65%), Gaps = 1/89 (1%)
 Frame = -2

Query  419  IAMLEVYSQSVKDeallvkavvdeeeveVIIFKGFSSSLSYGTSPDPTKSVLPAKAKIKY  240
            I  +E YS++   E L+++A  ++EEVE++IFKGFSS+L+  T+ DP   +L    +I  
Sbjct  4    IQEIEKYSENHPQEVLILRARDNQEEVEIMIFKGFSSNLTGSTAFDPDMPILSPDGEIIS  63

Query  239  IDRIKGPFNPSNIDYIERDI-PWDAFKSL  156
             DRI  P+NP+N  YIE++I P +  K L
Sbjct  64   CDRILSPYNPNNPQYIEKNISPSELLKLL  92



>ref|WP_036009008.1| hypothetical protein [Leptolyngbya sp. JSC-1]
Length=99

 Score = 48.1 bits (113),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 26/59 (44%), Positives = 35/59 (59%), Gaps = 0/59 (0%)
 Frame = -2

Query  329  IFKGFSSSLSYGTSPDPTKSVLPAKAKIKYIDRIKGPFNPSNIDYIERDIPWDAFKSLL  153
            IFKGFSSSL   T  DP   +LPA  +I  IDR++ P+NP    YI++ +     + LL
Sbjct  36   IFKGFSSSLMRPTDFDPDVPMLPAGTQIIAIDRLQSPYNPLAPRYIQQGLSLSDMEVLL  94



>ref|WP_011377546.1| hypothetical protein [Synechococcus elongatus]
 ref|YP_399382.1| hypothetical protein Synpcc7942_0363 [Synechococcus elongatus 
PCC 7942]
 gb|ABB56395.1| conserved hypothetical protein [Synechococcus elongatus PCC 7942]
 gb|AJD56556.1| hypothetical protein M744_01180 [Synechococcus sp. UTEX 2973]
Length=94

 Score = 47.8 bits (112),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 30/69 (43%), Positives = 41/69 (59%), Gaps = 0/69 (0%)
 Frame = -2

Query  419  IAMLEVYSQSVKDeallvkavvdeeeveVIIFKGFSSSLSYGTSPDPTKSVLPAKAKIKY  240
            I  LE YS   +D  L V A    + VE+++F+GFSSSL+  T  DP   VLPA A I+ 
Sbjct  5    IHQLEQYSLRHRDWVLRVLAEDQGKAVELLVFRGFSSSLTQPTDFDPDVPVLPASATIQS  64

Query  239  IDRIKGPFN  213
            + R + P+N
Sbjct  65   VQRFRSPYN  73



>ref|WP_011243462.1| hypothetical protein [Synechococcus elongatus]
 ref|YP_171860.1| hypothetical protein syc1150_c [Synechococcus elongatus PCC 6301]
 dbj|BAD79340.1| hypothetical protein [Synechococcus elongatus PCC 6301]
Length=94

 Score = 47.8 bits (112),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 30/69 (43%), Positives = 41/69 (59%), Gaps = 0/69 (0%)
 Frame = -2

Query  419  IAMLEVYSQSVKDeallvkavvdeeeveVIIFKGFSSSLSYGTSPDPTKSVLPAKAKIKY  240
            I  LE YS   +D  L V A    + VE+++F+GFSSSL+  T  DP   VLPA A I+ 
Sbjct  5    IHQLEQYSLRHRDWVLRVLAEDQGKAVELLVFRGFSSSLTQPTDFDPDVPVLPASATIQS  64

Query  239  IDRIKGPFN  213
            + R + P+N
Sbjct  65   VQRFRSPYN  73



>ref|WP_021836526.1| hypothetical protein [Crocosphaera watsonii]
 emb|CCQ63484.1| hypothetical protein CWATWH0401_3784 [Crocosphaera watsonii WH 
0401]
Length=94

 Score = 47.8 bits (112),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 23/59 (39%), Positives = 36/59 (61%), Gaps = 0/59 (0%)
 Frame = -2

Query  332  IIFKGFSSSLSYGTSPDPTKSVLPAKAKIKYIDRIKGPFNPSNIDYIERDIPWDAFKSL  156
            +IFKGFSSSL   T  +    ++   A+I  IDR++ P+NP    YIE+ + W+  ++L
Sbjct  35   MIFKGFSSSLMGPTEFNAEIPLISETAEIISIDRLQSPYNPKEPKYIEKGLTWEKMENL  93



>ref|WP_007310406.1| hypothetical protein [Crocosphaera watsonii]
 gb|EHJ13207.1| hypothetical protein CWATWH0003_2103 [Crocosphaera watsonii WH 
0003]
 emb|CCQ57422.1| hypothetical protein CWATWH0005_4657 [Crocosphaera watsonii WH 
0005]
 emb|CCQ68348.1| hypothetical protein CWATWH0402_2119 [Crocosphaera watsonii WH 
0402]
Length=94

 Score = 47.4 bits (111),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 23/59 (39%), Positives = 36/59 (61%), Gaps = 0/59 (0%)
 Frame = -2

Query  332  IIFKGFSSSLSYGTSPDPTKSVLPAKAKIKYIDRIKGPFNPSNIDYIERDIPWDAFKSL  156
            +IFKGFSSSL   T  +    ++   A+I  IDR++ P+NP    YIE+ + W+  ++L
Sbjct  35   MIFKGFSSSLMGPTEFNAEIPLISETAEIISIDRLQSPYNPKEPKYIEKGLTWEKMENL  93



>gb|AII46845.1| hypothetical protein KR49_10395 [Synechococcus sp. KORDI-49]
Length=97

 Score = 47.4 bits (111),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 20/43 (47%), Positives = 30/43 (70%), Gaps = 0/43 (0%)
 Frame = -2

Query  332  IIFKGFSSSLSYGTSPDPTKSVLPAKAKIKYIDRIKGPFNPSN  204
            +IF+GFSSS ++ T+ DP  SVLP   ++   D ++GP NPS+
Sbjct  36   LIFRGFSSSTTHPTAFDPDTSVLPEGTRLDRADLLQGPLNPSS  78



>ref|WP_011430936.1| hypothetical protein [Synechococcus sp. JA-3-3Ab]
 ref|YP_475525.1| hypothetical protein CYA_2122 [Synechococcus sp. JA-3-3Ab]
 gb|ABD00262.1| conserved hypothetical protein [Synechococcus sp. JA-3-3Ab]
Length=104

 Score = 47.0 bits (110),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 28/86 (33%), Positives = 48/86 (56%), Gaps = 0/86 (0%)
 Frame = -2

Query  410  LEVYSQSVKDeallvkavvdeeeveVIIFKGFSSSLSYGTSPDPTKSVLPAKAKIKYIDR  231
            LE YSQ+   E L V+   + E   V+I++G+SSSL   T PDP   V+P +A+   ++R
Sbjct  10   LERYSQAHPQEVLRVEVESEGETDLVLIYRGYSSSLRRPTPPDPEVPVIPPQARFLQLER  69

Query  230  IKGPFNPSNIDYIERDIPWDAFKSLL  153
            +  P++P +   +     W+  ++ L
Sbjct  70   LSAPYHPEHSQVLALYRSWEEVRAWL  95



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1042394327856