BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c55162_g1_i1 len=179 path=[32:0-154 234:155-178]

Length=179
                                                                      Score     E

ref|XP_009627680.1|  PREDICTED: receptor-like protein kinase 5        67.4    5e-11   
ref|XP_009619690.1|  PREDICTED: receptor-like protein kinase 5 is...  67.4    5e-11   
ref|XP_009759980.1|  PREDICTED: receptor-like protein kinase 5        67.0    6e-11   
ref|XP_009601880.1|  PREDICTED: receptor-like protein kinase 5        63.2    1e-09   
ref|XP_009795019.1|  PREDICTED: receptor-like protein kinase HSL1     60.8    7e-09   
ref|XP_002324456.2|  hypothetical protein POPTR_0018s09550g           57.0    2e-07   Populus trichocarpa [western balsam poplar]
ref|XP_011014419.1|  PREDICTED: receptor-like protein kinase 5        56.6    2e-07   
ref|XP_010047675.1|  PREDICTED: receptor-like protein kinase 5        55.8    3e-07   
gb|KCW79632.1|  hypothetical protein EUGRSUZ_C00991                   55.8    4e-07   
ref|XP_010050478.1|  PREDICTED: receptor-like protein kinase 5        55.5    4e-07   
ref|XP_010042505.1|  PREDICTED: receptor-like protein kinase 5        55.1    6e-07   
gb|EYU30701.1|  hypothetical protein MIMGU_mgv1a000689mg              55.1    8e-07   
ref|XP_010050477.1|  PREDICTED: receptor-like protein kinase 5        54.7    9e-07   
emb|CDP03253.1|  unnamed protein product                              54.7    1e-06   
emb|CDP03251.1|  unnamed protein product                              54.3    1e-06   
gb|KCW79628.1|  hypothetical protein EUGRSUZ_C00987                   54.3    1e-06   
ref|XP_010047671.1|  PREDICTED: receptor-like protein kinase 5        54.3    1e-06   
gb|KCW79119.1|  hypothetical protein EUGRSUZ_C00560                   53.9    2e-06   
ref|XP_010047254.1|  PREDICTED: receptor-like protein kinase 5        53.9    2e-06   
ref|XP_010050386.1|  PREDICTED: receptor-like protein kinase 5        53.9    2e-06   
ref|XP_008242547.1|  PREDICTED: LRR receptor-like serine/threonin...  53.5    2e-06   
gb|KCW79121.1|  hypothetical protein EUGRSUZ_C00562                   53.5    2e-06   
ref|XP_004251639.1|  PREDICTED: receptor-like protein kinase 5        53.5    3e-06   
ref|XP_010050388.1|  PREDICTED: receptor-like protein kinase 5        53.1    3e-06   
ref|XP_011008121.1|  PREDICTED: receptor-like protein kinase 5        53.1    3e-06   
ref|XP_010050476.1|  PREDICTED: LOW QUALITY PROTEIN: receptor-lik...  53.1    3e-06   
ref|XP_011007100.1|  PREDICTED: receptor-like protein kinase HSL1     53.1    3e-06   
ref|XP_010038613.1|  PREDICTED: probably inactive leucine-rich re...  52.8    3e-06   
gb|KCW79619.1|  hypothetical protein EUGRSUZ_C00974                   53.1    3e-06   
gb|KCW79623.1|  hypothetical protein EUGRSUZ_C00981                   52.8    4e-06   
ref|XP_006353495.1|  PREDICTED: receptor-like protein kinase 5-like   52.8    4e-06   
gb|KCW47028.1|  hypothetical protein EUGRSUZ_K00835                   52.8    4e-06   
ref|XP_010050387.1|  PREDICTED: receptor-like protein kinase 5        52.8    5e-06   
gb|KCW79120.1|  hypothetical protein EUGRSUZ_C00561                   52.4    5e-06   
ref|XP_010047673.1|  PREDICTED: receptor-like protein kinase 5        52.4    6e-06   
ref|XP_008242546.1|  PREDICTED: LOW QUALITY PROTEIN: receptor-lik...  52.4    6e-06   
gb|KCW79629.1|  hypothetical protein EUGRSUZ_C00988                   52.4    6e-06   
ref|XP_007013027.1|  Kinase family protein with leucine-rich repe...  52.4    6e-06   
ref|XP_007013028.1|  Kinase family protein with leucine-rich repe...  52.4    6e-06   
gb|KEH27213.1|  leucine-rich receptor-like kinase family protein      52.0    8e-06   
ref|XP_007203495.1|  hypothetical protein PRUPE_ppa022516mg           52.0    9e-06   
gb|KCW79124.1|  hypothetical protein EUGRSUZ_C00565                   51.6    9e-06   
ref|XP_007203222.1|  hypothetical protein PRUPE_ppa000737mg           51.6    1e-05   
gb|KEH27214.1|  leucine-rich receptor-like kinase family protein      51.6    1e-05   
gb|KCW79612.1|  hypothetical protein EUGRSUZ_C00966                   51.2    1e-05   
ref|XP_010050392.1|  PREDICTED: receptor-like protein kinase 5        51.2    2e-05   
ref|XP_002280395.1|  PREDICTED: receptor-like protein kinase 5        51.2    2e-05   Vitis vinifera
ref|XP_011078243.1|  PREDICTED: receptor-like protein kinase HSL1     50.8    2e-05   
ref|XP_010047668.1|  PREDICTED: receptor-like protein kinase 5        50.8    2e-05   
gb|KCW79630.1|  hypothetical protein EUGRSUZ_C00989                   50.4    3e-05   
ref|XP_010047672.1|  PREDICTED: receptor-like protein kinase 5        50.4    3e-05   
ref|XP_004513049.1|  PREDICTED: receptor-like protein kinase HSL1...  50.4    3e-05   
ref|XP_010050472.1|  PREDICTED: LOW QUALITY PROTEIN: receptor-lik...  50.4    3e-05   
ref|XP_008242544.1|  PREDICTED: receptor-like protein kinase HSL1     50.4    3e-05   
ref|XP_004513050.1|  PREDICTED: receptor-like protein kinase HSL1...  50.1    4e-05   
ref|XP_006372068.1|  hypothetical protein POPTR_0018s09520g           49.7    4e-05   
gb|KCW79622.1|  hypothetical protein EUGRSUZ_C00979                   49.7    5e-05   
ref|XP_010050474.1|  PREDICTED: receptor-like protein kinase 5        49.7    5e-05   
ref|XP_007204807.1|  hypothetical protein PRUPE_ppa019571mg           49.3    6e-05   
ref|XP_010050394.1|  PREDICTED: LRR receptor-like serine/threonin...  49.3    7e-05   
ref|XP_002514220.1|  serine-threonine protein kinase, plant-type,...  49.3    7e-05   Ricinus communis
gb|KDP33800.1|  hypothetical protein JCGZ_07371                       49.3    7e-05   
ref|XP_011007104.1|  PREDICTED: receptor-like protein kinase HSL1     49.3    8e-05   
ref|XP_006475586.1|  PREDICTED: receptor-like protein kinase 5-like   48.9    9e-05   
gb|KDO66581.1|  hypothetical protein CISIN_1g001778mg                 48.9    9e-05   
ref|XP_007013026.1|  Kinase family protein with leucine-rich repe...  48.9    9e-05   
ref|XP_006451306.1|  hypothetical protein CICLE_v10007383mg           48.9    1e-04   
ref|XP_010047253.1|  PREDICTED: LRR receptor-like serine/threonin...  48.9    1e-04   
ref|XP_007203859.1|  hypothetical protein PRUPE_ppa022167mg           48.9    1e-04   
ref|XP_010910701.1|  PREDICTED: receptor-like protein kinase HSL1...  48.5    1e-04   
ref|XP_010910702.1|  PREDICTED: receptor-like protein kinase HSL1...  48.5    1e-04   
ref|XP_006394841.1|  hypothetical protein EUTSA_v10003585mg           48.5    1e-04   
ref|XP_010910700.1|  PREDICTED: receptor-like protein kinase HSL1...  48.5    1e-04   
ref|XP_011007101.1|  PREDICTED: receptor-like protein kinase 5        48.1    2e-04   
ref|XP_006596181.1|  PREDICTED: receptor-like protein kinase HSL1...  48.1    2e-04   
ref|XP_006596182.1|  PREDICTED: receptor-like protein kinase HSL1...  48.1    2e-04   
ref|XP_002324455.2|  hypothetical protein POPTR_0018s09540g           47.8    2e-04   Populus trichocarpa [western balsam poplar]
ref|XP_010047669.1|  PREDICTED: receptor-like protein kinase 5        47.8    2e-04   
gb|KCW79627.1|  hypothetical protein EUGRSUZ_C00986                   47.8    2e-04   
gb|KCW79626.1|  hypothetical protein EUGRSUZ_C00986                   47.8    2e-04   
ref|XP_010924441.1|  PREDICTED: receptor-like protein kinase 5        47.8    2e-04   
ref|XP_010050391.1|  PREDICTED: receptor-like protein kinase 5        47.8    3e-04   
gb|KCW79123.1|  hypothetical protein EUGRSUZ_C00564                   47.8    3e-04   
gb|KEH27211.1|  LRR receptor-like kinase family protein               47.4    3e-04   
gb|KHN40381.1|  LRR receptor-like serine/threonine-protein kinase...  47.4    3e-04   
ref|XP_009151498.1|  PREDICTED: leucine-rich repeat receptor-like...  46.6    3e-04   
ref|XP_006286985.1|  hypothetical protein CARUB_v10000132mg           47.4    3e-04   
emb|CDX88207.1|  BnaA06g27980D                                        46.6    3e-04   
ref|XP_003517639.1|  PREDICTED: receptor-like protein kinase HSL1...  47.4    3e-04   
ref|NP_197965.1|  protein kinase family protein with leucine-rich...  47.0    4e-04   Arabidopsis thaliana [mouse-ear cress]
dbj|BAH19649.1|  AT5G25930                                            47.0    4e-04   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002872190.1|  leucine-rich repeat family protein               47.0    4e-04   
emb|CDX80547.1|  BnaC07g28970D                                        47.0    4e-04   
gb|KHN16979.1|  Receptor-like protein kinase HSL1                     46.6    5e-04   
ref|XP_006599802.1|  PREDICTED: receptor-like protein kinase HSL1...  46.6    5e-04   
gb|KCW79122.1|  hypothetical protein EUGRSUZ_C00563                   46.6    5e-04   
ref|XP_009352556.1|  PREDICTED: receptor-like protein kinase HSL1     46.6    5e-04   
ref|XP_010050389.1|  PREDICTED: receptor-like protein kinase HSL1     46.6    5e-04   
ref|XP_009409608.1|  PREDICTED: receptor-like protein kinase HSL1     46.6    6e-04   
ref|XP_009151111.1|  PREDICTED: receptor-like protein kinase 5        46.6    6e-04   
ref|XP_010454934.1|  PREDICTED: receptor-like protein kinase 5        46.6    6e-04   
gb|KHN40380.1|  Receptor-like protein kinase HSL1                     46.6    6e-04   
emb|CDX88206.1|  BnaA06g27970D                                        46.6    6e-04   
ref|XP_010421450.1|  PREDICTED: receptor-like protein kinase 5        46.2    7e-04   
emb|CDY05509.1|  BnaA02g31820D                                        46.2    7e-04   
ref|XP_010278042.1|  PREDICTED: receptor-like protein kinase 5        46.2    7e-04   
ref|XP_003516786.2|  PREDICTED: receptor-like protein kinase 5-like   46.2    8e-04   
ref|XP_008242543.1|  PREDICTED: receptor-like protein kinase HSL1     46.2    8e-04   
ref|XP_007152973.1|  hypothetical protein PHAVU_004G175900g           46.2    8e-04   
ref|XP_010249486.1|  PREDICTED: receptor-like protein kinase HSL1     46.2    8e-04   
ref|XP_010924676.1|  PREDICTED: receptor-like protein kinase 5        45.8    9e-04   
ref|XP_010493845.1|  PREDICTED: receptor-like protein kinase 5 is...  45.8    9e-04   



>ref|XP_009627680.1| PREDICTED: receptor-like protein kinase 5 [Nicotiana tomentosiformis]
Length=1015

 Score = 67.4 bits (163),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 43/56 (77%), Positives = 49/56 (88%), Gaps = 0/56 (0%)
 Frame = +1

Query  1    VPPEIGrlrltslnlssnhlsGRIPGELENAAFDKSFLNNPGLCATGPSFGLSICK  168
            +PPEIG L+LTSLNLSSN L+GRIP ELENAAFD+SFL+NPGLCA+ PS GL  CK
Sbjct  570  IPPEIGNLKLTSLNLSSNRLTGRIPVELENAAFDRSFLSNPGLCASDPSVGLGFCK  625



>ref|XP_009619690.1| PREDICTED: receptor-like protein kinase 5 isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009619691.1| PREDICTED: receptor-like protein kinase 5 isoform X2 [Nicotiana 
tomentosiformis]
Length=1044

 Score = 67.4 bits (163),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 43/56 (77%), Positives = 49/56 (88%), Gaps = 0/56 (0%)
 Frame = +1

Query  1    VPPEIGrlrltslnlssnhlsGRIPGELENAAFDKSFLNNPGLCATGPSFGLSICK  168
            +PPEIG L+LTSLNLSSN L+GRIP ELENAAFD+SFL+NPGLCA+ PS GL  CK
Sbjct  599  IPPEIGNLKLTSLNLSSNRLTGRIPVELENAAFDRSFLSNPGLCASDPSVGLGFCK  654



>ref|XP_009759980.1| PREDICTED: receptor-like protein kinase 5 [Nicotiana sylvestris]
Length=1042

 Score = 67.0 bits (162),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 43/56 (77%), Positives = 48/56 (86%), Gaps = 0/56 (0%)
 Frame = +1

Query  1    VPPEIGrlrltslnlssnhlsGRIPGELENAAFDKSFLNNPGLCATGPSFGLSICK  168
            +PPEIG LRL SLNLSSN L+GRIP ELENAAFD+SFL+NPGLCA+ PS GL  CK
Sbjct  597  IPPEIGNLRLASLNLSSNRLTGRIPVELENAAFDRSFLSNPGLCASDPSVGLGFCK  652



>ref|XP_009601880.1| PREDICTED: receptor-like protein kinase 5 [Nicotiana tomentosiformis]
Length=1018

 Score = 63.2 bits (152),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 41/56 (73%), Positives = 47/56 (84%), Gaps = 0/56 (0%)
 Frame = +1

Query  1    VPPEIGrlrltslnlssnhlsGRIPGELENAAFDKSFLNNPGLCATGPSFGLSICK  168
            +P E+G+L  TSLNLSSN LSG+IP +LENAAFDKSFLNNPGLCA+ P  GLS CK
Sbjct  568  IPTELGKLIPTSLNLSSNRLSGKIPAQLENAAFDKSFLNNPGLCASNPLVGLSSCK  623



>ref|XP_009795019.1| PREDICTED: receptor-like protein kinase HSL1 [Nicotiana sylvestris]
Length=1018

 Score = 60.8 bits (146),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 41/56 (73%), Positives = 47/56 (84%), Gaps = 0/56 (0%)
 Frame = +1

Query  1    VPPEIGrlrltslnlssnhlsGRIPGELENAAFDKSFLNNPGLCATGPSFGLSICK  168
            +P E+G+L LTSLNLSSN LSG+IP +LENAAFDKSFLNN GLCA+ P  GLS CK
Sbjct  568  IPTELGKLILTSLNLSSNRLSGKIPAQLENAAFDKSFLNNTGLCASNPLVGLSSCK  623



>ref|XP_002324456.2| hypothetical protein POPTR_0018s09550g [Populus trichocarpa]
 gb|EEF03021.2| hypothetical protein POPTR_0018s09550g [Populus trichocarpa]
Length=1010

 Score = 57.0 bits (136),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 36/55 (65%), Positives = 44/55 (80%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    VPPEIGrlrltslnlssnhlsGRIPGELENAAFDKSFLNNPGLCATGPSFGLSIC  165
            +PP++G LRLT LNLSSNHL G+IP E ENAA+  SFLNNPG+CA+ PS  L +C
Sbjct  562  IPPQLGLLRLTYLNLSSNHLVGKIPAEYENAAYSSSFLNNPGICASRPSLYLKVC  616



>ref|XP_011014419.1| PREDICTED: receptor-like protein kinase 5 [Populus euphratica]
Length=1012

 Score = 56.6 bits (135),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 36/55 (65%), Positives = 44/55 (80%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    VPPEIGrlrltslnlssnhlsGRIPGELENAAFDKSFLNNPGLCATGPSFGLSIC  165
            +PP++G LRLT LNLSSNHL G+IP E ENAA+  SFLNNPG+CA+ PS  L +C
Sbjct  564  IPPQLGLLRLTYLNLSSNHLVGKIPAEYENAAYSSSFLNNPGICASRPSLYLKVC  618



>ref|XP_010047675.1| PREDICTED: receptor-like protein kinase 5 [Eucalyptus grandis]
Length=731

 Score = 55.8 bits (133),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 36/55 (65%), Positives = 42/55 (76%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    VPPEIGrlrltslnlssnhlsGRIPGELENAAFDKSFLNNPGLCATGPSFGLSIC  165
            +PPEIG+L L  LNLSSN LSGRIP ELENA +D SFL+NPGLCA      L++C
Sbjct  574  IPPEIGQLNLNRLNLSSNRLSGRIPNELENAMYDASFLDNPGLCAANSFMRLNVC  628



>gb|KCW79632.1| hypothetical protein EUGRSUZ_C00991, partial [Eucalyptus grandis]
Length=725

 Score = 55.8 bits (133),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 36/55 (65%), Positives = 42/55 (76%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    VPPEIGrlrltslnlssnhlsGRIPGELENAAFDKSFLNNPGLCATGPSFGLSIC  165
            +PPEIG+L L  LNLSSN LSGRIP ELENA +D SFL+NPGLCA      L++C
Sbjct  574  IPPEIGQLNLNRLNLSSNRLSGRIPNELENAMYDASFLDNPGLCAANSFMRLNVC  628



>ref|XP_010050478.1| PREDICTED: receptor-like protein kinase 5 [Eucalyptus grandis]
Length=680

 Score = 55.5 bits (132),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 36/55 (65%), Positives = 43/55 (78%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    VPPEIGrlrltslnlssnhlsGRIPGELENAAFDKSFLNNPGLCATGPSFGLSIC  165
            +PPEIG+L L  LNLSSN LSGRIP ELENA ++ SFLNNPGLCA+     L++C
Sbjct  550  IPPEIGQLNLNLLNLSSNRLSGRIPNELENAVYNTSFLNNPGLCASNSFMWLNVC  604



>ref|XP_010042505.1| PREDICTED: receptor-like protein kinase 5 [Eucalyptus grandis]
Length=554

 Score = 55.1 bits (131),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 36/55 (65%), Positives = 41/55 (75%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    VPPEIGrlrltslnlssnhlsGRIPGELENAAFDKSFLNNPGLCATGPSFGLSIC  165
            VPPEIG  +L  LNLSSN LSG IP ELENA +D SFLNNPGLCA+     L++C
Sbjct  122  VPPEIGLQKLDLLNLSSNRLSGPIPEELENATYDASFLNNPGLCASNSFMRLNVC  176



>gb|EYU30701.1| hypothetical protein MIMGU_mgv1a000689mg [Erythranthe guttata]
Length=1017

 Score = 55.1 bits (131),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 38/59 (64%), Positives = 47/59 (80%), Gaps = 0/59 (0%)
 Frame = +1

Query  1    VPPEIGrlrltslnlssnhlsGRIPGELENAAFDKSFLNNPGLCATGPSFGLSICKLNT  177
            +P E+G LRL+SLNLSSN L+GRIP E EN AF++SFLNN GLC+  PS GLS C++ T
Sbjct  567  IPLELGNLRLSSLNLSSNRLTGRIPSEFENGAFNRSFLNNLGLCSNIPSVGLSNCRIKT  625



>ref|XP_010050477.1| PREDICTED: receptor-like protein kinase 5 [Eucalyptus grandis]
 gb|KCW79634.1| hypothetical protein EUGRSUZ_C00993 [Eucalyptus grandis]
Length=731

 Score = 54.7 bits (130),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 36/55 (65%), Positives = 42/55 (76%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    VPPEIGrlrltslnlssnhlsGRIPGELENAAFDKSFLNNPGLCATGPSFGLSIC  165
            +PPEIG+L L  LNLSSN LSGRIP ELENA ++ SFLNNPGLCA      L++C
Sbjct  574  IPPEIGQLNLNLLNLSSNRLSGRIPNELENAVYNTSFLNNPGLCAANSFMRLNVC  628



>emb|CDP03253.1| unnamed protein product [Coffea canephora]
Length=934

 Score = 54.7 bits (130),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 39/59 (66%), Positives = 44/59 (75%), Gaps = 0/59 (0%)
 Frame = +1

Query  1    VPPEIGrlrltslnlssnhlsGRIPGELENAAFDKSFLNNPGLCATGPSFGLSICKLNT  177
            +P +IG LRL SLNLSSN LSG IPGE ENAAFD+SFL N GLC+  PS GL+ C   T
Sbjct  487  IPAQIGLLRLNSLNLSSNRLSGSIPGEFENAAFDRSFLGNAGLCSRNPSLGLNACASQT  545



>emb|CDP03251.1| unnamed protein product [Coffea canephora]
Length=982

 Score = 54.3 bits (129),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 39/59 (66%), Positives = 44/59 (75%), Gaps = 0/59 (0%)
 Frame = +1

Query  1    VPPEIGrlrltslnlssnhlsGRIPGELENAAFDKSFLNNPGLCATGPSFGLSICKLNT  177
            +P +IG LRL SLNLSSN LSG IPGE ENAAFD+SFL N GLC+  PS GL+ C   T
Sbjct  535  IPAQIGLLRLNSLNLSSNRLSGSIPGEFENAAFDRSFLGNAGLCSRNPSLGLNACASQT  593



>gb|KCW79628.1| hypothetical protein EUGRSUZ_C00987 [Eucalyptus grandis]
Length=873

 Score = 54.3 bits (129),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 35/56 (63%), Positives = 44/56 (79%), Gaps = 0/56 (0%)
 Frame = +1

Query  1    VPPEIGrlrltslnlssnhlsGRIPGELENAAFDKSFLNNPGLCATGPSFGLSICK  168
            +PPEIG+L L  LNLSSN LSG IP +LENAA+D SFL+NPGLCA+     +++CK
Sbjct  425  IPPEIGQLNLIRLNLSSNLLSGPIPAKLENAAYDTSFLHNPGLCASNSFMRINVCK  480



>ref|XP_010047671.1| PREDICTED: receptor-like protein kinase 5 [Eucalyptus grandis]
Length=1020

 Score = 54.3 bits (129),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 35/56 (63%), Positives = 44/56 (79%), Gaps = 0/56 (0%)
 Frame = +1

Query  1    VPPEIGrlrltslnlssnhlsGRIPGELENAAFDKSFLNNPGLCATGPSFGLSICK  168
            +PPEIG+L L  LNLSSN LSG IP +LENAA+D SFL+NPGLCA+     +++CK
Sbjct  572  IPPEIGQLNLIRLNLSSNLLSGPIPAKLENAAYDTSFLHNPGLCASNSFMRINVCK  627



>gb|KCW79119.1| hypothetical protein EUGRSUZ_C00560 [Eucalyptus grandis]
Length=909

 Score = 53.9 bits (128),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 36/55 (65%), Positives = 42/55 (76%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    VPPEIGrlrltslnlssnhlsGRIPGELENAAFDKSFLNNPGLCATGPSFGLSIC  165
            VPPEIG L+L  LNLSSN LSGRIP +LENA +D SFLNNP LCA+     L++C
Sbjct  460  VPPEIGLLKLNLLNLSSNRLSGRIPEQLENAKYDASFLNNPSLCASNSFMRLNVC  514



>ref|XP_010047254.1| PREDICTED: receptor-like protein kinase 5 [Eucalyptus grandis]
 gb|KCW79116.1| hypothetical protein EUGRSUZ_C00557 [Eucalyptus grandis]
Length=1020

 Score = 53.9 bits (128),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 35/55 (64%), Positives = 43/55 (78%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    VPPEIGrlrltslnlssnhlsGRIPGELENAAFDKSFLNNPGLCATGPSFGLSIC  165
            +PPEIG+L L  LNLSSN LSG IP +LENAA+D SFLNNPGLCA+     +++C
Sbjct  572  IPPEIGQLNLNRLNLSSNRLSGPIPAKLENAAYDTSFLNNPGLCASNSFMRINVC  626



>ref|XP_010050386.1| PREDICTED: receptor-like protein kinase 5 [Eucalyptus grandis]
Length=1026

 Score = 53.9 bits (128),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 36/55 (65%), Positives = 42/55 (76%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    VPPEIGrlrltslnlssnhlsGRIPGELENAAFDKSFLNNPGLCATGPSFGLSIC  165
            VPPEIG L+L  LNLSSN LSGRIP +LENA +D SFLNNP LCA+     L++C
Sbjct  577  VPPEIGLLKLNLLNLSSNRLSGRIPEQLENAKYDASFLNNPSLCASNSFMRLNVC  631



>ref|XP_008242547.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
HSL2 [Prunus mume]
Length=979

 Score = 53.5 bits (127),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 36/55 (65%), Positives = 46/55 (84%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    VPPEIGrlrltslnlssnhlsGRIPGELENAAFDKSFLNNPGLCATGPSFGLSIC  165
            +P ++GRL+L +LNLSSNHLSG+IP E +NAA+D+SFL+N GLCAT PS  L IC
Sbjct  573  IPAQLGRLKLNNLNLSSNHLSGKIPIEFQNAAYDRSFLDNQGLCATSPSAKLKIC  627



>gb|KCW79121.1| hypothetical protein EUGRSUZ_C00562 [Eucalyptus grandis]
Length=1002

 Score = 53.5 bits (127),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 35/55 (64%), Positives = 43/55 (78%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    VPPEIGrlrltslnlssnhlsGRIPGELENAAFDKSFLNNPGLCATGPSFGLSIC  165
            +PPEIG+L L SLNLSSN L G IP +LENAA+D SFLNNPGLCA+     +++C
Sbjct  554  IPPEIGQLNLNSLNLSSNRLKGPIPAKLENAAYDTSFLNNPGLCASNSFMRINVC  608



>ref|XP_004251639.1| PREDICTED: receptor-like protein kinase 5 [Solanum lycopersicum]
Length=1008

 Score = 53.5 bits (127),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 37/59 (63%), Positives = 47/59 (80%), Gaps = 0/59 (0%)
 Frame = +1

Query  1    VPPEIGrlrltslnlssnhlsGRIPGELENAAFDKSFLNNPGLCATGPSFGLSICKLNT  177
            +P E+G L+L+SLNLSSN LSG IP +LENAAF KSFL+NPG+CA+ PS  ++ CK  T
Sbjct  559  IPTELGNLKLSSLNLSSNRLSGEIPSQLENAAFGKSFLDNPGICASNPSVEVASCKRET  617



>ref|XP_010050388.1| PREDICTED: receptor-like protein kinase 5 [Eucalyptus grandis]
Length=736

 Score = 53.1 bits (126),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 35/55 (64%), Positives = 43/55 (78%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    VPPEIGrlrltslnlssnhlsGRIPGELENAAFDKSFLNNPGLCATGPSFGLSIC  165
            +PPEIG+L L SLNLSSN L G IP +LENAA+D SFLNNPGLCA+     +++C
Sbjct  331  IPPEIGQLNLNSLNLSSNRLKGPIPAKLENAAYDTSFLNNPGLCASNSFMRINVC  385



>ref|XP_011008121.1| PREDICTED: receptor-like protein kinase 5 [Populus euphratica]
Length=1012

 Score = 53.1 bits (126),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 35/55 (64%), Positives = 42/55 (76%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    VPPEIGrlrltslnlssnhlsGRIPGELENAAFDKSFLNNPGLCATGPSFGLSIC  165
            +P + G LRLT LNLSSNHL G+IP E ENAA+  SFLNNPG+CA+ PS  L +C
Sbjct  564  IPTQFGLLRLTYLNLSSNHLVGKIPAEYENAAYSSSFLNNPGICASRPSLYLKVC  618



>ref|XP_010050476.1| PREDICTED: LOW QUALITY PROTEIN: receptor-like protein kinase 
5 [Eucalyptus grandis]
Length=916

 Score = 53.1 bits (126),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 35/55 (64%), Positives = 43/55 (78%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    VPPEIGrlrltslnlssnhlsGRIPGELENAAFDKSFLNNPGLCATGPSFGLSIC  165
            +PPEIG+L L  LNLSSN LSG IP +LENAA+D SFLNNPGLCA+     +++C
Sbjct  507  IPPEIGQLILNLLNLSSNRLSGPIPAKLENAAYDTSFLNNPGLCASNSFMRINVC  561



>ref|XP_011007100.1| PREDICTED: receptor-like protein kinase HSL1, partial [Populus 
euphratica]
Length=697

 Score = 53.1 bits (126),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 35/55 (64%), Positives = 42/55 (76%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    VPPEIGrlrltslnlssnhlsGRIPGELENAAFDKSFLNNPGLCATGPSFGLSIC  165
            +P + G LRLT LNLSSNHL G+IP E ENAA+  SFLNNPG+CA+ PS  L +C
Sbjct  560  IPTQFGLLRLTYLNLSSNHLVGKIPAEYENAAYSSSFLNNPGICASRPSLYLKVC  614



>ref|XP_010038613.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At2g25790 [Eucalyptus grandis]
Length=451

 Score = 52.8 bits (125),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 35/56 (63%), Positives = 42/56 (75%), Gaps = 0/56 (0%)
 Frame = +1

Query  1    VPPEIGrlrltslnlssnhlsGRIPGELENAAFDKSFLNNPGLCATGPSFGLSICK  168
            +PPEIG L L  LNLSSN LSG IP +LENAA+D SFLNNPGLCA+     +++C 
Sbjct  343  IPPEIGHLNLNRLNLSSNGLSGPIPAKLENAAYDASFLNNPGLCASNSFVRINVCN  398



>gb|KCW79619.1| hypothetical protein EUGRSUZ_C00974 [Eucalyptus grandis]
Length=945

 Score = 53.1 bits (126),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 35/55 (64%), Positives = 43/55 (78%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    VPPEIGrlrltslnlssnhlsGRIPGELENAAFDKSFLNNPGLCATGPSFGLSIC  165
            +PPEIG+L L  LNLSSN LSG IP +LENAA+D SFLNNPGLCA+     +++C
Sbjct  506  IPPEIGQLILNLLNLSSNRLSGPIPAKLENAAYDTSFLNNPGLCASNSFMRINVC  560



>gb|KCW79623.1| hypothetical protein EUGRSUZ_C00981 [Eucalyptus grandis]
Length=509

 Score = 52.8 bits (125),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 35/55 (64%), Positives = 43/55 (78%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    VPPEIGrlrltslnlssnhlsGRIPGELENAAFDKSFLNNPGLCATGPSFGLSIC  165
            +PPEIG+L L  LNLSSN LSG IP +LENAA+D SFLNNPGLCA+     +++C
Sbjct  413  IPPEIGQLILNLLNLSSNRLSGPIPAKLENAAYDTSFLNNPGLCASNSFMRINVC  467



>ref|XP_006353495.1| PREDICTED: receptor-like protein kinase 5-like [Solanum tuberosum]
Length=885

 Score = 52.8 bits (125),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 38/59 (64%), Positives = 44/59 (75%), Gaps = 0/59 (0%)
 Frame = +1

Query  1    VPPEIGrlrltslnlssnhlsGRIPGELENAAFDKSFLNNPGLCATGPSFGLSICKLNT  177
            +P E+G LR TSLNLSSN LSG IP +LENA F KSFL+NPGLCA  PS  ++ CK  T
Sbjct  436  IPTELGNLRFTSLNLSSNRLSGEIPSQLENAGFGKSFLDNPGLCAINPSVEVASCKRET  494



>gb|KCW47028.1| hypothetical protein EUGRSUZ_K00835 [Eucalyptus grandis]
Length=574

 Score = 52.8 bits (125),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 35/55 (64%), Positives = 42/55 (76%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    VPPEIGrlrltslnlssnhlsGRIPGELENAAFDKSFLNNPGLCATGPSFGLSIC  165
            +PPEIG L L  LNLSSN LSG IP +LENAA+D SFLNNPGLCA+     +++C
Sbjct  466  IPPEIGHLNLNRLNLSSNGLSGPIPAKLENAAYDASFLNNPGLCASNSFVRINVC  520



>ref|XP_010050387.1| PREDICTED: receptor-like protein kinase 5 [Eucalyptus grandis]
Length=1000

 Score = 52.8 bits (125),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 34/55 (62%), Positives = 42/55 (76%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    VPPEIGrlrltslnlssnhlsGRIPGELENAAFDKSFLNNPGLCATGPSFGLSIC  165
            +PPEIG+L L  LNLSSN L G IP +LENAA+D SFLNNPGLCA+     +++C
Sbjct  573  IPPEIGQLNLNCLNLSSNRLRGPIPAKLENAAYDTSFLNNPGLCASNSFMRINLC  627



>gb|KCW79120.1| hypothetical protein EUGRSUZ_C00561 [Eucalyptus grandis]
Length=851

 Score = 52.4 bits (124),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 34/55 (62%), Positives = 42/55 (76%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    VPPEIGrlrltslnlssnhlsGRIPGELENAAFDKSFLNNPGLCATGPSFGLSIC  165
            +PPEIG+L L  LNLSSN L G IP +LENAA+D SFLNNPGLCA+     +++C
Sbjct  424  IPPEIGQLNLNCLNLSSNRLRGPIPAKLENAAYDTSFLNNPGLCASNSFMRINLC  478



>ref|XP_010047673.1| PREDICTED: receptor-like protein kinase 5 [Eucalyptus grandis]
Length=1020

 Score = 52.4 bits (124),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 34/55 (62%), Positives = 43/55 (78%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    VPPEIGrlrltslnlssnhlsGRIPGELENAAFDKSFLNNPGLCATGPSFGLSIC  165
            +PPEIG+L L  LNLSSN LSG IP +LENAA+D SFL+NPGLCA+     +++C
Sbjct  572  IPPEIGQLNLIRLNLSSNLLSGPIPAKLENAAYDASFLHNPGLCASNSFMRINVC  626



>ref|XP_008242546.1| PREDICTED: LOW QUALITY PROTEIN: receptor-like protein kinase 
5 [Prunus mume]
Length=1100

 Score = 52.4 bits (124),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 36/55 (65%), Positives = 44/55 (80%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    VPPEIGrlrltslnlssnhlsGRIPGELENAAFDKSFLNNPGLCATGPSFGLSIC  165
            +P +IG L+L++ NLSSNHLSG+IP E EN A+D SFL+N GLCAT PS  LSIC
Sbjct  654  IPAQIGNLKLSNFNLSSNHLSGKIPIEFENPAYDGSFLDNQGLCATSPSAKLSIC  708



>gb|KCW79629.1| hypothetical protein EUGRSUZ_C00988 [Eucalyptus grandis]
Length=873

 Score = 52.4 bits (124),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 34/55 (62%), Positives = 43/55 (78%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    VPPEIGrlrltslnlssnhlsGRIPGELENAAFDKSFLNNPGLCATGPSFGLSIC  165
            +PPEIG+L L  LNLSSN LSG IP +LENAA+D SFL+NPGLCA+     +++C
Sbjct  425  IPPEIGQLNLIRLNLSSNLLSGPIPAKLENAAYDASFLHNPGLCASNSFMRINVC  479



>ref|XP_007013027.1| Kinase family protein with leucine-rich repeat domain, putative 
isoform 1 [Theobroma cacao]
 gb|EOY30646.1| Kinase family protein with leucine-rich repeat domain, putative 
isoform 1 [Theobroma cacao]
Length=1097

 Score = 52.4 bits (124),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 36/55 (65%), Positives = 41/55 (75%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    VPPEIGrlrltslnlssnhlsGRIPGELENAAFDKSFLNNPGLCATGPSFGLSIC  165
            +PP++GRLR T  NLSSNHL G IP E ENAA+  SFLNNPGLCAT  +  L IC
Sbjct  579  IPPQLGRLRFTPFNLSSNHLIGSIPREFENAAYSNSFLNNPGLCATNANVNLVIC  633



>ref|XP_007013028.1| Kinase family protein with leucine-rich repeat domain, putative 
isoform 2 [Theobroma cacao]
 gb|EOY30647.1| Kinase family protein with leucine-rich repeat domain, putative 
isoform 2 [Theobroma cacao]
Length=1019

 Score = 52.4 bits (124),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 36/55 (65%), Positives = 41/55 (75%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    VPPEIGrlrltslnlssnhlsGRIPGELENAAFDKSFLNNPGLCATGPSFGLSIC  165
            +PP++GRLR T  NLSSNHL G IP E ENAA+  SFLNNPGLCAT  +  L IC
Sbjct  579  IPPQLGRLRFTPFNLSSNHLIGSIPREFENAAYSNSFLNNPGLCATNANVNLVIC  633



>gb|KEH27213.1| leucine-rich receptor-like kinase family protein [Medicago truncatula]
Length=1015

 Score = 52.0 bits (123),  Expect = 8e-06, Method: Composition-based stats.
 Identities = 20/38 (53%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = +1

Query  64   GRIPGELENAAFDKSFLNNPGLCATGPSFGLSICKLNT  177
            GR+P   EN+A+D+SFLNN GLCA  P   L++C  N+
Sbjct  586  GRVPSAFENSAYDRSFLNNSGLCADTPKLNLTLCNSNS  623



>ref|XP_007203495.1| hypothetical protein PRUPE_ppa022516mg, partial [Prunus persica]
 gb|EMJ04694.1| hypothetical protein PRUPE_ppa022516mg, partial [Prunus persica]
Length=866

 Score = 52.0 bits (123),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 35/55 (64%), Positives = 43/55 (78%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    VPPEIGrlrltslnlssnhlsGRIPGELENAAFDKSFLNNPGLCATGPSFGLSIC  165
            +P ++G L L++ NLSSNHLSG+IP E EN A+D SFL+N GLCAT PS  LSIC
Sbjct  454  IPAQLGHLTLSNFNLSSNHLSGKIPIEFENPAYDVSFLDNQGLCATNPSAKLSIC  508



>gb|KCW79124.1| hypothetical protein EUGRSUZ_C00565 [Eucalyptus grandis]
Length=510

 Score = 51.6 bits (122),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 32/55 (58%), Positives = 40/55 (73%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    VPPEIGrlrltslnlssnhlsGRIPGELENAAFDKSFLNNPGLCATGPSFGLSIC  165
            +PPE G+L L  LNLS N L G IP +LENAA+D SFLNNPGLCA+     +++C
Sbjct  175  IPPEFGQLNLNRLNLSCNRLRGPIPAKLENAAYDTSFLNNPGLCASNSFMRINVC  229



>ref|XP_007203222.1| hypothetical protein PRUPE_ppa000737mg [Prunus persica]
 gb|EMJ04421.1| hypothetical protein PRUPE_ppa000737mg [Prunus persica]
Length=1018

 Score = 51.6 bits (122),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 35/55 (64%), Positives = 44/55 (80%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    VPPEIGrlrltslnlssnhlsGRIPGELENAAFDKSFLNNPGLCATGPSFGLSIC  165
            +P ++G L+L++ NLSSNHLSG+IP E EN A+D SFL+N GLCAT PS  LSIC
Sbjct  572  IPAQLGHLKLSNFNLSSNHLSGKIPIEFENPAYDGSFLDNQGLCATSPSAKLSIC  626



>gb|KEH27214.1| leucine-rich receptor-like kinase family protein [Medicago truncatula]
Length=953

 Score = 51.6 bits (122),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 20/38 (53%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = +1

Query  64   GRIPGELENAAFDKSFLNNPGLCATGPSFGLSICKLNT  177
            GR+P   EN+A+D+SFLNN GLCA  P   L++C  N+
Sbjct  586  GRVPSAFENSAYDRSFLNNSGLCADTPKLNLTLCNSNS  623



>gb|KCW79612.1| hypothetical protein EUGRSUZ_C00966 [Eucalyptus grandis]
Length=598

 Score = 51.2 bits (121),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 33/55 (60%), Positives = 41/55 (75%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    VPPEIGrlrltslnlssnhlsGRIPGELENAAFDKSFLNNPGLCATGPSFGLSIC  165
            +PPE G+  L  LNLSSN LSG IP +LENAA+D SFLNNPGLCA+     +++C
Sbjct  286  IPPEFGQPNLNRLNLSSNRLSGPIPAKLENAAYDASFLNNPGLCASNSFMRINVC  340



>ref|XP_010050392.1| PREDICTED: receptor-like protein kinase 5 [Eucalyptus grandis]
Length=1011

 Score = 51.2 bits (121),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 32/55 (58%), Positives = 40/55 (73%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    VPPEIGrlrltslnlssnhlsGRIPGELENAAFDKSFLNNPGLCATGPSFGLSIC  165
            +PPE G+L L  LNLS N L G IP +LENAA+D SFLNNPGLCA+     +++C
Sbjct  575  IPPEFGQLNLNRLNLSCNRLRGPIPAKLENAAYDTSFLNNPGLCASNSFMRINVC  629



>ref|XP_002280395.1| PREDICTED: receptor-like protein kinase 5 [Vitis vinifera]
Length=1021

 Score = 51.2 bits (121),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 33/51 (65%), Positives = 39/51 (76%), Gaps = 0/51 (0%)
 Frame = +1

Query  1    VPPEIGrlrltslnlssnhlsGRIPGELENAAFDKSFLNNPGLCATGPSFG  153
            +PPEIG L  T LNLSSNHL+G+IP + EN A+D SFLNNPGLC + P  G
Sbjct  569  IPPEIGLLTFTFLNLSSNHLTGKIPTKFENKAYDSSFLNNPGLCTSNPFLG  619



>ref|XP_011078243.1| PREDICTED: receptor-like protein kinase HSL1 [Sesamum indicum]
Length=1018

 Score = 50.8 bits (120),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 21/35 (60%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +1

Query  64   GRIPGELENAAFDKSFLNNPGLCATGPSFGLSICK  168
            GR+P + EN AFD+SFLNNPGLC+   S G+S C+
Sbjct  590  GRVPSKFENGAFDRSFLNNPGLCSNIRSLGISPCR  624



>ref|XP_010047668.1| PREDICTED: receptor-like protein kinase 5 [Eucalyptus grandis]
 gb|KCW79625.1| hypothetical protein EUGRSUZ_C00984 [Eucalyptus grandis]
Length=1026

 Score = 50.8 bits (120),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 28/55 (51%), Positives = 35/55 (64%), Gaps = 1/55 (2%)
 Frame = +1

Query  1    VPPEIGrlrltslnlssnhlsGRIPGELENAAFDKSFLNNPGLCATGPSFGLSIC  165
            +PP++GR        S+    GRIP ELENAA+  SFLNNPGLCA+ P   L+ C
Sbjct  576  IPPDLGRKLNILNLSSNRLS-GRIPDELENAAYATSFLNNPGLCASNPLIRLNSC  629



>gb|KCW79630.1| hypothetical protein EUGRSUZ_C00989, partial [Eucalyptus grandis]
Length=939

 Score = 50.4 bits (119),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 33/55 (60%), Positives = 41/55 (75%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    VPPEIGrlrltslnlssnhlsGRIPGELENAAFDKSFLNNPGLCATGPSFGLSIC  165
            +PPEIG+L L  LNLSSN LSG IP +LEN A+D  FLNNPGLCA+     +++C
Sbjct  541  IPPEIGQLILNRLNLSSNRLSGPIPAKLENTAYDTGFLNNPGLCASNSFMRINVC  595



>ref|XP_010047672.1| PREDICTED: receptor-like protein kinase 5 [Eucalyptus grandis]
Length=985

 Score = 50.4 bits (119),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 33/55 (60%), Positives = 41/55 (75%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    VPPEIGrlrltslnlssnhlsGRIPGELENAAFDKSFLNNPGLCATGPSFGLSIC  165
            +PPEIG+L L  LNLSSN LSG IP +LEN A+D  FLNNPGLCA+     +++C
Sbjct  572  IPPEIGQLILNRLNLSSNRLSGPIPAKLENTAYDTGFLNNPGLCASNSFMRINVC  626



>ref|XP_004513049.1| PREDICTED: receptor-like protein kinase HSL1-like [Cicer arietinum]
Length=1012

 Score = 50.4 bits (119),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 20/36 (56%), Positives = 25/36 (69%), Gaps = 0/36 (0%)
 Frame = +1

Query  64   GRIPGELENAAFDKSFLNNPGLCATGPSFGLSICKL  171
            GR+P E EN+AFD+SFLNN GLCA      L++C  
Sbjct  587  GRVPSEFENSAFDRSFLNNSGLCAYTKELSLTLCNF  622



>ref|XP_010050472.1| PREDICTED: LOW QUALITY PROTEIN: receptor-like protein kinase 
HSL1 [Eucalyptus grandis]
Length=1101

 Score = 50.4 bits (119),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 33/55 (60%), Positives = 42/55 (76%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    VPPEIGrlrltslnlssnhlsGRIPGELENAAFDKSFLNNPGLCATGPSFGLSIC  165
            +PP IG+L L  LNLSSN L+G IP +LENAA+D SFLNNPGLCA+     +++C
Sbjct  681  IPPGIGQLVLNRLNLSSNRLNGPIPAKLENAAYDTSFLNNPGLCASNSFMRINVC  735



>ref|XP_008242544.1| PREDICTED: receptor-like protein kinase HSL1 [Prunus mume]
Length=1858

 Score = 50.4 bits (119),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 35/55 (64%), Positives = 43/55 (78%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    VPPEIGrlrltslnlssnhlsGRIPGELENAAFDKSFLNNPGLCATGPSFGLSIC  165
            +P ++G L L++ NLSSNHLSG+IP E EN A+D SFL+N GLCAT PS  LSIC
Sbjct  572  IPAQLGNLELSNFNLSSNHLSGKIPIEFENPAYDGSFLDNQGLCATRPSAKLSIC  626


 Score = 50.4 bits (119),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 34/55 (62%), Positives = 45/55 (82%), Gaps = 0/55 (0%)
 Frame = +1

Query  1     VPPEIGrlrltslnlssnhlsGRIPGELENAAFDKSFLNNPGLCATGPSFGLSIC  165
             +P ++G L+L++ NLSSNHLSG+IP E EN+A++ SFL+N GLCAT PS  LSIC
Sbjct  1414  IPAQLGNLKLSNFNLSSNHLSGKIPIEFENSAYNGSFLDNQGLCATSPSAKLSIC  1468



>ref|XP_004513050.1| PREDICTED: receptor-like protein kinase HSL1-like [Cicer arietinum]
Length=1014

 Score = 50.1 bits (118),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 20/38 (53%), Positives = 26/38 (68%), Gaps = 0/38 (0%)
 Frame = +1

Query  64   GRIPGELENAAFDKSFLNNPGLCATGPSFGLSICKLNT  177
            GR+P E EN+A+D+SFLNN GLCA      L++C   T
Sbjct  586  GRVPSEFENSAYDRSFLNNSGLCADTEELSLTLCNSKT  623



>ref|XP_006372068.1| hypothetical protein POPTR_0018s09520g, partial [Populus trichocarpa]
 gb|ERP49865.1| hypothetical protein POPTR_0018s09520g, partial [Populus trichocarpa]
Length=955

 Score = 49.7 bits (117),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 31/55 (56%), Positives = 39/55 (71%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    VPPEIGrlrltslnlssnhlsGRIPGELENAAFDKSFLNNPGLCATGPSFGLSIC  165
            +PP++G L+L  LNLSSN+L G+IP E EN A+  SFLNNPGLC    S  L +C
Sbjct  562  IPPQLGSLKLVFLNLSSNNLMGQIPTEFENVAYATSFLNNPGLCTRRSSLHLKVC  616



>gb|KCW79622.1| hypothetical protein EUGRSUZ_C00979 [Eucalyptus grandis]
Length=992

 Score = 49.7 bits (117),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 31/55 (56%), Positives = 40/55 (73%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    VPPEIGrlrltslnlssnhlsGRIPGELENAAFDKSFLNNPGLCATGPSFGLSIC  165
            +PPE G+L L  LNLSSN L G+IP   +NAA+D SFLNNPGLCA+     +++C
Sbjct  575  IPPEFGQLNLNRLNLSSNRLRGKIPSLYDNAAYDTSFLNNPGLCASNSFMRINVC  629



>ref|XP_010050474.1| PREDICTED: receptor-like protein kinase 5 [Eucalyptus grandis]
Length=978

 Score = 49.7 bits (117),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 31/55 (56%), Positives = 40/55 (73%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    VPPEIGrlrltslnlssnhlsGRIPGELENAAFDKSFLNNPGLCATGPSFGLSIC  165
            +PPE G+L L  LNLSSN L G+IP   +NAA+D SFLNNPGLCA+     +++C
Sbjct  575  IPPEFGQLNLNRLNLSSNRLRGKIPSLYDNAAYDTSFLNNPGLCASNSFMRINVC  629



>ref|XP_007204807.1| hypothetical protein PRUPE_ppa019571mg [Prunus persica]
 gb|EMJ06006.1| hypothetical protein PRUPE_ppa019571mg [Prunus persica]
Length=1018

 Score = 49.3 bits (116),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 34/55 (62%), Positives = 43/55 (78%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    VPPEIGrlrltslnlssnhlsGRIPGELENAAFDKSFLNNPGLCATGPSFGLSIC  165
            +P ++G L+L++ NLSSNHLSG+IP E EN A+D SFL+N  LCAT PS  LSIC
Sbjct  572  IPAQLGHLKLSNFNLSSNHLSGKIPIEFENPAYDGSFLDNQDLCATSPSAKLSIC  626



>ref|XP_010050394.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO2 [Eucalyptus grandis]
Length=687

 Score = 49.3 bits (116),  Expect = 7e-05, Method: Composition-based stats.
 Identities = 20/34 (59%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = +1

Query  64   GRIPGELENAAFDKSFLNNPGLCATGPSFGLSIC  165
            G IP +LENAA+D SFLNNPGLCA+     +++C
Sbjct  396  GPIPAKLENAAYDTSFLNNPGLCASNSFMRINVC  429



>ref|XP_002514220.1| serine-threonine protein kinase, plant-type, putative [Ricinus 
communis]
 gb|EEF48174.1| serine-threonine protein kinase, plant-type, putative [Ricinus 
communis]
Length=769

 Score = 49.3 bits (116),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 32/55 (58%), Positives = 41/55 (75%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    VPPEIGrlrltslnlssnhlsGRIPGELENAAFDKSFLNNPGLCATGPSFGLSIC  165
            +PP++G L+L  LNLSSNHL+G IP  LENAA++ SFLNNPGLC +     L +C
Sbjct  340  IPPQLGSLKLNFLNLSSNHLTGEIPRLLENAAYNTSFLNNPGLCTSSSLLNLHVC  394



>gb|KDP33800.1| hypothetical protein JCGZ_07371 [Jatropha curcas]
Length=978

 Score = 49.3 bits (116),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 33/56 (59%), Positives = 43/56 (77%), Gaps = 0/56 (0%)
 Frame = +1

Query  1    VPPEIGrlrltslnlssnhlsGRIPGELENAAFDKSFLNNPGLCATGPSFGLSICK  168
            +PP+   L+LT LNLSSNHLSG IP E +NAA++ SFLNNPGLCA+     L++C+
Sbjct  563  IPPQCSSLKLTFLNLSSNHLSGEIPSEFQNAAYNNSFLNNPGLCASNSLLNLNVCQ  618



>ref|XP_011007104.1| PREDICTED: receptor-like protein kinase HSL1 [Populus euphratica]
Length=982

 Score = 49.3 bits (116),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 32/55 (58%), Positives = 39/55 (71%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    VPPEIGrlrltslnlssnhlsGRIPGELENAAFDKSFLNNPGLCATGPSFGLSIC  165
            +PP++G LRL  LNLSSN+L G+IP E EN A+  SFLNNPGLC    S  L +C
Sbjct  560  IPPQLGSLRLVFLNLSSNNLMGQIPTEYENVAYATSFLNNPGLCTRRSSLYLKVC  614



>ref|XP_006475586.1| PREDICTED: receptor-like protein kinase 5-like [Citrus sinensis]
Length=1014

 Score = 48.9 bits (115),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 34/55 (62%), Positives = 41/55 (75%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    VPPEIGrlrltslnlssnhlsGRIPGELENAAFDKSFLNNPGLCATGPSFGLSIC  165
            +PP+IGRL LTSLNLSSN L+G IP + EN A+  SFLNNPGLCA+  +  L  C
Sbjct  566  IPPQIGRLMLTSLNLSSNRLTGEIPSQFENRAYASSFLNNPGLCASSSNVNLKSC  620



>gb|KDO66581.1| hypothetical protein CISIN_1g001778mg [Citrus sinensis]
Length=1014

 Score = 48.9 bits (115),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 34/55 (62%), Positives = 41/55 (75%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    VPPEIGrlrltslnlssnhlsGRIPGELENAAFDKSFLNNPGLCATGPSFGLSIC  165
            +PP+IGRL LTSLNLSSN L+G IP + EN A+  SFLNNPGLCA+  +  L  C
Sbjct  566  IPPQIGRLMLTSLNLSSNRLTGEIPSQFENRAYASSFLNNPGLCASSSNVNLKSC  620



>ref|XP_007013026.1| Kinase family protein with leucine-rich repeat domain, putative 
[Theobroma cacao]
 gb|EOY30645.1| Kinase family protein with leucine-rich repeat domain, putative 
[Theobroma cacao]
Length=1006

 Score = 48.9 bits (115),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 34/55 (62%), Positives = 41/55 (75%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    VPPEIGrlrltslnlssnhlsGRIPGELENAAFDKSFLNNPGLCATGPSFGLSIC  165
            +PP++G LRLTSLNLSSN L G IP + ENAA+  SFL+NPGLCA+ P   L  C
Sbjct  570  IPPKLGLLRLTSLNLSSNLLIGNIPKQFENAAYSNSFLHNPGLCASSPYINLENC  624



>ref|XP_006451306.1| hypothetical protein CICLE_v10007383mg [Citrus clementina]
 gb|ESR64546.1| hypothetical protein CICLE_v10007383mg [Citrus clementina]
Length=934

 Score = 48.9 bits (115),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 34/55 (62%), Positives = 41/55 (75%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    VPPEIGrlrltslnlssnhlsGRIPGELENAAFDKSFLNNPGLCATGPSFGLSIC  165
            +PP+IGRL LTSLNLSSN L+G IP + EN A+  SFLNNPGLCA+  +  L  C
Sbjct  486  IPPQIGRLMLTSLNLSSNRLTGEIPSQFENRAYASSFLNNPGLCASSSNVNLKSC  540



>ref|XP_010047253.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO1 [Eucalyptus grandis]
 gb|KCW79117.1| hypothetical protein EUGRSUZ_C00558 [Eucalyptus grandis]
Length=1026

 Score = 48.9 bits (115),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 22/34 (65%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = +1

Query  64   GRIPGELENAAFDKSFLNNPGLCATGPSFGLSIC  165
            GRIP +LENAA+  SFLNNPGLCA+ P   L+ C
Sbjct  596  GRIPDKLENAAYAASFLNNPGLCASNPLIRLNSC  629



>ref|XP_007203859.1| hypothetical protein PRUPE_ppa022167mg [Prunus persica]
 gb|EMJ05058.1| hypothetical protein PRUPE_ppa022167mg [Prunus persica]
Length=1016

 Score = 48.9 bits (115),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 22/34 (65%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = +1

Query  64   GRIPGELENAAFDKSFLNNPGLCATGPSFGLSIC  165
            G+IP E EN A+D+SFL+N GLCAT  S  LSIC
Sbjct  594  GKIPFEFENPAYDRSFLDNQGLCATSSSEKLSIC  627



>ref|XP_010910701.1| PREDICTED: receptor-like protein kinase HSL1 isoform X2 [Elaeis 
guineensis]
Length=895

 Score = 48.5 bits (114),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 32/56 (57%), Positives = 43/56 (77%), Gaps = 0/56 (0%)
 Frame = +1

Query  1    VPPEIGrlrltslnlssnhlsGRIPGELENAAFDKSFLNNPGLCATGPSFGLSICK  168
            +PPEIG L+L +LNLSSN LSG IP  L++AA+++SFL+NP LCA+     + ICK
Sbjct  514  IPPEIGDLKLKTLNLSSNRLSGEIPISLQDAAYNRSFLSNPSLCASSELLNVPICK  569



>ref|XP_010910702.1| PREDICTED: receptor-like protein kinase HSL1 isoform X3 [Elaeis 
guineensis]
Length=894

 Score = 48.5 bits (114),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 32/56 (57%), Positives = 43/56 (77%), Gaps = 0/56 (0%)
 Frame = +1

Query  1    VPPEIGrlrltslnlssnhlsGRIPGELENAAFDKSFLNNPGLCATGPSFGLSICK  168
            +PPEIG L+L +LNLSSN LSG IP  L++AA+++SFL+NP LCA+     + ICK
Sbjct  514  IPPEIGDLKLKTLNLSSNRLSGEIPISLQDAAYNRSFLSNPSLCASSELLNVPICK  569



>ref|XP_006394841.1| hypothetical protein EUTSA_v10003585mg [Eutrema salsugineum]
 gb|ESQ32127.1| hypothetical protein EUTSA_v10003585mg [Eutrema salsugineum]
Length=1005

 Score = 48.5 bits (114),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 31/56 (55%), Positives = 42/56 (75%), Gaps = 0/56 (0%)
 Frame = +1

Query  1    VPPEIGrlrltslnlssnhlsGRIPGELENAAFDKSFLNNPGLCATGPSFGLSICK  168
            +PPEIG L+LT+L+LSSN L+G IP +L+N A+++SFLNN  LCA  P   L  C+
Sbjct  560  IPPEIGNLKLTTLDLSSNRLTGEIPDQLDNLAYERSFLNNSNLCADKPVLSLPDCR  615



>ref|XP_010910700.1| PREDICTED: receptor-like protein kinase HSL1 isoform X1 [Elaeis 
guineensis]
Length=934

 Score = 48.5 bits (114),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 32/56 (57%), Positives = 43/56 (77%), Gaps = 0/56 (0%)
 Frame = +1

Query  1    VPPEIGrlrltslnlssnhlsGRIPGELENAAFDKSFLNNPGLCATGPSFGLSICK  168
            +PPEIG L+L +LNLSSN LSG IP  L++AA+++SFL+NP LCA+     + ICK
Sbjct  514  IPPEIGDLKLKTLNLSSNRLSGEIPISLQDAAYNRSFLSNPSLCASSELLNVPICK  569



>ref|XP_011007101.1| PREDICTED: receptor-like protein kinase 5 [Populus euphratica]
Length=982

 Score = 48.1 bits (113),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 32/55 (58%), Positives = 39/55 (71%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    VPPEIGrlrltslnlssnhlsGRIPGELENAAFDKSFLNNPGLCATGPSFGLSIC  165
            +PP++G LRL  LNLSSN+L G+IP E ENAA+  SFLNNPGLC    S    +C
Sbjct  560  IPPQLGSLRLVFLNLSSNNLMGQIPTEYENAAYATSFLNNPGLCTRRSSLYHKVC  614



>ref|XP_006596181.1| PREDICTED: receptor-like protein kinase HSL1-like isoform X1 
[Glycine max]
Length=1032

 Score = 48.1 bits (113),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 33/55 (60%), Positives = 39/55 (71%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    VPPEIGrlrltslnlssnhlsGRIPGELENAAFDKSFLNNPGLCATGPSFGLSIC  165
            +PP++G LRL  LNLSSN LSG +P E  N A++ SFLNNP LCA  PS  LS C
Sbjct  563  IPPKLGTLRLVFLNLSSNKLSGSVPDEFNNLAYESSFLNNPDLCAYNPSLNLSSC  617



>ref|XP_006596182.1| PREDICTED: receptor-like protein kinase HSL1-like isoform X2 
[Glycine max]
Length=883

 Score = 48.1 bits (113),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 33/55 (60%), Positives = 39/55 (71%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    VPPEIGrlrltslnlssnhlsGRIPGELENAAFDKSFLNNPGLCATGPSFGLSIC  165
            +PP++G LRL  LNLSSN LSG +P E  N A++ SFLNNP LCA  PS  LS C
Sbjct  563  IPPKLGTLRLVFLNLSSNKLSGSVPDEFNNLAYESSFLNNPDLCAYNPSLNLSSC  617



>ref|XP_002324455.2| hypothetical protein POPTR_0018s09540g [Populus trichocarpa]
 gb|EEF03020.2| hypothetical protein POPTR_0018s09540g [Populus trichocarpa]
Length=984

 Score = 47.8 bits (112),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 31/55 (56%), Positives = 39/55 (71%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    VPPEIGrlrltslnlssnhlsGRIPGELENAAFDKSFLNNPGLCATGPSFGLSIC  165
            +PP++G LRL  LNLSSN+L G+IP E E+ A+  SFLNNPGLC    S  L +C
Sbjct  562  IPPQLGSLRLVFLNLSSNNLMGKIPTEYEDVAYATSFLNNPGLCTRRSSLYLKVC  616



>ref|XP_010047669.1| PREDICTED: receptor-like protein kinase 5 [Eucalyptus grandis]
Length=1020

 Score = 47.8 bits (112),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 33/55 (60%), Positives = 41/55 (75%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    VPPEIGrlrltslnlssnhlsGRIPGELENAAFDKSFLNNPGLCATGPSFGLSIC  165
            +PPEIG+L L  LNLSSN LSG IP +LE AA+D SFLNN GLCA+     +++C
Sbjct  572  IPPEIGQLNLNRLNLSSNRLSGPIPAKLEIAAYDTSFLNNTGLCASNSFMRINVC  626



>gb|KCW79627.1| hypothetical protein EUGRSUZ_C00986 [Eucalyptus grandis]
Length=776

 Score = 47.8 bits (112),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 33/55 (60%), Positives = 41/55 (75%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    VPPEIGrlrltslnlssnhlsGRIPGELENAAFDKSFLNNPGLCATGPSFGLSIC  165
            +PPEIG+L L  LNLSSN LSG IP +LE AA+D SFLNN GLCA+     +++C
Sbjct  445  IPPEIGQLNLNRLNLSSNRLSGPIPAKLEIAAYDTSFLNNTGLCASNSFMRINVC  499



>gb|KCW79626.1| hypothetical protein EUGRSUZ_C00986 [Eucalyptus grandis]
Length=893

 Score = 47.8 bits (112),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 33/55 (60%), Positives = 41/55 (75%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    VPPEIGrlrltslnlssnhlsGRIPGELENAAFDKSFLNNPGLCATGPSFGLSIC  165
            +PPEIG+L L  LNLSSN LSG IP +LE AA+D SFLNN GLCA+     +++C
Sbjct  445  IPPEIGQLNLNRLNLSSNRLSGPIPAKLEIAAYDTSFLNNTGLCASNSFMRINVC  499



>ref|XP_010924441.1| PREDICTED: receptor-like protein kinase 5 [Elaeis guineensis]
Length=1057

 Score = 47.8 bits (112),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 32/56 (57%), Positives = 43/56 (77%), Gaps = 0/56 (0%)
 Frame = +1

Query  1    VPPEIGrlrltslnlssnhlsGRIPGELENAAFDKSFLNNPGLCATGPSFGLSICK  168
            +PPEIG L+L +LNLSSN LSG IP  L++AA+++SFL+NP LCA+     + ICK
Sbjct  637  IPPEIGGLKLKTLNLSSNRLSGEIPISLQDAAYNRSFLSNPSLCASSELLNVPICK  692



>ref|XP_010050391.1| PREDICTED: receptor-like protein kinase 5 [Eucalyptus grandis]
Length=883

 Score = 47.8 bits (112),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 29/55 (53%), Positives = 38/55 (69%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    VPPEIGrlrltslnlssnhlsGRIPGELENAAFDKSFLNNPGLCATGPSFGLSIC  165
            +PPE G+L L  LN+S N L G IP + ENAA+D SFLNN GLCA+     +++C
Sbjct  425  IPPEFGQLNLDRLNVSFNRLRGPIPAKFENAAYDTSFLNNAGLCASNSFMRINVC  479



>gb|KCW79123.1| hypothetical protein EUGRSUZ_C00564, partial [Eucalyptus grandis]
Length=958

 Score = 47.8 bits (112),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 29/55 (53%), Positives = 38/55 (69%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    VPPEIGrlrltslnlssnhlsGRIPGELENAAFDKSFLNNPGLCATGPSFGLSIC  165
            +PPE G+L L  LN+S N L G IP + ENAA+D SFLNN GLCA+     +++C
Sbjct  521  IPPEFGQLNLDRLNVSFNRLRGPIPAKFENAAYDTSFLNNAGLCASNSFMRINVC  575



>gb|KEH27211.1| LRR receptor-like kinase family protein [Medicago truncatula]
Length=868

 Score = 47.4 bits (111),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 18/35 (51%), Positives = 26/35 (74%), Gaps = 0/35 (0%)
 Frame = +1

Query  64   GRIPGELENAAFDKSFLNNPGLCATGPSFGLSICK  168
            GR+P E EN+A+D+SFLNN G+C    +  L++CK
Sbjct  535  GRVPIEFENSAYDRSFLNNSGVCVGTQALNLTLCK  569



>gb|KHN40381.1| LRR receptor-like serine/threonine-protein kinase HSL2 [Glycine 
soja]
Length=804

 Score = 47.4 bits (111),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 18/34 (53%), Positives = 24/34 (71%), Gaps = 0/34 (0%)
 Frame = +1

Query  64   GRIPGELENAAFDKSFLNNPGLCATGPSFGLSIC  165
            GR+P E +N A+D SFL+N GLCA  P+  L +C
Sbjct  382  GRVPSEFDNPAYDTSFLDNSGLCADTPALSLRLC  415



>ref|XP_009151498.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase At1g17230 [Brassica rapa]
Length=317

 Score = 46.6 bits (109),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 28/56 (50%), Positives = 38/56 (68%), Gaps = 0/56 (0%)
 Frame = +1

Query  1    VPPEIGrlrltslnlssnhlsGRIPGELENAAFDKSFLNNPGLCATGPSFGLSICK  168
            +PPEIG L+  +LN SSN L+G +P +L+N A++ SFLNN  LCA  P   L  C+
Sbjct  224  IPPEIGNLKFKTLNFSSNMLTGEVPDQLDNLAYETSFLNNTNLCADKPVVKLQDCR  279



>ref|XP_006286985.1| hypothetical protein CARUB_v10000132mg [Capsella rubella]
 gb|EOA19883.1| hypothetical protein CARUB_v10000132mg [Capsella rubella]
Length=1006

 Score = 47.4 bits (111),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 30/56 (54%), Positives = 38/56 (68%), Gaps = 0/56 (0%)
 Frame = +1

Query  1    VPPEIGrlrltslnlssnhlsGRIPGELENAAFDKSFLNNPGLCATGPSFGLSICK  168
            +PPEIG L LT L+LSSN   G IP +L+N A+++SFLNN  LCA  P   L  C+
Sbjct  560  IPPEIGSLELTILDLSSNRFIGEIPYQLDNLAYERSFLNNSNLCADKPVINLPDCR  615



>emb|CDX88207.1| BnaA06g27980D [Brassica napus]
Length=348

 Score = 46.6 bits (109),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 28/56 (50%), Positives = 38/56 (68%), Gaps = 0/56 (0%)
 Frame = +1

Query  1    VPPEIGrlrltslnlssnhlsGRIPGELENAAFDKSFLNNPGLCATGPSFGLSICK  168
            +PPEIG L+  +LN SSN L+G +P +L+N A++ SFLNN  LCA  P   L  C+
Sbjct  224  IPPEIGNLKFKTLNFSSNMLTGEVPDQLDNLAYETSFLNNTNLCADKPVVKLQDCR  279



>ref|XP_003517639.1| PREDICTED: receptor-like protein kinase HSL1-like [Glycine max]
Length=1010

 Score = 47.4 bits (111),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 18/34 (53%), Positives = 24/34 (71%), Gaps = 0/34 (0%)
 Frame = +1

Query  64   GRIPGELENAAFDKSFLNNPGLCATGPSFGLSIC  165
            GR+P E +N A+D SFL+N GLCA  P+  L +C
Sbjct  588  GRVPSEFDNPAYDTSFLDNSGLCADTPALSLRLC  621



>ref|NP_197965.1| protein kinase family protein with leucine-rich repeat domain 
[Arabidopsis thaliana]
 gb|AAD40144.1|AF149413_25 contains similarity to protein kinase domains (Pfam F00069, Score=162.6, 
E=6.8e-45, N=1) and leucien rich repeats (Pfam PF00560, 
Score=210.7, E=2.2e-59, N=10) [Arabidopsis thaliana]
 gb|AAO42089.1| putative receptor protein kinase [Arabidopsis thaliana]
 gb|ACN59374.1| leucine-rich repeat receptor-like protein kinase [Arabidopsis 
thaliana]
 gb|AED93502.1| protein kinase family protein with leucine-rich repeat domain 
[Arabidopsis thaliana]
Length=1005

 Score = 47.0 bits (110),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 30/56 (54%), Positives = 41/56 (73%), Gaps = 0/56 (0%)
 Frame = +1

Query  1    VPPEIGrlrltslnlssnhlsGRIPGELENAAFDKSFLNNPGLCATGPSFGLSICK  168
            +PPEIG L+LT+ N+SSN L+G IP +L+N A+++SFLNN  LCA  P   L  C+
Sbjct  560  IPPEIGSLKLTTFNVSSNRLTGGIPEQLDNLAYERSFLNNSNLCADNPVLSLPDCR  615



>dbj|BAH19649.1| AT5G25930 [Arabidopsis thaliana]
Length=835

 Score = 47.0 bits (110),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 30/56 (54%), Positives = 41/56 (73%), Gaps = 0/56 (0%)
 Frame = +1

Query  1    VPPEIGrlrltslnlssnhlsGRIPGELENAAFDKSFLNNPGLCATGPSFGLSICK  168
            +PPEIG L+LT+ N+SSN L+G IP +L+N A+++SFLNN  LCA  P   L  C+
Sbjct  560  IPPEIGSLKLTTFNVSSNRLTGGIPEQLDNLAYERSFLNNSNLCADNPVLSLPDCR  615



>ref|XP_002872190.1| leucine-rich repeat family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH48449.1| leucine-rich repeat family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=1005

 Score = 47.0 bits (110),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 31/56 (55%), Positives = 42/56 (75%), Gaps = 0/56 (0%)
 Frame = +1

Query  1    VPPEIGrlrltslnlssnhlsGRIPGELENAAFDKSFLNNPGLCATGPSFGLSICK  168
            +PPEIG L+LT+LN+SSN L+G IP +L+N A+++SFLNN  LCA  P   L  C+
Sbjct  560  IPPEIGSLKLTTLNVSSNRLTGGIPEQLDNLAYERSFLNNSNLCADKPVLNLPDCR  615



>emb|CDX80547.1| BnaC07g28970D [Brassica napus]
Length=902

 Score = 47.0 bits (110),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 29/56 (52%), Positives = 40/56 (71%), Gaps = 0/56 (0%)
 Frame = +1

Query  1    VPPEIGrlrltslnlssnhlsGRIPGELENAAFDKSFLNNPGLCATGPSFGLSICK  168
            +PPE+G L+ T+LNLSSN L+G +P +L+N A++ SFLNN  LCA  P   L  C+
Sbjct  456  IPPEVGSLKFTTLNLSSNMLTGEVPDQLDNLAYETSFLNNTNLCADTPVVKLQDCR  511



>gb|KHN16979.1| Receptor-like protein kinase HSL1 [Glycine soja]
Length=744

 Score = 46.6 bits (109),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 20/34 (59%), Positives = 24/34 (71%), Gaps = 0/34 (0%)
 Frame = +1

Query  64   GRIPGELENAAFDKSFLNNPGLCATGPSFGLSIC  165
            GRIP ELEN A+ +SFLNN GLCA      L++C
Sbjct  563  GRIPSELENLAYARSFLNNSGLCADSKVLNLTLC  596



>ref|XP_006599802.1| PREDICTED: receptor-like protein kinase HSL1-like [Glycine max]
Length=718

 Score = 46.6 bits (109),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 20/34 (59%), Positives = 24/34 (71%), Gaps = 0/34 (0%)
 Frame = +1

Query  64   GRIPGELENAAFDKSFLNNPGLCATGPSFGLSIC  165
            GRIP ELEN A+ +SFLNN GLCA      L++C
Sbjct  537  GRIPSELENLAYARSFLNNSGLCADSKVLNLTLC  570



>gb|KCW79122.1| hypothetical protein EUGRSUZ_C00563 [Eucalyptus grandis]
Length=962

 Score = 46.6 bits (109),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 33/55 (60%), Positives = 40/55 (73%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    VPPEIGrlrltslnlssnhlsGRIPGELENAAFDKSFLNNPGLCATGPSFGLSIC  165
            +PPE G+L L  LNLSSN LSG IP  LENAA+D SFLNN GLCA+     +++C
Sbjct  558  IPPEFGQLNLNRLNLSSNRLSGPIPAILENAAYDVSFLNNLGLCASNSFMRINVC  612



>ref|XP_009352556.1| PREDICTED: receptor-like protein kinase HSL1 [Pyrus x bretschneideri]
Length=1023

 Score = 46.6 bits (109),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 31/55 (56%), Positives = 41/55 (75%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    VPPEIGrlrltslnlssnhlsGRIPGELENAAFDKSFLNNPGLCATGPSFGLSIC  165
            +P ++G L++  LNLSSNHL G+IP E ENAA++ SFL+N GLCAT  S  L +C
Sbjct  576  IPDQLGHLKINQLNLSSNHLYGKIPTEFENAAYEGSFLDNRGLCATSSSAKLPMC  630



>ref|XP_010050389.1| PREDICTED: receptor-like protein kinase HSL1 [Eucalyptus grandis]
Length=908

 Score = 46.6 bits (109),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 33/55 (60%), Positives = 40/55 (73%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    VPPEIGrlrltslnlssnhlsGRIPGELENAAFDKSFLNNPGLCATGPSFGLSIC  165
            +PPE G+L L  LNLSSN LSG IP  LENAA+D SFLNN GLCA+     +++C
Sbjct  565  IPPEFGQLNLNRLNLSSNRLSGPIPAILENAAYDVSFLNNLGLCASNSFMRINVC  619



>ref|XP_009409608.1| PREDICTED: receptor-like protein kinase HSL1 [Musa acuminata 
subsp. malaccensis]
Length=1042

 Score = 46.6 bits (109),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 28/55 (51%), Positives = 42/55 (76%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    VPPEIGrlrltslnlssnhlsGRIPGELENAAFDKSFLNNPGLCATGPSFGLSIC  165
            +PPEIG L+L  LNL+ N L+G +P +L+N A+++SFL+NPGLC++     L+IC
Sbjct  629  IPPEIGNLKLNLLNLTYNKLTGEVPLQLQNRAYERSFLSNPGLCSSKRIENLNIC  683



>ref|XP_009151111.1| PREDICTED: receptor-like protein kinase 5 [Brassica rapa]
Length=1006

 Score = 46.6 bits (109),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 29/56 (52%), Positives = 40/56 (71%), Gaps = 0/56 (0%)
 Frame = +1

Query  1    VPPEIGrlrltslnlssnhlsGRIPGELENAAFDKSFLNNPGLCATGPSFGLSICK  168
            +PPE+G L+ T+LNLSSN L+G +P +L+N A++ SFLNN  LCA  P   L  C+
Sbjct  560  IPPEVGSLKFTTLNLSSNMLTGEVPDQLDNLAYETSFLNNTNLCADTPVVKLQDCR  615



>ref|XP_010454934.1| PREDICTED: receptor-like protein kinase 5 [Camelina sativa]
Length=1007

 Score = 46.6 bits (109),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 29/56 (52%), Positives = 40/56 (71%), Gaps = 0/56 (0%)
 Frame = +1

Query  1    VPPEIGrlrltslnlssnhlsGRIPGELENAAFDKSFLNNPGLCATGPSFGLSICK  168
            +PPEIG ++LT L+LSSN L+G IP + +N A+++SFLNN  LCA  P   L  C+
Sbjct  560  IPPEIGNMKLTILDLSSNRLTGEIPDQYDNLAYERSFLNNSNLCADNPVVNLPDCR  615



>gb|KHN40380.1| Receptor-like protein kinase HSL1 [Glycine soja]
Length=930

 Score = 46.6 bits (109),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 20/34 (59%), Positives = 23/34 (68%), Gaps = 0/34 (0%)
 Frame = +1

Query  64   GRIPGELENAAFDKSFLNNPGLCATGPSFGLSIC  165
            GRIP ELEN A+  SFLNN GLCA      L++C
Sbjct  510  GRIPSELENLAYATSFLNNSGLCADSKVLNLTLC  543



>emb|CDX88206.1| BnaA06g27970D [Brassica napus]
Length=1007

 Score = 46.6 bits (109),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 30/56 (54%), Positives = 40/56 (71%), Gaps = 0/56 (0%)
 Frame = +1

Query  1    VPPEIGrlrltslnlssnhlsGRIPGELENAAFDKSFLNNPGLCATGPSFGLSICK  168
            +PPE+G L+ TSLNLSSN L+G +P +L+N A++ SFLNN  LCA  P   L  C+
Sbjct  560  IPPEVGSLKFTSLNLSSNMLTGEVPDQLDNLAYETSFLNNTNLCADTPVVKLQDCR  615



>ref|XP_010421450.1| PREDICTED: receptor-like protein kinase 5 [Camelina sativa]
Length=1007

 Score = 46.2 bits (108),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 29/56 (52%), Positives = 40/56 (71%), Gaps = 0/56 (0%)
 Frame = +1

Query  1    VPPEIGrlrltslnlssnhlsGRIPGELENAAFDKSFLNNPGLCATGPSFGLSICK  168
            +PPEIG ++LT L+LSSN L+G IP + +N A+++SFLNN  LCA  P   L  C+
Sbjct  560  IPPEIGNMKLTILDLSSNRLTGEIPDQYDNLAYERSFLNNSNLCADKPVVNLPDCR  615



>emb|CDY05509.1| BnaA02g31820D [Brassica napus]
Length=966

 Score = 46.2 bits (108),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 30/56 (54%), Positives = 41/56 (73%), Gaps = 0/56 (0%)
 Frame = +1

Query  1    VPPEIGrlrltslnlssnhlsGRIPGELENAAFDKSFLNNPGLCATGPSFGLSICK  168
            +PPEIG L+LT+LNLSSN L+G +P +L+N A+++SF NN  LCA  P   L  C+
Sbjct  527  IPPEIGNLKLTTLNLSSNRLTGEVPDQLDNLAYERSFFNNTNLCADKPVLNLPDCR  582



>ref|XP_010278042.1| PREDICTED: receptor-like protein kinase 5 [Nelumbo nucifera]
Length=1024

 Score = 46.2 bits (108),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 33/55 (60%), Positives = 37/55 (67%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    VPPEIGrlrltslnlssnhlsGRIPGELENAAFDKSFLNNPGLCATGPSFGLSIC  165
            +P EIGRLRLT LNLSSN   G+IP E EN A+  SFL NPGLCA      L +C
Sbjct  568  IPSEIGRLRLTFLNLSSNQFMGKIPDEFENMAYKNSFLINPGLCADNALLNLRVC  622



>ref|XP_003516786.2| PREDICTED: receptor-like protein kinase 5-like [Glycine max]
Length=1013

 Score = 46.2 bits (108),  Expect = 8e-04, Method: Composition-based stats.
 Identities = 20/34 (59%), Positives = 23/34 (68%), Gaps = 0/34 (0%)
 Frame = +1

Query  64   GRIPGELENAAFDKSFLNNPGLCATGPSFGLSIC  165
            GRIP ELEN A+  SFLNN GLCA      L++C
Sbjct  593  GRIPSELENLAYATSFLNNSGLCADSKVLNLTLC  626



>ref|XP_008242543.1| PREDICTED: receptor-like protein kinase HSL1 [Prunus mume]
Length=938

 Score = 46.2 bits (108),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 21/34 (62%), Positives = 25/34 (74%), Gaps = 0/34 (0%)
 Frame = +1

Query  64   GRIPGELENAAFDKSFLNNPGLCATGPSFGLSIC  165
            G+IP E EN A+D+SFL+N GLCA   S  LSIC
Sbjct  522  GKIPFEFENPAYDRSFLDNQGLCAISLSEKLSIC  555



>ref|XP_007152973.1| hypothetical protein PHAVU_004G175900g [Phaseolus vulgaris]
 gb|ESW24967.1| hypothetical protein PHAVU_004G175900g [Phaseolus vulgaris]
Length=1005

 Score = 46.2 bits (108),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 18/36 (50%), Positives = 24/36 (67%), Gaps = 0/36 (0%)
 Frame = +1

Query  64   GRIPGELENAAFDKSFLNNPGLCATGPSFGLSICKL  171
            GR+P E EN+ + +SFLNN GLCA  P   L +C +
Sbjct  580  GRVPNEFENSVYSESFLNNSGLCADTPVLNLRLCNV  615



>ref|XP_010249486.1| PREDICTED: receptor-like protein kinase HSL1 [Nelumbo nucifera]
Length=1034

 Score = 46.2 bits (108),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 33/55 (60%), Positives = 38/55 (69%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    VPPEIGrlrltslnlssnhlsGRIPGELENAAFDKSFLNNPGLCATGPSFGLSIC  165
            +P EIG LRLT LNLSSN L+G IP E EN A++ SFLNN GLCA      L +C
Sbjct  568  IPSEIGSLRLTFLNLSSNQLTGMIPDEFENMAYENSFLNNSGLCAANVFLNLRVC  622



>ref|XP_010924676.1| PREDICTED: receptor-like protein kinase 5 [Elaeis guineensis]
Length=864

 Score = 45.8 bits (107),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 30/56 (54%), Positives = 41/56 (73%), Gaps = 0/56 (0%)
 Frame = +1

Query  1    VPPEIGrlrltslnlssnhlsGRIPGELENAAFDKSFLNNPGLCATGPSFGLSICK  168
            +PPEIG L+L  L+LSSN LSG IP  L++AA+++SFL+NP LC +     + ICK
Sbjct  446  IPPEIGDLKLGMLDLSSNRLSGEIPISLQDAAYNQSFLSNPSLCTSSELLNVPICK  501



>ref|XP_010493845.1| PREDICTED: receptor-like protein kinase 5 isoform X1 [Camelina 
sativa]
 ref|XP_010493847.1| PREDICTED: receptor-like protein kinase 5 isoform X2 [Camelina 
sativa]
Length=1007

 Score = 45.8 bits (107),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 30/56 (54%), Positives = 40/56 (71%), Gaps = 0/56 (0%)
 Frame = +1

Query  1    VPPEIGrlrltslnlssnhlsGRIPGELENAAFDKSFLNNPGLCATGPSFGLSICK  168
            +PPEIG +RLT L+LSSN L+G IP + +N A+++SFLNN  LCA  P   L  C+
Sbjct  560  IPPEIGNIRLTILDLSSNRLTGEIPDQYDNLAYERSFLNNSNLCADKPVVNLPDCR  615



Lambda      K        H        a         alpha
   0.317    0.142    0.445    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 509996894868