BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c54887_g1_i1 len=144 path=[1:0-143]

Length=144
                                                                      Score     E

ref|XP_002527490.1|  conserved hypothetical protein                   43.1    5e-04   Ricinus communis



>ref|XP_002527490.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF34888.1| conserved hypothetical protein [Ricinus communis]
Length=60

 Score = 43.1 bits (100),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 22/37 (59%), Positives = 24/37 (65%), Gaps = 0/37 (0%)
 Frame = +2

Query  32   IYWLARSKW*VRLCSLCEGRGFSVLRSEGTASGWFHR  142
            + WLARSK  V  C L EG G    R+EGTA GWFHR
Sbjct  1    MIWLARSKLRVDPCGLGEGPGSMGPRAEGTALGWFHR  37



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 506149393984