BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c54495_g1_i1 len=169 path=[1:0-168]

Length=169
                                                                      Score     E

ref|XP_008358108.1|  PREDICTED: IST1 homolog                            103   1e-26   
ref|XP_008358845.1|  PREDICTED: IST1 homolog                            100   2e-25   
ref|XP_004290444.1|  PREDICTED: uncharacterized protein LOC101296917    106   2e-25   
ref|XP_008464351.1|  PREDICTED: uncharacterized protein LOC103502259    107   2e-25   
ref|XP_011038197.1|  PREDICTED: IST1 homolog                            106   3e-25   
ref|XP_010501779.1|  PREDICTED: IST1 homolog                            102   4e-25   
ref|XP_004162170.1|  PREDICTED: uncharacterized LOC101208940            106   4e-25   
ref|XP_004138362.1|  PREDICTED: uncharacterized protein LOC101208940    106   4e-25   
ref|XP_006376337.1|  hypothetical protein POPTR_0013s12140g             105   5e-25   
ref|XP_007201705.1|  hypothetical protein PRUPE_ppa004125mg             105   5e-25   
ref|XP_011074152.1|  PREDICTED: vacuolar protein sorting-associat...    104   7e-25   
ref|XP_009339749.1|  PREDICTED: IST1-like protein                       105   8e-25   
ref|XP_008381028.1|  PREDICTED: IST1-like protein                       105   8e-25   
ref|XP_008237348.1|  PREDICTED: IST1 homolog                            105   9e-25   
emb|CBI35325.3|  unnamed protein product                                103   1e-24   
ref|XP_011074151.1|  PREDICTED: uncharacterized protein LOC105158...    104   2e-24   
ref|XP_009339061.1|  PREDICTED: uncharacterized protein LOC103931...    104   2e-24   
gb|KDP22885.1|  hypothetical protein JCGZ_01959                         103   2e-24   
ref|XP_007020222.1|  Regulator of Vps4 activity in the MVB pathwa...    103   2e-24   
ref|XP_003548955.1|  PREDICTED: vacuolar protein sorting-associat...    103   3e-24   
gb|KHN32808.1|  IST1-like protein                                       103   3e-24   
ref|XP_003518384.1|  PREDICTED: uncharacterized protein DDB_G0271...    103   4e-24   
ref|XP_002534491.1|  protein with unknown function                      103   4e-24   Ricinus communis
emb|CAN60958.1|  hypothetical protein VITISV_034688                     103   4e-24   Vitis vinifera
ref|XP_002275027.1|  PREDICTED: uncharacterized protein LOC100245921    103   4e-24   Vitis vinifera
gb|ABY60784.1|  hypothetical protein                                    103   4e-24   Carica papaya [mamon]
gb|ABS32234.1|  hypothetical protein                                    103   4e-24   Carica papaya [mamon]
ref|XP_010499963.1|  PREDICTED: IST1 homolog isoform X1                 103   5e-24   
ref|XP_006473234.1|  PREDICTED: uncharacterized protein LOC102611062    102   5e-24   
ref|XP_002325569.2|  hypothetical protein POPTR_0019s11730g             102   5e-24   Populus trichocarpa [western balsam poplar]
gb|KDO83978.1|  hypothetical protein CISIN_1g009857mg                   102   5e-24   
ref|XP_010478853.1|  PREDICTED: IST1 homolog                            103   5e-24   
ref|XP_010543191.1|  PREDICTED: uncharacterized protein LOC104816...    102   6e-24   
ref|XP_010063798.1|  PREDICTED: IST1 homolog                            102   6e-24   
ref|XP_006434655.1|  hypothetical protein CICLE_v10000853mg             102   6e-24   
ref|XP_010530141.1|  PREDICTED: IST1 homolog                            102   8e-24   
gb|AAQ22619.1|  At1g34220                                               102   9e-24   Arabidopsis thaliana [mouse-ear cress]
ref|NP_174684.2|  Regulator of Vps4 activity in the MVB pathway p...    102   1e-23   Arabidopsis thaliana [mouse-ear cress]
gb|ABS32229.1|  hypothetical protein                                    101   1e-23   Carica papaya [mamon]
ref|NP_973961.1|  Regulator of Vps4 activity in the MVB pathway p...    102   1e-23   Arabidopsis thaliana [mouse-ear cress]
gb|KHG18028.1|  Uncharacterized protein F383_00577                      101   2e-23   
ref|XP_002893813.1|  hypothetical protein ARALYDRAFT_473574             102   2e-23   
ref|XP_010695698.1|  PREDICTED: IST1-like protein                     99.0    2e-23   
ref|XP_006303943.1|  hypothetical protein CARUB_v10008690mg             101   2e-23   
emb|CDX91784.1|  BnaC08g07030D                                          101   3e-23   
ref|XP_011002513.1|  PREDICTED: uncharacterized protein LOC105109486    100   3e-23   
ref|XP_008384411.1|  PREDICTED: uncharacterized protein LOC103447017    101   3e-23   
ref|XP_008809516.1|  PREDICTED: IST1-like protein isoform X1            100   4e-23   
emb|CDY46461.1|  BnaA08g06470D                                          100   4e-23   
ref|XP_008809517.1|  PREDICTED: IST1-like protein isoform X2            100   4e-23   
ref|XP_009107933.1|  PREDICTED: uncharacterized protein LOC103833603    100   4e-23   
ref|XP_004489726.1|  PREDICTED: dentin sialophosphoprotein-like         100   4e-23   
ref|XP_010939573.1|  PREDICTED: IST1 homolog                            100   5e-23   
ref|XP_004237874.1|  PREDICTED: uncharacterized protein LOC101268389    100   5e-23   
ref|XP_010261134.1|  PREDICTED: uncharacterized protein LOC104600038    100   5e-23   
ref|XP_006396076.1|  hypothetical protein EUTSA_v10007134mg             100   6e-23   
ref|XP_010692212.1|  PREDICTED: IST1 homolog                          99.4    8e-23   
ref|XP_010937030.1|  PREDICTED: IST1 homolog                          99.8    9e-23   
ref|NP_001275331.1|  uncharacterized protein LOC102585287             99.4    1e-22   
ref|XP_006354036.1|  PREDICTED: uncharacterized protein LOC102585287  99.0    1e-22   
ref|XP_009773832.1|  PREDICTED: uncharacterized protein LOC104223983  99.0    1e-22   
gb|KFK45126.1|  hypothetical protein AALP_AA1G347400                  99.4    2e-22   
ref|XP_010245870.1|  PREDICTED: uncharacterized protein LOC104589305  99.0    2e-22   
ref|XP_009591345.1|  PREDICTED: uncharacterized protein LOC104088390  98.6    2e-22   
ref|XP_009403189.1|  PREDICTED: ENHANCER OF AG-4 protein 2-like       98.6    2e-22   
ref|XP_007151911.1|  hypothetical protein PHAVU_004G086100g           98.2    2e-22   
gb|KEH25939.1|  regulator of Vps4 activity in the MVB pathway pro...  98.6    3e-22   
emb|CDP01161.1|  unnamed protein product                              98.2    3e-22   
ref|XP_009401388.1|  PREDICTED: IST1 homolog                          98.2    3e-22   
ref|XP_011083402.1|  PREDICTED: uncharacterized protein LOC105165944  97.4    6e-22   
ref|XP_008804491.1|  PREDICTED: IST1 homolog                          96.7    9e-22   
emb|CDY48635.1|  BnaC06g08120D                                        94.7    1e-21   
gb|EPS70884.1|  hypothetical protein M569_03876                       94.0    2e-21   
gb|EYU43558.1|  hypothetical protein MIMGU_mgv1a005603mg              92.4    2e-20   
gb|AFW57124.1|  hypothetical protein ZEAMMB73_703221                  85.5    4e-19   
ref|NP_001288461.1|  uncharacterized protein LOC103641204             89.4    4e-19   
ref|XP_006589468.1|  PREDICTED: IST1-like protein-like                82.8    3e-17   
emb|CDM86090.1|  unnamed protein product                              83.2    7e-17   
ref|XP_004972728.1|  PREDICTED: IST1-like protein-like isoform X1     82.4    1e-16   
dbj|BAJ94091.1|  predicted protein                                    82.0    2e-16   
ref|XP_004972729.1|  PREDICTED: IST1-like protein-like isoform X2     80.9    4e-16   
gb|AFK38152.1|  unknown                                               75.1    7e-16   
ref|XP_008676764.1|  PREDICTED: uncharacterized protein LOC100272...  80.1    8e-16   
ref|XP_006659884.1|  PREDICTED: polycystic kidney disease protein...  80.5    9e-16   
gb|EAZ05774.1|  hypothetical protein OsI_28007                        80.1    9e-16   Oryza sativa Indica Group [Indian rice]
ref|NP_001061111.1|  Os08g0175200                                     79.7    1e-15   Oryza sativa Japonica Group [Japonica rice]
gb|EMS63538.1|  hypothetical protein TRIUR3_01260                     79.3    1e-15   
ref|XP_003573416.1|  PREDICTED: IST1-like protein                     79.3    2e-15   
ref|XP_010543209.1|  PREDICTED: uncharacterized protein LOC104816...  79.0    2e-15   
gb|EMT04508.1|  hypothetical protein F775_29471                       77.8    5e-15   
gb|KHG18435.1|  IST1-like protein                                     78.2    6e-15   
ref|XP_010094831.1|  hypothetical protein L484_016412                 76.3    2e-14   
ref|XP_008806538.1|  PREDICTED: uncharacterized protein LOC103719...  76.6    2e-14   
ref|XP_008806530.1|  PREDICTED: uncharacterized protein LOC103719...  76.6    2e-14   
ref|XP_004513087.1|  PREDICTED: dentin sialophosphoprotein-like       76.6    2e-14   
ref|XP_010265126.1|  PREDICTED: IST1 homolog                          73.9    4e-14   
ref|XP_010924918.1|  PREDICTED: uncharacterized protein LOC105047619  76.3    4e-14   
ref|XP_007012909.1|  Regulator of Vps4 activity in the MVB pathwa...  74.7    1e-13   
ref|XP_008799245.1|  PREDICTED: IST1 homolog                          70.5    1e-13   
ref|XP_002456226.1|  hypothetical protein SORBIDRAFT_03g032440        73.9    2e-13   Sorghum bicolor [broomcorn]
ref|NP_001044016.2|  Os01g0706400                                     73.6    3e-13   Oryza sativa Japonica Group [Japonica rice]
gb|KHN32904.1|  IST1-like protein                                     73.6    3e-13   
ref|XP_003517626.1|  PREDICTED: dentin sialophosphoprotein-like       73.6    3e-13   
gb|EAY75540.1|  hypothetical protein OsI_03445                        73.6    3e-13   Oryza sativa Indica Group [Indian rice]
ref|XP_008656796.1|  PREDICTED: dentin sialophosphoprotein-like       73.2    4e-13   
ref|XP_009352609.1|  PREDICTED: filaggrin isoform X2                  73.2    5e-13   
ref|XP_009352608.1|  PREDICTED: filaggrin isoform X1                  73.2    5e-13   
ref|XP_002282696.1|  PREDICTED: IST1-like protein                     70.9    5e-13   Vitis vinifera
ref|XP_010912111.1|  PREDICTED: sericin 1-like                        72.8    5e-13   
ref|XP_004494081.1|  PREDICTED: IST1 homolog isoform X2               67.4    5e-13   
ref|XP_008361315.1|  PREDICTED: probable GPI-anchored adhesin-lik...  72.8    5e-13   
ref|XP_003530191.1|  PREDICTED: dentin sialophosphoprotein-like i...  72.8    6e-13   
ref|XP_007152932.1|  hypothetical protein PHAVU_004G172500g           72.8    6e-13   
ref|XP_006646252.1|  PREDICTED: dentin sialophosphoprotein-like       72.8    6e-13   
ref|XP_006360471.1|  PREDICTED: IST1 homolog                          67.8    6e-13   
gb|KHN40346.1|  IST1-like protein                                     72.4    7e-13   
ref|XP_004494080.1|  PREDICTED: IST1 homolog isoform X1               68.2    7e-13   
ref|XP_008242434.1|  PREDICTED: dentin sialophosphoprotein-like       72.4    7e-13   
ref|XP_009394434.1|  PREDICTED: IST1 homolog                          70.5    8e-13   
ref|XP_007046561.1|  Regulator of Vps4 activity in the MVB pathwa...  69.7    8e-13   
ref|XP_011079063.1|  PREDICTED: uncharacterized protein LOC105162673  71.2    9e-13   
ref|XP_004969692.1|  PREDICTED: dentin sialophosphoprotein-like       72.0    9e-13   
ref|XP_010266112.1|  PREDICTED: uncharacterized protein LOC104603713  71.2    9e-13   
ref|XP_008344216.1|  PREDICTED: IST1 homolog                          67.0    1e-12   
ref|XP_007203540.1|  hypothetical protein PRUPE_ppb008146mg           69.3    1e-12   
ref|XP_006412068.1|  hypothetical protein EUTSA_v10025095mg           70.9    1e-12   
ref|XP_002514165.1|  protein with unknown function                    71.6    1e-12   Ricinus communis
ref|XP_009150864.1|  PREDICTED: uncharacterized protein LOC103874176  70.5    1e-12   
gb|AES77090.2|  regulator of Vps4 activity in the MVB pathway pro...  71.6    1e-12   
ref|XP_003620872.1|  IST1-like protein                                71.6    1e-12   
gb|KCW82257.1|  hypothetical protein EUGRSUZ_C03673                   71.2    2e-12   
ref|XP_010049566.1|  PREDICTED: uncharacterized protein LOC104438...  71.2    2e-12   
ref|XP_008367261.1|  PREDICTED: probable GPI-anchored adhesin-lik...  71.2    2e-12   
gb|KCW56546.1|  hypothetical protein EUGRSUZ_I02282                   70.9    2e-12   
ref|XP_006296926.1|  hypothetical protein CARUB_v10012919mg           70.9    2e-12   
gb|KCW82256.1|  hypothetical protein EUGRSUZ_C03673                   70.9    2e-12   
ref|XP_010489136.1|  PREDICTED: uncharacterized protein LOC104766867  70.9    2e-12   
emb|CBI33275.3|  unnamed protein product                              69.3    3e-12   
ref|XP_009418373.1|  PREDICTED: IST1-like protein                     68.9    3e-12   
ref|XP_010416745.1|  PREDICTED: uncharacterized protein LOC104702567  70.9    3e-12   
ref|NP_179561.2|  Vps4 regulator of MVB pathway                       70.9    3e-12   Arabidopsis thaliana [mouse-ear cress]
dbj|BAF01603.1|  hypothetical protein                                 70.9    3e-12   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010262216.1|  PREDICTED: uncharacterized protein LOC104600776  70.9    3e-12   
ref|XP_008337638.1|  PREDICTED: dentin sialophosphoprotein isofor...  70.9    3e-12   
ref|XP_003635213.2|  PREDICTED: IST1-like protein                     69.7    3e-12   
ref|XP_003635529.1|  PREDICTED: IST1-like protein                     69.7    3e-12   
ref|XP_008337637.1|  PREDICTED: dentin sialophosphoprotein isofor...  70.5    3e-12   
ref|XP_008391519.1|  PREDICTED: dentin sialophosphoprotein-like       70.5    3e-12   
ref|XP_010495939.1|  PREDICTED: uncharacterized protein LOC104773084  70.5    4e-12   
ref|XP_004161651.1|  PREDICTED: IST1 homolog                          67.0    4e-12   
ref|XP_002279892.1|  PREDICTED: uncharacterized protein LOC100256...  70.1    5e-12   Vitis vinifera
emb|CDY41639.1|  BnaC03g62450D                                        68.9    5e-12   
ref|XP_011022214.1|  PREDICTED: IST1 homolog                          68.2    5e-12   
ref|XP_008781253.1|  PREDICTED: IST1-like protein                     68.9    5e-12   
dbj|BAJ93689.1|  predicted protein                                    65.9    5e-12   
gb|KFK30216.1|  hypothetical protein AALP_AA7G232900                  68.9    5e-12   
ref|XP_010941392.1|  PREDICTED: IST1-like protein                     68.9    5e-12   
ref|XP_008450820.1|  PREDICTED: probable GPI-anchored adhesin-lik...  70.1    5e-12   
ref|XP_006379742.1|  hypothetical protein POPTR_0008s12030g           67.8    6e-12   
ref|XP_004236982.1|  PREDICTED: IST1 homolog                          68.2    6e-12   
ref|XP_010656225.1|  PREDICTED: uncharacterized protein LOC100256...  69.7    6e-12   
gb|KHG16212.1|  IST1-like protein                                     68.6    7e-12   
ref|XP_002533970.1|  protein with unknown function                    67.8    7e-12   Ricinus communis
ref|XP_010921566.1|  PREDICTED: IST1 homolog isoform X2               67.8    7e-12   
ref|XP_011076713.1|  PREDICTED: IST1 homolog isoform X2               67.8    7e-12   
ref|XP_007044322.1|  Regulator of Vps4 activity in the MVB pathwa...  67.8    8e-12   
ref|XP_010113265.1|  hypothetical protein L484_026594                 68.6    8e-12   
ref|XP_010090010.1|  hypothetical protein L484_027240                 69.3    8e-12   
ref|XP_010051622.1|  PREDICTED: uncharacterized protein LOC104440388  68.9    8e-12   
gb|EPS63330.1|  hypothetical protein M569_11456                       66.2    9e-12   
ref|XP_008465781.1|  PREDICTED: IST1 homolog                          67.4    1e-11   
gb|KCW82531.1|  hypothetical protein EUGRSUZ_C03936                   68.6    1e-11   
ref|XP_004288917.1|  PREDICTED: uncharacterized protein LOC101312868  68.9    1e-11   
ref|XP_004140335.1|  PREDICTED: IST1 homolog                          67.4    1e-11   
ref|XP_007046560.1|  Regulator of Vps4 activity in the MVB pathwa...  68.2    1e-11   
emb|CDX82713.1|  BnaC07g01530D                                        68.9    1e-11   
ref|XP_009804183.1|  PREDICTED: IST1 homolog                          67.0    1e-11   
gb|KHG01623.1|  Uncharacterized protein F383_21801                    67.0    1e-11   
ref|XP_007222948.1|  hypothetical protein PRUPE_ppa008869mg           67.0    1e-11   
ref|XP_008243237.1|  PREDICTED: IST1 homolog                          67.0    1e-11   
ref|XP_006408888.1|  hypothetical protein EUTSA_v10001901mg           68.6    1e-11   
emb|CDX69159.1|  BnaC01g02940D                                        67.8    1e-11   
ref|XP_008339668.1|  PREDICTED: IST1 homolog                          66.6    1e-11   
ref|XP_009356835.1|  PREDICTED: IST1 homolog                          66.6    2e-11   
emb|CDM83721.1|  unnamed protein product                              68.6    2e-11   
ref|XP_010437435.1|  PREDICTED: uncharacterized protein LOC104721204  67.8    2e-11   
ref|XP_009624176.1|  PREDICTED: IST1 homolog                          66.6    2e-11   
ref|XP_009102144.1|  PREDICTED: uncharacterized protein LOC103828286  68.2    2e-11   
ref|XP_006283590.1|  hypothetical protein CARUB_v10004646mg           67.8    2e-11   
ref|XP_010681608.1|  PREDICTED: IST1 homolog isoform X1               66.6    2e-11   
ref|XP_010526826.1|  PREDICTED: uncharacterized protein LOC104804285  67.4    2e-11   
ref|XP_002869065.1|  hypothetical protein ARALYDRAFT_491075           67.4    2e-11   
ref|XP_010935225.1|  PREDICTED: IST1-like protein                     67.4    2e-11   
gb|KDP29414.1|  hypothetical protein JCGZ_18335                       66.6    2e-11   
ref|XP_009777469.1|  PREDICTED: uncharacterized protein LOC104227040  67.4    2e-11   
gb|EMT13152.1|  hypothetical protein F775_31310                       68.2    2e-11   
ref|XP_010446886.1|  PREDICTED: uncharacterized protein LOC104729623  67.4    2e-11   
ref|XP_008389286.1|  PREDICTED: IST1 homolog                          66.2    2e-11   
ref|XP_002521677.1|  protein with unknown function                    67.4    2e-11   Ricinus communis
ref|XP_008360045.1|  PREDICTED: IST1 homolog                          66.2    2e-11   
gb|EPS66564.1|  hypothetical protein M569_08211                       67.0    2e-11   
ref|XP_008797910.1|  PREDICTED: uncharacterized protein LOC103712964  68.2    2e-11   
ref|XP_010432238.1|  PREDICTED: uncharacterized protein LOC104716552  67.4    2e-11   
ref|XP_003569648.1|  PREDICTED: uncharacterized protein LOC100838789  68.2    2e-11   
ref|XP_010666831.1|  PREDICTED: uncharacterized protein LOC104883...  67.8    3e-11   
gb|KDO59271.1|  hypothetical protein CISIN_1g001451mg                 67.8    3e-11   
ref|XP_006475395.1|  PREDICTED: dentin sialophosphoprotein-like       67.8    3e-11   
ref|XP_009356258.1|  PREDICTED: IST1 homolog                          66.2    3e-11   
ref|XP_006451405.1|  hypothetical protein CICLE_v10010570mg           67.8    3e-11   
ref|XP_010666830.1|  PREDICTED: uncharacterized protein LOC104883...  67.8    3e-11   
ref|XP_009593841.1|  PREDICTED: IST1 homolog                          67.0    3e-11   
ref|XP_010267034.1|  PREDICTED: uncharacterized protein LOC104604...  67.8    3e-11   
ref|XP_004287747.1|  PREDICTED: uncharacterized protein LOC101305976  67.0    3e-11   
ref|XP_010267033.1|  PREDICTED: uncharacterized protein LOC104604...  67.8    3e-11   
ref|XP_002308291.2|  hypothetical protein POPTR_0006s15430g           67.8    3e-11   Populus trichocarpa [western balsam poplar]
ref|XP_010551261.1|  PREDICTED: IST1 homolog                          65.9    3e-11   
gb|EYU30364.1|  hypothetical protein MIMGU_mgv1a006443mg              66.6    4e-11   
ref|XP_004135813.1|  PREDICTED: uncharacterized protein LOC101217093  67.4    4e-11   
emb|CDP03201.1|  unnamed protein product                              67.4    5e-11   
ref|XP_006448467.1|  hypothetical protein CICLE_v10015906mg           65.5    5e-11   
gb|KHN35563.1|  IST1-like protein                                     66.2    5e-11   
emb|CDY69937.1|  BnaAnng32080D                                        66.2    5e-11   
ref|XP_004134834.1|  PREDICTED: uncharacterized protein LOC101215810  66.2    5e-11   
ref|NP_195298.2|  Regulator of Vps4 activity in the MVB pathway p...  66.2    5e-11   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008440890.1|  PREDICTED: IST1-like protein                     66.2    5e-11   
ref|XP_003536682.1|  PREDICTED: IST1 homolog isoform X1               65.5    6e-11   
ref|XP_011010805.1|  PREDICTED: uncharacterized protein LOC105115575  67.0    6e-11   
ref|XP_006853993.1|  hypothetical protein AMTR_s00036p00232910        67.0    6e-11   
ref|XP_008352419.1|  PREDICTED: uncharacterized protein LOC103415915  66.2    6e-11   
ref|XP_008337952.1|  PREDICTED: uncharacterized protein LOC103401027  65.9    7e-11   
ref|XP_009337093.1|  PREDICTED: uncharacterized protein LOC103929596  65.9    7e-11   
ref|XP_010066717.1|  PREDICTED: IST1 homolog                          65.1    8e-11   
ref|XP_010029609.1|  PREDICTED: IST1-like protein                     65.9    8e-11   
ref|XP_003547905.1|  PREDICTED: IST1-like protein-like                65.5    8e-11   
ref|XP_008393582.1|  PREDICTED: uncharacterized protein DDB_G0271670  65.9    8e-11   
ref|XP_011007786.1|  PREDICTED: uncharacterized protein LOC105113...  65.5    1e-10   
ref|XP_004497085.1|  PREDICTED: IST1 homolog isoform X1               64.7    1e-10   
ref|XP_003519849.1|  PREDICTED: IST1-like protein-like                65.1    1e-10   
ref|XP_004497086.1|  PREDICTED: IST1 homolog isoform X2               64.7    1e-10   
ref|XP_003592663.1|  IST1-like protein                                63.5    1e-10   
ref|XP_009614745.1|  PREDICTED: dentin sialophosphoprotein            66.2    1e-10   
ref|XP_004232542.1|  PREDICTED: uncharacterized protein LOC101250180  65.5    1e-10   
ref|XP_006468704.1|  PREDICTED: IST1 homolog                          64.3    1e-10   
gb|KDP33748.1|  hypothetical protein JCGZ_07319                       65.9    1e-10   
ref|XP_009783674.1|  PREDICTED: dentin sialophosphoprotein            65.9    1e-10   
ref|XP_010460384.1|  PREDICTED: IST1 homolog                          64.3    1e-10   
ref|XP_003555907.1|  PREDICTED: IST1 homolog                          64.3    1e-10   
ref|XP_010499113.1|  PREDICTED: IST1 homolog                          64.3    1e-10   
ref|XP_009401974.1|  PREDICTED: uncharacterized protein LOC103985842  65.9    1e-10   
gb|KDO76986.1|  hypothetical protein CISIN_1g020278mg                 64.3    1e-10   
gb|ACU23342.1|  unknown                                               64.3    1e-10   Glycine max [soybeans]
ref|XP_010477930.1|  PREDICTED: IST1 homolog                          64.3    2e-10   
ref|XP_002893427.1|  hypothetical protein ARALYDRAFT_890165           63.9    2e-10   
emb|CDP01823.1|  unnamed protein product                              65.1    2e-10   
ref|XP_011007785.1|  PREDICTED: uncharacterized protein LOC105113...  65.1    2e-10   
ref|XP_009109280.1|  PREDICTED: uncharacterized protein LOC103834941  64.7    2e-10   
ref|XP_004299071.1|  PREDICTED: IST1 homolog                          63.9    2e-10   
gb|AAM66100.1|  unknown                                               63.9    2e-10   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006828976.1|  hypothetical protein AMTR_s00001p00238960        65.5    2e-10   
ref|NP_564235.1|  Vps4 activity in the MVB pathway regulator          63.9    2e-10   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004509413.1|  PREDICTED: IST1-like protein-like                64.3    2e-10   
ref|XP_010438300.1|  PREDICTED: apoptotic chromatin condensation ...  65.1    2e-10   
ref|XP_006340806.1|  PREDICTED: uncharacterized protein LOC102584...  64.3    2e-10   
gb|AFK46378.1|  unknown                                               63.5    2e-10   
gb|EYU41608.1|  hypothetical protein MIMGU_mgv1a000472mg              65.1    2e-10   
gb|AES62914.2|  regulator of Vps4 activity in the MVB pathway pro...  63.5    2e-10   
ref|XP_006415870.1|  hypothetical protein EUTSA_v10008210mg           63.5    2e-10   
ref|XP_003629204.1|  IST1-like protein                                64.3    3e-10   
ref|XP_010541020.1|  PREDICTED: flocculation protein FLO11-like       65.1    3e-10   
ref|XP_006340805.1|  PREDICTED: uncharacterized protein LOC102584...  64.3    3e-10   
ref|XP_009392873.1|  PREDICTED: IST1-like protein                     64.3    3e-10   
ref|XP_006352060.1|  PREDICTED: dentin sialophosphoprotein-like       64.7    3e-10   
gb|AET03680.2|  regulator of Vps4 activity in the MVB pathway pro...  63.9    3e-10   
gb|KFK44522.1|  hypothetical protein AALP_AA1G267500                  63.2    3e-10   
ref|XP_010683018.1|  PREDICTED: IST1-like protein                     63.9    3e-10   
ref|XP_010447853.1|  PREDICTED: WASH complex subunit FAM21-like       64.7    3e-10   
ref|XP_007202071.1|  hypothetical protein PRUPE_ppa005964mg           63.9    4e-10   
ref|XP_002969507.1|  hypothetical protein SELMODRAFT_91777            61.6    4e-10   
ref|XP_002886026.1|  hypothetical protein ARALYDRAFT_480500           64.3    4e-10   
ref|XP_002986780.1|  hypothetical protein SELMODRAFT_124829           61.6    4e-10   
gb|EYU40759.1|  hypothetical protein MIMGU_mgv1a010655mg              62.8    4e-10   
ref|XP_007156216.1|  hypothetical protein PHAVU_003G268000g           63.5    4e-10   
ref|XP_008241981.1|  PREDICTED: uncharacterized protein LOC103340355  63.5    5e-10   
ref|NP_001141797.1|  hypothetical protein                             62.4    6e-10   
ref|XP_006305211.1|  hypothetical protein CARUB_v10009577mg           62.8    6e-10   
ref|XP_004243148.1|  PREDICTED: uncharacterized protein LOC101265657  63.9    7e-10   
ref|XP_006644556.1|  PREDICTED: IST1-like protein-like                62.4    7e-10   
ref|XP_002962032.1|  hypothetical protein SELMODRAFT_66879            60.8    7e-10   
emb|CDY43502.1|  BnaA01g07420D                                        63.5    7e-10   
ref|XP_002971060.1|  hypothetical protein SELMODRAFT_66889            60.5    8e-10   
ref|XP_011077935.1|  PREDICTED: uncharacterized protein LOC105161...  63.5    9e-10   
ref|XP_011077936.1|  PREDICTED: uncharacterized protein LOC105161...  63.5    9e-10   
gb|EYU30662.1|  hypothetical protein MIMGU_mgv1a000491mg              63.5    9e-10   
ref|XP_001765737.1|  predicted protein                                60.5    1e-09   
ref|XP_009128734.1|  PREDICTED: uncharacterized protein LOC103853...  63.2    1e-09   
ref|XP_009128739.1|  PREDICTED: uncharacterized protein LOC103853...  63.2    1e-09   
ref|NP_001043915.1|  Os01g0687700                                     61.6    1e-09   
gb|EEC71300.1|  hypothetical protein OsI_03320                        61.6    1e-09   
ref|XP_004969594.1|  PREDICTED: IST1-like protein-like                61.6    1e-09   
ref|XP_009103065.1|  PREDICTED: IST1 homolog                          61.2    2e-09   
gb|KHM99838.1|  IST1-like protein                                     62.0    2e-09   
gb|EPS57911.1|  hypothetical protein M569_16906                       59.3    2e-09   
emb|CDY53122.1|  BnaCnng24500D                                        60.8    3e-09   
emb|CDP00628.1|  unnamed protein product                              60.5    3e-09   
ref|XP_008812038.1|  PREDICTED: IST1-like protein                     61.2    3e-09   
ref|XP_001757890.1|  predicted protein                                58.9    3e-09   
ref|XP_006467048.1|  PREDICTED: IST1-like protein-like                61.2    3e-09   
gb|KDP43728.1|  hypothetical protein JCGZ_22355                       60.8    4e-09   
ref|NP_194673.2|  regulator of Vps4 activity protein                  61.2    5e-09   
gb|KDO71425.1|  hypothetical protein CISIN_1g012264mg                 60.1    7e-09   
emb|CAN83622.1|  hypothetical protein VITISV_007919                   59.7    2e-08   
ref|XP_006283052.1|  hypothetical protein CARUB_v10004047mg           59.7    2e-08   
ref|XP_002867408.1|  hypothetical protein ARALYDRAFT_491814           59.7    2e-08   
ref|XP_002462783.1|  hypothetical protein SORBIDRAFT_02g031850        58.5    3e-08   
ref|XP_003569587.1|  PREDICTED: IST1-like protein                     57.4    5e-08   
ref|XP_004957548.1|  PREDICTED: uncharacterized protein LOC101771957  57.8    5e-08   
emb|CDM83872.1|  unnamed protein product                              57.0    6e-08   
ref|NP_001130202.1|  uncharacterized protein LOC100191296             57.8    6e-08   
ref|XP_010921561.1|  PREDICTED: IST1 homolog isoform X1               56.6    1e-07   
gb|EEC84993.1|  hypothetical protein OsI_32271                        57.0    1e-07   
ref|NP_001063848.1|  Os09g0547200                                     57.0    1e-07   
ref|XP_008648642.1|  PREDICTED: uncharacterized protein LOC103629249  53.9    1e-07   
ref|XP_011076703.1|  PREDICTED: IST1-like protein isoform X1          55.1    3e-07   
ref|XP_003524418.1|  PREDICTED: suppressor protein SRP40-like         55.5    4e-07   
dbj|BAK06249.1|  predicted protein                                    54.3    8e-07   
tpg|DAA58064.1|  TPA: hypothetical protein ZEAMMB73_112435            52.8    2e-06   
ref|XP_002963979.1|  hypothetical protein SELMODRAFT_66952            51.2    2e-06   
ref|XP_002875044.1|  hypothetical protein ARALYDRAFT_912237           49.7    2e-06   
gb|KEH30755.1|  regulator of Vps4 activity in the MVB pathway pro...  52.0    5e-06   
gb|AES89896.2|  regulator of Vps4 activity in the MVB pathway pro...  52.0    5e-06   
gb|AAC62144.1|  hypothetical protein                                  52.0    8e-06   
ref|XP_002868332.1|  predicted protein                                48.5    8e-06   
gb|AAQ62878.1|  At2g19710                                             52.0    8e-06   
ref|XP_008352573.1|  PREDICTED: uncharacterized protein LOC103416083  50.8    2e-05   
ref|XP_006425319.1|  hypothetical protein CICLE_v10026997mg           50.8    2e-05   
ref|XP_005842806.1|  hypothetical protein CHLNCDRAFT_142619           50.8    2e-05   
ref|XP_002879204.1|  hypothetical protein ARALYDRAFT_901877           46.2    4e-05   
emb|CAA20043.1|  putative protein                                     49.3    4e-05   
ref|XP_010526411.1|  PREDICTED: protein IWS1 homolog A-like           49.7    5e-05   
ref|XP_005646055.1|  DUF292-domain-containing protein                 49.3    5e-05   
ref|XP_007016809.1|  Uncharacterized protein TCM_042107               45.1    1e-04   
ref|XP_001767597.1|  predicted protein                                45.8    3e-04   
emb|CAB79702.1|  putative protein                                     46.6    5e-04   
ref|XP_010433096.1|  PREDICTED: WASH complex subunit FAM21-like       46.6    6e-04   
ref|XP_003064465.1|  predicted protein                                45.8    7e-04   
ref|XP_003724278.1|  PREDICTED: IST1 homolog isoform 1                45.4    8e-04   
gb|KHN36623.1|  IST1-like protein                                     45.8    0.001   
ref|XP_003541917.1|  PREDICTED: uncharacterized protein LOC100810...  45.8    0.001   



>ref|XP_008358108.1| PREDICTED: IST1 homolog [Malus domestica]
 ref|XP_008358109.1| PREDICTED: IST1 homolog [Malus domestica]
 ref|XP_008358110.1| PREDICTED: IST1 homolog [Malus domestica]
 ref|XP_008358111.1| PREDICTED: IST1 homolog [Malus domestica]
Length=105

 Score =   103 bits (257),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 49/56 (88%), Positives = 55/56 (98%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    MDSFFNKGFKAAQCKTLLKLAIPRIKLLRNRREIQMKQIRREIAKLLETGQEATAR  169
            +DSFFNKGFKAA+CKT+LKL IPRIKLLRNRREIQ+KQ+RR+IAKLLETGQEATAR
Sbjct  4    LDSFFNKGFKAAKCKTMLKLTIPRIKLLRNRREIQIKQMRRDIAKLLETGQEATAR  59



>ref|XP_008358845.1| PREDICTED: IST1 homolog [Malus domestica]
Length=108

 Score =   100 bits (249),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 48/56 (86%), Positives = 53/56 (95%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    MDSFFNKGFKAAQCKTLLKLAIPRIKLLRNRREIQMKQIRREIAKLLETGQEATAR  169
            +DSFFNKGFKA +CKTLLKL  PRIKLLRNRREIQ+KQ+RR+IAKLLETGQEATAR
Sbjct  4    LDSFFNKGFKAVKCKTLLKLTTPRIKLLRNRREIQIKQMRRDIAKLLETGQEATAR  59



>ref|XP_004290444.1| PREDICTED: uncharacterized protein LOC101296917 [Fragaria vesca 
subsp. vesca]
Length=529

 Score =   106 bits (265),  Expect = 2e-25, Method: Composition-based stats.
 Identities = 50/56 (89%), Positives = 55/56 (98%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    MDSFFNKGFKAAQCKTLLKLAIPRIKLLRNRREIQMKQIRREIAKLLETGQEATAR  169
            +DSFFNKGFKAA+CKTLLKL IPRIKLLRNRREIQ+KQ+RR+IAKLLETGQEATAR
Sbjct  4    LDSFFNKGFKAAKCKTLLKLTIPRIKLLRNRREIQIKQMRRDIAKLLETGQEATAR  59



>ref|XP_008464351.1| PREDICTED: uncharacterized protein LOC103502259 [Cucumis melo]
Length=583

 Score =   107 bits (266),  Expect = 2e-25, Method: Composition-based stats.
 Identities = 50/56 (89%), Positives = 55/56 (98%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    MDSFFNKGFKAAQCKTLLKLAIPRIKLLRNRREIQMKQIRREIAKLLETGQEATAR  169
            ++SFFNKGFKAAQCKTLLKL IPRIKLLRNRREIQ+KQ+RR+IAKLLETGQEATAR
Sbjct  4    LNSFFNKGFKAAQCKTLLKLTIPRIKLLRNRREIQLKQMRRDIAKLLETGQEATAR  59



>ref|XP_011038197.1| PREDICTED: IST1 homolog [Populus euphratica]
 ref|XP_011038198.1| PREDICTED: IST1 homolog [Populus euphratica]
Length=579

 Score =   106 bits (265),  Expect = 3e-25, Method: Composition-based stats.
 Identities = 50/56 (89%), Positives = 54/56 (96%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    MDSFFNKGFKAAQCKTLLKLAIPRIKLLRNRREIQMKQIRREIAKLLETGQEATAR  169
            +DSFFNKGFKAA+CKTLLKL IPRIKLLRNRREIQMK +RR+IAKLLETGQEATAR
Sbjct  4    IDSFFNKGFKAAKCKTLLKLTIPRIKLLRNRREIQMKHMRRDIAKLLETGQEATAR  59



>ref|XP_010501779.1| PREDICTED: IST1 homolog [Camelina sativa]
Length=213

 Score =   102 bits (254),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 49/56 (88%), Positives = 54/56 (96%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    MDSFFNKGFKAAQCKTLLKLAIPRIKLLRNRREIQMKQIRREIAKLLETGQEATAR  169
            +DSFFNKGFKAA+CKTLLKL IPRIKL+RNRRE Q+KQ+RREIAKLLETGQEATAR
Sbjct  4    LDSFFNKGFKAAKCKTLLKLTIPRIKLIRNRREAQIKQMRREIAKLLETGQEATAR  59



>ref|XP_004162170.1| PREDICTED: uncharacterized LOC101208940 [Cucumis sativus]
Length=586

 Score =   106 bits (264),  Expect = 4e-25, Method: Composition-based stats.
 Identities = 50/56 (89%), Positives = 55/56 (98%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    MDSFFNKGFKAAQCKTLLKLAIPRIKLLRNRREIQMKQIRREIAKLLETGQEATAR  169
            ++SFFNKGFKAAQCKTLLKL IPRIKLLRNRREIQ+KQ+RR+IAKLLETGQEATAR
Sbjct  4    LNSFFNKGFKAAQCKTLLKLTIPRIKLLRNRREIQLKQMRRDIAKLLETGQEATAR  59



>ref|XP_004138362.1| PREDICTED: uncharacterized protein LOC101208940 [Cucumis sativus]
 gb|KGN45897.1| hypothetical protein Csa_6G020110 [Cucumis sativus]
Length=586

 Score =   106 bits (264),  Expect = 4e-25, Method: Composition-based stats.
 Identities = 50/56 (89%), Positives = 55/56 (98%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    MDSFFNKGFKAAQCKTLLKLAIPRIKLLRNRREIQMKQIRREIAKLLETGQEATAR  169
            ++SFFNKGFKAAQCKTLLKL IPRIKLLRNRREIQ+KQ+RR+IAKLLETGQEATAR
Sbjct  4    LNSFFNKGFKAAQCKTLLKLTIPRIKLLRNRREIQLKQMRRDIAKLLETGQEATAR  59



>ref|XP_006376337.1| hypothetical protein POPTR_0013s12140g [Populus trichocarpa]
 gb|ERP54134.1| hypothetical protein POPTR_0013s12140g [Populus trichocarpa]
Length=547

 Score =   105 bits (263),  Expect = 5e-25, Method: Composition-based stats.
 Identities = 49/56 (88%), Positives = 54/56 (96%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    MDSFFNKGFKAAQCKTLLKLAIPRIKLLRNRREIQMKQIRREIAKLLETGQEATAR  169
            +DSFFNKGFKAA+CKTLLKL IPRIKLLRNRR+IQMK +RR+IAKLLETGQEATAR
Sbjct  4    IDSFFNKGFKAAKCKTLLKLTIPRIKLLRNRRDIQMKHMRRDIAKLLETGQEATAR  59



>ref|XP_007201705.1| hypothetical protein PRUPE_ppa004125mg [Prunus persica]
 gb|EMJ02904.1| hypothetical protein PRUPE_ppa004125mg [Prunus persica]
Length=528

 Score =   105 bits (262),  Expect = 5e-25, Method: Composition-based stats.
 Identities = 50/56 (89%), Positives = 55/56 (98%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    MDSFFNKGFKAAQCKTLLKLAIPRIKLLRNRREIQMKQIRREIAKLLETGQEATAR  169
            +DSFFNKGFKAA+CKTLLKL IPRIKLLRNRREIQ+KQ+RR+IAKLLETGQEATAR
Sbjct  4    LDSFFNKGFKAAKCKTLLKLTIPRIKLLRNRREIQIKQMRRDIAKLLETGQEATAR  59



>ref|XP_011074152.1| PREDICTED: vacuolar protein sorting-associated protein IST1-like 
isoform X2 [Sesamum indicum]
Length=489

 Score =   104 bits (260),  Expect = 7e-25, Method: Composition-based stats.
 Identities = 50/56 (89%), Positives = 54/56 (96%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    MDSFFNKGFKAAQCKTLLKLAIPRIKLLRNRREIQMKQIRREIAKLLETGQEATAR  169
            +DSFFNKGFKAA+CKTLLKL IPRIKLLRNRR+IQMK +RREIAKLLETGQEATAR
Sbjct  2    LDSFFNKGFKAAKCKTLLKLTIPRIKLLRNRRDIQMKNMRREIAKLLETGQEATAR  57



>ref|XP_009339749.1| PREDICTED: IST1-like protein [Pyrus x bretschneideri]
 ref|XP_009339750.1| PREDICTED: IST1-like protein [Pyrus x bretschneideri]
Length=538

 Score =   105 bits (261),  Expect = 8e-25, Method: Composition-based stats.
 Identities = 49/56 (88%), Positives = 55/56 (98%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    MDSFFNKGFKAAQCKTLLKLAIPRIKLLRNRREIQMKQIRREIAKLLETGQEATAR  169
            +DSFFNKGFKAA+CKT+LKL IPRIKLLRNRREIQ+KQ+RR+IAKLLETGQEATAR
Sbjct  4    LDSFFNKGFKAAKCKTMLKLTIPRIKLLRNRREIQIKQMRRDIAKLLETGQEATAR  59



>ref|XP_008381028.1| PREDICTED: IST1-like protein [Malus domestica]
 ref|XP_008381029.1| PREDICTED: IST1-like protein [Malus domestica]
 ref|XP_008381030.1| PREDICTED: IST1-like protein [Malus domestica]
 ref|XP_008381031.1| PREDICTED: IST1-like protein [Malus domestica]
Length=538

 Score =   105 bits (261),  Expect = 8e-25, Method: Composition-based stats.
 Identities = 49/56 (88%), Positives = 55/56 (98%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    MDSFFNKGFKAAQCKTLLKLAIPRIKLLRNRREIQMKQIRREIAKLLETGQEATAR  169
            +DSFFNKGFKAA+CKT+LKL IPRIKLLRNRREIQ+KQ+RR+IAKLLETGQEATAR
Sbjct  4    LDSFFNKGFKAAKCKTMLKLTIPRIKLLRNRREIQIKQMRRDIAKLLETGQEATAR  59



>ref|XP_008237348.1| PREDICTED: IST1 homolog [Prunus mume]
Length=538

 Score =   105 bits (261),  Expect = 9e-25, Method: Composition-based stats.
 Identities = 50/56 (89%), Positives = 55/56 (98%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    MDSFFNKGFKAAQCKTLLKLAIPRIKLLRNRREIQMKQIRREIAKLLETGQEATAR  169
            +DSFFNKGFKAA+CKTLLKL IPRIKLLRNRREIQ+KQ+RR+IAKLLETGQEATAR
Sbjct  4    LDSFFNKGFKAAKCKTLLKLTIPRIKLLRNRREIQIKQMRRDIAKLLETGQEATAR  59



>emb|CBI35325.3| unnamed protein product [Vitis vinifera]
Length=388

 Score =   103 bits (256),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 48/56 (86%), Positives = 54/56 (96%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    MDSFFNKGFKAAQCKTLLKLAIPRIKLLRNRREIQMKQIRREIAKLLETGQEATAR  169
            +DSFFNKGFK ++CKTLLKL IPRIKLLRNRREIQ+KQ+RR+IAKLLETGQEATAR
Sbjct  4    LDSFFNKGFKGSKCKTLLKLTIPRIKLLRNRREIQIKQMRRDIAKLLETGQEATAR  59



>ref|XP_011074151.1| PREDICTED: uncharacterized protein LOC105158932 isoform X1 [Sesamum 
indicum]
Length=518

 Score =   104 bits (259),  Expect = 2e-24, Method: Composition-based stats.
 Identities = 50/56 (89%), Positives = 54/56 (96%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    MDSFFNKGFKAAQCKTLLKLAIPRIKLLRNRREIQMKQIRREIAKLLETGQEATAR  169
            +DSFFNKGFKAA+CKTLLKL IPRIKLLRNRR+IQMK +RREIAKLLETGQEATAR
Sbjct  2    LDSFFNKGFKAAKCKTLLKLTIPRIKLLRNRRDIQMKNMRREIAKLLETGQEATAR  57



>ref|XP_009339061.1| PREDICTED: uncharacterized protein LOC103931336 isoform X1 [Pyrus 
x bretschneideri]
 ref|XP_009339062.1| PREDICTED: uncharacterized protein LOC103931336 isoform X2 [Pyrus 
x bretschneideri]
 ref|XP_009339063.1| PREDICTED: uncharacterized protein LOC103931336 isoform X2 [Pyrus 
x bretschneideri]
Length=538

 Score =   104 bits (259),  Expect = 2e-24, Method: Composition-based stats.
 Identities = 49/56 (88%), Positives = 55/56 (98%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    MDSFFNKGFKAAQCKTLLKLAIPRIKLLRNRREIQMKQIRREIAKLLETGQEATAR  169
            +DSFFNKGFKAA+CKT+LKL IPRIKLLRNRREIQ+KQ+RR+IAKLLETGQEATAR
Sbjct  4    LDSFFNKGFKAAKCKTMLKLTIPRIKLLRNRREIQIKQMRRDIAKLLETGQEATAR  59



>gb|KDP22885.1| hypothetical protein JCGZ_01959 [Jatropha curcas]
Length=520

 Score =   103 bits (258),  Expect = 2e-24, Method: Composition-based stats.
 Identities = 50/56 (89%), Positives = 55/56 (98%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    MDSFFNKGFKAAQCKTLLKLAIPRIKLLRNRREIQMKQIRREIAKLLETGQEATAR  169
            +DSFFNKGFKAA+CKTLLKL IPRIKLLRNRREIQ+KQ+RR+IAKLLETGQEATAR
Sbjct  4    LDSFFNKGFKAAKCKTLLKLTIPRIKLLRNRREIQIKQMRRDIAKLLETGQEATAR  59



>ref|XP_007020222.1| Regulator of Vps4 activity in the MVB pathway protein [Theobroma 
cacao]
 gb|EOY17447.1| Regulator of Vps4 activity in the MVB pathway protein [Theobroma 
cacao]
Length=530

 Score =   103 bits (258),  Expect = 2e-24, Method: Composition-based stats.
 Identities = 49/56 (88%), Positives = 55/56 (98%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    MDSFFNKGFKAAQCKTLLKLAIPRIKLLRNRREIQMKQIRREIAKLLETGQEATAR  169
            +DSFF+KGFKAA+CKTLLKL IPRIKLLRNRREIQ+KQ+RR+IAKLLETGQEATAR
Sbjct  4    LDSFFSKGFKAAKCKTLLKLTIPRIKLLRNRREIQIKQMRRDIAKLLETGQEATAR  59



>ref|XP_003548955.1| PREDICTED: vacuolar protein sorting-associated protein IST1-like 
isoform X1 [Glycine max]
 ref|XP_006599451.1| PREDICTED: vacuolar protein sorting-associated protein IST1-like 
isoform X2 [Glycine max]
Length=528

 Score =   103 bits (257),  Expect = 3e-24, Method: Composition-based stats.
 Identities = 49/55 (89%), Positives = 52/55 (95%), Gaps = 0/55 (0%)
 Frame = +2

Query  5    DSFFNKGFKAAQCKTLLKLAIPRIKLLRNRREIQMKQIRREIAKLLETGQEATAR  169
            DS FNKGFKAA+CKTLLKL IPRIKLLRNRREIQ+K +RREIAKLLETGQEATAR
Sbjct  5    DSIFNKGFKAAKCKTLLKLTIPRIKLLRNRREIQLKNMRREIAKLLETGQEATAR  59



>gb|KHN32808.1| IST1-like protein [Glycine soja]
Length=528

 Score =   103 bits (256),  Expect = 3e-24, Method: Composition-based stats.
 Identities = 49/55 (89%), Positives = 52/55 (95%), Gaps = 0/55 (0%)
 Frame = +2

Query  5    DSFFNKGFKAAQCKTLLKLAIPRIKLLRNRREIQMKQIRREIAKLLETGQEATAR  169
            DS FNKGFKAA+CKTLLKL IPRIKLLRNRREIQ+K +RREIAKLLETGQEATAR
Sbjct  5    DSIFNKGFKAAKCKTLLKLTIPRIKLLRNRREIQLKNMRREIAKLLETGQEATAR  59



>ref|XP_003518384.1| PREDICTED: uncharacterized protein DDB_G0271670-like [Glycine 
max]
 gb|KHN00708.1| IST1 like [Glycine soja]
Length=537

 Score =   103 bits (256),  Expect = 4e-24, Method: Composition-based stats.
 Identities = 49/55 (89%), Positives = 52/55 (95%), Gaps = 0/55 (0%)
 Frame = +2

Query  5    DSFFNKGFKAAQCKTLLKLAIPRIKLLRNRREIQMKQIRREIAKLLETGQEATAR  169
            DS FNKGFKAA+CKTLLKL IPRIKLLRNRREIQ+K +RREIAKLLETGQEATAR
Sbjct  5    DSIFNKGFKAAKCKTLLKLTIPRIKLLRNRREIQLKNMRREIAKLLETGQEATAR  59



>ref|XP_002534491.1| protein with unknown function [Ricinus communis]
 gb|EEF27891.1| protein with unknown function [Ricinus communis]
Length=531

 Score =   103 bits (256),  Expect = 4e-24, Method: Composition-based stats.
 Identities = 49/56 (88%), Positives = 54/56 (96%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    MDSFFNKGFKAAQCKTLLKLAIPRIKLLRNRREIQMKQIRREIAKLLETGQEATAR  169
            +DSFFNKGFKA +CKTLLKL IPRIKLLRNRREIQ+KQ+RR+IAKLLETGQEATAR
Sbjct  4    LDSFFNKGFKATKCKTLLKLTIPRIKLLRNRREIQIKQMRRDIAKLLETGQEATAR  59



>emb|CAN60958.1| hypothetical protein VITISV_034688 [Vitis vinifera]
Length=557

 Score =   103 bits (257),  Expect = 4e-24, Method: Composition-based stats.
 Identities = 48/56 (86%), Positives = 54/56 (96%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    MDSFFNKGFKAAQCKTLLKLAIPRIKLLRNRREIQMKQIRREIAKLLETGQEATAR  169
            +DSFFNKGFK ++CKTLLKL IPRIKLLRNRREIQ+KQ+RR+IAKLLETGQEATAR
Sbjct  4    LDSFFNKGFKGSKCKTLLKLTIPRIKLLRNRREIQIKQMRRDIAKLLETGQEATAR  59



>ref|XP_002275027.1| PREDICTED: uncharacterized protein LOC100245921 [Vitis vinifera]
Length=539

 Score =   103 bits (256),  Expect = 4e-24, Method: Composition-based stats.
 Identities = 48/56 (86%), Positives = 54/56 (96%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    MDSFFNKGFKAAQCKTLLKLAIPRIKLLRNRREIQMKQIRREIAKLLETGQEATAR  169
            +DSFFNKGFK ++CKTLLKL IPRIKLLRNRREIQ+KQ+RR+IAKLLETGQEATAR
Sbjct  4    LDSFFNKGFKGSKCKTLLKLTIPRIKLLRNRREIQIKQMRRDIAKLLETGQEATAR  59



>gb|ABY60784.1| hypothetical protein [Carica papaya]
Length=528

 Score =   103 bits (256),  Expect = 4e-24, Method: Composition-based stats.
 Identities = 49/56 (88%), Positives = 55/56 (98%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    MDSFFNKGFKAAQCKTLLKLAIPRIKLLRNRREIQMKQIRREIAKLLETGQEATAR  169
            +DSFFNKGFKAA+CKTLLKL IPRI+LLRNRREIQ+KQ+RR+IAKLLETGQEATAR
Sbjct  4    LDSFFNKGFKAAKCKTLLKLTIPRIRLLRNRREIQIKQMRRDIAKLLETGQEATAR  59



>gb|ABS32234.1| hypothetical protein [Carica papaya]
Length=528

 Score =   103 bits (256),  Expect = 4e-24, Method: Composition-based stats.
 Identities = 49/56 (88%), Positives = 55/56 (98%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    MDSFFNKGFKAAQCKTLLKLAIPRIKLLRNRREIQMKQIRREIAKLLETGQEATAR  169
            +DSFFNKGFKAA+CKTLLKL IPRI+LLRNRREIQ+KQ+RR+IAKLLETGQEATAR
Sbjct  4    LDSFFNKGFKAAKCKTLLKLTIPRIRLLRNRREIQIKQMRRDIAKLLETGQEATAR  59



>ref|XP_010499963.1| PREDICTED: IST1 homolog isoform X1 [Camelina sativa]
 ref|XP_010499964.1| PREDICTED: IST1 homolog isoform X2 [Camelina sativa]
Length=597

 Score =   103 bits (257),  Expect = 5e-24, Method: Composition-based stats.
 Identities = 49/56 (88%), Positives = 54/56 (96%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    MDSFFNKGFKAAQCKTLLKLAIPRIKLLRNRREIQMKQIRREIAKLLETGQEATAR  169
            +DSFFNKGFKAA+CKTLLKL IPRIKL+RNRRE Q+KQ+RREIAKLLETGQEATAR
Sbjct  4    LDSFFNKGFKAAKCKTLLKLTIPRIKLIRNRREAQIKQMRREIAKLLETGQEATAR  59



>ref|XP_006473234.1| PREDICTED: uncharacterized protein LOC102611062 [Citrus sinensis]
Length=523

 Score =   102 bits (255),  Expect = 5e-24, Method: Composition-based stats.
 Identities = 49/56 (88%), Positives = 55/56 (98%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    MDSFFNKGFKAAQCKTLLKLAIPRIKLLRNRREIQMKQIRREIAKLLETGQEATAR  169
            +DSFFNKGFK ++CKTLLKLAIPRIKLLRNRREIQ+KQ+RR+IAKLLETGQEATAR
Sbjct  4    LDSFFNKGFKGSKCKTLLKLAIPRIKLLRNRREIQIKQMRRDIAKLLETGQEATAR  59



>ref|XP_002325569.2| hypothetical protein POPTR_0019s11730g [Populus trichocarpa]
 gb|EEE99950.2| hypothetical protein POPTR_0019s11730g [Populus trichocarpa]
Length=533

 Score =   102 bits (255),  Expect = 5e-24, Method: Composition-based stats.
 Identities = 48/56 (86%), Positives = 55/56 (98%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    MDSFFNKGFKAAQCKTLLKLAIPRIKLLRNRREIQMKQIRREIAKLLETGQEATAR  169
            +DSFF+KGFKAA+CKTLLKL IPRIKLLRNRREIQ+KQ+RR+IAKLLETGQEAT+R
Sbjct  4    LDSFFDKGFKAAKCKTLLKLTIPRIKLLRNRREIQIKQMRRDIAKLLETGQEATSR  59



>gb|KDO83978.1| hypothetical protein CISIN_1g009857mg [Citrus sinensis]
Length=523

 Score =   102 bits (255),  Expect = 5e-24, Method: Composition-based stats.
 Identities = 49/56 (88%), Positives = 55/56 (98%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    MDSFFNKGFKAAQCKTLLKLAIPRIKLLRNRREIQMKQIRREIAKLLETGQEATAR  169
            +DSFFNKGFK ++CKTLLKLAIPRIKLLRNRREIQ+KQ+RR+IAKLLETGQEATAR
Sbjct  4    LDSFFNKGFKGSKCKTLLKLAIPRIKLLRNRREIQIKQMRRDIAKLLETGQEATAR  59



>ref|XP_010478853.1| PREDICTED: IST1 homolog [Camelina sativa]
Length=597

 Score =   103 bits (256),  Expect = 5e-24, Method: Composition-based stats.
 Identities = 49/56 (88%), Positives = 54/56 (96%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    MDSFFNKGFKAAQCKTLLKLAIPRIKLLRNRREIQMKQIRREIAKLLETGQEATAR  169
            +DSFFNKGFKAA+CKTLLKL IPRIKL+RNRRE Q+KQ+RREIAKLLETGQEATAR
Sbjct  4    LDSFFNKGFKAAKCKTLLKLTIPRIKLIRNRREAQIKQMRREIAKLLETGQEATAR  59



>ref|XP_010543191.1| PREDICTED: uncharacterized protein LOC104816186 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010543201.1| PREDICTED: uncharacterized protein LOC104816186 isoform X1 [Tarenaya 
hassleriana]
Length=494

 Score =   102 bits (254),  Expect = 6e-24, Method: Composition-based stats.
 Identities = 47/56 (84%), Positives = 55/56 (98%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    MDSFFNKGFKAAQCKTLLKLAIPRIKLLRNRREIQMKQIRREIAKLLETGQEATAR  169
            +DSFFNKGFKA++CKTLLKL +PRIKLLRNRRE+Q+KQ+RREI+KLLETGQEATAR
Sbjct  4    LDSFFNKGFKASKCKTLLKLTVPRIKLLRNRREVQIKQMRREISKLLETGQEATAR  59



>ref|XP_010063798.1| PREDICTED: IST1 homolog [Eucalyptus grandis]
 gb|KCW71052.1| hypothetical protein EUGRSUZ_F04150 [Eucalyptus grandis]
Length=564

 Score =   102 bits (255),  Expect = 6e-24, Method: Composition-based stats.
 Identities = 50/56 (89%), Positives = 54/56 (96%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    MDSFFNKGFKAAQCKTLLKLAIPRIKLLRNRREIQMKQIRREIAKLLETGQEATAR  169
            MDSFF KGFKAA+CKTLLKL IPRIKLLRNRREIQ+KQ+RR+IAKLLETGQEATAR
Sbjct  4    MDSFFAKGFKAAKCKTLLKLTIPRIKLLRNRREIQLKQMRRDIAKLLETGQEATAR  59



>ref|XP_006434655.1| hypothetical protein CICLE_v10000853mg [Citrus clementina]
 gb|ESR47895.1| hypothetical protein CICLE_v10000853mg [Citrus clementina]
Length=523

 Score =   102 bits (254),  Expect = 6e-24, Method: Composition-based stats.
 Identities = 49/56 (88%), Positives = 55/56 (98%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    MDSFFNKGFKAAQCKTLLKLAIPRIKLLRNRREIQMKQIRREIAKLLETGQEATAR  169
            +DSFFNKGFK ++CKTLLKLAIPRIKLLRNRREIQ+KQ+RR+IAKLLETGQEATAR
Sbjct  4    LDSFFNKGFKGSKCKTLLKLAIPRIKLLRNRREIQIKQMRRDIAKLLETGQEATAR  59



>ref|XP_010530141.1| PREDICTED: IST1 homolog [Tarenaya hassleriana]
Length=492

 Score =   102 bits (253),  Expect = 8e-24, Method: Composition-based stats.
 Identities = 49/56 (88%), Positives = 54/56 (96%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    MDSFFNKGFKAAQCKTLLKLAIPRIKLLRNRREIQMKQIRREIAKLLETGQEATAR  169
            +DSFFNKGFKAA+CKTLLKL  PRIKLLRNRRE+Q+KQ+RREIAKLLETGQEATAR
Sbjct  4    LDSFFNKGFKAAKCKTLLKLTTPRIKLLRNRREVQIKQMRREIAKLLETGQEATAR  59



>gb|AAQ22619.1| At1g34220 [Arabidopsis thaliana]
 dbj|BAE99480.1| hypothetical protein [Arabidopsis thaliana]
Length=649

 Score =   102 bits (255),  Expect = 9e-24, Method: Composition-based stats.
 Identities = 49/56 (88%), Positives = 54/56 (96%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    MDSFFNKGFKAAQCKTLLKLAIPRIKLLRNRREIQMKQIRREIAKLLETGQEATAR  169
            +DSFFNKGFKAA+CKTLLKL IPRIKL+RNRRE Q+KQ+RREIAKLLETGQEATAR
Sbjct  4    LDSFFNKGFKAAKCKTLLKLTIPRIKLIRNRREAQIKQMRREIAKLLETGQEATAR  59



>ref|NP_174684.2| Regulator of Vps4 activity in the MVB pathway protein [Arabidopsis 
thaliana]
 gb|AEE31687.1| Regulator of Vps4 activity in the MVB pathway protein [Arabidopsis 
thaliana]
Length=649

 Score =   102 bits (255),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 49/56 (88%), Positives = 54/56 (96%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    MDSFFNKGFKAAQCKTLLKLAIPRIKLLRNRREIQMKQIRREIAKLLETGQEATAR  169
            +DSFFNKGFKAA+CKTLLKL IPRIKL+RNRRE Q+KQ+RREIAKLLETGQEATAR
Sbjct  4    LDSFFNKGFKAAKCKTLLKLTIPRIKLIRNRREAQIKQMRREIAKLLETGQEATAR  59



>gb|ABS32229.1| hypothetical protein [Carica papaya]
 gb|ABY60780.1| hypothetical protein [Carica papaya]
Length=533

 Score =   101 bits (252),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 49/56 (88%), Positives = 55/56 (98%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    MDSFFNKGFKAAQCKTLLKLAIPRIKLLRNRREIQMKQIRREIAKLLETGQEATAR  169
            +DSFFNKGFKAA+CKTLLKL IPRI+LLRNRREIQ+KQ+RR+IAKLLETGQEATAR
Sbjct  4    LDSFFNKGFKAAKCKTLLKLTIPRIRLLRNRREIQIKQMRRDIAKLLETGQEATAR  59



>ref|NP_973961.1| Regulator of Vps4 activity in the MVB pathway protein [Arabidopsis 
thaliana]
 gb|AAD39610.1|AC007454_9 F23M19.10 [Arabidopsis thaliana]
 gb|AEE31688.1| Regulator of Vps4 activity in the MVB pathway protein [Arabidopsis 
thaliana]
Length=619

 Score =   102 bits (254),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 49/56 (88%), Positives = 54/56 (96%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    MDSFFNKGFKAAQCKTLLKLAIPRIKLLRNRREIQMKQIRREIAKLLETGQEATAR  169
            +DSFFNKGFKAA+CKTLLKL IPRIKL+RNRRE Q+KQ+RREIAKLLETGQEATAR
Sbjct  4    LDSFFNKGFKAAKCKTLLKLTIPRIKLIRNRREAQIKQMRREIAKLLETGQEATAR  59



>gb|KHG18028.1| Uncharacterized protein F383_00577 [Gossypium arboreum]
Length=529

 Score =   101 bits (251),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 48/56 (86%), Positives = 53/56 (95%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    MDSFFNKGFKAAQCKTLLKLAIPRIKLLRNRREIQMKQIRREIAKLLETGQEATAR  169
            +DS FNKGFKAA+CKTLLKL IPRIKLLRNRREIQ+KQ+RR+IAKLLE GQEATAR
Sbjct  4    LDSLFNKGFKAAKCKTLLKLTIPRIKLLRNRREIQIKQMRRDIAKLLEIGQEATAR  59



>ref|XP_002893813.1| hypothetical protein ARALYDRAFT_473574 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH70072.1| hypothetical protein ARALYDRAFT_473574 [Arabidopsis lyrata subsp. 
lyrata]
Length=649

 Score =   102 bits (253),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 49/56 (88%), Positives = 54/56 (96%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    MDSFFNKGFKAAQCKTLLKLAIPRIKLLRNRREIQMKQIRREIAKLLETGQEATAR  169
            +DSFFNKGFKAA+CKTLLKL IPRIKL+RNRRE Q+KQ+RREIAKLLETGQEATAR
Sbjct  4    LDSFFNKGFKAAKCKTLLKLTIPRIKLIRNRREAQIKQMRREIAKLLETGQEATAR  59



>ref|XP_010695698.1| PREDICTED: IST1-like protein [Beta vulgaris subsp. vulgaris]
Length=283

 Score = 99.0 bits (245),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 45/56 (80%), Positives = 54/56 (96%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    MDSFFNKGFKAAQCKTLLKLAIPRIKLLRNRREIQMKQIRREIAKLLETGQEATAR  169
            MDSFF+KGFK ++CKTLLKL+IPRIKLLRNRRE+Q+KQ+R++IAKLLETGQE TAR
Sbjct  2    MDSFFSKGFKGSKCKTLLKLSIPRIKLLRNRRELQIKQMRKDIAKLLETGQETTAR  57



>ref|XP_006303943.1| hypothetical protein CARUB_v10008690mg [Capsella rubella]
 gb|EOA36841.1| hypothetical protein CARUB_v10008690mg [Capsella rubella]
Length=578

 Score =   101 bits (251),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 49/56 (88%), Positives = 54/56 (96%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    MDSFFNKGFKAAQCKTLLKLAIPRIKLLRNRREIQMKQIRREIAKLLETGQEATAR  169
            +DSFFNKGFKAA+CKTLLKL IPRIKL+RNRRE Q+KQ+RREIAKLLETGQEATAR
Sbjct  4    LDSFFNKGFKAAKCKTLLKLTIPRIKLIRNRREAQIKQMRREIAKLLETGQEATAR  59



>emb|CDX91784.1| BnaC08g07030D [Brassica napus]
Length=580

 Score =   101 bits (251),  Expect = 3e-23, Method: Composition-based stats.
 Identities = 49/56 (88%), Positives = 54/56 (96%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    MDSFFNKGFKAAQCKTLLKLAIPRIKLLRNRREIQMKQIRREIAKLLETGQEATAR  169
            +DSFFNKGFKAA+CKTLLKL IPRIKL+RNRRE Q+KQ+RREIAKLLETGQEATAR
Sbjct  4    LDSFFNKGFKAAKCKTLLKLTIPRIKLIRNRREAQIKQMRREIAKLLETGQEATAR  59



>ref|XP_011002513.1| PREDICTED: uncharacterized protein LOC105109486 [Populus euphratica]
Length=550

 Score =   100 bits (250),  Expect = 3e-23, Method: Composition-based stats.
 Identities = 47/56 (84%), Positives = 54/56 (96%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    MDSFFNKGFKAAQCKTLLKLAIPRIKLLRNRREIQMKQIRREIAKLLETGQEATAR  169
            +DSFF+KGFKAA+CKTLLKL IPRIKLLRNRREI++KQ+RR IAKLLETGQEAT+R
Sbjct  4    LDSFFDKGFKAAKCKTLLKLTIPRIKLLRNRREIEIKQMRRNIAKLLETGQEATSR  59



>ref|XP_008384411.1| PREDICTED: uncharacterized protein LOC103447017 [Malus domestica]
Length=597

 Score =   101 bits (251),  Expect = 3e-23, Method: Composition-based stats.
 Identities = 48/56 (86%), Positives = 53/56 (95%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    MDSFFNKGFKAAQCKTLLKLAIPRIKLLRNRREIQMKQIRREIAKLLETGQEATAR  169
            +DSFFNKGFKA +CKTLLKL  PRIKLLRNRREIQ+KQ+RR+IAKLLETGQEATAR
Sbjct  4    LDSFFNKGFKAVKCKTLLKLTTPRIKLLRNRREIQIKQMRRDIAKLLETGQEATAR  59



>ref|XP_008809516.1| PREDICTED: IST1-like protein isoform X1 [Phoenix dactylifera]
Length=560

 Score =   100 bits (250),  Expect = 4e-23, Method: Composition-based stats.
 Identities = 46/56 (82%), Positives = 53/56 (95%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    MDSFFNKGFKAAQCKTLLKLAIPRIKLLRNRREIQMKQIRREIAKLLETGQEATAR  169
            +D+FFNKGFK A+CKTLLKL IPRIKLLRNRRE+Q+KQ+RR+IAKLLE GQEATAR
Sbjct  4    LDAFFNKGFKGAKCKTLLKLTIPRIKLLRNRREVQLKQMRRDIAKLLENGQEATAR  59



>emb|CDY46461.1| BnaA08g06470D [Brassica napus]
Length=566

 Score =   100 bits (249),  Expect = 4e-23, Method: Composition-based stats.
 Identities = 49/56 (88%), Positives = 54/56 (96%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    MDSFFNKGFKAAQCKTLLKLAIPRIKLLRNRREIQMKQIRREIAKLLETGQEATAR  169
            +DSFFNKGFKAA+CKTLLKL IPRIKL+RNRRE Q+KQ+RREIAKLLETGQEATAR
Sbjct  4    LDSFFNKGFKAAKCKTLLKLTIPRIKLIRNRREAQIKQMRREIAKLLETGQEATAR  59



>ref|XP_008809517.1| PREDICTED: IST1-like protein isoform X2 [Phoenix dactylifera]
Length=560

 Score =   100 bits (249),  Expect = 4e-23, Method: Composition-based stats.
 Identities = 46/56 (82%), Positives = 53/56 (95%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    MDSFFNKGFKAAQCKTLLKLAIPRIKLLRNRREIQMKQIRREIAKLLETGQEATAR  169
            +D+FFNKGFK A+CKTLLKL IPRIKLLRNRRE+Q+KQ+RR+IAKLLE GQEATAR
Sbjct  4    LDAFFNKGFKGAKCKTLLKLTIPRIKLLRNRREVQLKQMRRDIAKLLENGQEATAR  59



>ref|XP_009107933.1| PREDICTED: uncharacterized protein LOC103833603 [Brassica rapa]
Length=566

 Score =   100 bits (249),  Expect = 4e-23, Method: Composition-based stats.
 Identities = 49/56 (88%), Positives = 54/56 (96%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    MDSFFNKGFKAAQCKTLLKLAIPRIKLLRNRREIQMKQIRREIAKLLETGQEATAR  169
            +DSFFNKGFKAA+CKTLLKL IPRIKL+RNRRE Q+KQ+RREIAKLLETGQEATAR
Sbjct  4    LDSFFNKGFKAAKCKTLLKLTIPRIKLIRNRREAQIKQMRREIAKLLETGQEATAR  59



>ref|XP_004489726.1| PREDICTED: dentin sialophosphoprotein-like [Cicer arietinum]
Length=523

 Score =   100 bits (248),  Expect = 4e-23, Method: Composition-based stats.
 Identities = 46/56 (82%), Positives = 53/56 (95%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    MDSFFNKGFKAAQCKTLLKLAIPRIKLLRNRREIQMKQIRREIAKLLETGQEATAR  169
            ++SFF +GFKAA+CKTLLKL IPRIKLLRNRREIQ+K +RR+IAKLLETGQEATAR
Sbjct  4    LNSFFAQGFKAAKCKTLLKLTIPRIKLLRNRREIQLKNMRRDIAKLLETGQEATAR  59



>ref|XP_010939573.1| PREDICTED: IST1 homolog [Elaeis guineensis]
Length=546

 Score =   100 bits (249),  Expect = 5e-23, Method: Composition-based stats.
 Identities = 47/56 (84%), Positives = 53/56 (95%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    MDSFFNKGFKAAQCKTLLKLAIPRIKLLRNRREIQMKQIRREIAKLLETGQEATAR  169
            +D+FFNKGFK A+CKTLLKL IPRIKLLRNRREIQ+KQ+RR+IAKLLE GQEATAR
Sbjct  4    LDAFFNKGFKGAKCKTLLKLTIPRIKLLRNRREIQLKQMRRDIAKLLENGQEATAR  59



>ref|XP_004237874.1| PREDICTED: uncharacterized protein LOC101268389 [Solanum lycopersicum]
Length=528

 Score =   100 bits (248),  Expect = 5e-23, Method: Composition-based stats.
 Identities = 48/56 (86%), Positives = 54/56 (96%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    MDSFFNKGFKAAQCKTLLKLAIPRIKLLRNRREIQMKQIRREIAKLLETGQEATAR  169
            MDSFF+KGFKAA+CKT+LKL IPRIKLLRNRRE Q+KQ+R+EIAKLLETGQEATAR
Sbjct  1    MDSFFSKGFKAAKCKTMLKLTIPRIKLLRNRREFQLKQMRKEIAKLLETGQEATAR  56



>ref|XP_010261134.1| PREDICTED: uncharacterized protein LOC104600038 [Nelumbo nucifera]
Length=544

 Score =   100 bits (248),  Expect = 5e-23, Method: Composition-based stats.
 Identities = 46/56 (82%), Positives = 53/56 (95%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    MDSFFNKGFKAAQCKTLLKLAIPRIKLLRNRREIQMKQIRREIAKLLETGQEATAR  169
            +D+FFNKGFK A+CKTLLKL IPRIKLLRNRRE Q+KQ+R+EI+KLLETGQEATAR
Sbjct  4    LDAFFNKGFKGAKCKTLLKLTIPRIKLLRNRREAQIKQMRKEISKLLETGQEATAR  59



>ref|XP_006396076.1| hypothetical protein EUTSA_v10007134mg [Eutrema salsugineum]
 gb|ESQ33362.1| hypothetical protein EUTSA_v10007134mg [Eutrema salsugineum]
Length=600

 Score =   100 bits (249),  Expect = 6e-23, Method: Composition-based stats.
 Identities = 49/56 (88%), Positives = 54/56 (96%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    MDSFFNKGFKAAQCKTLLKLAIPRIKLLRNRREIQMKQIRREIAKLLETGQEATAR  169
            +DSFFNKGFKAA+CKTLLKL IPRIKL+RNRRE Q+KQ+RREIAKLLETGQEATAR
Sbjct  4    LDSFFNKGFKAAKCKTLLKLTIPRIKLIRNRREAQIKQMRREIAKLLETGQEATAR  59



>ref|XP_010692212.1| PREDICTED: IST1 homolog [Beta vulgaris subsp. vulgaris]
Length=502

 Score = 99.4 bits (246),  Expect = 8e-23, Method: Composition-based stats.
 Identities = 46/56 (82%), Positives = 55/56 (98%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    MDSFFNKGFKAAQCKTLLKLAIPRIKLLRNRREIQMKQIRREIAKLLETGQEATAR  169
            MDSFF+KGFK ++CKTLLKL+IPRIKLLRNRRE+Q+KQ+R++IAKLLETGQEATAR
Sbjct  2    MDSFFSKGFKGSKCKTLLKLSIPRIKLLRNRRELQIKQMRKDIAKLLETGQEATAR  57



>ref|XP_010937030.1| PREDICTED: IST1 homolog [Elaeis guineensis]
Length=549

 Score = 99.8 bits (247),  Expect = 9e-23, Method: Composition-based stats.
 Identities = 45/55 (82%), Positives = 51/55 (93%), Gaps = 0/55 (0%)
 Frame = +2

Query  5    DSFFNKGFKAAQCKTLLKLAIPRIKLLRNRREIQMKQIRREIAKLLETGQEATAR  169
            D+FFNKGF+  +CKTLLKL IPRIKLLRNRREIQ+KQ+RR+IAKLLE GQEATAR
Sbjct  5    DAFFNKGFQGTKCKTLLKLTIPRIKLLRNRREIQLKQMRRDIAKLLENGQEATAR  59



>ref|NP_001275331.1| uncharacterized protein LOC102585287 [Solanum tuberosum]
 dbj|BAE46414.1| hypothetical protein [Solanum tuberosum]
Length=528

 Score = 99.4 bits (246),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 48/56 (86%), Positives = 54/56 (96%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    MDSFFNKGFKAAQCKTLLKLAIPRIKLLRNRREIQMKQIRREIAKLLETGQEATAR  169
            MDSFF+KGFKAA+CKT+LKL IPRIKLLRNRRE Q+KQ+R+EIAKLLETGQEATAR
Sbjct  1    MDSFFSKGFKAAKCKTMLKLTIPRIKLLRNRREFQLKQMRKEIAKLLETGQEATAR  56



>ref|XP_006354036.1| PREDICTED: uncharacterized protein LOC102585287 [Solanum tuberosum]
Length=528

 Score = 99.0 bits (245),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 48/56 (86%), Positives = 54/56 (96%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    MDSFFNKGFKAAQCKTLLKLAIPRIKLLRNRREIQMKQIRREIAKLLETGQEATAR  169
            MDSFF+KGFKAA+CKT+LKL IPRIKLLRNRRE Q+KQ+R+EIAKLLETGQEATAR
Sbjct  1    MDSFFSKGFKAAKCKTMLKLTIPRIKLLRNRREFQLKQMRKEIAKLLETGQEATAR  56



>ref|XP_009773832.1| PREDICTED: uncharacterized protein LOC104223983 [Nicotiana sylvestris]
 ref|XP_009773840.1| PREDICTED: uncharacterized protein LOC104223983 [Nicotiana sylvestris]
Length=532

 Score = 99.0 bits (245),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 49/56 (88%), Positives = 55/56 (98%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    MDSFFNKGFKAAQCKTLLKLAIPRIKLLRNRREIQMKQIRREIAKLLETGQEATAR  169
            MDSFF+KGFKAA+CKTLLKL IPRIKLLRNRRE+Q+KQ+R+EIAKLLETGQEATAR
Sbjct  1    MDSFFSKGFKAAKCKTLLKLTIPRIKLLRNRREMQLKQMRKEIAKLLETGQEATAR  56



>gb|KFK45126.1| hypothetical protein AALP_AA1G347400 [Arabis alpina]
Length=594

 Score = 99.4 bits (246),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 48/56 (86%), Positives = 54/56 (96%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    MDSFFNKGFKAAQCKTLLKLAIPRIKLLRNRREIQMKQIRREIAKLLETGQEATAR  169
            +D+FFNKGFKAA+CKTLLKL IPRIKL+RNRRE Q+KQ+RREIAKLLETGQEATAR
Sbjct  4    LDAFFNKGFKAAKCKTLLKLTIPRIKLIRNRREAQIKQMRREIAKLLETGQEATAR  59



>ref|XP_010245870.1| PREDICTED: uncharacterized protein LOC104589305 [Nelumbo nucifera]
Length=546

 Score = 99.0 bits (245),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 45/56 (80%), Positives = 53/56 (95%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    MDSFFNKGFKAAQCKTLLKLAIPRIKLLRNRREIQMKQIRREIAKLLETGQEATAR  169
            +D+FFNKGFK A+CKTLLKL IPRIKLLRNRRE+Q+KQ+R++IAKLLE GQEATAR
Sbjct  4    LDAFFNKGFKGAKCKTLLKLTIPRIKLLRNRREVQIKQMRKDIAKLLEAGQEATAR  59



>ref|XP_009591345.1| PREDICTED: uncharacterized protein LOC104088390 [Nicotiana tomentosiformis]
Length=530

 Score = 98.6 bits (244),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 48/56 (86%), Positives = 55/56 (98%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    MDSFFNKGFKAAQCKTLLKLAIPRIKLLRNRREIQMKQIRREIAKLLETGQEATAR  169
            MDSFF+KGFKAA+CKTLLKL IPRIKLLRNRRE+Q++Q+R+EIAKLLETGQEATAR
Sbjct  1    MDSFFSKGFKAAKCKTLLKLTIPRIKLLRNRREMQLRQMRKEIAKLLETGQEATAR  56



>ref|XP_009403189.1| PREDICTED: ENHANCER OF AG-4 protein 2-like [Musa acuminata subsp. 
malaccensis]
Length=594

 Score = 98.6 bits (244),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 45/56 (80%), Positives = 53/56 (95%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    MDSFFNKGFKAAQCKTLLKLAIPRIKLLRNRREIQMKQIRREIAKLLETGQEATAR  169
            +D+FF+KGFK A+CKTLLKL IPRIKLLRNRREIQ+KQ+R++IAKLLE GQEATAR
Sbjct  4    IDAFFSKGFKGAKCKTLLKLTIPRIKLLRNRREIQLKQMRKDIAKLLENGQEATAR  59



>ref|XP_007151911.1| hypothetical protein PHAVU_004G086100g [Phaseolus vulgaris]
 gb|ESW23905.1| hypothetical protein PHAVU_004G086100g [Phaseolus vulgaris]
Length=525

 Score = 98.2 bits (243),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 47/55 (85%), Positives = 51/55 (93%), Gaps = 0/55 (0%)
 Frame = +2

Query  5    DSFFNKGFKAAQCKTLLKLAIPRIKLLRNRREIQMKQIRREIAKLLETGQEATAR  169
            DS FNKGFKAA+CKTLLKL IPRIKLLRNRRE Q+K +RR+IAKLLETGQEATAR
Sbjct  5    DSLFNKGFKAAKCKTLLKLTIPRIKLLRNRRENQLKNMRRDIAKLLETGQEATAR  59



>gb|KEH25939.1| regulator of Vps4 activity in the MVB pathway protein [Medicago 
truncatula]
Length=585

 Score = 98.6 bits (244),  Expect = 3e-22, Method: Composition-based stats.
 Identities = 45/56 (80%), Positives = 53/56 (95%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    MDSFFNKGFKAAQCKTLLKLAIPRIKLLRNRREIQMKQIRREIAKLLETGQEATAR  169
            ++SFF +GFKA++CKTLLKL+IPRIKLLRNRRE Q+K +RREIAKLLETGQEATAR
Sbjct  4    LNSFFAQGFKASKCKTLLKLSIPRIKLLRNRRENQLKNMRREIAKLLETGQEATAR  59



>emb|CDP01161.1| unnamed protein product [Coffea canephora]
Length=530

 Score = 98.2 bits (243),  Expect = 3e-22, Method: Composition-based stats.
 Identities = 48/57 (84%), Positives = 55/57 (96%), Gaps = 1/57 (2%)
 Frame = +2

Query  2    MDSFFNKG-FKAAQCKTLLKLAIPRIKLLRNRREIQMKQIRREIAKLLETGQEATAR  169
            MDSFF+KG FKA++CKTLLKL+IPRIKLLRNRREIQ+KQ+RR+IA LLETGQEATAR
Sbjct  1    MDSFFSKGGFKASKCKTLLKLSIPRIKLLRNRREIQIKQMRRDIANLLETGQEATAR  57



>ref|XP_009401388.1| PREDICTED: IST1 homolog [Musa acuminata subsp. malaccensis]
Length=543

 Score = 98.2 bits (243),  Expect = 3e-22, Method: Composition-based stats.
 Identities = 43/56 (77%), Positives = 52/56 (93%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    MDSFFNKGFKAAQCKTLLKLAIPRIKLLRNRREIQMKQIRREIAKLLETGQEATAR  169
            +D+FFNKGF+ A+CKTLLKL IPRI+LLRNRRE Q+KQ+R++IAKLLE GQEATAR
Sbjct  4    LDAFFNKGFRGAKCKTLLKLTIPRIRLLRNRRESQLKQMRKDIAKLLEDGQEATAR  59



>ref|XP_011083402.1| PREDICTED: uncharacterized protein LOC105165944 [Sesamum indicum]
Length=522

 Score = 97.4 bits (241),  Expect = 6e-22, Method: Composition-based stats.
 Identities = 46/56 (82%), Positives = 52/56 (93%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    MDSFFNKGFKAAQCKTLLKLAIPRIKLLRNRREIQMKQIRREIAKLLETGQEATAR  169
            +DSFF + F AA+CKTLLKL IPRIKLLRNRREIQ+KQ+R+EIAKLLETGQEATAR
Sbjct  4    LDSFFKQRFNAAKCKTLLKLTIPRIKLLRNRREIQLKQMRKEIAKLLETGQEATAR  59



>ref|XP_008804491.1| PREDICTED: IST1 homolog [Phoenix dactylifera]
Length=546

 Score = 96.7 bits (239),  Expect = 9e-22, Method: Composition-based stats.
 Identities = 45/56 (80%), Positives = 51/56 (91%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    MDSFFNKGFKAAQCKTLLKLAIPRIKLLRNRREIQMKQIRREIAKLLETGQEATAR  169
            +D+FF KGFK A+CKTLLKL IPRIKLLRNRREIQ+K +RR+IAKLLE GQEATAR
Sbjct  4    LDAFFTKGFKGAKCKTLLKLTIPRIKLLRNRREIQLKHMRRDIAKLLENGQEATAR  59



>emb|CDY48635.1| BnaC06g08120D [Brassica napus]
Length=335

 Score = 94.7 bits (234),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 45/56 (80%), Positives = 51/56 (91%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    MDSFFNKGFKAAQCKTLLKLAIPRIKLLRNRREIQMKQIRREIAKLLETGQEATAR  169
            +DSFFNK FKA +CKTLLKL IPRIKL+RNRRE ++KQ+RREIAKLLETGQEAT R
Sbjct  4    LDSFFNKTFKAVKCKTLLKLLIPRIKLIRNRREAKIKQMRREIAKLLETGQEATTR  59



>gb|EPS70884.1| hypothetical protein M569_03876, partial [Genlisea aurea]
Length=274

 Score = 94.0 bits (232),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 45/56 (80%), Positives = 51/56 (91%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    MDSFFNKGFKAAQCKTLLKLAIPRIKLLRNRREIQMKQIRREIAKLLETGQEATAR  169
            MDSFF + F A +CKTLLKL IPRIKLLRNRR+IQ+KQ+R+EIAKLLETGQEATAR
Sbjct  1    MDSFFKQRFNAGKCKTLLKLTIPRIKLLRNRRDIQIKQMRKEIAKLLETGQEATAR  56



>gb|EYU43558.1| hypothetical protein MIMGU_mgv1a005603mg [Erythranthe guttata]
Length=477

 Score = 92.4 bits (228),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 44/56 (79%), Positives = 51/56 (91%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    MDSFFNKGFKAAQCKTLLKLAIPRIKLLRNRREIQMKQIRREIAKLLETGQEATAR  169
            +DS F + F AA+CKTLLKL IPRIKLLRNRRE+Q++Q+RREIAKLLETGQEATAR
Sbjct  4    LDSIFKQRFNAAKCKTLLKLTIPRIKLLRNRREMQLRQMRREIAKLLETGQEATAR  59



>gb|AFW57124.1| hypothetical protein ZEAMMB73_703221 [Zea mays]
Length=159

 Score = 85.5 bits (210),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 43/60 (72%), Positives = 54/60 (90%), Gaps = 4/60 (7%)
 Frame = +2

Query  2    MDSFFNKG----FKAAQCKTLLKLAIPRIKLLRNRREIQMKQIRREIAKLLETGQEATAR  169
            +D+FF+KG    F+ A+CKTLLKL+IPRIKLLRNRRE+Q++Q+RR+IAKLLE GQEATAR
Sbjct  4    LDTFFSKGGGGGFRGAKCKTLLKLSIPRIKLLRNRRELQLRQMRRDIAKLLEAGQEATAR  63



>ref|NP_001288461.1| uncharacterized protein LOC103641204 [Zea mays]
 gb|ACN34775.1| unknown [Zea mays]
 gb|AFW57123.1| hypothetical protein ZEAMMB73_703221 [Zea mays]
Length=516

 Score = 89.4 bits (220),  Expect = 4e-19, Method: Composition-based stats.
 Identities = 43/60 (72%), Positives = 54/60 (90%), Gaps = 4/60 (7%)
 Frame = +2

Query  2    MDSFFNKG----FKAAQCKTLLKLAIPRIKLLRNRREIQMKQIRREIAKLLETGQEATAR  169
            +D+FF+KG    F+ A+CKTLLKL+IPRIKLLRNRRE+Q++Q+RR+IAKLLE GQEATAR
Sbjct  4    LDTFFSKGGGGGFRGAKCKTLLKLSIPRIKLLRNRRELQLRQMRRDIAKLLEAGQEATAR  63



>ref|XP_006589468.1| PREDICTED: IST1-like protein-like [Glycine max]
Length=389

 Score = 82.8 bits (203),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 38/52 (73%), Positives = 46/52 (88%), Gaps = 0/52 (0%)
 Frame = +2

Query  11   FFNKGFKAAQCKTLLKLAIPRIKLLRNRREIQMKQIRREIAKLLETGQEATA  166
            FFNK FKA++C TLL+L IPRIKLLRNRRE+ +KQ+RR++AKLLE GQEA A
Sbjct  7    FFNKAFKASKCATLLQLTIPRIKLLRNRREVHLKQMRRDVAKLLEAGQEAKA  58



>emb|CDM86090.1| unnamed protein product [Triticum aestivum]
Length=511

 Score = 83.2 bits (204),  Expect = 7e-17, Method: Composition-based stats.
 Identities = 38/47 (81%), Positives = 46/47 (98%), Gaps = 0/47 (0%)
 Frame = +2

Query  29   KAAQCKTLLKLAIPRIKLLRNRREIQMKQIRREIAKLLETGQEATAR  169
            +AA+CKTLLKL+IPRIKLLRNRRE+Q++Q+RR+IAKLLE GQEATAR
Sbjct  20   RAAKCKTLLKLSIPRIKLLRNRRELQLRQMRRDIAKLLEAGQEATAR  66



>ref|XP_004972728.1| PREDICTED: IST1-like protein-like isoform X1 [Setaria italica]
Length=543

 Score = 82.4 bits (202),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 37/45 (82%), Positives = 43/45 (96%), Gaps = 0/45 (0%)
 Frame = +2

Query  35   AQCKTLLKLAIPRIKLLRNRREIQMKQIRREIAKLLETGQEATAR  169
            A+CKTLLKL IPRIKLLRNRRE+Q++Q+RR+IAKLLE GQEATAR
Sbjct  18   AKCKTLLKLTIPRIKLLRNRRELQLRQMRRDIAKLLEAGQEATAR  62



>dbj|BAJ94091.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=513

 Score = 82.0 bits (201),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 37/47 (79%), Positives = 46/47 (98%), Gaps = 0/47 (0%)
 Frame = +2

Query  29   KAAQCKTLLKLAIPRIKLLRNRREIQMKQIRREIAKLLETGQEATAR  169
            +AA+CKTLLKL+IPRIKLLRNRRE+Q++Q+RR+IAKLLE GQ+ATAR
Sbjct  20   RAAKCKTLLKLSIPRIKLLRNRRELQLRQMRRDIAKLLEAGQDATAR  66



>ref|XP_004972729.1| PREDICTED: IST1-like protein-like isoform X2 [Setaria italica]
Length=504

 Score = 80.9 bits (198),  Expect = 4e-16, Method: Composition-based stats.
 Identities = 37/45 (82%), Positives = 43/45 (96%), Gaps = 0/45 (0%)
 Frame = +2

Query  35   AQCKTLLKLAIPRIKLLRNRREIQMKQIRREIAKLLETGQEATAR  169
            A+CKTLLKL IPRIKLLRNRRE+Q++Q+RR+IAKLLE GQEATAR
Sbjct  18   AKCKTLLKLTIPRIKLLRNRRELQLRQMRRDIAKLLEAGQEATAR  62



>gb|AFK38152.1| unknown [Lotus japonicus]
Length=77

 Score = 75.1 bits (183),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 37/42 (88%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +2

Query  44   KTLLKLAIPRIKLLRNRREIQMKQIRREIAKLLETGQEATAR  169
            KTLLKL IPRIKLLRNRREIQ+K +RR+IAKLLETGQEATAR
Sbjct  13   KTLLKLTIPRIKLLRNRREIQLKNMRRDIAKLLETGQEATAR  54



>ref|XP_008676764.1| PREDICTED: uncharacterized protein LOC100272774 isoform X1 [Zea 
mays]
 gb|ACF85010.1| unknown [Zea mays]
 gb|AFW61114.1| hypothetical protein ZEAMMB73_013899 [Zea mays]
Length=511

 Score = 80.1 bits (196),  Expect = 8e-16, Method: Composition-based stats.
 Identities = 37/45 (82%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = +2

Query  35   AQCKTLLKLAIPRIKLLRNRREIQMKQIRREIAKLLETGQEATAR  169
            A+CKTLLKL+IPRIKLLRNRRE+Q++Q+RR+IAKLLE GQEATAR
Sbjct  17   AKCKTLLKLSIPRIKLLRNRRELQLRQMRRDIAKLLEAGQEATAR  61



>ref|XP_006659884.1| PREDICTED: polycystic kidney disease protein 1-like 3-like [Oryza 
brachyantha]
Length=662

 Score = 80.5 bits (197),  Expect = 9e-16, Method: Composition-based stats.
 Identities = 36/44 (82%), Positives = 42/44 (95%), Gaps = 0/44 (0%)
 Frame = +2

Query  38   QCKTLLKLAIPRIKLLRNRREIQMKQIRREIAKLLETGQEATAR  169
            +CKTLLKL IPRIKLLRNRRE+Q++Q+RR+IAKLLE GQEATAR
Sbjct  21   KCKTLLKLTIPRIKLLRNRRELQLRQMRRDIAKLLEAGQEATAR  64



>gb|EAZ05774.1| hypothetical protein OsI_28007 [Oryza sativa Indica Group]
Length=561

 Score = 80.1 bits (196),  Expect = 9e-16, Method: Composition-based stats.
 Identities = 36/43 (84%), Positives = 42/43 (98%), Gaps = 0/43 (0%)
 Frame = +2

Query  41   CKTLLKLAIPRIKLLRNRREIQMKQIRREIAKLLETGQEATAR  169
            CKTLLKL+IPRIKLLRNRRE+Q++Q+RR+IAKLLE GQEATAR
Sbjct  21   CKTLLKLSIPRIKLLRNRRELQLRQMRRDIAKLLEAGQEATAR  63



>ref|NP_001061111.1| Os08g0175200 [Oryza sativa Japonica Group]
 dbj|BAD05225.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAD05552.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF23025.1| Os08g0175200 [Oryza sativa Japonica Group]
 gb|EEE68132.1| hypothetical protein OsJ_26225 [Oryza sativa Japonica Group]
Length=561

 Score = 79.7 bits (195),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 36/43 (84%), Positives = 42/43 (98%), Gaps = 0/43 (0%)
 Frame = +2

Query  41   CKTLLKLAIPRIKLLRNRREIQMKQIRREIAKLLETGQEATAR  169
            CKTLLKL+IPRIKLLRNRRE+Q++Q+RR+IAKLLE GQEATAR
Sbjct  21   CKTLLKLSIPRIKLLRNRRELQLRQMRRDIAKLLEAGQEATAR  63



>gb|EMS63538.1| hypothetical protein TRIUR3_01260 [Triticum urartu]
Length=513

 Score = 79.3 bits (194),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 36/43 (84%), Positives = 42/43 (98%), Gaps = 0/43 (0%)
 Frame = +2

Query  41   CKTLLKLAIPRIKLLRNRREIQMKQIRREIAKLLETGQEATAR  169
            CKTLLKL+IPRIKLLRNRRE+Q++Q+RR+IAKLLE GQEATAR
Sbjct  24   CKTLLKLSIPRIKLLRNRRELQLRQMRRDIAKLLEAGQEATAR  66



>ref|XP_003573416.1| PREDICTED: IST1-like protein [Brachypodium distachyon]
Length=515

 Score = 79.3 bits (194),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 36/43 (84%), Positives = 42/43 (98%), Gaps = 0/43 (0%)
 Frame = +2

Query  41   CKTLLKLAIPRIKLLRNRREIQMKQIRREIAKLLETGQEATAR  169
            CKTLLKL+IPRIKLLRNRRE+Q++Q+RR+IAKLLE GQEATAR
Sbjct  25   CKTLLKLSIPRIKLLRNRRELQLRQMRRDIAKLLEAGQEATAR  67



>ref|XP_010543209.1| PREDICTED: uncharacterized protein LOC104816186 isoform X2 [Tarenaya 
hassleriana]
Length=490

 Score = 79.0 bits (193),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 38/49 (78%), Positives = 44/49 (90%), Gaps = 0/49 (0%)
 Frame = +2

Query  23   GFKAAQCKTLLKLAIPRIKLLRNRREIQMKQIRREIAKLLETGQEATAR  169
            GF   + KTLLKL +PRIKLLRNRRE+Q+KQ+RREI+KLLETGQEATAR
Sbjct  7    GFCNLRSKTLLKLTVPRIKLLRNRREVQIKQMRREISKLLETGQEATAR  55



>gb|EMT04508.1| hypothetical protein F775_29471 [Aegilops tauschii]
Length=481

 Score = 77.8 bits (190),  Expect = 5e-15, Method: Composition-based stats.
 Identities = 36/43 (84%), Positives = 41/43 (95%), Gaps = 0/43 (0%)
 Frame = +2

Query  41   CKTLLKLAIPRIKLLRNRREIQMKQIRREIAKLLETGQEATAR  169
            CKTLLKL+IPRIKLLRNRRE+Q +Q+RR+IAKLLE GQEATAR
Sbjct  25   CKTLLKLSIPRIKLLRNRRELQPRQMRRDIAKLLEAGQEATAR  67



>gb|KHG18435.1| IST1-like protein [Gossypium arboreum]
Length=854

 Score = 78.2 bits (191),  Expect = 6e-15, Method: Composition-based stats.
 Identities = 35/56 (63%), Positives = 47/56 (84%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    MDSFFNKGFKAAQCKTLLKLAIPRIKLLRNRREIQMKQIRREIAKLLETGQEATAR  169
            M    ++ FKAA+CKT LKLAIPRIKL++N+RE Q+KQI+RE+A+LLE+ Q+ TAR
Sbjct  1    MQKMLHRSFKAAKCKTALKLAIPRIKLMKNKREAQVKQIKRELAQLLESDQDQTAR  56



>ref|XP_010094831.1| hypothetical protein L484_016412 [Morus notabilis]
 gb|EXB57360.1| hypothetical protein L484_016412 [Morus notabilis]
Length=555

 Score = 76.3 bits (186),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 38/46 (83%), Positives = 44/46 (96%), Gaps = 0/46 (0%)
 Frame = +2

Query  32   AAQCKTLLKLAIPRIKLLRNRREIQMKQIRREIAKLLETGQEATAR  169
            + + KTLLKLAIPRIKLLRNRRE+Q+KQ+RR+IAKLLETGQEATAR
Sbjct  35   SKRSKTLLKLAIPRIKLLRNRREVQLKQMRRDIAKLLETGQEATAR  80



>ref|XP_008806538.1| PREDICTED: uncharacterized protein LOC103719187 isoform X2 [Phoenix 
dactylifera]
Length=1044

 Score = 76.6 bits (187),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 34/50 (68%), Positives = 45/50 (90%), Gaps = 0/50 (0%)
 Frame = +2

Query  20   KGFKAAQCKTLLKLAIPRIKLLRNRREIQMKQIRREIAKLLETGQEATAR  169
            +GFKA +CKT LKLA+ RIKLL+NRRE+ +KQ+RR++A+LLE+GQE TAR
Sbjct  13   RGFKAGKCKTSLKLAVARIKLLKNRREVLLKQMRRDLAQLLESGQEQTAR  62



>ref|XP_008806530.1| PREDICTED: uncharacterized protein LOC103719187 isoform X1 [Phoenix 
dactylifera]
Length=1073

 Score = 76.6 bits (187),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 34/50 (68%), Positives = 45/50 (90%), Gaps = 0/50 (0%)
 Frame = +2

Query  20   KGFKAAQCKTLLKLAIPRIKLLRNRREIQMKQIRREIAKLLETGQEATAR  169
            +GFKA +CKT LKLA+ RIKLL+NRRE+ +KQ+RR++A+LLE+GQE TAR
Sbjct  13   RGFKAGKCKTSLKLAVARIKLLKNRREVLLKQMRRDLAQLLESGQEQTAR  62



>ref|XP_004513087.1| PREDICTED: dentin sialophosphoprotein-like [Cicer arietinum]
Length=1062

 Score = 76.6 bits (187),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 33/52 (63%), Positives = 45/52 (87%), Gaps = 0/52 (0%)
 Frame = +2

Query  14   FNKGFKAAQCKTLLKLAIPRIKLLRNRREIQMKQIRREIAKLLETGQEATAR  169
             ++ FK A+CKT LKLA+ RIKLLRN+R+ Q+KQ++RE+AKLLE+GQ+ TAR
Sbjct  2    LHRSFKPAKCKTALKLAVSRIKLLRNKRDAQVKQLKRELAKLLESGQDQTAR  53



>ref|XP_010265126.1| PREDICTED: IST1 homolog [Nelumbo nucifera]
Length=334

 Score = 73.9 bits (180),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 33/56 (59%), Positives = 46/56 (82%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    MDSFFNKGFKAAQCKTLLKLAIPRIKLLRNRREIQMKQIRREIAKLLETGQEATAR  169
            ++  FN+G   A+CKT L LAI RIKLL+N+R++Q+KQ+R+EIA+ L+TGQEA AR
Sbjct  4    LNQLFNRGLLGAKCKTCLNLAISRIKLLQNKRDVQLKQMRKEIAQFLQTGQEAIAR  59



>ref|XP_010924918.1| PREDICTED: uncharacterized protein LOC105047619 [Elaeis guineensis]
Length=1089

 Score = 76.3 bits (186),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 33/50 (66%), Positives = 45/50 (90%), Gaps = 0/50 (0%)
 Frame = +2

Query  20   KGFKAAQCKTLLKLAIPRIKLLRNRREIQMKQIRREIAKLLETGQEATAR  169
            + FKAA+CKT LKLA+ RIKLL+N+RE+ +KQ+RR++A+LLE+GQE TAR
Sbjct  13   RSFKAAKCKTSLKLAVARIKLLKNKREVSLKQMRRDLAQLLESGQEQTAR  62



>ref|XP_007012909.1| Regulator of Vps4 activity in the MVB pathway-like protein isoform 
1 [Theobroma cacao]
 gb|EOY30528.1| Regulator of Vps4 activity in the MVB pathway-like protein isoform 
1 [Theobroma cacao]
Length=1110

 Score = 74.7 bits (182),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 32/52 (62%), Positives = 45/52 (87%), Gaps = 0/52 (0%)
 Frame = +2

Query  14   FNKGFKAAQCKTLLKLAIPRIKLLRNRREIQMKQIRREIAKLLETGQEATAR  169
             ++ FK A+CK  LKLAIPRIKL++N+RE Q+KQ++RE+A+LLE+GQ+ TAR
Sbjct  2    LHRSFKPAKCKIALKLAIPRIKLMKNKREAQVKQLKRELAQLLESGQDQTAR  53



>ref|XP_008799245.1| PREDICTED: IST1 homolog [Phoenix dactylifera]
Length=128

 Score = 70.5 bits (171),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 32/56 (57%), Positives = 44/56 (79%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    MDSFFNKGFKAAQCKTLLKLAIPRIKLLRNRREIQMKQIRREIAKLLETGQEATAR  169
            ++S FN+    A+CKT L LAI RIKLL N+RE+Q+K +R+EI++ L+TGQEA AR
Sbjct  4    LNSLFNRATLGARCKTCLNLAISRIKLLHNKRELQLKNMRKEISQYLQTGQEAIAR  59



>ref|XP_002456226.1| hypothetical protein SORBIDRAFT_03g032440 [Sorghum bicolor]
 gb|EES01346.1| hypothetical protein SORBIDRAFT_03g032440 [Sorghum bicolor]
Length=1098

 Score = 73.9 bits (180),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 31/56 (55%), Positives = 45/56 (80%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    MDSFFNKGFKAAQCKTLLKLAIPRIKLLRNRREIQMKQIRREIAKLLETGQEATAR  169
            +    +KGFK  +CKT L++A+ RIKLLRNR+E+Q++Q+RRE+A+LLE  Q+ TAR
Sbjct  8    LSGVLHKGFKPDKCKTSLRMAVARIKLLRNRKEVQVRQMRREVAQLLEANQDMTAR  63



>ref|NP_001044016.2| Os01g0706400 [Oryza sativa Japonica Group]
 dbj|BAD82253.1| MAPK activating protein-like [Oryza sativa Japonica Group]
 dbj|BAG90211.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAF05930.2| Os01g0706400 [Oryza sativa Japonica Group]
Length=1101

 Score = 73.6 bits (179),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 31/56 (55%), Positives = 45/56 (80%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    MDSFFNKGFKAAQCKTLLKLAIPRIKLLRNRREIQMKQIRREIAKLLETGQEATAR  169
            +    +KGFK  +CKT L++A+ RIKLLRNR+E+Q++Q+RRE+A+LLE  Q+ TAR
Sbjct  8    LSGVLHKGFKPDKCKTALRMALARIKLLRNRKEVQVRQMRREVAQLLEADQDQTAR  63



>gb|KHN32904.1| IST1-like protein [Glycine soja]
Length=1060

 Score = 73.6 bits (179),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 32/52 (62%), Positives = 45/52 (87%), Gaps = 0/52 (0%)
 Frame = +2

Query  14   FNKGFKAAQCKTLLKLAIPRIKLLRNRREIQMKQIRREIAKLLETGQEATAR  169
             ++ FK A+CKT LKLA+ RIKLL+N+RE Q+KQ++RE+A+LLE+GQ+ TAR
Sbjct  2    LHRSFKPAKCKTTLKLAVSRIKLLKNKREAQIKQLKRELAQLLESGQDRTAR  53



>ref|XP_003517626.1| PREDICTED: dentin sialophosphoprotein-like [Glycine max]
Length=1064

 Score = 73.6 bits (179),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 32/52 (62%), Positives = 45/52 (87%), Gaps = 0/52 (0%)
 Frame = +2

Query  14   FNKGFKAAQCKTLLKLAIPRIKLLRNRREIQMKQIRREIAKLLETGQEATAR  169
             ++ FK A+CKT LKLA+ RIKLL+N+RE Q+KQ++RE+A+LLE+GQ+ TAR
Sbjct  2    LHRSFKPAKCKTTLKLAVSRIKLLKNKREAQIKQLKRELAQLLESGQDRTAR  53



>gb|EAY75540.1| hypothetical protein OsI_03445 [Oryza sativa Indica Group]
Length=1102

 Score = 73.6 bits (179),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 31/56 (55%), Positives = 45/56 (80%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    MDSFFNKGFKAAQCKTLLKLAIPRIKLLRNRREIQMKQIRREIAKLLETGQEATAR  169
            +    +KGFK  +CKT L++A+ RIKLLRNR+E+Q++Q+RRE+A+LLE  Q+ TAR
Sbjct  8    LSGVLHKGFKPDKCKTALRMALARIKLLRNRKEVQVRQMRREVAQLLEADQDQTAR  63



>ref|XP_008656796.1| PREDICTED: dentin sialophosphoprotein-like [Zea mays]
 gb|AFW83696.1| hypothetical protein ZEAMMB73_522714 [Zea mays]
Length=1257

 Score = 73.2 bits (178),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 31/52 (60%), Positives = 44/52 (85%), Gaps = 0/52 (0%)
 Frame = +2

Query  14   FNKGFKAAQCKTLLKLAIPRIKLLRNRREIQMKQIRREIAKLLETGQEATAR  169
             +KGFK  +CKT L++A+ RIKLLRNR+E+Q++Q+RRE+A+LLE  Q+ TAR
Sbjct  188  LHKGFKPDKCKTSLRMAVARIKLLRNRKEVQVRQMRREVAQLLEANQDMTAR  239



>ref|XP_009352609.1| PREDICTED: filaggrin isoform X2 [Pyrus x bretschneideri]
Length=1268

 Score = 73.2 bits (178),  Expect = 5e-13, Method: Composition-based stats.
 Identities = 33/52 (63%), Positives = 45/52 (87%), Gaps = 0/52 (0%)
 Frame = +2

Query  14   FNKGFKAAQCKTLLKLAIPRIKLLRNRREIQMKQIRREIAKLLETGQEATAR  169
             +K FK A+CKT LKLA+ RIKLL+N+++ Q+KQ+RRE+A+LLETGQ+ TAR
Sbjct  2    LHKSFKPAKCKTALKLAVSRIKLLKNKKDAQVKQMRRELAQLLETGQDRTAR  53



>ref|XP_009352608.1| PREDICTED: filaggrin isoform X1 [Pyrus x bretschneideri]
Length=1269

 Score = 73.2 bits (178),  Expect = 5e-13, Method: Composition-based stats.
 Identities = 33/52 (63%), Positives = 45/52 (87%), Gaps = 0/52 (0%)
 Frame = +2

Query  14   FNKGFKAAQCKTLLKLAIPRIKLLRNRREIQMKQIRREIAKLLETGQEATAR  169
             +K FK A+CKT LKLA+ RIKLL+N+++ Q+KQ+RRE+A+LLETGQ+ TAR
Sbjct  2    LHKSFKPAKCKTALKLAVSRIKLLKNKKDAQVKQMRRELAQLLETGQDRTAR  53



>ref|XP_002282696.1| PREDICTED: IST1-like protein [Vitis vinifera]
 emb|CBI27012.3| unnamed protein product [Vitis vinifera]
Length=329

 Score = 70.9 bits (172),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 32/56 (57%), Positives = 44/56 (79%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    MDSFFNKGFKAAQCKTLLKLAIPRIKLLRNRREIQMKQIRREIAKLLETGQEATAR  169
            ++  FN+G   A+CKT L LAI RIKLL+N+R + +KQ+R+EIA+ L+TGQEA AR
Sbjct  4    LNQLFNRGILGAKCKTCLNLAISRIKLLQNKRSLHLKQMRKEIAQFLQTGQEAIAR  59



>ref|XP_010912111.1| PREDICTED: sericin 1-like [Elaeis guineensis]
Length=1073

 Score = 72.8 bits (177),  Expect = 5e-13, Method: Composition-based stats.
 Identities = 32/50 (64%), Positives = 44/50 (88%), Gaps = 0/50 (0%)
 Frame = +2

Query  20   KGFKAAQCKTLLKLAIPRIKLLRNRREIQMKQIRREIAKLLETGQEATAR  169
            K FKA +CKT LKLA+ RIKLL+N+RE+ +KQ++R++A+LLE+GQE TAR
Sbjct  13   KSFKAGKCKTSLKLALARIKLLKNKREVLLKQMKRDLAQLLESGQEQTAR  62



>ref|XP_004494081.1| PREDICTED: IST1 homolog isoform X2 [Cicer arietinum]
Length=76

 Score = 67.4 bits (163),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 30/54 (56%), Positives = 44/54 (81%), Gaps = 0/54 (0%)
 Frame = +2

Query  8    SFFNKGFKAAQCKTLLKLAIPRIKLLRNRREIQMKQIRREIAKLLETGQEATAR  169
            S    GF +++CKT  K+A+ RIKLLRN+RE+ ++Q+RR+IA LL++GQ+ATAR
Sbjct  20   SLLGLGFNSSKCKTAAKMAVARIKLLRNKREVVVRQMRRDIALLLQSGQDATAR  73



>ref|XP_008361315.1| PREDICTED: probable GPI-anchored adhesin-like protein PGA55 [Malus 
domestica]
Length=1270

 Score = 72.8 bits (177),  Expect = 5e-13, Method: Composition-based stats.
 Identities = 33/52 (63%), Positives = 45/52 (87%), Gaps = 0/52 (0%)
 Frame = +2

Query  14   FNKGFKAAQCKTLLKLAIPRIKLLRNRREIQMKQIRREIAKLLETGQEATAR  169
             ++ FK A+CKT LKLA+ RIKLL+N+++ Q+KQIRRE+A+LLETGQ+ TAR
Sbjct  2    LHRSFKPAKCKTSLKLAVSRIKLLKNKKDAQVKQIRRELAQLLETGQDRTAR  53



>ref|XP_003530191.1| PREDICTED: dentin sialophosphoprotein-like isoform X1 [Glycine 
max]
 ref|XP_006583570.1| PREDICTED: dentin sialophosphoprotein-like isoform X2 [Glycine 
max]
Length=1053

 Score = 72.8 bits (177),  Expect = 6e-13, Method: Composition-based stats.
 Identities = 32/52 (62%), Positives = 45/52 (87%), Gaps = 0/52 (0%)
 Frame = +2

Query  14   FNKGFKAAQCKTLLKLAIPRIKLLRNRREIQMKQIRREIAKLLETGQEATAR  169
             ++ FK A+CKT LKLA+ RIKLL+N+RE Q+KQ++RE+A+LLE+GQ+ TAR
Sbjct  2    LHRSFKPAKCKTALKLAVSRIKLLKNKREAQIKQLKRELAQLLESGQDRTAR  53



>ref|XP_007152932.1| hypothetical protein PHAVU_004G172500g [Phaseolus vulgaris]
 gb|ESW24926.1| hypothetical protein PHAVU_004G172500g [Phaseolus vulgaris]
Length=1052

 Score = 72.8 bits (177),  Expect = 6e-13, Method: Composition-based stats.
 Identities = 31/52 (60%), Positives = 45/52 (87%), Gaps = 0/52 (0%)
 Frame = +2

Query  14   FNKGFKAAQCKTLLKLAIPRIKLLRNRREIQMKQIRREIAKLLETGQEATAR  169
             ++ FK A+CKT LKLA+ R+KLLRN+RE Q++Q++RE+A+LLE+GQ+ TAR
Sbjct  2    LHRSFKPAKCKTALKLAVSRVKLLRNKREAQVRQLKRELAQLLESGQDRTAR  53



>ref|XP_006646252.1| PREDICTED: dentin sialophosphoprotein-like [Oryza brachyantha]
Length=1199

 Score = 72.8 bits (177),  Expect = 6e-13, Method: Composition-based stats.
 Identities = 30/56 (54%), Positives = 45/56 (80%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    MDSFFNKGFKAAQCKTLLKLAIPRIKLLRNRREIQMKQIRREIAKLLETGQEATAR  169
            +    +KGFK  +CKT L++A+ RIKLLRNR+E+Q++Q+RR++A+LLE  Q+ TAR
Sbjct  8    LSGVLHKGFKPDKCKTALRMALARIKLLRNRKEVQVRQMRRDVAQLLEADQDQTAR  63



>ref|XP_006360471.1| PREDICTED: IST1 homolog [Solanum tuberosum]
Length=96

 Score = 67.8 bits (164),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 30/56 (54%), Positives = 45/56 (80%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    MDSFFNKGFKAAQCKTLLKLAIPRIKLLRNRREIQMKQIRREIAKLLETGQEATAR  169
            ++  FN+G + ++CKT L LAI RIKLL+N+R+ Q++ +R+EIA+ L+TGQEA AR
Sbjct  4    LNQLFNRGLQGSKCKTCLTLAISRIKLLQNKRDAQLRLMRKEIAQFLQTGQEAIAR  59



>gb|KHN40346.1| IST1-like protein [Glycine soja]
Length=1048

 Score = 72.4 bits (176),  Expect = 7e-13, Method: Composition-based stats.
 Identities = 32/52 (62%), Positives = 45/52 (87%), Gaps = 0/52 (0%)
 Frame = +2

Query  14   FNKGFKAAQCKTLLKLAIPRIKLLRNRREIQMKQIRREIAKLLETGQEATAR  169
             ++ FK A+CKT LKLA+ RIKLL+N+RE Q+KQ++RE+A+LLE+GQ+ TAR
Sbjct  2    LHRSFKPAKCKTALKLAVSRIKLLKNKREAQIKQLKRELAQLLESGQDRTAR  53



>ref|XP_004494080.1| PREDICTED: IST1 homolog isoform X1 [Cicer arietinum]
Length=123

 Score = 68.2 bits (165),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 30/54 (56%), Positives = 44/54 (81%), Gaps = 0/54 (0%)
 Frame = +2

Query  8    SFFNKGFKAAQCKTLLKLAIPRIKLLRNRREIQMKQIRREIAKLLETGQEATAR  169
            S    GF +++CKT  K+A+ RIKLLRN+RE+ ++Q+RR+IA LL++GQ+ATAR
Sbjct  20   SLLGLGFNSSKCKTAAKMAVARIKLLRNKREVVVRQMRRDIALLLQSGQDATAR  73



>ref|XP_008242434.1| PREDICTED: dentin sialophosphoprotein-like [Prunus mume]
Length=1385

 Score = 72.4 bits (176),  Expect = 7e-13, Method: Composition-based stats.
 Identities = 33/52 (63%), Positives = 45/52 (87%), Gaps = 0/52 (0%)
 Frame = +2

Query  14   FNKGFKAAQCKTLLKLAIPRIKLLRNRREIQMKQIRREIAKLLETGQEATAR  169
             ++ FK A+CKT LKLA+ RIKLL+N+++ Q+KQI+RE+A+LLETGQE TAR
Sbjct  2    LHRSFKPAKCKTSLKLAVSRIKLLKNKKDAQVKQIKRELAQLLETGQERTAR  53



>ref|XP_009394434.1| PREDICTED: IST1 homolog [Musa acuminata subsp. malaccensis]
Length=326

 Score = 70.5 bits (171),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 32/56 (57%), Positives = 45/56 (80%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    MDSFFNKGFKAAQCKTLLKLAIPRIKLLRNRREIQMKQIRREIAKLLETGQEATAR  169
            ++S FN+     +CKT L LAI RIKLLRN+RE+Q+KQ+R+EI++ ++TGQEA AR
Sbjct  4    LNSLFNRAPFGTRCKTCLNLAISRIKLLRNKRELQLKQMRKEISQYIQTGQEAIAR  59



>ref|XP_007046561.1| Regulator of Vps4 activity in the MVB pathway protein isoform 
2 [Theobroma cacao]
 gb|EOX90718.1| Regulator of Vps4 activity in the MVB pathway protein isoform 
2 [Theobroma cacao]
Length=296

 Score = 69.7 bits (169),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 31/54 (57%), Positives = 45/54 (83%), Gaps = 0/54 (0%)
 Frame = +2

Query  8    SFFNKGFKAAQCKTLLKLAIPRIKLLRNRREIQMKQIRREIAKLLETGQEATAR  169
            S F  GF +++CKT  K+A+ RIKLLRN+R++ +KQ+RR+IA LL++GQ+ATAR
Sbjct  20   SLFRNGFNSSKCKTAAKMAVARIKLLRNKRQVVVKQMRRDIALLLQSGQDATAR  73



>ref|XP_011079063.1| PREDICTED: uncharacterized protein LOC105162673 [Sesamum indicum]
Length=473

 Score = 71.2 bits (173),  Expect = 9e-13, Method: Composition-based stats.
 Identities = 31/54 (57%), Positives = 47/54 (87%), Gaps = 0/54 (0%)
 Frame = +2

Query  8    SFFNKGFKAAQCKTLLKLAIPRIKLLRNRREIQMKQIRREIAKLLETGQEATAR  169
            S F++GF  ++CKT+ K+A+ R+KLLRN+RE+ +KQ+RR+IA LLE+GQ++TAR
Sbjct  17   SLFSRGFNPSKCKTMSKMAVARVKLLRNKREVVIKQMRRDIAMLLESGQDSTAR  70



>ref|XP_004969692.1| PREDICTED: dentin sialophosphoprotein-like [Setaria italica]
Length=1173

 Score = 72.0 bits (175),  Expect = 9e-13, Method: Composition-based stats.
 Identities = 31/56 (55%), Positives = 45/56 (80%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    MDSFFNKGFKAAQCKTLLKLAIPRIKLLRNRREIQMKQIRREIAKLLETGQEATAR  169
            +    +KGFK  +CKT L++A+ RIKLLRNR+E+Q++Q+RRE+A+LLE  Q+ TAR
Sbjct  8    LSGVLHKGFKPDKCKTSLRMAVARIKLLRNRKEVQVRQMRREVAQLLEANQDMTAR  63



>ref|XP_010266112.1| PREDICTED: uncharacterized protein LOC104603713 [Nelumbo nucifera]
Length=463

 Score = 71.2 bits (173),  Expect = 9e-13, Method: Composition-based stats.
 Identities = 32/54 (59%), Positives = 46/54 (85%), Gaps = 0/54 (0%)
 Frame = +2

Query  8    SFFNKGFKAAQCKTLLKLAIPRIKLLRNRREIQMKQIRREIAKLLETGQEATAR  169
            S F +GF +++CKT+ KLA  RIKLLRN+RE+ +KQ+RR++A LL++GQ+ATAR
Sbjct  24   SIFRRGFNSSKCKTMAKLATARIKLLRNKREVVVKQMRRDVALLLQSGQDATAR  77



>ref|XP_008344216.1| PREDICTED: IST1 homolog [Malus domestica]
Length=82

 Score = 67.0 bits (162),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 30/54 (56%), Positives = 44/54 (81%), Gaps = 0/54 (0%)
 Frame = +2

Query  8    SFFNKGFKAAQCKTLLKLAIPRIKLLRNRREIQMKQIRREIAKLLETGQEATAR  169
            S F  GF +++CK   K+A+ RIKLLRN+R++ +KQ+RR+IA LL++GQ+ATAR
Sbjct  20   SLFRWGFNSSKCKMQAKMAVARIKLLRNKRQVVVKQMRRDIALLLQSGQDATAR  73



>ref|XP_007203540.1| hypothetical protein PRUPE_ppb008146mg [Prunus persica]
 gb|EMJ04739.1| hypothetical protein PRUPE_ppb008146mg [Prunus persica]
Length=276

 Score = 69.3 bits (168),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 33/52 (63%), Positives = 45/52 (87%), Gaps = 0/52 (0%)
 Frame = +2

Query  14   FNKGFKAAQCKTLLKLAIPRIKLLRNRREIQMKQIRREIAKLLETGQEATAR  169
             ++ FK A+CKT LKLA+ RIKLL+N+++ Q+KQI+RE+A+LLETGQE TAR
Sbjct  2    LHRSFKPAKCKTSLKLAVSRIKLLKNKKDAQVKQIKRELAQLLETGQERTAR  53



>ref|XP_006412068.1| hypothetical protein EUTSA_v10025095mg [Eutrema salsugineum]
 gb|ESQ53521.1| hypothetical protein EUTSA_v10025095mg [Eutrema salsugineum]
Length=474

 Score = 70.9 bits (172),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 31/54 (57%), Positives = 46/54 (85%), Gaps = 0/54 (0%)
 Frame = +2

Query  8    SFFNKGFKAAQCKTLLKLAIPRIKLLRNRREIQMKQIRREIAKLLETGQEATAR  169
            S F +GF +++CKT  K+A+ RIKLLRN+R++ +KQ+RR+IA LL++GQ+ATAR
Sbjct  39   SLFRRGFNSSKCKTAAKMAVARIKLLRNKRQVVVKQMRRDIAVLLQSGQDATAR  92



>ref|XP_002514165.1| protein with unknown function [Ricinus communis]
 gb|EEF48119.1| protein with unknown function [Ricinus communis]
Length=1155

 Score = 71.6 bits (174),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 32/52 (62%), Positives = 45/52 (87%), Gaps = 0/52 (0%)
 Frame = +2

Query  14   FNKGFKAAQCKTLLKLAIPRIKLLRNRREIQMKQIRREIAKLLETGQEATAR  169
             +K FK A+CKT LKLA+ RIKLL+N+R+ Q+KQ++RE+A+LLE+GQ+ TAR
Sbjct  2    LHKSFKPAKCKTALKLAVSRIKLLKNKRDAQVKQLKRELAQLLESGQDRTAR  53



>ref|XP_009150864.1| PREDICTED: uncharacterized protein LOC103874176 [Brassica rapa]
 emb|CDX75521.1| BnaA01g01810D [Brassica napus]
Length=433

 Score = 70.5 bits (171),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 31/54 (57%), Positives = 46/54 (85%), Gaps = 0/54 (0%)
 Frame = +2

Query  8    SFFNKGFKAAQCKTLLKLAIPRIKLLRNRREIQMKQIRREIAKLLETGQEATAR  169
            S F +GF +++CKT  K+A+ RIKLLRN+R++ +KQ+RR+IA LL++GQ+ATAR
Sbjct  20   SLFRRGFNSSKCKTAAKMAVARIKLLRNKRQVVVKQMRRDIALLLQSGQDATAR  73



>gb|AES77090.2| regulator of Vps4 activity in the MVB pathway protein [Medicago 
truncatula]
Length=1037

 Score = 71.6 bits (174),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 31/52 (60%), Positives = 42/52 (81%), Gaps = 0/52 (0%)
 Frame = +2

Query  14   FNKGFKAAQCKTLLKLAIPRIKLLRNRREIQMKQIRREIAKLLETGQEATAR  169
             ++ FK A+CKT LKLA+ RIKLLRN+R+ Q+  ++RE+AKLLE GQ+ TAR
Sbjct  2    LHRSFKPAKCKTALKLAVSRIKLLRNKRQTQINLLKRELAKLLENGQDQTAR  53



>ref|XP_003620872.1| IST1-like protein [Medicago truncatula]
Length=1085

 Score = 71.6 bits (174),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 31/52 (60%), Positives = 42/52 (81%), Gaps = 0/52 (0%)
 Frame = +2

Query  14   FNKGFKAAQCKTLLKLAIPRIKLLRNRREIQMKQIRREIAKLLETGQEATAR  169
             ++ FK A+CKT LKLA+ RIKLLRN+R+ Q+  ++RE+AKLLE GQ+ TAR
Sbjct  2    LHRSFKPAKCKTALKLAVSRIKLLRNKRQTQINLLKRELAKLLENGQDQTAR  53



>gb|KCW82257.1| hypothetical protein EUGRSUZ_C03673 [Eucalyptus grandis]
Length=1289

 Score = 71.2 bits (173),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 32/52 (62%), Positives = 45/52 (87%), Gaps = 0/52 (0%)
 Frame = +2

Query  14   FNKGFKAAQCKTLLKLAIPRIKLLRNRREIQMKQIRREIAKLLETGQEATAR  169
             +K FK A+CKT LKLA  R+KLLRN++E+Q+KQ+RR++A+LLE+GQ+ TAR
Sbjct  68   LHKSFKPAKCKTALKLAASRLKLLRNKKEVQVKQMRRDLAQLLESGQDQTAR  119



>ref|XP_010049566.1| PREDICTED: uncharacterized protein LOC104438178 isoform X1 [Eucalyptus 
grandis]
Length=1310

 Score = 71.2 bits (173),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 32/52 (62%), Positives = 45/52 (87%), Gaps = 0/52 (0%)
 Frame = +2

Query  14   FNKGFKAAQCKTLLKLAIPRIKLLRNRREIQMKQIRREIAKLLETGQEATAR  169
             +K FK A+CKT LKLA  R+KLLRN++E+Q+KQ+RR++A+LLE+GQ+ TAR
Sbjct  2    LHKSFKPAKCKTALKLAASRLKLLRNKKEVQVKQMRRDLAQLLESGQDQTAR  53



>ref|XP_008367261.1| PREDICTED: probable GPI-anchored adhesin-like protein PGA55 [Malus 
domestica]
Length=1270

 Score = 71.2 bits (173),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 32/52 (62%), Positives = 44/52 (85%), Gaps = 0/52 (0%)
 Frame = +2

Query  14   FNKGFKAAQCKTLLKLAIPRIKLLRNRREIQMKQIRREIAKLLETGQEATAR  169
             ++ FK A+CKT LKLA+ RIKLL+N+++ Q+KQ+RRE+A+LLETGQ  TAR
Sbjct  2    LHRSFKPAKCKTALKLAVSRIKLLKNKKDAQVKQMRRELAQLLETGQXRTAR  53



>gb|KCW56546.1| hypothetical protein EUGRSUZ_I02282 [Eucalyptus grandis]
Length=945

 Score = 70.9 bits (172),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 30/54 (56%), Positives = 44/54 (81%), Gaps = 0/54 (0%)
 Frame = +2

Query  8    SFFNKGFKAAQCKTLLKLAIPRIKLLRNRREIQMKQIRREIAKLLETGQEATAR  169
            S F  GFK+++CKT  K+ + RIKLLRN+R+  ++Q+RR+IA LL++GQ+ATAR
Sbjct  20   SLFGGGFKSSKCKTAAKMTVARIKLLRNKRQAVVRQMRRDIALLLQSGQDATAR  73



>ref|XP_006296926.1| hypothetical protein CARUB_v10012919mg [Capsella rubella]
 gb|EOA29824.1| hypothetical protein CARUB_v10012919mg [Capsella rubella]
Length=933

 Score = 70.9 bits (172),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 31/56 (55%), Positives = 46/56 (82%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    MDSFFNKGFKAAQCKTLLKLAIPRIKLLRNRREIQMKQIRREIAKLLETGQEATAR  169
            M    ++GFK A+CKT L++A  R+K+L+N++EIQ+KQ+RRE+A+LLE+GQ  TAR
Sbjct  1    MKKVLHRGFKPAKCKTALQMANSRLKILKNKKEIQIKQLRRELAQLLESGQTPTAR  56



>gb|KCW82256.1| hypothetical protein EUGRSUZ_C03673 [Eucalyptus grandis]
Length=1376

 Score = 70.9 bits (172),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 32/52 (62%), Positives = 45/52 (87%), Gaps = 0/52 (0%)
 Frame = +2

Query  14   FNKGFKAAQCKTLLKLAIPRIKLLRNRREIQMKQIRREIAKLLETGQEATAR  169
             +K FK A+CKT LKLA  R+KLLRN++E+Q+KQ+RR++A+LLE+GQ+ TAR
Sbjct  68   LHKSFKPAKCKTALKLAASRLKLLRNKKEVQVKQMRRDLAQLLESGQDQTAR  119



>ref|XP_010489136.1| PREDICTED: uncharacterized protein LOC104766867 [Camelina sativa]
Length=944

 Score = 70.9 bits (172),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 30/56 (54%), Positives = 45/56 (80%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    MDSFFNKGFKAAQCKTLLKLAIPRIKLLRNRREIQMKQIRREIAKLLETGQEATAR  169
            M    N+GFK A+CKT +++A  R+K+L+N++EIQ+KQ+RRE+A+LLE+G   TAR
Sbjct  1    MKKVLNRGFKPAKCKTAMQMANSRLKILKNKKEIQIKQLRRELAQLLESGHTPTAR  56



>emb|CBI33275.3| unnamed protein product [Vitis vinifera]
Length=360

 Score = 69.3 bits (168),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 31/54 (57%), Positives = 46/54 (85%), Gaps = 0/54 (0%)
 Frame = +2

Query  8    SFFNKGFKAAQCKTLLKLAIPRIKLLRNRREIQMKQIRREIAKLLETGQEATAR  169
            S F +GF +++CKT+ K+A+ RIKLLRN+RE  ++Q+RR+IA LL++GQ+ATAR
Sbjct  6    SIFRRGFSSSKCKTMAKMAMARIKLLRNKREAVVRQMRRDIALLLQSGQDATAR  59



>ref|XP_009418373.1| PREDICTED: IST1-like protein [Musa acuminata subsp. malaccensis]
Length=327

 Score = 68.9 bits (167),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 31/56 (55%), Positives = 44/56 (79%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    MDSFFNKGFKAAQCKTLLKLAIPRIKLLRNRREIQMKQIRREIAKLLETGQEATAR  169
            ++S FN+     +CKT L LAI RIKLLRN+RE+Q+K +R+EI++ ++TGQEA AR
Sbjct  4    LNSIFNRASFGTRCKTCLNLAISRIKLLRNKRELQLKHMRKEISQYIQTGQEAIAR  59



>ref|XP_010416745.1| PREDICTED: uncharacterized protein LOC104702567 [Camelina sativa]
Length=942

 Score = 70.9 bits (172),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 30/56 (54%), Positives = 45/56 (80%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    MDSFFNKGFKAAQCKTLLKLAIPRIKLLRNRREIQMKQIRREIAKLLETGQEATAR  169
            M    N+GFK A+CKT +++A  R+K+L+N++EIQ+KQ+RRE+A+LLE+G   TAR
Sbjct  1    MKKVLNRGFKPAKCKTAMQMANSRLKILKNKKEIQIKQLRRELAQLLESGHTPTAR  56



>ref|NP_179561.2| Vps4 regulator of MVB pathway [Arabidopsis thaliana]
 gb|AEC06916.1| Vps4 regulator of MVB pathway [Arabidopsis thaliana]
Length=937

 Score = 70.9 bits (172),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 31/56 (55%), Positives = 45/56 (80%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    MDSFFNKGFKAAQCKTLLKLAIPRIKLLRNRREIQMKQIRREIAKLLETGQEATAR  169
            M     +GFK A+CKT L++A  R+K+L+N++EIQ+KQ+RRE+A+LLE+GQ  TAR
Sbjct  1    MKKVLQRGFKPAKCKTALQMANSRLKILKNKKEIQIKQLRRELAQLLESGQTPTAR  56



>dbj|BAF01603.1| hypothetical protein [Arabidopsis thaliana]
Length=937

 Score = 70.9 bits (172),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 31/56 (55%), Positives = 45/56 (80%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    MDSFFNKGFKAAQCKTLLKLAIPRIKLLRNRREIQMKQIRREIAKLLETGQEATAR  169
            M     +GFK A+CKT L++A  R+K+L+N++EIQ+KQ+RRE+A+LLE+GQ  TAR
Sbjct  1    MKKVLQRGFKPAKCKTALQMANSRLKILKNKKEIQIKQLRRELAQLLESGQTPTAR  56



>ref|XP_010262216.1| PREDICTED: uncharacterized protein LOC104600776 [Nelumbo nucifera]
 ref|XP_010262217.1| PREDICTED: uncharacterized protein LOC104600776 [Nelumbo nucifera]
Length=1239

 Score = 70.9 bits (172),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 32/52 (62%), Positives = 45/52 (87%), Gaps = 0/52 (0%)
 Frame = +2

Query  14   FNKGFKAAQCKTLLKLAIPRIKLLRNRREIQMKQIRREIAKLLETGQEATAR  169
             ++ FKAA+CKT LKLA  R+KLL+N+R+ Q+KQ++RE+AKL+E+GQE TAR
Sbjct  2    LHRSFKAAKCKTSLKLAASRLKLLKNKRDAQVKQLKRELAKLIESGQEQTAR  53



>ref|XP_008337638.1| PREDICTED: dentin sialophosphoprotein isoform X2 [Malus domestica]
Length=1306

 Score = 70.9 bits (172),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 33/52 (63%), Positives = 45/52 (87%), Gaps = 0/52 (0%)
 Frame = +2

Query  14   FNKGFKAAQCKTLLKLAIPRIKLLRNRREIQMKQIRREIAKLLETGQEATAR  169
             ++ FK A+CKT LKLA+ RIKLL+N+++ Q+KQIRRE+A+LLETGQ+ TAR
Sbjct  2    LHRSFKPAKCKTSLKLAVSRIKLLKNKKDAQVKQIRRELAQLLETGQDRTAR  53



>ref|XP_003635213.2| PREDICTED: IST1-like protein [Vitis vinifera]
Length=436

 Score = 69.7 bits (169),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 31/54 (57%), Positives = 46/54 (85%), Gaps = 0/54 (0%)
 Frame = +2

Query  8    SFFNKGFKAAQCKTLLKLAIPRIKLLRNRREIQMKQIRREIAKLLETGQEATAR  169
            S F +GF +++CKT+ K+A+ RIKLLRN+RE  ++Q+RR+IA LL++GQ+ATAR
Sbjct  20   SIFRRGFSSSKCKTMAKMAMARIKLLRNKREAVVRQMRRDIALLLQSGQDATAR  73



>ref|XP_003635529.1| PREDICTED: IST1-like protein [Vitis vinifera]
Length=436

 Score = 69.7 bits (169),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 31/54 (57%), Positives = 46/54 (85%), Gaps = 0/54 (0%)
 Frame = +2

Query  8    SFFNKGFKAAQCKTLLKLAIPRIKLLRNRREIQMKQIRREIAKLLETGQEATAR  169
            S F +GF +++CKT+ K+A+ RIKLLRN+RE  ++Q+RR+IA LL++GQ+ATAR
Sbjct  20   SIFRRGFSSSKCKTMAKMAMARIKLLRNKREAVVRQMRRDIALLLQSGQDATAR  73



>ref|XP_008337637.1| PREDICTED: dentin sialophosphoprotein isoform X1 [Malus domestica]
Length=1307

 Score = 70.5 bits (171),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 33/52 (63%), Positives = 45/52 (87%), Gaps = 0/52 (0%)
 Frame = +2

Query  14   FNKGFKAAQCKTLLKLAIPRIKLLRNRREIQMKQIRREIAKLLETGQEATAR  169
             ++ FK A+CKT LKLA+ RIKLL+N+++ Q+KQIRRE+A+LLETGQ+ TAR
Sbjct  2    LHRSFKPAKCKTSLKLAVSRIKLLKNKKDAQVKQIRRELAQLLETGQDRTAR  53



>ref|XP_008391519.1| PREDICTED: dentin sialophosphoprotein-like [Malus domestica]
Length=1270

 Score = 70.5 bits (171),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 32/52 (62%), Positives = 44/52 (85%), Gaps = 0/52 (0%)
 Frame = +2

Query  14   FNKGFKAAQCKTLLKLAIPRIKLLRNRREIQMKQIRREIAKLLETGQEATAR  169
             ++ FK A+CKT LKLA+ RIKLL+N+++ Q+KQ+RRE+A+LLETGQ  TAR
Sbjct  2    LHRSFKPAKCKTALKLAVSRIKLLKNKKDAQVKQMRRELAQLLETGQYRTAR  53



>ref|XP_010495939.1| PREDICTED: uncharacterized protein LOC104773084 [Camelina sativa]
Length=940

 Score = 70.5 bits (171),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 30/56 (54%), Positives = 45/56 (80%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    MDSFFNKGFKAAQCKTLLKLAIPRIKLLRNRREIQMKQIRREIAKLLETGQEATAR  169
            M    N+GFK A+CKT +++A  R+K+L+N++EIQ+KQ+RRE+A+LLE+G   TAR
Sbjct  1    MKKVLNRGFKPAKCKTAMQMANSRLKILKNKKEIQIKQLRRELAQLLESGHTPTAR  56



>ref|XP_004161651.1| PREDICTED: IST1 homolog [Cucumis sativus]
Length=219

 Score = 67.0 bits (162),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 31/56 (55%), Positives = 44/56 (79%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    MDSFFNKGFKAAQCKTLLKLAIPRIKLLRNRREIQMKQIRREIAKLLETGQEATAR  169
            ++  FN+G  A +CKT L LAI RIKLL+N+R++Q+K +R+EIA+ L+TGQE  AR
Sbjct  4    LNQLFNRGVFAGKCKTCLSLAISRIKLLQNKRDMQLKLMRKEIAQFLQTGQEQIAR  59



>ref|XP_002279892.1| PREDICTED: uncharacterized protein LOC100256064 isoform X1 [Vitis 
vinifera]
 emb|CBI27947.3| unnamed protein product [Vitis vinifera]
Length=1179

 Score = 70.1 bits (170),  Expect = 5e-12, Method: Composition-based stats.
 Identities = 31/52 (60%), Positives = 45/52 (87%), Gaps = 0/52 (0%)
 Frame = +2

Query  14   FNKGFKAAQCKTLLKLAIPRIKLLRNRREIQMKQIRREIAKLLETGQEATAR  169
             ++ FK A+CKT LKLA+ RIKLL+NRRE Q+KQ++R++A+LL++GQ+ TAR
Sbjct  2    LHRSFKPAKCKTSLKLAVSRIKLLKNRREAQLKQMKRDLAQLLQSGQDQTAR  53



>emb|CDY41639.1| BnaC03g62450D [Brassica napus]
Length=430

 Score = 68.9 bits (167),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 31/54 (57%), Positives = 45/54 (83%), Gaps = 0/54 (0%)
 Frame = +2

Query  8    SFFNKGFKAAQCKTLLKLAIPRIKLLRNRREIQMKQIRREIAKLLETGQEATAR  169
            S F  GF +++CKT  K+A+ RIKLLRN+R++ +KQ+RR+IA LL++GQ+ATAR
Sbjct  20   SLFRLGFNSSKCKTAAKMAVARIKLLRNKRQVVVKQMRRDIALLLQSGQDATAR  73



>ref|XP_011022214.1| PREDICTED: IST1 homolog [Populus euphratica]
Length=314

 Score = 68.2 bits (165),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 30/56 (54%), Positives = 44/56 (79%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    MDSFFNKGFKAAQCKTLLKLAIPRIKLLRNRREIQMKQIRREIAKLLETGQEATAR  169
            ++  FN+G   ++CKT L LAI RIKLL+N+R++Q+K +R+EIA+ L+ GQEA AR
Sbjct  4    LNQLFNRGVFGSKCKTCLSLAISRIKLLQNKRDLQLKHMRKEIAQFLQAGQEAIAR  59



>ref|XP_008781253.1| PREDICTED: IST1-like protein [Phoenix dactylifera]
Length=448

 Score = 68.9 bits (167),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 32/54 (59%), Positives = 45/54 (83%), Gaps = 0/54 (0%)
 Frame = +2

Query  8    SFFNKGFKAAQCKTLLKLAIPRIKLLRNRREIQMKQIRREIAKLLETGQEATAR  169
            S F +GF +++CKT  KLA+ RIKLLRN+RE+Q++Q+RR+IA LL++ QE TAR
Sbjct  18   SMFRRGFNSSKCKTEAKLAMARIKLLRNKREVQVRQMRRDIAMLLQSRQEDTAR  71



>dbj|BAJ93689.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=120

 Score = 65.9 bits (159),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 29/56 (52%), Positives = 44/56 (79%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    MDSFFNKGFKAAQCKTLLKLAIPRIKLLRNRREIQMKQIRREIAKLLETGQEATAR  169
            +    +KGFK  +CK  LK+A+ RIKLLRN++E+Q++Q+RRE+A+LL+  Q+ TAR
Sbjct  8    LSGVLSKGFKPDKCKIALKMAMARIKLLRNKKEVQVRQMRREVAQLLDGNQDQTAR  63



>gb|KFK30216.1| hypothetical protein AALP_AA7G232900 [Arabis alpina]
Length=461

 Score = 68.9 bits (167),  Expect = 5e-12, Method: Composition-based stats.
 Identities = 31/54 (57%), Positives = 46/54 (85%), Gaps = 0/54 (0%)
 Frame = +2

Query  8    SFFNKGFKAAQCKTLLKLAIPRIKLLRNRREIQMKQIRREIAKLLETGQEATAR  169
            S F +GF +++CKT  K+A+ RIKLLRN+R++ +KQ+RR+IA LL++GQ+ATAR
Sbjct  20   SLFRRGFNSSKCKTAAKMAVARIKLLRNKRQVVVKQMRRDIAVLLQSGQDATAR  73



>ref|XP_010941392.1| PREDICTED: IST1-like protein [Elaeis guineensis]
Length=462

 Score = 68.9 bits (167),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 32/54 (59%), Positives = 43/54 (80%), Gaps = 0/54 (0%)
 Frame = +2

Query  8    SFFNKGFKAAQCKTLLKLAIPRIKLLRNRREIQMKQIRREIAKLLETGQEATAR  169
            S F  GF +++CKT  +LA  RIKLLRN+RE+Q++Q+RR+IA LLE+ QE TAR
Sbjct  18   SIFRHGFNSSKCKTEARLATARIKLLRNKREVQVRQMRRDIAMLLESHQEDTAR  71



>ref|XP_008450820.1| PREDICTED: probable GPI-anchored adhesin-like protein PGA55 [Cucumis 
melo]
Length=1160

 Score = 70.1 bits (170),  Expect = 5e-12, Method: Composition-based stats.
 Identities = 31/52 (60%), Positives = 43/52 (83%), Gaps = 0/52 (0%)
 Frame = +2

Query  14   FNKGFKAAQCKTLLKLAIPRIKLLRNRREIQMKQIRREIAKLLETGQEATAR  169
             NK FK A+CKT LKLA+ RIKLLRN++++ +KQ++ ++AKLLE GQ+ TAR
Sbjct  2    LNKSFKPAKCKTSLKLAVSRIKLLRNKKDVHIKQLKGDLAKLLEAGQDQTAR  53



>ref|XP_006379742.1| hypothetical protein POPTR_0008s12030g [Populus trichocarpa]
 gb|ABK94695.1| unknown [Populus trichocarpa]
 gb|ERP57539.1| hypothetical protein POPTR_0008s12030g [Populus trichocarpa]
Length=314

 Score = 67.8 bits (164),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 30/56 (54%), Positives = 44/56 (79%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    MDSFFNKGFKAAQCKTLLKLAIPRIKLLRNRREIQMKQIRREIAKLLETGQEATAR  169
            ++  FN+G   ++CKT L LAI RIKLL+N+R++Q+K +R+EIA+ L+ GQEA AR
Sbjct  4    LNQLFNRGVFGSKCKTCLNLAISRIKLLQNKRDLQLKHMRKEIAQFLQAGQEAIAR  59



>ref|XP_004236982.1| PREDICTED: IST1 homolog [Solanum lycopersicum]
Length=323

 Score = 68.2 bits (165),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 30/56 (54%), Positives = 45/56 (80%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    MDSFFNKGFKAAQCKTLLKLAIPRIKLLRNRREIQMKQIRREIAKLLETGQEATAR  169
            ++  FN+G + ++CKT L LAI RIKLL+N+R+ Q++ +R+EIA+ L+TGQEA AR
Sbjct  4    LNQLFNRGLQGSKCKTCLTLAISRIKLLQNKRDAQLRLMRKEIAQFLQTGQEAIAR  59



>ref|XP_010656225.1| PREDICTED: uncharacterized protein LOC100256064 isoform X2 [Vitis 
vinifera]
Length=1157

 Score = 69.7 bits (169),  Expect = 6e-12, Method: Composition-based stats.
 Identities = 31/52 (60%), Positives = 45/52 (87%), Gaps = 0/52 (0%)
 Frame = +2

Query  14   FNKGFKAAQCKTLLKLAIPRIKLLRNRREIQMKQIRREIAKLLETGQEATAR  169
             ++ FK A+CKT LKLA+ RIKLL+NRRE Q+KQ++R++A+LL++GQ+ TAR
Sbjct  2    LHRSFKPAKCKTSLKLAVSRIKLLKNRREAQLKQMKRDLAQLLQSGQDQTAR  53



>gb|KHG16212.1| IST1-like protein [Gossypium arboreum]
Length=419

 Score = 68.6 bits (166),  Expect = 7e-12, Method: Composition-based stats.
 Identities = 31/54 (57%), Positives = 45/54 (83%), Gaps = 0/54 (0%)
 Frame = +2

Query  8    SFFNKGFKAAQCKTLLKLAIPRIKLLRNRREIQMKQIRREIAKLLETGQEATAR  169
            S F  GF +++CKT  K+A+ RIKLLRN+R++ +KQ+RR+IA LL++GQ+ATAR
Sbjct  20   SLFGNGFNSSKCKTAAKMAVARIKLLRNKRQVVVKQMRRDIALLLQSGQDATAR  73



>ref|XP_002533970.1| protein with unknown function [Ricinus communis]
 gb|EEF28417.1| protein with unknown function [Ricinus communis]
Length=327

 Score = 67.8 bits (164),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 30/56 (54%), Positives = 44/56 (79%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    MDSFFNKGFKAAQCKTLLKLAIPRIKLLRNRREIQMKQIRREIAKLLETGQEATAR  169
            ++  FN+G   A+CKT L L+I RIKLL+N+R++Q+K +R+EIA+ L+ GQEA AR
Sbjct  4    LNQLFNRGVFGAKCKTCLTLSISRIKLLQNKRDLQLKHMRKEIAQFLQAGQEAIAR  59



>ref|XP_010921566.1| PREDICTED: IST1 homolog isoform X2 [Elaeis guineensis]
Length=328

 Score = 67.8 bits (164),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 32/56 (57%), Positives = 42/56 (75%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    MDSFFNKGFKAAQCKTLLKLAIPRIKLLRNRREIQMKQIRREIAKLLETGQEATAR  169
            ++S FN+     +CKT L LAI RIKLL N+RE+Q+K +RREI + L+TGQEA AR
Sbjct  4    LNSLFNRATLGTRCKTCLNLAISRIKLLHNKRELQLKNMRREIFQYLQTGQEAIAR  59



>ref|XP_011076713.1| PREDICTED: IST1 homolog isoform X2 [Sesamum indicum]
Length=321

 Score = 67.8 bits (164),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 30/56 (54%), Positives = 43/56 (77%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    MDSFFNKGFKAAQCKTLLKLAIPRIKLLRNRREIQMKQIRREIAKLLETGQEATAR  169
            ++  FN+G   A+CKT L L I RIKLL+N+R++ +K +R+EIA+ L+TGQEA AR
Sbjct  4    LNQLFNRGLLGAKCKTCLTLGISRIKLLQNKRDVHLKLMRKEIAEFLQTGQEAIAR  59



>ref|XP_007044322.1| Regulator of Vps4 activity in the MVB pathway protein [Theobroma 
cacao]
 gb|EOY00154.1| Regulator of Vps4 activity in the MVB pathway protein [Theobroma 
cacao]
Length=327

 Score = 67.8 bits (164),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 30/56 (54%), Positives = 43/56 (77%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    MDSFFNKGFKAAQCKTLLKLAIPRIKLLRNRREIQMKQIRREIAKLLETGQEATAR  169
            ++  FN+G   A+CKT L LAI RIKLL+N+R++Q+K +R+EIA+ L+ GQE  AR
Sbjct  4    LNQLFNRGVFGAKCKTCLSLAISRIKLLQNKRDLQLKHMRKEIAQFLQAGQEPIAR  59



>ref|XP_010113265.1| hypothetical protein L484_026594 [Morus notabilis]
 gb|EXC35272.1| hypothetical protein L484_026594 [Morus notabilis]
Length=451

 Score = 68.6 bits (166),  Expect = 8e-12, Method: Composition-based stats.
 Identities = 31/54 (57%), Positives = 45/54 (83%), Gaps = 0/54 (0%)
 Frame = +2

Query  8    SFFNKGFKAAQCKTLLKLAIPRIKLLRNRREIQMKQIRREIAKLLETGQEATAR  169
            S F +GF + +CKT  K+A+ RIKLLRN+RE+ +KQ+RR+IA LL++GQ++TAR
Sbjct  20   SLFRRGFNSPKCKTAAKMAVARIKLLRNKREVVVKQMRRDIALLLQSGQDSTAR  73



>ref|XP_010090010.1| hypothetical protein L484_027240 [Morus notabilis]
 gb|EXB38807.1| hypothetical protein L484_027240 [Morus notabilis]
Length=1100

 Score = 69.3 bits (168),  Expect = 8e-12, Method: Composition-based stats.
 Identities = 31/52 (60%), Positives = 44/52 (85%), Gaps = 0/52 (0%)
 Frame = +2

Query  14   FNKGFKAAQCKTLLKLAIPRIKLLRNRREIQMKQIRREIAKLLETGQEATAR  169
             ++ FK A+CKT LKLA+ RIKLL N+RE+Q++Q++RE+A+LLE+GQ  TAR
Sbjct  2    LHRSFKPAKCKTALKLAVSRIKLLNNKREVQVRQMKRELAQLLESGQVQTAR  53



>ref|XP_010051622.1| PREDICTED: uncharacterized protein LOC104440388 [Eucalyptus grandis]
Length=567

 Score = 68.9 bits (167),  Expect = 8e-12, Method: Composition-based stats.
 Identities = 31/52 (60%), Positives = 44/52 (85%), Gaps = 0/52 (0%)
 Frame = +2

Query  14   FNKGFKAAQCKTLLKLAIPRIKLLRNRREIQMKQIRREIAKLLETGQEATAR  169
             +K FK A+CKT LKLA  R+KLLRN++E+ +KQ+RR++A+LLE+GQ+ TAR
Sbjct  2    LHKSFKPAKCKTALKLAASRLKLLRNKKEVLVKQMRRDLAQLLESGQDQTAR  53



>gb|EPS63330.1| hypothetical protein M569_11456, partial [Genlisea aurea]
Length=200

 Score = 66.2 bits (160),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 31/53 (58%), Positives = 42/53 (79%), Gaps = 0/53 (0%)
 Frame = +2

Query  8    SFFNKGFKAAQCKTLLKLAIPRIKLLRNRREIQMKQIRREIAKLLETGQEATA  166
            S  ++ F  A+CKT LKLA  R+KL RN++EIQ+KQ++REIA LLE+GQ+ TA
Sbjct  15   SMLSRSFNPAKCKTALKLATSRLKLSRNKKEIQVKQMKREIAALLESGQDRTA  67



>ref|XP_008465781.1| PREDICTED: IST1 homolog [Cucumis melo]
Length=325

 Score = 67.4 bits (163),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 31/56 (55%), Positives = 44/56 (79%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    MDSFFNKGFKAAQCKTLLKLAIPRIKLLRNRREIQMKQIRREIAKLLETGQEATAR  169
            ++  FN+G  A +CKT L LAI RIKLL+N+R++Q+K +R+EIA+ L+TGQE  AR
Sbjct  4    LNQLFNRGVFAGKCKTCLSLAISRIKLLQNKRDLQLKLMRKEIAQFLQTGQEQIAR  59



>gb|KCW82531.1| hypothetical protein EUGRSUZ_C03936 [Eucalyptus grandis]
Length=555

 Score = 68.6 bits (166),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 31/52 (60%), Positives = 44/52 (85%), Gaps = 0/52 (0%)
 Frame = +2

Query  14   FNKGFKAAQCKTLLKLAIPRIKLLRNRREIQMKQIRREIAKLLETGQEATAR  169
             +K FK A+CKT LKLA  R+KLLRN++E+ +KQ+RR++A+LLE+GQ+ TAR
Sbjct  2    LHKSFKPAKCKTALKLAASRLKLLRNKKEVLVKQMRRDLAQLLESGQDQTAR  53



>ref|XP_004288917.1| PREDICTED: uncharacterized protein LOC101312868 [Fragaria vesca 
subsp. vesca]
Length=1185

 Score = 68.9 bits (167),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 30/52 (58%), Positives = 44/52 (85%), Gaps = 0/52 (0%)
 Frame = +2

Query  14   FNKGFKAAQCKTLLKLAIPRIKLLRNRREIQMKQIRREIAKLLETGQEATAR  169
             ++ FK A+CKT LKLA+ RIKLL+N+++ Q+KQI+RE+A+L+E+GQ  TAR
Sbjct  2    LHRSFKPAKCKTALKLAVSRIKLLKNKKDAQVKQIKRELAQLMESGQYRTAR  53



>ref|XP_004140335.1| PREDICTED: IST1 homolog [Cucumis sativus]
 gb|KGN50955.1| hypothetical protein Csa_5G367190 [Cucumis sativus]
Length=323

 Score = 67.4 bits (163),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 31/56 (55%), Positives = 44/56 (79%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    MDSFFNKGFKAAQCKTLLKLAIPRIKLLRNRREIQMKQIRREIAKLLETGQEATAR  169
            ++  FN+G  A +CKT L LAI RIKLL+N+R++Q+K +R+EIA+ L+TGQE  AR
Sbjct  4    LNQLFNRGVFAGKCKTCLSLAISRIKLLQNKRDMQLKLMRKEIAQFLQTGQEQIAR  59



>ref|XP_007046560.1| Regulator of Vps4 activity in the MVB pathway protein isoform 
1 [Theobroma cacao]
 gb|EOX90717.1| Regulator of Vps4 activity in the MVB pathway protein isoform 
1 [Theobroma cacao]
Length=447

 Score = 68.2 bits (165),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 31/54 (57%), Positives = 45/54 (83%), Gaps = 0/54 (0%)
 Frame = +2

Query  8    SFFNKGFKAAQCKTLLKLAIPRIKLLRNRREIQMKQIRREIAKLLETGQEATAR  169
            S F  GF +++CKT  K+A+ RIKLLRN+R++ +KQ+RR+IA LL++GQ+ATAR
Sbjct  20   SLFRNGFNSSKCKTAAKMAVARIKLLRNKRQVVVKQMRRDIALLLQSGQDATAR  73



>emb|CDX82713.1| BnaC07g01530D [Brassica napus]
Length=919

 Score = 68.9 bits (167),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 30/56 (54%), Positives = 44/56 (79%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    MDSFFNKGFKAAQCKTLLKLAIPRIKLLRNRREIQMKQIRREIAKLLETGQEATAR  169
            M    ++GFK A+CKT L++A  R+K+L+N++EIQ+KQ+RRE+A+LLE G   TAR
Sbjct  1    MKKVLHRGFKPAKCKTALQMANSRLKILKNKKEIQIKQLRRELAQLLEAGNTPTAR  56



>ref|XP_009804183.1| PREDICTED: IST1 homolog [Nicotiana sylvestris]
Length=320

 Score = 67.0 bits (162),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 30/56 (54%), Positives = 44/56 (79%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    MDSFFNKGFKAAQCKTLLKLAIPRIKLLRNRREIQMKQIRREIAKLLETGQEATAR  169
            ++  FN+G + ++CKT L LAI RIKLL+N+R+ Q+K +R+EIA+ L+ GQEA AR
Sbjct  4    LNQLFNRGLQGSKCKTCLTLAISRIKLLQNKRDAQLKLMRKEIAQFLQAGQEAIAR  59



>gb|KHG01623.1| Uncharacterized protein F383_21801 [Gossypium arboreum]
Length=324

 Score = 67.0 bits (162),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 30/56 (54%), Positives = 43/56 (77%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    MDSFFNKGFKAAQCKTLLKLAIPRIKLLRNRREIQMKQIRREIAKLLETGQEATAR  169
            ++  FN+G   A+CKT L LAI RIKLL+N+R++Q+K +R+EIA+ L+ GQE  AR
Sbjct  4    LNQLFNRGVFGAKCKTCLSLAISRIKLLQNKRDLQLKNMRKEIAQFLQAGQEPIAR  59



>ref|XP_007222948.1| hypothetical protein PRUPE_ppa008869mg [Prunus persica]
 gb|EMJ24147.1| hypothetical protein PRUPE_ppa008869mg [Prunus persica]
Length=316

 Score = 67.0 bits (162),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 29/56 (52%), Positives = 43/56 (77%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    MDSFFNKGFKAAQCKTLLKLAIPRIKLLRNRREIQMKQIRREIAKLLETGQEATAR  169
            ++  FN+G    +CKT L LAI R+KLL+N+R++Q+K +R+EIA+ L+ GQEA AR
Sbjct  4    LNQLFNRGVFGTKCKTCLNLAISRMKLLQNKRDVQLKHMRKEIAQFLQAGQEAIAR  59



>ref|XP_008243237.1| PREDICTED: IST1 homolog [Prunus mume]
Length=316

 Score = 67.0 bits (162),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 29/56 (52%), Positives = 43/56 (77%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    MDSFFNKGFKAAQCKTLLKLAIPRIKLLRNRREIQMKQIRREIAKLLETGQEATAR  169
            ++  FN+G    +CKT L LAI R+KLL+N+R++Q+K +R+EIA+ L+ GQEA AR
Sbjct  4    LNQLFNRGVFGTKCKTCLNLAISRMKLLQNKRDVQLKHMRKEIAQFLQAGQEAIAR  59



>ref|XP_006408888.1| hypothetical protein EUTSA_v10001901mg [Eutrema salsugineum]
 gb|ESQ50341.1| hypothetical protein EUTSA_v10001901mg [Eutrema salsugineum]
Length=938

 Score = 68.6 bits (166),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 30/56 (54%), Positives = 44/56 (79%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    MDSFFNKGFKAAQCKTLLKLAIPRIKLLRNRREIQMKQIRREIAKLLETGQEATAR  169
            M    ++GFK A+CKT L++A  R+K+L+N++EIQ+KQ+RRE+A+LLE G   TAR
Sbjct  1    MKKVLHRGFKPAKCKTALQMANSRLKILKNKKEIQIKQLRRELAQLLEAGNTPTAR  56



>emb|CDX69159.1| BnaC01g02940D [Brassica napus]
Length=440

 Score = 67.8 bits (164),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 31/54 (57%), Positives = 46/54 (85%), Gaps = 0/54 (0%)
 Frame = +2

Query  8    SFFNKGFKAAQCKTLLKLAIPRIKLLRNRREIQMKQIRREIAKLLETGQEATAR  169
            S F +GF +++CKT  K+A+ RIKLLRN+R++ +KQ+RR+IA LL++GQ+ATAR
Sbjct  20   SLFRRGFNSSKCKTAAKMAVARIKLLRNKRQVVVKQMRRDIALLLQSGQDATAR  73



>ref|XP_008339668.1| PREDICTED: IST1 homolog [Malus domestica]
Length=315

 Score = 66.6 bits (161),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 29/56 (52%), Positives = 42/56 (75%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    MDSFFNKGFKAAQCKTLLKLAIPRIKLLRNRREIQMKQIRREIAKLLETGQEATAR  169
            ++  FN+G    +CKT L L I RIKLL+N+R++Q+K +R+EIA+ L+ GQEA AR
Sbjct  4    LNQLFNRGVFGTKCKTCLNLGISRIKLLQNKRDVQLKHMRKEIAQFLQAGQEAIAR  59



>ref|XP_009356835.1| PREDICTED: IST1 homolog [Pyrus x bretschneideri]
Length=315

 Score = 66.6 bits (161),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 29/56 (52%), Positives = 42/56 (75%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    MDSFFNKGFKAAQCKTLLKLAIPRIKLLRNRREIQMKQIRREIAKLLETGQEATAR  169
            ++  FN+G    +CKT L L I RIKLL+N+R++Q+K +R+EIA+ L+ GQEA AR
Sbjct  4    LNQLFNRGVFGTKCKTCLNLGISRIKLLQNKRDVQLKHMRKEIAQFLQAGQEAIAR  59



>emb|CDM83721.1| unnamed protein product [Triticum aestivum]
Length=1113

 Score = 68.6 bits (166),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 29/56 (52%), Positives = 44/56 (79%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    MDSFFNKGFKAAQCKTLLKLAIPRIKLLRNRREIQMKQIRREIAKLLETGQEATAR  169
            +    +KGFK  +CK  LK+A+ RIKLLRN++E+Q++Q+RRE+A+LL+  Q+ TAR
Sbjct  8    LSGVLSKGFKPDKCKIALKMAMARIKLLRNKKEVQVRQMRREVAQLLDGNQDQTAR  63



>ref|XP_010437435.1| PREDICTED: uncharacterized protein LOC104721204 [Camelina sativa]
Length=466

 Score = 67.8 bits (164),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 31/54 (57%), Positives = 46/54 (85%), Gaps = 0/54 (0%)
 Frame = +2

Query  8    SFFNKGFKAAQCKTLLKLAIPRIKLLRNRREIQMKQIRREIAKLLETGQEATAR  169
            S F +GF +++CKT  K+A+ RIKLLRN+R++ +KQ+RR+IA LL++GQ+ATAR
Sbjct  20   SLFRRGFNSSKCKTAAKMAVARIKLLRNKRQVVVKQMRRDIAVLLQSGQDATAR  73



>ref|XP_009624176.1| PREDICTED: IST1 homolog [Nicotiana tomentosiformis]
Length=323

 Score = 66.6 bits (161),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 30/56 (54%), Positives = 44/56 (79%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    MDSFFNKGFKAAQCKTLLKLAIPRIKLLRNRREIQMKQIRREIAKLLETGQEATAR  169
            ++  FN+G + ++CKT L LAI RIKLL+N+R+ Q+K +R+EIA+ L+ GQEA AR
Sbjct  4    LNQLFNRGLQGSKCKTCLTLAISRIKLLQNKRDAQLKLMRKEIAQFLQAGQEAIAR  59



>ref|XP_009102144.1| PREDICTED: uncharacterized protein LOC103828286 [Brassica rapa]
 emb|CDY35879.1| BnaA07g01080D [Brassica napus]
Length=917

 Score = 68.2 bits (165),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 30/56 (54%), Positives = 44/56 (79%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    MDSFFNKGFKAAQCKTLLKLAIPRIKLLRNRREIQMKQIRREIAKLLETGQEATAR  169
            M    ++GFK A+CKT L++A  R+K+L+N++EIQ+KQ+RRE+A+LLE G   TAR
Sbjct  1    MKKVLHRGFKPAKCKTALQMANSRLKILKNKKEIQIKQLRRELAQLLEAGNTPTAR  56



>ref|XP_006283590.1| hypothetical protein CARUB_v10004646mg, partial [Capsella rubella]
 gb|EOA16488.1| hypothetical protein CARUB_v10004646mg, partial [Capsella rubella]
Length=498

 Score = 67.8 bits (164),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 31/54 (57%), Positives = 46/54 (85%), Gaps = 0/54 (0%)
 Frame = +2

Query  8    SFFNKGFKAAQCKTLLKLAIPRIKLLRNRREIQMKQIRREIAKLLETGQEATAR  169
            S F +GF +++CKT  K+A+ RIKLLRN+R++ +KQ+RR+IA LL++GQ+ATAR
Sbjct  51   SLFRRGFNSSKCKTAAKMAVARIKLLRNKRQVVVKQMRRDIAVLLQSGQDATAR  104



>ref|XP_010681608.1| PREDICTED: IST1 homolog isoform X1 [Beta vulgaris subsp. vulgaris]
Length=330

 Score = 66.6 bits (161),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 31/56 (55%), Positives = 42/56 (75%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    MDSFFNKGFKAAQCKTLLKLAIPRIKLLRNRREIQMKQIRREIAKLLETGQEATAR  169
            ++  FN+G    +CKT L LAI RIKLL+NRR+  +KQ+ +EIA+ L+TGQEA AR
Sbjct  4    LNQLFNRGVLGTKCKTCLTLAISRIKLLQNRRDALLKQMHKEIAQFLQTGQEAIAR  59



>ref|XP_010526826.1| PREDICTED: uncharacterized protein LOC104804285 [Tarenaya hassleriana]
Length=473

 Score = 67.4 bits (163),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 31/54 (57%), Positives = 45/54 (83%), Gaps = 0/54 (0%)
 Frame = +2

Query  8    SFFNKGFKAAQCKTLLKLAIPRIKLLRNRREIQMKQIRREIAKLLETGQEATAR  169
            S F +GF  ++CKT  K+A+ RIKLLRN+R++ +KQ+RR+IA LL++GQ+ATAR
Sbjct  20   SLFRRGFNPSKCKTAAKMAMARIKLLRNKRQVVVKQMRRDIAMLLQSGQDATAR  73



>ref|XP_002869065.1| hypothetical protein ARALYDRAFT_491075 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH45324.1| hypothetical protein ARALYDRAFT_491075 [Arabidopsis lyrata subsp. 
lyrata]
Length=465

 Score = 67.4 bits (163),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 31/54 (57%), Positives = 45/54 (83%), Gaps = 0/54 (0%)
 Frame = +2

Query  8    SFFNKGFKAAQCKTLLKLAIPRIKLLRNRREIQMKQIRREIAKLLETGQEATAR  169
            S F +GF +++CKT  K+A+ RIKLLRN+R + +KQ+RR+IA LL++GQ+ATAR
Sbjct  20   SLFRRGFNSSKCKTAAKMAVARIKLLRNKRLVVVKQMRRDIAVLLQSGQDATAR  73



>ref|XP_010935225.1| PREDICTED: IST1-like protein [Elaeis guineensis]
Length=463

 Score = 67.4 bits (163),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 32/54 (59%), Positives = 45/54 (83%), Gaps = 0/54 (0%)
 Frame = +2

Query  8    SFFNKGFKAAQCKTLLKLAIPRIKLLRNRREIQMKQIRREIAKLLETGQEATAR  169
            S F +GF +++CKT  KLA+ RIKLLRN+RE+Q++Q+RR+IA LL++ QE TAR
Sbjct  18   SIFRRGFNSSKCKTEAKLAMARIKLLRNKREVQVRQMRRDIAMLLQSRQEDTAR  71



>gb|KDP29414.1| hypothetical protein JCGZ_18335 [Jatropha curcas]
Length=328

 Score = 66.6 bits (161),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 29/56 (52%), Positives = 43/56 (77%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    MDSFFNKGFKAAQCKTLLKLAIPRIKLLRNRREIQMKQIRREIAKLLETGQEATAR  169
            ++  FN+G   A+CKT L L+I RIKLL+N+R++Q+K +R+EIA+ L+ GQE  AR
Sbjct  4    LNQLFNRGVFGAKCKTCLTLSISRIKLLQNKRDLQLKHMRKEIAQFLQAGQEGIAR  59



>ref|XP_009777469.1| PREDICTED: uncharacterized protein LOC104227040 [Nicotiana sylvestris]
Length=501

 Score = 67.4 bits (163),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 30/54 (56%), Positives = 45/54 (83%), Gaps = 0/54 (0%)
 Frame = +2

Query  8    SFFNKGFKAAQCKTLLKLAIPRIKLLRNRREIQMKQIRREIAKLLETGQEATAR  169
            S F + F +++CKT+ K+A+ RIKLLRN+RE+ ++Q+RR+IA LLE+ Q+ATAR
Sbjct  20   SLFCRTFNSSRCKTMAKMAVARIKLLRNKREVVVRQMRRDIAMLLESRQDATAR  73



>gb|EMT13152.1| hypothetical protein F775_31310 [Aegilops tauschii]
Length=1145

 Score = 68.2 bits (165),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 29/56 (52%), Positives = 44/56 (79%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    MDSFFNKGFKAAQCKTLLKLAIPRIKLLRNRREIQMKQIRREIAKLLETGQEATAR  169
            +    +KGFK  +CK  LK+A+ RIKLLRN++E+Q++Q+RRE+A+LL+  Q+ TAR
Sbjct  8    LSGVLSKGFKPDKCKIALKMAMARIKLLRNKKEVQVRQMRREVAQLLDGNQDQTAR  63



>ref|XP_010446886.1| PREDICTED: uncharacterized protein LOC104729623 [Camelina sativa]
Length=463

 Score = 67.4 bits (163),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 31/54 (57%), Positives = 46/54 (85%), Gaps = 0/54 (0%)
 Frame = +2

Query  8    SFFNKGFKAAQCKTLLKLAIPRIKLLRNRREIQMKQIRREIAKLLETGQEATAR  169
            S F +GF +++CKT  K+A+ RIKLLRN+R++ +KQ+RR+IA LL++GQ+ATAR
Sbjct  20   SLFRRGFNSSKCKTAAKMAVARIKLLRNKRQVVVKQMRRDIAVLLQSGQDATAR  73



>ref|XP_008389286.1| PREDICTED: IST1 homolog [Malus domestica]
Length=315

 Score = 66.2 bits (160),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 29/56 (52%), Positives = 42/56 (75%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    MDSFFNKGFKAAQCKTLLKLAIPRIKLLRNRREIQMKQIRREIAKLLETGQEATAR  169
            ++  FN+G    +CKT L L I RIKLL+N+R++Q+K +R+EIA+ L+ GQEA AR
Sbjct  4    LNQLFNRGVFGTKCKTCLNLGISRIKLLQNKRDVQLKNMRKEIAQFLQAGQEAIAR  59



>ref|XP_002521677.1| protein with unknown function [Ricinus communis]
 gb|EEF40664.1| protein with unknown function [Ricinus communis]
Length=463

 Score = 67.4 bits (163),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 30/54 (56%), Positives = 45/54 (83%), Gaps = 0/54 (0%)
 Frame = +2

Query  8    SFFNKGFKAAQCKTLLKLAIPRIKLLRNRREIQMKQIRREIAKLLETGQEATAR  169
            S F+  F +++CKT  K+A+ RIKLLRN+RE+ ++Q++R+IA LLE+GQ+ATAR
Sbjct  20   SIFSPRFSSSRCKTAAKMAVARIKLLRNKREVVVRQMKRDIALLLESGQDATAR  73



>ref|XP_008360045.1| PREDICTED: IST1 homolog [Malus domestica]
Length=315

 Score = 66.2 bits (160),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 29/56 (52%), Positives = 42/56 (75%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    MDSFFNKGFKAAQCKTLLKLAIPRIKLLRNRREIQMKQIRREIAKLLETGQEATAR  169
            ++  FN+G    +CKT L L I RIKLL+N+R++Q+K +R+EIA+ L+ GQEA AR
Sbjct  4    LNQLFNRGVFGTKCKTCLNLGISRIKLLQNKRDVQLKNMRKEIAQFLQAGQEAIAR  59



>gb|EPS66564.1| hypothetical protein M569_08211 [Genlisea aurea]
Length=430

 Score = 67.0 bits (162),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 31/56 (55%), Positives = 44/56 (79%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    MDSFFNKGFKAAQCKTLLKLAIPRIKLLRNRREIQMKQIRREIAKLLETGQEATAR  169
            ++  FN+G   A+CKT L LAI RIKLL+N+R++ +K +R+EIA+ L+TGQEA AR
Sbjct  25   LNQLFNRGPFGAKCKTCLTLAISRIKLLQNKRDMHLKVMRKEIAEFLQTGQEAIAR  80



>ref|XP_008797910.1| PREDICTED: uncharacterized protein LOC103712964 [Phoenix dactylifera]
Length=1071

 Score = 68.2 bits (165),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 30/50 (60%), Positives = 43/50 (86%), Gaps = 0/50 (0%)
 Frame = +2

Query  20   KGFKAAQCKTLLKLAIPRIKLLRNRREIQMKQIRREIAKLLETGQEATAR  169
            K FKA +CKT LKLA  RIKLL+N+R++ +KQ++R++A+LL++GQE TAR
Sbjct  13   KSFKAGKCKTSLKLAGARIKLLKNKRQVLLKQMKRDLAQLLDSGQEQTAR  62



>ref|XP_010432238.1| PREDICTED: uncharacterized protein LOC104716552 [Camelina sativa]
Length=466

 Score = 67.4 bits (163),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 31/54 (57%), Positives = 46/54 (85%), Gaps = 0/54 (0%)
 Frame = +2

Query  8    SFFNKGFKAAQCKTLLKLAIPRIKLLRNRREIQMKQIRREIAKLLETGQEATAR  169
            S F +GF +++CKT  K+A+ RIKLLRN+R++ +KQ+RR+IA LL++GQ+ATAR
Sbjct  20   SLFRRGFNSSKCKTAAKMAVARIKLLRNKRQVVVKQMRRDIAVLLQSGQDATAR  73



>ref|XP_003569648.1| PREDICTED: uncharacterized protein LOC100838789 [Brachypodium 
distachyon]
Length=1129

 Score = 68.2 bits (165),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 29/56 (52%), Positives = 44/56 (79%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    MDSFFNKGFKAAQCKTLLKLAIPRIKLLRNRREIQMKQIRREIAKLLETGQEATAR  169
            +    +KGFK  +CK  LK+A+ RIKLLRN++E+Q++Q+RRE+A+LL+  Q+ TAR
Sbjct  8    LSGVLHKGFKPDKCKISLKMAMARIKLLRNKKEVQVRQMRREVAQLLDGNQDQTAR  63



>ref|XP_010666831.1| PREDICTED: uncharacterized protein LOC104883949 isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=1075

 Score = 67.8 bits (164),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 29/50 (58%), Positives = 43/50 (86%), Gaps = 0/50 (0%)
 Frame = +2

Query  20   KGFKAAQCKTLLKLAIPRIKLLRNRREIQMKQIRREIAKLLETGQEATAR  169
            + FK A+CKT L LA  RIKL++N+++IQ+KQ++RE+A+LLE+GQ+ TAR
Sbjct  5    RSFKPAKCKTALNLAKSRIKLMKNKKDIQLKQLKREVAQLLESGQDQTAR  54



>gb|KDO59271.1| hypothetical protein CISIN_1g001451mg [Citrus sinensis]
Length=1075

 Score = 67.8 bits (164),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 31/52 (60%), Positives = 43/52 (83%), Gaps = 0/52 (0%)
 Frame = +2

Query  14   FNKGFKAAQCKTLLKLAIPRIKLLRNRREIQMKQIRREIAKLLETGQEATAR  169
             ++ FK A+CKT LKLA  RIKLL+N+R  Q+KQ++RE+A+LLE+GQ+ TAR
Sbjct  2    LHRSFKPAKCKTSLKLASSRIKLLKNKRGAQVKQLKRELAQLLESGQDQTAR  53



>ref|XP_006475395.1| PREDICTED: dentin sialophosphoprotein-like [Citrus sinensis]
Length=1075

 Score = 67.8 bits (164),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 31/52 (60%), Positives = 43/52 (83%), Gaps = 0/52 (0%)
 Frame = +2

Query  14   FNKGFKAAQCKTLLKLAIPRIKLLRNRREIQMKQIRREIAKLLETGQEATAR  169
             ++ FK A+CKT LKLA  RIKLL+N+R  Q+KQ++RE+A+LLE+GQ+ TAR
Sbjct  2    LHRSFKPAKCKTSLKLASSRIKLLKNKRGAQVKQLKRELAQLLESGQDQTAR  53



>ref|XP_009356258.1| PREDICTED: IST1 homolog [Pyrus x bretschneideri]
 ref|XP_009356259.1| PREDICTED: IST1 homolog [Pyrus x bretschneideri]
Length=315

 Score = 66.2 bits (160),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 29/56 (52%), Positives = 42/56 (75%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    MDSFFNKGFKAAQCKTLLKLAIPRIKLLRNRREIQMKQIRREIAKLLETGQEATAR  169
            ++  FN+G    +CKT L L I RIKLL+N+R++Q+K +R+EIA+ L+ GQEA AR
Sbjct  4    LNQLFNRGVFGTKCKTCLNLGISRIKLLQNKRDVQLKNMRKEIAQFLQAGQEAIAR  59



>ref|XP_006451405.1| hypothetical protein CICLE_v10010570mg [Citrus clementina]
 gb|ESR64645.1| hypothetical protein CICLE_v10010570mg [Citrus clementina]
Length=1034

 Score = 67.8 bits (164),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 31/52 (60%), Positives = 43/52 (83%), Gaps = 0/52 (0%)
 Frame = +2

Query  14   FNKGFKAAQCKTLLKLAIPRIKLLRNRREIQMKQIRREIAKLLETGQEATAR  169
             ++ FK A+CKT LKLA  RIKLL+N+R  Q+KQ++RE+A+LLE+GQ+ TAR
Sbjct  2    LHRSFKPAKCKTSLKLASSRIKLLKNKRGAQVKQLKRELAQLLESGQDQTAR  53



>ref|XP_010666830.1| PREDICTED: uncharacterized protein LOC104883949 isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=1076

 Score = 67.8 bits (164),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 29/50 (58%), Positives = 43/50 (86%), Gaps = 0/50 (0%)
 Frame = +2

Query  20   KGFKAAQCKTLLKLAIPRIKLLRNRREIQMKQIRREIAKLLETGQEATAR  169
            + FK A+CKT L LA  RIKL++N+++IQ+KQ++RE+A+LLE+GQ+ TAR
Sbjct  5    RSFKPAKCKTALNLAKSRIKLMKNKKDIQLKQLKREVAQLLESGQDQTAR  54



>ref|XP_009593841.1| PREDICTED: IST1 homolog [Nicotiana tomentosiformis]
Length=491

 Score = 67.0 bits (162),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 30/54 (56%), Positives = 45/54 (83%), Gaps = 0/54 (0%)
 Frame = +2

Query  8    SFFNKGFKAAQCKTLLKLAIPRIKLLRNRREIQMKQIRREIAKLLETGQEATAR  169
            S F + F +++CKT+ K+A+ RIKLLRN+RE+ ++Q+RR+IA LLE+ Q+ATAR
Sbjct  20   SLFCRTFNSSKCKTMAKMAVARIKLLRNKREVVVRQMRRDIAMLLESRQDATAR  73



>ref|XP_010267034.1| PREDICTED: uncharacterized protein LOC104604416 isoform X2 [Nelumbo 
nucifera]
Length=1226

 Score = 67.8 bits (164),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 29/50 (58%), Positives = 44/50 (88%), Gaps = 0/50 (0%)
 Frame = +2

Query  20   KGFKAAQCKTLLKLAIPRIKLLRNRREIQMKQIRREIAKLLETGQEATAR  169
            + FKA++CKT LKLA  R+KLL+N+R+ Q+KQ++RE+A+LLE+GQ+ TA+
Sbjct  4    RSFKASKCKTSLKLAASRLKLLKNKRDAQVKQLKRELAQLLESGQDQTAK  53



>ref|XP_004287747.1| PREDICTED: uncharacterized protein LOC101305976 [Fragaria vesca 
subsp. vesca]
Length=483

 Score = 67.0 bits (162),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 30/54 (56%), Positives = 45/54 (83%), Gaps = 0/54 (0%)
 Frame = +2

Query  8    SFFNKGFKAAQCKTLLKLAIPRIKLLRNRREIQMKQIRREIAKLLETGQEATAR  169
            S F +GF +++CKT  K+A+ RIKLLRN+R++ +KQ+RR+IA LL+ G++ATAR
Sbjct  20   SLFRRGFNSSKCKTAAKMAVARIKLLRNKRQVVVKQMRRDIASLLQKGEDATAR  73



>ref|XP_010267033.1| PREDICTED: uncharacterized protein LOC104604416 isoform X1 [Nelumbo 
nucifera]
Length=1227

 Score = 67.8 bits (164),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 29/50 (58%), Positives = 44/50 (88%), Gaps = 0/50 (0%)
 Frame = +2

Query  20   KGFKAAQCKTLLKLAIPRIKLLRNRREIQMKQIRREIAKLLETGQEATAR  169
            + FKA++CKT LKLA  R+KLL+N+R+ Q+KQ++RE+A+LLE+GQ+ TA+
Sbjct  4    RSFKASKCKTSLKLAASRLKLLKNKRDAQVKQLKRELAQLLESGQDQTAK  53



>ref|XP_002308291.2| hypothetical protein POPTR_0006s15430g [Populus trichocarpa]
 gb|EEE91814.2| hypothetical protein POPTR_0006s15430g [Populus trichocarpa]
Length=1141

 Score = 67.8 bits (164),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 31/52 (60%), Positives = 42/52 (81%), Gaps = 0/52 (0%)
 Frame = +2

Query  14   FNKGFKAAQCKTLLKLAIPRIKLLRNRREIQMKQIRREIAKLLETGQEATAR  169
             ++ FK A+CKT LKLA  RIKLL+N+RE Q+K ++RE+A+LL+ GQE TAR
Sbjct  2    LHRSFKPAKCKTSLKLASSRIKLLKNKREAQVKHLKRELAQLLDAGQERTAR  53



>ref|XP_010551261.1| PREDICTED: IST1 homolog [Tarenaya hassleriana]
Length=315

 Score = 65.9 bits (159),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 29/56 (52%), Positives = 43/56 (77%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    MDSFFNKGFKAAQCKTLLKLAIPRIKLLRNRREIQMKQIRREIAKLLETGQEATAR  169
            ++  FN+G   A+CKT L LAI RIKLL+N+R++Q+K +++EIA+ L+ GQE  AR
Sbjct  4    LNQLFNRGIFGAKCKTCLNLAISRIKLLQNKRDMQLKHMKKEIAQFLQAGQEPIAR  59



>gb|EYU30364.1| hypothetical protein MIMGU_mgv1a006443mg [Erythranthe guttata]
Length=444

 Score = 66.6 bits (161),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 29/54 (54%), Positives = 45/54 (83%), Gaps = 0/54 (0%)
 Frame = +2

Query  8    SFFNKGFKAAQCKTLLKLAIPRIKLLRNRREIQMKQIRREIAKLLETGQEATAR  169
            + F +GF  ++CKT+ K+ + R+KLLRN+R++ +KQ+RR+IA LLE+GQ+ATAR
Sbjct  21   ALFRRGFNPSKCKTMAKMTVARVKLLRNKRDVVIKQMRRDIAMLLESGQDATAR  74



>ref|XP_004135813.1| PREDICTED: uncharacterized protein LOC101217093 [Cucumis sativus]
 ref|XP_004158460.1| PREDICTED: uncharacterized LOC101217093 [Cucumis sativus]
 gb|KGN66208.1| hypothetical protein Csa_1G580230 [Cucumis sativus]
Length=1167

 Score = 67.4 bits (163),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 30/52 (58%), Positives = 43/52 (83%), Gaps = 0/52 (0%)
 Frame = +2

Query  14   FNKGFKAAQCKTLLKLAIPRIKLLRNRREIQMKQIRREIAKLLETGQEATAR  169
             +K FK A+CKT LKLA+ RIKLLRN++++ +KQ++ ++AKLLE GQ+ TAR
Sbjct  2    LSKSFKPAKCKTSLKLAVSRIKLLRNKKDVHIKQLKGDLAKLLEAGQDQTAR  53



>emb|CDP03201.1| unnamed protein product [Coffea canephora]
Length=1217

 Score = 67.4 bits (163),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 29/52 (56%), Positives = 43/52 (83%), Gaps = 0/52 (0%)
 Frame = +2

Query  14   FNKGFKAAQCKTLLKLAIPRIKLLRNRREIQMKQIRREIAKLLETGQEATAR  169
             +K F  A+CKT LKLA  R+KL++N++E+Q+KQ++RE+A LLE+GQ+ TAR
Sbjct  14   LSKSFNPAKCKTALKLAASRMKLMKNKKEVQVKQMKRELAGLLESGQDQTAR  65



>ref|XP_006448467.1| hypothetical protein CICLE_v10015906mg [Citrus clementina]
 gb|ESR61707.1| hypothetical protein CICLE_v10015906mg [Citrus clementina]
Length=328

 Score = 65.5 bits (158),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 30/56 (54%), Positives = 43/56 (77%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    MDSFFNKGFKAAQCKTLLKLAIPRIKLLRNRREIQMKQIRREIAKLLETGQEATAR  169
            ++  FN+G   A+CKT L L I R+KLL+N+RE+Q+KQ+R+EIA+ L+ GQE  AR
Sbjct  4    LNQLFNRGVFGAKCKTSLTLGISRMKLLQNKRELQLKQMRKEIAQFLQAGQEPIAR  59



>gb|KHN35563.1| IST1-like protein [Glycine soja]
Length=436

 Score = 66.2 bits (160),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 30/54 (56%), Positives = 44/54 (81%), Gaps = 0/54 (0%)
 Frame = +2

Query  8    SFFNKGFKAAQCKTLLKLAIPRIKLLRNRREIQMKQIRREIAKLLETGQEATAR  169
            S    GF +++CKT  K+A+ RIKLLRN+RE+ ++Q+RR+IA LL++GQ+ATAR
Sbjct  15   SLLRLGFNSSKCKTAAKMAVARIKLLRNKREVVVRQMRRDIALLLQSGQDATAR  68



>emb|CDY69937.1| BnaAnng32080D, partial [Brassica napus]
Length=415

 Score = 66.2 bits (160),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 31/54 (57%), Positives = 45/54 (83%), Gaps = 0/54 (0%)
 Frame = +2

Query  8    SFFNKGFKAAQCKTLLKLAIPRIKLLRNRREIQMKQIRREIAKLLETGQEATAR  169
            S F  GF +++CKT  K+A+ RIKLLRN+R++ +KQ+RR+IA LL++GQ+ATAR
Sbjct  20   SLFRLGFNSSKCKTAAKMAVARIKLLRNKRQVVVKQMRRDIALLLQSGQDATAR  73



>ref|XP_004134834.1| PREDICTED: uncharacterized protein LOC101215810 [Cucumis sativus]
 ref|XP_004163404.1| PREDICTED: uncharacterized protein LOC101224934 [Cucumis sativus]
 gb|KGN48972.1| hypothetical protein Csa_6G507450 [Cucumis sativus]
Length=423

 Score = 66.2 bits (160),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 30/49 (61%), Positives = 42/49 (86%), Gaps = 0/49 (0%)
 Frame = +2

Query  23   GFKAAQCKTLLKLAIPRIKLLRNRREIQMKQIRREIAKLLETGQEATAR  169
            GF +++CKT  K+A+ RIKLLRN+RE  +KQ+RR+IA LL++GQ+ATAR
Sbjct  25   GFNSSKCKTAAKMAVARIKLLRNKREAVVKQMRRDIALLLQSGQDATAR  73



>ref|NP_195298.2| Regulator of Vps4 activity in the MVB pathway protein [Arabidopsis 
thaliana]
 gb|AEE86554.1| Regulator of Vps4 activity in the MVB pathway protein [Arabidopsis 
thaliana]
Length=466

 Score = 66.2 bits (160),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 30/54 (56%), Positives = 45/54 (83%), Gaps = 0/54 (0%)
 Frame = +2

Query  8    SFFNKGFKAAQCKTLLKLAIPRIKLLRNRREIQMKQIRREIAKLLETGQEATAR  169
            S F +GF +++CKT  K+A+ RIKL+RN+R + +KQ+RR+IA LL++GQ+ATAR
Sbjct  20   SLFRRGFNSSKCKTAAKMAVARIKLIRNKRLVVVKQMRRDIAVLLQSGQDATAR  73



>ref|XP_008440890.1| PREDICTED: IST1-like protein [Cucumis melo]
 ref|XP_008440891.1| PREDICTED: IST1-like protein [Cucumis melo]
 ref|XP_008440892.1| PREDICTED: IST1-like protein [Cucumis melo]
Length=421

 Score = 66.2 bits (160),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 30/49 (61%), Positives = 42/49 (86%), Gaps = 0/49 (0%)
 Frame = +2

Query  23   GFKAAQCKTLLKLAIPRIKLLRNRREIQMKQIRREIAKLLETGQEATAR  169
            GF +++CKT  K+A+ RIKLLRN+RE  +KQ+RR+IA LL++GQ+ATAR
Sbjct  25   GFNSSKCKTAAKMAVARIKLLRNKREAVVKQMRRDIALLLQSGQDATAR  73



>ref|XP_003536682.1| PREDICTED: IST1 homolog isoform X1 [Glycine max]
 gb|KHN05563.1| IST1 like [Glycine soja]
Length=324

 Score = 65.5 bits (158),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 30/56 (54%), Positives = 43/56 (77%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    MDSFFNKGFKAAQCKTLLKLAIPRIKLLRNRREIQMKQIRREIAKLLETGQEATAR  169
            ++  FN+G    +CKT L LAI RIKLL+N+R+IQ+KQ+ +EI++ L+ GQEA AR
Sbjct  4    INQLFNRGVFGTRCKTCLNLAISRIKLLQNKRDIQLKQMCKEISQFLQAGQEAIAR  59



>ref|XP_011010805.1| PREDICTED: uncharacterized protein LOC105115575 [Populus euphratica]
Length=1117

 Score = 67.0 bits (162),  Expect = 6e-11, Method: Composition-based stats.
 Identities = 30/52 (58%), Positives = 42/52 (81%), Gaps = 0/52 (0%)
 Frame = +2

Query  14   FNKGFKAAQCKTLLKLAIPRIKLLRNRREIQMKQIRREIAKLLETGQEATAR  169
             ++ FK A+CKT LKLA  RIKLL+N+RE Q+K ++RE+A+LL+ GQ+ TAR
Sbjct  2    LHRSFKPAKCKTSLKLASSRIKLLKNKREAQVKHLKRELAQLLDAGQDRTAR  53



>ref|XP_006853993.1| hypothetical protein AMTR_s00036p00232910 [Amborella trichopoda]
 gb|ERN15460.1| hypothetical protein AMTR_s00036p00232910 [Amborella trichopoda]
Length=1130

 Score = 67.0 bits (162),  Expect = 6e-11, Method: Composition-based stats.
 Identities = 29/52 (56%), Positives = 41/52 (79%), Gaps = 0/52 (0%)
 Frame = +2

Query  14   FNKGFKAAQCKTLLKLAIPRIKLLRNRREIQMKQIRREIAKLLETGQEATAR  169
              K FK  +CKT LKLAI RIKL++N++ +Q+KQ++RE+A+LL+ GQE  AR
Sbjct  2    LKKSFKPGKCKTSLKLAIARIKLMKNKKGVQLKQMKRELAQLLQAGQEQNAR  53



>ref|XP_008352419.1| PREDICTED: uncharacterized protein LOC103415915 [Malus domestica]
Length=494

 Score = 66.2 bits (160),  Expect = 6e-11, Method: Composition-based stats.
 Identities = 30/54 (56%), Positives = 44/54 (81%), Gaps = 0/54 (0%)
 Frame = +2

Query  8    SFFNKGFKAAQCKTLLKLAIPRIKLLRNRREIQMKQIRREIAKLLETGQEATAR  169
            S F  GF +++CK   K+A+ RIKLLRN+R++ +KQ+RR+IA LL++GQ+ATAR
Sbjct  20   SLFRWGFNSSKCKMQAKMAVARIKLLRNKRQVVVKQMRRDIALLLQSGQDATAR  73



>ref|XP_008337952.1| PREDICTED: uncharacterized protein LOC103401027 [Malus domestica]
Length=494

 Score = 65.9 bits (159),  Expect = 7e-11, Method: Composition-based stats.
 Identities = 30/54 (56%), Positives = 44/54 (81%), Gaps = 0/54 (0%)
 Frame = +2

Query  8    SFFNKGFKAAQCKTLLKLAIPRIKLLRNRREIQMKQIRREIAKLLETGQEATAR  169
            S F  GF +++CK   K+A+ RIKLLRN+R++ +KQ+RR+IA LL++GQ+ATAR
Sbjct  20   SLFRWGFNSSKCKMQAKMAVARIKLLRNKRQVVVKQMRRDIALLLQSGQDATAR  73



>ref|XP_009337093.1| PREDICTED: uncharacterized protein LOC103929596 [Pyrus x bretschneideri]
Length=493

 Score = 65.9 bits (159),  Expect = 7e-11, Method: Composition-based stats.
 Identities = 30/54 (56%), Positives = 44/54 (81%), Gaps = 0/54 (0%)
 Frame = +2

Query  8    SFFNKGFKAAQCKTLLKLAIPRIKLLRNRREIQMKQIRREIAKLLETGQEATAR  169
            S F  GF +++CK   K+A+ RIKLLRN+R++ +KQ+RR+IA LL++GQ+ATAR
Sbjct  20   SLFRWGFNSSKCKMQAKMAVARIKLLRNKRQVVVKQMRRDIALLLQSGQDATAR  73



>ref|XP_010066717.1| PREDICTED: IST1 homolog [Eucalyptus grandis]
 gb|KCW64728.1| hypothetical protein EUGRSUZ_G02315 [Eucalyptus grandis]
Length=322

 Score = 65.1 bits (157),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 30/56 (54%), Positives = 43/56 (77%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    MDSFFNKGFKAAQCKTLLKLAIPRIKLLRNRREIQMKQIRREIAKLLETGQEATAR  169
            ++  FN+G   A+CKT L LAI RIKLL+N+R++Q+K +R+EIA+ L+ GQE  AR
Sbjct  4    LNQLFNRGVFGAKCKTSLTLAISRIKLLQNKRDLQLKLMRKEIAQFLQAGQEPIAR  59



>ref|XP_010029609.1| PREDICTED: IST1-like protein [Eucalyptus grandis]
Length=466

 Score = 65.9 bits (159),  Expect = 8e-11, Method: Composition-based stats.
 Identities = 30/54 (56%), Positives = 44/54 (81%), Gaps = 0/54 (0%)
 Frame = +2

Query  8    SFFNKGFKAAQCKTLLKLAIPRIKLLRNRREIQMKQIRREIAKLLETGQEATAR  169
            S F  GFK+++CKT  K+ + RIKLLRN+R+  ++Q+RR+IA LL++GQ+ATAR
Sbjct  20   SLFGGGFKSSKCKTAAKMTVARIKLLRNKRQAVVRQMRRDIALLLQSGQDATAR  73



>ref|XP_003547905.1| PREDICTED: IST1-like protein-like [Glycine max]
Length=441

 Score = 65.5 bits (158),  Expect = 8e-11, Method: Composition-based stats.
 Identities = 30/54 (56%), Positives = 44/54 (81%), Gaps = 0/54 (0%)
 Frame = +2

Query  8    SFFNKGFKAAQCKTLLKLAIPRIKLLRNRREIQMKQIRREIAKLLETGQEATAR  169
            S    GF +++CKT  K+A+ RIKLLRN+RE+ ++Q+RR+IA LL++GQ+ATAR
Sbjct  20   SLLRLGFNSSKCKTAAKMAVARIKLLRNKREVVVRQMRRDIALLLQSGQDATAR  73



>ref|XP_008393582.1| PREDICTED: uncharacterized protein DDB_G0271670 [Malus domestica]
Length=494

 Score = 65.9 bits (159),  Expect = 8e-11, Method: Composition-based stats.
 Identities = 30/54 (56%), Positives = 44/54 (81%), Gaps = 0/54 (0%)
 Frame = +2

Query  8    SFFNKGFKAAQCKTLLKLAIPRIKLLRNRREIQMKQIRREIAKLLETGQEATAR  169
            S F  GF +++CK   K+A+ RIKLLRN+R++ +KQ+RR+IA LL++GQ+ATAR
Sbjct  20   SLFRWGFNSSKCKMQAKMAVARIKLLRNKRQVVVKQMRRDIALLLQSGQDATAR  73



>ref|XP_011007786.1| PREDICTED: uncharacterized protein LOC105113336 isoform X2 [Populus 
euphratica]
Length=466

 Score = 65.5 bits (158),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 31/54 (57%), Positives = 43/54 (80%), Gaps = 0/54 (0%)
 Frame = +2

Query  8    SFFNKGFKAAQCKTLLKLAIPRIKLLRNRREIQMKQIRREIAKLLETGQEATAR  169
            S F   F +++CKT  K+A+ RIKLLRN+RE  M+Q+RR+IA LL++GQ+ATAR
Sbjct  20   SIFCPRFNSSKCKTAAKMAVARIKLLRNKREAVMRQMRRDIAVLLQSGQDATAR  73



>ref|XP_004497085.1| PREDICTED: IST1 homolog isoform X1 [Cicer arietinum]
Length=330

 Score = 64.7 bits (156),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 28/56 (50%), Positives = 44/56 (79%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    MDSFFNKGFKAAQCKTLLKLAIPRIKLLRNRREIQMKQIRREIAKLLETGQEATAR  169
            ++  FN+G  + +CKT L LAI R+KLL+N+R++Q+KQ+R+EI++ L+ GQE  AR
Sbjct  4    LNQLFNRGVFSTRCKTCLNLAISRMKLLQNKRDVQLKQMRKEISQFLQAGQEPIAR  59



>ref|XP_003519849.1| PREDICTED: IST1-like protein-like [Glycine max]
 gb|KHN00433.1| IST1-like protein [Glycine soja]
Length=438

 Score = 65.1 bits (157),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 30/54 (56%), Positives = 44/54 (81%), Gaps = 0/54 (0%)
 Frame = +2

Query  8    SFFNKGFKAAQCKTLLKLAIPRIKLLRNRREIQMKQIRREIAKLLETGQEATAR  169
            S    GF +++CKT  K+A+ RIKLLRN+RE+ ++Q+RR+IA LL++GQ+ATAR
Sbjct  15   SLLRLGFNSSKCKTAAKMAVARIKLLRNKREVVVRQMRRDIALLLQSGQDATAR  68



>ref|XP_004497086.1| PREDICTED: IST1 homolog isoform X2 [Cicer arietinum]
Length=326

 Score = 64.7 bits (156),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 28/56 (50%), Positives = 44/56 (79%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    MDSFFNKGFKAAQCKTLLKLAIPRIKLLRNRREIQMKQIRREIAKLLETGQEATAR  169
            ++  FN+G  + +CKT L LAI R+KLL+N+R++Q+KQ+R+EI++ L+ GQE  AR
Sbjct  4    LNQLFNRGVFSTRCKTCLNLAISRMKLLQNKRDVQLKQMRKEISQFLQAGQEPIAR  59



>ref|XP_003592663.1| IST1-like protein, partial [Medicago truncatula]
Length=245

 Score = 63.5 bits (153),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 27/56 (48%), Positives = 44/56 (79%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    MDSFFNKGFKAAQCKTLLKLAIPRIKLLRNRREIQMKQIRREIAKLLETGQEATAR  169
            ++  F++G  + +CKT L LAI R+KLL+N+R++Q+KQ+R+EI++ L+ GQE  AR
Sbjct  4    LNQLFSRGVFSTRCKTCLNLAISRMKLLQNKRDVQLKQMRKEISQFLQAGQEPIAR  59



>ref|XP_009614745.1| PREDICTED: dentin sialophosphoprotein [Nicotiana tomentosiformis]
Length=1156

 Score = 66.2 bits (160),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 28/52 (54%), Positives = 43/52 (83%), Gaps = 0/52 (0%)
 Frame = +2

Query  14   FNKGFKAAQCKTLLKLAIPRIKLLRNRREIQMKQIRREIAKLLETGQEATAR  169
              K F +A+CKT LKLA  R+KLL+N++E+ +KQ++RE+A+LL++GQ+ TAR
Sbjct  14   LTKSFNSAKCKTSLKLASSRLKLLKNKKEVAVKQMKREVAQLLDSGQDRTAR  65



>ref|XP_004232542.1| PREDICTED: uncharacterized protein LOC101250180 [Solanum lycopersicum]
Length=489

 Score = 65.5 bits (158),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 29/54 (54%), Positives = 44/54 (81%), Gaps = 0/54 (0%)
 Frame = +2

Query  8    SFFNKGFKAAQCKTLLKLAIPRIKLLRNRREIQMKQIRREIAKLLETGQEATAR  169
            S F + F +++CKT+ K+ + RIKLLRN+RE+ ++Q+RR+IA LLE+ Q+ATAR
Sbjct  20   SLFCRTFNSSKCKTMAKMTVARIKLLRNKREVVVRQMRRDIAMLLESHQDATAR  73



>ref|XP_006468704.1| PREDICTED: IST1 homolog [Citrus sinensis]
Length=328

 Score = 64.3 bits (155),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 29/56 (52%), Positives = 43/56 (77%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    MDSFFNKGFKAAQCKTLLKLAIPRIKLLRNRREIQMKQIRREIAKLLETGQEATAR  169
            ++  FN+G   A+CKT L L I R+KLL+N+RE+Q++Q+R+EIA+ L+ GQE  AR
Sbjct  4    LNQLFNRGVFGAKCKTSLTLGISRMKLLQNKRELQLQQMRKEIAQFLQAGQEPIAR  59



>gb|KDP33748.1| hypothetical protein JCGZ_07319 [Jatropha curcas]
Length=1138

 Score = 65.9 bits (159),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 28/52 (54%), Positives = 43/52 (83%), Gaps = 0/52 (0%)
 Frame = +2

Query  14   FNKGFKAAQCKTLLKLAIPRIKLLRNRREIQMKQIRREIAKLLETGQEATAR  169
             ++ FK  +CKT LKLA+ RIKLL+N+R+ Q+K ++RE+A+LL++GQ+ TAR
Sbjct  2    LHRSFKPGKCKTALKLAVSRIKLLKNKRDSQVKHLKRELAQLLDSGQDQTAR  53



>ref|XP_009783674.1| PREDICTED: dentin sialophosphoprotein [Nicotiana sylvestris]
Length=1142

 Score = 65.9 bits (159),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 28/52 (54%), Positives = 43/52 (83%), Gaps = 0/52 (0%)
 Frame = +2

Query  14   FNKGFKAAQCKTLLKLAIPRIKLLRNRREIQMKQIRREIAKLLETGQEATAR  169
              K F +A+CKT LKLA  R+KLL+N++E+ +KQ++RE+A+LL++GQ+ TAR
Sbjct  14   LTKSFNSAKCKTSLKLASSRLKLLKNKKEVAVKQMKREVAQLLDSGQDRTAR  65



>ref|XP_010460384.1| PREDICTED: IST1 homolog [Camelina sativa]
Length=320

 Score = 64.3 bits (155),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 28/56 (50%), Positives = 43/56 (77%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    MDSFFNKGFKAAQCKTLLKLAIPRIKLLRNRREIQMKQIRREIAKLLETGQEATAR  169
            ++  FN+G   A+CKT L LAI R+KLL+N+R++Q+K +++EIA+ L+ GQE  AR
Sbjct  4    LNQLFNRGIFGAKCKTSLNLAIARMKLLQNKRDMQLKHMKKEIAQFLQAGQEPIAR  59



>ref|XP_003555907.1| PREDICTED: IST1 homolog [Glycine max]
 gb|KHN11413.1| IST1 like [Glycine soja]
Length=324

 Score = 64.3 bits (155),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 29/56 (52%), Positives = 43/56 (77%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    MDSFFNKGFKAAQCKTLLKLAIPRIKLLRNRREIQMKQIRREIAKLLETGQEATAR  169
            ++  FN+G    +CKT L LAI RIKLL+N+R++Q+KQ+ +EI++ L+ GQEA AR
Sbjct  4    LNQLFNRGVFGTRCKTCLNLAISRIKLLQNKRDMQLKQMCKEISQFLQAGQEAIAR  59



>ref|XP_010499113.1| PREDICTED: IST1 homolog [Camelina sativa]
Length=320

 Score = 64.3 bits (155),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 28/56 (50%), Positives = 43/56 (77%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    MDSFFNKGFKAAQCKTLLKLAIPRIKLLRNRREIQMKQIRREIAKLLETGQEATAR  169
            ++  FN+G   A+CKT L LAI R+KLL+N+R++Q+K +++EIA+ L+ GQE  AR
Sbjct  4    LNQLFNRGIFGAKCKTSLNLAIARMKLLQNKRDMQLKHMKKEIAQFLQAGQEPIAR  59



>ref|XP_009401974.1| PREDICTED: uncharacterized protein LOC103985842 [Musa acuminata 
subsp. malaccensis]
Length=1122

 Score = 65.9 bits (159),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 29/50 (58%), Positives = 42/50 (84%), Gaps = 0/50 (0%)
 Frame = +2

Query  20   KGFKAAQCKTLLKLAIPRIKLLRNRREIQMKQIRREIAKLLETGQEATAR  169
            + FK  +CKT LKLA+ R+KLL+N+RE  ++Q+RR++A+LLE+GQE TAR
Sbjct  13   RSFKPVKCKTSLKLAVSRMKLLKNKREASVRQMRRDLAQLLESGQEQTAR  62



>gb|KDO76986.1| hypothetical protein CISIN_1g020278mg [Citrus sinensis]
Length=328

 Score = 64.3 bits (155),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 29/56 (52%), Positives = 43/56 (77%), Gaps = 0/56 (0%)
 Frame = +2

Query  2    MDSFFNKGFKAAQCKTLLKLAIPRIKLLRNRREIQMKQIRREIAKLLETGQEATAR  169
            ++  FN+G   A+CKT L L I R+KLL+N+RE+Q++Q+R+EIA+ L+ GQE  AR
Sbjct  4    LNQLFNRGVFGAKCKTSLTLGISRMKLLQNKRELQLQQMRKEIAQFLQAGQEPIAR  59



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 527645914101