BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c5447_g2_i1 len=1422 path=[337:0-1421]

Length=1422
                                                                      Score     E

emb|CDP18856.1|  unnamed protein product                                450   9e-153   
ref|XP_009802575.1|  PREDICTED: peroxidase 46-like                      445   7e-151   
ref|XP_006342451.1|  PREDICTED: peroxidase 46-like                      446   7e-151   
ref|XP_009622668.1|  PREDICTED: peroxidase 46                           440   8e-149   
ref|XP_004253052.1|  PREDICTED: peroxidase 46-like isoform X1           439   2e-148   
ref|XP_007011667.1|  Peroxidase superfamily protein                     434   2e-146   
ref|XP_010049850.1|  PREDICTED: peroxidase 46-like                      428   3e-144   
ref|XP_008377474.1|  PREDICTED: peroxidase 18                           427   6e-144   
ref|XP_010246573.1|  PREDICTED: peroxidase 46-like                      427   7e-144   
ref|XP_002285587.1|  PREDICTED: peroxidase 46                           427   7e-144   Vitis vinifera
ref|XP_011028045.1|  PREDICTED: peroxidase 46-like isoform X2           427   1e-143   
ref|XP_009359075.1|  PREDICTED: peroxidase 18-like                      427   1e-143   
ref|XP_002324930.1|  hypothetical protein POPTR_0018s02910g             427   2e-143   Populus trichocarpa [western balsam poplar]
ref|XP_011082007.1|  PREDICTED: peroxidase 46                           427   2e-143   
ref|XP_010268457.1|  PREDICTED: peroxidase 46-like isoform X3           425   2e-143   
ref|XP_010268455.1|  PREDICTED: peroxidase 46-like isoform X1           425   8e-143   
ref|XP_006450240.1|  hypothetical protein CICLE_v10008792mg             424   2e-142   
gb|KDO67380.1|  hypothetical protein CISIN_1g019972mg                   423   4e-142   
gb|EYU22025.1|  hypothetical protein MIMGU_mgv1a021862mg                422   4e-142   
ref|XP_004145577.1|  PREDICTED: peroxidase 46-like                      422   4e-142   
ref|XP_008452817.1|  PREDICTED: peroxidase 18                           422   7e-142   
ref|XP_011028044.1|  PREDICTED: peroxidase 46-like isoform X1           421   3e-141   
ref|XP_010108290.1|  Peroxidase 46                                      420   5e-141   
ref|XP_008220634.1|  PREDICTED: peroxidase 18-like                      419   7e-141   
ref|XP_011031408.1|  PREDICTED: peroxidase 46-like                      417   9e-140   
ref|XP_002309694.2|  hypothetical protein POPTR_0006s28320g             416   2e-139   Populus trichocarpa [western balsam poplar]
ref|XP_006581324.1|  PREDICTED: peroxidase 18-like                      415   5e-139   
gb|KHN07009.1|  Peroxidase 18                                           414   6e-139   
gb|AHL39146.1|  class III peroxidase                                    415   6e-139   
gb|ACJ11760.1|  class III peroxidase                                    415   7e-139   Gossypium hirsutum [American cotton]
ref|XP_010314794.1|  PREDICTED: peroxidase 18-like isoform X2           413   7e-139   
ref|XP_003550235.1|  PREDICTED: peroxidase 46-like                      412   5e-138   
gb|KHN37103.1|  Peroxidase 46                                           412   5e-138   
ref|XP_010914047.1|  PREDICTED: peroxidase 18                           411   1e-137   
ref|XP_004293249.1|  PREDICTED: lariat debranching enzyme-like          424   3e-137   
ref|XP_006483726.1|  PREDICTED: lariat debranching enzyme-like          423   8e-137   
ref|XP_010268456.1|  PREDICTED: peroxidase 46-like isoform X2           408   3e-136   
gb|KCW82645.1|  hypothetical protein EUGRSUZ_C04029                     404   2e-135   
ref|XP_011036744.1|  PREDICTED: lariat debranching enzyme               420   3e-135   
ref|XP_002515390.1|  RNA lariat debranching enzyme, putative            418   2e-134   Ricinus communis
ref|XP_003544569.1|  PREDICTED: peroxidase 46-like                      401   1e-133   
ref|XP_008790102.1|  PREDICTED: peroxidase 18                           401   1e-133   
gb|KHN35567.1|  Peroxidase 46                                           401   1e-133   
gb|KHG25030.1|  Peroxidase 18 -like protein                             395   8e-131   
ref|XP_007161106.1|  hypothetical protein PHAVU_001G043100g             392   5e-130   
ref|XP_002867280.1|  hypothetical protein ARALYDRAFT_328551             388   1e-128   
ref|XP_010437998.1|  PREDICTED: peroxidase 46                           387   2e-128   
ref|XP_010525889.1|  PREDICTED: peroxidase 46                           388   3e-128   
ref|XP_009390539.1|  PREDICTED: peroxidase 18-like                      386   1e-127   
sp|O81772.1|PER46_ARATH  RecName: Full=Peroxidase 46; Short=Atper...    385   3e-127   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006412557.1|  hypothetical protein EUTSA_v10025685mg             384   7e-127   
ref|XP_009395226.1|  PREDICTED: peroxidase 18                           384   1e-126   
ref|XP_007224694.1|  hypothetical protein PRUPE_ppa025451mg             382   2e-126   
gb|KFK29773.1|  hypothetical protein AALP_AA7G177300                    383   2e-126   
ref|NP_180053.1|  peroxidase                                            381   1e-125   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010429474.1|  PREDICTED: peroxidase 18-like isoform X1           381   1e-125   
ref|XP_010472498.1|  PREDICTED: peroxidase 18                           379   4e-125   
ref|XP_006405046.1|  hypothetical protein EUTSA_v10000495mg             378   1e-124   
emb|CDY34754.1|  BnaA09g41210D                                          379   1e-124   
ref|XP_002880630.1|  hypothetical protein ARALYDRAFT_481340             378   1e-124   
ref|XP_010417238.1|  PREDICTED: peroxidase 18-like                      377   3e-124   
gb|AES73524.2|  peroxidase family protein                               377   5e-124   
ref|XP_009117098.1|  PREDICTED: peroxidase 18                           376   8e-124   
gb|KFK32609.1|  hypothetical protein AALP_AA6G266300                    375   8e-124   
ref|XP_006296309.1|  hypothetical protein CARUB_v10025481mg             376   1e-123   
emb|CDX76791.1|  BnaC08g33770D                                          375   2e-123   
emb|CDY71322.1|  BnaC08g49050D                                          375   4e-123   
ref|XP_007136928.1|  hypothetical protein PHAVU_009G085800g             372   3e-122   
ref|XP_004501789.1|  PREDICTED: lariat debranching enzyme-like          384   2e-121   
ref|NP_194904.2|  peroxidase 46                                         369   2e-120   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010451098.1|  PREDICTED: lariat debranching enzyme-like          382   2e-120   
ref|XP_010692957.1|  PREDICTED: peroxidase 46                           366   6e-120   
emb|CAA71496.1|  peroxidase                                             365   6e-120   Spinacia oleracea
gb|AGT16273.1|  peroxidase                                              350   2e-111   
ref|XP_008661583.1|  PREDICTED: uncharacterized protein LOC100273...    349   3e-111   
ref|XP_004976108.1|  PREDICTED: peroxidase 28-like isoform X2           344   1e-110   
ref|XP_003580073.1|  PREDICTED: peroxidase 46-like                      343   1e-108   
dbj|BAJ87785.1|  predicted protein                                      341   7e-108   
ref|XP_006845450.1|  hypothetical protein AMTR_s00019p00117340          333   2e-107   
ref|XP_006652476.1|  PREDICTED: peroxidase 18-like                      339   4e-107   
ref|XP_002448121.1|  hypothetical protein SORBIDRAFT_06g021550          337   3e-106   Sorghum bicolor [broomcorn]
ref|NP_001053214.1|  Os04g0498700                                       337   4e-106   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007161105.1|  hypothetical protein PHAVU_001G043100g             325   4e-105   
emb|CBI21172.3|  unnamed protein product                                313   1e-100   
ref|XP_003603273.1|  Peroxidase                                         311   4e-99    
ref|XP_002977027.1|  hypothetical protein SELMODRAFT_106106             304   1e-95    
ref|XP_002980766.1|  hypothetical protein SELMODRAFT_178409             302   3e-95    
gb|KEH35896.1|  peroxidase family protein                               296   8e-94    
gb|EMT10640.1|  Peroxidase 18                                           281   2e-86    
gb|EMS45152.1|  Peroxidase 18                                           271   2e-83    
gb|EAY94719.1|  hypothetical protein OsI_16496                          269   1e-82    Oryza sativa Indica Group [Indian rice]
ref|XP_006285183.1|  hypothetical protein CARUB_v10006533mg             247   1e-75    
gb|EPS69576.1|  hypothetical protein M569_05190                         238   2e-72    
ref|XP_002991057.1|  hypothetical protein SELMODRAFT_132865             241   1e-71    
ref|NP_200002.3|  peroxidase 66                                         239   7e-71    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002991681.1|  hypothetical protein SELMODRAFT_186230             239   7e-71    
ref|XP_006280819.1|  hypothetical protein CARUB_v10026787mg             239   1e-70    
ref|XP_009387950.1|  PREDICTED: peroxidase 51-like isoform X1           239   1e-70    
ref|XP_002865880.1|  peroxidase                                         238   2e-70    
ref|XP_010680021.1|  PREDICTED: peroxidase 16-like                      238   4e-70    
gb|EMT10332.1|  Peroxidase 5                                            237   6e-70    
gb|EMS51265.1|  Peroxidase 5                                            236   1e-69    
gb|KFK26799.1|  hypothetical protein AALP_AA8G295000                    236   1e-69    
gb|EEC71855.1|  hypothetical protein OsI_04549                          247   2e-69    Oryza sativa Indica Group [Indian rice]
ref|XP_006846424.1|  hypothetical protein AMTR_s00018p00028320          236   2e-69    
ref|XP_010442699.1|  PREDICTED: peroxidase 66                           235   2e-69    
dbj|BAJ33867.1|  unnamed protein product                                235   2e-69    
ref|XP_007136358.1|  hypothetical protein PHAVU_009G038500g             235   2e-69    
emb|CAE01626.3|  OSJNBa0029H02.5                                        241   3e-69    Oryza sativa [red rice]
ref|XP_009623550.1|  PREDICTED: peroxidase 66                           235   4e-69    
ref|XP_006401899.1|  hypothetical protein EUTSA_v10014117mg             234   4e-69    
ref|NP_001241968.1|  uncharacterized protein LOC100779031 precursor     235   4e-69    
gb|KHN19575.1|  Peroxidase 5                                            234   6e-69    
ref|XP_010482534.1|  PREDICTED: peroxidase 66-like                      234   6e-69    
ref|XP_002873650.1|  predicted protein                                  234   7e-69    
ref|XP_006470079.1|  PREDICTED: peroxidase 55-like                      234   7e-69    
ref|XP_006447048.1|  hypothetical protein CICLE_v10016043mg             233   9e-69    
ref|XP_010250695.1|  PREDICTED: peroxidase 51                           234   1e-68    
ref|XP_009768520.1|  PREDICTED: peroxidase 66                           233   1e-68    
emb|CDX91610.1|  BnaC02g15500D                                          233   2e-68    
gb|KHN31550.1|  Peroxidase 66                                           233   2e-68    
ref|XP_009387951.1|  PREDICTED: peroxidase 51-like isoform X2           232   3e-68    
ref|XP_009402171.1|  PREDICTED: peroxidase 51-like                      232   3e-68    
ref|XP_010444055.1|  PREDICTED: peroxidase 66-like                      232   5e-68    
gb|EPS60748.1|  hypothetical protein M569_14053                         231   6e-68    
ref|XP_010249037.1|  PREDICTED: peroxidase 55-like                      232   6e-68    
gb|KDO63914.1|  hypothetical protein CISIN_1g020449mg                   232   6e-68    
gb|KFK42864.1|  hypothetical protein AALP_AA1G049000                    231   8e-68    
ref|XP_004502775.1|  PREDICTED: peroxidase 5-like                       231   8e-68    
ref|XP_004976107.1|  PREDICTED: peroxidase 28-like isoform X1           234   8e-68    
ref|XP_002274131.2|  PREDICTED: peroxidase 55-like                      232   8e-68    Vitis vinifera
ref|XP_008231106.1|  PREDICTED: peroxidase 55                           231   9e-68    
ref|XP_010250084.1|  PREDICTED: peroxidase 3-like                       231   1e-67    
ref|XP_007152357.1|  hypothetical protein PHAVU_004G123100g             231   1e-67    
ref|XP_010921348.1|  PREDICTED: peroxidase 5-like                       230   2e-67    
ref|XP_003568989.1|  PREDICTED: peroxidase 5-like                       231   2e-67    
ref|XP_010270944.1|  PREDICTED: peroxidase 5-like                       231   2e-67    
ref|XP_010938174.1|  PREDICTED: peroxidase 5-like                       231   2e-67    
ref|XP_009127271.1|  PREDICTED: peroxidase 66                           230   2e-67    
ref|XP_003602405.1|  Peroxidase                                         230   2e-67    
ref|XP_006654965.1|  PREDICTED: peroxidase 5-like                       230   3e-67    
gb|AFK41025.1|  unknown                                                 230   3e-67    
ref|XP_009118603.1|  PREDICTED: LOW QUALITY PROTEIN: peroxidase 3...    230   3e-67    
ref|XP_010555640.1|  PREDICTED: peroxidase 66                           230   3e-67    
ref|XP_002268509.1|  PREDICTED: peroxidase 66                           230   3e-67    Vitis vinifera
gb|AAM52317.1|AC105363_6  Putative peroxidase                           229   3e-67    Oryza sativa Japonica Group [Japonica rice]
gb|EEC74412.1|  hypothetical protein OsI_09774                          229   3e-67    Oryza sativa Indica Group [Indian rice]
ref|XP_004304932.1|  PREDICTED: peroxidase 5-like                       230   3e-67    
ref|XP_002889542.1|  CBRCI35                                            230   3e-67    
ref|XP_006650985.1|  PREDICTED: peroxidase 5-like                       230   3e-67    
gb|KFK31897.1|  hypothetical protein AALP_AA6G173300                    230   3e-67    
ref|XP_010927767.1|  PREDICTED: peroxidase 55-like                      229   4e-67    
gb|AAM61240.1|  putative peroxidase                                     229   4e-67    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006654966.1|  PREDICTED: peroxidase 5-like                       229   4e-67    
ref|NP_172018.1|  peroxidase 3                                          229   4e-67    Arabidopsis thaliana [mouse-ear cress]
ref|NP_196917.1|  peroxidase 55                                         229   5e-67    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002450360.1|  hypothetical protein SORBIDRAFT_05g004180          230   5e-67    Sorghum bicolor [broomcorn]
ref|XP_006418047.1|  hypothetical protein EUTSA_v10008189mg             229   5e-67    
ref|XP_004984274.1|  PREDICTED: peroxidase 2-like                       229   6e-67    
ref|NP_001048793.1|  Os03g0121200                                       229   6e-67    Oryza sativa Japonica Group [Japonica rice]
ref|XP_010061689.1|  PREDICTED: peroxidase 66-like                      229   7e-67    
emb|CDY10037.1|  BnaC08g44140D                                          229   7e-67    
ref|XP_002440543.1|  hypothetical protein SORBIDRAFT_09g002810          229   7e-67    Sorghum bicolor [broomcorn]
ref|XP_008234311.1|  PREDICTED: peroxidase 66                           228   9e-67    
ref|XP_010911662.1|  PREDICTED: peroxidase 5-like                       228   1e-66    
ref|XP_010693447.1|  PREDICTED: peroxidase 66-like                      228   1e-66    
ref|NP_001136740.1|  uncharacterized protein LOC100216881 precursor     229   1e-66    Zea mays [maize]
gb|ABK21900.1|  unknown                                                 228   1e-66    Picea sitchensis
ref|XP_008781197.1|  PREDICTED: peroxidase 5-like                       228   2e-66    
ref|XP_010069738.1|  PREDICTED: peroxidase 5-like                       228   2e-66    
ref|XP_007219444.1|  hypothetical protein PRUPE_ppa020970mg             227   2e-66    
ref|XP_007153059.1|  hypothetical protein PHAVU_003G003100g             228   2e-66    
emb|CDY46845.1|  BnaA10g03290D                                          228   2e-66    
ref|XP_009408351.1|  PREDICTED: peroxidase 55-like                      228   2e-66    
ref|XP_010921347.1|  PREDICTED: peroxidase 5-like                       228   2e-66    
ref|XP_007216155.1|  hypothetical protein PRUPE_ppa015245mg             227   3e-66    
ref|XP_009107004.1|  PREDICTED: peroxidase 66                           227   3e-66    
gb|ACN60162.1|  peroxidase                                              227   3e-66    Tamarix hispida
ref|XP_009119172.1|  PREDICTED: peroxidase 3-like                       227   3e-66    
ref|XP_002872571.1|  peroxidase ATP19a                                  227   3e-66    
ref|XP_011097275.1|  PREDICTED: peroxidase 51                           227   3e-66    
emb|CDY13252.1|  BnaC09g24040D                                          227   3e-66    
ref|XP_008808296.1|  PREDICTED: peroxidase 5-like                       227   4e-66    
ref|XP_010272777.1|  PREDICTED: peroxidase 3-like                       227   4e-66    
ref|XP_009108181.1|  PREDICTED: peroxidase 39                           227   4e-66    
ref|XP_006396925.1|  hypothetical protein EUTSA_v10028797mg             227   4e-66    
ref|XP_002515749.1|  Peroxidase 3 precursor, putative                   227   4e-66    Ricinus communis
ref|XP_004965313.1|  PREDICTED: peroxidase 1-like                       227   5e-66    
ref|XP_004953531.1|  PREDICTED: peroxidase 5-like                       227   5e-66    
ref|XP_008246297.1|  PREDICTED: peroxidase 5-like                       227   5e-66    
ref|XP_010693446.1|  PREDICTED: peroxidase 66-like                      226   6e-66    
ref|XP_007161310.1|  hypothetical protein PHAVU_001G059100g             226   8e-66    
ref|XP_007144575.1|  hypothetical protein PHAVU_007G167200g             226   9e-66    
ref|XP_003638079.1|  Peroxidase                                         226   1e-65    
ref|XP_008234970.1|  PREDICTED: peroxidase 3-like                       226   1e-65    
ref|XP_006305430.1|  hypothetical protein CARUB_v10009829mg             225   1e-65    
gb|AII99881.1|  peroxidase                                              225   1e-65    
ref|XP_010033422.1|  PREDICTED: peroxidase 51-like                      226   1e-65    
ref|XP_010671316.1|  PREDICTED: peroxidase 5-like                       226   1e-65    
ref|XP_004238381.1|  PREDICTED: peroxidase 64-like                      225   1e-65    
ref|XP_010919026.1|  PREDICTED: peroxidase 5-like                       225   2e-65    
emb|CDP05261.1|  unnamed protein product                                225   2e-65    
gb|KHN29593.1|  Peroxidase 5                                            226   2e-65    
ref|XP_010921346.1|  PREDICTED: peroxidase 5-like                       226   2e-65    
ref|XP_003555769.1|  PREDICTED: peroxidase 5-like                       225   2e-65    
ref|XP_007200009.1|  hypothetical protein PRUPE_ppa024711mg             225   2e-65    
ref|XP_007145114.1|  hypothetical protein PHAVU_007G211100g             225   2e-65    
ref|XP_010066142.1|  PREDICTED: peroxidase 66-like                      225   2e-65    
ref|XP_010455535.1|  PREDICTED: peroxidase 39-like                      225   2e-65    
ref|XP_003534685.2|  PREDICTED: peroxidase 5-like                       225   2e-65    
ref|XP_004309239.1|  PREDICTED: peroxidase 66-like                      225   2e-65    
emb|CAN83265.1|  hypothetical protein VITISV_042486                     224   3e-65    Vitis vinifera
ref|XP_010906352.1|  PREDICTED: peroxidase 5-like                       224   3e-65    
ref|XP_009799014.1|  PREDICTED: peroxidase 5-like                       225   3e-65    
ref|XP_007153060.1|  hypothetical protein PHAVU_003G003200g             225   3e-65    
gb|AAT72298.1|  CBRCI35                                                 224   3e-65    Capsella bursa-pastoris
ref|XP_003536895.1|  PREDICTED: peroxidase 3-like                       224   3e-65    
ref|XP_006342073.1|  PREDICTED: peroxidase 64-like                      224   4e-65    
ref|XP_011074707.1|  PREDICTED: peroxidase 64-like                      224   4e-65    
ref|XP_010422076.1|  PREDICTED: peroxidase 39-like                      224   5e-65    
ref|NP_001148340.1|  peroxidase 1 precursor                             224   5e-65    Zea mays [maize]
ref|XP_004496622.1|  PREDICTED: peroxidase 66-like                      224   5e-65    
ref|XP_002884180.1|  hypothetical protein ARALYDRAFT_900345             224   5e-65    
ref|XP_003547618.1|  PREDICTED: cationic peroxidase 2-like              224   5e-65    
ref|XP_002510864.1|  Peroxidase 66 precursor, putative                  224   5e-65    Ricinus communis
ref|XP_010032732.1|  PREDICTED: peroxidase 5-like                       224   5e-65    
tpe|CAH69312.1|  TPA: class III peroxidase 70 precursor                 224   5e-65    
ref|XP_010435105.1|  PREDICTED: peroxidase 39                           224   5e-65    
dbj|BAK03531.1|  predicted protein                                      224   5e-65    
dbj|BAA77387.1|  peroxidase 1                                           224   6e-65    Scutellaria baicalensis [Baikal skullcap]
ref|XP_006288149.1|  hypothetical protein CARUB_v10001386mg             224   6e-65    
gb|AFK41517.1|  unknown                                                 224   6e-65    
ref|XP_002264451.1|  PREDICTED: peroxidase 66                           224   6e-65    Vitis vinifera
emb|CAA70034.1|  peroxidase ATP22a                                      224   7e-65    Arabidopsis thaliana [mouse-ear cress]
ref|XP_003518944.1|  PREDICTED: peroxidase 3-like                       224   7e-65    
ref|XP_004985934.1|  PREDICTED: peroxidase 5-like                       224   7e-65    
ref|XP_006356924.1|  PREDICTED: peroxidase 3-like                       224   7e-65    
ref|XP_010492211.1|  PREDICTED: peroxidase 55-like                      224   7e-65    
ref|NP_179488.1|  peroxidase 16                                         224   7e-65    Arabidopsis thaliana [mouse-ear cress]
ref|XP_008644003.1|  PREDICTED: hypothetical protein isoform X1         224   7e-65    
gb|AAM52320.1|AC105363_9  Putative peroxidase                           223   7e-65    Oryza sativa Japonica Group [Japonica rice]
ref|XP_008781200.1|  PREDICTED: peroxidase 5-like                       224   7e-65    
ref|XP_009796592.1|  PREDICTED: peroxidase 64-like                      223   7e-65    
gb|KDP27791.1|  hypothetical protein JCGZ_18871                         224   8e-65    
ref|XP_010484852.1|  PREDICTED: peroxidase 3-like                       224   8e-65    
ref|XP_001776111.1|  predicted protein                                  223   8e-65    
ref|XP_010457608.1|  PREDICTED: peroxidase 3-like                       223   8e-65    
ref|XP_009787965.1|  PREDICTED: peroxidase 24-like                      224   9e-65    
ref|XP_002991835.1|  hypothetical protein SELMODRAFT_269862             224   1e-64    
ref|XP_010106816.1|  Peroxidase 66                                      223   1e-64    
ref|XP_008656073.1|  PREDICTED: peroxidase 2-like                       224   1e-64    
gb|KHN30703.1|  Peroxidase 5                                            223   1e-64    
ref|NP_001241556.1|  uncharacterized protein LOC100793327 precursor     223   1e-64    
ref|XP_004234140.1|  PREDICTED: peroxidase 66                           223   1e-64    
gb|EYU19507.1|  hypothetical protein MIMGU_mgv1a010371mg                223   1e-64    
ref|XP_002972369.1|  hypothetical protein SELMODRAFT_97355              223   1e-64    
ref|XP_010032734.1|  PREDICTED: peroxidase 5-like                       223   1e-64    
ref|XP_002461102.1|  hypothetical protein SORBIDRAFT_02g040770          224   1e-64    Sorghum bicolor [broomcorn]
ref|XP_010461417.1|  PREDICTED: peroxidase 71-like                      223   2e-64    
ref|XP_010659811.1|  PREDICTED: peroxidase 5-like                       223   2e-64    
ref|XP_003536264.1|  PREDICTED: peroxidase 5-like                       223   2e-64    
ref|XP_002992995.1|  hypothetical protein SELMODRAFT_236645             223   2e-64    
ref|XP_004485565.1|  PREDICTED: cationic peroxidase 2-like              223   2e-64    
ref|XP_008790752.1|  PREDICTED: peroxidase 55                           223   2e-64    
ref|XP_006288205.1|  hypothetical protein CARUB_v10001445mg             223   2e-64    
ref|XP_002987185.1|  hypothetical protein SELMODRAFT_14540              222   2e-64    
emb|CAN68183.1|  hypothetical protein VITISV_028562                     223   2e-64    Vitis vinifera
ref|XP_008662930.1|  PREDICTED: peroxidase 5-like                       223   2e-64    
gb|AFW57508.1|  peroxidase 1                                            223   2e-64    
ref|XP_010475209.1|  PREDICTED: peroxidase 3                            223   2e-64    
gb|KHN23061.1|  Peroxidase 66                                           221   2e-64    
ref|XP_003557849.1|  PREDICTED: peroxidase 2-like                       223   2e-64    
ref|XP_009604384.1|  PREDICTED: peroxidase 3-like                       223   2e-64    
ref|XP_007035435.1|  Peroxidase 24, putative                            223   2e-64    
ref|XP_003589739.1|  Peroxidase                                         223   2e-64    
ref|XP_002452710.1|  hypothetical protein SORBIDRAFT_04g031120          223   2e-64    Sorghum bicolor [broomcorn]
ref|XP_010243339.1|  PREDICTED: peroxidase 3-like                       222   2e-64    
ref|XP_010919027.1|  PREDICTED: peroxidase 5-like                       222   3e-64    
ref|NP_192868.1|  peroxidase 39                                         222   3e-64    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010522326.1|  PREDICTED: peroxidase 3                            222   3e-64    
ref|XP_011101165.1|  PREDICTED: peroxidase 66-like                      222   3e-64    
ref|XP_007207711.1|  hypothetical protein PRUPE_ppa025326mg             222   3e-64    
ref|NP_001141025.1|  uncharacterized protein LOC100273104 precursor     223   3e-64    
emb|CAA67337.1|  peroxidase                                             222   3e-64    
gb|KCW61137.1|  hypothetical protein EUGRSUZ_H03910                     221   3e-64    
ref|XP_004298124.1|  PREDICTED: peroxidase 5-like                       222   3e-64    
ref|XP_008670597.1|  PREDICTED: peroxidase 2-like                       223   3e-64    
ref|XP_004134843.1|  PREDICTED: peroxidase 64-like                      222   3e-64    
ref|XP_003533237.1|  PREDICTED: peroxidase 66-like                      222   3e-64    
ref|XP_009411603.1|  PREDICTED: peroxidase 5 {ECO:0000250|UniProt...    222   4e-64    
gb|ABS44862.1|  putative peroxidase                                     222   4e-64    
ref|XP_008240579.1|  PREDICTED: peroxidase 44                           221   4e-64    
ref|NP_001050193.1|  Os03g0369400                                       222   4e-64    
ref|XP_003558948.1|  PREDICTED: peroxidase 5-like                       222   4e-64    
gb|EMS60334.1|  Peroxidase 5                                            222   4e-64    
gb|KHG27040.1|  Peroxidase 51 -like protein                             221   4e-64    
ref|XP_009335532.1|  PREDICTED: peroxidase 5-like                       221   5e-64    
ref|NP_001050186.2|  Os03g0368000                                       221   5e-64    
gb|KFK25644.1|  hypothetical protein AALP_AA8G141400                    222   5e-64    
ref|XP_006490463.1|  PREDICTED: peroxidase 66-like                      221   5e-64    
gb|KCW58172.1|  hypothetical protein EUGRSUZ_H00889                     221   5e-64    
ref|XP_006356923.1|  PREDICTED: peroxidase 3-like                       221   5e-64    
gb|AAG46141.1|AC082644_23  putative peroxidase                          221   5e-64    
ref|XP_010420034.1|  PREDICTED: peroxidase 55-like                      222   5e-64    
ref|XP_008808270.1|  PREDICTED: peroxidase 5-like                       222   5e-64    
ref|XP_008656069.1|  PREDICTED: peroxidase 2-like                       222   5e-64    
ref|NP_001050187.1|  Os03g0368300                                       221   6e-64    
ref|XP_002439234.1|  hypothetical protein SORBIDRAFT_09g002830          222   6e-64    
gb|KCW52189.1|  hypothetical protein EUGRSUZ_J01618                     221   6e-64    
ref|XP_003553930.1|  PREDICTED: peroxidase 55                           221   6e-64    
ref|XP_002272800.1|  PREDICTED: peroxidase 5                            221   7e-64    
gb|KDP25855.1|  hypothetical protein JCGZ_22885                         221   7e-64    
ref|XP_010444341.1|  PREDICTED: peroxidase 71-like                      221   7e-64    
ref|XP_004240140.1|  PREDICTED: peroxidase 3                            221   7e-64    
ref|XP_010438209.1|  PREDICTED: peroxidase 45-like                      221   7e-64    
ref|XP_006286152.1|  hypothetical protein CARUB_v10007711mg             221   7e-64    
ref|XP_007143359.1|  hypothetical protein PHAVU_007G065800g             221   7e-64    
ref|XP_001751596.1|  predicted protein                                  220   7e-64    
ref|XP_009763027.1|  PREDICTED: peroxidase 44-like                      221   8e-64    
ref|XP_006399923.1|  hypothetical protein EUTSA_v10014070mg             221   8e-64    
sp|P22196.1|PER2_ARAHY  RecName: Full=Cationic peroxidase 2; AltN...    221   9e-64    
ref|XP_004960411.1|  PREDICTED: peroxidase 5-like                       221   9e-64    
gb|KCW52190.1|  hypothetical protein EUGRSUZ_J01619                     220   9e-64    
ref|XP_010024692.1|  PREDICTED: peroxidase 5-like                       221   9e-64    
ref|XP_004299587.1|  PREDICTED: peroxidase 41-like                      221   9e-64    
ref|XP_009365500.1|  PREDICTED: peroxidase 5-like                       221   9e-64    
ref|XP_006362698.1|  PREDICTED: peroxidase 66-like                      220   1e-63    
ref|XP_008440862.1|  PREDICTED: peroxidase 64-like                      220   1e-63    
gb|EAY90172.1|  hypothetical protein OsI_11737                          221   1e-63    
ref|XP_006840292.1|  hypothetical protein AMTR_s00045p00063130          221   1e-63    
ref|XP_002510587.1|  Peroxidase 64 precursor, putative                  220   1e-63    
ref|XP_004960409.1|  PREDICTED: peroxidase 5-like                       221   1e-63    
ref|XP_009125965.1|  PREDICTED: peroxidase 55-like                      221   1e-63    
ref|XP_010484182.1|  PREDICTED: peroxidase 71                           221   1e-63    
ref|XP_011003206.1|  PREDICTED: peroxidase 3-like                       220   1e-63    
gb|EEC75333.1|  hypothetical protein OsI_11725                          220   1e-63    
ref|XP_006421817.1|  hypothetical protein CICLE_v10006448mg             220   1e-63    
ref|XP_008809845.1|  PREDICTED: peroxidase 1-like                       220   1e-63    
gb|KHN00317.1|  Peroxidase 5                                            220   1e-63    
ref|XP_010679746.1|  PREDICTED: peroxidase 27-like                      220   2e-63    
ref|XP_002963661.1|  hypothetical protein SELMODRAFT_266691             220   2e-63    
ref|XP_009606506.1|  PREDICTED: peroxidase 55                           221   2e-63    
gb|AFK42142.1|  unknown                                                 220   2e-63    
ref|XP_003535856.1|  PREDICTED: peroxidase 5-like                       220   2e-63    
ref|XP_004985933.1|  PREDICTED: peroxidase 5-like                       220   2e-63    
ref|XP_008441329.1|  PREDICTED: peroxidase 51-like                      220   2e-63    
ref|XP_002971841.1|  hypothetical protein SELMODRAFT_231875             219   2e-63    
ref|XP_002987767.1|  hypothetical protein SELMODRAFT_126670             220   2e-63    
ref|XP_004973034.1|  PREDICTED: peroxidase 47-like                      220   2e-63    
gb|EMT13671.1|  Peroxidase 5                                            220   2e-63    
ref|XP_004231304.1|  PREDICTED: peroxidase 5-like                       220   2e-63    
ref|NP_001170598.1|  hypothetical protein precursor                     220   2e-63    
ref|XP_010447758.1|  PREDICTED: peroxidase 45                           220   2e-63    
gb|AFY26878.1|  basic peroxidase swpb7                                  220   2e-63    
ref|XP_009341295.1|  PREDICTED: peroxidase 66-like                      221   2e-63    
ref|XP_010906360.1|  PREDICTED: peroxidase 5-like                       219   2e-63    
ref|XP_002488879.1|  hypothetical protein SORBIDRAFT_2674s002010        220   2e-63    
ref|XP_011083477.1|  PREDICTED: peroxidase 64-like                      219   3e-63    
ref|XP_003548517.2|  PREDICTED: peroxidase 55-like                      219   3e-63    
ref|XP_010680401.1|  PREDICTED: peroxidase 64 isoform X2                219   3e-63    
ref|NP_001043276.1|  Os01g0543100                                       220   3e-63    
ref|XP_006662005.1|  PREDICTED: peroxidase 5-like                       220   3e-63    
emb|CDY49518.1|  BnaC05g03300D                                          219   3e-63    
ref|XP_002516915.1|  Cationic peroxidase 2 precursor, putative          219   3e-63    
gb|KHN09929.1|  Peroxidase 55                                           219   3e-63    
ref|XP_007163044.1|  hypothetical protein PHAVU_001G201300g             219   3e-63    
ref|XP_006444582.1|  hypothetical protein CICLE_v10021010mg             220   3e-63    
ref|XP_009112290.1|  PREDICTED: peroxidase 72-like                      219   3e-63    
ref|XP_011037006.1|  PREDICTED: peroxidase 3-like                       219   3e-63    
ref|XP_006659757.1|  PREDICTED: peroxidase 47-like                      219   3e-63    
dbj|BAB89258.1|  putative peroxidase ATP6a                              219   3e-63    
ref|XP_004138796.1|  PREDICTED: peroxidase 51-like                      219   4e-63    
ref|XP_004981668.1|  PREDICTED: peroxidase 51-like                      219   4e-63    
gb|ABB45838.1|  hypothetical protein                                    219   4e-63    
gb|EAY90161.1|  hypothetical protein OsI_11726                          219   4e-63    
ref|XP_003573178.1|  PREDICTED: peroxidase 64                           219   4e-63    
gb|ACU20445.1|  unknown                                                 219   4e-63    
tpe|CAH69313.1|  TPA: class III peroxidase 71 precursor                 219   5e-63    
gb|EAY74439.1|  hypothetical protein OsI_02330                          219   5e-63    
ref|XP_010674524.1|  PREDICTED: peroxidase 5-like                       219   5e-63    
gb|ABM66586.1|  putative peroxidase                                     219   5e-63    
ref|XP_009627957.1|  PREDICTED: peroxidase 44                           219   5e-63    
gb|KCW61140.1|  hypothetical protein EUGRSUZ_H03915                     218   5e-63    
emb|CDY58408.1|  BnaC09g54550D                                          219   5e-63    
ref|XP_006393821.1|  hypothetical protein EUTSA_v10004548mg             219   5e-63    
emb|CDP20342.1|  unnamed protein product                                219   5e-63    
ref|XP_006489267.1|  PREDICTED: peroxidase 3-like                       219   5e-63    
ref|XP_009768247.1|  PREDICTED: peroxidase 3                            219   6e-63    
ref|XP_006656386.1|  PREDICTED: peroxidase 3-like                       219   6e-63    
ref|XP_004965312.1|  PREDICTED: peroxidase 1-like                       219   6e-63    
ref|XP_002516845.1|  Peroxidase 27 precursor, putative                  219   6e-63    
ref|NP_198774.1|  peroxidase 62                                         218   6e-63    
emb|CBI39654.3|  unnamed protein product                                220   6e-63    
ref|XP_010450796.1|  PREDICTED: peroxidase 62                           218   6e-63    
ref|XP_006280805.1|  hypothetical protein CARUB_v10026774mg             219   6e-63    
ref|XP_009411413.1|  PREDICTED: peroxidase 5 {ECO:0000250|UniProt...    218   6e-63    
ref|XP_008788317.1|  PREDICTED: peroxidase 47                           218   6e-63    
gb|KDO74974.1|  hypothetical protein CISIN_1g020619mg                   218   6e-63    
ref|XP_004138795.1|  PREDICTED: peroxidase 55-like                      218   7e-63    
gb|KHN28247.1|  Peroxidase 3                                            218   7e-63    
ref|XP_010093296.1|  Peroxidase 5                                       218   7e-63    
emb|CCD17872.1|  putative peroxidase                                    218   7e-63    
ref|XP_006414370.1|  hypothetical protein EUTSA_v10025534mg             219   7e-63    
ref|XP_010441073.1|  PREDICTED: peroxidase 62-like                      218   7e-63    
ref|XP_004240141.1|  PREDICTED: peroxidase 3-like                       218   7e-63    
ref|NP_001054574.1|  Os05g0135500                                       219   7e-63    
emb|CDX91081.1|  BnaC02g05160D                                          218   9e-63    
ref|XP_009598825.1|  PREDICTED: peroxidase 5 {ECO:0000250|UniProt...    218   9e-63    
gb|ABQ23446.1|  putative peroxidase                                     218   9e-63    
gb|KDP40041.1|  hypothetical protein JCGZ_02039                         218   9e-63    
emb|CDY65385.1|  BnaCnng46860D                                          218   9e-63    
ref|XP_010045225.1|  PREDICTED: peroxidase 5-like                       218   9e-63    
gb|ABK93918.1|  unknown                                                 218   9e-63    
ref|XP_006372957.1|  hypothetical protein POPTR_0017s06550g             218   1e-62    
ref|XP_006367225.1|  PREDICTED: peroxidase 44-like                      218   1e-62    
gb|KDP46270.1|  hypothetical protein JCGZ_10110                         218   1e-62    
ref|XP_010024694.1|  PREDICTED: peroxidase 5-like                       218   1e-62    
ref|XP_010435877.1|  PREDICTED: peroxidase 62-like                      218   1e-62    
ref|XP_002993742.1|  hypothetical protein SELMODRAFT_137572             218   1e-62    
ref|XP_009802952.1|  PREDICTED: peroxidase 55-like                      218   1e-62    
ref|XP_010024493.1|  PREDICTED: peroxidase 24-like                      218   1e-62    
ref|XP_008376941.1|  PREDICTED: peroxidase 66-like                      218   1e-62    
gb|ABE66389.1|  peroxidase                                              218   1e-62    
gb|EYU18494.1|  hypothetical protein MIMGU_mgv1a009839mg                218   1e-62    
gb|ABQ18321.1|  putative peroxidase                                     218   1e-62    
ref|XP_010111940.1|  Peroxidase 45                                      218   1e-62    
gb|EMS50723.1|  Peroxidase 1                                            218   1e-62    
ref|XP_007214109.1|  hypothetical protein PRUPE_ppa017084mg             218   1e-62    
ref|XP_004135971.1|  PREDICTED: peroxidase 5-like                       218   1e-62    
ref|XP_004304524.1|  PREDICTED: peroxidase 55-like                      218   2e-62    
ref|XP_009382231.1|  PREDICTED: peroxidase 5 {ECO:0000250|UniProt...    217   2e-62    
gb|EMT05880.1|  Peroxidase 3                                            218   2e-62    
gb|KFK28099.1|  hypothetical protein AALP_AA8G472200                    218   2e-62    
dbj|BAJ90491.1|  predicted protein                                      218   2e-62    
ref|XP_009609714.1|  PREDICTED: peroxidase 24-like                      218   2e-62    
emb|CCJ34837.1|  horseradish peroxidase isoenzyme HRP_22489.1           218   2e-62    
gb|KGN63166.1|  hypothetical protein Csa_2G406640                       218   2e-62    
ref|XP_006419700.1|  hypothetical protein CICLE_v10007121mg             217   2e-62    
ref|XP_009630373.1|  PREDICTED: peroxidase 3                            217   2e-62    
ref|XP_010696607.1|  PREDICTED: peroxidase 3                            218   2e-62    
gb|EYU45326.1|  hypothetical protein MIMGU_mgv1a009971mg                217   2e-62    
ref|XP_002519251.1|  Peroxidase 40 precursor, putative                  219   2e-62    
ref|XP_010914387.1|  PREDICTED: peroxidase 3-like                       217   2e-62    
gb|EMS48378.1|  Peroxidase 2                                            217   2e-62    
ref|XP_008812662.1|  PREDICTED: peroxidase 3-like                       217   2e-62    
ref|XP_008441330.1|  PREDICTED: peroxidase 55-like                      217   2e-62    
ref|XP_006659625.1|  PREDICTED: peroxidase 16-like                      217   2e-62    
ref|XP_008225182.1|  PREDICTED: peroxidase 19                           218   2e-62    
dbj|BAK02643.1|  predicted protein                                      217   2e-62    
ref|XP_009796691.1|  PREDICTED: peroxidase 3-like                       217   2e-62    
gb|AHL39150.1|  class III peroxidase                                    217   2e-62    
ref|XP_009779478.1|  PREDICTED: peroxidase 64-like                      217   2e-62    
ref|XP_003568991.1|  PREDICTED: peroxidase 5-like                       217   3e-62    
dbj|BAK01586.1|  predicted protein                                      217   3e-62    
ref|XP_002985332.1|  hypothetical protein SELMODRAFT_122100             220   3e-62    
gb|AFK37171.1|  unknown                                                 218   3e-62    
ref|XP_004498110.1|  PREDICTED: peroxidase 5-like                       217   3e-62    
gb|KHG06184.1|  Peroxidase 72                                           217   3e-62    
ref|XP_002453345.1|  hypothetical protein SORBIDRAFT_04g004250          218   3e-62    
ref|XP_010433020.1|  PREDICTED: peroxidase 45-like                      217   3e-62    
ref|XP_003592341.1|  Peroxidase                                         217   3e-62    
ref|XP_002985280.1|  hypothetical protein SELMODRAFT_122015             217   3e-62    
ref|XP_009405648.1|  PREDICTED: peroxidase 27-like                      217   3e-62    
ref|XP_010453527.1|  PREDICTED: peroxidase 55                           218   3e-62    
gb|AGT16805.1|  peroxidase precursor                                    218   3e-62    
ref|XP_009607401.1|  PREDICTED: peroxidase 64-like                      216   3e-62    
gb|KDP22346.1|  hypothetical protein JCGZ_26177                         216   3e-62    
ref|NP_201440.1|  peroxidase 72                                         217   3e-62    
ref|XP_009781189.1|  PREDICTED: peroxidase 5-like                       217   3e-62    
ref|XP_010261100.1|  PREDICTED: peroxidase 3-like                       217   3e-62    
ref|XP_002443747.1|  hypothetical protein SORBIDRAFT_07g001280          216   3e-62    
ref|XP_010112376.1|  Peroxidase 55                                      217   3e-62    
ref|XP_002868708.1|  hypothetical protein ARALYDRAFT_494031             216   4e-62    
ref|XP_008808268.1|  PREDICTED: peroxidase 5-like                       216   4e-62    
ref|XP_010103062.1|  Peroxidase 5                                       217   4e-62    
ref|XP_003571312.2|  PREDICTED: peroxidase 47                           216   4e-62    
gb|KDP39635.1|  hypothetical protein JCGZ_02655                         216   4e-62    
ref|XP_009411414.1|  PREDICTED: peroxidase 5 {ECO:0000250|UniProt...    216   4e-62    
ref|XP_003533700.1|  PREDICTED: peroxidase 5-like                       216   4e-62    
gb|KDP30908.1|  hypothetical protein JCGZ_15520                         216   4e-62    
ref|XP_010267773.1|  PREDICTED: peroxidase 3                            216   4e-62    
gb|EPS60801.1|  hypothetical protein M569_13997                         216   4e-62    
emb|CDO97463.1|  unnamed protein product                                216   4e-62    
gb|ACN60160.1|  peroxidase                                              216   4e-62    
ref|XP_004292686.1|  PREDICTED: peroxidase 3-like                       216   4e-62    
ref|XP_010113299.1|  Peroxidase 64                                      216   4e-62    
ref|XP_004166427.1|  PREDICTED: peroxidase 51-like                      216   4e-62    
gb|AFK44888.1|  unknown                                                 216   4e-62    
emb|CAA76374.2|  peroxidase                                             216   5e-62    
ref|XP_006373205.1|  hypothetical protein POPTR_0017s09640g             216   5e-62    
ref|XP_008388923.1|  PREDICTED: peroxidase 5-like                       216   5e-62    
gb|AFK46112.1|  unknown                                                 216   5e-62    
ref|XP_006600191.1|  PREDICTED: uncharacterized protein LOC100793...    216   5e-62    
ref|XP_009103543.1|  PREDICTED: LOW QUALITY PROTEIN: peroxidase 72      216   5e-62    
ref|XP_008644169.1|  PREDICTED: hypothetical protein isoform X1         216   5e-62    
ref|XP_006358573.1|  PREDICTED: peroxidase 5-like                       216   5e-62    
ref|XP_002866596.1|  hypothetical protein ARALYDRAFT_496608             216   5e-62    
ref|XP_004971522.1|  PREDICTED: peroxidase 1-like                       216   5e-62    
emb|CCJ34838.1|  horseradish peroxidase isoenzyme HRP_22489.2           216   5e-62    
ref|XP_007035579.1|  Cationic peroxidase 2 precursor                    217   5e-62    



>emb|CDP18856.1| unnamed protein product [Coffea canephora]
Length=327

 Score =   450 bits (1157),  Expect = 9e-153, Method: Compositional matrix adjust.
 Identities = 223/298 (75%), Positives = 261/298 (88%), Gaps = 2/298 (1%)
 Frame = +2

Query  239   FNFYAISCPSAELIVKNTVRSASSVDPTLPGKLLRLLFHDCFVEGCDASILLQGNDTERS  418
             F FYA SCP+AE+IVKNTVR ASS+DPTLPGKLLRL+FHDCFVEGCDASILLQGN TERS
Sbjct  31    FGFYATSCPTAEIIVKNTVREASSLDPTLPGKLLRLVFHDCFVEGCDASILLQGNGTERS  90

Query  419   DPANKSVGGFSTVDSAKRVLEIFCPETVSCADIIALAARDAVEFVGGPSVAIPTGRRDGR  598
             DPAN  +GGFS +DSAKRVLE FCP TVSCADI+ALAARDAVEF GGPSV IPTGRRDGR
Sbjct  91    DPANSFLGGFSIIDSAKRVLEFFCPGTVSCADILALAARDAVEFAGGPSVLIPTGRRDGR  150

Query  599   VSLGKNVRPNIIDTSFTMDEMMKIFAAKGLSLDDLVTLSGAHTIGSAHCSAFSDRFQLAS  778
             +SL  NVRPNIIDTSFTMD+M+KIF+AKGLSLDDLVTLSGAHTIGSAHC+AF DRF++ S
Sbjct  151   ISLASNVRPNIIDTSFTMDQMLKIFSAKGLSLDDLVTLSGAHTIGSAHCNAFMDRFKVDS  210

Query  779   NGSFLPIdaaldhayaaelaRQCPAG-ASDAVTVNNDPVTPSLFDNQYYKDLLAHRGLFQ  955
              G+F  ID++LD  YAA+L ++CP G A+ + T +NDP TP+LFDNQYYKDLLAH+GLFQ
Sbjct  211   KGNFTLIDSSLDREYAAQLTKRCPGGEAATSPTTDNDPETPNLFDNQYYKDLLAHKGLFQ  270

Query  956   SDSALLRDKRAMEKVQDFAGDQNNFFTSWEQSFLKLVSIGVKVGDDDGEIRRSCSSVN  1129
             SDS L+ DKR + KVQ+FA +Q++FF SWEQSFL+L SIGVK+ D++GE+R+ C+ VN
Sbjct  271   SDSVLVSDKRTISKVQNFANNQDSFFESWEQSFLRLTSIGVKI-DNEGEVRQLCAVVN  327



>ref|XP_009802575.1| PREDICTED: peroxidase 46-like [Nicotiana sylvestris]
Length=336

 Score =   445 bits (1145),  Expect = 7e-151, Method: Compositional matrix adjust.
 Identities = 220/297 (74%), Positives = 254/297 (86%), Gaps = 1/297 (0%)
 Frame = +2

Query  239   FNFYAISCPSAELIVKNTVRSASSVDPTLPGKLLRLLFHDCFVEGCDASILLQGNDTERS  418
             F+FYA+SCP+AE +VKNTVRSASS+DPTLPGKLLRLLFHDCFVEGCDASILL+GN TERS
Sbjct  41    FDFYALSCPTAEFMVKNTVRSASSMDPTLPGKLLRLLFHDCFVEGCDASILLEGNGTERS  100

Query  419   DPANKSVGGFSTVDSAKRVLEIFCPETVSCADIIALAARDAVEFVGGPSVAIPTGRRDGR  598
             DPANKS+GGFS ++SAKRVLEIFCP TVSCADIIALAARDAVEF GGP+V IPTGRRDG+
Sbjct  101   DPANKSLGGFSVIESAKRVLEIFCPRTVSCADIIALAARDAVEFAGGPNVQIPTGRRDGK  160

Query  599   VSLGKNVRPNIIDTSFTMDEMMKIFAAKGLSLDDLVTLSGAHTIGSAHCSAFSDRFQLAS  778
             +SL  NVRPNI+DTSF++D+M+ IF+AKGLSLDDLV LSGAHTIGSAHC+AFSDRFQ+ S
Sbjct  161   ISLASNVRPNIVDTSFSIDQMINIFSAKGLSLDDLVILSGAHTIGSAHCNAFSDRFQVDS  220

Query  779   NGSFLPIdaaldhayaaelaRQCPAGASDAVTVNNDPVTPSLFDNQYYKDLLAHRGLFQS  958
              G+   ID +LD  YAAEL +QCPAGA+ ++TV NDP TP LFDNQYYKDL AH+GLFQS
Sbjct  221   KGNVSLIDTSLDREYAAELTKQCPAGANPSITVKNDPQTPQLFDNQYYKDLSAHKGLFQS  280

Query  959   DSALLRDKRAMEKVQDFAGDQNNFFTSWEQSFLKLVSIGVKVGDDDGEIRRSCSSVN  1129
             DS L  D R  ++V DFA DQN FF  W QSF++L  +G+K G D+GEIR SCS  N
Sbjct  281   DSVLFSDGRTRKRVMDFADDQNIFFQGWSQSFVRLADLGIKSG-DEGEIRGSCSVTN  336



>ref|XP_006342451.1| PREDICTED: peroxidase 46-like [Solanum tuberosum]
Length=341

 Score =   446 bits (1146),  Expect = 7e-151, Method: Compositional matrix adjust.
 Identities = 220/298 (74%), Positives = 256/298 (86%), Gaps = 2/298 (1%)
 Frame = +2

Query  239   FNFYAISCPSAELIVKNTVRSASSVDPTLPGKLLRLLFHDCFVEGCDASILLQGNDTERS  418
             FNFY +SCPSAEL+VKNTVRSASS+DPT+PGKLLRLLFHDCFVEGCDASILL+GN TERS
Sbjct  45    FNFYGLSCPSAELMVKNTVRSASSMDPTIPGKLLRLLFHDCFVEGCDASILLEGNGTERS  104

Query  419   DPANKSVGGFSTVDSAKRVLEIFCPETVSCADIIALAARDAVEFVGGPSVAIPTGRRDGR  598
             DPANKS+GGFS +++AKRVLEIFCP TVSCADI+ALAARDAVEF GGP+V IPTGRRDGR
Sbjct  105   DPANKSLGGFSVIENAKRVLEIFCPFTVSCADIVALAARDAVEFAGGPNVQIPTGRRDGR  164

Query  599   VSLGKNVRPNIIDTSFTMDEMMKIFAAKGLSLDDLVTLSGAHTIGSAHCSAFSDRFQLAS  778
             +SL  NVRPNI+DTSFTMD+M+KIF  KGLSLDDLV LSGAHTIGSAHC+AFSDRF++ +
Sbjct  165   ISLTTNVRPNIVDTSFTMDQMIKIFTIKGLSLDDLVILSGAHTIGSAHCNAFSDRFRVDT  224

Query  779   NGSFLPIdaaldhayaaelaRQCPAG-ASDAVTVNNDPVTPSLFDNQYYKDLLAHRGLFQ  955
             NG+F  ID +LD AYA EL +QCPAG A+  +TV NDP TP LFDNQY+KDL+ H+GLFQ
Sbjct  225   NGNFTLIDPSLDKAYATELTKQCPAGAATSTITVKNDPQTPQLFDNQYFKDLIEHKGLFQ  284

Query  956   SDSALLRDKRAMEKVQDFAGDQNNFFTSWEQSFLKLVSIGVKVGDDDGEIRRSCSSVN  1129
             SDS L  D R  E+V +FA DQ+ FF SW QSF++L  +GVK G +DGE+R SCS +N
Sbjct  285   SDSVLFNDVRTKERVTEFANDQDGFFRSWSQSFVRLSVLGVKSG-EDGEVRTSCSVIN  341



>ref|XP_009622668.1| PREDICTED: peroxidase 46 [Nicotiana tomentosiformis]
Length=336

 Score =   440 bits (1132),  Expect = 8e-149, Method: Compositional matrix adjust.
 Identities = 219/297 (74%), Positives = 253/297 (85%), Gaps = 1/297 (0%)
 Frame = +2

Query  239   FNFYAISCPSAELIVKNTVRSASSVDPTLPGKLLRLLFHDCFVEGCDASILLQGNDTERS  418
             F FYA+SCP+AE +VKNTVRSASS+DPTLPGKLLRLLFHDCFVEGCDASILL+GN TERS
Sbjct  41    FEFYALSCPTAEFMVKNTVRSASSMDPTLPGKLLRLLFHDCFVEGCDASILLEGNGTERS  100

Query  419   DPANKSVGGFSTVDSAKRVLEIFCPETVSCADIIALAARDAVEFVGGPSVAIPTGRRDGR  598
             DPANKS+GGFS ++SAKRVLEIFCP TVSCADIIALAARDAVEF GGP+V IPTGRRDG+
Sbjct  101   DPANKSLGGFSVIESAKRVLEIFCPGTVSCADIIALAARDAVEFAGGPNVQIPTGRRDGK  160

Query  599   VSLGKNVRPNIIDTSFTMDEMMKIFAAKGLSLDDLVTLSGAHTIGSAHCSAFSDRFQLAS  778
             +SL  NVR NI+DTSF++D+M+ IF+AKGLSLDDLV LSGAHTIGSAHC+AFSDRFQ+ S
Sbjct  161   LSLVSNVRSNIVDTSFSIDQMINIFSAKGLSLDDLVILSGAHTIGSAHCNAFSDRFQVDS  220

Query  779   NGSFLPIdaaldhayaaelaRQCPAGASDAVTVNNDPVTPSLFDNQYYKDLLAHRGLFQS  958
              G+   ID +LD  YAAEL +QCPAGA+ ++TV NDP TP LFDNQYYKDL AH+GLFQS
Sbjct  221   KGNISVIDTSLDREYAAELTKQCPAGANPSITVKNDPQTPQLFDNQYYKDLSAHKGLFQS  280

Query  959   DSALLRDKRAMEKVQDFAGDQNNFFTSWEQSFLKLVSIGVKVGDDDGEIRRSCSSVN  1129
             DS L  D R  ++V DFA DQN+FF SW QSF++L  +G+K   D+GEIR SCS  N
Sbjct  281   DSVLFSDGRTRKRVMDFADDQNSFFQSWSQSFVRLAGLGIK-SVDEGEIRASCSVTN  336



>ref|XP_004253052.1| PREDICTED: peroxidase 46-like isoform X1 [Solanum lycopersicum]
Length=341

 Score =   439 bits (1130),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 217/298 (73%), Positives = 255/298 (86%), Gaps = 2/298 (1%)
 Frame = +2

Query  239   FNFYAISCPSAELIVKNTVRSASSVDPTLPGKLLRLLFHDCFVEGCDASILLQGNDTERS  418
             FNFY +SCPSAEL+VKNTVRSASS+DPT+PGKLLRLLFHDCFVEGCDASILL+GN TERS
Sbjct  45    FNFYGLSCPSAELMVKNTVRSASSMDPTIPGKLLRLLFHDCFVEGCDASILLEGNGTERS  104

Query  419   DPANKSVGGFSTVDSAKRVLEIFCPETVSCADIIALAARDAVEFVGGPSVAIPTGRRDGR  598
             DPANKS+GGFS +++AKRVLEIFCP TVSCADI+ALAARDAVEF GGP+V IPTGR+DGR
Sbjct  105   DPANKSLGGFSVIENAKRVLEIFCPFTVSCADIVALAARDAVEFAGGPNVQIPTGRKDGR  164

Query  599   VSLGKNVRPNIIDTSFTMDEMMKIFAAKGLSLDDLVTLSGAHTIGSAHCSAFSDRFQLAS  778
             +SL  NVRPNI+DTSFTMD+M+ IF  KGLSLDDLV LSGAHTIGSAHC+AFSDRF++ +
Sbjct  165   ISLITNVRPNIVDTSFTMDQMINIFTIKGLSLDDLVILSGAHTIGSAHCNAFSDRFRVDT  224

Query  779   NGSFLPIdaaldhayaaelaRQCPAG-ASDAVTVNNDPVTPSLFDNQYYKDLLAHRGLFQ  955
             NG+F  ID +LD AYA EL +QCPAG A+  +TV NDP TP LFDNQY+KDL+ H+GLFQ
Sbjct  225   NGNFTLIDPSLDKAYAIELTKQCPAGAATSTITVKNDPQTPQLFDNQYFKDLIQHKGLFQ  284

Query  956   SDSALLRDKRAMEKVQDFAGDQNNFFTSWEQSFLKLVSIGVKVGDDDGEIRRSCSSVN  1129
             SDS L  D R  ++V +FA DQ+ FF SW QSF++L  +GVK G +DGE+R SCS +N
Sbjct  285   SDSVLFNDVRTKKRVVEFANDQDGFFRSWSQSFVRLSVLGVKSG-EDGEVRTSCSVIN  341



>ref|XP_007011667.1| Peroxidase superfamily protein [Theobroma cacao]
 gb|EOY29286.1| Peroxidase superfamily protein [Theobroma cacao]
Length=331

 Score =   434 bits (1115),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 216/294 (73%), Positives = 245/294 (83%), Gaps = 1/294 (0%)
 Frame = +2

Query  239   FNFYAISCPSAELIVKNTVRSASSVDPTLPGKLLRLLFHDCFVEGCDASILLQGNDTERS  418
             FNFYAISCP AE +V NTVRSASS DPT+PGKLLRLLFHDCFVEGCDAS+LLQGN TER+
Sbjct  36    FNFYAISCPGAEFMVSNTVRSASSADPTIPGKLLRLLFHDCFVEGCDASVLLQGNGTERT  95

Query  419   DPANKSVGGFSTVDSAKRVLEIFCPETVSCADIIALAARDAVEFVGGPSVAIPTGRRDGR  598
             DPAN S+GGFS +DSAKRVLEIFCP TVSCADIIALAARDAV   GGPSV IPTGRRDGR
Sbjct  96    DPANTSLGGFSVIDSAKRVLEIFCPGTVSCADIIALAARDAVAIAGGPSVQIPTGRRDGR  155

Query  599   VSLGKNVRPNIIDTSFTMDEMMKIFAAKGLSLDDLVTLSGAHTIGSAHCSAFSDRFQLAS  778
             +S   NVRPNI+DTSFTMDEM K+F++KGLSLDDLVTLSGAHTIG AHC+AFSDRF+  S
Sbjct  156   ISNAANVRPNIVDTSFTMDEMTKLFSSKGLSLDDLVTLSGAHTIGLAHCNAFSDRFRQDS  215

Query  779   NGSFLPIdaaldhayaaelaRQCPAGASDAVTVNNDPVTPSLFDNQYYKDLLAHRGLFQS  958
              G    ID +LD  YA EL ++CPAGAS + TV+NDP T   FDNQYY +LLAHRGLFQS
Sbjct  216   KGKLTLIDTSLDSTYAEELMKKCPAGASTSTTVSNDPETSLAFDNQYYTNLLAHRGLFQS  275

Query  959   DSALLRDKRAMEKVQDFAGDQNNFFTSWEQSFLKLVSIGVKVGDDDGEIRRSCS  1120
             DS L++D R  ++V+ FA DQ +F  SW +SFLKL +IGVK  DD+GEIR+SCS
Sbjct  276   DSVLVKDGRTRKQVEAFANDQESFIRSWGESFLKLTTIGVKT-DDEGEIRQSCS  328



>ref|XP_010049850.1| PREDICTED: peroxidase 46-like [Eucalyptus grandis]
Length=326

 Score =   428 bits (1101),  Expect = 3e-144, Method: Compositional matrix adjust.
 Identities = 211/297 (71%), Positives = 251/297 (85%), Gaps = 1/297 (0%)
 Frame = +2

Query  239   FNFYAISCPSAELIVKNTVRSASSVDPTLPGKLLRLLFHDCFVEGCDASILLQGNDTERS  418
             F FYA SCP+AE IV+NTVRSASS DPT+PGKLLRLLFHDCFVEGCDAS+L++GN TE++
Sbjct  30    FGFYAASCPAAESIVRNTVRSASSSDPTIPGKLLRLLFHDCFVEGCDASVLIRGNGTEQN  89

Query  419   DPANKSVGGFSTVDSAKRVLEIFCPETVSCADIIALAARDAVEFVGGPSVAIPTGRRDGR  598
             DPAN S+GGFS +DSAKRVLE+FCP TVSCADIIALAARDAVE  GGP+V IPTGR+DGR
Sbjct  90    DPANTSLGGFSVIDSAKRVLELFCPGTVSCADIIALAARDAVELTGGPAVQIPTGRKDGR  149

Query  599   VSLGKNVRPNIIDTSFTMDEMMKIFAAKGLSLDDLVTLSGAHTIGSAHCSAFSDRFQLAS  778
             VS   NVRPNI+DTSFT++EM+K+F++KGLSL DLV LSGAHTIG+AHCSAFSDRFQ  S
Sbjct  150   VSAASNVRPNIVDTSFTINEMIKLFSSKGLSLADLVALSGAHTIGAAHCSAFSDRFQADS  209

Query  779   NGSFLPIdaaldhayaaelaRQCPAGASDAVTVNNDPVTPSLFDNQYYKDLLAHRGLFQS  958
              G F  ID++LD  YA EL R+CPAGAS ++TVNNDP T   FDNQYY++LL H+GLFQS
Sbjct  210   KGKFTLIDSSLDKNYAEELMRRCPAGASPSITVNNDPETSLSFDNQYYRNLLLHKGLFQS  269

Query  959   DSALLRDKRAMEKVQDFAGDQNNFFTSWEQSFLKLVSIGVKVGDDDGEIRRSCSSVN  1129
             DS L++D R  EKV++FA DQ++FF SW QSFLKL  + VK G + GE+R+SCS +N
Sbjct  270   DSVLVKDNRTREKVENFANDQDSFFASWAQSFLKLSVVEVKTG-NAGEVRQSCSLIN  325



>ref|XP_008377474.1| PREDICTED: peroxidase 18 [Malus domestica]
Length=329

 Score =   427 bits (1099),  Expect = 6e-144, Method: Compositional matrix adjust.
 Identities = 214/298 (72%), Positives = 244/298 (82%), Gaps = 1/298 (0%)
 Frame = +2

Query  239   FNFYAISCPSAELIVKNTVRSASSVDPTLPGKLLRLLFHDCFVEGCDASILLQGNDTERS  418
              NFYA SCPSAE IV+NTVRSAS +DPT+PGKLLRLLFHDCFVEGCDAS+LLQG  TERS
Sbjct  33    LNFYAASCPSAEFIVRNTVRSASDLDPTVPGKLLRLLFHDCFVEGCDASVLLQGTGTERS  92

Query  419   DPANKSVGGFSTVDSAKRVLEIFCPETVSCADIIALAARDAVEFVGGPSVAIPTGRRDGR  598
             DPAN S+GGF+ +DSAKR+LE+FCP TVSCADI+ALAARDAVEF GGP   IPTGRRDG+
Sbjct  93    DPANTSLGGFAVIDSAKRLLEVFCPGTVSCADIVALAARDAVEFXGGPVAQIPTGRRDGK  152

Query  599   VSLGKNVRPNIIDTSFTMDEMMKIFAAKGLSLDDLVTLSGAHTIGSAHCSAFSDRFQLAS  778
             VS   NVRPNI+DTSFTMDEM+K+F++KGLSL DL TLSGAHTIGSAHCSAF DRF+   
Sbjct  153   VSAASNVRPNIVDTSFTMDEMIKLFSSKGLSLVDLATLSGAHTIGSAHCSAFRDRFKQDP  212

Query  779   NGSFLPIdaaldhayaaelaRQCPAGASDAVTVNNDPVTPSLFDNQYYKDLLAHRGLFQS  958
              G F  ID +LD+ YA EL  QCPAGA+ + TV NDP T   FDNQYY++LLAHRGLFQS
Sbjct  213   KGKFTLIDTSLDNVYAEELMEQCPAGANQSTTVKNDPKTSFAFDNQYYQNLLAHRGLFQS  272

Query  959   DSALLRDKRAMEKVQDFAGDQNNFFTSWEQSFLKLVSIGVKVGDDDGEIRRSCSSVNA  1132
             DS LL D R  ++V+ FA DQ +FF SW +SFLKL SIGVK G D+GEIR SC + NA
Sbjct  273   DSVLLTDGRTRKQVEIFAQDQVSFFQSWTESFLKLASIGVKTG-DEGEIRASCPTTNA  329



>ref|XP_010246573.1| PREDICTED: peroxidase 46-like [Nelumbo nucifera]
Length=337

 Score =   427 bits (1099),  Expect = 7e-144, Method: Compositional matrix adjust.
 Identities = 210/298 (70%), Positives = 250/298 (84%), Gaps = 1/298 (0%)
 Frame = +2

Query  239   FNFYAISCPSAELIVKNTVRSASSVDPTLPGKLLRLLFHDCFVEGCDASILLQGNDTERS  418
             FNFYA SCP+AEL+V+NTVRSAS++DPT+PGKLLRLLFHDC VEGCDAS+LL+GN TERS
Sbjct  41    FNFYAASCPTAELMVRNTVRSASALDPTVPGKLLRLLFHDCMVEGCDASVLLEGNQTERS  100

Query  419   DPANKSVGGFSTVDSAKRVLEIFCPETVSCADIIALAARDAVEFVGGPSVAIPTGRRDGR  598
             DPAN S+GGFS VDSAK +LE+FCP T+SC+DI+ALAARDAVEF GGPSV IPTGRRDGR
Sbjct  101   DPANASLGGFSVVDSAKDLLELFCPGTISCSDILALAARDAVEFAGGPSVNIPTGRRDGR  160

Query  599   VSLGKNVRPNIIDTSFTMDEMMKIFAAKGLSLDDLVTLSGAHTIGSAHCSAFSDRFQLAS  778
             VS   NVRPN++DTSFT+DEM+++F++KGLSLDDLVTLSGAHTIGSAHCS FSDRFQ  S
Sbjct  161   VSSVSNVRPNMVDTSFTLDEMLELFSSKGLSLDDLVTLSGAHTIGSAHCSTFSDRFQEDS  220

Query  779   NGSFLPIdaaldhayaaelaRQCPAGASDAVTVNNDPVTPSLFDNQYYKDLLAHRGLFQS  958
             NG+   IDA+LD  YA EL +QCP GAS++VTVNNDP T  LFDNQYY++L++H+GLFQS
Sbjct  221   NGTMTSIDASLDKIYARELIKQCPIGASESVTVNNDPETSLLFDNQYYRNLISHKGLFQS  280

Query  959   DSALLRDKRAMEKVQDFAGDQNNFFTSWEQSFLKLVSIGVKVGDDDGEIRRSCSSVNA  1132
             DS L  D R   KV++ +  Q  FF  W QSF KL S+GVK G ++GEIR SC ++N 
Sbjct  281   DSVLFVDGRTKAKVEELSRSQEIFFQQWTQSFQKLCSVGVKTG-EEGEIRTSCRAING  337



>ref|XP_002285587.1| PREDICTED: peroxidase 46 [Vitis vinifera]
Length=329

 Score =   427 bits (1098),  Expect = 7e-144, Method: Compositional matrix adjust.
 Identities = 218/298 (73%), Positives = 246/298 (83%), Gaps = 1/298 (0%)
 Frame = +2

Query  239   FNFYAISCPSAELIVKNTVRSASSVDPTLPGKLLRLLFHDCFVEGCDASILLQGNDTERS  418
             FNFY  SCPSAE IVKNTVRSASS DPT+PGKLLRLLFHDC VEGCDAS+LLQGNDTERS
Sbjct  33    FNFYGASCPSAEFIVKNTVRSASSFDPTIPGKLLRLLFHDCMVEGCDASVLLQGNDTERS  92

Query  419   DPANKSVGGFSTVDSAKRVLEIFCPETVSCADIIALAARDAVEFVGGPSVAIPTGRRDGR  598
             DPAN S+GGFS ++SAKRVLEIFCP TVSCADI+ALAARDAVE VGGP + IPTGRRDGR
Sbjct  93    DPANASLGGFSVINSAKRVLEIFCPGTVSCADILALAARDAVEIVGGPMLQIPTGRRDGR  152

Query  599   VSLGKNVRPNIIDTSFTMDEMMKIFAAKGLSLDDLVTLSGAHTIGSAHCSAFSDRFQLAS  778
              S+   VR NIIDTSF+MDEMMK+F++KGLSLDDLV LSGAHTIGSAHCSAFSDRFQ  S
Sbjct  153   ASVASVVRFNIIDTSFSMDEMMKLFSSKGLSLDDLVILSGAHTIGSAHCSAFSDRFQADS  212

Query  779   NGSFLPIdaaldhayaaelaRQCPAGASDAVTVNNDPVTPSLFDNQYYKDLLAHRGLFQS  958
              G+   ID +LD AYA EL ++CP+  S +VTVNNDP T  LFDNQYY++L+AH+GLFQS
Sbjct  213   KGTLTRIDTSLDKAYANELRKKCPSSVSSSVTVNNDPETSFLFDNQYYRNLMAHKGLFQS  272

Query  959   DSALLRDKRAMEKVQDFAGDQNNFFTSWEQSFLKLVSIGVKVGDDDGEIRRSCSSVNA  1132
             DS L  DKR  + V+D A +QN+FF  W QSFLKL  IGVK  DD+GEIR+SC   N 
Sbjct  273   DSVLFSDKRTKKMVEDLANNQNSFFERWGQSFLKLTIIGVK-SDDEGEIRQSCEVANG  329



>ref|XP_011028045.1| PREDICTED: peroxidase 46-like isoform X2 [Populus euphratica]
Length=334

 Score =   427 bits (1098),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 213/294 (72%), Positives = 241/294 (82%), Gaps = 1/294 (0%)
 Frame = +2

Query  239   FNFYAISCPSAELIVKNTVRSASSVDPTLPGKLLRLLFHDCFVEGCDASILLQGNDTERS  418
             FNFY  SCP+AELIV NTVRSASS DPT+PGKLLRL+FHDCFVEGCDAS+LLQGN TERS
Sbjct  38    FNFYGASCPTAELIVSNTVRSASSSDPTIPGKLLRLVFHDCFVEGCDASVLLQGNGTERS  97

Query  419   DPANKSVGGFSTVDSAKRVLEIFCPETVSCADIIALAARDAVEFVGGPSVAIPTGRRDGR  598
             DP N+S+GGF  +DSAKR+LEIFCP TVSCAD++ALAARDAV   GGP + IPTGRRDGR
Sbjct  98    DPGNRSLGGFQVIDSAKRMLEIFCPGTVSCADVVALAARDAVAITGGPQLQIPTGRRDGR  157

Query  599   VSLGKNVRPNIIDTSFTMDEMMKIFAAKGLSLDDLVTLSGAHTIGSAHCSAFSDRFQLAS  778
             VS   NVRPNIIDT+FTM+EM+ IF AKGLS++DLV LSGAHTIGSAHCSAFSDRFQ  S
Sbjct  158   VSAAANVRPNIIDTTFTMNEMINIFTAKGLSIEDLVVLSGAHTIGSAHCSAFSDRFQEDS  217

Query  779   NGSFLPIdaaldhayaaelaRQCPAGASDAVTVNNDPVTPSLFDNQYYKDLLAHRGLFQS  958
              G    ID +LD  YA EL ++CP  AS ++TV NDP T S FDNQYY++L+AH+GLFQS
Sbjct  218   KGKLTLIDTSLDRNYANELMQRCPVDASASITVVNDPETSSSFDNQYYRNLVAHKGLFQS  277

Query  959   DSALLRDKRAMEKVQDFAGDQNNFFTSWEQSFLKLVSIGVKVGDDDGEIRRSCS  1120
             DS LL DKR    VQDFA DQ  FF SW QSFLKL SIGVK G ++GEIR+SCS
Sbjct  278   DSVLLDDKRTRNLVQDFANDQEKFFQSWSQSFLKLTSIGVKTG-EEGEIRQSCS  330



>ref|XP_009359075.1| PREDICTED: peroxidase 18-like [Pyrus x bretschneideri]
 ref|XP_009359158.1| PREDICTED: peroxidase 18-like [Pyrus x bretschneideri]
Length=329

 Score =   427 bits (1097),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 214/298 (72%), Positives = 245/298 (82%), Gaps = 1/298 (0%)
 Frame = +2

Query  239   FNFYAISCPSAELIVKNTVRSASSVDPTLPGKLLRLLFHDCFVEGCDASILLQGNDTERS  418
              NFYA SCPSAE IV+NTV SAS++DPT+PGKLLRLLFHDCFVEGCDAS+LLQG  TERS
Sbjct  33    LNFYAASCPSAEFIVRNTVSSASNLDPTVPGKLLRLLFHDCFVEGCDASVLLQGTGTERS  92

Query  419   DPANKSVGGFSTVDSAKRVLEIFCPETVSCADIIALAARDAVEFVGGPSVAIPTGRRDGR  598
             DPAN S+GGF+ +DSAKR+LEIFCP TVSCADI+ALAARDAVEF GGP V IPTGRRDG+
Sbjct  93    DPANTSLGGFAVIDSAKRLLEIFCPGTVSCADIVALAARDAVEFAGGPVVQIPTGRRDGK  152

Query  599   VSLGKNVRPNIIDTSFTMDEMMKIFAAKGLSLDDLVTLSGAHTIGSAHCSAFSDRFQLAS  778
              S   NVRPNI+DTSFTMDEM+K+F++KGLSL DL TLSGAHTIGSAHCSAF DRF+   
Sbjct  153   ASAASNVRPNIVDTSFTMDEMIKLFSSKGLSLVDLATLSGAHTIGSAHCSAFRDRFKQDP  212

Query  779   NGSFLPIdaaldhayaaelaRQCPAGASDAVTVNNDPVTPSLFDNQYYKDLLAHRGLFQS  958
              G F  ID +LD+ YA EL  QCPAGA+ + TV NDP T  +FDNQYY++LLAHRGLFQS
Sbjct  213   KGKFTLIDTSLDNVYAEELMEQCPAGANPSTTVKNDPKTSFVFDNQYYQNLLAHRGLFQS  272

Query  959   DSALLRDKRAMEKVQDFAGDQNNFFTSWEQSFLKLVSIGVKVGDDDGEIRRSCSSVNA  1132
             DS LL D R  ++V+ FA DQ +FF SW +SFLKL SIGVK G D+GEIR SC + NA
Sbjct  273   DSVLLTDGRTRKQVEIFAQDQVSFFKSWTESFLKLASIGVKTG-DEGEIRASCPTTNA  329



>ref|XP_002324930.1| hypothetical protein POPTR_0018s02910g [Populus trichocarpa]
 gb|EEF03495.1| hypothetical protein POPTR_0018s02910g [Populus trichocarpa]
 gb|AHL39193.1| class III peroxidase [Populus trichocarpa]
Length=334

 Score =   427 bits (1097),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 213/294 (72%), Positives = 241/294 (82%), Gaps = 1/294 (0%)
 Frame = +2

Query  239   FNFYAISCPSAELIVKNTVRSASSVDPTLPGKLLRLLFHDCFVEGCDASILLQGNDTERS  418
             FNFY  SCP+AELIV NTVRSASS DPT+PGKLLRL+FHDCFVEGCDAS+LLQGN TERS
Sbjct  38    FNFYGASCPTAELIVSNTVRSASSSDPTIPGKLLRLVFHDCFVEGCDASVLLQGNGTERS  97

Query  419   DPANKSVGGFSTVDSAKRVLEIFCPETVSCADIIALAARDAVEFVGGPSVAIPTGRRDGR  598
             DP N+S+GGF  +DSAKR+LEIFCP TVSCAD++ALAARDAV   GGP + IPTGRRDGR
Sbjct  98    DPGNRSLGGFQVIDSAKRMLEIFCPGTVSCADVVALAARDAVAITGGPQLQIPTGRRDGR  157

Query  599   VSLGKNVRPNIIDTSFTMDEMMKIFAAKGLSLDDLVTLSGAHTIGSAHCSAFSDRFQLAS  778
             +S   NVRPNIIDT+FTM+EM+ IF AKGLSL+DLV LSGAHTIGSAHCSAFSDRFQ  S
Sbjct  158   LSAAANVRPNIIDTTFTMNEMINIFTAKGLSLEDLVVLSGAHTIGSAHCSAFSDRFQEDS  217

Query  779   NGSFLPIdaaldhayaaelaRQCPAGASDAVTVNNDPVTPSLFDNQYYKDLLAHRGLFQS  958
              G    ID +LD  YA EL ++CP  AS ++TV NDP T S FDNQYY++L+AH+GLFQS
Sbjct  218   KGKLTLIDTSLDRNYANELMQRCPVDASASITVVNDPETSSSFDNQYYRNLVAHKGLFQS  277

Query  959   DSALLRDKRAMEKVQDFAGDQNNFFTSWEQSFLKLVSIGVKVGDDDGEIRRSCS  1120
             DS LL DKR    VQDFA DQ  FF SW QSFLKL SIGVK G ++GEIR+SCS
Sbjct  278   DSVLLDDKRTRNLVQDFANDQEKFFQSWSQSFLKLTSIGVKTG-EEGEIRQSCS  330



>ref|XP_011082007.1| PREDICTED: peroxidase 46 [Sesamum indicum]
Length=340

 Score =   427 bits (1097),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 211/297 (71%), Positives = 253/297 (85%), Gaps = 2/297 (1%)
 Frame = +2

Query  242   NFYAISCPSAELIVKNTVRSASSVDPTLPGKLLRLLFHDCFVEGCDASILLQGNDTERSD  421
             +FY  +CP+AE++VK+TVRSAS +DPT+PGKLLRLLFHDCFVEGCDAS+LLQGN TE SD
Sbjct  43    DFYTGTCPAAEMMVKDTVRSASDLDPTIPGKLLRLLFHDCFVEGCDASVLLQGNGTELSD  102

Query  422   PANKSVGGFSTVDSAKRVLEIFCPETVSCADIIALAARDAVEFVGGPSVAIPTGRRDGRV  601
             PANKS+GGFS +D+AKRVLEIFCPETVSCADI+ALAARDAVEF GGP++ IPTGRRDGR+
Sbjct  103   PANKSLGGFSVIDAAKRVLEIFCPETVSCADILALAARDAVEFAGGPNIQIPTGRRDGRI  162

Query  602   SLGKNVRPNIIDTSFTMDEMMKIFAAKGLSLDDLVTLSGAHTIGSAHCSAFSDRFQLASN  781
             SL  NVRPNIIDTSFT+DEM K+F AKGLS+DD+VTLSGAHTIG+AHCS+F+DRF+L SN
Sbjct  163   SLAANVRPNIIDTSFTLDEMAKVFTAKGLSMDDIVTLSGAHTIGTAHCSSFNDRFKLDSN  222

Query  782   GSFLPIdaaldhayaaelaRQCPAGA-SDAVTVNNDPVTPSLFDNQYYKDLLAHRGLFQS  958
             G+   ID++LD  YAA L + CP+GA  D+VTV+NDP TP LFDNQYY+ LL H+GLFQS
Sbjct  223   GNLTLIDSSLDRQYAAHLTKMCPSGAIDDSVTVSNDPSTPLLFDNQYYRILLEHKGLFQS  282

Query  959   DSALLRDKRAMEKVQDFAGDQNNFFTSWEQSFLKLVSIGVKVGDDDGEIRRSCSSVN  1129
             DSALL D+R   +V +FA +Q++F+  W  SF KL  IGVK  DD+GEIR+SCS  N
Sbjct  283   DSALLNDERTRNRVLEFANNQDSFYERWAVSFSKLTGIGVKT-DDEGEIRQSCSLSN  338



>ref|XP_010268457.1| PREDICTED: peroxidase 46-like isoform X3 [Nelumbo nucifera]
Length=312

 Score =   425 bits (1093),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 207/298 (69%), Positives = 249/298 (84%), Gaps = 1/298 (0%)
 Frame = +2

Query  239   FNFYAISCPSAELIVKNTVRSASSVDPTLPGKLLRLLFHDCFVEGCDASILLQGNDTERS  418
             F+FYA SCP+AE +VKNT+RSAS+ DPT+P KLLRLLFHDC VEGCD S+LL+GN+TERS
Sbjct  16    FDFYAASCPTAEAMVKNTLRSASTDDPTIPAKLLRLLFHDCMVEGCDGSVLLEGNETERS  75

Query  419   DPANKSVGGFSTVDSAKRVLEIFCPETVSCADIIALAARDAVEFVGGPSVAIPTGRRDGR  598
             DPAN S+GGFS V+SAK +LE+FCPETVSCADI+ALAARDAVEF GGPS+ IPTGRRDGR
Sbjct  76    DPANASLGGFSVVESAKGLLELFCPETVSCADILALAARDAVEFAGGPSIQIPTGRRDGR  135

Query  599   VSLGKNVRPNIIDTSFTMDEMMKIFAAKGLSLDDLVTLSGAHTIGSAHCSAFSDRFQLAS  778
             VS   NVRPNI+DTSFTMDEM+++F++KGLSL+DLVTLSGAHTIGSAHCS+FSDRFQ  S
Sbjct  136   VSSVSNVRPNIVDTSFTMDEMLELFSSKGLSLEDLVTLSGAHTIGSAHCSSFSDRFQEDS  195

Query  779   NGSFLPIdaaldhayaaelaRQCPAGASDAVTVNNDPVTPSLFDNQYYKDLLAHRGLFQS  958
              G+  PIDA+LD  YA EL +QCPAG   ++TVNNDP T  LFDNQYY++L++H+GLFQS
Sbjct  196   KGNLTPIDASLDRIYANELIKQCPAGVDKSITVNNDPETSLLFDNQYYRNLISHKGLFQS  255

Query  959   DSALLRDKRAMEKVQDFAGDQNNFFTSWEQSFLKLVSIGVKVGDDDGEIRRSCSSVNA  1132
             DS L  D R   KV++F+  Q  FF  W +SFLKL S+GVK G D+GE+R SC ++N 
Sbjct  256   DSVLFSDGRTKAKVEEFSDSQYMFFEKWTESFLKLSSVGVKTG-DEGEVRTSCRAING  312



>ref|XP_010268455.1| PREDICTED: peroxidase 46-like isoform X1 [Nelumbo nucifera]
Length=336

 Score =   425 bits (1092),  Expect = 8e-143, Method: Compositional matrix adjust.
 Identities = 207/298 (69%), Positives = 249/298 (84%), Gaps = 1/298 (0%)
 Frame = +2

Query  239   FNFYAISCPSAELIVKNTVRSASSVDPTLPGKLLRLLFHDCFVEGCDASILLQGNDTERS  418
             F+FYA SCP+AE +VKNT+RSAS+ DPT+P KLLRLLFHDC VEGCD S+LL+GN+TERS
Sbjct  40    FDFYAASCPTAEAMVKNTLRSASTDDPTIPAKLLRLLFHDCMVEGCDGSVLLEGNETERS  99

Query  419   DPANKSVGGFSTVDSAKRVLEIFCPETVSCADIIALAARDAVEFVGGPSVAIPTGRRDGR  598
             DPAN S+GGFS V+SAK +LE+FCPETVSCADI+ALAARDAVEF GGPS+ IPTGRRDGR
Sbjct  100   DPANASLGGFSVVESAKGLLELFCPETVSCADILALAARDAVEFAGGPSIQIPTGRRDGR  159

Query  599   VSLGKNVRPNIIDTSFTMDEMMKIFAAKGLSLDDLVTLSGAHTIGSAHCSAFSDRFQLAS  778
             VS   NVRPNI+DTSFTMDEM+++F++KGLSL+DLVTLSGAHTIGSAHCS+FSDRFQ  S
Sbjct  160   VSSVSNVRPNIVDTSFTMDEMLELFSSKGLSLEDLVTLSGAHTIGSAHCSSFSDRFQEDS  219

Query  779   NGSFLPIdaaldhayaaelaRQCPAGASDAVTVNNDPVTPSLFDNQYYKDLLAHRGLFQS  958
              G+  PIDA+LD  YA EL +QCPAG   ++TVNNDP T  LFDNQYY++L++H+GLFQS
Sbjct  220   KGNLTPIDASLDRIYANELIKQCPAGVDKSITVNNDPETSLLFDNQYYRNLISHKGLFQS  279

Query  959   DSALLRDKRAMEKVQDFAGDQNNFFTSWEQSFLKLVSIGVKVGDDDGEIRRSCSSVNA  1132
             DS L  D R   KV++F+  Q  FF  W +SFLKL S+GVK G D+GE+R SC ++N 
Sbjct  280   DSVLFSDGRTKAKVEEFSDSQYMFFEKWTESFLKLSSVGVKTG-DEGEVRTSCRAING  336



>ref|XP_006450240.1| hypothetical protein CICLE_v10008792mg [Citrus clementina]
 gb|ESR63480.1| hypothetical protein CICLE_v10008792mg [Citrus clementina]
Length=350

 Score =   424 bits (1091),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 209/298 (70%), Positives = 249/298 (84%), Gaps = 1/298 (0%)
 Frame = +2

Query  239   FNFYAISCPSAELIVKNTVRSASSVDPTLPGKLLRLLFHDCFVEGCDASILLQGNDTERS  418
             FNFYA SCPSAE +V NTVRSASS D T+PGKLLRLLFHDCFVEGCDAS+LLQGN TERS
Sbjct  54    FNFYAASCPSAEFMVANTVRSASSFDRTIPGKLLRLLFHDCFVEGCDASVLLQGNGTERS  113

Query  419   DPANKSVGGFSTVDSAKRVLEIFCPETVSCADIIALAARDAVEFVGGPSVAIPTGRRDGR  598
             DPAN S+GGF  +DSAKRVLEIFCP TVSCADIIALAARD+VE  GGP++ IPTGRRDGR
Sbjct  114   DPANASLGGFEVIDSAKRVLEIFCPGTVSCADIIALAARDSVEIAGGPAIQIPTGRRDGR  173

Query  599   VSLGKNVRPNIIDTSFTMDEMMKIFAAKGLSLDDLVTLSGAHTIGSAHCSAFSDRFQLAS  778
              S  +NVR NI+DT+FTM+EM+K F++KGLS+DDLVTLSGAHTIGSAHC+AF+DRF+   
Sbjct  174   ASAAENVRANIVDTTFTMNEMIKAFSSKGLSMDDLVTLSGAHTIGSAHCNAFNDRFREDP  233

Query  779   NGSFLPIdaaldhayaaelaRQCPAGASDAVTVNNDPVTPSLFDNQYYKDLLAHRGLFQS  958
              G    ID +LD +YA EL R+CPA AS +VTVNNDP T  +FDNQYY++LLAH+GLFQS
Sbjct  234   KGKLTLIDTSLDSSYANELMRKCPANASSSVTVNNDPETSFVFDNQYYRNLLAHKGLFQS  293

Query  959   DSALLRDKRAMEKVQDFAGDQNNFFTSWEQSFLKLVSIGVKVGDDDGEIRRSCSSVNA  1132
             DS LL D+R  ++V++FA DQ +FF++W  SFLK+ SIGVK  +D+GEIR++CS  N 
Sbjct  294   DSVLLHDERTRKQVENFANDQESFFSNWGLSFLKVTSIGVKT-EDEGEIRQTCSMTNG  350



>gb|KDO67380.1| hypothetical protein CISIN_1g019972mg [Citrus sinensis]
Length=333

 Score =   423 bits (1087),  Expect = 4e-142, Method: Compositional matrix adjust.
 Identities = 209/298 (70%), Positives = 249/298 (84%), Gaps = 1/298 (0%)
 Frame = +2

Query  239   FNFYAISCPSAELIVKNTVRSASSVDPTLPGKLLRLLFHDCFVEGCDASILLQGNDTERS  418
             FNFYA SCPSAE +V NTVRSASS D T+PGKLLRLLFHDCFVEGCDAS+LLQGN TERS
Sbjct  37    FNFYAASCPSAEFMVANTVRSASSFDRTIPGKLLRLLFHDCFVEGCDASVLLQGNGTERS  96

Query  419   DPANKSVGGFSTVDSAKRVLEIFCPETVSCADIIALAARDAVEFVGGPSVAIPTGRRDGR  598
             DPAN S+GGF  +DSAKRVLEIFCP TVSCADIIALAARD+VE  GGP++ IPTGRRDGR
Sbjct  97    DPANASLGGFEVIDSAKRVLEIFCPGTVSCADIIALAARDSVEIAGGPAIQIPTGRRDGR  156

Query  599   VSLGKNVRPNIIDTSFTMDEMMKIFAAKGLSLDDLVTLSGAHTIGSAHCSAFSDRFQLAS  778
              S  +NVR NI+DT+FTM+EM+K F++KGLS+DDLVTLSGAHTIGSAHC+AF+DRF+   
Sbjct  157   ASAAENVRANIVDTTFTMNEMIKAFSSKGLSMDDLVTLSGAHTIGSAHCNAFNDRFREDP  216

Query  779   NGSFLPIdaaldhayaaelaRQCPAGASDAVTVNNDPVTPSLFDNQYYKDLLAHRGLFQS  958
              G    ID +LD +YA EL R+CPA AS +VTVNNDP T  +FDNQYY++LLAH+GLFQS
Sbjct  217   KGKLTLIDTSLDSSYANELMRKCPANASSSVTVNNDPETSFVFDNQYYRNLLAHKGLFQS  276

Query  959   DSALLRDKRAMEKVQDFAGDQNNFFTSWEQSFLKLVSIGVKVGDDDGEIRRSCSSVNA  1132
             DS LL D+R  ++V++FA DQ +FF++W  SFLK+ SIGVK  +D+GEIR++CS  N 
Sbjct  277   DSVLLHDERTRKQVENFANDQESFFSNWGLSFLKVTSIGVKT-EDEGEIRQTCSMTNG  333



>gb|EYU22025.1| hypothetical protein MIMGU_mgv1a021862mg [Erythranthe guttata]
Length=320

 Score =   422 bits (1086),  Expect = 4e-142, Method: Compositional matrix adjust.
 Identities = 208/297 (70%), Positives = 246/297 (83%), Gaps = 1/297 (0%)
 Frame = +2

Query  239   FNFYAISCPSAELIVKNTVRSASSVDPTLPGKLLRLLFHDCFVEGCDASILLQGNDTERS  418
             F+FY +SCP  EL VKNTVRSAS VDPT+PGKLLRLLFHDCFV GCDAS+LLQGN TERS
Sbjct  24    FDFYTLSCPVVELTVKNTVRSASDVDPTIPGKLLRLLFHDCFVNGCDASVLLQGNATERS  83

Query  419   DPANKSVGGFSTVDSAKRVLEIFCPETVSCADIIALAARDAVEFVGGPSVAIPTGRRDGR  598
             DPAN+S+GGFS +DSAKRVLEIFCP TVSCADI+ALAARDAVEF GGP++ IPTGR+DGR
Sbjct  84    DPANQSLGGFSVIDSAKRVLEIFCPGTVSCADILALAARDAVEFTGGPNIQIPTGRKDGR  143

Query  599   VSLGKNVRPNIIDTSFTMDEMMKIFAAKGLSLDDLVTLSGAHTIGSAHCSAFSDRFQLAS  778
             +S+  NVRPNIIDTSFT+DEM+KIF+AKGLS+DDLVTLSGAHTIG +HC +F+DRF++ S
Sbjct  144   ISMAANVRPNIIDTSFTLDEMIKIFSAKGLSIDDLVTLSGAHTIGRSHCGSFNDRFKVDS  203

Query  779   NGSFLPIdaaldhayaaelaRQCPAGASDAVTVNNDPVTPSLFDNQYYKDLLAHRGLFQS  958
             NG+   ID +LD  YA +L + CP   +D VTVNNDP +P  FDN Y+K LLAH+GLFQS
Sbjct  204   NGNLTLIDLSLDRQYATQLMKMCPNNNNDRVTVNNDPSSPLQFDNAYFKILLAHKGLFQS  263

Query  959   DSALLRDKRAMEKVQDFAGDQNNFFTSWEQSFLKLVSIGVKVGDDDGEIRRSCSSVN  1129
             DSALL D+R   +V +FA  Q++FF  W  SFLKL S+GVK G  +GEIR+SCS  N
Sbjct  264   DSALLNDERTKNRVVEFANSQDSFFERWSSSFLKLSSVGVKTG-GEGEIRQSCSMSN  319



>ref|XP_004145577.1| PREDICTED: peroxidase 46-like [Cucumis sativus]
 ref|XP_004157132.1| PREDICTED: peroxidase 46-like [Cucumis sativus]
 gb|KGN55409.1| hypothetical protein Csa_4G651760 [Cucumis sativus]
Length=327

 Score =   422 bits (1086),  Expect = 4e-142, Method: Compositional matrix adjust.
 Identities = 208/297 (70%), Positives = 248/297 (84%), Gaps = 1/297 (0%)
 Frame = +2

Query  239   FNFYAISCPSAELIVKNTVRSASSVDPTLPGKLLRLLFHDCFVEGCDASILLQGNDTERS  418
             F FYA +CP+AEL+V+NTVRSASSVDPT+PGKLLRLLFHDCFVEGCDAS+L++GN TERS
Sbjct  31    FGFYAATCPAAELMVRNTVRSASSVDPTVPGKLLRLLFHDCFVEGCDASVLVEGNGTERS  90

Query  419   DPANKSVGGFSTVDSAKRVLEIFCPETVSCADIIALAARDAVEFVGGPSVAIPTGRRDGR  598
             DPANKS+GGF  +DSAKR LEIFCP TVSCADI+ LAARDAVEF GGPSV +PTGRRDG+
Sbjct  91    DPANKSLGGFEVIDSAKRTLEIFCPGTVSCADIVVLAARDAVEFTGGPSVQVPTGRRDGK  150

Query  599   VSLGKNVRPNIIDTSFTMDEMMKIFAAKGLSLDDLVTLSGAHTIGSAHCSAFSDRFQLAS  778
             +S   NVRPNI DTSF++++MM +F++KGLS+DDLV LSGAHTIG++HCSAFSDRF+   
Sbjct  151   ISAASNVRPNIADTSFSVNQMMNLFSSKGLSVDDLVILSGAHTIGTSHCSAFSDRFRRNP  210

Query  779   NGSFLPIdaaldhayaaelaRQCPAGASDAVTVNNDPVTPSLFDNQYYKDLLAHRGLFQS  958
             NG    IDA+LD AYA EL R+CPAGAS A TV NDP T S+FDNQYY+++L+HRGL QS
Sbjct  211   NGQLTLIDASLDGAYADELMRRCPAGASTAATVENDPATSSVFDNQYYRNILSHRGLLQS  270

Query  959   DSALLRDKRAMEKVQDFAGDQNNFFTSWEQSFLKLVSIGVKVGDDDGEIRRSCSSVN  1129
             DS L+ D R   +V+ FA D+  FF +W QSFLKL S+GVK G D+GEIR SCS+ N
Sbjct  271   DSVLISDGRTRARVESFANDEIGFFENWAQSFLKLSSVGVKSG-DEGEIRLSCSTPN  326



>ref|XP_008452817.1| PREDICTED: peroxidase 18 [Cucumis melo]
Length=327

 Score =   422 bits (1085),  Expect = 7e-142, Method: Compositional matrix adjust.
 Identities = 207/297 (70%), Positives = 248/297 (84%), Gaps = 1/297 (0%)
 Frame = +2

Query  239   FNFYAISCPSAELIVKNTVRSASSVDPTLPGKLLRLLFHDCFVEGCDASILLQGNDTERS  418
             F FYA +CP+AEL+V+NTVRSASSVDPT+PGKLLRLLFHDCFVEGCDAS+L++GN TERS
Sbjct  31    FGFYAATCPAAELMVRNTVRSASSVDPTVPGKLLRLLFHDCFVEGCDASVLVEGNGTERS  90

Query  419   DPANKSVGGFSTVDSAKRVLEIFCPETVSCADIIALAARDAVEFVGGPSVAIPTGRRDGR  598
             DPANKS+GGF  +DSAKR LEIFCP TVSCADI+ LAARDAVEF GGPSV +PTGRRDG+
Sbjct  91    DPANKSLGGFEVIDSAKRTLEIFCPGTVSCADIVVLAARDAVEFTGGPSVEVPTGRRDGK  150

Query  599   VSLGKNVRPNIIDTSFTMDEMMKIFAAKGLSLDDLVTLSGAHTIGSAHCSAFSDRFQLAS  778
             +S   NVRPNI DTSF++++MM +F++KGLS+DDLV LSGAHTIG++HCSAFSDRF+   
Sbjct  151   ISAASNVRPNIADTSFSVNQMMNLFSSKGLSVDDLVILSGAHTIGTSHCSAFSDRFRRNP  210

Query  779   NGSFLPIdaaldhayaaelaRQCPAGASDAVTVNNDPVTPSLFDNQYYKDLLAHRGLFQS  958
             NG    IDA+LD +YA EL R+CPAGA+ A TV NDP T  +FDNQYY+++L+H+GL QS
Sbjct  211   NGQLTLIDASLDGSYADELMRRCPAGAATAATVENDPATAFVFDNQYYRNILSHKGLLQS  270

Query  959   DSALLRDKRAMEKVQDFAGDQNNFFTSWEQSFLKLVSIGVKVGDDDGEIRRSCSSVN  1129
             DS L+ D R   +V+ FA DQ  FF +W QSFLKL SIGVK G D+GEIR SCS+VN
Sbjct  271   DSVLISDGRTRARVESFANDQIGFFENWAQSFLKLSSIGVKSG-DEGEIRLSCSTVN  326



>ref|XP_011028044.1| PREDICTED: peroxidase 46-like isoform X1 [Populus euphratica]
Length=339

 Score =   421 bits (1082),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 213/299 (71%), Positives = 241/299 (81%), Gaps = 6/299 (2%)
 Frame = +2

Query  239   FNFYAISCPSAELIVKNTVRSASSVDPTLPGKLLRLLFHDCFVE-----GCDASILLQGN  403
             FNFY  SCP+AELIV NTVRSASS DPT+PGKLLRL+FHDCFVE     GCDAS+LLQGN
Sbjct  38    FNFYGASCPTAELIVSNTVRSASSSDPTIPGKLLRLVFHDCFVEMSWLQGCDASVLLQGN  97

Query  404   DTERSDPANKSVGGFSTVDSAKRVLEIFCPETVSCADIIALAARDAVEFVGGPSVAIPTG  583
              TERSDP N+S+GGF  +DSAKR+LEIFCP TVSCAD++ALAARDAV   GGP + IPTG
Sbjct  98    GTERSDPGNRSLGGFQVIDSAKRMLEIFCPGTVSCADVVALAARDAVAITGGPQLQIPTG  157

Query  584   RRDGRVSLGKNVRPNIIDTSFTMDEMMKIFAAKGLSLDDLVTLSGAHTIGSAHCSAFSDR  763
             RRDGRVS   NVRPNIIDT+FTM+EM+ IF AKGLS++DLV LSGAHTIGSAHCSAFSDR
Sbjct  158   RRDGRVSAAANVRPNIIDTTFTMNEMINIFTAKGLSIEDLVVLSGAHTIGSAHCSAFSDR  217

Query  764   FQLASNGSFLPIdaaldhayaaelaRQCPAGASDAVTVNNDPVTPSLFDNQYYKDLLAHR  943
             FQ  S G    ID +LD  YA EL ++CP  AS ++TV NDP T S FDNQYY++L+AH+
Sbjct  218   FQEDSKGKLTLIDTSLDRNYANELMQRCPVDASASITVVNDPETSSSFDNQYYRNLVAHK  277

Query  944   GLFQSDSALLRDKRAMEKVQDFAGDQNNFFTSWEQSFLKLVSIGVKVGDDDGEIRRSCS  1120
             GLFQSDS LL DKR    VQDFA DQ  FF SW QSFLKL SIGVK G ++GEIR+SCS
Sbjct  278   GLFQSDSVLLDDKRTRNLVQDFANDQEKFFQSWSQSFLKLTSIGVKTG-EEGEIRQSCS  335



>ref|XP_010108290.1| Peroxidase 46 [Morus notabilis]
 gb|EXC18770.1| Peroxidase 46 [Morus notabilis]
Length=334

 Score =   420 bits (1080),  Expect = 5e-141, Method: Compositional matrix adjust.
 Identities = 210/298 (70%), Positives = 246/298 (83%), Gaps = 1/298 (0%)
 Frame = +2

Query  239   FNFYAISCPSAELIVKNTVRSASSVDPTLPGKLLRLLFHDCFVEGCDASILLQGNDTERS  418
             F FY+++CPSAE  V+NTVR+ASS DPT+PGKLLRL+FHDCFVEGCDAS+LLQGN TERS
Sbjct  38    FGFYSVACPSAEFTVRNTVRTASSRDPTIPGKLLRLVFHDCFVEGCDASVLLQGNGTERS  97

Query  419   DPANKSVGGFSTVDSAKRVLEIFCPETVSCADIIALAARDAVEFVGGPSVAIPTGRRDGR  598
             DPAN S+ G+S +DSAKRVLE FCPETVSCADI+ALAARDAVEF GGP+V IPTGRRDG+
Sbjct  98    DPANGSLDGYSVIDSAKRVLEFFCPETVSCADIVALAARDAVEFAGGPAVQIPTGRRDGK  157

Query  599   VSLGKNVRPNIIDTSFTMDEMMKIFAAKGLSLDDLVTLSGAHTIGSAHCSAFSDRFQLAS  778
             VS   NVRPNIIDTSFT++EM K+F++KGLSLDDLV LSGAHTIG AHCSAFSDRF+  S
Sbjct  158   VSSASNVRPNIIDTSFTINEMTKLFSSKGLSLDDLVILSGAHTIGRAHCSAFSDRFKEDS  217

Query  779   NGSFLPIdaaldhayaaelaRQCPAGASDAVTVNNDPVTPSLFDNQYYKDLLAHRGLFQS  958
              G    IDA+LD  YA EL +QCPA  + + TVN DP T SLFDNQYYK+L++ +GLFQS
Sbjct  218   KGKLTLIDASLDGTYAEELMKQCPAQPNPSTTVNTDPETSSLFDNQYYKNLMSKKGLFQS  277

Query  959   DSALLRDKRAMEKVQDFAGDQNNFFTSWEQSFLKLVSIGVKVGDDDGEIRRSCSSVNA  1132
             DS L  D R  E  ++FA DQ +FF SW +SF+KL +IGVK G D+GEIR SCSS+NA
Sbjct  278   DSVLFSDDRTRELAENFANDQFSFFNSWSRSFVKLTNIGVKTG-DEGEIRVSCSSLNA  334



>ref|XP_008220634.1| PREDICTED: peroxidase 18-like [Prunus mume]
Length=328

 Score =   419 bits (1078),  Expect = 7e-141, Method: Compositional matrix adjust.
 Identities = 214/298 (72%), Positives = 243/298 (82%), Gaps = 1/298 (0%)
 Frame = +2

Query  239   FNFYAISCPSAELIVKNTVRSASSVDPTLPGKLLRLLFHDCFVEGCDASILLQGNDTERS  418
              +FY+ SCPSAEL+VKNTVRSAS +DPT+PGKLLRLLFHDCFVEGCDAS+LLQG  TERS
Sbjct  32    LSFYSASCPSAELMVKNTVRSASDMDPTIPGKLLRLLFHDCFVEGCDASVLLQGTGTERS  91

Query  419   DPANKSVGGFSTVDSAKRVLEIFCPETVSCADIIALAARDAVEFVGGPSVAIPTGRRDGR  598
             DPAN S+GGFS +DSAKR+LEIFCP TVSCADI+ LAARDAVE  GGP V IPTGRRDG+
Sbjct  92    DPANTSLGGFSVIDSAKRLLEIFCPGTVSCADIVVLAARDAVEIAGGPVVQIPTGRRDGK  151

Query  599   VSLGKNVRPNIIDTSFTMDEMMKIFAAKGLSLDDLVTLSGAHTIGSAHCSAFSDRFQLAS  778
             VS   NVRPNI+DTSFTMDEM+K+F +KGLSLDDLVTLSGAHTIGSAHC AFSDRFQ  S
Sbjct  152   VSAASNVRPNIVDTSFTMDEMIKLFLSKGLSLDDLVTLSGAHTIGSAHCGAFSDRFQQDS  211

Query  779   NGSFLPIdaaldhayaaelaRQCPAGASDAVTVNNDPVTPSLFDNQYYKDLLAHRGLFQS  958
              G    ID +LD+AYA EL RQCPA A+ + TV  DP T  +FDNQYY++L+AHRGLFQS
Sbjct  212   KGKLKLIDTSLDNAYAGELMRQCPADANPSTTVKIDPNTSFVFDNQYYQNLIAHRGLFQS  271

Query  959   DSALLRDKRAMEKVQDFAGDQNNFFTSWEQSFLKLVSIGVKVGDDDGEIRRSCSSVNA  1132
             DS LL D R  + V+  A D+  FF SW QSFLKL SIGVK G ++GEIR SC + NA
Sbjct  272   DSVLLTDDRTRKLVESLAQDKVIFFESWAQSFLKLASIGVKTG-EEGEIRASCPTTNA  328



>ref|XP_011031408.1| PREDICTED: peroxidase 46-like [Populus euphratica]
Length=349

 Score =   417 bits (1073),  Expect = 9e-140, Method: Compositional matrix adjust.
 Identities = 210/298 (70%), Positives = 238/298 (80%), Gaps = 1/298 (0%)
 Frame = +2

Query  239   FNFYAISCPSAELIVKNTVRSASSVDPTLPGKLLRLLFHDCFVEGCDASILLQGNDTERS  418
             FNFY  SCP+AELIV NTVRSASS DPT+PGKL+RL+FHDCFVEGCDAS+LLQGN TER 
Sbjct  53    FNFYGASCPAAELIVSNTVRSASSSDPTIPGKLVRLVFHDCFVEGCDASVLLQGNGTERR  112

Query  419   DPANKSVGGFSTVDSAKRVLEIFCPETVSCADIIALAARDAVEFVGGPSVAIPTGRRDGR  598
             DP N+S+GGF  +DSAKR LEIFCP TVSCAD++ALAARDAV   GGP + IPTGRRDGR
Sbjct  113   DPGNRSLGGFQVIDSAKRNLEIFCPGTVSCADVVALAARDAVAISGGPQLQIPTGRRDGR  172

Query  599   VSLGKNVRPNIIDTSFTMDEMMKIFAAKGLSLDDLVTLSGAHTIGSAHCSAFSDRFQLAS  778
             VS   NVRPNIIDT+FTM+EM+ IF AKGLSL+DLV LSGAHTIGSAHCSAF DRFQ  S
Sbjct  173   VSAAANVRPNIIDTTFTMNEMISIFTAKGLSLEDLVVLSGAHTIGSAHCSAFRDRFQENS  232

Query  779   NGSFLPIdaaldhayaaelaRQCPAGASDAVTVNNDPVTPSLFDNQYYKDLLAHRGLFQS  958
              G    ID++LD  YA EL ++CP  ASD+VTV NDP T   FDNQYY++L+AH+GLFQS
Sbjct  233   KGKLTLIDSSLDKNYANELTQRCPVDASDSVTVVNDPETSLSFDNQYYRNLVAHKGLFQS  292

Query  959   DSALLRDKRAMEKVQDFAGDQNNFFTSWEQSFLKLVSIGVKVGDDDGEIRRSCSSVNA  1132
             DS LL D R    V+D A DQ  FF SW QSFLKL SIGVK G ++GEIR+SCS  N 
Sbjct  293   DSVLLDDNRTRNLVEDLANDQGRFFESWSQSFLKLTSIGVKTG-EEGEIRQSCSMTNG  349



>ref|XP_002309694.2| hypothetical protein POPTR_0006s28320g [Populus trichocarpa]
 gb|EEE93217.2| hypothetical protein POPTR_0006s28320g [Populus trichocarpa]
Length=349

 Score =   416 bits (1070),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 209/298 (70%), Positives = 238/298 (80%), Gaps = 1/298 (0%)
 Frame = +2

Query  239   FNFYAISCPSAELIVKNTVRSASSVDPTLPGKLLRLLFHDCFVEGCDASILLQGNDTERS  418
             FNFY  SCP+AELIV N VRSASS DPT+PGKL+RL+FHDCFVEGCDAS+LLQGN TERS
Sbjct  53    FNFYGASCPAAELIVSNKVRSASSSDPTIPGKLVRLVFHDCFVEGCDASVLLQGNGTERS  112

Query  419   DPANKSVGGFSTVDSAKRVLEIFCPETVSCADIIALAARDAVEFVGGPSVAIPTGRRDGR  598
             DP N+S+GGF  +DSAKR LEIFCP TVSCAD++ALAARDAV   GGP + IPTGRRDGR
Sbjct  113   DPGNRSLGGFQVIDSAKRNLEIFCPGTVSCADVVALAARDAVAISGGPQLQIPTGRRDGR  172

Query  599   VSLGKNVRPNIIDTSFTMDEMMKIFAAKGLSLDDLVTLSGAHTIGSAHCSAFSDRFQLAS  778
             VS   NVRPNIIDT+FTM+EM+ IF AKGLSL+DLV LSGAHTIGSAHCSAF DRFQ  S
Sbjct  173   VSAAANVRPNIIDTTFTMNEMISIFTAKGLSLEDLVVLSGAHTIGSAHCSAFRDRFQENS  232

Query  779   NGSFLPIdaaldhayaaelaRQCPAGASDAVTVNNDPVTPSLFDNQYYKDLLAHRGLFQS  958
              G    ID++LD  YA EL ++CP  ASD++TV NDP T   FDNQYY++L+AH+GLFQS
Sbjct  233   KGKLTLIDSSLDKNYANELTQRCPVDASDSITVVNDPETSLSFDNQYYRNLVAHKGLFQS  292

Query  959   DSALLRDKRAMEKVQDFAGDQNNFFTSWEQSFLKLVSIGVKVGDDDGEIRRSCSSVNA  1132
             DS LL D R    V+D A DQ  FF SW QSFLKL SIGVK G ++GEIR+SCS  N 
Sbjct  293   DSVLLDDNRTRNLVEDLANDQGRFFESWSQSFLKLTSIGVKTG-EEGEIRQSCSMTNG  349



>ref|XP_006581324.1| PREDICTED: peroxidase 18-like [Glycine max]
Length=326

 Score =   415 bits (1066),  Expect = 5e-139, Method: Compositional matrix adjust.
 Identities = 205/298 (69%), Positives = 239/298 (80%), Gaps = 1/298 (0%)
 Frame = +2

Query  239   FNFYAISCPSAELIVKNTVRSASSVDPTLPGKLLRLLFHDCFVEGCDASILLQGNDTERS  418
             FNFYA SCPSAE I++N V S+SS DPT+PGKLLRL+FHDCFVEGCDAS++LQGN+TE+S
Sbjct  30    FNFYAASCPSAESIIRNIVSSSSSTDPTIPGKLLRLVFHDCFVEGCDASLMLQGNNTEQS  89

Query  419   DPANKSVGGFSTVDSAKRVLEIFCPETVSCADIIALAARDAVEFVGGPSVAIPTGRRDGR  598
             DP N+SVGGF+ +DSAKR+LE FCP TVSCADIIALAARDAVE  GGP   IPTGRRDG 
Sbjct  90    DPGNRSVGGFTVIDSAKRILEKFCPGTVSCADIIALAARDAVEIAGGPRTMIPTGRRDGM  149

Query  599   VSLGKNVRPNIIDTSFTMDEMMKIFAAKGLSLDDLVTLSGAHTIGSAHCSAFSDRFQLAS  778
             VS+  NVRPNI+DTSF+MDEM+K+FA+KGLSL DLV LSGAHTIG+AHCS+F DRFQ  S
Sbjct  150   VSVASNVRPNIVDTSFSMDEMVKLFASKGLSLLDLVILSGAHTIGTAHCSSFRDRFQEDS  209

Query  779   NGSFLPIdaaldhayaaelaRQCPAGASDAVTVNNDPVTPSLFDNQYYKDLLAHRGLFQS  958
              G    ID  L+  YA EL +QCPAG   +VTVNNDP T   FDN YY++LLAH+GLFQS
Sbjct  210   KGKLRLIDKTLNSDYANELIKQCPAGVQPSVTVNNDPETSMAFDNMYYQNLLAHKGLFQS  269

Query  959   DSALLRDKRAMEKVQDFAGDQNNFFTSWEQSFLKLVSIGVKVGDDDGEIRRSCSSVNA  1132
             DS L+ +    + V DFA DQ  FF +W+QSFLKL S+GVK G D GEIR SC+S NA
Sbjct  270   DSVLISNDSTRKLVVDFANDQELFFENWDQSFLKLTSVGVKTG-DKGEIRISCASTNA  326



>gb|KHN07009.1| Peroxidase 18 [Glycine soja]
Length=310

 Score =   414 bits (1064),  Expect = 6e-139, Method: Compositional matrix adjust.
 Identities = 205/298 (69%), Positives = 239/298 (80%), Gaps = 1/298 (0%)
 Frame = +2

Query  239   FNFYAISCPSAELIVKNTVRSASSVDPTLPGKLLRLLFHDCFVEGCDASILLQGNDTERS  418
             FNFYA SCPSAE I++N V S+SS DPT+PGKLLRL+FHDCFVEGCDAS++LQGN+TE+S
Sbjct  14    FNFYAASCPSAESIIRNIVSSSSSTDPTIPGKLLRLVFHDCFVEGCDASLMLQGNNTEQS  73

Query  419   DPANKSVGGFSTVDSAKRVLEIFCPETVSCADIIALAARDAVEFVGGPSVAIPTGRRDGR  598
             DP N+SVGGF+ +DSAKR+LE FCP TVSCADIIALAARDAVE  GGP   IPTGRRDG 
Sbjct  74    DPGNRSVGGFTVIDSAKRILEKFCPGTVSCADIIALAARDAVEIAGGPRTMIPTGRRDGM  133

Query  599   VSLGKNVRPNIIDTSFTMDEMMKIFAAKGLSLDDLVTLSGAHTIGSAHCSAFSDRFQLAS  778
             VS+  NVRPNI+DTSF+MDEM+K+FA+KGLSL DLV LSGAHTIG+AHCS+F DRFQ  S
Sbjct  134   VSVASNVRPNIVDTSFSMDEMVKLFASKGLSLLDLVILSGAHTIGTAHCSSFRDRFQEDS  193

Query  779   NGSFLPIdaaldhayaaelaRQCPAGASDAVTVNNDPVTPSLFDNQYYKDLLAHRGLFQS  958
              G    ID  L+  YA EL +QCPAG   +VTVNNDP T   FDN YY++LLAH+GLFQS
Sbjct  194   KGKLRLIDKTLNSDYANELIKQCPAGVQPSVTVNNDPETSMAFDNMYYQNLLAHKGLFQS  253

Query  959   DSALLRDKRAMEKVQDFAGDQNNFFTSWEQSFLKLVSIGVKVGDDDGEIRRSCSSVNA  1132
             DS L+ +    + V DFA DQ  FF +W+QSFLKL S+GVK G D GEIR SC+S NA
Sbjct  254   DSVLISNDSTRKLVVDFANDQELFFENWDQSFLKLTSVGVKTG-DKGEIRISCASTNA  310



>gb|AHL39146.1| class III peroxidase [Populus trichocarpa]
Length=332

 Score =   415 bits (1066),  Expect = 6e-139, Method: Compositional matrix adjust.
 Identities = 209/298 (70%), Positives = 238/298 (80%), Gaps = 1/298 (0%)
 Frame = +2

Query  239   FNFYAISCPSAELIVKNTVRSASSVDPTLPGKLLRLLFHDCFVEGCDASILLQGNDTERS  418
             F+FY  SCP+AELIV N VRSASS DPT+PGKL+RL+FHDCFVEGCDAS+LLQGN TERS
Sbjct  36    FDFYGASCPAAELIVSNKVRSASSSDPTIPGKLVRLVFHDCFVEGCDASVLLQGNGTERS  95

Query  419   DPANKSVGGFSTVDSAKRVLEIFCPETVSCADIIALAARDAVEFVGGPSVAIPTGRRDGR  598
             DP N+S+GGF  +DSAKR LEIFCP TVSCAD++ALAARDAV   GGP + IPTGRRDGR
Sbjct  96    DPGNRSLGGFQVIDSAKRNLEIFCPGTVSCADVVALAARDAVAISGGPQLQIPTGRRDGR  155

Query  599   VSLGKNVRPNIIDTSFTMDEMMKIFAAKGLSLDDLVTLSGAHTIGSAHCSAFSDRFQLAS  778
             VS   NVRPNIIDT+FTM+EM+ IF AKGLSL+DLV LSGAHTIGSAHCSAF DRFQ  S
Sbjct  156   VSAAANVRPNIIDTTFTMNEMISIFTAKGLSLEDLVVLSGAHTIGSAHCSAFRDRFQENS  215

Query  779   NGSFLPIdaaldhayaaelaRQCPAGASDAVTVNNDPVTPSLFDNQYYKDLLAHRGLFQS  958
              G    ID++LD  YA EL ++CP  ASD+VTV NDP T   FDNQYY++L+AH+GLFQS
Sbjct  216   KGKLTLIDSSLDKNYANELTQRCPVDASDSVTVVNDPETSLSFDNQYYRNLVAHKGLFQS  275

Query  959   DSALLRDKRAMEKVQDFAGDQNNFFTSWEQSFLKLVSIGVKVGDDDGEIRRSCSSVNA  1132
             DS LL D R    V+D A DQ  FF SW QSFLKL SIGVK G ++GEIR+SCS  N 
Sbjct  276   DSVLLDDNRTRNLVEDLANDQGRFFESWSQSFLKLTSIGVKTG-EEGEIRQSCSMTNG  332



>gb|ACJ11760.1| class III peroxidase [Gossypium hirsutum]
Length=332

 Score =   415 bits (1066),  Expect = 7e-139, Method: Compositional matrix adjust.
 Identities = 211/298 (71%), Positives = 245/298 (82%), Gaps = 2/298 (1%)
 Frame = +2

Query  239   FNFYAISCPSAELIVKNTVRSASSVDPTLPGKLLRLLFHDCFVEGCDASILLQGNDTERS  418
             FNFYA SCP+AEL+V NTVR+ASS DPT+PGKLLRLLFHDCFVEGCDAS+LLQGN TERS
Sbjct  36    FNFYATSCPAAELMVSNTVRAASSNDPTIPGKLLRLLFHDCFVEGCDASVLLQGNGTERS  95

Query  419   DPANKSVGGFSTVDSAKRVLEIFCPETVSCADIIALAARDAVEFVGGPSVAIPTGRRDGR  598
             DPAN S+GGFS +DSAKRVLEIFCP TVSCADIIALAARDAV   GGP+  IPTGR+DGR
Sbjct  96    DPANTSLGGFSVIDSAKRVLEIFCPGTVSCADIIALAARDAVAIAGGPAFQIPTGRKDGR  155

Query  599   VSLGKNVRPNIIDTSFTMDEMMKIFAAKGLSLDDLVTLSGAHTIGSAHCSAFSDRFQLAS  778
             +S   NVRPNI+DTSFTMDEM+K+F +KGLSLDDLVTLSGAHTIG AHCSAFSDRFQ  S
Sbjct  156   ISNSVNVRPNIVDTSFTMDEMIKLFNSKGLSLDDLVTLSGAHTIGLAHCSAFSDRFQQDS  215

Query  779   NGSFLPIdaaldhayaaelaRQCPAGASD-AVTVNNDPVTPSLFDNQYYKDLLAHRGLFQ  955
              G    +D +LD  YA EL+++CPAG S  + TV+NDP T   FDNQYY +LLAH+GLFQ
Sbjct  216   KGKLRLVDTSLDITYAKELSKKCPAGGSSTSNTVSNDPETSFAFDNQYYGNLLAHKGLFQ  275

Query  956   SDSALLRDKRAMEKVQDFAGDQNNFFTSWEQSFLKLVSIGVKVGDDDGEIRRSCSSVN  1129
             SDS LL D R  ++V++FA ++  FF SW +SFLKL +I VK  D++GEIR+SCS  N
Sbjct  276   SDSVLLEDGRTRKQVEEFANNEERFFRSWGESFLKLTTIEVKT-DNEGEIRQSCSFTN  332



>ref|XP_010314794.1| PREDICTED: peroxidase 18-like isoform X2 [Solanum lycopersicum]
Length=284

 Score =   413 bits (1061),  Expect = 7e-139, Method: Compositional matrix adjust.
 Identities = 206/285 (72%), Positives = 243/285 (85%), Gaps = 2/285 (1%)
 Frame = +2

Query  278   IVKNTVRSASSVDPTLPGKLLRLLFHDCFVEGCDASILLQGNDTERSDPANKSVGGFSTV  457
             +VKNTVRSASS+DPT+PGKLLRLLFHDCFVEGCDASILL+GN TERSDPANKS+GGFS +
Sbjct  1     MVKNTVRSASSMDPTIPGKLLRLLFHDCFVEGCDASILLEGNGTERSDPANKSLGGFSVI  60

Query  458   DSAKRVLEIFCPETVSCADIIALAARDAVEFVGGPSVAIPTGRRDGRVSLGKNVRPNIID  637
             ++AKRVLEIFCP TVSCADI+ALAARDAVEF GGP+V IPTGR+DGR+SL  NVRPNI+D
Sbjct  61    ENAKRVLEIFCPFTVSCADIVALAARDAVEFAGGPNVQIPTGRKDGRISLITNVRPNIVD  120

Query  638   TSFTMDEMMKIFAAKGLSLDDLVTLSGAHTIGSAHCSAFSDRFQLASNGSFLPIdaaldh  817
             TSFTMD+M+ IF  KGLSLDDLV LSGAHTIGSAHC+AFSDRF++ +NG+F  ID +LD 
Sbjct  121   TSFTMDQMINIFTIKGLSLDDLVILSGAHTIGSAHCNAFSDRFRVDTNGNFTLIDPSLDK  180

Query  818   ayaaelaRQCPAG-ASDAVTVNNDPVTPSLFDNQYYKDLLAHRGLFQSDSALLRDKRAME  994
             AYA EL +QCPAG A+  +TV NDP TP LFDNQY+KDL+ H+GLFQSDS L  D R  +
Sbjct  181   AYAIELTKQCPAGAATSTITVKNDPQTPQLFDNQYFKDLIQHKGLFQSDSVLFNDVRTKK  240

Query  995   KVQDFAGDQNNFFTSWEQSFLKLVSIGVKVGDDDGEIRRSCSSVN  1129
             +V +FA DQ+ FF SW QSF++L  +GVK G +DGE+R SCS +N
Sbjct  241   RVVEFANDQDGFFRSWSQSFVRLSVLGVKSG-EDGEVRTSCSVIN  284



>ref|XP_003550235.1| PREDICTED: peroxidase 46-like [Glycine max]
Length=330

 Score =   412 bits (1060),  Expect = 5e-138, Method: Compositional matrix adjust.
 Identities = 210/298 (70%), Positives = 245/298 (82%), Gaps = 1/298 (0%)
 Frame = +2

Query  239   FNFYAISCPSAELIVKNTVRSASSVDPTLPGKLLRLLFHDCFVEGCDASILLQGNDTERS  418
             FNFYA SCP+AELIV+NTV S+SS DP++PGKLLRL+FHDCFVEGCDAS++L GN+TE+S
Sbjct  34    FNFYAASCPTAELIVRNTVSSSSSSDPSIPGKLLRLVFHDCFVEGCDASLMLLGNNTEKS  93

Query  419   DPANKSVGGFSTVDSAKRVLEIFCPETVSCADIIALAARDAVEFVGGPSVAIPTGRRDGR  598
             DPAN+SVGGFS ++SAKRVLE  CP TVSCADIIALAARDAVE VGGP + IPTGRRDG 
Sbjct  94    DPANRSVGGFSVIESAKRVLEFLCPGTVSCADIIALAARDAVEIVGGPMIEIPTGRRDGM  153

Query  599   VSLGKNVRPNIIDTSFTMDEMMKIFAAKGLSLDDLVTLSGAHTIGSAHCSAFSDRFQLAS  778
             VS+  NVRPNI+DTSFTMDEM+  F++KGLSL DLV LSGAHTIG+AHCS+F DRFQ  S
Sbjct  154   VSVASNVRPNILDTSFTMDEMINRFSSKGLSLFDLVILSGAHTIGAAHCSSFRDRFQEDS  213

Query  779   NGSFLPIdaaldhayaaelaRQCPAGASDAVTVNNDPVTPSLFDNQYYKDLLAHRGLFQS  958
              G    ID  LD+ YA EL ++CP  AS +VTVNNDP T  +FDNQYY++LL ++GLFQS
Sbjct  214   KGKLTLIDKTLDNTYADELMKECPLSASPSVTVNNDPETSMVFDNQYYRNLLTNKGLFQS  273

Query  959   DSALLRDKRAMEKVQDFAGDQNNFFTSWEQSFLKLVSIGVKVGDDDGEIRRSCSSVNA  1132
             DSALL D R  + V+D A DQ  FF SW QSFLKL SIGVK G D+GEIR SC+S+NA
Sbjct  274   DSALLSDNRTRKFVEDLANDQEFFFESWGQSFLKLTSIGVKTG-DEGEIRSSCASINA  330



>gb|KHN37103.1| Peroxidase 46 [Glycine soja]
Length=325

 Score =   412 bits (1059),  Expect = 5e-138, Method: Compositional matrix adjust.
 Identities = 210/298 (70%), Positives = 245/298 (82%), Gaps = 1/298 (0%)
 Frame = +2

Query  239   FNFYAISCPSAELIVKNTVRSASSVDPTLPGKLLRLLFHDCFVEGCDASILLQGNDTERS  418
             FNFYA SCP+AELIV+NTV S+SS DP++PGKLLRL+FHDCFVEGCDAS++L GN+TE+S
Sbjct  29    FNFYAASCPTAELIVRNTVSSSSSSDPSIPGKLLRLVFHDCFVEGCDASLMLLGNNTEKS  88

Query  419   DPANKSVGGFSTVDSAKRVLEIFCPETVSCADIIALAARDAVEFVGGPSVAIPTGRRDGR  598
             DPAN+SVGGFS ++SAKRVLE  CP TVSCADIIALAARDAVE VGGP + IPTGRRDG 
Sbjct  89    DPANRSVGGFSVIESAKRVLEFLCPGTVSCADIIALAARDAVEIVGGPMIEIPTGRRDGM  148

Query  599   VSLGKNVRPNIIDTSFTMDEMMKIFAAKGLSLDDLVTLSGAHTIGSAHCSAFSDRFQLAS  778
             VS+  NVRPNI+DTSFTMDEM+  F++KGLSL DLV LSGAHTIG+AHCS+F DRFQ  S
Sbjct  149   VSVASNVRPNILDTSFTMDEMINRFSSKGLSLFDLVILSGAHTIGAAHCSSFRDRFQEDS  208

Query  779   NGSFLPIdaaldhayaaelaRQCPAGASDAVTVNNDPVTPSLFDNQYYKDLLAHRGLFQS  958
              G    ID  LD+ YA EL ++CP  AS +VTVNNDP T  +FDNQYY++LL ++GLFQS
Sbjct  209   KGKLTLIDKTLDNTYADELMKECPLSASPSVTVNNDPETSMVFDNQYYRNLLTNKGLFQS  268

Query  959   DSALLRDKRAMEKVQDFAGDQNNFFTSWEQSFLKLVSIGVKVGDDDGEIRRSCSSVNA  1132
             DSALL D R  + V+D A DQ  FF SW QSFLKL SIGVK G D+GEIR SC+S+NA
Sbjct  269   DSALLSDNRTRKFVEDLANDQEFFFESWGQSFLKLTSIGVKTG-DEGEIRSSCASINA  325



>ref|XP_010914047.1| PREDICTED: peroxidase 18 [Elaeis guineensis]
Length=335

 Score =   411 bits (1057),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 201/296 (68%), Positives = 242/296 (82%), Gaps = 1/296 (0%)
 Frame = +2

Query  242   NFYAISCPSAELIVKNTVRSASSVDPTLPGKLLRLLFHDCFVEGCDASILLQGNDTERSD  421
             +FY++SCP+ EL+VKNTVRSA + DPTL GKLLRLLFHDC VEGCD S+L+QGN TERSD
Sbjct  37    DFYSLSCPNVELLVKNTVRSAVAFDPTLSGKLLRLLFHDCIVEGCDGSVLVQGNGTERSD  96

Query  422   PANKSVGGFSTVDSAKRVLEIFCPETVSCADIIALAARDAVEFVGGPSVAIPTGRRDGRV  601
             PAN+S+GGF  V+SAKR+LE+ CP TVSCAD++ + ARDAVE  GGPSV +P GRRDGRV
Sbjct  97    PANRSLGGFEVVESAKRLLEVLCPGTVSCADVLVMVARDAVEMAGGPSVQVPLGRRDGRV  156

Query  602   SLGKNVRPNIIDTSFTMDEMMKIFAAKGLSLDDLVTLSGAHTIGSAHCSAFSDRFQLASN  781
             S   NVRPN+IDTSF++ EM ++F++KGLS+DDLV LSGAHTIGSAHCSAFS+RFQ    
Sbjct  157   SSSSNVRPNMIDTSFSLGEMAQLFSSKGLSIDDLVILSGAHTIGSAHCSAFSERFQAGPK  216

Query  782   GSFLPIdaaldhayaaelaRQCPAGASDAVTVNNDPVTPSLFDNQYYKDLLAHRGLFQSD  961
             G+ +PID++LD  YA EL +QCPAGAS  VTVNNDPVT SLFDNQYY++LLA +GLFQSD
Sbjct  217   GNLVPIDSSLDKDYAMELIKQCPAGASATVTVNNDPVTASLFDNQYYRNLLAGKGLFQSD  276

Query  962   SALLRDKRAMEKVQDFAGDQNNFFTSWEQSFLKLVSIGVKVGDDDGEIRRSCSSVN  1129
             S L+ D R   KV+ F+  Q  FF SW +SF+KL +IGVK G D+GEIR SC SVN
Sbjct  277   SVLVNDSRTKGKVEAFSESQERFFASWAESFVKLTNIGVKTG-DEGEIRVSCMSVN  331



>ref|XP_004293249.1| PREDICTED: lariat debranching enzyme-like [Fragaria vesca subsp. 
vesca]
Length=735

 Score =   424 bits (1091),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 210/297 (71%), Positives = 248/297 (84%), Gaps = 1/297 (0%)
 Frame = +2

Query  239   FNFYAISCPSAELIVKNTVRSASSVDPTLPGKLLRLLFHDCFVEGCDASILLQGNDTERS  418
              NFY+ SCPSAEL+V+ TVRSAS++DPT+PGKLLRLLFHDCFVEGCDAS+LLQGN TERS
Sbjct  439   LNFYSTSCPSAELMVRGTVRSASNIDPTVPGKLLRLLFHDCFVEGCDASVLLQGNGTERS  498

Query  419   DPANKSVGGFSTVDSAKRVLEIFCPETVSCADIIALAARDAVEFVGGPSVAIPTGRRDGR  598
             DPAN+S+ GFS +D+AKR+LEI CP TVSCADI+ALAARDAVE  GGP V IPTGRRDG+
Sbjct  499   DPANQSLAGFSVIDTAKRLLEILCPRTVSCADIVALAARDAVEITGGPLVHIPTGRRDGK  558

Query  599   VSLGKNVRPNIIDTSFTMDEMMKIFAAKGLSLDDLVTLSGAHTIGSAHCSAFSDRFQLAS  778
             VS   NVRPNI+DTSFTM+EM+K+F++KGLSL DLVTLSGAHTIG+AHCSAFSDRFQ  S
Sbjct  559   VSSASNVRPNIVDTSFTMNEMIKLFSSKGLSLHDLVTLSGAHTIGAAHCSAFSDRFQQDS  618

Query  779   NGSFLPIdaaldhayaaelaRQCPAGASDAVTVNNDPVTPSLFDNQYYKDLLAHRGLFQS  958
              G F  ID +LD+ YA +L +QCPAGA+ + TV NDP T  +FDNQYY++LLAHRGLFQS
Sbjct  619   KGKFRLIDTSLDNGYAEKLMKQCPAGANPSTTVKNDPGTSFVFDNQYYRNLLAHRGLFQS  678

Query  959   DSALLRDKRAMEKVQDFAGDQNNFFTSWEQSFLKLVSIGVKVGDDDGEIRRSCSSVN  1129
             DS L  D R+ ++V++FA DQ NFF SW QSFLKL S  VK G D+GEIR  C++ N
Sbjct  679   DSVLFTDSRSSQQVENFAEDQVNFFESWVQSFLKLTSTHVKTG-DEGEIRTFCATAN  734



>ref|XP_006483726.1| PREDICTED: lariat debranching enzyme-like [Citrus sinensis]
Length=714

 Score =   423 bits (1087),  Expect = 8e-137, Method: Compositional matrix adjust.
 Identities = 209/298 (70%), Positives = 249/298 (84%), Gaps = 1/298 (0%)
 Frame = +2

Query  239   FNFYAISCPSAELIVKNTVRSASSVDPTLPGKLLRLLFHDCFVEGCDASILLQGNDTERS  418
             FNFYA SCPSAE +V NTVRSASS D T+PGKLLRLLFHDCFVEGCDAS+LLQGN TERS
Sbjct  418   FNFYAASCPSAEFMVANTVRSASSFDRTIPGKLLRLLFHDCFVEGCDASVLLQGNGTERS  477

Query  419   DPANKSVGGFSTVDSAKRVLEIFCPETVSCADIIALAARDAVEFVGGPSVAIPTGRRDGR  598
             DPAN S+GGF  +DSAKRVLEIFCP TVSCADIIALAARD+VE  GGP++ IPTGRRDGR
Sbjct  478   DPANASLGGFEVIDSAKRVLEIFCPGTVSCADIIALAARDSVEIAGGPAIQIPTGRRDGR  537

Query  599   VSLGKNVRPNIIDTSFTMDEMMKIFAAKGLSLDDLVTLSGAHTIGSAHCSAFSDRFQLAS  778
              S  +NVR NI+DT+FTM+EM+K F++KGLS+DDLVTLSGAHTIGSAHC+AF+DRF+   
Sbjct  538   ASAAENVRANIVDTTFTMNEMIKAFSSKGLSMDDLVTLSGAHTIGSAHCNAFNDRFREDP  597

Query  779   NGSFLPIdaaldhayaaelaRQCPAGASDAVTVNNDPVTPSLFDNQYYKDLLAHRGLFQS  958
              G    ID +LD +YA EL R+CPA AS +VTVNNDP T  +FDNQYY++LLAH+GLFQS
Sbjct  598   KGKLTLIDTSLDSSYANELMRKCPANASSSVTVNNDPETSFVFDNQYYRNLLAHKGLFQS  657

Query  959   DSALLRDKRAMEKVQDFAGDQNNFFTSWEQSFLKLVSIGVKVGDDDGEIRRSCSSVNA  1132
             DS LL D+R  ++V++FA DQ +FF++W  SFLK+ SIGVK  +D+GEIR++CS  N 
Sbjct  658   DSVLLHDERTRKQVENFANDQESFFSNWGLSFLKVTSIGVKT-EDEGEIRQTCSMTNG  714



>ref|XP_010268456.1| PREDICTED: peroxidase 46-like isoform X2 [Nelumbo nucifera]
Length=331

 Score =   408 bits (1049),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 202/298 (68%), Positives = 244/298 (82%), Gaps = 6/298 (2%)
 Frame = +2

Query  239   FNFYAISCPSAELIVKNTVRSASSVDPTLPGKLLRLLFHDCFVEGCDASILLQGNDTERS  418
             F+FYA SCP+AE +VKNT+RSAS+ DPT+P KLLRLLFHDC VEGCD S+LL+GN+TERS
Sbjct  40    FDFYAASCPTAEAMVKNTLRSASTDDPTIPAKLLRLLFHDCMVEGCDGSVLLEGNETERS  99

Query  419   DPANKSVGGFSTVDSAKRVLEIFCPETVSCADIIALAARDAVEFVGGPSVAIPTGRRDGR  598
             DPAN S+GGFS V+SAK +LE+FCPETVSCADI+ALAARDAVEF GGPS+ IPTGRRDGR
Sbjct  100   DPANASLGGFSVVESAKGLLELFCPETVSCADILALAARDAVEFAGGPSIQIPTGRRDGR  159

Query  599   VSLGKNVRPNIIDTSFTMDEMMKIFAAKGLSLDDLVTLSGAHTIGSAHCSAFSDRFQLAS  778
             VS   NVRPNI+DTSFTMDEM+++F++KGLSL+DLVTLS     GSAHCS+FSDRFQ  S
Sbjct  160   VSSVSNVRPNIVDTSFTMDEMLELFSSKGLSLEDLVTLS-----GSAHCSSFSDRFQEDS  214

Query  779   NGSFLPIdaaldhayaaelaRQCPAGASDAVTVNNDPVTPSLFDNQYYKDLLAHRGLFQS  958
              G+  PIDA+LD  YA EL +QCPAG   ++TVNNDP T  LFDNQYY++L++H+GLFQS
Sbjct  215   KGNLTPIDASLDRIYANELIKQCPAGVDKSITVNNDPETSLLFDNQYYRNLISHKGLFQS  274

Query  959   DSALLRDKRAMEKVQDFAGDQNNFFTSWEQSFLKLVSIGVKVGDDDGEIRRSCSSVNA  1132
             DS L  D R   KV++F+  Q  FF  W +SFLKL S+GVK G D+GE+R SC ++N 
Sbjct  275   DSVLFSDGRTKAKVEEFSDSQYMFFEKWTESFLKLSSVGVKTG-DEGEVRTSCRAING  331



>gb|KCW82645.1| hypothetical protein EUGRSUZ_C04029, partial [Eucalyptus grandis]
Length=281

 Score =   404 bits (1038),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 200/282 (71%), Positives = 238/282 (84%), Gaps = 1/282 (0%)
 Frame = +2

Query  287   NTVRSASSVDPTLPGKLLRLLFHDCFVEGCDASILLQGNDTERSDPANKSVGGFSTVDSA  466
             NTVRSASS DPT+PGKLLRLLFHDCFVEGCDAS+L++GN TE++DPAN S+GGFS +DSA
Sbjct  1     NTVRSASSSDPTIPGKLLRLLFHDCFVEGCDASVLIRGNGTEQNDPANTSLGGFSVIDSA  60

Query  467   KRVLEIFCPETVSCADIIALAARDAVEFVGGPSVAIPTGRRDGRVSLGKNVRPNIIDTSF  646
             KRVLE+FCP TVSCADIIALAARDAVE  GGP+V IPTGR+DGRVS   NVRPNI+DTSF
Sbjct  61    KRVLELFCPGTVSCADIIALAARDAVELTGGPAVQIPTGRKDGRVSAASNVRPNIVDTSF  120

Query  647   TMDEMMKIFAAKGLSLDDLVTLSGAHTIGSAHCSAFSDRFQLASNGSFLPIdaaldhaya  826
             T++EM+K+F++KGLSL DLV LSGAHTIG+AHCSAFSDRFQ  S G F  ID++LD  YA
Sbjct  121   TINEMIKLFSSKGLSLADLVALSGAHTIGAAHCSAFSDRFQADSKGKFTLIDSSLDKNYA  180

Query  827   aelaRQCPAGASDAVTVNNDPVTPSLFDNQYYKDLLAHRGLFQSDSALLRDKRAMEKVQD  1006
              EL R+CPAGAS ++TVNNDP T   FDNQYY++LL H+GLFQSDS L++D R  EKV++
Sbjct  181   EELMRRCPAGASPSITVNNDPETSLSFDNQYYRNLLLHKGLFQSDSVLVKDNRTREKVEN  240

Query  1007  FAGDQNNFFTSWEQSFLKLVSIGVKVGDDDGEIRRSCSSVNA  1132
             FA DQ++FF SW QSFLKL  + VK G + GE+R+SCS +N 
Sbjct  241   FANDQDSFFASWAQSFLKLSVVEVKTG-NAGEVRQSCSLING  281



>ref|XP_011036744.1| PREDICTED: lariat debranching enzyme [Populus euphratica]
Length=743

 Score =   420 bits (1079),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 213/299 (71%), Positives = 241/299 (81%), Gaps = 6/299 (2%)
 Frame = +2

Query  239   FNFYAISCPSAELIVKNTVRSASSVDPTLPGKLLRLLFHDCFVE-----GCDASILLQGN  403
             FNFY  SCP+AELIV NTVRSASS DPT+PGKLLRL+FHDCFVE     GCDAS+LLQGN
Sbjct  442   FNFYGASCPTAELIVSNTVRSASSSDPTIPGKLLRLVFHDCFVEMSWLQGCDASVLLQGN  501

Query  404   DTERSDPANKSVGGFSTVDSAKRVLEIFCPETVSCADIIALAARDAVEFVGGPSVAIPTG  583
              TERSDP N+S+GGF  +DSAKR+LEIFCP TVSCAD++ALAARDAV   GGP + IPTG
Sbjct  502   GTERSDPGNRSLGGFQVIDSAKRMLEIFCPGTVSCADVVALAARDAVAITGGPQLQIPTG  561

Query  584   RRDGRVSLGKNVRPNIIDTSFTMDEMMKIFAAKGLSLDDLVTLSGAHTIGSAHCSAFSDR  763
             RRDGRVS   NVRPNIIDT+FTM+EM+ IF AKGLS++DLV LSGAHTIGSAHCSAFSDR
Sbjct  562   RRDGRVSAAANVRPNIIDTTFTMNEMINIFTAKGLSIEDLVVLSGAHTIGSAHCSAFSDR  621

Query  764   FQLASNGSFLPIdaaldhayaaelaRQCPAGASDAVTVNNDPVTPSLFDNQYYKDLLAHR  943
             FQ  S G    ID +LD  YA EL ++CP  AS ++TV NDP T S FDNQYY++L+AH+
Sbjct  622   FQEDSKGKLTLIDTSLDRNYANELMQRCPVDASASITVVNDPETSSSFDNQYYRNLVAHK  681

Query  944   GLFQSDSALLRDKRAMEKVQDFAGDQNNFFTSWEQSFLKLVSIGVKVGDDDGEIRRSCS  1120
             GLFQSDS LL DKR    VQDFA DQ  FF SW QSFLKL SIGVK G ++GEIR+SCS
Sbjct  682   GLFQSDSVLLDDKRTRNLVQDFANDQEKFFQSWSQSFLKLTSIGVKTG-EEGEIRQSCS  739



>ref|XP_002515390.1| RNA lariat debranching enzyme, putative [Ricinus communis]
 gb|EEF46839.1| RNA lariat debranching enzyme, putative [Ricinus communis]
Length=760

 Score =   418 bits (1075),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 212/294 (72%), Positives = 240/294 (82%), Gaps = 1/294 (0%)
 Frame = +2

Query  251   AISCPSAELIVKNTVRSASSVDPTLPGKLLRLLFHDCFVEGCDASILLQGNDTERSDPAN  430
             A SCPS E +V NTVRSASS DPT+PGKLLRLLFHDCFVEGCDAS+LL+GN TERSDPAN
Sbjct  468   AASCPSVEFMVANTVRSASSADPTIPGKLLRLLFHDCFVEGCDASVLLRGNGTERSDPAN  527

Query  431   KSVGGFSTVDSAKRVLEIFCPETVSCADIIALAARDAVEFVGGPSVAIPTGRRDGRVSLG  610
              S+GGFS +DSAKR+LEIFCP TVSCADI+ALAARDAV   GGP + IPTGRRDGRVS  
Sbjct  528   TSLGGFSVIDSAKRLLEIFCPGTVSCADIVALAARDAVAITGGPLIQIPTGRRDGRVSSS  587

Query  611   KNVRPNIIDTSFTMDEMMKIFAAKGLSLDDLVTLSGAHTIGSAHCSAFSDRFQLASNGSF  790
              NVRPNI+DTSFTM+EM+KIF+ KGLSLDDLVTLSGAHTIG+AHCSAFSDRF   S G  
Sbjct  588   ANVRPNIVDTSFTMNEMIKIFSTKGLSLDDLVTLSGAHTIGTAHCSAFSDRFHEDSKGKL  647

Query  791   LPIdaaldhayaaelaRQCPAGASDAVTVNNDPVTPSLFDNQYYKDLLAHRGLFQSDSAL  970
               ID+ LD  YA EL R CPA AS ++ VNNDP T S FDNQYY++LLAH+GLFQSDS L
Sbjct  648   KLIDSTLDSTYANELMRICPAEASSSILVNNDPETSSAFDNQYYRNLLAHKGLFQSDSVL  707

Query  971   LRDKRAMEKVQDFAGDQNNFFTSWEQSFLKLVSIGVKVGDDDGEIRRSCSSVNA  1132
             L D R   +VQDFA D+  FF SW +SFLKL SIGVK G ++GEIR++CS +N 
Sbjct  708   LDDARTRRQVQDFADDEVRFFDSWSRSFLKLTSIGVKTG-EEGEIRQTCSLING  760



>ref|XP_003544569.1| PREDICTED: peroxidase 46-like [Glycine max]
Length=329

 Score =   401 bits (1031),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 207/298 (69%), Positives = 240/298 (81%), Gaps = 1/298 (0%)
 Frame = +2

Query  239   FNFYAISCPSAELIVKNTVRSASSVDPTLPGKLLRLLFHDCFVEGCDASILLQGNDTERS  418
             FNFYA SCP+AE IV+NTV S+SS D ++PGKLLRL+FHDCFVEGCDAS++L GN+TE+S
Sbjct  33    FNFYAASCPTAEFIVRNTVSSSSSSDSSIPGKLLRLVFHDCFVEGCDASLMLLGNNTEKS  92

Query  419   DPANKSVGGFSTVDSAKRVLEIFCPETVSCADIIALAARDAVEFVGGPSVAIPTGRRDGR  598
             DPAN+SVGGFS ++SAKRVLE  CP TVSCADIIALAARDAVE VGGP + IPTGRRDG 
Sbjct  93    DPANRSVGGFSVIESAKRVLEFLCPGTVSCADIIALAARDAVEIVGGPMIQIPTGRRDGM  152

Query  599   VSLGKNVRPNIIDTSFTMDEMMKIFAAKGLSLDDLVTLSGAHTIGSAHCSAFSDRFQLAS  778
             VS+  NVRPNI+DTSFTMDEM+  F+ K LSL DLV LSGAHTIG+AHCS+F DRFQ  S
Sbjct  153   VSVASNVRPNILDTSFTMDEMINRFSDKELSLFDLVILSGAHTIGTAHCSSFRDRFQEDS  212

Query  779   NGSFLPIdaaldhayaaelaRQCPAGASDAVTVNNDPVTPSLFDNQYYKDLLAHRGLFQS  958
              G    ID  LD  YA +L ++CP  AS +V VNNDP T  +FDNQYY++LL ++GLFQS
Sbjct  213   KGKLTLIDKTLDSTYADKLMQECPLSASPSVQVNNDPETSMVFDNQYYRNLLTNKGLFQS  272

Query  959   DSALLRDKRAMEKVQDFAGDQNNFFTSWEQSFLKLVSIGVKVGDDDGEIRRSCSSVNA  1132
             DSALLRD R  + V+D A DQ  FF SW QSFLKL SIGVK G D+GEIRRSC+S NA
Sbjct  273   DSALLRDNRTRKFVEDLANDQEFFFESWGQSFLKLTSIGVKTG-DEGEIRRSCASTNA  329



>ref|XP_008790102.1| PREDICTED: peroxidase 18 [Phoenix dactylifera]
Length=335

 Score =   401 bits (1031),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 196/296 (66%), Positives = 238/296 (80%), Gaps = 1/296 (0%)
 Frame = +2

Query  242   NFYAISCPSAELIVKNTVRSASSVDPTLPGKLLRLLFHDCFVEGCDASILLQGNDTERSD  421
             +FY++SCPS EL+VK+TVRSA   DPTL GKLLRLLFHDC VEGCD S+L+QGN TERSD
Sbjct  37    DFYSLSCPSVELLVKSTVRSAVGSDPTLSGKLLRLLFHDCIVEGCDGSVLVQGNGTERSD  96

Query  422   PANKSVGGFSTVDSAKRVLEIFCPETVSCADIIALAARDAVEFVGGPSVAIPTGRRDGRV  601
             PANKS+GGF  V+SAKR+LE+ CP TVSCADI+ + ARDAVE  GGPSV +P GRRDGRV
Sbjct  97    PANKSLGGFEVVESAKRLLEVLCPGTVSCADILVMVARDAVEMAGGPSVLVPLGRRDGRV  156

Query  602   SLGKNVRPNIIDTSFTMDEMMKIFAAKGLSLDDLVTLSGAHTIGSAHCSAFSDRFQLASN  781
             S   NVRPN++DTSF++ EM ++F++KGLS+DDLV LSGAHTIGSAHCSAFS+RFQ    
Sbjct  157   SSSSNVRPNMVDTSFSLGEMAQLFSSKGLSMDDLVILSGAHTIGSAHCSAFSERFQQGPK  216

Query  782   GSFLPIdaaldhayaaelaRQCPAGASDAVTVNNDPVTPSLFDNQYYKDLLAHRGLFQSD  961
             G  +P+D++L+  YA EL RQCPAGAS  VTVNNDPVT +LFDNQYY++LLA +GLF+SD
Sbjct  217   GDLVPVDSSLEKDYAMELVRQCPAGASTTVTVNNDPVTDALFDNQYYRNLLAGKGLFRSD  276

Query  962   SALLRDKRAMEKVQDFAGDQNNFFTSWEQSFLKLVSIGVKVGDDDGEIRRSCSSVN  1129
             S L  D R   KV+ F+  Q+ FF SW +SF++L +I VK G  +GEIR SC SVN
Sbjct  277   SVLAGDSRTKAKVEAFSESQDGFFASWAESFVRLANISVKTG-SEGEIRVSCMSVN  331



>gb|KHN35567.1| Peroxidase 46 [Glycine soja]
Length=324

 Score =   401 bits (1030),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 207/298 (69%), Positives = 240/298 (81%), Gaps = 1/298 (0%)
 Frame = +2

Query  239   FNFYAISCPSAELIVKNTVRSASSVDPTLPGKLLRLLFHDCFVEGCDASILLQGNDTERS  418
             FNFYA SCP+AE IV+NTV S+SS D ++PGKLLRL+FHDCFVEGCDAS++L GN+TE+S
Sbjct  28    FNFYAASCPTAEFIVRNTVSSSSSSDSSIPGKLLRLVFHDCFVEGCDASLMLLGNNTEKS  87

Query  419   DPANKSVGGFSTVDSAKRVLEIFCPETVSCADIIALAARDAVEFVGGPSVAIPTGRRDGR  598
             DPAN+SVGGFS ++SAKRVLE  CP TVSCADIIALAARDAVE VGGP + IPTGRRDG 
Sbjct  88    DPANRSVGGFSVIESAKRVLEFLCPGTVSCADIIALAARDAVEIVGGPMIQIPTGRRDGM  147

Query  599   VSLGKNVRPNIIDTSFTMDEMMKIFAAKGLSLDDLVTLSGAHTIGSAHCSAFSDRFQLAS  778
             VS+  NVRPNI+DTSFTMDEM+  F+ K LSL DLV LSGAHTIG+AHCS+F DRFQ  S
Sbjct  148   VSVASNVRPNILDTSFTMDEMINRFSDKELSLFDLVILSGAHTIGTAHCSSFRDRFQEDS  207

Query  779   NGSFLPIdaaldhayaaelaRQCPAGASDAVTVNNDPVTPSLFDNQYYKDLLAHRGLFQS  958
              G    ID  LD  YA +L ++CP  AS +V VNNDP T  +FDNQYY++LL ++GLFQS
Sbjct  208   KGKLTLIDKTLDSTYADKLMQECPLSASPSVQVNNDPETSMVFDNQYYRNLLTNKGLFQS  267

Query  959   DSALLRDKRAMEKVQDFAGDQNNFFTSWEQSFLKLVSIGVKVGDDDGEIRRSCSSVNA  1132
             DSALLRD R  + V+D A DQ  FF SW QSFLKL SIGVK G D+GEIRRSC+S NA
Sbjct  268   DSALLRDNRTRKFVEDLANDQEFFFESWGQSFLKLTSIGVKTG-DEGEIRRSCASTNA  324



>gb|KHG25030.1| Peroxidase 18 -like protein [Gossypium arboreum]
Length=371

 Score =   395 bits (1016),  Expect = 8e-131, Method: Compositional matrix adjust.
 Identities = 211/337 (63%), Positives = 246/337 (73%), Gaps = 41/337 (12%)
 Frame = +2

Query  239   FNFYAISCPSAELIVKNTVRSASSVDPTLPGKLLRLLFHDCFVEGCDASILLQGNDTERS  418
             FNFYA SCP+AEL+V NTVR+ASS DPT+PGKLLRLLFHDCFVEGCDAS+LLQGN TERS
Sbjct  36    FNFYATSCPAAELMVSNTVRAASSNDPTIPGKLLRLLFHDCFVEGCDASVLLQGNGTERS  95

Query  419   DPANKSVGGFSTVDSAKRVLEIFCPETVSCADIIALAARDAVEFV---------------  553
             DPAN S+GGFS +DSAKRVLEI CP TVSCADIIALAARDAV  V               
Sbjct  96    DPANTSLGGFSVIDSAKRVLEIICPGTVSCADIIALAARDAVAIVKFPILVFIYVFKLMF  155

Query  554   ------------------------GGPSVAIPTGRRDGRVSLGKNVRPNIIDTSFTMDEM  661
                                     GGP+  IPTGR+DGR+S   NVRPNI+DTSFTMDEM
Sbjct  156   PSLFFHHHICTSVVVLTIVTMEQAGGPAFQIPTGRKDGRISNSVNVRPNIVDTSFTMDEM  215

Query  662   MKIFAAKGLSLDDLVTLSGAHTIGSAHCSAFSDRFQLASNGSFLPIdaaldhayaaelaR  841
             +K+F +KGLSLDDLVTLSGAHTIG AHCSAFSDRFQ  S G    +D +LD  YA EL++
Sbjct  216   IKLFNSKGLSLDDLVTLSGAHTIGLAHCSAFSDRFQQDSKGKLRLVDTSLDITYAKELSK  275

Query  842   QCPA-GASDAVTVNNDPVTPSLFDNQYYKDLLAHRGLFQSDSALLRDKRAMEKVQDFAGD  1018
             +CPA G+S + TV+NDP T   FDNQYY +LLAH+GLFQSDS LL D R  ++V++FA +
Sbjct  276   KCPAGGSSTSNTVSNDPETSFAFDNQYYGNLLAHKGLFQSDSVLLEDGRTRKQVEEFANN  335

Query  1019  QNNFFTSWEQSFLKLVSIGVKVGDDDGEIRRSCSSVN  1129
             +  FF SW +SFLKL +I VK  D++GEIR+SCS  N
Sbjct  336   EERFFRSWGESFLKLTTIEVKT-DNEGEIRQSCSFTN  371



>ref|XP_007161106.1| hypothetical protein PHAVU_001G043100g [Phaseolus vulgaris]
 gb|ESW33100.1| hypothetical protein PHAVU_001G043100g [Phaseolus vulgaris]
Length=329

 Score =   392 bits (1007),  Expect = 5e-130, Method: Compositional matrix adjust.
 Identities = 205/298 (69%), Positives = 242/298 (81%), Gaps = 1/298 (0%)
 Frame = +2

Query  239   FNFYAISCPSAELIVKNTVRSASSVDPTLPGKLLRLLFHDCFVEGCDASILLQGNDTERS  418
             FNFYA SCP+AELIV+N++ S+SS DP++PGKLLRL+FHDCFVEGCDAS++L GN+TE+S
Sbjct  33    FNFYAASCPTAELIVRNSISSSSSSDPSIPGKLLRLIFHDCFVEGCDASLMLLGNNTEQS  92

Query  419   DPANKSVGGFSTVDSAKRVLEIFCPETVSCADIIALAARDAVEFVGGPSVAIPTGRRDGR  598
             DPAN+S+GGFS ++SAKRVLE  CP TVSCADIIALAARDAVE  GGP + IPTGRRDG 
Sbjct  93    DPANRSIGGFSVIESAKRVLEFLCPGTVSCADIIALAARDAVELTGGPMIQIPTGRRDGM  152

Query  599   VSLGKNVRPNIIDTSFTMDEMMKIFAAKGLSLDDLVTLSGAHTIGSAHCSAFSDRFQLAS  778
             VS+  NVRPNI+DTSFTMDEM+K F+ KGLSL DLV LSGAHTIG+AHCS+F DRFQ  S
Sbjct  153   VSVASNVRPNILDTSFTMDEMIKRFSNKGLSLFDLVILSGAHTIGTAHCSSFRDRFQQDS  212

Query  779   NGSFLPIdaaldhayaaelaRQCPAGASDAVTVNNDPVTPSLFDNQYYKDLLAHRGLFQS  958
              G    ID +LD +YA EL ++CP  AS +V VNNDP T  +FDN YY++LL ++GLFQS
Sbjct  213   KGKMKLIDKSLDSSYADELMKECPLSASPSVQVNNDPETSMVFDNHYYRNLLTNKGLFQS  272

Query  959   DSALLRDKRAMEKVQDFAGDQNNFFTSWEQSFLKLVSIGVKVGDDDGEIRRSCSSVNA  1132
             DSALL D R  + V+D A DQ  FF SW QSF+KL SIGVK G D+GEIRR CSS NA
Sbjct  273   DSALLSDNRTRKLVEDLANDQQFFFESWGQSFMKLTSIGVKTG-DEGEIRRFCSSTNA  329



>ref|XP_002867280.1| hypothetical protein ARALYDRAFT_328551 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43539.1| hypothetical protein ARALYDRAFT_328551 [Arabidopsis lyrata subsp. 
lyrata]
Length=326

 Score =   388 bits (997),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 188/297 (63%), Positives = 240/297 (81%), Gaps = 1/297 (0%)
 Frame = +2

Query  239   FNFYAISCPSAELIVKNTVRSASSVDPTLPGKLLRLLFHDCFVEGCDASILLQGNDTERS  418
             FNFYA SC  AE +V+NTVRSA+S DPT+PGKL+RLLFHDCFV+GCDAS+L+QGN TERS
Sbjct  31    FNFYAGSCSVAEFLVRNTVRSATSSDPTIPGKLVRLLFHDCFVQGCDASVLIQGNGTERS  90

Query  419   DPANKSVGGFSTVDSAKRVLEIFCPETVSCADIIALAARDAVEFVGGPSVAIPTGRRDGR  598
             DP N S+GGFS +D+AK  +EI CP+TVSCADI+ALAARDAVE  GGP V IPTGRRDG+
Sbjct  91    DPGNASLGGFSVIDTAKNAIEILCPDTVSCADIVALAARDAVEAAGGPVVKIPTGRRDGK  150

Query  599   VSLGKNVRPNIIDTSFTMDEMMKIFAAKGLSLDDLVTLSGAHTIGSAHCSAFSDRFQLAS  778
              S+  NVRPNIIDT FT+D+M+  F++KGLS+ DLV LSGAHTIG++HC+AF+ RFQ  S
Sbjct  151   ESMAANVRPNIIDTDFTLDQMIDAFSSKGLSIQDLVVLSGAHTIGASHCNAFNGRFQRDS  210

Query  779   NGSFLPIdaaldhayaaelaRQCPAGASDAVTVNNDPVTPSLFDNQYYKDLLAHRGLFQS  958
              G+F  IDA+LD++YA  L  +C +  S ++TV+NDP T S+FDNQYY++L  H+GLFQ+
Sbjct  211   KGNFELIDASLDNSYAETLMNKCSSSESSSLTVSNDPETSSIFDNQYYRNLETHKGLFQT  270

Query  959   DSALLRDKRAMEKVQDFAGDQNNFFTSWEQSFLKLVSIGVKVGDDDGEIRRSCSSVN  1129
             DSAL+ D R    V++ A D+ +F+  W +SF++L  +GVKVG +DGEIRRSCSS+N
Sbjct  271   DSALMEDNRTRTMVEELASDEESFYQRWSESFVRLSMVGVKVG-EDGEIRRSCSSIN  326



>ref|XP_010437998.1| PREDICTED: peroxidase 46 [Camelina sativa]
Length=327

 Score =   387 bits (995),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 192/297 (65%), Positives = 238/297 (80%), Gaps = 1/297 (0%)
 Frame = +2

Query  239   FNFYAISCPSAELIVKNTVRSASSVDPTLPGKLLRLLFHDCFVEGCDASILLQGNDTERS  418
             FNFYA SCP AEL+V+NTVRSA+  DPT+PGKLLRLLFHDCFV+GCDAS+L+QGN TERS
Sbjct  32    FNFYASSCPVAELLVRNTVRSATLSDPTIPGKLLRLLFHDCFVQGCDASVLIQGNTTERS  91

Query  419   DPANKSVGGFSTVDSAKRVLEIFCPETVSCADIIALAARDAVEFVGGPSVAIPTGRRDGR  598
             DP N S+GGFS +D+AK+ LEI CP TVSCADI+ALAARDAVE  GGP V I TGRRDGR
Sbjct  92    DPGNASLGGFSVIDTAKKALEIICPATVSCADIVALAARDAVEAAGGPVVEILTGRRDGR  151

Query  599   VSLGKNVRPNIIDTSFTMDEMMKIFAAKGLSLDDLVTLSGAHTIGSAHCSAFSDRFQLAS  778
             VS+  NVRPNIIDT F++D+M+  F++KGLS+ DLV LSGAHTIG++HC+AF+ RF+  S
Sbjct  152   VSIAANVRPNIIDTDFSLDQMIDGFSSKGLSIQDLVVLSGAHTIGASHCNAFNGRFKQDS  211

Query  779   NGSFLPIdaaldhayaaelaRQCPAGASDAVTVNNDPVTPSLFDNQYYKDLLAHRGLFQS  958
              GSF  IDA+LD +YA  L  +C +  S ++TV+NDP T S FDNQYY++L  H+GLFQ+
Sbjct  212   KGSFELIDASLDKSYAETLMNKCSSSESSSLTVSNDPETSSTFDNQYYRNLETHKGLFQT  271

Query  959   DSALLRDKRAMEKVQDFAGDQNNFFTSWEQSFLKLVSIGVKVGDDDGEIRRSCSSVN  1129
             DSAL+ D R  + V+  A D+  FF  W +SF+KL  +GV+VG +DGEIRR+CSSVN
Sbjct  272   DSALMEDDRTRKMVEALASDEEIFFQRWSESFVKLSMVGVRVG-EDGEIRRTCSSVN  327



>ref|XP_010525889.1| PREDICTED: peroxidase 46 [Tarenaya hassleriana]
Length=333

 Score =   388 bits (996),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 193/297 (65%), Positives = 238/297 (80%), Gaps = 4/297 (1%)
 Frame = +2

Query  239   FNFYAISCPSAELIVKNTVRSASSVDPTLPGKLLRLLFHDCFVEGCDASILLQGNDTERS  418
             FNFY ISCP AE +V+NTVRSASS D T+PGKLLRLLFHDCFV+GCD S++++GN TERS
Sbjct  40    FNFYGISCPGAEFVVRNTVRSASSNDLTVPGKLLRLLFHDCFVDGCDGSVMIEGNSTERS  99

Query  419   DPANKSVGGFSTVDSAKRVLEIFCPETVSCADIIALAARDAVEFVGGPSVAIPTGRRDGR  598
             DPAN S+GGFS +++AK VLEIFCP  VSCADIIALAARDAVE VGGP V IPTGR+DG 
Sbjct  100   DPANASLGGFSVIENAKSVLEIFCPGIVSCADIIALAARDAVEAVGGPVVEIPTGRKDGT  159

Query  599   VSLGKNVRPNIIDTSFTMDEMMKIFAAKGLSLDDLVTLSGAHTIGSAHCSAFSDRFQLAS  778
             VS+  NVRPNIIDT FT+D+M+ +F++KGLSL D+V LSGAHTIGSAHC+AF+DRF+   
Sbjct  160   VSVAANVRPNIIDTDFTLDQMLTVFSSKGLSLQDVVILSGAHTIGSAHCNAFNDRFKRDR  219

Query  779   NGSFLPIdaaldhayaaelaRQCPAGASDAVTVNNDPVTPSLFDNQYYKDLLAHRGLFQS  958
              G    ID +LD+AYA  L  +C   +SD+ +V+NDP T   FDNQYY++L AH+GLFQ+
Sbjct  220   KGELELIDKSLDNAYAESLMNKC---SSDSASVSNDPETAFAFDNQYYRNLQAHKGLFQT  276

Query  959   DSALLRDKRAMEKVQDFAGDQNNFFTSWEQSFLKLVSIGVKVGDDDGEIRRSCSSVN  1129
             DS LL D+R  + V+D A DQ +FF  W +SF+KL  +GV+ G +DGE+RRSCSSVN
Sbjct  277   DSVLLEDQRTRKMVEDLASDQASFFDKWSESFVKLSLVGVRTG-EDGEVRRSCSSVN  332



>ref|XP_009390539.1| PREDICTED: peroxidase 18-like [Musa acuminata subsp. malaccensis]
Length=333

 Score =   386 bits (991),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 190/297 (64%), Positives = 233/297 (78%), Gaps = 1/297 (0%)
 Frame = +2

Query  242   NFYAISCPSAELIVKNTVRSASSVDPTLPGKLLRLLFHDCFVEGCDASILLQGNDTERSD  421
             +FY  SCP+ E +V+NTV SAS++D T+PGKLLRLLFHDC +EGCDAS+L+QG  TERSD
Sbjct  38    DFYLFSCPNVERLVRNTVESASALDSTIPGKLLRLLFHDCLIEGCDASVLIQGKGTERSD  97

Query  422   PANKSVGGFSTVDSAKRVLEIFCPETVSCADIIALAARDAVEFVGGPSVAIPTGRRDGRV  601
             PANKS+GGF  VDSAK +LE+ CP TVSCADI+ LAARDAVE  GGPSVA+P GRRDG V
Sbjct  98    PANKSLGGFYVVDSAKELLEVLCPGTVSCADILVLAARDAVELTGGPSVAVPLGRRDGLV  157

Query  602   SLGKNVRPNIIDTSFTMDEMMKIFAAKGLSLDDLVTLSGAHTIGSAHCSAFSDRFQLASN  781
             S   NVRPN++DTSF++DE+ + F +KGLS+DDLV LSGAHT+GS+HC AFS+RF+ +SN
Sbjct  158   SSASNVRPNMVDTSFSVDELAQRFTSKGLSMDDLVVLSGAHTVGSSHCDAFSERFKQSSN  217

Query  782   GSFLPIdaaldhayaaelaRQCPAGASDAVTVNNDPVTPSLFDNQYYKDLLAHRGLFQSD  961
             G+ +P+D +L+  YA +LA  C AGAS    V+NDP TPSLFDNQYY +LLA+RGL  SD
Sbjct  218   GTMVPVDTSLEKGYAKQLAETCRAGASATTMVDNDPSTPSLFDNQYYVNLLANRGLLHSD  277

Query  962   SALLRDKRAMEKVQDFAGDQNNFFTSWEQSFLKLVSIGVKVGDDDGEIRRSCSSVNA  1132
             S L+ D R    V+ F+  Q+ FF SW +SF+KL  I VK G DDGEIR SCSSVN 
Sbjct  278   SVLVTDARTRRTVEAFSESQDAFFMSWAESFVKLSIIDVKTG-DDGEIRFSCSSVNG  333



>sp|O81772.1|PER46_ARATH RecName: Full=Peroxidase 46; Short=Atperox P46; AltName: Full=ATP48; 
Flags: Precursor [Arabidopsis thaliana]
 emb|CAA19747.1| peroxidase - like protein [Arabidopsis thaliana]
 emb|CAB79894.1| peroxidase-like protein [Arabidopsis thaliana]
Length=326

 Score =   385 bits (988),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 187/297 (63%), Positives = 237/297 (80%), Gaps = 1/297 (0%)
 Frame = +2

Query  239   FNFYAISCPSAELIVKNTVRSASSVDPTLPGKLLRLLFHDCFVEGCDASILLQGNDTERS  418
             FNFYA SC  AE +V+NTVRSA+S DPT+PGKLLRL FHDCFV+GCDAS+L+QGN TE+S
Sbjct  31    FNFYASSCSVAEFLVRNTVRSATSSDPTIPGKLLRLFFHDCFVQGCDASVLIQGNSTEKS  90

Query  419   DPANKSVGGFSTVDSAKRVLEIFCPETVSCADIIALAARDAVEFVGGPSVAIPTGRRDGR  598
             DP N S+GGFS +D+AK  +E  CP TVSCADI+ALAARDAVE  GGP V IPTGRRDG+
Sbjct  91    DPGNASLGGFSVIDTAKNAIENLCPATVSCADIVALAARDAVEAAGGPVVEIPTGRRDGK  150

Query  599   VSLGKNVRPNIIDTSFTMDEMMKIFAAKGLSLDDLVTLSGAHTIGSAHCSAFSDRFQLAS  778
              S+  NVRPNIIDT FT+D+M+  F++KGLS+ DLV LSGAHTIG++HC+AF+ RFQ  S
Sbjct  151   ESMAANVRPNIIDTDFTLDQMIDAFSSKGLSIQDLVVLSGAHTIGASHCNAFNGRFQRDS  210

Query  779   NGSFLPIdaaldhayaaelaRQCPAGASDAVTVNNDPVTPSLFDNQYYKDLLAHRGLFQS  958
              G+F  IDA+LD++YA  L  +C +  S ++TV+NDP T ++FDNQYY++L  H+GLFQ+
Sbjct  211   KGNFEVIDASLDNSYAETLMNKCSSSESSSLTVSNDPETSAVFDNQYYRNLETHKGLFQT  270

Query  959   DSALLRDKRAMEKVQDFAGDQNNFFTSWEQSFLKLVSIGVKVGDDDGEIRRSCSSVN  1129
             DSAL+ D R    V++ A D+ +FF  W +SF+KL  +GV+VG +DGEIRRSCSSVN
Sbjct  271   DSALMEDNRTRTMVEELASDEESFFQRWSESFVKLSMVGVRVG-EDGEIRRSCSSVN  326



>ref|XP_006412557.1| hypothetical protein EUTSA_v10025685mg [Eutrema salsugineum]
 gb|ESQ54010.1| hypothetical protein EUTSA_v10025685mg [Eutrema salsugineum]
Length=330

 Score =   384 bits (986),  Expect = 7e-127, Method: Compositional matrix adjust.
 Identities = 197/336 (59%), Positives = 252/336 (75%), Gaps = 8/336 (2%)
 Frame = +2

Query  125   APTCRCRRRRFHYLYNVVAVTTlmmlqllspasasslsFNFYAISCPSAELIVKNTVRSA  304
             A T    R  + YL N++   +  +      +      FNFYA SCP AE +V+NTVRSA
Sbjct  2     ASTVASYRINYSYLLNLLVFLSSFLTASSDLS------FNFYAASCPVAEFLVRNTVRSA  55

Query  305   SSVDPTLPGKLLRLLFHDCFVEGCDASILLQGNDTERSDPANKSVGGFSTVDSAKRVLEI  484
             SS DPT+PGKLLRLLFHDCFV+GCDAS+L+QGN TERSDP N S+GGFS ++ AK  +EI
Sbjct  56    SSSDPTIPGKLLRLLFHDCFVQGCDASVLIQGNSTERSDPGNASLGGFSVIERAKNAIEI  115

Query  485   FCPETVSCADIIALAARDAVEFVGGPSVAIPTGRRDGRVSLGKNVRPNIIDTSFTMDEMM  664
             FCP TVSCADI+ALAARDAVE  GGP V IPTGRRDG+VS+  +VRPNIIDT F++D+M+
Sbjct  116   FCPATVSCADIVALAARDAVEAAGGPVVEIPTGRRDGKVSVAADVRPNIIDTDFSLDKMI  175

Query  665   KIFAAKGLSLDDLVTLSGAHTIGSAHCSAFSDRFQLASNGSFLPIdaaldhayaaelaRQ  844
               F++KGLS+ DLV LSGAHTIG++HC+AF  RF+    G+   IDA+LD++YA  L  +
Sbjct  176   DAFSSKGLSIQDLVVLSGAHTIGASHCNAFDGRFKRDPKGNLELIDASLDNSYAETLMNK  235

Query  845   C-PAGASDAVTVNNDPVTPSLFDNQYYKDLLAHRGLFQSDSALLRDKRAMEKVQDFAGDQ  1021
             C  + +S ++TV+NDP T S FDNQYYK+L AH+GLFQ+DSAL+ D+R  + V+D A D+
Sbjct  236   CSSSSSSSSLTVSNDPETSSRFDNQYYKNLEAHKGLFQTDSALMEDERTRKMVEDLASDE  295

Query  1022  NNFFTSWEQSFLKLVSIGVKVGDDDGEIRRSCSSVN  1129
              +FF  W +SF+KL  +GV+ G +DGEIRRSCSSVN
Sbjct  296   ESFFQRWRESFVKLSMVGVRFG-EDGEIRRSCSSVN  330



>ref|XP_009395226.1| PREDICTED: peroxidase 18 [Musa acuminata subsp. malaccensis]
Length=331

 Score =   384 bits (985),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 188/293 (64%), Positives = 235/293 (80%), Gaps = 1/293 (0%)
 Frame = +2

Query  245   FYAISCPSAELIVKNTVRSASSVDPTLPGKLLRLLFHDCFVEGCDASILLQGNDTERSDP  424
             FY+ SCP  EL+VKNTVRSA  +D T+P KLLRLLFHDC V+GCD S+L++GN TERSDP
Sbjct  37    FYSSSCPDVELLVKNTVRSAYEIDSTIPAKLLRLLFHDCIVQGCDGSVLVEGNGTERSDP  96

Query  425   ANKSVGGFSTVDSAKRVLEIFCPETVSCADIIALAARDAVEFVGGPSVAIPTGRRDGRVS  604
             ANKS+GGF  V+SAKR+LE +CP TVSCADI+ LAARDAVE  GGPSV +P GRRDG VS
Sbjct  97    ANKSLGGFYVVESAKRLLEFWCPGTVSCADILVLAARDAVELTGGPSVVVPLGRRDGAVS  156

Query  605   LGKNVRPNIIDTSFTMDEMMKIFAAKGLSLDDLVTLSGAHTIGSAHCSAFSDRFQLASNG  784
                +VRPN++DT+FT+D++ + F++KGLS+DDLV LSGAHTIGSAHC+AFSDRF   S+G
Sbjct  157   SAASVRPNMVDTTFTVDQLAQRFSSKGLSMDDLVILSGAHTIGSAHCTAFSDRFNQLSDG  216

Query  785   SFLPIdaaldhayaaelaRQCPAGASDAVTVNNDPVTPSLFDNQYYKDLLAHRGLFQSDS  964
             + +P DA+L+  YA +LAR+CPAGASD+VT +NDPVTPSLFDNQYY +LLA +GL QSDS
Sbjct  217   TMVPADASLERNYAMQLARKCPAGASDSVTTSNDPVTPSLFDNQYYGNLLAKKGLLQSDS  276

Query  965   ALLRDKRAMEKVQDFAGDQNNFFTSWEQSFLKLVSIGVKVGDDDGEIRRSCSS  1123
              L+ D R    V+  +  Q+ FF SW +SF+KL +IGVK G ++G IR  C+S
Sbjct  277   VLVADARTKSTVEALSRSQDAFFASWAKSFVKLSTIGVKTG-NEGAIRFLCAS  328



>ref|XP_007224694.1| hypothetical protein PRUPE_ppa025451mg, partial [Prunus persica]
 gb|EMJ25893.1| hypothetical protein PRUPE_ppa025451mg, partial [Prunus persica]
Length=292

 Score =   382 bits (980),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 193/261 (74%), Positives = 218/261 (84%), Gaps = 0/261 (0%)
 Frame = +2

Query  239   FNFYAISCPSAELIVKNTVRSASSVDPTLPGKLLRLLFHDCFVEGCDASILLQGNDTERS  418
              +FY+ SCPSAEL+V+NTVRSAS +DPT+PGKLLRLLFHDCFVEGCDAS+LLQG  TERS
Sbjct  32    LSFYSASCPSAELMVRNTVRSASDIDPTIPGKLLRLLFHDCFVEGCDASVLLQGTGTERS  91

Query  419   DPANKSVGGFSTVDSAKRVLEIFCPETVSCADIIALAARDAVEFVGGPSVAIPTGRRDGR  598
             DPAN S+GGFS +DSAKR+LEIFCP TVSCADI+ALAARDAVE  GGP V IPTGRRDG+
Sbjct  92    DPANTSLGGFSVIDSAKRLLEIFCPGTVSCADIVALAARDAVEISGGPVVQIPTGRRDGK  151

Query  599   VSLGKNVRPNIIDTSFTMDEMMKIFAAKGLSLDDLVTLSGAHTIGSAHCSAFSDRFQLAS  778
             VS   NVRPNI+DTSFTMDEM+K+F++KGLSLDDLVTLSGAHTIGSAHC AFSDRFQ  S
Sbjct  152   VSAASNVRPNIVDTSFTMDEMIKLFSSKGLSLDDLVTLSGAHTIGSAHCGAFSDRFQQDS  211

Query  779   NGSFLPIdaaldhayaaelaRQCPAGASDAVTVNNDPVTPSLFDNQYYKDLLAHRGLFQS  958
              G    ID +LD+AYA EL RQCPAGA+ + TV  DP T   FDN YY++LLAHRGLFQS
Sbjct  212   KGKLKLIDTSLDNAYAEELMRQCPAGANPSTTVKIDPNTSFAFDNHYYQNLLAHRGLFQS  271

Query  959   DSALLRDKRAMEKVQDFAGDQ  1021
             DS LL D R  + V+ FA DQ
Sbjct  272   DSVLLSDDRTRKLVESFAQDQ  292



>gb|KFK29773.1| hypothetical protein AALP_AA7G177300 [Arabis alpina]
Length=327

 Score =   383 bits (983),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 191/297 (64%), Positives = 238/297 (80%), Gaps = 3/297 (1%)
 Frame = +2

Query  239   FNFYAISCPSAELIVKNTVRSASSVDPTLPGKLLRLLFHDCFVEGCDASILLQGNDTERS  418
             FNFYA SCP AE +V+NTVR+A S DPT+PGKLLRLLFHDCFV+GCDAS+L+QGN+TERS
Sbjct  34    FNFYAGSCPVAEFLVRNTVRTAFSSDPTIPGKLLRLLFHDCFVQGCDASVLIQGNNTERS  93

Query  419   DPANKSVGGFSTVDSAKRVLEIFCPETVSCADIIALAARDAVEFVGGPSVAIPTGRRDGR  598
             DP N S+GGFS ++ AK  +EIFCP TVSCADI+ LAARDAVE  GGP V IPTGRRDGR
Sbjct  94    DPGNTSLGGFSVIERAKNAVEIFCPATVSCADIVVLAARDAVEASGGPVVEIPTGRRDGR  153

Query  599   VSLGKNVRPNIIDTSFTMDEMMKIFAAKGLSLDDLVTLSGAHTIGSAHCSAFSDRFQLAS  778
             VS+  +VRPNIIDT F++D+M++ F++KGLS+ DLV LSGAHTIG +HC+AF  RF+  S
Sbjct  154   VSVAADVRPNIIDTDFSLDKMIESFSSKGLSIQDLVVLSGAHTIGDSHCNAFDGRFKRDS  213

Query  779   NGSFLPIdaaldhayaaelaRQCPAGASDAVTVNNDPVTPSLFDNQYYKDLLAHRGLFQS  958
              G+F  IDA+LD++YA  L  +C   +S ++TV+NDP T S FDNQYYK+L   +GLFQ+
Sbjct  214   KGNFELIDASLDNSYAETLMNKC--SSSTSLTVSNDPETSSRFDNQYYKNLEERKGLFQT  271

Query  959   DSALLRDKRAMEKVQDFAGDQNNFFTSWEQSFLKLVSIGVKVGDDDGEIRRSCSSVN  1129
             DSAL+ D R  + V+D A D+ +FF  W +SF+KL  +GVKVG +DGEIRRSCSSVN
Sbjct  272   DSALMEDNRTRKIVEDLASDEESFFERWRESFVKLSMVGVKVG-EDGEIRRSCSSVN  327



>ref|NP_180053.1| peroxidase [Arabidopsis thaliana]
 sp|Q9SK52.1|PER18_ARATH RecName: Full=Peroxidase 18; Short=Atperox P18; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAD23032.1| putative peroxidase [Arabidopsis thaliana]
 gb|AEC07630.1| peroxidase [Arabidopsis thaliana]
Length=329

 Score =   381 bits (978),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 191/298 (64%), Positives = 238/298 (80%), Gaps = 2/298 (1%)
 Frame = +2

Query  239   FNFYAISCPSAELIVKNTVRSASSVDPTLPGKLLRLLFHDCFVEGCDASILLQGNDTERS  418
             FNFYA SCP AELIV+NTVRSASS DP++ GKLLRL+FHDCFV+GCD S+L++GN TERS
Sbjct  33    FNFYAGSCPGAELIVRNTVRSASSSDPSVLGKLLRLIFHDCFVQGCDGSVLIRGNGTERS  92

Query  419   DPANKSVGGFSTVDSAKRVLEIFCPETVSCADIIALAARDAVEFVGGPSVAIPTGRRDGR  598
             DP N S+GGF+ ++S K +LEIFCP TVSCADI+ LAARDAVE +GGP V IPTGRRDGR
Sbjct  93    DPGNASLGGFAVIESVKNILEIFCPGTVSCADILVLAARDAVEALGGPVVPIPTGRRDGR  152

Query  599   VSLGKNVRPNIIDTSFTMDEMMKIFAAKGLSLDDLVTLSGAHTIGSAHCSAFSDRFQLAS  778
             VS+  NVRPNIIDT FT+D+M+ IF++KGLS+ DLV LSGAHTIG+AHC+ F+ RF+L  
Sbjct  153   VSMAANVRPNIIDTDFTVDKMINIFSSKGLSVHDLVVLSGAHTIGAAHCNTFNSRFKLDP  212

Query  779   NGSFLPIdaaldhayaaelaRQCPAGASDAVT-VNNDPVTPSLFDNQYYKDLLAHRGLFQ  955
              G+   IDA+LD++YA  L  +C +      T V+NDP T S FDNQYYK+LLAH+GLFQ
Sbjct  213   KGNLELIDASLDNSYAQTLVNKCSSSLDPTTTVVDNDPETSSTFDNQYYKNLLAHKGLFQ  272

Query  956   SDSALLRDKRAMEKVQDFAGDQNNFFTSWEQSFLKLVSIGVKVGDDDGEIRRSCSSVN  1129
             +DSAL+ D R  + V+  A DQ +FF  W +SFLK+  +GV+VG ++GEIRRSCS+VN
Sbjct  273   TDSALMEDDRTRKIVEILANDQESFFDRWTESFLKMSLMGVRVG-EEGEIRRSCSAVN  329



>ref|XP_010429474.1| PREDICTED: peroxidase 18-like isoform X1 [Camelina sativa]
 ref|XP_010429476.1| PREDICTED: peroxidase 18-like isoform X2 [Camelina sativa]
Length=332

 Score =   381 bits (978),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 189/298 (63%), Positives = 236/298 (79%), Gaps = 2/298 (1%)
 Frame = +2

Query  239   FNFYAISCPSAELIVKNTVRSASSVDPTLPGKLLRLLFHDCFVEGCDASILLQGNDTERS  418
             FNFYA SCP AELIV+NTVRSASS DP++ GKLLRL+FHDCFV+GCD S+L++GNDTERS
Sbjct  36    FNFYAGSCPGAELIVRNTVRSASSSDPSVLGKLLRLIFHDCFVQGCDGSVLIRGNDTERS  95

Query  419   DPANKSVGGFSTVDSAKRVLEIFCPETVSCADIIALAARDAVEFVGGPSVAIPTGRRDGR  598
             DP N S+GGF+ ++S K VLEIFCP TVSCADI+ LAARDAVE +GGP V +PTGRRDG 
Sbjct  96    DPGNASLGGFAVIESIKNVLEIFCPGTVSCADILVLAARDAVEALGGPVVPLPTGRRDGT  155

Query  599   VSLGKNVRPNIIDTSFTMDEMMKIFAAKGLSLDDLVTLSGAHTIGSAHCSAFSDRFQLAS  778
             VS+  NVRPNIIDT FT+D+M+ IF++KGLS+ DLV LSGAHTIG+AHC+ F+ RF+L  
Sbjct  156   VSIAANVRPNIIDTDFTVDKMINIFSSKGLSIQDLVVLSGAHTIGAAHCNTFNSRFKLDP  215

Query  779   NGSFLPIdaaldhayaaelaRQCPAGASDAVT-VNNDPVTPSLFDNQYYKDLLAHRGLFQ  955
              G+   ID++LD++YA  L  +C +      T V NDP T S FDNQYYK+LLAH+GLFQ
Sbjct  216   KGNLELIDSSLDNSYAQTLMNKCSSSLDPTTTVVENDPETSSTFDNQYYKNLLAHKGLFQ  275

Query  956   SDSALLRDKRAMEKVQDFAGDQNNFFTSWEQSFLKLVSIGVKVGDDDGEIRRSCSSVN  1129
             +DS L+ D R  + V+  A DQ +FF  W +SF+K+  IGV+VG ++GEIRRSCS+VN
Sbjct  276   TDSVLMEDDRTRKIVEILANDQESFFERWTESFMKMSVIGVRVG-EEGEIRRSCSAVN  332



>ref|XP_010472498.1| PREDICTED: peroxidase 18 [Camelina sativa]
Length=332

 Score =   379 bits (974),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 189/298 (63%), Positives = 235/298 (79%), Gaps = 2/298 (1%)
 Frame = +2

Query  239   FNFYAISCPSAELIVKNTVRSASSVDPTLPGKLLRLLFHDCFVEGCDASILLQGNDTERS  418
             FNFYA SCP AELIV+NTVRSASS DP++ GKLLRL+FHDCFV+GCD S+L++GN TERS
Sbjct  36    FNFYAGSCPGAELIVRNTVRSASSSDPSVLGKLLRLIFHDCFVQGCDGSVLIRGNGTERS  95

Query  419   DPANKSVGGFSTVDSAKRVLEIFCPETVSCADIIALAARDAVEFVGGPSVAIPTGRRDGR  598
             DP N S+GGF+ ++S K VLEIFCP TVSCADI+ LAARDAVE +GGP V IPTGRRDG 
Sbjct  96    DPGNASLGGFAVIESIKNVLEIFCPGTVSCADILVLAARDAVEALGGPVVPIPTGRRDGT  155

Query  599   VSLGKNVRPNIIDTSFTMDEMMKIFAAKGLSLDDLVTLSGAHTIGSAHCSAFSDRFQLAS  778
             VS+  NVRPNIIDT FT+D+M+ IF++KGLS+ DLV LSGAHTIG+AHC+ F+ RF+L  
Sbjct  156   VSMAANVRPNIIDTDFTVDKMINIFSSKGLSIQDLVVLSGAHTIGAAHCNTFNSRFKLDP  215

Query  779   NGSFLPIdaaldhayaaelaRQCPAGASDAVT-VNNDPVTPSLFDNQYYKDLLAHRGLFQ  955
              G+   ID++LD++YA  L  +C +      T V NDP T S FDNQYYK+LLAH+GLFQ
Sbjct  216   KGNLELIDSSLDNSYAQTLMNKCSSSLDPTTTVVENDPETSSTFDNQYYKNLLAHKGLFQ  275

Query  956   SDSALLRDKRAMEKVQDFAGDQNNFFTSWEQSFLKLVSIGVKVGDDDGEIRRSCSSVN  1129
             +DS L+ D R  + V+  A DQ +FF  W +SF+K+  IGV+VG ++GEIRRSCS+VN
Sbjct  276   TDSVLMEDDRTRKIVEILANDQESFFERWTESFMKMSVIGVRVG-EEGEIRRSCSAVN  332



>ref|XP_006405046.1| hypothetical protein EUTSA_v10000495mg [Eutrema salsugineum]
 gb|ESQ46499.1| hypothetical protein EUTSA_v10000495mg [Eutrema salsugineum]
Length=329

 Score =   378 bits (971),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 188/298 (63%), Positives = 237/298 (80%), Gaps = 2/298 (1%)
 Frame = +2

Query  239   FNFYAISCPSAELIVKNTVRSASSVDPTLPGKLLRLLFHDCFVEGCDASILLQGNDTERS  418
             FNFYA SCP AE IV+NTVRSAS+ DP++ GKLLRL+FHDCFV+GCDAS+L++GN TERS
Sbjct  33    FNFYAGSCPGAEFIVRNTVRSASTTDPSILGKLLRLIFHDCFVQGCDASVLIRGNGTERS  92

Query  419   DPANKSVGGFSTVDSAKRVLEIFCPETVSCADIIALAARDAVEFVGGPSVAIPTGRRDGR  598
             DP N S+GGF+ ++SAK VLEIFCP  VSCADI+ LAARDAVE +GGP VA+PTGRRDG 
Sbjct  93    DPGNASLGGFTVIESAKNVLEIFCPGIVSCADILVLAARDAVEALGGPVVAVPTGRRDGT  152

Query  599   VSLGKNVRPNIIDTSFTMDEMMKIFAAKGLSLDDLVTLSGAHTIGSAHCSAFSDRFQLAS  778
             VSL +NVRPNIIDT FT+D+M+ +F++KGLS+ DLV LSGAHTIG+AHC+ F+ RF+   
Sbjct  153   VSLAENVRPNIIDTDFTVDKMITVFSSKGLSVQDLVVLSGAHTIGAAHCNTFNSRFKRDP  212

Query  779   NGSFLPIdaaldhayaaelaRQCPAGASDAVT-VNNDPVTPSLFDNQYYKDLLAHRGLFQ  955
             NG+F  IDA+LD+ YA  L  +C +      T VNNDP T S FDNQYY++L AH+GLFQ
Sbjct  213   NGNFELIDASLDNNYAQTLMNKCSSSMDPTTTVVNNDPETSSTFDNQYYRNLQAHKGLFQ  272

Query  956   SDSALLRDKRAMEKVQDFAGDQNNFFTSWEQSFLKLVSIGVKVGDDDGEIRRSCSSVN  1129
             +DSAL+ D+R  + V+  A D+  FF  W +SF+K+  +GV+VG ++GEIRRSCS VN
Sbjct  273   TDSALMEDERTRKIVEILANDEEIFFERWSESFVKMSVMGVRVG-EEGEIRRSCSFVN  329



>emb|CDY34754.1| BnaA09g41210D [Brassica napus]
Length=333

 Score =   379 bits (972),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 191/298 (64%), Positives = 234/298 (79%), Gaps = 2/298 (1%)
 Frame = +2

Query  239   FNFYAISCPSAELIVKNTVRSASSVDPTLPGKLLRLLFHDCFVEGCDASILLQGNDTERS  418
             FNFY  SCP AE IV+NTVRSASS DP++ GKLLRL+FHDCFV+GCDAS+L++GN TERS
Sbjct  37    FNFYGSSCPGAEFIVRNTVRSASSSDPSVLGKLLRLVFHDCFVQGCDASVLVRGNSTERS  96

Query  419   DPANKSVGGFSTVDSAKRVLEIFCPETVSCADIIALAARDAVEFVGGPSVAIPTGRRDGR  598
             DP N S+GGF  ++SAK VLEIFCP  VSCADI+ LAARDAVE +GGP VAIPTGRRDG 
Sbjct  97    DPGNASLGGFDVIESAKNVLEIFCPGIVSCADILVLAARDAVEALGGPVVAIPTGRRDGT  156

Query  599   VSLGKNVRPNIIDTSFTMDEMMKIFAAKGLSLDDLVTLSGAHTIGSAHCSAFSDRFQLAS  778
             VS  +NVRPNIIDT FT+D+M+ IFA+KGLS+ DLV LSGAHT+G+AHC+ F+ RF    
Sbjct  157   VSAAENVRPNIIDTDFTVDKMINIFASKGLSVQDLVVLSGAHTVGAAHCNTFNSRFTRDP  216

Query  779   NGSFLPIdaaldhayaaelaRQCPAGASDAVT-VNNDPVTPSLFDNQYYKDLLAHRGLFQ  955
              G+F  IDA+LD++YA  L  +C +      T VNNDP T S FDNQYYK+LLAH+GLFQ
Sbjct  217   RGNFELIDASLDNSYAQTLLNKCSSSMDPTTTVVNNDPETSSTFDNQYYKNLLAHKGLFQ  276

Query  956   SDSALLRDKRAMEKVQDFAGDQNNFFTSWEQSFLKLVSIGVKVGDDDGEIRRSCSSVN  1129
             +DSAL+ D R  + V+  A D+ +F   W +SF+K+  IGV+VG ++GEIRRSCSSVN
Sbjct  277   TDSALMEDDRTRKIVEILANDEESFLERWTESFMKMSVIGVRVG-EEGEIRRSCSSVN  333



>ref|XP_002880630.1| hypothetical protein ARALYDRAFT_481340 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH56889.1| hypothetical protein ARALYDRAFT_481340 [Arabidopsis lyrata subsp. 
lyrata]
Length=329

 Score =   378 bits (971),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 190/298 (64%), Positives = 238/298 (80%), Gaps = 2/298 (1%)
 Frame = +2

Query  239   FNFYAISCPSAELIVKNTVRSASSVDPTLPGKLLRLLFHDCFVEGCDASILLQGNDTERS  418
             FNFYA SCP AELIV+NTVRSASS DP++ GKLLRL+FHDCFV+GCD S+L++GN TERS
Sbjct  33    FNFYAGSCPGAELIVRNTVRSASSSDPSVLGKLLRLIFHDCFVKGCDGSVLIRGNGTERS  92

Query  419   DPANKSVGGFSTVDSAKRVLEIFCPETVSCADIIALAARDAVEFVGGPSVAIPTGRRDGR  598
             DP N S+GGF+ ++S K VLEIFCP TVSCADI+ LAARDAVE +GGP V IPTGRRDG 
Sbjct  93    DPGNASLGGFTVIESIKNVLEIFCPGTVSCADILVLAARDAVEALGGPVVPIPTGRRDGT  152

Query  599   VSLGKNVRPNIIDTSFTMDEMMKIFAAKGLSLDDLVTLSGAHTIGSAHCSAFSDRFQLAS  778
             VS+ +NVRPNIIDT FT+D+M+ IF++KGLS+ DLV LSGAHTIG+AHC+ F+ RF+L  
Sbjct  153   VSMAENVRPNIIDTDFTVDKMINIFSSKGLSVQDLVVLSGAHTIGAAHCNTFNSRFKLDP  212

Query  779   NGSFLPIdaaldhayaaelaRQCPAGASDAVT-VNNDPVTPSLFDNQYYKDLLAHRGLFQ  955
              G+   IDA+LD++YA  L  +C +      T V+NDP T S FDNQYYK+LLAH+GLFQ
Sbjct  213   KGNLELIDASLDNSYAQTLVNKCSSSLDPTTTVVDNDPETSSTFDNQYYKNLLAHKGLFQ  272

Query  956   SDSALLRDKRAMEKVQDFAGDQNNFFTSWEQSFLKLVSIGVKVGDDDGEIRRSCSSVN  1129
             +DSAL+ D R  + V+  A D+ +FF  W +SFLK+  +GV+VG ++GEIRRSCS+VN
Sbjct  273   TDSALMEDDRTRKIVEILANDEESFFDRWTESFLKMSLMGVRVG-EEGEIRRSCSAVN  329



>ref|XP_010417238.1| PREDICTED: peroxidase 18-like [Camelina sativa]
Length=332

 Score =   377 bits (968),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 187/298 (63%), Positives = 235/298 (79%), Gaps = 2/298 (1%)
 Frame = +2

Query  239   FNFYAISCPSAELIVKNTVRSASSVDPTLPGKLLRLLFHDCFVEGCDASILLQGNDTERS  418
             FNFYA SCP AELIV+NTVRSASS DP++ GKLLRL+FHDCFV+GC+ S+L++GN TERS
Sbjct  36    FNFYAGSCPGAELIVRNTVRSASSSDPSVLGKLLRLIFHDCFVQGCEGSVLIRGNGTERS  95

Query  419   DPANKSVGGFSTVDSAKRVLEIFCPETVSCADIIALAARDAVEFVGGPSVAIPTGRRDGR  598
             DP N S+GGF+ ++S K VLEIFCP TVSCADI+ LAARDAVE +GGP V +PTGRRDG 
Sbjct  96    DPGNASLGGFTVIESIKNVLEIFCPGTVSCADILVLAARDAVEALGGPVVPLPTGRRDGT  155

Query  599   VSLGKNVRPNIIDTSFTMDEMMKIFAAKGLSLDDLVTLSGAHTIGSAHCSAFSDRFQLAS  778
             VS+  NVRPNIIDT FT+D+M+ IF++KGLS+ DLV LSGAHTIG+AHC+ F+ RF+L  
Sbjct  156   VSIAANVRPNIIDTDFTVDKMINIFSSKGLSIQDLVVLSGAHTIGAAHCNTFNSRFKLDP  215

Query  779   NGSFLPIdaaldhayaaelaRQCPAGASDAVT-VNNDPVTPSLFDNQYYKDLLAHRGLFQ  955
              G+   ID++LD++YA  L  +C +      T V NDP T S FDNQYYK+LLAH+GLFQ
Sbjct  216   KGNLELIDSSLDNSYAQTLMNKCSSSLDPTTTVVENDPETSSTFDNQYYKNLLAHKGLFQ  275

Query  956   SDSALLRDKRAMEKVQDFAGDQNNFFTSWEQSFLKLVSIGVKVGDDDGEIRRSCSSVN  1129
             +DS L+ D R  + V+  A DQ +FF  W +SF+K+  IGV+VG ++GEIRRSCS+VN
Sbjct  276   TDSVLMEDDRTRKIVEILANDQESFFERWTESFMKMSVIGVRVG-EEGEIRRSCSAVN  332



>gb|AES73524.2| peroxidase family protein [Medicago truncatula]
Length=324

 Score =   377 bits (967),  Expect = 5e-124, Method: Compositional matrix adjust.
 Identities = 192/297 (65%), Positives = 236/297 (79%), Gaps = 1/297 (0%)
 Frame = +2

Query  239   FNFYAISCPSAELIVKNTVRSASSVDPTLPGKLLRLLFHDCFVEGCDASILLQGNDTERS  418
             F+FYA SCP+AEL ++N V ++SS DP++PGKLLR++FHDCFVEGCDAS++LQGN+TE+S
Sbjct  27    FDFYAASCPTAELFIRNAVSTSSSNDPSIPGKLLRMVFHDCFVEGCDASLMLQGNNTEQS  86

Query  419   DPANKSVGGFSTVDSAKRVLEIFCPETVSCADIIALAARDAVEFVGGPSVAIPTGRRDGR  598
             DP N+SVGGFS +++AKRVLE+FCP TVSCADIIALAARDAVE  GGP V IPTGRRDG 
Sbjct  87    DPGNRSVGGFSVIETAKRVLEMFCPGTVSCADIIALAARDAVEIAGGPRVQIPTGRRDGM  146

Query  599   VSLGKNVRPNIIDTSFTMDEMMKIFAAKGLSLDDLVTLSGAHTIGSAHCSAFSDRFQLAS  778
             VS+  NVRPNI+DTSFTMDEM+K+F++KGLSL DLV LSGAHTIG+AHC+ F  RFQ   
Sbjct  147   VSIASNVRPNIVDTSFTMDEMLKLFSSKGLSLLDLVVLSGAHTIGTAHCNTFRGRFQQDR  206

Query  779   NGSFLPIdaaldhayaaelaRQCPAGASDAVTVNNDPVTPSLFDNQYYKDLLAHRGLFQS  958
             NGS   ID  +D  YA +L +QCP  A  +V VN DP T  LFDNQYY++LL  + LFQS
Sbjct  207   NGSLRLIDQTIDTNYADQLIKQCPINAQPSVAVNIDPETSMLFDNQYYRNLLDRKVLFQS  266

Query  959   DSALLRDKRAMEKVQDFAGDQNNFFTSWEQSFLKLVSIGVKVGDDDGEIRRSCSSVN  1129
             DS L+ +    + V+DFA DQ  FF +W  SF+KL SIGVK  D++GEIRRSC++ N
Sbjct  267   DSVLMNNDDTRKLVEDFANDQELFFDNWGVSFVKLTSIGVKT-DEEGEIRRSCAATN  322



>ref|XP_009117098.1| PREDICTED: peroxidase 18 [Brassica rapa]
Length=333

 Score =   376 bits (966),  Expect = 8e-124, Method: Compositional matrix adjust.
 Identities = 189/298 (63%), Positives = 234/298 (79%), Gaps = 2/298 (1%)
 Frame = +2

Query  239   FNFYAISCPSAELIVKNTVRSASSVDPTLPGKLLRLLFHDCFVEGCDASILLQGNDTERS  418
             FNFY  SCP AE IV+NTVRSASS DP++ GKLLRL+FHDCFV+GCDAS+L++GN TERS
Sbjct  37    FNFYGSSCPGAEFIVRNTVRSASSSDPSVLGKLLRLVFHDCFVQGCDASVLVRGNGTERS  96

Query  419   DPANKSVGGFSTVDSAKRVLEIFCPETVSCADIIALAARDAVEFVGGPSVAIPTGRRDGR  598
             DP N S+GGF  ++SAK VLEIFCP  VSCAD++ LAARDAVE +GGP VAIPTGRRDG 
Sbjct  97    DPGNASLGGFDVIESAKNVLEIFCPGIVSCADVLVLAARDAVEALGGPVVAIPTGRRDGT  156

Query  599   VSLGKNVRPNIIDTSFTMDEMMKIFAAKGLSLDDLVTLSGAHTIGSAHCSAFSDRFQLAS  778
             VS  +NVRPNIIDT FT+D+M+ IF++KGLS+ DLV LSGAHT+G+AHC+ F+ RF    
Sbjct  157   VSAAENVRPNIIDTDFTVDKMINIFSSKGLSVQDLVVLSGAHTVGAAHCNTFNSRFTRDP  216

Query  779   NGSFLPIdaaldhayaaelaRQCPAGASDAVT-VNNDPVTPSLFDNQYYKDLLAHRGLFQ  955
              G+F  IDA+LD++YA  L  +C +      T VNNDP T S FDNQYYK+LLAH+GLFQ
Sbjct  217   RGNFELIDASLDNSYAQTLLNKCSSSMDPTTTVVNNDPETSSTFDNQYYKNLLAHKGLFQ  276

Query  956   SDSALLRDKRAMEKVQDFAGDQNNFFTSWEQSFLKLVSIGVKVGDDDGEIRRSCSSVN  1129
             +DSAL+ D R  + V+  A D+ +F   W +SF+K+  IGV+VG ++GEIRRSCSSVN
Sbjct  277   TDSALMEDDRTRKIVEILANDEESFLERWTESFMKMSVIGVRVG-EEGEIRRSCSSVN  333



>gb|KFK32609.1| hypothetical protein AALP_AA6G266300 [Arabis alpina]
Length=302

 Score =   375 bits (963),  Expect = 8e-124, Method: Compositional matrix adjust.
 Identities = 186/298 (62%), Positives = 235/298 (79%), Gaps = 2/298 (1%)
 Frame = +2

Query  239   FNFYAISCPSAELIVKNTVRSASSVDPTLPGKLLRLLFHDCFVEGCDASILLQGNDTERS  418
             FNFYA SCP AE I++NTVRSAS+ DP++ GKLLRL+FHDCFV+GCDAS+L++GN TERS
Sbjct  6     FNFYAGSCPGAEFIIRNTVRSASTSDPSVLGKLLRLIFHDCFVQGCDASVLIRGNGTERS  65

Query  419   DPANKSVGGFSTVDSAKRVLEIFCPETVSCADIIALAARDAVEFVGGPSVAIPTGRRDGR  598
             DP N S+GGF+ ++SAK VLEIFCP  VSCADI+ LAARDAVE +GGP VAIPTGRRDG 
Sbjct  66    DPGNASLGGFTVIESAKNVLEIFCPGIVSCADILVLAARDAVEALGGPVVAIPTGRRDGM  125

Query  599   VSLGKNVRPNIIDTSFTMDEMMKIFAAKGLSLDDLVTLSGAHTIGSAHCSAFSDRFQLAS  778
             VS+ +NVRPNIIDT FT+D+M+ IF++KGLS+ DLV LSGAHTIG+AHC+ F+ RF+   
Sbjct  126   VSVAENVRPNIIDTDFTVDKMINIFSSKGLSVQDLVVLSGAHTIGAAHCNTFNSRFKRDP  185

Query  779   NGSFLPIdaaldhayaaelaRQCPAGASDAVT-VNNDPVTPSLFDNQYYKDLLAHRGLFQ  955
              G+F  ID +LD++YA  L  +C +      T VNNDP T S FDNQYY++LL H+GLFQ
Sbjct  186   RGNFELIDTSLDNSYAQTLLNKCSSSIDPTTTVVNNDPETSSTFDNQYYRNLLVHKGLFQ  245

Query  956   SDSALLRDKRAMEKVQDFAGDQNNFFTSWEQSFLKLVSIGVKVGDDDGEIRRSCSSVN  1129
             +DSAL+ D R  + V+  A D+ +FF  W +SF+K+  IGV+VG D+GEIR SC +VN
Sbjct  246   TDSALMEDDRTRKIVEVLANDEESFFERWSESFMKMSVIGVRVG-DEGEIRHSCFAVN  302



>ref|XP_006296309.1| hypothetical protein CARUB_v10025481mg [Capsella rubella]
 gb|EOA29207.1| hypothetical protein CARUB_v10025481mg [Capsella rubella]
Length=332

 Score =   376 bits (965),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 185/298 (62%), Positives = 237/298 (80%), Gaps = 2/298 (1%)
 Frame = +2

Query  239   FNFYAISCPSAELIVKNTVRSASSVDPTLPGKLLRLLFHDCFVEGCDASILLQGNDTERS  418
             FNFYA SCP AELIV+NTVRSA+S DP++ GKLLRL+FHDCFV+GCD S+L++GN TERS
Sbjct  36    FNFYAGSCPGAELIVRNTVRSAASSDPSVLGKLLRLIFHDCFVQGCDGSVLIRGNGTERS  95

Query  419   DPANKSVGGFSTVDSAKRVLEIFCPETVSCADIIALAARDAVEFVGGPSVAIPTGRRDGR  598
             DP N S+GGF+ +++ K VLEIFCP TVSCAD++ LAARDAVE +GGP V IPTGRRDG 
Sbjct  96    DPGNASLGGFAVIENVKNVLEIFCPGTVSCADLLVLAARDAVEALGGPVVPIPTGRRDGT  155

Query  599   VSLGKNVRPNIIDTSFTMDEMMKIFAAKGLSLDDLVTLSGAHTIGSAHCSAFSDRFQLAS  778
             VS+  NVRPNIIDT FT+D+M+ IF++KGLS+ DLV LSGAHTIG+AHC+ F+ RF+L  
Sbjct  156   VSMAANVRPNIIDTDFTVDKMINIFSSKGLSIQDLVVLSGAHTIGAAHCNTFNSRFKLGP  215

Query  779   NGSFLPIdaaldhayaaelaRQCPAGASDAVT-VNNDPVTPSLFDNQYYKDLLAHRGLFQ  955
              G+   ID++LD++YA  L  +C +      T V+NDP T S FDNQYYK+L+AH+GLFQ
Sbjct  216   KGNLELIDSSLDNSYAQTLLNKCSSSLDPTTTVVDNDPETSSTFDNQYYKNLIAHKGLFQ  275

Query  956   SDSALLRDKRAMEKVQDFAGDQNNFFTSWEQSFLKLVSIGVKVGDDDGEIRRSCSSVN  1129
             +DSAL+ D R  + V+  A DQ +FF  W +SF+K+  +GV+VG ++GEIRRSCS+VN
Sbjct  276   TDSALMEDDRTRKIVEILANDQESFFERWTESFMKMSVMGVRVG-EEGEIRRSCSAVN  332



>emb|CDX76791.1| BnaC08g33770D [Brassica napus]
Length=333

 Score =   375 bits (964),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 188/298 (63%), Positives = 235/298 (79%), Gaps = 2/298 (1%)
 Frame = +2

Query  239   FNFYAISCPSAELIVKNTVRSASSVDPTLPGKLLRLLFHDCFVEGCDASILLQGNDTERS  418
             FNFY  SCP AE IV+NTVRSASS DP++ GKLLRL+FHDCFV+GCDAS+L++GN TER+
Sbjct  37    FNFYGSSCPGAEFIVRNTVRSASSSDPSVLGKLLRLIFHDCFVQGCDASVLVRGNGTERT  96

Query  419   DPANKSVGGFSTVDSAKRVLEIFCPETVSCADIIALAARDAVEFVGGPSVAIPTGRRDGR  598
             DP N S+GGF  ++SAK ++EIFCP  VSCADI+ALAARDAVE +GGP VAIPTGRRDG 
Sbjct  97    DPGNASLGGFDVIESAKNLVEIFCPGIVSCADILALAARDAVEALGGPVVAIPTGRRDGT  156

Query  599   VSLGKNVRPNIIDTSFTMDEMMKIFAAKGLSLDDLVTLSGAHTIGSAHCSAFSDRFQLAS  778
             VS  +NVRPNIIDT FT+D+M+ IF++KGLS+ DLV LSGAHT+G+AHC+ F+ RF    
Sbjct  157   VSAAENVRPNIIDTDFTVDKMINIFSSKGLSVQDLVVLSGAHTVGAAHCNTFNSRFTRDP  216

Query  779   NGSFLPIdaaldhayaaelaRQCPAGASDAVTV-NNDPVTPSLFDNQYYKDLLAHRGLFQ  955
              G+F  IDA+LD++YA  L  +C +      TV NNDP T S FDNQYYK+LLAH+GLFQ
Sbjct  217   RGNFELIDASLDNSYAQTLLNKCSSSMDPTTTVGNNDPETSSTFDNQYYKNLLAHKGLFQ  276

Query  956   SDSALLRDKRAMEKVQDFAGDQNNFFTSWEQSFLKLVSIGVKVGDDDGEIRRSCSSVN  1129
             +DSAL+ D R  + V+  A D+ +F   W +SF+K+  IGV+VG ++GEIRRSCSSVN
Sbjct  277   TDSALMEDDRTRKIVEILANDEESFLERWTESFMKMSVIGVRVG-EEGEIRRSCSSVN  333



>emb|CDY71322.1| BnaC08g49050D, partial [Brassica napus]
Length=337

 Score =   375 bits (962),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 188/298 (63%), Positives = 235/298 (79%), Gaps = 2/298 (1%)
 Frame = +2

Query  239   FNFYAISCPSAELIVKNTVRSASSVDPTLPGKLLRLLFHDCFVEGCDASILLQGNDTERS  418
             FNFY  SCP AE IV+NTVRSASS DP++ GKLLRL+FHDCFV+GCDAS+L++GN TER+
Sbjct  41    FNFYGSSCPGAEFIVRNTVRSASSSDPSVLGKLLRLIFHDCFVQGCDASVLVRGNGTERT  100

Query  419   DPANKSVGGFSTVDSAKRVLEIFCPETVSCADIIALAARDAVEFVGGPSVAIPTGRRDGR  598
             DP N S+GGF  ++SAK ++EIFCP  VSCADI+ALAARDAVE +GGP VAIPTGRRDG 
Sbjct  101   DPGNASLGGFDVIESAKNLVEIFCPGIVSCADILALAARDAVEALGGPVVAIPTGRRDGT  160

Query  599   VSLGKNVRPNIIDTSFTMDEMMKIFAAKGLSLDDLVTLSGAHTIGSAHCSAFSDRFQLAS  778
             VS  +NVRPNIIDT FT+D+M+ IF++KGLS+ DLV LSGAHT+G+AHC+ F+ RF+   
Sbjct  161   VSAAENVRPNIIDTDFTVDKMINIFSSKGLSVQDLVVLSGAHTVGAAHCNTFNSRFKRDP  220

Query  779   NGSFLPIdaaldhayaaelaRQCPAGASDAVT-VNNDPVTPSLFDNQYYKDLLAHRGLFQ  955
              G+F  IDA+LD++YA  L  +C +      T VNNDP T S FDNQYYK+LLAH+GLFQ
Sbjct  221   RGNFELIDASLDNSYAQTLLNKCSSSMDPTTTVVNNDPETSSTFDNQYYKNLLAHKGLFQ  280

Query  956   SDSALLRDKRAMEKVQDFAGDQNNFFTSWEQSFLKLVSIGVKVGDDDGEIRRSCSSVN  1129
             +DSAL+ D R  + V+  A D  +F   W +SF+K+  IGV+VG ++GEIRRSCSSVN
Sbjct  281   TDSALMEDDRTRKIVEILANDGESFLERWTESFMKMSVIGVRVG-EEGEIRRSCSSVN  337



>ref|XP_007136928.1| hypothetical protein PHAVU_009G085800g [Phaseolus vulgaris]
 gb|ESW08922.1| hypothetical protein PHAVU_009G085800g [Phaseolus vulgaris]
Length=326

 Score =   372 bits (955),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 195/298 (65%), Positives = 233/298 (78%), Gaps = 1/298 (0%)
 Frame = +2

Query  239   FNFYAISCPSAELIVKNTVRSASSVDPTLPGKLLRLLFHDCFVEGCDASILLQGNDTERS  418
             FNFYA SCPSAELI+++TV S+SS DP++PGKLLRL+FHDCFVEGCDAS++LQGN+TE+S
Sbjct  30    FNFYAASCPSAELIIRDTVSSSSSTDPSIPGKLLRLVFHDCFVEGCDASLMLQGNNTEQS  89

Query  419   DPANKSVGGFSTVDSAKRVLEIFCPETVSCADIIALAARDAVEFVGGPSVAIPTGRRDGR  598
             DP N+SVGGFS +DSAKRVLE FCP TVSCADIIA+AARDAVE  GGP + IPTGRRDG 
Sbjct  90    DPGNRSVGGFSVIDSAKRVLEKFCPGTVSCADIIAIAARDAVEIAGGPRIMIPTGRRDGM  149

Query  599   VSLGKNVRPNIIDTSFTMDEMMKIFAAKGLSLDDLVTLSGAHTIGSAHCSAFSDRFQLAS  778
             VS+  NVRPNI+DTSF+MD+M+++FA KGLSL DLV LSGAHTIG+AHC++F DRFQ   
Sbjct  150   VSVASNVRPNIVDTSFSMDQMIQLFATKGLSLLDLVVLSGAHTIGTAHCNSFRDRFQEDL  209

Query  779   NGSFLPIdaaldhayaaelaRQCPAGASDAVTVNNDPVTPSLFDNQYYKDLLAHRGLFQS  958
              G    +D  LD  YA  L  QCPAG   ++ VNNDP T  +FDN YY++LL H+GLFQ 
Sbjct  210   TGKLRLVDKTLDSNYANMLIGQCPAGVQPSIKVNNDPETSLIFDNMYYQNLLRHKGLFQF  269

Query  959   DSALLRDKRAMEKVQDFAGDQNNFFTSWEQSFLKLVSIGVKVGDDDGEIRRSCSSVNA  1132
             DS L+ +      V+DFA DQ  FF  W  SFLKL S+GVK G D GEIR SC+S N+
Sbjct  270   DSVLINNDSTRILVEDFANDQELFFEKWGPSFLKLTSVGVKSG-DMGEIRISCASTNS  326



>ref|XP_004501789.1| PREDICTED: lariat debranching enzyme-like [Cicer arietinum]
Length=778

 Score =   384 bits (987),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 199/297 (67%), Positives = 241/297 (81%), Gaps = 1/297 (0%)
 Frame = +2

Query  239   FNFYAISCPSAELIVKNTVRSASSVDPTLPGKLLRLLFHDCFVEGCDASILLQGNDTERS  418
             F+FYA SCP+AELI++NTV S+SS DP++PGKLLRL+FHDCFVEGCDAS++LQGN+TE+S
Sbjct  478   FDFYATSCPTAELIIRNTVSSSSSNDPSIPGKLLRLIFHDCFVEGCDASLMLQGNNTEQS  537

Query  419   DPANKSVGGFSTVDSAKRVLEIFCPETVSCADIIALAARDAVEFVGGPSVAIPTGRRDGR  598
             DP N+SVGGFS ++SAKRVLE+FCP TVSCADIIALAARDAVE  GGP + IPTGRRDG 
Sbjct  538   DPGNRSVGGFSVIESAKRVLEMFCPGTVSCADIIALAARDAVEIAGGPRIQIPTGRRDGM  597

Query  599   VSLGKNVRPNIIDTSFTMDEMMKIFAAKGLSLDDLVTLSGAHTIGSAHCSAFSDRFQLAS  778
             VS+  NVRPNI+DTSFTMDEM+K+F+ KGLSL DLV LSGAHTIGSAHC  F DRFQ  S
Sbjct  598   VSIASNVRPNIVDTSFTMDEMVKLFSTKGLSLLDLVVLSGAHTIGSAHCHTFRDRFQQDS  657

Query  779   NGSFLPIdaaldhayaaelaRQCPAGASDAVTVNNDPVTPSLFDNQYYKDLLAHRGLFQS  958
              G+   ID  +D +YA EL +QCP  A  ++TVNNDP T  LFDNQY+++LLAH+ LFQS
Sbjct  658   KGNLKLIDQTIDSSYADELIKQCPINAQPSMTVNNDPATSMLFDNQYFRNLLAHKVLFQS  717

Query  959   DSALLRDKRAMEKVQDFAGDQNNFFTSWEQSFLKLVSIGVKVGDDDGEIRRSCSSVN  1129
             DS LL D    + V+DFA DQ  FF +W  SF++L S+GVK  D++GEIRR C++ N
Sbjct  718   DSVLLNDNNTRKLVEDFANDQQLFFDNWAVSFVRLTSVGVKT-DEEGEIRRFCAATN  773



>ref|NP_194904.2| peroxidase 46 [Arabidopsis thaliana]
 gb|AEE85954.1| peroxidase 46 [Arabidopsis thaliana]
Length=354

 Score =   369 bits (946),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 176/285 (62%), Positives = 226/285 (79%), Gaps = 0/285 (0%)
 Frame = +2

Query  239   FNFYAISCPSAELIVKNTVRSASSVDPTLPGKLLRLLFHDCFVEGCDASILLQGNDTERS  418
             FNFYA SC  AE +V+NTVRSA+S DPT+PGKLLRL FHDCFV+GCDAS+L+QGN TE+S
Sbjct  31    FNFYASSCSVAEFLVRNTVRSATSSDPTIPGKLLRLFFHDCFVQGCDASVLIQGNSTEKS  90

Query  419   DPANKSVGGFSTVDSAKRVLEIFCPETVSCADIIALAARDAVEFVGGPSVAIPTGRRDGR  598
             DP N S+GGFS +D+AK  +E  CP TVSCADI+ALAARDAVE  GGP V IPTGRRDG+
Sbjct  91    DPGNASLGGFSVIDTAKNAIENLCPATVSCADIVALAARDAVEAAGGPVVEIPTGRRDGK  150

Query  599   VSLGKNVRPNIIDTSFTMDEMMKIFAAKGLSLDDLVTLSGAHTIGSAHCSAFSDRFQLAS  778
              S+  NVRPNIIDT FT+D+M+  F++KGLS+ DLV LSGAHTIG++HC+AF+ RFQ  S
Sbjct  151   ESMAANVRPNIIDTDFTLDQMIDAFSSKGLSIQDLVVLSGAHTIGASHCNAFNGRFQRDS  210

Query  779   NGSFLPIdaaldhayaaelaRQCPAGASDAVTVNNDPVTPSLFDNQYYKDLLAHRGLFQS  958
              G+F  IDA+LD++YA  L  +C +  S ++TV+NDP T ++FDNQYY++L  H+GLFQ+
Sbjct  211   KGNFEVIDASLDNSYAETLMNKCSSSESSSLTVSNDPETSAVFDNQYYRNLETHKGLFQT  270

Query  959   DSALLRDKRAMEKVQDFAGDQNNFFTSWEQSFLKLVSIGVKVGDD  1093
             DSAL+ D R    V++ A D+ +FF  W +SF+KL  +GV+VG+D
Sbjct  271   DSALMEDNRTRTMVEELASDEESFFQRWSESFVKLSMVGVRVGED  315



>ref|XP_010451098.1| PREDICTED: lariat debranching enzyme-like [Camelina sativa]
Length=801

 Score =   382 bits (982),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 191/297 (64%), Positives = 238/297 (80%), Gaps = 1/297 (0%)
 Frame = +2

Query  239   FNFYAISCPSAELIVKNTVRSASSVDPTLPGKLLRLLFHDCFVEGCDASILLQGNDTERS  418
             FNFYA SCP AEL+V+NTVRSA+  DPT+PGKLLRLLFHDCFV+GCDAS+L+QGN TERS
Sbjct  506   FNFYASSCPVAELLVRNTVRSATLSDPTIPGKLLRLLFHDCFVQGCDASVLIQGNTTERS  565

Query  419   DPANKSVGGFSTVDSAKRVLEIFCPETVSCADIIALAARDAVEFVGGPSVAIPTGRRDGR  598
             DP N S+GGFS +D+AK+ LEI CP TVSCADI+ALAARDAVE  GGP V I TGRRDGR
Sbjct  566   DPGNASLGGFSVIDTAKKALEILCPATVSCADIVALAARDAVEAAGGPVVEILTGRRDGR  625

Query  599   VSLGKNVRPNIIDTSFTMDEMMKIFAAKGLSLDDLVTLSGAHTIGSAHCSAFSDRFQLAS  778
             VS+  NVRPNIIDT F++D+M+  F++KGLS+ DLV LSGAHTIG++HC+AF+ RF+  S
Sbjct  626   VSIAANVRPNIIDTDFSLDQMIDGFSSKGLSIQDLVVLSGAHTIGASHCNAFNGRFKQDS  685

Query  779   NGSFLPIdaaldhayaaelaRQCPAGASDAVTVNNDPVTPSLFDNQYYKDLLAHRGLFQS  958
              GSF  IDA+LD +YA  L  +C +  S ++TV+NDPVT S FDNQYY++L  H+GL Q+
Sbjct  686   KGSFELIDASLDKSYAETLLNKCSSSESSSLTVSNDPVTSSTFDNQYYRNLETHKGLIQT  745

Query  959   DSALLRDKRAMEKVQDFAGDQNNFFTSWEQSFLKLVSIGVKVGDDDGEIRRSCSSVN  1129
             DSAL+ D R  + V+  A D+ +F   W +SF+KL  +GV+VG +DGEIRR+CSSVN
Sbjct  746   DSALMDDDRTRKMVEALASDEESFLQRWSESFVKLSMVGVRVG-EDGEIRRTCSSVN  801



>ref|XP_010692957.1| PREDICTED: peroxidase 46 [Beta vulgaris subsp. vulgaris]
Length=333

 Score =   366 bits (940),  Expect = 6e-120, Method: Compositional matrix adjust.
 Identities = 185/296 (63%), Positives = 230/296 (78%), Gaps = 3/296 (1%)
 Frame = +2

Query  245   FYAISCPSAELIVKNTVRSASSVDPTLPGKLLRLLFHDCFVEGCDASILLQGNDTERSDP  424
             FYA SCP  E IV++TVRSA+S DPT+PGKLLRLLFHDCFVEGCDAS+L++G+ TER+DP
Sbjct  41    FYAFSCPGVEFIVRDTVRSAASTDPTIPGKLLRLLFHDCFVEGCDASVLVKGDGTERADP  100

Query  425   ANKSVGGFSTVDSAKRVLEIFCPETVSCADIIALAARDAVEFVGGPSVAIPTGRRDGRVS  604
             AN S+GGF  +++AKR LE+FCP TVSCADI+ALAARDAV   GGP + +PTGR+DG VS
Sbjct  101   ANASLGGFEVIETAKRELELFCPGTVSCADILALAARDAVVMSGGPDIQMPTGRQDGMVS  160

Query  605   LGKNVRPNIIDTSFTMDEMMKIFAAKGLSLDDLVTLSGAHTIGSAHCSAFSDRFQLASNG  784
                NVRPNIIDTSFT+D+M+KIF++KGLSL DLV LSGAHTIG AHC+AFSDR Q  S G
Sbjct  161   AISNVRPNIIDTSFTVDDMIKIFSSKGLSLADLVILSGAHTIGIAHCTAFSDRIQFDSKG  220

Query  785   SFLPIdaaldhayaaelaRQCPAGASDAVTVNNDPVTPSLFDNQYYKDLLAHRGLFQSDS  964
             +    D++LD  YA++LA++C   AS + TVN DP T   FDNQYY +L+A RGL Q+DS
Sbjct  221   NLTSADSSLDKDYASKLAKKC--AASKSATVNIDPNTSFSFDNQYYNNLIAKRGLLQTDS  278

Query  965   ALLRDKRAMEKVQDFAGDQNNFFTSWEQSFLKLVSIGVKVGDDDGEIRRSCSSVNA  1132
              L  D+R    V+ FA D N F+ +W +SFLKL SIG+K  D +GE+R+ CS +N 
Sbjct  279   ILFDDQRTRILVEQFASDLNTFYEAWSESFLKLSSIGIK-ADGEGEVRQICSRING  333



>emb|CAA71496.1| peroxidase [Spinacia oleracea]
Length=308

 Score =   365 bits (938),  Expect = 6e-120, Method: Compositional matrix adjust.
 Identities = 183/298 (61%), Positives = 230/298 (77%), Gaps = 3/298 (1%)
 Frame = +2

Query  239   FNFYAISCPSAELIVKNTVRSASSVDPTLPGKLLRLLFHDCFVEGCDASILLQGNDTERS  418
               FYA+SCP  E +V++ VRSASS DP++PGKLLRLLFHDCFV GCDAS+L++G+ TER+
Sbjct  14    LEFYALSCPGVEFVVRDVVRSASSSDPSIPGKLLRLLFHDCFVYGCDASVLVEGDGTERA  73

Query  419   DPANKSVGGFSTVDSAKRVLEIFCPETVSCADIIALAARDAVEFVGGPSVAIPTGRRDGR  598
             DPANKS+GGF  +++AKR LE+FCP+TVSCADI+ALAARDAV   GGP + +PTGRRDG 
Sbjct  74    DPANKSLGGFEVIEAAKRELELFCPQTVSCADILALAARDAVVMAGGPDIQMPTGRRDGL  133

Query  599   VSLGKNVRPNIIDTSFTMDEMMKIFAAKGLSLDDLVTLSGAHTIGSAHCSAFSDRFQLAS  778
             VS   NVRPNI+DTSFT+D+M++IF AKGL+L+DLV LSGAHTIG AHC+AFSDRFQ++S
Sbjct  134   VSAISNVRPNIVDTSFTVDDMIRIFGAKGLTLNDLVILSGAHTIGLAHCNAFSDRFQVSS  193

Query  779   NGSFLPIdaaldhayaaelaRQCPAGASDAVTVNNDPVTPSLFDNQYYKDLLAHRGLFQS  958
              G+   +D++LD  YA +LA++C   AS + TVN DP T   FDNQYY +L+A +GL Q+
Sbjct  194   KGNLTFVDSSLDKDYAGKLAKKC--AASTSATVNIDPKTAFSFDNQYYNNLIAKKGLLQT  251

Query  959   DSALLRDKRAMEKVQDFAGDQNNFFTSWEQSFLKLVSIGVKVGDDDGEIRRSCSSVNA  1132
             DS L  D R    V   A D N F+  W  SFLKL SIGVK GD +GE+R+ CS +N 
Sbjct  252   DSILFNDPRTKNLVLQLASDLNGFYEGWSTSFLKLSSIGVK-GDGEGEVRQICSRING  308



>gb|AGT16273.1| peroxidase [Saccharum hybrid cultivar R570]
Length=492

 Score =   350 bits (897),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 180/299 (60%), Positives = 228/299 (76%), Gaps = 5/299 (2%)
 Frame = +2

Query  242   NFYAISCPSAELIVKNTVRSASSVDPTLPGKLLRLLFHDCFVEGCDASILLQGNDTERSD  421
             +FYA+SCP  EL V++ VRSAS++DP++PGKLLRL+FHDCFVEGCDAS+L+QGN TER+D
Sbjct  195   SFYALSCPGVELAVRDVVRSASTLDPSIPGKLLRLVFHDCFVEGCDASVLIQGNGTERTD  254

Query  422   PANKSVGGFSTVDSAKRVLEIFCPETVSCADIIALAARDAVEFVGGPSVAIPTGRRDGRV  601
             PAN S+GGF+ +D+AKR+LE+ CP TVSC+DII LAARDAV F GGP+V +  GRRDG V
Sbjct  255   PANLSLGGFNVIDAAKRLLEVVCPATVSCSDIIVLAARDAVVFTGGPAVPVALGRRDGLV  314

Query  602   SLGKNVRPNIIDTSFTMDEMMKIFAAKGLSLDDLVTLSGAHTIGSAHCSAFSDRFQLASN  781
             SL  NVR NIIDT F++D M   F AKGLSLDDLVTLSG HTIGSAHC+ F +RFQ+A N
Sbjct  315   SLASNVRRNIIDTGFSVDAMAASFTAKGLSLDDLVTLSGGHTIGSAHCNTFRERFQVA-N  373

Query  782   GSFLPIdaaldhayaaelaRQCPA--GASDAVT-VNNDPVTPSLFDNQYYKDLLAHRGLF  952
             GS  PID +++  YA EL + C A  GA  A T V+ D  + S+FDN+Y+ +LL  RGL 
Sbjct  374   GSMTPIDGSMNADYANELIQACSAANGAVSAGTAVDCDSGSASVFDNRYFANLLDGRGLL  433

Query  953   QSDSALLRDKRAMEKVQDFAGDQNNFFTSWEQSFLKLVSIGVKVGDDDGEIRRSCSSVN  1129
             ++D+ L+++     KV +FA  Q+ FF SW  S+ +L  +GVK G  DGEIRR+CSSVN
Sbjct  434   RTDAVLVQNATTRAKVAEFAQSQDGFFASWASSYARLTGLGVKTG-ADGEIRRTCSSVN  491



>ref|XP_008661583.1| PREDICTED: uncharacterized protein LOC100273055 isoform X1 [Zea 
mays]
 gb|ACR34255.1| unknown [Zea mays]
 gb|ACR35716.1| unknown [Zea mays]
 gb|AFW58741.1| hypothetical protein ZEAMMB73_339345 [Zea mays]
Length=484

 Score =   349 bits (896),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 176/302 (58%), Positives = 225/302 (75%), Gaps = 10/302 (3%)
 Frame = +2

Query  242   NFYAISCPSAELIVKNTVRSASSVDPTLPGKLLRLLFHDCFVEGCDASILLQGNDTERSD  421
             +FYA SCP  EL V++ VRSAS++DP++PGKLLRL+FHDCFVEGCDAS+L+QGN TER+D
Sbjct  186   SFYAQSCPDVELAVRDVVRSASTLDPSIPGKLLRLVFHDCFVEGCDASVLIQGNGTERTD  245

Query  422   PANKSVGGFSTVDSAKRVLEIFCPETVSCADIIALAARDAVEFVGGPSVAIPTGRRDGRV  601
             PAN S+GGF+ +D+AKR+LE  CP TVSC+DI+ LAARDAV F GGP+V +  GRRDG V
Sbjct  246   PANLSLGGFNVIDAAKRLLEAVCPATVSCSDIVVLAARDAVVFTGGPAVPVALGRRDGLV  305

Query  602   SLGKNVRPNIIDTSFTMDEMMKIFAAKGLSLDDLVTLSGAHTIGSAHCSAFSDRFQLASN  781
             SL  NVR NIIDT F++D M   F AKGL+LDDLVTLSG HTIGSAHC+ F +RFQ  +N
Sbjct  306   SLASNVRRNIIDTGFSVDAMAASFTAKGLTLDDLVTLSGGHTIGSAHCNTFRERFQQVAN  365

Query  782   GSFLPIdaaldhayaaelaRQC------PAGASDAVTVNNDPVTPSLFDNQYYKDLLAHR  943
             GS  P+D +++  YA EL + C      PAG +    V  D  + S+FDN Y+ +LL  R
Sbjct  366   GSMTPVDGSMNADYANELIQACSANGTVPAGTA---AVGCDSGSASVFDNTYFANLLGGR  422

Query  944   GLFQSDSALLRDKRAMEKVQDFAGDQNNFFTSWEQSFLKLVSIGVKVGDDDGEIRRSCSS  1123
             GL ++D+AL+++     KV +FA  Q+ FF SW  S+ +L S+GVKVG  DGE+RR+CSS
Sbjct  423   GLLRTDAALVQNATTRAKVAEFAQSQDGFFASWASSYARLTSLGVKVG-ADGEVRRTCSS  481

Query  1124  VN  1129
             VN
Sbjct  482   VN  483



>ref|XP_004976108.1| PREDICTED: peroxidase 28-like isoform X2 [Setaria italica]
Length=371

 Score =   344 bits (882),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 175/299 (59%), Positives = 223/299 (75%), Gaps = 4/299 (1%)
 Frame = +2

Query  242   NFYAISCPSAELIVKNTVRSASSVDPTLPGKLLRLLFHDCFVEGCDASILLQGNDTERSD  421
             +FYA SCP  EL V++ VRSAS +DP++PGKLLRL+FHDCFVEGCDAS+L+QG+ TER+D
Sbjct  75    SFYAQSCPGVELAVRDVVRSASLLDPSIPGKLLRLVFHDCFVEGCDASVLIQGSGTERTD  134

Query  422   PANKSVGGFSTVDSAKRVLEIFCPETVSCADIIALAARDAVEFVGGPSVAIPTGRRDGRV  601
             PAN S+GGF+ +D+AKR+LE+ CP TVSC+DII LAARDAV F GGP+V +  GRRDG V
Sbjct  135   PANLSLGGFNVIDAAKRLLEVVCPATVSCSDIIVLAARDAVVFTGGPAVPVMLGRRDGLV  194

Query  602   SLGKNVRPNIIDTSFTMDEMMKIFAAKGLSLDDLVTLSGAHTIGSAHCSAFSDRFQLASN  781
             SL  NVR NIIDT F++D M   F AKGL+LDDLVTLSG HTIGSAHC+ F +RFQ+A N
Sbjct  195   SLASNVRRNIIDTGFSVDAMAASFTAKGLTLDDLVTLSGGHTIGSAHCNTFRERFQVA-N  253

Query  782   GSFLPIdaaldhayaaelaRQCPAGA--SDAVTVNNDPVTPSLFDNQYYKDLLAHRGLFQ  955
             GS  P+D +++  YA EL R C A    S    V+ D  + S+FDN+Y+ +LL  RGL +
Sbjct  254   GSMAPVDGSMNTDYANELIRACSANGTVSAGTAVDCDSGSASVFDNRYFANLLEGRGLLR  313

Query  956   SDSALLRDKRAMEKVQDFAGDQNNFFTSWEQSFLKLVSIGVKVGDDDGEIRRSCSSVNA  1132
             +D+ L+++     KV +FA  Q+ FF SW  S+ +L  +GVK G  DGEIRR+CSSVN 
Sbjct  314   TDAVLVQNATTRAKVAEFAQSQDGFFASWADSYARLTGLGVKTG-ADGEIRRTCSSVNG  371



>ref|XP_003580073.1| PREDICTED: peroxidase 46-like [Brachypodium distachyon]
Length=496

 Score =   343 bits (880),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 174/296 (59%), Positives = 222/296 (75%), Gaps = 2/296 (1%)
 Frame = +2

Query  242   NFYAISCPSAELIVKNTVRSASSVDPTLPGKLLRLLFHDCFVEGCDASILLQGNDTERSD  421
             +FYA SCPS EL V + VRSAS++DPT+PGKLLR++FHDCFVEGCDAS+L++G+ TER+D
Sbjct  202   SFYAASCPSVELAVNDVVRSASTLDPTIPGKLLRMVFHDCFVEGCDASVLIEGSGTERTD  261

Query  422   PANKSVGGFSTVDSAKRVLEIFCPETVSCADIIALAARDAVEFVGGPSVAIPTGRRDGRV  601
             PAN S+GGF+ +D AKR+LE  CP TVSC+DII LAARDAV + GGPSV +  GRRD  V
Sbjct  262   PANLSLGGFNVIDEAKRLLEAVCPATVSCSDIIVLAARDAVTYTGGPSVPVSLGRRDSLV  321

Query  602   SLGKNVRPNIIDTSFTMDEMMKIFAAKGLSLDDLVTLSGAHTIGSAHCSAFSDRFQLASN  781
             SL  NVR NIIDT F++D M   FA+KGL+LDDLVTLSG HTIGSAHC  F +RF   +N
Sbjct  322   SLASNVRANIIDTGFSVDAMAASFASKGLTLDDLVTLSGGHTIGSAHCGTFRERFHPDAN  381

Query  782   GSFLPIdaaldhayaaelaRQCPAGASDAVTVNNDPVTPSLFDNQYYKDLLAHRGLFQSD  961
             GS +P+DA+++  YA EL + C +G S  VTV+ D  +  +FDN+Y+ +LL  RGL ++D
Sbjct  382   GSMVPVDASMNTDYANELMQTCSSGNS-TVTVDCDEGSAKVFDNRYFSNLLDGRGLLRTD  440

Query  962   SALLRDKRAMEKVQDFAGDQNNFFTSWEQSFLKLVSIGVKVGDDDGEIRRSCSSVN  1129
             + L+++     KV  FA  Q +FF SW  S+ +L S+GVK G  DGEIRR CSSVN
Sbjct  441   AVLVQNATTRAKVSAFAQSQESFFASWAGSYARLTSLGVKTG-SDGEIRRLCSSVN  495



>dbj|BAJ87785.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ87917.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=498

 Score =   341 bits (875),  Expect = 7e-108, Method: Compositional matrix adjust.
 Identities = 172/296 (58%), Positives = 219/296 (74%), Gaps = 3/296 (1%)
 Frame = +2

Query  242   NFYAISCPSAELIVKNTVRSASSVDPTLPGKLLRLLFHDCFVEGCDASILLQGNDTERSD  421
             +FYA SCPS EL V + VRSAS++D ++PGKLLR++FHDCFVEGCDAS+L+QGN TER+D
Sbjct  205   SFYAASCPSVELAVSDVVRSASTLDSSIPGKLLRMVFHDCFVEGCDASVLIQGNGTERTD  264

Query  422   PANKSVGGFSTVDSAKRVLEIFCPETVSCADIIALAARDAVEFVGGPSVAIPTGRRDGRV  601
             PAN S+GGF+ +D AKR+LE  CP TVSC+DII LAARDAV F GGPSV +  GRRD  V
Sbjct  265   PANLSLGGFNVIDEAKRLLEAVCPATVSCSDIIVLAARDAVTFTGGPSVPVSLGRRDSLV  324

Query  602   SLGKNVRPNIIDTSFTMDEMMKIFAAKGLSLDDLVTLSGAHTIGSAHCSAFSDRFQLASN  781
             SL  NVR NIIDT F++D M   FA+KGLSLDDLVTLSG HTIGSAHC  F +RF+  +N
Sbjct  325   SLASNVRANIIDTGFSVDAMAASFASKGLSLDDLVTLSGGHTIGSAHCGTFRERFRADAN  384

Query  782   GSFLPIdaaldhayaaelaRQCPAGASDAVTVNNDPVTPSLFDNQYYKDLLAHRGLFQSD  961
             GS +P+D+ ++  YA EL R C A  S AV  ++   +   FDN+Y+ +LL  RGL ++D
Sbjct  385   GSMVPVDSTMNAEYATELMRACAASGSAAVGCDDG--SAEAFDNRYFSNLLDGRGLLRTD  442

Query  962   SALLRDKRAMEKVQDFAGDQNNFFTSWEQSFLKLVSIGVKVGDDDGEIRRSCSSVN  1129
             + L+++     +V  FA  Q++FF SW  SF +L ++GVK G  DGE+RR CSSVN
Sbjct  443   AVLVQNATTRARVAAFAQSQDSFFGSWAGSFARLTTLGVKTG-SDGEVRRLCSSVN  497



>ref|XP_006845450.1| hypothetical protein AMTR_s00019p00117340 [Amborella trichopoda]
 gb|ERN07125.1| hypothetical protein AMTR_s00019p00117340 [Amborella trichopoda]
Length=285

 Score =   333 bits (853),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 166/286 (58%), Positives = 208/286 (73%), Gaps = 1/286 (0%)
 Frame = +2

Query  275   LIVKNTVRSASSVDPTLPGKLLRLLFHDCFVEGCDASILLQGNDTERSDPANKSVGGFST  454
             ++V + VRSAS+ D T+P KLLRLLFHDC VEGCD S+L++GN TER+DPAN S+GGF  
Sbjct  1     MLVTDAVRSASTFDQTVPAKLLRLLFHDCMVEGCDGSVLVEGNGTERADPANASLGGFQV  60

Query  455   VDSAKRVLEIFCPETVSCADIIALAARDAVEFVGGPSVAIPTGRRDGRVSLGKNVRPNII  634
             V+SAK ++E+FCP TVSCAD++ LAARDAV   GGP+V +  GR+DGRVS   NVR NI+
Sbjct  61    VESAKALVEVFCPSTVSCADVLVLAARDAVRLGGGPNVRVLMGRKDGRVSSEANVRANIV  120

Query  635   DTSFTMDEMMKIFAAKGLSLDDLVTLSGAHTIGSAHCSAFSDRFQLASNGSFLPIdaald  814
             DT+F +D+M KIF++K L+LDDLV LSGAHTIG +HCSAFSDRF   S G   P D  LD
Sbjct  121   DTTFDLDQMTKIFSSKALNLDDLVALSGAHTIGRSHCSAFSDRFAQDSKGKLTPTDPLLD  180

Query  815   hayaaelaRQCPAGASDAVTVNNDPVTPSLFDNQYYKDLLAHRGLFQSDSALLRDKRAME  994
               Y  +L  QCP  A  ++TV+NDP T  +FDN YY++L+  +GLF SDS L  D R   
Sbjct  181   KKYGNDLLSQCPRNADPSITVDNDPETGLVFDNVYYQNLVMGKGLFHSDSVLFGDTRTRN  240

Query  995   KVQDFAGDQNNFFTSWEQSFLKLVSIGVKVGDDDGEIRRSCSSVNA  1132
             KV  FA  + +FF  WE+SFL+L SIGVK G + GEIRR C  +N 
Sbjct  241   KVLRFAESEESFFEGWERSFLRLTSIGVKTG-NQGEIRRLCREING  285



>ref|XP_006652476.1| PREDICTED: peroxidase 18-like [Oryza brachyantha]
Length=498

 Score =   339 bits (870),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 172/300 (57%), Positives = 223/300 (74%), Gaps = 5/300 (2%)
 Frame = +2

Query  242   NFYAISCPSAELIVKNTVRSASSVDPTLPGKLLRLLFHDCFVEGCDASILLQGNDTERSD  421
             NFYA SCPS EL V++ VRSAS++D T+PGKLLR+LFHDCFVEGCDAS++++G+ TER+D
Sbjct  199   NFYAASCPSVELAVRDVVRSASTLDSTIPGKLLRMLFHDCFVEGCDASVMIEGSGTERTD  258

Query  422   PANKSVGGFSTVDSAKRVLEIFCPETVSCADIIALAARDAVEFVGGPSVAIPTGRRDGRV  601
             PAN S+GGF+ +D+AKR+LE+ CP TVSC+DI+ LAARDAV   GGPSV +  GRRDG V
Sbjct  259   PANLSLGGFNVIDAAKRLLEVVCPATVSCSDILVLAARDAVTLTGGPSVPVSLGRRDGLV  318

Query  602   SLGKNVRPNIIDTSFTMDEMMKIFAAKGLSLDDLVTLSGAHTIGSAHCSAFSDRFQLASN  781
             SL  NVR NIIDT F++D M + FAAKGL+LDDLVTLSG HTIGSAHC+ F +RF++ +N
Sbjct  319   SLASNVRANIIDTGFSVDAMARSFAAKGLTLDDLVTLSGGHTIGSAHCTTFGERFRVDAN  378

Query  782   GSFLPIdaaldhayaaelaR-QCPA---GASDAVTVNNDPVTPSLFDNQYYKDLLAHRGL  949
             GS +P+DAA++  YA EL R  C A     S    V+ D  +   FDN Y+ +LLA RGL
Sbjct  379   GSTVPVDAAMNTDYAGELIRAACSAVNGTVSSTAAVDCDEGSALRFDNAYFANLLAGRGL  438

Query  950   FQSDSALLRDKRAMEKVQDFAGDQNNFFTSWEQSFLKLVSIGVKVGDDDGEIRRSCSSVN  1129
              ++D+ L+++      V+ FA  + +FF SW  SF +L S+GV+ G  DGE+RR CS VN
Sbjct  439   LRTDAVLVQNTTTRATVEAFARSEESFFASWAVSFARLTSLGVRTG-ADGEVRRLCSRVN  497



>ref|XP_002448121.1| hypothetical protein SORBIDRAFT_06g021550 [Sorghum bicolor]
 gb|EES12449.1| hypothetical protein SORBIDRAFT_06g021550 [Sorghum bicolor]
Length=498

 Score =   337 bits (864),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 175/299 (59%), Positives = 224/299 (75%), Gaps = 5/299 (2%)
 Frame = +2

Query  242   NFYAISCPSAELIVKNTVRSASSVDPTLPGKLLRLLFHDCFVEGCDASILLQGNDTERSD  421
             +FYA SCP  EL V++ VRSAS++DP++PGKLLRL+FHDCFVEGCDAS+L+QGN TER+D
Sbjct  201   SFYAQSCPGVELAVRDVVRSASTLDPSIPGKLLRLVFHDCFVEGCDASVLIQGNGTERTD  260

Query  422   PANKSVGGFSTVDSAKRVLEIFCPETVSCADIIALAARDAVEFVGGPSVAIPTGRRDGRV  601
             PAN S+GGF+ +D+AKR+LE+ CP TVSC+DI+ LAARDAV F GGP+V +  GRRDG V
Sbjct  261   PANLSLGGFNVIDAAKRLLEVVCPATVSCSDIVVLAARDAVVFTGGPAVPVALGRRDGLV  320

Query  602   SLGKNVRPNIIDTSFTMDEMMKIFAAKGLSLDDLVTLSGAHTIGSAHCSAFSDRFQLASN  781
             SL  NVR NIIDT F++D M   F AKGL+LDDLVTLSG HTIGSAHC+ F +RFQ+A N
Sbjct  321   SLASNVRRNIIDTGFSVDAMAASFTAKGLTLDDLVTLSGGHTIGSAHCNTFRERFQVA-N  379

Query  782   GSFLPIdaaldhayaaelaR---QCPAGASDAVTVNNDPVTPSLFDNQYYKDLLAHRGLF  952
             GS  PID +++  YA EL +        AS A  V+ D  + S+FDN+Y+ +LL  RGL 
Sbjct  380   GSMTPIDGSMNADYANELIQACAAANGAASAATAVDCDSGSASVFDNRYFANLLDGRGLL  439

Query  953   QSDSALLRDKRAMEKVQDFAGDQNNFFTSWEQSFLKLVSIGVKVGDDDGEIRRSCSSVN  1129
             ++D+ L+++     KV +FA  Q+ FF SW  S+ +L  +GVK G  DGEIRR+CSSVN
Sbjct  440   RTDAVLVQNATTKAKVAEFAQSQDGFFASWASSYARLTGLGVKTG-ADGEIRRTCSSVN  497



>ref|NP_001053214.1| Os04g0498700 [Oryza sativa Japonica Group]
 emb|CAD41241.2| OSJNBa0067K08.24 [Oryza sativa Japonica Group]
 dbj|BAF15128.1| Os04g0498700 [Oryza sativa Japonica Group]
 dbj|BAG87069.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE55714.1| hypothetical protein OsJ_04177 [Oryza sativa Japonica Group]
Length=508

 Score =   337 bits (864),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 170/299 (57%), Positives = 221/299 (74%), Gaps = 4/299 (1%)
 Frame = +2

Query  242   NFYAISCPSAELIVKNTVRSASSVDPTLPGKLLRLLFHDCFVEGCDASILLQGNDTERSD  421
             NFYA SCPS EL V++ VRSAS++D T+PGKLLR+LFHDCFVEGCDAS++++G+ TER+D
Sbjct  210   NFYAQSCPSVELAVRDVVRSASTLDSTIPGKLLRMLFHDCFVEGCDASVMIEGSGTERTD  269

Query  422   PANKSVGGFSTVDSAKRVLEIFCPETVSCADIIALAARDAVEFVGGPSVAIPTGRRDGRV  601
             PAN S+GGF+ +D+AKR+LE  CP TVSC+DI+ LAARDAV F GGP V +  GR DG V
Sbjct  270   PANLSLGGFNVIDAAKRLLEAVCPVTVSCSDILVLAARDAVTFTGGPLVPVSLGRLDGLV  329

Query  602   SLGKNVRPNIIDTSFTMDEMMKIFAAKGLSLDDLVTLSGAHTIGSAHCSAFSDRFQLASN  781
             SL  NVR NIIDT F++D M + F+AKGL+LDDLVTLSG HTIGSAHC+ F +RF++ +N
Sbjct  330   SLASNVRANIIDTGFSVDAMARSFSAKGLTLDDLVTLSGGHTIGSAHCTTFGERFRVDAN  389

Query  782   GSFLPIdaaldhayaaelaRQCPA---GASDAVTVNNDPVTPSLFDNQYYKDLLAHRGLF  952
             GS +P DAA++  YA  L R C A     S    V+ D  + S FDN Y+ +LLA RGL 
Sbjct  390   GSTVPADAAMNADYAGGLIRACSAVNNTVSSTAAVDCDEGSASRFDNAYFANLLAGRGLL  449

Query  953   QSDSALLRDKRAMEKVQDFAGDQNNFFTSWEQSFLKLVSIGVKVGDDDGEIRRSCSSVN  1129
             ++D+ L+++      V+ FA  + +FF SW  SF +L S+GV+ G  DGE+RR+CS VN
Sbjct  450   RTDAVLVQNATTRATVEAFARSEGSFFASWAASFARLTSLGVRTG-ADGEVRRTCSRVN  507



>ref|XP_007161105.1| hypothetical protein PHAVU_001G043100g [Phaseolus vulgaris]
 gb|ESW33099.1| hypothetical protein PHAVU_001G043100g [Phaseolus vulgaris]
Length=247

 Score =   325 bits (833),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 167/248 (67%), Positives = 195/248 (79%), Gaps = 1/248 (0%)
 Frame = +2

Query  389   LLQGNDTERSDPANKSVGGFSTVDSAKRVLEIFCPETVSCADIIALAARDAVEFVGGPSV  568
             +L GN+TE+SDPAN+S+GGFS ++SAKRVLE  CP TVSCADIIALAARDAVE  GGP +
Sbjct  1     MLLGNNTEQSDPANRSIGGFSVIESAKRVLEFLCPGTVSCADIIALAARDAVELTGGPMI  60

Query  569   AIPTGRRDGRVSLGKNVRPNIIDTSFTMDEMMKIFAAKGLSLDDLVTLSGAHTIGSAHCS  748
              IPTGRRDG VS+  NVRPNI+DTSFTMDEM+K F+ KGLSL DLV LSGAHTIG+AHCS
Sbjct  61    QIPTGRRDGMVSVASNVRPNILDTSFTMDEMIKRFSNKGLSLFDLVILSGAHTIGTAHCS  120

Query  749   AFSDRFQLASNGSFLPIdaaldhayaaelaRQCPAGASDAVTVNNDPVTPSLFDNQYYKD  928
             +F DRFQ  S G    ID +LD +YA EL ++CP  AS +V VNNDP T  +FDN YY++
Sbjct  121   SFRDRFQQDSKGKMKLIDKSLDSSYADELMKECPLSASPSVQVNNDPETSMVFDNHYYRN  180

Query  929   LLAHRGLFQSDSALLRDKRAMEKVQDFAGDQNNFFTSWEQSFLKLVSIGVKVGDDDGEIR  1108
             LL ++GLFQSDSALL D R  + V+D A DQ  FF SW QSF+KL SIGVK G D+GEIR
Sbjct  181   LLTNKGLFQSDSALLSDNRTRKLVEDLANDQQFFFESWGQSFMKLTSIGVKTG-DEGEIR  239

Query  1109  RSCSSVNA  1132
             R CSS NA
Sbjct  240   RFCSSTNA  247



>emb|CBI21172.3| unnamed protein product [Vitis vinifera]
Length=243

 Score =   313 bits (802),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 151/187 (81%), Positives = 164/187 (88%), Gaps = 0/187 (0%)
 Frame = +2

Query  239  FNFYAISCPSAELIVKNTVRSASSVDPTLPGKLLRLLFHDCFVEGCDASILLQGNDTERS  418
            FNFY  SCPSAE IVKNTVRSASS DPT+PGKLLRLLFHDC VEGCDAS+LLQGNDTERS
Sbjct  33   FNFYGASCPSAEFIVKNTVRSASSFDPTIPGKLLRLLFHDCMVEGCDASVLLQGNDTERS  92

Query  419  DPANKSVGGFSTVDSAKRVLEIFCPETVSCADIIALAARDAVEFVGGPSVAIPTGRRDGR  598
            DPAN S+GGFS ++SAKRVLEIFCP TVSCADI+ALAARDAVE VGGP + IPTGRRDGR
Sbjct  93   DPANASLGGFSVINSAKRVLEIFCPGTVSCADILALAARDAVEIVGGPMLQIPTGRRDGR  152

Query  599  VSLGKNVRPNIIDTSFTMDEMMKIFAAKGLSLDDLVTLSGAHTIGSAHCSAFSDRFQLAS  778
             S+   VR NIIDTSF+MDEMMK+F++KGLSLDDLV LSGAHTIGSAHCSAFSDRFQ  S
Sbjct  153  ASVASVVRFNIIDTSFSMDEMMKLFSSKGLSLDDLVILSGAHTIGSAHCSAFSDRFQADS  212

Query  779  NGSFLPI  799
             G+   I
Sbjct  213  KGTLTRI  219



>ref|XP_003603273.1| Peroxidase [Medicago truncatula]
Length=279

 Score =   311 bits (797),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 167/265 (63%), Positives = 203/265 (77%), Gaps = 3/265 (1%)
 Frame = +2

Query  341   RLLFHDC--FVEGCDASILLQGNDTERSDPANKSVGGFSTVDSAKRVLEIFCPETVSCAD  514
             +L  H C  +V GCDAS++LQGN+TE+SDP N+SVGGFS +++AKRVLE+FCP TVSCAD
Sbjct  14    QLQCHVCCIYVSGCDASLMLQGNNTEQSDPGNRSVGGFSVIETAKRVLEMFCPGTVSCAD  73

Query  515   IIALAARDAVEFVGGPSVAIPTGRRDGRVSLGKNVRPNIIDTSFTMDEMMKIFAAKGLSL  694
             IIALAARDAVE  GGP V IPTGRRDG VS+  NVRPNI+DTSFTMDEM+K+F++KGLSL
Sbjct  74    IIALAARDAVEIAGGPRVQIPTGRRDGMVSIASNVRPNIVDTSFTMDEMLKLFSSKGLSL  133

Query  695   DDLVTLSGAHTIGSAHCSAFSDRFQLASNGSFLPIdaaldhayaaelaRQCPAGASDAVT  874
              DLV LSGAHTIG+AHC+ F  RFQ   NGS   ID  +D  YA +L +QCP  A  +V 
Sbjct  134   LDLVVLSGAHTIGTAHCNTFRGRFQQDRNGSLRLIDQTIDTNYADQLIKQCPINAQPSVA  193

Query  875   VNNDPVTPSLFDNQYYKDLLAHRGLFQSDSALLRDKRAMEKVQDFAGDQNNFFTSWEQSF  1054
             VN DP T  LFDNQYY++LL  + LFQSDS L+ +    + V+DFA DQ  FF +W  SF
Sbjct  194   VNIDPETSMLFDNQYYRNLLDRKVLFQSDSVLMNNDDTRKLVEDFANDQELFFDNWGVSF  253

Query  1055  LKLVSIGVKVGDDDGEIRRSCSSVN  1129
             +KL SIGVK  D++GEIRRSC++ N
Sbjct  254   VKLTSIGVKT-DEEGEIRRSCAATN  277



>ref|XP_002977027.1| hypothetical protein SELMODRAFT_106106 [Selaginella moellendorffii]
 gb|EFJ22137.1| hypothetical protein SELMODRAFT_106106 [Selaginella moellendorffii]
Length=325

 Score =   304 bits (778),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 156/300 (52%), Positives = 204/300 (68%), Gaps = 5/300 (2%)
 Frame = +2

Query  239   FNFYAISCPSAELIVKNTVRSASSVDPTLPGKLLRLLFHDCFVEGCDASILLQ---GNDT  409
             F+FYA SCP  E +V N +RSA+  D TLP KLLRL+FHDCF+EGCD SIL+     +  
Sbjct  28    FDFYANSCPRVEAVVANAIRSATFFDSTLPPKLLRLMFHDCFIEGCDGSILVDSTANHTA  87

Query  410   ERSDPANKSVGGFSTVDSAKRVLEIFCPETVSCADIIALAARDAVEFVGGPSVAIPTGRR  589
             E+ D +NK+V G++ +DSAK  LE FCP  VSCADI+ALAAR+AV  +GGP V IP GRR
Sbjct  88    EKEDESNKTVDGYAAIDSAKSALEFFCPGVVSCADIVALAAREAVIMMGGPQVQIPMGRR  147

Query  590   DGRVSLGKNVRPNIIDTSFTMDEMMKIFAAKGLSLDDLVTLSGAHTIGSAHCSAFSDRFQ  769
             DG +S   NVR NI DT+ T+D++ K+F +KGLS  DL+ LSGAHT+G AHC AF++RF 
Sbjct  148   DGLISKVSNVRGNIPDTTLTLDQLTKVFNSKGLSQKDLIVLSGAHTVGLAHCFAFNERFH  207

Query  770   LASNGSFLPIdaaldhayaaelaRQCPAGASDAVTVNNDPVTPSLFDNQYYKDLLAHRGL  949
              +SNGS + +D+ LD  +A +L + CP   +  V V  DP TP+ FDN YY++L   +GL
Sbjct  208   FSSNGS-VKVDSTLDPGFARQLLQACPERPNPRVAVAIDPTTPNAFDNAYYRNLQNGKGL  266

Query  950   FQSDSALLRDKRAMEKVQDFAGDQNNFFTSWEQSFLKLVSIGVKVGDDDGEIRRSCSSVN  1129
             F SD  L  D+R+ + V   +GD   FF SW  SFLKL  +  K G + GE+RR C + N
Sbjct  267   FGSDQVLFTDRRSRQAVNSLSGDSREFFGSWADSFLKLSVVHTKTG-NQGEVRRRCRAFN  325



>ref|XP_002980766.1| hypothetical protein SELMODRAFT_178409 [Selaginella moellendorffii]
 gb|EFJ18417.1| hypothetical protein SELMODRAFT_178409 [Selaginella moellendorffii]
Length=325

 Score =   302 bits (774),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 155/300 (52%), Positives = 203/300 (68%), Gaps = 5/300 (2%)
 Frame = +2

Query  239   FNFYAISCPSAELIVKNTVRSASSVDPTLPGKLLRLLFHDCFVEGCDASILLQ---GNDT  409
             F+FYA SCP  E +V N +RSA+  D TLP KLLRL+FHDCF+EGCD SIL+     +  
Sbjct  28    FDFYANSCPRVEAVVANAIRSATFFDSTLPPKLLRLMFHDCFIEGCDGSILIDSTANHTA  87

Query  410   ERSDPANKSVGGFSTVDSAKRVLEIFCPETVSCADIIALAARDAVEFVGGPSVAIPTGRR  589
             E+ D +NK+  G++ +DSAK  LE FCP  VSCADI+ALAAR+AV  +GGP V IP GRR
Sbjct  88    EKEDESNKTADGYAAIDSAKSALEFFCPGVVSCADIVALAAREAVIMMGGPQVQIPMGRR  147

Query  590   DGRVSLGKNVRPNIIDTSFTMDEMMKIFAAKGLSLDDLVTLSGAHTIGSAHCSAFSDRFQ  769
             DG +S   NVR NI DT+ T+D++ K+F +KGLS  DL+ LSGAHT+G AHC AF++RF 
Sbjct  148   DGLISKVSNVRGNIPDTTLTLDQLTKVFNSKGLSQKDLIVLSGAHTVGLAHCFAFNERFH  207

Query  770   LASNGSFLPIdaaldhayaaelaRQCPAGASDAVTVNNDPVTPSLFDNQYYKDLLAHRGL  949
              +SNGS + +D+ LD  +A +L + CP   +  V V  DP TP+ FDN YY++L   +GL
Sbjct  208   FSSNGS-VKVDSTLDPGFARQLLQACPERPNPRVAVAIDPTTPNAFDNAYYRNLQNGKGL  266

Query  950   FQSDSALLRDKRAMEKVQDFAGDQNNFFTSWEQSFLKLVSIGVKVGDDDGEIRRSCSSVN  1129
             F SD  L  D+R+ + V   +GD   FF SW  SFLKL  +  K G + GE+RR C + N
Sbjct  267   FGSDQVLFTDRRSRQAVNSLSGDSREFFGSWADSFLKLSVVHTKTG-NQGEVRRRCRAFN  325



>gb|KEH35896.1| peroxidase family protein [Medicago truncatula]
Length=248

 Score =   296 bits (758),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 158/247 (64%), Positives = 191/247 (77%), Gaps = 1/247 (0%)
 Frame = +2

Query  389   LLQGNDTERSDPANKSVGGFSTVDSAKRVLEIFCPETVSCADIIALAARDAVEFVGGPSV  568
             +LQGN+TE+SDP N+SVGGFS +++AKRVLE+FCP TVSCADIIALAARDAVE  GGP V
Sbjct  1     MLQGNNTEQSDPGNRSVGGFSVIETAKRVLEMFCPGTVSCADIIALAARDAVEIAGGPRV  60

Query  569   AIPTGRRDGRVSLGKNVRPNIIDTSFTMDEMMKIFAAKGLSLDDLVTLSGAHTIGSAHCS  748
              IPTGRRDG VS+  NVRPNI+DTSFTMDEM+K+F++KGLSL DLV LSGAHTIG+AHC+
Sbjct  61    QIPTGRRDGMVSIASNVRPNIVDTSFTMDEMLKLFSSKGLSLLDLVVLSGAHTIGTAHCN  120

Query  749   AFSDRFQLASNGSFLPIdaaldhayaaelaRQCPAGASDAVTVNNDPVTPSLFDNQYYKD  928
              F  RFQ   NGS   ID  +D  YA +L +QCP  A  +V VN DP T  LFDNQYY++
Sbjct  121   TFRGRFQQDRNGSLRLIDQTIDTNYADQLIKQCPINAQPSVAVNIDPETSMLFDNQYYRN  180

Query  929   LLAHRGLFQSDSALLRDKRAMEKVQDFAGDQNNFFTSWEQSFLKLVSIGVKVGDDDGEIR  1108
             LL  + LFQSDS L+ +    + V+DFA DQ  FF +W  SF+KL SIGVK  D++GEIR
Sbjct  181   LLDRKVLFQSDSVLMNNDDTRKLVEDFANDQELFFDNWGVSFVKLTSIGVKT-DEEGEIR  239

Query  1109  RSCSSVN  1129
             RSC++ N
Sbjct  240   RSCAATN  246



>gb|EMT10640.1| Peroxidase 18 [Aegilops tauschii]
Length=373

 Score =   281 bits (720),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 159/320 (50%), Positives = 206/320 (64%), Gaps = 27/320 (8%)
 Frame = +2

Query  242   NFYAISCPSAELIVKNTVRSASSVDPTLPGKLLRLLFHDCFVEGCDASILLQGNDTERSD  421
             NFYA SCPS EL V + VRSAS++DP++PGKLLR++FHDCFVEGCDAS+L+QG+ TER+D
Sbjct  56    NFYAASCPSVELAVNDVVRSASTLDPSIPGKLLRMVFHDCFVEGCDASVLIQGSGTERTD  115

Query  422   PANKSVGGFSTVDSAKRVLEIFCPETVSCADIIALAARDAVEFVG---------------  556
             PAN S+GGF+ +D AKR+LE  CP TVSC+DII LAARDAV F                 
Sbjct  116   PANLSLGGFNVIDEAKRLLEAVCPATVSCSDIIVLAARDAVTFSSLCSEDLLCMTAFANF  175

Query  557   GPSVAIPTGRR----DGRVSLGKNVRPNIIDTSFT-----MDEMMKIFAAKGLSLDDLVT  709
              P    P  RR       V+    +RP    TS T            FA+KGLSLDDLVT
Sbjct  176   RPIELRPEDRRCRSPSADVTASSPLRPTSEQTSSTPASPSTPWRRASFASKGLSLDDLVT  235

Query  710   LSGAHTIGSAHCSAFSDRFQLASNGSFLPIdaaldhayaaelaRQCPAGASDAVTVNNDP  889
             LSG HTIGSAHC  F +RF+  +NGS +P+D  ++  YA EL R C A  S AV  ++  
Sbjct  236   LSGGHTIGSAHCGTFRERFRPDANGSMVPVDGTMNAEYATELMRACAASGSAAVGCDDG-  294

Query  890   VTPSLFDNQYYKDLLAHRGLFQSDSALLRDKRAMEKVQDFAGDQNNFFTSWEQSFLKLVS  1069
              + + FDN+Y+ +LL  RGL ++D+ L+++     +V  FA  Q++FF SW  S ++L +
Sbjct  295   -SAAAFDNRYFSNLLDGRGLLRTDAVLVQNATTRARVAAFAQSQDSFFGSWAGSSVRLTT  353

Query  1070  IGVKVGDDDGEIRRSCSSVN  1129
             +GVK G  DGE+RR CSSVN
Sbjct  354   LGVKTG-SDGEVRRLCSSVN  372



>gb|EMS45152.1| Peroxidase 18 [Triticum urartu]
Length=289

 Score =   271 bits (692),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 126/186 (68%), Positives = 151/186 (81%), Gaps = 0/186 (0%)
 Frame = +2

Query  242  NFYAISCPSAELIVKNTVRSASSVDPTLPGKLLRLLFHDCFVEGCDASILLQGNDTERSD  421
            NFYA SCPS EL V + VRSAS++DP++PGKLLR++FHDCFVEGCDAS+L+QG+ TER+D
Sbjct  67   NFYAASCPSVELAVNDVVRSASTLDPSIPGKLLRMVFHDCFVEGCDASVLIQGSGTERTD  126

Query  422  PANKSVGGFSTVDSAKRVLEIFCPETVSCADIIALAARDAVEFVGGPSVAIPTGRRDGRV  601
            PAN S+GGF+ +D AKR+LE  CP TVSC+DII LAARDAV F GGPSV +  GRRD  V
Sbjct  127  PANLSLGGFNVIDEAKRLLEAVCPATVSCSDIIVLAARDAVTFTGGPSVPVSLGRRDSLV  186

Query  602  SLGKNVRPNIIDTSFTMDEMMKIFAAKGLSLDDLVTLSGAHTIGSAHCSAFSDRFQLASN  781
            SL  NVR NIIDT F++D M   FA+KGLSLDDLVTLSG HTIGSAHC  F +RF+  +N
Sbjct  187  SLASNVRANIIDTGFSVDAMAASFASKGLSLDDLVTLSGGHTIGSAHCGTFRERFRPDAN  246

Query  782  GSFLPI  799
            GS +P+
Sbjct  247  GSMVPV  252



>gb|EAY94719.1| hypothetical protein OsI_16496 [Oryza sativa Indica Group]
Length=307

 Score =   269 bits (688),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 139/256 (54%), Positives = 183/256 (71%), Gaps = 4/256 (2%)
 Frame = +2

Query  371   GCDASILLQGNDTERSDPANKSVGGFSTVDSAKRVLEIFCPETVSCADIIALAARDAVEF  550
             GCDAS++++G+ TER+DPAN S+GGF+ +D+AKR+LE  CP TVSC+DI+ LAARDAV F
Sbjct  52    GCDASVMIEGSGTERTDPANLSLGGFNVIDAAKRLLEAVCPATVSCSDILVLAARDAVTF  111

Query  551   VGGPSVAIPTGRRDGRVSLGKNVRPNIIDTSFTMDEMMKIFAAKGLSLDDLVTLSGAHTI  730
              GGPSV +  GR DG VSL  NVR NIIDT F++D M + F+AKGL+LDDLVTLSG HTI
Sbjct  112   TGGPSVPVSLGRLDGLVSLASNVRANIIDTGFSVDAMARSFSAKGLTLDDLVTLSGGHTI  171

Query  731   GSAHCSAFSDRFQLASNGSFLPIdaaldhayaaelaRQCPA---GASDAVTVNNDPVTPS  901
             GSAHC+ F +RF++ +NGS +P D A++  YA EL R C A     S    V+ D  + S
Sbjct  172   GSAHCTTFGERFRVDANGSTVPADTAMNADYAGELIRACSAVNNTVSSTAAVDCDEGSAS  231

Query  902   LFDNQYYKDLLAHRGLFQSDSALLRDKRAMEKVQDFAGDQNNFFTSWEQSFLKLVSIGVK  1081
              FDN Y+ +LLA RGL ++D+ L+++      V+ FA  + +FF  W  SF +L S+GVK
Sbjct  232   RFDNAYFANLLAGRGLLRTDAVLVQNATTRATVEAFARSEGSFFAGWAASFARLTSLGVK  291

Query  1082  VGDDDGEIRRSCSSVN  1129
              G  DGE+RR+CS VN
Sbjct  292   TG-ADGEVRRTCSRVN  306



>ref|XP_006285183.1| hypothetical protein CARUB_v10006533mg [Capsella rubella]
 gb|EOA18081.1| hypothetical protein CARUB_v10006533mg [Capsella rubella]
Length=196

 Score =   247 bits (631),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 113/162 (70%), Positives = 135/162 (83%), Gaps = 0/162 (0%)
 Frame = +2

Query  239  FNFYAISCPSAELIVKNTVRSASSVDPTLPGKLLRLLFHDCFVEGCDASILLQGNDTERS  418
            FNFYA SCP AE +V+NTVRSA+S DPT+PGKLLRLLFHDCFV+GCDAS+L+QGN TERS
Sbjct  31   FNFYANSCPLAEFLVRNTVRSATSSDPTIPGKLLRLLFHDCFVQGCDASVLIQGNSTERS  90

Query  419  DPANKSVGGFSTVDSAKRVLEIFCPETVSCADIIALAARDAVEFVGGPSVAIPTGRRDGR  598
            DP N S+GGFS ++ AK  +EI CP TVSCADI+ALAARDAVE  GGP V IPTGRRDG 
Sbjct  91   DPGNASLGGFSVIERAKNAIEILCPATVSCADIVALAARDAVEAAGGPVVEIPTGRRDGN  150

Query  599  VSLGKNVRPNIIDTSFTMDEMMKIFAAKGLSLDDLVTLSGAH  724
            +S+  NVRPNIIDT F++ +M+  F++KGLS+ DLV LSG +
Sbjct  151  ISMAANVRPNIIDTDFSLGQMIDAFSSKGLSIQDLVVLSGIY  192



>gb|EPS69576.1| hypothetical protein M569_05190, partial [Genlisea aurea]
Length=169

 Score =   238 bits (607),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 109/158 (69%), Positives = 133/158 (84%), Gaps = 0/158 (0%)
 Frame = +2

Query  245  FYAISCPSAELIVKNTVRSASSVDPTLPGKLLRLLFHDCFVEGCDASILLQGNDTERSDP  424
            FYA SCP+AE+ VKN VR AS +DP+LP KLLRLLFHDCFVEGCDAS+L+QGN+TE +DP
Sbjct  12   FYADSCPNAEMTVKNAVREASQLDPSLPAKLLRLLFHDCFVEGCDASVLIQGNETEMTDP  71

Query  425  ANKSVGGFSTVDSAKRVLEIFCPETVSCADIIALAARDAVEFVGGPSVAIPTGRRDGRVS  604
             N+S+GGFS +DS KR+LE+FCP  VSCADIIALAARD+VE  GGPSV IPTGR+DGR+S
Sbjct  72   FNESLGGFSIIDSIKRLLEVFCPGIVSCADIIALAARDSVEITGGPSVRIPTGRKDGRIS  131

Query  605  LGKNVRPNIIDTSFTMDEMMKIFAAKGLSLDDLVTLSG  718
               NV+PN++  +FT ++   +F AKGLS+DDLVTLSG
Sbjct  132  SASNVKPNVVSANFTSNQTADVFFAKGLSVDDLVTLSG  169



>ref|XP_002991057.1| hypothetical protein SELMODRAFT_132865 [Selaginella moellendorffii]
 gb|EFJ07865.1| hypothetical protein SELMODRAFT_132865 [Selaginella moellendorffii]
Length=317

 Score =   241 bits (615),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 139/300 (46%), Positives = 188/300 (63%), Gaps = 11/300 (4%)
 Frame = +2

Query  245   FYAISCPSAELIVKNTVRSASSVDPTLPGKLLRLLFHDCFVEGCDASILLQ---GNDTER  415
             FY  SCP AE IV+ +V  A   +  L  +L+RL FHDCFV+GCDASILL     N  E+
Sbjct  25    FYDSSCPRAESIVQQSVMMAIQSNRPLASRLVRLFFHDCFVQGCDASILLDSTPNNTAEK  84

Query  416   SDPANKSVGGFSTVDSAKRVLEIFCPETVSCADIIALAARDAVEFVGGPSVAIPTGRRDG  595
                A+ +VGG+  +D+AK  LE  CP TVSCAD++ALAARDA+ F GGP   +PTGRRDG
Sbjct  85    DSRASATVGGYEVIDAAKNTLEAVCPGTVSCADVVALAARDAIFFSGGPHWDVPTGRRDG  144

Query  596   RVSLGKNVRPNIIDTSFTMDEMMKIFAAKGLSLDDLVTLSGAHTIGSAHCSAFSDRFQLA  775
              VS    V  N+ D SFT+D+    F+AKGLS  DLV LSGAHTIG AHC A  +RF  +
Sbjct  145   LVSQASVVASNLPDPSFTVDQSTASFSAKGLSQSDLVVLSGAHTIGFAHCGAIMNRF--S  202

Query  776   SNGSFLPIdaaldhayaaelaRQCPAGASDAVT-VNNDPVTPSLFDNQYYKDLLAHRGLF  952
             +NGS    D  LD  +   L   CP+ + DA   +  D ++ ++FDN Y+ +L A +GL 
Sbjct  203   ANGS----DPTLDPTFGKMLESSCPSPSPDATKLLPLDVLSNTIFDNAYFVNLQAGKGLM  258

Query  953   QSDSALLRDKRAMEKVQDFAGDQNNFFTSWEQSFLKLVSIGVKVGDDDGEIRRSCSSVNA  1132
              SD AL  D R    V  FA + N+F  +++ + ++L  + VK G  DG+IR++C ++N+
Sbjct  259   SSDQALFTDPRTKPLVNAFAQNANSFSANFQLAMVRLGQVQVKTG-SDGQIRKNCRAINS  317



>ref|NP_200002.3| peroxidase 66 [Arabidopsis thaliana]
 sp|Q9LT91.1|PER66_ARATH RecName: Full=Peroxidase 66; Short=Atperox P66; AltName: Full=ATP27a; 
Flags: Precursor [Arabidopsis thaliana]
 dbj|BAA97224.1| peroxidase [Arabidopsis thaliana]
 gb|AAL59943.1| putative peroxidase [Arabidopsis thaliana]
 gb|AAM67501.1| putative peroxidase [Arabidopsis thaliana]
 gb|AED96142.1| peroxidase 66 [Arabidopsis thaliana]
Length=322

 Score =   239 bits (611),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 137/302 (45%), Positives = 193/302 (64%), Gaps = 14/302 (5%)
 Frame = +2

Query  242   NFYAISCPSAELIVKNTVRSASSVDPTLPGKLLRLLFHDCFVEGCDASILL---QGNDTE  412
             ++Y  SCP+AE I+  TVR+A+  DP +P +LLR+ FHDCF+ GCDASILL   + N  E
Sbjct  29    HYYDQSCPAAEKIILETVRNATLYDPKVPARLLRMFFHDCFIRGCDASILLDSTRSNQAE  88

Query  413   RSDPANKSVGGFSTVDSAKRVLEIFCPETVSCADIIALAARDAVEFVGGPSVAIPTGRRD  592
             +  P N SV  F  ++ AKR LE  CP TVSCAD+IA+AARD V   GGP  ++  GR+D
Sbjct  89    KDGPPNISVRSFYVIEDAKRKLEKACPRTVSCADVIAIAARDVVTLSGGPYWSVLKGRKD  148

Query  593   GRVSLGKNVRPNIIDTSFTMDEMMKIFAAKGLSLDDLVTLSGAHTIGSAHCSAFSDRFQL  772
             G +S     R N+   +F + ++++ FAA+GLS+ D+VTLSG HTIG +HCS+F  R Q 
Sbjct  149   GTISRANETR-NLPPPTFNVSQLIQSFAARGLSVKDMVTLSGGHTIGFSHCSSFESRLQN  207

Query  773   ASNGSFLPIdaaldhayaaelaRQCPAGAS---DAVTVNNDPVTPSLFDNQYYKDLLAHR  943
              S   F  ID ++++A+A  L ++CP  ++   +A TV +   T S+FDN YYK +L+ +
Sbjct  208   FSK--FHDIDPSMNYAFAQTLKKKCPRTSNRGKNAGTVLDS--TSSVFDNVYYKQILSGK  263

Query  944   GLFQSDSALLRDKRAMEKVQDFAGDQNNFFTSWEQSFLKLVSIGVKVGDDDGEIRRSCSS  1123
             G+F SD ALL D R    V+ FA DQ  FF  +  S +KL + GVK   + G++R +   
Sbjct  264   GVFGSDQALLGDSRTKWIVETFAQDQKAFFREFAASMVKLGNFGVK---ETGQVRVNTRF  320

Query  1124  VN  1129
             VN
Sbjct  321   VN  322



>ref|XP_002991681.1| hypothetical protein SELMODRAFT_186230 [Selaginella moellendorffii]
 gb|EFJ07252.1| hypothetical protein SELMODRAFT_186230 [Selaginella moellendorffii]
Length=317

 Score =   239 bits (610),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 138/300 (46%), Positives = 187/300 (62%), Gaps = 11/300 (4%)
 Frame = +2

Query  245   FYAISCPSAELIVKNTVRSASSVDPTLPGKLLRLLFHDCFVEGCDASILLQ---GNDTER  415
             FY  SCP AE IV+ +V  A   +  L  +L+RL FHDCFV+GCDASILL     N  E+
Sbjct  25    FYDSSCPRAESIVQQSVMMAIQSNRPLASRLVRLFFHDCFVQGCDASILLDSTPNNTAEK  84

Query  416   SDPANKSVGGFSTVDSAKRVLEIFCPETVSCADIIALAARDAVEFVGGPSVAIPTGRRDG  595
                A+ +VGG+  +D+AK  LE  CP TVSCAD++ALAARDA+ F GGP   +PTGRRDG
Sbjct  85    DSRASATVGGYEVIDAAKNTLEAVCPGTVSCADVVALAARDAIFFSGGPHWDVPTGRRDG  144

Query  596   RVSLGKNVRPNIIDTSFTMDEMMKIFAAKGLSLDDLVTLSGAHTIGSAHCSAFSDRFQLA  775
              VS    V  N+ D SF +D+    F+AKGLS  DLV LSGAHTIG AHC A  +RF  +
Sbjct  145   LVSQASVVASNLPDPSFNVDQSTASFSAKGLSQSDLVVLSGAHTIGFAHCGAIMNRF--S  202

Query  776   SNGSFLPIdaaldhayaaelaRQCPAGASDAVT-VNNDPVTPSLFDNQYYKDLLAHRGLF  952
             +NGS    D  LD  +   L   CP+ + DA   +  D ++ ++FDN Y+ +L A +GL 
Sbjct  203   ANGS----DPTLDPTFGKMLESSCPSPSPDATKLLPLDVLSNTIFDNAYFVNLQAGKGLM  258

Query  953   QSDSALLRDKRAMEKVQDFAGDQNNFFTSWEQSFLKLVSIGVKVGDDDGEIRRSCSSVNA  1132
              SD AL  D R    V  FA + N+F  +++ + ++L  + VK G  DG+IR++C ++N+
Sbjct  259   SSDQALFTDPRTKPLVNAFAQNANSFSANFQLAMVRLGQVQVKTG-SDGQIRKNCRAINS  317



>ref|XP_006280819.1| hypothetical protein CARUB_v10026787mg [Capsella rubella]
 gb|EOA13717.1| hypothetical protein CARUB_v10026787mg [Capsella rubella]
Length=322

 Score =   239 bits (609),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 135/295 (46%), Positives = 191/295 (65%), Gaps = 14/295 (5%)
 Frame = +2

Query  242   NFYAISCPSAELIVKNTVRSASSVDPTLPGKLLRLLFHDCFVEGCDASILL---QGNDTE  412
             ++Y  SCP+AE I+  TVR+A+  DP +P +LLR+ FHDCF+ GCDASILL   + N  E
Sbjct  29    HYYDRSCPAAEKIILETVRNATLYDPKVPARLLRMFFHDCFIRGCDASILLDSTRSNQAE  88

Query  413   RSDPANKSVGGFSTVDSAKRVLEIFCPETVSCADIIALAARDAVEFVGGPSVAIPTGRRD  592
             +  P N SV  F  ++ AKR LE  CP TVSCAD+IA+AARD V   GGP  ++  GR+D
Sbjct  89    KDGPPNISVRSFYVIEDAKRKLEKACPRTVSCADVIAIAARDVVTLSGGPYWSVLKGRKD  148

Query  593   GRVSLGKNVRPNIIDTSFTMDEMMKIFAAKGLSLDDLVTLSGAHTIGSAHCSAFSDRFQL  772
             G VS     R N+   +F + ++++ FAA+GLS+ D+VTLSG HTIG +HCS+F  R Q 
Sbjct  149   GTVSRANETR-NLPPPTFNVSQLIQSFAARGLSVKDMVTLSGGHTIGFSHCSSFESRLQN  207

Query  773   ASNGSFLPIdaaldhayaaelaRQCPAGAS---DAVTVNNDPVTPSLFDNQYYKDLLAHR  943
              S   F  ID ++++A+A  L ++CP  ++   +A TV +   T S+FDN YYK +L+ +
Sbjct  208   FSK--FQDIDPSMNYAFAQTLKKKCPRSSNRGKNAGTVLDS--TASVFDNVYYKLILSGK  263

Query  944   GLFQSDSALLRDKRAMEKVQDFAGDQNNFFTSWEQSFLKLVSIGVKVGDDDGEIR  1108
             G+F SD ALL D R    V+ +A DQ  FF  +  S +KL ++GVK   + G++R
Sbjct  264   GVFGSDQALLGDSRTKWIVETYAQDQKAFFREFAASMVKLGNVGVK---ETGQVR  315



>ref|XP_009387950.1| PREDICTED: peroxidase 51-like isoform X1 [Musa acuminata subsp. 
malaccensis]
Length=323

 Score =   239 bits (609),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 138/301 (46%), Positives = 182/301 (60%), Gaps = 9/301 (3%)
 Frame = +2

Query  242   NFYAISCPSAELIVKNTV-RSASSVDPTLPGKLLRLLFHDCFVEGCDASILLQG--NDTE  412
             NFY +SCPS E IV+  V +       T+P  L RL FHDCFVEGCDAS+++     D E
Sbjct  27    NFYQVSCPSVESIVRQAVLKKLKQTIVTVPATL-RLFFHDCFVEGCDASVIIASPRGDAE  85

Query  413   RSDPANKSVGG--FSTVDSAKRVLEIFCPETVSCADIIALAARDAVEFVGGPSVAIPTGR  586
             +  P N S+ G  F TV  AK+ +E  CP  VSCADI+A+AARD V   GGP+ A+  GR
Sbjct  86    KDAPDNLSLAGDGFDTVIKAKQAVEAQCPGVVSCADILAIAARDVVVLSGGPTFAVELGR  145

Query  587   RDGRVSLGKNVRPNIIDTSFTMDEMMKIFAAKGLSLDDLVTLSGAHTIGSAHCSAFSDRF  766
             RDG  S    V  N+    F++D +  +F    LS  D++ LSGAHT+G +HCS F+DR 
Sbjct  146   RDGVTSRADRVTGNLPGPEFSVDLLSSMFRKNNLSTRDMIALSGAHTVGFSHCSRFADR-  204

Query  767   QLASNGSFLPIdaaldhayaaelaRQCPAGASDAVTVNNDPVTPSLFDNQYYKDLLAHRG  946
              L S  S  P+D +++ AYA  L R CP      + +N D  TP  FDN YYK+LL   G
Sbjct  205   -LYSFNSTSPVDPSMNPAYAKALMRVCPRNVDPTIAINMDLNTPITFDNVYYKNLLNGEG  263

Query  947   LFQSDSALLRDKRAMEKVQDFAGDQNNFFTSWEQSFLKLVSIGVKVGDDDGEIRRSCSSV  1126
             LF SD  L  D+R+   V++FA DQN+FF ++  S ++L  +GVK G   GEIRR C++ 
Sbjct  264   LFTSDQVLFTDQRSRPVVKEFAADQNSFFKAFASSMIRLGRLGVKTG-SQGEIRRDCTAF  322

Query  1127  N  1129
             N
Sbjct  323   N  323



>ref|XP_002865880.1| peroxidase [Arabidopsis lyrata subsp. lyrata]
 gb|EFH42139.1| peroxidase [Arabidopsis lyrata subsp. lyrata]
Length=322

 Score =   238 bits (607),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 136/302 (45%), Positives = 190/302 (63%), Gaps = 14/302 (5%)
 Frame = +2

Query  242   NFYAISCPSAELIVKNTVRSASSVDPTLPGKLLRLLFHDCFVEGCDASILL---QGNDTE  412
             ++Y  SCP+AE I+  TVR+A+  DP +P +LLR+ FHDCF+ GCDASILL     N  E
Sbjct  29    HYYDRSCPAAEKIILETVRNATLYDPKVPARLLRMFFHDCFIRGCDASILLDSTWSNQAE  88

Query  413   RSDPANKSVGGFSTVDSAKRVLEIFCPETVSCADIIALAARDAVEFVGGPSVAIPTGRRD  592
             +  P N SV  F  ++ AKR LE  CP TVSCAD+IA+AARD V   GGP  ++  GR+D
Sbjct  89    KDGPPNISVRSFYVIEDAKRKLEKACPRTVSCADVIAIAARDVVTLSGGPYWSVLKGRKD  148

Query  593   GRVSLGKNVRPNIIDTSFTMDEMMKIFAAKGLSLDDLVTLSGAHTIGSAHCSAFSDRFQL  772
             G +S     R N+   +F + ++++ FAA+GLS+ D+VTLSG HTIG +HCS+F  R Q 
Sbjct  149   GTISRANETR-NLPAPTFNVSQLIQSFAARGLSVKDMVTLSGGHTIGFSHCSSFESRLQN  207

Query  773   ASNGSFLPIdaaldhayaaelaRQCPAGAS---DAVTVNNDPVTPSLFDNQYYKDLLAHR  943
              S      ID ++++ +A  L R+CP  ++   +A TV +   T S+FDN YYK +L+ +
Sbjct  208   FSK--LHDIDPSMNYEFAQTLKRKCPRSSNRGKNAGTVLDS--TSSVFDNVYYKQILSGK  263

Query  944   GLFQSDSALLRDKRAMEKVQDFAGDQNNFFTSWEQSFLKLVSIGVKVGDDDGEIRRSCSS  1123
             G+F SD ALL D R    V+ FA DQ  FF  +  S +KL + GVK   + G++R +   
Sbjct  264   GVFGSDQALLGDSRTKWIVETFARDQKAFFREFAASMVKLGNFGVK---ETGQVRVNTRF  320

Query  1124  VN  1129
             VN
Sbjct  321   VN  322



>ref|XP_010680021.1| PREDICTED: peroxidase 16-like [Beta vulgaris subsp. vulgaris]
Length=337

 Score =   238 bits (606),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 136/301 (45%), Positives = 183/301 (61%), Gaps = 7/301 (2%)
 Frame = +2

Query  242   NFYAISCPSAELIVKNTVRSASSVDPTLPGKLLRLLFHDCFVEGCDASILL--QGNDTER  415
             NFY  SCP  E IV+  V    S         LRL FHDCFVEGCDAS+++     D E+
Sbjct  40    NFYTTSCPRVETIVRQAVAKKYSQTFITAQATLRLFFHDCFVEGCDASVMIFSPKGDAEK  99

Query  416   SDPANKSVGG--FSTVDSAKRVLEIFCPETVSCADIIALAARDAVEFVGGPSVAIPTGRR  589
               P + S+ G  F TV  AK+ LE  CP  VSCADI+ALAARDAV   GGPS ++  GRR
Sbjct  100   DSPDDLSLAGDGFDTVIKAKQALEAACPGVVSCADILALAARDAVVLTGGPSFSVELGRR  159

Query  590   DGRVSLGKNVRPNIIDTSFTMDEMMKIFAAKGLSLDDLVTLSGAHTIGSAHCSAFSDRFQ  769
             DG  S   +V  N+ + +F + +++ +FA   L+  DLV LSGAHTIG+AHCS FS+R  
Sbjct  160   DGLRSKASDVSGNLPEPTFNLGQLLTMFAKHNLTQTDLVALSGAHTIGAAHCSKFSNRLY  219

Query  770   LASNGSFLPIdaaldhayaaelaRQCPAGASDAVTVNNDPVTPSLFDNQYYKDLLAHRGL  949
               S  +  PID +++  YA +L +QCP   +  + V  DP TP+ FDN+YY+DL+A RGL
Sbjct  220   NFSPSN--PIDPSMNPTYAQQLKQQCPTNVNPNLVVFMDPRTPTTFDNKYYQDLVAGRGL  277

Query  950   FQSDSALLRDKRAMEKVQDFAGDQNNFFTSWEQSFLKLVSIGVKVGDDDGEIRRSCSSVN  1129
             F SD  L  +  +   V +FA +  NF  ++     KL  +GVK G + GEIRR+C++ N
Sbjct  278   FTSDQELYTNPASRPTVINFANNPGNFNAAFIIGMKKLGRVGVKTG-NQGEIRRNCAAFN  336

Query  1130  A  1132
             +
Sbjct  337   S  337



>gb|EMT10332.1| Peroxidase 5 [Aegilops tauschii]
Length=331

 Score =   237 bits (605),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 136/303 (45%), Positives = 184/303 (61%), Gaps = 9/303 (3%)
 Frame = +2

Query  245   FYAISCPSAELIVKNTVRSASSVDPTLPGKLLRLLFHDCFVEGCDASILLQ---GNDTER  415
             FY   CP AE +V+  V  A   +P  PG ++RL FHDCFV GCDAS+LL+   GN  ER
Sbjct  30    FYRELCPKAEKVVRRVVTKAFKKEPGTPGDIIRLFFHDCFVRGCDASVLLESTPGNTAER  89

Query  416   -SDPANKSVGGFSTVDSAKRVLEIFCPETVSCADIIALAARDAVEFVGGPSVAIPTGRRD  592
              S P N S+ GF  +  AK +LE  CP+TVSCADI+AL+ARD      G + AIPTGRRD
Sbjct  90    DSKPNNPSLDGFEVISDAKEILEKLCPQTVSCADILALSARDGAFLASGLNYAIPTGRRD  149

Query  593   GRVSLGKNVRPNIIDTSFTMDEMMKIFAAKGLSLDDLVTLSGAHTIGSAHCSAFSDRFQL  772
             G VS    V P++    F  D+++  F AKG + ++LVTLSGAH+IG++HCS+F+DR   
Sbjct  150   GLVSKADEVLPSVPHPDFHHDQLIGNFTAKGFTAEELVTLSGAHSIGTSHCSSFTDRLYK  209

Query  773   ASNGSFLPIdaaldhayaaelaRQCP---AGASDAVTVNNDPVTPSLFDNQYYKDLLAHR  943
               N      D A+  AYA  L ++CP   A  +D   V  D VTP + DNQYYK+LLA  
Sbjct  210   YYNDGAYGTDPAMPAAYAERLKKKCPPETAAHNDTTMVQLDDVTPFVMDNQYYKNLLAGT  269

Query  944   GLFQSDSALLRDKRAMEKVQDFAGDQNNFFTS-WEQSFLKLVSIGVKVGDDDGEIRRSCS  1120
               F SD AL+ D      V+ +A + ++++T  +  + +K+  + V  G  +GEIR +CS
Sbjct  270   VAFDSDMALMDDPETAALVELYAREPSDYWTERFAAAMVKISKMDVLTG-SEGEIRLNCS  328

Query  1121  SVN  1129
              VN
Sbjct  329   KVN  331



>gb|EMS51265.1| Peroxidase 5 [Triticum urartu]
Length=331

 Score =   236 bits (603),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 138/303 (46%), Positives = 183/303 (60%), Gaps = 9/303 (3%)
 Frame = +2

Query  245   FYAISCPSAELIVKNTVRSASSVDPTLPGKLLRLLFHDCFVEGCDASILLQ---GNDTER  415
             FY   CP AE +V+  V  A   +P  PG ++RL FHDCFV GCDAS+LL+   GN  ER
Sbjct  30    FYKELCPKAEKVVRRVVTKAFKKEPGTPGDIIRLFFHDCFVRGCDASVLLESTPGNTAER  89

Query  416   -SDPANKSVGGFSTVDSAKRVLEIFCPETVSCADIIALAARDAVEFVGGPSVAIPTGRRD  592
              S P N S+ GF  +  AK +LE  CP+TVSCADI+AL+ARD      G   AIPTGRRD
Sbjct  90    DSKPNNPSLDGFEVISDAKEILEKLCPQTVSCADILALSARDGAFLASGLDYAIPTGRRD  149

Query  593   GRVSLGKNVRPNIIDTSFTMDEMMKIFAAKGLSLDDLVTLSGAHTIGSAHCSAFSDRFQL  772
             G VS    V P++    F  D+++K F AKG + ++LVTLSGAH+IG++HCS+F+DR   
Sbjct  150   GLVSKEDEVLPSVPHPDFRHDQLIKNFTAKGFTAEELVTLSGAHSIGTSHCSSFTDRLYK  209

Query  773   ASNGSFLPIdaaldhayaaelaRQCP---AGASDAVTVNNDPVTPSLFDNQYYKDLLAHR  943
               N      D A+  AYAA L ++CP   A  +D   V  D VTP + DNQYYK+LLA  
Sbjct  210   YYNNGAYGTDPAIPPAYAARLKKKCPPSTAAHNDTTMVQLDDVTPFVMDNQYYKNLLAGT  269

Query  944   GLFQSDSALLRDKRAMEKVQDFAGDQNNFFTS-WEQSFLKLVSIGVKVGDDDGEIRRSCS  1120
               F SD AL+ D      V  +A + ++++T  +  + +K+  + V  G   GEIR +CS
Sbjct  270   VAFDSDMALMDDPETAALVDLYAREPSDYWTKRFAAAMVKVSEMDVLTG-SKGEIRLNCS  328

Query  1121  SVN  1129
              VN
Sbjct  329   KVN  331



>gb|KFK26799.1| hypothetical protein AALP_AA8G295000 [Arabis alpina]
Length=322

 Score =   236 bits (602),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 137/302 (45%), Positives = 189/302 (63%), Gaps = 14/302 (5%)
 Frame = +2

Query  242   NFYAISCPSAELIVKNTVRSASSVDPTLPGKLLRLLFHDCFVEGCDASILL---QGNDTE  412
             ++Y  SCP+AE I+  TVR+A+  DP +P +LLR+ FHDCF+ GCDASILL   Q N  E
Sbjct  29    HYYDQSCPAAEKIILETVRNATLYDPKVPARLLRMFFHDCFIRGCDASILLDSTQSNQAE  88

Query  413   RSDPANKSVGGFSTVDSAKRVLEIFCPETVSCADIIALAARDAVEFVGGPSVAIPTGRRD  592
             +  P N SV  F  ++ AK  LE  CP TVSCAD+IA+AARD V   GGP  ++  GR+D
Sbjct  89    KDGPPNISVRSFYVIEDAKAKLERVCPRTVSCADVIAIAARDVVTLSGGPYWSVLKGRKD  148

Query  593   GRVSLGKNVRPNIIDTSFTMDEMMKIFAAKGLSLDDLVTLSGAHTIGSAHCSAFSDRFQL  772
             G VS   N   N+   +F + ++++ FAA+GLS+ D+VTLSG HT+G +HCS+F  R Q 
Sbjct  149   GTVSRA-NETINLPAPTFNVSQLIQSFAARGLSVKDMVTLSGGHTLGFSHCSSFESRLQN  207

Query  773   ASNGSFLPIdaaldhayaaelaRQCPAGAS---DAVTVNNDPVTPSLFDNQYYKDLLAHR  943
              S   F  ID +++ A+A  L ++CP  ++   +A TV +   T S+FDN YYK +L+ +
Sbjct  208   FSK--FHDIDPSMNFAFAQSLKKKCPKSSNRGKNAGTVLDS--TTSVFDNVYYKQILSGK  263

Query  944   GLFQSDSALLRDKRAMEKVQDFAGDQNNFFTSWEQSFLKLVSIGVKVGDDDGEIRRSCSS  1123
             G+F SD ALL D R    V+ FA DQ  FF  +  S +KL   GVK   + G++R     
Sbjct  264   GVFGSDQALLGDDRTKWIVETFAQDQKAFFREFATSMVKLGKFGVK---ETGQVRVKSRF  320

Query  1124  VN  1129
             VN
Sbjct  321   VN  322



>gb|EEC71855.1| hypothetical protein OsI_04549 [Oryza sativa Indica Group]
Length=775

 Score =   247 bits (630),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 138/296 (47%), Positives = 184/296 (62%), Gaps = 42/296 (14%)
 Frame = +2

Query  368   EGCDASILLQGNDTERSDPANKSVGGFSTVDSAKRVLEIFCPETVSCADIIALAARDAVE  547
             +GCDAS++++G+ TER+DPAN S+GGF+ +D+AKR+LE  CP TVSC+DI+ LAARDAV 
Sbjct  481   QGCDASVMIEGSGTERTDPANLSLGGFNVIDAAKRLLEAVCPVTVSCSDILVLAARDAVT  540

Query  548   FVGGPSVAIPTGRRDGRVSLGKNVRPNIIDTSFTMDEMMKIFAAKGLSLDDLVTLS----  715
             F GGP V +  GR DG VSL  NVR NIIDT F++D M + F+AKGL+LDDLVTLS    
Sbjct  541   FTGGPLVPVSLGRLDGLVSLASNVRANIIDTGFSVDAMARSFSAKGLTLDDLVTLSGTHT  600

Query  716   ----------------------------------GAHTIGSAHCSAFSDRFQLASNGSFL  793
                                               G HTIGSAHC+ F +RF++ +NGS +
Sbjct  601   HALECWRINCDFHFSPGLTVSTRLSIAGVAHWRAGGHTIGSAHCTTFGERFRVDANGSTV  660

Query  794   PIdaaldhayaaelaRQCPA---GASDAVTVNNDPVTPSLFDNQYYKDLLAHRGLFQSDS  964
             P DAA++  YA  L R C A     S    V+ D  + S FDN Y+ +LLA RGL ++D+
Sbjct  661   PADAAMNADYAGGLIRACSAVNNTVSSTAAVDCDEGSASRFDNAYFANLLAGRGLLRTDA  720

Query  965   ALLRDKRAMEKVQDFAGDQNNFFTSWEQSFLKLVSIGVKVGDDDGEIRRSCSSVNA  1132
              L+++      V+ FA  + +FF SW  SF +L S+GV+ G  DGE+RR+CS VN 
Sbjct  721   VLVQNATTRATVEAFARSEGSFFASWAASFARLTSLGVRTG-ADGEVRRTCSRVNG  775



>ref|XP_006846424.1| hypothetical protein AMTR_s00018p00028320 [Amborella trichopoda]
 gb|ERN08099.1| hypothetical protein AMTR_s00018p00028320 [Amborella trichopoda]
Length=325

 Score =   236 bits (601),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 137/301 (46%), Positives = 192/301 (64%), Gaps = 10/301 (3%)
 Frame = +2

Query  245   FYAISCPSAELIVKNTVRSASSVDPTLPGKLLRLLFHDCFVEGCDASILLQGNDTERSDP  424
             FY+  C  AE IVK+ VRSA S D  L   L+ + FHDCFV GCD SIL+  N T  ++ 
Sbjct  29    FYSQRCSPAERIVKDAVRSAVSNDVGLAADLIHMYFHDCFVRGCDGSILIDSNSTNTAEK  88

Query  425   ---ANK-SVGGFSTVDSAKRVLEIFCPETVSCADIIALAARDAVEFVGGPSVAIPTGRRD  592
                ANK S+  F  +DSAK  LE  C   VSCADI+A AARDA E VGG    +P GRRD
Sbjct  89    DFFANKISLRSFGVLDSAKSKLEDMCKGVVSCADILAFAARDAAEMVGGIGWDVPAGRRD  148

Query  593   GRVSLGKNVRPNIIDTSFTMDEMMKIFAAKGLSLDDLVTLSGAHTIGSAHCSAFSDR-FQ  769
             GR+SL      N+   +FT+ ++ ++F +KGL+ +++VTLSGAHTIG +HC++FS+R F 
Sbjct  149   GRISLASENLANLPAPTFTVPQLTQLFLSKGLTQEEMVTLSGAHTIGRSHCTSFSNRLFN  208

Query  770   LASNGSFLPIdaaldhayaaelaRQCPAGASDA-VTVNNDPVTPSLFDNQYYKDLLAHRG  946
              +S  S  P   +LD  YA +L  +CP G ++  + V  DP++P++ DN YYK++LA+RG
Sbjct  209   FSSTSSQDP---SLDPRYATQLKSKCPKGNTNTNLVVPMDPLSPTVLDNAYYKNILANRG  265

Query  947   LFQSDSALLRDKRAMEKVQDFAGDQNNFFTSWEQSFLKLVSIGVKVGDDDGEIRRSCSSV  1126
             LF SD ALL D     +V ++A +   + T +  + +++  IGV  G + GEIRR+C +V
Sbjct  266   LFTSDHALLSDPSTSSQVSEYAANVFLWRTKFGAAMVRMGQIGVLTG-NAGEIRRNCRAV  324

Query  1127  N  1129
             N
Sbjct  325   N  325



>ref|XP_010442699.1| PREDICTED: peroxidase 66 [Camelina sativa]
Length=322

 Score =   235 bits (600),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 135/302 (45%), Positives = 192/302 (64%), Gaps = 14/302 (5%)
 Frame = +2

Query  242   NFYAISCPSAELIVKNTVRSASSVDPTLPGKLLRLLFHDCFVEGCDASILLQG---NDTE  412
             ++Y  SCP+AE I+ +TVR+AS  DP +P +LLR+ FHDCF+ GCDASILL     N  E
Sbjct  29    HYYDQSCPAAEKIILDTVRNASLYDPKVPARLLRMFFHDCFIRGCDASILLDSVVSNQAE  88

Query  413   RSDPANKSVGGFSTVDSAKRVLEIFCPETVSCADIIALAARDAVEFVGGPSVAIPTGRRD  592
             +  P N SV  F  ++ AK+ LE  CP TVSCAD+IA+AARD V   GGP  ++  GR+D
Sbjct  89    KDGPPNISVRSFYVIEDAKKKLEKACPRTVSCADVIAIAARDVVTLSGGPYWSVLKGRKD  148

Query  593   GRVSLGKNVRPNIIDTSFTMDEMMKIFAAKGLSLDDLVTLSGAHTIGSAHCSAFSDRFQL  772
             G VSL      N+   +F + ++++ FAA+GLS+ D+VTLSG HTIG +HCS+F  R Q 
Sbjct  149   GTVSLASE-STNLPPPTFNVSQLIQSFAARGLSVKDMVTLSGGHTIGFSHCSSFEPRLQN  207

Query  773   ASNGSFLPIdaaldhayaaelaRQCPAGAS---DAVTVNNDPVTPSLFDNQYYKDLLAHR  943
              S   F  ID ++++A+A  L ++CP   +   +A T  +   T S+FDN YYK +L+ +
Sbjct  208   FSK--FHDIDPSMNYAFAQTLKKKCPRSTNRDKNAGTFLDS--TASVFDNVYYKQILSGK  263

Query  944   GLFQSDSALLRDKRAMEKVQDFAGDQNNFFTSWEQSFLKLVSIGVKVGDDDGEIRRSCSS  1123
             G+F SD  LL D R  + V+ +A DQ  FF  +  S +KL +IGVK   + G++R +   
Sbjct  264   GVFVSDQTLLGDSRTKKIVEKYAQDQKAFFREFAASMVKLGNIGVK---ETGQVRVNPRF  320

Query  1124  VN  1129
             +N
Sbjct  321   IN  322



>dbj|BAJ33867.1| unnamed protein product [Thellungiella halophila]
 dbj|BAJ33890.1| unnamed protein product [Thellungiella halophila]
Length=322

 Score =   235 bits (600),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 136/302 (45%), Positives = 191/302 (63%), Gaps = 14/302 (5%)
 Frame = +2

Query  242   NFYAISCPSAELIVKNTVRSASSVDPTLPGKLLRLLFHDCFVEGCDASILL---QGNDTE  412
             ++Y  SCP AE I+ +TVR+A+  DP +P +LLR+ FHDCF+ GCDASILL   + N  E
Sbjct  29    HYYDRSCPVAEKIILDTVRNATLYDPKVPARLLRMFFHDCFIRGCDASILLDSTRSNQAE  88

Query  413   RSDPANKSVGGFSTVDSAKRVLEIFCPETVSCADIIALAARDAVEFVGGPSVAIPTGRRD  592
             +  P+N SV  F  ++ AK  LE  CP TVSCAD+IA+AARD V   GGP  ++  GR+D
Sbjct  89    KDGPSNISVRSFYVIEEAKTKLEKVCPRTVSCADVIAIAARDVVTLSGGPYWSVLKGRKD  148

Query  593   GRVSLGKNVRPNIIDTSFTMDEMMKIFAAKGLSLDDLVTLSGAHTIGSAHCSAFSDRFQL  772
             G +S   N   N+   +F + ++++ FAA+GLS+ D+VTLSG HT+G +HCS+F  R Q 
Sbjct  149   GTISRA-NETVNLPAPTFNVSQLIQSFAARGLSVKDMVTLSGGHTLGFSHCSSFEARLQN  207

Query  773   ASNGSFLPIdaaldhayaaelaRQCPAGAS---DAVTVNNDPVTPSLFDNQYYKDLLAHR  943
              S   F  ID +++ A+A  L ++CP  ++   +A TV +   T S+FDN YYK +L+ +
Sbjct  208   FSK--FHDIDPSMNFAFAQTLKKKCPRSSNRGKNAGTVLDS--TTSVFDNDYYKQILSGK  263

Query  944   GLFQSDSALLRDKRAMEKVQDFAGDQNNFFTSWEQSFLKLVSIGVKVGDDDGEIRRSCSS  1123
             G+F SD ALL D R    V+ FA DQ  FF  +  S +KL + GVK   + GE+R     
Sbjct  264   GVFGSDQALLGDYRTKWIVETFARDQKAFFREFAASMVKLGNFGVK---ETGEVRVKSGF  320

Query  1124  VN  1129
             VN
Sbjct  321   VN  322



>ref|XP_007136358.1| hypothetical protein PHAVU_009G038500g [Phaseolus vulgaris]
 gb|ESW08352.1| hypothetical protein PHAVU_009G038500g [Phaseolus vulgaris]
Length=327

 Score =   235 bits (600),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 133/302 (44%), Positives = 191/302 (63%), Gaps = 10/302 (3%)
 Frame = +2

Query  245   FYAISCPSAELIVKNTVRSASSVDPTLPGKLLRLLFHDCFVEGCDASILLQG---NDTER  415
             FY+ SC  AE IVK+ VR A S +P +   L+R+ FHDCF+ GCDAS+LL     N  E+
Sbjct  30    FYSYSCGMAEFIVKDEVRKAVSNNPGIAAGLVRMHFHDCFIRGCDASVLLDSTPSNTAEK  89

Query  416   SDPANK-SVGGFSTVDSAKRVLEIFCPETVSCADIIALAARDAVEFVGGPSVAIPTGRRD  592
               PANK S+ G+  +D AK  LE  CP  VSCADI+A AARD+VE  GG    +P GRRD
Sbjct  90    DSPANKPSLRGYEVIDHAKAQLEAVCPGIVSCADIVAFAARDSVELAGGLGYDVPAGRRD  149

Query  593   GRVSLGKNVRPNIIDTSFTMDEMMKIFAAKGLSLDDLVTLSGAHTIGSAHCSAFSDR-FQ  769
             GR+SL  + R  +   +F ++++ ++FA KGL+ D++VTLSGAHTIG +HCS+FS+R + 
Sbjct  150   GRISLASDTRTELPPPTFNVNQLTQLFARKGLTQDEMVTLSGAHTIGRSHCSSFSNRLYN  209

Query  770   LASNGSFLPIdaaldhayaaelaRQCPAGASDA-VTVNNDPVTPSLFDNQYYKDLLAHRG  946
              +   S  P   +LD +YAA L RQCP G+++  + V  +P +P + D  YY D+L++RG
Sbjct  210   FSGTSSKDP---SLDPSYAALLKRQCPQGSTNPNLVVPMNPSSPGIADVGYYVDILSNRG  266

Query  947   LFQSDSALLRDKRAMEKVQDFAGDQNNFFTSWEQSFLKLVSIGVKVGDDDGEIRRSCSSV  1126
             LF SD  LL +     +V+  A D   + + +  + +K+  I V  G + GEIR +C  V
Sbjct  267   LFTSDQTLLTNAETASQVKQNARDGYQWASKFADAMVKMGQISVLTG-NAGEIRTNCRVV  325

Query  1127  NA  1132
             ++
Sbjct  326   SS  327



>emb|CAE01626.3| OSJNBa0029H02.5 [Oryza sativa Japonica Group]
Length=513

 Score =   241 bits (614),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 139/314 (44%), Positives = 185/314 (59%), Gaps = 61/314 (19%)
 Frame = +2

Query  368   EGCDASILLQGNDTERSDPANKSVGGFSTVDSAKRVLEIFCPETVSCADIIALAARDAVE  547
             +GCDAS++++G+ TER+DPAN S+GGF+ +D+AKR+LE  CP TVSC+DI+ LAARDAV 
Sbjct  200   QGCDASVMIEGSGTERTDPANLSLGGFNVIDAAKRLLEAVCPVTVSCSDILVLAARDAVT  259

Query  548   FV-------------------GGPSVAIPTGRRDGRVSLGKNVRPNIIDTSFTMDEMMKI  670
             FV                   GGP V +  GR DG VSL  NVR NIIDT F++D M + 
Sbjct  260   FVSMMALCDFSFLVATIHSKTGGPLVPVSLGRLDGLVSLASNVRANIIDTGFSVDAMARS  319

Query  671   FAAKGLSLDDLVTLS--------------------------------------GAHTIGS  736
             F+AKGL+LDDLVTLS                                      G HTIGS
Sbjct  320   FSAKGLTLDDLVTLSGTHTHALECWRINCDFHFSPGLTVSTRLSIAGVAHWRAGGHTIGS  379

Query  737   AHCSAFSDRFQLASNGSFLPIdaaldhayaaelaRQCPA---GASDAVTVNNDPVTPSLF  907
             AHC+ F +RF++ +NGS +P DAA++  YA  L R C A     S    V+ D  + S F
Sbjct  380   AHCTTFGERFRVDANGSTVPADAAMNADYAGGLIRACSAVNNTVSSTAAVDCDEGSASRF  439

Query  908   DNQYYKDLLAHRGLFQSDSALLRDKRAMEKVQDFAGDQNNFFTSWEQSFLKLVSIGVKVG  1087
             DN Y+ +LLA RGL ++D+ L+++      V+ FA  + +FF SW  SF +L S+GV+ G
Sbjct  440   DNAYFANLLAGRGLLRTDAVLVQNATTRATVEAFARSEGSFFASWAASFARLTSLGVRTG  499

Query  1088  DDDGEIRRSCSSVN  1129
               DGE+RR+CS VN
Sbjct  500   -ADGEVRRTCSRVN  512



>ref|XP_009623550.1| PREDICTED: peroxidase 66 [Nicotiana tomentosiformis]
Length=323

 Score =   235 bits (599),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 131/299 (44%), Positives = 182/299 (61%), Gaps = 9/299 (3%)
 Frame = +2

Query  242   NFYAISCPSAELIVKNTVRSASSVDPTLPGKLLRLLFHDCFVEGCDASILLQ---GNDTE  412
             N+Y  +CP AE I+   VR+ASS DP +P +LLR+ FHDCF+ GCDAS+LL    GN  E
Sbjct  31    NYYDQTCPQAEDIIYQAVRNASSYDPKVPARLLRMFFHDCFIRGCDASVLLDSTPGNKAE  90

Query  413   RSDPANKSVGGFSTVDSAKRVLEIFCPETVSCADIIALAARDAVEFVGGPSVAIPTGRRD  592
             +  P N S+  F  +D AK  LE  CP TVSCADI+A+AARD V   GGP   +  GR+D
Sbjct  91    KDGPPNVSLRAFYVIDDAKTKLEKSCPRTVSCADIVAIAARDVVAMSGGPHWNVLKGRKD  150

Query  593   GRVSLGKNVRPNIIDTSFTMDEMMKIFAAKGLSLDDLVTLSGAHTIGSAHCSAFSDRFQL  772
             GR+S   N   N+   SF   ++++ FA +GL + DLV LSG HT+G +HCS+F  R  L
Sbjct  151   GRISRA-NETINLPAPSFNTSQLIQSFAKRGLGMKDLVALSGGHTLGFSHCSSFEAR--L  207

Query  773   ASNGSFLPIdaaldhayaaelaRQCPAGASDAVTVNNDPVTPSLFDNQYYKDLLAHRGLF  952
              +  +    D +L+  +A  L + CP    D+        T  +FDN YYK ++A +G+F
Sbjct  208   HNFSAVHDTDPSLNAVFAESLKKNCPKPNRDSNAGQFLDPTSLVFDNNYYKQIVAGKGVF  267

Query  953   QSDSALLRDKRAMEKVQDFAGDQNNFFTSWEQSFLKLVSIGVKVGDDDGEIRRSCSSVN  1129
              SD +LL D R    V+ FA DQ +FF  +  S +KL ++GV+   +DGE+R +C +VN
Sbjct  268   ASDQSLLNDYRTGWIVKAFANDQASFFWEFAASMIKLGNVGVQ---EDGEVRLNCRAVN  323



>ref|XP_006401899.1| hypothetical protein EUTSA_v10014117mg [Eutrema salsugineum]
 gb|ESQ43352.1| hypothetical protein EUTSA_v10014117mg [Eutrema salsugineum]
Length=322

 Score =   234 bits (598),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 136/302 (45%), Positives = 190/302 (63%), Gaps = 14/302 (5%)
 Frame = +2

Query  242   NFYAISCPSAELIVKNTVRSASSVDPTLPGKLLRLLFHDCFVEGCDASILL---QGNDTE  412
             ++Y  SCP AE I+ +TVR+A+  DP +P +LLR+ FHDCF+ GCDASILL   + N  E
Sbjct  29    HYYDRSCPVAEKIILDTVRNATLYDPKVPARLLRMFFHDCFIRGCDASILLDSTRSNQAE  88

Query  413   RSDPANKSVGGFSTVDSAKRVLEIFCPETVSCADIIALAARDAVEFVGGPSVAIPTGRRD  592
             +  P N SV  F  ++ AK  LE  CP TVSCAD+IA+AARD V   GGP  ++  GR+D
Sbjct  89    KDGPPNISVRSFYVIEEAKTKLEKVCPRTVSCADVIAIAARDVVTLSGGPYWSVLKGRKD  148

Query  593   GRVSLGKNVRPNIIDTSFTMDEMMKIFAAKGLSLDDLVTLSGAHTIGSAHCSAFSDRFQL  772
             G +S   N   N+   +F + ++++ FAA+GLS+ D+VTLSG HT+G +HCS+F  R Q 
Sbjct  149   GTISRA-NETVNLPAPTFNVSQLIQSFAARGLSVKDMVTLSGGHTLGFSHCSSFEARLQN  207

Query  773   ASNGSFLPIdaaldhayaaelaRQCPAGAS---DAVTVNNDPVTPSLFDNQYYKDLLAHR  943
              S   F  ID +++ A+A  L ++CP  ++   +A TV +   T S+FDN YYK +L+ +
Sbjct  208   FSK--FHDIDPSMNFAFAQTLKKKCPRSSNRGKNAGTVLDS--TTSVFDNDYYKQILSGK  263

Query  944   GLFQSDSALLRDKRAMEKVQDFAGDQNNFFTSWEQSFLKLVSIGVKVGDDDGEIRRSCSS  1123
             G+F SD ALL D R    V+ FA DQ  FF  +  S +KL + GVK   + GE+R     
Sbjct  264   GVFGSDQALLGDYRTKWIVETFARDQKAFFREFAASMVKLGNFGVK---ETGEVRVKSGF  320

Query  1124  VN  1129
             VN
Sbjct  321   VN  322



>ref|NP_001241968.1| uncharacterized protein LOC100779031 precursor [Glycine max]
 gb|ACU20835.1| unknown [Glycine max]
Length=327

 Score =   235 bits (599),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 134/302 (44%), Positives = 191/302 (63%), Gaps = 10/302 (3%)
 Frame = +2

Query  245   FYAISCPSAELIVKNTVRSASSVDPTLPGKLLRLLFHDCFVEGCDASILLQG---NDTER  415
             +Y+ SC  AE IVK+ VR   + +P +   L+R+ FHDCF+ GCDAS+LL     N  E+
Sbjct  30    YYSYSCSMAEFIVKDEVRKGVTNNPGIAAGLVRMHFHDCFIRGCDASVLLDSTPLNTAEK  89

Query  416   SDPANK-SVGGFSTVDSAKRVLEIFCPETVSCADIIALAARDAVEFVGGPSVAIPTGRRD  592
               PANK S+ G+  +D+AK  LE  CP  VSCADI+A AARD+VEF  G    +P GRRD
Sbjct  90    DSPANKPSLRGYEVIDNAKAKLEAVCPGIVSCADIVAFAARDSVEFARGLGYNVPAGRRD  149

Query  593   GRVSLGKNVRPNIIDTSFTMDEMMKIFAAKGLSLDDLVTLSGAHTIGSAHCSAFSDR-FQ  769
             GR+SL  + R  +   +F ++++ ++FA KGL+ D++VTLSGAHTIG +HCSAFS R + 
Sbjct  150   GRISLASDTRTELPPPTFNVNQLTQLFARKGLTQDEMVTLSGAHTIGRSHCSAFSSRLYN  209

Query  770   LASNGSFLPIdaaldhayaaelaRQCPAGASDA-VTVNNDPVTPSLFDNQYYKDLLAHRG  946
              ++  S  P   +LD +YAA L RQCP G+++  + V  DP +P + D  YY D+LA+RG
Sbjct  210   FSTTSSQDP---SLDPSYAALLKRQCPQGSTNQNLVVPMDPSSPGIADVGYYVDILANRG  266

Query  947   LFQSDSALLRDKRAMEKVQDFAGDQNNFFTSWEQSFLKLVSIGVKVGDDDGEIRRSCSSV  1126
             LF SD  LL +     +V+  A D   + + +  + +K+  I V  G + GEIR +C  V
Sbjct  267   LFTSDQTLLTNAETASQVKQNARDPYLWASQFADAMVKMGQIIVLKG-NAGEIRTNCRVV  325

Query  1127  NA  1132
             N+
Sbjct  326   NS  327



>gb|KHN19575.1| Peroxidase 5 [Glycine soja]
Length=327

 Score =   234 bits (598),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 134/302 (44%), Positives = 191/302 (63%), Gaps = 10/302 (3%)
 Frame = +2

Query  245   FYAISCPSAELIVKNTVRSASSVDPTLPGKLLRLLFHDCFVEGCDASILLQG---NDTER  415
             +Y+ SC  AE IVK+ VR   + +P +   L+R+ FHDCF+ GCDAS+LL     N  E+
Sbjct  30    YYSYSCSMAEFIVKDEVRKGVTNNPGIAAGLVRMHFHDCFIRGCDASVLLDSTPLNTAEK  89

Query  416   SDPANK-SVGGFSTVDSAKRVLEIFCPETVSCADIIALAARDAVEFVGGPSVAIPTGRRD  592
               PANK S+ G+  +D+AK  LE  CP  VSCADI+A AARD+VEF  G    +P GRRD
Sbjct  90    DSPANKPSLRGYEVIDNAKAKLEAVCPGIVSCADIVAFAARDSVEFARGLGYDVPAGRRD  149

Query  593   GRVSLGKNVRPNIIDTSFTMDEMMKIFAAKGLSLDDLVTLSGAHTIGSAHCSAFSDR-FQ  769
             GR+SL  + R  +   +F ++++ ++FA KGL+ D++VTLSGAHTIG +HCSAFS R + 
Sbjct  150   GRISLASDTRTELPPPTFNVNQLTQLFARKGLTQDEMVTLSGAHTIGRSHCSAFSSRLYN  209

Query  770   LASNGSFLPIdaaldhayaaelaRQCPAGASDA-VTVNNDPVTPSLFDNQYYKDLLAHRG  946
              ++  S  P   +LD +YAA L RQCP G+++  + V  DP +P + D  YY D+LA+RG
Sbjct  210   FSTTSSQDP---SLDPSYAALLKRQCPQGSTNQNLVVPMDPSSPGIADVGYYVDILANRG  266

Query  947   LFQSDSALLRDKRAMEKVQDFAGDQNNFFTSWEQSFLKLVSIGVKVGDDDGEIRRSCSSV  1126
             LF SD  LL +     +V+  A D   + + +  + +K+  I V  G + GEIR +C  V
Sbjct  267   LFTSDQTLLTNAETASQVKQNARDPYLWASQFADAMVKMGQIIVLKG-NAGEIRTNCRVV  325

Query  1127  NA  1132
             N+
Sbjct  326   NS  327



>ref|XP_010482534.1| PREDICTED: peroxidase 66-like [Camelina sativa]
Length=322

 Score =   234 bits (597),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 132/295 (45%), Positives = 187/295 (63%), Gaps = 14/295 (5%)
 Frame = +2

Query  242   NFYAISCPSAELIVKNTVRSASSVDPTLPGKLLRLLFHDCFVEGCDASILLQG---NDTE  412
             ++Y  SCP+AE I+ +TVR+AS  DP +P +LLR+ FHDCF+ GCDASILL     N  E
Sbjct  29    HYYDQSCPAAEKIILDTVRNASLYDPKVPARLLRMFFHDCFIRGCDASILLDSVVSNQAE  88

Query  413   RSDPANKSVGGFSTVDSAKRVLEIFCPETVSCADIIALAARDAVEFVGGPSVAIPTGRRD  592
             +  P N SV  F  ++ AK+ LE  CP TVSCAD+IA+AARD V   GGP  ++  GR+D
Sbjct  89    KDGPPNISVRSFYVIEEAKKKLEKACPRTVSCADVIAIAARDVVTLSGGPYWSVLKGRKD  148

Query  593   GRVSLGKNVRPNIIDTSFTMDEMMKIFAAKGLSLDDLVTLSGAHTIGSAHCSAFSDRFQL  772
             G VSL      N+   +F + ++++ FAA+GLS+ D+VTLSG HTIG +HCS+F  R Q 
Sbjct  149   GTVSLASE-STNLPPPTFNVSQLIQSFAARGLSVKDMVTLSGGHTIGFSHCSSFEPRLQN  207

Query  773   ASNGSFLPIdaaldhayaaelaRQCPAGAS---DAVTVNNDPVTPSLFDNQYYKDLLAHR  943
              S   F  ID ++++ +A  L ++CP   +   +A T  +   T S+FDN YYK +L+ +
Sbjct  208   FSK--FHDIDPSMNYEFAQTLKKKCPRSTNRDKNAGTFLDS--TASVFDNVYYKQILSGK  263

Query  944   GLFQSDSALLRDKRAMEKVQDFAGDQNNFFTSWEQSFLKLVSIGVKVGDDDGEIR  1108
             G+F SD  LL D R  + V+ +A DQ  FF  +  + +KL +IGVK     G++R
Sbjct  264   GVFVSDQTLLGDSRTKKIVEKYAQDQKAFFREFAAAMVKLGNIGVK---KTGQVR  315



>ref|XP_002873650.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH49909.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=330

 Score =   234 bits (597),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 137/300 (46%), Positives = 182/300 (61%), Gaps = 8/300 (3%)
 Frame = +2

Query  242   NFYAISCPSAELIVKNTVRSASSVDPTLPGKLLRLLFHDCFVEGCDASILLQGN--DTER  415
             N+YA +CP+ ELIVK  V +     PT     LR+ FHDCFVEGCDAS+ +  +  D E+
Sbjct  35    NYYASTCPNVELIVKQAVTTKFQQTPTTAPATLRMFFHDCFVEGCDASVFIASDNEDAEK  94

Query  416   SDPANKSV--GGFSTVDSAKRVLEIFCPETVSCADIIALAARDAVEFVGGPSVAIPTGRR  589
               P NKS+   GF TV  AK  +E  CP  VSCADI+ALAARD V  VGGP   +  GRR
Sbjct  95    DAPDNKSLPGDGFDTVIKAKTAVESQCPGVVSCADILALAARDVVVIVGGPEFKVELGRR  154

Query  590   DGRVSLGKNVRPNIIDTSFTMDEMMKIFAAKGLSLDDLVTLSGAHTIGSAHCSAFSDRFQ  769
             DG VS    V   + +    +  +++IFA+ GLSL D++ LSGAHTIGS+HC+ F++R  
Sbjct  155   DGLVSQASRVTGKLPEPGLDVRGLVQIFASNGLSLTDMIALSGAHTIGSSHCNRFANR--  212

Query  770   LASNGSFLPIdaaldhayaaelaRQCPAGASDAVTVNNDPVTPSLFDNQYYKDLLAHRGL  949
             L +  +FLP+D  +D AYA +L + C     D V V  DP T   FDN Y+++L+A RGL
Sbjct  213   LHNFSTFLPLDPTIDPAYAQQLTKDCSNPDPDFV-VPLDPTTTDTFDNSYFQNLVARRGL  271

Query  950   FQSDSALLRDKRAMEKVQDFAGDQNNFFTSWEQSFLKLVSIGVKVGDDDGEIRRSCSSVN  1129
               SD AL  D  +   V  FA +   F+ ++  +   L  +GVKVG  +GEIRR CS+ N
Sbjct  272   LTSDQALFNDLSSQSTVMRFANNAEEFYGAFSSAMRNLGRVGVKVG-SEGEIRRDCSAFN  330



>ref|XP_006470079.1| PREDICTED: peroxidase 55-like [Citrus sinensis]
Length=326

 Score =   234 bits (597),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 135/301 (45%), Positives = 188/301 (62%), Gaps = 9/301 (3%)
 Frame = +2

Query  242   NFYAISCPSAELIVKNTVRSA-SSVDPTLPGKLLRLLFHDCFVEGCDASILLQ--GNDTE  412
             NFY+ +CP+ E IV   V +  S    T+P  L RL FHDCF+ GCDAS+L+Q    D E
Sbjct  30    NFYSSTCPNVESIVNRVVSTKFSQTFITVPATL-RLFFHDCFIVGCDASVLIQSPNGDAE  88

Query  413   RSDPANKSVGG--FSTVDSAKRVLEIFCPETVSCADIIALAARDAVEFVGGPSVAIPTGR  586
             +  P N S+ G  F TV  AK+ +E  CP  VSCADI+A+AARD V   GG S ++  GR
Sbjct  89    KDAPDNLSLAGDGFDTVVQAKQAVEAQCPGVVSCADILAIAARDVVVLAGGASFSVELGR  148

Query  587   RDGRVSLGKNVRPNIIDTSFTMDEMMKIFAAKGLSLDDLVTLSGAHTIGSAHCSAFSDRF  766
             RDG VS   +V+ N+ + +F +DE+ ++FA  GLS  D++ LSGAHT+G +HC  F++R 
Sbjct  149   RDGLVSRASSVKGNLPEPTFNLDELNQMFAKHGLSQIDMIALSGAHTLGFSHCDRFANRI  208

Query  767   QLASNGSFLPIdaaldhayaaelaRQCPAGASDAVTVNNDPVTPSLFDNQYYKDLLAHRG  946
                S+ S  P+D +LD AYA +L + CP      + +N DPVTP  FDN YY++L+A +G
Sbjct  209   YSFSSSS--PVDPSLDPAYAQQLMQACPRNVDPQIAINMDPVTPRTFDNMYYQNLVAGKG  266

Query  947   LFQSDSALLRDKRAMEKVQDFAGDQNNFFTSWEQSFLKLVSIGVKVGDDDGEIRRSCSSV  1126
             LF SD  L  D  +   V+DFA +  +F  ++  +  KL  +GVK G + GEIRR C++ 
Sbjct  267   LFTSDQVLFTDASSQPTVKDFARNPLDFNAAFATAMRKLGRVGVKTG-NQGEIRRDCTAF  325

Query  1127  N  1129
             N
Sbjct  326   N  326



>ref|XP_006447048.1| hypothetical protein CICLE_v10016043mg [Citrus clementina]
 gb|ESR60288.1| hypothetical protein CICLE_v10016043mg [Citrus clementina]
Length=307

 Score =   233 bits (595),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 135/301 (45%), Positives = 188/301 (62%), Gaps = 9/301 (3%)
 Frame = +2

Query  242   NFYAISCPSAELIVKNTVRSA-SSVDPTLPGKLLRLLFHDCFVEGCDASILLQ--GNDTE  412
             NFY+ +CP+ E IV   V +  S    T+P  L RL FHDCF+ GCDAS+L+Q    D E
Sbjct  11    NFYSSTCPNVESIVNRVVSTKFSQTFITVPATL-RLFFHDCFIVGCDASVLIQSPNGDAE  69

Query  413   RSDPANKSVGG--FSTVDSAKRVLEIFCPETVSCADIIALAARDAVEFVGGPSVAIPTGR  586
             +  P N S+ G  F TV  AK+ +E  CP  VSCADI+A+AARD V   GG S ++  GR
Sbjct  70    KDAPDNLSLAGDGFDTVVQAKQAVEAQCPGVVSCADILAIAARDVVVLAGGASFSVELGR  129

Query  587   RDGRVSLGKNVRPNIIDTSFTMDEMMKIFAAKGLSLDDLVTLSGAHTIGSAHCSAFSDRF  766
             RDG VS   +V+ N+ + +F +DE+ ++FA  GLS  D++ LSGAHT+G +HC  F++R 
Sbjct  130   RDGLVSRASSVKGNLPEPTFNLDELNQMFAKHGLSQIDMIALSGAHTLGFSHCDRFANRI  189

Query  767   QLASNGSFLPIdaaldhayaaelaRQCPAGASDAVTVNNDPVTPSLFDNQYYKDLLAHRG  946
                S+ S  P+D +LD AYA +L + CP      + +N DPVTP  FDN YY++L+A +G
Sbjct  190   YSFSSSS--PVDPSLDPAYAQQLMQACPRNVDPQIAINMDPVTPRTFDNMYYQNLVAGKG  247

Query  947   LFQSDSALLRDKRAMEKVQDFAGDQNNFFTSWEQSFLKLVSIGVKVGDDDGEIRRSCSSV  1126
             LF SD  L  D  +   V+DFA +  +F  ++  +  KL  +GVK G + GEIRR C++ 
Sbjct  248   LFTSDQVLFTDASSQPTVKDFARNPLDFNAAFATAMRKLGRVGVKTG-NQGEIRRDCTAF  306

Query  1127  N  1129
             N
Sbjct  307   N  307



>ref|XP_010250695.1| PREDICTED: peroxidase 51 [Nelumbo nucifera]
Length=326

 Score =   234 bits (596),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 136/301 (45%), Positives = 182/301 (60%), Gaps = 9/301 (3%)
 Frame = +2

Query  242   NFYAISCPSAELIVKNTVRSA-SSVDPTLPGKLLRLLFHDCFVEGCDASILLQ--GNDTE  412
             NFY  +CP  E IV  TVR+     + T+P  L RL FHDCFVEGCDAS+L+     D E
Sbjct  27    NFYGSTCPKVEDIVSETVRTKIKQTNVTIPATL-RLFFHDCFVEGCDASVLIASANGDAE  85

Query  413   RSDPANKSVGG--FSTVDSAKRVLEIFCPETVSCADIIALAARDAVEFVGGPSVAIPTGR  586
             +    N S+ G  F TV  AK+ LE  CP  VSCADI+ALA RD V   GGP   +  GR
Sbjct  86    KDAEDNLSLAGDGFDTVVRAKQALEKECPGVVSCADILALATRDVVFQAGGPRYQVELGR  145

Query  587   RDGRVSLGKNVRPNIIDTSFTMDEMMKIFAAKGLSLDDLVTLSGAHTIGSAHCSAFSDRF  766
             RDG VS    V  N+ +  F +D++  IF++  LS  D++ LSGAHT+G +HC  F++R 
Sbjct  146   RDGLVSQKSRVAGNLPEAKFDLDQLNSIFSSNNLSQIDMIALSGAHTVGFSHCKQFANRL  205

Query  767   QLASNGSFLPIdaaldhayaaelaRQCPAGASDAVTVNNDPVTPSLFDNQYYKDLLAHRG  946
                +  S  P+D ++D  YA+E+   CP     +V VN DP+TP +FDN YY++LLA +G
Sbjct  206   YSFTPSS--PVDPSMDSNYASEIMLSCPQNVDPSVAVNMDPLTPVVFDNVYYQNLLAGKG  263

Query  947   LFQSDSALLRDKRAMEKVQDFAGDQNNFFTSWEQSFLKLVSIGVKVGDDDGEIRRSCSSV  1126
             LF SD  L  D  +   V DFA + NNF  +++ +  KL  +GVK G  +GEIR+ C+S 
Sbjct  264   LFTSDQVLFTDPASRPTVNDFASNPNNFNEAFKTAMTKLGRVGVKTG-TEGEIRKDCTSF  322

Query  1127  N  1129
             N
Sbjct  323   N  323



>ref|XP_009768520.1| PREDICTED: peroxidase 66 [Nicotiana sylvestris]
Length=323

 Score =   233 bits (595),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 131/299 (44%), Positives = 182/299 (61%), Gaps = 9/299 (3%)
 Frame = +2

Query  242   NFYAISCPSAELIVKNTVRSASSVDPTLPGKLLRLLFHDCFVEGCDASILLQ---GNDTE  412
             ++Y  +CP AE I+   VR+ASS DP +P +LLR+ FHDCF+ GCDAS+LL    GN  E
Sbjct  31    HYYDQTCPQAEDIIYQVVRNASSYDPKVPARLLRMFFHDCFIRGCDASVLLDSTPGNKAE  90

Query  413   RSDPANKSVGGFSTVDSAKRVLEIFCPETVSCADIIALAARDAVEFVGGPSVAIPTGRRD  592
             +  P N S+  F  +D AK  LE  CP TVSCADI+A+AARD V   GGP   +  GR+D
Sbjct  91    KDGPPNISLRAFYVIDDAKTKLEKACPRTVSCADIVAIAARDVVAMSGGPHWNVLIGRKD  150

Query  593   GRVSLGKNVRPNIIDTSFTMDEMMKIFAAKGLSLDDLVTLSGAHTIGSAHCSAFSDRFQL  772
             GR+S   N   N+   SF   ++++ FA +GL + DLV LSG HT+G +HCS+F  R  L
Sbjct  151   GRISRA-NETINLPAPSFNTSQLIQSFAKRGLGVKDLVALSGGHTLGFSHCSSFEAR--L  207

Query  773   ASNGSFLPIdaaldhayaaelaRQCPAGASDAVTVNNDPVTPSLFDNQYYKDLLAHRGLF  952
              +  S    D +L+  +A  L + CP    D+        T S+FDN YYK ++A +G+F
Sbjct  208   RNFSSVHDTDPSLNAVFAESLKKNCPKPNRDSNAGQLLDTTSSVFDNNYYKQIVAGKGVF  267

Query  953   QSDSALLRDKRAMEKVQDFAGDQNNFFTSWEQSFLKLVSIGVKVGDDDGEIRRSCSSVN  1129
              SD +LL D R    V+ FA DQ++FF  +  S +KL ++GV+  D   E+R +C +VN
Sbjct  268   ASDQSLLNDYRTGWIVKAFANDQSSFFWEFAASMVKLGNVGVQEND---EVRLNCRAVN  323



>emb|CDX91610.1| BnaC02g15500D [Brassica napus]
Length=322

 Score =   233 bits (593),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 134/302 (44%), Positives = 189/302 (63%), Gaps = 14/302 (5%)
 Frame = +2

Query  242   NFYAISCPSAELIVKNTVRSASSVDPTLPGKLLRLLFHDCFVEGCDASILL---QGNDTE  412
             ++Y  SCP AE I+  TV++A+  DP +P +LLR+ FHDCF+ GCDASILL   +    E
Sbjct  29    HYYDRSCPVAEKIILETVKNATLYDPKVPARLLRMFFHDCFIRGCDASILLDSTKSTQAE  88

Query  413   RSDPANKSVGGFSTVDSAKRVLEIFCPETVSCADIIALAARDAVEFVGGPSVAIPTGRRD  592
             +  P N SV  F  ++ AKR LE  CP TVSCAD+IA+AARD V   GGP   +  GR+D
Sbjct  89    KDGPPNISVRSFYVIEDAKRKLEKVCPRTVSCADVIAIAARDVVTLSGGPYWNVLKGRKD  148

Query  593   GRVSLGKNVRPNIIDTSFTMDEMMKIFAAKGLSLDDLVTLSGAHTIGSAHCSAFSDRFQL  772
             G++S   N   N+   +F + ++++ FAA+GLS+ D+VTLSG HTIG +HCS+F  R Q 
Sbjct  149   GKISRA-NETINLPAPTFNVSQLIQSFAARGLSVKDMVTLSGGHTIGFSHCSSFEARLQN  207

Query  773   ASNGSFLPIdaaldhayaaelaRQCPAG---ASDAVTVNNDPVTPSLFDNQYYKDLLAHR  943
              S   F  +D ++++A+A  L ++CP       +A TV +   T S+FDN YYK +L+ +
Sbjct  208   FSK--FHDVDPSMNYAFAQSLKKKCPRSNNRGKNAGTVLDS--TSSVFDNDYYKQILSGK  263

Query  944   GLFQSDSALLRDKRAMEKVQDFAGDQNNFFTSWEQSFLKLVSIGVKVGDDDGEIRRSCSS  1123
             G+F SD ALL D R    V+ FA DQ  FF  +  S +KL + GVK   + G++R +   
Sbjct  264   GVFGSDQALLGDYRTKWIVETFARDQKAFFREFATSMVKLGNFGVK---ETGQVRVNSRL  320

Query  1124  VN  1129
             VN
Sbjct  321   VN  322



>gb|KHN31550.1| Peroxidase 66 [Glycine soja]
Length=325

 Score =   233 bits (594),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 132/300 (44%), Positives = 184/300 (61%), Gaps = 11/300 (4%)
 Frame = +2

Query  242   NFYAISCPSAELIVKNTVRSASSVDPTLPGKLLRLLFHDCFVEGCDASILLQG---NDTE  412
             ++Y  +CP AE I+ + V  AS+ DP +P ++LR+ FHDCF+ GCDASILL     N  E
Sbjct  33    HYYDKTCPQAEKIISDAVHRASTFDPKVPARILRMFFHDCFIRGCDASILLDSTPKNLAE  92

Query  413   RSDPANKSVGGFSTVDSAKRVLEIFCPETVSCADIIALAARDAVEFVGGPSVAIPTGRRD  592
             +  P N SV  F  +D AK  LE  CP TVSCADIIA+AARD V   GGP   +  GR+D
Sbjct  93    KDGPPNLSVHAFYVIDEAKAKLEKACPHTVSCADIIAIAARDVVALSGGPYWNVLKGRKD  152

Query  593   GRVSLGKNVRPNIIDTSFTMDEMMKIFAAKGLSLDDLVTLSGAHTIGSAHCSAFSDRFQL  772
             GRVS       N+   +  ++++++ FA +GL + D+VTLSG HT+G +HCS+F  R Q 
Sbjct  153   GRVSKASETV-NLPAPTLNVNQLIQSFAKRGLGVKDMVTLSGGHTLGFSHCSSFQARIQ-  210

Query  773   ASNGSFLP-IdaaldhayaaelaRQCPAGASDAVTVNNDPVTPSLFDNQYYKDLLAHRGL  949
               N S L  ID +L+  +A +L ++CP   ++         T S+FDN YY+ LL  +GL
Sbjct  211   --NFSLLHDIDPSLNTEFALDLKKKCPKPNTNFSAGQFLDSTASVFDNDYYRQLLVGKGL  268

Query  950   FQSDSALLRDKRAMEKVQDFAGDQNNFFTSWEQSFLKLVSIGVKVGDDDGEIRRSCSSVN  1129
             F SD +L+ D+R    V+ FA DQ+ FF  +E S LKL  +GV    ++GE+R +C  VN
Sbjct  269   FSSDQSLVGDQRTRWIVEAFAKDQSLFFKEFEASMLKLGYVGV---SENGEVRLNCKVVN  325



>ref|XP_009387951.1| PREDICTED: peroxidase 51-like isoform X2 [Musa acuminata subsp. 
malaccensis]
Length=320

 Score =   232 bits (592),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 137/301 (46%), Positives = 181/301 (60%), Gaps = 12/301 (4%)
 Frame = +2

Query  242   NFYAISCPSAELIVKNTV-RSASSVDPTLPGKLLRLLFHDCFVEGCDASILLQG--NDTE  412
             NFY +SCPS E IV+  V +       T+P  L RL FHDCFVEGCDAS+++     D E
Sbjct  27    NFYQVSCPSVESIVRQAVLKKLKQTIVTVPATL-RLFFHDCFVEGCDASVIIASPRGDAE  85

Query  413   RSDPANKSVGG--FSTVDSAKRVLEIFCPETVSCADIIALAARDAVEFVGGPSVAIPTGR  586
             +  P N S+ G  F TV  AK+ +E  CP  VSCADI+A+AARD     GGP+ A+  GR
Sbjct  86    KDAPDNLSLAGDGFDTVIKAKQAVEAQCPGVVSCADILAIAARDVS---GGPTFAVELGR  142

Query  587   RDGRVSLGKNVRPNIIDTSFTMDEMMKIFAAKGLSLDDLVTLSGAHTIGSAHCSAFSDRF  766
             RDG  S    V  N+    F++D +  +F    LS  D++ LSGAHT+G +HCS F+DR 
Sbjct  143   RDGVTSRADRVTGNLPGPEFSVDLLSSMFRKNNLSTRDMIALSGAHTVGFSHCSRFADR-  201

Query  767   QLASNGSFLPIdaaldhayaaelaRQCPAGASDAVTVNNDPVTPSLFDNQYYKDLLAHRG  946
              L S  S  P+D +++ AYA  L R CP      + +N D  TP  FDN YYK+LL   G
Sbjct  202   -LYSFNSTSPVDPSMNPAYAKALMRVCPRNVDPTIAINMDLNTPITFDNVYYKNLLNGEG  260

Query  947   LFQSDSALLRDKRAMEKVQDFAGDQNNFFTSWEQSFLKLVSIGVKVGDDDGEIRRSCSSV  1126
             LF SD  L  D+R+   V++FA DQN+FF ++  S ++L  +GVK G   GEIRR C++ 
Sbjct  261   LFTSDQVLFTDQRSRPVVKEFAADQNSFFKAFASSMIRLGRLGVKTG-SQGEIRRDCTAF  319

Query  1127  N  1129
             N
Sbjct  320   N  320



>ref|XP_009402171.1| PREDICTED: peroxidase 51-like [Musa acuminata subsp. malaccensis]
Length=323

 Score =   232 bits (592),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 136/301 (45%), Positives = 182/301 (60%), Gaps = 9/301 (3%)
 Frame = +2

Query  242   NFYAISCPSAELIVKNTV-RSASSVDPTLPGKLLRLLFHDCFVEGCDASILLQG--NDTE  412
             NFY +SCP+ E IV+  V +  +    T+P  L RL FHDCFVEGCDAS+++     D E
Sbjct  27    NFYQVSCPNVESIVRRAVLKKLNQTIVTVPATL-RLFFHDCFVEGCDASVIIASPRGDAE  85

Query  413   RSDPANKSVGG--FSTVDSAKRVLEIFCPETVSCADIIALAARDAVEFVGGPSVAIPTGR  586
             +  P N S+ G  F TV  AK+ +E  CP  VSCADI+A+AARD V   GGP+ A+  GR
Sbjct  86    KDAPDNLSLAGDGFDTVIKAKQAVEAQCPGVVSCADILAIAARDVVVLSGGPTFAVELGR  145

Query  587   RDGRVSLGKNVRPNIIDTSFTMDEMMKIFAAKGLSLDDLVTLSGAHTIGSAHCSAFSDRF  766
             RDG  S    V  N+    F++D +  +F    L+  D++ LSGAHT+G +HC+ F+DR 
Sbjct  146   RDGVTSRADRVTGNLPGPEFSVDLLSSMFRKNNLTTRDMIALSGAHTVGFSHCNRFADR-  204

Query  767   QLASNGSFLPIdaaldhayaaelaRQCPAGASDAVTVNNDPVTPSLFDNQYYKDLLAHRG  946
              L S  S   +D +L+ AYA  L R CP      + VN D  TP  FDN YYK+LL   G
Sbjct  205   -LYSFNSTSAVDPSLNPAYANALMRACPRNVDPTIAVNMDLNTPITFDNVYYKNLLNGEG  263

Query  947   LFQSDSALLRDKRAMEKVQDFAGDQNNFFTSWEQSFLKLVSIGVKVGDDDGEIRRSCSSV  1126
             LF SD  L  D+R+   V+ FA DQN+FF ++ +S ++L  +GVK G   GEIRR C++ 
Sbjct  264   LFTSDQVLFTDQRSRPVVKKFAADQNSFFKAFARSMIRLGRLGVKTG-SQGEIRRDCTAF  322

Query  1127  N  1129
             N
Sbjct  323   N  323



>ref|XP_010444055.1| PREDICTED: peroxidase 66-like [Camelina sativa]
Length=322

 Score =   232 bits (591),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 133/302 (44%), Positives = 190/302 (63%), Gaps = 14/302 (5%)
 Frame = +2

Query  242   NFYAISCPSAELIVKNTVRSASSVDPTLPGKLLRLLFHDCFVEGCDASILLQG---NDTE  412
             +FY  SCP+AE I+ +TVR+AS  DP +P +LLR+ FHDCF+ GCDASILL     N  E
Sbjct  29    HFYDQSCPTAEKIILDTVRNASLYDPKVPARLLRMFFHDCFIRGCDASILLDSVVSNQAE  88

Query  413   RSDPANKSVGGFSTVDSAKRVLEIFCPETVSCADIIALAARDAVEFVGGPSVAIPTGRRD  592
             +  P N SV  F  ++ AK+ LE  CP TVSCAD+IA+AARD V   GGP  ++  GR+D
Sbjct  89    KDGPPNISVRSFYVIEDAKKKLEKACPRTVSCADVIAIAARDVVTLSGGPYWSVLKGRKD  148

Query  593   GRVSLGKNVRPNIIDTSFTMDEMMKIFAAKGLSLDDLVTLSGAHTIGSAHCSAFSDRFQL  772
             G VSL      N+   +F + ++++ FAA+GLS+ D+VTLSG HTIG +HCS+F  R Q 
Sbjct  149   GTVSLASE-STNLPPPTFNVSQLIQSFAARGLSVKDMVTLSGGHTIGFSHCSSFEPRLQN  207

Query  773   ASNGSFLPIdaaldhayaaelaRQCPAGAS---DAVTVNNDPVTPSLFDNQYYKDLLAHR  943
              S      ID ++++A+A  L ++CP   +   +A T  +   T S+FDN YYK +L+ +
Sbjct  208   FSK--IHDIDPSMNYAFAQTLKKKCPRSTNRDKNAGTFMDS--TGSVFDNVYYKQILSGK  263

Query  944   GLFQSDSALLRDKRAMEKVQDFAGDQNNFFTSWEQSFLKLVSIGVKVGDDDGEIRRSCSS  1123
             G+F SD  LL D R  + V+ +A DQ  FF  +  + +KL ++GVK     G++R +   
Sbjct  264   GVFVSDQTLLGDSRTKKIVEKYAQDQKAFFREFAAAMVKLGNVGVK---KTGQVRVNPRF  320

Query  1124  VN  1129
             +N
Sbjct  321   IN  322



>gb|EPS60748.1| hypothetical protein M569_14053, partial [Genlisea aurea]
Length=318

 Score =   231 bits (590),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 130/302 (43%), Positives = 187/302 (62%), Gaps = 9/302 (3%)
 Frame = +2

Query  242   NFYAISCPSAELIVKNTVRSASSVDPTLPGKLLRLLFHDCFVEGCDASILLQGNDTERSD  421
             NFY   CP+A  I++  V +A + D  L   L+R+ FHDCFV GCD S+L+    + +++
Sbjct  21    NFYDSVCPNARFIIREEVSNAFNRDRGLAAGLVRMHFHDCFVRGCDGSVLIDSTPSNKAE  80

Query  422   ----PANKSVGGFSTVDSAKRVLEIFCPETVSCADIIALAARDAVEFVGGPSVAIPTGRR  589
                 P N S+ GF  +D+AKR +E  CP  VSCADI+A AARD+VE  GG    +P GRR
Sbjct  81    KDAPPNNPSLRGFEVIDAAKRRIEAACPGVVSCADILAFAARDSVEITGGYRFEVPAGRR  140

Query  590   DGRVSLGKNVRPNIIDTSFTMDEMMKIFAAKGLSLDDLVTLSGAHTIGSAHCSAFSDR-F  766
             DGRVSL   V  NI   +F ++++ + F  KGL+ +++VTLSGAHTIG +HC+  +DR +
Sbjct  141   DGRVSLASEVLTNIPAPTFDLNQLTQSFQNKGLTQEEMVTLSGAHTIGRSHCTTITDRLY  200

Query  767   QLASNGSFLPIdaaldhayaaelaRQCPAGASDAVTVNNDPVTPSLFDNQYYKDLLAHRG  946
               +S  S  P   +LD AYA EL ++CP   +  + +  DPVTP   D +YY++++ +RG
Sbjct  201   NFSSTASTDP---SLDPAYANELKQRCPPNPAADLVLPMDPVTPDRTDVEYYREVIRNRG  257

Query  947   LFQSDSALLRDKRAMEKVQDFAGDQNNFFTSWEQSFLKLVSIGVKVGDDDGEIRRSCSSV  1126
             LFQSD+ALL      ++V     D N +FT +  + +KL   GV  G   GEIRR+C  +
Sbjct  258   LFQSDAALLTSTNTRDQVVLNVRDPNAWFTKFSDAMVKLGQTGVLTG-SAGEIRRNCRVI  316

Query  1127  NA  1132
             N+
Sbjct  317   NS  318



>ref|XP_010249037.1| PREDICTED: peroxidase 55-like [Nelumbo nucifera]
Length=326

 Score =   232 bits (591),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 131/301 (44%), Positives = 180/301 (60%), Gaps = 7/301 (2%)
 Frame = +2

Query  242   NFYAISCPSAELIVKNTVRSASSVDPTLPGKLLRLLFHDCFVEGCDASILLQ--GNDTER  415
             NFYA +CP+ E IV+ TV +  S   T     LRL FHDCFVEGCDAS+L+     D E+
Sbjct  29    NFYAFTCPNVEAIVRQTVSTKFSQTFTTIPATLRLFFHDCFVEGCDASVLIASPNGDAEK  88

Query  416   SDPANKSVGG--FSTVDSAKRVLEIFCPETVSCADIIALAARDAVEFVGGPSVAIPTGRR  589
                 N S+ G  F TV  AK+ +E  CP  VSCAD++A+AARD V   GGPS  +  GRR
Sbjct  89    DAKDNLSLAGDGFDTVIKAKQAVEAVCPGVVSCADVLAIAARDVVVLAGGPSFNVELGRR  148

Query  590   DGRVSLGKNVRPNIIDTSFTMDEMMKIFAAKGLSLDDLVTLSGAHTIGSAHCSAFSDRFQ  769
             DG +S    V  N+    F + ++  IF+   LSL D++ LSGAHT+G +HC+ F+ R  
Sbjct  149   DGLISQASRVDGNLPQPEFNIGQLTSIFSKNNLSLIDMIALSGAHTVGFSHCNRFAKRLY  208

Query  770   LASNGSFLPIdaaldhayaaelaRQCPAGASDAVTVNNDPVTPSLFDNQYYKDLLAHRGL  949
               S  S  P+D +LD  YA +L  +CP      + VN DPVTP+ FDN YY++L+A +GL
Sbjct  209   SFSPSS--PVDPSLDPNYATQLMAECPQNVDPTIAVNMDPVTPNKFDNVYYQNLVAGKGL  266

Query  950   FQSDSALLRDKRAMEKVQDFAGDQNNFFTSWEQSFLKLVSIGVKVGDDDGEIRRSCSSVN  1129
             F SD  L  +  +   V+DFA +  NF  ++  + + L  +GVK G   G+IRR C++ N
Sbjct  267   FTSDEVLFTNPASQSTVKDFASNPFNFNAAFATAMVNLGRVGVKTG-AQGQIRRDCTAFN  325

Query  1130  A  1132
             +
Sbjct  326   S  326



>gb|KDO63914.1| hypothetical protein CISIN_1g020449mg [Citrus sinensis]
Length=326

 Score =   232 bits (591),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 134/301 (45%), Positives = 186/301 (62%), Gaps = 9/301 (3%)
 Frame = +2

Query  242   NFYAISCPSAELIVKNTVRSA-SSVDPTLPGKLLRLLFHDCFVEGCDASILLQ--GNDTE  412
             NFY+ +CP+ E IV   V +  S    T+P  L RL FHDCF+ GCDAS+L+Q    D E
Sbjct  30    NFYSSTCPNVESIVNRVVSTKFSQTFITVPATL-RLFFHDCFIVGCDASVLIQSPNGDAE  88

Query  413   RSDPANKSVGG--FSTVDSAKRVLEIFCPETVSCADIIALAARDAVEFVGGPSVAIPTGR  586
             +  P N S+ G  F TV  AK+ +E  CP  VSCADI+A+AARD V   GG   ++  GR
Sbjct  89    KDAPDNLSLAGDGFDTVVQAKQAVEAQCPGVVSCADILAIAARDVVVLAGGAPFSVELGR  148

Query  587   RDGRVSLGKNVRPNIIDTSFTMDEMMKIFAAKGLSLDDLVTLSGAHTIGSAHCSAFSDRF  766
             RDG VS   +V+ N+ + +F +DE+ ++FA  GLS  D++ LSGAHT+G +HC  F++R 
Sbjct  149   RDGLVSRASSVKGNLPEPTFNLDELNQMFAKHGLSQIDMIALSGAHTLGFSHCDRFANRI  208

Query  767   QLASNGSFLPIdaaldhayaaelaRQCPAGASDAVTVNNDPVTPSLFDNQYYKDLLAHRG  946
                S+ S  P+D +LD AYA +L + CP      + +N DPVTP  FDN YY++L+A +G
Sbjct  209   YSFSSSS--PVDPSLDPAYAQQLMQSCPRNVDPQIAINMDPVTPRTFDNMYYQNLVAGKG  266

Query  947   LFQSDSALLRDKRAMEKVQDFAGDQNNFFTSWEQSFLKLVSIGVKVGDDDGEIRRSCSSV  1126
             LF SD  L  D  +   V DFA +  +F  ++  +  KL  +GVK G + GEIRR C++ 
Sbjct  267   LFTSDQVLFTDASSQPTVNDFARNPLDFNAAFATAMRKLGRVGVKTG-NQGEIRRDCTAF  325

Query  1127  N  1129
             N
Sbjct  326   N  326



>gb|KFK42864.1| hypothetical protein AALP_AA1G049000 [Arabis alpina]
Length=326

 Score =   231 bits (590),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 130/301 (43%), Positives = 178/301 (59%), Gaps = 7/301 (2%)
 Frame = +2

Query  242   NFYAISCPSAELIVKNTVRSASSVDPTLPGKLLRLLFHDCFVEGCDASILLQGN--DTER  415
             NFYA +CP+AE IV++ V +  S  P+L   LLR+ FHDCFV GCD S+L+     + ER
Sbjct  29    NFYANTCPNAEKIVQDYVSNHISNAPSLAASLLRMHFHDCFVRGCDGSVLINSTSGNAER  88

Query  416   SDPANKSVGGFSTVDSAKRVLEIFCPETVSCADIIALAARDAVEFVGGPSVAIPTGRRDG  595
                 N ++ GF  +D+ K VLE  CP  VSCAD+IALA+RDAV F GGP+ ++PTGRRDG
Sbjct  89    DSTPNLTLRGFGFIDAIKAVLEAQCPGIVSCADVIALASRDAVVFTGGPNWSVPTGRRDG  148

Query  596   RVSLGKNVRPNIIDTSFTMDEMMKIFAAKGLSLDDLVTLSGAHTIGSAHCSAFSDR-FQL  772
             R+S       NI   +  +  +  +FA +GL+L DLV LSGAHTIG +HCS+F++R +  
Sbjct  149   RISKASEALANIPPPTSNITNLQTLFANQGLNLKDLVLLSGAHTIGVSHCSSFTNRLYNF  208

Query  773   ASNGSFLPIdaaldhayaaelaRQCPAGASDAVTVNNDPVTPSLFDNQYYKDLLAHRGLF  952
                G   P  A      A   +R+CP    +   V  DP + + FD  YY+ +L  RGLF
Sbjct  209   TGRGGQDP--ALDSEYAANLKSRKCPRLNDNTTIVEMDPGSRTTFDLSYYQLVLKRRGLF  266

Query  953   QSDSALLRDKRAMEKV-QDFAGDQNNFFTSWEQSFLKLVSIGVKVGDDDGEIRRSCSSVN  1129
             QSDSAL  +   +  + Q   G   +FF+ + +S  K+  I VK G   G +RR CS  N
Sbjct  267   QSDSALTTNPTTLSNINQILKGSVESFFSEFAKSMEKMGRINVKTG-SAGVVRRQCSVAN  325

Query  1130  A  1132
             +
Sbjct  326   S  326



>ref|XP_004502775.1| PREDICTED: peroxidase 5-like [Cicer arietinum]
Length=327

 Score =   231 bits (590),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 135/301 (45%), Positives = 187/301 (62%), Gaps = 8/301 (3%)
 Frame = +2

Query  245   FYAISCPSAELIVKNTVRSASSVDPTLPGKLLRLLFHDCFVEGCDASILLQG---NDTER  415
             FY+ SC  AELIVK+ VR + + +P +   L+R+ FHDCF+ GCDAS+LL     N  E+
Sbjct  30    FYSYSCGMAELIVKDEVRKSFNKNPGIAAGLVRMHFHDCFIRGCDASVLLDSTPSNTAEK  89

Query  416   SDPANK-SVGGFSTVDSAKRVLEIFCPETVSCADIIALAARDAVEFVGGPSVAIPTGRRD  592
               PANK S+ GF  +D+AK  LE  C  TVSCADIIA AARD+VE  GG    +P GRRD
Sbjct  90    DSPANKPSLRGFEVIDNAKAKLEAVCNGTVSCADIIAFAARDSVELAGGIGYDVPAGRRD  149

Query  593   GRVSLGKNVRPNIIDTSFTMDEMMKIFAAKGLSLDDLVTLSGAHTIGSAHCSAFSDRFQL  772
             G++SL  + R ++   +F ++++ ++FA KGL+ +++VTLSGAHTIG AHCSAFS+R  L
Sbjct  150   GKISLASDTRTDLPPPTFNVNQLTQLFAKKGLTQEEMVTLSGAHTIGRAHCSAFSNR--L  207

Query  773   ASNGSFLPIdaaldhayaaelaRQCPAGASDA-VTVNNDPVTPSLFDNQYYKDLLAHRGL  949
              +  S L  D  LD +Y   L RQCP G ++  + V  DP +P   D  YY ++L  RGL
Sbjct  208   YNFSSTLKQDPNLDSSYVPLLKRQCPQGNTNPNLAVPMDPSSPGTADVGYYINILEDRGL  267

Query  950   FQSDSALLRDKRAMEKVQDFAGDQNNFFTSWEQSFLKLVSIGVKVGDDDGEIRRSCSSVN  1129
             F SD  LL +     +V   A +   +   +  + +K+  IGV  G + GEIR +C  VN
Sbjct  268   FTSDQTLLTNTGTARQVNKNARNPYLWADKFADAMVKMGQIGVLTG-NAGEIRTNCRMVN  326

Query  1130  A  1132
             +
Sbjct  327   S  327



>ref|XP_004976107.1| PREDICTED: peroxidase 28-like isoform X1 [Setaria italica]
Length=414

 Score =   234 bits (597),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 114/182 (63%), Positives = 140/182 (77%), Gaps = 1/182 (1%)
 Frame = +2

Query  242  NFYAISCPSAELIVKNTVRSASSVDPTLPGKLLRLLFHDCFVEGCDASILLQGNDTERSD  421
            +FYA SCP  EL V++ VRSAS +DP++PGKLLRL+FHDCFVEGCDAS+L+QG+ TER+D
Sbjct  75   SFYAQSCPGVELAVRDVVRSASLLDPSIPGKLLRLVFHDCFVEGCDASVLIQGSGTERTD  134

Query  422  PANKSVGGFSTVDSAKRVLEIFCPETVSCADIIALAARDAVEFVGGPSVAIPTGRRDGRV  601
            PAN S+GGF+ +D+AKR+LE+ CP TVSC+DII LAARDAV F GGP+V +  GRRDG V
Sbjct  135  PANLSLGGFNVIDAAKRLLEVVCPATVSCSDIIVLAARDAVVFTGGPAVPVMLGRRDGLV  194

Query  602  SLGKNVRPNIIDTSFTMDEMMKIFAAKGLSLDDLVTLSGAHTIGSAHCSAF-SDRFQLAS  778
            SL  NVR NIIDT F++D M   F AKGL+LDDLVTLSG     +   S+F S R  +  
Sbjct  195  SLASNVRRNIIDTGFSVDAMAASFTAKGLTLDDLVTLSGIQQTNTLLVSSFYSPRLNIVP  254

Query  779  NG  784
             G
Sbjct  255  AG  256



>ref|XP_002274131.2| PREDICTED: peroxidase 55-like [Vitis vinifera]
 ref|XP_010660749.1| PREDICTED: peroxidase 55-like [Vitis vinifera]
Length=336

 Score =   232 bits (591),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 135/301 (45%), Positives = 182/301 (60%), Gaps = 7/301 (2%)
 Frame = +2

Query  242   NFYAISCPSAELIVKNTVRSASSVDPTLPGKLLRLLFHDCFVEGCDASILLQ--GNDTER  415
             NFY+ SCP+ E IVK  V +  S   T     LRL FHDCFVEGCDAS+L+     D E+
Sbjct  39    NFYSSSCPNVEAIVKQEVSTKFSQTFTTIPATLRLFFHDCFVEGCDASVLISSPNGDAEK  98

Query  416   SDPANKSVGG--FSTVDSAKRVLEIFCPETVSCADIIALAARDAVEFVGGPSVAIPTGRR  589
                 N S+ G  F TV  AK+ +E  CP  VSCADI+ALAARD V   GGPS ++  GRR
Sbjct  99    DSDDNLSLAGDGFDTVIKAKQSVEAACPGIVSCADILALAARDVVVLAGGPSFSVELGRR  158

Query  590   DGRVSLGKNVRPNIIDTSFTMDEMMKIFAAKGLSLDDLVTLSGAHTIGSAHCSAFSDRFQ  769
             DG +S    V  N+ + SF +D++  +FA   LS  D++ LSGAHT+G +HCS F++R  
Sbjct  159   DGLISQASRVAGNLPEPSFDLDQLNSMFARHNLSQLDMIALSGAHTVGFSHCSRFANRLY  218

Query  770   LASNGSFLPIdaaldhayaaelaRQCPAGASDAVTVNNDPVTPSLFDNQYYKDLLAHRGL  949
               S+ S   +D +LD  YA +L   CP     ++ ++ DPVTP  FDN+YY++L+A +GL
Sbjct  219   SFSSSS--QVDPSLDSDYAKQLMSGCPQNVDPSIAIDMDPVTPRTFDNEYYQNLVAGKGL  276

Query  950   FQSDSALLRDKRAMEKVQDFAGDQNNFFTSWEQSFLKLVSIGVKVGDDDGEIRRSCSSVN  1129
             F SD AL  D  +   V DFA     F  ++  +  KL  +GVK G D GEIR+ C++ N
Sbjct  277   FTSDEALFSDPSSQPTVTDFANSPGEFNGAFITAMRKLGRVGVKTG-DQGEIRKDCTAFN  335

Query  1130  A  1132
             +
Sbjct  336   S  336



>ref|XP_008231106.1| PREDICTED: peroxidase 55 [Prunus mume]
Length=326

 Score =   231 bits (590),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 138/301 (46%), Positives = 182/301 (60%), Gaps = 9/301 (3%)
 Frame = +2

Query  242   NFYAISCPSAELIVKNTVRSASSVDPTLPGKLLRLLFHDCFVEGCDASILLQ--GNDTER  415
             NFY+ +CP+ ELIVK  V +  S  P      LRL FHDCFVEGCDAS+++     D E+
Sbjct  31    NFYSSTCPNVELIVKQAVSTKLSQTPITIPSTLRLFFHDCFVEGCDASVMIASANGDAEK  90

Query  416   SDPANKSVGG--FSTVDSAKRVLEIFCPETVSCADIIALAARDAVEFVGGPSVAIPTGRR  589
                 N S+ G  F TV  AK+ +E  CP  VSCADI+ALAARD V   GGP+ ++  GRR
Sbjct  91    DFTDNLSLAGDGFDTVIKAKQAVEALCPGVVSCADILALAARDCVVLAGGPAFSVELGRR  150

Query  590   DGRVSLGKNVRPNIIDTSFTMDEMMKIFAAKGLSLDDLVTLSGAHTIGSAHCSAFSDRFQ  769
             DG VS    V  N+ + +F +D++  +FA   LS  D+V LSGAHT+G +HC  FSDR  
Sbjct  151   DGLVSQASQVAGNLPEPNFNLDQLNTMFAKHNLSQTDVVALSGAHTVGFSHCGRFSDRLS  210

Query  770   LASNGSFLPIdaaldhayaaelaRQCPAGASDAVTVNNDPVTPSLFDNQYYKDLLAHRGL  949
               S+ S  P+D +LD  YA +L   CP  A D V +N DP TP+ FDN YY++L+A +GL
Sbjct  211   NFSSNS--PVDPSLDPGYAKQLIGACPINA-DPV-INLDPETPATFDNAYYRNLVAGKGL  266

Query  950   FQSDSALLRDKRAMEKVQDFAGDQNNFFTSWEQSFLKLVSIGVKVGDDDGEIRRSCSSVN  1129
               SD  L  D  +   V DFA +  NF  ++  +  KL  +GVK G D GEIR  C++ N
Sbjct  267   LSSDQVLFSDSASQPTVIDFANNPGNFNGAFITAMRKLGRVGVKTG-DQGEIRTDCTTFN  325

Query  1130  A  1132
             +
Sbjct  326   S  326



>ref|XP_010250084.1| PREDICTED: peroxidase 3-like [Nelumbo nucifera]
Length=322

 Score =   231 bits (589),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 136/300 (45%), Positives = 180/300 (60%), Gaps = 10/300 (3%)
 Frame = +2

Query  242   NFYAISCPSAELIVKNTVRSASSVDPTLPGKLLRLLFHDCFVEGCDASILLQGND---TE  412
             +FY  SCP AE I++  V    + D T+P  L+RL +HDCFV GCD S+LL        E
Sbjct  29    HFYKKSCPQAEDIIRKVVWKNVAQDATIPAGLVRLHYHDCFVRGCDGSVLLNSTKDHLAE  88

Query  413   RSDPANKSVGGFSTVDSAKRVLEIFCPETVSCADIIALAARDAVEF-VGGPSVAIPTGRR  589
             R    N ++ GF  VD AK  ++  CP  VSCADI+ALAARDAV F    P   + TGRR
Sbjct  89    RDAQPNLTLDGFEVVDEAKDAVDKACPGVVSCADILALAARDAVAFQFKKPMWKVLTGRR  148

Query  590   DGRVSLGKNVRPNIIDTSFTMDEMMKIFAAKGLSLDDLVTLSGAHTIGSAHCSAFSDRFQ  769
             DGRVS+ K    N+   SF   E++K FA+KGL + DLV LSGAHTIG AHC +F  R  
Sbjct  149   DGRVSIAKEAVDNLPPPSFNFAELVKNFASKGLDVHDLVVLSGAHTIGQAHCESFFKRLH  208

Query  770   LASNGSFLPIdaaldhayaaelaRQCPAGASDAVTVNNDPVTPSLFDNQYYKDLLAHRGL  949
                 G+    + +LD  YAA LA QCP  ++    V+ DP +   FDN YY +L  H+GL
Sbjct  209   KNHGGA----EKSLDPKYAAFLASQCPNLSNKTTQVDMDPQSAESFDNHYYVNLKQHKGL  264

Query  950   FQSDSALLRDKRAMEKVQDFAGDQNNFFTSWEQSFLKLVSIGVKVGDDDGEIRRSCSSVN  1129
             F SD+ALL +K++ EK+ +   DQ  FF ++  S  K+ +I V  G + GE+R+ C+ VN
Sbjct  265   FHSDAALLTNKKS-EKIVNKLLDQKAFFKAFAHSMKKMGAIEVLTG-NSGEVRKKCTVVN  322



>ref|XP_007152357.1| hypothetical protein PHAVU_004G123100g [Phaseolus vulgaris]
 gb|ESW24351.1| hypothetical protein PHAVU_004G123100g [Phaseolus vulgaris]
Length=325

 Score =   231 bits (588),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 133/300 (44%), Positives = 184/300 (61%), Gaps = 11/300 (4%)
 Frame = +2

Query  242   NFYAISCPSAELIVKNTVRSASSVDPTLPGKLLRLLFHDCFVEGCDASILLQG---NDTE  412
             ++Y  +CP AE I+ +TV SAS  DP +P ++LR+ FHDCF+ GCDASILL     N  E
Sbjct  33    HYYDKTCPQAEKIISDTVLSASKFDPKVPARILRMFFHDCFIRGCDASILLDSTPKNLAE  92

Query  413   RSDPANKSVGGFSTVDSAKRVLEIFCPETVSCADIIALAARDAVEFVGGPSVAIPTGRRD  592
             +  P N SV  F  +D AK  LE  CP TVSCADII++AARD V   GGPS ++  GR+D
Sbjct  93    KDAPPNLSVHSFYVIDEAKTKLEKACPHTVSCADIISIAARDVVALSGGPSWSVLKGRKD  152

Query  593   GRVSLGKNVRPNIIDTSFTMDEMMKIFAAKGLSLDDLVTLSGAHTIGSAHCSAFSDRFQL  772
             GRVS       N+   +  + ++++ FA +GL + D+VTLSG HT+G +HCS+F  R   
Sbjct  153   GRVSKASETV-NLPAPTLNVSQLIQSFAKRGLGVKDMVTLSGGHTLGFSHCSSFQARVH-  210

Query  773   ASNGSFLP-IdaaldhayaaelaRQCPAGASDAVTVNNDPVTPSLFDNQYYKDLLAHRGL  949
               N S L  ID +L+  +A +L  +CP   ++    +    T S+FDN YY+ LL  +GL
Sbjct  211   --NFSLLHDIDPSLNTEFALDLKGKCPKLNTNPSAGHFLDSTSSVFDNDYYRQLLVGKGL  268

Query  950   FQSDSALLRDKRAMEKVQDFAGDQNNFFTSWEQSFLKLVSIGVKVGDDDGEIRRSCSSVN  1129
             F SD +L+ D+R    V+ FA DQ  FFT +  S LKL ++GV     +GE+R +C  VN
Sbjct  269   FSSDQSLVGDQRTRWIVEAFAKDQGLFFTEFVASMLKLGNVGVS---QNGEVRLNCKVVN  325



>ref|XP_010921348.1| PREDICTED: peroxidase 5-like [Elaeis guineensis]
Length=321

 Score =   230 bits (587),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 135/303 (45%), Positives = 182/303 (60%), Gaps = 10/303 (3%)
 Frame = +2

Query  245   FYAISCPSAELIVKNTVRSASSVDPTLPGKLLRLLFHDCFVEGCDASILLQ---GNDTER  415
             FY  +CPSAE IV+ TV  A + +P     L+R+ FHDCFV GCDAS+LL    GN +E+
Sbjct  22    FYEETCPSAEAIVRETVSQAIAKNPGFAAGLIRMHFHDCFVRGCDASVLLNSTPGNPSEK  81

Query  416   -SDPANKSVGGFSTVDSAKRVLEIFCPETVSCADIIALAARDAVEFVGGPSVAIPTGRRD  592
              + P N S+ GF  +D+AK  +E  CP  VSCADIIA AARD+    GG    +P GRRD
Sbjct  82    EAPPNNPSLRGFEVIDAAKAAVEAKCPCKVSCADIIAFAARDSAYITGGNDYEVPAGRRD  141

Query  593   GRVSLGKNVRPNIIDTSFTMDEMMKIFAAKGLSLDDLVTLSGAHTIGSAHCSAFSDRFQL  772
             GR+SL      NI   +FT D++ + F  KGL+LD++VTLSGAH+IG +HCS+F+ R  L
Sbjct  142   GRISLASEALDNIPFPTFTADKLKESFERKGLTLDEMVTLSGAHSIGRSHCSSFTTR--L  199

Query  773   ASNGSFLPIdaaldhayaaelaRQCP---AGASDAVTVNNDPVTPSLFDNQYYKDLLAHR  943
              +  +  P D +++ A+AA L  +CP   A  SD  TV  D VTP+  DN YY++LL HR
Sbjct  200   YNFSATQPQDPSMEPAFAAYLKTRCPPSTASPSDPTTVLLDAVTPTRLDNMYYRNLLKHR  259

Query  944   GLFQSDSALLRDKRAMEKVQDFAGDQNNFFTSWEQSFLKLVSIGVKVGDDDGEIRRSCSS  1123
             G+  SD  L       + V   A  Q+ +   +  + +K+ SI V  G   GEIR  C  
Sbjct  260   GVLTSDQTLQDSSETTKHVWYNAKHQSAWAAKFASAMVKMGSIEVLTG-SQGEIREKCWV  318

Query  1124  VNA  1132
             VN+
Sbjct  319   VNS  321



>ref|XP_003568989.1| PREDICTED: peroxidase 5-like [Brachypodium distachyon]
Length=336

 Score =   231 bits (589),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 136/304 (45%), Positives = 178/304 (59%), Gaps = 9/304 (3%)
 Frame = +2

Query  242   NFYAISCPSAELIVKNTVRSASSVDPTLPGKLLRLLFHDCFVEGCDASILLQ---GNDTE  412
              FY  SCP AE +V+  +  A   +P  P  ++RL FHDCFV GCDAS+LL+   G+  E
Sbjct  34    GFYRESCPKAEKVVRRIMAKAFKKEPGTPADIIRLFFHDCFVRGCDASVLLESMPGSMAE  93

Query  413   R-SDPANKSVGGFSTVDSAKRVLEIFCPETVSCADIIALAARDAVEFVGGPSVAIPTGRR  589
             R S P N S+ GF  +  AK +LE  CP TVSCADI+ALAARD     GG   AIPTGRR
Sbjct  94    RDSKPNNPSLDGFEVIADAKELLEKLCPSTVSCADILALAARDGAYLAGGFDYAIPTGRR  153

Query  590   DGRVSLGKNVRPNIIDTSFTMDEMMKIFAAKGLSLDDLVTLSGAHTIGSAHCSAFSDRFQ  769
             DG VS  ++V PN+    F  DE++  F AKG +L+++VTLSGAHTIG++HCS+F+DR  
Sbjct  154   DGLVSKEEDVLPNVPHADFNHDELVGNFTAKGFTLEEMVTLSGAHTIGTSHCSSFTDRLY  213

Query  770   LASNGSFLPIdaaldhayaaelaRQCPAGAS---DAVTVNNDPVTPSLFDNQYYKDLLAH  940
                +      D  +  AYAA L ++CP   S   D   V  D VTP   DNQYYK++LA 
Sbjct  214   DYYHDGVYGTDPGMPVAYAAGLKKKCPPVTSAHDDPTMVQLDDVTPFAMDNQYYKNVLAG  273

Query  941   RGLFQSDSALLRDKRAMEKVQDFAGDQNNFFT-SWEQSFLKLVSIGVKVGDDDGEIRRSC  1117
                F SD ALL        V+ +A     ++   +  + +K+  + V  G   GEIR +C
Sbjct  274   TVAFGSDMALLESPETAAMVERYAAKPTAYWLRRFAAAMVKVSEMAVLTG-SKGEIRLNC  332

Query  1118  SSVN  1129
             S VN
Sbjct  333   SKVN  336



>ref|XP_010270944.1| PREDICTED: peroxidase 5-like [Nelumbo nucifera]
Length=339

 Score =   231 bits (589),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 138/303 (46%), Positives = 189/303 (62%), Gaps = 11/303 (4%)
 Frame = +2

Query  245   FYAISCPSAELIVKNTVRSASSVDPTLPGKLLRLLFHDCFVEGCDASILLQ---GNDTER  415
             FY+ +CPSAE IV+  V  A S +P +   L+R+ FHDCFV GCDAS+LL    GND E+
Sbjct  40    FYSSTCPSAEAIVRKAVTKAISQNPGIGAGLIRMHFHDCFVRGCDASVLLDSTPGNDAEK  99

Query  416   SDPANK-SVGGFSTVDSAKRVLEIFCPETVSCADIIALAARDAVEFVGGPSVAIPTGRRD  592
             S PAN  S+ GF  +D AK  +E  CP+TVSCADIIA AARD+   +GG + A+P GRRD
Sbjct  100   SHPANNPSLRGFEVIDMAKAHIEAVCPQTVSCADIIAFAARDSAYKLGGINYAVPAGRRD  159

Query  593   GRVSLGKNVRPNIIDTSFTMDEMMKIFAAKGLSLDDLVTLSGAHTIGSAHCSAFSDRFQL  772
             G +S   ++R N+   SFT  ++   FA KGLSL+++VTLSGAH+IG +HCS+F +R  L
Sbjct  160   GLISRSADIRANLPPPSFTAKQLEDRFAGKGLSLEEMVTLSGAHSIGVSHCSSFLNR--L  217

Query  773   ASNGSFLPIdaaldhayaaelaRQCP----AGASDAVTVNNDPVTPSLFDNQYYKDLLAH  940
              +  +  P D ++D  YAA L  +CP    AG+S   TV  D +TP+  DN+YYK+L  H
Sbjct  218   YNFNATHPQDPSMDPDYAAFLKTRCPPTSTAGSSLDPTVPLDVLTPNRLDNKYYKNLKNH  277

Query  941   RGLFQSDSALLRDKRAMEKVQDFAGDQNNFFTSWEQSFLKLVSIGVKVGDDDGEIRRSCS  1120
              GL  SD  L+        V++ A   + + + +  + + +  I V  G   GEIR+SCS
Sbjct  278   HGLLTSDWTLMSSHSTAWMVRNNAKHPSAWASKFAAAMVHMGYIDVLTG-TQGEIRKSCS  336

Query  1121  SVN  1129
              VN
Sbjct  337   VVN  339



>ref|XP_010938174.1| PREDICTED: peroxidase 5-like [Elaeis guineensis]
Length=329

 Score =   231 bits (588),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 133/303 (44%), Positives = 172/303 (57%), Gaps = 15/303 (5%)
 Frame = +2

Query  245   FYAISCPSAELIVKNTVRSASSVDPTLPGKLLRLLFHDCFVEGCDASILLQ---GNDTER  415
             FY  SCPSAE IV+NTV  A + +P +   L+R+ FHDCFV GCDAS+LL    GN  E+
Sbjct  35    FYKESCPSAEDIVRNTVSQAVAQNPGIAAGLIRMHFHDCFVRGCDASVLLNSTPGNTAEK  94

Query  416   -SDPANKSVGGFSTVDSAKRVLEIFCPETVSCADIIALAARDAVEFVGGPSVAIPTGRRD  592
              + P N S+ GF  +D+AK  +E  CP  VSCADI+A AARD     GG    +P GRRD
Sbjct  95    DAPPNNPSLRGFQVIDAAKAAVEACCPRKVSCADILAFAARDGAYLTGGIDYQVPAGRRD  154

Query  593   GRVSLGKNVRPNIIDTSFTMDEMMKIFAAKGLSLDDLVTLSGAHTIGSAHCSAFSDRFQL  772
             GR+S       NI   +   +++ + F  KGLSLD++VTLSGAH+IG +HCS+F++R   
Sbjct  155   GRISRESEALANIPSPNSNAEQLKENFTNKGLSLDEMVTLSGAHSIGRSHCSSFTNRLYG  214

Query  773   ASNGSFLPIdaaldhayaaelaRQCP---AGASDAVTVNNDPVTPSLFDNQYYKDLLAHR  943
               + S  P  AA   A        CP   A  SD  TV  D VTP   DN YY +LL HR
Sbjct  215   VQDPSMDPAFAAQLKAT-------CPPSTASPSDPTTVVLDAVTPDRLDNMYYWNLLKHR  267

Query  944   GLFQSDSALLRDKRAMEKVQDFAGDQNNFFTSWEQSFLKLVSIGVKVGDDDGEIRRSCSS  1123
             G+  SD  L       + V  +A DQ+ +   +  + +K+ SI V  G   GEIR  C  
Sbjct  268   GVLTSDQTLEESSETAKLVWYYAEDQSTWAAKFAAAMVKMGSIEVLTG-SQGEIREKCWV  326

Query  1124  VNA  1132
             VNA
Sbjct  327   VNA  329



>ref|XP_009127271.1| PREDICTED: peroxidase 66 [Brassica rapa]
 emb|CDY27100.1| BnaA02g11200D [Brassica napus]
Length=322

 Score =   230 bits (587),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 134/302 (44%), Positives = 187/302 (62%), Gaps = 14/302 (5%)
 Frame = +2

Query  242   NFYAISCPSAELIVKNTVRSASSVDPTLPGKLLRLLFHDCFVEGCDASILL---QGNDTE  412
             ++Y  SCP AE I+  TV++A+  DP +P +LLR+ FHDCF+ GCDASILL        E
Sbjct  29    HYYDRSCPVAEKIILETVKNATLYDPKVPARLLRMFFHDCFIRGCDASILLDSTMSTQAE  88

Query  413   RSDPANKSVGGFSTVDSAKRVLEIFCPETVSCADIIALAARDAVEFVGGPSVAIPTGRRD  592
             +  P N SV  F  ++ AKR LE  CP TVSCAD+IA+AARD V   GGP   +  GR+D
Sbjct  89    KDGPPNISVRSFYVIEDAKRKLEKVCPRTVSCADVIAIAARDVVTLSGGPYWNVLKGRKD  148

Query  593   GRVSLGKNVRPNIIDTSFTMDEMMKIFAAKGLSLDDLVTLSGAHTIGSAHCSAFSDRFQL  772
             G +S   N   N+   +F + ++++ FAA+GLS+ D+VTLSG HTIG +HCS+F  R Q 
Sbjct  149   GTISRA-NETINLPAPTFNVSQLIQSFAARGLSVKDMVTLSGGHTIGFSHCSSFEARLQN  207

Query  773   ASNGSFLPIdaaldhayaaelaRQCPAG---ASDAVTVNNDPVTPSLFDNQYYKDLLAHR  943
              S   F  +D ++++A+A  L ++CP       +A TV +   T S+FDN YYK +L+ +
Sbjct  208   FSK--FHDVDPSMNYAFAQSLKKKCPRSNNRGKNAGTVLDS--TSSVFDNDYYKQILSGK  263

Query  944   GLFQSDSALLRDKRAMEKVQDFAGDQNNFFTSWEQSFLKLVSIGVKVGDDDGEIRRSCSS  1123
             G+F SD ALL D R    V+ FA DQ  FF  +  S +KL + GVK   + G++R +   
Sbjct  264   GVFGSDQALLGDYRTKWIVETFARDQKAFFREFATSMVKLGNFGVK---ETGQVRVNSRF  320

Query  1124  VN  1129
             VN
Sbjct  321   VN  322



>ref|XP_003602405.1| Peroxidase [Medicago truncatula]
 gb|AES72656.1| peroxidase family protein [Medicago truncatula]
Length=327

 Score =   230 bits (587),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 135/301 (45%), Positives = 186/301 (62%), Gaps = 8/301 (3%)
 Frame = +2

Query  245   FYAISCPSAELIVKNTVRSASSVDPTLPGKLLRLLFHDCFVEGCDASILLQG---NDTER  415
             FY  SC  AE IVK+ VR + + +P +   L+R+ FHDCF+ GCDAS+LL     N  E+
Sbjct  30    FYTYSCGMAEFIVKDEVRKSFNKNPGIAAGLVRMHFHDCFIRGCDASVLLDSTLSNIAEK  89

Query  416   SDPANK-SVGGFSTVDSAKRVLEIFCPETVSCADIIALAARDAVEFVGGPSVAIPTGRRD  592
               PANK S+ GF  +D+AK  LE  C   VSCADI+A AARD+VE  GG    +P GRRD
Sbjct  90    DSPANKPSLRGFEVIDNAKAKLEEECKGIVSCADIVAFAARDSVELAGGLGYDVPAGRRD  149

Query  593   GRVSLGKNVRPNIIDTSFTMDEMMKIFAAKGLSLDDLVTLSGAHTIGSAHCSAFSDRFQL  772
             G++SL  + R  +   +F ++++ ++FA KGL+ D++VTLSGAHTIG +HCSAFS R   
Sbjct  150   GKISLASDTRTELPPPTFNVNQLTQLFAKKGLTQDEMVTLSGAHTIGRSHCSAFSKRLYN  209

Query  773   ASNGSFLPIdaaldhayaaelaRQCPAGASDA-VTVNNDPVTPSLFDNQYYKDLLAHRGL  949
              S+ S    D +LD +YAA L RQCP G ++  + V  DP +P   D  YY D+LA+RGL
Sbjct  210   FSSTSIQ--DPSLDPSYAALLKRQCPQGNTNQNLVVPMDPSSPGTADVGYYNDILANRGL  267

Query  950   FQSDSALLRDKRAMEKVQDFAGDQNNFFTSWEQSFLKLVSIGVKVGDDDGEIRRSCSSVN  1129
             F SD  LL +     KV   A +   +   +  + +K+  +GV  G + GEIR +C  VN
Sbjct  268   FTSDQTLLTNTGTARKVHQNARNPYLWSNKFADAMVKMGQVGVLTG-NAGEIRTNCRVVN  326

Query  1130  A  1132
             +
Sbjct  327   S  327



>ref|XP_006654965.1| PREDICTED: peroxidase 5-like [Oryza brachyantha]
Length=337

 Score =   230 bits (587),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 140/303 (46%), Positives = 184/303 (61%), Gaps = 10/303 (3%)
 Frame = +2

Query  245   FYAISCPSAELIVKNTVRSASSVDPTLPGKLLRLLFHDCFVEGCDASILLQ---GNDTER  415
             FY  SCP AE IV+N VR A + D  L   L+R+ FHDCFV GCD SIL+    GN  E+
Sbjct  34    FYQHSCPQAEEIVRNAVRRAVARDAGLAAGLIRMHFHDCFVRGCDGSILINSTPGNKAEK  93

Query  416   SDPANK-SVGGFSTVDSAKRVLEIFCPETVSCADIIALAARDAVEFVGGPSVAIPTGRRD  592
                AN  S+ GF  VD AK V+E  CP TVSCAD++A AARDA    GG    +P+GRRD
Sbjct  94    DSVANNPSMRGFDVVDDAKAVVEAHCPRTVSCADVLAFAARDAAYLAGGIEYPVPSGRRD  153

Query  593   GRVSLGKNVR-PNIIDTSFTMDEMMKIFAAKGLSLDDLVTLSGAHTIGSAHCSAFSDRFQ  769
             GRVSL   V   N+   +F + ++++ FA KGL+ DD+VTLSGAHTIG +HCS+F+ R  
Sbjct  154   GRVSLSDEVLVNNVPGPTFNVSDLIESFARKGLTADDMVTLSGAHTIGRSHCSSFTQRLY  213

Query  770   LASNGSFLPIdaaldhayaaelaRQCPAGA---SDAVTVNNDPVTPSLFDNQYYKDLLAH  940
               S G     D A+D AYA +L  +CP      +D  TV  DPVTP+ FDNQYYK++LAH
Sbjct  214   NFS-GEAGRTDPAIDPAYAEQLKYRCPPATDDQNDPTTVPLDPVTPTAFDNQYYKNVLAH  272

Query  941   RGLFQSDSALLRDKRAMEKVQDFAGDQNNFFTSWEQSFLKLVSIGVKVGDDDGEIRRSCS  1120
             + +  SD  LL +      V+  +     F   +  + +K+ ++ V  G D+GEIR  C 
Sbjct  273   KVVLHSDQTLLDNPWTAGLVKFHSAVDKVFKVKFAAAMVKMGNVEVLTG-DEGEIREKCF  331

Query  1121  SVN  1129
             +VN
Sbjct  332   AVN  334



>gb|AFK41025.1| unknown [Lotus japonicus]
Length=325

 Score =   230 bits (586),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 137/303 (45%), Positives = 179/303 (59%), Gaps = 11/303 (4%)
 Frame = +2

Query  242   NFYAISCPSAELIVKNTVRSASSVDPTLPGKLLRLLFHDCFVEGCDASILLQ---GNDTE  412
              FY  SC  AE IVK T++   S  P LP KLLR+ FHDCFV GCD S+LL    GN  E
Sbjct  28    QFYRKSCSQAEQIVKTTIQQHVSSRPELPAKLLRMHFHDCFVRGCDGSVLLNSTAGNTAE  87

Query  413   RSDPANKSVGGFSTVDSAKRVLEIFCPETVSCADIIALAARDAV--EFVGGPSVAIPTGR  586
             +    N S+ GF  +D  K  LE  CP+ VSCADI+ALAARDAV  +F   P   + TGR
Sbjct  88    KDAIPNLSLSGFDVIDEIKEALEAKCPKIVSCADILALAARDAVSVQFNNEPKWEVLTGR  147

Query  587   RDGRVSLGKNVRPNIIDTSFTMDEMMKIFAAKGLSLDDLVTLSGAHTIGSAHCSAFSDR-  763
             RDG VS    V  NI    FT  ++ + F +K L+L D+V LSG HTIG  HC+ FS+R 
Sbjct  148   RDGTVSKSSEVLTNIPAPFFTFTQLKQSFESKKLTLHDMVVLSGGHTIGVGHCNLFSNRL  207

Query  764   FQLASNGSFLPIdaaldhayaaelaRQCPAGASDAVTVNNDPVTPSLFDNQYYKDLLAHR  943
             +     G   P   +L+  YA  L  +C + +    TV+ DP + + FD+ YY  LL ++
Sbjct  208   YNFTGKGDQDP---SLNPTYAEFLKTKCKSLSDTTTTVDMDPNSGTTFDSNYYSILLQNK  264

Query  944   GLFQSDSALLRDKRAMEKVQDFAGDQNNFFTSWEQSFLKLVSIGVKVGDDDGEIRRSCSS  1123
             G+FQSD+ALL  K++ + V +  G QN FFT + QS  ++ +I V  G   GEIRR CS 
Sbjct  265   GMFQSDAALLATKQSKKIVNELVG-QNKFFTEFGQSMKRMGAIEVLSG-TAGEIRRKCSV  322

Query  1124  VNA  1132
             VN+
Sbjct  323   VNS  325



>ref|XP_009118603.1| PREDICTED: LOW QUALITY PROTEIN: peroxidase 3-like [Brassica rapa]
 emb|CDY59800.1| BnaAnng16310D [Brassica napus]
Length=326

 Score =   230 bits (586),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 132/302 (44%), Positives = 176/302 (58%), Gaps = 7/302 (2%)
 Frame = +2

Query  239   FNFYAISCPSAELIVKNTVRSASSVDPTLPGKLLRLLFHDCFVEGCDASILLQGN--DTE  412
              NFYA +CP+AE IV++ V +  S  P+L   LLR+ FHDCFV GCD S+L+     + E
Sbjct  28    MNFYANTCPNAEKIVQDFVSNHISNAPSLAAALLRMHFHDCFVRGCDGSVLINSTSGNAE  87

Query  413   RSDPANKSVGGFSTVDSAKRVLEIFCPETVSCADIIALAARDAVEFVGGPSVAIPTGRRD  592
             R    N +V GF  +++ K VLE  CP  VSCADIIALA+RDAV F GGPS ++PTGRRD
Sbjct  88    RDATPNLTVRGFGFIEAIKTVLEAQCPGIVSCADIIALASRDAVVFTGGPSWSVPTGRRD  147

Query  593   GRVSLGKNVRPNIIDTSFTMDEMMKIFAAKGLSLDDLVTLSGAHTIGSAHCSAFSDR-FQ  769
             GR+S       NI   +     +  +FA +GL L DLV LSGAHTIG +HCS+F++R + 
Sbjct  148   GRISNASEALANIPPPTSNFTNLQTLFANQGLDLKDLVLLSGAHTIGVSHCSSFTNRLYN  207

Query  770   LASNGSFLPIdaaldhayaaelaRQCPAGASDAVTVNNDPVTPSLFDNQYYKDLLAHRGL  949
                 G   P  A      A   +R+CP+   +   V  DP +   FD  YY+ +L  RGL
Sbjct  208   FTGRGDQDP--ALDSQYAANLKSRKCPSLNDNTTIVEMDPGSRKTFDLSYYQLVLKRRGL  265

Query  950   FQSDSALLRDKRAMEKV-QDFAGDQNNFFTSWEQSFLKLVSIGVKVGDDDGEIRRSCSSV  1126
             FQSDSAL  +   +  + Q   G   +FF+ + +S  K+  I VK G   G +RR CS  
Sbjct  266   FQSDSALTTNPTTLSNINQLLKGSVESFFSEFAKSMEKMGRINVKTG-SAGVVRRQCSVA  324

Query  1127  NA  1132
             N+
Sbjct  325   NS  326



>ref|XP_010555640.1| PREDICTED: peroxidase 66 [Tarenaya hassleriana]
Length=321

 Score =   230 bits (586),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 132/298 (44%), Positives = 180/298 (60%), Gaps = 9/298 (3%)
 Frame = +2

Query  245   FYAISCPSAELIVKNTVRSASSVDPTLPGKLLRLLFHDCFVEGCDASILL---QGNDTER  415
             +Y   CP+AE IV  TVR+A+  DP +P ++LR+ FHDCF+ GCDAS+LL   + N  E+
Sbjct  30    YYDRLCPAAEKIVLETVRNATLHDPKVPARILRMFFHDCFIRGCDASLLLDSTRTNQAEK  89

Query  416   SDPANKSVGGFSTVDSAKRVLEIFCPETVSCADIIALAARDAVEFVGGPSVAIPTGRRDG  595
               P N SV  F  +D AK  LE  CP  VSCADIIA+AARD V   GGP   +  GR+DG
Sbjct  90    DGPPNISVRAFYVIDDAKTKLEKACPRKVSCADIIAIAARDVVTLSGGPYWNVLKGRKDG  149

Query  596   RVSLGKNVRPNIIDTSFTMDEMMKIFAAKGLSLDDLVTLSGAHTIGSAHCSAFSDRFQLA  775
             R+S   N   N+   +F + ++++ F A+GL + D+VTLSG HT+G +HCS+F  R Q  
Sbjct  150   RISRA-NETINLPAPTFNVSQLIQSFGARGLGIKDMVTLSGGHTLGFSHCSSFESRLQNF  208

Query  776   SNGSFLPIdaaldhayaaelaRQCPAGASDAVTVNNDPVTPSLFDNQYYKDLLAHRGLFQ  955
             S  S   ID +++  +A  L + CP    D         T S+FDN YYK +LA +G+F 
Sbjct  209   S--SLHDIDPSMNENFAQTLRKNCPKLKRDKNAGQFLDSTSSVFDNDYYKQILAGKGVFG  266

Query  956   SDSALLRDKRAMEKVQDFAGDQNNFFTSWEQSFLKLVSIGVKVGDDDGEIRRSCSSVN  1129
             SD ALL D R    V+ FA D+  FF  +  S +KL ++GVK   + GE+R +C  VN
Sbjct  267   SDQALLGDLRTKWIVETFARDKTAFFREFGASMVKLGNVGVK---EVGEVRVNCRFVN  321



>ref|XP_002268509.1| PREDICTED: peroxidase 66 [Vitis vinifera]
 emb|CAN64852.1| hypothetical protein VITISV_025395 [Vitis vinifera]
 emb|CBI31870.3| unnamed protein product [Vitis vinifera]
Length=323

 Score =   230 bits (586),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 132/299 (44%), Positives = 177/299 (59%), Gaps = 9/299 (3%)
 Frame = +2

Query  242   NFYAISCPSAELIVKNTVRSASSVDPTLPGKLLRLLFHDCFVEGCDASILLQ---GNDTE  412
             ++Y  +CP AE I+  TVR AS  DP +P ++LR+ FHDCF+ GCDAS+LL    GN  E
Sbjct  31    HYYHQTCPQAENIIFETVRKASINDPKVPARILRMFFHDCFIRGCDASVLLDSTPGNQAE  90

Query  413   RSDPANKSVGGFSTVDSAKRVLEIFCPETVSCADIIALAARDAVEFVGGPSVAIPTGRRD  592
             +  P N S+  F  ++ AK  LE+ CP TVSCADIIA+AARD V    GP   + TGR+D
Sbjct  91    KDGPPNISLASFYVIEDAKTKLEMACPGTVSCADIIAIAARDVVAMSRGPYWNVLTGRKD  150

Query  593   GRVSLGKNVRPNIIDTSFTMDEMMKIFAAKGLSLDDLVTLSGAHTIGSAHCSAFSDRFQL  772
             GRVS       N+   +F + ++++ FA +GL L DLV LSG H++G +HCS+F  R   
Sbjct  151   GRVSKASETV-NLPAPTFNVTQLIQSFAQRGLGLKDLVALSGGHSLGFSHCSSFEARVHN  209

Query  773   ASNGSFLPIdaaldhayaaelaRQCPAGASDAVTVNNDPVTPSLFDNQYYKDLLAHRGLF  952
              S  S   ID  ++  +A  L ++CP   SD         T S FDN YY  L+A  GLF
Sbjct  210   FS--SVHDIDPTMNTEFAERLKKKCPKPNSDRNAGEFLDSTASTFDNNYYLQLMAGEGLF  267

Query  953   QSDSALLRDKRAMEKVQDFAGDQNNFFTSWEQSFLKLVSIGVKVGDDDGEIRRSCSSVN  1129
              SD ALL D R    V+ FA DQ  FF  +  S +KL ++GV    ++GE+R  C +VN
Sbjct  268   GSDQALLTDYRTRWIVESFAKDQGLFFREFTASMVKLGNVGVL---ENGEVRLKCQAVN  323



>gb|AAM52317.1|AC105363_6 Putative peroxidase [Oryza sativa Japonica Group]
 tpe|CAH69275.1| TPA: class III peroxidase 33 precursor [Oryza sativa Japonica 
Group]
Length=311

 Score =   229 bits (585),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 132/296 (45%), Positives = 182/296 (61%), Gaps = 8/296 (3%)
 Frame = +2

Query  245   FYAISCPSAELIVKNTVRSASSVDPTLPGKLLRLLFHDCFVEGCDASILL---QGNDTER  415
             +Y   CP+AE+IV+  V  A S +P +   L+RL FHDCFV GCDAS+LL   QGN  E+
Sbjct  15    YYDTLCPAAEIIVQEEVSKAVSGNPGMAAGLVRLHFHDCFVRGCDASVLLDSTQGNRAEK  74

Query  416   SDPANKSVGGFSTVDSAKRVLEIFCPETVSCADIIALAARDAVEFVGGPSVAIPTGRRDG  595
               P N S+ GF  +DSAK  LE  C   VSCAD++A AARDA+  VGG +  +P GRRDG
Sbjct  75    DAPPNTSLRGFEVIDSAKSRLETACFGVVSCADVLAFAARDALALVGGNAYQVPGGRRDG  134

Query  596   RVSLGKNVRPNIIDTSFTMDEMMKIFAAKGLSLDDLVTLSGAHTIGSAHCSAFSDRFQLA  775
              VS+ +    N+   S  + ++ ++F AKGL+  ++V LSGAHTIG +HCS+FS+R  L 
Sbjct  135   NVSVAQETNGNLPPPSANVAQLNQMFGAKGLTQAEMVALSGAHTIGVSHCSSFSNR--LY  192

Query  776   SNGSFLPIdaaldhayaaelaRQCP--AGASDAVTVNNDPVTPSLFDNQYYKDLLAHRGL  949
             S+G     D ++D +Y A L  QCP   G   A  V  D VTP+ FD  YY  ++A+RGL
Sbjct  193   SSGPNAGQDPSMDPSYVAALTTQCPQQQGQPAAGMVPMDAVTPNAFDTNYYAAIVANRGL  252

Query  950   FQSDSALLRDKRAMEKVQDFAGDQNNFFTSWEQSFLKLVSIGVKVGDDDGEIRRSC  1117
               SD ALL D+    +V  +  + ++F T +  + +K+ SIGV  G + G IR +C
Sbjct  253   LSSDQALLADQTTAAQVVGYTNNPDSFQTDFAAAMVKMGSIGVLTG-NAGTIRTNC  307



>gb|EEC74412.1| hypothetical protein OsI_09774 [Oryza sativa Indica Group]
Length=313

 Score =   229 bits (585),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 132/296 (45%), Positives = 182/296 (61%), Gaps = 8/296 (3%)
 Frame = +2

Query  245   FYAISCPSAELIVKNTVRSASSVDPTLPGKLLRLLFHDCFVEGCDASILL---QGNDTER  415
             +Y   CP+AE+IV+  V  A S +P +   L+RL FHDCFV GCDAS+LL   QGN  E+
Sbjct  17    YYDTLCPAAEIIVQEEVSKAVSGNPGMAAGLVRLHFHDCFVRGCDASVLLDSTQGNRAEK  76

Query  416   SDPANKSVGGFSTVDSAKRVLEIFCPETVSCADIIALAARDAVEFVGGPSVAIPTGRRDG  595
               P N S+ GF  +DSAK  LE  C   VSCAD++A AARDA+  VGG +  +P GRRDG
Sbjct  77    DAPPNTSLRGFEVIDSAKSRLETACFGVVSCADVLAFAARDALALVGGNAYQVPGGRRDG  136

Query  596   RVSLGKNVRPNIIDTSFTMDEMMKIFAAKGLSLDDLVTLSGAHTIGSAHCSAFSDRFQLA  775
              VS+ +    N+   S  + ++ ++F AKGL+  ++V LSGAHTIG +HCS+FS+R  L 
Sbjct  137   NVSVAQETNGNLPPPSANVAQLNQMFGAKGLTQAEMVALSGAHTIGVSHCSSFSNR--LY  194

Query  776   SNGSFLPIdaaldhayaaelaRQCP--AGASDAVTVNNDPVTPSLFDNQYYKDLLAHRGL  949
             S+G     D ++D +Y A L  QCP   G   A  V  D VTP+ FD  YY  ++A+RGL
Sbjct  195   SSGPNAGQDPSMDPSYVAALTTQCPQQQGQPAAGMVPMDAVTPNAFDTNYYAAIVANRGL  254

Query  950   FQSDSALLRDKRAMEKVQDFAGDQNNFFTSWEQSFLKLVSIGVKVGDDDGEIRRSC  1117
               SD ALL D+    +V  +  + ++F T +  + +K+ SIGV  G + G IR +C
Sbjct  255   LSSDQALLADQTTAAQVVGYTNNPDSFQTDFAAAMVKMGSIGVLTG-NAGTIRTNC  309



>ref|XP_004304932.1| PREDICTED: peroxidase 5-like [Fragaria vesca subsp. vesca]
Length=324

 Score =   230 bits (586),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 138/299 (46%), Positives = 179/299 (60%), Gaps = 7/299 (2%)
 Frame = +2

Query  245   FYAISCPSAELIVKNTVRSASSVDPTLPGKLLRLLFHDCFVEGCDASILLQ---GNDTER  415
             FY  +CPSAE IV+  V  A   +P +   L+R+ FHDCFV GCDAS+LL    G  +E+
Sbjct  29    FYRTTCPSAEAIVRKAVNKAVMKNPGIAAGLIRMHFHDCFVRGCDASVLLDSTPGKLSEK  88

Query  416   SDPANK-SVGGFSTVDSAKRVLEIFCPETVSCADIIALAARDAVEFVGGPSVAIPTGRRD  592
               PANK S+ GF  +D AKR LE  CP TVSCADI+A AARD    VGG S  +P+GRRD
Sbjct  89    EHPANKPSLRGFEVIDEAKRELETLCPRTVSCADILAFAARDGALAVGGISYQVPSGRRD  148

Query  593   GRVSLGKNVRPNIIDTSFTMDEMMKIFAAKGLSLDDLVTLSGAHTIGSAHCSAFSDRFQL  772
             GRVSL      N+   S    E+   FA KG SLD++VTLSGAH+IG +HCS+FS+R   
Sbjct  149   GRVSLFDEPSNNLPSPSLNAKELAASFARKGFSLDEMVTLSGAHSIGVSHCSSFSNRL-Y  207

Query  773   ASNGSFLPIdaaldhayaaelaRQCPAGASDAVTVNNDPVTPSLFDNQYYKDLLAHRGLF  952
             A N +    D +LD  +A +L  +CP  +S    V  D VTP+  DN+YY +L+ HRGLF
Sbjct  208   AFNETHTQ-DPSLDPKFARDLKAKCPPSSSPNNVVQLDGVTPNRLDNKYYTNLMNHRGLF  266

Query  953   QSDSALLRDKRAMEKVQDFAGDQNNFFTSWEQSFLKLVSIGVKVGDDDGEIRRSCSSVN  1129
              SD  LL  +     V++ A     +   +  + +K+ SI V  G   GEIR+ C  VN
Sbjct  267   ASDQTLLSSRSTAGMVRNNARLGPAWAKKFASAMVKMGSIDVLTG-RQGEIRKKCGVVN  324



>ref|XP_002889542.1| CBRCI35 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH65801.1| CBRCI35 [Arabidopsis lyrata subsp. lyrata]
Length=326

 Score =   230 bits (586),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 131/302 (43%), Positives = 177/302 (59%), Gaps = 7/302 (2%)
 Frame = +2

Query  239   FNFYAISCPSAELIVKNTVRSASSVDPTLPGKLLRLLFHDCFVEGCDASILLQGN--DTE  412
              NFYA SCP+AE IV++ V +  S  P+L   L+R+ FHDCFV GCD S+L+     + E
Sbjct  28    MNFYANSCPNAEKIVQDFVSNHISNAPSLAAALIRMHFHDCFVRGCDGSVLINSTSGNAE  87

Query  413   RSDPANKSVGGFSTVDSAKRVLEIFCPETVSCADIIALAARDAVEFVGGPSVAIPTGRRD  592
             R    N +V GF  +D+ K VLE  CP  VSCADIIALA+RDAV F GGP+ ++PTGRRD
Sbjct  88    RDATPNLTVRGFGFIDAIKAVLEAQCPGIVSCADIIALASRDAVVFTGGPNWSVPTGRRD  147

Query  593   GRVSLGKNVRPNIIDTSFTMDEMMKIFAAKGLSLDDLVTLSGAHTIGSAHCSAFSDR-FQ  769
             GR+S       NI   +  +  +  +FA +GL L DLV LSGAHTIG +HCS+F++R + 
Sbjct  148   GRISNASEALANIPPPTSNITNLQTLFANQGLDLKDLVLLSGAHTIGVSHCSSFTNRLYN  207

Query  770   LASNGSFLPIdaaldhayaaelaRQCPAGASDAVTVNNDPVTPSLFDNQYYKDLLAHRGL  949
              +  G   P  A      A   +R+CP+   +   V  DP +   FD  YY+ +L  RGL
Sbjct  208   FSGRGDQDP--ALDSAYAANLKSRKCPSLNDNKTIVEMDPGSRKTFDLSYYQLVLKRRGL  265

Query  950   FQSDSALLRDKRAMEKVQD-FAGDQNNFFTSWEQSFLKLVSIGVKVGDDDGEIRRSCSSV  1126
             FQSDSAL  +   +  +     G   +FF+ + +S  K+  I VK G   G +RR CS  
Sbjct  266   FQSDSALTTNPTTLSNINRILTGSVESFFSEFAKSMEKMGRINVKTG-SAGVVRRQCSVA  324

Query  1127  NA  1132
             N+
Sbjct  325   NS  326



>ref|XP_006650985.1| PREDICTED: peroxidase 5-like [Oryza brachyantha]
Length=336

 Score =   230 bits (586),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 135/305 (44%), Positives = 181/305 (59%), Gaps = 13/305 (4%)
 Frame = +2

Query  242   NFYAISCPSAELIVKNTVRSASSVDPTLPGKLLRLLFHDCFVEGCDASILLQGND---TE  412
              FYA +CP AE IV+  V  A   +  L   L+R+ FHDCFV GCD S+LL+       E
Sbjct  36    GFYAATCPQAETIVRQEVARALYANAGLAAGLVRMHFHDCFVRGCDGSVLLESTPDSAAE  95

Query  413   RSDPANK-SVGGFSTVDSAKRVLEIFCPETVSCADIIALAARDAVEFVGGPSVAIPTGRR  589
             R  P N  S+ GF  +DSAK  LE  CP  VSCAD++A AARD+V   GGP   +P GRR
Sbjct  96    RDSPINNPSLRGFEVIDSAKVRLEAACPGVVSCADVLAYAARDSVALTGGPRYDVPGGRR  155

Query  590   DGRVSLGKNVRPNIIDTSFTMDEMMKIFAAKGLSLDDLVTLSGAHTIGSAHCSAFSDR-F  766
             DG VSL   V  NI   +FT+DE+ + FAAKGL+ +++VTLSGAHTIG AHC++FSDR +
Sbjct  156   DGTVSLESEVADNIPAPTFTLDELTRSFAAKGLTQEEMVTLSGAHTIGRAHCTSFSDRLY  215

Query  767   QLASNGSFLPIdaaldhayaaelaRQCPAGASDAVTVN----NDPVTPSLFDNQYYKDLL  934
               ++ G+  P   ++  A+ ++L R CPAG   AV  N     +P TP+ FD  YY  +L
Sbjct  216   NFSAMGAADP---SVAPAFLSQLRRACPAGPDGAVDANLAVPMEPRTPNGFDALYYWAVL  272

Query  935   AHRGLFQSDSALLRDKRAMEKVQDFAGDQNNFFTSWEQSFLKLVSIGVKVGDDDGEIRRS  1114
              +RGLF SD ALL       +V+  A     +   +  + +K+  + V  G   GEIR  
Sbjct  273   RNRGLFTSDQALLSSPPTAAQVRQSAYGGYPWKLKFAAAMVKMGQVEVLTG-SSGEIRTK  331

Query  1115  CSSVN  1129
             C++VN
Sbjct  332   CAAVN  336



>gb|KFK31897.1| hypothetical protein AALP_AA6G173300 [Arabis alpina]
Length=326

 Score =   230 bits (586),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 130/301 (43%), Positives = 178/301 (59%), Gaps = 9/301 (3%)
 Frame = +2

Query  245   FYAISCPSAELIVKNTVRSASSVDPTLPGKLLRLLFHDCFVEGCDASILL----QGNDTE  412
             FY  +CP+AE IV++ V       P+L   L+R+ FHDCFV GCD SIL+    +    E
Sbjct  29    FYDKTCPNAEKIVQSVVNQHIQNVPSLAAGLIRMHFHDCFVRGCDGSILINATSRNQQVE  88

Query  413   RSDPANKSVGGFSTVDSAKRVLEIFCPETVSCADIIALAARDAVEFVGGPSVAIPTGRRD  592
             +  P N +V GF  +D  K VLE  CP  VSCADII LA RD++  +GGP+ ++PTGRRD
Sbjct  89    KVAPPNLTVRGFDFIDLVKFVLESKCPGIVSCADIITLATRDSIAAIGGPTWSVPTGRRD  148

Query  593   GRVSLGKNVRPNIIDTSFTMDEMMKIFAAKGLSLDDLVTLSGAHTIGSAHCSAFSDR-FQ  769
             GR+S     R NI         ++ +F  +GL + DLV LSGAHTIG +HCS+FS+R F 
Sbjct  149   GRISNATEARNNIPPPFGNFTTLITLFGNQGLDVKDLVLLSGAHTIGVSHCSSFSNRLFN  208

Query  770   LASNGSFLPIdaaldhayaaelaRQCPAGASDAVTVNNDPVTPSLFDNQYYKDLLAHRGL  949
                 G   P  +      A    R+C + A +   V  DP + + FD  Y+K +L  RGL
Sbjct  209   FTGVGDQDP--SLDSEYAANLKTRRCLSLADNTTKVEMDPGSRNTFDLSYFKLVLKRRGL  266

Query  950   FQSDSALLRDKRAMEKVQDFA-GDQNNFFTSWEQSFLKLVSIGVKVGDDDGEIRRSCSSV  1126
             F+SD+AL  +  A+ +V+ FA G + +FF  + +S  K+  IGV+ G  DGEIRR+CS V
Sbjct  267   FESDAALTMNSEALSQVRRFARGSEQDFFAEFAKSMEKMGRIGVQTG-SDGEIRRTCSVV  325

Query  1127  N  1129
             N
Sbjct  326   N  326



>ref|XP_010927767.1| PREDICTED: peroxidase 55-like [Elaeis guineensis]
Length=325

 Score =   229 bits (585),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 129/301 (43%), Positives = 177/301 (59%), Gaps = 7/301 (2%)
 Frame = +2

Query  242   NFYAISCPSAELIVKNTVRSASSVDPTLPGKLLRLLFHDCFVEGCDASILLQG--NDTER  415
             NFY  SCP+ E IV+  ++   S         LRL FHDCF+EGCDASI++    +DTER
Sbjct  27    NFYQSSCPNVESIVRQAIQQKLSQTSVTVAATLRLFFHDCFIEGCDASIMVASPKHDTER  86

Query  416   SDPANKSVGG--FSTVDSAKRVLEIFCPETVSCADIIALAARDAVEFVGGPSVAIPTGRR  589
               P N S+ G  F T++ AK  +E  CP  VSCADI+A+AARD V   GGPS  +  GRR
Sbjct  87    DAPDNLSLAGDGFDTIEKAKEAVEAQCPGVVSCADILAIAARDVVVLSGGPSFIVELGRR  146

Query  590   DGRVSLGKNVRPNIIDTSFTMDEMMKIFAAKGLSLDDLVTLSGAHTIGSAHCSAFSDRFQ  769
             DG +S    V   +    F +  +  IF    L+L D++ LSGAHT+G +HCS F+ R  
Sbjct  147   DGLISQAGRVPGKLPGPDFDLKLLAWIFGKNNLTLLDMIALSGAHTLGFSHCSRFAKR--  204

Query  770   LASNGSFLPIdaaldhayaaelaRQCPAGASDAVTVNNDPVTPSLFDNQYYKDLLAHRGL  949
             L S    LP+D +L+  YA +L   CP      + V  DP TP+ FDN Y+K+L+  RGL
Sbjct  205   LYSFAPSLPVDPSLNPRYAQQLMHACPQNVDPNIVVGMDPFTPNTFDNVYFKNLVNGRGL  264

Query  950   FQSDSALLRDKRAMEKVQDFAGDQNNFFTSWEQSFLKLVSIGVKVGDDDGEIRRSCSSVN  1129
             F SD  L  +  +   V +FA +Q NFF ++  + ++L  +GVK G ++GEIRR C++ N
Sbjct  265   FTSDEVLFTNPLSRPVVSNFAANQGNFFKAFASAMVRLGRVGVKTG-NEGEIRRDCTAFN  323

Query  1130  A  1132
              
Sbjct  324   G  324



>gb|AAM61240.1| putative peroxidase [Arabidopsis thaliana]
Length=326

 Score =   229 bits (585),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 131/302 (43%), Positives = 176/302 (58%), Gaps = 7/302 (2%)
 Frame = +2

Query  239   FNFYAISCPSAELIVKNTVRSASSVDPTLPGKLLRLLFHDCFVEGCDASILLQGN--DTE  412
              NFYA SCP+AE IV++ V +  S  P+L   L+R+ FHDCFV GCD S+L+     + E
Sbjct  28    MNFYANSCPNAEKIVQDFVSNHVSNAPSLAAALIRMHFHDCFVRGCDGSVLINSTSGNAE  87

Query  413   RSDPANKSVGGFSTVDSAKRVLEIFCPETVSCADIIALAARDAVEFVGGPSVAIPTGRRD  592
             R    N +V GF  +D+ K VLE  CP  VSCADIIALA+RDAV F GGP+ ++PTGRRD
Sbjct  88    RDATPNLTVRGFGFIDAIKSVLEAQCPGIVSCADIIALASRDAVVFTGGPNWSVPTGRRD  147

Query  593   GRVSLGKNVRPNIIDTSFTMDEMMKIFAAKGLSLDDLVTLSGAHTIGSAHCSAFSDR-FQ  769
             GR+S       NI   +  +  +  +FA +GL L DLV LSGAHTIG +HCS+F++R + 
Sbjct  148   GRISNAAEALANIPPPTSNITNLQTLFANQGLDLKDLVLLSGAHTIGVSHCSSFTNRLYN  207

Query  770   LASNGSFLPIdaaldhayaaelaRQCPAGASDAVTVNNDPVTPSLFDNQYYKDLLAHRGL  949
                 G   P  A      A   +R+CP+   +   V  DP +   FD  YY+ +L  RGL
Sbjct  208   FTGRGGQDP--ALDSEYAANLKSRKCPSLNDNKTIVEMDPGSRKTFDLSYYQLVLKRRGL  265

Query  950   FQSDSALLRDKRAMEKVQD-FAGDQNNFFTSWEQSFLKLVSIGVKVGDDDGEIRRSCSSV  1126
             FQSDSAL  +   +  +     G   +FF+ + +S  K+  I VK G   G +RR CS  
Sbjct  266   FQSDSALTTNPTTLSNINRILTGSVGSFFSEFAKSMEKMGRINVKTG-SAGVVRRQCSVA  324

Query  1127  NA  1132
             N+
Sbjct  325   NS  326



>ref|XP_006654966.1| PREDICTED: peroxidase 5-like [Oryza brachyantha]
Length=332

 Score =   229 bits (585),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 138/304 (45%), Positives = 185/304 (61%), Gaps = 10/304 (3%)
 Frame = +2

Query  242   NFYAISCPSAELIVKNTVRSASSVDPTLPGKLLRLLFHDCFVEGCDASILLQ---GNDTE  412
              FYA SCP AE IV+ TV  A    P  P  L+RL FHDCFV GCDAS+LL+   G+  E
Sbjct  32    GFYAESCPKAEAIVRETVSKAFKKGPGTPADLIRLFFHDCFVRGCDASVLLESTAGSKAE  91

Query  413   R-SDPANKSVGGFSTVDSAKRVLEIFCPETVSCADIIALAARDAVEFVGGPSVAIPTGRR  589
             R S P N S+ GF  VD AK +LE  CP+TVSC+DI+ALAARD+    GG    IPTGRR
Sbjct  92    RDSKPNNPSLDGFDVVDDAKDLLEKACPQTVSCSDILALAARDSAYLAGGLDFDIPTGRR  151

Query  590   DGRVSLGKNVRPNIIDTSFTMDEMMKIFAAKGLSLDDLVTLSGAHTIGSAHCSAFSDRFQ  769
             DG VS    V PN+    F   +++K F AKG + +++VTLSGAH+IG++HCS+F++R  
Sbjct  152   DGLVSKEDEVLPNVPHPDFGAKDLLKNFTAKGFTAEEMVTLSGAHSIGTSHCSSFTNRL-  210

Query  770   LASNGSFLPIdaaldhayaaelaRQCP---AGASDAVTVNNDPVTPSLFDNQYYKDLLAH  940
                 G++   D A+  AYAA++ R+CP   A   D   V  D VTP + D+QYYK++LA 
Sbjct  211   YKYYGTY-GTDPAMPAAYAADMMRKCPPETAAQQDPTMVQLDDVTPFVMDSQYYKNVLAG  269

Query  941   RGLFQSDSALLRDKRAMEKVQDFAGDQNNFFTSWEQSFLKLVSIGVKVGDDDGEIRRSCS  1120
                F SD ALL        V+ +AG    +   +  + +K+  + V  G  +G+IR +CS
Sbjct  270   HVAFASDVALLDTPETAALVELYAGHSALWLGRFAAALVKVSKLDVLTG-GEGQIRLNCS  328

Query  1121  SVNA  1132
              VN+
Sbjct  329   RVNS  332



>ref|NP_172018.1| peroxidase 3 [Arabidopsis thaliana]
 sp|O23044.1|PER3_ARATH RecName: Full=Peroxidase 3; Short=Atperox P3; AltName: Full=ATPRC; 
AltName: Full=RCI3A; AltName: Full=Rare cold-inducible 
protein; Flags: Precursor [Arabidopsis thaliana]
 gb|AAB71452.1| Strong similarity to Arabidopsis peroxidase ATPEROX7A (gb|X98321) 
[Arabidopsis thaliana]
 gb|AAB94661.1| peroxidase precursor [Arabidopsis thaliana]
 gb|AAO44083.1| At1g05260 [Arabidopsis thaliana]
 dbj|BAE99836.1| putative peroxidase [Arabidopsis thaliana]
 gb|AEE27815.1| peroxidase 3 [Arabidopsis thaliana]
Length=326

 Score =   229 bits (585),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 131/302 (43%), Positives = 176/302 (58%), Gaps = 7/302 (2%)
 Frame = +2

Query  239   FNFYAISCPSAELIVKNTVRSASSVDPTLPGKLLRLLFHDCFVEGCDASILLQGN--DTE  412
              NFYA SCP+AE IV++ V +  S  P+L   L+R+ FHDCFV GCD S+L+     + E
Sbjct  28    MNFYANSCPNAEKIVQDFVSNHVSNAPSLAAALIRMHFHDCFVRGCDGSVLINSTSGNAE  87

Query  413   RSDPANKSVGGFSTVDSAKRVLEIFCPETVSCADIIALAARDAVEFVGGPSVAIPTGRRD  592
             R    N +V GF  +D+ K VLE  CP  VSCADIIALA+RDAV F GGP+ ++PTGRRD
Sbjct  88    RDATPNLTVRGFGFIDAIKSVLEAQCPGIVSCADIIALASRDAVVFTGGPNWSVPTGRRD  147

Query  593   GRVSLGKNVRPNIIDTSFTMDEMMKIFAAKGLSLDDLVTLSGAHTIGSAHCSAFSDR-FQ  769
             GR+S       NI   +  +  +  +FA +GL L DLV LSGAHTIG +HCS+F++R + 
Sbjct  148   GRISNAAEALANIPPPTSNITNLQTLFANQGLDLKDLVLLSGAHTIGVSHCSSFTNRLYN  207

Query  770   LASNGSFLPIdaaldhayaaelaRQCPAGASDAVTVNNDPVTPSLFDNQYYKDLLAHRGL  949
                 G   P  A      A   +R+CP+   +   V  DP +   FD  YY+ +L  RGL
Sbjct  208   FTGRGGQDP--ALDSEYAANLKSRKCPSLNDNKTIVEMDPGSRKTFDLSYYQLVLKRRGL  265

Query  950   FQSDSALLRDKRAMEKVQD-FAGDQNNFFTSWEQSFLKLVSIGVKVGDDDGEIRRSCSSV  1126
             FQSDSAL  +   +  +     G   +FF+ + +S  K+  I VK G   G +RR CS  
Sbjct  266   FQSDSALTTNPTTLSNINRILTGSVGSFFSEFAKSMEKMGRINVKTG-SAGVVRRQCSVA  324

Query  1127  NA  1132
             N+
Sbjct  325   NS  326



>ref|NP_196917.1| peroxidase 55 [Arabidopsis thaliana]
 sp|Q96509.1|PER55_ARATH RecName: Full=Peroxidase 55; Short=Atperox P55; AltName: Full=ATP20a; 
Flags: Precursor [Arabidopsis thaliana]
 emb|CAA67338.1| peroxidase [Arabidopsis thaliana]
 dbj|BAB08292.1| peroxidase ATP20a [Arabidopsis thaliana]
 gb|AAL14402.1| AT5g14130/MUA22_13 [Arabidopsis thaliana]
 gb|AAM70543.1| AT5g14130/MUA22_13 [Arabidopsis thaliana]
 gb|AED91991.1| peroxidase 55 [Arabidopsis thaliana]
Length=330

 Score =   229 bits (585),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 134/300 (45%), Positives = 182/300 (61%), Gaps = 8/300 (3%)
 Frame = +2

Query  242   NFYAISCPSAELIVKNTVRSASSVDPTLPGKLLRLLFHDCFVEGCDASILL--QGNDTER  415
             N+YA +CPS ELIVK  V +      T     LR+ FHDCFVEGCDAS+ +  +  D E+
Sbjct  35    NYYASTCPSVELIVKQAVTTKFKQTVTTAPATLRMFFHDCFVEGCDASVFIASENEDAEK  94

Query  416   SDPANKSVGG--FSTVDSAKRVLEIFCPETVSCADIIALAARDAVEFVGGPSVAIPTGRR  589
                 NKS+ G  F TV  AK  +E  CP  VSCADI+ALAARD V  VGGP   +  GRR
Sbjct  95    DADDNKSLAGDGFDTVIKAKTAVESQCPGVVSCADILALAARDVVVLVGGPEFKVELGRR  154

Query  590   DGRVSLGKNVRPNIIDTSFTMDEMMKIFAAKGLSLDDLVTLSGAHTIGSAHCSAFSDRFQ  769
             DG VS    V   + +    +  +++IFA+ GLSL D++ LSGAHTIGS+HC+ F++R  
Sbjct  155   DGLVSKASRVTGKLPEPGLDVRGLVQIFASNGLSLTDMIALSGAHTIGSSHCNRFANR--  212

Query  770   LASNGSFLPIdaaldhayaaelaRQCPAGASDAVTVNNDPVTPSLFDNQYYKDLLAHRGL  949
             L +  +F+P+D  +D  YA +L + C     DAV V+ D  +   FDN YY++L+A +GL
Sbjct  213   LHNFSTFMPVDPTMDPVYAQQLIQACSDPNPDAV-VDIDLTSRDTFDNSYYQNLVARKGL  271

Query  950   FQSDSALLRDKRAMEKVQDFAGDQNNFFTSWEQSFLKLVSIGVKVGDDDGEIRRSCSSVN  1129
             F SD AL  D  +   V  FA +   F++++  +   L  +GVKVG + GEIRR CS+ N
Sbjct  272   FTSDQALFNDLSSQATVVRFANNAEEFYSAFSSAMRNLGRVGVKVG-NQGEIRRDCSAFN  330



>ref|XP_002450360.1| hypothetical protein SORBIDRAFT_05g004180 [Sorghum bicolor]
 gb|EES09348.1| hypothetical protein SORBIDRAFT_05g004180 [Sorghum bicolor]
Length=340

 Score =   230 bits (586),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 142/304 (47%), Positives = 178/304 (59%), Gaps = 11/304 (4%)
 Frame = +2

Query  245   FYAISCPSAELIVKNTVRSASSVDPTLPGKLLRLLFHDCFVEGCDASILLQG---NDTER  415
             FY  SCP AE IV+N VR   + D  +   L+R+ FHDCFV GCDASIL+     N  E+
Sbjct  36    FYKHSCPKAESIVRNAVRRGIARDAGVGAGLIRMHFHDCFVRGCDASILINSTPRNKAEK  95

Query  416   SDPANK-SVGGFSTVDSAKRVLEIFCPETVSCADIIALAARDAVEFVGGPSVAIPTGRRD  592
                AN  S+ GF  VD AK VLE  CP TVSCADIIA AARD     GG    +P+GRRD
Sbjct  96    DSVANNPSMRGFDVVDDAKAVLEAHCPRTVSCADIIAFAARDGAYLAGGLDYKVPSGRRD  155

Query  593   GRVSLGKNVRPNIIDTSF-TMDEMMKIFAAKGLSLDDLVTLSGAHTIGSAHCSAFSDRFQ  769
             GRVS    V  N +   F  + E++K F  KGL+ DD+VTLSGAHTIG +HCS+F+ R  
Sbjct  156   GRVSKEDEVLDNNVPAPFDDVAELIKSFKRKGLNADDMVTLSGAHTIGRSHCSSFTQRLY  215

Query  770   LASNGSFLPIdaaldhayaaelaRQCPA----GASDAVTVNNDPVTPSLFDNQYYKDLLA  937
               S G     D +LD  YA  L  +CP     G  D   V  DPVTP+ FDNQYYK++LA
Sbjct  216   NFS-GQLGRTDPSLDPTYAEHLKMRCPWPSSNGQMDPTVVPLDPVTPATFDNQYYKNVLA  274

Query  938   HRGLFQSDSALLRDKRAMEKVQDFAGDQNNFFTSWEQSFLKLVSIGVKVGDDDGEIRRSC  1117
             H+GLF SD+ LL +      V   A  +  +   + ++ +K+  + V  G D+GEIR  C
Sbjct  275   HKGLFVSDNTLLDNPWTAGMVHFNAAVEKAWQVKFAKAMVKMGKVQVLTG-DEGEIREKC  333

Query  1118  SSVN  1129
               VN
Sbjct  334   FVVN  337



>ref|XP_006418047.1| hypothetical protein EUTSA_v10008189mg [Eutrema salsugineum]
 gb|ESQ36400.1| hypothetical protein EUTSA_v10008189mg [Eutrema salsugineum]
Length=326

 Score =   229 bits (584),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 130/302 (43%), Positives = 177/302 (59%), Gaps = 7/302 (2%)
 Frame = +2

Query  239   FNFYAISCPSAELIVKNTVRSASSVDPTLPGKLLRLLFHDCFVEGCDASILLQGN--DTE  412
              NFYA +CP+AE IV++ V +  S  P+L   LLR+ FHDCFV GCD S+L+     + E
Sbjct  28    MNFYANTCPNAEKIVQDFVSNHVSNAPSLAAALLRMHFHDCFVRGCDGSVLINSTSGNAE  87

Query  413   RSDPANKSVGGFSTVDSAKRVLEIFCPETVSCADIIALAARDAVEFVGGPSVAIPTGRRD  592
             +    N +V GF  +D+ K VLE  CP  VSCADIIALA+RDAV F GGP+ ++PTGRRD
Sbjct  88    KDATPNLTVRGFGFIDAIKSVLEAQCPGIVSCADIIALASRDAVVFTGGPTWSVPTGRRD  147

Query  593   GRVSLGKNVRPNIIDTSFTMDEMMKIFAAKGLSLDDLVTLSGAHTIGSAHCSAFSDR-FQ  769
             GR+S       NI   +     +  +FA +GL L DLV LSGAHTIG +HCS+F++R + 
Sbjct  148   GRISNASEALANIPPPTSNFTNLQTLFANQGLDLRDLVLLSGAHTIGVSHCSSFTNRLYN  207

Query  770   LASNGSFLPIdaaldhayaaelaRQCPAGASDAVTVNNDPVTPSLFDNQYYKDLLAHRGL  949
                 G   P  A      A   +R+CP+   +   V  DP +   FD  YY+ +L  RGL
Sbjct  208   FTGRGDQDP--ALDSQYAANLKSRKCPSLNDNTTIVEMDPGSRKTFDLSYYQLVLKRRGL  265

Query  950   FQSDSALLRDKRAMEKV-QDFAGDQNNFFTSWEQSFLKLVSIGVKVGDDDGEIRRSCSSV  1126
             FQSDSAL  +   ++ + Q   G   +FF+ + +S  K+  I +K G   G +RR CS  
Sbjct  266   FQSDSALTTNPTTLQNINQILKGSVESFFSEFAKSMEKMGRINLKTG-SAGVVRRQCSIA  324

Query  1127  NA  1132
             N+
Sbjct  325   NS  326



>ref|XP_004984274.1| PREDICTED: peroxidase 2-like [Setaria italica]
Length=330

 Score =   229 bits (584),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 138/307 (45%), Positives = 181/307 (59%), Gaps = 24/307 (8%)
 Frame = +2

Query  245   FYAISCPSAELIVKNTVRSASSVDPTLPGKLLRLLFHDCFVEGCDASILL-----QGNDT  409
             +Y   CP AE IVK+ V +A   +P +   L+R+LFHDCFVEGCDAS+LL          
Sbjct  36    YYHEKCPHAEAIVKHVVGAAVRKNPGVGAGLIRMLFHDCFVEGCDASVLLDPTPANPQPE  95

Query  410   ERSDPANKSVGGFSTVDSAKRVLEIFCPETVSCADIIALAARDAVEFVGGPSVA--IPTG  583
             + S P N S+ GF  +D+AK  LE  CP  VSCADI+A AARDA  F+GG  V+  +P G
Sbjct  96    KLSPPNNPSLRGFEVIDAAKAALERACPGVVSCADIVAFAARDASAFLGGRGVSFDMPAG  155

Query  584   RRDGRVSLGKNVRPNIIDTSFTMDEMMKIFAAKGLSLDDLVTLSGAHTIGSAHCSAF-SD  760
             R DGR S+       +    FT+ E++  FAAKGL ++D+V LSGAHT+G +HCS+F  D
Sbjct  156   RLDGRASVASRALDFLPPPVFTLPELVASFAAKGLGVEDMVVLSGAHTVGRSHCSSFVPD  215

Query  761   RFQLAS--NGSFLPIdaaldhayaaelaRQCPA--GASDAVTVNNDPVTPSLFDNQYYKD  928
             R    S  N SF           AA L  QCPA   A +  TV  D VTP   DNQYYK+
Sbjct  216   RLAAPSDINPSF-----------AASLRGQCPASPSAGNDPTVVQDAVTPDALDNQYYKN  264

Query  929   LLAHRGLFQSDSALLRDKRAMEKVQDFAGDQNNFFTSWEQSFLKLVSIGVKVGDDDGEIR  1108
             +LAHR LF SD+ALL      + V D A     +   ++++ +K+ S+ VK G + GE+R
Sbjct  265   VLAHRVLFTSDAALLTSPETAKMVSDNANIPGWWEDRFKKAMVKMASVEVKTG-NHGEVR  323

Query  1109  RSCSSVN  1129
             R+C  VN
Sbjct  324   RNCRVVN  330



>ref|NP_001048793.1| Os03g0121200 [Oryza sativa Japonica Group]
 gb|ABF93699.1| Peroxidase family protein, expressed [Oryza sativa Japonica Group]
 dbj|BAF10707.1| Os03g0121200 [Oryza sativa Japonica Group]
 dbj|BAG96194.1| unnamed protein product [Oryza sativa Japonica Group]
Length=331

 Score =   229 bits (584),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 132/296 (45%), Positives = 182/296 (61%), Gaps = 8/296 (3%)
 Frame = +2

Query  245   FYAISCPSAELIVKNTVRSASSVDPTLPGKLLRLLFHDCFVEGCDASILL---QGNDTER  415
             +Y   CP+AE+IV+  V  A S +P +   L+RL FHDCFV GCDAS+LL   QGN  E+
Sbjct  35    YYDTLCPAAEIIVQEEVSKAVSGNPGMAAGLVRLHFHDCFVRGCDASVLLDSTQGNRAEK  94

Query  416   SDPANKSVGGFSTVDSAKRVLEIFCPETVSCADIIALAARDAVEFVGGPSVAIPTGRRDG  595
               P N S+ GF  +DSAK  LE  C   VSCAD++A AARDA+  VGG +  +P GRRDG
Sbjct  95    DAPPNTSLRGFEVIDSAKSRLETACFGVVSCADVLAFAARDALALVGGNAYQVPGGRRDG  154

Query  596   RVSLGKNVRPNIIDTSFTMDEMMKIFAAKGLSLDDLVTLSGAHTIGSAHCSAFSDRFQLA  775
              VS+ +    N+   S  + ++ ++F AKGL+  ++V LSGAHTIG +HCS+FS+R  L 
Sbjct  155   NVSVAQETNGNLPPPSANVAQLNQMFGAKGLTQAEMVALSGAHTIGVSHCSSFSNR--LY  212

Query  776   SNGSFLPIdaaldhayaaelaRQCP--AGASDAVTVNNDPVTPSLFDNQYYKDLLAHRGL  949
             S+G     D ++D +Y A L  QCP   G   A  V  D VTP+ FD  YY  ++A+RGL
Sbjct  213   SSGPNAGQDPSMDPSYVAALTTQCPQQQGQPAAGMVPMDAVTPNAFDTNYYAAIVANRGL  272

Query  950   FQSDSALLRDKRAMEKVQDFAGDQNNFFTSWEQSFLKLVSIGVKVGDDDGEIRRSC  1117
               SD ALL D+    +V  +  + ++F T +  + +K+ SIGV  G + G IR +C
Sbjct  273   LSSDQALLADQTTAAQVVGYTNNPDSFQTDFAAAMVKMGSIGVLTG-NAGTIRTNC  327



>ref|XP_010061689.1| PREDICTED: peroxidase 66-like [Eucalyptus grandis]
 gb|KCW90772.1| hypothetical protein EUGRSUZ_A02844 [Eucalyptus grandis]
Length=323

 Score =   229 bits (583),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 133/299 (44%), Positives = 182/299 (61%), Gaps = 9/299 (3%)
 Frame = +2

Query  242   NFYAISCPSAELIVKNTVRSASSVDPTLPGKLLRLLFHDCFVEGCDASILLQ---GNDTE  412
             ++Y  +CP AE I+  TV++A+  DP +P +LLR+ FHDCF+ GCDAS+LL    GN  E
Sbjct  31    HYYDQTCPQAEKIILQTVQNATRHDPKVPARLLRMFFHDCFIRGCDASLLLDSTPGNQAE  90

Query  413   RSDPANKSVGGFSTVDSAKRVLEIFCPETVSCADIIALAARDAVEFVGGPSVAIPTGRRD  592
             +  P N SV  F  +D AK  LE+ CP TVSCADIIA+AARD V   GGPS  +  GR+D
Sbjct  91    KDGPPNISVRAFYVIDDAKAKLEMACPHTVSCADIIAIAARDVVTMAGGPSWNVLKGRKD  150

Query  593   GRVSLGKNVRPNIIDTSFTMDEMMKIFAAKGLSLDDLVTLSGAHTIGSAHCSAFSDRFQL  772
             GRVS       N+   +F + ++++ FA +GL L DLV LSG HT+G +HCS+F  R  L
Sbjct  151   GRVSNASET-INLPAPTFNVTQLLQSFAERGLGLKDLVALSGGHTLGFSHCSSFDAR--L  207

Query  773   ASNGSFLPIdaaldhayaaelaRQCPAGASDAVTVNNDPVTPSLFDNQYYKDLLAHRGLF  952
              +  S   ID  L+HA+A  L  +CP    +         T S FDN YY+ L+A  G+F
Sbjct  208   RNFSSTHDIDPTLNHAFAQLLKNECPKPNRNRNAGQFLDATSSTFDNDYYRRLVAGEGVF  267

Query  953   QSDSALLRDKRAMEKVQDFAGDQNNFFTSWEQSFLKLVSIGVKVGDDDGEIRRSCSSVN  1129
              SD AL  D R    V  FA DQ+ FF+ +  S ++L ++GV+   ++GE+R  C +VN
Sbjct  268   GSDQALYSDYRTRWIVNLFAQDQSLFFSEFAASMVRLGNVGVR---ENGEVRIKCRAVN  323



>emb|CDY10037.1| BnaC08g44140D [Brassica napus]
Length=326

 Score =   229 bits (584),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 131/302 (43%), Positives = 176/302 (58%), Gaps = 7/302 (2%)
 Frame = +2

Query  239   FNFYAISCPSAELIVKNTVRSASSVDPTLPGKLLRLLFHDCFVEGCDASILLQGN--DTE  412
              NFYA +CP+AE IV++ V +  S  P+L   LLR+ FHDCFV GCD S+L+     + E
Sbjct  28    MNFYANTCPNAEKIVQDFVSNHISNAPSLAAALLRMHFHDCFVRGCDGSVLINSTSGNAE  87

Query  413   RSDPANKSVGGFSTVDSAKRVLEIFCPETVSCADIIALAARDAVEFVGGPSVAIPTGRRD  592
             +    N +V GF  +++ K VLE  CP  VSCADIIALA+RDAV F GGPS ++PTGRRD
Sbjct  88    KDATPNLTVRGFGFIEAIKTVLEAQCPGIVSCADIIALASRDAVVFTGGPSWSVPTGRRD  147

Query  593   GRVSLGKNVRPNIIDTSFTMDEMMKIFAAKGLSLDDLVTLSGAHTIGSAHCSAFSDR-FQ  769
             GR+S       NI   +     +  +FA +GL L DLV LSGAHTIG +HCS+F++R + 
Sbjct  148   GRISNASEALANIPPPTSNFTNLQTLFANQGLDLKDLVLLSGAHTIGVSHCSSFTNRLYN  207

Query  770   LASNGSFLPIdaaldhayaaelaRQCPAGASDAVTVNNDPVTPSLFDNQYYKDLLAHRGL  949
                 G   P  A      A   +R+CP+   +   V  DP +   FD  YY+ +L  RGL
Sbjct  208   FTGRGDQDP--ALDSQYAANLKSRKCPSLNDNTTIVEMDPGSRKTFDLSYYQLVLKRRGL  265

Query  950   FQSDSALLRDKRAMEKV-QDFAGDQNNFFTSWEQSFLKLVSIGVKVGDDDGEIRRSCSSV  1126
             FQSDSAL  +   +  + Q   G   +FF+ + +S  K+  I VK G   G +RR CS  
Sbjct  266   FQSDSALTTNPTTLSNINQLLKGSVESFFSEFAKSMEKMGRINVKTG-SAGVVRRQCSVA  324

Query  1127  NA  1132
             N+
Sbjct  325   NS  326



>ref|XP_002440543.1| hypothetical protein SORBIDRAFT_09g002810 [Sorghum bicolor]
 gb|EES18973.1| hypothetical protein SORBIDRAFT_09g002810 [Sorghum bicolor]
Length=333

 Score =   229 bits (584),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 142/304 (47%), Positives = 178/304 (59%), Gaps = 11/304 (4%)
 Frame = +2

Query  245   FYAISCPSAELIVKNTVRSASSVDPTLPGKLLRLLFHDCFVEGCDASILLQ---GNDTER  415
             FY  SCP AE IV+N VR   + D  +   L+R+ FHDCFV GCDASIL+    GN  E+
Sbjct  29    FYKHSCPKAEEIVRNAVRRGIARDAGVGAGLIRMQFHDCFVRGCDASILINSTPGNKAEK  88

Query  416   SDPANK-SVGGFSTVDSAKRVLEIFCPETVSCADIIALAARDAVEFVGGPSVAIPTGRRD  592
                AN  S+ GF  VD AK VLE  CP TVSCADIIA AARD     GG    +P+GRRD
Sbjct  89    DSVANNPSMRGFDVVDDAKAVLEAHCPRTVSCADIIAFAARDGAYLAGGLDYKVPSGRRD  148

Query  593   GRVSLGKNVRPNIIDTSF-TMDEMMKIFAAKGLSLDDLVTLSGAHTIGSAHCSAFSDRFQ  769
             GRVS    V  N +   F  + E++K F  KGL+ DD+VTLSGAHTIG +HCS+F+ R  
Sbjct  149   GRVSKEDEVLDNNVPAPFDDVAELIKSFKRKGLNADDMVTLSGAHTIGRSHCSSFTQRLY  208

Query  770   LASNGSFLPIdaaldhayaaelaRQCPA----GASDAVTVNNDPVTPSLFDNQYYKDLLA  937
               S G     D +LD  YA  L  +CP     G  D   V  DPVTP+ FDNQYYK++LA
Sbjct  209   NFS-GQLGRTDPSLDPTYAEHLKMRCPWPSSNGQMDTTVVPLDPVTPATFDNQYYKNVLA  267

Query  938   HRGLFQSDSALLRDKRAMEKVQDFAGDQNNFFTSWEQSFLKLVSIGVKVGDDDGEIRRSC  1117
             H+ LF SD+ LL +      V   A  +  +   + ++ +K+  + V  G D+GEIR  C
Sbjct  268   HKVLFVSDNTLLDNPWTAGMVHFNAAVEKAWQVKFAKAMVKMGKVQVLTG-DEGEIREKC  326

Query  1118  SSVN  1129
               VN
Sbjct  327   FVVN  330



>ref|XP_008234311.1| PREDICTED: peroxidase 66 [Prunus mume]
Length=324

 Score =   228 bits (582),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 129/299 (43%), Positives = 180/299 (60%), Gaps = 9/299 (3%)
 Frame = +2

Query  242   NFYAISCPSAELIVKNTVRSASSVDPTLPGKLLRLLFHDCFVEGCDASILLQ---GNDTE  412
             N+Y  +CP AE I+  TV +AS  D  +P ++LR+ FHDCF+ GCDAS+LL    GN  E
Sbjct  32    NYYHQTCPQAEKIILQTVYNASMHDSKIPARILRMFFHDCFIRGCDASLLLDSTPGNQAE  91

Query  413   RSDPANKSVGGFSTVDSAKRVLEIFCPETVSCADIIALAARDAVEFVGGPSVAIPTGRRD  592
             +  P N SV  F  +D AK  LE+ CP TVSCADII +AARD V   GGP   +  GR+D
Sbjct  92    KDGPPNISVRSFYVIDDAKAKLEMACPRTVSCADIIGIAARDVVTMSGGPYWNVLKGRKD  151

Query  593   GRVSLGKNVRPNIIDTSFTMDEMMKIFAAKGLSLDDLVTLSGAHTIGSAHCSAFSDRFQL  772
             GRVS   N   N+   +F + ++++ FA +GL + +LV LSG HT+G +HCS+F  R  L
Sbjct  152   GRVSRA-NETINLPAPTFNVSQLIQSFAKRGLGVKELVALSGGHTLGFSHCSSFESR--L  208

Query  773   ASNGSFLPIdaaldhayaaelaRQCPAGASDAVTVNNDPVTPSLFDNQYYKDLLAHRGLF  952
              +  S   +D ++++ +A +L ++CP    D         T S FDN YYK ++A +G+F
Sbjct  209   RNFTSLHDVDPSMNNEFAQKLRKKCPKPNRDRTAGELLDSTSSTFDNDYYKHVVAGKGVF  268

Query  953   QSDSALLRDKRAMEKVQDFAGDQNNFFTSWEQSFLKLVSIGVKVGDDDGEIRRSCSSVN  1129
              SD AL  D R    V+ FA DQ+ FF  +  S +KL  +GV    +DGE+R +C  VN
Sbjct  269   GSDQALFSDYRTRWIVESFAEDQSLFFKEFAASMVKLGKVGVI---EDGEVRLNCRVVN  324



>ref|XP_010911662.1| PREDICTED: peroxidase 5-like [Elaeis guineensis]
Length=321

 Score =   228 bits (582),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 133/303 (44%), Positives = 182/303 (60%), Gaps = 10/303 (3%)
 Frame = +2

Query  245   FYAISCPSAELIVKNTVRSASSVDPTLPGKLLRLLFHDCFVEGCDASILLQ---GNDTER  415
             FY  +CPSAE IV+ TV  A + +P     L+R+ FHDCFV GCDAS+LL    GN +E+
Sbjct  22    FYEKTCPSAEAIVRETVSQAIAKNPGFAAGLIRMHFHDCFVRGCDASVLLNSTPGNPSEK  81

Query  416   -SDPANKSVGGFSTVDSAKRVLEIFCPETVSCADIIALAARDAVEFVGGPSVAIPTGRRD  592
              + P N S+ GF  +++AK  +E  CP  VSCADIIA AARD+    GG    +P GRRD
Sbjct  82    EAPPNNPSLRGFEVINAAKAAVEAKCPCKVSCADIIAFAARDSAYITGGIDYEVPAGRRD  141

Query  593   GRVSLGKNVRPNIIDTSFTMDEMMKIFAAKGLSLDDLVTLSGAHTIGSAHCSAFSDRFQL  772
             GR+SL      NI   +FT D++ + F  KGL+LD++VTLSGAH+IG +HCS+F+ R  L
Sbjct  142   GRISLASEALDNIPFPTFTADKLKESFERKGLTLDEMVTLSGAHSIGRSHCSSFTTR--L  199

Query  773   ASNGSFLPIdaaldhayaaelaRQCP---AGASDAVTVNNDPVTPSLFDNQYYKDLLAHR  943
              +  +  P D +++ A+AA L  +CP   A  +D  TV  D VTP+  DN YY++LL HR
Sbjct  200   YNFSATHPQDPSMEPAFAAYLKTRCPPSTASPTDPTTVLLDAVTPTRLDNMYYRNLLKHR  259

Query  944   GLFQSDSALLRDKRAMEKVQDFAGDQNNFFTSWEQSFLKLVSIGVKVGDDDGEIRRSCSS  1123
             G+  SD  L       + V   A  Q+ +   +  + +K+ SI V  G   GEIR  C  
Sbjct  260   GVLTSDQTLQESSETTKHVWYNAKHQSAWAAKFASAMVKMGSIEVLTG-SQGEIREKCWV  318

Query  1124  VNA  1132
             VN+
Sbjct  319   VNS  321



>ref|XP_010693447.1| PREDICTED: peroxidase 66-like [Beta vulgaris subsp. vulgaris]
Length=323

 Score =   228 bits (582),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 127/303 (42%), Positives = 176/303 (58%), Gaps = 17/303 (6%)
 Frame = +2

Query  242   NFYAISCPSAELIVKNTVRSASSVDPTLPGKLLRLLFHDCFVEGCDASILLQ---GNDTE  412
             ++Y  +CP AE I+  T+R+AS  DP +P +LLR+ FHDCF+ GCDASILL    GN  E
Sbjct  31    HYYDQTCPQAEYIIAQTIRNASIYDPKVPARLLRMFFHDCFIRGCDASILLDSTPGNKAE  90

Query  413   RSDPANKSVGGFSTVDSAKRVLEIFCPETVSCADIIALAARDAVEFVGGPSVAIPTGRRD  592
             +  P N SV  F  ++ AK  LE  CP TVSCADIIA+AARD V   GGP   +  GR+D
Sbjct  91    KDGPPNISVRAFYVIEDAKAKLEKACPHTVSCADIIAMAARDVVTMTGGPFWNVLKGRKD  150

Query  593   GRVSLG---KNVRPNIIDTSFTMDEMMKIFAAKGLSLDDLVTLSGAHTIGSAHCSAFSDR  763
             GRVS      N+ P  ++ +    ++++ FA +GL + DLV LSG HT+G +HCS+F  R
Sbjct  151   GRVSKATDTTNLPPAFLNAT----QLIQTFAKRGLGIKDLVALSGGHTLGFSHCSSFVAR  206

Query  764   FQLASNGSFLPIdaaldhayaaelaRQ-CPAGASDAVTVNNDPVTPSLFDNQYYKDLLAH  940
                  N S +       +   A + RQ CP   ++         T S FDN YYK ++A 
Sbjct  207   VH---NFSIVHYTDPSMNPEFASMLRQKCPRSNNNGDAGQFLDSTASQFDNIYYKQIIAR  263

Query  941   RGLFQSDSALLRDKRAMEKVQDFAGDQNNFFTSWEQSFLKLVSIGVKVGDDDGEIRRSCS  1120
             +G+F +D  +  D R    ++ FA +QN FF  +  S +KL ++GVK   + GE+R SC 
Sbjct  264   KGVFGTDQVMYDDPRTRWMIEAFANNQNLFFKEFAASMIKLGNVGVK---EVGEVRLSCG  320

Query  1121  SVN  1129
              VN
Sbjct  321   RVN  323



>ref|NP_001136740.1| uncharacterized protein LOC100216881 precursor [Zea mays]
 gb|ACF82515.1| unknown [Zea mays]
 gb|AFW72903.1| hypothetical protein ZEAMMB73_932177 [Zea mays]
Length=337

 Score =   229 bits (583),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 144/308 (47%), Positives = 184/308 (60%), Gaps = 14/308 (5%)
 Frame = +2

Query  242   NFYAISCPSAELIVKNTVRSASSVDPTLPGKLLRLLFHDCFVEGCDASILL-----QGND  406
              FY  SCP AE IV+N VR A + DP L   L+R+ FHDCFV GCDASILL     Q +D
Sbjct  30    GFYEHSCPQAEDIVRNAVRRAVARDPGLAAGLIRMHFHDCFVRGCDASILLDSAPGQQHD  89

Query  407   TERSDPAN-KSVGGFSTVDSAKRVLEIFCPETVSCADIIALAARDAVEFVGGPSVAIPTG  583
             TE+  PAN +S+ GF  +D AK V+E  CP TVSCADI+A AARD     GG    +P G
Sbjct  90    TEKYSPANFQSLRGFEVIDEAKAVVEEHCPRTVSCADIVAFAARDGAYLAGGIDYRVPAG  149

Query  584   RRDGRVSLGKNVRP--NIIDTSFTMDEMMKIFAAKGLSLDDLVTLSGAHTIGSAHCSAFS  757
             RRDGRVS+   V    N+    FT+ E+++ F  KGLS DD+VTLSGAH+IG +HCS+ +
Sbjct  150   RRDGRVSVKDEVLEDGNLPFPEFTVAELIENFRRKGLSADDMVTLSGAHSIGRSHCSSIT  209

Query  758   DRFQLASNGSFLPIdaaldhayaaelaRQCPAGA----SDAVTVNNDPVTPSLFDNQYYK  925
             DR   +  G     D AL  AYAA+L R+CP        D  TV  D VTP+ FDNQY+K
Sbjct  210   DRL-YSFQGEPGRTDPALHPAYAADLKRRCPPSTDGDMEDRTTVPLDTVTPNAFDNQYFK  268

Query  926   DLLAHRGLFQSDSALLRDKRAMEKVQDFAGDQNNFFTSWEQSFLKLVSIGVKVGDDDGEI  1105
             ++L H+  F SD  LL        V   A     +   + ++ +K+ +I V  G  +GEI
Sbjct  269   NVLEHKVPFTSDQTLLDSPWTAGLVAFHAAVGQAWEAKFAKAMVKMGAIEVLTG-YEGEI  327

Query  1106  RRSCSSVN  1129
             R+ CS VN
Sbjct  328   RQKCSMVN  335



>gb|ABK21900.1| unknown [Picea sitchensis]
Length=333

 Score =   228 bits (582),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 134/302 (44%), Positives = 180/302 (60%), Gaps = 10/302 (3%)
 Frame = +2

Query  242   NFYAISCPSAELIVKNTV-RSASSVDPTLPGKLLRLLFHDCFVEGCDASILLQ---GNDT  409
             NFYA  CP+ E IV+N V +  S    T+PG L RL FHDCFVEGCDAS+++Q    N  
Sbjct  36    NFYAKICPNVESIVRNAVSQKFSQTFVTVPGTL-RLFFHDCFVEGCDASVIIQSTSNNTA  94

Query  410   ERSDPANKSVGG--FSTVDSAKRVLEIFCPETVSCADIIALAARDAVEFVGGPSVAIPTG  583
             E+    N S+ G  F TV  AK+ +E  CP TVSCADI+ +AARD V   GGP   +  G
Sbjct  95    EKDFSDNLSLAGDGFDTVVKAKQAVEKVCPNTVSCADILTMAARDVVALAGGPQFNVELG  154

Query  584   RRDGRVSLGKNVRPNIIDTSFTMDEMMKIFAAKGLSLDDLVTLSGAHTIGSAHCSAFSDR  763
             RRDG +S    V  N+   SFT++++  +FA+KGLS  D+V LSGAHT+G +HC+  S+R
Sbjct  155   RRDGLISQASRVSGNLPKASFTLNQLNFLFASKGLSQTDMVALSGAHTLGFSHCNQISNR  214

Query  764   FQLASNGSFLPIdaaldhayaaelaRQCPAGASDAVTVNNDPVTPSLFDNQYYKDLLAHR  943
               + S  +  P+D +L+ +YA +L + CP      + +N DP TP  FDN YY++L + +
Sbjct  215   --IYSFSASTPVDPSLNPSYATQLQQMCPKNVDPTIAINIDPTTPRQFDNVYYQNLQSGK  272

Query  944   GLFQSDSALLRDKRAMEKVQDFAGDQNNFFTSWEQSFLKLVSIGVKVGDDDGEIRRSCSS  1123
             GLF SD  L  D R    V  FA     F T++  +   L  +GVK G   GEIR+ CS 
Sbjct  273   GLFSSDEVLYTDLRTRNAVNTFAQSSGAFNTAFVNAMRNLGRVGVKTG-FQGEIRQDCSR  331

Query  1124  VN  1129
              N
Sbjct  332   FN  333



>ref|XP_008781197.1| PREDICTED: peroxidase 5-like [Phoenix dactylifera]
Length=334

 Score =   228 bits (582),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 136/303 (45%), Positives = 179/303 (59%), Gaps = 10/303 (3%)
 Frame = +2

Query  245   FYAISCPSAELIVKNTVRSASSVDPTLPGKLLRLLFHDCFVEGCDASILLQ---GNDTER  415
             FY  +CPSAE IV+ TV  A   +P     L+R+ FHDCFV GCDAS+LL    GN +E+
Sbjct  35    FYEETCPSAETIVRETVSQAIVRNPGFAAGLIRMHFHDCFVRGCDASVLLNSTSGNPSEK  94

Query  416   SDPANK-SVGGFSTVDSAKRVLEIFCPETVSCADIIALAARDAVEFVGGPSVAIPTGRRD  592
               P N  S+ GF  +D+AK  +E  CP  VSCADIIA AARD+    GG    +P GRRD
Sbjct  95    EAPPNNPSLRGFEVIDAAKAAVEAKCPRKVSCADIIAFAARDSAYLAGGIDYQVPAGRRD  154

Query  593   GRVSLGKNVRPNIIDTSFTMDEMMKIFAAKGLSLDDLVTLSGAHTIGSAHCSAFSDRFQL  772
             GR+SL      NI   SFT D++ + F  KGLSL+++VTLSGAH+IG +HCS+F+ R  L
Sbjct  155   GRISLSSEALDNIPFPSFTADKLKENFERKGLSLNEMVTLSGAHSIGRSHCSSFTTR--L  212

Query  773   ASNGSFLPIdaaldhayaaelaRQCP---AGASDAVTVNNDPVTPSLFDNQYYKDLLAHR  943
              +  +  P D +++ A AA L  +CP   A  SD  TV  D VTP+  DN YY++LL HR
Sbjct  213   YNFSATHPQDPSMEPALAAYLKARCPPSTASLSDPTTVLLDSVTPTCLDNLYYRNLLKHR  272

Query  944   GLFQSDSALLRDKRAMEKVQDFAGDQNNFFTSWEQSFLKLVSIGVKVGDDDGEIRRSCSS  1123
             G+  SD  L       + V   A  Q+ +   +  + +K+ SI V  G   GEIR  C  
Sbjct  273   GVLTSDQTLQDSSETTKLVWYNAKHQSAWAAKFASAMVKMGSIEVLTG-SQGEIREKCWV  331

Query  1124  VNA  1132
             VN+
Sbjct  332   VNS  334



>ref|XP_010069738.1| PREDICTED: peroxidase 5-like [Eucalyptus grandis]
Length=335

 Score =   228 bits (582),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 140/300 (47%), Positives = 181/300 (60%), Gaps = 8/300 (3%)
 Frame = +2

Query  245   FYAISCPSAELIVKNTVRSASSVDPTLPGKLLRLLFHDCFVEGCDASILL---QGNDTER  415
             FY  +CP AE IV+ T+  A S DP L    LR+ FHDCFV GCDASILL   +GN  E+
Sbjct  39    FYKYTCPPAEAIVRATLYEAFSSDPGLAADFLRMYFHDCFVRGCDASILLNSTKGNTAEK  98

Query  416   SDPANK-SVGGFSTVDSAKRVLEIFCPETVSCADIIALAARDAVEFVGGPSVAIPTGRRD  592
               P N  S+ GF  +D AK  LE  CP TVSCADIIA AARD+V   G     +P+GRRD
Sbjct  99    DSPVNNPSLEGFDVIDQAKARLEAACPRTVSCADIIAFAARDSVFKAGRIYYDVPSGRRD  158

Query  593   GRVSLGKNVRPNIIDTSFTMDEMMKIFAAKGLSLDDLVTLSGAHTIGSAHCSAFSDRFQL  772
             GR+S    V  N+   +FT+ +++  FA KG S+D++VTLSGAH+IGS+HCS+FS+R  L
Sbjct  159   GRISRASEVIQNLPPPTFTVPQLIANFARKGFSMDEMVTLSGAHSIGSSHCSSFSNR--L  216

Query  773   ASNGSFLPIdaaldhayaaelaRQCPAGASDA-VTVNNDPVTPSLFDNQYYKDLLAHRGL  949
              S  +    D  LD  YAA L  +CP G S     V  D +TP+  DN+YY+ LL +RGL
Sbjct  217   YSFNATHKQDPLLDPKYAAFLKTKCPQGNSKTDPKVALDSITPNTLDNKYYQQLLTYRGL  276

Query  950   FQSDSALLRDKRAMEKVQDFAGDQNNFFTSWEQSFLKLVSIGVKVGDDDGEIRRSCSSVN  1129
             F SD AL   K     V + A     +   + ++ +KL S+ V  G   GEIR+ C +VN
Sbjct  277   FSSDEALYTSKLTKGMVLNNAKYGRVWGPKFVKAMVKLGSLDVLTG-QQGEIRKVCGAVN  335



>ref|XP_007219444.1| hypothetical protein PRUPE_ppa020970mg [Prunus persica]
 gb|EMJ20643.1| hypothetical protein PRUPE_ppa020970mg [Prunus persica]
Length=304

 Score =   227 bits (579),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 129/299 (43%), Positives = 180/299 (60%), Gaps = 9/299 (3%)
 Frame = +2

Query  242   NFYAISCPSAELIVKNTVRSASSVDPTLPGKLLRLLFHDCFVEGCDASILLQ---GNDTE  412
             N+Y  +CP AE I+  TV +A   DP +P ++LR+ FHDCF+ GCDAS+LL    GN  E
Sbjct  12    NYYHQTCPQAEKIILQTVYNAFMHDPKIPARILRMFFHDCFIRGCDASLLLDSTPGNQAE  71

Query  413   RSDPANKSVGGFSTVDSAKRVLEIFCPETVSCADIIALAARDAVEFVGGPSVAIPTGRRD  592
             +  P N SV  F  +D AK  LE+ CP TVSCADII +AARD V   GGP   +  GR+D
Sbjct  72    KDGPPNISVRSFYVIDDAKAKLEMACPRTVSCADIIGIAARDVVTMSGGPYWNVLKGRKD  131

Query  593   GRVSLGKNVRPNIIDTSFTMDEMMKIFAAKGLSLDDLVTLSGAHTIGSAHCSAFSDRFQL  772
             GRVS   N   N+   +F + ++++ FA +GL + +LV LSG HT+G +HCS+F  R  L
Sbjct  132   GRVSRA-NETINLPAPTFNVSQLIQSFARRGLGVKELVALSGGHTLGFSHCSSFESR--L  188

Query  773   ASNGSFLPIdaaldhayaaelaRQCPAGASDAVTVNNDPVTPSLFDNQYYKDLLAHRGLF  952
              +  S   +D ++++ +A +L ++CP    D         T S FDN YYK ++A +G+F
Sbjct  189   RNFTSLHDVDPSMNNEFAQKLRKKCPKPNRDRTAGELLDSTSSTFDNDYYKQVVAGKGVF  248

Query  953   QSDSALLRDKRAMEKVQDFAGDQNNFFTSWEQSFLKLVSIGVKVGDDDGEIRRSCSSVN  1129
              SD AL  D R    V+ FA DQ+ FF  +  S +KL + GV    +DGE+R +C  VN
Sbjct  249   GSDQALFSDYRTRWIVESFAEDQSLFFKEFAASMVKLGNAGVI---EDGEVRLNCRVVN  304



>ref|XP_007153059.1| hypothetical protein PHAVU_003G003100g [Phaseolus vulgaris]
 gb|ESW25053.1| hypothetical protein PHAVU_003G003100g [Phaseolus vulgaris]
Length=330

 Score =   228 bits (581),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 139/302 (46%), Positives = 185/302 (61%), Gaps = 11/302 (4%)
 Frame = +2

Query  245   FYAISCPSAELIVKNTVRSASSVDPTLPGKLLRLLFHDCFVEGCDASILLQ---GNDTER  415
             FY+ +CPSAE IVK+TV  A S +P L   L+R+ FHDCFV GCD S+LL    GN    
Sbjct  33    FYSFTCPSAEAIVKSTVEKAISANPGLAAGLIRMHFHDCFVRGCDGSVLLASIPGNPIAE  92

Query  416   SDP--ANKSVGGFSTVDSAKRVLEIFCPETVSCADIIALAARDAVEFVGGPSVAIPTGRR  589
              D    N S+ GF  ++ AK+ +E  CP TVSCADI+A AARD+   VG  +  +P+GRR
Sbjct  93    RDSFINNPSLRGFEVIEEAKKQVEAACPNTVSCADILAFAARDSASKVGAINYDVPSGRR  152

Query  590   DGRVSLGKNVRPNIIDTSFTMDEMMKIFAAKGLSLDDLVTLSGAHTIGSAHCSAFSDRFQ  769
             DGRVS+G  V  N+    F +DE++  FA KGLS+D++VTLSGAH+IG AHC AFS+R  
Sbjct  153   DGRVSIGDEVIQNLPGPGFVVDELIGNFAQKGLSVDEMVTLSGAHSIGVAHCGAFSNR--  210

Query  770   LASNGSFLPIdaaldhayaaelaRQCPAGA--SDAVTVNNDPVTPSLFDNQYYKDLLAHR  943
             L S    L  D +LD +YA  L   CP     +DA+ V+ +P TP   D++YY+ L+ HR
Sbjct  211   LYSFSDTLRQDPSLDPSYAETLKAMCPPPPPITDAI-VSLEPSTPIRLDSKYYEGLINHR  269

Query  944   GLFQSDSALLRDKRAMEKVQDFAGDQNNFFTSWEQSFLKLVSIGVKVGDDDGEIRRSCSS  1123
             GL  SD  L       E V+  A +  N+   +  + +++ SI V  G  DGEIR+ CS 
Sbjct  270   GLLTSDQTLFDTPSTKEIVESNAYNGANWAQKFALAMVRMGSIQVLTG-SDGEIRKQCSF  328

Query  1124  VN  1129
             VN
Sbjct  329   VN  330



>emb|CDY46845.1| BnaA10g03290D [Brassica napus]
Length=326

 Score =   228 bits (581),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 129/302 (43%), Positives = 175/302 (58%), Gaps = 7/302 (2%)
 Frame = +2

Query  239   FNFYAISCPSAELIVKNTVRSASSVDPTLPGKLLRLLFHDCFVEGCDASILLQGN--DTE  412
              NFYA +CP+AE IV++ V +  S  P+L   LLR+ FHDCFV GCD S+L+     + E
Sbjct  28    MNFYANTCPNAEKIVQDFVSNHISNAPSLAAALLRMHFHDCFVRGCDGSVLINSTSGNAE  87

Query  413   RSDPANKSVGGFSTVDSAKRVLEIFCPETVSCADIIALAARDAVEFVGGPSVAIPTGRRD  592
             +    N +V GF  +++ K VLE  CP  VSCADIIALA+RDA+ F GGP+ ++PTGRRD
Sbjct  88    KDAAPNLTVRGFGFIEAIKAVLEAQCPGIVSCADIIALASRDAIVFTGGPNWSVPTGRRD  147

Query  593   GRVSLGKNVRPNIIDTSFTMDEMMKIFAAKGLSLDDLVTLSGAHTIGSAHCSAFSDR-FQ  769
             GR+S       NI   +     +  +FA +GL L DLV LSGAHTIG +HCS+F++R + 
Sbjct  148   GRISNASEALANIPPPTSNFTNLQTLFANQGLDLKDLVLLSGAHTIGVSHCSSFTNRLYN  207

Query  770   LASNGSFLPIdaaldhayaaelaRQCPAGASDAVTVNNDPVTPSLFDNQYYKDLLAHRGL  949
                 G   P  A      A   +R+CP+   +   V  DP +   FD  YY+ LL  RGL
Sbjct  208   FTGRGDQDP--ALDSEYAANLKSRKCPSLKDNTTIVEMDPGSRKTFDLSYYQLLLKRRGL  265

Query  950   FQSDSALLRDKRAMEKV-QDFAGDQNNFFTSWEQSFLKLVSIGVKVGDDDGEIRRSCSSV  1126
             FQSDSAL  +   +  + Q   G    FF+ + +S  K+  I VK G   G +R+ CS  
Sbjct  266   FQSDSALTTNPTTLSNINQILKGSVEGFFSEFAKSMEKMGRINVKTG-SSGVVRKQCSVA  324

Query  1127  NA  1132
             N+
Sbjct  325   NS  326



>ref|XP_009408351.1| PREDICTED: peroxidase 55-like [Musa acuminata subsp. malaccensis]
Length=325

 Score =   228 bits (580),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 128/301 (43%), Positives = 177/301 (59%), Gaps = 9/301 (3%)
 Frame = +2

Query  242   NFYAISCPSAELIVKNTV-RSASSVDPTLPGKLLRLLFHDCFVEGCDASILLQG--NDTE  412
             NFY  +CP  E IV+  V +       T+P  L RL FHDCFVEGCDAS+L+     D E
Sbjct  29    NFYQFTCPKVESIVRQAVLKKVRQTFVTVPATL-RLFFHDCFVEGCDASVLIASPRGDAE  87

Query  413   RSDPANKSVGG--FSTVDSAKRVLEIFCPETVSCADIIALAARDAVEFVGGPSVAIPTGR  586
             +  P N S+ G  F TV  AK+ +E  CP  VSCAD++A+AARD V   GGPS  +  GR
Sbjct  88    KDAPDNLSLAGDGFDTVIKAKQAVEARCPGVVSCADVLAIAARDVVVLSGGPSFTVELGR  147

Query  587   RDGRVSLGKNVRPNIIDTSFTMDEMMKIFAAKGLSLDDLVTLSGAHTIGSAHCSAFSDRF  766
             RDG +S  + V  ++    F ++ +  +F    L+  D++ LSGAHT+G +HCS F+ R 
Sbjct  148   RDGLISQARRVAGHLPGPDFNLNILANLFRMNNLTTHDMIALSGAHTVGFSHCSRFAKR-  206

Query  767   QLASNGSFLPIdaaldhayaaelaRQCPAGASDAVTVNNDPVTPSLFDNQYYKDLLAHRG  946
              L + G   P+D + +  YA  L R CP      + VN DP TP++FDN YY++LL   G
Sbjct  207   -LYAFGPSSPVDPSFNLPYAQLLMRACPRDVGPTIAVNMDPFTPTVFDNVYYRNLLKGEG  265

Query  947   LFQSDSALLRDKRAMEKVQDFAGDQNNFFTSWEQSFLKLVSIGVKVGDDDGEIRRSCSSV  1126
             LF SD  L  +  +   V+ FA DQ++FF ++  S +KL  +GVK G   GEIR+ C++ 
Sbjct  266   LFTSDQVLFSNLLSRPVVKKFAADQSSFFRAFAASMVKLGRVGVKTG-HQGEIRKDCTAF  324

Query  1127  N  1129
             N
Sbjct  325   N  325



>ref|XP_010921347.1| PREDICTED: peroxidase 5-like [Elaeis guineensis]
Length=321

 Score =   228 bits (580),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 133/303 (44%), Positives = 181/303 (60%), Gaps = 10/303 (3%)
 Frame = +2

Query  245   FYAISCPSAELIVKNTVRSASSVDPTLPGKLLRLLFHDCFVEGCDASILLQ---GNDTER  415
             FY  +CPSAE IV+ TV  A + +P     L+R+ FHDCFV GCDAS+LL    GN +E+
Sbjct  22    FYGETCPSAEAIVRETVSQAIAKNPGFAAGLIRMHFHDCFVRGCDASVLLNSTPGNPSEK  81

Query  416   -SDPANKSVGGFSTVDSAKRVLEIFCPETVSCADIIALAARDAVEFVGGPSVAIPTGRRD  592
              + P N ++ GF  +D+AK  +E  CP  VSCADIIA AARD+    GG    +P GRRD
Sbjct  82    EAPPNNPTLRGFEVIDAAKAAVEAKCPRKVSCADIIAFAARDSAYITGGMDYEVPAGRRD  141

Query  593   GRVSLGKNVRPNIIDTSFTMDEMMKIFAAKGLSLDDLVTLSGAHTIGSAHCSAFSDRFQL  772
             GR+SL      NI   +FT D++ + F  KGLSLD++VTLSGAH+IG +HCS+F+ R  L
Sbjct  142   GRISLASEALDNIPFPTFTADKLKENFERKGLSLDEMVTLSGAHSIGRSHCSSFTTR--L  199

Query  773   ASNGSFLPIdaaldhayaaelaRQCP---AGASDAVTVNNDPVTPSLFDNQYYKDLLAHR  943
              +  +  P D +++ A+AA L  +CP   A  SD  TV  D VTP+  DN YY++LL HR
Sbjct  200   YNFSATHPQDPSMEPAFAAYLKARCPPSTASLSDPTTVLLDAVTPTRLDNIYYRNLLKHR  259

Query  944   GLFQSDSALLRDKRAMEKVQDFAGDQNNFFTSWEQSFLKLVSIGVKVGDDDGEIRRSCSS  1123
             G+  SD  L       + V   A  Q+ +   +  + +K+ SI V  G   G+IR  C  
Sbjct  260   GVLTSDQTLQESSETAKHVWYNAKHQSAWAAKFASAMVKMGSIEVLTG-SQGKIREKCWV  318

Query  1124  VNA  1132
              N+
Sbjct  319   ANS  321



>ref|XP_007216155.1| hypothetical protein PRUPE_ppa015245mg [Prunus persica]
 gb|EMJ17354.1| hypothetical protein PRUPE_ppa015245mg [Prunus persica]
Length=310

 Score =   227 bits (578),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 134/302 (44%), Positives = 179/302 (59%), Gaps = 11/302 (4%)
 Frame = +2

Query  242   NFYAISCPSAELIVKNTVRSASSVDPTLPGKLLRLLFHDCFVEGCDASILLQ--GNDTER  415
             NFY+ +CP+ E IVK  V +  S  P      LRL FHDCFVEGCDAS+++     D E+
Sbjct  15    NFYSSTCPNVEFIVKQAVSTKLSQTPITIPATLRLFFHDCFVEGCDASVMIASPNGDAEK  74

Query  416   SDPANKSVGG--FSTVDSAKRVLEIFCPETVSCADIIALAARDAVEFVGGPSVAIPTGRR  589
                 N S+ G  F TV  AK+ +E  CP  VSCADI+ALAARD V   GGP+ ++  GRR
Sbjct  75    DFSDNLSLAGDGFDTVIKAKQAVEALCPGVVSCADILALAARDCVVLAGGPAFSVELGRR  134

Query  590   DGRVSLGKNVRPNIIDTSFTMDEMMKIFAAKGLSLDDLVTLSGAHTIGSAHCSAFSDR-F  766
             DG VS    V  N+ + +F +D++  +FA   LS  D+V LSGAHT+G +HC  FSDR +
Sbjct  135   DGLVSQASQVVGNLPEPNFNLDQLNTMFAKHNLSQTDVVALSGAHTVGFSHCGRFSDRLY  194

Query  767   QLASNGSFLPIdaaldhayaaelaRQCPAGASDAVTVNNDPVTPSLFDNQYYKDLLAHRG  946
               +SN    P+D +LD  YA +L   CP  A     +N DP TP  FDN YY++L+A +G
Sbjct  195   NFSSNS---PVDPSLDPGYAKQLMGACPINADQ--VINLDPETPDTFDNAYYRNLVAGKG  249

Query  947   LFQSDSALLRDKRAMEKVQDFAGDQNNFFTSWEQSFLKLVSIGVKVGDDDGEIRRSCSSV  1126
             L  SD  L  D  +   V DFA +  NF  ++  +  KL  +GVK G D G+IR  C++ 
Sbjct  250   LLSSDQVLFSDSASRPTVIDFANNPGNFNGAFITAMRKLGRVGVKTG-DQGQIRTDCTTF  308

Query  1127  NA  1132
             N+
Sbjct  309   NS  310



>ref|XP_009107004.1| PREDICTED: peroxidase 66 [Brassica rapa]
Length=322

 Score =   227 bits (579),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 133/302 (44%), Positives = 187/302 (62%), Gaps = 14/302 (5%)
 Frame = +2

Query  242   NFYAISCPSAELIVKNTVRSASSVDPTLPGKLLRLLFHDCFVEGCDASILL---QGNDTE  412
             ++Y  SCP+AE ++  TV+ A   DP +  +LLR+ FHDCF+ GCDASILL   + N  E
Sbjct  29    HYYDRSCPAAEKVILETVKKAILHDPKVHARLLRMFFHDCFIRGCDASILLDSTKSNQAE  88

Query  413   RSDPANKSVGGFSTVDSAKRVLEIFCPETVSCADIIALAARDAVEFVGGPSVAIPTGRRD  592
             +  P N SV  F  +D+AK  LE  CP TVSCAD+IA+AARD V   GGP  ++  GR+D
Sbjct  89    KDGPPNISVRSFYVIDNAKTKLEKVCPRTVSCADVIAIAARDVVTLSGGPYWSVLKGRKD  148

Query  593   GRVSLGKNVRPNIIDTSFTMDEMMKIFAAKGLSLDDLVTLSGAHTIGSAHCSAFSDRFQL  772
             GR+S   N   N+   +F + ++++ FAA+GLS+ D+VTLSG HTIG +HCS+F  R  L
Sbjct  149   GRMSRA-NETINLPGPTFNVSQLIQSFAARGLSVKDMVTLSGGHTIGFSHCSSFEAR--L  205

Query  773   ASNGSFLPIdaaldhayaaelaRQCPAG---ASDAVTVNNDPVTPSLFDNQYYKDLLAHR  943
              +   F  ID +++ A+A  L ++CP       +A T  +   T S+FDN YYK +L+ +
Sbjct  206   HNFSKFHDIDPSMNFAFAQSLKKKCPISNNRGKNAGTFLDS--TTSVFDNDYYKQILSRK  263

Query  944   GLFQSDSALLRDKRAMEKVQDFAGDQNNFFTSWEQSFLKLVSIGVKVGDDDGEIRRSCSS  1123
             G+F SD ALL D R    V+ +A DQ  FF  +  S +KL + GVK   + GE+R +   
Sbjct  264   GVFGSDQALLGDYRTRWIVETYARDQKAFFREFATSMVKLGNFGVK---ETGEVRVNPRF  320

Query  1124  VN  1129
             VN
Sbjct  321   VN  322



>gb|ACN60162.1| peroxidase [Tamarix hispida]
Length=324

 Score =   227 bits (579),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 127/299 (42%), Positives = 172/299 (58%), Gaps = 11/299 (4%)
 Frame = +2

Query  245   FYAISCPSAELIVKNTVRSASSVDPTLPGKLLRLLFHDCFVEGCDASILLQG---NDTER  415
             +Y  +CP AE I+  TV +AS  DP    +LLRL FHDCF+ GCDAS+LL     N  E+
Sbjct  32    YYDTTCPQAEQIIAETVLNASMHDPKAAARLLRLFFHDCFIRGCDASVLLDSTLQNKAEK  91

Query  416   SDPANKSVGGFSTVDSAKRVLEIFCPETVSCADIIALAARDAVEFVGGPSVAIPTGRRDG  595
               P N S+  F  +D AK  LE  CP TVSCADIIA+ ARD V   GGP  ++  GR+DG
Sbjct  92    DGPPNMSLAAFYVIDDAKAKLEKACPHTVSCADIIAITARDVVTMNGGPYWSVLKGRKDG  151

Query  596   RVSLGKNVRPNIIDTSFTMDEMMKIFAAKGLSLDDLVTLSGAHTIGSAHCSAFSDRFQLA  775
             RVS     R N+   SF   ++++ FA +GL + D+V LSG HT+G +HCS+F  R    
Sbjct  152   RVSRAYETR-NLPPPSFNTTQLIQTFAKRGLGVKDMVALSGGHTVGFSHCSSFVPRIH--  208

Query  776   SNGSFLPIdaaldhayaaelaRQ-CPAGASDAVTVNNDPVTPSLFDNQYYKDLLAHRGLF  952
              N S +       +   A+  +Q CP+   +         T S FDN YYK +LA +G+ 
Sbjct  209   -NFSLMHTVDPSMNQEFAQTLKQKCPSPNKNGDAGQFLDSTASKFDNDYYKQILAGKGVL  267

Query  953   QSDSALLRDKRAMEKVQDFAGDQNNFFTSWEQSFLKLVSIGVKVGDDDGEIRRSCSSVN  1129
              SD  L  D R    V+ FA D+N+FFT +  S +KL ++GVK   ++GE+R +C  VN
Sbjct  268   LSDQTLYGDLRRRGFVESFAKDENSFFTEFADSMVKLGNVGVK---EEGEVRLNCRVVN  323



>ref|XP_009119172.1| PREDICTED: peroxidase 3-like [Brassica rapa]
Length=326

 Score =   227 bits (579),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 129/302 (43%), Positives = 175/302 (58%), Gaps = 7/302 (2%)
 Frame = +2

Query  239   FNFYAISCPSAELIVKNTVRSASSVDPTLPGKLLRLLFHDCFVEGCDASILLQGN--DTE  412
              NFYA +CP+AE IV++ V +  S  P+L   LLR+ FHDCFV GCD S+L+     + E
Sbjct  28    MNFYANTCPNAEKIVQDFVSNHISNAPSLAAALLRMHFHDCFVRGCDGSVLINSTSGNAE  87

Query  413   RSDPANKSVGGFSTVDSAKRVLEIFCPETVSCADIIALAARDAVEFVGGPSVAIPTGRRD  592
             +    N +V GF  +++ K VLE  CP  VSCADIIALA+RDA+ F GGP+ ++PTGRRD
Sbjct  88    KDAAPNLTVRGFGFIEAIKAVLEAQCPGIVSCADIIALASRDAIVFTGGPNWSVPTGRRD  147

Query  593   GRVSLGKNVRPNIIDTSFTMDEMMKIFAAKGLSLDDLVTLSGAHTIGSAHCSAFSDR-FQ  769
             GR+S       NI   +     +  +FA +GL L DLV LSGAHTIG +HCS+F++R + 
Sbjct  148   GRISNASEALANIPPPTSNFTNLQTLFANQGLDLKDLVLLSGAHTIGVSHCSSFTNRLYN  207

Query  770   LASNGSFLPIdaaldhayaaelaRQCPAGASDAVTVNNDPVTPSLFDNQYYKDLLAHRGL  949
                 G   P  A      A   +R+CP+   +   V  DP +   FD  YY+ LL  RGL
Sbjct  208   FTGRGDQDP--ALDSEYAANLKSRKCPSLKDNTTIVEMDPGSRKTFDLSYYQLLLKRRGL  265

Query  950   FQSDSALLRDKRAMEKV-QDFAGDQNNFFTSWEQSFLKLVSIGVKVGDDDGEIRRSCSSV  1126
             FQSDSAL  +   +  + Q   G    FF+ + +S  K+  I VK G   G +R+ CS  
Sbjct  266   FQSDSALTTNPTTLSNINQILKGSVAGFFSEFAKSMEKMGRINVKTG-SSGVVRKQCSVA  324

Query  1127  NA  1132
             N+
Sbjct  325   NS  326



>ref|XP_002872571.1| peroxidase ATP19a [Arabidopsis lyrata subsp. lyrata]
 gb|EFH48830.1| peroxidase ATP19a [Arabidopsis lyrata subsp. lyrata]
Length=327

 Score =   227 bits (579),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 129/301 (43%), Positives = 175/301 (58%), Gaps = 9/301 (3%)
 Frame = +2

Query  245   FYAISCPSAELIVKNTVRSASSVDPTLPGKLLRLLFHDCFVEGCDASILLQGNDT----E  412
             FY  +CP AE IV++ V       P+L   L+R+ FHDCFV GCD SIL+    +    E
Sbjct  30    FYDQTCPYAEKIVQDVVNQHIHNAPSLAAGLIRMHFHDCFVRGCDGSILINATSSNQQVE  89

Query  413   RSDPANKSVGGFSTVDSAKRVLEIFCPETVSCADIIALAARDAVEFVGGPSVAIPTGRRD  592
             +  P N +V GF  +D  K  LE  CP  VSCADII LA RD++  +GGP+  +PTGRRD
Sbjct  90    KLAPPNLTVRGFDFIDKVKSALESKCPGIVSCADIITLATRDSIVAIGGPTWNVPTGRRD  149

Query  593   GRVSLGKNVRPNIIDTSFTMDEMMKIFAAKGLSLDDLVTLSGAHTIGSAHCSAFSDR-FQ  769
             GR+S     R NI         ++ +F  +GL + DLV LSGAHTIG +HCS+FS+R F 
Sbjct  150   GRISNFAEARNNIPPPFGNFTTLITLFGNQGLDVKDLVLLSGAHTIGVSHCSSFSNRLFN  209

Query  770   LASNGSFLPIdaaldhayaaelaRQCPAGASDAVTVNNDPVTPSLFDNQYYKDLLAHRGL  949
                 G   P  +          +R+C A A +  TV  DP + + FD  YY+ +L  RGL
Sbjct  210   FTGVGDQDP--SMDSEYVDNLKSRRCLALADNTTTVEMDPGSRNTFDLSYYRLVLKRRGL  267

Query  950   FQSDSALLRDKRAMEKVQDFA-GDQNNFFTSWEQSFLKLVSIGVKVGDDDGEIRRSCSSV  1126
             F+SD+AL  +  A+ +V+ F+ G +  FF  + +S  K+  IGVK G  DGEIRR+C+ V
Sbjct  268   FESDAALTMNPAALAQVKRFSGGSEQEFFAEFSKSMEKMGRIGVKTG-SDGEIRRTCAFV  326

Query  1127  N  1129
             N
Sbjct  327   N  327



>ref|XP_011097275.1| PREDICTED: peroxidase 51 [Sesamum indicum]
Length=326

 Score =   227 bits (579),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 130/302 (43%), Positives = 185/302 (61%), Gaps = 9/302 (3%)
 Frame = +2

Query  242   NFYAISCPSAELIVKNTVRSA-SSVDPTLPGKLLRLLFHDCFVEGCDASILLQ--GNDTE  412
             NFY+ SCP+ E IV+  VR+  +    T+P  L RL FHDCFVEGCDAS+++    ND E
Sbjct  29    NFYSSSCPNVEAIVRQVVRTKINQTFVTIPATL-RLYFHDCFVEGCDASVVIASPNNDAE  87

Query  413   RSDPANKSVGG--FSTVDSAKRVLEIFCPETVSCADIIALAARDAVEFVGGPSVAIPTGR  586
             +  P N S+ G  F TV  AK+ +E  CP  VSCADI+A+AARD V   GGP+  +  GR
Sbjct  88    KDAPDNLSLAGDGFDTVVKAKQAVEAQCPGIVSCADILAIAARDVVFLAGGPAYDVELGR  147

Query  587   RDGRVSLGKNVRPNIIDTSFTMDEMMKIFAAKGLSLDDLVTLSGAHTIGSAHCSAFSDRF  766
             RDG +S    V  N+ + +F + ++  IFA   LS  D++ LSGAHT+G +HC+  ++R 
Sbjct  148   RDGLISQASRVAGNLPEPTFNLIQLNTIFAKNNLSQIDMIALSGAHTLGFSHCNRVANRL  207

Query  767   QLASNGSFLPIdaaldhayaaelaRQCPAGASDAVTVNNDPVTPSLFDNQYYKDLLAHRG  946
                S  +  P+D ALD  YA +L ++CP      + +N DPVTP  FDN Y+++L+  +G
Sbjct  208   YSFSPSN--PVDPALDPTYAQQLMQECPQNVDPQIAINMDPVTPQTFDNVYFQNLVGGKG  265

Query  947   LFQSDSALLRDKRAMEKVQDFAGDQNNFFTSWEQSFLKLVSIGVKVGDDDGEIRRSCSSV  1126
             LF SD  L  D  +   V DFA +  +F  ++  +  KL  +GVK+G + GEIRR C++ 
Sbjct  266   LFTSDQVLFTDPASQPTVMDFAQNSGDFNGAFITAMTKLGRVGVKIG-NQGEIRRDCTAF  324

Query  1127  NA  1132
             N+
Sbjct  325   NS  326



>emb|CDY13252.1| BnaC09g24040D [Brassica napus]
Length=326

 Score =   227 bits (579),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 131/303 (43%), Positives = 175/303 (58%), Gaps = 9/303 (3%)
 Frame = +2

Query  239   FNFYAISCPSAELIVKNTVRSASSVDPTLPGKLLRLLFHDCFVEGCDASILLQGNDT---  409
               FY  +CP+AE IV+  V       P+L   L+R+ FHDCFV GCD SIL+    +   
Sbjct  27    LGFYDKTCPNAEKIVQAVVNQHIRNVPSLAAGLIRMHFHDCFVRGCDGSILINATSSNQQ  86

Query  410   -ERSDPANKSVGGFSTVDSAKRVLEIFCPETVSCADIIALAARDAVEFVGGPSVAIPTGR  586
              E+  P N +V GF  +D  K VLE  CP  VSCADII LA RD+V  +GGP+  +PTGR
Sbjct  87    VEKVAPPNLTVRGFDFIDLVKTVLERKCPGVVSCADIITLATRDSVAAIGGPTWNVPTGR  146

Query  587   RDGRVSLGKNVRPNIIDTSFTMDEMMKIFAAKGLSLDDLVTLSGAHTIGSAHCSAFSDR-  763
             RDGR+S       NI         ++ +F  +GL + DLV LSGAHTIG +HCS+FS+R 
Sbjct  147   RDGRISNATEALNNIPPPFGNFTTLITLFGNQGLDVKDLVLLSGAHTIGVSHCSSFSNRL  206

Query  764   FQLASNGSFLPIdaaldhayaaelaRQCPAGASDAVTVNNDPVTPSLFDNQYYKDLLAHR  943
             F     G   P  +          +R+C + A +   V  DP + + FD  Y+K +L  R
Sbjct  207   FNFTGVGDQDP--SLDSEYADNLKSRKCLSIADNTTQVEMDPGSRNTFDLSYFKLVLKRR  264

Query  944   GLFQSDSALLRDKRAMEKVQDFAGDQ-NNFFTSWEQSFLKLVSIGVKVGDDDGEIRRSCS  1120
             GLF+SD+AL +D  A+ +V+ FAG    +FF  + +S  K+  IGVK G  DGEIRR+CS
Sbjct  265   GLFESDAALTKDPTALGQVRSFAGGSLQDFFVEFGKSMEKMGRIGVKTG-SDGEIRRTCS  323

Query  1121  SVN  1129
              VN
Sbjct  324   VVN  326



>ref|XP_008808296.1| PREDICTED: peroxidase 5-like [Phoenix dactylifera]
Length=324

 Score =   227 bits (578),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 130/299 (43%), Positives = 183/299 (61%), Gaps = 7/299 (2%)
 Frame = +2

Query  245   FYAISCPSAELIVKNTVRSASSVDPTLPGKLLRLLFHDCFVEGCDASILLQG---NDTER  415
             FY  +CP AELIVK  V  A + +  L   L+RL FHDCFV GCD S+L+     N  E+
Sbjct  29    FYDATCPQAELIVKLLVTKAVASNIGLAAGLVRLHFHDCFVRGCDGSVLIDSTSTNTAEK  88

Query  416   SDPANKSVGGFSTVDSAKRVLEIFCPETVSCADIIALAARDAVEFVGGPSVAIPTGRRDG  595
                 N S+ GF  +DSAK +LE  C   VSCADI+A AARD++   GG S  +P GRRDG
Sbjct  89    DSSINTSLRGFEVIDSAKALLEATCNGVVSCADILAFAARDSIALTGGISYQVPAGRRDG  148

Query  596   RVSLGKNVRPNIIDTSFTMDEMMKIFAAKGLSLDDLVTLSGAHTIGSAHCSAFSDRFQLA  775
             RVSL  +   N+   SF +D++ + F AKGL+ D +VTLSGAHTIG +HCS+FS+R  L 
Sbjct  149   RVSLASDTFANLPAPSFNVDQLTQSFQAKGLTQDQMVTLSGAHTIGRSHCSSFSNR--LY  206

Query  776   SNGSFLPIdaaldhayaaelaRQCPAGASDA-VTVNNDPVTPSLFDNQYYKDLLAHRGLF  952
             +  + +  D +LD  YAA+L +QCP G++++ + V  DP +P++ D  YY D+L +RGLF
Sbjct  207   NFNTTVKQDPSLDATYAAQLKKQCPQGSTNSNLVVPMDPPSPNIVDTNYYNDILVNRGLF  266

Query  953   QSDSALLRDKRAMEKVQDFAGDQNNFFTSWEQSFLKLVSIGVKVGDDDGEIRRSCSSVN  1129
              SD  LL        V+  A +   +   +  + + +  +GV  G  +GEIR +C ++N
Sbjct  267   TSDQTLLSKATTASHVKQNAANSLLWQNKFATAMVAMGQVGVLTG-SNGEIRLNCRAIN  324



>ref|XP_010272777.1| PREDICTED: peroxidase 3-like [Nelumbo nucifera]
Length=325

 Score =   227 bits (578),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 139/302 (46%), Positives = 176/302 (58%), Gaps = 10/302 (3%)
 Frame = +2

Query  242   NFYAISCPSAELIVKNTVRSASSVDPTLPGKLLRLLFHDCFVEGCDASILLQ---GNDTE  412
             NFY  SCP AE IV++ +   ++ DP LP +L+RL FHDCFV GCDAS+LL     N  E
Sbjct  29    NFYKDSCPLAEKIVRDVIWKLAASDPALPAELVRLNFHDCFVRGCDASVLLNSTPNNVAE  88

Query  413   RSDPANKSVGGFSTVDSAKRVLEIFCPETVSCADIIALAARDAVEF-VGGPSVAIPTGRR  589
             +    N ++ G   +D  K  +E  CP  VSCADIIALAARD+V F    P   + TGRR
Sbjct  89    KDAVPNLTLDGADIIDKVKDEVEKACPGVVSCADIIALAARDSVAFQFKKPMWEVLTGRR  148

Query  590   DGRVSLGKNVRPNIIDTSFTMDEMMKIFAAKGLSLDDLVTLSGAHTIGSAHCSAFSDR-F  766
             DG VSL      N+   S     +   FA KGL+L DLV LSGAHT G  HC AFS R +
Sbjct  149   DGTVSLASEAVANLPQPSSDFATLRSNFAKKGLTLHDLVVLSGAHTFGHGHCDAFSKRLY  208

Query  767   QLASNGSFLPIdaaldhayaaelaRQCPAGASDAVTVNNDPVTPSLFDNQYYKDLLAHRG  946
                  G   P   +LD  YAA L  QC   + +  TV+ DP +P  FDN YY  L  H+G
Sbjct  209   NFTGKGDVDP---SLDPTYAAFLKTQCKTLSDNTTTVDMDPESPQSFDNHYYVVLKQHKG  265

Query  947   LFQSDSALLRDKRAMEKVQDFAGDQNNFFTSWEQSFLKLVSIGVKVGDDDGEIRRSCSSV  1126
             LFQSD+ALL +K +   V +   +QN FFT + QS  ++ +IGV  G + GEIR+ C  V
Sbjct  266   LFQSDAALLTNKMSSNIVDELL-NQNKFFTEFGQSMKRMGAIGVLTG-NSGEIRKKCGVV  323

Query  1127  NA  1132
             N+
Sbjct  324   NS  325



>ref|XP_009108181.1| PREDICTED: peroxidase 39 [Brassica rapa]
 emb|CDX86795.1| BnaA09g21850D [Brassica napus]
Length=326

 Score =   227 bits (578),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 131/303 (43%), Positives = 175/303 (58%), Gaps = 9/303 (3%)
 Frame = +2

Query  239   FNFYAISCPSAELIVKNTVRSASSVDPTLPGKLLRLLFHDCFVEGCDASILLQGNDT---  409
               FY  +CP+AE IV+  V       P+L   L+R+ FHDCFV GCD SIL+    +   
Sbjct  27    LGFYDKTCPNAEKIVQAVVNQHIRNVPSLAAGLIRMHFHDCFVRGCDGSILINATSSNQQ  86

Query  410   -ERSDPANKSVGGFSTVDSAKRVLEIFCPETVSCADIIALAARDAVEFVGGPSVAIPTGR  586
              E+  P N +V GF  +D  K VLE  CP  VSCADII LA RD+V  +GGP+  +PTGR
Sbjct  87    VEKVAPPNLTVRGFDFIDLVKTVLERKCPGVVSCADIITLATRDSVAAIGGPTWNVPTGR  146

Query  587   RDGRVSLGKNVRPNIIDTSFTMDEMMKIFAAKGLSLDDLVTLSGAHTIGSAHCSAFSDR-  763
             RDGR+S       NI         ++ +F  +GL + DLV LSGAHTIG +HCS+FS+R 
Sbjct  147   RDGRISNATEALNNIPPPFGNFSTLITLFGNQGLDVKDLVLLSGAHTIGVSHCSSFSNRL  206

Query  764   FQLASNGSFLPIdaaldhayaaelaRQCPAGASDAVTVNNDPVTPSLFDNQYYKDLLAHR  943
             F     G   P  +          +R+C + A +   V  DP + + FD  Y+K +L  R
Sbjct  207   FNFTGVGDQDP--SLDSEYADNLKSRKCLSIADNTTQVEMDPGSRNTFDLSYFKLVLKRR  264

Query  944   GLFQSDSALLRDKRAMEKVQDFAGDQ-NNFFTSWEQSFLKLVSIGVKVGDDDGEIRRSCS  1120
             GLF+SD+AL +D  A+ +V+ FAG    +FF  + +S  K+  IGVK G  DGEIRR+CS
Sbjct  265   GLFESDAALTKDPTALGQVRGFAGGSLQDFFVEFGKSMEKMGRIGVKTG-SDGEIRRTCS  323

Query  1121  SVN  1129
              VN
Sbjct  324   VVN  326



>ref|XP_006396925.1| hypothetical protein EUTSA_v10028797mg [Eutrema salsugineum]
 gb|ESQ38378.1| hypothetical protein EUTSA_v10028797mg [Eutrema salsugineum]
Length=326

 Score =   227 bits (578),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 130/301 (43%), Positives = 177/301 (59%), Gaps = 9/301 (3%)
 Frame = +2

Query  245   FYAISCPSAELIVKNTVRSASSVDPTLPGKLLRLLFHDCFVEGCDASILL----QGNDTE  412
             FY  +CP+AE IV+N V       P+L   L+R+ FHDCFV GCD SIL+    +    E
Sbjct  29    FYDKTCPNAEKIVQNLVNQHIGNVPSLAAGLIRMHFHDCFVRGCDGSILINATSRNQQVE  88

Query  413   RSDPANKSVGGFSTVDSAKRVLEIFCPETVSCADIIALAARDAVEFVGGPSVAIPTGRRD  592
             +  P N +V GF  +D  K+VLE  CP  VSCADII LA RD+V  +GGP+ ++PTGRRD
Sbjct  89    KVSPPNLTVRGFDFIDLVKKVLESKCPGIVSCADIITLATRDSVAAIGGPTWSVPTGRRD  148

Query  593   GRVSLGKNVRPNIIDTSFTMDEMMKIFAAKGLSLDDLVTLSGAHTIGSAHCSAFSDR-FQ  769
             GR+S       NI         ++ +F  +GL + DLV LSGAHTIG +HCS+FS+R F 
Sbjct  149   GRISNANESLNNIPPPFGNFTTLITLFGNQGLDVKDLVLLSGAHTIGVSHCSSFSNRLFN  208

Query  770   LASNGSFLPIdaaldhayaaelaRQCPAGASDAVTVNNDPVTPSLFDNQYYKDLLAHRGL  949
                 G   P  +          AR+C + A +   V  DP + + FD  Y++ +L  RGL
Sbjct  209   FTGVGDQDP--SLDSEYADNLKARRCLSLADNTTKVEMDPGSRNTFDLSYFRLVLKRRGL  266

Query  950   FQSDSALLRDKRAMEKVQDFA-GDQNNFFTSWEQSFLKLVSIGVKVGDDDGEIRRSCSSV  1126
             F+SD+AL  +  A+  V+ FA G + +FF  + +S  K+  IGVK G  DGEIRR+C+ V
Sbjct  267   FESDAALTMNSAALALVRRFAGGSEQDFFVEFGKSMEKMGRIGVKTG-SDGEIRRTCAVV  325

Query  1127  N  1129
             N
Sbjct  326   N  326



>ref|XP_002515749.1| Peroxidase 3 precursor, putative [Ricinus communis]
 gb|EEF46696.1| Peroxidase 3 precursor, putative [Ricinus communis]
Length=324

 Score =   227 bits (578),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 133/302 (44%), Positives = 169/302 (56%), Gaps = 9/302 (3%)
 Frame = +2

Query  245   FYAISCPSAELIVKNTVRSASSVDPTLPGKLLRLLFHDCFVEGCDASILLQ----GNDTE  412
             FY+ SCP AE IV+  V       P+L    +R+ FHDCFV GCDAS+LL     GN TE
Sbjct  26    FYSKSCPRAEQIVQGFVNQHIHNAPSLAATFIRMHFHDCFVRGCDASVLLNSSSSGNQTE  85

Query  413   RSDPANKSVGGFSTVDSAKRVLEIFCPETVSCADIIALAARDAVEFVGGPSVAIPTGRRD  592
             +S   N ++ GF  +DS K +LE  CP  VSCAD+IAL ARD++   GGPS  +PTGRRD
Sbjct  86    KSATPNLTLRGFGFIDSVKSLLEAECPGVVSCADVIALVARDSIVATGGPSWRVPTGRRD  145

Query  593   GRVSLGKNVRPNIIDTSFTMDEMMKIFAAKGLSLDDLVTLSGAHTIGSAHCSAFSDR-FQ  769
             G VS+      NI   +  +  + ++FA  GL L DLV LSGAHTIG AHC +FS+R + 
Sbjct  146   GTVSMASEALNNIPPPTSNLTTLQRLFANVGLDLKDLVLLSGAHTIGIAHCPSFSNRLYN  205

Query  770   LASNGSFLPIdaaldhayaaelaRQCPAGASDAVTVNNDPVTPSLFDNQYYKDLLAHRGL  949
                 G   P  A      A   AR+C     +   V  DP +   FD  YY +LL  RGL
Sbjct  206   FTGVGDQDP--ALDSEYAAVLKARKCTTPNDNTTIVEMDPGSRKTFDLSYYSNLLKRRGL  263

Query  950   FQSDSALLRDKRAMEKV-QDFAGDQNNFFTSWEQSFLKLVSIGVKVGDDDGEIRRSCSSV  1126
             FQSDSAL      +  + Q  +G   NFF  +  S  K+  I VK G   GEIR+ C+ V
Sbjct  264   FQSDSALTTSSATLSTINQLLSGSLENFFAEFAASIEKMGQINVKTG-SAGEIRKQCAFV  322

Query  1127  NA  1132
             N+
Sbjct  323   NS  324



>ref|XP_004965313.1| PREDICTED: peroxidase 1-like [Setaria italica]
Length=327

 Score =   227 bits (578),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 130/300 (43%), Positives = 171/300 (57%), Gaps = 9/300 (3%)
 Frame = +2

Query  245   FYAISCPSAELIVKNTVRSASSVDPTLPGKLLRLLFHDCFVEGCDASILL---QGNDTER  415
             +Y+ +CP+AE IV++ +    S  P+L G LLRL FHDCFV GCDAS+LL   +GN  ER
Sbjct  32    YYSKTCPNAEAIVRDEMEKIISAAPSLAGPLLRLHFHDCFVRGCDASVLLNSTEGNLAER  91

Query  416   SDPANKSVGGFSTVDSAKRVLEIFCPETVSCADIIALAARDAVEFVGGPSVAIPTGRRDG  595
                 NKS+ GF +VD  K  LE  CP TVSCAD++A+ ARDAV    GPS  +P GRRDG
Sbjct  92    DAKPNKSLRGFGSVDRVKAKLEAACPNTVSCADVLAIMARDAVVLAKGPSWPVPLGRRDG  151

Query  596   RVSLGKNVRPNIIDTSFTMDEMMKIFAAKGLSLDDLVTLSGAHTIGSAHCSAFSDRFQLA  775
             RVS       N+      +  + KIFAA GL L DLV LSGAHT+G+AHC +++ R    
Sbjct  152   RVSSATEAADNLPPAFGDIPLLTKIFAANGLDLKDLVVLSGAHTLGTAHCPSYAARLYNF  211

Query  776   SNGSFLPIdaaldhayaaelaRQCPAGASDAVTVNNDPVTPSLFDNQYYKDLLAHRGLFQ  955
             S     P   +           +C +    A+    DP +   FD  YY++L   RGLFQ
Sbjct  212   SAAGADPTLDSEYADRLRT---RCKSVDDTAMLSETDPGSYKTFDTSYYRNLAKRRGLFQ  268

Query  956   SDSALLRDKRAMEKVQDFAGDQ--NNFFTSWEQSFLKLVSIGVKVGDDDGEIRRSCSSVN  1129
             SD+ALL D    E VQ  A  +  + +F  + +S +K+ + GV  G   GEIR+ C  VN
Sbjct  269   SDAALLTDATTREYVQRIATGKFDDMYFEDFGESMVKMGNAGVLTG-AQGEIRKKCYIVN  327



>ref|XP_004953531.1| PREDICTED: peroxidase 5-like [Setaria italica]
Length=331

 Score =   227 bits (578),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 141/307 (46%), Positives = 186/307 (61%), Gaps = 16/307 (5%)
 Frame = +2

Query  242   NFYAISCPSAELIVKNTVRSASSVDPTLPGKLLRLLFHDCFVEGCDASILLQGNDTERSD  421
              FY  SCP AE IV+N VR A + DP L   L+R+ FHDCFV GCDASILL+    ++++
Sbjct  28    GFYEHSCPQAEDIVRNAVRRAVARDPGLAAGLIRMHFHDCFVRGCDASILLESTPWQKAE  87

Query  422   ----PANKSVGGFSTVDSAKRVLEIFCPETVSCADIIALAARDAVEFVGGPSVAIPTGRR  589
                   N S+ GF  +D AK ++E  CP TVSCADI+A AARD     GG    +P+GRR
Sbjct  88    RDSTANNPSLRGFEVIDEAKAIVEAHCPRTVSCADIVAFAARDGAALAGGIDYRVPSGRR  147

Query  590   DGRVSL-GKNVRPNIIDTSFTMDEMMKIFAAKGLSLDDLVTLSGAHTIGSAHCSAFSDR-  763
             DGRVS+ G+ +  N+   +FT+ E+++ F  KGLS DD+VTLSGAH+IG +HCS+ +DR 
Sbjct  148   DGRVSVEGEVLDGNVPFPTFTVGELVENFRRKGLSADDMVTLSGAHSIGRSHCSSVTDRL  207

Query  764   --FQLASNGSFLPIdaaldhayaaelaRQCPAGASD---AVTVNNDPVTPSLFDNQYYKD  928
               FQ    G   P    LD AYAA+L R+CP   S+     TV  DPVTP+  DNQY+K+
Sbjct  208   YNFQ-GEPGRTDP---ELDPAYAADLKRRCPPSMSNMDYPTTVPLDPVTPAGLDNQYFKN  263

Query  929   LLAHRGLFQSDSALLRDKRAMEKVQDFAGDQNNFFTSWEQSFLKLVSIGVKVGDDDGEIR  1108
             +LAH+  F SD ALL        V   A     +   +  + +K+ +I V  G  +GEIR
Sbjct  264   VLAHKVPFTSDQALLDSPWTAGLVAFHAAVGQAWEAKFAAAMVKMGAIEVLTG-QEGEIR  322

Query  1109  RSCSSVN  1129
               CS VN
Sbjct  323   EKCSVVN  329



>ref|XP_008246297.1| PREDICTED: peroxidase 5-like [Prunus mume]
Length=327

 Score =   227 bits (578),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 138/304 (45%), Positives = 184/304 (61%), Gaps = 16/304 (5%)
 Frame = +2

Query  245   FYAISCPSAELIVKNTVRSASSVDPTLPGKLLRLLFHDCFVEGCDASILLQ---GNDTER  415
             FY  SCP+AE IV+  V  A + +P +   L+R+ FHDCFV GCDASILL    G  +E+
Sbjct  31    FYQRSCPAAEAIVRKAVNKAVAKNPGIAAGLIRMHFHDCFVRGCDASILLDSTPGQPSEK  90

Query  416   SDPANK-SVGGFSTVDSAKRVLEIFCPETVSCADIIALAARDAVEFVGGPSVAIPTGRRD  592
               PAN  S+ GF  +D AK  +E  CP+TVSCADI+A AARD+   VGG +  +P+GRRD
Sbjct  91    EHPANNPSLRGFEVIDEAKAEIEAKCPKTVSCADILAFAARDSALEVGGINYDVPSGRRD  150

Query  593   GRVSLGKNVRPNIIDTSFTMDEMMKIFAAKGLSLDDLVTLSGAHTIGSAHCSAFSDRFQL  772
             GRVSL      ++   SF   ++ + FA KGLSLD++VTLSGAH+IG +HCS+FSDR   
Sbjct  151   GRVSLQDEPTQHLPSPSFNAKQLEESFARKGLSLDEMVTLSGAHSIGVSHCSSFSDRLYF  210

Query  773   ASNGSFLPIdaaldhayaaelaRQCPAGA-SDAVTVNNDPVTPSLFDNQYYKDLLAHRGL  949
              +  +  P D ++D  +A  L ++CP  + +D VTV  D +TP+  DN+YY DL  H GL
Sbjct  211   FN--ATHPQDPSMDPIFARNLKKKCPRSSNNDRVTVPLDILTPNRLDNKYYTDLKNHHGL  268

Query  950   FQSDSALLRDKRAMEKVQDFAGDQNNFFTSWEQSF----LKLVSIGVKVGDDDGEIRRSC  1117
               SD  LL        V++ A     F T+W   F    +K+ SI V  G   GEIR +C
Sbjct  269   LTSDQTLLTSHSTAGIVRNNA----RFGTAWANKFAAAMVKMGSIDVLTG-RQGEIRNNC  323

Query  1118  SSVN  1129
               VN
Sbjct  324   KVVN  327



>ref|XP_010693446.1| PREDICTED: peroxidase 66-like [Beta vulgaris subsp. vulgaris]
Length=320

 Score =   226 bits (577),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 125/303 (41%), Positives = 180/303 (59%), Gaps = 17/303 (6%)
 Frame = +2

Query  242   NFYAISCPSAELIVKNTVRSASSVDPTLPGKLLRLLFHDCFVEGCDASILLQ---GNDTE  412
             ++Y  +CP AE IV  TVR+AS  DP +P +LLR+ FHDCF+ GCDASILL    GN  E
Sbjct  28    HYYDQTCPQAEFIVAQTVRNASLFDPKVPARLLRMFFHDCFIRGCDASILLDSTPGNKAE  87

Query  413   RSDPANKSVGGFSTVDSAKRVLEIFCPETVSCADIIALAARDAVEFVGGPSVAIPTGRRD  592
             +  P N SV  F  +D AK  LE  CP TVSCAD++A+AARD V   GGP   +  GR+D
Sbjct  88    KDGPPNVSVRSFYVIDDAKAKLEKACPHTVSCADVVAMAARDVVTMTGGPYWNVLKGRKD  147

Query  593   GRVSLGK---NVRPNIIDTSFTMDEMMKIFAAKGLSLDDLVTLSGAHTIGSAHCSAFSDR  763
             GRVS      N+ P  ++ +    ++++ FA +GL + DLV LSG HT+G +HCS+F  R
Sbjct  148   GRVSKASDTTNLPPPFLNAT----QLIQTFANRGLDIKDLVALSGGHTLGFSHCSSFVAR  203

Query  764   FQLASNGSFLPIdaaldhayaaelaRQ-CPAGASDAVTVNNDPVTPSLFDNQYYKDLLAH  940
                  N S +       +A  A + +Q CP   ++         T + FDN YYK ++A 
Sbjct  204   VH---NFSTVHATDPSMNAEFASVLKQKCPGSNNNGDAGQLLDSTATQFDNDYYKQIIAG  260

Query  941   RGLFQSDSALLRDKRAMEKVQDFAGDQNNFFTSWEQSFLKLVSIGVKVGDDDGEIRRSCS  1120
             +G+F +D A+  D+R+   ++ FA +QN FF  +  S +KL ++GV   ++ GE+R +C 
Sbjct  261   KGVFGTDQAMYNDQRSRPIIEAFAKNQNLFFREFAASMIKLGNVGV---NEVGEVRLNCR  317

Query  1121  SVN  1129
              +N
Sbjct  318   RIN  320



>ref|XP_007161310.1| hypothetical protein PHAVU_001G059100g [Phaseolus vulgaris]
 gb|ESW33304.1| hypothetical protein PHAVU_001G059100g [Phaseolus vulgaris]
Length=326

 Score =   226 bits (576),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 134/303 (44%), Positives = 179/303 (59%), Gaps = 11/303 (4%)
 Frame = +2

Query  242   NFYAISCPSAELIVKNTVRSASSVDPTLPGKLLRLLFHDCFVEGCDASILLQGND--TER  415
             ++Y  +CP+ E IV+  V       P      LRL+FHDCFV GCDAS++L   +  +E+
Sbjct  28    DYYRNTCPNVESIVRRAVEMKLQQTPVTAPATLRLIFHDCFVRGCDASVMLASTNHTSEK  87

Query  416   SDPANKSVGG--FSTVDSAKRVLEIF--CPETVSCADIIALAARDAVEFVGGPSVAIPTG  583
              +P N S+ G  F TV  AK  ++    C   VSCADI+A+A RD V   GGPS A+  G
Sbjct  88    DNPINLSLAGDGFDTVIKAKAAVDSVPGCQNKVSCADILAMATRDVVALAGGPSYAVELG  147

Query  584   RRDGRVSLGKNVRPNIIDTSFTMDEMMKIFAAKGLSLDDLVTLSGAHTIGSAHCSAFSDR  763
             R DGRVS   +VR ++    F ++++ ++FA+ GL+L DLV LSGAHTIG +HCS FS R
Sbjct  148   RLDGRVSTKASVRHHLPHPDFKLEQLNQMFASHGLTLTDLVALSGAHTIGFSHCSQFSKR  207

Query  764   -FQLASNGSFLPIdaaldhayaaelaRQCPAGASDAVTVNNDPVTPSLFDNQYYKDLLAH  940
              +   S  S   ID  L+ AYA +L + CP  A     V  D +TP +FDNQYYK+L   
Sbjct  208   IYNFKSKKS---IDHTLNSAYAEKLQQDCPKNADPRTVVEMDLITPRIFDNQYYKNLQQG  264

Query  941   RGLFQSDSALLRDKRAMEKVQDFAGDQNNFFTSWEQSFLKLVSIGVKVGDDDGEIRRSCS  1120
             +GL  SD AL   KR  + V  FA +   F T++  +  KL  IG+K G + GEIRR CS
Sbjct  265   KGLLASDQALFTHKRTRDLVNLFASNNTVFETAFVSAMTKLGRIGIKTG-NQGEIRRDCS  323

Query  1121  SVN  1129
              VN
Sbjct  324   MVN  326



>ref|XP_007144575.1| hypothetical protein PHAVU_007G167200g [Phaseolus vulgaris]
 gb|ESW16569.1| hypothetical protein PHAVU_007G167200g [Phaseolus vulgaris]
Length=321

 Score =   226 bits (576),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 137/306 (45%), Positives = 184/306 (60%), Gaps = 17/306 (6%)
 Frame = +2

Query  242   NFYAISCPSAELIVKNTVRSASSVDPTLPGKLLRLLFHDCFVEGCDASILLQ---GNDTE  412
             NFY  SCP AE I+K+  +   S +P LP KL+RL FHDCFV GCD S+LL     N  E
Sbjct  24    NFYRNSCPQAEDIIKSQTQQHVSANPNLPAKLIRLHFHDCFVRGCDGSVLLSSTANNTAE  83

Query  413   RSDPANKSVGGFSTVDSAKRVLEIFCPETVSCADIIALAARDAV--EFVGGPSVAIPTGR  586
             R    N S+ GF  +D+ K  +E  CP+TVSCADI+ALAARDAV  +F       + TGR
Sbjct  84    RDAIPNLSLAGFDVIDAIKSAVEAKCPKTVSCADILALAARDAVSVQFNNKQMWEVLTGR  143

Query  587   RDGRVSLGKNVRPNIIDTSFTMDEMMKIFAAKGLSLDDLVTLSGAHTIGSAHCSAFSDR-  763
             RDG+VS       NI    F + ++ + FA+KGL+L DLV LSGAHTIG  HC+ FS+R 
Sbjct  144   RDGKVSTSNEALANIPAPFFNLTQLRQSFASKGLTLHDLVVLSGAHTIGVGHCNLFSNRL  203

Query  764   FQLASNGSFLPIdaaldhayaaelaRQCPAGASDAVTVNNDPVTPSLFDNQYYKDLLAHR  943
             +     G   P   +L+  YAA L  +C + +    TV  DP + + FD+ +Y +LL  +
Sbjct  204   YNFTGKGDQDP---SLNDTYAAFLKTKCQSLSDRTTTVEMDPESSTNFDSDFYPNLLQKK  260

Query  944   GLFQSDSALLRDKRAMEKVQDFAG---DQNNFFTSWEQSFLKLVSIGVKVGDDDGEIRRS  1114
             GLFQSD+ALL     +++  D AG   D++ FFT + QS  ++ +I V + D  GEIR  
Sbjct  261   GLFQSDAALL----TLDQSADIAGELADKDKFFTEFAQSMKRMGNIEV-LTDSAGEIRNK  315

Query  1115  CSSVNA  1132
             CS VN+
Sbjct  316   CSVVNS  321



>ref|XP_003638079.1| Peroxidase [Medicago truncatula]
 gb|KEH24352.1| cationic peroxidase [Medicago truncatula]
Length=320

 Score =   226 bits (575),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 138/300 (46%), Positives = 172/300 (57%), Gaps = 11/300 (4%)
 Frame = +2

Query  242   NFYAISCPSAELIVKNTVRSASSVDPTLPGKLLRLLFHDCFVEGCDASILLQ---GNDTE  412
             NFY  SCP AE IVKN      S  P LP KL+RL FHDCFV GCDAS+LL+   GN  E
Sbjct  28    NFYKKSCPQAEEIVKNITLQHVSSRPELPAKLIRLHFHDCFVRGCDASVLLESTAGNTAE  87

Query  413   RSDPANKSVGGFSTVDSAKRVLEIFCPETVSCADIIALAARDAVEFVGGPSVAIPTGRRD  592
             +    N S+ GF  ++  K  LE  CP  VSCADI+ LA RDA  F   P+  + TGRRD
Sbjct  88    KDAIPNLSLAGFDVIEDIKEALEEKCPGIVSCADILTLATRDA--FKNKPNWEVLTGRRD  145

Query  593   GRVSLGKNVRPNIIDTSFTMDEMMKIFAAKGLSLDDLVTLSGAHTIGSAHCSAFSDR-FQ  769
             G VS       NI      + ++ +IFA K L+L DLV LSGAHTIG  HC+ FS+R F 
Sbjct  146   GTVSRSIEALINIPAPFHNITQLRQIFANKKLTLHDLVVLSGAHTIGVGHCNLFSNRLFN  205

Query  770   LASNGSFLPIdaaldhayaaelaRQCPAGASDAVTVNNDPVTPSLFDNQYYKDLLAHRGL  949
                 G   P   +L+  YA  L  +C   +    TV  DP + + FDN YY  LL ++GL
Sbjct  206   FTGKGDQDP---SLNPTYANFLKTKCQGLSDTTTTVEMDPNSSTTFDNDYYPVLLQNKGL  262

Query  950   FQSDSALLRDKRAMEKVQDFAGDQNNFFTSWEQSFLKLVSIGVKVGDDDGEIRRSCSSVN  1129
             F SD+ALL  K++   V +    QN FFT + QS  ++ +I V  G  +GEIRR CS VN
Sbjct  263   FTSDAALLTTKQSRNIVNELVS-QNKFFTEFSQSMKRMGAIEVLTG-SNGEIRRKCSVVN  320



>ref|XP_008234970.1| PREDICTED: peroxidase 3-like [Prunus mume]
Length=324

 Score =   226 bits (575),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 137/302 (45%), Positives = 181/302 (60%), Gaps = 10/302 (3%)
 Frame = +2

Query  242   NFYAISCPSAELIVKNTVRSASSVDPTLPGKLLRLLFHDCFVEGCDASILLQ--GNDTER  415
             NFY  +CPSAE IV+N   +  S +P LP KLLR+ FHDCFV GCD S+LL    N+T  
Sbjct  27    NFYRSTCPSAEEIVRNVTWNHVSSNPNLPAKLLRMHFHDCFVRGCDGSVLLNSTANNTAE  86

Query  416   SDPA-NKSVGGFSTVDSAKRVLEIFCPETVSCADIIALAARDAVEFVGGPSV-AIPTGRR  589
              D A N S+ GF+ +D  K  +E  CP  VSCADI+ALAARD+V F    S+  + TGRR
Sbjct  87    KDAAPNLSLAGFNVIDDIKENVENKCPGIVSCADILALAARDSVSFQFKRSLWKVLTGRR  146

Query  590   DGRVSLGKNVRPNIIDTSFTMDEMMKIFAAKGLSLDDLVTLSGAHTIGSAHCSAFSDR-F  766
             DG +S  +    NI   +F   ++ + FA+K L++ DLV LSG+HTIG  HC  FS+R +
Sbjct  147   DGTISRTREALINIPPPAFNFTQLKQRFASKNLTVHDLVVLSGSHTIGVGHCPTFSNRLY  206

Query  767   QLASNGSFLPIdaaldhayaaelaRQCPAGASDAVTVNNDPVTPSLFDNQYYKDLLAHRG  946
                  G   P   +L+  YAA L  +CP+      TV  DP +   FD  YY  L  H+G
Sbjct  207   NFTGKGDQDP---SLNATYAAFLKTKCPSLNDTTTTVEMDPGSSLKFDTGYYATLKQHKG  263

Query  947   LFQSDSALLRDKRAMEKVQDFAGDQNNFFTSWEQSFLKLVSIGVKVGDDDGEIRRSCSSV  1126
             LFQSD+ALL +K A   VQ+  GD + FFT + QS +++ +I V  G   GEIR  C +V
Sbjct  264   LFQSDAALLTNKGAANIVQEL-GDNDKFFTEFAQSMVRMGAIEVLTG-TSGEIRSKCWAV  321

Query  1127  NA  1132
             N+
Sbjct  322   NS  323



>ref|XP_006305430.1| hypothetical protein CARUB_v10009829mg [Capsella rubella]
 gb|EOA38328.1| hypothetical protein CARUB_v10009829mg [Capsella rubella]
Length=309

 Score =   225 bits (574),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 128/302 (42%), Positives = 174/302 (58%), Gaps = 7/302 (2%)
 Frame = +2

Query  239   FNFYAISCPSAELIVKNTVRSASSVDPTLPGKLLRLLFHDCFVEGCDASILLQGN--DTE  412
              NFYA +CP+AE IV++ V +  S  P+L   L+R+ FHDCFV GCD S+L+     + E
Sbjct  11    MNFYANTCPNAEKIVQDFVSNHISNAPSLAAALIRMHFHDCFVRGCDGSVLINSTSGNAE  70

Query  413   RSDPANKSVGGFSTVDSAKRVLEIFCPETVSCADIIALAARDAVEFVGGPSVAIPTGRRD  592
             R    N +V GF  +D+ K VLE  CP  VSCADIIALA+RDA+ F GGP+  +PTGRRD
Sbjct  71    RDATPNLTVRGFGFIDAIKAVLEAQCPGIVSCADIIALASRDAIVFTGGPNWNVPTGRRD  130

Query  593   GRVSLGKNVRPNIIDTSFTMDEMMKIFAAKGLSLDDLVTLSGAHTIGSAHCSAFSDR-FQ  769
             GR+S       NI   +     +  +FA +GL L DLV LSGAHTIG +HCS+F++R + 
Sbjct  131   GRISNASEALANIPPPTSNFTNLQTLFANQGLDLKDLVLLSGAHTIGVSHCSSFTNRLYN  190

Query  770   LASNGSFLPIdaaldhayaaelaRQCPAGASDAVTVNNDPVTPSLFDNQYYKDLLAHRGL  949
                 G   P  A      A   +R+CP+   +   V  DP +   FD  YY+ +L  RGL
Sbjct  191   FTGRGDQDP--ALDSEYAANLKSRKCPSLNDNKTIVEMDPGSRKTFDLSYYQLVLKRRGL  248

Query  950   FQSDSALLRDKRAMEKVQD-FAGDQNNFFTSWEQSFLKLVSIGVKVGDDDGEIRRSCSSV  1126
             FQSDSAL  +   +  +     G   +F++ + +S  K+  I VK G   G +RR CS  
Sbjct  249   FQSDSALTTNPTTLSNINRILTGSVESFYSEFAKSMEKMGRINVKTG-SAGVVRRQCSVA  307

Query  1127  NA  1132
             N+
Sbjct  308   NS  309



>gb|AII99881.1| peroxidase [Cicer arietinum]
Length=307

 Score =   225 bits (574),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 125/301 (42%), Positives = 171/301 (57%), Gaps = 25/301 (8%)
 Frame = +2

Query  242   NFYAISCPSAELIVKNTVRSASSVDPTLPGKLLRLLFHDCFVEGCDASILLQGNDT---E  412
             NFY  SCP A+ I+KN      + +P LP KLLR+ FHDCFV GCDAS+LL   D    E
Sbjct  28    NFYQHSCPQADNIIKNKTLQHVAANPNLPAKLLRMHFHDCFVRGCDASVLLNSTDNNTAE  87

Query  413   RSDPANKSVGGFSTVDSAKRVLEIFCPETVSCADIIALAARDAVEF-VGGPSVAIPTGRR  589
             +    N ++ GF+ +D  K  +E   P+TVSCADI+ALAARDAV      P   + TGRR
Sbjct  88    KDAIPNLTLAGFNVIDDIKNAVEAIYPKTVSCADILALAARDAVSVQFNKPMWEVLTGRR  147

Query  590   DGRVSLGKNVRPNIIDTSFTMDEMMKIFAAKGLSLDDLVTLSGAHTIGSAHCSAFSDRFQ  769
             DG VS       NI   +F   ++ + FA+KGL+L DLV LSGAHTIG+ HC+ FS+R  
Sbjct  148   DGTVSKRSEALANIPAPTFNFTQLKQNFASKGLTLHDLVVLSGAHTIGTGHCNFFSNRL-  206

Query  770   LASNGSFLPIdaaldhayaaelaRQCPAGASDAVTVNNDPVTPSLFDNQYYKDLLAHRGL  949
                                     +C + + +   V  DP + + FD+ YY +LL  +GL
Sbjct  207   -------------------YNFTTKCKSLSDNTTRVAMDPGSSNNFDSHYYPNLLQKKGL  247

Query  950   FQSDSALLRDKRAMEKVQDFAGDQNNFFTSWEQSFLKLVSIGVKVGDDDGEIRRSCSSVN  1129
             FQSD+ALL   ++ +  ++   ++N FFT + QS  ++ +I V VG   GEIR  CS VN
Sbjct  248   FQSDAALLTQDQSTDIAEELVNNKNKFFTEFAQSMKRMGAIEVLVG-SAGEIRIKCSVVN  306

Query  1130  A  1132
             +
Sbjct  307   S  307



>ref|XP_010033422.1| PREDICTED: peroxidase 51-like [Eucalyptus grandis]
 gb|KCW53058.1| hypothetical protein EUGRSUZ_J02352 [Eucalyptus grandis]
Length=326

 Score =   226 bits (575),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 127/301 (42%), Positives = 178/301 (59%), Gaps = 9/301 (3%)
 Frame = +2

Query  245   FYAISCPSAELIVKNTVRSA-SSVDPTLPGKLLRLLFHDCFVEGCDASILLQ--GNDTER  415
             FY  +CP+ E IVK  V +       T+PG L RL FHDCF+EGCDASIL+     D E+
Sbjct  30    FYGQTCPNVESIVKQAVTTKFGQTFITIPGTL-RLFFHDCFIEGCDASILISSPNGDAEK  88

Query  416   SDPANKSVGG--FSTVDSAKRVLEIFCPETVSCADIIALAARDAVEFVGGPSVAIPTGRR  589
               P N+S+ G  F TV  AK+ +E  C   VSCADI+A+AARD V   GGPS  +  GRR
Sbjct  89    DAPDNQSLAGDGFDTVIKAKQAVEASCQGVVSCADILAIAARDVVVLAGGPSFNVELGRR  148

Query  590   DGRVSLGKNVRPNIIDTSFTMDEMMKIFAAKGLSLDDLVTLSGAHTIGSAHCSAFSDRFQ  769
             DG +S    V   + + +F +D++  IF+  GL+  D++ LSGAHT+G +HC  F++R  
Sbjct  149   DGLISKASQVAGKLPEPNFDLDQLNAIFSQHGLTQSDMIALSGAHTLGFSHCDRFANRLY  208

Query  770   LASNGSFLPIdaaldhayaaelaRQCPAGASDAVTVNNDPVTPSLFDNQYYKDLLAHRGL  949
               S+ S  P+D  L+  YA +L ++CP      + +N DPVTP  FDN YY +L+  +GL
Sbjct  209   SFSSSS--PVDPTLNSTYAVQLMQECPQNVDPQIAINMDPVTPQTFDNMYYTNLVQGKGL  266

Query  950   FQSDSALLRDKRAMEKVQDFAGDQNNFFTSWEQSFLKLVSIGVKVGDDDGEIRRSCSSVN  1129
             F SD  L  D  +   V +FA    +F  ++  +  KL  +G+K G   GEIRR C++ N
Sbjct  267   FTSDETLFTDSASKPTVLNFANSPGSFNQAFATAMRKLGRVGIKTG-SQGEIRRDCTAFN  325

Query  1130  A  1132
             +
Sbjct  326   S  326



>ref|XP_010671316.1| PREDICTED: peroxidase 5-like [Beta vulgaris subsp. vulgaris]
Length=334

 Score =   226 bits (575),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 136/301 (45%), Positives = 184/301 (61%), Gaps = 10/301 (3%)
 Frame = +2

Query  245   FYAISCPSAELIVKNTVRSASSVDPTLPGKLLRLLFHDCFVEGCDASILLQ---GNDTER  415
             FY  SCP AE IVK+ VR A   D      L+RL FHDCFV GCDAS+LL    GN  E+
Sbjct  38    FYMQSCPMAEFIVKDEVRQAFFSDRGYAAGLVRLHFHDCFVRGCDASVLLDSTPGNAAEK  97

Query  416   SDPANK-SVGGFSTVDSAKRVLEIFCPETVSCADIIALAARDAVEFVGGPSVAIPTGRRD  592
                AN  S+ GF  +D+AK  LE  CP TVSCADI+A AARD+VE  GG    +P GRRD
Sbjct  98    DAEANNPSLRGFDVIDNAKARLENLCPGTVSCADILAYAARDSVEMTGGFGYDVPGGRRD  157

Query  593   GRVSLGKNVRPNIIDTSFTMDEMMKIFAAKGLSLDDLVTLSGAHTIGSAHCSAFSDR-FQ  769
             GRVS       N+      +D + KIF +KGL+ +++V LSGAHTIG +HC++FS R + 
Sbjct  158   GRVSSSSEATRNLPPPFADVDLLTKIFGSKGLTQEEMVILSGAHTIGRSHCTSFSKRLYS  217

Query  770   LASNGSFLPIdaaldhayaaelaRQCPAGASDA-VTVNNDPVTPSLFDNQYYKDLLAHRG  946
              ++  +  P   +++ AYAA+L RQCPAG + A + V  DP++P++ D  YY+++L +RG
Sbjct  218   FSTTAAQDP---SINSAYAAQLQRQCPAGNAGANIVVPMDPISPTISDTAYYRNILNNRG  274

Query  947   LFQSDSALLRDKRAMEKVQDFAGDQNNFFTSWEQSFLKLVSIGVKVGDDDGEIRRSCSSV  1126
             LF SD ALL D      V  +A +   +   +  +   +  IGV  G D+GEIR +C  +
Sbjct  275   LFTSDQALLSDSTTASLVTLYARNPGLWGRKFATAMGSMGQIGVLTG-DEGEIRSNCRVI  333

Query  1127  N  1129
             N
Sbjct  334   N  334



>ref|XP_004238381.1| PREDICTED: peroxidase 64-like [Solanum lycopersicum]
Length=314

 Score =   225 bits (574),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 128/299 (43%), Positives = 177/299 (59%), Gaps = 10/299 (3%)
 Frame = +2

Query  242   NFYAISCPSAELIVKNTVRSASSVDPTLPGKLLRLLFHDCFVEGCDASILL---QGNDTE  412
             N+Y  +CP AE  ++  V+ A S D T+P  LLR+ FHDCFV GCD S+LL   + N  E
Sbjct  23    NYYDQTCPDAESTIRQVVKKAMSNDKTVPAALLRMHFHDCFVRGCDGSVLLNSTKNNQAE  82

Query  413   RSDPANKSVGGFSTVDSAKRVLEIFCPETVSCADIIALAARDAVEFVGGPSVAIPTGRRD  592
             +  P N S+  F  +D AK+ +E  CP  VSCADI+ALAARDAV   GGP  A+P GR+D
Sbjct  83    KDGPPNISLHSFYVIDVAKKQIENMCPGVVSCADILALAARDAVTLSGGPYWAVPKGRKD  142

Query  593   GRVSLGKNVRPNIIDTSFTMDEMMKIFAAKGLSLDDLVTLSGAHTIGSAHCSAFSDRFQL  772
             GR+S+    R  +   +F + ++ + F+ +GLSLDDLV LSG HT+G +HCS+F +R + 
Sbjct  143   GRISIASETR-QLPGPNFNISQLQQSFSQRGLSLDDLVALSGGHTLGFSHCSSFRNRIEN  201

Query  773   ASNGSFLPIdaaldhayaaelaRQCPAGASDAVTVNNDPVTPSLFDNQYYKDLLAHRGLF  952
               + +   +D +LD ++AA L + CP   +          T  LFDN YYK +L  +GLF
Sbjct  202   FDSKN--DVDPSLDASFAANLKKICPVKNTTKNAGATMDTTTFLFDNAYYKLILQKKGLF  259

Query  953   QSDSALLRDKRAMEKVQDFAGDQNNFFTSWEQSFLKLVSIGVKVGDDDGEIRRSCSSVN  1129
              SDS LL + R    V +FA  Q+ FF ++  S +K+ SI         EIR  C  VN
Sbjct  260   SSDSTLLTNSRTKTLVLNFANSQHEFFKAFADSMIKMSSI----SGSGQEIRHDCRFVN  314



>ref|XP_010919026.1| PREDICTED: peroxidase 5-like [Elaeis guineensis]
Length=324

 Score =   225 bits (574),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 130/299 (43%), Positives = 182/299 (61%), Gaps = 7/299 (2%)
 Frame = +2

Query  245   FYAISCPSAELIVKNTVRSASSVDPTLPGKLLRLLFHDCFVEGCDASILLQG---NDTER  415
             FY   CP AELIVK  V  A   +  L   L+R+ FHDCF+ GCD S+L+     N  E+
Sbjct  29    FYDSICPQAELIVKTQVTVALLSNIGLAAGLVRMHFHDCFIRGCDGSVLIDSTSTNTAEK  88

Query  416   SDPANKSVGGFSTVDSAKRVLEIFCPETVSCADIIALAARDAVEFVGGPSVAIPTGRRDG  595
                 NKS+ GF  +DSAK +LE  CP  VSCADI+A+AARD++E  GG S  +P GRRDG
Sbjct  89    DSSINKSLRGFDVIDSAKALLEATCPGMVSCADILAIAARDSIELTGGLSYEVPAGRRDG  148

Query  596   RVSLGKNVRPNIIDTSFTMDEMMKIFAAKGLSLDDLVTLSGAHTIGSAHCSAFSDRFQLA  775
              VSL      N+    F +D++ + F  KGL+ + +VTLSGAHTIG +HCS+FS+R  L 
Sbjct  149   TVSLASETFTNLPGPGFNVDQLTQSFKVKGLTQEQMVTLSGAHTIGRSHCSSFSNR--LY  206

Query  776   SNGSFLPIdaaldhayaaelaRQCPAGASDA-VTVNNDPVTPSLFDNQYYKDLLAHRGLF  952
             +  + +  D +LD  YAA+L ++CP G++D  + V  DP +P++ D  YY ++LA+RGLF
Sbjct  207   NFSTTVKEDPSLDATYAAQLMQECPQGSTDPNLVVPMDPSSPNIVDTGYYSNILANRGLF  266

Query  953   QSDSALLRDKRAMEKVQDFAGDQNNFFTSWEQSFLKLVSIGVKVGDDDGEIRRSCSSVN  1129
              SD  LL       +V+  A +   +   +  + + +  IGV  G  +GEIRR+C  VN
Sbjct  267   TSDQTLLSQVATAGQVRQNAANSMLWQNKFAAAMVAMGQIGVLTG-SNGEIRRNCRVVN  324



>emb|CDP05261.1| unnamed protein product [Coffea canephora]
Length=318

 Score =   225 bits (574),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 129/299 (43%), Positives = 180/299 (60%), Gaps = 9/299 (3%)
 Frame = +2

Query  242   NFYAISCPSAELIVKNTVRSASSVDPTLPGKLLRLLFHDCFVEGCDASILLQ---GNDTE  412
             ++Y  +CP AE I+  T+R+AS  D  +P ++LR+ FHDCF+ GCDASILL    GN  E
Sbjct  26    HYYDKTCPQAESIIFQTLRNASLYDRKVPARILRMFFHDCFIRGCDASILLDSTPGNKAE  85

Query  413   RSDPANKSVGGFSTVDSAKRVLEIFCPETVSCADIIALAARDAVEFVGGPSVAIPTGRRD  592
             +  P N SV  F  +D AK  LE  CP TVSCADIIA+AARD V   GGP   +  GR+D
Sbjct  86    KDGPPNISVRSFYVIDDAKTNLESACPHTVSCADIIAVAARDVVAMSGGPHWNVLKGRKD  145

Query  593   GRVSLGKNVRPNIIDTSFTMDEMMKIFAAKGLSLDDLVTLSGAHTIGSAHCSAFSDRFQL  772
             GRVS+  N   ++   S    ++++ FA +GL + DLV LSG HT+G +HCS+F  R  L
Sbjct  146   GRVSIA-NETIDLPAPSSNSTQLIQSFAKRGLGVKDLVALSGGHTLGFSHCSSFEAR--L  202

Query  773   ASNGSFLPIdaaldhayaaelaRQCPAGASDAVTVNNDPVTPSLFDNQYYKDLLAHRGLF  952
              +  S   +D  L+  +A  L ++CP   +D+        T S FDN+YYK ++A +G+F
Sbjct  203   RNFSSLHEVDPTLNTEFAENLKKKCPKHHTDSNAGQFLDSTASTFDNEYYKRVIAGKGVF  262

Query  953   QSDSALLRDKRAMEKVQDFAGDQNNFFTSWEQSFLKLVSIGVKVGDDDGEIRRSCSSVN  1129
              SD AL  D R    V+ FA DQ  FF+ +  S ++L ++GV   ++ GE+R  C  VN
Sbjct  263   ASDQALYGDHRTKWIVESFARDQALFFSEFASSMVRLGNVGV---NEHGEVRTKCRVVN  318



>gb|KHN29593.1| Peroxidase 5 [Glycine soja]
Length=328

 Score =   226 bits (575),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 139/301 (46%), Positives = 186/301 (62%), Gaps = 9/301 (3%)
 Frame = +2

Query  245   FYAISCPSAELIVKNTVRSASSVDPTLPGKLLRLLFHDCFVEGCDASILLQ---GNDT-E  412
             FY+ +CPSAE IV++TV  A S    +   L+R+ FHDCFV GCD S+LL    GN   E
Sbjct  31    FYSSTCPSAEEIVRSTVNKAISHKAGIAAGLIRMHFHDCFVRGCDGSVLLASTPGNPVAE  90

Query  413   RSDPANK-SVGGFSTVDSAKRVLEIFCPETVSCADIIALAARDAVEFVGGPSVAIPTGRR  589
             R + AN  S+ GF  ++ AK  LE  CP+TVSCADI+A AARD+   VGG +  +P+GRR
Sbjct  91    RDNFANNPSLRGFEVIEEAKTQLEAACPQTVSCADILAFAARDSALKVGGINYDVPSGRR  150

Query  590   DGRVSLGKNVRPNIIDTSFTMDEMMKIFAAKGLSLDDLVTLSGAHTIGSAHCSAFSDRFQ  769
             DGR+S+   V  N+   + T DE++  F+ KGLS D++VTLSGAH+IG +HCSAFS R  
Sbjct  151   DGRISIADEVPRNLPAPTSTADELVSNFSRKGLSADEMVTLSGAHSIGVSHCSAFSKR--  208

Query  770   LASNGSFLPIdaaldhayaaelaRQCPAGASDA-VTVNNDPVTPSLFDNQYYKDLLAHRG  946
             L S    +  D ++D +YA  L   CPA  S    TV+ DP TP   DN+YY+ L+ HRG
Sbjct  209   LYSFNDTVTQDPSMDSSYAETLKSICPAPPSTTDSTVSLDPSTPIRLDNKYYEGLINHRG  268

Query  947   LFQSDSALLRDKRAMEKVQDFAGDQNNFFTSWEQSFLKLVSIGVKVGDDDGEIRRSCSSV  1126
             L  SD  L   +   E VQ  A +  ++   + ++ +++ SI V  G  DGEIRR CS V
Sbjct  269   LLTSDQTLHTSQTTREMVQSNANNGASWAEKFAKAMVQMGSIEVLTG-SDGEIRRHCSLV  327

Query  1127  N  1129
             N
Sbjct  328   N  328



>ref|XP_010921346.1| PREDICTED: peroxidase 5-like [Elaeis guineensis]
Length=328

 Score =   226 bits (575),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 137/303 (45%), Positives = 186/303 (61%), Gaps = 11/303 (4%)
 Frame = +2

Query  245   FYAISCPSAELIVKNTVRSASSVDPTLPGKLLRLLFHDCFVEGCDASILLQ---GNDTER  415
             FY   CP+AE IV+ TV  A + +P +   L+R+ FHDCFV GCDAS+LL    GN  E+
Sbjct  29    FYLSRCPAAESIVRRTVTEAVAKNPGIAAGLVRMHFHDCFVRGCDASVLLDSTPGNPAEK  88

Query  416   SDPANK-SVGGFSTVDSAKRVLEIFCPETVSCADIIALAARDAVEFVGGPSVAIPTGRRD  592
               PAN  S+ GF  +D AK  +E  CP+TVSCADI+A AARD     GG    +P GRRD
Sbjct  89    ESPANNPSLRGFEVIDKAKAEIEAQCPQTVSCADILAFAARDGAFRAGGIDYTVPAGRRD  148

Query  593   GRVSLGKNVRPNIIDTSFTMDEMMKIFAAKGLSLDDLVTLSGAHTIGSAHCSAFSDRFQL  772
             GR+SL  +V  NI    FT+D++ + FA KGLSLD++VTLSGAH+IG +HCS+FS+R  L
Sbjct  149   GRISLESDVLQNIPAPFFTVDQLQQNFARKGLSLDEMVTLSGAHSIGVSHCSSFSNR--L  206

Query  773   ASNGSFLPIdaaldhayaaelaRQCP----AGASDAVTVNNDPVTPSLFDNQYYKDLLAH  940
              S  +  P D +L+  +AA L  +CP     GA    TV  D VTP+  DN+YYK+L  +
Sbjct  207   YSFNATNPQDPSLNPGFAAFLKTKCPPPSSTGAGQDATVPLDIVTPNRLDNRYYKNLRNN  266

Query  941   RGLFQSDSALLRDKRAMEKVQDFAGDQNNFFTSWEQSFLKLVSIGVKVGDDDGEIRRSCS  1120
             +GL  SD +L+ D      V++ A     +   +  + +++ SI V  G   GEIR++C 
Sbjct  267   KGLLTSDQSLMSDPSTKTIVRNNANRGAEWAAKFAAAMVQMGSIEVLTG-TQGEIRKNCR  325

Query  1121  SVN  1129
              VN
Sbjct  326   LVN  328



>ref|XP_003555769.1| PREDICTED: peroxidase 5-like [Glycine max]
Length=329

 Score =   225 bits (574),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 138/301 (46%), Positives = 184/301 (61%), Gaps = 9/301 (3%)
 Frame = +2

Query  245   FYAISCPSAELIVKNTVRSASSVDPTLPGKLLRLLFHDCFVEGCDASILLQ---GNDTER  415
             FY+ +CPSAE IVK+TV  A S +P +   L+R+ FHDCFV GCD S+LL    GN    
Sbjct  32    FYSSTCPSAEAIVKSTVEKAISANPGIAAGLIRMHFHDCFVRGCDGSVLLASTPGNPISE  91

Query  416   SDP--ANKSVGGFSTVDSAKRVLEIFCPETVSCADIIALAARDAVEFVGGPSVAIPTGRR  589
              D    N S+ GF  ++ AK  +E  CPETVSCADI+A AARD+V  VGG S  +P+GRR
Sbjct  92    RDNFVNNPSLRGFEVIEDAKNQIEAACPETVSCADILAFAARDSVSKVGGISYDVPSGRR  151

Query  590   DGRVSLGKNVRPNIIDTSFTMDEMMKIFAAKGLSLDDLVTLSGAHTIGSAHCSAFSDRFQ  769
             DGRVS+G  V  N+   S + D+++  F  KGLS D++VTLSGAH+IG +HC AFS+R  
Sbjct  152   DGRVSIGDEVLDNLPRPSLSADDLISNFERKGLSADEMVTLSGAHSIGVSHCGAFSNR--  209

Query  770   LASNGSFLPIdaaldhayaaelaRQCPAGASDA-VTVNNDPVTPSLFDNQYYKDLLAHRG  946
             L S    +  D +LD +YA  L  QCP     +  TV+ +P TP   D++YY+ L+ HRG
Sbjct  210   LYSFSDTVTQDPSLDSSYAETLKTQCPPPPPTSDPTVSLEPSTPIRLDSKYYEGLINHRG  269

Query  947   LFQSDSALLRDKRAMEKVQDFAGDQNNFFTSWEQSFLKLVSIGVKVGDDDGEIRRSCSSV  1126
             L  SD  L   +     VQ  A +  ++   +  + L++ SI V  G  DGEIR+ CS V
Sbjct  270   LLTSDQTLYTSQSTRGMVQSNANNGASWADKFALAMLRMGSIEVLTG-SDGEIRKQCSFV  328

Query  1127  N  1129
             N
Sbjct  329   N  329



>ref|XP_007200009.1| hypothetical protein PRUPE_ppa024711mg [Prunus persica]
 gb|EMJ01208.1| hypothetical protein PRUPE_ppa024711mg [Prunus persica]
Length=324

 Score =   225 bits (574),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 137/302 (45%), Positives = 180/302 (60%), Gaps = 10/302 (3%)
 Frame = +2

Query  242   NFYAISCPSAELIVKNTVRSASSVDPTLPGKLLRLLFHDCFVEGCDASILLQ--GNDTER  415
             NFY  +CPSAE IV+N   +  S +P LP KLLR+ FHDCFV GCD S+LL    N+T  
Sbjct  27    NFYRSTCPSAEEIVRNVTWNHVSSNPNLPAKLLRMHFHDCFVRGCDGSVLLNSTANNTAE  86

Query  416   SDPA-NKSVGGFSTVDSAKRVLEIFCPETVSCADIIALAARDAVEFVGGPSV-AIPTGRR  589
              D A N S+ GF+ +D  K  LE  CP  VSCADI+ALAARD+V F    S+  + TGRR
Sbjct  87    KDAAPNLSLAGFNVIDDIKENLENKCPGIVSCADILALAARDSVSFQFKRSLWKVLTGRR  146

Query  590   DGRVSLGKNVRPNIIDTSFTMDEMMKIFAAKGLSLDDLVTLSGAHTIGSAHCSAFSDR-F  766
             DG +S  +    NI   +F   ++ + FA+K L++ DLV LSG+HTIG  HC  FS+R +
Sbjct  147   DGTISRTREALINIPPPAFNFTQLKQRFASKNLTVHDLVVLSGSHTIGVGHCPTFSNRLY  206

Query  767   QLASNGSFLPIdaaldhayaaelaRQCPAGASDAVTVNNDPVTPSLFDNQYYKDLLAHRG  946
                  G   P   +L+  YAA L  +CP+      TV  DP +   FD  YY  L  H+G
Sbjct  207   NFTGKGDQDP---SLNATYAAFLKTKCPSLNDTTTTVEMDPGSSLKFDTGYYATLKQHKG  263

Query  947   LFQSDSALLRDKRAMEKVQDFAGDQNNFFTSWEQSFLKLVSIGVKVGDDDGEIRRSCSSV  1126
             LFQSD+ALL +K A   VQ+  GD + FF  + QS +++ +I V  G   GEIR  C +V
Sbjct  264   LFQSDAALLTNKGAANIVQEL-GDNDKFFAEFAQSMVRMGAIEVLTG-TSGEIRSKCWAV  321

Query  1127  NA  1132
             N+
Sbjct  322   NS  323



>ref|XP_007145114.1| hypothetical protein PHAVU_007G211100g [Phaseolus vulgaris]
 gb|ESW17108.1| hypothetical protein PHAVU_007G211100g [Phaseolus vulgaris]
Length=324

 Score =   225 bits (574),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 134/300 (45%), Positives = 182/300 (61%), Gaps = 10/300 (3%)
 Frame = +2

Query  242   NFYAISCPSAELIVKNTVRSASSVDPTLPGKLLRLLFHDCFVEGCDASILLQ---GNDTE  412
             +FY  +CPSAE IV++ V  A S++P +   L+R+ FHDCFV GCD S+LL+   GN +E
Sbjct  31    DFYKTTCPSAESIVRSAVEKAVSLNPGIAAGLIRMHFHDCFVRGCDGSVLLESTPGNPSE  90

Query  413   RSDPANK-SVGGFSTVDSAKRVLEIFCPETVSCADIIALAARDAVEFVGGPSVAIPTGRR  589
             R  PAN  S+ GF  +D AK  +E  CP TVSCADI+A AARD+   VGG + A+P GRR
Sbjct  91    RDHPANNPSLRGFQVIDEAKAQIEAECPHTVSCADILAFAARDSANKVGGINYAVPAGRR  150

Query  590   DGRVSLGKNVRPNIIDTSFTMDEMMKIFAAKGLSLDDLVTLSGAHTIGSAHCSAFSDRFQ  769
             DGRVS+        + TS   D+++  F  KGLS D++VTLSGAH+IG +HCS+FSDR  
Sbjct  151   DGRVSIRDEASQLPLPTS-NADQLIANFRRKGLSADEMVTLSGAHSIGVSHCSSFSDR--  207

Query  770   LASNGSFLPIdaaldhayaaelaRQCPAGASDAVTVNNDPVTPSLFDNQYYKDLLAHRGL  949
             L S  +  P D ++D  YA  L  +CPAG+ + V +  D  TP+  DN+YY +L  HRGL
Sbjct  208   LYSFNATFPQDPSMDSKYATSLKSKCPAGSDNTVPL--DASTPNRLDNKYYTELKKHRGL  265

Query  950   FQSDSALLRDKRAMEKVQDFAGDQNNFFTSWEQSFLKLVSIGVKVGDDDGEIRRSCSSVN  1129
               SD  LL        +   A   + +   + ++ + + SI V  G   GEIR  C+ VN
Sbjct  266   LTSDQTLLGSPSTRPMLLTNAKHSSVWARKFAKAMVHMGSIDVLTG-SQGEIRTRCALVN  324



>ref|XP_010066142.1| PREDICTED: peroxidase 66-like [Eucalyptus grandis]
 gb|KCW63956.1| hypothetical protein EUGRSUZ_G01637 [Eucalyptus grandis]
Length=323

 Score =   225 bits (574),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 130/300 (43%), Positives = 179/300 (60%), Gaps = 11/300 (4%)
 Frame = +2

Query  242   NFYAISCPSAELIVKNTVRSASSVDPTLPGKLLRLLFHDCFVEGCDASILLQ---GNDTE  412
             ++Y  +CP AE I+  TV++A+  DP +P +LLR+ FHDCF+ GCDAS+LL    GN  E
Sbjct  31    HYYDRTCPQAEKIILQTVQNATRHDPKVPARLLRMFFHDCFIRGCDASLLLDSTPGNKAE  90

Query  413   RSDPANKSVGGFSTVDSAKRVLEIFCPETVSCADIIALAARDAVEFVGGPSVAIPTGRRD  592
             +  P N SV  F  +D AK  LE  CP TVSCADI+A+AARD V   GGP   +P GR+D
Sbjct  91    KDGPPNISVRAFYVIDDAKARLETACPHTVSCADIVAVAARDVVTMAGGPYWNVPKGRKD  150

Query  593   GRVSLGKNVRPNIIDTSFTMDEMMKIFAAKGLSLDDLVTLSGAHTIGSAHCSAFSDRFQL  772
             GRVS       N+   +F + ++++ FA +GL L DLV LSG HT+G +HCS+F  R + 
Sbjct  151   GRVSNASET-VNLPAPTFNVTQLLQSFAKRGLGLKDLVALSGGHTLGFSHCSSFEARLR-  208

Query  773   ASNGSFLP-IdaaldhayaaelaRQCPAGASDAVTVNNDPVTPSLFDNQYYKDLLAHRGL  949
               N S +  +D  L+ A+A +L  +CP    D         T   FDN YY+ L+A  G+
Sbjct  209   --NFSLIHDVDPTLNRAFAQQLKNKCPKPNRDRNAGQFLDATSLTFDNVYYRRLVAGEGV  266

Query  950   FQSDSALLRDKRAMEKVQDFAGDQNNFFTSWEQSFLKLVSIGVKVGDDDGEIRRSCSSVN  1129
             F SD AL  D R    V  FA DQ+ FF  +  S ++L ++GV     +GE+R +C +VN
Sbjct  267   FGSDQALYSDYRTRWMVDSFAKDQSLFFREFAASMVRLGNVGVL---HNGEVRVNCRTVN  323



>ref|XP_010455535.1| PREDICTED: peroxidase 39-like [Camelina sativa]
Length=326

 Score =   225 bits (574),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 128/301 (43%), Positives = 179/301 (59%), Gaps = 9/301 (3%)
 Frame = +2

Query  245   FYAISCPSAELIVKNTVRSASSVDPTLPGKLLRLLFHDCFVEGCDASILLQGNDT----E  412
             FY  +CP+AE IV++ V    +  P+L   L+R+ FHDCFV GCD SIL+    +    E
Sbjct  29    FYGKTCPNAEKIVQDVVNQHINNAPSLAAGLIRMHFHDCFVRGCDGSILINATSSNQQVE  88

Query  413   RSDPANKSVGGFSTVDSAKRVLEIFCPETVSCADIIALAARDAVEFVGGPSVAIPTGRRD  592
             +  P N +V GF  +D  K  LE  CP  VSCADII LA RD++  +GGP+  +PTGRRD
Sbjct  89    KLAPPNLTVRGFDFIDKVKSALESKCPGIVSCADIITLATRDSIVAIGGPTWNVPTGRRD  148

Query  593   GRVSLGKNVRPNIIDTSFTMDEMMKIFAAKGLSLDDLVTLSGAHTIGSAHCSAFSDR-FQ  769
             GR+S     R NI         ++ +FA +GL + DLV LSGAHTIG +HCS+FS+R F 
Sbjct  149   GRISNFAEARNNIPPPFGNFTTLITLFANQGLDVKDLVLLSGAHTIGVSHCSSFSNRLFN  208

Query  770   LASNGSFLPIdaaldhayaaelaRQCPAGASDAVTVNNDPVTPSLFDNQYYKDLLAHRGL  949
                 G   P  +      A   +R+C + A +   V  DP + + FD  Y+K +L  RGL
Sbjct  209   FTGVGDEDP--SLDSEYAANLKSRRCLSLADNTTKVEMDPGSRNTFDLSYFKLVLKRRGL  266

Query  950   FQSDSALLRDKRAMEKVQDFA-GDQNNFFTSWEQSFLKLVSIGVKVGDDDGEIRRSCSSV  1126
             F+SD+AL  +  A+ +V+ FA G + +FF+ + ++  K+  IGVK G   GEIRR+C+ V
Sbjct  267   FESDAALTMNPAALAQVRRFAGGSEQDFFSEFSKAMEKMGRIGVKTG-SAGEIRRTCAFV  325

Query  1127  N  1129
             N
Sbjct  326   N  326



>ref|XP_003534685.2| PREDICTED: peroxidase 5-like [Glycine max]
Length=328

 Score =   225 bits (574),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 139/301 (46%), Positives = 186/301 (62%), Gaps = 9/301 (3%)
 Frame = +2

Query  245   FYAISCPSAELIVKNTVRSASSVDPTLPGKLLRLLFHDCFVEGCDASILLQ---GNDT-E  412
             FY+ +CPSAE IV++TV  A S    +   L+R+ FHDCFV GCD S+LL    GN   E
Sbjct  31    FYSSTCPSAEEIVRSTVNKAISDKAGIAAGLIRMHFHDCFVRGCDGSVLLASTPGNPVAE  90

Query  413   RSDPANK-SVGGFSTVDSAKRVLEIFCPETVSCADIIALAARDAVEFVGGPSVAIPTGRR  589
             R + AN  S+ GF  ++ AK  LE  CP+TVSCADI+A AARD+   VGG +  +P+GRR
Sbjct  91    RDNFANNPSLRGFEVIEEAKTQLEAACPQTVSCADILAFAARDSALKVGGINYDVPSGRR  150

Query  590   DGRVSLGKNVRPNIIDTSFTMDEMMKIFAAKGLSLDDLVTLSGAHTIGSAHCSAFSDRFQ  769
             DGR+S+   V  N+   + T DE++  F+ KGLS D++VTLSGAH+IG +HCSAFS R  
Sbjct  151   DGRISIADEVPRNLPAPTSTADELVSNFSRKGLSADEMVTLSGAHSIGVSHCSAFSKR--  208

Query  770   LASNGSFLPIdaaldhayaaelaRQCPAGASDA-VTVNNDPVTPSLFDNQYYKDLLAHRG  946
             L S    +  D ++D +YA  L   CPA  S    TV+ DP TP   DN+YY+ L+ HRG
Sbjct  209   LYSFNDTVTQDPSMDSSYAETLKSICPAPPSTTDSTVSLDPSTPIRLDNKYYEGLINHRG  268

Query  947   LFQSDSALLRDKRAMEKVQDFAGDQNNFFTSWEQSFLKLVSIGVKVGDDDGEIRRSCSSV  1126
             L  SD  L   +   E VQ  A +  ++   + ++ +++ SI V  G  DGEIRR CS V
Sbjct  269   LLTSDQTLHTSQTTREMVQSNANNGASWAEKFAKAMVQMGSIEVLTG-SDGEIRRHCSLV  327

Query  1127  N  1129
             N
Sbjct  328   N  328



>ref|XP_004309239.1| PREDICTED: peroxidase 66-like [Fragaria vesca subsp. vesca]
Length=323

 Score =   225 bits (573),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 128/302 (42%), Positives = 178/302 (59%), Gaps = 15/302 (5%)
 Frame = +2

Query  242   NFYAISCPSAELIVKNTVRSASSVDPTLPGKLLRLLFHDCFVEGCDASILLQ---GNDTE  412
             ++Y  +CP AE I+  TV +AS  DP +P ++LR+ FHDCF+ GCDAS+LL    GN  E
Sbjct  31    HYYDKTCPQAEKIIFQTVYNASMHDPKVPARILRMFFHDCFIRGCDASLLLDSTPGNQAE  90

Query  413   RSDPANKSVGGFSTVDSAKRVLEIFCPETVSCADIIALAARDAVEFVGGPSVAIPTGRRD  592
             +  P N SV  F  +D AK  LE  CP  VSCADII +AARD V    GP   +  GR+D
Sbjct  91    KDGPPNISVRSFYVIDEAKAKLEAACPHIVSCADIIGIAARDVVTMSRGPYWTVLKGRKD  150

Query  593   GRVSLGKNVRPNIIDTSFTMDEMMKIFAAKGLSLDDLVTLSGAHTIGSAHCSAFSDRFQL  772
             GRVS   N   N+   +F + ++++ FA +GL + +LV LSG HT+G +HCS+F  R + 
Sbjct  151   GRVSRA-NETINLPAPTFNVSQLIQSFAKRGLGVKELVALSGGHTLGFSHCSSFEARLR-  208

Query  773   ASNGSFLPId---aaldhayaaelaRQCPAGASDAVTVNNDPVTPSLFDNQYYKDLLAHR  943
                 +F P+      +D  +A +L +QCP    D         T S+FDN YYK L+  +
Sbjct  209   ----NFSPVHDVDPTMDSEFALKLRKQCPKPNRDHSAGELLDSTSSIFDNDYYKQLIGGK  264

Query  944   GLFQSDSALLRDKRAMEKVQDFAGDQNNFFTSWEQSFLKLVSIGVKVGDDDGEIRRSCSS  1123
             G+F SD AL RD R    V+ FA DQ+ FF  +  S +KL ++GV    ++GE+R +C  
Sbjct  265   GVFGSDQALFRDFRTKWIVESFAKDQSLFFKEFAASMVKLGNVGVI---ENGEVRVNCRV  321

Query  1124  VN  1129
             VN
Sbjct  322   VN  323



>emb|CAN83265.1| hypothetical protein VITISV_042486 [Vitis vinifera]
Length=301

 Score =   224 bits (571),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 129/299 (43%), Positives = 174/299 (58%), Gaps = 9/299 (3%)
 Frame = +2

Query  242   NFYAISCPSAELIVKNTVRSASSVDPTLPGKLLRLLFHDCFVEGCDASILLQ---GNDTE  412
             ++Y  +CP AE I+  TVR AS  DP +P ++LR+ FHDCF+ GCDAS+LL    GN  E
Sbjct  9     HYYHQTCPQAENIIFETVRKASINDPKVPARILRMFFHDCFIRGCDASVLLDSTPGNQAE  68

Query  413   RSDPANKSVGGFSTVDSAKRVLEIFCPETVSCADIIALAARDAVEFVGGPSVAIPTGRRD  592
             +  P N S+  F  ++ AK  LE+ CP TVSCADIIA+AARD V    GP   +  GR+D
Sbjct  69    KDGPPNVSLASFYVIEDAKTKLEMACPGTVSCADIIAIAARDVVAMSRGPYWNVLKGRKD  128

Query  593   GRVSLGKNVRPNIIDTSFTMDEMMKIFAAKGLSLDDLVTLSGAHTIGSAHCSAFSDRFQL  772
             GRVS       N+   +F + ++ + FA +GL L DLV LSG H++G +HCS+F  R   
Sbjct  129   GRVSEASET-VNLPAPTFNVTQLFQSFAQRGLGLKDLVALSGGHSLGFSHCSSFEARVHN  187

Query  773   ASNGSFLPIdaaldhayaaelaRQCPAGASDAVTVNNDPVTPSLFDNQYYKDLLAHRGLF  952
              S  S   +D  ++  +A  L ++CP    D         T S FDN YY  L+A  GLF
Sbjct  188   FS--SVHDVDPTMNTEFAERLKKKCPKPNRDRNAGEFLDSTASTFDNDYYLRLMAGEGLF  245

Query  953   QSDSALLRDKRAMEKVQDFAGDQNNFFTSWEQSFLKLVSIGVKVGDDDGEIRRSCSSVN  1129
              SD ALL D R    V+ FA DQ  FF  +  S +KL ++GV    ++GE+R  C +VN
Sbjct  246   GSDQALLTDYRTRWIVESFAKDQGLFFREFTASMVKLGNVGVL---ENGEVRLKCQAVN  301



>ref|XP_010906352.1| PREDICTED: peroxidase 5-like, partial [Elaeis guineensis]
Length=322

 Score =   224 bits (572),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 135/299 (45%), Positives = 175/299 (59%), Gaps = 11/299 (4%)
 Frame = +2

Query  245   FYAISCPSAELIVKNTVRSASSVDPTLPGKLLRLLFHDCFVEGCDASILLQ---GNDTER  415
             +Y   CPSAE IV+ TVR A   +P +   L+R+ FHDCFV GCDAS+LL    GN +E+
Sbjct  29    YYKHKCPSAETIVRQTVRKAMIHNPGIGAGLIRMHFHDCFVRGCDASVLLDSTPGNPSEK  88

Query  416   SDPANK-SVGGFSTVDSAKRVLEIFCPETVSCADIIALAARDAVEFVGGPSVAIPTGRRD  592
               PAN  S+ GF  +D AK  +E  CP TVSCADI+  A+RDA  F GG   A+P GRRD
Sbjct  89    ESPANNPSLRGFEVIDEAKARIESVCPSTVSCADILTFASRDAAYFAGGIQYAVPAGRRD  148

Query  593   GRVSLGKNVRPNIIDTSFTMDEMMKIFAAKGLSLDDLVTLSGAHTIGSAHCSAFSDRFQL  772
             GRVS+   V  N+    F   ++   FA KG +LD++VTLSGAH+ G +HCS+F+DR   
Sbjct  149   GRVSIESEVLDNVPPFFFNAVQLENSFARKGFTLDEMVTLSGAHSFGVSHCSSFADRLNT  208

Query  773   ASNGSFLPIdaaldhayaaelaRQCPAGASDAVTVNNDPVTPSLFDNQYYKDLLAHRGLF  952
              +     P D  +D  +AA L  +C    SD  TVN D VTP+  DNQYYK+L   RGL 
Sbjct  209   TA-----PQDPKMDRKFAAFLKSKCSRAGSDP-TVNLDVVTPNRLDNQYYKNLQKGRGLL  262

Query  953   QSDSALLRDKRAMEKVQDFAGDQNNFFTSWEQSFLKLVSIGVKVGDDDGEIRRSCSSVN  1129
              SD  L         V   A     +  ++  + +K+ SI V  G D GEIRR+C +VN
Sbjct  263   TSDQTLQASALTSRLVDTNAKRPQAWAANFAAAMVKMGSIEVLTG-DQGEIRRTCRAVN  320



>ref|XP_009799014.1| PREDICTED: peroxidase 5-like [Nicotiana sylvestris]
Length=334

 Score =   225 bits (573),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 135/303 (45%), Positives = 182/303 (60%), Gaps = 11/303 (4%)
 Frame = +2

Query  245   FYAISCPSAELIVKNTVRSASSVDPTLPGKLLRLLFHDCFVEGCDASILLQ---GNDTER  415
             FY  +CP+AE IV+ TV  A S +P L   ++R+ FHDCFV GCDASILL    GN TE+
Sbjct  35    FYQSNCPNAEAIVRKTVNKAVSRNPGLGAGIIRMHFHDCFVRGCDASILLDSTPGNPTEK  94

Query  416   SDPANK-SVGGFSTVDSAKRVLEIFCPETVSCADIIALAARDAVEFVGGPSVAIPTGRRD  592
               PAN  S+ G+  +D+AK  LE  CP+TVSC+DIIA AARD+   +GG   ++P GRRD
Sbjct  95    EHPANNPSLRGYEVIDAAKAALESVCPQTVSCSDIIAFAARDSAYKLGGIRYSVPAGRRD  154

Query  593   GRVSLGKNVRPNIIDTSFTMDEMMKIFAAKGLSLDDLVTLSGAHTIGSAHCSAFSDRFQL  772
             GRVS+      ++   +F   ++ + FA KGLSLD++VTLSGAH+IG  HCS+FS R  L
Sbjct  155   GRVSILDEPNEHLPPFTFNAKQLEENFARKGLSLDEMVTLSGAHSIGRTHCSSFSSR--L  212

Query  773   ASNGSFLPIdaaldhayaaelaRQCPAGASDAV----TVNNDPVTPSLFDNQYYKDLLAH  940
              S  S    D ++D   A +L ++CP+  +D      TV  D VTP+  DN+YY +L  H
Sbjct  213   YSFNSTHTQDPSMDPRLAKQLRKRCPSPNNDGTGNDPTVPLDVVTPNRLDNKYYVNLKNH  272

Query  941   RGLFQSDSALLRDKRAMEKVQDFAGDQNNFFTSWEQSFLKLVSIGVKVGDDDGEIRRSCS  1120
             RGL  SD  L         V+  A    N+   +  + +K+ SI V  G   GEIR++C 
Sbjct  273   RGLLTSDQTLWNSPLTAGMVRSNAIHGVNWARKYAAAMVKMGSIEVMTG-KQGEIRKNCR  331

Query  1121  SVN  1129
              VN
Sbjct  332   VVN  334



>ref|XP_007153060.1| hypothetical protein PHAVU_003G003200g [Phaseolus vulgaris]
 gb|ESW25054.1| hypothetical protein PHAVU_003G003200g [Phaseolus vulgaris]
Length=331

 Score =   225 bits (573),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 136/301 (45%), Positives = 182/301 (60%), Gaps = 9/301 (3%)
 Frame = +2

Query  245   FYAISCPSAELIVKNTVRSASSVDPTLPGKLLRLLFHDCFVEGCDASILLQ---GNDTER  415
             FYA +CPSAE IV+  V    S +P +   L+R+ FHDCFV GC+ S+LL    GN    
Sbjct  34    FYASTCPSAEEIVRTAVNKGVSQNPGIAAGLIRMHFHDCFVRGCEGSVLLASTPGNPIAE  93

Query  416   SD--PANKSVGGFSTVDSAKRVLEIFCPETVSCADIIALAARDAVEFVGGPSVAIPTGRR  589
              D    N S+ GF  ++ AK  LE  CPETVSCADI+A AARD+   VGG +  +P+GRR
Sbjct  94    RDHFANNPSLRGFEVIEEAKIQLEAACPETVSCADILAFAARDSALKVGGITYDVPSGRR  153

Query  590   DGRVSLGKNVRPNIIDTSFTMDEMMKIFAAKGLSLDDLVTLSGAHTIGSAHCSAFSDRFQ  769
             DGRVS+   V  N+   +  +DE++  FA KGLS D++VTLSGAH+IG +HCSAFS R  
Sbjct  154   DGRVSVADEVGQNLPGPTSNVDELVNRFAQKGLSADEMVTLSGAHSIGVSHCSAFSKR--  211

Query  770   LASNGSFLPIdaaldhayaaelaRQCPA-GASDAVTVNNDPVTPSLFDNQYYKDLLAHRG  946
             L S       D ++D +YA  L  QCPA  A+   TV+ DP TP   D++YY+ L+ HRG
Sbjct  212   LYSFNDTFKQDPSMDSSYAETLKTQCPAPPATSDPTVSFDPSTPLRLDSKYYEGLIGHRG  271

Query  947   LFQSDSALLRDKRAMEKVQDFAGDQNNFFTSWEQSFLKLVSIGVKVGDDDGEIRRSCSSV  1126
             L  SD  L   +   E V   A +  ++   + ++ +K+ SI V  G + GEIR+ CS V
Sbjct  272   LLTSDQTLFATQSTREMVVSNANNGASWSEKFARAMVKMGSIEVLTG-NSGEIRKHCSFV  330

Query  1127  N  1129
             N
Sbjct  331   N  331



>gb|AAT72298.1| CBRCI35 [Capsella bursa-pastoris]
Length=326

 Score =   224 bits (572),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 128/302 (42%), Positives = 173/302 (57%), Gaps = 7/302 (2%)
 Frame = +2

Query  239   FNFYAISCPSAELIVKNTVRSASSVDPTLPGKLLRLLFHDCFVEGCDASILLQGN--DTE  412
              NFYA +CP+AE  V++ V +  S  P+L   L+R+ FHDCFV GCD S+L+     + E
Sbjct  28    MNFYANTCPNAEKTVQDFVSNHISNAPSLAAALIRMHFHDCFVRGCDGSVLINSTSGNAE  87

Query  413   RSDPANKSVGGFSTVDSAKRVLEIFCPETVSCADIIALAARDAVEFVGGPSVAIPTGRRD  592
             R    N +V GF  +D+ K VLE  CP  VSCADIIALA+RDA+ F GGP+  +PTGRRD
Sbjct  88    RDATPNLTVRGFGFIDAIKAVLEAQCPGIVSCADIIALASRDAIVFTGGPNWNVPTGRRD  147

Query  593   GRVSLGKNVRPNIIDTSFTMDEMMKIFAAKGLSLDDLVTLSGAHTIGSAHCSAFSDR-FQ  769
             GR+S       NI   +     +  +FA +GL L DLV LSGAHTIG +HCS+F++R + 
Sbjct  148   GRISNASEALANIPPPTSNFTNLQTLFANQGLDLKDLVLLSGAHTIGVSHCSSFTNRLYN  207

Query  770   LASNGSFLPIdaaldhayaaelaRQCPAGASDAVTVNNDPVTPSLFDNQYYKDLLAHRGL  949
                 G   P  A      A   +R+CP+   +   V  DP +   FD  YY+ +L  RGL
Sbjct  208   FTGRGDQDP--ALDSEYAANLKSRKCPSPNDNKTIVEMDPGSRKTFDLSYYQLVLKRRGL  265

Query  950   FQSDSALLRDKRAMEKVQD-FAGDQNNFFTSWEQSFLKLVSIGVKVGDDDGEIRRSCSSV  1126
             FQSDSAL  +   +  +     G   +FF+ + +S  K+  I VK G   G +RR CS  
Sbjct  266   FQSDSALTTNPTTLSNINRILTGSVESFFSEFAKSMEKMGRINVKTG-SAGVVRRQCSVA  324

Query  1127  NA  1132
             N+
Sbjct  325   NS  326



>ref|XP_003536895.1| PREDICTED: peroxidase 3-like [Glycine max]
Length=322

 Score =   224 bits (572),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 135/301 (45%), Positives = 176/301 (58%), Gaps = 10/301 (3%)
 Frame = +2

Query  245   FYAISCPSAELIVKNTVRSASSVDPTLPGKLLRLLFHDCFVEGCDASILLQ---GNDTER  415
             FY  SCP AE I+K   +   S +P LP KLLR+ FHDCFV GCDAS+LL     N  ER
Sbjct  27    FYRDSCPQAEDIIKTKTQQHVSANPDLPAKLLRMHFHDCFVRGCDASVLLNSTASNTAER  86

Query  416   SDPANKSVGGFSTVDSAKRVLEIFCPETVSCADIIALAARDAVEF-VGGPSVAIPTGRRD  592
                 N S+ GF  +D  K  +E  C +TVSCADI+ALAARDAV      P   + TGRRD
Sbjct  87    DAIPNLSLAGFDVIDDIKSAVEAKCSKTVSCADILALAARDAVSVQFNKPMWEVLTGRRD  146

Query  593   GRVSLGKNVRPNIIDTSFTMDEMMKIFAAKGLSLDDLVTLSGAHTIGSAHCSAFSDR-FQ  769
             G VS       NI    F   ++ + FA KGL+L DLV LSGAHTIG  HC+ FS+R + 
Sbjct  147   GTVSNSNEALANIPAPFFNFTQLKESFAGKGLTLHDLVVLSGAHTIGIGHCNLFSNRLYN  206

Query  770   LASNGSFLPIdaaldhayaaelaRQCPAGASDAVTVNNDPVTPSLFDNQYYKDLLAHRGL  949
                 G   P   +L+  YA  L  +C + +    TV  DP + + FD+ YY +LL ++GL
Sbjct  207   FTGKGDQDP---SLNTTYAEFLKTKCQSLSDTTTTVEMDPGSSTKFDSDYYPNLLQNKGL  263

Query  950   FQSDSALLRDKRAMEKVQDFAGDQNNFFTSWEQSFLKLVSIGVKVGDDDGEIRRSCSSVN  1129
             FQSD+ALL  +++ +  ++   DQN FFT + QS  ++ +I V  G   GEIR  CS VN
Sbjct  264   FQSDAALLTQEQSEDIAKELV-DQNKFFTEFAQSMKRMGAIEVLTG-SAGEIRNKCSVVN  321

Query  1130  A  1132
             +
Sbjct  322   S  322



>ref|XP_006342073.1| PREDICTED: peroxidase 64-like [Solanum tuberosum]
Length=317

 Score =   224 bits (571),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 128/299 (43%), Positives = 176/299 (59%), Gaps = 10/299 (3%)
 Frame = +2

Query  242   NFYAISCPSAELIVKNTVRSASSVDPTLPGKLLRLLFHDCFVEGCDASILL---QGNDTE  412
             N+Y  +CP AE  ++  V+ A S D T+P  LLR+ FHDCFV GCD S+LL   + N  E
Sbjct  26    NYYDQTCPDAESTIRQVVKKAMSNDKTVPAALLRMHFHDCFVRGCDGSVLLNSTKSNQAE  85

Query  413   RSDPANKSVGGFSTVDSAKRVLEIFCPETVSCADIIALAARDAVEFVGGPSVAIPTGRRD  592
             +  P N S+  F  +D AK+ +E  CP  VSCADI+ALAARDAV   GGP  A+P GR+D
Sbjct  86    KDGPPNISLHSFYVIDVAKKQIENMCPNVVSCADILALAARDAVTLSGGPYWAVPKGRKD  145

Query  593   GRVSLGKNVRPNIIDTSFTMDEMMKIFAAKGLSLDDLVTLSGAHTIGSAHCSAFSDRFQL  772
             GR+S+    R  +   +  + ++ + F+ +GLSLDDLV LSG HT+G +HCS+F +R + 
Sbjct  146   GRISIASETR-QLPGPNSNISQLQQSFSQRGLSLDDLVALSGGHTLGFSHCSSFRNRIEN  204

Query  773   ASNGSFLPIdaaldhayaaelaRQCPAGASDAVTVNNDPVTPSLFDNQYYKDLLAHRGLF  952
               + +   +D  LD ++AA L + CP   +          T  LFDN YYK +L  +GLF
Sbjct  205   FDSKN--DVDPTLDASFAANLKKICPVKNTTENAGATMDTTTFLFDNAYYKLVLQKKGLF  262

Query  953   QSDSALLRDKRAMEKVQDFAGDQNNFFTSWEQSFLKLVSIGVKVGDDDGEIRRSCSSVN  1129
              SDS LL + R    V +FA  Q+ FF ++  S +K+ SI         EIRR C  VN
Sbjct  263   SSDSNLLTNSRTKTLVSNFANSQHEFFKAFADSMIKMSSI----SGSGQEIRRDCRFVN  317



>ref|XP_011074707.1| PREDICTED: peroxidase 64-like [Sesamum indicum]
Length=319

 Score =   224 bits (571),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 127/300 (42%), Positives = 171/300 (57%), Gaps = 12/300 (4%)
 Frame = +2

Query  242   NFYAISCPSAELIVKNTVRSASSVDPTLPGKLLRLLFHDCFVEGCDASILLQG---NDTE  412
             N+Y  +CP+A+ IV N +R A+  D T+P  LLR  FHDCF+ GCDAS+LL     N  E
Sbjct  28    NYYHQTCPTADSIVTNVMRKATMNDKTVPAALLRTHFHDCFIRGCDASVLLNSKGKNKAE  87

Query  413   RSDPANKSVGGFSTVDSAKRVLEIFCPETVSCADIIALAARDAVEFVGGPSVAIPTGRRD  592
             +  P N S+     +D AK+ LE  CP  VSCADI+ALAARDAV   GGP+  +P GR+D
Sbjct  88    KDGPPNISLHALYVIDQAKKQLEKKCPGVVSCADILALAARDAVVLSGGPTWDVPKGRKD  147

Query  593   GRVSLGKNVRPNIIDTSFTMDEMMKIFAAKGLSLDDLVTLSGAHTIGSAHCSAFSDRFQL  772
             GR+S   + R   + T F + ++ + F+ +GLSLDDLV LSG HT+G +HCS+F +R   
Sbjct  148   GRISKAIDTRKLPVPT-FNISQLKQSFSQRGLSLDDLVALSGGHTLGFSHCSSFQNRIH-  205

Query  773   ASNGSFLPIdaaldhayaaelaRQ-CPAGASDAVTVNNDPVTPSLFDNQYYKDLLAHRGL  949
               N + +           A   RQ CP          N   TP++FDN YYK LL  + +
Sbjct  206   --NFNKVTDVDPSMDQSFAGKLRQVCPVNNKAKNAGANLDSTPTVFDNAYYKLLLQGKSI  263

Query  950   FQSDSALLRDKRAMEKVQDFAGDQNNFFTSWEQSFLKLVSIGVKVGDDDGEIRRSCSSVN  1129
             F SD ALL + R    V+ FAG +N FF ++  S +K+ SI         E+R  C  VN
Sbjct  264   FSSDQALLTNSRTKALVKKFAGSENVFFEAFVNSMIKMSSI----SGGGTEVRLDCGVVN  319



>ref|XP_010422076.1| PREDICTED: peroxidase 39-like [Camelina sativa]
Length=326

 Score =   224 bits (571),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 128/301 (43%), Positives = 179/301 (59%), Gaps = 9/301 (3%)
 Frame = +2

Query  245   FYAISCPSAELIVKNTVRSASSVDPTLPGKLLRLLFHDCFVEGCDASILLQGNDT----E  412
             FY  +CP+AE IV++ V    +  P+L   L+R+ FHDCFV GCD SIL+    +    E
Sbjct  29    FYDKTCPNAEKIVQDVVNQHINNAPSLAAGLIRMHFHDCFVRGCDGSILINATSSNQQVE  88

Query  413   RSDPANKSVGGFSTVDSAKRVLEIFCPETVSCADIIALAARDAVEFVGGPSVAIPTGRRD  592
             +  P N +V GF  +D  K  LE  CP  VSCADII LA RD++  +GGP+  +PTGRRD
Sbjct  89    KLAPPNLTVRGFDFIDKVKSALESKCPGIVSCADIITLATRDSIVAIGGPTWNVPTGRRD  148

Query  593   GRVSLGKNVRPNIIDTSFTMDEMMKIFAAKGLSLDDLVTLSGAHTIGSAHCSAFSDR-FQ  769
             GR+S     R NI         ++ +FA +GL + DLV LSGAHTIG +HCS+FS+R F 
Sbjct  149   GRISNFAEARDNIPPPFGNFTTLITLFANQGLDVKDLVLLSGAHTIGVSHCSSFSNRLFN  208

Query  770   LASNGSFLPIdaaldhayaaelaRQCPAGASDAVTVNNDPVTPSLFDNQYYKDLLAHRGL  949
                 G   P  +      A   +R+C + A +   V  DP + + FD  Y+K +L  RGL
Sbjct  209   FTGVGDEDP--SLDSEYAANLKSRRCLSLADNTTKVEMDPGSRNTFDLSYFKLVLKRRGL  266

Query  950   FQSDSALLRDKRAMEKVQDFA-GDQNNFFTSWEQSFLKLVSIGVKVGDDDGEIRRSCSSV  1126
             F+SD+AL  +  A+ +V+ FA G + +FF+ + ++  K+  IGVK G   GEIRR+C+ V
Sbjct  267   FESDAALTMNPAALAQVRRFAGGSEQDFFSEFSKAMEKMGRIGVKTG-SAGEIRRTCAFV  325

Query  1127  N  1129
             N
Sbjct  326   N  326



>ref|NP_001148340.1| peroxidase 1 precursor [Zea mays]
 gb|ACG30856.1| peroxidase 1 precursor [Zea mays]
Length=339

 Score =   224 bits (572),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 140/304 (46%), Positives = 184/304 (61%), Gaps = 11/304 (4%)
 Frame = +2

Query  245   FYAISCPSAELIVKNTVRSASSVDPTLPGKLLRLLFHDCFVEGCDASILLQ---GNDTER  415
             FY  SCP AE IV+N VR   + DP +   L+R+ FHDCFV GCDASIL+    GN  E+
Sbjct  35    FYKHSCPQAEDIVRNAVRRGLARDPGIGAGLIRMHFHDCFVRGCDASILINSTPGNLAEK  94

Query  416   SDPANK-SVGGFSTVDSAKRVLEIFCPETVSCADIIALAARDAVEFVGGPSVAIPTGRRD  592
                AN  S+ GF  +D AK VLE  CP TVSCADI+A AARD+    GG    +P+GRRD
Sbjct  95    DSVANNPSMRGFDVIDDAKAVLEAHCPRTVSCADIVAFAARDSACSAGGLEYEVPSGRRD  154

Query  593   GRVSLGKNVRPNIIDT-SFTMDEMMKIFAAKGLSLDDLVTLSGAHTIGSAHCSAFSDRFQ  769
             GRVS    V  N + T +  + E+++ F  KGLS DD+VTLSGAHT+G +HCS+F+ R  
Sbjct  155   GRVSRQDEVLDNNVPTPTDDVAELIESFKRKGLSADDMVTLSGAHTVGRSHCSSFTQRLY  214

Query  770   LASNGSFLPIdaaldhayaaelaRQCPAGAS----DAVTVNNDPVTPSLFDNQYYKDLLA  937
               S G     D ++D AYA  L  +CP  +S    D   V  DPVTP+ FDNQY+K++LA
Sbjct  215   NFS-GQLGRTDPSVDPAYAGHLKARCPWPSSDDQMDPTVVPQDPVTPATFDNQYFKNVLA  273

Query  938   HRGLFQSDSALLRDKRAMEKVQDFAGDQNNFFTSWEQSFLKLVSIGVKVGDDDGEIRRSC  1117
             H+ LF SD+ LL +      VQ  A  +  +   + ++ +K+  + V  G D+GEIR  C
Sbjct  274   HKVLFVSDNTLLDNPWTAGIVQFNAAVEKAWQVRFVKAMVKMGKVQVLTG-DEGEIREKC  332

Query  1118  SSVN  1129
               VN
Sbjct  333   FVVN  336



>ref|XP_004496622.1| PREDICTED: peroxidase 66-like [Cicer arietinum]
Length=322

 Score =   224 bits (571),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 129/299 (43%), Positives = 180/299 (60%), Gaps = 9/299 (3%)
 Frame = +2

Query  242   NFYAISCPSAELIVKNTVRSASSVDPTLPGKLLRLLFHDCFVEGCDASILLQG---NDTE  412
             ++Y  +CP  E IV  TV +AS  DP +P ++LR+ FHDCF++GCDASILL     N  E
Sbjct  30    HYYDQTCPQLEKIVSETVLNASIHDPKVPARILRMFFHDCFIKGCDASILLDSTATNQAE  89

Query  413   RSDPANKSVGGFSTVDSAKRVLEIFCPETVSCADIIALAARDAVEFVGGPSVAIPTGRRD  592
             +  P N SV  F  +D AK  LE+ CP TVSCADI+A+ ARD V   GGP  ++  GR+D
Sbjct  90    KDGPPNISVQSFYVIDDAKAKLELACPGTVSCADILAITARDVVAMSGGPYWSVLKGRKD  149

Query  593   GRVSLGKNVRPNIIDTSFTMDEMMKIFAAKGLSLDDLVTLSGAHTIGSAHCSAFSDRFQL  772
             GRVS   +   N+   +  +D++++ FA +GL + D+VTLSG HT+G +HCS+F  R   
Sbjct  150   GRVSKASDT-INLPAPTLNVDQLIQSFAKRGLGVKDMVTLSGGHTLGFSHCSSFEARVHN  208

Query  773   ASNGSFLPIdaaldhayaaelaRQCPAGASDAVTVNNDPVTPSLFDNQYYKDLLAHRGLF  952
              S  S   ID  ++  +A +L  +CP   ++         T S+FDN YYK LLA +G+F
Sbjct  209   FS--SLHDIDPRMNTNFALDLKNKCPKPNNNRNAGQFLDSTASVFDNDYYKQLLAGKGVF  266

Query  953   QSDSALLRDKRAMEKVQDFAGDQNNFFTSWEQSFLKLVSIGVKVGDDDGEIRRSCSSVN  1129
              SD +L+ D R    V+ FA DQ+ FF  +  S LKL   G   G ++GE+R +C  VN
Sbjct  267   SSDQSLVGDYRTRRIVEAFARDQSLFFKEFAASMLKL---GNLRGSNNGEVRLNCRFVN  322



>ref|XP_002884180.1| hypothetical protein ARALYDRAFT_900345 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH60439.1| hypothetical protein ARALYDRAFT_900345 [Arabidopsis lyrata subsp. 
lyrata]
Length=323

 Score =   224 bits (571),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 133/300 (44%), Positives = 176/300 (59%), Gaps = 8/300 (3%)
 Frame = +2

Query  242   NFYAISCPSAELIVKNTVRSASSVDPTLPGKLLRLLFHDCFVEGCDASILLQGNDTERSD  421
             NFY  SCP+ E IV+N VR            +LRL FHDCFV GCDASILL  + +E+  
Sbjct  28    NFYRKSCPNVETIVRNPVRQKFQQTFVTAPAILRLFFHDCFVRGCDASILL-ASPSEKDH  86

Query  422   PANKSVGG--FSTVDSAKRVLE--IFCPETVSCADIIALAARDAVEFVGGPSVAIPTGRR  589
             P +KS+ G  F TV  AK+ ++    C   VSCADI+ALA RD V   GGP+  +  GRR
Sbjct  87    PDDKSLAGDGFDTVAKAKQAVDRDPNCRNKVSCADILALATRDVVVLTGGPNYPVELGRR  146

Query  590   DGRVSLGKNVRPNIIDTSFTMDEMMKIFAAKGLSLDDLVTLSGAHTIGSAHCSAFSDRFQ  769
             DGR+S   +V+ ++   SF +D++  +FA  GLS  D++ LSGAHTIG AHC  FS R  
Sbjct  147   DGRLSTIASVQHSLPQPSFKLDQLNTMFARHGLSQTDMIALSGAHTIGFAHCGRFSKRIY  206

Query  770   LASNGSFLPIdaaldhayaaelaRQCPAGASDAVTVNNDPVTPSLFDNQYYKDLLAHRGL  949
               S     PID  L+  YA +L + CP      + +N DP +P+ FDN Y+K+L    GL
Sbjct  207   NFSPKR--PIDPTLNTQYALQLRQMCPIRVDPRIAINMDPTSPNTFDNAYFKNLQKGMGL  264

Query  950   FQSDSALLRDKRAMEKVQDFAGDQNNFFTSWEQSFLKLVSIGVKVGDDDGEIRRSCSSVN  1129
             F SD  L  D+R+   V  FA ++  F  ++  +  KL  +GVK G + GEIRR CS VN
Sbjct  265   FTSDQVLFSDQRSRSTVNSFASNEATFRQAFILAITKLGRVGVKTG-NAGEIRRDCSRVN  323



>ref|XP_003547618.1| PREDICTED: cationic peroxidase 2-like [Glycine max]
Length=322

 Score =   224 bits (570),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 130/301 (43%), Positives = 179/301 (59%), Gaps = 15/301 (5%)
 Frame = +2

Query  245   FYAISCPSAELIVKNTVRSASSVDPTLPGKLLRLLFHDCFVEGCDASILLQGNDTERSDP  424
             FY+ +CP AE IV++TV+S    DPTL   LLR+ FHDCFV+GCDAS+L+ G+ TER+  
Sbjct  31    FYSSTCPRAEFIVRSTVQSHVRSDPTLAAGLLRMHFHDCFVQGCDASVLIAGDGTERTAF  90

Query  425   ANKSVGGFSTVDSAKRVLEIFCPETVSCADIIALAARDAVEFVGGPSVAIPTGRRDGRVS  604
             AN  + GF  +D+AK  LE  CP  VSCADI+ALAARD+V   GGP+  +PTGRRDGR+S
Sbjct  91    ANLGLRGFEVIDNAKTQLEAACPGVVSCADILALAARDSVSLSGGPNWQVPTGRRDGRIS  150

Query  605   LGKNVRPNIIDTSFTMDEMMKIFAAKGLSLDDLVTLSGAHTIGSAHCSAFSDR-FQLASN  781
                +V  N+     ++D   + FAAKGL+  DLVTL G H+IG+  C  FS+R +   +N
Sbjct  151   QASDV-SNLPAPFDSVDVQKQKFAAKGLNTQDLVTLVGGHSIGTTACQFFSNRLYNFTAN  209

Query  782   G---SFLPIdaaldhayaaelaRQCPAGASDAVTVNNDPVTPSLFDNQYYKDLLAHRGLF  952
             G   S  P+  +   A        CP  +  +  V  D  + + FD  Y+ +L   RG+ 
Sbjct  210   GPDSSINPLFLSQLRAL-------CPQNSGGSNRVALDTGSQTRFDTSYFANLRIGRGIL  262

Query  953   QSDSALLRDKRAMEKVQDFAGDQNN--FFTSWEQSFLKLVSIGVKVGDDDGEIRRSCSSV  1126
             QSD AL  D      VQ + G      F   + +S +K+ +I +K G  DGEIR+ CS++
Sbjct  263   QSDQALWNDPSTKSFVQRYLGGFKGLLFNVEFAKSMVKMSNIELKTG-TDGEIRKICSAI  321

Query  1127  N  1129
             N
Sbjct  322   N  322



>ref|XP_002510864.1| Peroxidase 66 precursor, putative [Ricinus communis]
 gb|EEF51466.1| Peroxidase 66 precursor, putative [Ricinus communis]
Length=323

 Score =   224 bits (571),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 128/299 (43%), Positives = 178/299 (60%), Gaps = 9/299 (3%)
 Frame = +2

Query  242   NFYAISCPSAELIVKNTVRSASSVDPTLPGKLLRLLFHDCFVEGCDASILLQ---GNDTE  412
             ++Y  +CP AE IV  TV++AS  DP +P  LLR+ FHDCF+ GCDASILL    GN  E
Sbjct  31    HYYDQTCPQAENIVLQTVQNASMHDPKVPAHLLRMFFHDCFIRGCDASILLDSTPGNQAE  90

Query  413   RSDPANKSVGGFSTVDSAKRVLEIFCPETVSCADIIALAARDAVEFVGGPSVAIPTGRRD  592
             +  P N SV  F  +D AK  LE+ CP T+SCADIIA+AARD V   GGP   +  GR+D
Sbjct  91    KDGPPNISVRPFYVIDDAKAKLEMVCPHTISCADIIAIAARDVVAMSGGPHWNVLKGRKD  150

Query  593   GRVSLGKNVRPNIIDTSFTMDEMMKIFAAKGLSLDDLVTLSGAHTIGSAHCSAFSDRFQL  772
             GRVS   N   N+   +F + ++++ FA + L + D+V LSG HT+G +HCS+F  R  L
Sbjct  151   GRVSRA-NDTINLPAPTFNVTQLIQSFAKRSLGVKDMVALSGGHTLGFSHCSSFEAR--L  207

Query  773   ASNGSFLPIdaaldhayaaelaRQCPAGASDAVTVNNDPVTPSLFDNQYYKDLLAHRGLF  952
              +  S   +D ++   +A +L ++CP    D        +T S FDN YYK L   +G+F
Sbjct  208   RNFSSVHDVDPSMKSEFAEKLRKKCPKQNKDRNAGEFLDLTSSTFDNDYYKQLKEGKGVF  267

Query  953   QSDSALLRDKRAMEKVQDFAGDQNNFFTSWEQSFLKLVSIGVKVGDDDGEIRRSCSSVN  1129
              SD AL  D R    V+ F+ DQ+ FF  +  S +KL ++GV    ++GE+R  C  V+
Sbjct  268   GSDQALFSDYRTRWIVETFSRDQSLFFREFAASMVKLGNVGVI---ENGEVRHKCQVVS  323



>ref|XP_010032732.1| PREDICTED: peroxidase 5-like [Eucalyptus grandis]
Length=326

 Score =   224 bits (571),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 135/301 (45%), Positives = 182/301 (60%), Gaps = 10/301 (3%)
 Frame = +2

Query  245   FYAISCPSAELIVKNTVRSASSVDPTLPGKLLRLLFHDCFVEGCDASILLQ---GNDTER  415
             FY  +CPSAE +V+  V  A + +P +   L+R+ FHDCFV GCDASILL    GN +E+
Sbjct  30    FYRSTCPSAESVVRKAVNKAVAKNPGIGAGLIRMHFHDCFVRGCDASILLDSTPGNPSEK  89

Query  416   SDPANK-SVGGFSTVDSAKRVLEIFCPETVSCADIIALAARDAVEFVGGPSVAIPTGRRD  592
               PAN  S+ GF  +D AK  LE  CP+ VSCADI+A AARD+   +G  + A+P GRRD
Sbjct  90    EHPANNPSLRGFEVIDEAKAELESLCPQKVSCADILAFAARDSAYKLGSINYAVPAGRRD  149

Query  593   GRVSLGKNVRPNIIDTSFTMDEMMKIFAAKGLSLDDLVTLSGAHTIGSAHCSAFSDRFQL  772
             G VSL      N+    F   ++   FA+KGLSLD++VTLSGAH+IG +HCS+FSDR  L
Sbjct  150   GLVSLKDEPSQNLPPFFFNAQQLEANFASKGLSLDEMVTLSGAHSIGVSHCSSFSDR--L  207

Query  773   ASNGSFLPIdaaldhayaaelaRQCP--AGASDAVTVNNDPVTPSLFDNQYYKDLLAHRG  946
              S  +    D ++D   A++L  +CP   GASD  TV  D VTP+  DN+YY +L  HRG
Sbjct  208   YSFNATHTQDPSMDTKLASQLKSKCPNNGGASDP-TVPLDLVTPNRLDNKYYTNLKNHRG  266

Query  947   LFQSDSALLRDKRAMEKVQDFAGDQNNFFTSWEQSFLKLVSIGVKVGDDDGEIRRSCSSV  1126
             L  SD  L         V+  A +   +   +  + +K+ SI +  G ++GEIRR C+ V
Sbjct  267   LLTSDQTLFNSPSTANIVRSNANNGGAWANKFAAAMVKMGSIDILTG-NEGEIRRKCTVV  325

Query  1127  N  1129
             N
Sbjct  326   N  326



>tpe|CAH69312.1| TPA: class III peroxidase 70 precursor [Oryza sativa Japonica 
Group]
Length=335

 Score =   224 bits (571),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 141/304 (46%), Positives = 184/304 (61%), Gaps = 11/304 (4%)
 Frame = +2

Query  245   FYAISCPSAELIVKNTVRSASSVDPTLPGKLLRLLFHDCFVEGCDASILLQ---GNDTER  415
             FY  SCP AE IV+N VR A + DP L   L+R+ FHDCFV GCD SIL+    G+  E+
Sbjct  31    FYEHSCPQAEEIVRNAVRRAVARDPGLAAGLIRMHFHDCFVRGCDGSILINSTPGHVAEK  90

Query  416   SDPANK-SVGGFSTVDSAKRVLEIFCPETVSCADIIALAARDAVEFVGGP-SVAIPTGRR  589
                AN  S+ GF  VD AK ++E  CP TVSCADI+A AARD+    G      +P+GRR
Sbjct  91    DSVANNPSMRGFEVVDDAKAIVEAHCPRTVSCADILAFAARDSAHLAGATVDYPVPSGRR  150

Query  590   DGRVSLGKNVRP-NIIDTSFTMDEMMKIFAAKGLSLDDLVTLSGAHTIGSAHCSAFSDRF  766
             DGRVS+   V   N+   +F++ +++  F  KGL+ DD+VTLSGAHTIG +HCS+F+ R 
Sbjct  151   DGRVSVSDEVLADNVPAPTFSLAQLVASFERKGLTADDMVTLSGAHTIGRSHCSSFTARL  210

Query  767   QLASNGSFLPIdaaldhayaaelaRQCPAGASDAV---TVNNDPVTPSLFDNQYYKDLLA  937
                S G     D A+D AYAAEL R+CP    D +   TV  DPVTP+ FDNQYYK++L 
Sbjct  211   YNFS-GEAGRTDPAIDPAYAAELKRRCPPATDDQMDPTTVPLDPVTPASFDNQYYKNVLK  269

Query  938   HRGLFQSDSALLRDKRAMEKVQDFAGDQNNFFTSWEQSFLKLVSIGVKVGDDDGEIRRSC  1117
             HR +  SD ALL        V+  +  +  F   +  + +K+ +I V  G D+GEIR  C
Sbjct  270   HRVVLNSDQALLDSPWTAGVVKLHSAVEKVFQVKFAAAMVKMGNIDVLTG-DEGEIREKC  328

Query  1118  SSVN  1129
               VN
Sbjct  329   FMVN  332



>ref|XP_010435105.1| PREDICTED: peroxidase 39 [Camelina sativa]
Length=326

 Score =   224 bits (571),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 128/301 (43%), Positives = 178/301 (59%), Gaps = 9/301 (3%)
 Frame = +2

Query  245   FYAISCPSAELIVKNTVRSASSVDPTLPGKLLRLLFHDCFVEGCDASILLQGNDT----E  412
             FY  +CP+AE IV++ V    +  P+L   L+R+ FHDCFV GCD SIL+    +    E
Sbjct  29    FYDKTCPTAEKIVQDVVNQHINNAPSLAAGLIRMHFHDCFVLGCDGSILINATSSNQQVE  88

Query  413   RSDPANKSVGGFSTVDSAKRVLEIFCPETVSCADIIALAARDAVEFVGGPSVAIPTGRRD  592
             +  P N +V GF  +D  K  LE  CP  VSCADII LA RD++  +GGP+  +PTGRRD
Sbjct  89    KLAPPNLTVRGFDFIDKVKSALESKCPGIVSCADIITLATRDSIVAIGGPTWNVPTGRRD  148

Query  593   GRVSLGKNVRPNIIDTSFTMDEMMKIFAAKGLSLDDLVTLSGAHTIGSAHCSAFSDR-FQ  769
             GR+S     R NI         ++ +FA +GL + DLV LSGAHTIG +HCS+FS+R F 
Sbjct  149   GRISNFAEARDNIPPPFGNFTTLITLFANQGLDVKDLVLLSGAHTIGVSHCSSFSNRLFN  208

Query  770   LASNGSFLPIdaaldhayaaelaRQCPAGASDAVTVNNDPVTPSLFDNQYYKDLLAHRGL  949
                 G   P  +          +R+C + A +   V  DP + + FD  Y+K +L  RGL
Sbjct  209   FTGVGDQDP--SLDSEYADNLKSRRCLSLADNTTKVEMDPGSRNTFDLSYFKLVLKRRGL  266

Query  950   FQSDSALLRDKRAMEKVQDFA-GDQNNFFTSWEQSFLKLVSIGVKVGDDDGEIRRSCSSV  1126
             F+SD+AL  +  A+ +V+ FA G + +FF+ + +S  K+  IGVK G   GEIRR+C+ V
Sbjct  267   FESDAALTMNPAALAQVRRFAGGSEQDFFSEFSKSMEKMGRIGVKTG-SAGEIRRTCAFV  325

Query  1127  N  1129
             N
Sbjct  326   N  326



>dbj|BAK03531.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=334

 Score =   224 bits (571),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 131/298 (44%), Positives = 180/298 (60%), Gaps = 7/298 (2%)
 Frame = +2

Query  242   NFYAISCPSAELIVKNTVRSASSVDPTLPGKLLRLLFHDCFVEGCDASILL---QGNDTE  412
              FY  SCP+AE+IV+  V  A + +P L   LLRL FHDCFV GC+AS+L+   +GN  E
Sbjct  41    GFYDSSCPAAEIIVQQEVSKAVTANPGLAAGLLRLHFHDCFVGGCEASVLVDSTKGNTAE  100

Query  413   RSDPANKSVGGFSTVDSAKRVLEIFCPETVSCADIIALAARDAVEFVGGPSVAIPTGRRD  592
             +    N S+ GF  +D  K  +E  C   VSCADI+A AARD+V   GG +  +P GRRD
Sbjct  101   KDAGPNTSLRGFEVIDRIKARVEQACFGVVSCADILAFAARDSVALTGGNAYQVPAGRRD  160

Query  593   GRVSLGKNVRPNIIDTSFTMDEMMKIFAAKGLSLDDLVTLSGAHTIGSAHCSAFSDRFQL  772
             G VS  ++   N+   S  ++++ KIFA+KGL+  DLVTLSGAHTIG +HCS+FS R Q 
Sbjct  161   GGVSRAQDTGGNLPPPSPNVNQLTKIFASKGLNQKDLVTLSGAHTIGGSHCSSFSSRLQT  220

Query  773   ASNGSFLPIdaaldhayaaelaRQCPAGASDAVTVNNDPVTPSLFDNQYYKDLLAHRGLF  952
              S  +  P    +D  Y A+LA+QC A +S    V  D VTP+ FD  +YK ++++RGL 
Sbjct  221   PSPTAQDPT---MDPGYVAQLAQQCGASSSPGPLVPMDAVTPNSFDEGFYKGIMSNRGLL  277

Query  953   QSDSALLRDKRAMEKVQDFAGDQNNFFTSWEQSFLKLVSIGVKVGDDDGEIRRSCSSV  1126
              SD ALL D     +V  +A D   F + +  + +K+  +GV  G   G+IR +C  V
Sbjct  278   ASDQALLSDGNTAVQVVSYANDPATFQSDFAAAMVKMGYVGVLTG-SSGKIRANCRVV  334



>dbj|BAA77387.1| peroxidase 1 [Scutellaria baicalensis]
Length=322

 Score =   224 bits (570),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 135/301 (45%), Positives = 185/301 (61%), Gaps = 8/301 (3%)
 Frame = +2

Query  245   FYAISCPSAELIVKNTVRSASSVDPTLPGKLLRLLFHDCFVEGCDASILLQ--GNDTERS  418
             FY +SC  AE IVK  VR+A   D  +   L+RL FHDCFV GCD S+L+   G++T   
Sbjct  25    FYQLSCGFAETIVKQEVRNAFFRDSGIAAGLIRLHFHDCFVRGCDGSVLIDSTGSNTAEK  84

Query  419   D--PANKSVGGFSTVDSAKRVLEIFCPETVSCADIIALAARDAVEFVGGPSVAIPTGRRD  592
             D  P N S+ GF  VD+ KR LE+ CP  VSCADI+A AARD+VE   G    +  GRRD
Sbjct  85    DSPPNNPSLRGFEVVDAIKRRLEVSCPGVVSCADILAYAARDSVEITRGLGYDVLAGRRD  144

Query  593   GRVSLGKNVRPNIIDTSFTMDEMMKIFAAKGLSLDDLVTLSGAHTIGSAHCSAFSDRFQL  772
             GRVSL      N+   SF +D++ + FA KGLS D++VTLSGAHT+G +HC++F++R   
Sbjct  145   GRVSLASEALSNLPPPSFNVDQLTRAFANKGLSQDEMVTLSGAHTLGRSHCTSFNNRLYN  204

Query  773   ASNGSFLPIdaaldhayaaelaRQCPAGASDA-VTVNNDPVTPSLFDNQYYKDLLAHRGL  949
              S  S    D  LD AYA++L +QCP G+++  + V  DP TP++ D  YY+ +LA+RGL
Sbjct  205   FSTSSMQ--DPTLDLAYASQLKQQCPQGSANPNLVVPMDPPTPAVSDVSYYRGVLANRGL  262

Query  950   FQSDSALLRDKRAMEKVQDFAGDQNNFFTSWEQSFLKLVSIGVKVGDDDGEIRRSCSSVN  1129
             F SD  LL   +   +V   A +Q  ++  +  + + + +IGV  G   GEIRR C  +N
Sbjct  263   FTSDQTLLTSPQTRAQVLQNAQNQFLWWRKFAGAMVSMGNIGVITG-GAGEIRRDCRVIN  321

Query  1130  A  1132
              
Sbjct  322   G  322



>ref|XP_006288149.1| hypothetical protein CARUB_v10001386mg [Capsella rubella]
 gb|EOA21047.1| hypothetical protein CARUB_v10001386mg [Capsella rubella]
Length=335

 Score =   224 bits (571),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 132/301 (44%), Positives = 179/301 (59%), Gaps = 8/301 (3%)
 Frame = +2

Query  242   NFYAISCPSAELIVKNTVRSASSVDPTLPGKLLRLLFHDCFVEGCDASILL--QGNDTER  415
             N+Y+ +CP+ E IV+  V +     PT     LR+ FHDCFVEGCD S+L+  +  D E+
Sbjct  38    NYYSSTCPNVESIVQQAVATKFQQTPTTAPATLRIFFHDCFVEGCDGSVLIASENEDAEK  97

Query  416   SDPANKSVGG--FSTVDSAKRVLEIFCPETVSCADIIALAARDAVEFVGGPSVAIPTGRR  589
               P NKS+ G  F TV  AK  +E  CP  VSCADI+ALAARD V  VGGP   +  GRR
Sbjct  98    DAPDNKSLAGDGFDTVIKAKAAVEAQCPGVVSCADILALAARDVVVLVGGPGFKVELGRR  157

Query  590   DGRVSLGKNVRPNIIDTSFTMDEMMKIFAAKGLSLDDLVTLSGAHTIGSAHCSAFSDRFQ  769
             DG VS    V   + +    +  +++ FA  GLSL D++ LSGAHTIG +HC+ F++R  
Sbjct  158   DGLVSKASRVTGKLPEPGLDVRGLVENFARNGLSLTDMIALSGAHTIGFSHCNRFANR--  215

Query  770   LASNGSFLPIdaaldhayaaelaRQCP-AGASDAVTVNNDPVTPSLFDNQYYKDLLAHRG  946
             L +  +F+P+D  LD AYA +L   CP +G + A  V  D  T  +FDN YY++L+A +G
Sbjct  216   LYNFSTFMPVDPTLDPAYAQQLMSSCPRSGGNPAQVVEIDLTTGRVFDNLYYQNLVARKG  275

Query  947   LFQSDSALLRDKRAMEKVQDFAGDQNNFFTSWEQSFLKLVSIGVKVGDDDGEIRRSCSSV  1126
             LF SD  L  D      V  FA +   F+ ++  +   L  +GVKVG + GEIRR CS+ 
Sbjct  276   LFTSDQVLFDDLSTQSIVMRFANNAGEFYAAFISAMRNLGRVGVKVG-NQGEIRRDCSAF  334

Query  1127  N  1129
             N
Sbjct  335   N  335



>gb|AFK41517.1| unknown [Lotus japonicus]
Length=325

 Score =   224 bits (570),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 135/303 (45%), Positives = 177/303 (58%), Gaps = 11/303 (4%)
 Frame = +2

Query  242   NFYAISCPSAELIVKNTVRSASSVDPTLPGKLLRLLFHDCFVEGCDASILLQ---GNDTE  412
              FY  SC  AE IVK T++   S  P LP KLLR+ FHDCFV GCD S+LL    GN  E
Sbjct  28    QFYRKSCSQAEQIVKTTIQQHVSSRPELPAKLLRMHFHDCFVRGCDGSVLLNSTAGNTAE  87

Query  413   RSDPANKSVGGFSTVDSAKRVLEIFCPETVSCADIIALAARDA--VEFVGGPSVAIPTGR  586
             +    N S+ GF  +D  K  LE  CP+ VSCADI+ALAARDA  V+F   P   + TGR
Sbjct  88    KDAIPNLSLSGFDVIDEIKEALEAKCPKIVSCADILALAARDAVSVQFNNEPKWEVLTGR  147

Query  587   RDGRVSLGKNVRPNIIDTSFTMDEMMKIFAAKGLSLDDLVTLSGAHTIGSAHCSAFSDR-  763
             RDG VS    V  NI    FT  ++ + F +K L+L D+V LS  HTIG  HC+ FS+R 
Sbjct  148   RDGTVSKSSEVLTNIPAPFFTFTQLKQSFESKKLTLHDMVVLSRGHTIGVGHCNLFSNRL  207

Query  764   FQLASNGSFLPIdaaldhayaaelaRQCPAGASDAVTVNNDPVTPSLFDNQYYKDLLAHR  943
             +     G   P   +L+  YA  L  +C + +    TV+ DP + + FD+ YY  LL ++
Sbjct  208   YNFTGKGDQDP---SLNPTYAEFLKTKCKSLSDTTTTVDMDPNSGTTFDSNYYSILLQNK  264

Query  944   GLFQSDSALLRDKRAMEKVQDFAGDQNNFFTSWEQSFLKLVSIGVKVGDDDGEIRRSCSS  1123
             G+FQSD+ALL  K++ + V +  G QN FFT + QS  ++ +I V  G   GEIR  CS 
Sbjct  265   GMFQSDAALLATKQSKKIVNELVG-QNKFFTEFGQSMKRMGAIEVLSG-TAGEIRTKCSV  322

Query  1124  VNA  1132
             VN+
Sbjct  323   VNS  325



>ref|XP_002264451.1| PREDICTED: peroxidase 66 [Vitis vinifera]
 emb|CBI24458.3| unnamed protein product [Vitis vinifera]
Length=323

 Score =   224 bits (570),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 129/299 (43%), Positives = 174/299 (58%), Gaps = 9/299 (3%)
 Frame = +2

Query  242   NFYAISCPSAELIVKNTVRSASSVDPTLPGKLLRLLFHDCFVEGCDASILLQ---GNDTE  412
             ++Y  +CP AE I+  TVR AS  DP +P ++LR+ FHDCF+ GCDAS+LL    GN  E
Sbjct  31    HYYHQTCPQAENIIFETVRKASINDPKVPARILRMFFHDCFIRGCDASVLLDSTPGNQAE  90

Query  413   RSDPANKSVGGFSTVDSAKRVLEIFCPETVSCADIIALAARDAVEFVGGPSVAIPTGRRD  592
             +  P N S+  F  ++ AK  LE+ CP TVSCADIIA+AARD V    GP   +  GR+D
Sbjct  91    KDGPPNVSLASFYVIEDAKTKLEMACPGTVSCADIIAIAARDVVAMSRGPYWNVLKGRKD  150

Query  593   GRVSLGKNVRPNIIDTSFTMDEMMKIFAAKGLSLDDLVTLSGAHTIGSAHCSAFSDRFQL  772
             GRVS       N+   +F + ++ + FA +GL L DLV LSG H++G +HCS+F  R   
Sbjct  151   GRVSEASET-VNLPAPTFNVTQLFQSFAQRGLGLKDLVALSGGHSLGFSHCSSFEARVHN  209

Query  773   ASNGSFLPIdaaldhayaaelaRQCPAGASDAVTVNNDPVTPSLFDNQYYKDLLAHRGLF  952
              S  S   +D  ++  +A  L ++CP    D         T S FDN YY  L+A  GLF
Sbjct  210   FS--SVHDVDPTMNTEFAERLKKKCPKPNRDRNAGEFLDSTASTFDNDYYLRLMAGEGLF  267

Query  953   QSDSALLRDKRAMEKVQDFAGDQNNFFTSWEQSFLKLVSIGVKVGDDDGEIRRSCSSVN  1129
              SD ALL D R    V+ FA DQ  FF  +  S +KL ++GV    ++GE+R  C +VN
Sbjct  268   GSDQALLTDYRTRWIVESFAKDQGLFFREFTASMVKLGNVGVL---ENGEVRLKCQAVN  323



>emb|CAA70034.1| peroxidase ATP22a [Arabidopsis thaliana]
Length=322

 Score =   224 bits (570),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 134/300 (45%), Positives = 174/300 (58%), Gaps = 8/300 (3%)
 Frame = +2

Query  242   NFYAISCPSAELIVKNTVRSASSVDPTLPGKLLRLLFHDCFVEGCDASILLQGNDTERSD  421
             NFY  SCP+ E IV+N VR             LRL FHDCFV GCDASILL  + +E+  
Sbjct  27    NFYRKSCPNVETIVRNAVRQKFQQTFVTAPATLRLFFHDCFVRGCDASILL-ASPSEKDH  85

Query  422   PANKSVGG--FSTVDSAKRVLE--IFCPETVSCADIIALAARDAVEFVGGPSVAIPTGRR  589
             P +KS+ G  F TV  AK+ L+    C   VSCADI+ALA RD V   GGP+  +  GRR
Sbjct  86    PDDKSLAGDGFDTVAKAKQALDRDPNCRNKVSCADILALATRDVVVLTGGPNYPVELGRR  145

Query  590   DGRVSLGKNVRPNIIDTSFTMDEMMKIFAAKGLSLDDLVTLSGAHTIGSAHCSAFSDRFQ  769
             DGR+S   +V+ ++   SF +D++  +FA  GLS  D++ LSGAHTIG AHC  FS R  
Sbjct  146   DGRLSTVASVQHSLPQPSFKLDQLNTMFARHGLSQTDMIALSGAHTIGFAHCGKFSKRIY  205

Query  770   LASNGSFLPIdaaldhayaaelaRQCPAGASDAVTVNNDPVTPSLFDNQYYKDLLAHRGL  949
               S     PID  L+  YA +L + CP      + +N DP +P+ FDN Y+K+L    GL
Sbjct  206   NFSPKR--PIDPTLNIRYALQLRQMCPIRVDLRIAINMDPTSPNTFDNAYFKNLQKGMGL  263

Query  950   FQSDSALLRDKRAMEKVQDFAGDQNNFFTSWEQSFLKLVSIGVKVGDDDGEIRRSCSSVN  1129
             F SD  L  D+R+   V  FA  +  F  ++  +  KL  +GVK G + GEIRR CS VN
Sbjct  264   FTSDQVLFSDERSRSTVNSFASSEATFRQAFISAITKLGRVGVKTG-NAGEIRRDCSRVN  322



>ref|XP_003518944.1| PREDICTED: peroxidase 3-like [Glycine max]
 gb|KHN46603.1| Peroxidase 3 [Glycine soja]
Length=322

 Score =   224 bits (570),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 135/301 (45%), Positives = 181/301 (60%), Gaps = 10/301 (3%)
 Frame = +2

Query  245   FYAISCPSAELIVKNTVRSASSVDPTLPGKLLRLLFHDCFVEGCDASILLQ---GNDTER  415
             FY  SC  AE I+K+  +   S +P LP KLLR+ FHDCFV GCDAS+LL     N  ER
Sbjct  27    FYKDSCSQAEDIIKSKTQQHVSANPDLPAKLLRMHFHDCFVRGCDASVLLNSTANNTAER  86

Query  416   SDPANKSVGGFSTVDSAKRVLEIFCPETVSCADIIALAARDAVEFVGGPSV-AIPTGRRD  592
                 N S+ GF  +D  K  LE  CP+TVSCADI+ALAARDAV      S+  + TGRRD
Sbjct  87    DAIPNLSLAGFDVIDDIKSELEAKCPKTVSCADILALAARDAVSVQFNKSMWEVLTGRRD  146

Query  593   GRVSLGKNVRPNIIDTSFTMDEMMKIFAAKGLSLDDLVTLSGAHTIGSAHCSAFSDR-FQ  769
             G VS       NI    F   ++ + FA+KGL+L DLV LSGAHTIG  HC+ FS+R + 
Sbjct  147   GTVSNSNEALANIPAPFFNFTQLKQNFASKGLTLHDLVVLSGAHTIGIGHCNLFSNRLYN  206

Query  770   LASNGSFLPIdaaldhayaaelaRQCPAGASDAVTVNNDPVTPSLFDNQYYKDLLAHRGL  949
                 G   P   +L+  YA  L  +C + +    TV  DP + + FD+ YY +LL ++GL
Sbjct  207   FTGKGDQDP---SLNSTYAEFLKTKCQSLSDTTTTVEMDPGSSTNFDSDYYPNLLQNKGL  263

Query  950   FQSDSALLRDKRAMEKVQDFAGDQNNFFTSWEQSFLKLVSIGVKVGDDDGEIRRSCSSVN  1129
             FQSD+ALL ++++ +  ++   DQ+ FFT + QS  ++ +I V + D  GEIR  CS VN
Sbjct  264   FQSDAALLTEEQSEDIAKELV-DQDKFFTEFAQSMKRMGAIDV-LTDSAGEIRNKCSVVN  321

Query  1130  A  1132
             +
Sbjct  322   S  322



>ref|XP_004985934.1| PREDICTED: peroxidase 5-like [Setaria italica]
Length=331

 Score =   224 bits (570),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 128/297 (43%), Positives = 177/297 (60%), Gaps = 10/297 (3%)
 Frame = +2

Query  245   FYAISCPSAELIVKNTVRSASSVDPTLPGKLLRLLFHDCFVEGCDASILLQ---GNDTER  415
             FY + CP+AE+IV+  V  A S +P +   L+RL FHDCFV GCDAS+LL    GN  E+
Sbjct  35    FYDMLCPAAEIIVQEEVSKAVSGNPGVAASLVRLHFHDCFVRGCDASVLLDSTPGNQAEK  94

Query  416   SDPANKSVGGFSTVDSAKRVLEIFCPETVSCADIIALAARDAVEFVGGPSVAIPTGRRDG  595
                 N S+ GF  +DSAK  LE  C   VSCAD++A AARDA+  VGG +  +P+GRRDG
Sbjct  95    DASPNTSLRGFEVIDSAKTRLEQACYGVVSCADVLAFAARDALALVGGNAYQVPSGRRDG  154

Query  596   RVSLGKNVRPNIIDTSFTMDEMMKIFAAKGLSLDDLVTLSGAHTIGSAHCSAFSDR-FQL  772
              VS+ +    N+   + ++ ++ +IF +KGL+  D+V LSGAHTIG+AHCS+F  R +  
Sbjct  155   NVSVAQETSGNLPPPTASVSQLNQIFGSKGLTQADMVALSGAHTIGNAHCSSFDSRLYAY  214

Query  773   ASNGSFLPIdaaldhayaaelaRQCP--AGASDAVTVNNDPVTPSLFDNQYYKDLLAHRG  946
               N    P   ++D +Y A L +QCP  +G     TV  DPVTP+ FD  YY  ++A RG
Sbjct  215   GPNAGQDP---SMDPSYLAALTQQCPNQSGGGPDGTVAMDPVTPTAFDTNYYASIVAKRG  271

Query  947   LFQSDSALLRDKRAMEKVQDFAGDQNNFFTSWEQSFLKLVSIGVKVGDDDGEIRRSC  1117
             L  SD ALL D     +V  +    + F   +  + +K+ +IGV  G   G IR +C
Sbjct  272   LLASDQALLADPTTAAQVVAYTNSPDTFQADFAAAMVKMGAIGVLTG-TAGTIRTNC  327



>ref|XP_006356924.1| PREDICTED: peroxidase 3-like [Solanum tuberosum]
Length=327

 Score =   224 bits (570),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 130/303 (43%), Positives = 168/303 (55%), Gaps = 7/303 (2%)
 Frame = +2

Query  242   NFYAISCPSAELIVKNTVRSASSVDPTLPGKLLRLLFHDCFVEGCDASILLQ-----GND  406
             NFYA SCP AE I+ + V       P+L   L+R+ FHDCFV GCDAS+LL      GN 
Sbjct  26    NFYAKSCPKAEKIILDYVHKHIPNAPSLAAALIRMHFHDCFVRGCDASVLLNFTSSTGNQ  85

Query  407   TERSDPANKSVGGFSTVDSAKRVLEIFCPETVSCADIIALAARDAVEFVGGPSVAIPTGR  586
             TE+    N ++ GFS +D+ K+++E  CP  VSCADI+AL ARD+V   GGPS ++PTGR
Sbjct  86    TEKFGIPNLTLRGFSFIDNVKKIIEDECPGVVSCADIVALVARDSVVVTGGPSWSVPTGR  145

Query  587   RDGRVSLGKNVRPNIIDTSFTMDEMMKIFAAKGLSLDDLVTLSGAHTIGSAHCSAFSDRF  766
             RDGR+S       +I   +     +   FA KGL L DLV LSGAHTIG +HCS+FS R 
Sbjct  146   RDGRISNASETLTDIPAPTSNFSTLQNDFAKKGLDLKDLVLLSGAHTIGVSHCSSFSTRL  205

Query  767   QLASNGSFLPIdaaldhayaaelaRQCPAGASDAVTVNNDPVTPSLFDNQYYKDLLAHRG  946
                +        +          A +C +   +   V  DP +   FD  YYK LL  RG
Sbjct  206   YNFTGTFGTQDPSLDSEYATNLKANKCKSINDNTTIVEMDPGSFRTFDLSYYKLLLKRRG  265

Query  947   LFQSDSALLRDKRAMEKV-QDFAGDQNNFFTSWEQSFLKLVSIGVKVGDDDGEIRRSCSS  1123
             LFQSD+AL         + Q  AG    F+  + QS  K+  I VK G  DGEIR+ C+ 
Sbjct  266   LFQSDAALTTSTTTKSYIDQLVAGSLKEFYAEFAQSMEKMGRIEVKTG-SDGEIRKHCAV  324

Query  1124  VNA  1132
             VN+
Sbjct  325   VNS  327



>ref|XP_010492211.1| PREDICTED: peroxidase 55-like [Camelina sativa]
Length=332

 Score =   224 bits (570),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 131/301 (44%), Positives = 180/301 (60%), Gaps = 8/301 (3%)
 Frame = +2

Query  242   NFYAISCPSAELIVKNTVRSASSVDPTLPGKLLRLLFHDCFVEGCDASILL--QGNDTER  415
             N+Y+ +CP+ E IV+  V +     PT     LR+ FHDCFVEGCDAS+L+  +  D E+
Sbjct  35    NYYSSTCPNVERIVQQAVTTKFQQTPTTAPATLRMFFHDCFVEGCDASVLIASENEDAEK  94

Query  416   SDPANKSVGG--FSTVDSAKRVLEIFCPETVSCADIIALAARDAVEFVGGPSVAIPTGRR  589
               P NKS+ G  F TV  AK  +E  CP  VSCAD++ALAARD V  VGG    +  GRR
Sbjct  95    DAPDNKSLAGDGFDTVIKAKAAVEAQCPGVVSCADVLALAARDVVVLVGGTGFKVELGRR  154

Query  590   DGRVSLGKNVRPNIIDTSFTMDEMMKIFAAKGLSLDDLVTLSGAHTIGSAHCSAFSDRFQ  769
             DG VS    V   + +    +  +++ FA  GLSL D++ LSGAHTIG +HC+ F++R  
Sbjct  155   DGLVSKASRVTGKLPEPDLDVRSLVENFAKNGLSLTDMIALSGAHTIGFSHCNRFANRLY  214

Query  770   LASNGSFLPIdaaldhayaaelaRQCP-AGASDAVTVNNDPVTPSLFDNQYYKDLLAHRG  946
               SN  F+P+D  LD AYA +L   CP +G + A  +  DP T + FDN Y+++L+A +G
Sbjct  215   NFSN--FMPLDPTLDPAYAQQLMSSCPRSGGNPAQAIPLDPTTQNNFDNTYFQNLVARKG  272

Query  947   LFQSDSALLRDKRAMEKVQDFAGDQNNFFTSWEQSFLKLVSIGVKVGDDDGEIRRSCSSV  1126
             L  SD  L  D  +   V  FA +   F +++  +  KL  +GVKVG + GEIRR CS+ 
Sbjct  273   LLTSDQVLFNDISSQATVIRFANNAEEFSSAFSSAMRKLGRVGVKVG-NQGEIRRDCSAF  331

Query  1127  N  1129
             N
Sbjct  332   N  332



>ref|NP_179488.1| peroxidase 16 [Arabidopsis thaliana]
 sp|Q96518.2|PER16_ARATH RecName: Full=Peroxidase 16; Short=Atperox P16; AltName: Full=ATP22a; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AAC09031.1| peroxidase (ATP22a) [Arabidopsis thaliana]
 gb|AAO23647.1| At2g18980 [Arabidopsis thaliana]
 dbj|BAE99626.1| peroxidase [Arabidopsis thaliana]
 gb|AEC06835.1| peroxidase 16 [Arabidopsis thaliana]
Length=323

 Score =   224 bits (570),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 134/300 (45%), Positives = 174/300 (58%), Gaps = 8/300 (3%)
 Frame = +2

Query  242   NFYAISCPSAELIVKNTVRSASSVDPTLPGKLLRLLFHDCFVEGCDASILLQGNDTERSD  421
             NFY  SCP+ E IV+N VR             LRL FHDCFV GCDASILL  + +E+  
Sbjct  28    NFYRKSCPNVETIVRNAVRQKFQQTFVTAPATLRLFFHDCFVRGCDASILL-ASPSEKDH  86

Query  422   PANKSVGG--FSTVDSAKRVLE--IFCPETVSCADIIALAARDAVEFVGGPSVAIPTGRR  589
             P +KS+ G  F TV  AK+ L+    C   VSCADI+ALA RD V   GGP+  +  GRR
Sbjct  87    PDDKSLAGDGFDTVAKAKQALDRDPNCRNKVSCADILALATRDVVVLTGGPNYPVELGRR  146

Query  590   DGRVSLGKNVRPNIIDTSFTMDEMMKIFAAKGLSLDDLVTLSGAHTIGSAHCSAFSDRFQ  769
             DGR+S   +V+ ++   SF +D++  +FA  GLS  D++ LSGAHTIG AHC  FS R  
Sbjct  147   DGRLSTVASVQHSLPQPSFKLDQLNTMFARHGLSQTDMIALSGAHTIGFAHCGKFSKRIY  206

Query  770   LASNGSFLPIdaaldhayaaelaRQCPAGASDAVTVNNDPVTPSLFDNQYYKDLLAHRGL  949
               S     PID  L+  YA +L + CP      + +N DP +P+ FDN Y+K+L    GL
Sbjct  207   NFSPKR--PIDPTLNIRYALQLRQMCPIRVDLRIAINMDPTSPNTFDNAYFKNLQKGMGL  264

Query  950   FQSDSALLRDKRAMEKVQDFAGDQNNFFTSWEQSFLKLVSIGVKVGDDDGEIRRSCSSVN  1129
             F SD  L  D+R+   V  FA  +  F  ++  +  KL  +GVK G + GEIRR CS VN
Sbjct  265   FTSDQVLFSDERSRSTVNSFASSEATFRQAFISAITKLGRVGVKTG-NAGEIRRDCSRVN  323



>ref|XP_008644003.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 tpg|DAA51530.1| TPA: hypothetical protein ZEAMMB73_619996 [Zea mays]
Length=325

 Score =   224 bits (570),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 129/303 (43%), Positives = 173/303 (57%), Gaps = 13/303 (4%)
 Frame = +2

Query  242   NFYAISCPSAELIVKNTVRSASSVDPTLPGKLLRLLFHDCFVEGCDASILL--QGNDT-E  412
             ++YA  CP  E IV+  V       P   G  +RL FHDCFVEGCDAS++L   GN+T E
Sbjct  29    DYYAAVCPDLESIVRAAVSKKVQAQPVAVGATIRLFFHDCFVEGCDASVILVSTGNNTAE  88

Query  413   RSDPANKSVGG--FSTVDSAKRVLEIF--CPETVSCADIIALAARDAVEFVGGPSVAIPT  580
             +  P+N S+ G  F TV  AK  ++    C   VSCADI+ALA RD +E  GGPS A+  
Sbjct  89    KDHPSNLSLAGDGFDTVIQAKAAVDAVPACANQVSCADILALATRDVIELAGGPSYAVEL  148

Query  581   GRRDGRVSLGKNVRPNIIDTSFTMDEMMKIFAAKGLSLDDLVTLSGAHTIGSAHCSAFSD  760
             GR DG VS+  NV   +   SF +D++  IFA   LS  D++ LS AHT+G AHCS FSD
Sbjct  149   GRLDGLVSMSTNVDGKLPPPSFNLDQLTSIFALNNLSQADMIALSAAHTVGFAHCSTFSD  208

Query  761   RFQLASNGSFLPIdaaldhayaaelaRQCPAGASDAVTVNNDPVTPSLFDNQYYKDLLAH  940
             R Q  S      +D  ++  YA +L   CPAG    + +  DPVTP  FDNQY+ +L+  
Sbjct  209   RIQPQS------VDPTMNATYAEDLQAACPAGVDPNIALQLDPVTPQAFDNQYFANLVDG  262

Query  941   RGLFQSDSALLRDKRAMEKVQDFAGDQNNFFTSWEQSFLKLVSIGVKVGDDDGEIRRSCS  1120
             RGLF SD  L  D R+   V  +A +   F  ++  +  +L  +GVK     G++RR C+
Sbjct  263   RGLFASDQVLFSDARSQPTVVAWAQNATAFEQAFVDAITRLGRVGVKTDPSLGDVRRDCA  322

Query  1121  SVN  1129
              +N
Sbjct  323   FLN  325



>gb|AAM52320.1|AC105363_9 Putative peroxidase [Oryza sativa Japonica Group]
 tpe|CAH69277.1| TPA: class III peroxidase 35 precursor [Oryza sativa Japonica 
Group]
 gb|EAZ25397.1| hypothetical protein OsJ_09215 [Oryza sativa Japonica Group]
Length=319

 Score =   223 bits (569),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 135/306 (44%), Positives = 180/306 (59%), Gaps = 14/306 (5%)
 Frame = +2

Query  242   NFYAISCPSAELIVKNTVRSASSVDPTLPGKLLRLLFHDCFVEGCDASILLQG---NDTE  412
             NFYA +CP AE IV+  V  A   +      L+R+ FHDCFV GCD S+LL+    N  E
Sbjct  18    NFYAATCPQAETIVRQEVTRALYTNIGFAAGLVRMHFHDCFVRGCDGSVLLESTSDNVAE  77

Query  413   RSDPANK-SVGGFSTVDSAKRVLEIFCPETVSCADIIALAARDAVEFVGGPSVAIPTGRR  589
             R  P N  S+ GF  +D+AK  LE  CP  VSCAD++A AARD V   GGP   +P GRR
Sbjct  78    RDSPINNPSLRGFEVIDAAKARLEAACPGVVSCADVLAYAARDGVALTGGPRYDVPGGRR  137

Query  590   DGRVSLGKNVRPNIIDTSFTMDEMMKIFAAKGLSLDDLVTLSGAHTIGSAHCSAFSDR-F  766
             DG  SL   V  NI   +FT+D++ + FAAKGL+ +++VTLSGAHT+G AHC++FSDR +
Sbjct  138   DGTASLEPEVADNIPAPTFTLDQLTQSFAAKGLTQEEMVTLSGAHTVGRAHCTSFSDRLY  197

Query  767   QLASNGSFLPIdaaldhayaaelaRQCPA----GASDA-VTVNNDPVTPSLFDNQYYKDL  931
               ++ G+  P   ++D A   +L R CPA    GA DA + V  +P TP+ FD  YY  +
Sbjct  198   NFSATGAADP---SVDPALLPQLRRACPAAGPDGAVDAGLVVPMEPRTPNGFDALYYWAV  254

Query  932   LAHRGLFQSDSALLRDKRAMEKVQDFAGDQNNFFTSWEQSFLKLVSIGVKVGDDDGEIRR  1111
             L +R LF SD ALL       +V+  A     +   +  + +K+  I V  G   GEIR 
Sbjct  255   LRNRALFTSDQALLSSPPTAAQVRQTAYGGYPWKLKFAAAMVKMGQIEVLTG-GSGEIRT  313

Query  1112  SCSSVN  1129
              CS+VN
Sbjct  314   KCSAVN  319



>ref|XP_008781200.1| PREDICTED: peroxidase 5-like [Phoenix dactylifera]
Length=328

 Score =   224 bits (570),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 137/303 (45%), Positives = 185/303 (61%), Gaps = 11/303 (4%)
 Frame = +2

Query  245   FYAISCPSAELIVKNTVRSASSVDPTLPGKLLRLLFHDCFVEGCDASILLQ---GNDTER  415
             FY   CP+AE IV+ TV  A + +P +   LLR+ FHDCFV GCDAS+LL    GN  E+
Sbjct  29    FYQSKCPAAESIVRRTVTEAVAKNPGIAAGLLRMHFHDCFVRGCDASVLLDSTPGNPAEK  88

Query  416   SDPANK-SVGGFSTVDSAKRVLEIFCPETVSCADIIALAARDAVEFVGGPSVAIPTGRRD  592
               PANK S+ GF  +D AK  +E  CP+TVSCADI+A AARD     GG   A+P GRRD
Sbjct  89    ESPANKPSLRGFEVIDRAKAEIEAQCPQTVSCADILAFAARDGAFRAGGIDYAVPAGRRD  148

Query  593   GRVSLGKNVRPNIIDTSFTMDEMMKIFAAKGLSLDDLVTLSGAHTIGSAHCSAFSDRFQL  772
             GR+SL   V  NI    FT+D++ + FA KGLS D++VTLSGAH+IG +HCS+FS+R  L
Sbjct  149   GRISLESEVLQNIPAPFFTVDQLQQNFARKGLSRDEMVTLSGAHSIGVSHCSSFSNR--L  206

Query  773   ASNGSFLPIdaaldhayaaelaRQCPAGASDAV----TVNNDPVTPSLFDNQYYKDLLAH  940
              S  +  P D +L+  +AA L  +CP  +S       TV  D V+P+  DN YYK+L + 
Sbjct  207   YSFNATNPQDPSLNPGFAAFLKTKCPPPSSTGTGQDGTVPLDIVSPNRLDNWYYKNLRSS  266

Query  941   RGLFQSDSALLRDKRAMEKVQDFAGDQNNFFTSWEQSFLKLVSIGVKVGDDDGEIRRSCS  1120
             +GL  SD +L+ D      V++ A     +   +  + +++ SI V  G   GEIR++C 
Sbjct  267   KGLLTSDQSLMDDPSTKTIVRNNANRGAEWAAKFAAAMVRMGSIEVLTG-TQGEIRKNCR  325

Query  1121  SVN  1129
              VN
Sbjct  326   LVN  328



>ref|XP_009796592.1| PREDICTED: peroxidase 64-like [Nicotiana sylvestris]
Length=317

 Score =   223 bits (569),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 127/299 (42%), Positives = 174/299 (58%), Gaps = 10/299 (3%)
 Frame = +2

Query  242   NFYAISCPSAELIVKNTVRSASSVDPTLPGKLLRLLFHDCFVEGCDASILL---QGNDTE  412
             N+Y  +CP AE  +   VR A   D T+P  LLR+ FHDCFV GCD S+LL   + N  E
Sbjct  26    NYYDKTCPDAESTITQVVRKAMWNDKTVPAALLRMHFHDCFVRGCDGSVLLNSTKNNQAE  85

Query  413   RSDPANKSVGGFSTVDSAKRVLEIFCPETVSCADIIALAARDAVEFVGGPSVAIPTGRRD  592
             +  P N S+  F  +D AK+ +E  CP  VSCADI+ALAARDAV+  GGP+  +P GR+D
Sbjct  86    KDGPPNISLHAFYVIDVAKKQIENMCPGIVSCADILALAARDAVKLSGGPNWEVPKGRKD  145

Query  593   GRVSLGKNVRPNIIDTSFTMDEMMKIFAAKGLSLDDLVTLSGAHTIGSAHCSAFSDRFQL  772
             GR+S     +  +   +F + ++ + F+ +GLSLDDLV LSG HT+G +HCS+F +R   
Sbjct  146   GRISKASETQ-QLPPPTFNISQLQQSFSQRGLSLDDLVALSGGHTLGFSHCSSFQNRIHK  204

Query  773   ASNGSFLPIdaaldhayaaelaRQCPAGASDAVTVNNDPVTPSLFDNQYYKDLLAHRGLF  952
                 +   +D  L+ ++AA L + CP   +     +    T  LFDN YYK +L ++GLF
Sbjct  205   FDKKN--DVDPTLETSFAATLKKVCPIKNTVKNAGSTLDSTTFLFDNVYYKLVLQNKGLF  262

Query  953   QSDSALLRDKRAMEKVQDFAGDQNNFFTSWEQSFLKLVSIGVKVGDDDGEIRRSCSSVN  1129
              SDS LL + R    V  FA  QN FF ++  S +K+ SI         EIRR C  VN
Sbjct  263   SSDSTLLTNSRTKNLVSTFANSQNEFFKAFANSMIKMSSI----SGSGQEIRRDCRFVN  317



>gb|KDP27791.1| hypothetical protein JCGZ_18871 [Jatropha curcas]
Length=328

 Score =   224 bits (570),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 130/303 (43%), Positives = 186/303 (61%), Gaps = 12/303 (4%)
 Frame = +2

Query  245   FYAISCPSAELIVKNTVRSASSVDPTLPGKLLRLLFHDCFVEGCDASILLQ---GNDTER  415
             FY  SCP AE IV++TV++A + D  +P  L+RL FHDCFV GCDASILL    G+  E+
Sbjct  29    FYKKSCPLAETIVRSTVKNAFANDTGIPPALIRLHFHDCFVRGCDASILLDSTPGSKAEK  88

Query  416   SDPANKSVGGFSTVDSAKRVLEIFCPETVSCADIIALAARDAVEFVGGPSVAIPTGRRDG  595
                 NK VGGF  +D AK  +E +CP TVSCADIIA AARD+V   GG    +P+GRRDG
Sbjct  89    ESMGNKGVGGFEVIDEAKAKMETYCPNTVSCADIIAFAARDSVLLAGGIYYEVPSGRRDG  148

Query  596   RVSLGKNVRPNIIDTSFTMDEMMKIFAAKGLSLDDLVTLSGAHTIGSAHCSAFSDRFQL-  772
               SL   V  N+ D+ F + ++   FA KGLSL+++VTLSGAH+IG +HCS+FS R    
Sbjct  149   TKSLIHEVSKNLPDSFFNVIQLKDNFANKGLSLEEMVTLSGAHSIGDSHCSSFSKRLYSF  208

Query  773   -ASNGSFLPIdaaldhayaaelaRQCPAGASDAV--TVNNDPVTPSLFDNQYYKDLLAHR  943
              A++G     D ++D AYA+ L  +CP   ++ +   V+ DP TP+  DN YY++L  ++
Sbjct  209   NATHGQ----DPSMDSAYASFLKTKCPKPVNNGIDPLVSFDPSTPTRLDNNYYRNLKMNK  264

Query  944   GLFQSDSALLRDKRAMEKVQDFAGDQNNFFTSWEQSFLKLVSIGVKVGDDDGEIRRSCSS  1123
             GL  SD  L  +      V+       ++ + +  + + + SI V  G  +GE+R++C  
Sbjct  265   GLLFSDQVLWSNSLTKSMVKSNINHPGSWASKFASAMVHMGSIEVITG-SNGEVRKNCRV  323

Query  1124  VNA  1132
             +N+
Sbjct  324   LNS  326



>ref|XP_010484852.1| PREDICTED: peroxidase 3-like [Camelina sativa]
Length=326

 Score =   224 bits (570),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 129/302 (43%), Positives = 174/302 (58%), Gaps = 7/302 (2%)
 Frame = +2

Query  239   FNFYAISCPSAELIVKNTVRSASSVDPTLPGKLLRLLFHDCFVEGCDASILLQGN--DTE  412
              NFYA +CP+AE IV++ V +  S  P+L   L+R+ FHDCFV GCD S+L+     + E
Sbjct  28    MNFYANTCPNAEKIVQDFVSNHISNAPSLAAALIRMHFHDCFVRGCDGSVLINSTSGNAE  87

Query  413   RSDPANKSVGGFSTVDSAKRVLEIFCPETVSCADIIALAARDAVEFVGGPSVAIPTGRRD  592
             R    N +V GF  +++ K VLE  CP  VSCADIIALA+RDA+ F GGP+ ++PTGRRD
Sbjct  88    RDATPNLTVRGFGFIEAIKAVLEAQCPGIVSCADIIALASRDAIVFTGGPNWSVPTGRRD  147

Query  593   GRVSLGKNVRPNIIDTSFTMDEMMKIFAAKGLSLDDLVTLSGAHTIGSAHCSAFSDR-FQ  769
             GR+S       NI   +     +  +FA +GL L DLV LSGAHTIG +HCS+FS+R + 
Sbjct  148   GRISNSSEALANIPPPTSNFTNLQTLFANQGLDLKDLVLLSGAHTIGVSHCSSFSNRLYN  207

Query  770   LASNGSFLPIdaaldhayaaelaRQCPAGASDAVTVNNDPVTPSLFDNQYYKDLLAHRGL  949
                 G   P  A      A   +R+C +   +   V  DP +   FD  YY+ +L  RGL
Sbjct  208   FTGRGDQDP--ALDSEYAANLKSRKCLSLNDNKTIVEMDPGSRKTFDLSYYQLVLKRRGL  265

Query  950   FQSDSALLRDKRAMEKVQD-FAGDQNNFFTSWEQSFLKLVSIGVKVGDDDGEIRRSCSSV  1126
             FQSDSAL  +   +  +     G   +FF+ + +S  K+  I VK G   G IRR CS  
Sbjct  266   FQSDSALTTNPTTLSNINRILTGSVESFFSEFAKSMEKMGRINVKTG-SAGVIRRQCSVA  324

Query  1127  NA  1132
             N+
Sbjct  325   NS  326



>ref|XP_001776111.1| predicted protein [Physcomitrella patens]
 gb|EDQ59022.1| predicted protein [Physcomitrella patens]
Length=304

 Score =   223 bits (568),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 125/299 (42%), Positives = 165/299 (55%), Gaps = 14/299 (5%)
 Frame = +2

Query  242   NFYAISCPSAELIVKNTVRSASSVDPTLPGKLLRLLFHDCFVEGCDASILLQGNDTERSD  421
              +Y +SCPSAE I++  +      D  +   +LRL FHDCFVEGCD S+LL   ++E++ 
Sbjct  17    GYYDLSCPSAERIIRQAMERGMQQDQGIAAGVLRLHFHDCFVEGCDGSVLLDNPNSEKTS  76

Query  422   PANKSVGGFSTVDSAKRVLEIFCPETVSCADIIALAARDAVEFVGGPSVAIPTGRRDGRV  601
             P N S+ GF  VD+AK  LE  CP  VSCADI+A  ARDAVE +GG    +  GR DGRV
Sbjct  77    PPNFSLRGFEVVDAAKADLEALCPGVVSCADILAFGARDAVELMGGLGWRVRAGRYDGRV  136

Query  602   SLGKNVRPNIIDTSFTMDEMMKIFAAKGLSLDDLVTLSGAHTIGSAHCSAFSDRFQLASN  781
             S        I D  +T++E+  +FA KGLS  D++ LSGAHTIG AHC++ + R      
Sbjct  137   SSAARALAEIPDPRYTVEEITALFARKGLSKSDMIVLSGAHTIGRAHCASVTPR------  190

Query  782   GSFLPIdaaldhayaaelaRQ-CPAGASDAVTVNNDPVTPSLFDNQYYKDLLAHRGLFQS  958
                 P+         A   R  CP     A T + D  TP  FDN YY +L+A+RGL  S
Sbjct  191   --LYPVQDPQMSQAMAAFLRTACPPQGGSAATFSLDSTTPYRFDNMYYTNLIANRGLLHS  248

Query  959   DSALLRD--KRAMEKVQDFAGDQNNFFTSWEQSFLKLVSIGVKVGDDDGEIRRSCSSVN  1129
             D AL+ D   R       FA     F   + +  +++ +I VK G  DGEIRR C  +N
Sbjct  249   DQALINDMSTRGETIFNSFAAGPWAF--QFSRVMIEMGNIQVKSG-PDGEIRRHCRFIN  304



>ref|XP_010457608.1| PREDICTED: peroxidase 3-like [Camelina sativa]
Length=326

 Score =   223 bits (569),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 129/302 (43%), Positives = 174/302 (58%), Gaps = 7/302 (2%)
 Frame = +2

Query  239   FNFYAISCPSAELIVKNTVRSASSVDPTLPGKLLRLLFHDCFVEGCDASILLQGN--DTE  412
              NFYA +CPSAE IV++ V +  S  P+L   L+R+ FHDCFV GCD S+L+     + E
Sbjct  28    MNFYANTCPSAEKIVQDFVSNHISNAPSLAAALIRMHFHDCFVRGCDGSVLINSTSGNAE  87

Query  413   RSDPANKSVGGFSTVDSAKRVLEIFCPETVSCADIIALAARDAVEFVGGPSVAIPTGRRD  592
             R    N +V GF  +++ K VLE  CP  VSCADIIALA+RDA+ F GGP+ ++PTGRRD
Sbjct  88    RDATPNLTVRGFGFIEAIKTVLEAQCPGIVSCADIIALASRDAIVFTGGPNWSVPTGRRD  147

Query  593   GRVSLGKNVRPNIIDTSFTMDEMMKIFAAKGLSLDDLVTLSGAHTIGSAHCSAFSDR-FQ  769
             GR+S       NI   +     +  +FA +GL L DLV LSGAHTIG +HCS+FS+R + 
Sbjct  148   GRISNSSEALANIPPPTSNFTNLQTLFANQGLDLKDLVLLSGAHTIGVSHCSSFSNRLYN  207

Query  770   LASNGSFLPIdaaldhayaaelaRQCPAGASDAVTVNNDPVTPSLFDNQYYKDLLAHRGL  949
                 G   P  A      A   +R+C +   +   V  DP +   FD  YY+ +L  RGL
Sbjct  208   FTGRGDQDP--ALDSEYAANLKSRKCLSLNDNKTIVEMDPGSRKTFDLSYYQLVLKRRGL  265

Query  950   FQSDSALLRDKRAMEKVQD-FAGDQNNFFTSWEQSFLKLVSIGVKVGDDDGEIRRSCSSV  1126
             FQSDSAL  +   +  +     G   +FF+ + +S  K+  I VK G   G +RR CS  
Sbjct  266   FQSDSALTTNPTTLSNINRILTGSVESFFSEFAKSMEKMGRINVKTG-SAGVVRRQCSVA  324

Query  1127  NA  1132
             N+
Sbjct  325   NS  326



>ref|XP_009787965.1| PREDICTED: peroxidase 24-like [Nicotiana sylvestris]
 dbj|BAA07663.1| cationic peroxidase isozyme 38K precursor [Nicotiana tabacum]
Length=329

 Score =   224 bits (570),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 136/298 (46%), Positives = 180/298 (60%), Gaps = 11/298 (4%)
 Frame = +2

Query  242   NFYA-ISCPSAELIVKNTVRSASSVDPTLPGKLLRLLFHDCFVEGCDASILLQGNDTERS  418
             NFY    CP+AE  V++   S +  D TL  KLLRL +HDCFV GCDASILL    T++S
Sbjct  33    NFYKNTRCPNAEQFVRDITWSKAKNDATLSAKLLRLHYHDCFVRGCDASILLDKVGTDQS  92

Query  419   DPA---NKSVGGFSTVDSAKRVLEIFCPETVSCADIIALAARDAVEFVGGPSVA-IPTGR  586
             +     N S+GGF  +D  KR +E  CPE VSCADI+ALAARDAV F    S+  + TGR
Sbjct  93    EKEARPNLSLGGFDVIDDIKRQVEEKCPEIVSCADILALAARDAVSFPFKKSLWDVATGR  152

Query  587   RDGRVSLGKNVRPNIIDTSFTMDEMMKIFAAKGLSLDDLVTLSGAHTIGSAHCSAFSDR-  763
             +DG VS G  V  N+         + ++FA KGL+++DLV LSGAHTIG AHC AFS R 
Sbjct  153   KDGNVSFGSEVNGNLPSPFSDFATLQQLFAKKGLNVNDLVALSGAHTIGVAHCGAFSRRL  212

Query  764   FQLASNGSFLPIdaaldhayaaelaRQCPAGASDAVTVNNDPVTPSLFDNQYYKDLLAHR  943
             F     G   P   +L+  Y   L + CP  A+ A TV  DP + + FD+ Y+  L  ++
Sbjct  213   FNFTGKGDMDP---SLNPTYVESLKQLCPNPANPATTVEMDPQSSTSFDSNYFNILTQNK  269

Query  944   GLFQSDSALLRDKRAMEKVQDFAGDQNNFFTSWEQSFLKLVSIGVKVGDDDGEIRRSC  1117
             GLFQSD+ LL DK++ + V+      N FF+ + +S  K+ +I V  G + GEIR+SC
Sbjct  270   GLFQSDAVLLTDKKSAKVVKQLQ-KTNTFFSEFAKSMQKMGAIEVLTG-NAGEIRKSC  325



>ref|XP_002991835.1| hypothetical protein SELMODRAFT_269862 [Selaginella moellendorffii]
 gb|EFJ07097.1| hypothetical protein SELMODRAFT_269862 [Selaginella moellendorffii]
Length=335

 Score =   224 bits (570),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 133/305 (44%), Positives = 173/305 (57%), Gaps = 11/305 (4%)
 Frame = +2

Query  239   FNFYAISCPSAELIVKNTVRSASSVDPTLPGKLLRLLFHDCFVEGCDASILLQGNDT---  409
             F+FY  +CP+ + IV N   + S  D  +P  +LRL FHDC VEGCDASIL+    T   
Sbjct  31    FDFYKTACPNVDAIVANVTLALSKRDNVVPPAVLRLYFHDCLVEGCDASILISSTPTNVA  90

Query  410   ERSDPANKSV--GGFSTVDSAKRVLEIFCPETVSCADIIALAARDAVEFVGGPSVAIPTG  583
             ER    N S    GF  +  AK+ +E  CP  VSCADI+A+AARD V F GGP  A+P G
Sbjct  91    ERDAADNLSFPQNGFDAIVEAKKAVEAACPAVVSCADILAMAARDVVVFSGGPRWAVPKG  150

Query  584   RRDGRVSLGKNVRPNIIDTSFTMDEMMKIFAAKGLSLDDLVTLSGAHTIGSAHCSAFSDR  763
             RRDG +S    V   +  +SF + +++ + A   LS++DLV LSGAHTIG +HC+ FS R
Sbjct  151   RRDGLISRAARVEGRLPASSFNVSQLITLLATVNLSIEDLVVLSGAHTIGFSHCNQFSKR  210

Query  764   -FQLASNGSFLPIdaaldhayaaelaRQCP-AGASDAVTVNNDPVTPSLFDNQYYKDLLA  937
              +  +S     P   +LD   AA L   CP  G S       D  TP  FDN YY++L  
Sbjct  211   LYNFSSAAKTDP---SLDPTLAASLKASCPQVGGSPNTVRGFDATTPLAFDNSYYRNLQN  267

Query  938   HRGLFQSDSALLRDKRAMEKVQDFAGDQNNFFTSWEQSFLKLVSIGVKVGDDDGEIRRSC  1117
             +RGL  SD AL  DKR    V   A  Q +FF ++ Q+ +KL   G+K G   GE+RR C
Sbjct  268   NRGLLVSDQALALDKRTSPVVASLAASQEDFFFAFMQAMVKLGYTGIKTG-SQGEVRRDC  326

Query  1118  SSVNA  1132
              + NA
Sbjct  327   RAFNA  331



>ref|XP_010106816.1| Peroxidase 66 [Morus notabilis]
 gb|EXC11901.1| Peroxidase 66 [Morus notabilis]
Length=324

 Score =   223 bits (569),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 127/299 (42%), Positives = 174/299 (58%), Gaps = 9/299 (3%)
 Frame = +2

Query  242   NFYAISCPSAELIVKNTVRSASSVDPTLPGKLLRLLFHDCFVEGCDASILLQ---GNDTE  412
             N+Y+ +CP  E I+  TV +AS  DP +P +LLR+ FHDCF+ GCDAS+LL    GN  E
Sbjct  32    NYYSQTCPQVEKIILETVYNASVRDPKVPARLLRMFFHDCFIRGCDASVLLDSTAGNQVE  91

Query  413   RSDPANKSVGGFSTVDSAKRVLEIFCPETVSCADIIALAARDAVEFVGGPSVAIPTGRRD  592
             +  P N S+  F  +D AK  LE  CP TVSCADI+A+AARD V   GGP   +  GR+D
Sbjct  92    KDGPPNISLAAFYVIDDAKAKLEAACPNTVSCADIVAIAARDVVTISGGPYWNVLKGRKD  151

Query  593   GRVSLGKNVRPNIIDTSFTMDEMMKIFAAKGLSLDDLVTLSGAHTIGSAHCSAFSDRFQL  772
             GRVS       N+   +  + ++++ F  +GL + DLV LSG HT+G +HCS+F  R + 
Sbjct  152   GRVSKASET-ANLPAPTLNLSQLIQSFDNRGLGIKDLVALSGGHTLGFSHCSSFEPRLRN  210

Query  773   ASNGSFLPIdaaldhayaaelaRQCPAGASDAVTVNNDPVTPSLFDNQYYKDLLAHRGLF  952
              S      ID +++   A EL ++CP    D         T S FDN YYK L+A +G+F
Sbjct  211   FSASR--DIDPSMNIELAQELRKKCPKPNKDRNAGEFLDSTSSTFDNNYYKRLVAGKGVF  268

Query  953   QSDSALLRDKRAMEKVQDFAGDQNNFFTSWEQSFLKLVSIGVKVGDDDGEIRRSCSSVN  1129
              SD AL+ D R    V+ F  DQ+ FF  +  S + L ++GV    +DGE+R  C  VN
Sbjct  269   GSDQALVGDYRTRWIVESFVKDQSLFFREFAASMVNLGNVGVT---EDGEVRVKCRVVN  324



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3905951464779