BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c54475_g1_i1 len=117 path=[95:0-116]

Length=117
                                                                      Score     E

ref|XP_006654551.1|  PREDICTED: B3 domain-containing protein Os05...  54.3    2e-07   
gb|EEE64119.1|  hypothetical protein OsJ_18951                        53.9    3e-07   Oryza sativa Japonica Group [Japonica rice]
gb|EEC79411.1|  hypothetical protein OsI_20363                        53.9    3e-07   Oryza sativa Indica Group [Indian rice]
ref|NP_001055860.1|  Os05g0481400                                     53.9    3e-07   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010666633.1|  PREDICTED: B3 domain-containing protein At3g...  51.6    5e-07   
ref|XP_009387551.1|  PREDICTED: B3 domain-containing protein Os05...  53.1    6e-07   
ref|XP_010507495.1|  PREDICTED: B3 domain-containing protein At3g...  52.8    7e-07   
gb|EAY88816.1|  hypothetical protein OsI_10288                        51.6    1e-06   Oryza sativa Indica Group [Indian rice]
dbj|BAK03128.1|  predicted protein                                    52.0    1e-06   
ref|NP_001049190.1|  Os03g0184500                                     51.6    1e-06   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003568233.1|  PREDICTED: B3 domain-containing protein Os05...  52.0    2e-06   
ref|XP_004961727.1|  PREDICTED: B3 domain-containing protein Os05...  51.6    2e-06   
gb|EMT05021.1|  B3 domain-containing protein                          52.4    2e-06   
gb|EMT25279.1|  B3 domain-containing protein                          50.8    2e-06   
ref|XP_008444633.1|  PREDICTED: B3 domain-containing protein At5g...  50.8    2e-06   
ref|XP_008780798.1|  PREDICTED: B3 domain-containing protein Os05...  49.7    2e-06   
ref|XP_010233026.1|  PREDICTED: B3 domain-containing protein Os01...  51.6    4e-06   
ref|XP_010466051.1|  PREDICTED: B3 domain-containing protein At3g...  50.4    5e-06   
ref|XP_006298352.1|  hypothetical protein CARUB_v10014420mg           50.4    5e-06   
emb|CAN67499.1|  hypothetical protein VITISV_019679                   51.2    7e-06   Vitis vinifera
gb|EYU26113.1|  hypothetical protein MIMGU_mgv1a025604mg              50.4    7e-06   
dbj|BAJ88414.1|  predicted protein                                    49.7    7e-06   
gb|ADX60289.1|  ABIVP1 transcription factor                           49.7    9e-06   
ref|XP_010487846.1|  PREDICTED: B3 domain-containing protein At3g...  49.7    9e-06   
ref|XP_010487845.1|  PREDICTED: B3 domain-containing protein At3g...  49.7    1e-05   
ref|XP_006423042.1|  hypothetical protein CICLE_v10030084mg           50.1    1e-05   
ref|XP_006643962.1|  PREDICTED: LOW QUALITY PROTEIN: B3 domain-co...  50.1    1e-05   
ref|XP_004289224.1|  PREDICTED: B3 domain-containing protein Os01...  50.1    1e-05   
ref|NP_001151065.1|  DNA binding protein                              48.9    1e-05   Zea mays [maize]
gb|ACN31478.1|  unknown                                               48.9    1e-05   Zea mays [maize]
ref|XP_008803014.1|  PREDICTED: B3 domain-containing protein Os05...  49.3    1e-05   
gb|EYU44388.1|  hypothetical protein MIMGU_mgv1a005456mg              50.1    2e-05   
emb|CBI32428.3|  unnamed protein product                              48.5    2e-05   
gb|EMT12994.1|  B3 domain-containing protein                          48.9    2e-05   
ref|XP_010487844.1|  PREDICTED: B3 domain-containing protein At3g...  48.9    2e-05   
ref|XP_010647760.1|  PREDICTED: B3 domain-containing protein At3g...  48.9    2e-05   
ref|XP_008662020.1|  PREDICTED: DNA binding protein isoform X3        48.9    2e-05   
ref|XP_009106684.1|  PREDICTED: B3 domain-containing protein At3g...  48.5    2e-05   
ref|XP_008662019.1|  PREDICTED: DNA binding protein isoform X2        48.5    2e-05   
ref|XP_004985456.1|  PREDICTED: B3 domain-containing protein Os03...  48.1    2e-05   
gb|KDP42308.1|  hypothetical protein JCGZ_01632                       48.1    2e-05   
ref|XP_004152735.1|  PREDICTED: B3 domain-containing protein At5g...  48.1    2e-05   
gb|KDO42473.1|  hypothetical protein CISIN_1g036935mg                 48.9    3e-05   
ref|XP_010229077.1|  PREDICTED: B3 domain-containing protein Os03...  48.1    3e-05   
ref|XP_006389869.1|  hypothetical protein EUTSA_v10019015mg           48.1    3e-05   
ref|XP_010269220.1|  PREDICTED: B3 domain-containing protein At3g...  48.1    3e-05   
ref|XP_006649518.1|  PREDICTED: B3 domain-containing protein Os03...  47.8    3e-05   
ref|NP_001136712.1|  uncharacterized protein LOC100216848             48.1    3e-05   Zea mays [maize]
ref|XP_002883165.1|  DNA binding protein                              48.1    3e-05   
emb|CDX88552.1|  BnaC06g39960D                                        48.1    3e-05   
ref|XP_010664581.1|  PREDICTED: B3 domain-containing protein At5g...  47.8    4e-05   
emb|CBI19534.3|  unnamed protein product                              47.4    4e-05   
ref|XP_004230784.1|  PREDICTED: B3 domain-containing protein At3g...  47.4    4e-05   
ref|NP_001131637.1|  hypothetical protein                             46.2    4e-05   Zea mays [maize]
ref|XP_008645408.1|  PREDICTED: hypothetical protein isoform X1       47.8    4e-05   
emb|CDX87371.1|  BnaA07g35020D                                        48.9    4e-05   
dbj|BAD81380.1|  unknown protein                                      48.5    4e-05   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008676668.1|  PREDICTED: uncharacterized protein LOC100216...  47.4    4e-05   
gb|EEC70251.1|  hypothetical protein OsI_01044                        48.5    4e-05   Oryza sativa Indica Group [Indian rice]
ref|NP_001042515.1|  Os01g0234100                                     48.5    4e-05   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010269238.1|  PREDICTED: B3 domain-containing protein Os01...  48.5    4e-05   
gb|EEE54186.1|  hypothetical protein OsJ_01011                        48.5    4e-05   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010487847.1|  PREDICTED: B3 domain-containing protein At3g...  47.4    5e-05   
ref|XP_010269230.1|  PREDICTED: B3 domain-containing protein Os01...  48.5    5e-05   
ref|XP_011000257.1|  PREDICTED: B3 domain-containing protein Os01...  48.5    5e-05   
ref|XP_011006478.1|  PREDICTED: B3 domain-containing protein Os01...  48.5    5e-05   
ref|XP_011000251.1|  PREDICTED: B3 domain-containing protein Os01...  48.5    5e-05   
ref|XP_006384419.1|  hypothetical protein POPTR_0004s14900g           48.5    5e-05   
ref|XP_002313110.1|  hypothetical protein POPTR_0009s10620g           48.5    5e-05   Populus trichocarpa [western balsam poplar]
ref|XP_011006479.1|  PREDICTED: B3 domain-containing protein Os01...  48.5    5e-05   
gb|ADX60144.1|  ABIVP1 transcription factor                           47.4    5e-05   
tpg|DAA43744.1|  TPA: hypothetical protein ZEAMMB73_433086            47.4    5e-05   
ref|XP_008456113.1|  PREDICTED: B3 domain-containing protein Os01...  48.1    6e-05   
ref|XP_010070516.1|  PREDICTED: B3 domain-containing protein Os01...  48.1    6e-05   
ref|XP_010070338.1|  PREDICTED: B3 domain-containing protein Os01...  48.1    6e-05   
ref|XP_002441275.1|  hypothetical protein SORBIDRAFT_09g023630        47.8    6e-05   Sorghum bicolor [broomcorn]
ref|XP_008456112.1|  PREDICTED: B3 domain-containing protein Os01...  48.1    6e-05   
ref|XP_008662018.1|  PREDICTED: DNA binding protein isoform X1        47.4    6e-05   
ref|XP_006346419.1|  PREDICTED: B3 domain-containing protein At3g...  47.0    6e-05   
ref|XP_001753039.1|  predicted protein                                46.6    7e-05   
ref|NP_001141031.1|  hypothetical protein                             47.4    7e-05   Zea mays [maize]
gb|EYU42667.1|  hypothetical protein MIMGU_mgv1a006218mg              47.8    7e-05   
ref|XP_009778964.1|  PREDICTED: B3 domain-containing protein Os01...  47.8    8e-05   
emb|CBI21437.3|  unnamed protein product                              47.8    8e-05   
emb|CAN61149.1|  hypothetical protein VITISV_029172                   47.8    8e-05   Vitis vinifera
ref|XP_009778966.1|  PREDICTED: B3 domain-containing protein Os01...  47.8    9e-05   
ref|XP_010519303.1|  PREDICTED: B3 domain-containing protein At3g...  47.0    9e-05   
ref|XP_010519302.1|  PREDICTED: B3 domain-containing protein At3g...  47.0    1e-04   
emb|CDP07203.1|  unnamed protein product                              47.0    1e-04   
ref|XP_003638142.1|  B3 domain-containing protein                     47.4    1e-04   
gb|EMT09213.1|  B3 domain-containing protein                          46.2    1e-04   
ref|XP_010107957.1|  B3 domain-containing protein                     45.8    1e-04   
gb|KGN57545.1|  hypothetical protein Csa_3G207940                     47.0    2e-04   
ref|XP_011092583.1|  PREDICTED: B3 domain-containing protein Os01...  46.6    2e-04   
gb|AFW60989.1|  hypothetical protein ZEAMMB73_261802                  44.7    2e-04   
ref|XP_004152734.1|  PREDICTED: B3 domain-containing protein At5g...  45.8    2e-04   
gb|KDP42311.1|  hypothetical protein JCGZ_01635                       47.0    2e-04   
ref|XP_011092580.1|  PREDICTED: B3 domain-containing protein Os01...  46.6    2e-04   
emb|CDO97163.1|  unnamed protein product                              47.0    2e-04   
gb|KGN62530.1|  hypothetical protein Csa_2G359985                     45.4    2e-04   
gb|KEH35747.1|  B3 domain transcription factor                        45.4    2e-04   
ref|XP_010227844.1|  PREDICTED: B3 domain-containing protein Os06...  45.8    2e-04   
ref|XP_009375697.1|  PREDICTED: B3 domain-containing protein Os01...  46.6    2e-04   
ref|XP_008361398.1|  PREDICTED: B3 domain-containing protein Os01...  46.6    2e-04   
ref|XP_009403572.1|  PREDICTED: B3 domain-containing protein Os06...  45.8    2e-04   
ref|XP_003603025.1|  B3 domain-containing protein                     45.4    2e-04   
ref|XP_011088273.1|  PREDICTED: B3 domain-containing protein At3g...  45.4    2e-04   
ref|XP_002445218.1|  hypothetical protein SORBIDRAFT_07g006170        45.4    2e-04   Sorghum bicolor [broomcorn]
gb|AFW60986.1|  hypothetical protein ZEAMMB73_261802                  44.3    2e-04   
ref|XP_009403573.1|  PREDICTED: B3 domain-containing protein Os06...  45.4    2e-04   
ref|XP_009612762.1|  PREDICTED: B3 domain-containing protein Os01...  46.6    2e-04   
ref|XP_010922799.1|  PREDICTED: B3 domain-containing protein Os05...  45.8    2e-04   
ref|XP_006856095.1|  hypothetical protein AMTR_s00059p00130960        45.4    2e-04   
ref|XP_002518782.1|  conserved hypothetical protein                   46.6    2e-04   Ricinus communis
gb|EYU39334.1|  hypothetical protein MIMGU_mgv1a005357mg              46.6    2e-04   
gb|ACN30651.1|  unknown                                               44.3    3e-04   Zea mays [maize]
ref|XP_009778972.1|  PREDICTED: B3 domain-containing protein At5g...  45.4    3e-04   
ref|XP_009778971.1|  PREDICTED: B3 domain-containing protein At5g...  45.4    3e-04   
gb|EPS67764.1|  hypothetical protein M569_07011                       44.3    3e-04   
ref|XP_009612763.1|  PREDICTED: B3 domain-containing protein Os01...  46.2    3e-04   
ref|XP_011005880.1|  PREDICTED: B3 domain-containing protein Os01...  45.8    3e-04   
ref|XP_010481963.1|  PREDICTED: B3 domain-containing protein At5g...  45.1    3e-04   
ref|XP_010481962.1|  PREDICTED: B3 domain-containing protein At5g...  45.1    3e-04   
ref|XP_010922411.1|  PREDICTED: B3 domain-containing protein Os06...  45.1    3e-04   
gb|KDO42472.1|  hypothetical protein CISIN_1g036915mg                 45.4    3e-04   
emb|CDM87216.1|  unnamed protein product                              45.1    3e-04   
ref|XP_009778970.1|  PREDICTED: B3 domain-containing protein At3g...  45.4    3e-04   
gb|KFK39239.1|  hypothetical protein AALP_AA3G218400                  45.4    3e-04   
ref|XP_010094372.1|  B3 domain-containing protein                     46.2    3e-04   
ref|XP_011005879.1|  PREDICTED: B3 domain-containing protein Os01...  45.8    3e-04   
ref|XP_002307261.1|  hypothetical protein POPTR_0005s18090g           45.8    3e-04   Populus trichocarpa [western balsam poplar]
ref|XP_009778967.1|  PREDICTED: B3 domain-containing protein At5g...  45.4    3e-04   
ref|XP_011005878.1|  PREDICTED: B3 domain-containing protein Os01...  45.8    3e-04   
ref|XP_011005877.1|  PREDICTED: B3 domain-containing protein Os01...  45.8    3e-04   
ref|XP_010922413.1|  PREDICTED: B3 domain-containing protein Os06...  45.1    4e-04   
ref|XP_006487088.1|  PREDICTED: B3 domain-containing protein At3g...  45.4    4e-04   
ref|XP_006487087.1|  PREDICTED: B3 domain-containing protein At3g...  45.4    4e-04   
emb|CDM82532.1|  unnamed protein product                              45.8    4e-04   
emb|CDM82531.1|  unnamed protein product                              45.8    4e-04   
ref|XP_010481961.1|  PREDICTED: B3 domain-containing protein At5g...  45.1    4e-04   
ref|XP_009778969.1|  PREDICTED: B3 domain-containing protein At5g...  45.4    4e-04   
ref|XP_008788064.1|  PREDICTED: B3 domain-containing protein Os06...  44.7    4e-04   
ref|XP_008241504.1|  PREDICTED: B3 domain-containing protein Os01...  45.8    4e-04   
gb|EMT26046.1|  B3 domain-containing protein                          45.8    4e-04   
ref|XP_011010191.1|  PREDICTED: B3 domain-containing protein Os01...  45.8    4e-04   
ref|XP_006380709.1|  hypothetical protein POPTR_0007s11170g           45.8    4e-04   
ref|XP_011010190.1|  PREDICTED: B3 domain-containing protein Os01...  45.8    4e-04   
ref|XP_002310730.2|  hypothetical protein POPTR_0007s11170g           45.8    4e-04   Populus trichocarpa [western balsam poplar]
ref|XP_010666630.1|  PREDICTED: B3 domain-containing protein Os01...  45.4    4e-04   
gb|EMT06248.1|  B3 domain-containing protein                          45.8    4e-04   
ref|XP_010666629.1|  PREDICTED: B3 domain-containing protein Os01...  45.4    4e-04   
gb|EMT13106.1|  B3 domain-containing protein                          44.7    5e-04   
ref|XP_004240808.1|  PREDICTED: B3 domain-containing protein Os01...  45.4    5e-04   
ref|XP_007200257.1|  hypothetical protein PRUPE_ppa015021mg           45.4    5e-04   
ref|XP_009612764.1|  PREDICTED: B3 domain-containing protein At5g...  44.7    5e-04   
ref|XP_009612765.1|  PREDICTED: B3 domain-containing protein At5g...  44.7    5e-04   
ref|XP_006473345.1|  PREDICTED: B3 domain-containing protein At3g...  44.7    5e-04   
ref|XP_007042395.1|  AP2/B3-like transcriptional factor family pr...  45.4    5e-04   
ref|XP_006423041.1|  hypothetical protein CICLE_v10029072mg           44.7    5e-04   
ref|XP_008236526.1|  PREDICTED: B3 domain-containing protein Os01...  45.4    5e-04   
gb|KDO84218.1|  hypothetical protein CISIN_1g026276mg                 44.7    5e-04   
ref|XP_004291119.1|  PREDICTED: B3 domain-containing protein Os06...  43.5    5e-04   
ref|XP_011000298.1|  PREDICTED: B3 domain-containing protein At3g...  44.7    5e-04   
ref|XP_004136984.1|  PREDICTED: B3 domain-containing protein At3g...  45.1    6e-04   
ref|XP_006434799.1|  hypothetical protein CICLE_v10002314mg           44.7    6e-04   
ref|XP_002313112.2|  hypothetical protein POPTR_0009s10590g           44.7    6e-04   Populus trichocarpa [western balsam poplar]
ref|XP_008457832.1|  PREDICTED: B3 domain-containing protein Os01...  45.4    6e-04   
ref|XP_010107958.1|  B3 domain-containing protein                     45.4    6e-04   
ref|XP_011088274.1|  PREDICTED: B3 domain-containing protein At3g...  44.3    6e-04   
ref|XP_008457831.1|  PREDICTED: B3 domain-containing protein Os01...  45.4    6e-04   
ref|XP_002523562.1|  hypothetical protein RCOM_1407360                45.1    7e-04   Ricinus communis
ref|XP_008454940.1|  PREDICTED: B3 domain-containing protein At3g...  44.7    8e-04   
ref|XP_008454939.1|  PREDICTED: B3 domain-containing protein At3g...  44.7    8e-04   
gb|ABK95016.1|  unknown                                               43.5    8e-04   Populus trichocarpa [western balsam poplar]
ref|XP_002465742.1|  hypothetical protein SORBIDRAFT_01g044910        43.9    0.001   Sorghum bicolor [broomcorn]
ref|XP_006374961.1|  hypothetical protein POPTR_0014s03130g           43.5    0.001   



>ref|XP_006654551.1| PREDICTED: B3 domain-containing protein Os05g0481400-like [Oryza 
brachyantha]
Length=277

 Score = 54.3 bits (129),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 19/38 (50%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = -2

Query  116  LDPTQPSFIKFLSRTYATLGFWVGLPPDFCKMYLPPHD  3
            LDP  PSF+K + R++ +  FW+GLP  FCK++LPP +
Sbjct  129  LDPENPSFVKTMVRSHVSSCFWLGLPSRFCKLHLPPRE  166



>gb|EEE64119.1| hypothetical protein OsJ_18951 [Oryza sativa Japonica Group]
Length=279

 Score = 53.9 bits (128),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 19/38 (50%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = -2

Query  116  LDPTQPSFIKFLSRTYATLGFWVGLPPDFCKMYLPPHD  3
            LDP  PSF+K + R++ +  FW+GLP  FCK++LPP +
Sbjct  132  LDPENPSFVKTMVRSHVSSCFWLGLPTRFCKLHLPPKE  169



>gb|EEC79411.1| hypothetical protein OsI_20363 [Oryza sativa Indica Group]
Length=279

 Score = 53.9 bits (128),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 19/38 (50%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = -2

Query  116  LDPTQPSFIKFLSRTYATLGFWVGLPPDFCKMYLPPHD  3
            LDP  PSF+K + R++ +  FW+GLP  FCK++LPP +
Sbjct  132  LDPENPSFVKTMVRSHVSSCFWLGLPTRFCKLHLPPKE  169



>ref|NP_001055860.1| Os05g0481400 [Oryza sativa Japonica Group]
 sp|Q5KQI4.1|Y5814_ORYSJ RecName: Full=B3 domain-containing protein Os05g0481400 [Oryza 
sativa Japonica Group]
 gb|AAW56868.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF17774.1| Os05g0481400 [Oryza sativa Japonica Group]
Length=279

 Score = 53.9 bits (128),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 19/38 (50%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = -2

Query  116  LDPTQPSFIKFLSRTYATLGFWVGLPPDFCKMYLPPHD  3
            LDP  PSF+K + R++ +  FW+GLP  FCK++LPP +
Sbjct  132  LDPENPSFVKTMVRSHVSSCFWLGLPTRFCKLHLPPKE  169



>ref|XP_010666633.1| PREDICTED: B3 domain-containing protein At3g19184-like isoform 
X2 [Beta vulgaris subsp. vulgaris]
Length=144

 Score = 51.6 bits (122),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 20/38 (53%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = -2

Query  116  LDPTQPSFIKFLSRTYATLGFWVGLPPDFCKMYLPPHD  3
            LDP  PSFIK + +++ T GFW+GLP  FC+ +LP +D
Sbjct  32   LDPRYPSFIKVMLKSHVTGGFWMGLPASFCEKHLPLND  69



>ref|XP_009387551.1| PREDICTED: B3 domain-containing protein Os05g0481400 [Musa acuminata 
subsp. malaccensis]
Length=278

 Score = 53.1 bits (126),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 20/38 (53%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = -2

Query  116  LDPTQPSFIKFLSRTYATLGFWVGLPPDFCKMYLPPHD  3
            LDP  PSFIK + R++ +  FW+GLP  FCK +LPP++
Sbjct  126  LDPIYPSFIKSMVRSHVSSCFWLGLPTRFCKEHLPPYE  163



>ref|XP_010507495.1| PREDICTED: B3 domain-containing protein At3g19184-like [Camelina 
sativa]
Length=259

 Score = 52.8 bits (125),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 21/38 (55%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = -2

Query  116  LDPTQPSFIKFLSRTYATLGFWVGLPPDFCKMYLPPHD  3
            LDP  PSF+K + +++ T GFW+GLP  FCK YLP  D
Sbjct  118  LDPEFPSFVKPMLQSHVTGGFWMGLPLHFCKTYLPKRD  155



>gb|EAY88816.1| hypothetical protein OsI_10288 [Oryza sativa Indica Group]
Length=237

 Score = 51.6 bits (122),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 20/38 (53%), Positives = 26/38 (68%), Gaps = 0/38 (0%)
 Frame = -2

Query  116  LDPTQPSFIKFLSRTYATLGFWVGLPPDFCKMYLPPHD  3
            LDP  PSF+K +  ++   GFW+GLP  FC+ YLP HD
Sbjct  130  LDPEFPSFVKPMLHSHVVRGFWLGLPRHFCETYLPKHD  167



>dbj|BAK03128.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=284

 Score = 52.0 bits (123),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 19/38 (50%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = -2

Query  116  LDPTQPSFIKFLSRTYATLGFWVGLPPDFCKMYLPPHD  3
            LDP  PSF+K + R++ +  FW+GLP  FCK +LPP +
Sbjct  130  LDPDNPSFVKNMVRSHVSSCFWLGLPSSFCKDHLPPRE  167



>ref|NP_001049190.1| Os03g0184500 [Oryza sativa Japonica Group]
 sp|Q10QS9.1|Y3845_ORYSJ RecName: Full=B3 domain-containing protein Os03g0184500 [Oryza 
sativa Japonica Group]
 gb|AAK92622.1|AC079633_2 Unknown protein [Oryza sativa Japonica Group]
 gb|ABF94348.1| B3 DNA binding domain containing protein, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF11104.1| Os03g0184500 [Oryza sativa Japonica Group]
 gb|EAZ25847.1| hypothetical protein OsJ_09687 [Oryza sativa Japonica Group]
 dbj|BAH00755.1| unnamed protein product [Oryza sativa Japonica Group]
Length=237

 Score = 51.6 bits (122),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 20/38 (53%), Positives = 26/38 (68%), Gaps = 0/38 (0%)
 Frame = -2

Query  116  LDPTQPSFIKFLSRTYATLGFWVGLPPDFCKMYLPPHD  3
            LDP  PSF+K +  ++   GFW+GLP  FC+ YLP HD
Sbjct  130  LDPEFPSFVKPMLHSHVVRGFWLGLPRHFCETYLPKHD  167



>ref|XP_003568233.1| PREDICTED: B3 domain-containing protein Os05g0481400 [Brachypodium 
distachyon]
Length=274

 Score = 52.0 bits (123),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 19/38 (50%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = -2

Query  116  LDPTQPSFIKFLSRTYATLGFWVGLPPDFCKMYLPPHD  3
            LDP  PSF+K + R++ +  FW+GLP  FCK +LPP +
Sbjct  130  LDPDNPSFVKTMVRSHVSSCFWLGLPTRFCKDHLPPRE  167



>ref|XP_004961727.1| PREDICTED: B3 domain-containing protein Os05g0481400-like [Setaria 
italica]
Length=278

 Score = 51.6 bits (122),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 19/36 (53%), Positives = 25/36 (69%), Gaps = 0/36 (0%)
 Frame = -2

Query  116  LDPTQPSFIKFLSRTYATLGFWVGLPPDFCKMYLPP  9
            LDP  PSF+K + R++ +  FW+GLP  FCK  LPP
Sbjct  134  LDPNNPSFVKTMVRSHVSSCFWLGLPTSFCKQNLPP  169



>gb|EMT05021.1| B3 domain-containing protein [Aegilops tauschii]
Length=427

 Score = 52.4 bits (124),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 19/38 (50%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = -2

Query  116  LDPTQPSFIKFLSRTYATLGFWVGLPPDFCKMYLPPHD  3
            LDP  PSF+K + R++ +  FW+GLP  FCK +LPP +
Sbjct  276  LDPDNPSFVKTMVRSHVSSCFWLGLPSSFCKDHLPPRE  313



>gb|EMT25279.1| B3 domain-containing protein [Aegilops tauschii]
Length=223

 Score = 50.8 bits (120),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 20/38 (53%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = -2

Query  116  LDPTQPSFIKFLSRTYATLGFWVGLPPDFCKMYLPPHD  3
            LDP  PSF+K +++++ T GFW+GLP  FC  YLP  D
Sbjct  128  LDPRHPSFVKPMTQSHVTGGFWLGLPKQFCTKYLPKRD  165



>ref|XP_008444633.1| PREDICTED: B3 domain-containing protein At5g42700-like [Cucumis 
melo]
Length=230

 Score = 50.8 bits (120),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 19/38 (50%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = -2

Query  116  LDPTQPSFIKFLSRTYATLGFWVGLPPDFCKMYLPPHD  3
            L+P  PSFIK + +++ + GFW+GLP  FCK++LP  D
Sbjct  120  LEPNYPSFIKSMLQSHVSGGFWLGLPSHFCKIHLPNRD  157



>ref|XP_008780798.1| PREDICTED: B3 domain-containing protein Os05g0481400, partial 
[Phoenix dactylifera]
Length=114

 Score = 49.7 bits (117),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 19/38 (50%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = -2

Query  116  LDPTQPSFIKFLSRTYATLGFWVGLPPDFCKMYLPPHD  3
            LDP  PSF+K + R++ +  FW+GLP  FCK++LPP +
Sbjct  49   LDPENPSFVKTMVRSHVSSCFWLGLPTRFCKLHLPPKE  86



>ref|XP_010233026.1| PREDICTED: B3 domain-containing protein Os01g0234100-like [Brachypodium 
distachyon]
Length=587

 Score = 51.6 bits (122),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 20/38 (53%), Positives = 25/38 (66%), Gaps = 0/38 (0%)
 Frame = -2

Query  116  LDPTQPSFIKFLSRTYATLGFWVGLPPDFCKMYLPPHD  3
            L    PSFIK + +++   GFW+GLP DFC  YLP HD
Sbjct  238  LPAEHPSFIKHMLQSHVIQGFWLGLPCDFCNKYLPKHD  275



>ref|XP_010466051.1| PREDICTED: B3 domain-containing protein At3g19184-like [Camelina 
sativa]
Length=262

 Score = 50.4 bits (119),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 20/38 (53%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = -2

Query  116  LDPTQPSFIKFLSRTYATLGFWVGLPPDFCKMYLPPHD  3
            LDP  PSF+K + +++ T GFW+GLP  FCK +LP  D
Sbjct  118  LDPEFPSFVKPMLQSHVTGGFWLGLPLRFCKTHLPKRD  155



>ref|XP_006298352.1| hypothetical protein CARUB_v10014420mg [Capsella rubella]
 gb|EOA31250.1| hypothetical protein CARUB_v10014420mg [Capsella rubella]
Length=262

 Score = 50.4 bits (119),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 20/38 (53%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = -2

Query  116  LDPTQPSFIKFLSRTYATLGFWVGLPPDFCKMYLPPHD  3
            LDP  PSF+K + +++ T GFW+GLP  FCK +LP  D
Sbjct  118  LDPEFPSFVKPMLQSHVTGGFWLGLPLRFCKTHLPKRD  155



>emb|CAN67499.1| hypothetical protein VITISV_019679 [Vitis vinifera]
Length=930

 Score = 51.2 bits (121),  Expect = 7e-06, Method: Composition-based stats.
 Identities = 20/38 (53%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = -2

Query  116  LDPTQPSFIKFLSRTYATLGFWVGLPPDFCKMYLPPHD  3
            L+   PSF+K + +++ T GFW+GLP  FCKM+LP HD
Sbjct  761  LETDFPSFVKPMLQSHVTGGFWLGLPVHFCKMHLPKHD  798



>gb|EYU26113.1| hypothetical protein MIMGU_mgv1a025604mg [Erythranthe guttata]
Length=327

 Score = 50.4 bits (119),  Expect = 7e-06, Method: Composition-based stats.
 Identities = 18/33 (55%), Positives = 25/33 (76%), Gaps = 0/33 (0%)
 Frame = -2

Query  101  PSFIKFLSRTYATLGFWVGLPPDFCKMYLPPHD  3
            PSF+K + R++ T GFW+GLP  FC+ YLP +D
Sbjct  16   PSFVKLMLRSHVTQGFWLGLPNKFCRDYLPKND  48



>dbj|BAJ88414.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=249

 Score = 49.7 bits (117),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 19/38 (50%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = -2

Query  116  LDPTQPSFIKFLSRTYATLGFWVGLPPDFCKMYLPPHD  3
            LDP   SF+K +++++ T GFW+GLP +FC  +LP HD
Sbjct  147  LDPGHHSFVKPMTQSHVTGGFWLGLPKEFCNKHLPKHD  184



>gb|ADX60289.1| ABIVP1 transcription factor [Oryza sativa Japonica Group]
Length=279

 Score = 49.7 bits (117),  Expect = 9e-06, Method: Composition-based stats.
 Identities = 18/38 (47%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = -2

Query  116  LDPTQPSFIKFLSRTYATLGFWVGLPPDFCKMYLPPHD  3
            LDP  PSF+K + R++ +  FW+GL   FCK++LPP +
Sbjct  132  LDPENPSFVKTMVRSHVSSCFWLGLRTRFCKLHLPPKE  169



>ref|XP_010487846.1| PREDICTED: B3 domain-containing protein At3g19184-like isoform 
X3 [Camelina sativa]
Length=249

 Score = 49.7 bits (117),  Expect = 9e-06, Method: Composition-based stats.
 Identities = 19/38 (50%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = -2

Query  116  LDPTQPSFIKFLSRTYATLGFWVGLPPDFCKMYLPPHD  3
            LDP  PSF+K + +++ T GFW+GLP  FCK ++P  D
Sbjct  109  LDPDFPSFVKPMLQSHVTGGFWMGLPLRFCKTHMPKRD  146



>ref|XP_010487845.1| PREDICTED: B3 domain-containing protein At3g19184-like isoform 
X2 [Camelina sativa]
Length=258

 Score = 49.7 bits (117),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 19/38 (50%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = -2

Query  116  LDPTQPSFIKFLSRTYATLGFWVGLPPDFCKMYLPPHD  3
            LDP  PSF+K + +++ T GFW+GLP  FCK ++P  D
Sbjct  118  LDPDFPSFVKPMLQSHVTGGFWMGLPLRFCKTHMPKRD  155



>ref|XP_006423042.1| hypothetical protein CICLE_v10030084mg, partial [Citrus clementina]
 gb|ESR36282.1| hypothetical protein CICLE_v10030084mg, partial [Citrus clementina]
Length=354

 Score = 50.1 bits (118),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 21/38 (55%), Positives = 25/38 (66%), Gaps = 0/38 (0%)
 Frame = -2

Query  116  LDPTQPSFIKFLSRTYATLGFWVGLPPDFCKMYLPPHD  3
            LDP  PSFIKF+ R++ T GFW+GL   FC   LP  D
Sbjct  32   LDPQFPSFIKFMLRSHVTGGFWLGLSRKFCTDNLPKQD  69



>ref|XP_006643962.1| PREDICTED: LOW QUALITY PROTEIN: B3 domain-containing protein 
Os01g0234100-like [Oryza brachyantha]
Length=501

 Score = 50.1 bits (118),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 18/38 (47%), Positives = 25/38 (66%), Gaps = 0/38 (0%)
 Frame = -2

Query  116  LDPTQPSFIKFLSRTYATLGFWVGLPPDFCKMYLPPHD  3
            L    PSF+K + +++   GFW+GLP DFC  +LP HD
Sbjct  152  LPAEHPSFVKHMLQSHVVRGFWLGLPADFCNKHLPKHD  189



>ref|XP_004289224.1| PREDICTED: B3 domain-containing protein Os01g0234100-like [Fragaria 
vesca subsp. vesca]
Length=557

 Score = 50.1 bits (118),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 21/38 (55%), Positives = 26/38 (68%), Gaps = 0/38 (0%)
 Frame = -2

Query  116  LDPTQPSFIKFLSRTYATLGFWVGLPPDFCKMYLPPHD  3
            LDPT PSF+K L R++    FW+GLP  FCK +LP  D
Sbjct  192  LDPTFPSFVKSLLRSHVASCFWMGLPSLFCKSHLPDKD  229



>ref|NP_001151065.1| DNA binding protein [Zea mays]
 gb|ACG41483.1| DNA binding protein [Zea mays]
Length=232

 Score = 48.9 bits (115),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 19/38 (50%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = -2

Query  116  LDPTQPSFIKFLSRTYATLGFWVGLPPDFCKMYLPPHD  3
            LD + P FIK +++++ T GFW+GLP  FC+ YLP  D
Sbjct  127  LDSSFPVFIKPMTQSHVTGGFWLGLPNHFCRKYLPKRD  164



>gb|ACN31478.1| unknown [Zea mays]
 gb|AFT82695.1| ABI51 ABI3VP1 type transcription factor, partial [Zea mays subsp. 
mays]
 gb|AFW57009.1| DNA binding protein [Zea mays]
Length=232

 Score = 48.9 bits (115),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 19/38 (50%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = -2

Query  116  LDPTQPSFIKFLSRTYATLGFWVGLPPDFCKMYLPPHD  3
            LD + P FIK +++++ T GFW+GLP  FC+ YLP  D
Sbjct  127  LDSSFPVFIKPMTQSHVTGGFWLGLPNHFCRKYLPKRD  164



>ref|XP_008803014.1| PREDICTED: B3 domain-containing protein Os05g0481400 [Phoenix 
dactylifera]
Length=279

 Score = 49.3 bits (116),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 18/38 (47%), Positives = 26/38 (68%), Gaps = 0/38 (0%)
 Frame = -2

Query  116  LDPTQPSFIKFLSRTYATLGFWVGLPPDFCKMYLPPHD  3
            L+   PSF+K + R++ +  FW+GLP  FCK  LPPH+
Sbjct  126  LNSNHPSFVKSMLRSHVSSCFWLGLPSKFCKENLPPHE  163



>gb|EYU44388.1| hypothetical protein MIMGU_mgv1a005456mg [Erythranthe guttata]
Length=483

 Score = 50.1 bits (118),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 20/38 (53%), Positives = 26/38 (68%), Gaps = 0/38 (0%)
 Frame = -2

Query  116  LDPTQPSFIKFLSRTYATLGFWVGLPPDFCKMYLPPHD  3
            L   QP+F+KFL R++    FW+GLP  FCK+YLP  D
Sbjct  131  LSNDQPNFLKFLVRSHVGSCFWMGLPVPFCKVYLPSED  168



>emb|CBI32428.3| unnamed protein product [Vitis vinifera]
Length=223

 Score = 48.5 bits (114),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 20/38 (53%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = -2

Query  116  LDPTQPSFIKFLSRTYATLGFWVGLPPDFCKMYLPPHD  3
            L+   PSF+K + +++ T GFW+GLP  FCKM+LP HD
Sbjct  123  LETDFPSFVKPMLQSHVTGGFWLGLPVHFCKMHLPKHD  160



>gb|EMT12994.1| B3 domain-containing protein [Aegilops tauschii]
Length=241

 Score = 48.9 bits (115),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 19/38 (50%), Positives = 25/38 (66%), Gaps = 0/38 (0%)
 Frame = -2

Query  116  LDPTQPSFIKFLSRTYATLGFWVGLPPDFCKMYLPPHD  3
            LDP  PSF+K +  ++   GFW+GLP  FC  YLP +D
Sbjct  133  LDPEFPSFMKRMLHSHVVRGFWLGLPSHFCDTYLPKND  170



>ref|XP_010487844.1| PREDICTED: B3 domain-containing protein At3g19184-like isoform 
X1 [Camelina sativa]
Length=265

 Score = 48.9 bits (115),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 19/38 (50%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = -2

Query  116  LDPTQPSFIKFLSRTYATLGFWVGLPPDFCKMYLPPHD  3
            LDP  PSF+K + +++ T GFW+GLP  FCK ++P  D
Sbjct  126  LDPDFPSFVKPMLQSHVTGGFWMGLPLRFCKTHMPKRD  163



>ref|XP_010647760.1| PREDICTED: B3 domain-containing protein At3g19184 isoform X1 
[Vitis vinifera]
Length=251

 Score = 48.9 bits (115),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 20/38 (53%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = -2

Query  116  LDPTQPSFIKFLSRTYATLGFWVGLPPDFCKMYLPPHD  3
            L+   PSF+K + +++ T GFW+GLP  FCKM+LP HD
Sbjct  122  LETDFPSFVKPMLQSHVTGGFWLGLPVHFCKMHLPKHD  159



>ref|XP_008662020.1| PREDICTED: DNA binding protein isoform X3 [Zea mays]
Length=259

 Score = 48.9 bits (115),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 19/38 (50%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = -2

Query  116  LDPTQPSFIKFLSRTYATLGFWVGLPPDFCKMYLPPHD  3
            LD + P FIK +++++ T GFW+GLP  FC+ YLP  D
Sbjct  127  LDSSFPVFIKPMTQSHVTGGFWLGLPNHFCRKYLPKRD  164



>ref|XP_009106684.1| PREDICTED: B3 domain-containing protein At3g19184 [Brassica rapa]
Length=261

 Score = 48.5 bits (114),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 19/38 (50%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = -2

Query  116  LDPTQPSFIKFLSRTYATLGFWVGLPPDFCKMYLPPHD  3
            L+P  PSFIK + +++ T GFW+GLP  FC  +LP +D
Sbjct  117  LEPEFPSFIKPMLQSHVTGGFWLGLPRQFCHTHLPKYD  154



>ref|XP_008662019.1| PREDICTED: DNA binding protein isoform X2 [Zea mays]
Length=266

 Score = 48.5 bits (114),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 19/38 (50%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = -2

Query  116  LDPTQPSFIKFLSRTYATLGFWVGLPPDFCKMYLPPHD  3
            LD + P FIK +++++ T GFW+GLP  FC+ YLP  D
Sbjct  127  LDSSFPVFIKPMTQSHVTGGFWLGLPNHFCRKYLPKRD  164



>ref|XP_004985456.1| PREDICTED: B3 domain-containing protein Os03g0184500-like [Setaria 
italica]
Length=237

 Score = 48.1 bits (113),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 18/38 (47%), Positives = 24/38 (63%), Gaps = 0/38 (0%)
 Frame = -2

Query  116  LDPTQPSFIKFLSRTYATLGFWVGLPPDFCKMYLPPHD  3
            LDP  PSF+K +  ++   GFW+GLP  FC  Y+P  D
Sbjct  130  LDPEIPSFVKAMLHSHVVRGFWLGLPSHFCDTYMPKQD  167



>gb|KDP42308.1| hypothetical protein JCGZ_01632 [Jatropha curcas]
Length=227

 Score = 48.1 bits (113),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 19/38 (50%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = -2

Query  116  LDPTQPSFIKFLSRTYATLGFWVGLPPDFCKMYLPPHD  3
            L+P  PSF+K +++++ T GFW+GLP  FCK  LP  D
Sbjct  37   LEPGFPSFVKPMTQSHVTGGFWLGLPVQFCKDNLPKRD  74



>ref|XP_004152735.1| PREDICTED: B3 domain-containing protein At5g42700-like [Cucumis 
sativus]
 ref|XP_004160007.1| PREDICTED: B3 domain-containing protein At5g42700-like [Cucumis 
sativus]
 gb|KGN62529.1| hypothetical protein Csa_2G359980 [Cucumis sativus]
Length=229

 Score = 48.1 bits (113),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 19/38 (50%), Positives = 26/38 (68%), Gaps = 0/38 (0%)
 Frame = -2

Query  116  LDPTQPSFIKFLSRTYATLGFWVGLPPDFCKMYLPPHD  3
            L+P  PSFIK + +++ + GFW+GLP  FCK  LP  D
Sbjct  120  LEPNYPSFIKSMLQSHVSGGFWLGLPSHFCKNRLPNRD  157



>gb|KDO42473.1| hypothetical protein CISIN_1g036935mg, partial [Citrus sinensis]
Length=399

 Score = 48.9 bits (115),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 21/38 (55%), Positives = 25/38 (66%), Gaps = 0/38 (0%)
 Frame = -2

Query  116  LDPTQPSFIKFLSRTYATLGFWVGLPPDFCKMYLPPHD  3
            LDP  PSFIKF+ R++ T GFW+GL   FC   LP  D
Sbjct  32   LDPQFPSFIKFMLRSHVTGGFWLGLSRKFCIDNLPKQD  69



>ref|XP_010229077.1| PREDICTED: B3 domain-containing protein Os03g0184500-like [Brachypodium 
distachyon]
Length=235

 Score = 48.1 bits (113),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 19/38 (50%), Positives = 24/38 (63%), Gaps = 0/38 (0%)
 Frame = -2

Query  116  LDPTQPSFIKFLSRTYATLGFWVGLPPDFCKMYLPPHD  3
            LDP  PSF+K +  ++   GFW+GLP  FC  YLP  D
Sbjct  128  LDPEFPSFVKRMLHSHVVRGFWLGLPSHFCDSYLPKQD  165



>ref|XP_006389869.1| hypothetical protein EUTSA_v10019015mg [Eutrema salsugineum]
 gb|ESQ27155.1| hypothetical protein EUTSA_v10019015mg [Eutrema salsugineum]
Length=261

 Score = 48.1 bits (113),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 18/38 (47%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = -2

Query  116  LDPTQPSFIKFLSRTYATLGFWVGLPPDFCKMYLPPHD  3
            L+P  PSF+K + +++ T GFW+GLP  FC+ +LP  D
Sbjct  118  LEPGFPSFVKSMLQSHVTGGFWLGLPHQFCRTHLPHRD  155



>ref|XP_010269220.1| PREDICTED: B3 domain-containing protein At3g19184-like [Nelumbo 
nucifera]
Length=244

 Score = 48.1 bits (113),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 19/38 (50%), Positives = 26/38 (68%), Gaps = 0/38 (0%)
 Frame = -2

Query  116  LDPTQPSFIKFLSRTYATLGFWVGLPPDFCKMYLPPHD  3
            L+P  PSF+K + +++ T GFW+GL   FCKM LP  D
Sbjct  122  LEPEYPSFVKTMLQSHVTGGFWLGLSVQFCKMNLPKRD  159



>ref|XP_006649518.1| PREDICTED: B3 domain-containing protein Os03g0184500-like [Oryza 
brachyantha]
Length=235

 Score = 47.8 bits (112),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 19/38 (50%), Positives = 25/38 (66%), Gaps = 0/38 (0%)
 Frame = -2

Query  116  LDPTQPSFIKFLSRTYATLGFWVGLPPDFCKMYLPPHD  3
            LDP  PSF+K +  ++   GFW+GLP  FC+ YLP  D
Sbjct  128  LDPEFPSFVKPMLHSHVVRGFWLGLPRHFCETYLPKRD  165



>ref|NP_001136712.1| uncharacterized protein LOC100216848 [Zea mays]
 ref|XP_008676667.1| PREDICTED: uncharacterized protein LOC100216848 isoform X1 [Zea 
mays]
 gb|ACF82449.1| unknown [Zea mays]
 gb|AFW60984.1| hypothetical protein ZEAMMB73_261802 [Zea mays]
 gb|AIB04371.1| ABI3VP1 transcription factor, partial [Zea mays]
Length=251

 Score = 48.1 bits (113),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 19/38 (50%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = -2

Query  116  LDPTQPSFIKFLSRTYATLGFWVGLPPDFCKMYLPPHD  3
            LD + P FIK +++++ T GFW+GLP  FC+ YLP  D
Sbjct  146  LDSSFPIFIKPMTQSHVTGGFWLGLPIHFCRKYLPKRD  183



>ref|XP_002883165.1| DNA binding protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH59424.1| DNA binding protein [Arabidopsis lyrata subsp. lyrata]
Length=275

 Score = 48.1 bits (113),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 19/38 (50%), Positives = 26/38 (68%), Gaps = 0/38 (0%)
 Frame = -2

Query  116  LDPTQPSFIKFLSRTYATLGFWVGLPPDFCKMYLPPHD  3
            LDP  PSF K + +++ T GFW+GLP  FCK ++P  D
Sbjct  120  LDPEFPSFTKPMLQSHVTGGFWLGLPLPFCKAHMPKRD  157



>emb|CDX88552.1| BnaC06g39960D [Brassica napus]
Length=269

 Score = 48.1 bits (113),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 19/38 (50%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = -2

Query  116  LDPTQPSFIKFLSRTYATLGFWVGLPPDFCKMYLPPHD  3
            L+P  PSFIK + +++ T GFW+GLP  FC  +LP +D
Sbjct  117  LEPEFPSFIKPMLQSHVTGGFWLGLPRSFCHTHLPKYD  154



>ref|XP_010664581.1| PREDICTED: B3 domain-containing protein At5g42700 [Vitis vinifera]
Length=241

 Score = 47.8 bits (112),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 19/38 (50%), Positives = 26/38 (68%), Gaps = 0/38 (0%)
 Frame = -2

Query  116  LDPTQPSFIKFLSRTYATLGFWVGLPPDFCKMYLPPHD  3
            L+P  PSF+K + +++ T GFW+GLP  FCK  LP  D
Sbjct  135  LEPQYPSFLKSMLQSHVTGGFWLGLPVHFCKTTLPKSD  172



>emb|CBI19534.3| unnamed protein product [Vitis vinifera]
Length=217

 Score = 47.4 bits (111),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 19/38 (50%), Positives = 26/38 (68%), Gaps = 0/38 (0%)
 Frame = -2

Query  116  LDPTQPSFIKFLSRTYATLGFWVGLPPDFCKMYLPPHD  3
            L+P  PSF+K + +++ T GFW+GLP  FCK  LP  D
Sbjct  106  LEPQYPSFLKSMLQSHVTGGFWLGLPVHFCKTTLPKSD  143



>ref|XP_004230784.1| PREDICTED: B3 domain-containing protein At3g19184 [Solanum lycopersicum]
Length=224

 Score = 47.4 bits (111),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 20/38 (53%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = -2

Query  116  LDPTQPSFIKFLSRTYATLGFWVGLPPDFCKMYLPPHD  3
            LD   PSF+K + +++ T GFW+GLP  FCK +LP HD
Sbjct  122  LDVDFPSFVKPMLQSHVTGGFWLGLPVHFCKTHLPKHD  159



>ref|NP_001131637.1| hypothetical protein [Zea mays]
 gb|ACF80139.1| unknown [Zea mays]
 tpg|DAA43743.1| TPA: hypothetical protein ZEAMMB73_433086 [Zea mays]
Length=146

 Score = 46.2 bits (108),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 18/38 (47%), Positives = 24/38 (63%), Gaps = 0/38 (0%)
 Frame = -2

Query  116  LDPTQPSFIKFLSRTYATLGFWVGLPPDFCKMYLPPHD  3
            LDP  PSF+K +  ++   GFW+GLP  FC  Y+P  D
Sbjct  39   LDPEIPSFVKAMLHSHVVRGFWLGLPSHFCDTYMPKQD  76



>ref|XP_008645408.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 gb|ACR37653.1| unknown [Zea mays]
 tpg|DAA43745.1| TPA: hypothetical protein ZEAMMB73_433086 [Zea mays]
Length=239

 Score = 47.8 bits (112),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 18/38 (47%), Positives = 24/38 (63%), Gaps = 0/38 (0%)
 Frame = -2

Query  116  LDPTQPSFIKFLSRTYATLGFWVGLPPDFCKMYLPPHD  3
            LDP  PSF+K +  ++   GFW+GLP  FC  Y+P  D
Sbjct  132  LDPEIPSFVKAMLHSHVVRGFWLGLPSHFCDTYMPKQD  169



>emb|CDX87371.1| BnaA07g35020D [Brassica napus]
Length=526

 Score = 48.9 bits (115),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 19/38 (50%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = -2

Query  116  LDPTQPSFIKFLSRTYATLGFWVGLPPDFCKMYLPPHD  3
            L+P  PSFIK + +++ T GFW+GLP  FC  +LP +D
Sbjct  353  LEPEFPSFIKPMLQSHVTGGFWLGLPRQFCHTHLPKYD  390



>dbj|BAD81380.1| unknown protein [Oryza sativa Japonica Group]
Length=473

 Score = 48.5 bits (114),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 18/38 (47%), Positives = 23/38 (61%), Gaps = 0/38 (0%)
 Frame = -2

Query  116  LDPTQPSFIKFLSRTYATLGFWVGLPPDFCKMYLPPHD  3
            L    PSF+K +  ++   GFW+GLP  FC  YLP HD
Sbjct  123  LPAEHPSFVKHMLHSHVVSGFWLGLPAGFCNKYLPKHD  160



>ref|XP_008676668.1| PREDICTED: uncharacterized protein LOC100216848 isoform X2 [Zea 
mays]
 gb|AFW60985.1| hypothetical protein ZEAMMB73_261802 [Zea mays]
Length=232

 Score = 47.4 bits (111),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 19/38 (50%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = -2

Query  116  LDPTQPSFIKFLSRTYATLGFWVGLPPDFCKMYLPPHD  3
            LD + P FIK +++++ T GFW+GLP  FC+ YLP  D
Sbjct  127  LDSSFPIFIKPMTQSHVTGGFWLGLPIHFCRKYLPKRD  164



>gb|EEC70251.1| hypothetical protein OsI_01044 [Oryza sativa Indica Group]
Length=495

 Score = 48.5 bits (114),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 18/38 (47%), Positives = 23/38 (61%), Gaps = 0/38 (0%)
 Frame = -2

Query  116  LDPTQPSFIKFLSRTYATLGFWVGLPPDFCKMYLPPHD  3
            L    PSF+K +  ++   GFW+GLP  FC  YLP HD
Sbjct  145  LPAEHPSFVKHMLHSHVVSGFWLGLPAGFCNKYLPKHD  182



>ref|NP_001042515.1| Os01g0234100 [Oryza sativa Japonica Group]
 sp|Q0JP99.1|Y1341_ORYSJ RecName: Full=B3 domain-containing protein Os01g0234100 [Oryza 
sativa Japonica Group]
 dbj|BAF04429.1| Os01g0234100 [Oryza sativa Japonica Group]
Length=495

 Score = 48.5 bits (114),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 18/38 (47%), Positives = 23/38 (61%), Gaps = 0/38 (0%)
 Frame = -2

Query  116  LDPTQPSFIKFLSRTYATLGFWVGLPPDFCKMYLPPHD  3
            L    PSF+K +  ++   GFW+GLP  FC  YLP HD
Sbjct  145  LPAEHPSFVKHMLHSHVVSGFWLGLPAGFCNKYLPKHD  182



>ref|XP_010269238.1| PREDICTED: B3 domain-containing protein Os01g0234100-like isoform 
X2 [Nelumbo nucifera]
Length=453

 Score = 48.5 bits (114),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 19/38 (50%), Positives = 25/38 (66%), Gaps = 0/38 (0%)
 Frame = -2

Query  116  LDPTQPSFIKFLSRTYATLGFWVGLPPDFCKMYLPPHD  3
            L+P  PSF+K + R++ T GFW+GLP  FC   LP  D
Sbjct  89   LEPEFPSFVKVMLRSHVTNGFWLGLPAKFCLSNLPKQD  126



>gb|EEE54186.1| hypothetical protein OsJ_01011 [Oryza sativa Japonica Group]
Length=521

 Score = 48.5 bits (114),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 18/38 (47%), Positives = 23/38 (61%), Gaps = 0/38 (0%)
 Frame = -2

Query  116  LDPTQPSFIKFLSRTYATLGFWVGLPPDFCKMYLPPHD  3
            L    PSF+K +  ++   GFW+GLP  FC  YLP HD
Sbjct  145  LPAEHPSFVKHMLHSHVVSGFWLGLPAGFCNKYLPKHD  182



>ref|XP_010487847.1| PREDICTED: B3 domain-containing protein At3g19184-like isoform 
X4 [Camelina sativa]
Length=216

 Score = 47.4 bits (111),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 19/38 (50%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = -2

Query  116  LDPTQPSFIKFLSRTYATLGFWVGLPPDFCKMYLPPHD  3
            LDP  PSF+K + +++ T GFW+GLP  FCK ++P  D
Sbjct  76   LDPDFPSFVKPMLQSHVTGGFWMGLPLRFCKTHMPKRD  113



>ref|XP_010269230.1| PREDICTED: B3 domain-containing protein Os01g0234100-like isoform 
X1 [Nelumbo nucifera]
Length=488

 Score = 48.5 bits (114),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 19/38 (50%), Positives = 25/38 (66%), Gaps = 0/38 (0%)
 Frame = -2

Query  116  LDPTQPSFIKFLSRTYATLGFWVGLPPDFCKMYLPPHD  3
            L+P  PSF+K + R++ T GFW+GLP  FC   LP  D
Sbjct  124  LEPEFPSFVKVMLRSHVTNGFWLGLPAKFCLSNLPKQD  161



>ref|XP_011000257.1| PREDICTED: B3 domain-containing protein Os01g0234100-like isoform 
X2 [Populus euphratica]
Length=467

 Score = 48.5 bits (114),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 20/38 (53%), Positives = 26/38 (68%), Gaps = 0/38 (0%)
 Frame = -2

Query  116  LDPTQPSFIKFLSRTYATLGFWVGLPPDFCKMYLPPHD  3
            L+   PSF K L R+  T+GFW+ LP  FCKM+LP +D
Sbjct  105  LEAAYPSFAKTLVRSNVTVGFWMHLPMRFCKMHLPKND  142



>ref|XP_011006478.1| PREDICTED: B3 domain-containing protein Os01g0234100-like isoform 
X1 [Populus euphratica]
Length=476

 Score = 48.5 bits (114),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 20/38 (53%), Positives = 26/38 (68%), Gaps = 0/38 (0%)
 Frame = -2

Query  116  LDPTQPSFIKFLSRTYATLGFWVGLPPDFCKMYLPPHD  3
            L+   PSF K L R+  T+GFW+ LP  FCKM+LP +D
Sbjct  105  LEAAYPSFAKTLVRSNVTVGFWMHLPMRFCKMHLPKND  142



>ref|XP_011000251.1| PREDICTED: B3 domain-containing protein Os01g0234100-like isoform 
X1 [Populus euphratica]
Length=476

 Score = 48.5 bits (114),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 20/38 (53%), Positives = 26/38 (68%), Gaps = 0/38 (0%)
 Frame = -2

Query  116  LDPTQPSFIKFLSRTYATLGFWVGLPPDFCKMYLPPHD  3
            L+   PSF K L R+  T+GFW+ LP  FCKM+LP +D
Sbjct  105  LEAAYPSFAKTLVRSNVTVGFWMHLPMRFCKMHLPKND  142



>ref|XP_006384419.1| hypothetical protein POPTR_0004s14900g [Populus trichocarpa]
 gb|ERP62216.1| hypothetical protein POPTR_0004s14900g [Populus trichocarpa]
Length=476

 Score = 48.5 bits (114),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 20/38 (53%), Positives = 26/38 (68%), Gaps = 0/38 (0%)
 Frame = -2

Query  116  LDPTQPSFIKFLSRTYATLGFWVGLPPDFCKMYLPPHD  3
            L+   PSF K L R+  T+GFW+ LP  FCKM+LP +D
Sbjct  105  LEAAYPSFAKTLVRSNVTVGFWMHLPMRFCKMHLPKND  142



>ref|XP_002313110.1| hypothetical protein POPTR_0009s10620g [Populus trichocarpa]
 gb|EEE87065.1| hypothetical protein POPTR_0009s10620g [Populus trichocarpa]
Length=476

 Score = 48.5 bits (114),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 20/38 (53%), Positives = 26/38 (68%), Gaps = 0/38 (0%)
 Frame = -2

Query  116  LDPTQPSFIKFLSRTYATLGFWVGLPPDFCKMYLPPHD  3
            L+   PSF K L R+  T+GFW+ LP  FCKM+LP +D
Sbjct  105  LEAAYPSFAKTLVRSNVTVGFWMHLPMRFCKMHLPKND  142



>ref|XP_011006479.1| PREDICTED: B3 domain-containing protein Os01g0234100-like isoform 
X2 [Populus euphratica]
Length=477

 Score = 48.5 bits (114),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 20/38 (53%), Positives = 26/38 (68%), Gaps = 0/38 (0%)
 Frame = -2

Query  116  LDPTQPSFIKFLSRTYATLGFWVGLPPDFCKMYLPPHD  3
            L+   PSF K L R+  T+GFW+ LP  FCKM+LP +D
Sbjct  106  LEAAYPSFAKTLVRSNVTVGFWMHLPMRFCKMHLPKND  143



>gb|ADX60144.1| ABIVP1 transcription factor [Zea mays]
Length=239

 Score = 47.4 bits (111),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 18/38 (47%), Positives = 24/38 (63%), Gaps = 0/38 (0%)
 Frame = -2

Query  116  LDPTQPSFIKFLSRTYATLGFWVGLPPDFCKMYLPPHD  3
            LDP  PSF+K +  ++   GFW+GLP  FC  Y+P  D
Sbjct  132  LDPEIPSFVKAMLHSHVVRGFWLGLPSHFCDTYMPKQD  169



>tpg|DAA43744.1| TPA: hypothetical protein ZEAMMB73_433086 [Zea mays]
Length=230

 Score = 47.4 bits (111),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 18/38 (47%), Positives = 24/38 (63%), Gaps = 0/38 (0%)
 Frame = -2

Query  116  LDPTQPSFIKFLSRTYATLGFWVGLPPDFCKMYLPPHD  3
            LDP  PSF+K +  ++   GFW+GLP  FC  Y+P  D
Sbjct  132  LDPEIPSFVKAMLHSHVVRGFWLGLPSHFCDTYMPKQD  169



>ref|XP_008456113.1| PREDICTED: B3 domain-containing protein Os01g0234100-like isoform 
X2 [Cucumis melo]
Length=465

 Score = 48.1 bits (113),  Expect = 6e-05, Method: Composition-based stats.
 Identities = 18/38 (47%), Positives = 25/38 (66%), Gaps = 0/38 (0%)
 Frame = -2

Query  116  LDPTQPSFIKFLSRTYATLGFWVGLPPDFCKMYLPPHD  3
            L P+ PS IK +  ++ T GFW+GLP  FC ++LP  D
Sbjct  73   LSPSHPSLIKVMLPSHVTGGFWLGLPKGFCDIHLPKQD  110



>ref|XP_010070516.1| PREDICTED: B3 domain-containing protein Os01g0234100-like [Eucalyptus 
grandis]
 gb|KCW59322.1| hypothetical protein EUGRSUZ_H02009 [Eucalyptus grandis]
Length=498

 Score = 48.1 bits (113),  Expect = 6e-05, Method: Composition-based stats.
 Identities = 20/38 (53%), Positives = 26/38 (68%), Gaps = 0/38 (0%)
 Frame = -2

Query  116  LDPTQPSFIKFLSRTYATLGFWVGLPPDFCKMYLPPHD  3
            L+PT PSFIK L R++    FW+GLP  FC+ +LP  D
Sbjct  124  LEPTYPSFIKALVRSHVGSCFWMGLPGVFCRAHLPNKD  161



>ref|XP_010070338.1| PREDICTED: B3 domain-containing protein Os01g0234100-like [Eucalyptus 
grandis]
 gb|KCW59024.1| hypothetical protein EUGRSUZ_H01651 [Eucalyptus grandis]
Length=498

 Score = 48.1 bits (113),  Expect = 6e-05, Method: Composition-based stats.
 Identities = 20/38 (53%), Positives = 26/38 (68%), Gaps = 0/38 (0%)
 Frame = -2

Query  116  LDPTQPSFIKFLSRTYATLGFWVGLPPDFCKMYLPPHD  3
            L+PT PSFIK L R++    FW+GLP  FC+ +LP  D
Sbjct  124  LEPTYPSFIKALVRSHVGSCFWMGLPGVFCRAHLPNKD  161



>ref|XP_002441275.1| hypothetical protein SORBIDRAFT_09g023630 [Sorghum bicolor]
 gb|EES19705.1| hypothetical protein SORBIDRAFT_09g023630 [Sorghum bicolor]
Length=280

 Score = 47.8 bits (112),  Expect = 6e-05, Method: Composition-based stats.
 Identities = 18/35 (51%), Positives = 24/35 (69%), Gaps = 0/35 (0%)
 Frame = -2

Query  116  LDPTQPSFIKFLSRTYATLGFWVGLPPDFCKMYLP  12
            LDP  PSF+K + R++ +  FW+GLP  FCK  LP
Sbjct  137  LDPNNPSFVKTMVRSHVSSCFWLGLPTSFCKDNLP  171



>ref|XP_008456112.1| PREDICTED: B3 domain-containing protein Os01g0234100-like isoform 
X1 [Cucumis melo]
Length=493

 Score = 48.1 bits (113),  Expect = 6e-05, Method: Composition-based stats.
 Identities = 18/38 (47%), Positives = 25/38 (66%), Gaps = 0/38 (0%)
 Frame = -2

Query  116  LDPTQPSFIKFLSRTYATLGFWVGLPPDFCKMYLPPHD  3
            L P+ PS IK +  ++ T GFW+GLP  FC ++LP  D
Sbjct  101  LSPSHPSLIKVMLPSHVTGGFWLGLPKGFCDIHLPKQD  138



>ref|XP_008662018.1| PREDICTED: DNA binding protein isoform X1 [Zea mays]
Length=266

 Score = 47.4 bits (111),  Expect = 6e-05, Method: Composition-based stats.
 Identities = 19/38 (50%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = -2

Query  116  LDPTQPSFIKFLSRTYATLGFWVGLPPDFCKMYLPPHD  3
            LD + P FIK +++++ T GFW+GLP  FC+ YLP  D
Sbjct  127  LDSSFPVFIKPMTQSHVTGGFWLGLPNHFCRKYLPKRD  164



>ref|XP_006346419.1| PREDICTED: B3 domain-containing protein At3g19184-like [Solanum 
tuberosum]
Length=224

 Score = 47.0 bits (110),  Expect = 6e-05, Method: Composition-based stats.
 Identities = 19/38 (50%), Positives = 26/38 (68%), Gaps = 0/38 (0%)
 Frame = -2

Query  116  LDPTQPSFIKFLSRTYATLGFWVGLPPDFCKMYLPPHD  3
             D   PSF+K + +++ T GFW+GLP  FCK +LP HD
Sbjct  122  FDADFPSFVKPMLQSHVTGGFWLGLPVHFCKTHLPKHD  159



>ref|XP_001753039.1| predicted protein [Physcomitrella patens]
 gb|EDQ82080.1| predicted protein, partial [Physcomitrella patens]
Length=217

 Score = 46.6 bits (109),  Expect = 7e-05, Method: Composition-based stats.
 Identities = 17/37 (46%), Positives = 24/37 (65%), Gaps = 0/37 (0%)
 Frame = -2

Query  113  DPTQPSFIKFLSRTYATLGFWVGLPPDFCKMYLPPHD  3
            D   P+F+K +  ++   GFW+GLP +FCK YLP  D
Sbjct  122  DIKNPAFVKPMLHSHTASGFWLGLPSNFCKQYLPHRD  158



>ref|NP_001141031.1| hypothetical protein [Zea mays]
 gb|ACF85222.1| unknown [Zea mays]
 gb|AFW78411.1| hypothetical protein ZEAMMB73_316843 [Zea mays]
Length=278

 Score = 47.4 bits (111),  Expect = 7e-05, Method: Composition-based stats.
 Identities = 18/35 (51%), Positives = 24/35 (69%), Gaps = 0/35 (0%)
 Frame = -2

Query  116  LDPTQPSFIKFLSRTYATLGFWVGLPPDFCKMYLP  12
            LDP  PSF+K + R++ +  FW+GLP  FCK  LP
Sbjct  135  LDPNNPSFVKTMVRSHVSSCFWLGLPISFCKNNLP  169



>gb|EYU42667.1| hypothetical protein MIMGU_mgv1a006218mg [Erythranthe guttata]
Length=452

 Score = 47.8 bits (112),  Expect = 7e-05, Method: Composition-based stats.
 Identities = 19/37 (51%), Positives = 26/37 (70%), Gaps = 1/37 (3%)
 Frame = -2

Query  110  PTQ-PSFIKFLSRTYATLGFWVGLPPDFCKMYLPPHD  3
            P Q PSF+K +SR++ T GFW+G+P  FC  +LP  D
Sbjct  90   PKQFPSFVKLMSRSHVTQGFWLGVPRQFCDDHLPMKD  126



>ref|XP_009778964.1| PREDICTED: B3 domain-containing protein Os01g0234100-like isoform 
X2 [Nicotiana sylvestris]
Length=498

 Score = 47.8 bits (112),  Expect = 8e-05, Method: Composition-based stats.
 Identities = 19/37 (51%), Positives = 25/37 (68%), Gaps = 1/37 (3%)
 Frame = -2

Query  110  PTQ-PSFIKFLSRTYATLGFWVGLPPDFCKMYLPPHD  3
            P+Q PSF KF+  ++ T GFW+G P  FC  +LP HD
Sbjct  83   PSQFPSFAKFMLPSHVTGGFWLGFPKKFCDRHLPKHD  119



>emb|CBI21437.3| unnamed protein product [Vitis vinifera]
Length=508

 Score = 47.8 bits (112),  Expect = 8e-05, Method: Composition-based stats.
 Identities = 19/38 (50%), Positives = 25/38 (66%), Gaps = 0/38 (0%)
 Frame = -2

Query  116  LDPTQPSFIKFLSRTYATLGFWVGLPPDFCKMYLPPHD  3
            L P  PSF+K L R++ +  FW+GLP  FC M+LP  D
Sbjct  133  LGPEFPSFVKVLVRSHVSSCFWMGLPGPFCDMHLPKKD  170



>emb|CAN61149.1| hypothetical protein VITISV_029172 [Vitis vinifera]
Length=554

 Score = 47.8 bits (112),  Expect = 8e-05, Method: Composition-based stats.
 Identities = 19/38 (50%), Positives = 25/38 (66%), Gaps = 0/38 (0%)
 Frame = -2

Query  116  LDPTQPSFIKFLSRTYATLGFWVGLPPDFCKMYLPPHD  3
            L P  PSF+K L R++ +  FW+GLP  FC M+LP  D
Sbjct  182  LGPEFPSFVKVLVRSHVSSCFWMGLPGPFCDMHLPKKD  219



>ref|XP_009778966.1| PREDICTED: B3 domain-containing protein Os01g0234100-like [Nicotiana 
sylvestris]
Length=448

 Score = 47.8 bits (112),  Expect = 9e-05, Method: Composition-based stats.
 Identities = 17/37 (46%), Positives = 25/37 (68%), Gaps = 1/37 (3%)
 Frame = -2

Query  110  PTQ-PSFIKFLSRTYATLGFWVGLPPDFCKMYLPPHD  3
            P+Q PSF+K++  ++ + GFW+  P  FC  YLP HD
Sbjct  83   PSQFPSFVKYMLHSHVSRGFWLSFPRKFCNSYLPKHD  119



>ref|XP_010519303.1| PREDICTED: B3 domain-containing protein At3g19184 isoform X2 
[Tarenaya hassleriana]
Length=260

 Score = 47.0 bits (110),  Expect = 9e-05, Method: Composition-based stats.
 Identities = 19/38 (50%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = -2

Query  116  LDPTQPSFIKFLSRTYATLGFWVGLPPDFCKMYLPPHD  3
            L+P  PSF+K + +++ T GFW+GLP  FCK +LP  D
Sbjct  122  LEPEFPSFVKPMLQSHVTGGFWLGLPLRFCKAHLPKCD  159



>ref|XP_010519302.1| PREDICTED: B3 domain-containing protein At3g19184 isoform X1 
[Tarenaya hassleriana]
Length=313

 Score = 47.0 bits (110),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 19/38 (50%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = -2

Query  116  LDPTQPSFIKFLSRTYATLGFWVGLPPDFCKMYLPPHD  3
            L+P  PSF+K + +++ T GFW+GLP  FCK +LP  D
Sbjct  175  LEPEFPSFVKPMLQSHVTGGFWLGLPLRFCKAHLPKCD  212



>emb|CDP07203.1| unnamed protein product [Coffea canephora]
Length=274

 Score = 47.0 bits (110),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 20/38 (53%), Positives = 26/38 (68%), Gaps = 0/38 (0%)
 Frame = -2

Query  116  LDPTQPSFIKFLSRTYATLGFWVGLPPDFCKMYLPPHD  3
            LD   PSF+K + +++ T GFW+GLP  FCK YLP  D
Sbjct  169  LDSKIPSFVKPMLQSHVTGGFWLGLPVQFCKTYLPKRD  206



>ref|XP_003638142.1| B3 domain-containing protein [Medicago truncatula]
 ref|XP_003638738.1| B3 domain-containing protein [Medicago truncatula]
Length=456

 Score = 47.4 bits (111),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 19/38 (50%), Positives = 25/38 (66%), Gaps = 0/38 (0%)
 Frame = -2

Query  116  LDPTQPSFIKFLSRTYATLGFWVGLPPDFCKMYLPPHD  3
            L+P  PSF+K L R++    FW+GLP  FCK +LP  D
Sbjct  95   LEPEFPSFVKSLVRSHVASCFWMGLPVSFCKRHLPDKD  132



>gb|EMT09213.1| B3 domain-containing protein [Aegilops tauschii]
Length=232

 Score = 46.2 bits (108),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 17/33 (52%), Positives = 24/33 (73%), Gaps = 0/33 (0%)
 Frame = -2

Query  101  PSFIKFLSRTYATLGFWVGLPPDFCKMYLPPHD  3
            PSF+K + +++ T GFW+GLP  FC +YLP  D
Sbjct  135  PSFVKPMKQSHVTGGFWLGLPSQFCGLYLPGSD  167



>ref|XP_010107957.1| B3 domain-containing protein [Morus notabilis]
 gb|EXC17357.1| B3 domain-containing protein [Morus notabilis]
Length=207

 Score = 45.8 bits (107),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 20/38 (53%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = -2

Query  116  LDPTQPSFIKFLSRTYATLGFWVGLPPDFCKMYLPPHD  3
            LD   P+FIK + +++ T GFW+GLP DFCK +LP  D
Sbjct  122  LDSDVPNFIKPMLQSHVTGGFWLGLPSDFCKRHLPHED  159



>gb|KGN57545.1| hypothetical protein Csa_3G207940 [Cucumis sativus]
Length=482

 Score = 47.0 bits (110),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 18/38 (47%), Positives = 24/38 (63%), Gaps = 0/38 (0%)
 Frame = -2

Query  116  LDPTQPSFIKFLSRTYATLGFWVGLPPDFCKMYLPPHD  3
            L P  PS IK +  ++ T GFW+GLP  FC ++LP  D
Sbjct  90   LSPRNPSLIKVMLPSHVTGGFWLGLPKGFCDIHLPKQD  127



>ref|XP_011092583.1| PREDICTED: B3 domain-containing protein Os01g0234100-like isoform 
X2 [Sesamum indicum]
Length=379

 Score = 46.6 bits (109),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 18/38 (47%), Positives = 25/38 (66%), Gaps = 0/38 (0%)
 Frame = -2

Query  116  LDPTQPSFIKFLSRTYATLGFWVGLPPDFCKMYLPPHD  3
            L P  PSF+K + R++ + GFW+GLP  FC  +LP  D
Sbjct  11   LSPHFPSFLKLMLRSHVSGGFWLGLPKKFCDGHLPKGD  48



>gb|AFW60989.1| hypothetical protein ZEAMMB73_261802 [Zea mays]
Length=144

 Score = 44.7 bits (104),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 19/38 (50%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = -2

Query  116  LDPTQPSFIKFLSRTYATLGFWVGLPPDFCKMYLPPHD  3
            LD + P FIK +++++ T GFW+GLP  FC+ YLP  D
Sbjct  39   LDSSFPIFIKPMTQSHVTGGFWLGLPIHFCRKYLPKRD  76



>ref|XP_004152734.1| PREDICTED: B3 domain-containing protein At5g42700-like [Cucumis 
sativus]
 ref|XP_004160008.1| PREDICTED: B3 domain-containing protein At5g42700-like [Cucumis 
sativus]
Length=228

 Score = 45.8 bits (107),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 18/38 (47%), Positives = 26/38 (68%), Gaps = 0/38 (0%)
 Frame = -2

Query  116  LDPTQPSFIKFLSRTYATLGFWVGLPPDFCKMYLPPHD  3
            L+P  PS IK + R++ +  FW+GLP  FCK +LP +D
Sbjct  119  LEPNYPSCIKSMVRSHVSGCFWLGLPSHFCKTHLPKND  156



>gb|KDP42311.1| hypothetical protein JCGZ_01635 [Jatropha curcas]
Length=466

 Score = 47.0 bits (110),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 19/38 (50%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = -2

Query  116  LDPTQPSFIKFLSRTYATLGFWVGLPPDFCKMYLPPHD  3
            L+ + PSF K L R+  T+GFW+ LP  FCK++LP +D
Sbjct  99   LEASFPSFAKALVRSNVTVGFWMHLPMRFCKLHLPKND  136



>ref|XP_011092580.1| PREDICTED: B3 domain-containing protein Os01g0234100-like isoform 
X1 [Sesamum indicum]
 ref|XP_011092581.1| PREDICTED: B3 domain-containing protein Os01g0234100-like isoform 
X1 [Sesamum indicum]
Length=459

 Score = 46.6 bits (109),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 18/38 (47%), Positives = 25/38 (66%), Gaps = 0/38 (0%)
 Frame = -2

Query  116  LDPTQPSFIKFLSRTYATLGFWVGLPPDFCKMYLPPHD  3
            L P  PSF+K + R++ + GFW+GLP  FC  +LP  D
Sbjct  91   LSPHFPSFLKLMLRSHVSGGFWLGLPKKFCDGHLPKGD  128



>emb|CDO97163.1| unnamed protein product [Coffea canephora]
Length=742

 Score = 47.0 bits (110),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 19/38 (50%), Positives = 25/38 (66%), Gaps = 0/38 (0%)
 Frame = -2

Query  116  LDPTQPSFIKFLSRTYATLGFWVGLPPDFCKMYLPPHD  3
            LD   PSF+K + R+    GFW+ LP  FCK++LP HD
Sbjct  28   LDAKFPSFVKPMIRSNVKKGFWLSLPRLFCKLHLPDHD  65



>gb|KGN62530.1| hypothetical protein Csa_2G359985 [Cucumis sativus]
Length=209

 Score = 45.4 bits (106),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 18/38 (47%), Positives = 26/38 (68%), Gaps = 0/38 (0%)
 Frame = -2

Query  116  LDPTQPSFIKFLSRTYATLGFWVGLPPDFCKMYLPPHD  3
            L+P  PS IK + R++ +  FW+GLP  FCK +LP +D
Sbjct  110  LEPNYPSCIKSMVRSHVSGCFWLGLPSHFCKTHLPKND  147



>gb|KEH35747.1| B3 domain transcription factor [Medicago truncatula]
Length=223

 Score = 45.4 bits (106),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 17/38 (45%), Positives = 25/38 (66%), Gaps = 0/38 (0%)
 Frame = -2

Query  116  LDPTQPSFIKFLSRTYATLGFWVGLPPDFCKMYLPPHD  3
            LD   P+F+K + +++ T GFW+GLP  FC+  LP  D
Sbjct  119  LDSDHPTFVKSMLQSHVTGGFWLGLPNHFCRKNLPKRD  156



>ref|XP_010227844.1| PREDICTED: B3 domain-containing protein Os06g0194400-like [Brachypodium 
distachyon]
 ref|XP_010227845.1| PREDICTED: B3 domain-containing protein Os06g0194400-like [Brachypodium 
distachyon]
Length=227

 Score = 45.8 bits (107),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 16/33 (48%), Positives = 24/33 (73%), Gaps = 0/33 (0%)
 Frame = -2

Query  101  PSFIKFLSRTYATLGFWVGLPPDFCKMYLPPHD  3
            P F+K +++++ T GFW+GLP  FC+ YLP  D
Sbjct  130  PIFVKPMTQSHVTGGFWLGLPTQFCRKYLPKRD  162



>ref|XP_009375697.1| PREDICTED: B3 domain-containing protein Os01g0234100-like [Pyrus 
x bretschneideri]
Length=501

 Score = 46.6 bits (109),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 19/38 (50%), Positives = 25/38 (66%), Gaps = 0/38 (0%)
 Frame = -2

Query  116  LDPTQPSFIKFLSRTYATLGFWVGLPPDFCKMYLPPHD  3
            L+P  PSF+K L R++    FW+GLP  FCK +LP  D
Sbjct  120  LEPQFPSFVKSLVRSHVASCFWMGLPSLFCKSHLPDKD  157



>ref|XP_008361398.1| PREDICTED: B3 domain-containing protein Os01g0234100-like [Malus 
domestica]
Length=501

 Score = 46.6 bits (109),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 19/38 (50%), Positives = 25/38 (66%), Gaps = 0/38 (0%)
 Frame = -2

Query  116  LDPTQPSFIKFLSRTYATLGFWVGLPPDFCKMYLPPHD  3
            L+P  PSF+K L R++    FW+GLP  FCK +LP  D
Sbjct  120  LEPQFPSFVKSLVRSHVASCFWMGLPSLFCKSHLPDKD  157



>ref|XP_009403572.1| PREDICTED: B3 domain-containing protein Os06g0194400-like isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=229

 Score = 45.8 bits (107),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 18/35 (51%), Positives = 25/35 (71%), Gaps = 0/35 (0%)
 Frame = -2

Query  116  LDPTQPSFIKFLSRTYATLGFWVGLPPDFCKMYLP  12
            LDP  PSF+K + +++ T GFW+GLP  FC  +LP
Sbjct  126  LDPKFPSFVKSMLQSHTTGGFWLGLPIIFCNKHLP  160



>ref|XP_003603025.1| B3 domain-containing protein [Medicago truncatula]
 gb|AES73276.1| B3 domain transcription factor [Medicago truncatula]
Length=231

 Score = 45.4 bits (106),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 17/38 (45%), Positives = 25/38 (66%), Gaps = 0/38 (0%)
 Frame = -2

Query  116  LDPTQPSFIKFLSRTYATLGFWVGLPPDFCKMYLPPHD  3
            LD   P+F+K + +++ T GFW+GLP  FC+  LP  D
Sbjct  127  LDSDHPTFVKSMLQSHVTGGFWLGLPNHFCRKNLPKRD  164



>ref|XP_011088273.1| PREDICTED: B3 domain-containing protein At3g19184 isoform X1 
[Sesamum indicum]
Length=224

 Score = 45.4 bits (106),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 19/38 (50%), Positives = 26/38 (68%), Gaps = 0/38 (0%)
 Frame = -2

Query  116  LDPTQPSFIKFLSRTYATLGFWVGLPPDFCKMYLPPHD  3
            LD   PSF+K + +++ T GFW+GLP  FCK +LP  D
Sbjct  119  LDQDIPSFVKPMLQSHVTGGFWLGLPVQFCKTHLPSRD  156



>ref|XP_002445218.1| hypothetical protein SORBIDRAFT_07g006170 [Sorghum bicolor]
 gb|EES14713.1| hypothetical protein SORBIDRAFT_07g006170 [Sorghum bicolor]
Length=230

 Score = 45.4 bits (106),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 18/38 (47%), Positives = 26/38 (68%), Gaps = 0/38 (0%)
 Frame = -2

Query  116  LDPTQPSFIKFLSRTYATLGFWVGLPPDFCKMYLPPHD  3
            LD   P FIK +++++ T GFW+GLP  FC+ +LP  D
Sbjct  125  LDSRFPLFIKPMTQSHVTGGFWLGLPTGFCRKHLPKRD  162



>gb|AFW60986.1| hypothetical protein ZEAMMB73_261802 [Zea mays]
Length=158

 Score = 44.3 bits (103),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 19/38 (50%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = -2

Query  116  LDPTQPSFIKFLSRTYATLGFWVGLPPDFCKMYLPPHD  3
            LD + P FIK +++++ T GFW+GLP  FC+ YLP  D
Sbjct  66   LDSSFPIFIKPMTQSHVTGGFWLGLPIHFCRKYLPKRD  103



>ref|XP_009403573.1| PREDICTED: B3 domain-containing protein Os06g0194400-like isoform 
X2 [Musa acuminata subsp. malaccensis]
Length=226

 Score = 45.4 bits (106),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 18/35 (51%), Positives = 25/35 (71%), Gaps = 0/35 (0%)
 Frame = -2

Query  116  LDPTQPSFIKFLSRTYATLGFWVGLPPDFCKMYLP  12
            LDP  PSF+K + +++ T GFW+GLP  FC  +LP
Sbjct  123  LDPKFPSFVKSMLQSHTTGGFWLGLPIIFCNKHLP  157



>ref|XP_009612762.1| PREDICTED: B3 domain-containing protein Os01g0234100-like [Nicotiana 
tomentosiformis]
Length=491

 Score = 46.6 bits (109),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 18/37 (49%), Positives = 25/37 (68%), Gaps = 1/37 (3%)
 Frame = -2

Query  110  PTQ-PSFIKFLSRTYATLGFWVGLPPDFCKMYLPPHD  3
            P+Q PSF+K++  T+ T GFW+G P  FC  +LP  D
Sbjct  83   PSQFPSFVKYMLPTHVTGGFWLGFPKKFCDYHLPKRD  119



>ref|XP_010922799.1| PREDICTED: B3 domain-containing protein Os05g0481400 [Elaeis 
guineensis]
Length=279

 Score = 45.8 bits (107),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 17/38 (45%), Positives = 25/38 (66%), Gaps = 0/38 (0%)
 Frame = -2

Query  116  LDPTQPSFIKFLSRTYATLGFWVGLPPDFCKMYLPPHD  3
            L+   PSF+K + R++ +  FW+GLP  FCK  LP H+
Sbjct  126  LNSNHPSFVKSMLRSHVSSCFWLGLPSKFCKENLPSHE  163



>ref|XP_006856095.1| hypothetical protein AMTR_s00059p00130960 [Amborella trichopoda]
 gb|ERN17562.1| hypothetical protein AMTR_s00059p00130960 [Amborella trichopoda]
Length=243

 Score = 45.4 bits (106),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 18/38 (47%), Positives = 26/38 (68%), Gaps = 0/38 (0%)
 Frame = -2

Query  116  LDPTQPSFIKFLSRTYATLGFWVGLPPDFCKMYLPPHD  3
            L+P  PSF+K +  ++  +GFW+GLP  FCK  LP +D
Sbjct  121  LEPIYPSFVKPMLHSHVKVGFWLGLPVGFCKSNLPKND  158



>ref|XP_002518782.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF43707.1| conserved hypothetical protein [Ricinus communis]
Length=470

 Score = 46.6 bits (109),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 19/38 (50%), Positives = 26/38 (68%), Gaps = 0/38 (0%)
 Frame = -2

Query  116  LDPTQPSFIKFLSRTYATLGFWVGLPPDFCKMYLPPHD  3
            LD + PSF K L R+   +GFW+ LP  FCK++LP +D
Sbjct  107  LDSSFPSFAKCLVRSNVKVGFWMHLPMPFCKLHLPKND  144



>gb|EYU39334.1| hypothetical protein MIMGU_mgv1a005357mg [Erythranthe guttata]
Length=487

 Score = 46.6 bits (109),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 18/34 (53%), Positives = 24/34 (71%), Gaps = 0/34 (0%)
 Frame = -2

Query  104  QPSFIKFLSRTYATLGFWVGLPPDFCKMYLPPHD  3
             PSF+KFL R++    FW+GLP  FCK++LP  D
Sbjct  133  HPSFLKFLVRSHVGSCFWMGLPVPFCKLHLPFKD  166



>gb|ACN30651.1| unknown [Zea mays]
 gb|AFW60987.1| hypothetical protein ZEAMMB73_261802 [Zea mays]
 gb|AFW60988.1| hypothetical protein ZEAMMB73_261802 [Zea mays]
Length=171

 Score = 44.3 bits (103),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 19/38 (50%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = -2

Query  116  LDPTQPSFIKFLSRTYATLGFWVGLPPDFCKMYLPPHD  3
            LD + P FIK +++++ T GFW+GLP  FC+ YLP  D
Sbjct  66   LDSSFPIFIKPMTQSHVTGGFWLGLPIHFCRKYLPKRD  103



>ref|XP_009778972.1| PREDICTED: B3 domain-containing protein At5g42700-like isoform 
X5 [Nicotiana sylvestris]
Length=246

 Score = 45.4 bits (106),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 18/38 (47%), Positives = 25/38 (66%), Gaps = 0/38 (0%)
 Frame = -2

Query  116  LDPTQPSFIKFLSRTYATLGFWVGLPPDFCKMYLPPHD  3
            L    PSF+K + R+  T GFW+ LP  FC+++LP HD
Sbjct  57   LSTKYPSFMKPMIRSNVTAGFWLSLPRFFCQLHLPRHD  94



>ref|XP_009778971.1| PREDICTED: B3 domain-containing protein At5g42700-like isoform 
X4 [Nicotiana sylvestris]
Length=248

 Score = 45.4 bits (106),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 18/38 (47%), Positives = 25/38 (66%), Gaps = 0/38 (0%)
 Frame = -2

Query  116  LDPTQPSFIKFLSRTYATLGFWVGLPPDFCKMYLPPHD  3
            L    PSF+K + R+  T GFW+ LP  FC+++LP HD
Sbjct  57   LSTKYPSFMKPMIRSNVTAGFWLSLPRFFCQLHLPRHD  94



>gb|EPS67764.1| hypothetical protein M569_07011, partial [Genlisea aurea]
Length=167

 Score = 44.3 bits (103),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 18/37 (49%), Positives = 25/37 (68%), Gaps = 0/37 (0%)
 Frame = -2

Query  113  DPTQPSFIKFLSRTYATLGFWVGLPPDFCKMYLPPHD  3
            D   PSF+K + +++ T GFW+GLP  FCK +LP  D
Sbjct  76   DTNYPSFVKPMLQSHVTGGFWLGLPLGFCKRHLPRRD  112



>ref|XP_009612763.1| PREDICTED: B3 domain-containing protein Os01g0234100-like [Nicotiana 
tomentosiformis]
Length=443

 Score = 46.2 bits (108),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 15/33 (45%), Positives = 22/33 (67%), Gaps = 0/33 (0%)
 Frame = -2

Query  101  PSFIKFLSRTYATLGFWVGLPPDFCKMYLPPHD  3
            PSF+K++  ++ + GFW+  P  FC  YLP HD
Sbjct  85   PSFVKYMLHSHVSRGFWLSFPRKFCDSYLPKHD  117



>ref|XP_011005880.1| PREDICTED: B3 domain-containing protein Os01g0234100-like isoform 
X4 [Populus euphratica]
 ref|XP_011005881.1| PREDICTED: B3 domain-containing protein Os01g0234100-like isoform 
X4 [Populus euphratica]
Length=386

 Score = 45.8 bits (107),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 18/38 (47%), Positives = 25/38 (66%), Gaps = 0/38 (0%)
 Frame = -2

Query  116  LDPTQPSFIKFLSRTYATLGFWVGLPPDFCKMYLPPHD  3
            L+P  PSF+K L R++    FW+GLP  FC+ +LP  D
Sbjct  11   LEPAFPSFVKSLVRSHVASCFWMGLPGTFCRAHLPSVD  48



>ref|XP_010481963.1| PREDICTED: B3 domain-containing protein At5g42700-like isoform 
X3 [Camelina sativa]
Length=211

 Score = 45.1 bits (105),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 16/33 (48%), Positives = 24/33 (73%), Gaps = 0/33 (0%)
 Frame = -2

Query  101  PSFIKFLSRTYATLGFWVGLPPDFCKMYLPPHD  3
            PSF+K + +++ + GFW+GLP  FC+ YL  HD
Sbjct  110  PSFVKSMLQSHVSGGFWLGLPVQFCRSYLGKHD  142



>ref|XP_010481962.1| PREDICTED: B3 domain-containing protein At5g42700-like isoform 
X2 [Camelina sativa]
Length=213

 Score = 45.1 bits (105),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 16/33 (48%), Positives = 24/33 (73%), Gaps = 0/33 (0%)
 Frame = -2

Query  101  PSFIKFLSRTYATLGFWVGLPPDFCKMYLPPHD  3
            PSF+K + +++ + GFW+GLP  FC+ YL  HD
Sbjct  112  PSFVKSMLQSHVSGGFWLGLPVQFCRSYLGKHD  144



>ref|XP_010922411.1| PREDICTED: B3 domain-containing protein Os06g0194400 isoform 
X1 [Elaeis guineensis]
 ref|XP_010922412.1| PREDICTED: B3 domain-containing protein Os06g0194400 isoform 
X1 [Elaeis guineensis]
Length=226

 Score = 45.1 bits (105),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 18/38 (47%), Positives = 26/38 (68%), Gaps = 0/38 (0%)
 Frame = -2

Query  116  LDPTQPSFIKFLSRTYATLGFWVGLPPDFCKMYLPPHD  3
            LDP  P+F+K + +++ T GFW+GLP  FC  +LP  D
Sbjct  123  LDPKFPTFVKPMLQSHVTGGFWLGLPRHFCTKHLPRKD  160



>gb|KDO42472.1| hypothetical protein CISIN_1g036915mg, partial [Citrus sinensis]
Length=307

 Score = 45.4 bits (106),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 19/38 (50%), Positives = 26/38 (68%), Gaps = 0/38 (0%)
 Frame = -2

Query  116  LDPTQPSFIKFLSRTYATLGFWVGLPPDFCKMYLPPHD  3
            LD   PSF+K + +++ T GFW+GLP  FCK +LP  D
Sbjct  164  LDSQYPSFVKPMLQSHVTGGFWLGLPVHFCKEHLPHSD  201



>emb|CDM87216.1| unnamed protein product [Triticum aestivum]
Length=232

 Score = 45.1 bits (105),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 17/33 (52%), Positives = 24/33 (73%), Gaps = 0/33 (0%)
 Frame = -2

Query  101  PSFIKFLSRTYATLGFWVGLPPDFCKMYLPPHD  3
            PSF+K + +++ T GFW+GLP  FC +YLP  D
Sbjct  134  PSFVKPMKQSHVTGGFWLGLPSHFCGLYLPGSD  166



>ref|XP_009778970.1| PREDICTED: B3 domain-containing protein At3g19184-like isoform 
X3 [Nicotiana sylvestris]
Length=257

 Score = 45.4 bits (106),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 18/38 (47%), Positives = 25/38 (66%), Gaps = 0/38 (0%)
 Frame = -2

Query  116  LDPTQPSFIKFLSRTYATLGFWVGLPPDFCKMYLPPHD  3
            L    PSF+K + R+  T GFW+ LP  FC+++LP HD
Sbjct  28   LSTKYPSFMKPMIRSNVTAGFWLSLPRFFCQLHLPRHD  65



>gb|KFK39239.1| hypothetical protein AALP_AA3G218400 [Arabis alpina]
Length=305

 Score = 45.4 bits (106),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 18/38 (47%), Positives = 26/38 (68%), Gaps = 0/38 (0%)
 Frame = -2

Query  116  LDPTQPSFIKFLSRTYATLGFWVGLPPDFCKMYLPPHD  3
            L+   PSF+K + +++ T GFW+GLP  FCK +LP  D
Sbjct  114  LEQEFPSFVKPMLQSHVTGGFWLGLPRQFCKSHLPKRD  151



>ref|XP_010094372.1| B3 domain-containing protein [Morus notabilis]
 gb|EXB55909.1| B3 domain-containing protein [Morus notabilis]
Length=494

 Score = 46.2 bits (108),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 19/38 (50%), Positives = 25/38 (66%), Gaps = 0/38 (0%)
 Frame = -2

Query  116  LDPTQPSFIKFLSRTYATLGFWVGLPPDFCKMYLPPHD  3
            L+P  PSF+K L R++    FW+GLP  FCK +LP  D
Sbjct  120  LEPEFPSFVKSLVRSHVASCFWMGLPGLFCKSHLPDKD  157



>ref|XP_011005879.1| PREDICTED: B3 domain-containing protein Os01g0234100-like isoform 
X3 [Populus euphratica]
Length=453

 Score = 45.8 bits (107),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 18/38 (47%), Positives = 25/38 (66%), Gaps = 0/38 (0%)
 Frame = -2

Query  116  LDPTQPSFIKFLSRTYATLGFWVGLPPDFCKMYLPPHD  3
            L+P  PSF+K L R++    FW+GLP  FC+ +LP  D
Sbjct  78   LEPAFPSFVKSLVRSHVASCFWMGLPGTFCRAHLPSVD  115



>ref|XP_002307261.1| hypothetical protein POPTR_0005s18090g [Populus trichocarpa]
 gb|EEE94257.1| hypothetical protein POPTR_0005s18090g [Populus trichocarpa]
Length=456

 Score = 45.8 bits (107),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 18/38 (47%), Positives = 25/38 (66%), Gaps = 0/38 (0%)
 Frame = -2

Query  116  LDPTQPSFIKFLSRTYATLGFWVGLPPDFCKMYLPPHD  3
            L+P  PSF+K L R++    FW+GLP  FC+ +LP  D
Sbjct  98   LEPAFPSFVKSLVRSHVASCFWMGLPGTFCRAHLPSVD  135



>ref|XP_009778967.1| PREDICTED: B3 domain-containing protein At5g42700-like isoform 
X1 [Nicotiana sylvestris]
 ref|XP_009778968.1| PREDICTED: B3 domain-containing protein At5g42700-like isoform 
X1 [Nicotiana sylvestris]
Length=286

 Score = 45.4 bits (106),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 18/38 (47%), Positives = 25/38 (66%), Gaps = 0/38 (0%)
 Frame = -2

Query  116  LDPTQPSFIKFLSRTYATLGFWVGLPPDFCKMYLPPHD  3
            L    PSF+K + R+  T GFW+ LP  FC+++LP HD
Sbjct  57   LSTKYPSFMKPMIRSNVTAGFWLSLPRFFCQLHLPRHD  94



>ref|XP_011005878.1| PREDICTED: B3 domain-containing protein Os01g0234100-like isoform 
X2 [Populus euphratica]
Length=473

 Score = 45.8 bits (107),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 18/38 (47%), Positives = 25/38 (66%), Gaps = 0/38 (0%)
 Frame = -2

Query  116  LDPTQPSFIKFLSRTYATLGFWVGLPPDFCKMYLPPHD  3
            L+P  PSF+K L R++    FW+GLP  FC+ +LP  D
Sbjct  98   LEPAFPSFVKSLVRSHVASCFWMGLPGTFCRAHLPSVD  135



>ref|XP_011005877.1| PREDICTED: B3 domain-containing protein Os01g0234100-like isoform 
X1 [Populus euphratica]
Length=475

 Score = 45.8 bits (107),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 18/38 (47%), Positives = 25/38 (66%), Gaps = 0/38 (0%)
 Frame = -2

Query  116  LDPTQPSFIKFLSRTYATLGFWVGLPPDFCKMYLPPHD  3
            L+P  PSF+K L R++    FW+GLP  FC+ +LP  D
Sbjct  100  LEPAFPSFVKSLVRSHVASCFWMGLPGTFCRAHLPSVD  137



>ref|XP_010922413.1| PREDICTED: B3 domain-containing protein Os06g0194400 isoform 
X2 [Elaeis guineensis]
Length=225

 Score = 45.1 bits (105),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 18/38 (47%), Positives = 26/38 (68%), Gaps = 0/38 (0%)
 Frame = -2

Query  116  LDPTQPSFIKFLSRTYATLGFWVGLPPDFCKMYLPPHD  3
            LDP  P+F+K + +++ T GFW+GLP  FC  +LP  D
Sbjct  122  LDPKFPTFVKPMLQSHVTGGFWLGLPRHFCTKHLPRKD  159



>ref|XP_006487088.1| PREDICTED: B3 domain-containing protein At3g19184-like isoform 
X2 [Citrus sinensis]
Length=266

 Score = 45.4 bits (106),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 19/38 (50%), Positives = 26/38 (68%), Gaps = 0/38 (0%)
 Frame = -2

Query  116  LDPTQPSFIKFLSRTYATLGFWVGLPPDFCKMYLPPHD  3
            LD   PSF+K + +++ T GFW+GLP  FCK +LP  D
Sbjct  118  LDSQYPSFVKPMLQSHVTGGFWLGLPVHFCKEHLPHSD  155



>ref|XP_006487087.1| PREDICTED: B3 domain-containing protein At3g19184-like isoform 
X1 [Citrus sinensis]
Length=270

 Score = 45.4 bits (106),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 19/38 (50%), Positives = 26/38 (68%), Gaps = 0/38 (0%)
 Frame = -2

Query  116  LDPTQPSFIKFLSRTYATLGFWVGLPPDFCKMYLPPHD  3
            LD   PSF+K + +++ T GFW+GLP  FCK +LP  D
Sbjct  122  LDSQYPSFVKPMLQSHVTGGFWLGLPVHFCKEHLPHSD  159



>emb|CDM82532.1| unnamed protein product [Triticum aestivum]
Length=480

 Score = 45.8 bits (107),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 17/38 (45%), Positives = 23/38 (61%), Gaps = 0/38 (0%)
 Frame = -2

Query  116  LDPTQPSFIKFLSRTYATLGFWVGLPPDFCKMYLPPHD  3
            L    PSF+K +  ++   GFW+GLP DFC  +LP  D
Sbjct  123  LPAEHPSFVKHMLHSHVVHGFWLGLPSDFCNKHLPKKD  160



>emb|CDM82531.1| unnamed protein product [Triticum aestivum]
Length=480

 Score = 45.8 bits (107),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 17/38 (45%), Positives = 23/38 (61%), Gaps = 0/38 (0%)
 Frame = -2

Query  116  LDPTQPSFIKFLSRTYATLGFWVGLPPDFCKMYLPPHD  3
            L    PSF+K +  ++   GFW+GLP DFC  +LP  D
Sbjct  123  LPAEHPSFVKHMLHSHVVHGFWLGLPSDFCNKHLPKKD  160



>ref|XP_010481961.1| PREDICTED: B3 domain-containing protein At5g42700-like isoform 
X1 [Camelina sativa]
Length=231

 Score = 45.1 bits (105),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 16/33 (48%), Positives = 24/33 (73%), Gaps = 0/33 (0%)
 Frame = -2

Query  101  PSFIKFLSRTYATLGFWVGLPPDFCKMYLPPHD  3
            PSF+K + +++ + GFW+GLP  FC+ YL  HD
Sbjct  130  PSFVKSMLQSHVSGGFWLGLPVQFCRSYLGKHD  162



>ref|XP_009778969.1| PREDICTED: B3 domain-containing protein At5g42700-like isoform 
X2 [Nicotiana sylvestris]
Length=284

 Score = 45.4 bits (106),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 18/38 (47%), Positives = 25/38 (66%), Gaps = 0/38 (0%)
 Frame = -2

Query  116  LDPTQPSFIKFLSRTYATLGFWVGLPPDFCKMYLPPHD  3
            L    PSF+K + R+  T GFW+ LP  FC+++LP HD
Sbjct  57   LSTKYPSFMKPMIRSNVTAGFWLSLPRFFCQLHLPRHD  94



>ref|XP_008788064.1| PREDICTED: B3 domain-containing protein Os06g0194400 [Phoenix 
dactylifera]
 ref|XP_008788065.1| PREDICTED: B3 domain-containing protein Os06g0194400 [Phoenix 
dactylifera]
Length=226

 Score = 44.7 bits (104),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 18/38 (47%), Positives = 26/38 (68%), Gaps = 0/38 (0%)
 Frame = -2

Query  116  LDPTQPSFIKFLSRTYATLGFWVGLPPDFCKMYLPPHD  3
            LDP  P+F+K + +++ T GFW+GLP  FC  +LP  D
Sbjct  123  LDPKFPTFVKPMLQSHVTGGFWLGLPRHFCTKHLPRKD  160



>ref|XP_008241504.1| PREDICTED: B3 domain-containing protein Os01g0234100-like [Prunus 
mume]
Length=497

 Score = 45.8 bits (107),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 19/38 (50%), Positives = 25/38 (66%), Gaps = 0/38 (0%)
 Frame = -2

Query  116  LDPTQPSFIKFLSRTYATLGFWVGLPPDFCKMYLPPHD  3
            L+P  PSF+K L R++    FW+GLP  FCK +LP  D
Sbjct  131  LEPRFPSFVKSLVRSHVASCFWMGLPSLFCKSHLPDKD  168



>gb|EMT26046.1| B3 domain-containing protein [Aegilops tauschii]
Length=607

 Score = 45.8 bits (107),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 17/38 (45%), Positives = 23/38 (61%), Gaps = 0/38 (0%)
 Frame = -2

Query  116  LDPTQPSFIKFLSRTYATLGFWVGLPPDFCKMYLPPHD  3
            L    PSF+K +  ++   GFW+GLP DFC  +LP  D
Sbjct  233  LPAEHPSFVKHMLHSHVVHGFWLGLPSDFCNKHLPKKD  270



>ref|XP_011010191.1| PREDICTED: B3 domain-containing protein Os01g0234100-like isoform 
X2 [Populus euphratica]
Length=475

 Score = 45.8 bits (107),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 18/38 (47%), Positives = 25/38 (66%), Gaps = 0/38 (0%)
 Frame = -2

Query  116  LDPTQPSFIKFLSRTYATLGFWVGLPPDFCKMYLPPHD  3
            L+P  PSF+K L R++    FW+GLP  FC+ +LP  D
Sbjct  100  LEPAFPSFVKSLVRSHVASCFWMGLPGQFCRAHLPHVD  137



>ref|XP_006380709.1| hypothetical protein POPTR_0007s11170g [Populus trichocarpa]
 gb|ERP58506.1| hypothetical protein POPTR_0007s11170g [Populus trichocarpa]
Length=475

 Score = 45.8 bits (107),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 18/38 (47%), Positives = 25/38 (66%), Gaps = 0/38 (0%)
 Frame = -2

Query  116  LDPTQPSFIKFLSRTYATLGFWVGLPPDFCKMYLPPHD  3
            L+P  PSF+K L R++    FW+GLP  FC+ +LP  D
Sbjct  100  LEPAFPSFVKSLVRSHVASCFWMGLPGQFCRAHLPHVD  137



>ref|XP_011010190.1| PREDICTED: B3 domain-containing protein Os01g0234100-like isoform 
X1 [Populus euphratica]
Length=477

 Score = 45.8 bits (107),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 18/38 (47%), Positives = 25/38 (66%), Gaps = 0/38 (0%)
 Frame = -2

Query  116  LDPTQPSFIKFLSRTYATLGFWVGLPPDFCKMYLPPHD  3
            L+P  PSF+K L R++    FW+GLP  FC+ +LP  D
Sbjct  102  LEPAFPSFVKSLVRSHVASCFWMGLPGQFCRAHLPHVD  139



>ref|XP_002310730.2| hypothetical protein POPTR_0007s11170g [Populus trichocarpa]
 gb|EEE91180.2| hypothetical protein POPTR_0007s11170g [Populus trichocarpa]
Length=477

 Score = 45.8 bits (107),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 18/38 (47%), Positives = 25/38 (66%), Gaps = 0/38 (0%)
 Frame = -2

Query  116  LDPTQPSFIKFLSRTYATLGFWVGLPPDFCKMYLPPHD  3
            L+P  PSF+K L R++    FW+GLP  FC+ +LP  D
Sbjct  102  LEPAFPSFVKSLVRSHVASCFWMGLPGQFCRAHLPHVD  139



>ref|XP_010666630.1| PREDICTED: B3 domain-containing protein Os01g0234100-like isoform 
X2 [Beta vulgaris subsp. vulgaris]
Length=431

 Score = 45.4 bits (106),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 18/38 (47%), Positives = 25/38 (66%), Gaps = 0/38 (0%)
 Frame = -2

Query  116  LDPTQPSFIKFLSRTYATLGFWVGLPPDFCKMYLPPHD  3
            L+   P FIK + +++    FW+GLP  FCKMYLP +D
Sbjct  50   LEANYPCFIKPMLKSHVASCFWMGLPVPFCKMYLPQND  87



>gb|EMT06248.1| B3 domain-containing protein [Aegilops tauschii]
Length=644

 Score = 45.8 bits (107),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 15/33 (45%), Positives = 24/33 (73%), Gaps = 0/33 (0%)
 Frame = -2

Query  101  PSFIKFLSRTYATLGFWVGLPPDFCKMYLPPHD  3
            PSF+K + +++   GFW+G+P +FC  +LP HD
Sbjct  291  PSFVKLMQKSHVVKGFWLGVPLNFCGEHLPKHD  323



>ref|XP_010666629.1| PREDICTED: B3 domain-containing protein Os01g0234100-like isoform 
X1 [Beta vulgaris subsp. vulgaris]
Length=457

 Score = 45.4 bits (106),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 18/38 (47%), Positives = 25/38 (66%), Gaps = 0/38 (0%)
 Frame = -2

Query  116  LDPTQPSFIKFLSRTYATLGFWVGLPPDFCKMYLPPHD  3
            L+   P FIK + +++    FW+GLP  FCKMYLP +D
Sbjct  50   LEANYPCFIKPMLKSHVASCFWMGLPVPFCKMYLPQND  87



>gb|EMT13106.1| B3 domain-containing protein [Aegilops tauschii]
Length=233

 Score = 44.7 bits (104),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 16/33 (48%), Positives = 25/33 (76%), Gaps = 0/33 (0%)
 Frame = -2

Query  101  PSFIKFLSRTYATLGFWVGLPPDFCKMYLPPHD  3
            PSF+K +++++ T GFW+GLP  FC+ +LP  D
Sbjct  135  PSFVKPMTQSHVTGGFWLGLPLPFCRKHLPKRD  167



>ref|XP_004240808.1| PREDICTED: B3 domain-containing protein Os01g0234100-like [Solanum 
lycopersicum]
Length=445

 Score = 45.4 bits (106),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 17/37 (46%), Positives = 25/37 (68%), Gaps = 1/37 (3%)
 Frame = -2

Query  110  PTQ-PSFIKFLSRTYATLGFWVGLPPDFCKMYLPPHD  3
            P Q PSF+K++  ++ + GFW+G P  FC  +LP HD
Sbjct  78   PCQFPSFVKYMLPSHVSGGFWLGFPKRFCDCHLPKHD  114



>ref|XP_007200257.1| hypothetical protein PRUPE_ppa015021mg [Prunus persica]
 gb|EMJ01456.1| hypothetical protein PRUPE_ppa015021mg [Prunus persica]
Length=359

 Score = 45.4 bits (106),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 18/38 (47%), Positives = 24/38 (63%), Gaps = 0/38 (0%)
 Frame = -2

Query  116  LDPTQPSFIKFLSRTYATLGFWVGLPPDFCKMYLPPHD  3
            LDP  PS +K +  ++ T GFW+GLP  FC  +LP  D
Sbjct  37   LDPKFPSLLKVMLPSHVTGGFWLGLPKKFCCEHLPKQD  74



>ref|XP_009612764.1| PREDICTED: B3 domain-containing protein At5g42700-like isoform 
X1 [Nicotiana tomentosiformis]
Length=253

 Score = 44.7 bits (104),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 18/38 (47%), Positives = 25/38 (66%), Gaps = 0/38 (0%)
 Frame = -2

Query  116  LDPTQPSFIKFLSRTYATLGFWVGLPPDFCKMYLPPHD  3
            L    PSF+K + R+  T GFW+ LP  FC+++LP HD
Sbjct  28   LSTKYPSFMKPMIRSNVTAGFWLSLPRFFCQLHLPRHD  65



>ref|XP_009612765.1| PREDICTED: B3 domain-containing protein At5g42700-like isoform 
X2 [Nicotiana tomentosiformis]
Length=251

 Score = 44.7 bits (104),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 18/38 (47%), Positives = 25/38 (66%), Gaps = 0/38 (0%)
 Frame = -2

Query  116  LDPTQPSFIKFLSRTYATLGFWVGLPPDFCKMYLPPHD  3
            L    PSF+K + R+  T GFW+ LP  FC+++LP HD
Sbjct  28   LSTKYPSFMKPMIRSNVTAGFWLSLPRFFCQLHLPRHD  65



>ref|XP_006473345.1| PREDICTED: B3 domain-containing protein At3g19184-like [Citrus 
sinensis]
Length=241

 Score = 44.7 bits (104),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 18/38 (47%), Positives = 25/38 (66%), Gaps = 0/38 (0%)
 Frame = -2

Query  116  LDPTQPSFIKFLSRTYATLGFWVGLPPDFCKMYLPPHD  3
            L P  P+FIK + +++ T GFW+GLP  FC+  LP  D
Sbjct  121  LGPEHPTFIKPMLQSHVTGGFWLGLPGYFCRRNLPKRD  158



>ref|XP_007042395.1| AP2/B3-like transcriptional factor family protein, putative [Theobroma 
cacao]
 gb|EOX98226.1| AP2/B3-like transcriptional factor family protein, putative [Theobroma 
cacao]
Length=465

 Score = 45.4 bits (106),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 17/33 (52%), Positives = 23/33 (70%), Gaps = 0/33 (0%)
 Frame = -2

Query  101  PSFIKFLSRTYATLGFWVGLPPDFCKMYLPPHD  3
            PS IK++  ++ T GFW+GLP DFC  +LP  D
Sbjct  85   PSLIKYMLPSHVTGGFWLGLPKDFCLKHLPKED  117



>ref|XP_006423041.1| hypothetical protein CICLE_v10029072mg [Citrus clementina]
 gb|ESR36281.1| hypothetical protein CICLE_v10029072mg [Citrus clementina]
Length=265

 Score = 44.7 bits (104),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 19/38 (50%), Positives = 26/38 (68%), Gaps = 0/38 (0%)
 Frame = -2

Query  116  LDPTQPSFIKFLSRTYATLGFWVGLPPDFCKMYLPPHD  3
            LD   PSF+K + +++ T GFW+GLP  FCK +LP  D
Sbjct  122  LDSQYPSFVKPMLQSHVTGGFWLGLPVHFCKEHLPHSD  159



>ref|XP_008236526.1| PREDICTED: B3 domain-containing protein Os01g0234100-like [Prunus 
mume]
Length=415

 Score = 45.4 bits (106),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 18/38 (47%), Positives = 24/38 (63%), Gaps = 0/38 (0%)
 Frame = -2

Query  116  LDPTQPSFIKFLSRTYATLGFWVGLPPDFCKMYLPPHD  3
            LDP  PS +K +  ++ T GFW+GLP  FC  +LP  D
Sbjct  61   LDPKFPSLLKVMLPSHVTGGFWLGLPKKFCCEHLPKQD  98



>gb|KDO84218.1| hypothetical protein CISIN_1g026276mg [Citrus sinensis]
Length=241

 Score = 44.7 bits (104),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 18/38 (47%), Positives = 25/38 (66%), Gaps = 0/38 (0%)
 Frame = -2

Query  116  LDPTQPSFIKFLSRTYATLGFWVGLPPDFCKMYLPPHD  3
            L P  P+FIK + +++ T GFW+GLP  FC+  LP  D
Sbjct  121  LGPEHPTFIKPMLQSHVTGGFWLGLPGYFCRRNLPKRD  158



>ref|XP_004291119.1| PREDICTED: B3 domain-containing protein Os06g0194400-like [Fragaria 
vesca subsp. vesca]
Length=175

 Score = 43.5 bits (101),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 16/33 (48%), Positives = 24/33 (73%), Gaps = 0/33 (0%)
 Frame = -2

Query  101  PSFIKFLSRTYATLGFWVGLPPDFCKMYLPPHD  3
            P+F+K + +++ T GFW+GLP  FC+ YLP  D
Sbjct  80   PTFVKPMLQSHVTGGFWMGLPLSFCRKYLPKRD  112



>ref|XP_011000298.1| PREDICTED: B3 domain-containing protein At3g19184-like [Populus 
euphratica]
Length=270

 Score = 44.7 bits (104),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 17/33 (52%), Positives = 25/33 (76%), Gaps = 0/33 (0%)
 Frame = -2

Query  101  PSFIKFLSRTYATLGFWVGLPPDFCKMYLPPHD  3
            PSF+K + +++ T GFW+GLP  FCK +LP +D
Sbjct  123  PSFVKPMLQSHVTGGFWLGLPVPFCKAHLPHYD  155



>ref|XP_004136984.1| PREDICTED: B3 domain-containing protein At3g19184-like [Cucumis 
sativus]
 ref|XP_004166666.1| PREDICTED: B3 domain-containing protein At3g19184-like [Cucumis 
sativus]
 gb|KGN43939.1| hypothetical protein Csa_7G073740 [Cucumis sativus]
Length=322

 Score = 45.1 bits (105),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 17/38 (45%), Positives = 26/38 (68%), Gaps = 0/38 (0%)
 Frame = -2

Query  116  LDPTQPSFIKFLSRTYATLGFWVGLPPDFCKMYLPPHD  3
            L+   PSF+K + +++ + GFW+GLP  FCK +LP  D
Sbjct  121  LESEYPSFVKPMLQSHVSGGFWLGLPVQFCKTHLPRED  158



>ref|XP_006434799.1| hypothetical protein CICLE_v10002314mg [Citrus clementina]
 gb|ESR48039.1| hypothetical protein CICLE_v10002314mg [Citrus clementina]
Length=241

 Score = 44.7 bits (104),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 18/38 (47%), Positives = 25/38 (66%), Gaps = 0/38 (0%)
 Frame = -2

Query  116  LDPTQPSFIKFLSRTYATLGFWVGLPPDFCKMYLPPHD  3
            L P  P+FIK + +++ T GFW+GLP  FC+  LP  D
Sbjct  121  LGPEHPTFIKPMLQSHVTGGFWLGLPGYFCRRNLPKRD  158



>ref|XP_002313112.2| hypothetical protein POPTR_0009s10590g [Populus trichocarpa]
 gb|EEE87067.2| hypothetical protein POPTR_0009s10590g [Populus trichocarpa]
Length=270

 Score = 44.7 bits (104),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 17/33 (52%), Positives = 25/33 (76%), Gaps = 0/33 (0%)
 Frame = -2

Query  101  PSFIKFLSRTYATLGFWVGLPPDFCKMYLPPHD  3
            PSF+K + +++ T GFW+GLP  FCK +LP +D
Sbjct  123  PSFVKPMLQSHVTGGFWLGLPVPFCKAHLPHYD  155



>ref|XP_008457832.1| PREDICTED: B3 domain-containing protein Os01g0234100-like isoform 
X2 [Cucumis melo]
Length=437

 Score = 45.4 bits (106),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 19/38 (50%), Positives = 24/38 (63%), Gaps = 0/38 (0%)
 Frame = -2

Query  116  LDPTQPSFIKFLSRTYATLGFWVGLPPDFCKMYLPPHD  3
            L+   PSF+K L R++    FW+GLP  FCK YLP  D
Sbjct  64   LEQEFPSFVKSLVRSHVASLFWMGLPGAFCKSYLPARD  101



>ref|XP_010107958.1| B3 domain-containing protein [Morus notabilis]
 gb|EXC17358.1| B3 domain-containing protein [Morus notabilis]
Length=867

 Score = 45.4 bits (106),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 16/38 (42%), Positives = 25/38 (66%), Gaps = 0/38 (0%)
 Frame = -2

Query  116  LDPTQPSFIKFLSRTYATLGFWVGLPPDFCKMYLPPHD  3
            L P  PS +K++  ++ T GFW+GL   FC +++P HD
Sbjct  512  LAPEFPSLVKYMLHSHVTGGFWLGLSKKFCDLHMPKHD  549



>ref|XP_011088274.1| PREDICTED: B3 domain-containing protein At3g19184 isoform X2 
[Sesamum indicum]
Length=222

 Score = 44.3 bits (103),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 19/38 (50%), Positives = 26/38 (68%), Gaps = 0/38 (0%)
 Frame = -2

Query  116  LDPTQPSFIKFLSRTYATLGFWVGLPPDFCKMYLPPHD  3
            LD   PSF+K + +++ T GFW+GLP  FCK +LP  D
Sbjct  117  LDQDIPSFVKPMLQSHVTGGFWLGLPVQFCKTHLPSRD  154



>ref|XP_008457831.1| PREDICTED: B3 domain-containing protein Os01g0234100-like isoform 
X1 [Cucumis melo]
Length=488

 Score = 45.4 bits (106),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 19/38 (50%), Positives = 24/38 (63%), Gaps = 0/38 (0%)
 Frame = -2

Query  116  LDPTQPSFIKFLSRTYATLGFWVGLPPDFCKMYLPPHD  3
            L+   PSF+K L R++    FW+GLP  FCK YLP  D
Sbjct  115  LEQEFPSFVKSLVRSHVASLFWMGLPGAFCKSYLPARD  152



>ref|XP_002523562.1| hypothetical protein RCOM_1407360 [Ricinus communis]
 gb|EEF38757.1| hypothetical protein RCOM_1407360 [Ricinus communis]
Length=529

 Score = 45.1 bits (105),  Expect = 7e-04, Method: Composition-based stats.
 Identities = 18/38 (47%), Positives = 25/38 (66%), Gaps = 0/38 (0%)
 Frame = -2

Query  116  LDPTQPSFIKFLSRTYATLGFWVGLPPDFCKMYLPPHD  3
            L+ T PSF+K L R++    FW+GLP  FC+ +LP  D
Sbjct  120  LESTYPSFVKSLVRSHVGSCFWMGLPGPFCRAHLPRED  157



>ref|XP_008454940.1| PREDICTED: B3 domain-containing protein At3g19184-like isoform 
X2 [Cucumis melo]
Length=320

 Score = 44.7 bits (104),  Expect = 8e-04, Method: Composition-based stats.
 Identities = 17/38 (45%), Positives = 26/38 (68%), Gaps = 0/38 (0%)
 Frame = -2

Query  116  LDPTQPSFIKFLSRTYATLGFWVGLPPDFCKMYLPPHD  3
            L+   PSF+K + +++ + GFW+GLP  FCK +LP  D
Sbjct  121  LESKYPSFVKPMLQSHVSGGFWLGLPVRFCKTHLPHED  158



>ref|XP_008454939.1| PREDICTED: B3 domain-containing protein At3g19184-like isoform 
X1 [Cucumis melo]
Length=322

 Score = 44.7 bits (104),  Expect = 8e-04, Method: Composition-based stats.
 Identities = 17/38 (45%), Positives = 26/38 (68%), Gaps = 0/38 (0%)
 Frame = -2

Query  116  LDPTQPSFIKFLSRTYATLGFWVGLPPDFCKMYLPPHD  3
            L+   PSF+K + +++ + GFW+GLP  FCK +LP  D
Sbjct  121  LESKYPSFVKPMLQSHVSGGFWLGLPVRFCKTHLPHED  158



>gb|ABK95016.1| unknown [Populus trichocarpa]
Length=192

 Score = 43.5 bits (101),  Expect = 8e-04, Method: Composition-based stats.
 Identities = 17/33 (52%), Positives = 23/33 (70%), Gaps = 0/33 (0%)
 Frame = -2

Query  101  PSFIKFLSRTYATLGFWVGLPPDFCKMYLPPHD  3
            P FIK + +++ T GFW+GLP DFC+  LP  D
Sbjct  125  PIFIKSMLQSHVTGGFWLGLPVDFCRRNLPRRD  157



>ref|XP_002465742.1| hypothetical protein SORBIDRAFT_01g044910 [Sorghum bicolor]
 gb|EER92740.1| hypothetical protein SORBIDRAFT_01g044910 [Sorghum bicolor]
Length=239

 Score = 43.9 bits (102),  Expect = 0.001, Method: Composition-based stats.
 Identities = 17/38 (45%), Positives = 23/38 (61%), Gaps = 0/38 (0%)
 Frame = -2

Query  116  LDPTQPSFIKFLSRTYATLGFWVGLPPDFCKMYLPPHD  3
            LDP  PSF+K +  ++   GFW+ LP  FC  Y+P  D
Sbjct  132  LDPDIPSFVKAMLHSHVVRGFWLQLPCHFCHTYMPKQD  169



>ref|XP_006374961.1| hypothetical protein POPTR_0014s03130g [Populus trichocarpa]
 gb|ERP52758.1| hypothetical protein POPTR_0014s03130g [Populus trichocarpa]
Length=205

 Score = 43.5 bits (101),  Expect = 0.001, Method: Composition-based stats.
 Identities = 17/33 (52%), Positives = 23/33 (70%), Gaps = 0/33 (0%)
 Frame = -2

Query  101  PSFIKFLSRTYATLGFWVGLPPDFCKMYLPPHD  3
            P FIK + +++ T GFW+GLP DFC+  LP  D
Sbjct  110  PIFIKSMLQSHVTGGFWLGLPVDFCRRNLPRRD  142



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 519686539684