BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c54427_g1_i1 len=185 path=[1:0-184]

Length=185
                                                                      Score     E

ref|XP_009618162.1|  PREDICTED: mitogen-activated protein kinase ...  79.0    3e-16   
ref|XP_009781047.1|  PREDICTED: mitogen-activated protein kinase ...  77.8    8e-16   
ref|XP_006367407.1|  PREDICTED: mitogen-activated protein kinase ...  78.2    2e-15   
ref|XP_007019852.1|  Mitogen-activated protein kinase kinase kina...  73.2    6e-14   
ref|XP_010094786.1|  putative serine/threonine-protein kinase         72.0    7e-14   
ref|XP_006367406.1|  PREDICTED: mitogen-activated protein kinase ...  73.6    2e-13   
ref|XP_006355243.1|  PREDICTED: mitogen-activated protein kinase ...  71.6    3e-13   
ref|XP_010325688.1|  PREDICTED: mitogen-activated protein kinase ...  71.6    3e-13   
ref|XP_006355242.1|  PREDICTED: mitogen-activated protein kinase ...  71.6    4e-13   
ref|XP_009597448.1|  PREDICTED: mitogen-activated protein kinase ...  70.9    8e-13   
ref|XP_009791903.1|  PREDICTED: mitogen-activated protein kinase ...  70.5    9e-13   
ref|XP_004243871.1|  PREDICTED: mitogen-activated protein kinase ...  70.1    2e-12   
ref|XP_004245431.1|  PREDICTED: mitogen-activated protein kinase ...  69.7    2e-12   
ref|XP_009607566.1|  PREDICTED: protein kinase byr2-like              68.6    5e-12   
ref|XP_009770458.1|  PREDICTED: mitogen-activated protein kinase ...  68.9    8e-12   
ref|XP_010093852.1|  MAP kinase kinase kinase mkh1                    63.5    2e-11   
ref|XP_009605056.1|  PREDICTED: mitogen-activated protein kinase ...  66.2    3e-11   
ref|XP_011004631.1|  PREDICTED: mitogen-activated protein kinase ...  65.5    5e-11   
ref|XP_002267176.1|  PREDICTED: mitogen-activated protein kinase ...  65.5    6e-11   Vitis vinifera
ref|XP_006352951.1|  PREDICTED: mitogen-activated protein kinase ...  64.3    9e-11   
ref|XP_009609364.1|  PREDICTED: MAP kinase kinase kinase wis4-like    65.9    9e-11   
ref|XP_007021946.1|  Mitogen-activated protein kinase kinase kina...  65.1    9e-11   
ref|XP_010090324.1|  Mitogen-activated protein kinase kinase kina...  64.3    1e-10   
ref|XP_010658122.1|  PREDICTED: mitogen-activated protein kinase ...  64.7    1e-10   
ref|XP_007032910.1|  Mitogen-activated protein kinase kinase kina...  63.2    4e-10   
ref|XP_010658120.1|  PREDICTED: calcium/calmodulin-dependent prot...  60.8    5e-10   
gb|KHN40490.1|  MAP kinase kinase kinase mkh1                         62.0    7e-10   
ref|XP_006603574.1|  PREDICTED: mitogen-activated protein kinase ...  62.0    7e-10   
ref|XP_002281578.1|  PREDICTED: mitogen-activated protein kinase ...  62.8    8e-10   Vitis vinifera
ref|XP_007021680.1|  Mitogen-activated protein kinase kinase kina...  62.0    9e-10   
ref|XP_002312977.2|  hypothetical protein POPTR_0009s13360g           60.8    3e-09   Populus trichocarpa [western balsam poplar]
gb|KHN37195.1|  Mitogen-activated protein kinase kinase kinase ANP1   59.3    4e-09   
ref|XP_010658127.1|  PREDICTED: mitogen-activated protein kinase ...  59.7    4e-09   
ref|XP_007145474.1|  hypothetical protein PHAVU_007G242000g           60.1    4e-09   
ref|XP_006410091.1|  hypothetical protein EUTSA_v10017626mg           59.7    5e-09   
ref|XP_007099532.1|  Kinase superfamily protein                       60.1    5e-09   
ref|XP_006410262.1|  hypothetical protein EUTSA_v10017935mg           59.7    5e-09   
ref|XP_008446738.1|  PREDICTED: mitogen-activated protein kinase ...  58.9    5e-09   
ref|XP_006582669.1|  PREDICTED: mitogen-activated protein kinase ...  59.3    6e-09   
ref|XP_006410145.1|  hypothetical protein EUTSA_v10017877mg           59.7    7e-09   
ref|XP_006582671.1|  PREDICTED: mitogen-activated protein kinase ...  59.3    7e-09   
ref|XP_006582632.1|  PREDICTED: mitogen-activated protein kinase ...  59.3    7e-09   
emb|CDY66799.1|  BnaC04g55540D                                        59.3    7e-09   
ref|XP_004147419.1|  PREDICTED: mitogen-activated protein kinase ...  57.8    1e-08   
emb|CDY50455.1|  BnaC04g25010D                                        58.9    1e-08   
ref|XP_007023072.1|  Kinase superfamily protein                       60.1    1e-08   
ref|XP_010507222.1|  PREDICTED: mitogen-activated protein kinase ...  59.3    1e-08   
ref|XP_006403002.1|  hypothetical protein EUTSA_v10006421mg           58.5    1e-08   
ref|XP_010512901.1|  PREDICTED: mitogen-activated protein kinase ...  58.9    1e-08   
gb|KGN65602.1|  hypothetical protein Csa_1G467210                     57.0    1e-08   
ref|XP_010527554.1|  PREDICTED: mitogen-activated protein kinase ...  58.2    2e-08   
ref|XP_009144248.1|  PREDICTED: mitogen-activated protein kinase ...  58.5    2e-08   
ref|XP_009144229.1|  PREDICTED: mitogen-activated protein kinase ...  58.5    2e-08   
emb|CDY10791.1|  BnaA05g11450D                                        58.5    2e-08   
ref|XP_003633375.1|  PREDICTED: mitogen-activated protein kinase ...  58.2    2e-08   
ref|XP_010527555.1|  PREDICTED: mitogen-activated protein kinase ...  58.5    2e-08   
ref|XP_010095583.1|  Mitogen-activated protein kinase kinase kina...  58.5    2e-08   
ref|XP_004171739.1|  PREDICTED: mitogen-activated protein kinase ...  57.8    3e-08   
ref|XP_010095581.1|  Mitogen-activated protein kinase kinase kina...  58.5    3e-08   
emb|CDY24757.1|  BnaC04g13620D                                        57.8    3e-08   
ref|WP_011649226.1|  nitrogen fixation serine/threonine-protein k...  57.8    4e-08   
ref|NP_180976.1|  protein kinase family protein                       57.0    4e-08   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002267086.1|  PREDICTED: mitogen-activated protein kinase ...  57.4    4e-08   Vitis vinifera
emb|CAN76632.1|  hypothetical protein VITISV_032336                   57.4    4e-08   Vitis vinifera
ref|XP_004163151.1|  PREDICTED: serine/threonine-protein kinase B...  57.8    4e-08   
ref|XP_002880821.1|  kinase family protein                            57.4    5e-08   
ref|XP_010090302.1|  Mitogen-activated protein kinase kinase kina...  57.4    6e-08   
ref|XP_004137063.1|  PREDICTED: mitogen-activated protein kinase ...  57.4    6e-08   
ref|XP_009144249.1|  PREDICTED: mitogen-activated protein kinase ...  56.6    6e-08   
emb|CDX76047.1|  BnaA04g03110D                                        57.0    6e-08   
ref|XP_004136151.1|  PREDICTED: serine/threonine-protein kinase B...  57.4    6e-08   
emb|CDY50458.1|  BnaC04g25040D                                        57.0    6e-08   
ref|XP_002876359.1|  hypothetical protein ARALYDRAFT_348712           57.4    6e-08   
ref|XP_008451652.1|  PREDICTED: serine/threonine-protein kinase g...  56.6    7e-08   
emb|CBI29770.3|  unnamed protein product                              56.2    7e-08   
ref|XP_010431031.1|  PREDICTED: mitogen-activated protein kinase ...  57.0    9e-08   
ref|XP_008465601.1|  PREDICTED: mitogen-activated protein kinase ...  56.6    9e-08   
ref|XP_009132717.1|  PREDICTED: mitogen-activated protein kinase ...  56.6    9e-08   
emb|CDX76059.1|  BnaA04g03230D                                        56.6    9e-08   
ref|XP_011097967.1|  PREDICTED: mitogen-activated protein kinase ...  57.4    9e-08   
ref|XP_004146989.1|  PREDICTED: mitogen-activated protein kinase ...  55.8    1e-07   
ref|XP_006292246.1|  hypothetical protein CARUB_v10018453mg           57.0    1e-07   
ref|XP_002306171.2|  hypothetical protein POPTR_0004s17730g           56.2    1e-07   Populus trichocarpa [western balsam poplar]
emb|CDY10776.1|  BnaA05g11600D                                        56.2    1e-07   
ref|XP_009139118.1|  PREDICTED: mitogen-activated protein kinase ...  55.8    1e-07   
emb|CDY24731.1|  BnaC04g13360D                                        56.6    1e-07   
ref|XP_010524977.1|  PREDICTED: mitogen-activated protein kinase ...  56.2    1e-07   
gb|AAL17786.1|AF361470_6  ImpN                                        55.8    1e-07   Rhizobium leguminosarum bv. trifolii
ref|XP_009144247.1|  PREDICTED: mitogen-activated protein kinase ...  56.2    1e-07   
gb|AHG49394.1|  nitrogen fixation serine/threonine-protein kinase     55.8    2e-07   
gb|KFK23195.1|  hypothetical protein AALP_AAs74393U000200             55.8    2e-07   
ref|XP_006399726.1|  hypothetical protein EUTSA_v10015480mg           55.8    2e-07   
gb|KGN44756.1|  hypothetical protein Csa_7G378450                     55.8    2e-07   
emb|CDY65405.1|  BnaC04g55520D                                        55.8    2e-07   
ref|XP_004914907.1|  PREDICTED: protein kinase C theta type-like      56.6    2e-07   
ref|XP_006283707.1|  hypothetical protein CARUB_v10004778mg           56.6    2e-07   
emb|CDJ02510.1|  death associated protein kinase 1                    56.6    2e-07   
emb|CDS24224.1|  death associated protein kinase 1                    56.6    2e-07   
ref|XP_006289563.1|  hypothetical protein CARUB_v10003109mg           55.8    2e-07   
gb|EUB58820.1|  Death-associated protein kinase 2                     56.6    2e-07   
gb|KFK34893.1|  hypothetical protein AALP_AA5G207100                  55.5    2e-07   
ref|XP_010269485.1|  PREDICTED: mitogen-activated protein kinase ...  55.8    2e-07   
ref|XP_008455530.1|  PREDICTED: mitogen-activated protein kinase ...  55.8    2e-07   
ref|XP_006419000.1|  hypothetical protein EUTSA_v10003065mg           55.5    2e-07   
ref|XP_002879959.1|  kinase family protein                            55.5    2e-07   
ref|XP_006292308.1|  hypothetical protein CARUB_v10018519mg           54.7    2e-07   
ref|WP_029871463.1|  membrane protein                                 55.5    3e-07   
ref|XP_010535523.1|  PREDICTED: mitogen-activated protein kinase ...  55.5    3e-07   
ref|XP_009139343.1|  PREDICTED: mitogen-activated protein kinase ...  55.1    3e-07   
ref|XP_009144246.1|  PREDICTED: mitogen-activated protein kinase ...  55.5    3e-07   
ref|XP_010418753.1|  PREDICTED: mitogen-activated protein kinase ...  55.5    3e-07   
ref|XP_010468117.1|  PREDICTED: mitogen-activated protein kinase ...  55.5    3e-07   
ref|XP_002306473.2|  hypothetical protein POPTR_0005s18240g           55.5    3e-07   Populus trichocarpa [western balsam poplar]
emb|CDY10778.1|  BnaA05g11580D                                        55.5    3e-07   
emb|CDY53489.1|  BnaC04g02670D                                        54.7    3e-07   
ref|XP_004241675.1|  PREDICTED: mitogen-activated protein kinase ...  55.5    3e-07   
ref|XP_006356256.1|  PREDICTED: mitogen-activated protein kinase ...  55.5    3e-07   
emb|CDY10813.1|  BnaA05g11230D                                        55.1    3e-07   
ref|XP_007337453.1|  hypothetical protein AURDEDRAFT_179722           56.2    3e-07   
gb|EPS63968.1|  hypothetical protein M569_10815                       54.7    3e-07   
ref|XP_010489776.1|  PREDICTED: mitogen-activated protein kinase ...  55.1    3e-07   
ref|WP_017956922.1|  nitrogen fixation serine/threonine-protein k...  55.1    3e-07   
emb|CDY29107.1|  BnaC09g18330D                                        55.1    4e-07   
ref|XP_001322268.1|  CMGC family protein kinase                       55.1    4e-07   Trichomonas vaginalis G3
ref|NP_181723.1|  putative protein serine/threonine kinase            54.7    4e-07   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010455116.1|  PREDICTED: mitogen-activated protein kinase ...  54.7    4e-07   
ref|XP_010028244.1|  PREDICTED: mitogen-activated protein kinase ...  55.1    5e-07   
ref|XP_002306472.2|  hypothetical protein POPTR_0005s18230g           54.7    5e-07   Populus trichocarpa [western balsam poplar]
ref|NP_198103.1|  protein kinase family protein                       54.7    5e-07   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010028243.1|  PREDICTED: mitogen-activated protein kinase ...  55.1    5e-07   
ref|XP_006355241.1|  PREDICTED: mitogen-activated protein kinase ...  54.7    5e-07   
ref|XP_009132736.1|  PREDICTED: mitogen-activated protein kinase ...  54.7    5e-07   
ref|XP_009625704.1|  PREDICTED: mitogen-activated protein kinase ...  54.7    5e-07   
ref|XP_009142826.1|  PREDICTED: mitogen-activated protein kinase ...  54.7    5e-07   
ref|XP_009113904.1|  PREDICTED: mitogen-activated protein kinase ...  54.7    5e-07   
ref|XP_009114073.1|  PREDICTED: mitogen-activated protein kinase ...  54.7    5e-07   
emb|CDY13093.1|  BnaA09g17240D                                        54.7    5e-07   
ref|XP_002875747.1|  predicted protein                                54.7    5e-07   
ref|XP_010471614.1|  PREDICTED: probable serine/threonine-protein...  53.9    5e-07   
ref|XP_010028242.1|  PREDICTED: mitogen-activated protein kinase ...  54.7    5e-07   
ref|XP_010493426.1|  PREDICTED: mitogen-activated protein kinase ...  54.3    5e-07   
ref|XP_011008530.1|  PREDICTED: mitogen-activated protein kinase ...  54.7    5e-07   
ref|XP_010554993.1|  PREDICTED: mitogen-activated protein kinase ...  53.9    5e-07   
ref|XP_002877436.1|  hypothetical protein ARALYDRAFT_905755           54.7    6e-07   
ref|WP_003575650.1|  protein kinase family protein                    54.3    6e-07   
gb|EYU21752.1|  hypothetical protein MIMGU_mgv1a021677mg              54.7    6e-07   
ref|XP_006295977.1|  hypothetical protein CARUB_v10025120mg           54.3    6e-07   
ref|XP_010495543.1|  PREDICTED: mitogen-activated protein kinase ...  54.3    6e-07   
ref|WP_027686720.1|  membrane protein                                 54.3    7e-07   
ref|XP_009613859.1|  PREDICTED: mitogen-activated protein kinase ...  54.3    7e-07   
ref|XP_010468299.1|  PREDICTED: mitogen-activated protein kinase ...  54.3    7e-07   
emb|CDY23999.1|  BnaC03g16920D                                        53.9    7e-07   
ref|XP_008782769.1|  PREDICTED: mitogen-activated protein kinase ...  53.5    7e-07   
ref|XP_005828031.1|  hypothetical protein GUITHDRAFT_88507            54.7    7e-07   
gb|KDP31943.1|  hypothetical protein JCGZ_12404                       54.3    7e-07   
ref|XP_010093628.1|  Mitogen-activated protein kinase kinase kina...  54.3    8e-07   
ref|XP_004911783.1|  PREDICTED: protein kinase C delta type-like      53.1    8e-07   
gb|EYB81415.1|  hypothetical protein Y032_0384g403                    54.3    8e-07   
ref|XP_010471603.1|  PREDICTED: mitogen-activated protein kinase ...  53.9    8e-07   
ref|XP_005843023.1|  hypothetical protein CHLNCDRAFT_141712           54.3    8e-07   
ref|XP_006393169.1|  hypothetical protein EUTSA_v10012148mg           53.9    8e-07   
gb|EYB81416.1|  hypothetical protein Y032_0384g403                    54.3    8e-07   
ref|XP_006393688.1|  hypothetical protein EUTSA_v10012166mg           54.3    8e-07   
gb|EYB81418.1|  hypothetical protein Y032_0384g403                    54.3    8e-07   
gb|KCW54938.1|  hypothetical protein EUGRSUZ_I00911                   54.3    8e-07   
gb|KEH36902.1|  MAP kinase kinase kinase                              53.9    8e-07   
ref|XP_006293406.1|  hypothetical protein CARUB_v10024721mg           53.1    8e-07   
ref|XP_006393690.1|  hypothetical protein EUTSA_v10012137mg           53.9    8e-07   
gb|EYB81417.1|  hypothetical protein Y032_0384g403                    54.3    9e-07   
ref|XP_010028240.1|  PREDICTED: mitogen-activated protein kinase ...  54.3    9e-07   
ref|XP_002936098.2|  PREDICTED: protein kinase C delta type-like      53.1    9e-07   
emb|CDY51516.1|  BnaC04g02350D                                        53.5    9e-07   
ref|XP_009418544.1|  PREDICTED: mitogen-activated protein kinase ...  53.9    9e-07   
gb|EMD48003.1|  protein kinase, putative                              53.9    9e-07   
ref|XP_010445964.1|  PREDICTED: mitogen-activated protein kinase ...  53.5    1e-06   
ref|XP_653785.1|  protein kinase                                      53.9    1e-06   Entamoeba histolytica HM-1:IMSS
ref|XP_008858548.1|  protein kinase, putative                         53.9    1e-06   
emb|CDX84833.1|  BnaA03g13970D                                        53.5    1e-06   
emb|CDX79877.1|  BnaA05g02790D                                        53.9    1e-06   
ref|XP_002269638.1|  PREDICTED: mitogen-activated protein kinase ...  53.9    1e-06   Vitis vinifera
emb|CDX84854.1|  BnaA03g13760D                                        53.5    1e-06   
emb|CDY24024.1|  BnaC03g16670D                                        53.5    1e-06   
ref|XP_001739968.1|  cyclin-dependent kinase C-1                      53.9    1e-06   Entamoeba dispar SAW760
ref|XP_002879958.1|  kinase family protein                            53.9    1e-06   
ref|XP_006414753.1|  hypothetical protein EUTSA_v10027196mg           53.9    1e-06   
ref|XP_010443097.1|  PREDICTED: mitogen-activated protein kinase ...  53.5    1e-06   
gb|KFA59986.1|  hypothetical protein S40285_08483                     53.9    1e-06   
emb|CDS28834.1|  Casein kinase II, alpha subunit Cell cycle           53.9    1e-06   
ref|XP_004253984.1|  cyclin-dependent kinase C-1, putative            53.5    1e-06   
ref|XP_010421111.1|  PREDICTED: mitogen-activated protein kinase ...  53.5    1e-06   
ref|XP_006300905.1|  hypothetical protein CARUB_v10021274mg           53.5    1e-06   
ref|XP_010421603.1|  PREDICTED: mitogen-activated protein kinase ...  53.5    1e-06   
gb|EJY74363.1|  Calcium/calmodulin-dependent protein kinase kinas...  53.9    1e-06   
emb|CDP14935.1|  unnamed protein product                              53.5    1e-06   
emb|CAN71000.1|  hypothetical protein VITISV_023637                   53.9    1e-06   Vitis vinifera
ref|XP_002267830.1|  PREDICTED: mitogen-activated protein kinase ...  53.5    1e-06   Vitis vinifera
emb|CDY39393.1|  BnaAnng05240D                                        52.4    1e-06   
gb|KFK34894.1|  hypothetical protein AALP_AA5G207300                  52.0    1e-06   
emb|CDY54727.1|  BnaCnng27530D                                        53.5    1e-06   
ref|XP_009783074.1|  PREDICTED: mitogen-activated protein kinase ...  53.1    1e-06   
emb|CDY39391.1|  BnaAnng05220D                                        52.4    2e-06   
ref|XP_008194624.1|  PREDICTED: serine/threonine-protein kinase C...  53.5    2e-06   
ref|XP_010535545.1|  PREDICTED: mitogen-activated protein kinase ...  53.5    2e-06   
ref|XP_009629290.1|  PREDICTED: serine/threonine-protein kinase 1...  53.1    2e-06   
ref|XP_010652559.1|  PREDICTED: mitogen-activated protein kinase ...  53.1    2e-06   
ref|XP_002875767.1|  hypothetical protein ARALYDRAFT_905795           53.5    2e-06   
ref|XP_006289424.1|  hypothetical protein CARUB_v10002924mg           53.1    2e-06   
ref|XP_009144193.1|  PREDICTED: mitogen-activated protein kinase ...  53.1    2e-06   
ref|XP_004261228.1|  cell division control protein 15 , CDC15, pu...  54.3    2e-06   
ref|XP_004173609.1|  PREDICTED: mitogen-activated protein kinase ...  53.1    2e-06   
ref|WP_020919497.1|  serine/threonine protein kinase-like domain-...  53.1    2e-06   
ref|XP_004912409.1|  PREDICTED: protein kinase C delta type-like      53.5    2e-06   
ref|XP_008440288.1|  PREDICTED: mitogen-activated protein kinase ...  53.1    2e-06   
emb|CDY34372.1|  BnaA09g11140D                                        53.1    2e-06   
ref|XP_010542110.1|  PREDICTED: mitogen-activated protein kinase ...  52.8    2e-06   
ref|XP_972529.1|  PREDICTED: serine/threonine-protein kinase Chk2...  53.5    2e-06   Tribolium castaneum [rust-red flour beetle]
ref|XP_006418994.1|  hypothetical protein EUTSA_v10002972mg           53.1    2e-06   
ref|XP_006418955.1|  hypothetical protein EUTSA_v10002928mg           53.1    2e-06   
ref|XP_002881835.1|  hypothetical protein ARALYDRAFT_346029           52.0    2e-06   
ref|XP_002875768.1|  hypothetical protein ARALYDRAFT_905796           53.1    2e-06   
ref|WP_003592306.1|  protein kinase family protein                    52.8    2e-06   
ref|XP_010513669.1|  PREDICTED: mitogen-activated protein kinase ...  52.8    2e-06   
ref|XP_004912384.1|  PREDICTED: protein kinase C delta type-like      53.1    2e-06   
ref|XP_002883681.1|  kinase family protein                            52.8    2e-06   
gb|ETN75398.1|  kinase domain protein                                 52.8    2e-06   
ref|XP_011073592.1|  PREDICTED: LOW QUALITY PROTEIN: mitogen-acti...  51.2    2e-06   
ref|NP_178581.1|  protein kinase family protein                       52.8    2e-06   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006299683.1|  hypothetical protein CARUB_v10015871mg           52.4    2e-06   
ref|XP_010474210.1|  PREDICTED: mitogen-activated protein kinase ...  52.8    2e-06   
ref|XP_010511919.1|  PREDICTED: mitogen-activated protein kinase ...  52.8    2e-06   
ref|NP_190165.1|  protein kinase-related protein                      52.8    2e-06   Arabidopsis thaliana [mouse-ear cress]
emb|CDP04579.1|  unnamed protein product                              53.1    2e-06   
ref|XP_004914894.1|  PREDICTED: protein kinase C delta type-like      52.0    2e-06   
ref|XP_009123612.1|  PREDICTED: mitogen-activated protein kinase ...  52.8    2e-06   
emb|CDY16498.1|  BnaA08g02690D                                        52.8    3e-06   
ref|XP_010275098.1|  PREDICTED: mitogen-activated protein kinase ...  52.8    3e-06   
ref|XP_010468520.1|  PREDICTED: mitogen-activated protein kinase ...  52.4    3e-06   
emb|CCC52125.1|  putative tyrosine protein kinase                     52.8    3e-06   
ref|XP_009101647.1|  PREDICTED: probable serine/threonine-protein...  52.4    3e-06   
ref|XP_005827797.1|  hypothetical protein GUITHDRAFT_158278           52.4    3e-06   
emb|CDY49825.1|  BnaCnng18220D                                        52.4    3e-06   
gb|ETO20769.1|  Protein kinase domain containing protein              53.1    3e-06   
gb|EZG89330.1|  protein kinase domain protein                         53.5    3e-06   
ref|XP_010419018.1|  PREDICTED: mitogen-activated protein kinase ...  52.8    3e-06   
ref|XP_006296273.1|  hypothetical protein CARUB_v10025441mg           52.4    3e-06   
emb|CDY43225.1|  BnaC08g04980D                                        52.4    3e-06   
ref|XP_011095801.1|  PREDICTED: mitogen-activated protein kinase ...  52.8    3e-06   
gb|KEY74820.1|  hypothetical protein S7711_06507                      52.8    3e-06   
ref|XP_004141910.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  53.1    3e-06   
ref|XP_005780461.1|  hypothetical protein EMIHUDRAFT_443049           53.1    3e-06   
ref|XP_005777803.1|  hypothetical protein EMIHUDRAFT_443668           53.1    3e-06   
gb|KCW54944.1|  hypothetical protein EUGRSUZ_I00918                   52.4    3e-06   
ref|XP_010489777.1|  PREDICTED: serine/threonine-protein kinase P...  51.2    3e-06   
ref|XP_006296243.1|  hypothetical protein CARUB_v10025410mg           52.4    3e-06   
gb|AAL87297.1|  unknown protein                                       52.8    3e-06   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002164920.2|  PREDICTED: serine/threonine-protein kinase D...  53.1    3e-06   
ref|XP_010028245.1|  PREDICTED: mitogen-activated protein kinase ...  52.4    3e-06   
emb|CDY06893.1|  BnaA04g24220D                                        52.4    3e-06   
ref|XP_009142027.1|  PREDICTED: mitogen-activated protein kinase ...  52.4    3e-06   
ref|XP_010275096.1|  PREDICTED: mitogen-activated protein kinase ...  52.8    3e-06   
ref|XP_002879993.1|  kinase family protein                            52.4    3e-06   
emb|CDY55394.1|  BnaA05g34300D                                        52.0    3e-06   
ref|XP_006396574.1|  hypothetical protein EUTSA_v10029514mg           52.0    4e-06   
ref|XP_010028246.1|  PREDICTED: mitogen-activated protein kinase ...  52.4    4e-06   
ref|XP_004920430.1|  PREDICTED: protein kinase C theta type-like      52.0    4e-06   
dbj|BAF00528.1|  putative NPK1-related protein kinase                 52.8    4e-06   Arabidopsis thaliana [mouse-ear cress]
emb|CCO28908.1|  CAMK family protein kinase                           51.2    4e-06   
gb|EWM29196.1|  mitogen-activated protein kinase                      52.8    4e-06   
ref|NP_194419.2|  mitogen-activated protein kinase kinase kinase 16   52.8    4e-06   Arabidopsis thaliana [mouse-ear cress]
emb|CAB36535.1|  putative NPK1-related protein kinase                 52.8    4e-06   Arabidopsis thaliana [mouse-ear cress]
emb|CDY34500.1|  BnaC04g12990D                                        52.4    4e-06   
ref|XP_010028241.1|  PREDICTED: mitogen-activated protein kinase ...  52.4    4e-06   
emb|CDY55749.1|  BnaA05g35340D                                        52.0    4e-06   
ref|XP_002869589.1|  hypothetical protein ARALYDRAFT_492112           52.4    4e-06   
emb|CDJ49954.1|  CMGC kinase, putative                                53.1    4e-06   
ref|NP_181722.1|  putative protein serine/threonine kinase            52.4    4e-06   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011073306.1|  PREDICTED: mitogen-activated protein kinase ...  52.4    4e-06   
ref|XP_002881837.1|  hypothetical protein ARALYDRAFT_903588           52.0    4e-06   
ref|XP_003747755.1|  PREDICTED: serine/threonine-protein kinase D...  52.8    4e-06   
ref|XP_009802290.1|  PREDICTED: mitogen-activated protein kinase ...  52.4    4e-06   
emb|CDY32842.1|  BnaC08g02640D                                        52.0    4e-06   
gb|ERG83839.1|  cyclin-dependent kinase 20                            52.0    4e-06   
ref|XP_009521882.1|  hypothetical protein PHYSODRAFT_494608           52.4    4e-06   
ref|XP_009107581.1|  PREDICTED: mitogen-activated protein kinase ...  52.0    4e-06   
gb|ERG82179.1|  mitogen-activated protein kinase 7                    52.4    4e-06   
ref|XP_002296732.1|  hypothetical protein THAPSDRAFT_269874           51.6    4e-06   
ref|XP_010525514.1|  PREDICTED: mitogen-activated protein kinase ...  51.6    4e-06   
ref|XP_010471412.1|  PREDICTED: mitogen-activated protein kinase ...  52.0    4e-06   
ref|XP_004149711.1|  PREDICTED: mitogen-activated protein kinase ...  52.0    4e-06   
ref|XP_010490161.1|  PREDICTED: mitogen-activated protein kinase ...  52.0    4e-06   
ref|XP_010445108.1|  PREDICTED: mitogen-activated protein kinase ...  52.4    5e-06   
gb|KHN83351.1|  Mitogen-activated protein kinase 7                    52.4    5e-06   
gb|KIG15924.1|  Serine/threonine protein kinase PrkC, regulator o...  51.6    5e-06   
emb|CDW72187.1|  protein kinase domain containing protein             52.0    5e-06   
ref|XP_006411493.1|  hypothetical protein EUTSA_v10017907mg           52.0    5e-06   
ref|XP_010425332.1|  PREDICTED: serine/threonine-protein kinase 3...  52.0    5e-06   
ref|XP_002164848.2|  PREDICTED: serine/threonine-protein kinase D...  52.8    5e-06   
emb|CDW74981.1|  glycogen synthase kinase 3                           52.0    5e-06   
ref|XP_010484956.1|  PREDICTED: mitogen-activated protein kinase ...  51.6    5e-06   
emb|CBY20337.1|  unnamed protein product                              52.0    5e-06   
ref|XP_006303627.1|  hypothetical protein CARUB_v10011504mg           51.6    5e-06   
ref|XP_010632569.1|  PREDICTED: mitogen-activated protein kinase ...  51.2    5e-06   
ref|XP_006390549.1|  hypothetical protein EUTSA_v10019452mg           51.6    5e-06   
emb|CBY38891.1|  unnamed protein product                              52.0    5e-06   
ref|XP_004916492.1|  PREDICTED: protein kinase C delta type-like      49.7    5e-06   
ref|XP_009366427.1|  PREDICTED: mitogen-activated protein kinase ...  52.0    5e-06   
ref|XP_011043532.1|  PREDICTED: mitogen-activated protein kinase ...  52.0    5e-06   
ref|XP_002879245.1|  MAPKKK14                                         52.0    5e-06   
ref|XP_009598440.1|  PREDICTED: mitogen-activated protein kinase ...  51.6    5e-06   
ref|XP_002888929.1|  ATMKK9                                           51.6    5e-06   
emb|CCX11126.1|  Similar to Serine/threonine-protein kinase chk1;...  52.4    5e-06   
ref|XP_006296300.1|  hypothetical protein CARUB_v10025472mg           51.6    5e-06   
ref|NP_177492.1|  MAP kinase kinase 9                                 51.6    5e-06   
ref|XP_004914895.1|  PREDICTED: protein kinase C delta type-like      52.0    6e-06   
ref|XP_004915741.1|  PREDICTED: protein kinase C delta type-like      51.6    6e-06   
ref|XP_002881726.1|  hypothetical protein ARALYDRAFT_903349           51.6    6e-06   
ref|XP_002879874.1|  hypothetical protein ARALYDRAFT_903343           51.6    6e-06   
ref|XP_667043.1|  serine/threonine protein kinase KKIALRE             52.4    6e-06   
ref|XP_001388433.1|  serine/threonine protein kinase KKIALRE          52.4    6e-06   
emb|CDX96979.1|  BnaC02g31170D                                        51.6    6e-06   
ref|XP_004916493.1|  PREDICTED: protein kinase C delta type-like      52.0    6e-06   
ref|XP_004911851.1|  PREDICTED: protein kinase C delta type-like      52.0    6e-06   
gb|EGN97612.1|  hypothetical protein SERLA73DRAFT_110912              51.2    6e-06   
ref|XP_007029410.1|  Mitogen-activated protein kinase kinase kina...  51.6    6e-06   
ref|XP_008457763.1|  PREDICTED: mitogen-activated protein kinase ...  51.6    6e-06   
ref|XP_002559704.1|  Pc13g12890                                       51.6    6e-06   
ref|XP_009604127.1|  PREDICTED: mitogen-activated protein kinase ...  52.0    6e-06   
emb|CBY41192.1|  unnamed protein product                              51.6    6e-06   
emb|CCC50561.1|  putative MAP kinase, fragment                        52.0    6e-06   
ref|XP_010525515.1|  PREDICTED: mitogen-activated protein kinase ...  51.6    6e-06   
gb|KHN42094.1|  Serine/threonine-protein kinase BCK1/SLK1/SSP31       50.4    6e-06   
gb|ABF55669.1|  double MYC-tagged mitogen activated protein kinas...  51.6    7e-06   
ref|XP_006411462.1|  hypothetical protein EUTSA_v10016824mg           51.6    7e-06   
emb|CCA23380.1|  cell cyclerelated kinase putative                    51.6    7e-06   
ref|XP_003073977.1|  cyclin-dependent protein kinase                  51.2    7e-06   
dbj|BAF01668.1|  putative protein kinase                              50.8    7e-06   
ref|XP_004915739.1|  PREDICTED: protein kinase C delta type-like      51.6    7e-06   
ref|XP_004915738.1|  PREDICTED: protein kinase C delta type-like      51.6    7e-06   
ref|XP_010431392.1|  PREDICTED: serine/threonine-protein kinase P...  50.8    7e-06   
ref|XP_008907272.1|  CMGC/CDK/CDC2 protein kinase                     50.8    7e-06   
ref|XP_004915737.1|  PREDICTED: protein kinase C delta type-like      51.6    7e-06   
ref|XP_004915740.1|  PREDICTED: protein kinase C delta type-like      51.6    7e-06   
ref|XP_001325928.1|  CMGC family protein kinase                       51.2    7e-06   
gb|ABQ85219.1|  BUD1                                                  49.3    7e-06   
gb|ABQ85220.1|  BUD1                                                  49.3    7e-06   
emb|CDY70990.1|  BnaCnng70750D                                        49.7    7e-06   
ref|XP_009144058.1|  PREDICTED: mitogen-activated protein kinase ...  50.8    7e-06   
ref|XP_009367209.1|  PREDICTED: mitogen-activated protein kinase ...  51.2    7e-06   
ref|XP_010437375.1|  PREDICTED: probable WRKY transcription facto...  52.4    8e-06   
ref|XP_002934130.2|  PREDICTED: uncharacterized protein LOC100494970  52.4    8e-06   
ref|XP_010632570.1|  PREDICTED: mitogen-activated protein kinase ...  50.8    8e-06   
ref|XP_002523600.1|  ATP binding protein, putative                    51.2    8e-06   
gb|ADD62790.1|  mitogen-activated protein kinase HOG1                 50.4    8e-06   
sp|Q5I6M2.2|HOG1_SETTU  RecName: Full=Mitogen-activated protein k...  51.2    8e-06   
ref|NP_181783.1|  protein kinase family protein                       51.2    8e-06   
gb|EGT40801.1|  hypothetical protein CAEBREN_31636                    51.6    8e-06   
ref|XP_009343294.1|  PREDICTED: mitogen-activated protein kinase ...  51.2    8e-06   
ref|WP_012910751.1|  serine/threonine protein kinase                  51.2    8e-06   
gb|KFK34896.1|  hypothetical protein AALP_AA5G207500                  50.8    8e-06   
ref|XP_004914261.1|  PREDICTED: cAMP-dependent protein kinase typ...  49.3    8e-06   
ref|NP_190200.1|  protein kinase-related protein                      51.2    8e-06   
ref|XP_009615697.1|  PREDICTED: mitogen-activated protein kinase ...  51.6    8e-06   
ref|XP_006367818.1|  PREDICTED: mitogen-activated protein kinase ...  51.2    8e-06   
ref|XP_010431394.1|  PREDICTED: serine/threonine-protein kinase p...  50.8    8e-06   
ref|XP_010508067.1|  PREDICTED: mitogen-activated protein kinase 12   51.2    8e-06   
ref|XP_006295877.1|  hypothetical protein CARUB_v10025007mg           51.2    8e-06   
ref|XP_006404926.1|  hypothetical protein EUTSA_v10000714mg           51.2    8e-06   
ref|XP_010507692.1|  PREDICTED: mitogen-activated protein kinase ...  51.2    9e-06   
ref|NP_494947.2|  Protein MPK-2, isoform b                            51.6    9e-06   
gb|KDN50491.1|  hypothetical protein RSAG8_00989                      51.6    9e-06   
emb|CDK29966.1|  unnamed protein product                              51.2    9e-06   
ref|XP_009496679.1|  CAMK protein kinase                              52.0    9e-06   
gb|ETK83981.1|  CMGC/CDK/CDC2 protein kinase                          50.8    9e-06   
gb|EPX70559.1|  CMGC/RCK/MAK protein kinase Pit1                      51.6    9e-06   
ref|XP_002884461.1|  hypothetical protein ARALYDRAFT_477739           48.9    9e-06   
gb|EUC64820.1|  alpha,alpha-trehalose-phosphate synthase              51.6    9e-06   
ref|XP_010518268.1|  PREDICTED: mitogen-activated protein kinase ...  51.2    9e-06   
ref|XP_010506603.1|  PREDICTED: mitogen-activated protein kinase ...  51.2    9e-06   
gb|ETI43935.1|  CMGC/CDK/CDC2 protein kinase                          50.8    9e-06   
emb|CDY55748.1|  BnaA05g35330D                                        50.8    9e-06   
emb|CDO94524.1|  unnamed protein product                              51.2    9e-06   
ref|XP_009494093.1|  CMGC/MAPK/P38 protein kinase                     51.6    9e-06   
emb|CEG65824.1|  hypothetical protein RMATCC62417_02524               51.6    9e-06   
emb|CEI99293.1|  hypothetical protein RMCBS344292_13384               51.2    9e-06   
gb|AFK49025.1|  unknown                                               51.6    9e-06   
emb|CDY66991.1|  BnaCnng53060D                                        50.8    1e-05   
ref|XP_004256896.1|  cell division control protein 15 , CDC15, pu...  52.0    1e-05   
gb|KHN79296.1|  Cyclin-dependent kinase 20                            51.2    1e-05   
ref|XP_009174321.1|  hypothetical protein T265_14978                  52.0    1e-05   
dbj|GAA38101.2|  Rho-associated protein kinase 2                      52.0    1e-05   
gb|AIC31012.1|  serine/threonine protein kinase-like domain-conta...  50.8    1e-05   
ref|NP_181590.1|  putative serine/threonine kinase                    50.8    1e-05   
emb|CDJ27850.1|  CMGC kinase, putative                                50.8    1e-05   
gb|ABQ85221.1|  BUD1                                                  48.9    1e-05   
gb|ABQ85222.1|  BUD1                                                  48.9    1e-05   
ref|XP_010632568.1|  PREDICTED: mitogen-activated protein kinase ...  50.4    1e-05   
ref|XP_002630655.1|  C. briggsae CBR-MPK-2 protein                    51.6    1e-05   
ref|XP_006353720.1|  PREDICTED: mitogen-activated protein kinase ...  51.2    1e-05   
ref|XP_003239910.1|  cyclin-dependent kinase-like 2                   50.8    1e-05   
emb|CCK72805.1|  hypothetical protein KNAG_0L01860                    50.8    1e-05   
ref|XP_010512905.1|  PREDICTED: mitogen-activated protein kinase ...  51.2    1e-05   
ref|XP_002997704.1|  cell division protein kinase, putative           50.8    1e-05   
gb|AHF87009.1|  nitrogen fixation serine/threonine-protein kinase     50.8    1e-05   
ref|NP_001021913.1|  Protein MPK-2, isoform c                         51.6    1e-05   
gb|EGT51072.1|  CBN-MPK-2 protein                                     51.6    1e-05   
emb|CAP24171.2|  Protein CBR-MPK-2                                    51.6    1e-05   
gb|ETO61668.1|  AGC protein kinase                                    51.2    1e-05   
ref|XP_008897660.1|  AGC protein kinase                               51.2    1e-05   
ref|XP_454284.1|  hypothetical protein                                50.8    1e-05   
emb|CDY17301.1|  BnaA10g09350D                                        51.2    1e-05   
gb|EPS71117.1|  hypothetical protein M569_03641                       50.8    1e-05   
ref|XP_009121273.1|  PREDICTED: mitogen-activated protein kinase ...  51.2    1e-05   
ref|XP_009165112.1|  hypothetical protein T265_02569                  52.0    1e-05   
ref|XP_003109019.1|  CRE-MPK-2 protein                                51.6    1e-05   
ref|NP_494946.2|  Protein MPK-2, isoform a                            51.6    1e-05   
ref|WP_018553868.1|  serine/threonine protein kinase                  51.2    1e-05   
dbj|GAA53903.1|  citron Rho-interacting kinase                        52.0    1e-05   
emb|CCH42999.1|  Casein kinase II subunit alpha                       50.8    1e-05   
ref|XP_011082542.1|  PREDICTED: mitogen-activated protein kinase ...  51.2    1e-05   
ref|XP_004242223.1|  PREDICTED: serine/threonine-protein kinase p...  50.8    1e-05   
ref|XP_010507478.1|  PREDICTED: serine/threonine-protein kinase P...  50.4    1e-05   
gb|ADD17355.1|  HOG1-like protein kinase                              50.8    1e-05   
ref|NP_180565.1|  mitogen-activated protein kinase kinase kinase 14   51.2    1e-05   
ref|XP_009149768.1|  PREDICTED: mitogen-activated protein kinase ...  50.8    1e-05   
ref|XP_004252025.1|  PREDICTED: mitogen-activated protein kinase ...  50.4    1e-05   
ref|XP_010106871.1|  Mitogen-activated protein kinase kinase kina...  50.4    1e-05   
ref|XP_003842518.1|  hypothetical protein LEMA_P082780.1              50.4    1e-05   
gb|AAY82585.1|  putative MAP kinase                                   49.3    1e-05   
ref|WP_018101908.1|  MULTISPECIES: serine/threonine protein kinase    50.8    1e-05   
ref|XP_006411516.1|  hypothetical protein EUTSA_v10017904mg           50.8    1e-05   
sp|Q4PNJ1.1|HOG1_FUSCU  RecName: Full=Mitogen-activated protein k...  49.3    1e-05   
ref|XP_001300194.1|  CMGC family protein kinase                       50.8    1e-05   
ref|XP_009144189.1|  PREDICTED: mitogen-activated protein kinase ...  50.8    1e-05   
emb|CCA73946.1|  probable osmotic sensitive-2 protein (putative m...  50.4    1e-05   
ref|XP_001423977.1|  hypothetical protein                             51.2    1e-05   
ref|XP_001308566.1|  CMGC family protein kinase                       50.8    1e-05   
ref|XP_003389961.1|  PREDICTED: hypothetical protein LOC100633652     51.6    1e-05   
gb|EPE02190.1|  protein kinase                                        51.6    1e-05   
gb|KFY52800.1|  hypothetical protein V497_08442                       50.1    1e-05   
gb|KFX89455.1|  hypothetical protein V490_07005                       50.4    1e-05   
ref|XP_008046279.1|  PREDICTED: mitogen-activated protein kinase 12   50.4    1e-05   
ref|XP_006353719.1|  PREDICTED: mitogen-activated protein kinase ...  50.4    1e-05   
ref|XP_003675903.1|  hypothetical protein NCAS_0C05490                50.4    1e-05   
gb|EPY51717.1|  CMGC/RCK/MAK protein kinase Pit1                      51.2    1e-05   
gb|AAN61521.1|  301KDa_2 protein                                      51.6    1e-05   
gb|AAN61520.1|  301KDa_1 protein                                      51.6    1e-05   
pir||T34416  hypothetical protein F12F3.2 - Caenorhabditis elegans    51.6    1e-05
ref|XP_010508835.1|  PREDICTED: serine/threonine-protein kinase 1...  50.4    1e-05   
ref|XP_009783859.1|  PREDICTED: mitogen-activated protein kinase ...  50.8    1e-05   
gb|KFM27703.1|  Mitogen-activated protein kinase 4                    50.8    1e-05   
gb|EYU34013.1|  hypothetical protein MIMGU_mgv1a020948mg              50.4    1e-05   
ref|XP_002879960.1|  hypothetical protein ARALYDRAFT_483279           50.4    1e-05   
ref|XP_004244346.1|  PREDICTED: mitogen-activated protein kinase ...  50.8    1e-05   
ref|XP_010275095.1|  PREDICTED: mitogen-activated protein kinase ...  50.4    1e-05   
ref|XP_008346208.1|  PREDICTED: mitogen-activated protein kinase ...  50.1    1e-05   
emb|CDW53561.1|  serine:threonine protein kinase D3                   51.2    1e-05   
ref|NP_001024203.1|  Protein TTN-1, isoform f                         51.6    1e-05   
ref|NP_001024202.1|  Protein TTN-1, isoform e                         51.6    1e-05   
ref|NP_001024204.1|  Protein TTN-1, isoform g                         51.6    1e-05   
gb|AGG18075.1|  hog1 protein                                          50.4    1e-05   
ref|XP_010430889.1|  PREDICTED: mitogen-activated protein kinase ...  50.8    1e-05   
sp|Q4PKS0.1|HOG1_GIBIN  RecName: Full=Mitogen-activated protein k...  49.3    2e-05   
ref|XP_002837997.1|  hypothetical protein                             50.4    2e-05   
gb|EPZ36165.1|  Protein kinase, catalytic domain-containing protein   50.4    2e-05   
emb|CEG77459.1|  hypothetical protein RMATCC62417_12207               50.4    2e-05   
ref|XP_003738358.1|  PREDICTED: serine/threonine-protein kinase D3    51.2    2e-05   
ref|XP_006294159.1|  hypothetical protein CARUB_v10023152mg           50.8    2e-05   
ref|WP_037702053.1|  serine/threonine protein kinase                  50.8    2e-05   
ref|XP_001803505.1|  hypothetical protein SNOG_13296                  50.1    2e-05   
ref|XP_010537511.1|  PREDICTED: mitogen-activated protein kinase ...  50.4    2e-05   
ref|WP_030930457.1|  serine/threonine protein kinase                  50.8    2e-05   
ref|WP_030972431.1|  serine/threonine protein kinase                  50.8    2e-05   
ref|XP_006453743.1|  hypothetical protein AGABI2DRAFT_41003           50.4    2e-05   
ref|XP_009270326.1|  Mitogen-activated protein kinase HOG1            50.4    2e-05   
ref|WP_002881447.1|  Serine/threonine protein kinase                  50.1    2e-05   
emb|CDH14234.1|  probable CKA2-Casein kinase II alpha` chain          50.4    2e-05   
emb|CCG83352.1|  Mitogen-activated protein kinase hog1                50.4    2e-05   
gb|EPQ65454.1|  Mitogen-activated protein kinase                      50.4    2e-05   
gb|KEQ97934.1|  hypothetical protein AUEXF2481DRAFT_37504             50.4    2e-05   
gb|KEQ70577.1|  mitogen-activated protein kinase Hog1                 50.4    2e-05   
gb|KEQ63082.1|  mitogen-activated protein kinase Hog1                 50.4    2e-05   
ref|XP_001935555.1|  mitogen-activated protein kinase HOG1            50.4    2e-05   
gb|KEQ83837.1|  Hog1-like MAP kinase protein                          50.4    2e-05   
ref|XP_008026125.1|  hypothetical protein SETTUDRAFT_47519            50.4    2e-05   
ref|XP_001457796.1|  hypothetical protein                             50.8    2e-05   
ref|XP_004914965.1|  PREDICTED: protein kinase C delta type-like      50.8    2e-05   
ref|XP_009821772.1|  CMGC/CDK/CDC2 protein kinase                     50.1    2e-05   
ref|XP_007710641.1|  hypothetical protein COCCADRAFT_91929            50.4    2e-05   
ref|WP_024489494.1|  serine/threonine protein kinase                  50.8    2e-05   
emb|CDI56475.1|  probable osmotic sensitive-2 protein (putative m...  50.4    2e-05   
ref|XP_758504.1|  hypothetical protein UM02357.1                      50.4    2e-05   
gb|ETS60865.1|  hypothetical protein PaG_04782                        50.4    2e-05   
ref|XP_007922665.1|  mitogen-activated protein kinase                 50.4    2e-05   
emb|CCF51821.1|  probable osmotic sensitive-2 protein (putative m...  50.4    2e-05   
sp|Q4W6D3.1|HOG1_COCHE  RecName: Full=Mitogen-activated protein k...  50.4    2e-05   
ref|XP_504383.1|  YALI0E25135p                                        50.4    2e-05   
gb|EST05869.1|  Protein kinase                                        50.4    2e-05   
ref|XP_007676263.1|  hypothetical protein BAUCODRAFT_69717            50.4    2e-05   
ref|XP_002897623.1|  protein kinase, putative                         50.4    2e-05   
ref|XP_007877403.1|  hypothetical protein PFL1_01702                  50.4    2e-05   



>ref|XP_009618162.1| PREDICTED: mitogen-activated protein kinase kinase kinase NPK1-like 
[Nicotiana tomentosiformis]
Length=252

 Score = 79.0 bits (193),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 33/59 (56%), Positives = 46/59 (78%), Gaps = 0/59 (0%)
 Frame = -3

Query  183  EGEVAFYAYQLLVGLSDLHAMGIVHCDLKPLNVLVFPMEQNGLNRLKIADFGLAIQDGK  7
            E E+ FYAYQLL G+ D+H  G VHCD+KP NVLVF   + G+++LK+ADFGL+++ G+
Sbjct  3    EVEIGFYAYQLLKGIQDVHKKGWVHCDIKPANVLVFEANERGMHKLKLADFGLSLRIGE  61



>ref|XP_009781047.1| PREDICTED: mitogen-activated protein kinase kinase kinase NPK1-like, 
partial [Nicotiana sylvestris]
Length=209

 Score = 77.8 bits (190),  Expect = 8e-16, Method: Composition-based stats.
 Identities = 33/59 (56%), Positives = 45/59 (76%), Gaps = 0/59 (0%)
 Frame = -3

Query  183  EGEVAFYAYQLLVGLSDLHAMGIVHCDLKPLNVLVFPMEQNGLNRLKIADFGLAIQDGK  7
            E E+ FYAYQLL G+ D+H  G VHCD+KP NVLVF   + G+ +LK+ADFGL+++ G+
Sbjct  3    EVEIGFYAYQLLKGIQDVHKRGWVHCDIKPANVLVFDANERGMYKLKLADFGLSLRIGE  61



>ref|XP_006367407.1| PREDICTED: mitogen-activated protein kinase kinase kinase 4-like 
[Solanum tuberosum]
Length=348

 Score = 78.2 bits (191),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 31/56 (55%), Positives = 45/56 (80%), Gaps = 0/56 (0%)
 Frame = -3

Query  183  EGEVAFYAYQLLVGLSDLHAMGIVHCDLKPLNVLVFPMEQNGLNRLKIADFGLAIQ  16
            E E A+YA+Q+LVG+  +H+ G +HCDLKP N+LVFP  Q+GL  +K+ADFGL+++
Sbjct  102  ESEAAYYAFQILVGICHVHSKGFIHCDLKPANILVFPGGQHGLANVKLADFGLSLR  157



>ref|XP_007019852.1| Mitogen-activated protein kinase kinase kinase 21, putative [Theobroma 
cacao]
 gb|EOY17077.1| Mitogen-activated protein kinase kinase kinase 21, putative [Theobroma 
cacao]
Length=316

 Score = 73.2 bits (178),  Expect = 6e-14, Method: Composition-based stats.
 Identities = 36/60 (60%), Positives = 43/60 (72%), Gaps = 1/60 (2%)
 Frame = -3

Query  183  EGEVAFYAYQLLVGLSDLHAMGIVHCDLKPLNVLVFPMEQNGL-NRLKIADFGLAIQDGK  7
            E    FYA  L++GL ++H  G VHCDLKP N+LVFP + NGL N LKIADFGLA Q G+
Sbjct  119  ECNARFYARMLVLGLRNIHERGYVHCDLKPENILVFPFDLNGLINGLKIADFGLAKQPGE  178



>ref|XP_010094786.1| putative serine/threonine-protein kinase [Morus notabilis]
 gb|EXB57022.1| putative serine/threonine-protein kinase [Morus notabilis]
Length=177

 Score = 72.0 bits (175),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 31/54 (57%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -3

Query  183  EGEVAFYAYQLLVGLSDLHAMGIVHCDLKPLNVLVFPMEQNGLNRLKIADFGLA  22
            E +V  Y + +L GLS +HA G+VHCD+KP N+LVFP E +G+ +LKI+DFGLA
Sbjct  11   EIDVRLYTWMVLNGLSRIHAKGVVHCDIKPDNILVFPTEHDGIYQLKISDFGLA  64



>ref|XP_006367406.1| PREDICTED: mitogen-activated protein kinase kinase kinase 4-like 
[Solanum tuberosum]
Length=489

 Score = 73.6 bits (179),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 30/56 (54%), Positives = 43/56 (77%), Gaps = 0/56 (0%)
 Frame = -3

Query  183  EGEVAFYAYQLLVGLSDLHAMGIVHCDLKPLNVLVFPMEQNGLNRLKIADFGLAIQ  16
            E E A+YA+Q+LVG+  +H  G +HCDLKP  +LVFP  Q+GL  +K+ADFGL+++
Sbjct  102  ESEAAYYAFQILVGICHVHRKGFIHCDLKPAYILVFPGGQHGLANVKLADFGLSLR  157



>ref|XP_006355243.1| PREDICTED: mitogen-activated protein kinase kinase kinase NPK1-like 
[Solanum tuberosum]
Length=324

 Score = 71.6 bits (174),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 30/54 (56%), Positives = 41/54 (76%), Gaps = 0/54 (0%)
 Frame = -3

Query  183  EGEVAFYAYQLLVGLSDLHAMGIVHCDLKPLNVLVFPMEQNGLNRLKIADFGLA  22
            E EVA+Y++Q+L G+S +H  G +HCDLKP N+LVFP  Q  +  LK+ADFGL+
Sbjct  105  ESEVAYYSFQILTGISHIHRNGYIHCDLKPANILVFPRAQLDVPDLKLADFGLS  158



>ref|XP_010325688.1| PREDICTED: mitogen-activated protein kinase kinase kinase NPK1-like 
[Solanum lycopersicum]
Length=313

 Score = 71.6 bits (174),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 32/57 (56%), Positives = 44/57 (77%), Gaps = 1/57 (2%)
 Frame = -3

Query  183  EGEVAFYAYQLLVGLSDLHAMGIVHCDLKPLNVLVF-PMEQNGLNRLKIADFGLAIQ  16
            E EV FYAYQLL G+  +H  G VHCD+KP NVL+F   E+ G+++LK+ADFGL+++
Sbjct  109  EVEVGFYAYQLLKGIQHVHEKGWVHCDIKPANVLIFNNAERGGMHKLKLADFGLSLR  165



>ref|XP_006355242.1| PREDICTED: mitogen-activated protein kinase kinase kinase 2-like 
[Solanum tuberosum]
Length=350

 Score = 71.6 bits (174),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 31/56 (55%), Positives = 43/56 (77%), Gaps = 1/56 (2%)
 Frame = -3

Query  183  EGEVAFYAYQLLVGLSDLHAMGIVHCDLKPLNVLVFPMEQNGLNRLKIADFGLAIQ  16
            E E A+YA+QLL G+S +H  G +HCDLKP N+LVFP  +  + RLK+ADFGL+++
Sbjct  105  ESEAAYYAFQLLEGISHVHNKGFIHCDLKPANILVFPPTEKYM-RLKLADFGLSLK  159



>ref|XP_009597448.1| PREDICTED: mitogen-activated protein kinase kinase kinase ANP1-like 
[Nicotiana tomentosiformis]
Length=356

 Score = 70.9 bits (172),  Expect = 8e-13, Method: Composition-based stats.
 Identities = 32/61 (52%), Positives = 43/61 (70%), Gaps = 5/61 (8%)
 Frame = -3

Query  183  EGEVAFYAYQLLVGLSDLHAMGIVHCDLKPLNVLVFPMEQNGLN-----RLKIADFGLAI  19
            E EVA+YA+QLL G+S +H  G +HCDLKP N+LVFP   +        RLK+ADFGL++
Sbjct  104  ESEVAYYAFQLLTGISHVHRKGFIHCDLKPSNILVFPTVDHEYGSIVDVRLKLADFGLSL  163

Query  18   Q  16
            +
Sbjct  164  K  164



>ref|XP_009791903.1| PREDICTED: mitogen-activated protein kinase kinase kinase NPK1-like 
[Nicotiana sylvestris]
Length=354

 Score = 70.5 bits (171),  Expect = 9e-13, Method: Composition-based stats.
 Identities = 32/61 (52%), Positives = 43/61 (70%), Gaps = 5/61 (8%)
 Frame = -3

Query  183  EGEVAFYAYQLLVGLSDLHAMGIVHCDLKPLNVLVFPMEQNGLN-----RLKIADFGLAI  19
            E EVA+YA+QLL G+S +H  G +HCDLKP N+LVFP   +        RLK+ADFGL++
Sbjct  104  ESEVAYYAFQLLTGISHVHRKGFIHCDLKPSNILVFPTIDDEYGSIVDVRLKLADFGLSL  163

Query  18   Q  16
            +
Sbjct  164  R  164



>ref|XP_004243871.1| PREDICTED: mitogen-activated protein kinase kinase kinase 2-like 
[Solanum lycopersicum]
Length=349

 Score = 70.1 bits (170),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 28/56 (50%), Positives = 42/56 (75%), Gaps = 0/56 (0%)
 Frame = -3

Query  183  EGEVAFYAYQLLVGLSDLHAMGIVHCDLKPLNVLVFPMEQNGLNRLKIADFGLAIQ  16
            E + A+YA+Q+LVG+  +H  G +HCDLKP N+LVFP  Q+ L  +K+ADFG +++
Sbjct  102  EADAAYYAFQILVGICHVHRKGFIHCDLKPANILVFPGGQHRLASVKLADFGASLR  157



>ref|XP_004245431.1| PREDICTED: mitogen-activated protein kinase kinase kinase NPK1-like 
[Solanum lycopersicum]
Length=320

 Score = 69.7 bits (169),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 29/55 (53%), Positives = 39/55 (71%), Gaps = 0/55 (0%)
 Frame = -3

Query  183  EGEVAFYAYQLLVGLSDLHAMGIVHCDLKPLNVLVFPMEQNGLNRLKIADFGLAI  19
            E E A+Y +Q+L G+S +H  G VHCDLKP N+LVFP  Q  +  LK+ DFGL++
Sbjct  106  ESEAAYYTFQILSGISHIHRKGYVHCDLKPANILVFPRPQFKVPHLKLTDFGLSL  160



>ref|XP_009607566.1| PREDICTED: protein kinase byr2-like [Nicotiana tomentosiformis]
Length=348

 Score = 68.6 bits (166),  Expect = 5e-12, Method: Composition-based stats.
 Identities = 30/61 (49%), Positives = 44/61 (72%), Gaps = 5/61 (8%)
 Frame = -3

Query  183  EGEVAFYAYQLLVGLSDLHAMGIVHCDLKPLNVLVFPMEQNGLN-----RLKIADFGLAI  19
            E +VA+Y++QLL G+S +H  G +HCDLKP N+LVFP   +  +     RLK+ADFGL++
Sbjct  104  ESQVAYYSFQLLTGISHVHRKGFIHCDLKPSNILVFPTIDHEYDSIVDVRLKLADFGLSL  163

Query  18   Q  16
            +
Sbjct  164  R  164



>ref|XP_009770458.1| PREDICTED: mitogen-activated protein kinase kinase kinase ANP1-like 
[Nicotiana sylvestris]
Length=528

 Score = 68.9 bits (167),  Expect = 8e-12, Method: Composition-based stats.
 Identities = 31/61 (51%), Positives = 43/61 (70%), Gaps = 5/61 (8%)
 Frame = -3

Query  183  EGEVAFYAYQLLVGLSDLHAMGIVHCDLKPLNVLVFPMEQNGLN-----RLKIADFGLAI  19
            E +VA+YA+QLL G+S +H  G +HCDLKP N+LVFP   +        RLK+ADFGL++
Sbjct  104  ESKVAYYAFQLLTGISHVHRKGFIHCDLKPSNILVFPTIDDEYGSIVDVRLKLADFGLSL  163

Query  18   Q  16
            +
Sbjct  164  R  164



>ref|XP_010093852.1| MAP kinase kinase kinase mkh1 [Morus notabilis]
 gb|EXB54740.1| MAP kinase kinase kinase mkh1 [Morus notabilis]
Length=78

 Score = 63.5 bits (153),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 29/44 (66%), Positives = 36/44 (82%), Gaps = 0/44 (0%)
 Frame = -3

Query  153  LLVGLSDLHAMGIVHCDLKPLNVLVFPMEQNGLNRLKIADFGLA  22
            +L GLS +HA GIVHCD+KP N+LVFP E +G+  LKI+DFGLA
Sbjct  2    ILKGLSCIHAKGIVHCDIKPDNILVFPCEHDGIYGLKISDFGLA  45



>ref|XP_009605056.1| PREDICTED: mitogen-activated protein kinase kinase kinase 2-like 
[Nicotiana tomentosiformis]
Length=323

 Score = 66.2 bits (160),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 30/63 (48%), Positives = 44/63 (70%), Gaps = 4/63 (6%)
 Frame = -3

Query  183  EGEVAFYAYQLLVGLSDLHAMGIVHCDLKPLNVLVFP---MEQNGL-NRLKIADFGLAIQ  16
            E E A+Y YQ+L+ +  +H+ G +HCD+ P N+LVFP   +  NG+ NRLK+ADFG A +
Sbjct  117  EEEAAYYTYQILMAIFHIHSKGYIHCDINPQNILVFPNAVIHANGVNNRLKLADFGSAQR  176

Query  15   DGK  7
             G+
Sbjct  177  KGE  179



>ref|XP_011004631.1| PREDICTED: mitogen-activated protein kinase kinase kinase A-like 
[Populus euphratica]
Length=303

 Score = 65.5 bits (158),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 34/61 (56%), Positives = 42/61 (69%), Gaps = 2/61 (3%)
 Frame = -3

Query  183  EGEVAFYAYQLLVGLSDLHAMGIVHCDLKPLNVLVFPMEQNGLN--RLKIADFGLAIQDG  10
            E  V  Y   LL GLS +H  G VHCDLKP N+LVFP + +GL+  +LKIADFGLA + G
Sbjct  104  ESHVRKYTKMLLKGLSCIHNSGHVHCDLKPANILVFPRQVDGLSDIQLKIADFGLAKEPG  163

Query  9    K  7
            +
Sbjct  164  E  164



>ref|XP_002267176.1| PREDICTED: mitogen-activated protein kinase kinase kinase 2 [Vitis 
vinifera]
 emb|CBI23749.3| unnamed protein product [Vitis vinifera]
Length=329

 Score = 65.5 bits (158),  Expect = 6e-11, Method: Composition-based stats.
 Identities = 30/59 (51%), Positives = 40/59 (68%), Gaps = 1/59 (2%)
 Frame = -3

Query  183  EGEVAFYAYQLLVGLSDLHAMGIVHCDLKPLNVLVFPMEQNGLNRLKIADFGLAIQDGK  7
            E  V  Y   +L GL  +H  G VHCD+KP N+L+FP+E  G N++KIADFGLA + G+
Sbjct  104  ESNVQLYTRMILKGLCHIHEKGYVHCDIKPSNMLIFPLEDGG-NKVKIADFGLAKRIGE  161



>ref|XP_006352951.1| PREDICTED: mitogen-activated protein kinase kinase kinase 4-like 
[Solanum tuberosum]
Length=281

 Score = 64.3 bits (155),  Expect = 9e-11, Method: Composition-based stats.
 Identities = 27/54 (50%), Positives = 40/54 (74%), Gaps = 0/54 (0%)
 Frame = -3

Query  183  EGEVAFYAYQLLVGLSDLHAMGIVHCDLKPLNVLVFPMEQNGLNRLKIADFGLA  22
            E +V+++AYQLL G+ D+H  G VHCD+KP NVL+F   Q+    LK++DFG++
Sbjct  109  EKQVSYFAYQLLKGIQDVHNTGWVHCDIKPTNVLIFKYAQHIGLHLKLSDFGMS  162



>ref|XP_009609364.1| PREDICTED: MAP kinase kinase kinase wis4-like [Nicotiana tomentosiformis]
Length=507

 Score = 65.9 bits (159),  Expect = 9e-11, Method: Composition-based stats.
 Identities = 30/63 (48%), Positives = 44/63 (70%), Gaps = 4/63 (6%)
 Frame = -3

Query  183  EGEVAFYAYQLLVGLSDLHAMGIVHCDLKPLNVLVFP---MEQNGL-NRLKIADFGLAIQ  16
            E E A+Y YQ+L+ +  +H+ G +HCD+ P N+LVFP   +  NG+ NRLK+ADFG A +
Sbjct  301  EEEAAYYTYQILMAIFHIHSKGYIHCDINPQNILVFPNAVIHANGVNNRLKLADFGSAQR  360

Query  15   DGK  7
             G+
Sbjct  361  KGE  363


 Score = 65.9 bits (159),  Expect = 9e-11, Method: Composition-based stats.
 Identities = 30/63 (48%), Positives = 44/63 (70%), Gaps = 4/63 (6%)
 Frame = -3

Query  183  EGEVAFYAYQLLVGLSDLHAMGIVHCDLKPLNVLVFP---MEQNGL-NRLKIADFGLAIQ  16
            E E A+Y YQ+L+ +  +H+ G +HCD+ P N+LVFP   +  NG+ NRLK+ADFG A +
Sbjct  117  EEEAAYYTYQILMAILHIHSKGYIHCDINPQNILVFPNAVIHANGVNNRLKLADFGSAQR  176

Query  15   DGK  7
             G+
Sbjct  177  KGE  179



>ref|XP_007021946.1| Mitogen-activated protein kinase kinase kinase 21, putative [Theobroma 
cacao]
 gb|EOY13471.1| Mitogen-activated protein kinase kinase kinase 21, putative [Theobroma 
cacao]
Length=330

 Score = 65.1 bits (157),  Expect = 9e-11, Method: Composition-based stats.
 Identities = 32/54 (59%), Positives = 35/54 (65%), Gaps = 0/54 (0%)
 Frame = -3

Query  183  EGEVAFYAYQLLVGLSDLHAMGIVHCDLKPLNVLVFPMEQNGLNRLKIADFGLA  22
            E  V  Y   +L GL D+H  G VHCDLKP NVLV+P  Q GL  LKI DFGLA
Sbjct  122  ESYVRCYIRMILGGLCDIHKRGYVHCDLKPENVLVYPSNQYGLFTLKIGDFGLA  175



>ref|XP_010090324.1| Mitogen-activated protein kinase kinase kinase 2 [Morus notabilis]
 gb|EXB39294.1| Mitogen-activated protein kinase kinase kinase 2 [Morus notabilis]
Length=287

 Score = 64.3 bits (155),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 29/50 (58%), Positives = 35/50 (70%), Gaps = 0/50 (0%)
 Frame = -3

Query  174  VAFYAYQLLVGLSDLHAMGIVHCDLKPLNVLVFPMEQNGLNRLKIADFGL  25
            +  Y   +L GL  +HA G VHCDLKP N+LVFP +Q G  R+KIADFGL
Sbjct  119  IRIYTTIILKGLRYMHAKGYVHCDLKPDNILVFPSDQRGCYRVKIADFGL  168



>ref|XP_010658122.1| PREDICTED: mitogen-activated protein kinase kinase kinase 2-like 
[Vitis vinifera]
Length=366

 Score = 64.7 bits (156),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 33/61 (54%), Positives = 41/61 (67%), Gaps = 1/61 (2%)
 Frame = -3

Query  183  EGEVAFYAYQLLVGLSDLHAMGIVHCDLKPLNVLVFPMEQNGLNRLKIADFGLAIQDGKI  4
            E EV  YA  +  GL  +H  G+ HCDLKP NVLVFP +  G N +KIADFG+A +DG+ 
Sbjct  103  EPEVRHYARMIARGLCHMHERGLTHCDLKPDNVLVFPGKDGG-NVVKIADFGMARRDGEQ  161

Query  3    E  1
            E
Sbjct  162  E  162



>ref|XP_007032910.1| Mitogen-activated protein kinase kinase kinase 21, putative [Theobroma 
cacao]
 gb|EOY03836.1| Mitogen-activated protein kinase kinase kinase 21, putative [Theobroma 
cacao]
Length=304

 Score = 63.2 bits (152),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 31/54 (57%), Positives = 40/54 (74%), Gaps = 1/54 (2%)
 Frame = -3

Query  165  YAYQLLVGLSDLHAMGIVHCDLKPLNVLVFPMEQNG-LNRLKIADFGLAIQDGK  7
            YA  L+ G+ D+H  G VHCDLKP NVLV+P ++ G ++ LKIADFGLA Q G+
Sbjct  125  YARILVEGVRDIHERGYVHCDLKPGNVLVYPSDEYGSVSSLKIADFGLAEQPGE  178



>ref|XP_010658120.1| PREDICTED: calcium/calmodulin-dependent protein kinase type II 
delta chain-like [Vitis vinifera]
Length=124

 Score = 60.8 bits (146),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 31/54 (57%), Positives = 38/54 (70%), Gaps = 1/54 (2%)
 Frame = -3

Query  183  EGEVAFYAYQLLVGLSDLHAMGIVHCDLKPLNVLVFPMEQNGLNRLKIADFGLA  22
            E E   YA  ++ GL  +H  G+VHCD+KP NVLVFP E NG N +K+ADFGLA
Sbjct  34   EFEARHYARMIIRGLRYMHERGVVHCDVKPDNVLVFPGE-NGGNVVKLADFGLA  86



>gb|KHN40490.1| MAP kinase kinase kinase mkh1 [Glycine soja]
Length=290

 Score = 62.0 bits (149),  Expect = 7e-10, Method: Composition-based stats.
 Identities = 31/56 (55%), Positives = 42/56 (75%), Gaps = 2/56 (4%)
 Frame = -3

Query  183  EGEVAFYAYQLLVGLSDLHAMGIVHCDLKPLNVLVFPM-EQNGLN-RLKIADFGLA  22
            E +V  Y+  LL GLS +H  G+VHCDLKP N+L+FP  E+N ++ +LKIADFGL+
Sbjct  116  ESQVRVYSRMLLKGLSLVHRFGVVHCDLKPDNILLFPSGEENDVDYQLKIADFGLS  171



>ref|XP_006603574.1| PREDICTED: mitogen-activated protein kinase kinase kinase A-like 
[Glycine max]
Length=290

 Score = 62.0 bits (149),  Expect = 7e-10, Method: Composition-based stats.
 Identities = 31/56 (55%), Positives = 42/56 (75%), Gaps = 2/56 (4%)
 Frame = -3

Query  183  EGEVAFYAYQLLVGLSDLHAMGIVHCDLKPLNVLVFPM-EQNGLN-RLKIADFGLA  22
            E +V  Y+  LL GLS +H  G+VHCDLKP N+L+FP  E+N ++ +LKIADFGL+
Sbjct  116  ESQVRVYSRMLLKGLSLVHRFGVVHCDLKPDNILLFPSGEENDVDYQLKIADFGLS  171



>ref|XP_002281578.1| PREDICTED: mitogen-activated protein kinase kinase kinase 2-like 
[Vitis vinifera]
Length=385

 Score = 62.8 bits (151),  Expect = 8e-10, Method: Composition-based stats.
 Identities = 34/61 (56%), Positives = 41/61 (67%), Gaps = 1/61 (2%)
 Frame = -3

Query  183  EGEVAFYAYQLLVGLSDLHAMGIVHCDLKPLNVLVFPMEQNGLNRLKIADFGLAIQDGKI  4
            E EV  YA  ++ GL  +H  G+VHCDLKP NVLVFP    G N +KIADFGLA + G+ 
Sbjct  106  ESEVRDYARMIIRGLCYIHQKGLVHCDLKPDNVLVFPGVDGG-NVVKIADFGLAKRVGEE  164

Query  3    E  1
            E
Sbjct  165  E  165



>ref|XP_007021680.1| Mitogen-activated protein kinase kinase kinase 21, putative [Theobroma 
cacao]
 gb|EOY13205.1| Mitogen-activated protein kinase kinase kinase 21, putative [Theobroma 
cacao]
Length=322

 Score = 62.0 bits (149),  Expect = 9e-10, Method: Composition-based stats.
 Identities = 31/55 (56%), Positives = 37/55 (67%), Gaps = 1/55 (2%)
 Frame = -3

Query  183  EGEVAFYAYQLLVGLSDLHAMGIVHCDLKPLNVLVFPMEQ-NGLNRLKIADFGLA  22
            E  V  Y   LL GL D+H  G VHCDLKP N+LV P +Q + L+ L+IADFGLA
Sbjct  122  ESHVKSYTRMLLEGLRDVHKRGYVHCDLKPGNILVHPSDQPDSLSTLRIADFGLA  176



>ref|XP_002312977.2| hypothetical protein POPTR_0009s13360g [Populus trichocarpa]
 gb|EEE86932.2| hypothetical protein POPTR_0009s13360g [Populus trichocarpa]
Length=303

 Score = 60.8 bits (146),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 32/61 (52%), Positives = 41/61 (67%), Gaps = 2/61 (3%)
 Frame = -3

Query  183  EGEVAFYAYQLLVGLSDLHAMGIVHCDLKPLNVLVFPMEQNGLN--RLKIADFGLAIQDG  10
            E  V  Y   LL GLS +H+ G VHCDLKP N+LVFP + + L+  +LKIAD GLA + G
Sbjct  104  ESHVRKYTKMLLKGLSCIHSSGHVHCDLKPANILVFPRQVDRLSDIQLKIADIGLAKEPG  163

Query  9    K  7
            +
Sbjct  164  E  164



>gb|KHN37195.1| Mitogen-activated protein kinase kinase kinase ANP1 [Glycine 
soja]
Length=247

 Score = 59.3 bits (142),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 29/55 (53%), Positives = 38/55 (69%), Gaps = 1/55 (2%)
 Frame = -3

Query  183  EGEVAFYAYQLLVGLSDLHAMGIVHCDLKPLNVLVFP-MEQNGLNRLKIADFGLA  22
            + EV  Y   LL GLS +H  G+VHCDLKP N+L+FP  + +   +LKIADFGL+
Sbjct  58   DSEVRVYTRMLLKGLSCIHRKGVVHCDLKPDNILLFPSSDDHARYQLKIADFGLS  112



>ref|XP_010658127.1| PREDICTED: mitogen-activated protein kinase kinase kinase 2-like 
[Vitis vinifera]
Length=266

 Score = 59.7 bits (143),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 31/61 (51%), Positives = 41/61 (67%), Gaps = 1/61 (2%)
 Frame = -3

Query  183  EGEVAFYAYQLLVGLSDLHAMGIVHCDLKPLNVLVFPMEQNGLNRLKIADFGLAIQDGKI  4
            EGEV  +   ++ GL D+H  G VHCDLK  N+LVF  E NG +++KIADFG A + G+ 
Sbjct  101  EGEVQRFTRMIVRGLRDVHKEGFVHCDLKVDNILVFHSE-NGGHKVKIADFGHAKRSGRE  159

Query  3    E  1
            E
Sbjct  160  E  160



>ref|XP_007145474.1| hypothetical protein PHAVU_007G242000g [Phaseolus vulgaris]
 gb|ESW17468.1| hypothetical protein PHAVU_007G242000g [Phaseolus vulgaris]
Length=298

 Score = 60.1 bits (144),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 30/60 (50%), Positives = 40/60 (67%), Gaps = 1/60 (2%)
 Frame = -3

Query  183  EGEVAFYAYQLLVGLSDLHAMGIVHCDLKPLNVLVFP-MEQNGLNRLKIADFGLAIQDGK  7
            E EV  Y + LL GL  +H  G+VHCDLKP N+L+FP  + +   +LKIADFGL+   G+
Sbjct  105  EKEVIIYTHMLLKGLCCIHREGVVHCDLKPDNILLFPSSDAHAKYQLKIADFGLSKTRGE  164



>ref|XP_006410091.1| hypothetical protein EUTSA_v10017626mg [Eutrema salsugineum]
 ref|XP_006410092.1| hypothetical protein EUTSA_v10017749mg [Eutrema salsugineum]
 gb|ESQ51544.1| hypothetical protein EUTSA_v10017626mg [Eutrema salsugineum]
 gb|ESQ51545.1| hypothetical protein EUTSA_v10017749mg [Eutrema salsugineum]
Length=276

 Score = 59.7 bits (143),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 30/58 (52%), Positives = 39/58 (67%), Gaps = 6/58 (10%)
 Frame = -3

Query  165  YAYQLLVGLSDLHAMGIVHCDLKPLNVLVFP--MEQNGLNR----LKIADFGLAIQDG  10
            +   LL GL+ +H  G VHCDLKP N+LVFP  + +NG  R    LKI+DFGL+ +DG
Sbjct  114  FTLMLLEGLATIHGHGYVHCDLKPDNILVFPSCVSKNGCRRTSYELKISDFGLSRRDG  171



>ref|XP_007099532.1| Kinase superfamily protein, partial [Theobroma cacao]
 gb|EOY20498.1| Kinase superfamily protein, partial [Theobroma cacao]
Length=306

 Score = 60.1 bits (144),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 32/60 (53%), Positives = 39/60 (65%), Gaps = 3/60 (5%)
 Frame = -3

Query  183  EGEVAFYAYQLLVGLSDLHAMGIVHCDLKPLNVLVFPMEQNG--LNRLKIADFGLAIQDG  10
            E    FYA  +L GL D+H  G +H DLKP N+LVFP  Q+G  L+ LKIADFGL  + G
Sbjct  60   ERHAKFYARMILEGLVDIHRKGYIHSDLKPRNILVFP-SQDGISLDTLKIADFGLVKKYG  118



>ref|XP_006410262.1| hypothetical protein EUTSA_v10017935mg [Eutrema salsugineum]
 gb|ESQ51715.1| hypothetical protein EUTSA_v10017935mg [Eutrema salsugineum]
Length=276

 Score = 59.7 bits (143),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 30/58 (52%), Positives = 39/58 (67%), Gaps = 6/58 (10%)
 Frame = -3

Query  165  YAYQLLVGLSDLHAMGIVHCDLKPLNVLVFP--MEQNGLNR----LKIADFGLAIQDG  10
            +   LL GL+ +H  G VHCDLKP N+LVFP  + +NG  R    LKI+DFGL+ +DG
Sbjct  113  FTLMLLEGLATIHGHGYVHCDLKPDNILVFPSFVSKNGWRRTSYELKISDFGLSRRDG  170



>ref|XP_008446738.1| PREDICTED: mitogen-activated protein kinase kinase kinase A-like 
[Cucumis melo]
Length=242

 Score = 58.9 bits (141),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 30/59 (51%), Positives = 39/59 (66%), Gaps = 1/59 (2%)
 Frame = -3

Query  183  EGEVAFYAYQLLVGLSDLHAMGIVHCDLKPLNVLVFPMEQNGLNRLKIADFGLAIQDGK  7
            E EV  Y   +L GLS +H  G VH DLKP N+L FP + NG  +LKIADFG++ + G+
Sbjct  88   ENEVKEYLKMILKGLSCIHRKGFVHADLKPANILAFP-QNNGKMKLKIADFGISRRCGE  145



>ref|XP_006582669.1| PREDICTED: mitogen-activated protein kinase kinase kinase A-like 
[Glycine max]
Length=281

 Score = 59.3 bits (142),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 29/55 (53%), Positives = 38/55 (69%), Gaps = 1/55 (2%)
 Frame = -3

Query  183  EGEVAFYAYQLLVGLSDLHAMGIVHCDLKPLNVLVFP-MEQNGLNRLKIADFGLA  22
            + EV  Y   LL GLS +H  G+VHCDLKP N+L+FP  + +   +LKIADFGL+
Sbjct  106  DSEVRVYTRMLLKGLSCIHRKGVVHCDLKPDNILLFPSSDDHARYQLKIADFGLS  160



>ref|XP_006410145.1| hypothetical protein EUTSA_v10017877mg [Eutrema salsugineum]
 gb|ESQ51598.1| hypothetical protein EUTSA_v10017877mg [Eutrema salsugineum]
Length=325

 Score = 59.7 bits (143),  Expect = 7e-09, Method: Composition-based stats.
 Identities = 30/58 (52%), Positives = 39/58 (67%), Gaps = 6/58 (10%)
 Frame = -3

Query  165  YAYQLLVGLSDLHAMGIVHCDLKPLNVLVFP--MEQNGLNR----LKIADFGLAIQDG  10
            +   LL GL+ +H  G VHCDLKP N+LVFP  + +NG  R    LKI+DFGL+ +DG
Sbjct  114  FTLMLLEGLATIHGHGYVHCDLKPDNILVFPSCVSKNGCRRTSYELKISDFGLSRRDG  171



>ref|XP_006582671.1| PREDICTED: mitogen-activated protein kinase kinase kinase A-like 
[Glycine max]
Length=295

 Score = 59.3 bits (142),  Expect = 7e-09, Method: Composition-based stats.
 Identities = 29/55 (53%), Positives = 38/55 (69%), Gaps = 1/55 (2%)
 Frame = -3

Query  183  EGEVAFYAYQLLVGLSDLHAMGIVHCDLKPLNVLVFP-MEQNGLNRLKIADFGLA  22
            + EV  Y   LL GLS +H  G+VHCDLKP N+L+FP  + +   +LKIADFGL+
Sbjct  106  DSEVRVYTRMLLKGLSCIHRKGVVHCDLKPDNILLFPSSDDHARYQLKIADFGLS  160



>ref|XP_006582632.1| PREDICTED: mitogen-activated protein kinase kinase kinase YODA-like 
[Glycine max]
Length=295

 Score = 59.3 bits (142),  Expect = 7e-09, Method: Composition-based stats.
 Identities = 29/55 (53%), Positives = 38/55 (69%), Gaps = 1/55 (2%)
 Frame = -3

Query  183  EGEVAFYAYQLLVGLSDLHAMGIVHCDLKPLNVLVFP-MEQNGLNRLKIADFGLA  22
            + EV  Y   LL GLS +H  G+VHCDLKP N+L+FP  + +   +LKIADFGL+
Sbjct  106  DSEVRVYTRMLLKGLSCIHRKGVVHCDLKPDNILLFPSSDDHARYQLKIADFGLS  160



>emb|CDY66799.1| BnaC04g55540D [Brassica napus]
Length=290

 Score = 59.3 bits (142),  Expect = 7e-09, Method: Composition-based stats.
 Identities = 28/55 (51%), Positives = 35/55 (64%), Gaps = 1/55 (2%)
 Frame = -3

Query  183  EGEVAFYAYQLLVGLSDLHAMGIVHCDLKPLNVLVFP-MEQNGLNRLKIADFGLA  22
            E  + +  +Q+L GL DLH  G VHCDLKP N+L+FP   Q  L  LK+ DFG A
Sbjct  113  ENVIGYCIFQVLEGLRDLHQQGYVHCDLKPENILIFPSYSQEDLCELKLGDFGSA  167



>ref|XP_004147419.1| PREDICTED: mitogen-activated protein kinase kinase kinase A-like 
[Cucumis sativus]
Length=196

 Score = 57.8 bits (138),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 30/59 (51%), Positives = 38/59 (64%), Gaps = 1/59 (2%)
 Frame = -3

Query  183  EGEVAFYAYQLLVGLSDLHAMGIVHCDLKPLNVLVFPMEQNGLNRLKIADFGLAIQDGK  7
            E EV  Y   +L GLS +H  G VH DLKP N+L FP + NG   LKIADFG++ + G+
Sbjct  71   EDEVKEYLKMILKGLSCIHRKGFVHADLKPANILAFP-QNNGKMELKIADFGISRRCGE  128



>emb|CDY50455.1| BnaC04g25010D [Brassica napus]
Length=290

 Score = 58.9 bits (141),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 28/55 (51%), Positives = 35/55 (64%), Gaps = 1/55 (2%)
 Frame = -3

Query  183  EGEVAFYAYQLLVGLSDLHAMGIVHCDLKPLNVLVFP-MEQNGLNRLKIADFGLA  22
            E  + +  +Q+L GL DLH  G VHCDLKP N+L+FP   Q  L  LK+ DFG A
Sbjct  113  ENVIGYCIFQVLEGLRDLHQHGYVHCDLKPENILIFPSYAQEDLCELKLGDFGSA  167



>ref|XP_007023072.1| Kinase superfamily protein [Theobroma cacao]
 gb|EOY25694.1| Kinase superfamily protein [Theobroma cacao]
Length=702

 Score = 60.1 bits (144),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 32/60 (53%), Positives = 39/60 (65%), Gaps = 3/60 (5%)
 Frame = -3

Query  183  EGEVAFYAYQLLVGLSDLHAMGIVHCDLKPLNVLVFPMEQNG--LNRLKIADFGLAIQDG  10
            E    FYA  +L GL D+H  G +H DLKP N+LVFP  Q+G  L+ LKIADFGL  + G
Sbjct  103  ERHAKFYARMILEGLVDIHRKGYIHSDLKPRNILVFP-SQDGISLDTLKIADFGLVKKYG  161


 Score = 58.2 bits (139),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 29/59 (49%), Positives = 37/59 (63%), Gaps = 1/59 (2%)
 Frame = -3

Query  183  EGEVAFYAYQLLVGLSDLHAMGIVHCDLKPLNVLVFPMEQ-NGLNRLKIADFGLAIQDG  10
            E    +YA  +L GL D+H  G +H DLKP N+LVFP +    L+ LKIADFGL  + G
Sbjct  459  ERHAKYYARMILEGLVDIHRKGYIHSDLKPGNILVFPSQDGTALDTLKIADFGLVRKYG  517



>ref|XP_010507222.1| PREDICTED: mitogen-activated protein kinase kinase kinase ANP1-like 
[Camelina sativa]
Length=366

 Score = 59.3 bits (142),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 31/65 (48%), Positives = 42/65 (65%), Gaps = 4/65 (6%)
 Frame = -3

Query  183  EGEVAFYAYQLLVGLSDLHAMGIVHCDLKPLNVLVFPM--EQNGLNRL--KIADFGLAIQ  16
            E +V   A  +LVGL D+HA  I+H D+KP N+L+ P+   QN  NR   KI DFGLA++
Sbjct  184  EFDVKLIARDVLVGLRDIHAKNIIHGDIKPDNLLLTPIFNHQNRFNRYVTKIGDFGLALE  243

Query  15   DGKIE  1
             G +E
Sbjct  244  KGSVE  248



>ref|XP_006403002.1| hypothetical protein EUTSA_v10006421mg [Eutrema salsugineum]
 gb|ESQ44455.1| hypothetical protein EUTSA_v10006421mg [Eutrema salsugineum]
Length=291

 Score = 58.5 bits (140),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 30/55 (55%), Positives = 35/55 (64%), Gaps = 1/55 (2%)
 Frame = -3

Query  183  EGEVAFYAYQLLVGLSDLHAMGIVHCDLKPLNVLVFPMEQNG-LNRLKIADFGLA  22
            E  V +    +L GL DLH  G VHCDL+P NVL+FP    G L  LK+ADFGLA
Sbjct  113  ENVVGYCTLPVLEGLKDLHQHGYVHCDLRPENVLIFPSYAQGELCDLKLADFGLA  167



>ref|XP_010512901.1| PREDICTED: mitogen-activated protein kinase kinase kinase YODA-like 
[Camelina sativa]
Length=337

 Score = 58.9 bits (141),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 27/53 (51%), Positives = 37/53 (70%), Gaps = 2/53 (4%)
 Frame = -3

Query  165  YAYQLLVGLSDLHAMGIVHCDLKPLNVLVFPMEQNGLNRLKIADFGLAIQDGK  7
            + Y +L GL  +H+ G VHCDLKP N+LVFP  +N    LKIADFG++ + G+
Sbjct  113  FTYMILEGLVSIHSHGNVHCDLKPENILVFP--RNASYELKIADFGMSTKVGQ  163



>gb|KGN65602.1| hypothetical protein Csa_1G467210 [Cucumis sativus]
Length=178

 Score = 57.0 bits (136),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 30/59 (51%), Positives = 38/59 (64%), Gaps = 1/59 (2%)
 Frame = -3

Query  183  EGEVAFYAYQLLVGLSDLHAMGIVHCDLKPLNVLVFPMEQNGLNRLKIADFGLAIQDGK  7
            E EV  Y   +L GLS +H  G VH DLKP N+L FP + NG   LKIADFG++ + G+
Sbjct  71   EDEVKEYLKMILKGLSCIHRKGFVHADLKPANILAFP-QNNGKMELKIADFGISRRCGE  128



>ref|XP_010527554.1| PREDICTED: mitogen-activated protein kinase kinase kinase YODA-like 
[Tarenaya hassleriana]
Length=265

 Score = 58.2 bits (139),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 27/58 (47%), Positives = 38/58 (66%), Gaps = 1/58 (2%)
 Frame = -3

Query  183  EGEVAFYAYQLLVGLSDLHAMGIVHCDLKPLNVLVFPMEQNGLNRLKIADFGLAIQDG  10
            EG    +   +L GL  +H++G VHCDLKP N+LVFP   +    +KIADFG++ +DG
Sbjct  104  EGMARQFTRMILEGLVSIHSLGYVHCDLKPGNLLVFPTSSSSY-EIKIADFGMSRRDG  160



>ref|XP_009144248.1| PREDICTED: mitogen-activated protein kinase kinase kinase ANP1-like 
[Brassica rapa]
Length=322

 Score = 58.5 bits (140),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 30/58 (52%), Positives = 38/58 (66%), Gaps = 6/58 (10%)
 Frame = -3

Query  165  YAYQLLVGLSDLHAMGIVHCDLKPLNVLVFP--MEQNGLNR----LKIADFGLAIQDG  10
            +   LL GL+ +H  G VHCDLKP N+LVFP  + +NG  R    LKI+DFGL  +DG
Sbjct  117  FTRMLLEGLATIHGRGYVHCDLKPANILVFPSYINKNGAWRSSHELKISDFGLTRRDG  174



>ref|XP_009144229.1| PREDICTED: mitogen-activated protein kinase kinase kinase ANP1-like 
[Brassica rapa]
Length=322

 Score = 58.5 bits (140),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 30/58 (52%), Positives = 38/58 (66%), Gaps = 6/58 (10%)
 Frame = -3

Query  165  YAYQLLVGLSDLHAMGIVHCDLKPLNVLVFP--MEQNGLNR----LKIADFGLAIQDG  10
            +   LL GL+ +H  G VHCDLKP N+LVFP  + +NG  R    LKI+DFGL  +DG
Sbjct  117  FTRMLLEGLATIHGRGYVHCDLKPANILVFPSYINKNGAWRSSHELKISDFGLTRRDG  174



>emb|CDY10791.1| BnaA05g11450D [Brassica napus]
Length=322

 Score = 58.5 bits (140),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 30/58 (52%), Positives = 38/58 (66%), Gaps = 6/58 (10%)
 Frame = -3

Query  165  YAYQLLVGLSDLHAMGIVHCDLKPLNVLVFP--MEQNGLNR----LKIADFGLAIQDG  10
            +   LL GL+ +H  G VHCDLKP N+LVFP  + +NG  R    LKI+DFGL  +DG
Sbjct  117  FTRMLLEGLATIHGRGYVHCDLKPANILVFPSYINKNGAWRSSHELKISDFGLTRRDG  174



>ref|XP_003633375.1| PREDICTED: mitogen-activated protein kinase kinase kinase NPK1-like 
[Vitis vinifera]
Length=273

 Score = 58.2 bits (139),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 30/61 (49%), Positives = 41/61 (67%), Gaps = 1/61 (2%)
 Frame = -3

Query  183  EGEVAFYAYQLLVGLSDLHAMGIVHCDLKPLNVLVFPMEQNGLNRLKIADFGLAIQDGKI  4
            E EV +Y   ++ GL  +H  G VHCDLK  N+L+FP E +G  R+KIADFGL+ + G+ 
Sbjct  103  ESEVQWYTRMIVRGLHAVHREGFVHCDLKLSNMLLFPTE-DGRWRVKIADFGLSKRFGRE  161

Query  3    E  1
            E
Sbjct  162  E  162



>ref|XP_010527555.1| PREDICTED: mitogen-activated protein kinase kinase 7-like [Tarenaya 
hassleriana]
Length=320

 Score = 58.5 bits (140),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 27/58 (47%), Positives = 38/58 (66%), Gaps = 1/58 (2%)
 Frame = -3

Query  183  EGEVAFYAYQLLVGLSDLHAMGIVHCDLKPLNVLVFPMEQNGLNRLKIADFGLAIQDG  10
            +G +  +   +L GL  +H++G VHCDLKP N+LVFP   +    +KIADFGL+  DG
Sbjct  104  DGMIIQFTRMILEGLVSIHSLGYVHCDLKPENLLVFPTSSSSF-EIKIADFGLSRGDG  160



>ref|XP_010095583.1| Mitogen-activated protein kinase kinase kinase A [Morus notabilis]
 gb|EXB61156.1| Mitogen-activated protein kinase kinase kinase A [Morus notabilis]
Length=346

 Score = 58.5 bits (140),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 31/58 (53%), Positives = 39/58 (67%), Gaps = 5/58 (9%)
 Frame = -3

Query  183  EGEVAFYAYQLLVGLSDLHAMGIVHCDLKPLNVLVFPMEQNGLNRLKIADFGLAIQDG  10
            E E+  +A  +L GLS +HA G VHCD+KP N+LVF    NG   +KIADFGLA + G
Sbjct  104  ESEIRQHAKSILKGLSFMHAKGFVHCDIKPQNILVF---DNG--SVKIADFGLAKESG  156



>ref|XP_004171739.1| PREDICTED: mitogen-activated protein kinase kinase kinase A-like 
[Cucumis sativus]
Length=278

 Score = 57.8 bits (138),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 30/59 (51%), Positives = 38/59 (64%), Gaps = 1/59 (2%)
 Frame = -3

Query  183  EGEVAFYAYQLLVGLSDLHAMGIVHCDLKPLNVLVFPMEQNGLNRLKIADFGLAIQDGK  7
            E EV  Y   +L GLS +H  G VH DLKP N+L FP + NG   LKIADFG++ + G+
Sbjct  102  EDEVKEYLKMILKGLSCIHRKGFVHADLKPANILAFP-QNNGKMELKIADFGISRRCGE  159



>ref|XP_010095581.1| Mitogen-activated protein kinase kinase kinase A [Morus notabilis]
 gb|EXB61154.1| Mitogen-activated protein kinase kinase kinase A [Morus notabilis]
Length=423

 Score = 58.5 bits (140),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 31/58 (53%), Positives = 39/58 (67%), Gaps = 5/58 (9%)
 Frame = -3

Query  183  EGEVAFYAYQLLVGLSDLHAMGIVHCDLKPLNVLVFPMEQNGLNRLKIADFGLAIQDG  10
            E E+  +A  +L GLS +HA G VHCD+KP N+LVF    NG   +KIADFGLA + G
Sbjct  104  ESEIRQHAKSILKGLSFMHAKGFVHCDIKPQNILVF---DNG--SVKIADFGLAKESG  156



>emb|CDY24757.1| BnaC04g13620D [Brassica napus]
Length=321

 Score = 57.8 bits (138),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 29/58 (50%), Positives = 38/58 (66%), Gaps = 6/58 (10%)
 Frame = -3

Query  165  YAYQLLVGLSDLHAMGIVHCDLKPLNVLVFP--MEQNGLNR----LKIADFGLAIQDG  10
            +   LL GL+ +H  G VHCDLKP N+L+FP  + +NG  R    LKI+DFGL  +DG
Sbjct  117  FTRMLLEGLATIHGHGYVHCDLKPANILIFPSYVNKNGAWRSSYELKISDFGLTRRDG  174



>ref|WP_011649226.1| nitrogen fixation serine/threonine-protein kinase [Rhizobium 
leguminosarum]
 ref|YP_764968.1| nitrogen fixation serine/threonine-protein kinase [Rhizobium 
leguminosarum bv. viciae 3841]
 emb|CAK12171.1| putative serine/threonine-protein kinase involved in nitrogen 
fixation [Rhizobium leguminosarum bv. viciae 3841]
Length=304

 Score = 57.8 bits (138),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 29/57 (51%), Positives = 36/57 (63%), Gaps = 4/57 (7%)
 Frame = -3

Query  180  GEVAFYAYQLLVGLSDLHAMGIVHCDLKPLNVLVFPMEQNGLNRLKIADFGLAIQDG  10
            GE+      +L GL  +HA G VHCDL PLN+L        L+RLKIADFG+A+Q G
Sbjct  158  GEITSAMTSVLSGLEAIHAGGFVHCDLSPLNLLA----DGDLSRLKIADFGIALQRG  210



>ref|NP_180976.1| protein kinase family protein [Arabidopsis thaliana]
 gb|AAC27405.1| putative protein kinase [Arabidopsis thaliana]
 gb|AAY78715.1| protein kinase family protein [Arabidopsis thaliana]
 gb|AEC08949.1| protein kinase family protein [Arabidopsis thaliana]
Length=265

 Score = 57.0 bits (136),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 28/52 (54%), Positives = 36/52 (69%), Gaps = 1/52 (2%)
 Frame = -3

Query  165  YAYQLLVGLSDLHAMGIVHCDLKPLNVLVFPMEQNGLNRLKIADFGLAIQDG  10
            +   LL GL+ +H  G VHCDLKP N+LVFP     L +LKI+DFGL+ +DG
Sbjct  110  FTRMLLEGLATIHRHGYVHCDLKPENILVFPGSVCDL-KLKISDFGLSKRDG  160



>ref|XP_002267086.1| PREDICTED: mitogen-activated protein kinase kinase kinase 2-like 
[Vitis vinifera]
Length=276

 Score = 57.4 bits (137),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 30/61 (49%), Positives = 40/61 (66%), Gaps = 1/61 (2%)
 Frame = -3

Query  183  EGEVAFYAYQLLVGLSDLHAMGIVHCDLKPLNVLVFPMEQNGLNRLKIADFGLAIQDGKI  4
            E EV  +   ++ GL D+H  G VHCDLK  N+LVF  E NG +++KIADFG A + G+ 
Sbjct  101  ESEVQRFTRMIVRGLRDVHKEGFVHCDLKVDNILVFHSE-NGGHKVKIADFGHAKRSGRE  159

Query  3    E  1
            E
Sbjct  160  E  160



>emb|CAN76632.1| hypothetical protein VITISV_032336 [Vitis vinifera]
Length=276

 Score = 57.4 bits (137),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 30/61 (49%), Positives = 40/61 (66%), Gaps = 1/61 (2%)
 Frame = -3

Query  183  EGEVAFYAYQLLVGLSDLHAMGIVHCDLKPLNVLVFPMEQNGLNRLKIADFGLAIQDGKI  4
            E EV  +   ++ GL D+H  G VHCDLK  N+LVF  E NG +++KIADFG A + G+ 
Sbjct  101  ESEVQRFTRMIVRGLRDVHKEGFVHCDLKVDNILVFHSE-NGGHKVKIADFGHAKRSGRE  159

Query  3    E  1
            E
Sbjct  160  E  160



>ref|XP_004163151.1| PREDICTED: serine/threonine-protein kinase BCK1/SLK1/SSP31-like 
[Cucumis sativus]
Length=350

 Score = 57.8 bits (138),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 30/54 (56%), Positives = 36/54 (67%), Gaps = 1/54 (2%)
 Frame = -3

Query  183  EGEVAFYAYQLLVGLSDLHAMGIVHCDLKPLNVLVFPMEQNGLNRLKIADFGLA  22
            E EV  Y   +L GLS +H  G VH DLKP N+L FP + +G  +LKIADFGLA
Sbjct  111  EDEVKKYLQMILKGLSCIHRKGFVHVDLKPDNILAFP-QSDGKMKLKIADFGLA  163



>ref|XP_002880821.1| kinase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH57080.1| kinase family protein [Arabidopsis lyrata subsp. lyrata]
Length=318

 Score = 57.4 bits (137),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 30/58 (52%), Positives = 39/58 (67%), Gaps = 6/58 (10%)
 Frame = -3

Query  165  YAYQLLVGLSDLHAMGIVHCDLKPLNVLVFP--MEQNGLNR----LKIADFGLAIQDG  10
            +   LL GL+ +H  G VHCDLKP N+LVFP  + +NG  R    LKI+DFGL+ +DG
Sbjct  117  FTRMLLEGLATIHEHGYVHCDLKPENILVFPSSVYKNGAWRSSYQLKISDFGLSKRDG  174



>ref|XP_010090302.1| Mitogen-activated protein kinase kinase kinase A [Morus notabilis]
 gb|EXB39272.1| Mitogen-activated protein kinase kinase kinase A [Morus notabilis]
Length=330

 Score = 57.4 bits (137),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 27/52 (52%), Positives = 37/52 (71%), Gaps = 1/52 (2%)
 Frame = -3

Query  177  EVAFYAYQLLVGLSDLHAMGIVHCDLKPLNVLVFPMEQNGLNRLKIADFGLA  22
            ++  Y + +L GL  +HA G VHCDLKP N+LVF  + +G  +LKIADFGL+
Sbjct  119  DIRIYTWVILKGLCCMHAKGYVHCDLKPENILVFRSQDHGY-QLKIADFGLS  169



>ref|XP_004137063.1| PREDICTED: mitogen-activated protein kinase kinase kinase ANP1-like 
[Cucumis sativus]
 ref|XP_004155498.1| PREDICTED: mitogen-activated protein kinase kinase kinase ANP1-like 
[Cucumis sativus]
 gb|KGN43756.1| hypothetical protein Csa_7G065150 [Cucumis sativus]
Length=354

 Score = 57.4 bits (137),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 30/54 (56%), Positives = 35/54 (65%), Gaps = 1/54 (2%)
 Frame = -3

Query  183  EGEVAFYAYQLLVGLSDLHAMGIVHCDLKPLNVLVFPMEQNGLNRLKIADFGLA  22
            E EV  Y   +L GLS +H+ G VH DLKP N+L FP   NG  +LKIADFG A
Sbjct  113  EDEVKEYLRMILKGLSCIHSKGFVHVDLKPKNILAFP-RSNGKMKLKIADFGHA  165



>ref|XP_009144249.1| PREDICTED: mitogen-activated protein kinase kinase kinase 1-like 
[Brassica rapa]
Length=281

 Score = 56.6 bits (135),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 29/61 (48%), Positives = 41/61 (67%), Gaps = 6/61 (10%)
 Frame = -3

Query  165  YAYQLLVGLSDLHAMGIVHCDLKPLNVLVFPM---EQNGLN---RLKIADFGLAIQDGKI  4
            +   +L GL  +H+ G VHCDLKP N+L+FP+   +Q   N    LKIADFGLA+++G+ 
Sbjct  107  FTRMILQGLVSVHSDGYVHCDLKPGNLLLFPVYDHQQTSTNHTYELKIADFGLALKEGEE  166

Query  3    E  1
            E
Sbjct  167  E  167



>emb|CDX76047.1| BnaA04g03110D [Brassica napus]
Length=290

 Score = 57.0 bits (136),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 27/55 (49%), Positives = 34/55 (62%), Gaps = 1/55 (2%)
 Frame = -3

Query  183  EGEVAFYAYQLLVGLSDLHAMGIVHCDLKPLNVLVFP-MEQNGLNRLKIADFGLA  22
            E  + +  +Q+L GL DLH  G VHCDLKP N+L+FP      L  LK+ DFG A
Sbjct  113  ENVIGYCIFQVLEGLRDLHQHGYVHCDLKPENILIFPSYAHEDLCELKLGDFGSA  167



>ref|XP_004136151.1| PREDICTED: serine/threonine-protein kinase BCK1/SLK1/SSP31-like 
[Cucumis sativus]
 gb|KGN45019.1| hypothetical protein Csa_7G407720 [Cucumis sativus]
Length=353

 Score = 57.4 bits (137),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 30/54 (56%), Positives = 36/54 (67%), Gaps = 1/54 (2%)
 Frame = -3

Query  183  EGEVAFYAYQLLVGLSDLHAMGIVHCDLKPLNVLVFPMEQNGLNRLKIADFGLA  22
            E EV  Y   +L GLS +H  G VH DLKP N+L FP + +G  +LKIADFGLA
Sbjct  111  EDEVKKYLQMILKGLSCIHRKGFVHVDLKPDNILAFP-QSDGKMKLKIADFGLA  163



>emb|CDY50458.1| BnaC04g25040D [Brassica napus]
Length=290

 Score = 57.0 bits (136),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 27/55 (49%), Positives = 34/55 (62%), Gaps = 1/55 (2%)
 Frame = -3

Query  183  EGEVAFYAYQLLVGLSDLHAMGIVHCDLKPLNVLVFP-MEQNGLNRLKIADFGLA  22
            E  + +  +Q+L GL DLH  G VHCDLKP N+L+FP      L  LK+ DFG A
Sbjct  113  ENVIGYCIFQVLEGLRDLHQHGYVHCDLKPENILIFPSYAHEDLCELKLGDFGSA  167



>ref|XP_002876359.1| hypothetical protein ARALYDRAFT_348712 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH52618.1| hypothetical protein ARALYDRAFT_348712 [Arabidopsis lyrata subsp. 
lyrata]
Length=362

 Score = 57.4 bits (137),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 29/55 (53%), Positives = 35/55 (64%), Gaps = 1/55 (2%)
 Frame = -3

Query  183  EGEVAFYAYQLLVGLSDLHAMGIVHCDLKPLNVLVFPMEQNG-LNRLKIADFGLA  22
            E  V +    +L GL DLH  G VHCDL P N+L+FP   +G L  LK+ADFGLA
Sbjct  185  ENVVGYCTLLILEGLKDLHKDGYVHCDLMPENILIFPTYTHGELCELKLADFGLA  239



>ref|XP_008451652.1| PREDICTED: serine/threonine-protein kinase grp-like [Cucumis 
melo]
Length=289

 Score = 56.6 bits (135),  Expect = 7e-08, Method: Composition-based stats.
 Identities = 30/54 (56%), Positives = 36/54 (67%), Gaps = 1/54 (2%)
 Frame = -3

Query  183  EGEVAFYAYQLLVGLSDLHAMGIVHCDLKPLNVLVFPMEQNGLNRLKIADFGLA  22
            E EV  Y   +L GLS +H  G VH DLKP N+L FP + +G  +LKIADFGLA
Sbjct  110  EDEVKKYLQMILKGLSCIHRKGFVHVDLKPDNILAFP-QSDGKMKLKIADFGLA  162



>emb|CBI29770.3| unnamed protein product [Vitis vinifera]
Length=247

 Score = 56.2 bits (134),  Expect = 7e-08, Method: Composition-based stats.
 Identities = 26/44 (59%), Positives = 33/44 (75%), Gaps = 1/44 (2%)
 Frame = -3

Query  132  LHAMGIVHCDLKPLNVLVFPMEQNGLNRLKIADFGLAIQDGKIE  1
            +H  G+ HCDLKP NVLVFP +  G N +KIADFG+A +DG+ E
Sbjct  1    MHERGLTHCDLKPDNVLVFPGKDGG-NVVKIADFGMARRDGEQE  43



>ref|XP_010431031.1| PREDICTED: mitogen-activated protein kinase kinase kinase 2-like 
[Camelina sativa]
Length=383

 Score = 57.0 bits (136),  Expect = 9e-08, Method: Composition-based stats.
 Identities = 26/65 (40%), Positives = 41/65 (63%), Gaps = 4/65 (6%)
 Frame = -3

Query  183  EGEVAFYAYQLLVGLSDLHAMGIVHCDLKPLNVLVFPMEQNGLN----RLKIADFGLAIQ  16
            E +V   A  +L GL D+HA  I+HCD+KP N+L+ P++ + +       K+ DFGLA++
Sbjct  204  EFDVKLIARDVLAGLRDIHARNIIHCDIKPDNLLLTPIDNHQIRFNSYVTKVGDFGLALE  263

Query  15   DGKIE  1
             G +E
Sbjct  264  KGSVE  268



>ref|XP_008465601.1| PREDICTED: mitogen-activated protein kinase kinase kinase ANP1-like, 
partial [Cucumis melo]
Length=321

 Score = 56.6 bits (135),  Expect = 9e-08, Method: Composition-based stats.
 Identities = 29/54 (54%), Positives = 36/54 (67%), Gaps = 1/54 (2%)
 Frame = -3

Query  183  EGEVAFYAYQLLVGLSDLHAMGIVHCDLKPLNVLVFPMEQNGLNRLKIADFGLA  22
            E EV  Y   +L GLS +H+ G VH DLKP N+L FP + +G  +LKIADFG A
Sbjct  114  EAEVKDYLRMILKGLSCIHSKGFVHVDLKPNNILAFP-QSDGKMKLKIADFGQA  166



>ref|XP_009132717.1| PREDICTED: mitogen-activated protein kinase kinase kinase ANP1-like 
[Brassica rapa]
Length=330

 Score = 56.6 bits (135),  Expect = 9e-08, Method: Composition-based stats.
 Identities = 30/58 (52%), Positives = 39/58 (67%), Gaps = 6/58 (10%)
 Frame = -3

Query  165  YAYQLLVGLSDLHAMGIVHCDLKPLNVLVFP--MEQNGLNR----LKIADFGLAIQDG  10
            +   LL GL+ +HA G VHCDLKP N+LVFP    +NG  R    LKI+DFGL+ ++G
Sbjct  117  FTRMLLQGLATIHAHGYVHCDLKPENILVFPSYAYKNGAWRSSFELKISDFGLSRREG  174



>emb|CDX76059.1| BnaA04g03230D [Brassica napus]
Length=290

 Score = 56.6 bits (135),  Expect = 9e-08, Method: Composition-based stats.
 Identities = 27/55 (49%), Positives = 34/55 (62%), Gaps = 1/55 (2%)
 Frame = -3

Query  183  EGEVAFYAYQLLVGLSDLHAMGIVHCDLKPLNVLVFP-MEQNGLNRLKIADFGLA  22
            E  + +  +Q+L GL DLH    VHCDLKP N+L+FP   Q  L  LK+ DFG A
Sbjct  113  ENVIGYCIFQVLEGLRDLHQHSYVHCDLKPENILIFPSYAQEDLCELKLGDFGSA  167



>ref|XP_011097967.1| PREDICTED: mitogen-activated protein kinase kinase kinase NPK1-like 
[Sesamum indicum]
Length=477

 Score = 57.4 bits (137),  Expect = 9e-08, Method: Composition-based stats.
 Identities = 29/54 (54%), Positives = 37/54 (69%), Gaps = 6/54 (11%)
 Frame = -3

Query  183  EGEVAFYAYQLLVGLSDLHAMGIVHCDLKPLNVLVFPMEQNGLNRLKIADFGLA  22
            E  + FYA ++L+GLS LH MG+VHCD+K  NVL+      G + LKIADFG A
Sbjct  98   ESVIRFYAREMLLGLSYLHLMGLVHCDIKGQNVLI------GSDGLKIADFGCA  145



>ref|XP_004146989.1| PREDICTED: mitogen-activated protein kinase kinase kinase 3-like 
[Cucumis sativus]
 ref|XP_004165639.1| PREDICTED: mitogen-activated protein kinase kinase kinase 3-like 
[Cucumis sativus]
Length=256

 Score = 55.8 bits (133),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 29/54 (54%), Positives = 36/54 (67%), Gaps = 1/54 (2%)
 Frame = -3

Query  183  EGEVAFYAYQLLVGLSDLHAMGIVHCDLKPLNVLVFPMEQNGLNRLKIADFGLA  22
            E EV  Y   +L GLS +H+ G VH DLKP N+L FP + +G  +LKIADFG A
Sbjct  111  EDEVKDYLRMILKGLSCIHSKGFVHVDLKPNNILAFP-QSDGKMKLKIADFGQA  163



>ref|XP_006292246.1| hypothetical protein CARUB_v10018453mg, partial [Capsella rubella]
 gb|EOA25144.1| hypothetical protein CARUB_v10018453mg, partial [Capsella rubella]
Length=448

 Score = 57.0 bits (136),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 30/65 (46%), Positives = 41/65 (63%), Gaps = 5/65 (8%)
 Frame = -3

Query  183  EGEVAFYAYQLLVGLSDLHAMGIVHCDLKPLNVLVFPMEQ----NGLNRLKIADFGLAIQ  16
            E +V  YA  +L GLS +H   IVHCD+KP N+L+ P++     NG    KI DFGLA++
Sbjct  264  EFDVKLYAKDVLSGLSYIHDRNIVHCDIKPDNLLLTPVDHRFRSNGF-LTKIGDFGLAME  322

Query  15   DGKIE  1
             G +E
Sbjct  323  KGSVE  327



>ref|XP_002306171.2| hypothetical protein POPTR_0004s17730g [Populus trichocarpa]
 gb|EEE86682.2| hypothetical protein POPTR_0004s17730g [Populus trichocarpa]
Length=311

 Score = 56.2 bits (134),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 31/61 (51%), Positives = 39/61 (64%), Gaps = 2/61 (3%)
 Frame = -3

Query  183  EGEVAFYAYQLLVGLSDLHAMGIVHCDLKPLNVLVFPMEQNGL--NRLKIADFGLAIQDG  10
            E  V  Y   LL GLS ++  G VHCDLK  N+LVFP   +G+  + LKIADFGLA + G
Sbjct  87   ESHVRKYTQMLLKGLSCIYYNGHVHCDLKLANILVFPCRDHGVKGHHLKIADFGLAREPG  146

Query  9    K  7
            +
Sbjct  147  E  147



>emb|CDY10776.1| BnaA05g11600D [Brassica napus]
Length=321

 Score = 56.2 bits (134),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 29/58 (50%), Positives = 37/58 (64%), Gaps = 6/58 (10%)
 Frame = -3

Query  165  YAYQLLVGLSDLHAMGIVHCDLKPLNVLVFP--MEQNGLNR----LKIADFGLAIQDG  10
            +   LL GL+ +H  G VHCDLKP N+LVFP  + +NG  R    LKI+D GL  +DG
Sbjct  117  FTRMLLEGLATIHGRGYVHCDLKPANILVFPSYINKNGAWRSSHELKISDLGLTRRDG  174



>ref|XP_009139118.1| PREDICTED: mitogen-activated protein kinase kinase kinase 1-like 
[Brassica rapa]
Length=290

 Score = 55.8 bits (133),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 27/55 (49%), Positives = 34/55 (62%), Gaps = 1/55 (2%)
 Frame = -3

Query  183  EGEVAFYAYQLLVGLSDLHAMGIVHCDLKPLNVLVFP-MEQNGLNRLKIADFGLA  22
            E  + +  +Q+L GL DLH  G VHCDLKP N+L+FP      L  LK+ DFG A
Sbjct  113  ENVIGYCIFQVLEGLRDLHRDGYVHCDLKPENILIFPSYAHEDLCELKLGDFGSA  167



>emb|CDY24731.1| BnaC04g13360D [Brassica napus]
Length=387

 Score = 56.6 bits (135),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 28/60 (47%), Positives = 40/60 (67%), Gaps = 5/60 (8%)
 Frame = -3

Query  165  YAYQLLVGLSDLHAMGIVHCDLKPLNVLVFPM--EQNGLN---RLKIADFGLAIQDGKIE  1
            +   +L GL  +H+ G VHCDLKP N+L+FP+  +Q   N    LKIADFGL +++G+ E
Sbjct  153  FTRMILQGLVSIHSHGYVHCDLKPGNLLLFPVYDQQTSTNHTYELKIADFGLTLKEGEEE  212



>ref|XP_010524977.1| PREDICTED: mitogen-activated protein kinase kinase kinase 1-like 
[Tarenaya hassleriana]
Length=338

 Score = 56.2 bits (134),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 27/48 (56%), Positives = 33/48 (69%), Gaps = 4/48 (8%)
 Frame = -3

Query  153  LLVGLSDLHAMGIVHCDLKPLNVLVFPMEQNGLNR----LKIADFGLA  22
            +L GL  +H  G VHCDLKP N+LVFP E NG  R    +KI+DFGL+
Sbjct  115  ILEGLVFIHGHGYVHCDLKPTNILVFPREGNGTCRTTYEIKISDFGLS  162



>gb|AAL17786.1|AF361470_6 ImpN [Rhizobium leguminosarum bv. trifolii]
Length=304

 Score = 55.8 bits (133),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 28/57 (49%), Positives = 35/57 (61%), Gaps = 4/57 (7%)
 Frame = -3

Query  180  GEVAFYAYQLLVGLSDLHAMGIVHCDLKPLNVLVFPMEQNGLNRLKIADFGLAIQDG  10
            GE+      +L GL  +H  G VHCDL PLN+L        L+RLKIADFG+A+Q G
Sbjct  158  GEITSAMTSVLSGLEAIHTGGFVHCDLSPLNLLA----DGDLSRLKIADFGIALQRG  210



>ref|XP_009144247.1| PREDICTED: mitogen-activated protein kinase kinase kinase ANP1-like 
[Brassica rapa]
Length=329

 Score = 56.2 bits (134),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 29/58 (50%), Positives = 37/58 (64%), Gaps = 6/58 (10%)
 Frame = -3

Query  165  YAYQLLVGLSDLHAMGIVHCDLKPLNVLVFP--MEQNGLNR----LKIADFGLAIQDG  10
            +   LL GL+ +H  G VHCDLKP N+LVFP  + +NG  R    LKI+D GL  +DG
Sbjct  117  FTRMLLEGLAPIHGRGYVHCDLKPANILVFPSYINKNGAWRSSHELKISDLGLTRRDG  174



>gb|AHG49394.1| nitrogen fixation serine/threonine-protein kinase [Rhizobium 
leguminosarum bv. trifolii CB782]
Length=307

 Score = 55.8 bits (133),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 27/57 (47%), Positives = 36/57 (63%), Gaps = 3/57 (5%)
 Frame = -3

Query  180  GEVAFYAYQLLVGLSDLHAMGIVHCDLKPLNVLVFPMEQNGLNRLKIADFGLAIQDG  10
            G+V      +L GL  +HA G VHCDL PLN+L     +   +RLKIADFG+A++ G
Sbjct  164  GDVTAIMTSVLTGLGAIHAAGFVHCDLSPLNLL---FAEGDFSRLKIADFGVALEAG  217



>gb|KFK23195.1| hypothetical protein AALP_AAs74393U000200 [Arabis alpina]
Length=327

 Score = 55.8 bits (133),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 29/55 (53%), Positives = 35/55 (64%), Gaps = 1/55 (2%)
 Frame = -3

Query  183  EGEVAFYAYQLLVGLSDLHAMGIVHCDLKPLNVLVFPMEQNGLN-RLKIADFGLA  22
            E  +   A  +L GL  LH+ G VHCDLKP NVLVFP +  G    LK+ADFGL+
Sbjct  12   ENTIRHVALMILQGLEALHSHGYVHCDLKPANVLVFPSKAVGERWDLKLADFGLS  66



>ref|XP_006399726.1| hypothetical protein EUTSA_v10015480mg, partial [Eutrema salsugineum]
 gb|ESQ41179.1| hypothetical protein EUTSA_v10015480mg, partial [Eutrema salsugineum]
Length=283

 Score = 55.8 bits (133),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 26/54 (48%), Positives = 36/54 (67%), Gaps = 2/54 (4%)
 Frame = -3

Query  165  YAYQLLVGLSDLHAMGIVHCDLKPLNVLVFPMEQNGLNRLKIADFGLAIQDGKI  4
            +   +L GL  +H  G VHCDLKP N+LVFP E      LKI+DFGL+++ G++
Sbjct  117  FTRMILEGLVSIHGHGYVHCDLKPENILVFPCED--WYELKISDFGLSLKVGEV  168



>gb|KGN44756.1| hypothetical protein Csa_7G378450 [Cucumis sativus]
Length=331

 Score = 55.8 bits (133),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 29/54 (54%), Positives = 36/54 (67%), Gaps = 1/54 (2%)
 Frame = -3

Query  183  EGEVAFYAYQLLVGLSDLHAMGIVHCDLKPLNVLVFPMEQNGLNRLKIADFGLA  22
            E EV  Y   +L GLS +H+ G VH DLKP N+L FP + +G  +LKIADFG A
Sbjct  111  EDEVKDYLRMILKGLSCIHSKGFVHVDLKPNNILAFP-QSDGKMKLKIADFGQA  163



>emb|CDY65405.1| BnaC04g55520D [Brassica napus]
Length=290

 Score = 55.8 bits (133),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 26/55 (47%), Positives = 34/55 (62%), Gaps = 1/55 (2%)
 Frame = -3

Query  183  EGEVAFYAYQLLVGLSDLHAMGIVHCDLKPLNVLVFP-MEQNGLNRLKIADFGLA  22
            E  + +  +Q+L G+ DLH  G VHCDLKP N+L+FP      L  LK+ DFG A
Sbjct  113  ENVIGYCIFQVLEGIRDLHQHGYVHCDLKPENILIFPSYAHEDLCELKLGDFGSA  167



>ref|XP_004914907.1| PREDICTED: protein kinase C theta type-like [Xenopus (Silurana) 
tropicalis]
Length=504

 Score = 56.6 bits (135),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 25/54 (46%), Positives = 38/54 (70%), Gaps = 5/54 (9%)
 Frame = -3

Query  177  EVAFYAYQLLVGLSDLHAMGIVHCDLKPLNVLVFPMEQNGLNRLKIADFGLAIQ  16
            +V FY+ +++ GL  LH+ GI+HCDLKP N+L+     +    +KIADFGLA++
Sbjct  291  QVIFYSAEMVCGLQYLHSRGIIHCDLKPDNILI-----SSEGHIKIADFGLAVE  339



>ref|XP_006283707.1| hypothetical protein CARUB_v10004778mg [Capsella rubella]
 gb|EOA16605.1| hypothetical protein CARUB_v10004778mg [Capsella rubella]
Length=454

 Score = 56.6 bits (135),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 32/54 (59%), Positives = 37/54 (69%), Gaps = 5/54 (9%)
 Frame = -3

Query  183  EGEVAFYAYQLLVGLSDLHAMGIVHCDLKPLNVLVFPMEQNGLNRLKIADFGLA  22
            E E++ Y  Q+L GL  LH  GIVHCDLK  NVLV   E+NG+  LKIADFG A
Sbjct  100  EPEISSYTRQILNGLVYLHERGIVHCDLKSQNVLV---EENGV--LKIADFGCA  148



>emb|CDJ02510.1| death associated protein kinase 1 [Echinococcus multilocularis]
 emb|CDS39792.1| death associated protein kinase 1 [Echinococcus multilocularis]
Length=572

 Score = 56.6 bits (135),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 26/54 (48%), Positives = 37/54 (69%), Gaps = 3/54 (6%)
 Frame = -3

Query  183  EGEVAFYAYQLLVGLSDLHAMGIVHCDLKPLNVLVFPMEQNGLNRLKIADFGLA  22
            E E  F+  Q+L+G++ +H +GIVH DLKP N+++  ME     R+KI DFGLA
Sbjct  74   EQEAVFFIAQILLGVNHMHQLGIVHLDLKPENIMIEDMET---KRIKIIDFGLA  124



>emb|CDS24224.1| death associated protein kinase 1 [Echinococcus granulosus]
Length=572

 Score = 56.6 bits (135),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 26/54 (48%), Positives = 37/54 (69%), Gaps = 3/54 (6%)
 Frame = -3

Query  183  EGEVAFYAYQLLVGLSDLHAMGIVHCDLKPLNVLVFPMEQNGLNRLKIADFGLA  22
            E E  F+  Q+L+G++ +H +GIVH DLKP N+++  ME     R+KI DFGLA
Sbjct  74   EQEAVFFIAQILLGVNHMHQLGIVHLDLKPENIMIEDMET---KRIKIIDFGLA  124



>ref|XP_006289563.1| hypothetical protein CARUB_v10003109mg [Capsella rubella]
 gb|EOA22461.1| hypothetical protein CARUB_v10003109mg [Capsella rubella]
Length=326

 Score = 55.8 bits (133),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 27/56 (48%), Positives = 38/56 (68%), Gaps = 4/56 (7%)
 Frame = -3

Query  165  YAYQLLVGLSDLHAMGIVHCDLKPLNVLVFPMEQNGLN---RLKIADFGLAIQDGK  7
            + + +L GL  +H+ G VHCDLKP N+LVFP   +G N    LKI+DFG+A + G+
Sbjct  113  FTHMILEGLVSIHSHGYVHCDLKPENILVFP-RTSGCNVSYELKISDFGMATKVGQ  167



>gb|EUB58820.1| Death-associated protein kinase 2 [Echinococcus granulosus]
Length=596

 Score = 56.6 bits (135),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 26/54 (48%), Positives = 37/54 (69%), Gaps = 3/54 (6%)
 Frame = -3

Query  183  EGEVAFYAYQLLVGLSDLHAMGIVHCDLKPLNVLVFPMEQNGLNRLKIADFGLA  22
            E E  F+  Q+L+G++ +H +GIVH DLKP N+++  ME     R+KI DFGLA
Sbjct  58   EQEAVFFIAQILLGVNHMHQLGIVHLDLKPENIMIEDMET---KRIKIIDFGLA  108



>gb|KFK34893.1| hypothetical protein AALP_AA5G207100 [Arabis alpina]
Length=291

 Score = 55.5 bits (132),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 29/55 (53%), Positives = 35/55 (64%), Gaps = 1/55 (2%)
 Frame = -3

Query  183  EGEVAFYAYQLLVGLSDLHAMGIVHCDLKPLNVLVFPMEQNG-LNRLKIADFGLA  22
            E  V +   Q+L GL DLH  G VHCDLKP N+L+FP   +G L  LK+A F LA
Sbjct  112  ENVVGYCILQVLEGLRDLHRDGYVHCDLKPENILIFPTYTHGELCELKLASFSLA  166



>ref|XP_010269485.1| PREDICTED: mitogen-activated protein kinase kinase kinase NPK1-like 
[Nelumbo nucifera]
Length=380

 Score = 55.8 bits (133),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 31/60 (52%), Positives = 39/60 (65%), Gaps = 5/60 (8%)
 Frame = -3

Query  183  EGEVAFYAYQLLVGLSDLHAMGIVHCDLKPLNVLV--FPMEQNGLNRLKIADFGLAIQDG  10
            E +V  YA  +L GL  +HA G VHCD+KP N+LV  +P   +G N +KIADFGLA   G
Sbjct  106  ESDVRRYARSILRGLRCIHANGYVHCDIKPQNILVCSYP---DGSNGVKIADFGLAKTAG  162



>ref|XP_008455530.1| PREDICTED: mitogen-activated protein kinase kinase kinase A-like 
[Cucumis melo]
Length=371

 Score = 55.8 bits (133),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 29/54 (54%), Positives = 36/54 (67%), Gaps = 1/54 (2%)
 Frame = -3

Query  183  EGEVAFYAYQLLVGLSDLHAMGIVHCDLKPLNVLVFPMEQNGLNRLKIADFGLA  22
            E EV  Y   +L GLS +H+ G VH DLKP N+L FP + +G  +LKIADFG A
Sbjct  111  ENEVKDYLRMILKGLSCVHSKGFVHVDLKPNNILAFP-QSDGKMKLKIADFGHA  163



>ref|XP_006419000.1| hypothetical protein EUTSA_v10003065mg [Eutrema salsugineum]
 gb|ESQ37436.1| hypothetical protein EUTSA_v10003065mg [Eutrema salsugineum]
Length=306

 Score = 55.5 bits (132),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 29/65 (45%), Positives = 40/65 (62%), Gaps = 5/65 (8%)
 Frame = -3

Query  183  EGEVAFYAYQLLVGLSDLHAMGIVHCDLKPLNVLVFPMEQ----NGLNRLKIADFGLAIQ  16
            E +V  +A  +L GLS +H   I+HCD+KP N+L+ P +     NG    KI DFGLA++
Sbjct  134  ESDVKLFARDVLSGLSYIHDRNIIHCDIKPDNLLLCPTDHRFRPNGY-LTKIGDFGLAME  192

Query  15   DGKIE  1
             G IE
Sbjct  193  KGSIE  197



>ref|XP_002879959.1| kinase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH56218.1| kinase family protein [Arabidopsis lyrata subsp. lyrata]
Length=318

 Score = 55.5 bits (132),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 29/58 (50%), Positives = 38/58 (66%), Gaps = 6/58 (10%)
 Frame = -3

Query  165  YAYQLLVGLSDLHAMGIVHCDLKPLNVLVFP--MEQNGLNR----LKIADFGLAIQDG  10
            +   LL GL+ +H  G VHCDLKP N+LVFP  + +NG  R    LK +DFGL+ +DG
Sbjct  117  FTRMLLEGLATIHKHGYVHCDLKPENILVFPSSVYKNGAWRSSYELKFSDFGLSKRDG  174



>ref|XP_006292308.1| hypothetical protein CARUB_v10018519mg [Capsella rubella]
 gb|EOA25206.1| hypothetical protein CARUB_v10018519mg [Capsella rubella]
Length=253

 Score = 54.7 bits (130),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 28/55 (51%), Positives = 36/55 (65%), Gaps = 1/55 (2%)
 Frame = -3

Query  183  EGEVAFYAYQLLVGLSDLHAMGIVHCDLKPLNVLVFPMEQNG-LNRLKIADFGLA  22
            E  V +    +L GL DLH  G VHCDL+P N+L+F    +G L +LK+ADFGLA
Sbjct  76   ENVVGYCTLLILEGLKDLHRAGYVHCDLRPENILIFRTFTHGELCQLKLADFGLA  130



>ref|WP_029871463.1| membrane protein [Rhizobium leguminosarum]
Length=304

 Score = 55.5 bits (132),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 28/57 (49%), Positives = 36/57 (63%), Gaps = 4/57 (7%)
 Frame = -3

Query  180  GEVAFYAYQLLVGLSDLHAMGIVHCDLKPLNVLVFPMEQNGLNRLKIADFGLAIQDG  10
            GE+      +L GL  +HA G VHCDL PLN+L        L+RLKIADFG+A++ G
Sbjct  158  GEITSAMTSVLSGLEAIHAGGFVHCDLSPLNLLA----DGDLSRLKIADFGIALKRG  210



>ref|XP_010535523.1| PREDICTED: mitogen-activated protein kinase kinase kinase ANP1-like 
[Tarenaya hassleriana]
Length=368

 Score = 55.5 bits (132),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 29/66 (44%), Positives = 39/66 (59%), Gaps = 7/66 (11%)
 Frame = -3

Query  183  EGEVAFYAYQLLVGLSDLHAMGIVHCDLKPLNVLVFPMEQNGLNR-----LKIADFGLAI  19
            E  V   A  +L GL+D+H   I+HCD+KP N+L+ P  Q   NR      KIADFGLA+
Sbjct  191  ESHVKLLATDILRGLNDIHCRRIIHCDIKPANILLVP--QVKWNRPDWFVAKIADFGLAV  248

Query  18   QDGKIE  1
            +   +E
Sbjct  249  EKDTVE  254



>ref|XP_009139343.1| PREDICTED: mitogen-activated protein kinase kinase kinase YODA-like 
[Brassica rapa]
Length=290

 Score = 55.1 bits (131),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 27/55 (49%), Positives = 33/55 (60%), Gaps = 1/55 (2%)
 Frame = -3

Query  183  EGEVAFYAYQLLVGLSDLHAMGIVHCDLKPLNVLVFP-MEQNGLNRLKIADFGLA  22
            E  + +   Q+L GL DLH  G VHCDLKP N+L+FP      L  LK+ DFG A
Sbjct  113  ENVIGYCILQVLEGLRDLHQHGYVHCDLKPENILIFPSYAHEDLCELKLGDFGSA  167



>ref|XP_009144246.1| PREDICTED: mitogen-activated protein kinase kinase kinase 1-like 
[Brassica rapa]
Length=351

 Score = 55.5 bits (132),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 27/57 (47%), Positives = 40/57 (70%), Gaps = 4/57 (7%)
 Frame = -3

Query  165  YAYQLLVGLSDLHAMGIVHCDLKPLNVLVFPM-EQNGLN---RLKIADFGLAIQDGK  7
            +   +L GL  +H+ G VHCDLKP N+L+FP+ +Q       +LKIADFGLA+++G+
Sbjct  121  FTRMILQGLVSVHSHGYVHCDLKPDNLLLFPVYDQQAWTYSYQLKIADFGLALKEGE  177



>ref|XP_010418753.1| PREDICTED: mitogen-activated protein kinase kinase kinase YODA-like 
[Camelina sativa]
Length=338

 Score = 55.5 bits (132),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 27/56 (48%), Positives = 37/56 (66%), Gaps = 4/56 (7%)
 Frame = -3

Query  165  YAYQLLVGLSDLHAMGIVHCDLKPLNVLVFPMEQNGLN---RLKIADFGLAIQDGK  7
            + Y +L GL  +H+ G VHCDLKP N+LVFP    G N    LKI+DFG++ + G+
Sbjct  113  FTYMILEGLVSIHSHGYVHCDLKPENILVFP-RTCGCNVSYELKISDFGMSTKVGQ  167



>ref|XP_010468117.1| PREDICTED: mitogen-activated protein kinase kinase kinase YODA-like 
[Camelina sativa]
Length=340

 Score = 55.5 bits (132),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 27/56 (48%), Positives = 37/56 (66%), Gaps = 4/56 (7%)
 Frame = -3

Query  165  YAYQLLVGLSDLHAMGIVHCDLKPLNVLVFPMEQNGLN---RLKIADFGLAIQDGK  7
            + Y +L GL  +H+ G VHCDLKP N+LVFP    G N    LKI+DFG++ + G+
Sbjct  114  FTYMILEGLVSIHSHGYVHCDLKPENILVFP-RTCGCNVSYELKISDFGMSTKVGQ  168



>ref|XP_002306473.2| hypothetical protein POPTR_0005s18240g [Populus trichocarpa]
 gb|EEE93469.2| hypothetical protein POPTR_0005s18240g [Populus trichocarpa]
Length=338

 Score = 55.5 bits (132),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 30/61 (49%), Positives = 39/61 (64%), Gaps = 5/61 (8%)
 Frame = -3

Query  183  EGEVAFYAYQLLVGLSDLHAMGIVHCDLKPLNVLVFPMEQNGLNRLKIADFGLAIQDGKI  4
            E +V  YA  +L GL  +HA G VHCDLK  N+L+F  E+     +KIADFGLA + GK 
Sbjct  100  ERDVKDYARSILKGLRHIHAKGFVHCDLKLDNILLFENEE-----VKIADFGLARKAGKA  154

Query  3    E  1
            +
Sbjct  155  Q  155



>emb|CDY10778.1| BnaA05g11580D [Brassica napus]
Length=351

 Score = 55.5 bits (132),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 27/57 (47%), Positives = 40/57 (70%), Gaps = 4/57 (7%)
 Frame = -3

Query  165  YAYQLLVGLSDLHAMGIVHCDLKPLNVLVFPM-EQNGLN---RLKIADFGLAIQDGK  7
            +   +L GL  +H+ G VHCDLKP N+L+FP+ +Q       +LKIADFGLA+++G+
Sbjct  121  FTRMILEGLVSVHSHGYVHCDLKPDNLLLFPVYDQQAWTYSYQLKIADFGLALKEGE  177



>emb|CDY53489.1| BnaC04g02670D [Brassica napus]
Length=269

 Score = 54.7 bits (130),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 26/52 (50%), Positives = 34/52 (65%), Gaps = 3/52 (6%)
 Frame = -3

Query  153  LLVGLSDLHAMGIVHCDLKPLNVLVFPMEQNGLN---RLKIADFGLAIQDGK  7
            +L GL  +H  G VHCDLKP N+LVFP    GL     LKI+DFG++ + G+
Sbjct  46   ILQGLVSVHGHGYVHCDLKPENLLVFPRRVGGLQSTYELKISDFGMSTKAGE  97



>ref|XP_004241675.1| PREDICTED: mitogen-activated protein kinase kinase kinase NPK1-like 
[Solanum lycopersicum]
Length=426

 Score = 55.5 bits (132),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 28/61 (46%), Positives = 37/61 (61%), Gaps = 2/61 (3%)
 Frame = -3

Query  183  EGEVAFYAYQLLVGLSDLHAMGIVHCDLKPLNVLVFPMEQNGLN--RLKIADFGLAIQDG  10
            E EV  Y   +L GL+ +HA+G VHCD+KP NVL+ P    G    R KI D GLA ++ 
Sbjct  132  EFEVRLYTRSMLRGLNHIHAIGYVHCDMKPENVLLVPSSSKGSVEFRAKIGDLGLAKREN  191

Query  9    K  7
            +
Sbjct  192  Q  192



>ref|XP_006356256.1| PREDICTED: mitogen-activated protein kinase kinase kinase YODA-like 
[Solanum tuberosum]
Length=436

 Score = 55.5 bits (132),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 28/61 (46%), Positives = 37/61 (61%), Gaps = 2/61 (3%)
 Frame = -3

Query  183  EGEVAFYAYQLLVGLSDLHAMGIVHCDLKPLNVLVFPMEQNGLN--RLKIADFGLAIQDG  10
            E EV  Y   +L GL+ +HA+G VHCD+KP NVL+ P    G    R KI D GLA ++ 
Sbjct  131  EFEVRLYTRSMLRGLNHIHAIGYVHCDMKPENVLLVPSSSKGSVEFRAKIGDLGLAKREN  190

Query  9    K  7
            +
Sbjct  191  Q  191



>emb|CDY10813.1| BnaA05g11230D [Brassica napus]
Length=346

 Score = 55.1 bits (131),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 25/58 (43%), Positives = 38/58 (66%), Gaps = 5/58 (9%)
 Frame = -3

Query  165  YAYQLLVGLSDLHAMGIVHCDLKPLNVLVFPMEQNGLNR-----LKIADFGLAIQDGK  7
            +   +L GL  +HA G VHCDLKP N+LVFP +  G+ +     LK++DFG++ + G+
Sbjct  112  FTRMILEGLVSVHANGYVHCDLKPDNILVFPRDDVGVTKEVSYELKLSDFGMSTEAGE  169



>ref|XP_007337453.1| hypothetical protein AURDEDRAFT_179722 [Auricularia delicata 
TFB-10046 SS5]
 gb|EJD54606.1| hypothetical protein AURDEDRAFT_179722 [Auricularia delicata 
TFB-10046 SS5]
Length=1231

 Score = 56.2 bits (134),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 29/55 (53%), Positives = 37/55 (67%), Gaps = 5/55 (9%)
 Frame = -3

Query  174   VAFYAYQLLVGLSDLHAMGIVHCDLKPLNVLVFPMEQNGLNRLKIADFGLAIQDG  10
             V ++ YQ+L GL  LH+ G+VH DLKP N+L+    QNG   LKI DFGLA  +G
Sbjct  989   VQYFTYQILRGLKFLHSAGVVHRDLKPSNILI---NQNG--SLKIGDFGLARSEG  1038



>gb|EPS63968.1| hypothetical protein M569_10815, partial [Genlisea aurea]
Length=284

 Score = 54.7 bits (130),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 27/60 (45%), Positives = 35/60 (58%), Gaps = 6/60 (10%)
 Frame = -3

Query  183  EGEVAFYAYQLLVGLSDLHAMGIVHCDLKPLNVLVFPMEQNGLN------RLKIADFGLA  22
            E E   YA  +L GL  +H +G +HCDLKP N+ +FP++  G        R KI DFGLA
Sbjct  113  ETEAKSYAKCILRGLKHIHQLGYIHCDLKPDNIFLFPVKARGGGSSPARFRAKIGDFGLA  172



>ref|XP_010489776.1| PREDICTED: mitogen-activated protein kinase kinase kinase A-like 
[Camelina sativa]
Length=338

 Score = 55.1 bits (131),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 27/56 (48%), Positives = 37/56 (66%), Gaps = 4/56 (7%)
 Frame = -3

Query  165  YAYQLLVGLSDLHAMGIVHCDLKPLNVLVFPMEQNGLN---RLKIADFGLAIQDGK  7
            + Y +L GL  +H+ G VHCDLKP N+LVFP    G N    LKI+DFG++ + G+
Sbjct  113  FTYMILEGLVSIHSHGYVHCDLKPENILVFP-RTCGCNVSYELKISDFGMSTKVGE  167



>ref|WP_017956922.1| nitrogen fixation serine/threonine-protein kinase [Rhizobium 
leguminosarum]
Length=305

 Score = 55.1 bits (131),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 27/57 (47%), Positives = 36/57 (63%), Gaps = 4/57 (7%)
 Frame = -3

Query  180  GEVAFYAYQLLVGLSDLHAMGIVHCDLKPLNVLVFPMEQNGLNRLKIADFGLAIQDG  10
            GE+      +L GL  +HA G VHCDL PLN+L        L+RL+IADFG+A++ G
Sbjct  159  GEITSAMTSVLSGLEAIHAAGFVHCDLSPLNLLA----DGDLSRLRIADFGIALERG  211



>emb|CDY29107.1| BnaC09g18330D [Brassica napus]
Length=325

 Score = 55.1 bits (131),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 28/52 (54%), Positives = 35/52 (67%), Gaps = 1/52 (2%)
 Frame = -3

Query  162  AYQLLVGLSDLHAMGIVHCDLKPLNVLVFPMEQNGLN-RLKIADFGLAIQDG  10
            A  +L GL  LH+ G VHCDLKP NVL+FP +  G    LK+ADFGL+ + G
Sbjct  130  ALMILQGLEALHSQGYVHCDLKPANVLLFPSKTFGEPWDLKLADFGLSKEPG  181



>ref|XP_001322268.1| CMGC family protein kinase [Trichomonas vaginalis G3]
 gb|EAY10045.1| CMGC family protein kinase [Trichomonas vaginalis G3]
Length=341

 Score = 55.1 bits (131),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 25/49 (51%), Positives = 33/49 (67%), Gaps = 4/49 (8%)
 Frame = -3

Query  168  FYAYQLLVGLSDLHAMGIVHCDLKPLNVLVFPMEQNGLNRLKIADFGLA  22
             Y+YQ+L GL D+HA+GI H D+KP N+LV P+       +KI DFG A
Sbjct  141  LYSYQILTGLRDIHALGIAHRDIKPENILVNPLH----GEIKICDFGSA  185



>ref|NP_181723.1| putative protein serine/threonine kinase [Arabidopsis thaliana]
 gb|AAB63550.1| putative protein kinase [Arabidopsis thaliana]
 gb|AAL69474.1| At2g41920/T6D20.18 [Arabidopsis thaliana]
 gb|AEC10049.1| protein kinase-like protein [Arabidopsis thaliana]
Length=318

 Score = 54.7 bits (130),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 28/61 (46%), Positives = 39/61 (64%), Gaps = 6/61 (10%)
 Frame = -3

Query  165  YAYQLLVGLSDLHAMGIVHCDLKPLNVLVFP--MEQNGL----NRLKIADFGLAIQDGKI  4
            +   LL GL+ +H  G VHCDLKP N+LVFP  + +NG       LKI+DFG++ +DG  
Sbjct  117  FTRMLLEGLATIHRHGYVHCDLKPENILVFPSSVYKNGAWIRSYELKISDFGMSKRDGDT  176

Query  3    E  1
            +
Sbjct  177  Q  177



>ref|XP_010455116.1| PREDICTED: mitogen-activated protein kinase kinase 2-like [Camelina 
sativa]
Length=321

 Score = 54.7 bits (130),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 26/54 (48%), Positives = 36/54 (67%), Gaps = 2/54 (4%)
 Frame = -3

Query  165  YAYQLLVGLSDLHAMGIVHCDLKPLNVLVFPMEQNGLNRLKIADFGLAIQDGKI  4
            +   +L GL  +H  G VHCDLKP N+LVFP   +    LKI+DFGL+++ GK+
Sbjct  113  FTRMILEGLVSIHGHGYVHCDLKPDNLLVFPSGDS--YELKISDFGLSLEVGKV  164



>ref|XP_010028244.1| PREDICTED: mitogen-activated protein kinase kinase kinase YODA-like 
[Eucalyptus grandis]
 gb|KCW54942.1| hypothetical protein EUGRSUZ_I00916 [Eucalyptus grandis]
Length=370

 Score = 55.1 bits (131),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 27/54 (50%), Positives = 36/54 (67%), Gaps = 3/54 (6%)
 Frame = -3

Query  183  EGEVAFYAYQLLVGLSDLHAMGIVHCDLKPLNVLVFPMEQNGLNRLKIADFGLA  22
            E E+  +   +L GL  +H+ G VHCD+K  N+LVFP   NG + +KIADFGLA
Sbjct  106  EAEIRRHTRSILEGLEFVHSKGFVHCDVKLQNILVFP---NGGDEVKIADFGLA  156



>ref|XP_002306472.2| hypothetical protein POPTR_0005s18230g, partial [Populus trichocarpa]
 gb|EEE93468.2| hypothetical protein POPTR_0005s18230g, partial [Populus trichocarpa]
Length=342

 Score = 54.7 bits (130),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 30/59 (51%), Positives = 39/59 (66%), Gaps = 5/59 (8%)
 Frame = -3

Query  183  EGEVAFYAYQLLVGLSDLHAMGIVHCDLKPLNVLVFPMEQNGLNRLKIADFGLAIQDGK  7
            EG+V  Y   +L GLS +H  G VHCDLK  N+L+F   +NG   +KIADFGLA + G+
Sbjct  105  EGDVKDYTRSILKGLSYVHGKGFVHCDLKLDNILLF---ENG--EVKIADFGLAKKTGQ  158



>ref|NP_198103.1| protein kinase family protein [Arabidopsis thaliana]
 gb|AED93695.1| protein kinase family protein [Arabidopsis thaliana]
Length=301

 Score = 54.7 bits (130),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 26/54 (48%), Positives = 37/54 (69%), Gaps = 2/54 (4%)
 Frame = -3

Query  165  YAYQLLVGLSDLHAMGIVHCDLKPLNVLVFPMEQNGLNRLKIADFGLAIQDGKI  4
            +   +L GL  +H+ G VHCDLKP NVLVFP   +    +KI+DFGL++Q G++
Sbjct  113  FTRMILQGLVSIHSHGYVHCDLKPENVLVFPCGDS--YEVKISDFGLSLQVGEV  164



>ref|XP_010028243.1| PREDICTED: mitogen-activated protein kinase kinase kinase NPK1-like 
[Eucalyptus grandis]
 gb|KCW54941.1| hypothetical protein EUGRSUZ_I00915 [Eucalyptus grandis]
Length=372

 Score = 55.1 bits (131),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 28/59 (47%), Positives = 38/59 (64%), Gaps = 3/59 (5%)
 Frame = -3

Query  183  EGEVAFYAYQLLVGLSDLHAMGIVHCDLKPLNVLVFPMEQNGLNRLKIADFGLAIQDGK  7
            E E+  +A  +L GL  +H+ G VHCD+K  N+LVFP    G   +KIADFGLA + G+
Sbjct  106  EAEIRRHARSILEGLEFVHSKGFVHCDIKLQNILVFP---RGGEEVKIADFGLAKRAGE  161



>ref|XP_006355241.1| PREDICTED: mitogen-activated protein kinase kinase kinase YODA-like 
[Solanum tuberosum]
Length=337

 Score = 54.7 bits (130),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 23/43 (53%), Positives = 33/43 (77%), Gaps = 1/43 (2%)
 Frame = -3

Query  144  GLSDLHAMGIVHCDLKPLNVLVFPMEQNGLNRLKIADFGLAIQ  16
            G+S +H  G +HCDLKP N+LVFP  +  + RLK+ADFGL+++
Sbjct  108  GISHVHNKGFIHCDLKPANILVFPPTEKYM-RLKLADFGLSLK  149



>ref|XP_009132736.1| PREDICTED: mitogen-activated protein kinase kinase kinase ANP1-like 
[Brassica rapa]
Length=331

 Score = 54.7 bits (130),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 29/58 (50%), Positives = 37/58 (64%), Gaps = 6/58 (10%)
 Frame = -3

Query  165  YAYQLLVGLSDLHAMGIVHCDLKPLNVLVFP--MEQNGL----NRLKIADFGLAIQDG  10
            +   LL GL+ +HA G VHCDLKP N+LVFP  +  NG       LKI+DFGL  ++G
Sbjct  117  FTRMLLQGLATIHAHGYVHCDLKPENILVFPSYINNNGAWSSSFELKISDFGLLRREG  174



>ref|XP_009625704.1| PREDICTED: mitogen-activated protein kinase kinase kinase ANP1-like 
[Nicotiana tomentosiformis]
 ref|XP_009625705.1| PREDICTED: mitogen-activated protein kinase kinase kinase ANP1-like 
[Nicotiana tomentosiformis]
Length=329

 Score = 54.7 bits (130),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 27/56 (48%), Positives = 37/56 (66%), Gaps = 1/56 (2%)
 Frame = -3

Query  183  EGEVAFYAYQLLVGLSDLHAMGIVHCDLKPLNV-LVFPMEQNGLNRLKIADFGLAI  19
            E EV  +   +++GLS +H  GI+HCDLKP N+ LV P + +     KIADFGLA+
Sbjct  120  EVEVTEHTKNVVLGLSRIHGAGIIHCDLKPHNILLVTPTDDDTTGIAKIADFGLAM  175



>ref|XP_009142826.1| PREDICTED: mitogen-activated protein kinase kinase kinase A [Brassica 
rapa]
Length=340

 Score = 54.7 bits (130),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 25/56 (45%), Positives = 36/56 (64%), Gaps = 3/56 (5%)
 Frame = -3

Query  165  YAYQLLVGLSDLHAMGIVHCDLKPLNVLVFPMEQNGLN---RLKIADFGLAIQDGK  7
            +   +L GL  +H+ G VHCDLKP N+LVFP    GL     LK++DFG++ + G+
Sbjct  108  FTLMILQGLVSVHSHGYVHCDLKPENLLVFPRHVGGLQSTYELKLSDFGMSTKAGE  163



>ref|XP_009113904.1| PREDICTED: mitogen-activated protein kinase kinase kinase ANP1-like 
[Brassica rapa]
Length=325

 Score = 54.7 bits (130),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 28/52 (54%), Positives = 35/52 (67%), Gaps = 1/52 (2%)
 Frame = -3

Query  162  AYQLLVGLSDLHAMGIVHCDLKPLNVLVFPMEQNGLN-RLKIADFGLAIQDG  10
            A  +L GL  LH+ G VHCDLKP NVL+FP +  G    LK+ADFGL+ + G
Sbjct  130  ALMILQGLEALHSRGYVHCDLKPANVLLFPSKTFGEPWDLKLADFGLSKEPG  181



>ref|XP_009114073.1| PREDICTED: mitogen-activated protein kinase kinase kinase ANP1-like 
[Brassica rapa]
 emb|CDY13094.1| BnaA09g17230D [Brassica napus]
Length=325

 Score = 54.7 bits (130),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 28/52 (54%), Positives = 35/52 (67%), Gaps = 1/52 (2%)
 Frame = -3

Query  162  AYQLLVGLSDLHAMGIVHCDLKPLNVLVFPMEQNGLN-RLKIADFGLAIQDG  10
            A  +L GL  LH+ G VHCDLKP NVL+FP +  G    LK+ADFGL+ + G
Sbjct  131  ALMILQGLEALHSRGYVHCDLKPANVLLFPSKTFGEPWDLKLADFGLSKEPG  182



>emb|CDY13093.1| BnaA09g17240D [Brassica napus]
Length=325

 Score = 54.7 bits (130),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 28/52 (54%), Positives = 35/52 (67%), Gaps = 1/52 (2%)
 Frame = -3

Query  162  AYQLLVGLSDLHAMGIVHCDLKPLNVLVFPMEQNGLN-RLKIADFGLAIQDG  10
            A  +L GL  LH+ G VHCDLKP NVL+FP +  G    LK+ADFGL+ + G
Sbjct  130  ALMILQGLEALHSRGYVHCDLKPANVLLFPSKTFGEPWDLKLADFGLSKEPG  181



>ref|XP_002875747.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH52006.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=393

 Score = 54.7 bits (130),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 28/65 (43%), Positives = 44/65 (68%), Gaps = 5/65 (8%)
 Frame = -3

Query  183  EGEVAFYAYQLLVGLSDLHAMGIVHCDLKPLNVLVFPMEQ----NGLNRLKIADFGLAIQ  16
            E +V  ++  +L GLS +H+  IVHCD+KP N+L+ P++     NG   +KIADFGL+++
Sbjct  209  EFDVKQFSRDVLSGLSYIHSRNIVHCDIKPDNLLLSPVDHRFRFNGY-LIKIADFGLSME  267

Query  15   DGKIE  1
             G +E
Sbjct  268  KGSVE  272



>ref|XP_010471614.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0270146 
[Camelina sativa]
Length=260

 Score = 53.9 bits (128),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 28/55 (51%), Positives = 34/55 (62%), Gaps = 1/55 (2%)
 Frame = -3

Query  183  EGEVAFYAYQLLVGLSDLHAMGIVHCDLKPLNVLVFPMEQNGLN-RLKIADFGLA  22
            E  +   A+ +L GL  LH+ G VHCDLKP NVLVFP    G    LK+ADFG +
Sbjct  69   ENMIGRAAFMILQGLDALHSNGYVHCDLKPANVLVFPSTTVGEPWDLKLADFGFS  123



>ref|XP_010028242.1| PREDICTED: mitogen-activated protein kinase kinase kinase YODA-like 
[Eucalyptus grandis]
 gb|KCW54940.1| hypothetical protein EUGRSUZ_I00914 [Eucalyptus grandis]
Length=399

 Score = 54.7 bits (130),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 27/59 (46%), Positives = 39/59 (66%), Gaps = 3/59 (5%)
 Frame = -3

Query  183  EGEVAFYAYQLLVGLSDLHAMGIVHCDLKPLNVLVFPMEQNGLNRLKIADFGLAIQDGK  7
            + E+  +   +L GL  +H+ G VHCD+K  N+LVFP   NG + +KIADFGLA + G+
Sbjct  106  DAEIRRHTRSILEGLEFVHSKGFVHCDVKLQNILVFP---NGGDEVKIADFGLAKKAGE  161



>ref|XP_010493426.1| PREDICTED: mitogen-activated protein kinase kinase kinase 3-like 
[Camelina sativa]
Length=306

 Score = 54.3 bits (129),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 28/55 (51%), Positives = 34/55 (62%), Gaps = 1/55 (2%)
 Frame = -3

Query  183  EGEVAFYAYQLLVGLSDLHAMGIVHCDLKPLNVLVFPMEQNGLN-RLKIADFGLA  22
            E  +   A+ +L GL  LH  G VHCDLKP N+LVFP    G    LK+ADFGL+
Sbjct  115  ENMIGRAAFMILQGLDALHTNGYVHCDLKPANILVFPSTTVGEPWDLKLADFGLS  169



>ref|XP_011008530.1| PREDICTED: mitogen-activated protein kinase kinase kinase YODA 
[Populus euphratica]
Length=352

 Score = 54.7 bits (130),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 30/59 (51%), Positives = 39/59 (66%), Gaps = 5/59 (8%)
 Frame = -3

Query  183  EGEVAFYAYQLLVGLSDLHAMGIVHCDLKPLNVLVFPMEQNGLNRLKIADFGLAIQDGK  7
            EG+V  Y   +L GLS +H  G VHCDLK  N+L+F   +NG   +KIADFGLA + G+
Sbjct  105  EGDVKDYTRSILKGLSCVHGKGFVHCDLKLDNILLF---ENG--EVKIADFGLAKKTGQ  158



>ref|XP_010554993.1| PREDICTED: mitogen-activated protein kinase kinase kinase YODA-like 
[Tarenaya hassleriana]
Length=270

 Score = 53.9 bits (128),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 28/55 (51%), Positives = 34/55 (62%), Gaps = 1/55 (2%)
 Frame = -3

Query  183  EGEVAFYAYQLLVGLSDLHAMGIVHCDLKPLNVLVFPMEQNG-LNRLKIADFGLA  22
            E  V  +   +L GL  LHA G VHCDLKP N+L FP +  G +  LKI+DFG A
Sbjct  120  EKHVKCFTRMILRGLMALHAEGYVHCDLKPANILAFPSKAVGEICELKISDFGSA  174



>ref|XP_002877436.1| hypothetical protein ARALYDRAFT_905755 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH53695.1| hypothetical protein ARALYDRAFT_905755 [Arabidopsis lyrata subsp. 
lyrata]
Length=418

 Score = 54.7 bits (130),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 28/65 (43%), Positives = 44/65 (68%), Gaps = 5/65 (8%)
 Frame = -3

Query  183  EGEVAFYAYQLLVGLSDLHAMGIVHCDLKPLNVLVFPMEQ----NGLNRLKIADFGLAIQ  16
            E +V  ++  +L GLS +H+  IVHCD+KP N+L+ P++     NG   +KIADFGL+++
Sbjct  234  EFDVKQFSRDVLSGLSYIHSRNIVHCDIKPDNLLLSPVDHRFRFNGY-LIKIADFGLSME  292

Query  15   DGKIE  1
             G +E
Sbjct  293  KGSVE  297



>ref|WP_003575650.1| protein kinase family protein [Rhizobium leguminosarum]
 gb|EJC83410.1| protein kinase family protein [Rhizobium leguminosarum bv. trifolii 
WSM2297]
 gb|EJC84998.1| protein kinase family protein [Rhizobium leguminosarum bv. trifolii 
WSM2297]
Length=307

 Score = 54.3 bits (129),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 28/57 (49%), Positives = 35/57 (61%), Gaps = 3/57 (5%)
 Frame = -3

Query  180  GEVAFYAYQLLVGLSDLHAMGIVHCDLKPLNVLVFPMEQNGLNRLKIADFGLAIQDG  10
            GEV      +L GL  +HA G VHCDL PLN+L         +RLKIADFG+A++ G
Sbjct  164  GEVTAIMTSVLFGLQAIHAAGFVHCDLSPLNLL---SADGDFSRLKIADFGVALEVG  217



>gb|EYU21752.1| hypothetical protein MIMGU_mgv1a021677mg [Erythranthe guttata]
Length=345

 Score = 54.7 bits (130),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 27/54 (50%), Positives = 33/54 (61%), Gaps = 1/54 (2%)
 Frame = -3

Query  183  EGEVAFYAYQLLVGLSDLHAMGIVHCDLKPLNVLVFPMEQNGLNRLKIADFGLA  22
            E E   Y   +L GL+ +H  G VHCDLKP N+L+ P    G+ R KI DFGLA
Sbjct  118  ECEARVYTRSILRGLNHIHGNGYVHCDLKPENILLVPNSGAGI-RAKIGDFGLA  170



>ref|XP_006295977.1| hypothetical protein CARUB_v10025120mg [Capsella rubella]
 gb|EOA28875.1| hypothetical protein CARUB_v10025120mg [Capsella rubella]
Length=308

 Score = 54.3 bits (129),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 29/59 (49%), Positives = 39/59 (66%), Gaps = 6/59 (10%)
 Frame = -3

Query  165  YAYQLLVGLSDLHAMGIVHCDLKPLNVLVFP--MEQNGLNR----LKIADFGLAIQDGK  7
            +   LL GL+ +H    VHCDLKP N+LVFP  + +NG  R    LKI+DFGLA ++G+
Sbjct  117  FTRMLLEGLATIHGRRYVHCDLKPENILVFPSRVYKNGAWRSSYELKISDFGLAKKEGE  175



>ref|XP_010495543.1| PREDICTED: mitogen-activated protein kinase kinase 2-like [Camelina 
sativa]
Length=321

 Score = 54.3 bits (129),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 26/54 (48%), Positives = 36/54 (67%), Gaps = 2/54 (4%)
 Frame = -3

Query  165  YAYQLLVGLSDLHAMGIVHCDLKPLNVLVFPMEQNGLNRLKIADFGLAIQDGKI  4
            +   +L GL  +H  G VHCDLKP N+LVFP   +    LKI+DFGL++Q G++
Sbjct  112  FTRMILEGLVSIHGHGYVHCDLKPDNLLVFPSGDS--YELKISDFGLSLQVGQV  163



>ref|WP_027686720.1| membrane protein [Rhizobium leguminosarum]
Length=303

 Score = 54.3 bits (129),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 27/56 (48%), Positives = 36/56 (64%), Gaps = 4/56 (7%)
 Frame = -3

Query  177  EVAFYAYQLLVGLSDLHAMGIVHCDLKPLNVLVFPMEQNGLNRLKIADFGLAIQDG  10
            E+      +L GL  +HA G VHCDL PLN+LV       ++RLKIADFG+A++ G
Sbjct  159  EITSVMTSVLSGLEAIHAGGFVHCDLSPLNLLV----DGDISRLKIADFGIALKHG  210



>ref|XP_009613859.1| PREDICTED: mitogen-activated protein kinase kinase kinase 3-like 
[Nicotiana tomentosiformis]
Length=331

 Score = 54.3 bits (129),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 27/56 (48%), Positives = 37/56 (66%), Gaps = 1/56 (2%)
 Frame = -3

Query  183  EGEVAFYAYQLLVGLSDLHAMGIVHCDLKPLNV-LVFPMEQNGLNRLKIADFGLAI  19
            E EV  +   +++GLS +H  GI+HCDLKP N+ LV P + +     KIADFGLA+
Sbjct  120  EVEVKKHTKNVVLGLSRIHGSGIIHCDLKPHNILLVTPTDDDTTEIAKIADFGLAM  175



>ref|XP_010468299.1| PREDICTED: mitogen-activated protein kinase kinase 7-like [Camelina 
sativa]
Length=311

 Score = 54.3 bits (129),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 27/65 (42%), Positives = 41/65 (63%), Gaps = 5/65 (8%)
 Frame = -3

Query  183  EGEVAFYAYQLLVGLSDLHAMGIVHCDLKPLNVLVFPMEQ----NGLNRLKIADFGLAIQ  16
            E +V  ++  +L G+S +H+M I+HCD+KP N+L+ P       NG    KIADFGLA++
Sbjct  209  ESDVQLFSTDILKGISYIHSMTIIHCDIKPGNILLKPQVTRSMPNGFEP-KIADFGLALR  267

Query  15   DGKIE  1
               +E
Sbjct  268  KTSVE  272



>emb|CDY23999.1| BnaC03g16920D [Brassica napus]
Length=306

 Score = 53.9 bits (128),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 29/53 (55%), Positives = 37/53 (70%), Gaps = 6/53 (11%)
 Frame = -3

Query  150  LVGLSDLHAMGIVHCDLKPLNVLVFP--MEQNGLNR----LKIADFGLAIQDG  10
            L+ L+ +HA G VHCDLKP NVLVFP    +NG  R    LKI+DFGL+ ++G
Sbjct  97   LMSLATIHAHGYVHCDLKPENVLVFPRYAYKNGAWRSSFELKISDFGLSRREG  149



>ref|XP_008782769.1| PREDICTED: mitogen-activated protein kinase kinase kinase YODA-like 
[Phoenix dactylifera]
Length=246

 Score = 53.5 bits (127),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 28/54 (52%), Positives = 35/54 (65%), Gaps = 5/54 (9%)
 Frame = -3

Query  183  EGEVAFYAYQLLVGLSDLHAMGIVHCDLKPLNVLVFPMEQNGLNRLKIADFGLA  22
            E EV   A  +L GL+ +HA G VHCD+KP N+LV     +G   +KIADFGLA
Sbjct  73   ESEVRRCARSILRGLTHIHAKGYVHCDIKPHNILV-----SGSGEVKIADFGLA  121



>ref|XP_005828031.1| hypothetical protein GUITHDRAFT_88507 [Guillardia theta CCMP2712]
 gb|EKX41051.1| hypothetical protein GUITHDRAFT_88507 [Guillardia theta CCMP2712]
Length=491

 Score = 54.7 bits (130),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 27/54 (50%), Positives = 38/54 (70%), Gaps = 5/54 (9%)
 Frame = -3

Query  183  EGEVAFYAYQLLVGLSDLHAMGIVHCDLKPLNVLVFPMEQNGLNRLKIADFGLA  22
            EG  AFYA Q+++GL  LH  GI+H D+KP N L   +++NG+  LK++DFG A
Sbjct  236  EGLAAFYAKQIIIGLEYLHVHGIIHGDIKPANCL---LDKNGV--LKLSDFGCA  284



>gb|KDP31943.1| hypothetical protein JCGZ_12404 [Jatropha curcas]
Length=348

 Score = 54.3 bits (129),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 28/59 (47%), Positives = 38/59 (64%), Gaps = 5/59 (8%)
 Frame = -3

Query  183  EGEVAFYAYQLLVGLSDLHAMGIVHCDLKPLNVLVFPMEQNGLNRLKIADFGLAIQDGK  7
            E E+  +   +L GL D+HA G VHCD+K  N+L+F    NG   +KIADFGLA + G+
Sbjct  101  ESEIKRFTRSILKGLRDIHAKGFVHCDIKLQNLLLF---DNG--EVKIADFGLATKTGE  154



>ref|XP_010093628.1| Mitogen-activated protein kinase kinase kinase A [Morus notabilis]
 gb|EXB54389.1| Mitogen-activated protein kinase kinase kinase A [Morus notabilis]
Length=360

 Score = 54.3 bits (129),  Expect = 8e-07, Method: Composition-based stats.
 Identities = 31/61 (51%), Positives = 42/61 (69%), Gaps = 6/61 (10%)
 Frame = -3

Query  183  EGEVAFYAYQLLVGLSDLHAMGIVHCDLKPLNVLVFPMEQNGLNRLKIADFGLAIQDGKI  4
            E E+  +A  +L GLS +HA G VHCD+KP N+LVF    +G   +KIADFGLA ++ K+
Sbjct  118  ELEIRRHARSILKGLSFIHAKGFVHCDIKPQNILVF---DDG--AVKIADFGLA-KEAKM  171

Query  3    E  1
            E
Sbjct  172  E  172



>ref|XP_004911783.1| PREDICTED: protein kinase C delta type-like [Xenopus (Silurana) 
tropicalis]
Length=225

 Score = 53.1 bits (126),  Expect = 8e-07, Method: Composition-based stats.
 Identities = 26/53 (49%), Positives = 37/53 (70%), Gaps = 5/53 (9%)
 Frame = -3

Query  174  VAFYAYQLLVGLSDLHAMGIVHCDLKPLNVLVFPMEQNGLNRLKIADFGLAIQ  16
            V FY  ++++GL  LH+ GIVHCDLKP N+LV   + +G   +KI DFGL+ +
Sbjct  13   VKFYTAEIVIGLQFLHSNGIVHCDLKPDNILV---DMDG--HIKICDFGLSAE  60



>gb|EYB81415.1| hypothetical protein Y032_0384g403 [Ancylostoma ceylanicum]
Length=354

 Score = 54.3 bits (129),  Expect = 8e-07, Method: Composition-based stats.
 Identities = 29/54 (54%), Positives = 36/54 (67%), Gaps = 5/54 (9%)
 Frame = -3

Query  183  EGEVAFYAYQLLVGLSDLHAMGIVHCDLKPLNVLVFPMEQNGLNRLKIADFGLA  22
            E    ++ YQLL GL  LH++GIVH DLKP N+LV     NG   L+IADFG+A
Sbjct  111  EQHFQYFLYQLLRGLKYLHSVGIVHRDLKPSNLLV-----NGDCLLRIADFGMA  159



>ref|XP_010471603.1| PREDICTED: mitogen-activated protein kinase kinase kinase ANP1-like 
[Camelina sativa]
Length=306

 Score = 53.9 bits (128),  Expect = 8e-07, Method: Composition-based stats.
 Identities = 28/55 (51%), Positives = 34/55 (62%), Gaps = 1/55 (2%)
 Frame = -3

Query  183  EGEVAFYAYQLLVGLSDLHAMGIVHCDLKPLNVLVFPMEQNGLN-RLKIADFGLA  22
            E  +   A+ +L GL  LH+ G VHCDLKP NVLVFP    G    LK+ADFG +
Sbjct  115  ENMIGRAAFMILQGLDALHSNGYVHCDLKPANVLVFPSTTVGEPWDLKLADFGFS  169



>ref|XP_005843023.1| hypothetical protein CHLNCDRAFT_141712 [Chlorella variabilis]
 gb|EFN50921.1| hypothetical protein CHLNCDRAFT_141712 [Chlorella variabilis]
Length=381

 Score = 54.3 bits (129),  Expect = 8e-07, Method: Composition-based stats.
 Identities = 29/54 (54%), Positives = 35/54 (65%), Gaps = 5/54 (9%)
 Frame = -3

Query  183  EGEVAFYAYQLLVGLSDLHAMGIVHCDLKPLNVLVFPMEQNGLNRLKIADFGLA  22
            E  V F+ YQLL GL  LH+ G+VH DLKP N+L+     NG   L+I DFGLA
Sbjct  142  EEHVQFFIYQLLRGLKYLHSAGVVHRDLKPSNLLL-----NGNCELRICDFGLA  190



>ref|XP_006393169.1| hypothetical protein EUTSA_v10012148mg [Eutrema salsugineum]
 gb|ESQ30455.1| hypothetical protein EUTSA_v10012148mg [Eutrema salsugineum]
Length=319

 Score = 53.9 bits (128),  Expect = 8e-07, Method: Composition-based stats.
 Identities = 25/54 (46%), Positives = 35/54 (65%), Gaps = 0/54 (0%)
 Frame = -3

Query  165  YAYQLLVGLSDLHAMGIVHCDLKPLNVLVFPMEQNGLNRLKIADFGLAIQDGKI  4
            +   +L GL  +H  G VHCDLKP N+LVFP   +    LKI+DFG +++ G+I
Sbjct  115  FTRMILEGLVCIHGHGYVHCDLKPDNLLVFPSRDSSSYELKISDFGNSLEVGEI  168



>gb|EYB81416.1| hypothetical protein Y032_0384g403 [Ancylostoma ceylanicum]
Length=360

 Score = 54.3 bits (129),  Expect = 8e-07, Method: Composition-based stats.
 Identities = 29/54 (54%), Positives = 36/54 (67%), Gaps = 5/54 (9%)
 Frame = -3

Query  183  EGEVAFYAYQLLVGLSDLHAMGIVHCDLKPLNVLVFPMEQNGLNRLKIADFGLA  22
            E    ++ YQLL GL  LH++GIVH DLKP N+LV     NG   L+IADFG+A
Sbjct  117  EQHFQYFLYQLLRGLKYLHSVGIVHRDLKPSNLLV-----NGDCLLRIADFGMA  165



>ref|XP_006393688.1| hypothetical protein EUTSA_v10012166mg [Eutrema salsugineum]
 gb|ESQ30974.1| hypothetical protein EUTSA_v10012166mg [Eutrema salsugineum]
Length=351

 Score = 54.3 bits (129),  Expect = 8e-07, Method: Composition-based stats.
 Identities = 25/54 (46%), Positives = 36/54 (67%), Gaps = 0/54 (0%)
 Frame = -3

Query  165  YAYQLLVGLSDLHAMGIVHCDLKPLNVLVFPMEQNGLNRLKIADFGLAIQDGKI  4
            +   +L GL  +H  G VHCDLKP N+LVFP + +    LKI+DFG +++ G+I
Sbjct  115  FTRMILEGLVCIHGHGYVHCDLKPDNLLVFPCKDSSSYELKISDFGNSLKVGQI  168



>gb|EYB81418.1| hypothetical protein Y032_0384g403 [Ancylostoma ceylanicum]
Length=376

 Score = 54.3 bits (129),  Expect = 8e-07, Method: Composition-based stats.
 Identities = 29/54 (54%), Positives = 36/54 (67%), Gaps = 5/54 (9%)
 Frame = -3

Query  183  EGEVAFYAYQLLVGLSDLHAMGIVHCDLKPLNVLVFPMEQNGLNRLKIADFGLA  22
            E    ++ YQLL GL  LH++GIVH DLKP N+LV     NG   L+IADFG+A
Sbjct  133  EQHFQYFLYQLLRGLKYLHSVGIVHRDLKPSNLLV-----NGDCLLRIADFGMA  181



>gb|KCW54938.1| hypothetical protein EUGRSUZ_I00911 [Eucalyptus grandis]
Length=378

 Score = 54.3 bits (129),  Expect = 8e-07, Method: Composition-based stats.
 Identities = 28/59 (47%), Positives = 40/59 (68%), Gaps = 3/59 (5%)
 Frame = -3

Query  183  EGEVAFYAYQLLVGLSDLHAMGIVHCDLKPLNVLVFPMEQNGLNRLKIADFGLAIQDGK  7
            E E+  +A  +L GL  +H+ G VHCD+K  N+LVFP   +G + +KIADFGLA + G+
Sbjct  107  EPEMRRHARSILEGLEFVHSKGFVHCDVKLQNILVFP---DGGDEVKIADFGLAKRAGE  162



>gb|KEH36902.1| MAP kinase kinase kinase [Medicago truncatula]
Length=335

 Score = 53.9 bits (128),  Expect = 8e-07, Method: Composition-based stats.
 Identities = 31/54 (57%), Positives = 35/54 (65%), Gaps = 6/54 (11%)
 Frame = -3

Query  183  EGEVAFYAYQLLVGLSDLHAMGIVHCDLKPLNVLVFPMEQNGLNRLKIADFGLA  22
            E  V FYA Q+L+GL+ LH  GIVHCDLK  NVLV   EQ      KI+DFG A
Sbjct  101  EAMVGFYARQILLGLNYLHLNGIVHCDLKGQNVLV--TEQGA----KISDFGCA  148



>ref|XP_006293406.1| hypothetical protein CARUB_v10024721mg, partial [Capsella rubella]
 gb|EOA26304.1| hypothetical protein CARUB_v10024721mg, partial [Capsella rubella]
Length=242

 Score = 53.1 bits (126),  Expect = 8e-07, Method: Composition-based stats.
 Identities = 26/51 (51%), Positives = 35/51 (69%), Gaps = 2/51 (4%)
 Frame = -3

Query  153  LLVGLSDLHAMGIVHCDLKPLNVLVFPME--QNGLNRLKIADFGLAIQDGK  7
            +L GL  +H+ G VHCDLKP N+LVFP     N +  LKI+DFG+A + G+
Sbjct  22   ILEGLVSIHSQGYVHCDLKPKNILVFPRTCGCNVVYDLKISDFGMATKVGE  72



>ref|XP_006393690.1| hypothetical protein EUTSA_v10012137mg [Eutrema salsugineum]
 gb|ESQ30976.1| hypothetical protein EUTSA_v10012137mg [Eutrema salsugineum]
Length=351

 Score = 53.9 bits (128),  Expect = 8e-07, Method: Composition-based stats.
 Identities = 25/54 (46%), Positives = 36/54 (67%), Gaps = 0/54 (0%)
 Frame = -3

Query  165  YAYQLLVGLSDLHAMGIVHCDLKPLNVLVFPMEQNGLNRLKIADFGLAIQDGKI  4
            +   +L GL  +H  G VHCDLKP N+LVFP + +    LKI+DFG +++ G+I
Sbjct  115  FTRMILEGLVCIHGHGYVHCDLKPDNLLVFPCKDSSSYELKISDFGNSLKVGQI  168



>gb|EYB81417.1| hypothetical protein Y032_0384g403 [Ancylostoma ceylanicum]
Length=387

 Score = 54.3 bits (129),  Expect = 9e-07, Method: Composition-based stats.
 Identities = 29/54 (54%), Positives = 36/54 (67%), Gaps = 5/54 (9%)
 Frame = -3

Query  183  EGEVAFYAYQLLVGLSDLHAMGIVHCDLKPLNVLVFPMEQNGLNRLKIADFGLA  22
            E    ++ YQLL GL  LH++GIVH DLKP N+LV     NG   L+IADFG+A
Sbjct  144  EQHFQYFLYQLLRGLKYLHSVGIVHRDLKPSNLLV-----NGDCLLRIADFGMA  192



>ref|XP_010028240.1| PREDICTED: mitogen-activated protein kinase kinase kinase NPK1-like 
[Eucalyptus grandis]
Length=394

 Score = 54.3 bits (129),  Expect = 9e-07, Method: Composition-based stats.
 Identities = 28/59 (47%), Positives = 40/59 (68%), Gaps = 3/59 (5%)
 Frame = -3

Query  183  EGEVAFYAYQLLVGLSDLHAMGIVHCDLKPLNVLVFPMEQNGLNRLKIADFGLAIQDGK  7
            E E+  +A  +L GL  +H+ G VHCD+K  N+LVFP   +G + +KIADFGLA + G+
Sbjct  107  EPEMRRHARSILEGLEFVHSKGFVHCDVKLQNILVFP---DGGDEVKIADFGLAKRAGE  162



>ref|XP_002936098.2| PREDICTED: protein kinase C delta type-like [Xenopus (Silurana) 
tropicalis]
Length=238

 Score = 53.1 bits (126),  Expect = 9e-07, Method: Composition-based stats.
 Identities = 26/53 (49%), Positives = 37/53 (70%), Gaps = 5/53 (9%)
 Frame = -3

Query  174  VAFYAYQLLVGLSDLHAMGIVHCDLKPLNVLVFPMEQNGLNRLKIADFGLAIQ  16
            V FY  ++++GL  LH+ GIVHCDLKP N+LV   + +G   +KI DFGL+ +
Sbjct  48   VKFYTAEIVIGLQFLHSNGIVHCDLKPDNILV---DMDG--HIKICDFGLSAE  95



>emb|CDY51516.1| BnaC04g02350D [Brassica napus]
Length=289

 Score = 53.5 bits (127),  Expect = 9e-07, Method: Composition-based stats.
 Identities = 25/54 (46%), Positives = 36/54 (67%), Gaps = 2/54 (4%)
 Frame = -3

Query  165  YAYQLLVGLSDLHAMGIVHCDLKPLNVLVFPMEQNGLNRLKIADFGLAIQDGKI  4
            +   LL GL  +H +G VHCDLKP N+L+FP  Q+    LKI+DFG + + G++
Sbjct  117  FTRMLLRGLVSIHNLGYVHCDLKPENLLIFPCGQS--YELKISDFGSSTEVGEV  168



>ref|XP_009418544.1| PREDICTED: mitogen-activated protein kinase kinase 5-like [Musa 
acuminata subsp. malaccensis]
Length=329

 Score = 53.9 bits (128),  Expect = 9e-07, Method: Composition-based stats.
 Identities = 28/54 (52%), Positives = 36/54 (67%), Gaps = 5/54 (9%)
 Frame = -3

Query  183  EGEVAFYAYQLLVGLSDLHAMGIVHCDLKPLNVLVFPMEQNGLNRLKIADFGLA  22
            E ++A  A Q+LVGL+DLH   IVH D+KP N+LV     NG   +KIADFG+ 
Sbjct  147  EAQLAAVARQVLVGLADLHGRRIVHRDIKPSNLLV-----NGAGEVKIADFGVG  195



>gb|EMD48003.1| protein kinase, putative, partial [Entamoeba histolytica KU27]
Length=338

 Score = 53.9 bits (128),  Expect = 9e-07, Method: Composition-based stats.
 Identities = 28/53 (53%), Positives = 36/53 (68%), Gaps = 5/53 (9%)
 Frame = -3

Query  180  GEVAFYAYQLLVGLSDLHAMGIVHCDLKPLNVLVFPMEQNGLNRLKIADFGLA  22
            G++  Y  QLL+G+  LH++GIVH DLKP N+L+     N    LKIADFGLA
Sbjct  115  GQLKGYMKQLLIGIQYLHSIGIVHRDLKPSNLLI-----NNEGYLKIADFGLA  162



>ref|XP_010445964.1| PREDICTED: mitogen-activated protein kinase kinase kinase 3-like 
[Camelina sativa]
Length=308

 Score = 53.5 bits (127),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 27/48 (56%), Positives = 32/48 (67%), Gaps = 1/48 (2%)
 Frame = -3

Query  162  AYQLLVGLSDLHAMGIVHCDLKPLNVLVFPMEQNGLN-RLKIADFGLA  22
            A+ +L GL  LH+ G VHCDLKP NVLVFP    G    LK+ADFG +
Sbjct  124  AFMILQGLDALHSNGYVHCDLKPANVLVFPSTTVGEPWDLKLADFGFS  171



>ref|XP_653785.1| protein kinase [Entamoeba histolytica HM-1:IMSS]
 gb|EAL48399.1| protein kinase, putative [Entamoeba histolytica HM-1:IMSS]
 gb|EMH77562.1| protein kinase, putative [Entamoeba histolytica HM-1:IMSS-B]
 gb|EMS16517.1| protein kinase, putative [Entamoeba histolytica HM-3:IMSS]
 gb|ENY64298.1| protein kinase, putative [Entamoeba histolytica HM-1:IMSS-A]
Length=335

 Score = 53.9 bits (128),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 28/53 (53%), Positives = 36/53 (68%), Gaps = 5/53 (9%)
 Frame = -3

Query  180  GEVAFYAYQLLVGLSDLHAMGIVHCDLKPLNVLVFPMEQNGLNRLKIADFGLA  22
            G++  Y  QLL+G+  LH++GIVH DLKP N+L+     N    LKIADFGLA
Sbjct  112  GQLKGYMKQLLIGIQYLHSIGIVHRDLKPSNLLI-----NNEGYLKIADFGLA  159



>ref|XP_008858548.1| protein kinase, putative [Entamoeba nuttalli P19]
 gb|EKE39120.1| protein kinase, putative [Entamoeba nuttalli P19]
Length=335

 Score = 53.9 bits (128),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 28/53 (53%), Positives = 36/53 (68%), Gaps = 5/53 (9%)
 Frame = -3

Query  180  GEVAFYAYQLLVGLSDLHAMGIVHCDLKPLNVLVFPMEQNGLNRLKIADFGLA  22
            G++  Y  QLL+G+  LH++GIVH DLKP N+L+     N    LKIADFGLA
Sbjct  112  GQLKGYMKQLLIGIQYLHSIGIVHRDLKPSNLLI-----NNEGYLKIADFGLA  159



>emb|CDX84833.1| BnaA03g13970D [Brassica napus]
Length=306

 Score = 53.5 bits (127),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 28/53 (53%), Positives = 37/53 (70%), Gaps = 6/53 (11%)
 Frame = -3

Query  150  LVGLSDLHAMGIVHCDLKPLNVLVFP--MEQNGLNR----LKIADFGLAIQDG  10
            L+ L+ +HA G VHCDLKP N+LVFP  +  NG  R    LKI+DFGL+ ++G
Sbjct  97   LMRLATIHAHGYVHCDLKPENILVFPSYVNNNGAWRSSFELKISDFGLSRREG  149



>emb|CDX79877.1| BnaA05g02790D [Brassica napus]
Length=335

 Score = 53.9 bits (128),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 25/53 (47%), Positives = 34/53 (64%), Gaps = 3/53 (6%)
 Frame = -3

Query  165  YAYQLLVGLSDLHAMGIVHCDLKPLNVLVFPMEQNGLN---RLKIADFGLAIQ  16
            +   +L GL  +H+ G VHCDLKP N+LVFP    GL     LKI+DFG++ +
Sbjct  108  FTLMILQGLVSVHSHGYVHCDLKPENLLVFPRHVGGLQSTYELKISDFGMSTK  160



>ref|XP_002269638.1| PREDICTED: mitogen-activated protein kinase kinase kinase YODA-like 
[Vitis vinifera]
Length=350

 Score = 53.9 bits (128),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 27/54 (50%), Positives = 33/54 (61%), Gaps = 1/54 (2%)
 Frame = -3

Query  183  EGEVAFYAYQLLVGLSDLHAMGIVHCDLKPLNVLVFPMEQNGLNRLKIADFGLA  22
            E EV  Y   ++ GL  +H  G VHCD+KP N+L+ P   NG  R KI DFGLA
Sbjct  165  ENEVRCYTRDIVRGLCYIHGHGYVHCDIKPDNILLVPTCCNGF-RAKIGDFGLA  217



>emb|CDX84854.1| BnaA03g13760D [Brassica napus]
Length=306

 Score = 53.5 bits (127),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 28/53 (53%), Positives = 37/53 (70%), Gaps = 6/53 (11%)
 Frame = -3

Query  150  LVGLSDLHAMGIVHCDLKPLNVLVFP--MEQNGLNR----LKIADFGLAIQDG  10
            L+ L+ +HA G VHCDLKP N+LVFP    +NG  R    LKI+DFGL+ ++G
Sbjct  97   LMSLATIHAHGYVHCDLKPENILVFPSYAYKNGAWRSSFELKISDFGLSRREG  149



>emb|CDY24024.1| BnaC03g16670D [Brassica napus]
Length=306

 Score = 53.5 bits (127),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 28/53 (53%), Positives = 37/53 (70%), Gaps = 6/53 (11%)
 Frame = -3

Query  150  LVGLSDLHAMGIVHCDLKPLNVLVFP--MEQNGLNR----LKIADFGLAIQDG  10
            L+ L+ +HA G VHCDLKP N+LVFP    +NG  R    LKI+DFGL+ ++G
Sbjct  97   LMSLATIHAHGYVHCDLKPENILVFPSYAYKNGAWRSSFELKISDFGLSRREG  149



>ref|XP_001739968.1| cyclin-dependent kinase C-1 [Entamoeba dispar SAW760]
 gb|EDR23645.1| cyclin-dependent kinase C-1, putative [Entamoeba dispar SAW760]
Length=335

 Score = 53.9 bits (128),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 28/53 (53%), Positives = 36/53 (68%), Gaps = 5/53 (9%)
 Frame = -3

Query  180  GEVAFYAYQLLVGLSDLHAMGIVHCDLKPLNVLVFPMEQNGLNRLKIADFGLA  22
            G++  Y  QLL+G+  LH++GIVH DLKP N+L+     N    LKIADFGLA
Sbjct  112  GQLKGYMKQLLIGIRYLHSIGIVHRDLKPSNLLI-----NNEGYLKIADFGLA  159



>ref|XP_002879958.1| kinase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH56217.1| kinase family protein [Arabidopsis lyrata subsp. lyrata]
Length=383

 Score = 53.9 bits (128),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 28/58 (48%), Positives = 37/58 (64%), Gaps = 6/58 (10%)
 Frame = -3

Query  165  YAYQLLVGLSDLHAMGIVHCDLKPLNVLVFP--MEQNGLNR----LKIADFGLAIQDG  10
            +   +L GL+ +H  G VHCDLKP N+LVFP  + + G  R    LKI+DFGL  +DG
Sbjct  115  FTRMILEGLATIHGQGYVHCDLKPGNILVFPKCVYKKGAWRSSYELKISDFGLTKRDG  172



>ref|XP_006414753.1| hypothetical protein EUTSA_v10027196mg [Eutrema salsugineum]
 gb|ESQ56206.1| hypothetical protein EUTSA_v10027196mg [Eutrema salsugineum]
Length=351

 Score = 53.9 bits (128),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 25/54 (46%), Positives = 35/54 (65%), Gaps = 0/54 (0%)
 Frame = -3

Query  165  YAYQLLVGLSDLHAMGIVHCDLKPLNVLVFPMEQNGLNRLKIADFGLAIQDGKI  4
            +   +L GL  +H  G VHCDLKP N+LVFP   +    LKI+DFG +++ G+I
Sbjct  115  FTRMILEGLVCIHGHGYVHCDLKPDNLLVFPSRDSSSYELKISDFGNSLEVGEI  168



>ref|XP_010443097.1| PREDICTED: mitogen-activated protein kinase kinase kinase 2-like 
[Camelina sativa]
Length=306

 Score = 53.5 bits (127),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 27/55 (49%), Positives = 34/55 (62%), Gaps = 1/55 (2%)
 Frame = -3

Query  183  EGEVAFYAYQLLVGLSDLHAMGIVHCDLKPLNVLVFPMEQNGLN-RLKIADFGLA  22
            E  +   A+ +L GL  LH+ G VHCDLKP N+LVFP    G    LK+ADFG +
Sbjct  115  ENMIGRAAFMILQGLDALHSNGYVHCDLKPANILVFPSTTVGEPWDLKLADFGFS  169



>gb|KFA59986.1| hypothetical protein S40285_08483 [Stachybotrys chlorohalonata 
IBT 40285]
Length=366

 Score = 53.9 bits (128),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 28/52 (54%), Positives = 37/52 (71%), Gaps = 5/52 (10%)
 Frame = -3

Query  177  EVAFYAYQLLVGLSDLHAMGIVHCDLKPLNVLVFPMEQNGLNRLKIADFGLA  22
            EV  +  QL+ G+  LH+MG+ HCDLKP N+L   + Q+GL  LKIADFGL+
Sbjct  185  EVRCFFKQLMQGVQYLHSMGVAHCDLKPDNLL---LTQDGL--LKIADFGLS  231



>emb|CDS28834.1| Casein kinase II, alpha subunit Cell cycle [Hymenolepis microstoma]
Length=396

 Score = 53.9 bits (128),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 21/52 (40%), Positives = 37/52 (71%), Gaps = 4/52 (8%)
 Frame = -3

Query  177  EVAFYAYQLLVGLSDLHAMGIVHCDLKPLNVLVFPMEQNGLNRLKIADFGLA  22
            ++ +Y+YQLL+ L + H   I+HCD+KP N+L+ P+++     L++ DFG+A
Sbjct  202  DIKYYSYQLLIALDECHKRNIIHCDVKPDNILIDPIKR----VLRLIDFGMA  249



>ref|XP_004253984.1| cyclin-dependent kinase C-1, putative [Entamoeba invadens IP1]
 gb|ELP87213.1| cyclin-dependent kinase C-1, putative [Entamoeba invadens IP1]
Length=336

 Score = 53.5 bits (127),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 29/60 (48%), Positives = 37/60 (62%), Gaps = 5/60 (8%)
 Frame = -3

Query  180  GEVAFYAYQLLVGLSDLHAMGIVHCDLKPLNVLVFPMEQNGLNRLKIADFGLAIQDGKIE  1
             ++  Y +Q LVG++ LH  GIVH DLKP N+L+     N    LKIADFGLA +  K E
Sbjct  113  AQIKGYLFQFLVGINYLHKTGIVHRDLKPSNLLI-----NNKGYLKIADFGLARRASKSE  167



>ref|XP_010421111.1| PREDICTED: mitogen-activated protein kinase kinase kinase 3-like 
[Camelina sativa]
Length=306

 Score = 53.5 bits (127),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 28/53 (53%), Positives = 33/53 (62%), Gaps = 1/53 (2%)
 Frame = -3

Query  183  EGEVAFYAYQLLVGLSDLHAMGIVHCDLKPLNVLVFPMEQNGLN-RLKIADFG  28
            E  +   A+ +L GL  LH+ G VHCDLKP NVLVFP    G    LK+ADFG
Sbjct  115  ENMIGRAAFMILQGLEALHSNGYVHCDLKPANVLVFPSTTVGEPWDLKLADFG  167



>ref|XP_006300905.1| hypothetical protein CARUB_v10021274mg [Capsella rubella]
 gb|EOA33803.1| hypothetical protein CARUB_v10021274mg [Capsella rubella]
Length=304

 Score = 53.5 bits (127),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 28/53 (53%), Positives = 33/53 (62%), Gaps = 1/53 (2%)
 Frame = -3

Query  183  EGEVAFYAYQLLVGLSDLHAMGIVHCDLKPLNVLVFPMEQNGLN-RLKIADFG  28
            E  +   A  +L GL  LH+ G VHCDLKP NVLVFP   +G    LK+ADFG
Sbjct  110  ENMIGRAALMILQGLDALHSHGYVHCDLKPANVLVFPSTTSGEPWDLKLADFG  162



>ref|XP_010421603.1| PREDICTED: mitogen-activated protein kinase kinase 2-like [Camelina 
sativa]
Length=321

 Score = 53.5 bits (127),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 25/54 (46%), Positives = 36/54 (67%), Gaps = 2/54 (4%)
 Frame = -3

Query  165  YAYQLLVGLSDLHAMGIVHCDLKPLNVLVFPMEQNGLNRLKIADFGLAIQDGKI  4
            +   +L GL  +H  G VHCDLKP N+LVFP   +    LKI+DFGL+++ G++
Sbjct  113  FTRMILEGLVSIHGHGYVHCDLKPDNLLVFPSGDS--YELKISDFGLSLEVGQV  164



>gb|EJY74363.1| Calcium/calmodulin-dependent protein kinase kinase 1, alpha [Oxytricha 
trifallax]
Length=455

 Score = 53.9 bits (128),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 24/54 (44%), Positives = 40/54 (74%), Gaps = 5/54 (9%)
 Frame = -3

Query  183  EGEVAFYAYQLLVGLSDLHAMGIVHCDLKPLNVLVFPMEQNGLNRLKIADFGLA  22
            E E+ +++ Q++ GL  +H+ GI+HCDLKPLN+L+   ++N  N  K+ADFG++
Sbjct  83   EDEIRYFSRQIVQGLDYIHSQGILHCDLKPLNILI---DEN--NIAKLADFGVS  131



>emb|CDP14935.1| unnamed protein product [Coffea canephora]
Length=393

 Score = 53.5 bits (127),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 26/56 (46%), Positives = 37/56 (66%), Gaps = 1/56 (2%)
 Frame = -3

Query  183  EGEVAFYAYQLLVGLSDLHAMGIVHCDLKPLNVLVFPMEQNGLNRLKIADFGLAIQ  16
            EGEV  +   +L+GLS +HA G  HCD+KP N+L+   E+ G    K++DFGLA +
Sbjct  113  EGEVKQFTRSVLLGLSYIHAEGYAHCDIKPANILLVDDEE-GNRTAKVSDFGLATK  167



>emb|CAN71000.1| hypothetical protein VITISV_023637 [Vitis vinifera]
Length=456

 Score = 53.9 bits (128),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 27/54 (50%), Positives = 33/54 (61%), Gaps = 1/54 (2%)
 Frame = -3

Query  183  EGEVAFYAYQLLVGLSDLHAMGIVHCDLKPLNVLVFPMEQNGLNRLKIADFGLA  22
            E EV  Y   ++ GL  +H  G VHCD+KP N+L+ P   NG  R KI DFGLA
Sbjct  271  ENEVRCYTRDIVRGLCYIHGHGYVHCDIKPDNILLVPTCCNGF-RAKIGDFGLA  323



>ref|XP_002267830.1| PREDICTED: mitogen-activated protein kinase kinase kinase ANP1-like 
[Vitis vinifera]
Length=345

 Score = 53.5 bits (127),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 26/57 (46%), Positives = 35/57 (61%), Gaps = 1/57 (2%)
 Frame = -3

Query  183  EGEVAFYAYQLLVGLSDLHAMGIVHCDLKPLNVLVFPMEQNGLNRLKIADFGLAIQD  13
            E E+  Y   ++ GL  +H  G  HCD+KP N+L+ P   NGL R KI DFGLA ++
Sbjct  155  EKEMRSYTRDIVRGLCYVHGHGYTHCDIKPENILLVPTSCNGL-RAKIGDFGLAKKE  210



>emb|CDY39393.1| BnaAnng05240D [Brassica napus]
Length=233

 Score = 52.4 bits (124),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 27/48 (56%), Positives = 33/48 (69%), Gaps = 1/48 (2%)
 Frame = -3

Query  162  AYQLLVGLSDLHAMGIVHCDLKPLNVLVFPMEQNGLN-RLKIADFGLA  22
            A  +L GL  LH+ G VHCDLKP NVL+FP +  G    LK+ADFGL+
Sbjct  70   ALMILQGLEALHSRGYVHCDLKPANVLLFPSKIVGEPWDLKLADFGLS  117



>gb|KFK34894.1| hypothetical protein AALP_AA5G207300 [Arabis alpina]
Length=208

 Score = 52.0 bits (123),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 29/55 (53%), Positives = 34/55 (62%), Gaps = 1/55 (2%)
 Frame = -3

Query  183  EGEVAFYAYQLLVGLSDLHAMGIVHCDLKPLNVLVFPMEQNG-LNRLKIADFGLA  22
            E    +   Q+L GL DLH  G VHCDLKP NVL+FP   +G L  LK+A F LA
Sbjct  33   ENVAGYCILQVLEGLRDLHRDGYVHCDLKPENVLIFPSYTHGELCELKLAGFSLA  87



>emb|CDY54727.1| BnaCnng27530D [Brassica napus]
Length=348

 Score = 53.5 bits (127),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 26/59 (44%), Positives = 36/59 (61%), Gaps = 6/59 (10%)
 Frame = -3

Query  165  YAYQLLVGLSDLHAMGIVHCDLKPLNVLVFPMEQNG------LNRLKIADFGLAIQDGK  7
            +   +L GL  +H  G VHCDLKP N+LVFP + NG         LKI+DFG++ + G+
Sbjct  113  FTRMILEGLVSVHDHGYVHCDLKPDNILVFPRDVNGGVTKEVSYELKISDFGMSTEAGE  171



>ref|XP_009783074.1| PREDICTED: mitogen-activated protein kinase kinase kinase NPK1-like 
[Nicotiana sylvestris]
Length=333

 Score = 53.1 bits (126),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 28/57 (49%), Positives = 36/57 (63%), Gaps = 4/57 (7%)
 Frame = -3

Query  177  EVAFYAYQLLVGLSDLHAMGIVHCDLKPLNVLVFPMEQNGLNRLKIADFGLAIQDGK  7
            EV  YA  +L+GLSD+H  G VH D+KP N+L+   E+      KIADFG A + GK
Sbjct  114  EVKQYAKSILLGLSDIHGRGFVHLDIKPDNILLVGTEKVA----KIADFGFAKKVGK  166



>emb|CDY39391.1| BnaAnng05220D [Brassica napus]
Length=235

 Score = 52.4 bits (124),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 27/48 (56%), Positives = 33/48 (69%), Gaps = 1/48 (2%)
 Frame = -3

Query  162  AYQLLVGLSDLHAMGIVHCDLKPLNVLVFPMEQNGLN-RLKIADFGLA  22
            A  +L GL  LH+ G VHCDLKP NVL+FP +  G    LK+ADFGL+
Sbjct  70   ALMILQGLEALHSRGYVHCDLKPANVLLFPSKIVGEPWDLKLADFGLS  117



>ref|XP_008194624.1| PREDICTED: serine/threonine-protein kinase Chk2 isoform X2 [Tribolium 
castaneum]
Length=367

 Score = 53.5 bits (127),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 28/54 (52%), Positives = 36/54 (67%), Gaps = 2/54 (4%)
 Frame = -3

Query  183  EGEVAFYAYQLLVGLSDLHAMGIVHCDLKPLNVLVFPMEQNGLNRLKIADFGLA  22
            E EV F  YQ+L+G+  LH  G+ H DLKP NVL+    QN   R+KI+DFGL+
Sbjct  250  ECEVKFIFYQILLGVRYLHLNGVTHRDLKPENVLL--STQNQYPRVKISDFGLS  301



>ref|XP_010535545.1| PREDICTED: mitogen-activated protein kinase kinase kinase ANP1 
[Tarenaya hassleriana]
Length=378

 Score = 53.5 bits (127),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 27/65 (42%), Positives = 39/65 (60%), Gaps = 5/65 (8%)
 Frame = -3

Query  183  EGEVAFYAYQLLVGLSDLHAMGIVHCDLKPLNVLVFPMEQNGLNR----LKIADFGLAIQ  16
            E  V   A  +L GL+D+H   I+HCD+KP N+L+ P +   + R     KIADFGLA++
Sbjct  190  ESHVKLLATDILRGLNDIHCRRIIHCDIKPANILLVP-QVEWIRRDWFVAKIADFGLAVE  248

Query  15   DGKIE  1
               +E
Sbjct  249  KDTVE  253



>ref|XP_009629290.1| PREDICTED: serine/threonine-protein kinase 17A-like [Nicotiana 
tomentosiformis]
Length=321

 Score = 53.1 bits (126),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 27/56 (48%), Positives = 39/56 (70%), Gaps = 6/56 (11%)
 Frame = -3

Query  183  EGEVAFYAYQLLVGLSDLHAMGIVHCDLKPLNVLVFPMEQNGLNRL-KIADFGLAI  19
            E EV  +   +L+GLS +H+ G++HCD+KP N+LV      G +R+ KIADFGLA+
Sbjct  122  EFEVQKHTKNVLLGLSHVHSKGVIHCDIKPHNILVV-----GTDRIAKIADFGLAM  172



>ref|XP_010652559.1| PREDICTED: mitogen-activated protein kinase kinase kinase YODA-like 
[Vitis vinifera]
Length=340

 Score = 53.1 bits (126),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 27/54 (50%), Positives = 33/54 (61%), Gaps = 1/54 (2%)
 Frame = -3

Query  183  EGEVAFYAYQLLVGLSDLHAMGIVHCDLKPLNVLVFPMEQNGLNRLKIADFGLA  22
            E EV  Y   ++ GL  +H  G VHCD+KP N+L+ P   NG  R KI DFGLA
Sbjct  160  ENEVRCYTRDIVRGLCYIHGHGYVHCDIKPDNILLAPTCCNGF-RAKIGDFGLA  212



>ref|XP_002875767.1| hypothetical protein ARALYDRAFT_905795 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH52026.1| hypothetical protein ARALYDRAFT_905795 [Arabidopsis lyrata subsp. 
lyrata]
Length=403

 Score = 53.5 bits (127),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 27/65 (42%), Positives = 40/65 (62%), Gaps = 5/65 (8%)
 Frame = -3

Query  183  EGEVAFYAYQLLVGLSDLHAMGIVHCDLKPLNVLVFPMEQ----NGLNRLKIADFGLAIQ  16
            E +V  +A  +L GL  +H   I+HCD+KP N+L+ P++     NG    KI DFGLA++
Sbjct  230  EFDVKLFARDVLCGLIHIHEKNIIHCDIKPDNLLLSPLDHRYRSNGY-IAKIGDFGLALE  288

Query  15   DGKIE  1
             G +E
Sbjct  289  KGSVE  293



>ref|XP_006289424.1| hypothetical protein CARUB_v10002924mg [Capsella rubella]
 gb|EOA22322.1| hypothetical protein CARUB_v10002924mg [Capsella rubella]
Length=318

 Score = 53.1 bits (126),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 25/54 (46%), Positives = 36/54 (67%), Gaps = 2/54 (4%)
 Frame = -3

Query  165  YAYQLLVGLSDLHAMGIVHCDLKPLNVLVFPMEQNGLNRLKIADFGLAIQDGKI  4
            +   +L GL  +H  G VHCDLKP N+LVFP   +    LKI+DFGL+++ G++
Sbjct  113  FTRMILQGLVSIHGHGYVHCDLKPDNLLVFPCGDS--YELKISDFGLSLEVGQV  164



>ref|XP_009144193.1| PREDICTED: mitogen-activated protein kinase kinase kinase A-like 
[Brassica rapa]
Length=346

 Score = 53.1 bits (126),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 24/58 (41%), Positives = 38/58 (66%), Gaps = 5/58 (9%)
 Frame = -3

Query  165  YAYQLLVGLSDLHAMGIVHCDLKPLNVLVFPMEQNGLNR-----LKIADFGLAIQDGK  7
            +   +L GL  +HA G VHCDLKP N+L+FP +  G+ +     LK++DFG++ + G+
Sbjct  112  FTRMILEGLVSVHANGYVHCDLKPDNLLLFPRDDVGVTKEVSYELKLSDFGMSTEAGE  169



>ref|XP_004261228.1| cell division control protein 15 , CDC15, putative [Entamoeba 
invadens IP1]
 gb|ELP94457.1| cell division control protein 15 , CDC15, putative [Entamoeba 
invadens IP1]
Length=1577

 Score = 54.3 bits (129),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 28/57 (49%), Positives = 40/57 (70%), Gaps = 5/57 (9%)
 Frame = -3

Query  171  AFYAYQLLVGLSDLHAMGIVHCDLKPLNVLVFPMEQNGLNRLKIADFGLAIQDGKIE  1
            A Y YQ+L+GL  +H+ GIVH D+K  N+LV    ++G  R+KIADFG++IQ   +E
Sbjct  540  AKYIYQVLIGLEYIHSQGIVHRDIKAANILV---AKDG--RVKIADFGVSIQTSDLE  591



>ref|XP_004173609.1| PREDICTED: mitogen-activated protein kinase kinase kinase 1-like 
[Cucumis sativus]
 gb|KGN48531.1| hypothetical protein Csa_6G490950 [Cucumis sativus]
Length=350

 Score = 53.1 bits (126),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 29/59 (49%), Positives = 35/59 (59%), Gaps = 5/59 (8%)
 Frame = -3

Query  183  EGEVAFYAYQLLVGLSDLHAMGIVHCDLKPLNVLVFPMEQNGLNRLKIADFGLAIQDGK  7
            E EV  Y   +L GL  +H  G VHCD+KP N+LVF     G    KIADFGL+ + GK
Sbjct  104  EFEVRRYTRTILEGLRYIHGKGFVHCDVKPRNILVF-----GDGDAKIADFGLSKKAGK  157



>ref|WP_020919497.1| serine/threonine protein kinase-like domain-containing protein 
[Rhizobium etli]
 ref|YP_008369056.1| serine/threonine protein kinase-like domain-containing protein 
[Rhizobium etli bv. mimosae str. Mim1]
 gb|AGS26127.1| serine/threonine protein kinase-like domain-containing protein 
[Rhizobium etli bv. mimosae str. Mim1]
Length=303

 Score = 53.1 bits (126),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 28/57 (49%), Positives = 36/57 (63%), Gaps = 3/57 (5%)
 Frame = -3

Query  180  GEVAFYAYQLLVGLSDLHAMGIVHCDLKPLNVLVFPMEQNGLNRLKIADFGLAIQDG  10
            G+V      +  GL  +HA G VHCDL PLN+L  P   N  +RLKIADFG+A++ G
Sbjct  160  GDVTSIMTSVFFGLDAIHAAGFVHCDLSPLNLL--PAGGN-FSRLKIADFGVALEAG  213



>ref|XP_004912409.1| PREDICTED: protein kinase C delta type-like [Xenopus (Silurana) 
tropicalis]
Length=452

 Score = 53.5 bits (127),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 26/51 (51%), Positives = 34/51 (67%), Gaps = 5/51 (10%)
 Frame = -3

Query  174  VAFYAYQLLVGLSDLHAMGIVHCDLKPLNVLVFPMEQNGLNRLKIADFGLA  22
            V FY+ +L+ GL  LH MGIVH DLKP N+++     +G   +KI DFGLA
Sbjct  236  VLFYSAELVCGLESLHNMGIVHRDLKPANIML-----DGEGHIKITDFGLA  281



>ref|XP_008440288.1| PREDICTED: mitogen-activated protein kinase kinase kinase 3-like 
[Cucumis melo]
Length=354

 Score = 53.1 bits (126),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 29/59 (49%), Positives = 35/59 (59%), Gaps = 5/59 (8%)
 Frame = -3

Query  183  EGEVAFYAYQLLVGLSDLHAMGIVHCDLKPLNVLVFPMEQNGLNRLKIADFGLAIQDGK  7
            E EV  Y   +L GL  +H  G VHCD+KP N+LVF     G    KIADFGL+ + GK
Sbjct  104  EFEVRRYTRTILEGLRYIHGKGFVHCDVKPRNILVF-----GDGDAKIADFGLSKKAGK  157



>emb|CDY34372.1| BnaA09g11140D [Brassica napus]
Length=306

 Score = 53.1 bits (126),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 27/53 (51%), Positives = 37/53 (70%), Gaps = 6/53 (11%)
 Frame = -3

Query  150  LVGLSDLHAMGIVHCDLKPLNVLVFP--MEQNGL----NRLKIADFGLAIQDG  10
            L+ L+ +HA G VHCDLKP N+LVFP  + +NG       LKI+DFGL+ ++G
Sbjct  97   LMSLATIHAHGYVHCDLKPENILVFPSYVNKNGAWSSSFELKISDFGLSRREG  149



>ref|XP_010542110.1| PREDICTED: mitogen-activated protein kinase kinase kinase YODA-like 
[Tarenaya hassleriana]
Length=269

 Score = 52.8 bits (125),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 27/55 (49%), Positives = 33/55 (60%), Gaps = 1/55 (2%)
 Frame = -3

Query  183  EGEVAFYAYQLLVGLSDLHAMGIVHCDLKPLNVLVFPMEQNG-LNRLKIADFGLA  22
            E  V  +   +L GL  LH  G VHCDLKP N+L FP +  G +  LKI+DFG A
Sbjct  119  EKHVKCFTRMILRGLIALHTEGYVHCDLKPTNILAFPSKAVGEICELKISDFGTA  173



>ref|XP_972529.1| PREDICTED: serine/threonine-protein kinase Chk2 isoform X1 [Tribolium 
castaneum]
 gb|EFA09109.1| hypothetical protein TcasGA2_TC015484 [Tribolium castaneum]
Length=450

 Score = 53.5 bits (127),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 28/54 (52%), Positives = 36/54 (67%), Gaps = 2/54 (4%)
 Frame = -3

Query  183  EGEVAFYAYQLLVGLSDLHAMGIVHCDLKPLNVLVFPMEQNGLNRLKIADFGLA  22
            E EV F  YQ+L+G+  LH  G+ H DLKP NVL+    QN   R+KI+DFGL+
Sbjct  250  ECEVKFIFYQILLGVRYLHLNGVTHRDLKPENVLL--STQNQYPRVKISDFGLS  301



>ref|XP_006418994.1| hypothetical protein EUTSA_v10002972mg [Eutrema salsugineum]
 gb|ESQ37430.1| hypothetical protein EUTSA_v10002972mg [Eutrema salsugineum]
Length=390

 Score = 53.1 bits (126),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 28/68 (41%), Positives = 39/68 (57%), Gaps = 11/68 (16%)
 Frame = -3

Query  183  EGEVAFYAYQLLVGLSDLHAMGIVHCDLKPLNVLVFPMEQNGLNRL-------KIADFGL  25
            E  V  +A  +L GL  +H   I+HCD+KP N+ + P+    +NRL       KI DFGL
Sbjct  150  EKNVKVFARDILYGLHYIHGQRIIHCDIKPDNIFLTPV----VNRLSTNVYLAKIGDFGL  205

Query  24   AIQDGKIE  1
            A++ G IE
Sbjct  206  AMEKGSIE  213



>ref|XP_006418955.1| hypothetical protein EUTSA_v10002928mg, partial [Eutrema salsugineum]
 gb|ESQ37391.1| hypothetical protein EUTSA_v10002928mg, partial [Eutrema salsugineum]
Length=388

 Score = 53.1 bits (126),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 27/65 (42%), Positives = 38/65 (58%), Gaps = 5/65 (8%)
 Frame = -3

Query  183  EGEVAFYAYQLLVGLSDLHAMGIVHCDLKPLNVLVFPMEQ----NGLNRLKIADFGLAIQ  16
            E +V  +A  +L GL  +H   I+HCD+KP N+ + P +     NG    KI DFGLA++
Sbjct  216  ESDVKLFARDILSGLRYIHDQNIIHCDIKPENLFLCPTDHRLRANGY-LTKIGDFGLAME  274

Query  15   DGKIE  1
             G IE
Sbjct  275  KGSIE  279



>ref|XP_002881835.1| hypothetical protein ARALYDRAFT_346029 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH58094.1| hypothetical protein ARALYDRAFT_346029 [Arabidopsis lyrata subsp. 
lyrata]
Length=229

 Score = 52.0 bits (123),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 25/55 (45%), Positives = 35/55 (64%), Gaps = 2/55 (4%)
 Frame = -3

Query  165  YAYQLLVGLSDLHAMGIVHCDLKPLNVLVFPMEQNG--LNRLKIADFGLAIQDGK  7
            +   +L GL  +H+ G VHCDLKP N+LVFP    G     LKI+DFG++ + G+
Sbjct  87   FTRMILEGLVSIHSHGYVHCDLKPENILVFPRTCEGSVSYELKISDFGISTKVGE  141



>ref|XP_002875768.1| hypothetical protein ARALYDRAFT_905796 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH52027.1| hypothetical protein ARALYDRAFT_905796 [Arabidopsis lyrata subsp. 
lyrata]
Length=394

 Score = 53.1 bits (126),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 28/68 (41%), Positives = 41/68 (60%), Gaps = 11/68 (16%)
 Frame = -3

Query  183  EGEVAFYAYQLLVGLSDLHAMGIVHCDLKPLNVLVFPMEQNGLNRL-------KIADFGL  25
            E +V  +A  +L GL+ +H   I+HCD+KP N+L+ P+E    NR+       KI DFGL
Sbjct  220  EKDVKMFARYILNGLNYIHRENIIHCDIKPENILLSPVE----NRIRPNGYVTKIGDFGL  275

Query  24   AIQDGKIE  1
            A++ G  E
Sbjct  276  ALEKGSSE  283



>ref|WP_003592306.1| protein kinase family protein [Rhizobium leguminosarum]
 gb|EJB06911.1| protein kinase family protein [Rhizobium leguminosarum bv. trifolii 
WSM597]
Length=306

 Score = 52.8 bits (125),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 25/48 (52%), Positives = 33/48 (69%), Gaps = 4/48 (8%)
 Frame = -3

Query  153  LLVGLSDLHAMGIVHCDLKPLNVLVFPMEQNGLNRLKIADFGLAIQDG  10
            +L GL  +HA G VHCDL PLN+L        L+RLKIADFG++++ G
Sbjct  173  VLSGLDTIHAAGFVHCDLSPLNLLF----DGDLSRLKIADFGISLEAG  216



>ref|XP_010513669.1| PREDICTED: mitogen-activated protein kinase kinase kinase 2-like 
[Camelina sativa]
Length=314

 Score = 52.8 bits (125),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 28/60 (47%), Positives = 37/60 (62%), Gaps = 8/60 (13%)
 Frame = -3

Query  165  YAYQLLVGLSDLHAMGIVHCDLKPLNVLVFPME----QNGLNR----LKIADFGLAIQDG  10
            +   LL GL+ +H  G VHCDLKP N+LVFP      + G  R    LKI+DFGL+ ++G
Sbjct  117  FTRMLLEGLATIHGHGYVHCDLKPENILVFPSRVYDYKTGAWRTSYELKISDFGLSKKEG  176



>ref|XP_004912384.1| PREDICTED: protein kinase C delta type-like [Xenopus (Silurana) 
tropicalis]
Length=378

 Score = 53.1 bits (126),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 26/53 (49%), Positives = 37/53 (70%), Gaps = 5/53 (9%)
 Frame = -3

Query  174  VAFYAYQLLVGLSDLHAMGIVHCDLKPLNVLVFPMEQNGLNRLKIADFGLAIQ  16
            V FY  ++++GL  LH+ GIVHCDLKP N+LV   + +G   +KI DFGL+ +
Sbjct  166  VKFYTAEIVIGLQFLHSNGIVHCDLKPDNILV---DMDG--HIKICDFGLSAE  213



>ref|XP_002883681.1| kinase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH59940.1| kinase family protein [Arabidopsis lyrata subsp. lyrata]
Length=307

 Score = 52.8 bits (125),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 25/52 (48%), Positives = 35/52 (67%), Gaps = 5/52 (10%)
 Frame = -3

Query  165  YAYQLLVGLSDLHAMGIVHCDLKPLNVLVFPMEQNGLNRLKIADFGLAIQDG  10
            +   +L GL+ +H  G VHCDLKP N+LVFP  +     LKI+DFGL+ ++G
Sbjct  125  FTRMILEGLAVIHGHGYVHCDLKPENILVFPSFE-----LKISDFGLSKREG  171



>gb|ETN75398.1| kinase domain protein [Necator americanus]
Length=360

 Score = 52.8 bits (125),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 28/54 (52%), Positives = 36/54 (67%), Gaps = 5/54 (9%)
 Frame = -3

Query  183  EGEVAFYAYQLLVGLSDLHAMGIVHCDLKPLNVLVFPMEQNGLNRLKIADFGLA  22
            E    ++ YQL+ GL  LH++GIVH DLKP N+LV     NG   L+IADFG+A
Sbjct  117  EQHFQYFLYQLVRGLKYLHSVGIVHRDLKPSNLLV-----NGDCLLRIADFGMA  165



>ref|XP_011073592.1| PREDICTED: LOW QUALITY PROTEIN: mitogen-activated protein kinase 
kinase kinase 3-like [Sesamum indicum]
Length=199

 Score = 51.2 bits (121),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 29/59 (49%), Positives = 37/59 (63%), Gaps = 7/59 (12%)
 Frame = -3

Query  183  EGEVAFYAYQLLVGLSDLHAMGIVHCDLKPLNVLVFPMEQNGLN-RLKIADFGLAIQDG  10
            E EV  Y   LL G+  +H  G VHCD+K  N+L+      G+N R+KIADFGLA +DG
Sbjct  46   ESEVRGYTKALLKGIHYIHKFGYVHCDIKLQNILL------GVNGRVKIADFGLAKRDG  98



>ref|NP_178581.1| protein kinase family protein [Arabidopsis thaliana]
 gb|AAD25594.1| putative protein kinase [Arabidopsis thaliana]
 gb|AEC05892.1| protein kinase family protein [Arabidopsis thaliana]
Length=315

 Score = 52.8 bits (125),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 25/52 (48%), Positives = 35/52 (67%), Gaps = 5/52 (10%)
 Frame = -3

Query  165  YAYQLLVGLSDLHAMGIVHCDLKPLNVLVFPMEQNGLNRLKIADFGLAIQDG  10
            +   +L GL+ +H  G VHCDLKP N+LVFP  +     LKI+DFGL+ ++G
Sbjct  125  FTRMILEGLAVIHGHGYVHCDLKPENILVFPSFE-----LKISDFGLSKREG  171



>ref|XP_006299683.1| hypothetical protein CARUB_v10015871mg [Capsella rubella]
 gb|EOA32581.1| hypothetical protein CARUB_v10015871mg [Capsella rubella]
Length=293

 Score = 52.4 bits (124),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 27/53 (51%), Positives = 33/53 (62%), Gaps = 1/53 (2%)
 Frame = -3

Query  183  EGEVAFYAYQLLVGLSDLHAMGIVHCDLKPLNVLVFPMEQNGLN-RLKIADFG  28
            E  +   A  +L GL  LH+ G VHCDLKP N+LVFP   +G    LK+ADFG
Sbjct  111  ENMIGRAALMILQGLDALHSHGYVHCDLKPDNILVFPSTTSGEPWELKLADFG  163



>ref|XP_010474210.1| PREDICTED: mitogen-activated protein kinase kinase kinase NPK1-like 
[Camelina sativa]
Length=318

 Score = 52.8 bits (125),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 28/60 (47%), Positives = 37/60 (62%), Gaps = 8/60 (13%)
 Frame = -3

Query  165  YAYQLLVGLSDLHAMGIVHCDLKPLNVLVFPME----QNGLNR----LKIADFGLAIQDG  10
            +   LL GL+ +H  G VHCDLKP N+LVFP      + G  R    LKI+DFGL+ ++G
Sbjct  117  FTRMLLEGLATIHGHGYVHCDLKPENILVFPSRVYDYKKGAWRWSYELKISDFGLSKKEG  176



>ref|XP_010511919.1| PREDICTED: mitogen-activated protein kinase kinase kinase NPK1-like 
[Camelina sativa]
Length=318

 Score = 52.8 bits (125),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 28/60 (47%), Positives = 37/60 (62%), Gaps = 8/60 (13%)
 Frame = -3

Query  165  YAYQLLVGLSDLHAMGIVHCDLKPLNVLVFPME----QNGLNR----LKIADFGLAIQDG  10
            +   LL GL+ +H  G VHCDLKP N+LVFP      + G  R    LKI+DFGL+ ++G
Sbjct  118  FTRMLLEGLATIHGHGYVHCDLKPENILVFPSRVYDYKKGAWRTSYELKISDFGLSKKEG  177



>ref|NP_190165.1| protein kinase-related protein [Arabidopsis thaliana]
 emb|CAB75792.1| putative protein [Arabidopsis thaliana]
 gb|AEE78074.1| protein kinase-related protein [Arabidopsis thaliana]
Length=376

 Score = 52.8 bits (125),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 28/68 (41%), Positives = 39/68 (57%), Gaps = 11/68 (16%)
 Frame = -3

Query  183  EGEVAFYAYQLLVGLSDLHAMGIVHCDLKPLNVLVFPMEQNGLNRL-------KIADFGL  25
            E +V   A  +L GL  +H   I+HCD+KP N+L+ P+E    NR+       KI DFGL
Sbjct  199  EKDVKLLARDILYGLDYIHRANIIHCDIKPENILLAPVE----NRIRPNGYVAKIGDFGL  254

Query  24   AIQDGKIE  1
            A++ G  E
Sbjct  255  ALEKGSSE  262



>emb|CDP04579.1| unnamed protein product [Coffea canephora]
Length=414

 Score = 53.1 bits (126),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 28/57 (49%), Positives = 34/57 (60%), Gaps = 3/57 (5%)
 Frame = -3

Query  183  EGEVAFYAYQLLVGLSDLHAMGIVHCDLKPLNVLVFPMEQNGLN---RLKIADFGLA  22
            E EV  Y   +L GL+ +H +G VHCDLKP N+L+ P    G     R KI DFGLA
Sbjct  118  EFEVRCYTRSILKGLNFIHEIGYVHCDLKPENILLVPNNAGGGRAGFRAKIGDFGLA  174



>ref|XP_004914894.1| PREDICTED: protein kinase C delta type-like [Xenopus (Silurana) 
tropicalis]
Length=251

 Score = 52.0 bits (123),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 25/55 (45%), Positives = 37/55 (67%), Gaps = 5/55 (9%)
 Frame = -3

Query  177  EVAFYAYQLLVGLSDLHAMGIVHCDLKPLNVLVFPMEQNGLNRLKIADFGLAIQD  13
            +V FY+ +++ GL  LH+ GI+H DLKP N+LV     +    +KIADFGLA ++
Sbjct  37   QVIFYSAEMVCGLQYLHSRGIIHSDLKPDNILV-----SSEGHIKIADFGLAAEN  86



>ref|XP_009123612.1| PREDICTED: mitogen-activated protein kinase kinase kinase 3-like 
[Brassica rapa]
Length=316

 Score = 52.8 bits (125),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 26/48 (54%), Positives = 32/48 (67%), Gaps = 1/48 (2%)
 Frame = -3

Query  162  AYQLLVGLSDLHAMGIVHCDLKPLNVLVFPMEQNGLN-RLKIADFGLA  22
            A  +L GL  LH+ G VHCDLKP NVL+FP +  G    LK+ DFGL+
Sbjct  119  ALMILQGLEALHSNGYVHCDLKPANVLIFPSKNFGQPWDLKLGDFGLS  166



>emb|CDY16498.1| BnaA08g02690D [Brassica napus]
Length=356

 Score = 52.8 bits (125),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 24/54 (44%), Positives = 35/54 (65%), Gaps = 1/54 (2%)
 Frame = -3

Query  165  YAYQLLVGLSDLHAMGIVHCDLKPLNVLVFPMEQNGLNRLKIADFGLAIQDGKI  4
            +   +L GL  +H  G VHCD+KP N+LVFP  Q+    LKI+DFG  ++ G++
Sbjct  116  FTRMILEGLVSIHDHGYVHCDIKPDNLLVFPSRQDSF-ELKISDFGNTLEVGEV  168



>ref|XP_010275098.1| PREDICTED: mitogen-activated protein kinase kinase kinase NPK1-like 
[Nelumbo nucifera]
Length=365

 Score = 52.8 bits (125),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 28/60 (47%), Positives = 38/60 (63%), Gaps = 1/60 (2%)
 Frame = -3

Query  183  EGEVAFYAYQLLVGLSDLHAMGIVHCDLKPLNVLVFP-MEQNGLNRLKIADFGLAIQDGK  7
            E EV  Y   +L GLS +H  G VHCD+KP N+L+ P     G + +KIADFGL+ + G+
Sbjct  153  ESEVRRYTRSILTGLSHIHKCGFVHCDIKPENLLLVPSSSSKGRSSVKIADFGLSKRVGE  212



>ref|XP_010468520.1| PREDICTED: mitogen-activated protein kinase kinase kinase ANP1-like 
[Camelina sativa]
Length=322

 Score = 52.4 bits (124),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 25/52 (48%), Positives = 35/52 (67%), Gaps = 5/52 (10%)
 Frame = -3

Query  165  YAYQLLVGLSDLHAMGIVHCDLKPLNVLVFPMEQNGLNRLKIADFGLAIQDG  10
            +   +L GL+ +H  G VHCDLKP N+LVFP  +     LKI+DFGL+ ++G
Sbjct  125  FTRMVLEGLAIIHGHGYVHCDLKPENILVFPSLE-----LKISDFGLSKREG  171



>emb|CCC52125.1| putative tyrosine protein kinase [Trypanosoma vivax Y486]
Length=384

 Score = 52.8 bits (125),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 26/59 (44%), Positives = 37/59 (63%), Gaps = 5/59 (8%)
 Frame = -3

Query  183  EGEVAFYAYQLLVGLSDLHAMGIVHCDLKPLNVLVFPMEQNGLNRLKIADFGLAIQDGK  7
            EG + F+ YQ+L  L  +HA G++H D+ P N+LV     N    LKI DFGLA ++G+
Sbjct  123  EGHIQFFIYQILRALKVIHAAGVIHRDITPANILV-----NRNCDLKICDFGLAKENGQ  176



>ref|XP_009101647.1| PREDICTED: probable serine/threonine-protein kinase mkcD [Brassica 
rapa]
Length=296

 Score = 52.4 bits (124),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 27/48 (56%), Positives = 33/48 (69%), Gaps = 1/48 (2%)
 Frame = -3

Query  162  AYQLLVGLSDLHAMGIVHCDLKPLNVLVFPMEQNGLN-RLKIADFGLA  22
            A  +L GL  LH+ G VHCDLKP NVL+FP +  G    LK+ADFGL+
Sbjct  132  ALMILQGLEALHSRGYVHCDLKPANVLLFPSKIVGEPWDLKLADFGLS  179



>ref|XP_005827797.1| hypothetical protein GUITHDRAFT_158278 [Guillardia theta CCMP2712]
 gb|EKX40817.1| hypothetical protein GUITHDRAFT_158278 [Guillardia theta CCMP2712]
Length=332

 Score = 52.4 bits (124),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 26/54 (48%), Positives = 34/54 (63%), Gaps = 2/54 (4%)
 Frame = -3

Query  183  EGEVAFYAYQLLVGLSDLHAMGIVHCDLKPLNVLVFPMEQNGLNRLKIADFGLA  22
            E E A    Q+L  +  +H+ G+VHCDLKP N+L   M +N  + LKIADFG A
Sbjct  113  EREAAAVVKQMLEAIGHMHSRGLVHCDLKPENILYADMSEN--SPLKIADFGFA  164



>emb|CDY49825.1| BnaCnng18220D [Brassica napus]
Length=293

 Score = 52.4 bits (124),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 27/48 (56%), Positives = 33/48 (69%), Gaps = 1/48 (2%)
 Frame = -3

Query  162  AYQLLVGLSDLHAMGIVHCDLKPLNVLVFPMEQNGLN-RLKIADFGLA  22
            A  +L GL  LH+ G VHCDLKP NVL+FP +  G    LK+ADFGL+
Sbjct  130  ALMILQGLEALHSHGYVHCDLKPANVLLFPSKIVGEPWDLKLADFGLS  177



>gb|ETO20769.1| Protein kinase domain containing protein, partial [Reticulomyxa 
filosa]
Length=529

 Score = 53.1 bits (126),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 29/57 (51%), Positives = 39/57 (68%), Gaps = 8/57 (14%)
 Frame = -3

Query  168  FYAYQLLVGLSDLHAMGIVHCDLKPLNVLVFPMEQNGLN-RLKIADFGLA--IQDGK  7
            F+ YQ+L GL  +H+ G+VH DLKP N+LV     NG N  +KI+DFGLA  + DG+
Sbjct  324  FFIYQILRGLKYIHSAGVVHRDLKPENILV-----NGSNCNVKISDFGLARGVHDGE  375



>gb|EZG89330.1| protein kinase domain protein, partial [Gregarina niphandrodes]
Length=850

 Score = 53.5 bits (127),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 28/56 (50%), Positives = 36/56 (64%), Gaps = 2/56 (4%)
 Frame = -3

Query  183  EGEVAFYAYQLLVGLSDLHAMGIVHCDLKPLNVLVFPMEQNGLNRLKIADFGLAIQ  16
            E   A    QLL G++ LH MGIVH D+KP NVL+    +N +N LKI DFGL+ +
Sbjct  615  EKNAAIMIKQLLSGIAYLHQMGIVHRDMKPENVLL--KNKNDINNLKIIDFGLSTK  668



>ref|XP_010419018.1| PREDICTED: mitogen-activated protein kinase kinase 7-like [Camelina 
sativa]
Length=384

 Score = 52.8 bits (125),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 24/59 (41%), Positives = 39/59 (66%), Gaps = 3/59 (5%)
 Frame = -3

Query  183  EGEVAFYAYQLLVGLSDLHAMGIVHCDLKPLNVLVFPMEQNGLN---RLKIADFGLAIQ  16
            E +V  ++  +L G+S +H+M I+HCD+KP N+L+ P     ++     KIADFGLA++
Sbjct  201  ENDVQLFSTDILKGISYIHSMKIIHCDIKPGNILLKPQVTRSMSNGFEPKIADFGLALR  259



>ref|XP_006296273.1| hypothetical protein CARUB_v10025441mg [Capsella rubella]
 gb|EOA29171.1| hypothetical protein CARUB_v10025441mg [Capsella rubella]
Length=342

 Score = 52.4 bits (124),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 26/53 (49%), Positives = 36/53 (68%), Gaps = 2/53 (4%)
 Frame = -3

Query  165  YAYQLLVGLSDLHAMGIVHCDLKPLNVLVFPMEQNGLNRLKIADFGLAIQDGK  7
            +A  +L GL  +H+ G VHCDLKP N+LVFP  Q+    LKI+DFG + + G+
Sbjct  117  FARMILQGLVSVHSHGYVHCDLKPDNLLVFPCRQS--YELKISDFGSSRKVGE  167



>emb|CDY43225.1| BnaC08g04980D [Brassica napus]
Length=322

 Score = 52.4 bits (124),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 22/54 (41%), Positives = 34/54 (63%), Gaps = 0/54 (0%)
 Frame = -3

Query  165  YAYQLLVGLSDLHAMGIVHCDLKPLNVLVFPMEQNGLNRLKIADFGLAIQDGKI  4
            + + +L GL  +H  G  HCD+KP N+LVFP   +    +KI+DFG A++ G +
Sbjct  100  FTWMILEGLVSVHGHGYAHCDIKPDNLLVFPCSSSEGYEIKISDFGSALEVGDV  153



>ref|XP_011095801.1| PREDICTED: mitogen-activated protein kinase kinase kinase 2 [Sesamum 
indicum]
Length=441

 Score = 52.8 bits (125),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 28/58 (48%), Positives = 36/58 (62%), Gaps = 6/58 (10%)
 Frame = -3

Query  183  EGEVAFYAYQLLVGLSDLHAMGIVHCDLKPLNVLVFPMEQNGLNRLKIADFGLAIQDG  10
            E  + FY +Q+L GL+ LH  G+VHCD+K  NVL+      G + LKIADFG A   G
Sbjct  98   ENVIRFYTHQMLQGLNYLHLKGVVHCDVKGQNVLI------GDDGLKIADFGCAKWSG  149



>gb|KEY74820.1| hypothetical protein S7711_06507 [Stachybotrys chartarum IBT 
7711]
 gb|KFA50004.1| hypothetical protein S40293_05980 [Stachybotrys chartarum IBT 
40293]
Length=374

 Score = 52.8 bits (125),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 27/52 (52%), Positives = 37/52 (71%), Gaps = 5/52 (10%)
 Frame = -3

Query  177  EVAFYAYQLLVGLSDLHAMGIVHCDLKPLNVLVFPMEQNGLNRLKIADFGLA  22
            EV  +  QL+ G+  LH+MG+ HCDLKP N+L   + Q+G+  LKIADFGL+
Sbjct  185  EVGCFFKQLVQGVQYLHSMGVAHCDLKPDNLL---LTQDGV--LKIADFGLS  231



>ref|XP_004141910.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC101215204 
[Cucumis sativus]
Length=740

 Score = 53.1 bits (126),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 29/59 (49%), Positives = 35/59 (59%), Gaps = 5/59 (8%)
 Frame = -3

Query  183  EGEVAFYAYQLLVGLSDLHAMGIVHCDLKPLNVLVFPMEQNGLNRLKIADFGLAIQDGK  7
            E EV  Y   +L GL  +H  G VHCD+KP N+LVF     G    KIADFGL+ + GK
Sbjct  104  EFEVRRYTRTILEGLRYIHGKGFVHCDVKPRNILVF-----GDGDAKIADFGLSKKAGK  157



>ref|XP_005780461.1| hypothetical protein EMIHUDRAFT_443049 [Emiliania huxleyi CCMP1516]
 gb|EOD28032.1| hypothetical protein EMIHUDRAFT_443049 [Emiliania huxleyi CCMP1516]
Length=637

 Score = 53.1 bits (126),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 27/54 (50%), Positives = 36/54 (67%), Gaps = 5/54 (9%)
 Frame = -3

Query  183  EGEVAFYAYQLLVGLSDLHAMGIVHCDLKPLNVLVFPMEQNGLNRLKIADFGLA  22
            E    F+A+QLL GL+ LH+ G++H D+KP N+LV     N    LKIADFG+A
Sbjct  276  EQHARFFAWQLLRGLAALHSAGVIHRDIKPSNLLV-----NANCDLKIADFGIA  324



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 506872938168