BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c54032_g1_i1 len=159 path=[1:0-158]

Length=159
                                                                      Score     E

ref|XP_009798025.1|  PREDICTED: cycloartenol synthase-like            90.9    3e-20   
ref|XP_009618436.1|  PREDICTED: cycloartenol synthase-like isofor...  92.8    3e-20   
ref|XP_008809097.1|  PREDICTED: cycloartenol synthase-like            85.1    8e-19   
gb|KDO62053.1|  hypothetical protein CISIN_1g043885mg                 88.2    2e-18   
ref|XP_006474650.1|  PREDICTED: cycloartenol synthase 2-like          88.2    2e-18   
ref|XP_006453177.1|  hypothetical protein CICLE_v10007530mg           87.4    2e-18   
emb|CDP12483.1|  unnamed protein product                              87.0    3e-18   
ref|XP_011078187.1|  PREDICTED: cycloartenol synthase-like isofor...  87.0    4e-18   
ref|XP_011078186.1|  PREDICTED: cycloartenol synthase-like isofor...  87.0    4e-18   
ref|XP_007014713.1|  Beta-Amyrin Synthase isoform 2                   85.9    9e-18   
ref|XP_007014712.1|  Beta-Amyrin Synthase isoform 1                   85.9    9e-18   
ref|XP_006360676.1|  PREDICTED: cycloartenol synthase-like            85.9    1e-17   
dbj|BAF73929.1|  cycloartenol synthase                                85.5    1e-17   Rhizophora stylosa
ref|XP_004240118.1|  PREDICTED: cycloartenol synthase-like            85.5    1e-17   
ref|XP_006340479.1|  PREDICTED: cycloartenol Synthase-like            85.5    1e-17   
ref|XP_004308480.1|  PREDICTED: lupeol synthase-like                  85.5    2e-17   
gb|KDO60880.1|  hypothetical protein CISIN_1g048279mg                 81.6    2e-17   
gb|ADC84219.1|  putative 2,3 oxidosqualene cyclase                    85.1    2e-17   Actaea racemosa
ref|XP_011078188.1|  PREDICTED: cycloartenol synthase-like isofor...  84.7    2e-17   
gb|KGN45402.1|  hypothetical protein Csa_7G447170                     84.0    3e-17   
ref|XP_006474342.1|  PREDICTED: lanosterol synthase-like              81.6    3e-17   
emb|CAN60556.1|  hypothetical protein VITISV_020304                   84.3    3e-17   Vitis vinifera
ref|XP_010669609.1|  PREDICTED: lupeol synthase-like                  84.3    3e-17   
ref|XP_008809074.1|  PREDICTED: cycloartenol synthase-like isofor...  84.0    3e-17   
dbj|BAA33462.1|  Oxidosqualene Cyclase                                84.3    4e-17   Panax ginseng [Chinese ginseng]
ref|XP_008348400.1|  PREDICTED: LOW QUALITY PROTEIN: cycloartenol...  84.3    4e-17   
ref|XP_008655663.1|  PREDICTED: cycloartenol synthase-like isofor...  84.3    4e-17   
ref|XP_008655662.1|  PREDICTED: cycloartenol synthase-like isofor...  84.3    4e-17   
gb|AFW80117.1|  hypothetical protein ZEAMMB73_095189                  84.3    4e-17   
ref|XP_011017592.1|  PREDICTED: LOW QUALITY PROTEIN: cycloartenol...  84.3    4e-17   
ref|XP_009618437.1|  PREDICTED: cycloartenol synthase 2-like isof...  84.0    4e-17   
ref|XP_006372242.1|  cycloartenol synthase family protein             84.0    4e-17   
ref|XP_008796948.1|  PREDICTED: cycloartenol synthase-like            83.6    4e-17   
ref|XP_008223939.1|  PREDICTED: LOW QUALITY PROTEIN: cycloartenol...  84.0    5e-17   
ref|XP_004159000.1|  PREDICTED: cycloartenol synthase-like            84.0    5e-17   
ref|XP_004141754.1|  PREDICTED: cycloartenol synthase-like            84.0    5e-17   
ref|XP_010263443.1|  PREDICTED: uncharacterized protein LOC104601708  83.6    5e-17   
dbj|BAF93208.1|  cycloartenol synthase                                84.0    5e-17   Adiantum capillus-veneris [maidenhair fern]
ref|XP_006437236.1|  hypothetical protein CICLE_v10032410mg           80.9    5e-17   
ref|XP_008462186.1|  PREDICTED: cycloartenol synthase                 83.6    6e-17   
emb|CDP10846.1|  unnamed protein product                              81.3    6e-17   
ref|XP_009379198.1|  PREDICTED: cycloartenol synthase-like            83.6    6e-17   
gb|EYU25764.1|  hypothetical protein MIMGU_mgv1a024154mg              83.6    6e-17   
gb|EEE56272.1|  hypothetical protein OsJ_05323                        83.6    6e-17   Oryza sativa Japonica Group [Japonica rice]
gb|AIY33888.1|  cycloartenol synthase                                 83.6    6e-17   
ref|XP_009620777.1|  PREDICTED: cycloartenol Synthase-like isofor...  83.6    7e-17   
ref|XP_010927166.1|  PREDICTED: cycloartenol synthase-like isofor...  83.6    7e-17   
ref|XP_010656689.1|  PREDICTED: lupeol synthase isoform X2            83.6    7e-17   
gb|AAF03375.1|AF169966_1  putative cycloartenol synthase              83.6    7e-17   Oryza sativa [red rice]
ref|XP_004305793.1|  PREDICTED: beta-amyrin synthase-like             83.6    7e-17   
ref|XP_009764154.1|  PREDICTED: cycloartenol Synthase-like            83.2    7e-17   
ref|NP_001045848.1|  Os02g0139700                                     83.2    8e-17   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010927164.1|  PREDICTED: cycloartenol Synthase-like isofor...  83.6    8e-17   
gb|EEC72452.1|  hypothetical protein OsI_05794                        83.2    8e-17   Oryza sativa Indica Group [Indian rice]
ref|XP_010927163.1|  PREDICTED: cycloartenol synthase-like isofor...  83.2    8e-17   
ref|XP_009362029.1|  PREDICTED: cycloartenol synthase 2-like          83.2    8e-17   
gb|AFC67276.1|  cycloartenol synthase                                 83.2    9e-17   
ref|XP_008391430.1|  PREDICTED: cycloartenol synthase 2 isoform X1    83.2    9e-17   
ref|XP_007160210.1|  hypothetical protein PHAVU_002G302200g           83.2    9e-17   
ref|XP_008391431.1|  PREDICTED: cycloartenol synthase isoform X2      83.2    9e-17   
ref|XP_006484812.1|  PREDICTED: cycloartenol synthase 2-like          83.2    9e-17   
ref|XP_011094034.1|  PREDICTED: cycloartenol Synthase                 83.2    9e-17   
gb|AGC82085.1|  cycloartenol synthase protein                         83.2    9e-17   
ref|XP_010677527.1|  PREDICTED: cycloartenol synthase 2               83.2    1e-16   
dbj|BAA86930.1|  lupeol synthase                                      83.2    1e-16   Olea europaea
ref|XP_007224874.1|  hypothetical protein PRUPE_ppa022710mg           83.2    1e-16   
gb|ADG60271.1|  cycloartenol synthase                                 82.8    1e-16   
ref|XP_009346737.1|  PREDICTED: cycloartenol synthase-like            82.8    1e-16   
sp|Q9SLP9.1|CAS1_LUFAE  RecName: Full=Cycloartenol synthase; Shor...  82.8    1e-16   Luffa aegyptiaca [dishcloth gourd]
gb|AEO27878.1|  cycloartenol synthases                                82.8    1e-16   
ref|XP_010906067.1|  PREDICTED: cycloartenol synthase-like            82.8    1e-16   
dbj|BAF73930.1|  cycloartenol synthase                                82.8    1e-16   Kandelia candel
ref|XP_008809071.1|  PREDICTED: cycloartenol synthase-like isofor...  82.8    1e-16   
ref|XP_010932785.1|  PREDICTED: cycloartenol synthase-like isofor...  82.4    1e-16   
ref|XP_006646871.1|  PREDICTED: cycloartenol synthase-like            82.8    1e-16   
ref|XP_010048520.1|  PREDICTED: LOW QUALITY PROTEIN: lupeol synth...  82.4    1e-16   
sp|E2IUB0.1|CASS_KALDA  RecName: Full=Cycloartenol synthase; Shor...  82.4    1e-16   
ref|XP_010541955.1|  PREDICTED: cycloartenol synthase                 82.4    1e-16   
gb|KCW80789.1|  hypothetical protein EUGRSUZ_C02165                   82.4    1e-16   
ref|XP_008223938.1|  PREDICTED: cycloartenol synthase 2               82.4    1e-16   
sp|Q2XPU6.1|CAS1_RICCO  RecName: Full=Cycloartenol synthase; Shor...  82.4    1e-16   Ricinus communis
ref|XP_002527812.1|  Cycloartenol synthase, putative                  82.4    2e-16   Ricinus communis
ref|XP_007153005.1|  hypothetical protein PHAVU_004G178500g           82.4    2e-16   
ref|XP_007153003.1|  hypothetical protein PHAVU_004G178300g           82.4    2e-16   
sp|Q9SXV6.1|CAS1_GLYGL  RecName: Full=Cycloartenol synthase           82.4    2e-16   Glycyrrhiza glabra
ref|XP_009370034.1|  PREDICTED: cycloartenol synthase 2               82.4    2e-16   
ref|XP_009345284.1|  PREDICTED: cycloartenol synthase 2-like          82.4    2e-16   
ref|XP_007019806.1|  Cycloartenol synthase 1 isoform 5                82.0    2e-16   
gb|EYU25760.1|  hypothetical protein MIMGU_mgv1a001797mg              82.4    2e-16   
ref|XP_008228021.1|  PREDICTED: cycloartenol synthase                 82.4    2e-16   
gb|AIU41743.1|  beta-amyrin synthase                                  82.4    2e-16   
ref|XP_008679954.1|  PREDICTED: cycloartenol synthase isoform X1      82.0    2e-16   
ref|XP_007019803.1|  Cycloartenol synthase 1 isoform 2                82.0    2e-16   
dbj|BAA23533.1|  cycloartenol synthase                                82.0    2e-16   Pisum sativum [garden pea]
ref|XP_010932783.1|  PREDICTED: cycloartenol Synthase-like isofor...  82.0    2e-16   
ref|XP_007214976.1|  hypothetical protein PRUPE_ppa001806mg           82.0    2e-16   
gb|AGK62447.1|  cycloartenol synthase                                 82.0    2e-16   
sp|Q8W3Z3.1|CAS2_BETPL  RecName: Full=Cycloartenol synthase 2         82.0    2e-16   Betula platyphylla [Asian white birch]
ref|XP_007019802.1|  Cycloartenol synthase 1 isoform 1                82.0    2e-16   
ref|NP_001233784.1|  cycloartenol synthase                            82.0    2e-16   
ref|XP_006362808.1|  PREDICTED: cycloartenol Synthase-like isofor...  82.0    2e-16   
gb|AIU41742.1|  cycloartenol synthase                                 82.0    2e-16   
ref|XP_004303790.1|  PREDICTED: cycloartenol synthase-like            82.0    2e-16   
ref|XP_010271332.1|  PREDICTED: cycloartenol Synthase isoform X2      82.0    2e-16   
ref|XP_010271331.1|  PREDICTED: cycloartenol Synthase isoform X1      82.0    2e-16   
ref|XP_002453283.1|  hypothetical protein SORBIDRAFT_04g003200        82.0    2e-16   Sorghum bicolor [broomcorn]
gb|EYU23540.1|  hypothetical protein MIMGU_mgv1a020935mg              82.0    2e-16   
ref|XP_004299756.1|  PREDICTED: cycloartenol synthase-like            82.0    3e-16   
ref|XP_004513124.1|  PREDICTED: cycloartenol synthase-like            82.0    3e-16   
ref|XP_006403308.1|  hypothetical protein EUTSA_v10003155mg           81.6    3e-16   
ref|XP_011031251.1|  PREDICTED: cycloartenol synthase-like            81.6    3e-16   
ref|XP_003574426.1|  PREDICTED: cycloartenol synthase                 81.6    3e-16   
ref|XP_010932787.1|  PREDICTED: cycloartenol Synthase-like isofor...  81.3    3e-16   
gb|AAT38891.1|  cycloartenol synthase                                 81.6    3e-16   Avena strigosa
ref|XP_002310905.1|  hypothetical protein POPTR_0007s15200g           81.6    3e-16   Populus trichocarpa [western balsam poplar]
sp|H2KWF1.1|PAKSY_ORYSJ  RecName: Full=Parkeol synthase               81.6    3e-16   
ref|XP_010927167.1|  PREDICTED: cycloartenol synthase-like            81.6    3e-16   
ref|XP_008341139.1|  PREDICTED: cycloartenol synthase 2-like          81.3    3e-16   
ref|XP_007225240.1|  hypothetical protein PRUPE_ppa001844mg           81.6    3e-16   
emb|CBD47302.1|  cycloartenol synthase                                81.6    3e-16   Dioscorea zingiberensis
gb|AEM42981.1|  cycloartenol synthase                                 81.6    3e-16   
emb|CAM91422.1|  cycloartenol synthase                                81.6    3e-16   Dioscorea zingiberensis
gb|ABG22398.1|  Cycloartenol synthase, putative, expressed            81.3    3e-16   
ref|XP_004951930.1|  PREDICTED: cycloartenol synthase-like            81.6    3e-16   
emb|CBI16773.3|  unnamed protein product                              79.3    4e-16   
gb|AAG44096.1|AF216755_1  cycloartenol synthase                       81.3    4e-16   Abies magnifica [California red fir]
ref|XP_010052737.1|  PREDICTED: beta-amyrin synthase-like isoform X2  81.3    4e-16   
ref|XP_004299757.1|  PREDICTED: cycloartenol synthase-like            81.3    4e-16   
ref|XP_010052738.1|  PREDICTED: beta-amyrin synthase-like isoform X3  81.3    4e-16   
ref|NP_001176396.1|  Os11g0189600                                     81.3    4e-16   
ref|XP_010052732.1|  PREDICTED: beta-amyrin synthase-like isoform X1  81.3    4e-16   
emb|CAN73194.1|  hypothetical protein VITISV_028269                   80.9    4e-16   Vitis vinifera
gb|KDP27754.1|  hypothetical protein JCGZ_19783                       81.3    4e-16   
ref|XP_007153001.1|  hypothetical protein PHAVU_004G1782001g          81.3    4e-16   
ref|XP_003620645.1|  Lanosterol synthase                              80.9    4e-16   
emb|CDP12480.1|  unnamed protein product                              81.3    4e-16   
emb|CDP14235.1|  unnamed protein product                              80.9    4e-16   
ref|XP_010063691.1|  PREDICTED: beta-amyrin synthase-like             81.3    5e-16   
gb|AGF87141.1|  cycloartenol synthase                                 81.3    5e-16   
dbj|BAA84603.1|  oxidosqualene cyclase                                81.3    5e-16   Allium macrostemon
emb|CDP08999.1|  unnamed protein product                              81.3    5e-16   
ref|XP_003620644.1|  Lanosterol synthase                              80.9    5e-16   
gb|EYU26563.1|  hypothetical protein MIMGU_mgv1a001814mg              80.9    5e-16   
gb|AAT38887.1|  cycloartenol synthase                                 80.9    6e-16   Avena clauda
gb|AAT38892.1|  cycloartenol synthase                                 80.9    6e-16   Avena ventricosa
gb|AAT38890.1|  cycloartenol synthase                                 80.9    6e-16   Avena prostrata
ref|XP_002513298.1|  Cycloartenol synthase, putative                  80.9    6e-16   Ricinus communis
emb|CAC84559.1|  cycloartenol synthase                                80.9    6e-16   Avena strigosa
gb|EYU30432.1|  hypothetical protein MIMGU_mgv1a021184mg              78.2    6e-16   
sp|Q6BE25.1|CAS1_CUCPE  RecName: Full=Cycloartenol synthase           80.9    6e-16   Cucurbita pepo
gb|AAT38888.1|  cycloartenol synthase                                 80.9    6e-16   Avena longiglumis
gb|KCW70930.1|  hypothetical protein EUGRSUZ_F04043                   80.5    6e-16   
ref|XP_003610947.1|  Cycloartenol synthase                            80.9    6e-16   
gb|AAT38889.1|  cycloartenol synthase                                 80.9    6e-16   Avena longiglumis
gb|ABX75046.1|  cycloartenol synthase 1                               80.9    6e-16   Polygala tenuifolia [Chinese senega-root]
ref|XP_011019951.1|  PREDICTED: LOW QUALITY PROTEIN: cycloartenol...  80.9    6e-16   
gb|KHN32929.1|  Cycloartenol synthase                                 80.5    7e-16   
ref|XP_010669612.1|  PREDICTED: lupeol synthase-like                  80.5    7e-16   
ref|XP_003516849.1|  PREDICTED: cycloartenol synthase                 80.5    7e-16   
ref|XP_010095206.1|  Lupeol synthase                                  80.5    7e-16   
ref|NP_001168640.1|  hypothetical protein                             80.5    8e-16   Zea mays [maize]
dbj|BAA86932.1|  lupeol synthase                                      80.5    8e-16   Taraxacum officinale [dandelion]
ref|XP_010091121.1|  Lupeol synthase                                  80.5    8e-16   
dbj|BAE53431.1|  cycloartenol synthase                                80.5    8e-16   Lotus japonicus
ref|XP_002989569.1|  hypothetical protein SELMODRAFT_269539           80.5    8e-16   
ref|XP_002964244.1|  hypothetical protein SELMODRAFT_266790           80.5    8e-16   
ref|XP_004517133.1|  PREDICTED: probable oxidosqualene cyclase-like   77.0    8e-16   
gb|KEH27284.1|  cycloartenol synthase                                 80.5    8e-16   
sp|O82139.1|CAS1_PANGI  RecName: Full=Cycloartenol Synthase           80.5    8e-16   Panax ginseng [Chinese ginseng]
ref|XP_007023625.1|  Cycloartenol synthase 1                          80.5    8e-16   
ref|XP_004305792.1|  PREDICTED: beta-amyrin synthase-like             80.1    9e-16   
ref|XP_009764017.1|  PREDICTED: LOW QUALITY PROTEIN: cycloartenol...  80.1    9e-16   
ref|XP_008240807.1|  PREDICTED: lupeol synthase-like                  80.1    1e-15   
gb|ABY90140.2|  beta-amyrin synthase                                  80.1    1e-15   Bupleurum chinense
ref|XP_010656690.1|  PREDICTED: lupeol synthase isoform X3            80.1    1e-15   
gb|AIW81530.1|  cycloartenol synthase protein                         80.1    1e-15   
ref|XP_002309028.2|  hypothetical protein POPTR_0006s07890g           80.1    1e-15   Populus trichocarpa [western balsam poplar]
ref|XP_002269060.2|  PREDICTED: lupeol synthase isoform X1            80.1    1e-15   Vitis vinifera
ref|XP_002308131.2|  cycloartenol synthase family protein             80.1    1e-15   Populus trichocarpa [western balsam poplar]
ref|XP_010234655.1|  PREDICTED: cycloartenol synthase-like isofor...  80.1    1e-15   
gb|AIK19224.1|  triterpene synthase                                   80.1    1e-15   
emb|CBI24038.3|  unnamed protein product                              80.1    1e-15   
ref|XP_006381170.1|  hypothetical protein POPTR_0006s07870g           80.1    1e-15   
ref|XP_010252186.1|  PREDICTED: lupeol synthase-like                  80.1    1e-15   
ref|XP_007134028.1|  hypothetical protein PHAVU_010G013200g           80.1    1e-15   
ref|XP_003573823.1|  PREDICTED: cycloartenol synthase-like isofor...  80.1    1e-15   
ref|XP_010245756.1|  PREDICTED: beta-amyrin synthase-like             80.1    1e-15   
sp|Q8W3Z4.1|CAS1_BETPL  RecName: Full=Cycloartenol synthase           80.1    1e-15   Betula platyphylla [Asian white birch]
sp|E2IUA6.1|TARS_KALDA  RecName: Full=Taraxerol synthase; Short=K...  79.7    1e-15   
dbj|BAJ91961.1|  predicted protein                                    79.7    1e-15   
ref|XP_003530475.1|  PREDICTED: lupeol synthase isoform 1             79.7    1e-15   
gb|ABY60426.1|  cycloartenol synthase                                 79.7    1e-15   Panax notoginseng [san-qi]
ref|XP_010063692.1|  PREDICTED: beta-amyrin synthase                  79.7    1e-15   
ref|XP_002264289.1|  PREDICTED: cycloartenol Synthase                 79.7    1e-15   Vitis vinifera
gb|KHN16704.1|  Lupeol synthase                                       79.7    1e-15   
gb|EPS63519.1|  cycloartenol synthase                                 79.7    1e-15   
ref|XP_001758555.1|  predicted protein                                79.7    1e-15   
ref|XP_002989509.1|  hypothetical protein SELMODRAFT_129950           79.7    1e-15   
emb|CDP20858.1|  unnamed protein product                              79.7    1e-15   
gb|ABL07607.1|  beta-amyrin synthase                                  79.7    1e-15   Polygala tenuifolia [Chinese senega-root]
gb|AFJ19235.1|  mixed amyrin synthase                                 79.7    2e-15   
gb|AAS01524.1|  cycloartenol synthase                                 79.7    2e-15   Centella asiatica [Asiatic pennywort]
gb|AAS83469.1|  cycloartenol synthase                                 79.7    2e-15   Bupleurum kaoi
ref|XP_010065064.1|  PREDICTED: beta-amyrin synthase-like             79.3    2e-15   
gb|AEX99665.1|  amyrin synthase                                       79.7    2e-15   
emb|CDP15852.1|  unnamed protein product                              79.7    2e-15   
ref|XP_011019952.1|  PREDICTED: cycloartenol synthase 2-like          79.3    2e-15   
ref|XP_009102615.1|  PREDICTED: cycloartenol synthase-like            79.3    2e-15   
gb|KHN10150.1|  Cycloartenol synthase                                 79.3    2e-15   
emb|CDP12624.1|  unnamed protein product                              79.3    2e-15   
sp|Q8W3Z2.1|LUPS_BETPL  RecName: Full=Lupeol synthase                 79.3    2e-15   Betula platyphylla [Asian white birch]
ref|XP_002453282.1|  hypothetical protein SORBIDRAFT_04g003190        79.3    2e-15   Sorghum bicolor [broomcorn]
ref|XP_006850984.1|  hypothetical protein AMTR_s00025p00210690        79.3    2e-15   
gb|KEH22896.1|  cycloartenol synthase                                 79.3    2e-15   
gb|KHN32928.1|  Cycloartenol synthase                                 79.3    2e-15   
ref|XP_008679955.1|  PREDICTED: cycloartenol synthase isoform X2      79.0    2e-15   
ref|XP_003517615.1|  PREDICTED: cycloartenol synthase-like            79.3    2e-15   
ref|XP_010520562.1|  PREDICTED: lanosterol synthase isoform X2        79.3    2e-15   
sp|Q6BE23.1|OXSC_CUCPE  RecName: Full=Probable oxidosqualene cyclase  79.3    2e-15   Cucurbita pepo
ref|XP_010520561.1|  PREDICTED: lanosterol synthase isoform X1        79.3    2e-15   
ref|XP_003570909.1|  PREDICTED: cycloartenol synthase-like            79.3    2e-15   
ref|XP_006474653.1|  PREDICTED: cycloartenol Synthase-like            79.0    2e-15   
ref|XP_010063690.1|  PREDICTED: beta-amyrin synthase-like             79.0    2e-15   
gb|KHG28038.1|  Beta-amyrin synthase                                  79.0    2e-15   
dbj|BAB83253.1|  cycloartenol synthase                                79.0    3e-15   Cheilocostus speciosus [crepe-ginger]
ref|XP_006474339.1|  PREDICTED: cycloartenol synthase 2-like isof...  79.0    3e-15   
ref|XP_006453168.1|  hypothetical protein CICLE_v10007532mg           79.0    3e-15   
gb|KCW70932.1|  hypothetical protein EUGRSUZ_F04049                   79.0    3e-15   
sp|Q8W3Z1.1|BAMS_BETPL  RecName: Full=Beta-amyrin synthase            79.0    3e-15   Betula platyphylla [Asian white birch]
ref|XP_008353332.1|  PREDICTED: LOW QUALITY PROTEIN: cycloartenol...  78.6    3e-15   
ref|XP_011006636.1|  PREDICTED: beta-amyrin synthase-like             79.0    3e-15   
gb|EPS65499.1|  beta-amyrin synthase                                  79.0    3e-15   
ref|XP_002527810.1|  cycloartenol synthase, putative                  75.9    3e-15   Ricinus communis
ref|XP_011096562.1|  PREDICTED: dammarenediol II synthase-like        78.6    3e-15   
ref|XP_010065062.1|  PREDICTED: beta-amyrin synthase-like             78.6    3e-15   
ref|XP_004139371.1|  PREDICTED: isomultiflorenol synthase-like        78.6    4e-15   
ref|XP_009409584.1|  PREDICTED: cycloartenol synthase-like            78.6    4e-15   
ref|XP_007225523.1|  hypothetical protein PRUPE_ppa025507mg           78.2    4e-15   
ref|XP_006377610.1|  putative oxidosqualene cyclase family protein    78.6    4e-15   
ref|XP_003573825.1|  PREDICTED: cycloartenol synthase-like isofor...  78.6    4e-15   
ref|XP_010244586.1|  PREDICTED: cycloartenol synthase 2 isoform X2    78.2    4e-15   
dbj|BAE53430.1|  lupeol synthase                                      78.2    5e-15   Lotus japonicus
ref|XP_007202928.1|  hypothetical protein PRUPE_ppa016625mg           78.2    5e-15   
dbj|BAI48072.1|  cycloartenol synthase                                78.2    5e-15   Polypodiodes niponica
ref|XP_006436398.1|  hypothetical protein CICLE_v10033377mg           78.2    5e-15   
ref|XP_010245747.1|  PREDICTED: beta-amyrin synthase-like isoform X2  77.8    5e-15   
gb|AFS49705.1|  cycloartenol synthase                                 78.2    5e-15   
ref|XP_007023608.1|  Beta-Amyrin Synthase                             78.2    5e-15   
ref|XP_006396090.1|  hypothetical protein EUTSA_v10002412mg           78.2    5e-15   
ref|XP_009786280.1|  PREDICTED: lupeol synthase                       78.2    5e-15   
ref|XP_009779988.1|  PREDICTED: beta-amyrin synthase                  78.2    5e-15   
ref|XP_010245746.1|  PREDICTED: beta-amyrin synthase-like isoform X1  78.2    5e-15   
emb|CDP17720.1|  unnamed protein product                              78.2    5e-15   
gb|AGA17940.1|  beta-amyrin synthase                                  78.2    5e-15   
ref|XP_008459938.1|  PREDICTED: cucurbitadienol synthase              78.2    6e-15   
ref|XP_006396089.1|  hypothetical protein EUTSA_v10002412mg           78.2    6e-15   
ref|XP_010244585.1|  PREDICTED: cycloartenol synthase 2 isoform X1    78.2    6e-15   
gb|AIK19223.1|  triterpene synthase                                   78.2    6e-15   
dbj|BAF63702.1|  mixed amyrin synthase                                77.8    6e-15   Olea europaea
dbj|BAA86933.1|  oxidosqualene cyclase                                77.8    6e-15   Taraxacum officinale [dandelion]
gb|AAC04931.1|  cycloartenol synthase                                 77.8    6e-15   Arabidopsis thaliana [mouse-ear cress]
ref|NP_178722.1|  cycloartenol synthase                               77.8    6e-15   Arabidopsis thaliana [mouse-ear cress]
gb|AHX97777.1|  beta-amyrin synthase                                  77.8    6e-15   
ref|XP_007025071.1|  Beta-Amyrin Synthase, putative                   77.8    6e-15   
emb|CDP08328.1|  unnamed protein product                              77.8    7e-15   
ref|XP_010313621.1|  PREDICTED: delta-amyrin synthase isoform X1      77.8    7e-15   
ref|XP_010234656.1|  PREDICTED: cycloartenol synthase-like isofor...  77.8    7e-15   
gb|AHY94897.1|  cycloartenol synthase                                 77.8    7e-15   
ref|XP_010234657.1|  PREDICTED: cycloartenol synthase-like isofor...  77.4    7e-15   
ref|XP_009591746.1|  PREDICTED: beta-amyrin synthase-like             77.8    7e-15   
ref|XP_004975971.1|  PREDICTED: cycloartenol synthase-like            77.8    7e-15   
dbj|BAL41371.1|  lupeol synthase                                      77.8    8e-15   
ref|XP_006300769.1|  hypothetical protein CARUB_v10019844mg           77.8    8e-15   
ref|XP_006468104.1|  PREDICTED: beta-amyrin synthase-like isoform X1  77.8    8e-15   
ref|XP_004488915.1|  PREDICTED: beta-amyrin synthase-like             77.8    8e-15   
sp|Q764T8.1|LUPS_GLYGL  RecName: Full=Lupeol synthase; Short=GgLUS1   77.8    8e-15   Glycyrrhiza glabra
ref|XP_009136183.1|  PREDICTED: cycloartenol synthase                 77.8    8e-15   
ref|XP_009612988.1|  PREDICTED: beta-amyrin synthase                  77.4    8e-15   
ref|XP_008380418.1|  PREDICTED: beta-amyrin synthase                  77.4    8e-15   
gb|KHN38108.1|  Beta-amyrin synthase                                  77.8    8e-15   
ref|XP_009344015.1|  PREDICTED: beta-amyrin synthase                  77.4    9e-15   
ref|XP_008365649.1|  PREDICTED: beta-amyrin synthase                  77.4    9e-15   
ref|XP_010252425.1|  PREDICTED: taraxerol synthase-like               76.6    9e-15   
ref|XP_006351975.1|  PREDICTED: beta-amyrin synthase-like             77.4    9e-15   
ref|NP_001234604.1|  beta-amyrin synthase                             77.4    9e-15   
ref|XP_010313624.1|  PREDICTED: beta-amyrin synthase isoform X1       77.4    9e-15   
ref|XP_006468105.1|  PREDICTED: beta-amyrin synthase-like isoform X2  77.4    9e-15   
ref|XP_008353811.1|  PREDICTED: LOW QUALITY PROTEIN: beta-amyrin ...  77.0    9e-15   
gb|AIE17466.1|  oxidosqualene cyclase                                 77.4    9e-15   
gb|KCW83375.1|  hypothetical protein EUGRSUZ_B00308                   77.4    1e-14   
dbj|BAE95409.1|  oxidosqualene cyclase                                77.4    1e-14   
ref|XP_010067808.1|  PREDICTED: cycloartenol synthase 2-like isof...  77.4    1e-14   
ref|XP_002964634.1|  hypothetical protein SELMODRAFT_81943            77.4    1e-14   
ref|XP_003531781.1|  PREDICTED: beta-amyrin synthase-like isoform 1   77.4    1e-14   
ref|XP_010067807.1|  PREDICTED: cycloartenol synthase 2-like isof...  77.4    1e-14   
gb|ACM89978.1|  putative beta amyrin synthase                         77.0    1e-14   
gb|AHI17180.1|  beta-amyrin synthase                                  77.0    1e-14   
gb|KHG28306.1|  Beta-amyrin synthase                                  77.0    1e-14   
ref|NP_001234597.1|  delta-amyrin synthase                            77.0    1e-14   
gb|KGN60855.1|  hypothetical protein Csa_2G014580                     76.3    1e-14   
gb|EYU33367.1|  hypothetical protein MIMGU_mgv1a001775mg              77.0    1e-14   
sp|A8CDT2.1|BAS_BRUGY  RecName: Full=Beta-amyrin synthase; Short=...  77.0    1e-14   
ref|XP_006364889.1|  PREDICTED: delta-amyrin synthase-like            77.0    1e-14   
ref|XP_010488811.1|  PREDICTED: cycloartenol synthase-like            77.0    1e-14   
ref|XP_010472731.1|  PREDICTED: camelliol C synthase-like isoform X1  77.0    1e-14   
ref|XP_006374734.1|  hypothetical protein POPTR_0014s00350g           77.0    1e-14   
ref|XP_010413093.1|  PREDICTED: cycloartenol synthase                 77.0    1e-14   
ref|XP_011093795.1|  PREDICTED: beta-amyrin synthase                  77.0    1e-14   
ref|XP_009779991.1|  PREDICTED: beta-amyrin synthase-like             77.0    1e-14   
ref|XP_010068959.1|  PREDICTED: cycloartenol synthase-like            76.6    1e-14   
ref|XP_010467143.1|  PREDICTED: cycloartenol synthase-like            77.0    1e-14   
gb|KFK39919.1|  hypothetical protein AALP_AA3G306200                  77.0    1e-14   
ref|XP_002989508.1|  hypothetical protein SELMODRAFT_160256           77.0    1e-14   
ref|XP_010027674.1|  PREDICTED: beta-amyrin synthase-like isoform X2  76.6    1e-14   
gb|AEM42982.1|  cucurbitadienol synthase                              76.6    2e-14   
ref|XP_006296684.1|  hypothetical protein CARUB_v10013036mg           76.6    2e-14   
ref|XP_010027664.1|  PREDICTED: beta-amyrin synthase-like isoform X1  76.6    2e-14   
ref|XP_008362476.1|  PREDICTED: beta-amyrin synthase-like             76.6    2e-14   
ref|XP_004513122.1|  PREDICTED: cycloartenol synthase-like            76.6    2e-14   
ref|XP_007214977.1|  hypothetical protein PRUPE_ppa001810mg           76.6    2e-14   
ref|XP_002883756.1|  cycloartenol synthase                            76.6    2e-14   
ref|XP_010027785.1|  PREDICTED: beta-amyrin synthase-like             76.6    2e-14   
ref|XP_008365698.1|  PREDICTED: beta-amyrin synthase-like             76.6    2e-14   
ref|XP_006606308.1|  PREDICTED: lupeol synthase-like isoform X1       76.6    2e-14   
gb|KHN00954.1|  Lupeol synthase                                       76.6    2e-14   
ref|XP_004513136.1|  PREDICTED: cycloartenol synthase-like            76.6    2e-14   
ref|NP_001236591.1|  beta-amyrin synthase                             76.3    2e-14   
gb|KDP37006.1|  hypothetical protein JCGZ_06062                       76.6    2e-14   
ref|XP_006364890.1|  PREDICTED: beta-amyrin synthase-like             76.3    2e-14   
gb|KHN39383.1|  Beta-amyrin synthase                                  76.3    2e-14   
emb|CDP10664.1|  unnamed protein product                              76.3    2e-14   
ref|XP_006582958.1|  PREDICTED: beta-amyrin synthase isoform X1       76.3    2e-14   
gb|ACV21067.1|  beta-amyrin synthase                                  76.3    2e-14   
sp|A8C980.1|GERS_RHISY  RecName: Full=Germanicol synthase; Short=...  76.3    2e-14   
ref|XP_009347735.1|  PREDICTED: beta-amyrin synthase-like             76.3    2e-14   
ref|XP_008228023.1|  PREDICTED: beta-amyrin synthase                  76.3    2e-14   
ref|XP_004170173.1|  PREDICTED: isomultiflorenol synthase-like        76.3    2e-14   
ref|XP_007135871.1|  hypothetical protein PHAVU_010G165100g           76.3    2e-14   
emb|CDX88493.1|  BnaC06g39370D                                        76.3    2e-14   
ref|XP_009379199.1|  PREDICTED: beta-amyrin synthase-like             76.3    3e-14   
ref|XP_007214978.1|  hypothetical protein PRUPE_ppa001812mg           76.3    3e-14   
gb|KDP37007.1|  hypothetical protein JCGZ_06063                       76.3    3e-14   
gb|AHF49822.1|  bAS                                                   76.3    3e-14   
sp|Q6BE24.1|CUCS_CUCPE  RecName: Full=Cucurbitadienol synthase        76.3    3e-14   
gb|ACH88048.1|  beta-amyrin synthase                                  76.3    3e-14   
sp|Q9MB42.1|BAMS_GLYGL  RecName: Full=Beta-amyrin synthase            76.3    3e-14   
ref|XP_011034491.1|  PREDICTED: lupeol synthase-like isoform X2       75.9    3e-14   
gb|ADE88148.1|  beta-amyrin synthase                                  75.9    3e-14   
ref|XP_006368910.1|  hypothetical protein POPTR_0001s146002g          75.9    3e-14   
ref|XP_011034490.1|  PREDICTED: lupeol synthase-like isoform X1       75.9    3e-14   
ref|XP_006468242.1|  PREDICTED: LOW QUALITY PROTEIN: beta-Amyrin ...  76.3    3e-14   
ref|XP_002299271.2|  hypothetical protein POPTR_0001s14610g           75.9    3e-14   
ref|XP_006368912.1|  hypothetical protein POPTR_0001s14610g           75.9    3e-14   
ref|XP_006436395.1|  hypothetical protein CICLE_v10030771mg           75.9    3e-14   
sp|E2IUA7.1|GLUTS_KALDA  RecName: Full=Glutinol synthase; Short=K...  75.9    3e-14   
dbj|BAE95410.1|  lanosterol synthase                                  75.9    4e-14   
ref|XP_010063688.1|  PREDICTED: beta-amyrin synthase-like             75.9    4e-14   
ref|XP_010241100.1|  PREDICTED: beta-Amyrin Synthase 1-like           75.5    4e-14   
ref|XP_004139372.1|  PREDICTED: isomultiflorenol synthase-like        75.5    4e-14   
gb|EYU38890.1|  hypothetical protein MIMGU_mgv1a001796mg              75.5    4e-14   
ref|XP_011031247.1|  PREDICTED: beta-amyrin synthase                  75.5    4e-14   
ref|XP_002305339.1|  putative oxidosqualene cyclase family protein    75.5    4e-14   
ref|XP_002310349.1|  beta-Amyrin synthase family protein              75.5    4e-14   
ref|XP_006468107.1|  PREDICTED: beta-amyrin synthase-like             75.5    4e-14   
sp|O82140.1|BAMS1_PANGI  RecName: Full=Beta-Amyrin Synthase 1         75.5    4e-14   
gb|KGN60853.1|  hypothetical protein Csa_2G013830                     75.5    4e-14   
ref|XP_004156484.1|  PREDICTED: LOW QUALITY PROTEIN: isomultiflor...  75.5    4e-14   
gb|AER41023.1|  cycloartenol synthase                                 75.5    4e-14   
ref|XP_011009932.1|  PREDICTED: beta-amyrin synthase-like isoform X1  75.5    4e-14   
gb|KEH27290.1|  beta-amyrin synthase                                  75.5    5e-14   
ref|XP_006380842.1|  hypothetical protein POPTR_0007s15180g           75.1    5e-14   
ref|XP_007214979.1|  hypothetical protein PRUPE_ppa001817mg           75.5    5e-14   
sp|E2IUA9.1|LUPS_KALDA  RecName: Full=Lupeol synthase; Short=KdLUS    75.5    5e-14   
ref|XP_004140567.1|  PREDICTED: cucurbitadienol synthase-like         75.5    5e-14   
gb|AIT72030.1|  oxidosqualene cyclase                                 75.5    5e-14   
ref|XP_011009936.1|  PREDICTED: beta-amyrin synthase-like isoform X3  75.1    5e-14   
dbj|BAE53429.1|  beta-amyrin synthase                                 75.1    5e-14   
ref|XP_010048521.1|  PREDICTED: cycloartenol synthase-like            75.1    5e-14   
gb|AAO33579.1|AF478454_1  putative beta-amyrin synthase               75.1    5e-14   
gb|AGA17939.1|  lupeol synthase                                       75.1    6e-14   
gb|AHF22084.1|  OSC2                                                  75.1    6e-14   
gb|AGG09939.1|  beta-amyrin synthase                                  75.1    6e-14   
ref|XP_010106930.1|  Cycloartenol synthase                            75.1    6e-14   
sp|O82146.1|BAMS2_PANGI  RecName: Full=Beta-Amyrin Synthase 2         75.1    6e-14   
ref|XP_006468103.1|  PREDICTED: beta-amyrin synthase-like             75.1    6e-14   
ref|XP_002269889.1|  PREDICTED: cycloartenol Synthase-like            75.1    6e-14   
ref|XP_011009935.1|  PREDICTED: beta-amyrin synthase-like isoform X2  75.1    7e-14   
ref|XP_010245750.1|  PREDICTED: beta-amyrin synthase-like isoform X2  74.7    7e-14   
ref|XP_009344148.1|  PREDICTED: beta-amyrin synthase-like             75.1    7e-14   
gb|KDO67049.1|  hypothetical protein CISIN_1g048260mg                 71.6    7e-14   
ref|XP_009337925.1|  PREDICTED: beta-amyrin synthase-like             74.7    7e-14   
gb|KFK42270.1|  hypothetical protein AALP_AA2G234200                  74.7    7e-14   
ref|XP_009370029.1|  PREDICTED: cycloartenol Synthase-like            74.7    7e-14   
ref|XP_002507650.1|  predicted protein                                74.7    8e-14   
ref|XP_010531957.1|  PREDICTED: beta-amyrin synthase-like isoform X7  74.7    8e-14   
gb|EYU34015.1|  hypothetical protein MIMGU_mgv1a021513mg              74.7    8e-14   
ref|XP_008342985.1|  PREDICTED: LOW QUALITY PROTEIN: cycloartenol...  74.7    8e-14   
ref|XP_009369010.1|  PREDICTED: beta-amyrin synthase-like             74.7    8e-14   
ref|XP_010245749.1|  PREDICTED: beta-amyrin synthase-like isoform X1  74.7    8e-14   
ref|XP_010531956.1|  PREDICTED: beta-amyrin synthase-like isoform X6  74.3    8e-14   
gb|KDP25031.1|  hypothetical protein JCGZ_22566                       75.1    8e-14   
gb|ACA13386.1|  beta-amyrin synthase                                  74.7    8e-14   
ref|XP_002887740.1|  hypothetical protein ARALYDRAFT_316749           74.7    8e-14   
ref|XP_010531948.1|  PREDICTED: camelliol C synthase-like isoform X2  74.7    9e-14   
gb|ADM86392.1|  putative beta-amyrin synthase                         74.7    9e-14   
ref|XP_004251564.1|  PREDICTED: beta-amyrin synthase-like isoform X1  74.7    9e-14   
ref|XP_003604122.1|  Beta-amyrin synthase                             74.3    1e-13   
ref|XP_003604121.1|  Beta-amyrin synthase                             74.3    1e-13   
gb|AAO33578.1|AF478453_1  beta-amyrin synthase                        74.3    1e-13   
ref|XP_010531951.1|  PREDICTED: camelliol C synthase-like isoform X1  74.3    1e-13   
ref|XP_010054896.1|  PREDICTED: beta-amyrin synthase-like             74.3    1e-13   
ref|XP_006353758.1|  PREDICTED: lupeol synthase-like                  74.3    1e-13   
gb|KCW66014.1|  hypothetical protein EUGRSUZ_G033031                  73.6    1e-13   
ref|XP_010531947.1|  PREDICTED: camelliol C synthase-like isoform X1  74.3    1e-13   
gb|KCW78276.1|  hypothetical protein EUGRSUZ_D02459                   74.3    1e-13   
ref|XP_010323971.1|  PREDICTED: lupeol synthase isoform X2            74.3    1e-13   
ref|XP_010534788.1|  PREDICTED: seco-amyrin synthase-like             74.3    1e-13   
ref|XP_010531952.1|  PREDICTED: camelliol C synthase-like isoform X2  74.3    1e-13   
ref|XP_010313692.1|  PREDICTED: delta-amyrin synthase-like isofor...  74.3    1e-13   
ref|XP_010532332.1|  PREDICTED: camelliol C synthase-like             74.3    1e-13   
ref|XP_007014076.1|  Cycloartenol synthase 1                          74.3    1e-13   
gb|KDP37004.1|  hypothetical protein JCGZ_06060                       73.9    1e-13   
ref|XP_004243674.1|  PREDICTED: lupeol synthase isoform X1            74.3    1e-13   
sp|Q2XPU7.1|LUPS_RICCO  RecName: Full=Lupeol synthase                 74.3    1e-13   
ref|XP_009106612.1|  PREDICTED: camelliol C synthase                  73.9    1e-13   
ref|XP_002527337.1|  Cycloartenol synthase, putative                  73.9    1e-13   
gb|ADK12003.1|  beta-amyrin synthase                                  73.9    2e-13   
emb|CBI18385.3|  unnamed protein product                              72.8    2e-13   
dbj|BAB83254.1|  multifunctional triterpene synthase                  73.9    2e-13   
ref|XP_010068963.1|  PREDICTED: cycloartenol Synthase-like            73.9    2e-13   
ref|XP_009379200.1|  PREDICTED: beta-amyrin synthase-like             73.6    2e-13   
gb|ACN34296.1|  unknown                                               73.6    2e-13   
dbj|BAG82628.1|  beta-amyrin synthase                                 73.6    2e-13   
ref|NP_178016.2|  beta-amyrin synthase                                73.6    2e-13   
ref|XP_011037652.1|  PREDICTED: beta-amyrin synthase-like             73.6    2e-13   
sp|E2IUA8.1|FRIES_KALDA  RecName: Full=Friedelin synthase; Short=...  73.6    2e-13   
ref|XP_008362456.1|  PREDICTED: LOW QUALITY PROTEIN: cycloartenol...  73.6    2e-13   
gb|AAC17080.1|  Strong similarity to lupeol synthase gb|U49919 an...  73.9    2e-13   
ref|XP_003632939.1|  PREDICTED: cycloartenol synthase-like            73.6    2e-13   
ref|XP_002304910.2|  putative oxidosqualene cyclase family protein    73.6    2e-13   
gb|KFK33925.1|  hypothetical protein AALP_AA5G078800                  73.6    2e-13   
gb|ACB87531.1|  beta-amyrin synthase                                  73.6    2e-13   
gb|KCW70935.1|  hypothetical protein EUGRSUZ_F04052                   73.6    2e-13   
ref|XP_004166391.1|  PREDICTED: LOW QUALITY PROTEIN: probable oxi...  73.6    2e-13   
ref|XP_006408625.1|  hypothetical protein EUTSA_v10001913mg           73.6    2e-13   
emb|CDP17718.1|  unnamed protein product                              72.4    2e-13   
ref|XP_006389937.1|  hypothetical protein EUTSA_v10018165mg           73.2    3e-13   
sp|Q948R6.1|IMFS_LUFAE  RecName: Full=Isomultiflorenol synthase; ...  73.2    3e-13   
ref|XP_002269849.1|  PREDICTED: cycloartenol synthase                 73.2    3e-13   
ref|XP_010472732.1|  PREDICTED: camelliol C synthase-like isoform X2  73.2    3e-13   
ref|XP_010429761.1|  PREDICTED: beta-amyrin synthase                  73.2    3e-13   
dbj|BAA85267.1|  oxidosqualene cyclase                                73.2    3e-13   
gb|KFK42271.1|  hypothetical protein AALP_AA2G234300                  73.2    3e-13   
ref|XP_010091128.1|  Beta-amyrin synthase                             73.2    3e-13   
ref|XP_004507563.1|  PREDICTED: beta-amyrin synthase-like isoform X2  72.8    3e-13   
ref|XP_004507562.1|  PREDICTED: beta-amyrin synthase-like isoform X1  72.8    3e-13   
ref|XP_002889222.1|  hypothetical protein ARALYDRAFT_316793           73.2    4e-13   
gb|AIK19225.1|  triterpene synthase                                   72.8    4e-13   
ref|XP_003521100.1|  PREDICTED: beta-amyrin synthase-like isoformX1   72.8    4e-13   
gb|ADX01169.1|  putative beta-amyrin synthase                         72.4    4e-13   
gb|KCW89781.1|  hypothetical protein EUGRSUZ_A02035                   72.4    4e-13   
gb|KEH25838.1|  beta-amyrin synthase                                  72.4    5e-13   
sp|Q9LRH8.1|BAMS_PEA  RecName: Full=Beta-amyrin synthase              72.4    5e-13   
ref|NP_683508.1|  camelliol C synthase 1                              72.4    5e-13   
ref|XP_010531942.1|  PREDICTED: beta-amyrin synthase-like             72.4    5e-13   
emb|CAB72151.1|  oxidosqualene cyclase-like protein                   72.4    5e-13   
ref|XP_004513125.1|  PREDICTED: lupeol synthase-like                  72.4    5e-13   
ref|XP_006425178.1|  hypothetical protein CICLE_v10027855mg           72.4    5e-13   
ref|NP_190099.3|  lanosterol synthase 1                               72.4    5e-13   
ref|XP_009344016.1|  PREDICTED: beta-amyrin synthase-like             72.4    5e-13   
ref|XP_004510379.1|  PREDICTED: mixed-amyrin synthase-like            72.4    5e-13   
ref|XP_002527335.1|  Cycloartenol synthase, putative                  72.4    5e-13   
gb|KEH28511.1|  beta-amyrin synthase                                  72.4    6e-13   
emb|CDY50938.1|  BnaC03g74380D                                        72.4    6e-13   
ref|XP_007023364.1|  Beta-Amyrin Synthase                             72.4    6e-13   
ref|XP_010537755.1|  PREDICTED: camelliol C synthase-like isoform X1  72.4    6e-13   
ref|XP_010245752.1|  PREDICTED: taraxerol synthase-like               72.4    6e-13   
gb|AAS83468.1|  beta-armyrin synthase                                 72.4    6e-13   
ref|XP_010655670.1|  PREDICTED: beta-amyrin synthase                  72.0    6e-13   
gb|KEH17471.1|  beta-amyrin synthase                                  72.0    6e-13   
ref|XP_006488602.1|  PREDICTED: beta-amyrin synthase-like             72.0    6e-13   
dbj|BAF35580.1|  multifunctional triterpene synthase                  72.0    6e-13   
sp|A8CDT3.1|LUPS_BRUGY  RecName: Full=Lupeol synthase; Short=BgLUS    72.0    7e-13   
gb|AIK21788.1|  dammarenediol-II synthase                             72.0    7e-13   
gb|AGI19258.1|  dammarenediol synthase                                72.0    7e-13   
gb|AED99865.1|  DS synthase                                           72.0    7e-13   
gb|AGS79229.1|  dammarenediol-II synthase                             72.0    7e-13   
ref|XP_002270051.2|  PREDICTED: beta-amyrin synthase                  72.0    7e-13   
ref|XP_010655672.1|  PREDICTED: beta-amyrin synthase isoform X2       72.0    7e-13   
ref|XP_002269395.2|  PREDICTED: beta-amyrin synthase isoform X1       72.0    7e-13   
gb|AGI15962.1|  dammarenediol synthase                                72.0    7e-13   
gb|KDO47538.1|  hypothetical protein CISIN_1g044313mg                 70.5    7e-13   
ref|XP_010054047.1|  PREDICTED: beta-amyrin synthase-like             72.0    7e-13   
gb|ADM89633.1|  beta-amyrin synthase                                  72.0    7e-13   
gb|KFK42272.1|  hypothetical protein AALP_AA2G234400                  72.0    7e-13   
gb|AGK62449.1|  dammarenediol-II synthase                             72.0    7e-13   
gb|AEO27862.1|  dammarenediol synthase                                72.0    7e-13   
gb|ACZ71036.1|  dammarenediol synthase protein                        72.0    7e-13   
gb|AED99864.1|  DS synthase                                           72.0    7e-13   
sp|Q08IT1.1|DADIS_PANGI  RecName: Full=Dammarenediol II synthase      72.0    8e-13   



>ref|XP_009798025.1| PREDICTED: cycloartenol synthase-like [Nicotiana sylvestris]
Length=385

 Score = 90.9 bits (224),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 42/53 (79%), Positives = 47/53 (89%), Gaps = 0/53 (0%)
 Frame = -1

Query  159  PLFLLHCLIIGLSVMGTINAILQEEHQKEILRYIYNHQNVDGGWGLHIEGHST  1
            PLFLL  L+I L +MG +NA+L EEHQKEILRY+YNHQNVDGGWGLHIEGHST
Sbjct  121  PLFLLPGLVICLYIMGVVNAVLSEEHQKEILRYLYNHQNVDGGWGLHIEGHST  173



>ref|XP_009618436.1| PREDICTED: cycloartenol synthase-like isoform X1 [Nicotiana tomentosiformis]
Length=762

 Score = 92.8 bits (229),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 42/53 (79%), Positives = 47/53 (89%), Gaps = 0/53 (0%)
 Frame = -1

Query  159  PLFLLHCLIIGLSVMGTINAILQEEHQKEILRYIYNHQNVDGGWGLHIEGHST  1
            PLFLL  L+I L +MG +NA+L EEHQKEILRY+YNHQNVDGGWGLHIEGHST
Sbjct  122  PLFLLPGLVISLYIMGVVNAVLSEEHQKEILRYLYNHQNVDGGWGLHIEGHST  174



>ref|XP_008809097.1| PREDICTED: cycloartenol synthase-like, partial [Phoenix dactylifera]
Length=195

 Score = 85.1 bits (209),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 39/53 (74%), Positives = 44/53 (83%), Gaps = 0/53 (0%)
 Frame = -1

Query  159  PLFLLHCLIIGLSVMGTINAILQEEHQKEILRYIYNHQNVDGGWGLHIEGHST  1
            PLFL+  LII LSV G +NA+L  EHQ+EI RY+YNHQN DGGWGLHIEGHST
Sbjct  121  PLFLMPGLIIVLSVTGALNAVLSPEHQREIRRYLYNHQNKDGGWGLHIEGHST  173



>gb|KDO62053.1| hypothetical protein CISIN_1g043885mg [Citrus sinensis]
Length=765

 Score = 88.2 bits (217),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 37/53 (70%), Positives = 45/53 (85%), Gaps = 0/53 (0%)
 Frame = -1

Query  159  PLFLLHCLIIGLSVMGTINAILQEEHQKEILRYIYNHQNVDGGWGLHIEGHST  1
            PLFLL CL+IGL + G +N ILQ E+++E+LRY+YNHQN DGGWGLHIEG ST
Sbjct  126  PLFLLPCLVIGLYITGDLNTILQVEYRREMLRYLYNHQNEDGGWGLHIEGEST  178



>ref|XP_006474650.1| PREDICTED: cycloartenol synthase 2-like [Citrus sinensis]
Length=765

 Score = 88.2 bits (217),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 37/53 (70%), Positives = 45/53 (85%), Gaps = 0/53 (0%)
 Frame = -1

Query  159  PLFLLHCLIIGLSVMGTINAILQEEHQKEILRYIYNHQNVDGGWGLHIEGHST  1
            PLFLL CL+IGL + G +N ILQ E+++E+LRY+YNHQN DGGWGLHIEG ST
Sbjct  126  PLFLLPCLVIGLYITGDLNTILQVEYRREMLRYLYNHQNEDGGWGLHIEGEST  178



>ref|XP_006453177.1| hypothetical protein CICLE_v10007530mg [Citrus clementina]
 gb|ESR66417.1| hypothetical protein CICLE_v10007530mg [Citrus clementina]
Length=767

 Score = 87.4 bits (215),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 37/53 (70%), Positives = 45/53 (85%), Gaps = 0/53 (0%)
 Frame = -1

Query  159  PLFLLHCLIIGLSVMGTINAILQEEHQKEILRYIYNHQNVDGGWGLHIEGHST  1
            PLFLL CL+IGL + G +N ILQ E+++E+LRY+YNHQN DGGWGLHIEG ST
Sbjct  126  PLFLLPCLVIGLYITGDLNTILQVEYRREMLRYLYNHQNEDGGWGLHIEGEST  178



>emb|CDP12483.1| unnamed protein product [Coffea canephora]
Length=761

 Score = 87.0 bits (214),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 40/53 (75%), Positives = 44/53 (83%), Gaps = 0/53 (0%)
 Frame = -1

Query  159  PLFLLHCLIIGLSVMGTINAILQEEHQKEILRYIYNHQNVDGGWGLHIEGHST  1
            PLFLL  LIIGL +MG IN +L EE QKEI RY+YNHQN DGGWG+HIEGHST
Sbjct  124  PLFLLPGLIIGLYIMGAINTVLSEEQQKEIRRYLYNHQNEDGGWGIHIEGHST  176



>ref|XP_011078187.1| PREDICTED: cycloartenol synthase-like isoform X2 [Sesamum indicum]
Length=756

 Score = 87.0 bits (214),  Expect = 4e-18, Method: Composition-based stats.
 Identities = 39/53 (74%), Positives = 44/53 (83%), Gaps = 0/53 (0%)
 Frame = -1

Query  159  PLFLLHCLIIGLSVMGTINAILQEEHQKEILRYIYNHQNVDGGWGLHIEGHST  1
            PLFLL  LII LS+M ++N IL EEHQKEI RY+YNHQN DGGWGLHIEG S+
Sbjct  121  PLFLLPGLIIALSIMDSLNTILPEEHQKEIRRYLYNHQNPDGGWGLHIEGRSS  173



>ref|XP_011078186.1| PREDICTED: cycloartenol synthase-like isoform X1 [Sesamum indicum]
Length=757

 Score = 87.0 bits (214),  Expect = 4e-18, Method: Composition-based stats.
 Identities = 39/53 (74%), Positives = 44/53 (83%), Gaps = 0/53 (0%)
 Frame = -1

Query  159  PLFLLHCLIIGLSVMGTINAILQEEHQKEILRYIYNHQNVDGGWGLHIEGHST  1
            PLFLL  LII LS+M ++N IL EEHQKEI RY+YNHQN DGGWGLHIEG S+
Sbjct  121  PLFLLPGLIIALSIMDSLNTILPEEHQKEIRRYLYNHQNPDGGWGLHIEGRSS  173



>ref|XP_007014713.1| Beta-Amyrin Synthase isoform 2 [Theobroma cacao]
 gb|EOY32332.1| Beta-Amyrin Synthase isoform 2 [Theobroma cacao]
Length=685

 Score = 85.9 bits (211),  Expect = 9e-18, Method: Composition-based stats.
 Identities = 38/53 (72%), Positives = 42/53 (79%), Gaps = 0/53 (0%)
 Frame = -1

Query  159  PLFLLHCLIIGLSVMGTINAILQEEHQKEILRYIYNHQNVDGGWGLHIEGHST  1
            PLF L  L++ L V G +N IL  EHQKEI+RYIYNHQN DGGWGLHIEGHST
Sbjct  120  PLFFLPPLVMALYVTGGLNTILSPEHQKEIIRYIYNHQNEDGGWGLHIEGHST  172



>ref|XP_007014712.1| Beta-Amyrin Synthase isoform 1 [Theobroma cacao]
 gb|EOY32331.1| Beta-Amyrin Synthase isoform 1 [Theobroma cacao]
Length=755

 Score = 85.9 bits (211),  Expect = 9e-18, Method: Composition-based stats.
 Identities = 38/53 (72%), Positives = 42/53 (79%), Gaps = 0/53 (0%)
 Frame = -1

Query  159  PLFLLHCLIIGLSVMGTINAILQEEHQKEILRYIYNHQNVDGGWGLHIEGHST  1
            PLF L  L++ L V G +N IL  EHQKEI+RYIYNHQN DGGWGLHIEGHST
Sbjct  120  PLFFLPPLVMALYVTGGLNTILSPEHQKEIIRYIYNHQNEDGGWGLHIEGHST  172



>ref|XP_006360676.1| PREDICTED: cycloartenol synthase-like [Solanum tuberosum]
Length=759

 Score = 85.9 bits (211),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 39/53 (74%), Positives = 44/53 (83%), Gaps = 0/53 (0%)
 Frame = -1

Query  159  PLFLLHCLIIGLSVMGTINAILQEEHQKEILRYIYNHQNVDGGWGLHIEGHST  1
            PLFLL  L+I L +M  +N +L EEHQKEILRY+YNHQN DGGWGLHIEGHST
Sbjct  116  PLFLLPGLVISLFIMRAVNVVLSEEHQKEILRYLYNHQNKDGGWGLHIEGHST  168



>dbj|BAF73929.1| cycloartenol synthase [Rhizophora stylosa]
Length=758

 Score = 85.5 bits (210),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 37/53 (70%), Positives = 43/53 (81%), Gaps = 0/53 (0%)
 Frame = -1

Query  159  PLFLLHCLIIGLSVMGTINAILQEEHQKEILRYIYNHQNVDGGWGLHIEGHST  1
            P+FL+  L+I LSV G +NAIL  EHQ+EI RY+YNHQN DGGWGLHIEG ST
Sbjct  122  PMFLMPGLVIALSVTGALNAILSREHQREICRYLYNHQNEDGGWGLHIEGPST  174



>ref|XP_004240118.1| PREDICTED: cycloartenol synthase-like [Solanum lycopersicum]
Length=758

 Score = 85.5 bits (210),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 39/53 (74%), Positives = 44/53 (83%), Gaps = 0/53 (0%)
 Frame = -1

Query  159  PLFLLHCLIIGLSVMGTINAILQEEHQKEILRYIYNHQNVDGGWGLHIEGHST  1
            PLFLL  L+I L +M  +N +L EEHQKEILRY+YNHQN DGGWGLHIEGHST
Sbjct  116  PLFLLPGLVISLFIMEAMNVVLSEEHQKEILRYLYNHQNKDGGWGLHIEGHST  168



>ref|XP_006340479.1| PREDICTED: cycloartenol Synthase-like [Solanum tuberosum]
Length=757

 Score = 85.5 bits (210),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 37/53 (70%), Positives = 44/53 (83%), Gaps = 0/53 (0%)
 Frame = -1

Query  159  PLFLLHCLIIGLSVMGTINAILQEEHQKEILRYIYNHQNVDGGWGLHIEGHST  1
            P+FLL  L+I LSV G +NA+L EEH++EI RY+YNHQN DGGWGLHIE HST
Sbjct  121  PMFLLPGLVIALSVTGALNAVLSEEHKREICRYLYNHQNCDGGWGLHIESHST  173



>ref|XP_004308480.1| PREDICTED: lupeol synthase-like [Fragaria vesca subsp. vesca]
Length=769

 Score = 85.5 bits (210),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 37/53 (70%), Positives = 42/53 (79%), Gaps = 0/53 (0%)
 Frame = -1

Query  159  PLFLLHCLIIGLSVMGTINAILQEEHQKEILRYIYNHQNVDGGWGLHIEGHST  1
            PLF +  L+I L V G + A+L  EHQKEI+RYIYNHQN DGGWGLHIEGHST
Sbjct  120  PLFFIQPLVIALYVTGALCAVLGPEHQKEIIRYIYNHQNEDGGWGLHIEGHST  172



>gb|KDO60880.1| hypothetical protein CISIN_1g048279mg, partial [Citrus sinensis]
Length=202

 Score = 81.6 bits (200),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 35/53 (66%), Positives = 44/53 (83%), Gaps = 0/53 (0%)
 Frame = -1

Query  159  PLFLLHCLIIGLSVMGTINAILQEEHQKEILRYIYNHQNVDGGWGLHIEGHST  1
            P+FL+  L+I LS+ G +NA+L EEH+KE+ RY+YNHQN DGGWGLHIEG ST
Sbjct  55   PMFLMPGLVITLSITGALNAVLSEEHKKEMCRYVYNHQNRDGGWGLHIEGPST  107



>gb|ADC84219.1| putative 2,3 oxidosqualene cyclase [Actaea racemosa]
 gb|ADC84220.1| putative 2,3 oxidosqualene cyclase [Actaea racemosa]
Length=757

 Score = 85.1 bits (209),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 37/53 (70%), Positives = 42/53 (79%), Gaps = 0/53 (0%)
 Frame = -1

Query  159  PLFLLHCLIIGLSVMGTINAILQEEHQKEILRYIYNHQNVDGGWGLHIEGHST  1
            PLFL+  L+I LSV G +NA+L  EHQ+E  RYIYNHQN DGGWGLHIEG ST
Sbjct  121  PLFLMPGLVIALSVTGALNAVLSSEHQRETRRYIYNHQNEDGGWGLHIEGSST  173



>ref|XP_011078188.1| PREDICTED: cycloartenol synthase-like isoform X3 [Sesamum indicum]
Length=657

 Score = 84.7 bits (208),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 39/53 (74%), Positives = 44/53 (83%), Gaps = 0/53 (0%)
 Frame = -1

Query  159  PLFLLHCLIIGLSVMGTINAILQEEHQKEILRYIYNHQNVDGGWGLHIEGHST  1
            PLFLL  LII LS+M ++N IL EEHQKEI RY+YNHQN DGGWGLHIEG S+
Sbjct  21   PLFLLPGLIIALSIMDSLNTILPEEHQKEIRRYLYNHQNPDGGWGLHIEGRSS  73



>gb|KGN45402.1| hypothetical protein Csa_7G447170 [Cucumis sativus]
Length=558

 Score = 84.0 bits (206),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 36/53 (68%), Positives = 43/53 (81%), Gaps = 0/53 (0%)
 Frame = -1

Query  159  PLFLLHCLIIGLSVMGTINAILQEEHQKEILRYIYNHQNVDGGWGLHIEGHST  1
            P+FLL  L+I LS+ G +NA+L  EHQ+EI RY+YNHQN DGGWGLHIEG ST
Sbjct  129  PMFLLPGLVITLSITGALNAVLSTEHQREICRYLYNHQNRDGGWGLHIEGPST  181



>ref|XP_006474342.1| PREDICTED: lanosterol synthase-like [Citrus sinensis]
Length=260

 Score = 81.6 bits (200),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 36/53 (68%), Positives = 44/53 (83%), Gaps = 0/53 (0%)
 Frame = -1

Query  159  PLFLLHCLIIGLSVMGTINAILQEEHQKEILRYIYNHQNVDGGWGLHIEGHST  1
            PLFLL  L++GL V G +NAIL  EH++E++RY+YNHQN DGGWGLHIEG ST
Sbjct  126  PLFLLPGLVMGLFVTGALNAILTVEHRREMIRYLYNHQNRDGGWGLHIEGCST  178



>emb|CAN60556.1| hypothetical protein VITISV_020304 [Vitis vinifera]
Length=758

 Score = 84.3 bits (207),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 35/53 (66%), Positives = 43/53 (81%), Gaps = 0/53 (0%)
 Frame = -1

Query  159  PLFLLHCLIIGLSVMGTINAILQEEHQKEILRYIYNHQNVDGGWGLHIEGHST  1
            PLF L  L+I L ++G +NA+L  +HQKEI+RYIYNHQN DGGWG+HI GHST
Sbjct  121  PLFFLPPLVIALYIIGAVNAVLSLQHQKEIIRYIYNHQNEDGGWGIHIAGHST  173



>ref|XP_010669609.1| PREDICTED: lupeol synthase-like [Beta vulgaris subsp. vulgaris]
Length=762

 Score = 84.3 bits (207),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 37/53 (70%), Positives = 40/53 (75%), Gaps = 0/53 (0%)
 Frame = -1

Query  159  PLFLLHCLIIGLSVMGTINAILQEEHQKEILRYIYNHQNVDGGWGLHIEGHST  1
            PLF L  L+I L + G  N IL  +HQKEI RYIYNHQN DGGWGLHIEGHST
Sbjct  121  PLFFLPPLVIALHITGATNTILSPQHQKEIKRYIYNHQNEDGGWGLHIEGHST  173



>ref|XP_008809074.1| PREDICTED: cycloartenol synthase-like isoform X2 [Phoenix dactylifera]
Length=628

 Score = 84.0 bits (206),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 38/53 (72%), Positives = 44/53 (83%), Gaps = 0/53 (0%)
 Frame = -1

Query  159  PLFLLHCLIIGLSVMGTINAILQEEHQKEILRYIYNHQNVDGGWGLHIEGHST  1
            P+FL+  LII LSV G +NA+L  EHQ+EI RY+YNHQN DGGWGLHIEGHST
Sbjct  13   PMFLMPGLIIVLSVTGALNAVLSPEHQREIRRYLYNHQNKDGGWGLHIEGHST  65



>dbj|BAA33462.1| Oxidosqualene Cyclase [Panax ginseng]
Length=780

 Score = 84.3 bits (207),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 39/53 (74%), Positives = 45/53 (85%), Gaps = 0/53 (0%)
 Frame = -1

Query  159  PLFLLHCLIIGLSVMGTINAILQEEHQKEILRYIYNHQNVDGGWGLHIEGHST  1
            PLFLL  L+IGL VMG ++ IL +EHQ+E+ RYIYNHQNVDGGWGLHIEG ST
Sbjct  126  PLFLLPGLVIGLYVMGVMDTILAKEHQREMCRYIYNHQNVDGGWGLHIEGCST  178



>ref|XP_008348400.1| PREDICTED: LOW QUALITY PROTEIN: cycloartenol synthase-like [Malus 
domestica]
Length=763

 Score = 84.3 bits (207),  Expect = 4e-17, Method: Composition-based stats.
 Identities = 36/53 (68%), Positives = 44/53 (83%), Gaps = 0/53 (0%)
 Frame = -1

Query  159  PLFLLHCLIIGLSVMGTINAILQEEHQKEILRYIYNHQNVDGGWGLHIEGHST  1
            P+FLL  LII LS+ G +NA+L +EHQ+E+ RY+YNHQN DGGWGLHIEG ST
Sbjct  127  PMFLLPGLIITLSITGALNAVLSKEHQREMCRYLYNHQNEDGGWGLHIEGPST  179



>ref|XP_008655663.1| PREDICTED: cycloartenol synthase-like isoform X2 [Zea mays]
Length=767

 Score = 84.3 bits (207),  Expect = 4e-17, Method: Composition-based stats.
 Identities = 37/52 (71%), Positives = 42/52 (81%), Gaps = 0/52 (0%)
 Frame = -1

Query  159  PLFLLHCLIIGLSVMGTINAILQEEHQKEILRYIYNHQNVDGGWGLHIEGHS  4
            PLFLL  LII L V G +NA+L  EHQ+EI RY+YNHQN DGGWGLH+EGHS
Sbjct  126  PLFLLPGLIITLYVTGALNAVLSSEHQREIRRYLYNHQNEDGGWGLHMEGHS  177



>ref|XP_008655662.1| PREDICTED: cycloartenol synthase-like isoform X1 [Zea mays]
Length=768

 Score = 84.3 bits (207),  Expect = 4e-17, Method: Composition-based stats.
 Identities = 37/52 (71%), Positives = 42/52 (81%), Gaps = 0/52 (0%)
 Frame = -1

Query  159  PLFLLHCLIIGLSVMGTINAILQEEHQKEILRYIYNHQNVDGGWGLHIEGHS  4
            PLFLL  LII L V G +NA+L  EHQ+EI RY+YNHQN DGGWGLH+EGHS
Sbjct  127  PLFLLPGLIITLYVTGALNAVLSSEHQREIRRYLYNHQNEDGGWGLHMEGHS  178



>gb|AFW80117.1| hypothetical protein ZEAMMB73_095189, partial [Zea mays]
Length=762

 Score = 84.3 bits (207),  Expect = 4e-17, Method: Composition-based stats.
 Identities = 37/52 (71%), Positives = 42/52 (81%), Gaps = 0/52 (0%)
 Frame = -1

Query  159  PLFLLHCLIIGLSVMGTINAILQEEHQKEILRYIYNHQNVDGGWGLHIEGHS  4
            PLFLL  LII L V G +NA+L  EHQ+EI RY+YNHQN DGGWGLH+EGHS
Sbjct  127  PLFLLPGLIITLYVTGALNAVLSSEHQREIRRYLYNHQNEDGGWGLHMEGHS  178



>ref|XP_011017592.1| PREDICTED: LOW QUALITY PROTEIN: cycloartenol synthase-like [Populus 
euphratica]
Length=756

 Score = 84.3 bits (207),  Expect = 4e-17, Method: Composition-based stats.
 Identities = 35/53 (66%), Positives = 45/53 (85%), Gaps = 0/53 (0%)
 Frame = -1

Query  159  PLFLLHCLIIGLSVMGTINAILQEEHQKEILRYIYNHQNVDGGWGLHIEGHST  1
            P+FLL  L+I LS+ G +NA+L +EH+KE++RY+YNHQN DGGWGLHIEG ST
Sbjct  122  PMFLLPGLVITLSITGALNAVLSDEHKKEMIRYLYNHQNRDGGWGLHIEGPST  174



>ref|XP_009618437.1| PREDICTED: cycloartenol synthase 2-like isoform X2 [Nicotiana 
tomentosiformis]
Length=641

 Score = 84.0 bits (206),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 36/46 (78%), Positives = 42/46 (91%), Gaps = 0/46 (0%)
 Frame = -1

Query  138  LIIGLSVMGTINAILQEEHQKEILRYIYNHQNVDGGWGLHIEGHST  1
            ++I L +MG +NA+L EEHQKEILRY+YNHQNVDGGWGLHIEGHST
Sbjct  8    MVISLYIMGVVNAVLSEEHQKEILRYLYNHQNVDGGWGLHIEGHST  53



>ref|XP_006372242.1| cycloartenol synthase family protein [Populus trichocarpa]
 gb|ERP50039.1| cycloartenol synthase family protein [Populus trichocarpa]
Length=760

 Score = 84.0 bits (206),  Expect = 4e-17, Method: Composition-based stats.
 Identities = 35/53 (66%), Positives = 45/53 (85%), Gaps = 0/53 (0%)
 Frame = -1

Query  159  PLFLLHCLIIGLSVMGTINAILQEEHQKEILRYIYNHQNVDGGWGLHIEGHST  1
            P+FLL  L+I LS+ G +NA+L +EH+KE++RY+YNHQN DGGWGLHIEG ST
Sbjct  122  PMFLLPGLVITLSITGALNAVLSDEHKKEMIRYLYNHQNRDGGWGLHIEGPST  174



>ref|XP_008796948.1| PREDICTED: cycloartenol synthase-like [Phoenix dactylifera]
Length=569

 Score = 83.6 bits (205),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 38/53 (72%), Positives = 44/53 (83%), Gaps = 0/53 (0%)
 Frame = -1

Query  159  PLFLLHCLIIGLSVMGTINAILQEEHQKEILRYIYNHQNVDGGWGLHIEGHST  1
            P+FL+  LII LSV G +NA+L  EHQ+EI RY+YNHQN DGGWGLHIEGHST
Sbjct  121  PMFLMPGLIIVLSVSGALNAVLSPEHQREIRRYLYNHQNKDGGWGLHIEGHST  173



>ref|XP_008223939.1| PREDICTED: LOW QUALITY PROTEIN: cycloartenol Synthase-like [Prunus 
mume]
Length=742

 Score = 84.0 bits (206),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 39/53 (74%), Positives = 45/53 (85%), Gaps = 0/53 (0%)
 Frame = -1

Query  159  PLFLLHCLIIGLSVMGTINAILQEEHQKEILRYIYNHQNVDGGWGLHIEGHST  1
            PLFLL  L+IGLSV G ++AIL  EHQ+EI RY+YNHQN+DGGWGLHIEG ST
Sbjct  124  PLFLLPGLVIGLSVTGALHAILPHEHQQEIWRYLYNHQNIDGGWGLHIEGPST  176



>ref|XP_004159000.1| PREDICTED: cycloartenol synthase-like [Cucumis sativus]
Length=765

 Score = 84.0 bits (206),  Expect = 5e-17, Method: Composition-based stats.
 Identities = 36/53 (68%), Positives = 43/53 (81%), Gaps = 0/53 (0%)
 Frame = -1

Query  159  PLFLLHCLIIGLSVMGTINAILQEEHQKEILRYIYNHQNVDGGWGLHIEGHST  1
            P+FLL  L+I LS+ G +NA+L  EHQ+EI RY+YNHQN DGGWGLHIEG ST
Sbjct  129  PMFLLPGLVITLSITGALNAVLSTEHQREICRYLYNHQNRDGGWGLHIEGPST  181



>ref|XP_004141754.1| PREDICTED: cycloartenol synthase-like [Cucumis sativus]
Length=765

 Score = 84.0 bits (206),  Expect = 5e-17, Method: Composition-based stats.
 Identities = 36/53 (68%), Positives = 43/53 (81%), Gaps = 0/53 (0%)
 Frame = -1

Query  159  PLFLLHCLIIGLSVMGTINAILQEEHQKEILRYIYNHQNVDGGWGLHIEGHST  1
            P+FLL  L+I LS+ G +NA+L  EHQ+EI RY+YNHQN DGGWGLHIEG ST
Sbjct  129  PMFLLPGLVITLSITGALNAVLSTEHQREICRYLYNHQNRDGGWGLHIEGPST  181



>ref|XP_010263443.1| PREDICTED: uncharacterized protein LOC104601708 [Nelumbo nucifera]
Length=609

 Score = 83.6 bits (205),  Expect = 5e-17, Method: Composition-based stats.
 Identities = 35/53 (66%), Positives = 43/53 (81%), Gaps = 0/53 (0%)
 Frame = -1

Query  159  PLFLLHCLIIGLSVMGTINAILQEEHQKEILRYIYNHQNVDGGWGLHIEGHST  1
            P+FLL  LII L + G +NA+L +EHQ+E+ RY+YNHQN DGGWGLHIEG ST
Sbjct  351  PMFLLPGLIITLYITGALNAVLSKEHQREMCRYLYNHQNEDGGWGLHIEGPST  403



>dbj|BAF93208.1| cycloartenol synthase [Adiantum capillus-veneris]
Length=758

 Score = 84.0 bits (206),  Expect = 5e-17, Method: Composition-based stats.
 Identities = 34/53 (64%), Positives = 44/53 (83%), Gaps = 0/53 (0%)
 Frame = -1

Query  159  PLFLLHCLIIGLSVMGTINAILQEEHQKEILRYIYNHQNVDGGWGLHIEGHST  1
            P+FL+  L+I L V G++N +L E H+KE++RY+YNHQN DGGWGLHIEGHST
Sbjct  123  PMFLMPGLVIALYVTGSLNVVLSEAHKKEMVRYLYNHQNKDGGWGLHIEGHST  175



>ref|XP_006437236.1| hypothetical protein CICLE_v10032410mg [Citrus clementina]
 gb|ESR50476.1| hypothetical protein CICLE_v10032410mg [Citrus clementina]
Length=269

 Score = 80.9 bits (198),  Expect = 5e-17, Method: Composition-based stats.
 Identities = 36/53 (68%), Positives = 44/53 (83%), Gaps = 0/53 (0%)
 Frame = -1

Query  159  PLFLLHCLIIGLSVMGTINAILQEEHQKEILRYIYNHQNVDGGWGLHIEGHST  1
            P+FL+  L+I LS+ G +NA+L EEH+KE+ RYIYNHQN DGGWGLHIEG ST
Sbjct  121  PMFLMPGLVITLSITGALNAVLLEEHKKEMCRYIYNHQNRDGGWGLHIEGPST  173



>ref|XP_008462186.1| PREDICTED: cycloartenol synthase [Cucumis melo]
Length=765

 Score = 83.6 bits (205),  Expect = 6e-17, Method: Composition-based stats.
 Identities = 36/53 (68%), Positives = 43/53 (81%), Gaps = 0/53 (0%)
 Frame = -1

Query  159  PLFLLHCLIIGLSVMGTINAILQEEHQKEILRYIYNHQNVDGGWGLHIEGHST  1
            P+FLL  L+I LS+ G +NA+L  EHQ+EI RY+YNHQN DGGWGLHIEG ST
Sbjct  129  PMFLLPGLVITLSITGALNAVLSTEHQREICRYLYNHQNRDGGWGLHIEGPST  181



>emb|CDP10846.1| unnamed protein product [Coffea canephora]
Length=326

 Score = 81.3 bits (199),  Expect = 6e-17, Method: Composition-based stats.
 Identities = 34/53 (64%), Positives = 41/53 (77%), Gaps = 0/53 (0%)
 Frame = -1

Query  159  PLFLLHCLIIGLSVMGTINAILQEEHQKEILRYIYNHQNVDGGWGLHIEGHST  1
            PLF    L++GL + G +N +L  EHQKEI+RY+YNHQN DGGWGL IEGHST
Sbjct  122  PLFFSPPLVMGLYITGALNTVLSPEHQKEIVRYLYNHQNEDGGWGLQIEGHST  174



>ref|XP_009379198.1| PREDICTED: cycloartenol synthase-like [Pyrus x bretschneideri]
Length=768

 Score = 83.6 bits (205),  Expect = 6e-17, Method: Composition-based stats.
 Identities = 35/53 (66%), Positives = 44/53 (83%), Gaps = 0/53 (0%)
 Frame = -1

Query  159  PLFLLHCLIIGLSVMGTINAILQEEHQKEILRYIYNHQNVDGGWGLHIEGHST  1
            P+FLL  L+I LS+ G +NA+L +EHQ+E+ RY+YNHQN DGGWGLHIEG ST
Sbjct  127  PMFLLPGLVITLSITGALNAVLSKEHQREMCRYLYNHQNEDGGWGLHIEGPST  179



>gb|EYU25764.1| hypothetical protein MIMGU_mgv1a024154mg [Erythranthe guttata]
Length=760

 Score = 83.6 bits (205),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 36/53 (68%), Positives = 43/53 (81%), Gaps = 0/53 (0%)
 Frame = -1

Query  159  PLFLLHCLIIGLSVMGTINAILQEEHQKEILRYIYNHQNVDGGWGLHIEGHST  1
            PLF L  L++ L + G INA+L  EH+KEI+RYIYNHQN DGGWG+HIEGHST
Sbjct  125  PLFFLPPLVLALYITGAINAVLSPEHRKEIIRYIYNHQNEDGGWGIHIEGHST  177



>gb|EEE56272.1| hypothetical protein OsJ_05323 [Oryza sativa Japonica Group]
Length=744

 Score = 83.6 bits (205),  Expect = 6e-17, Method: Composition-based stats.
 Identities = 37/53 (70%), Positives = 41/53 (77%), Gaps = 0/53 (0%)
 Frame = -1

Query  159  PLFLLHCLIIGLSVMGTINAILQEEHQKEILRYIYNHQNVDGGWGLHIEGHST  1
            P+FL+  LII L V G +N  L  EHQKEI RY+YNHQN DGGWGLHIEGHST
Sbjct  96   PMFLMPGLIITLYVSGALNTALSSEHQKEIRRYLYNHQNEDGGWGLHIEGHST  148



>gb|AIY33888.1| cycloartenol synthase [Nicotiana tabacum]
Length=757

 Score = 83.6 bits (205),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 34/53 (64%), Positives = 45/53 (85%), Gaps = 0/53 (0%)
 Frame = -1

Query  159  PLFLLHCLIIGLSVMGTINAILQEEHQKEILRYIYNHQNVDGGWGLHIEGHST  1
            P+FL+  ++I LSV G +NA+L  EH++E++RY+YNHQN DGGWGLHIEGHST
Sbjct  121  PMFLMPGMVIALSVTGALNAVLTSEHKREMIRYLYNHQNSDGGWGLHIEGHST  173



>ref|XP_009620777.1| PREDICTED: cycloartenol Synthase-like isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009620778.1| PREDICTED: cycloartenol Synthase-like isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009620779.1| PREDICTED: cycloartenol Synthase-like isoform X2 [Nicotiana tomentosiformis]
Length=757

 Score = 83.6 bits (205),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 34/53 (64%), Positives = 45/53 (85%), Gaps = 0/53 (0%)
 Frame = -1

Query  159  PLFLLHCLIIGLSVMGTINAILQEEHQKEILRYIYNHQNVDGGWGLHIEGHST  1
            P+FL+  ++I LSV G +NA+L  EH++E++RY+YNHQN DGGWGLHIEGHST
Sbjct  121  PMFLMPGMVIALSVTGALNAVLTSEHKREMIRYLYNHQNSDGGWGLHIEGHST  173



>ref|XP_010927166.1| PREDICTED: cycloartenol synthase-like isoform X3 [Elaeis guineensis]
Length=799

 Score = 83.6 bits (205),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 35/53 (66%), Positives = 44/53 (83%), Gaps = 0/53 (0%)
 Frame = -1

Query  159  PLFLLHCLIIGLSVMGTINAILQEEHQKEILRYIYNHQNVDGGWGLHIEGHST  1
            P+FL+  LII LS++G +N +L  EH++EI RY+YNHQN DGGWGLHIEGHST
Sbjct  173  PMFLMPILIIALSIIGALNTVLSPEHKREIRRYLYNHQNKDGGWGLHIEGHST  225



>ref|XP_010656689.1| PREDICTED: lupeol synthase isoform X2 [Vitis vinifera]
Length=754

 Score = 83.6 bits (205),  Expect = 7e-17, Method: Composition-based stats.
 Identities = 34/53 (64%), Positives = 43/53 (81%), Gaps = 0/53 (0%)
 Frame = -1

Query  159  PLFLLHCLIIGLSVMGTINAILQEEHQKEILRYIYNHQNVDGGWGLHIEGHST  1
            PLF L  L++ L ++G +NA+L  +HQKEI+RYIYNHQN DGGWG+HI GHST
Sbjct  121  PLFFLPPLVLALYIIGAVNAVLSLQHQKEIIRYIYNHQNEDGGWGIHIAGHST  173



>gb|AAF03375.1|AF169966_1 putative cycloartenol synthase [Oryza sativa]
Length=757

 Score = 83.6 bits (205),  Expect = 7e-17, Method: Composition-based stats.
 Identities = 37/53 (70%), Positives = 41/53 (77%), Gaps = 0/53 (0%)
 Frame = -1

Query  159  PLFLLHCLIIGLSVMGTINAILQEEHQKEILRYIYNHQNVDGGWGLHIEGHST  1
            P+FL+  LII L V G +N  L  EHQKEI RY+YNHQN DGGWGLHIEGHST
Sbjct  120  PMFLMPGLIITLYVSGALNTALSSEHQKEIRRYLYNHQNEDGGWGLHIEGHST  172



>ref|XP_004305793.1| PREDICTED: beta-amyrin synthase-like [Fragaria vesca subsp. vesca]
Length=769

 Score = 83.6 bits (205),  Expect = 7e-17, Method: Composition-based stats.
 Identities = 35/53 (66%), Positives = 43/53 (81%), Gaps = 0/53 (0%)
 Frame = -1

Query  159  PLFLLHCLIIGLSVMGTINAILQEEHQKEILRYIYNHQNVDGGWGLHIEGHST  1
            PLF L  L+IGL + G ++++  EEH+KEILRYIY HQN DGGWGLH+EGHST
Sbjct  123  PLFFLPPLVIGLYITGHLDSVFHEEHRKEILRYIYYHQNEDGGWGLHVEGHST  175



>ref|XP_009764154.1| PREDICTED: cycloartenol Synthase-like [Nicotiana sylvestris]
 ref|XP_009764155.1| PREDICTED: cycloartenol Synthase-like [Nicotiana sylvestris]
Length=699

 Score = 83.2 bits (204),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 34/53 (64%), Positives = 45/53 (85%), Gaps = 0/53 (0%)
 Frame = -1

Query  159  PLFLLHCLIIGLSVMGTINAILQEEHQKEILRYIYNHQNVDGGWGLHIEGHST  1
            P+FL+  ++I LSV G +NA+L  EH++E++RY+YNHQN DGGWGLHIEGHST
Sbjct  121  PMFLMPGMVIALSVTGALNAVLTSEHKREMIRYLYNHQNSDGGWGLHIEGHST  173



>ref|NP_001045848.1| Os02g0139700 [Oryza sativa Japonica Group]
 sp|Q6Z2X6.1|CAS_ORYSJ RecName: Full=Cycloartenol synthase [Oryza sativa Japonica Group]
 dbj|BAD10254.1| putative cycloartenol synthase [Oryza sativa Japonica Group]
 dbj|BAF07762.1| Os02g0139700 [Oryza sativa Japonica Group]
 dbj|BAH00370.1| unnamed protein product [Oryza sativa Japonica Group]
Length=759

 Score = 83.2 bits (204),  Expect = 8e-17, Method: Composition-based stats.
 Identities = 37/53 (70%), Positives = 41/53 (77%), Gaps = 0/53 (0%)
 Frame = -1

Query  159  PLFLLHCLIIGLSVMGTINAILQEEHQKEILRYIYNHQNVDGGWGLHIEGHST  1
            P+FL+  LII L V G +N  L  EHQKEI RY+YNHQN DGGWGLHIEGHST
Sbjct  122  PMFLMPGLIITLYVSGALNTALSSEHQKEIRRYLYNHQNEDGGWGLHIEGHST  174



>ref|XP_010927164.1| PREDICTED: cycloartenol Synthase-like isoform X2 [Elaeis guineensis]
Length=811

 Score = 83.6 bits (205),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 35/53 (66%), Positives = 44/53 (83%), Gaps = 0/53 (0%)
 Frame = -1

Query  159  PLFLLHCLIIGLSVMGTINAILQEEHQKEILRYIYNHQNVDGGWGLHIEGHST  1
            P+FL+  LII LS++G +N +L  EH++EI RY+YNHQN DGGWGLHIEGHST
Sbjct  173  PMFLMPILIIALSIIGALNTVLSPEHKREIRRYLYNHQNKDGGWGLHIEGHST  225



>gb|EEC72452.1| hypothetical protein OsI_05794 [Oryza sativa Indica Group]
Length=767

 Score = 83.2 bits (204),  Expect = 8e-17, Method: Composition-based stats.
 Identities = 37/53 (70%), Positives = 41/53 (77%), Gaps = 0/53 (0%)
 Frame = -1

Query  159  PLFLLHCLIIGLSVMGTINAILQEEHQKEILRYIYNHQNVDGGWGLHIEGHST  1
            P+FL+  LII L V G +N  L  EHQKEI RY+YNHQN DGGWGLHIEGHST
Sbjct  119  PMFLMPGLIITLYVSGALNTALSSEHQKEIRRYLYNHQNEDGGWGLHIEGHST  171



>ref|XP_010927163.1| PREDICTED: cycloartenol synthase-like isoform X1 [Elaeis guineensis]
Length=813

 Score = 83.2 bits (204),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 35/53 (66%), Positives = 44/53 (83%), Gaps = 0/53 (0%)
 Frame = -1

Query  159  PLFLLHCLIIGLSVMGTINAILQEEHQKEILRYIYNHQNVDGGWGLHIEGHST  1
            P+FL+  LII LS++G +N +L  EH++EI RY+YNHQN DGGWGLHIEGHST
Sbjct  173  PMFLMPILIIALSIIGALNTVLSPEHKREIRRYLYNHQNKDGGWGLHIEGHST  225



>ref|XP_009362029.1| PREDICTED: cycloartenol synthase 2-like [Pyrus x bretschneideri]
 ref|XP_009362030.1| PREDICTED: cycloartenol synthase 2-like [Pyrus x bretschneideri]
Length=756

 Score = 83.2 bits (204),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 36/53 (68%), Positives = 44/53 (83%), Gaps = 0/53 (0%)
 Frame = -1

Query  159  PLFLLHCLIIGLSVMGTINAILQEEHQKEILRYIYNHQNVDGGWGLHIEGHST  1
            P+FLL  L+I LS+ G +NA+L +EH+KEI RY+YNHQN DGGWGLHIEG ST
Sbjct  121  PMFLLPGLVIALSITGALNAVLSDEHKKEICRYLYNHQNKDGGWGLHIEGPST  173



>gb|AFC67276.1| cycloartenol synthase [Eleutherococcus senticosus]
Length=758

 Score = 83.2 bits (204),  Expect = 9e-17, Method: Composition-based stats.
 Identities = 34/53 (64%), Positives = 44/53 (83%), Gaps = 0/53 (0%)
 Frame = -1

Query  159  PLFLLHCLIIGLSVMGTINAILQEEHQKEILRYIYNHQNVDGGWGLHIEGHST  1
            P+FL+  L+I LS+ G +NA+L +EH++EI RY+YNHQN DGGWGLHIEG ST
Sbjct  121  PMFLMPGLVITLSITGALNAVLSKEHKREICRYLYNHQNRDGGWGLHIEGPST  173



>ref|XP_008391430.1| PREDICTED: cycloartenol synthase 2 isoform X1 [Malus domestica]
Length=756

 Score = 83.2 bits (204),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 36/53 (68%), Positives = 44/53 (83%), Gaps = 0/53 (0%)
 Frame = -1

Query  159  PLFLLHCLIIGLSVMGTINAILQEEHQKEILRYIYNHQNVDGGWGLHIEGHST  1
            P+FLL  L+I LS+ G +NA+L +EH+KEI RY+YNHQN DGGWGLHIEG ST
Sbjct  121  PMFLLPGLVIALSITGALNAVLSDEHKKEICRYLYNHQNKDGGWGLHIEGPST  173



>ref|XP_007160210.1| hypothetical protein PHAVU_002G302200g, partial [Phaseolus vulgaris]
 gb|ESW32204.1| hypothetical protein PHAVU_002G302200g, partial [Phaseolus vulgaris]
Length=751

 Score = 83.2 bits (204),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 35/53 (66%), Positives = 44/53 (83%), Gaps = 0/53 (0%)
 Frame = -1

Query  159  PLFLLHCLIIGLSVMGTINAILQEEHQKEILRYIYNHQNVDGGWGLHIEGHST  1
            PLF +  L++ L + G++NA+L  EHQKEI+RY+YNHQN DGGWGLHIEGHST
Sbjct  120  PLFFIQPLVMALYITGSLNAVLGPEHQKEIIRYLYNHQNKDGGWGLHIEGHST  172



>ref|XP_008391431.1| PREDICTED: cycloartenol synthase isoform X2 [Malus domestica]
Length=708

 Score = 83.2 bits (204),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 36/53 (68%), Positives = 44/53 (83%), Gaps = 0/53 (0%)
 Frame = -1

Query  159  PLFLLHCLIIGLSVMGTINAILQEEHQKEILRYIYNHQNVDGGWGLHIEGHST  1
            P+FLL  L+I LS+ G +NA+L +EH+KEI RY+YNHQN DGGWGLHIEG ST
Sbjct  121  PMFLLPGLVIALSITGALNAVLSDEHKKEICRYLYNHQNKDGGWGLHIEGPST  173



>ref|XP_006484812.1| PREDICTED: cycloartenol synthase 2-like [Citrus sinensis]
Length=764

 Score = 83.2 bits (204),  Expect = 9e-17, Method: Composition-based stats.
 Identities = 36/53 (68%), Positives = 44/53 (83%), Gaps = 0/53 (0%)
 Frame = -1

Query  159  PLFLLHCLIIGLSVMGTINAILQEEHQKEILRYIYNHQNVDGGWGLHIEGHST  1
            P+FL+  L+I LS+ G +NA+L EEH+KE+ RYIYNHQN DGGWGLHIEG ST
Sbjct  121  PMFLMPGLVITLSITGALNAVLLEEHKKEMCRYIYNHQNRDGGWGLHIEGPST  173



>ref|XP_011094034.1| PREDICTED: cycloartenol Synthase [Sesamum indicum]
 ref|XP_011094035.1| PREDICTED: cycloartenol Synthase [Sesamum indicum]
 ref|XP_011094036.1| PREDICTED: cycloartenol Synthase [Sesamum indicum]
 ref|XP_011094037.1| PREDICTED: cycloartenol Synthase [Sesamum indicum]
 ref|XP_011094038.1| PREDICTED: cycloartenol Synthase [Sesamum indicum]
Length=757

 Score = 83.2 bits (204),  Expect = 9e-17, Method: Composition-based stats.
 Identities = 35/53 (66%), Positives = 44/53 (83%), Gaps = 0/53 (0%)
 Frame = -1

Query  159  PLFLLHCLIIGLSVMGTINAILQEEHQKEILRYIYNHQNVDGGWGLHIEGHST  1
            P+FL+  L+I LS+ G +NAIL +EH++EI RY+YNHQN DGGWGLHIEG ST
Sbjct  121  PMFLMPGLVITLSITGALNAILSKEHRREICRYLYNHQNPDGGWGLHIEGPST  173



>gb|AGC82085.1| cycloartenol synthase protein [Azadirachta indica]
Length=758

 Score = 83.2 bits (204),  Expect = 9e-17, Method: Composition-based stats.
 Identities = 34/53 (64%), Positives = 44/53 (83%), Gaps = 0/53 (0%)
 Frame = -1

Query  159  PLFLLHCLIIGLSVMGTINAILQEEHQKEILRYIYNHQNVDGGWGLHIEGHST  1
            P+FL+  L+I +S+ G +NA+L EEH+KE+ RY+YNHQN DGGWGLHIEG ST
Sbjct  121  PMFLMPGLVITMSITGALNAVLSEEHKKEMCRYLYNHQNRDGGWGLHIEGPST  173



>ref|XP_010677527.1| PREDICTED: cycloartenol synthase 2 [Beta vulgaris subsp. vulgaris]
Length=757

 Score = 83.2 bits (204),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 36/53 (68%), Positives = 44/53 (83%), Gaps = 0/53 (0%)
 Frame = -1

Query  159  PLFLLHCLIIGLSVMGTINAILQEEHQKEILRYIYNHQNVDGGWGLHIEGHST  1
            P+FL+  L+I LSV G +NA+L +EHQKE+ RY+YNHQN DGGWGLHIEG ST
Sbjct  121  PMFLMPGLVIALSVSGALNAVLSKEHQKEMRRYLYNHQNEDGGWGLHIEGQST  173



>dbj|BAA86930.1| lupeol synthase [Olea europaea]
Length=758

 Score = 83.2 bits (204),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 37/53 (70%), Positives = 41/53 (77%), Gaps = 0/53 (0%)
 Frame = -1

Query  159  PLFLLHCLIIGLSVMGTINAILQEEHQKEILRYIYNHQNVDGGWGLHIEGHST  1
            PLF L  L++ L V G IN +L  EHQKEI RYIYNHQN DGGWG+HIEGHST
Sbjct  121  PLFFLPPLVLALYVTGAINVVLSREHQKEITRYIYNHQNEDGGWGIHIEGHST  173



>ref|XP_007224874.1| hypothetical protein PRUPE_ppa022710mg [Prunus persica]
 gb|EMJ26073.1| hypothetical protein PRUPE_ppa022710mg [Prunus persica]
Length=793

 Score = 83.2 bits (204),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 39/53 (74%), Positives = 45/53 (85%), Gaps = 0/53 (0%)
 Frame = -1

Query  159  PLFLLHCLIIGLSVMGTINAILQEEHQKEILRYIYNHQNVDGGWGLHIEGHST  1
            PLFLL  L+IGLSV G ++AIL  EHQ+EI RY+YNHQN+DGGWGLHIEG ST
Sbjct  124  PLFLLPGLVIGLSVTGALHAILPHEHQQEICRYLYNHQNMDGGWGLHIEGPST  176



>gb|ADG60271.1| cycloartenol synthase [Withania somnifera]
Length=758

 Score = 82.8 bits (203),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 33/53 (62%), Positives = 43/53 (81%), Gaps = 0/53 (0%)
 Frame = -1

Query  159  PLFLLHCLIIGLSVMGTINAILQEEHQKEILRYIYNHQNVDGGWGLHIEGHST  1
            P+FL+  LII LS+ G +NA+   EH++E++RY+YNHQN DGGWGLHIE HST
Sbjct  121  PMFLMPGLIIALSITGALNAVFSSEHKREMIRYLYNHQNSDGGWGLHIESHST  173



>ref|XP_009346737.1| PREDICTED: cycloartenol synthase-like [Pyrus x bretschneideri]
Length=765

 Score = 82.8 bits (203),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 35/53 (66%), Positives = 44/53 (83%), Gaps = 0/53 (0%)
 Frame = -1

Query  159  PLFLLHCLIIGLSVMGTINAILQEEHQKEILRYIYNHQNVDGGWGLHIEGHST  1
            P+FLL  L+I LS+ G INA+L +EH++E+ RY+YNHQN DGGWGLHIEG ST
Sbjct  127  PMFLLPGLVITLSITGAINAVLSKEHKREMCRYLYNHQNEDGGWGLHIEGPST  179



>sp|Q9SLP9.1|CAS1_LUFAE RecName: Full=Cycloartenol synthase; Short=LcCAS1 [Luffa aegyptiaca]
 dbj|BAA85266.1| cycloartenol synthase [Luffa aegyptiaca]
Length=765

 Score = 82.8 bits (203),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 35/53 (66%), Positives = 43/53 (81%), Gaps = 0/53 (0%)
 Frame = -1

Query  159  PLFLLHCLIIGLSVMGTINAILQEEHQKEILRYIYNHQNVDGGWGLHIEGHST  1
            P+FL+  L+I LS+ G +NA+L  EHQ+EI RY+YNHQN DGGWGLHIEG ST
Sbjct  129  PMFLIPGLVITLSITGALNAVLSTEHQREICRYLYNHQNKDGGWGLHIEGPST  181



>gb|AEO27878.1| cycloartenol synthases [Fritillaria thunbergii]
Length=756

 Score = 82.8 bits (203),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 35/53 (66%), Positives = 43/53 (81%), Gaps = 0/53 (0%)
 Frame = -1

Query  159  PLFLLHCLIIGLSVMGTINAILQEEHQKEILRYIYNHQNVDGGWGLHIEGHST  1
            P+FL+  LII L+V G +NA+L  EHQ+E+ RY+YNHQN DGGWGLHIEG ST
Sbjct  121  PMFLMPGLIITLTVTGALNAVLSPEHQREMCRYLYNHQNEDGGWGLHIEGQST  173



>ref|XP_010906067.1| PREDICTED: cycloartenol synthase-like [Elaeis guineensis]
 ref|XP_010906068.1| PREDICTED: cycloartenol synthase-like [Elaeis guineensis]
Length=759

 Score = 82.8 bits (203),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 36/53 (68%), Positives = 43/53 (81%), Gaps = 0/53 (0%)
 Frame = -1

Query  159  PLFLLHCLIIGLSVMGTINAILQEEHQKEILRYIYNHQNVDGGWGLHIEGHST  1
            P+FL+  LII LSV G +N +L  EH++EI RY+YNHQN DGGWGLHIEGHST
Sbjct  121  PMFLMPGLIIALSVTGALNTVLSPEHKREIRRYLYNHQNKDGGWGLHIEGHST  173



>dbj|BAF73930.1| cycloartenol synthase [Kandelia candel]
Length=758

 Score = 82.8 bits (203),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 37/53 (70%), Positives = 42/53 (79%), Gaps = 0/53 (0%)
 Frame = -1

Query  159  PLFLLHCLIIGLSVMGTINAILQEEHQKEILRYIYNHQNVDGGWGLHIEGHST  1
            P+FL+  L+I LSV G +NAIL  EHQ EI RY+YNHQN DGGWGLHIEG ST
Sbjct  122  PMFLMPGLVITLSVAGALNAILSREHQGEICRYLYNHQNEDGGWGLHIEGPST  174



>ref|XP_008809071.1| PREDICTED: cycloartenol synthase-like isoform X1 [Phoenix dactylifera]
 ref|XP_008809072.1| PREDICTED: cycloartenol synthase-like isoform X1 [Phoenix dactylifera]
 ref|XP_008809073.1| PREDICTED: cycloartenol synthase-like isoform X1 [Phoenix dactylifera]
Length=736

 Score = 82.8 bits (203),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 37/53 (70%), Positives = 43/53 (81%), Gaps = 0/53 (0%)
 Frame = -1

Query  159  PLFLLHCLIIGLSVMGTINAILQEEHQKEILRYIYNHQNVDGGWGLHIEGHST  1
            P+FL+  LII LSV G +N +L  EHQ+EI RY+YNHQN DGGWGLHIEGHST
Sbjct  121  PMFLMPGLIIVLSVTGALNTVLSPEHQREIRRYLYNHQNKDGGWGLHIEGHST  173



>ref|XP_010932785.1| PREDICTED: cycloartenol synthase-like isoform X2 [Elaeis guineensis]
Length=703

 Score = 82.4 bits (202),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 35/53 (66%), Positives = 41/53 (77%), Gaps = 0/53 (0%)
 Frame = -1

Query  159  PLFLLHCLIIGLSVMGTINAILQEEHQKEILRYIYNHQNVDGGWGLHIEGHST  1
            P+F L   IIGL V+G +N +   EHQ+EILRY+YNHQN DGGWGLHIEG ST
Sbjct  65   PMFNLPLWIIGLHVIGALNTVFSSEHQREILRYMYNHQNEDGGWGLHIEGPST  117



>ref|XP_006646871.1| PREDICTED: cycloartenol synthase-like [Oryza brachyantha]
Length=759

 Score = 82.8 bits (203),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 36/53 (68%), Positives = 41/53 (77%), Gaps = 0/53 (0%)
 Frame = -1

Query  159  PLFLLHCLIIGLSVMGTINAILQEEHQKEILRYIYNHQNVDGGWGLHIEGHST  1
            P+FL+  LII L V G +N  L  EHQKE+ RY+YNHQN DGGWGLHIEGHST
Sbjct  122  PMFLMPGLIITLYVSGALNTALSSEHQKEMRRYLYNHQNEDGGWGLHIEGHST  174



>ref|XP_010048520.1| PREDICTED: LOW QUALITY PROTEIN: lupeol synthase-like [Eucalyptus 
grandis]
Length=755

 Score = 82.4 bits (202),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 34/53 (64%), Positives = 39/53 (74%), Gaps = 0/53 (0%)
 Frame = -1

Query  159  PLFLLHCLIIGLSVMGTINAILQEEHQKEILRYIYNHQNVDGGWGLHIEGHST  1
            PLF    ++  LS+ G +NAI   EH+KEI RYIYNHQN DGGWG HIEGHST
Sbjct  120  PLFFFPPMVFALSITGAMNAIFSPEHKKEIKRYIYNHQNEDGGWGFHIEGHST  172



>sp|E2IUB0.1|CASS_KALDA RecName: Full=Cycloartenol synthase; Short=KdCAS [Kalanchoe daigremontiana]
 gb|ADK35127.1| cycloartenol synthase [Kalanchoe daigremontiana]
Length=764

 Score = 82.4 bits (202),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 35/53 (66%), Positives = 44/53 (83%), Gaps = 0/53 (0%)
 Frame = -1

Query  159  PLFLLHCLIIGLSVMGTINAILQEEHQKEILRYIYNHQNVDGGWGLHIEGHST  1
            PLFL+  L+I LS+ G +NA+L +EH+KE+ RY+YNHQN DGGWGLHIEG ST
Sbjct  122  PLFLMPGLVITLSITGALNAVLSKEHKKEMCRYLYNHQNEDGGWGLHIEGPST  174



>ref|XP_010541955.1| PREDICTED: cycloartenol synthase [Tarenaya hassleriana]
 ref|XP_010541956.1| PREDICTED: cycloartenol synthase [Tarenaya hassleriana]
 ref|XP_010541957.1| PREDICTED: cycloartenol synthase [Tarenaya hassleriana]
 ref|XP_010541958.1| PREDICTED: cycloartenol synthase [Tarenaya hassleriana]
Length=757

 Score = 82.4 bits (202),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 34/53 (64%), Positives = 44/53 (83%), Gaps = 0/53 (0%)
 Frame = -1

Query  159  PLFLLHCLIIGLSVMGTINAILQEEHQKEILRYIYNHQNVDGGWGLHIEGHST  1
            P+FLL  L+I LS+ G +NA+L E+H++E+ RY+YNHQN DGGWGLHIEG ST
Sbjct  121  PMFLLPGLVIALSITGALNAVLSEQHKQEMCRYLYNHQNEDGGWGLHIEGPST  173



>gb|KCW80789.1| hypothetical protein EUGRSUZ_C02165 [Eucalyptus grandis]
Length=724

 Score = 82.4 bits (202),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 34/53 (64%), Positives = 39/53 (74%), Gaps = 0/53 (0%)
 Frame = -1

Query  159  PLFLLHCLIIGLSVMGTINAILQEEHQKEILRYIYNHQNVDGGWGLHIEGHST  1
            PLF    ++  LS+ G +NAI   EH+KEI RYIYNHQN DGGWG HIEGHST
Sbjct  120  PLFFFPPMVFALSITGAMNAIFSPEHKKEIKRYIYNHQNEDGGWGFHIEGHST  172



>ref|XP_008223938.1| PREDICTED: cycloartenol synthase 2 [Prunus mume]
Length=757

 Score = 82.4 bits (202),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 36/53 (68%), Positives = 44/53 (83%), Gaps = 0/53 (0%)
 Frame = -1

Query  159  PLFLLHCLIIGLSVMGTINAILQEEHQKEILRYIYNHQNVDGGWGLHIEGHST  1
            P+FLL  L+I LS+ G +NA+L +EH+KEI RY+YNHQN DGGWGLHIEG ST
Sbjct  121  PMFLLPGLVITLSITGALNAVLSDEHKKEICRYLYNHQNKDGGWGLHIEGPST  173



>sp|Q2XPU6.1|CAS1_RICCO RecName: Full=Cycloartenol synthase; Short=RcCAS [Ricinus communis]
 gb|ABB76767.1| cycloartenol synthase [Ricinus communis]
Length=759

 Score = 82.4 bits (202),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 36/53 (68%), Positives = 44/53 (83%), Gaps = 0/53 (0%)
 Frame = -1

Query  159  PLFLLHCLIIGLSVMGTINAILQEEHQKEILRYIYNHQNVDGGWGLHIEGHST  1
            P+FL+  LII LS+ G +NAIL EEH++E+ RY+YNHQN DGGWGLHIEG ST
Sbjct  123  PMFLMPGLIIALSITGALNAILSEEHKREMCRYLYNHQNRDGGWGLHIEGPST  175



>ref|XP_002527812.1| Cycloartenol synthase, putative [Ricinus communis]
 gb|EEF34564.1| Cycloartenol synthase, putative [Ricinus communis]
Length=753

 Score = 82.4 bits (202),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 36/53 (68%), Positives = 44/53 (83%), Gaps = 0/53 (0%)
 Frame = -1

Query  159  PLFLLHCLIIGLSVMGTINAILQEEHQKEILRYIYNHQNVDGGWGLHIEGHST  1
            P+FL+  LII LS+ G +NAIL EEH++E+ RY+YNHQN DGGWGLHIEG ST
Sbjct  123  PMFLMPGLIIALSITGALNAILSEEHKREMCRYLYNHQNRDGGWGLHIEGPST  175



>ref|XP_007153005.1| hypothetical protein PHAVU_004G178500g [Phaseolus vulgaris]
 gb|ESW24999.1| hypothetical protein PHAVU_004G178500g [Phaseolus vulgaris]
Length=764

 Score = 82.4 bits (202),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 33/53 (62%), Positives = 43/53 (81%), Gaps = 0/53 (0%)
 Frame = -1

Query  159  PLFLLHCLIIGLSVMGTINAILQEEHQKEILRYIYNHQNVDGGWGLHIEGHST  1
            PLF L  L++ L + G+++A+L  EH+KEI+RY+YNHQN DGGWG HIEGHST
Sbjct  120  PLFFLQPLVMALYITGSLDAVLGPEHKKEIIRYLYNHQNEDGGWGFHIEGHST  172



>ref|XP_007153003.1| hypothetical protein PHAVU_004G178300g [Phaseolus vulgaris]
 gb|ESW24997.1| hypothetical protein PHAVU_004G178300g [Phaseolus vulgaris]
Length=757

 Score = 82.4 bits (202),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 36/53 (68%), Positives = 44/53 (83%), Gaps = 0/53 (0%)
 Frame = -1

Query  159  PLFLLHCLIIGLSVMGTINAILQEEHQKEILRYIYNHQNVDGGWGLHIEGHST  1
            P+FL+  L+I LS+ G +NA+L EEH+KEI RY+YNHQN DGGWGLHIEG ST
Sbjct  121  PMFLMPGLVITLSITGALNAVLTEEHKKEICRYLYNHQNKDGGWGLHIEGPST  173



>sp|Q9SXV6.1|CAS1_GLYGL RecName: Full=Cycloartenol synthase [Glycyrrhiza glabra]
 dbj|BAA76902.1| cycloartenol synthase [Glycyrrhiza glabra]
Length=757

 Score = 82.4 bits (202),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 36/53 (68%), Positives = 44/53 (83%), Gaps = 0/53 (0%)
 Frame = -1

Query  159  PLFLLHCLIIGLSVMGTINAILQEEHQKEILRYIYNHQNVDGGWGLHIEGHST  1
            P+FL+  L+I LS+ G +NA+L EEH+KEI RY+YNHQN DGGWGLHIEG ST
Sbjct  121  PMFLMPGLVITLSITGALNAVLTEEHRKEICRYLYNHQNKDGGWGLHIEGPST  173



>ref|XP_009370034.1| PREDICTED: cycloartenol synthase 2 [Pyrus x bretschneideri]
Length=757

 Score = 82.4 bits (202),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 36/53 (68%), Positives = 44/53 (83%), Gaps = 0/53 (0%)
 Frame = -1

Query  159  PLFLLHCLIIGLSVMGTINAILQEEHQKEILRYIYNHQNVDGGWGLHIEGHST  1
            P+FLL  L+I LS+ G +NA+L +EH+KEI RY+YNHQN DGGWGLHIEG ST
Sbjct  121  PMFLLPGLVITLSITGALNAVLSDEHKKEICRYLYNHQNKDGGWGLHIEGPST  173



>ref|XP_009345284.1| PREDICTED: cycloartenol synthase 2-like [Pyrus x bretschneideri]
Length=757

 Score = 82.4 bits (202),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 36/53 (68%), Positives = 44/53 (83%), Gaps = 0/53 (0%)
 Frame = -1

Query  159  PLFLLHCLIIGLSVMGTINAILQEEHQKEILRYIYNHQNVDGGWGLHIEGHST  1
            P+FLL  L+I LS+ G +NA+L +EH+KEI RY+YNHQN DGGWGLHIEG ST
Sbjct  121  PMFLLPGLVITLSITGALNAVLSDEHKKEICRYLYNHQNKDGGWGLHIEGPST  173



>ref|XP_007019806.1| Cycloartenol synthase 1 isoform 5 [Theobroma cacao]
 gb|EOY17031.1| Cycloartenol synthase 1 isoform 5 [Theobroma cacao]
Length=612

 Score = 82.0 bits (201),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 35/53 (66%), Positives = 44/53 (83%), Gaps = 0/53 (0%)
 Frame = -1

Query  159  PLFLLHCLIIGLSVMGTINAILQEEHQKEILRYIYNHQNVDGGWGLHIEGHST  1
            P+FL+  L+I LS+ G +NA+L EEH+KE+ RY+YNHQN DGGWGLHIEG ST
Sbjct  121  PMFLMPGLVISLSITGALNAVLSEEHKKEMCRYLYNHQNEDGGWGLHIEGPST  173



>gb|EYU25760.1| hypothetical protein MIMGU_mgv1a001797mg [Erythranthe guttata]
Length=757

 Score = 82.4 bits (202),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 34/53 (64%), Positives = 43/53 (81%), Gaps = 0/53 (0%)
 Frame = -1

Query  159  PLFLLHCLIIGLSVMGTINAILQEEHQKEILRYIYNHQNVDGGWGLHIEGHST  1
            P+FL+  L+I LS+ G +NA L +EH++EI RY+YNHQN DGGWGLHIEG ST
Sbjct  121  PMFLMPGLVIALSITGALNATLSKEHKREICRYLYNHQNSDGGWGLHIEGPST  173



>ref|XP_008228021.1| PREDICTED: cycloartenol synthase [Prunus mume]
Length=762

 Score = 82.4 bits (202),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 35/53 (66%), Positives = 43/53 (81%), Gaps = 0/53 (0%)
 Frame = -1

Query  159  PLFLLHCLIIGLSVMGTINAILQEEHQKEILRYIYNHQNVDGGWGLHIEGHST  1
            P+FLL  L+I LS+ G +NA+L +EHQ E+ RY+YNHQN DGGWGLHIEG ST
Sbjct  126  PMFLLPGLVITLSITGALNAVLSKEHQHEMCRYLYNHQNKDGGWGLHIEGPST  178



>gb|AIU41743.1| beta-amyrin synthase [Chlorophytum borivilianum]
Length=758

 Score = 82.4 bits (202),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 35/53 (66%), Positives = 45/53 (85%), Gaps = 0/53 (0%)
 Frame = -1

Query  159  PLFLLHCLIIGLSVMGTINAILQEEHQKEILRYIYNHQNVDGGWGLHIEGHST  1
            P+FL+  L+I LS+ G +NA+L EEH+KE++RY+YNHQN DGGWGLHIEG ST
Sbjct  122  PMFLMPGLVITLSITGALNAVLSEEHKKEMIRYLYNHQNEDGGWGLHIEGPST  174



>ref|XP_008679954.1| PREDICTED: cycloartenol synthase isoform X1 [Zea mays]
 gb|AFW66542.1| hypothetical protein ZEAMMB73_213979 [Zea mays]
Length=757

 Score = 82.0 bits (201),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 36/53 (68%), Positives = 41/53 (77%), Gaps = 0/53 (0%)
 Frame = -1

Query  159  PLFLLHCLIIGLSVMGTINAILQEEHQKEILRYIYNHQNVDGGWGLHIEGHST  1
            P+FL+  LII L V G +N +L  EHQKEI RY+YNHQN DGGWGLHIEG ST
Sbjct  119  PMFLMPGLIITLYVTGALNTVLSSEHQKEIRRYLYNHQNEDGGWGLHIEGPST  171



>ref|XP_007019803.1| Cycloartenol synthase 1 isoform 2, partial [Theobroma cacao]
 gb|EOY17028.1| Cycloartenol synthase 1 isoform 2, partial [Theobroma cacao]
Length=748

 Score = 82.0 bits (201),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 35/53 (66%), Positives = 44/53 (83%), Gaps = 0/53 (0%)
 Frame = -1

Query  159  PLFLLHCLIIGLSVMGTINAILQEEHQKEILRYIYNHQNVDGGWGLHIEGHST  1
            P+FL+  L+I LS+ G +NA+L EEH+KE+ RY+YNHQN DGGWGLHIEG ST
Sbjct  121  PMFLMPGLVISLSITGALNAVLSEEHKKEMCRYLYNHQNEDGGWGLHIEGPST  173



>dbj|BAA23533.1| cycloartenol synthase [Pisum sativum]
Length=756

 Score = 82.0 bits (201),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 35/53 (66%), Positives = 44/53 (83%), Gaps = 0/53 (0%)
 Frame = -1

Query  159  PLFLLHCLIIGLSVMGTINAILQEEHQKEILRYIYNHQNVDGGWGLHIEGHST  1
            P+FL+  L+I LSV G +NA+L +EH+KE+ RY+YNHQN DGGWGLHIEG ST
Sbjct  121  PMFLMPGLVITLSVTGALNAVLTDEHRKEMRRYLYNHQNKDGGWGLHIEGPST  173



>ref|XP_010932783.1| PREDICTED: cycloartenol Synthase-like isoform X1 [Elaeis guineensis]
 ref|XP_010932784.1| PREDICTED: cycloartenol Synthase-like isoform X1 [Elaeis guineensis]
 ref|XP_010932786.1| PREDICTED: cycloartenol Synthase-like isoform X1 [Elaeis guineensis]
Length=759

 Score = 82.0 bits (201),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 35/53 (66%), Positives = 41/53 (77%), Gaps = 0/53 (0%)
 Frame = -1

Query  159  PLFLLHCLIIGLSVMGTINAILQEEHQKEILRYIYNHQNVDGGWGLHIEGHST  1
            P+F L   IIGL V+G +N +   EHQ+EILRY+YNHQN DGGWGLHIEG ST
Sbjct  121  PMFNLPLWIIGLHVIGALNTVFSSEHQREILRYMYNHQNEDGGWGLHIEGPST  173



>ref|XP_007214976.1| hypothetical protein PRUPE_ppa001806mg [Prunus persica]
 gb|EMJ16175.1| hypothetical protein PRUPE_ppa001806mg [Prunus persica]
Length=762

 Score = 82.0 bits (201),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 35/53 (66%), Positives = 43/53 (81%), Gaps = 0/53 (0%)
 Frame = -1

Query  159  PLFLLHCLIIGLSVMGTINAILQEEHQKEILRYIYNHQNVDGGWGLHIEGHST  1
            P+FLL  L+I LS+ G +NA+L +EHQ E+ RY+YNHQN DGGWGLHIEG ST
Sbjct  126  PMFLLPGLVITLSITGALNAVLSKEHQHEMCRYLYNHQNKDGGWGLHIEGPST  178



>gb|AGK62447.1| cycloartenol synthase [Panax quinquefolius]
Length=757

 Score = 82.0 bits (201),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 34/53 (64%), Positives = 44/53 (83%), Gaps = 0/53 (0%)
 Frame = -1

Query  159  PLFLLHCLIIGLSVMGTINAILQEEHQKEILRYIYNHQNVDGGWGLHIEGHST  1
            P+FL+  L+I LS+ G +NA+L +EH++EI RY+YNHQN DGGWGLHIEG ST
Sbjct  121  PMFLMPGLVITLSITGALNAVLSKEHKREICRYLYNHQNRDGGWGLHIEGPST  173



>sp|Q8W3Z3.1|CAS2_BETPL RecName: Full=Cycloartenol synthase 2 [Betula platyphylla]
 dbj|BAB83086.1| cycloartenol synthase [Betula platyphylla]
Length=757

 Score = 82.0 bits (201),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 34/53 (64%), Positives = 43/53 (81%), Gaps = 0/53 (0%)
 Frame = -1

Query  159  PLFLLHCLIIGLSVMGTINAILQEEHQKEILRYIYNHQNVDGGWGLHIEGHST  1
            P+FL+  L+I LS+ G +N +L EEH+KE+ RY+YNHQN DGGWGLHIEG ST
Sbjct  121  PMFLMPGLVITLSITGALNTVLSEEHKKEMCRYLYNHQNKDGGWGLHIEGPST  173



>ref|XP_007019802.1| Cycloartenol synthase 1 isoform 1 [Theobroma cacao]
 ref|XP_007019804.1| Cycloartenol synthase 1 isoform 1 [Theobroma cacao]
 ref|XP_007019805.1| Cycloartenol synthase 1 isoform 1 [Theobroma cacao]
 gb|EOY17027.1| Cycloartenol synthase 1 isoform 1 [Theobroma cacao]
 gb|EOY17029.1| Cycloartenol synthase 1 isoform 1 [Theobroma cacao]
 gb|EOY17030.1| Cycloartenol synthase 1 isoform 1 [Theobroma cacao]
Length=756

 Score = 82.0 bits (201),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 35/53 (66%), Positives = 44/53 (83%), Gaps = 0/53 (0%)
 Frame = -1

Query  159  PLFLLHCLIIGLSVMGTINAILQEEHQKEILRYIYNHQNVDGGWGLHIEGHST  1
            P+FL+  L+I LS+ G +NA+L EEH+KE+ RY+YNHQN DGGWGLHIEG ST
Sbjct  121  PMFLMPGLVISLSITGALNAVLSEEHKKEMCRYLYNHQNEDGGWGLHIEGPST  173



>ref|NP_001233784.1| cycloartenol synthase [Solanum lycopersicum]
 ref|XP_010320043.1| PREDICTED: cycloartenol synthase isoform X1 [Solanum lycopersicum]
 gb|ACA28830.1| cycloartenol synthase [Solanum lycopersicum]
Length=757

 Score = 82.0 bits (201),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 32/53 (60%), Positives = 43/53 (81%), Gaps = 0/53 (0%)
 Frame = -1

Query  159  PLFLLHCLIIGLSVMGTINAILQEEHQKEILRYIYNHQNVDGGWGLHIEGHST  1
            P+FL+  +II LS+ G +NA+   EH++E++RY+YNHQN DGGWGLHIE HST
Sbjct  121  PMFLMPGMIIALSITGALNAVFSSEHKREMIRYLYNHQNSDGGWGLHIESHST  173



>ref|XP_006362808.1| PREDICTED: cycloartenol Synthase-like isoform X1 [Solanum tuberosum]
 ref|XP_006362809.1| PREDICTED: cycloartenol Synthase-like isoform X2 [Solanum tuberosum]
Length=757

 Score = 82.0 bits (201),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 32/53 (60%), Positives = 43/53 (81%), Gaps = 0/53 (0%)
 Frame = -1

Query  159  PLFLLHCLIIGLSVMGTINAILQEEHQKEILRYIYNHQNVDGGWGLHIEGHST  1
            P+FL+  +II LS+ G +NA+   EH++E++RY+YNHQN DGGWGLHIE HST
Sbjct  121  PMFLMPGMIIALSITGALNAVFSSEHKREMIRYLYNHQNSDGGWGLHIESHST  173



>gb|AIU41742.1| cycloartenol synthase [Chlorophytum borivilianum]
Length=758

 Score = 82.0 bits (201),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 35/53 (66%), Positives = 45/53 (85%), Gaps = 0/53 (0%)
 Frame = -1

Query  159  PLFLLHCLIIGLSVMGTINAILQEEHQKEILRYIYNHQNVDGGWGLHIEGHST  1
            P+FL+  L+I LS+ G +NA+L EEH+KE++RY+YNHQN DGGWGLHIEG ST
Sbjct  122  PMFLMPGLVITLSITGALNAVLSEEHKKEMIRYLYNHQNEDGGWGLHIEGPST  174



>ref|XP_004303790.1| PREDICTED: cycloartenol synthase-like [Fragaria vesca subsp. 
vesca]
Length=763

 Score = 82.0 bits (201),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 35/53 (66%), Positives = 43/53 (81%), Gaps = 0/53 (0%)
 Frame = -1

Query  159  PLFLLHCLIIGLSVMGTINAILQEEHQKEILRYIYNHQNVDGGWGLHIEGHST  1
            P+FLL  L+I LS+ G +NA+L  EHQ+E+ RY+YNHQN DGGWGLHIEG ST
Sbjct  127  PMFLLPGLVITLSITGALNAVLSIEHQREMCRYLYNHQNEDGGWGLHIEGPST  179



>ref|XP_010271332.1| PREDICTED: cycloartenol Synthase isoform X2 [Nelumbo nucifera]
Length=757

 Score = 82.0 bits (201),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 37/53 (70%), Positives = 44/53 (83%), Gaps = 0/53 (0%)
 Frame = -1

Query  159  PLFLLHCLIIGLSVMGTINAILQEEHQKEILRYIYNHQNVDGGWGLHIEGHST  1
            P+FLL  L+I L V GT+NA+L +EHQ+E+ RYIYNHQN DGGWGLHIEG ST
Sbjct  121  PMFLLPGLVITLHVTGTLNAVLTKEHQREMCRYIYNHQNRDGGWGLHIEGPST  173



>ref|XP_010271331.1| PREDICTED: cycloartenol Synthase isoform X1 [Nelumbo nucifera]
Length=758

 Score = 82.0 bits (201),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 37/53 (70%), Positives = 44/53 (83%), Gaps = 0/53 (0%)
 Frame = -1

Query  159  PLFLLHCLIIGLSVMGTINAILQEEHQKEILRYIYNHQNVDGGWGLHIEGHST  1
            P+FLL  L+I L V GT+NA+L +EHQ+E+ RYIYNHQN DGGWGLHIEG ST
Sbjct  121  PMFLLPGLVITLHVTGTLNAVLTKEHQREMCRYIYNHQNRDGGWGLHIEGPST  173



>ref|XP_002453283.1| hypothetical protein SORBIDRAFT_04g003200 [Sorghum bicolor]
 gb|EES06259.1| hypothetical protein SORBIDRAFT_04g003200 [Sorghum bicolor]
Length=757

 Score = 82.0 bits (201),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 36/53 (68%), Positives = 41/53 (77%), Gaps = 0/53 (0%)
 Frame = -1

Query  159  PLFLLHCLIIGLSVMGTINAILQEEHQKEILRYIYNHQNVDGGWGLHIEGHST  1
            P+FL+  LII L V G +N +L  EHQKEI RY+YNHQN DGGWGLHIEG ST
Sbjct  119  PMFLMPGLIITLYVTGALNTVLSPEHQKEIRRYLYNHQNEDGGWGLHIEGPST  171



>gb|EYU23540.1| hypothetical protein MIMGU_mgv1a020935mg [Erythranthe guttata]
Length=758

 Score = 82.0 bits (201),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 34/53 (64%), Positives = 44/53 (83%), Gaps = 0/53 (0%)
 Frame = -1

Query  159  PLFLLHCLIIGLSVMGTINAILQEEHQKEILRYIYNHQNVDGGWGLHIEGHST  1
            PLFLL  L+I L+VMG + +I+ +EH+KEILRY+YNHQN+DGGWGLH E  S+
Sbjct  125  PLFLLPGLVIALTVMGAVKSIISDEHKKEILRYLYNHQNIDGGWGLHTEARSS  177



>ref|XP_004299756.1| PREDICTED: cycloartenol synthase-like [Fragaria vesca subsp. 
vesca]
Length=757

 Score = 82.0 bits (201),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 36/53 (68%), Positives = 44/53 (83%), Gaps = 0/53 (0%)
 Frame = -1

Query  159  PLFLLHCLIIGLSVMGTINAILQEEHQKEILRYIYNHQNVDGGWGLHIEGHST  1
            P+FLL  L+I LS+ G +NA+L +EH+KEI RY+YNHQN DGGWGLHIEG ST
Sbjct  121  PMFLLPGLVITLSITGALNAVLSDEHRKEICRYLYNHQNEDGGWGLHIEGPST  173



>ref|XP_004513124.1| PREDICTED: cycloartenol synthase-like [Cicer arietinum]
Length=757

 Score = 82.0 bits (201),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 35/53 (66%), Positives = 44/53 (83%), Gaps = 0/53 (0%)
 Frame = -1

Query  159  PLFLLHCLIIGLSVMGTINAILQEEHQKEILRYIYNHQNVDGGWGLHIEGHST  1
            P+FL+  L+I LSV G +NA+L +EH+KE+ RY+YNHQN DGGWGLHIEG ST
Sbjct  121  PMFLMPGLVIALSVTGALNAVLTDEHRKEMCRYLYNHQNKDGGWGLHIEGPST  173



>ref|XP_006403308.1| hypothetical protein EUTSA_v10003155mg [Eutrema salsugineum]
 gb|ESQ44761.1| hypothetical protein EUTSA_v10003155mg [Eutrema salsugineum]
Length=759

 Score = 81.6 bits (200),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 36/53 (68%), Positives = 44/53 (83%), Gaps = 0/53 (0%)
 Frame = -1

Query  159  PLFLLHCLIIGLSVMGTINAILQEEHQKEILRYIYNHQNVDGGWGLHIEGHST  1
            P+FLL  LII LS+ G +N +L E+H++E+ RYIYNHQN DGGWGLHIEGHST
Sbjct  121  PMFLLPGLIITLSITGALNTVLSEQHKQEMRRYIYNHQNEDGGWGLHIEGHST  173



>ref|XP_011031251.1| PREDICTED: cycloartenol synthase-like [Populus euphratica]
Length=763

 Score = 81.6 bits (200),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 36/53 (68%), Positives = 44/53 (83%), Gaps = 0/53 (0%)
 Frame = -1

Query  159  PLFLLHCLIIGLSVMGTINAILQEEHQKEILRYIYNHQNVDGGWGLHIEGHST  1
            P+FLL  LII LS+ G +NA+L +EHQ+E+ RY+YNHQN DGGWGLHIEG ST
Sbjct  127  PMFLLPGLIITLSITGALNAVLSKEHQREMCRYLYNHQNRDGGWGLHIEGPST  179



>ref|XP_003574426.1| PREDICTED: cycloartenol synthase [Brachypodium distachyon]
Length=760

 Score = 81.6 bits (200),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 35/53 (66%), Positives = 42/53 (79%), Gaps = 0/53 (0%)
 Frame = -1

Query  159  PLFLLHCLIIGLSVMGTINAILQEEHQKEILRYIYNHQNVDGGWGLHIEGHST  1
            P+FL+  L+I L V G++N +L  EHQKEI RY+YNHQN DGGWGLHIEG ST
Sbjct  122  PMFLMPGLLITLYVTGSLNTVLSSEHQKEICRYLYNHQNEDGGWGLHIEGPST  174



>ref|XP_010932787.1| PREDICTED: cycloartenol Synthase-like isoform X3 [Elaeis guineensis]
Length=584

 Score = 81.3 bits (199),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 35/53 (66%), Positives = 41/53 (77%), Gaps = 0/53 (0%)
 Frame = -1

Query  159  PLFLLHCLIIGLSVMGTINAILQEEHQKEILRYIYNHQNVDGGWGLHIEGHST  1
            P+F L   IIGL V+G +N +   EHQ+EILRY+YNHQN DGGWGLHIEG ST
Sbjct  121  PMFNLPLWIIGLHVIGALNTVFSSEHQREILRYMYNHQNEDGGWGLHIEGPST  173



>gb|AAT38891.1| cycloartenol synthase [Avena strigosa]
Length=759

 Score = 81.6 bits (200),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 36/53 (68%), Positives = 42/53 (79%), Gaps = 0/53 (0%)
 Frame = -1

Query  159  PLFLLHCLIIGLSVMGTINAILQEEHQKEILRYIYNHQNVDGGWGLHIEGHST  1
            P+FL+  L+I L V G +NA+L  EHQKEI RY+YNHQN DGGWGLHIEG ST
Sbjct  122  PMFLMPGLLITLYVTGALNAVLSPEHQKEIRRYLYNHQNEDGGWGLHIEGPST  174



>ref|XP_002310905.1| hypothetical protein POPTR_0007s15200g [Populus trichocarpa]
 gb|EEE91355.1| hypothetical protein POPTR_0007s15200g [Populus trichocarpa]
Length=763

 Score = 81.6 bits (200),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 36/53 (68%), Positives = 44/53 (83%), Gaps = 0/53 (0%)
 Frame = -1

Query  159  PLFLLHCLIIGLSVMGTINAILQEEHQKEILRYIYNHQNVDGGWGLHIEGHST  1
            P+FLL  LII LS+ G +NA+L +EHQ+E+ RY+YNHQN DGGWGLHIEG ST
Sbjct  127  PMFLLPGLIITLSITGALNAVLSKEHQREMCRYLYNHQNRDGGWGLHIEGPST  179



>sp|H2KWF1.1|PAKSY_ORYSJ RecName: Full=Parkeol synthase [Oryza sativa Japonica Group]
 gb|ABG22399.1| Cycloartenol synthase, putative, expressed [Oryza sativa Japonica 
Group]
Length=759

 Score = 81.6 bits (200),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 36/52 (69%), Positives = 40/52 (77%), Gaps = 0/52 (0%)
 Frame = -1

Query  156  LFLLHCLIIGLSVMGTINAILQEEHQKEILRYIYNHQNVDGGWGLHIEGHST  1
            +F L  LII L V G +N +L  EHQKE+ RYIYNHQN DGGWGLHIEGHST
Sbjct  122  MFFLPGLIITLHVSGVLNTVLSSEHQKEMRRYIYNHQNEDGGWGLHIEGHST  173



>ref|XP_010927167.1| PREDICTED: cycloartenol synthase-like [Elaeis guineensis]
Length=759

 Score = 81.6 bits (200),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 34/53 (64%), Positives = 43/53 (81%), Gaps = 0/53 (0%)
 Frame = -1

Query  159  PLFLLHCLIIGLSVMGTINAILQEEHQKEILRYIYNHQNVDGGWGLHIEGHST  1
            P+FL+  LI+ LS+ G +N +L  EH++EI RY+YNHQN DGGWGLHIEGHST
Sbjct  121  PMFLMPGLIVALSITGALNTVLSPEHKREIRRYLYNHQNKDGGWGLHIEGHST  173



>ref|XP_008341139.1| PREDICTED: cycloartenol synthase 2-like [Malus domestica]
Length=546

 Score = 81.3 bits (199),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 35/53 (66%), Positives = 44/53 (83%), Gaps = 0/53 (0%)
 Frame = -1

Query  159  PLFLLHCLIIGLSVMGTINAILQEEHQKEILRYIYNHQNVDGGWGLHIEGHST  1
            P+FLL  L+I L++ G +NA+L +EH+KEI RY+YNHQN DGGWGLHIEG ST
Sbjct  121  PMFLLPGLVITLTITGALNAVLSDEHKKEICRYLYNHQNKDGGWGLHIEGPST  173



>ref|XP_007225240.1| hypothetical protein PRUPE_ppa001844mg [Prunus persica]
 gb|EMJ26439.1| hypothetical protein PRUPE_ppa001844mg [Prunus persica]
Length=757

 Score = 81.6 bits (200),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 35/53 (66%), Positives = 44/53 (83%), Gaps = 0/53 (0%)
 Frame = -1

Query  159  PLFLLHCLIIGLSVMGTINAILQEEHQKEILRYIYNHQNVDGGWGLHIEGHST  1
            P+FLL  L+I LS+ G +NA+L +EH++EI RY+YNHQN DGGWGLHIEG ST
Sbjct  121  PMFLLPGLVITLSITGALNAVLSDEHKREICRYLYNHQNKDGGWGLHIEGPST  173



>emb|CBD47302.1| cycloartenol synthase [Dioscorea zingiberensis]
Length=759

 Score = 81.6 bits (200),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 35/53 (66%), Positives = 42/53 (79%), Gaps = 0/53 (0%)
 Frame = -1

Query  159  PLFLLHCLIIGLSVMGTINAILQEEHQKEILRYIYNHQNVDGGWGLHIEGHST  1
            P+FL+  L+I L V G +N +L  EHQ+EI RY+YNHQN DGGWGLHIEGHST
Sbjct  121  PMFLMPGLVIALYVTGALNTVLSPEHQREICRYLYNHQNKDGGWGLHIEGHST  173



>gb|AEM42981.1| cycloartenol synthase [Siraitia grosvenorii]
Length=765

 Score = 81.6 bits (200),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 35/53 (66%), Positives = 42/53 (79%), Gaps = 0/53 (0%)
 Frame = -1

Query  159  PLFLLHCLIIGLSVMGTINAILQEEHQKEILRYIYNHQNVDGGWGLHIEGHST  1
            P+FL+  L+I LS+ G +NA+L  EHQ EI RY+YNHQN DGGWGLHIEG ST
Sbjct  129  PMFLIPGLVITLSITGALNAVLSTEHQHEICRYLYNHQNKDGGWGLHIEGPST  181



>emb|CAM91422.1| cycloartenol synthase [Dioscorea zingiberensis]
Length=759

 Score = 81.6 bits (200),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 35/53 (66%), Positives = 42/53 (79%), Gaps = 0/53 (0%)
 Frame = -1

Query  159  PLFLLHCLIIGLSVMGTINAILQEEHQKEILRYIYNHQNVDGGWGLHIEGHST  1
            P+FL+  L+I L V G +N +L  EHQ+EI RY+YNHQN DGGWGLHIEGHST
Sbjct  121  PMFLMPGLVIALYVTGALNTVLSPEHQREICRYLYNHQNKDGGWGLHIEGHST  173



>gb|ABG22398.1| Cycloartenol synthase, putative, expressed [Oryza sativa Japonica 
Group]
 dbj|BAG89914.1| unnamed protein product [Oryza sativa Japonica Group]
Length=671

 Score = 81.3 bits (199),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 36/52 (69%), Positives = 40/52 (77%), Gaps = 0/52 (0%)
 Frame = -1

Query  156  LFLLHCLIIGLSVMGTINAILQEEHQKEILRYIYNHQNVDGGWGLHIEGHST  1
            +F L  LII L V G +N +L  EHQKE+ RYIYNHQN DGGWGLHIEGHST
Sbjct  34   MFFLPGLIITLHVSGVLNTVLSSEHQKEMRRYIYNHQNEDGGWGLHIEGHST  85



>ref|XP_004951930.1| PREDICTED: cycloartenol synthase-like [Setaria italica]
Length=757

 Score = 81.6 bits (200),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 36/53 (68%), Positives = 41/53 (77%), Gaps = 0/53 (0%)
 Frame = -1

Query  159  PLFLLHCLIIGLSVMGTINAILQEEHQKEILRYIYNHQNVDGGWGLHIEGHST  1
            P+FL+  LII L V G +N +L  EHQKEI RY+YNHQN DGGWGLHIEG ST
Sbjct  119  PMFLMPGLIITLYVSGALNTVLSSEHQKEIRRYLYNHQNEDGGWGLHIEGPST  171



>emb|CBI16773.3| unnamed protein product [Vitis vinifera]
Length=340

 Score = 79.3 bits (194),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 36/52 (69%), Positives = 42/52 (81%), Gaps = 0/52 (0%)
 Frame = -1

Query  159  PLFLLHCLIIGLSVMGTINAILQEEHQKEILRYIYNHQNVDGGWGLHIEGHS  4
            PLFLL  L+IGL V G IN IL  EHQ+E+ RY+YNHQN DGGWGLHI+GH+
Sbjct  85   PLFLLPGLVIGLYVTGAINTILSSEHQQEMCRYLYNHQNRDGGWGLHIKGHN  136



>gb|AAG44096.1|AF216755_1 cycloartenol synthase [Abies magnifica]
Length=756

 Score = 81.3 bits (199),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 36/53 (68%), Positives = 43/53 (81%), Gaps = 0/53 (0%)
 Frame = -1

Query  159  PLFLLHCLIIGLSVMGTINAILQEEHQKEILRYIYNHQNVDGGWGLHIEGHST  1
            P+FL+  L+I L V G +NA+L E H+KEI RY+YNHQN DGGWGLHIEGHST
Sbjct  121  PMFLMPGLVIALYVTGALNAVLSEMHKKEICRYLYNHQNEDGGWGLHIEGHST  173



>ref|XP_010052737.1| PREDICTED: beta-amyrin synthase-like isoform X2 [Eucalyptus grandis]
Length=672

 Score = 81.3 bits (199),  Expect = 4e-16, Method: Composition-based stats.
 Identities = 35/53 (66%), Positives = 42/53 (79%), Gaps = 0/53 (0%)
 Frame = -1

Query  159  PLFLLHCLIIGLSVMGTINAILQEEHQKEILRYIYNHQNVDGGWGLHIEGHST  1
            PLF L  L++ + + G +NA+   EH+KEILRYIYNHQN DGGWGLHIEGHST
Sbjct  122  PLFFLPPLVMCVYITGHLNAVFTVEHRKEILRYIYNHQNEDGGWGLHIEGHST  174



>ref|XP_004299757.1| PREDICTED: cycloartenol synthase-like [Fragaria vesca subsp. 
vesca]
Length=771

 Score = 81.3 bits (199),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 38/53 (72%), Positives = 43/53 (81%), Gaps = 0/53 (0%)
 Frame = -1

Query  159  PLFLLHCLIIGLSVMGTINAILQEEHQKEILRYIYNHQNVDGGWGLHIEGHST  1
            PLFLL  L+IGL+V G ++AIL  +H KEI RYIYNHQN DGGWGLHIEG ST
Sbjct  127  PLFLLPGLVIGLAVTGALDAILSHQHHKEICRYIYNHQNKDGGWGLHIEGPST  179



>ref|XP_010052738.1| PREDICTED: beta-amyrin synthase-like isoform X3 [Eucalyptus grandis]
Length=666

 Score = 81.3 bits (199),  Expect = 4e-16, Method: Composition-based stats.
 Identities = 35/53 (66%), Positives = 42/53 (79%), Gaps = 0/53 (0%)
 Frame = -1

Query  159  PLFLLHCLIIGLSVMGTINAILQEEHQKEILRYIYNHQNVDGGWGLHIEGHST  1
            PLF L  L++ + + G +NA+   EH+KEILRYIYNHQN DGGWGLHIEGHST
Sbjct  122  PLFFLPPLVMCVYITGHLNAVFTVEHRKEILRYIYNHQNEDGGWGLHIEGHST  174



>ref|NP_001176396.1| Os11g0189600 [Oryza sativa Japonica Group]
 dbj|BAH95124.1| Os11g0189600, partial [Oryza sativa Japonica Group]
Length=718

 Score = 81.3 bits (199),  Expect = 4e-16, Method: Composition-based stats.
 Identities = 36/52 (69%), Positives = 40/52 (77%), Gaps = 0/52 (0%)
 Frame = -1

Query  156  LFLLHCLIIGLSVMGTINAILQEEHQKEILRYIYNHQNVDGGWGLHIEGHST  1
            +F L  LII L V G +N +L  EHQKE+ RYIYNHQN DGGWGLHIEGHST
Sbjct  81   MFFLPGLIITLHVSGVLNTVLSSEHQKEMRRYIYNHQNEDGGWGLHIEGHST  132



>ref|XP_010052732.1| PREDICTED: beta-amyrin synthase-like isoform X1 [Eucalyptus grandis]
 ref|XP_010052734.1| PREDICTED: beta-amyrin synthase-like isoform X1 [Eucalyptus grandis]
 ref|XP_010052735.1| PREDICTED: beta-amyrin synthase-like isoform X1 [Eucalyptus grandis]
 ref|XP_010052736.1| PREDICTED: beta-amyrin synthase-like isoform X1 [Eucalyptus grandis]
 gb|KCW76806.1| hypothetical protein EUGRSUZ_D01163 [Eucalyptus grandis]
Length=761

 Score = 81.3 bits (199),  Expect = 4e-16, Method: Composition-based stats.
 Identities = 35/53 (66%), Positives = 42/53 (79%), Gaps = 0/53 (0%)
 Frame = -1

Query  159  PLFLLHCLIIGLSVMGTINAILQEEHQKEILRYIYNHQNVDGGWGLHIEGHST  1
            PLF L  L++ + + G +NA+   EH+KEILRYIYNHQN DGGWGLHIEGHST
Sbjct  122  PLFFLPPLVMCVYITGHLNAVFTVEHRKEILRYIYNHQNEDGGWGLHIEGHST  174



>emb|CAN73194.1| hypothetical protein VITISV_028269 [Vitis vinifera]
Length=630

 Score = 80.9 bits (198),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 37/52 (71%), Positives = 42/52 (81%), Gaps = 0/52 (0%)
 Frame = -1

Query  159  PLFLLHCLIIGLSVMGTINAILQEEHQKEILRYIYNHQNVDGGWGLHIEGHS  4
            PLFLL  L+IGL V G IN IL  EHQ+E+ RY+YNHQN DGGWGLHIEGH+
Sbjct  96   PLFLLPGLVIGLYVTGAINTILSSEHQQEMCRYLYNHQNRDGGWGLHIEGHN  147



>gb|KDP27754.1| hypothetical protein JCGZ_19783 [Jatropha curcas]
Length=758

 Score = 81.3 bits (199),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 35/53 (66%), Positives = 44/53 (83%), Gaps = 0/53 (0%)
 Frame = -1

Query  159  PLFLLHCLIIGLSVMGTINAILQEEHQKEILRYIYNHQNVDGGWGLHIEGHST  1
            P+FL+  L+I LSV G +NA+L EEH++E+ RY+YNHQN DGGWGLHIEG ST
Sbjct  122  PMFLMPGLVITLSVTGALNAVLSEEHKREMCRYLYNHQNRDGGWGLHIEGPST  174



>ref|XP_007153001.1| hypothetical protein PHAVU_004G1782001g, partial [Phaseolus vulgaris]
 gb|ESW24995.1| hypothetical protein PHAVU_004G1782001g, partial [Phaseolus vulgaris]
Length=685

 Score = 81.3 bits (199),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 37/52 (71%), Positives = 43/52 (83%), Gaps = 0/52 (0%)
 Frame = -1

Query  159  PLFLLHCLIIGLSVMGTINAILQEEHQKEILRYIYNHQNVDGGWGLHIEGHS  4
            PLFLL  L+IGL V GT+NA+L+ EHQ E+ RY+ NHQN DGGWGLHIEGHS
Sbjct  47   PLFLLPGLVIGLWVTGTLNAVLRREHQSEMRRYLLNHQNEDGGWGLHIEGHS  98



>ref|XP_003620645.1| Lanosterol synthase [Medicago truncatula]
 gb|AES76863.1| cycloartenol synthase [Medicago truncatula]
Length=653

 Score = 80.9 bits (198),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 36/53 (68%), Positives = 42/53 (79%), Gaps = 0/53 (0%)
 Frame = -1

Query  159  PLFLLHCLIIGLSVMGTINAILQEEHQKEILRYIYNHQNVDGGWGLHIEGHST  1
            PLFLL  L+IGL V G +NA+L  EHQ E+ RY++NHQN DGGWGLHIEG ST
Sbjct  105  PLFLLPSLVIGLWVTGAVNAVLTPEHQSEMRRYVFNHQNEDGGWGLHIEGPST  157



>emb|CDP12480.1| unnamed protein product [Coffea canephora]
Length=758

 Score = 81.3 bits (199),  Expect = 4e-16, Method: Composition-based stats.
 Identities = 35/53 (66%), Positives = 43/53 (81%), Gaps = 0/53 (0%)
 Frame = -1

Query  159  PLFLLHCLIIGLSVMGTINAILQEEHQKEILRYIYNHQNVDGGWGLHIEGHST  1
            P+FL+  LII LS+ G +NA+L +EH+ E+ RYIYNHQN DGGWGLHIEG ST
Sbjct  122  PMFLMPGLIITLSITGALNAVLSKEHKLEMCRYIYNHQNPDGGWGLHIEGPST  174



>emb|CDP14235.1| unnamed protein product [Coffea canephora]
Length=696

 Score = 80.9 bits (198),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 37/53 (70%), Positives = 43/53 (81%), Gaps = 0/53 (0%)
 Frame = -1

Query  159  PLFLLHCLIIGLSVMGTINAILQEEHQKEILRYIYNHQNVDGGWGLHIEGHST  1
            PLF L  L+I L V G +NAIL  EH+KEI+RYI+NHQN DGGWG+HIEGHST
Sbjct  61   PLFFLPPLVIALYVTGELNAILSIEHKKEIIRYIFNHQNEDGGWGIHIEGHST  113



>ref|XP_010063691.1| PREDICTED: beta-amyrin synthase-like [Eucalyptus grandis]
 gb|KCW70924.1| hypothetical protein EUGRSUZ_F04039 [Eucalyptus grandis]
Length=761

 Score = 81.3 bits (199),  Expect = 5e-16, Method: Composition-based stats.
 Identities = 33/53 (62%), Positives = 42/53 (79%), Gaps = 0/53 (0%)
 Frame = -1

Query  159  PLFLLHCLIIGLSVMGTINAILQEEHQKEILRYIYNHQNVDGGWGLHIEGHST  1
            PL+ L  L++G+ + G +NA+   EH+KEILRY+YNHQN DGGWG HIEGHST
Sbjct  122  PLYFLPPLVMGVYITGHLNAVFPAEHRKEILRYLYNHQNGDGGWGFHIEGHST  174



>gb|AGF87141.1| cycloartenol synthase [Paris polyphylla var. yunnanensis]
Length=759

 Score = 81.3 bits (199),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 37/53 (70%), Positives = 42/53 (79%), Gaps = 0/53 (0%)
 Frame = -1

Query  159  PLFLLHCLIIGLSVMGTINAILQEEHQKEILRYIYNHQNVDGGWGLHIEGHST  1
            P+FL+  LII L VMG IN +L  EH++EI RYIYNHQN DGGWGLHIEG ST
Sbjct  121  PMFLMPGLIIALYVMGAINTVLSLEHRREICRYIYNHQNKDGGWGLHIEGQST  173



>dbj|BAA84603.1| oxidosqualene cyclase [Allium macrostemon]
Length=762

 Score = 81.3 bits (199),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 37/53 (70%), Positives = 42/53 (79%), Gaps = 0/53 (0%)
 Frame = -1

Query  159  PLFLLHCLIIGLSVMGTINAILQEEHQKEILRYIYNHQNVDGGWGLHIEGHST  1
            P+FL+  LII LSV G +N +L  EHQ EI RY+YNHQN DGGWGLHIEGHST
Sbjct  122  PMFLMPGLIIALSVTGALNTVLSVEHQHEIRRYLYNHQNEDGGWGLHIEGHST  174



>emb|CDP08999.1| unnamed protein product [Coffea canephora]
Length=759

 Score = 81.3 bits (199),  Expect = 5e-16, Method: Composition-based stats.
 Identities = 36/53 (68%), Positives = 41/53 (77%), Gaps = 0/53 (0%)
 Frame = -1

Query  159  PLFLLHCLIIGLSVMGTINAILQEEHQKEILRYIYNHQNVDGGWGLHIEGHST  1
            PLF L  L++ L + G +N+I   EHQKEILRYIY HQN DGGWGLHIEGHST
Sbjct  122  PLFFLPPLVMCLYITGHLNSIFPAEHQKEILRYIYCHQNEDGGWGLHIEGHST  174



>ref|XP_003620644.1| Lanosterol synthase [Medicago truncatula]
 gb|AES76862.1| cycloartenol synthase [Medicago truncatula]
Length=741

 Score = 80.9 bits (198),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 36/53 (68%), Positives = 42/53 (79%), Gaps = 0/53 (0%)
 Frame = -1

Query  159  PLFLLHCLIIGLSVMGTINAILQEEHQKEILRYIYNHQNVDGGWGLHIEGHST  1
            PLFLL  L+IGL V G +NA+L  EHQ E+ RY++NHQN DGGWGLHIEG ST
Sbjct  105  PLFLLPSLVIGLWVTGAVNAVLTPEHQSEMRRYVFNHQNEDGGWGLHIEGPST  157



>gb|EYU26563.1| hypothetical protein MIMGU_mgv1a001814mg [Erythranthe guttata]
Length=756

 Score = 80.9 bits (198),  Expect = 5e-16, Method: Composition-based stats.
 Identities = 34/53 (64%), Positives = 43/53 (81%), Gaps = 0/53 (0%)
 Frame = -1

Query  159  PLFLLHCLIIGLSVMGTINAILQEEHQKEILRYIYNHQNVDGGWGLHIEGHST  1
            PLFLL  L+I LSVM  +  I+ +EH+KE+ RY+YNHQN+DGGWGLHIEG S+
Sbjct  121  PLFLLPGLVIALSVMDAVKTIITDEHKKEMCRYLYNHQNLDGGWGLHIEGRSS  173



>gb|AAT38887.1| cycloartenol synthase [Avena clauda]
Length=759

 Score = 80.9 bits (198),  Expect = 6e-16, Method: Composition-based stats.
 Identities = 35/53 (66%), Positives = 42/53 (79%), Gaps = 0/53 (0%)
 Frame = -1

Query  159  PLFLLHCLIIGLSVMGTINAILQEEHQKEILRYIYNHQNVDGGWGLHIEGHST  1
            P+FL+  L+I L V G++N +L  EHQKEI RY+YNHQN DGGWGLHIEG ST
Sbjct  122  PMFLMPGLLITLYVTGSLNTVLSPEHQKEIRRYLYNHQNEDGGWGLHIEGPST  174



>gb|AAT38892.1| cycloartenol synthase [Avena ventricosa]
Length=759

 Score = 80.9 bits (198),  Expect = 6e-16, Method: Composition-based stats.
 Identities = 35/53 (66%), Positives = 42/53 (79%), Gaps = 0/53 (0%)
 Frame = -1

Query  159  PLFLLHCLIIGLSVMGTINAILQEEHQKEILRYIYNHQNVDGGWGLHIEGHST  1
            P+FL+  L+I L V G++N +L  EHQKEI RY+YNHQN DGGWGLHIEG ST
Sbjct  122  PMFLMPGLLITLYVTGSLNTVLSPEHQKEIRRYLYNHQNEDGGWGLHIEGPST  174



>gb|AAT38890.1| cycloartenol synthase [Avena prostrata]
Length=759

 Score = 80.9 bits (198),  Expect = 6e-16, Method: Composition-based stats.
 Identities = 35/53 (66%), Positives = 42/53 (79%), Gaps = 0/53 (0%)
 Frame = -1

Query  159  PLFLLHCLIIGLSVMGTINAILQEEHQKEILRYIYNHQNVDGGWGLHIEGHST  1
            P+FL+  L+I L V G++N +L  EHQKEI RY+YNHQN DGGWGLHIEG ST
Sbjct  122  PMFLMPGLLITLYVTGSLNTVLSPEHQKEIRRYLYNHQNEDGGWGLHIEGPST  174



>ref|XP_002513298.1| Cycloartenol synthase, putative [Ricinus communis]
 gb|EEF48701.1| Cycloartenol synthase, putative [Ricinus communis]
Length=744

 Score = 80.9 bits (198),  Expect = 6e-16, Method: Composition-based stats.
 Identities = 35/53 (66%), Positives = 42/53 (79%), Gaps = 0/53 (0%)
 Frame = -1

Query  159  PLFLLHCLIIGLSVMGTINAILQEEHQKEILRYIYNHQNVDGGWGLHIEGHST  1
            PLF L  L++ + + G ++ IL  EH+KEILRYIYNHQN DGGWGLHIEGHST
Sbjct  123  PLFFLPPLVMCMYITGHLDTILPSEHRKEILRYIYNHQNEDGGWGLHIEGHST  175



>emb|CAC84559.1| cycloartenol synthase [Avena strigosa]
 gb|ADB83310.1| cycloartenol synthase [Avena strigosa]
Length=759

 Score = 80.9 bits (198),  Expect = 6e-16, Method: Composition-based stats.
 Identities = 35/53 (66%), Positives = 42/53 (79%), Gaps = 0/53 (0%)
 Frame = -1

Query  159  PLFLLHCLIIGLSVMGTINAILQEEHQKEILRYIYNHQNVDGGWGLHIEGHST  1
            P+FL+  L+I L V G++N +L  EHQKEI RY+YNHQN DGGWGLHIEG ST
Sbjct  122  PMFLMPGLLITLYVTGSLNTVLSPEHQKEIRRYLYNHQNEDGGWGLHIEGPST  174



>gb|EYU30432.1| hypothetical protein MIMGU_mgv1a021184mg, partial [Erythranthe 
guttata]
Length=311

 Score = 78.2 bits (191),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 37/53 (70%), Positives = 41/53 (77%), Gaps = 0/53 (0%)
 Frame = -1

Query  159  PLFLLHCLIIGLSVMGTINAILQEEHQKEILRYIYNHQNVDGGWGLHIEGHST  1
            PLF L  LIIGL VM  +  IL  EH++EI RYIYNHQNVDGGWGLHIEG S+
Sbjct  128  PLFFLPELIIGLYVMDMLETILPNEHKREICRYIYNHQNVDGGWGLHIEGSSS  180



>sp|Q6BE25.1|CAS1_CUCPE RecName: Full=Cycloartenol synthase [Cucurbita pepo]
 dbj|BAD34644.1| cycloartenol synthase [Cucurbita pepo]
Length=766

 Score = 80.9 bits (198),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 35/53 (66%), Positives = 43/53 (81%), Gaps = 0/53 (0%)
 Frame = -1

Query  159  PLFLLHCLIIGLSVMGTINAILQEEHQKEILRYIYNHQNVDGGWGLHIEGHST  1
            P+FL+  L+I LS+ G +NA+L  EHQ+EI RY+YNHQN DGGWGLHIEG ST
Sbjct  129  PMFLIPGLVITLSITGALNAVLSTEHQREICRYLYNHQNKDGGWGLHIEGPST  181



>gb|AAT38888.1| cycloartenol synthase [Avena longiglumis]
Length=759

 Score = 80.9 bits (198),  Expect = 6e-16, Method: Composition-based stats.
 Identities = 35/53 (66%), Positives = 42/53 (79%), Gaps = 0/53 (0%)
 Frame = -1

Query  159  PLFLLHCLIIGLSVMGTINAILQEEHQKEILRYIYNHQNVDGGWGLHIEGHST  1
            P+FL+  L+I L V G++N +L  EHQKEI RY+YNHQN DGGWGLHIEG ST
Sbjct  122  PMFLMPGLLITLYVTGSLNTVLSPEHQKEIRRYLYNHQNEDGGWGLHIEGPST  174



>gb|KCW70930.1| hypothetical protein EUGRSUZ_F04043 [Eucalyptus grandis]
Length=628

 Score = 80.5 bits (197),  Expect = 6e-16, Method: Composition-based stats.
 Identities = 33/53 (62%), Positives = 42/53 (79%), Gaps = 0/53 (0%)
 Frame = -1

Query  159  PLFLLHCLIIGLSVMGTINAILQEEHQKEILRYIYNHQNVDGGWGLHIEGHST  1
            PL+ L  L++G+ + G +NA+   EH+KEILRY+YNHQN DGGWG HIEGHST
Sbjct  105  PLYFLPPLVMGVYITGHLNAVFPAEHRKEILRYLYNHQNGDGGWGFHIEGHST  157



>ref|XP_003610947.1| Cycloartenol synthase [Medicago truncatula]
 gb|AES93905.1| cycloartenol synthase [Medicago truncatula]
Length=757

 Score = 80.9 bits (198),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 35/53 (66%), Positives = 44/53 (83%), Gaps = 0/53 (0%)
 Frame = -1

Query  159  PLFLLHCLIIGLSVMGTINAILQEEHQKEILRYIYNHQNVDGGWGLHIEGHST  1
            P+FLL  L+I LS+ G +NA+L +EH+KE+ RY+YNHQN DGGWGLHIEG ST
Sbjct  121  PMFLLPGLVITLSITGALNAVLTDEHRKEMRRYLYNHQNKDGGWGLHIEGPST  173



>gb|AAT38889.1| cycloartenol synthase [Avena longiglumis]
Length=759

 Score = 80.9 bits (198),  Expect = 6e-16, Method: Composition-based stats.
 Identities = 35/53 (66%), Positives = 42/53 (79%), Gaps = 0/53 (0%)
 Frame = -1

Query  159  PLFLLHCLIIGLSVMGTINAILQEEHQKEILRYIYNHQNVDGGWGLHIEGHST  1
            P+FL+  L+I L V G++N +L  EHQKEI RY+YNHQN DGGWGLHIEG ST
Sbjct  122  PMFLMPGLLITLYVTGSLNTVLSPEHQKEIRRYLYNHQNEDGGWGLHIEGPST  174



>gb|ABX75046.1| cycloartenol synthase 1 [Polygala tenuifolia]
Length=761

 Score = 80.9 bits (198),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 35/53 (66%), Positives = 43/53 (81%), Gaps = 0/53 (0%)
 Frame = -1

Query  159  PLFLLHCLIIGLSVMGTINAILQEEHQKEILRYIYNHQNVDGGWGLHIEGHST  1
            PLFL+  L+I LS+ G  NA+L E+H+KE+ RY+YN QN DGGWGLHIEGHST
Sbjct  125  PLFLMPGLVITLSITGAPNAVLSEQHRKEMCRYLYNRQNKDGGWGLHIEGHST  177



>ref|XP_011019951.1| PREDICTED: LOW QUALITY PROTEIN: cycloartenol synthase-like [Populus 
euphratica]
Length=769

 Score = 80.9 bits (198),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 35/53 (66%), Positives = 45/53 (85%), Gaps = 0/53 (0%)
 Frame = -1

Query  159  PLFLLHCLIIGLSVMGTINAILQEEHQKEILRYIYNHQNVDGGWGLHIEGHST  1
            PLFL+  L+I LS+ G ++A+L +EH+KEI+RY+YNHQN DGGWGLHIEG ST
Sbjct  122  PLFLMPGLVITLSITGALHAVLSDEHKKEIIRYLYNHQNRDGGWGLHIEGPST  174



>gb|KHN32929.1| Cycloartenol synthase [Glycine soja]
Length=757

 Score = 80.5 bits (197),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 35/53 (66%), Positives = 43/53 (81%), Gaps = 0/53 (0%)
 Frame = -1

Query  159  PLFLLHCLIIGLSVMGTINAILQEEHQKEILRYIYNHQNVDGGWGLHIEGHST  1
            P+FL+  L+I LS+ G +N +L EEH+KEI RY+YNHQN DGGWGLHIEG ST
Sbjct  121  PMFLMPGLVITLSITGALNTVLTEEHRKEICRYLYNHQNKDGGWGLHIEGPST  173



>ref|XP_010669612.1| PREDICTED: lupeol synthase-like [Beta vulgaris subsp. vulgaris]
Length=760

 Score = 80.5 bits (197),  Expect = 7e-16, Method: Composition-based stats.
 Identities = 37/52 (71%), Positives = 40/52 (77%), Gaps = 0/52 (0%)
 Frame = -1

Query  156  LFLLHCLIIGLSVMGTINAILQEEHQKEILRYIYNHQNVDGGWGLHIEGHST  1
            LFLL  L+I L + G I+ IL  EHQ EI RYIYNHQN DGGWGLHIEGHST
Sbjct  122  LFLLPPLVIALYISGDIDRILSPEHQTEIKRYIYNHQNEDGGWGLHIEGHST  173



>ref|XP_003516849.1| PREDICTED: cycloartenol synthase [Glycine max]
Length=757

 Score = 80.5 bits (197),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 35/53 (66%), Positives = 43/53 (81%), Gaps = 0/53 (0%)
 Frame = -1

Query  159  PLFLLHCLIIGLSVMGTINAILQEEHQKEILRYIYNHQNVDGGWGLHIEGHST  1
            P+FL+  L+I LS+ G +N +L EEH+KEI RY+YNHQN DGGWGLHIEG ST
Sbjct  121  PMFLMPGLVITLSITGALNTVLTEEHRKEICRYLYNHQNKDGGWGLHIEGPST  173



>ref|XP_010095206.1| Lupeol synthase [Morus notabilis]
 gb|EXB58667.1| Lupeol synthase [Morus notabilis]
Length=788

 Score = 80.5 bits (197),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 36/53 (68%), Positives = 42/53 (79%), Gaps = 0/53 (0%)
 Frame = -1

Query  159  PLFLLHCLIIGLSVMGTINAILQEEHQKEILRYIYNHQNVDGGWGLHIEGHST  1
            PL  +  L+I L V G +NA+L  EH+KEI+RYIYNHQN DGGWGLHIEGHST
Sbjct  153  PLTAIKALVISLYVTGAVNAVLGPEHRKEIIRYIYNHQNEDGGWGLHIEGHST  205



>ref|NP_001168640.1| hypothetical protein [Zea mays]
 gb|ACN28975.1| unknown [Zea mays]
 gb|AFW70111.1| hypothetical protein ZEAMMB73_823385 [Zea mays]
Length=759

 Score = 80.5 bits (197),  Expect = 8e-16, Method: Composition-based stats.
 Identities = 36/53 (68%), Positives = 41/53 (77%), Gaps = 0/53 (0%)
 Frame = -1

Query  159  PLFLLHCLIIGLSVMGTINAILQEEHQKEILRYIYNHQNVDGGWGLHIEGHST  1
            P+FL+  LII L V G +N +L  EHQKEI RY+YNHQN DGGWGLHIEG ST
Sbjct  119  PMFLMPGLIITLYVTGALNTVLSLEHQKEIRRYLYNHQNEDGGWGLHIEGPST  171



>dbj|BAA86932.1| lupeol synthase [Taraxacum officinale]
Length=758

 Score = 80.5 bits (197),  Expect = 8e-16, Method: Composition-based stats.
 Identities = 37/53 (70%), Positives = 39/53 (74%), Gaps = 0/53 (0%)
 Frame = -1

Query  159  PLFLLHCLIIGLSVMGTINAILQEEHQKEILRYIYNHQNVDGGWGLHIEGHST  1
            PLF L  L+I L V G +N IL   HQ EI RYIYNHQN DGGWGLHIEGHST
Sbjct  122  PLFFLPPLVIALYVTGAMNDILTPAHQLEIKRYIYNHQNEDGGWGLHIEGHST  174



>ref|XP_010091121.1| Lupeol synthase [Morus notabilis]
 gb|EXB42556.1| Lupeol synthase [Morus notabilis]
Length=720

 Score = 80.5 bits (197),  Expect = 8e-16, Method: Composition-based stats.
 Identities = 37/52 (71%), Positives = 41/52 (79%), Gaps = 0/52 (0%)
 Frame = -1

Query  156  LFLLHCLIIGLSVMGTINAILQEEHQKEILRYIYNHQNVDGGWGLHIEGHST  1
            LFLL  L+I L V G INA+   EH+KEI+RYIYNHQN DGGWGLHIEG ST
Sbjct  121  LFLLPPLVITLYVTGAINAVFGPEHRKEIIRYIYNHQNEDGGWGLHIEGPST  172



>dbj|BAE53431.1| cycloartenol synthase [Lotus japonicus]
Length=757

 Score = 80.5 bits (197),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 34/53 (64%), Positives = 44/53 (83%), Gaps = 0/53 (0%)
 Frame = -1

Query  159  PLFLLHCLIIGLSVMGTINAILQEEHQKEILRYIYNHQNVDGGWGLHIEGHST  1
            P+FL+  L+I LS+ G +NA+L +EH+KE+ RY+YNHQN DGGWGLHIEG ST
Sbjct  121  PMFLMPDLVITLSITGALNAVLTDEHRKEMCRYLYNHQNKDGGWGLHIEGPST  173



>ref|XP_002989569.1| hypothetical protein SELMODRAFT_269539 [Selaginella moellendorffii]
 gb|EFJ09445.1| hypothetical protein SELMODRAFT_269539 [Selaginella moellendorffii]
Length=762

 Score = 80.5 bits (197),  Expect = 8e-16, Method: Composition-based stats.
 Identities = 34/53 (64%), Positives = 40/53 (75%), Gaps = 0/53 (0%)
 Frame = -1

Query  159  PLFLLHCLIIGLSVMGTINAILQEEHQKEILRYIYNHQNVDGGWGLHIEGHST  1
            P+FL+  LII L V G IN +L  EH +E+ RY +NHQN DGGWGLHIEGHST
Sbjct  120  PMFLMPGLIIALYVTGAINVVLSPEHHREMCRYFFNHQNEDGGWGLHIEGHST  172



>ref|XP_002964244.1| hypothetical protein SELMODRAFT_266790 [Selaginella moellendorffii]
 gb|EFJ34577.1| hypothetical protein SELMODRAFT_266790 [Selaginella moellendorffii]
Length=762

 Score = 80.5 bits (197),  Expect = 8e-16, Method: Composition-based stats.
 Identities = 34/53 (64%), Positives = 40/53 (75%), Gaps = 0/53 (0%)
 Frame = -1

Query  159  PLFLLHCLIIGLSVMGTINAILQEEHQKEILRYIYNHQNVDGGWGLHIEGHST  1
            P+FL+  LII L V G IN +L  EH +E+ RY +NHQN DGGWGLHIEGHST
Sbjct  120  PMFLMPGLIIALYVTGAINVVLSPEHHREMCRYFFNHQNEDGGWGLHIEGHST  172



>ref|XP_004517133.1| PREDICTED: probable oxidosqualene cyclase-like, partial [Cicer 
arietinum]
Length=201

 Score = 77.0 bits (188),  Expect = 8e-16, Method: Composition-based stats.
 Identities = 33/53 (62%), Positives = 41/53 (77%), Gaps = 0/53 (0%)
 Frame = -1

Query  159  PLFLLHCLIIGLSVMGTINAILQEEHQKEILRYIYNHQNVDGGWGLHIEGHST  1
            PLFL+  L+IGL V G +NA+L  +HQ E+ RY++NHQN DGGWGLHI G ST
Sbjct  99   PLFLMPSLVIGLWVTGALNAVLSPDHQTEMRRYLFNHQNKDGGWGLHIAGPST  151



>gb|KEH27284.1| cycloartenol synthase [Medicago truncatula]
Length=775

 Score = 80.5 bits (197),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 36/53 (68%), Positives = 42/53 (79%), Gaps = 0/53 (0%)
 Frame = -1

Query  159  PLFLLHCLIIGLSVMGTINAILQEEHQKEILRYIYNHQNVDGGWGLHIEGHST  1
            PLFLL  L+IGL V G +NA+L  EHQ E+ RY++NHQN DGGWGLHIEG ST
Sbjct  131  PLFLLPSLVIGLWVTGAVNAVLTPEHQSEMRRYLFNHQNEDGGWGLHIEGPST  183



>sp|O82139.1|CAS1_PANGI RecName: Full=Cycloartenol Synthase [Panax ginseng]
 dbj|BAA33460.1| Cycloartenol Synthase [Panax ginseng]
Length=758

 Score = 80.5 bits (197),  Expect = 8e-16, Method: Composition-based stats.
 Identities = 33/53 (62%), Positives = 43/53 (81%), Gaps = 0/53 (0%)
 Frame = -1

Query  159  PLFLLHCLIIGLSVMGTINAILQEEHQKEILRYIYNHQNVDGGWGLHIEGHST  1
            P+FL+  L+I LS+ G +N +L +EH++EI RY+YNHQN DGGWGLHIEG ST
Sbjct  121  PMFLMPGLVITLSITGVLNVVLSKEHKREICRYLYNHQNRDGGWGLHIEGPST  173



>ref|XP_007023625.1| Cycloartenol synthase 1 [Theobroma cacao]
 gb|EOY26247.1| Cycloartenol synthase 1 [Theobroma cacao]
Length=761

 Score = 80.5 bits (197),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 36/53 (68%), Positives = 43/53 (81%), Gaps = 0/53 (0%)
 Frame = -1

Query  159  PLFLLHCLIIGLSVMGTINAILQEEHQKEILRYIYNHQNVDGGWGLHIEGHST  1
            P+FLL  L+I LSV G +NA+L +EHQ E+ RY+YNHQN DGGWGLHIEG ST
Sbjct  125  PMFLLPGLVITLSVTGALNAVLSKEHQYEMCRYLYNHQNRDGGWGLHIEGPST  177



>ref|XP_004305792.1| PREDICTED: beta-amyrin synthase-like [Fragaria vesca subsp. vesca]
Length=764

 Score = 80.1 bits (196),  Expect = 9e-16, Method: Composition-based stats.
 Identities = 34/53 (64%), Positives = 42/53 (79%), Gaps = 0/53 (0%)
 Frame = -1

Query  159  PLFLLHCLIIGLSVMGTINAILQEEHQKEILRYIYNHQNVDGGWGLHIEGHST  1
            PLF L  L+I + + G +N++  EEH+KEILRY+Y HQN DGGWGLHIEGHST
Sbjct  124  PLFFLPPLVICMYITGHLNSVFPEEHRKEILRYLYYHQNEDGGWGLHIEGHST  176



>ref|XP_009764017.1| PREDICTED: LOW QUALITY PROTEIN: cycloartenol Synthase-like [Nicotiana 
sylvestris]
Length=757

 Score = 80.1 bits (196),  Expect = 9e-16, Method: Composition-based stats.
 Identities = 33/53 (62%), Positives = 43/53 (81%), Gaps = 0/53 (0%)
 Frame = -1

Query  159  PLFLLHCLIIGLSVMGTINAILQEEHQKEILRYIYNHQNVDGGWGLHIEGHST  1
            P+FL+  L+I LSV G ++A+L EEH++EI RY+YNHQN DGGWGLH+E  ST
Sbjct  121  PMFLMPGLVIALSVTGALSAVLSEEHKREICRYLYNHQNSDGGWGLHVESPST  173



>ref|XP_008240807.1| PREDICTED: lupeol synthase-like [Prunus mume]
Length=758

 Score = 80.1 bits (196),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 35/53 (66%), Positives = 43/53 (81%), Gaps = 0/53 (0%)
 Frame = -1

Query  159  PLFLLHCLIIGLSVMGTINAILQEEHQKEILRYIYNHQNVDGGWGLHIEGHST  1
            PLF L   II L V G++NA+L ++HQKE++RY+YNHQN DGGWGLHIEG ST
Sbjct  120  PLFFLPPTIIALYVTGSLNAVLGQQHQKEMIRYLYNHQNEDGGWGLHIEGQST  172



>gb|ABY90140.2| beta-amyrin synthase [Bupleurum chinense]
Length=764

 Score = 80.1 bits (196),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 35/53 (66%), Positives = 40/53 (75%), Gaps = 0/53 (0%)
 Frame = -1

Query  159  PLFLLHCLIIGLSVMGTINAILQEEHQKEILRYIYNHQNVDGGWGLHIEGHST  1
            PLF L  L++ L + G +N +   EHQKEILRYIY HQN DGGWGLHIEGHST
Sbjct  124  PLFFLPPLVMCLYITGHLNTVFPAEHQKEILRYIYCHQNEDGGWGLHIEGHST  176



>ref|XP_010656690.1| PREDICTED: lupeol synthase isoform X3 [Vitis vinifera]
Length=752

 Score = 80.1 bits (196),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 34/53 (64%), Positives = 43/53 (81%), Gaps = 0/53 (0%)
 Frame = -1

Query  159  PLFLLHCLIIGLSVMGTINAILQEEHQKEILRYIYNHQNVDGGWGLHIEGHST  1
            PLF L  L++ L ++G +NA+L  +HQKEI+RYIYNHQN DGGWG+HI GHST
Sbjct  124  PLFFLPPLVLALYIIGAVNAVLSLQHQKEIIRYIYNHQNEDGGWGIHIAGHST  176



>gb|AIW81530.1| cycloartenol synthase protein [Dioscorea composita]
Length=759

 Score = 80.1 bits (196),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 34/53 (64%), Positives = 43/53 (81%), Gaps = 0/53 (0%)
 Frame = -1

Query  159  PLFLLHCLIIGLSVMGTINAILQEEHQKEILRYIYNHQNVDGGWGLHIEGHST  1
            P+FL+  L+I L V G +N +L  +HQ+EI+RY+YNHQN DGGWGLHIEGHST
Sbjct  121  PMFLMPGLVIALYVTGALNTVLSAQHQQEIIRYLYNHQNKDGGWGLHIEGHST  173



>ref|XP_002309028.2| hypothetical protein POPTR_0006s07890g [Populus trichocarpa]
 gb|EEE92551.2| hypothetical protein POPTR_0006s07890g [Populus trichocarpa]
Length=756

 Score = 80.1 bits (196),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 34/53 (64%), Positives = 42/53 (79%), Gaps = 0/53 (0%)
 Frame = -1

Query  159  PLFLLHCLIIGLSVMGTINAILQEEHQKEILRYIYNHQNVDGGWGLHIEGHST  1
            P+FLL  L+I L V G +N IL  +H++E+ RY+YNHQNVDGGWGLHIEG ST
Sbjct  121  PMFLLPGLVICLYVTGALNTILHNQHRQEMCRYLYNHQNVDGGWGLHIEGSST  173



>ref|XP_002269060.2| PREDICTED: lupeol synthase isoform X1 [Vitis vinifera]
Length=757

 Score = 80.1 bits (196),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 34/53 (64%), Positives = 43/53 (81%), Gaps = 0/53 (0%)
 Frame = -1

Query  159  PLFLLHCLIIGLSVMGTINAILQEEHQKEILRYIYNHQNVDGGWGLHIEGHST  1
            PLF L  L++ L ++G +NA+L  +HQKEI+RYIYNHQN DGGWG+HI GHST
Sbjct  124  PLFFLPPLVLALYIIGAVNAVLSLQHQKEIIRYIYNHQNEDGGWGIHIAGHST  176



>ref|XP_002308131.2| cycloartenol synthase family protein [Populus trichocarpa]
 gb|EEE91654.2| cycloartenol synthase family protein [Populus trichocarpa]
Length=760

 Score = 80.1 bits (196),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 34/53 (64%), Positives = 45/53 (85%), Gaps = 0/53 (0%)
 Frame = -1

Query  159  PLFLLHCLIIGLSVMGTINAILQEEHQKEILRYIYNHQNVDGGWGLHIEGHST  1
            P+FL+  L+I LS+ G ++A+L +EH+KEI+RY+YNHQN DGGWGLHIEG ST
Sbjct  122  PMFLMPGLVITLSITGALHAVLSDEHKKEIIRYLYNHQNRDGGWGLHIEGPST  174



>ref|XP_010234655.1| PREDICTED: cycloartenol synthase-like isoform X2 [Brachypodium 
distachyon]
Length=677

 Score = 80.1 bits (196),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 35/52 (67%), Positives = 40/52 (77%), Gaps = 0/52 (0%)
 Frame = -1

Query  156  LFLLHCLIIGLSVMGTINAILQEEHQKEILRYIYNHQNVDGGWGLHIEGHST  1
            LFLL  LI+ L V  ++N +L  EHQKEI RY+YNHQN DGGWGLHIEG ST
Sbjct  121  LFLLPSLIVALHVTESLNTVLSSEHQKEIRRYLYNHQNEDGGWGLHIEGRST  172



>gb|AIK19224.1| triterpene synthase [Eugenia uniflora]
Length=757

 Score = 80.1 bits (196),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 33/53 (62%), Positives = 44/53 (83%), Gaps = 0/53 (0%)
 Frame = -1

Query  159  PLFLLHCLIIGLSVMGTINAILQEEHQKEILRYIYNHQNVDGGWGLHIEGHST  1
            P+FL+  L+I LS+ G +NA+L E+H++E+ RY+YNHQN DGGWGLHIEG ST
Sbjct  121  PMFLMPGLVIALSITGALNAVLSEQHKQEMCRYLYNHQNKDGGWGLHIEGPST  173



>emb|CBI24038.3| unnamed protein product [Vitis vinifera]
Length=801

 Score = 80.1 bits (196),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 34/53 (64%), Positives = 43/53 (81%), Gaps = 0/53 (0%)
 Frame = -1

Query  159  PLFLLHCLIIGLSVMGTINAILQEEHQKEILRYIYNHQNVDGGWGLHIEGHST  1
            PLF L  L++ L ++G +NA+L  +HQKEI+RYIYNHQN DGGWG+HI GHST
Sbjct  168  PLFFLPPLVLALYIIGAVNAVLSLQHQKEIIRYIYNHQNEDGGWGIHIAGHST  220



>ref|XP_006381170.1| hypothetical protein POPTR_0006s07870g [Populus trichocarpa]
 gb|ERP58967.1| hypothetical protein POPTR_0006s07870g [Populus trichocarpa]
Length=738

 Score = 80.1 bits (196),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 34/53 (64%), Positives = 42/53 (79%), Gaps = 0/53 (0%)
 Frame = -1

Query  159  PLFLLHCLIIGLSVMGTINAILQEEHQKEILRYIYNHQNVDGGWGLHIEGHST  1
            P+FLL  L+I L V G +N IL  +H++E+ RY+YNHQNVDGGWGLHIEG ST
Sbjct  121  PMFLLPGLVICLYVTGALNTILHNQHRQEMCRYLYNHQNVDGGWGLHIEGSST  173



>ref|XP_010252186.1| PREDICTED: lupeol synthase-like [Nelumbo nucifera]
 ref|XP_010252187.1| PREDICTED: lupeol synthase-like [Nelumbo nucifera]
Length=755

 Score = 80.1 bits (196),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 33/53 (62%), Positives = 40/53 (75%), Gaps = 0/53 (0%)
 Frame = -1

Query  159  PLFLLHCLIIGLSVMGTINAILQEEHQKEILRYIYNHQNVDGGWGLHIEGHST  1
            P+F L  L+I L + G +N +L  EHQKEI RY+YN QN DGGWGLH+EGHST
Sbjct  120  PIFFLPPLVIALYITGALNTVLSPEHQKEIRRYLYNTQNKDGGWGLHVEGHST  172



>ref|XP_007134028.1| hypothetical protein PHAVU_010G013200g [Phaseolus vulgaris]
 gb|ESW06022.1| hypothetical protein PHAVU_010G013200g [Phaseolus vulgaris]
Length=756

 Score = 80.1 bits (196),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 34/53 (64%), Positives = 43/53 (81%), Gaps = 0/53 (0%)
 Frame = -1

Query  159  PLFLLHCLIIGLSVMGTINAILQEEHQKEILRYIYNHQNVDGGWGLHIEGHST  1
            P+F++  LII L + G +N++L EEH+KEI R+IYNHQN DGGWGLHIEG ST
Sbjct  121  PMFMIPSLIIALYISGAVNSVLTEEHRKEIRRFIYNHQNEDGGWGLHIEGSST  173



>ref|XP_003573823.1| PREDICTED: cycloartenol synthase-like isoform X1 [Brachypodium 
distachyon]
Length=759

 Score = 80.1 bits (196),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 35/52 (67%), Positives = 40/52 (77%), Gaps = 0/52 (0%)
 Frame = -1

Query  156  LFLLHCLIIGLSVMGTINAILQEEHQKEILRYIYNHQNVDGGWGLHIEGHST  1
            LFLL  LI+ L V  ++N +L  EHQKEI RY+YNHQN DGGWGLHIEG ST
Sbjct  121  LFLLPSLIVALHVTESLNTVLSSEHQKEIRRYLYNHQNEDGGWGLHIEGRST  172



>ref|XP_010245756.1| PREDICTED: beta-amyrin synthase-like [Nelumbo nucifera]
Length=763

 Score = 80.1 bits (196),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 36/52 (69%), Positives = 41/52 (79%), Gaps = 0/52 (0%)
 Frame = -1

Query  159  PLFLLHCLIIGLSVMGTINAILQEEHQKEILRYIYNHQNVDGGWGLHIEGHS  4
            PLF L  L+I L + G +N + Q EH+KEILRYIYNHQN DGGWGLHIEGHS
Sbjct  121  PLFFLPPLVICLYITGHLNTVFQAEHRKEILRYIYNHQNEDGGWGLHIEGHS  172



>sp|Q8W3Z4.1|CAS1_BETPL RecName: Full=Cycloartenol synthase [Betula platyphylla]
 dbj|BAB83085.1| cycloartenol synthase [Betula platyphylla]
Length=767

 Score = 80.1 bits (196),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 36/53 (68%), Positives = 43/53 (81%), Gaps = 0/53 (0%)
 Frame = -1

Query  159  PLFLLHCLIIGLSVMGTINAILQEEHQKEILRYIYNHQNVDGGWGLHIEGHST  1
            P+FL+  L+I LS+ GT+NA L +EHQ EI RY+YNHQN DGGWGLHIEG ST
Sbjct  132  PMFLIPGLVITLSITGTLNAFLSKEHQCEICRYLYNHQNEDGGWGLHIEGPST  184



>sp|E2IUA6.1|TARS_KALDA RecName: Full=Taraxerol synthase; Short=KdTAS [Kalanchoe daigremontiana]
 gb|ADK35123.1| taraxerol synthase [Kalanchoe daigremontiana]
Length=779

 Score = 79.7 bits (195),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 34/53 (64%), Positives = 40/53 (75%), Gaps = 0/53 (0%)
 Frame = -1

Query  159  PLFLLHCLIIGLSVMGTINAILQEEHQKEILRYIYNHQNVDGGWGLHIEGHST  1
            PLF L  L++ L + G +N +   EHQ+EILRYIY HQN DGGWGLHIEGHST
Sbjct  141  PLFFLPPLVMCLYITGHLNTVFPAEHQREILRYIYYHQNEDGGWGLHIEGHST  193



>dbj|BAJ91961.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=760

 Score = 79.7 bits (195),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 35/53 (66%), Positives = 41/53 (77%), Gaps = 0/53 (0%)
 Frame = -1

Query  159  PLFLLHCLIIGLSVMGTINAILQEEHQKEILRYIYNHQNVDGGWGLHIEGHST  1
            P+FL+  L+I L V G +N +L  EHQKEI RY+YNHQN DGGWGLHIEG ST
Sbjct  122  PMFLMPGLLIMLHVTGALNTVLSSEHQKEIRRYLYNHQNEDGGWGLHIEGPST  174



>ref|XP_003530475.1| PREDICTED: lupeol synthase isoform 1 [Glycine max]
Length=763

 Score = 79.7 bits (195),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 34/53 (64%), Positives = 42/53 (79%), Gaps = 0/53 (0%)
 Frame = -1

Query  159  PLFLLHCLIIGLSVMGTINAILQEEHQKEILRYIYNHQNVDGGWGLHIEGHST  1
            PLF L  L++ L + G++N +L  EHQKEI+RY+YNHQN DGGWGLHIE HST
Sbjct  120  PLFFLQPLVMALYITGSLNDVLGPEHQKEIIRYLYNHQNEDGGWGLHIESHST  172



>gb|ABY60426.1| cycloartenol synthase [Panax notoginseng]
Length=758

 Score = 79.7 bits (195),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 33/53 (62%), Positives = 43/53 (81%), Gaps = 0/53 (0%)
 Frame = -1

Query  159  PLFLLHCLIIGLSVMGTINAILQEEHQKEILRYIYNHQNVDGGWGLHIEGHST  1
            P+FL+  L+I LS+ G +NA+L +EH+ E+ RY+YNHQN DGGWGLHIEG ST
Sbjct  121  PMFLMPGLVITLSITGALNAVLSKEHKHEMCRYLYNHQNRDGGWGLHIEGPST  173



>ref|XP_010063692.1| PREDICTED: beta-amyrin synthase [Eucalyptus grandis]
 ref|XP_010063693.1| PREDICTED: beta-amyrin synthase [Eucalyptus grandis]
 gb|KCW70922.1| hypothetical protein EUGRSUZ_F04038 [Eucalyptus grandis]
 gb|KCW70923.1| hypothetical protein EUGRSUZ_F04038 [Eucalyptus grandis]
Length=761

 Score = 79.7 bits (195),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 34/53 (64%), Positives = 42/53 (79%), Gaps = 0/53 (0%)
 Frame = -1

Query  159  PLFLLHCLIIGLSVMGTINAILQEEHQKEILRYIYNHQNVDGGWGLHIEGHST  1
            PLF L  L++ + + G ++A+   EH+KEILRYIYNHQN DGGWGLHIEGHST
Sbjct  122  PLFFLPPLVMCVYITGHLDAVFPAEHRKEILRYIYNHQNEDGGWGLHIEGHST  174



>ref|XP_002264289.1| PREDICTED: cycloartenol Synthase [Vitis vinifera]
 emb|CBI24077.3| unnamed protein product [Vitis vinifera]
Length=760

 Score = 79.7 bits (195),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 35/53 (66%), Positives = 44/53 (83%), Gaps = 0/53 (0%)
 Frame = -1

Query  159  PLFLLHCLIIGLSVMGTINAILQEEHQKEILRYIYNHQNVDGGWGLHIEGHST  1
            P+FLL  LII LS+ G +NA+L +EH++E+ RY+YNHQN DGGWGLHIEG ST
Sbjct  121  PMFLLPGLIITLSITGALNAVLSKEHRQEMCRYLYNHQNKDGGWGLHIEGPST  173



>gb|KHN16704.1| Lupeol synthase [Glycine soja]
Length=729

 Score = 79.7 bits (195),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 34/53 (64%), Positives = 42/53 (79%), Gaps = 0/53 (0%)
 Frame = -1

Query  159  PLFLLHCLIIGLSVMGTINAILQEEHQKEILRYIYNHQNVDGGWGLHIEGHST  1
            PLF L  L++ L + G++N +L  EHQKEI+RY+YNHQN DGGWGLHIE HST
Sbjct  126  PLFFLQPLVMALYITGSLNDVLGPEHQKEIIRYLYNHQNEDGGWGLHIESHST  178



>gb|EPS63519.1| cycloartenol synthase, partial [Genlisea aurea]
Length=711

 Score = 79.7 bits (195),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 34/53 (64%), Positives = 42/53 (79%), Gaps = 0/53 (0%)
 Frame = -1

Query  159  PLFLLHCLIIGLSVMGTINAILQEEHQKEILRYIYNHQNVDGGWGLHIEGHST  1
            P+FL+  LII LS+ G ++ +L  EH++EI RYIYNHQN DGGWGLHIEG ST
Sbjct  56   PMFLVPGLIIALSITGALDVVLSTEHRREICRYIYNHQNRDGGWGLHIEGPST  108



>ref|XP_001758555.1| predicted protein [Physcomitrella patens]
 gb|EDQ76533.1| predicted protein [Physcomitrella patens]
Length=761

 Score = 79.7 bits (195),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 33/53 (62%), Positives = 40/53 (75%), Gaps = 0/53 (0%)
 Frame = -1

Query  159  PLFLLHCLIIGLSVMGTINAILQEEHQKEILRYIYNHQNVDGGWGLHIEGHST  1
            P+FL+  L+I L V G +N +L   HQ E+ RY+YNHQN DGGWGLHIEGHST
Sbjct  126  PMFLMPGLVIALYVTGALNTVLTPAHQSEMRRYLYNHQNKDGGWGLHIEGHST  178



>ref|XP_002989509.1| hypothetical protein SELMODRAFT_129950 [Selaginella moellendorffii]
 gb|EFJ09385.1| hypothetical protein SELMODRAFT_129950 [Selaginella moellendorffii]
Length=782

 Score = 79.7 bits (195),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 35/53 (66%), Positives = 41/53 (77%), Gaps = 0/53 (0%)
 Frame = -1

Query  159  PLFLLHCLIIGLSVMGTINAILQEEHQKEILRYIYNHQNVDGGWGLHIEGHST  1
            P+FL+  LII L V G IN +L  EHQ+E+ RY +NHQN DGGWGLHIEGHST
Sbjct  126  PMFLMPGLIIALYVTGAINVVLSPEHQREMCRYFFNHQNEDGGWGLHIEGHST  178



>emb|CDP20858.1| unnamed protein product [Coffea canephora]
Length=730

 Score = 79.7 bits (195),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 35/53 (66%), Positives = 41/53 (77%), Gaps = 0/53 (0%)
 Frame = -1

Query  159  PLFLLHCLIIGLSVMGTINAILQEEHQKEILRYIYNHQNVDGGWGLHIEGHST  1
            PLF +  LI+ L + GTIN +L  EH+KEI+RYIYNHQN DGGWG HIE HST
Sbjct  121  PLFYVPPLIMLLYMSGTINVVLSSEHKKEIMRYIYNHQNKDGGWGFHIEDHST  173



>gb|ABL07607.1| beta-amyrin synthase [Polygala tenuifolia]
Length=762

 Score = 79.7 bits (195),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 34/53 (64%), Positives = 40/53 (75%), Gaps = 0/53 (0%)
 Frame = -1

Query  159  PLFLLHCLIIGLSVMGTINAILQEEHQKEILRYIYNHQNVDGGWGLHIEGHST  1
            PLF +  L+  L + G +N +  EEH+KEILRYIY HQN DGGWGLHIEGHST
Sbjct  122  PLFFMPPLVFCLYITGHLNTVFPEEHRKEILRYIYYHQNEDGGWGLHIEGHST  174



>gb|AFJ19235.1| mixed amyrin synthase [Catharanthus roseus]
Length=762

 Score = 79.7 bits (195),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 33/53 (62%), Positives = 40/53 (75%), Gaps = 0/53 (0%)
 Frame = -1

Query  159  PLFLLHCLIIGLSVMGTINAILQEEHQKEILRYIYNHQNVDGGWGLHIEGHST  1
            P+F    L+I L + G IN IL  EH+KE++RYIYNHQN DGGWG +IEGHST
Sbjct  124  PMFFTPPLLIALYISGAINTILTSEHKKELVRYIYNHQNEDGGWGFYIEGHST  176



>gb|AAS01524.1| cycloartenol synthase [Centella asiatica]
Length=757

 Score = 79.7 bits (195),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 34/53 (64%), Positives = 43/53 (81%), Gaps = 0/53 (0%)
 Frame = -1

Query  159  PLFLLHCLIIGLSVMGTINAILQEEHQKEILRYIYNHQNVDGGWGLHIEGHST  1
            P+FL+  L+I LS+   +NAIL +EH++EI RY+YNHQN DGGWGLHIEG ST
Sbjct  121  PMFLMPGLVITLSITEALNAILSKEHKREICRYLYNHQNRDGGWGLHIEGPST  173



>gb|AAS83469.1| cycloartenol synthase [Bupleurum kaoi]
Length=757

 Score = 79.7 bits (195),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 35/53 (66%), Positives = 43/53 (81%), Gaps = 0/53 (0%)
 Frame = -1

Query  159  PLFLLHCLIIGLSVMGTINAILQEEHQKEILRYIYNHQNVDGGWGLHIEGHST  1
            P+FL+  L+I LS+ G +NA+L +EH+ EI RYIYNHQN DGGWGLHIEG ST
Sbjct  121  PMFLMPGLVITLSITGALNAVLSKEHKHEICRYIYNHQNRDGGWGLHIEGPST  173



>ref|XP_010065064.1| PREDICTED: beta-amyrin synthase-like [Eucalyptus grandis]
Length=698

 Score = 79.3 bits (194),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 33/53 (62%), Positives = 41/53 (77%), Gaps = 0/53 (0%)
 Frame = -1

Query  159  PLFLLHCLIIGLSVMGTINAILQEEHQKEILRYIYNHQNVDGGWGLHIEGHST  1
            PL+ L  L+I + + G +NA+   EH+KEILRY+YNHQN DGGWG HIEGHST
Sbjct  59   PLYFLPPLVICVYITGHLNAVFPAEHRKEILRYLYNHQNGDGGWGFHIEGHST  111



>gb|AEX99665.1| amyrin synthase [Catharanthus roseus]
Length=762

 Score = 79.7 bits (195),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 33/53 (62%), Positives = 40/53 (75%), Gaps = 0/53 (0%)
 Frame = -1

Query  159  PLFLLHCLIIGLSVMGTINAILQEEHQKEILRYIYNHQNVDGGWGLHIEGHST  1
            P+F    L+I L + G IN IL  EH+KE++RYIYNHQN DGGWG +IEGHST
Sbjct  124  PMFFTPPLLIALYISGAINTILTSEHKKELVRYIYNHQNEDGGWGFYIEGHST  176



>emb|CDP15852.1| unnamed protein product [Coffea canephora]
Length=757

 Score = 79.7 bits (195),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 34/53 (64%), Positives = 41/53 (77%), Gaps = 0/53 (0%)
 Frame = -1

Query  159  PLFLLHCLIIGLSVMGTINAILQEEHQKEILRYIYNHQNVDGGWGLHIEGHST  1
            PLF +  L++ L + G +N++   EHQKEILRYIY HQN DGGWGLHIEGHST
Sbjct  122  PLFFVPPLVMCLYITGHLNSVFPAEHQKEILRYIYYHQNEDGGWGLHIEGHST  174



>ref|XP_011019952.1| PREDICTED: cycloartenol synthase 2-like [Populus euphratica]
Length=756

 Score = 79.3 bits (194),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 33/53 (62%), Positives = 42/53 (79%), Gaps = 0/53 (0%)
 Frame = -1

Query  159  PLFLLHCLIIGLSVMGTINAILQEEHQKEILRYIYNHQNVDGGWGLHIEGHST  1
            P+FLL  L+I L V G +N IL  +H++E+ RY+YNHQNVDGGWGLH+EG ST
Sbjct  121  PMFLLPGLVICLYVTGALNTILHNQHRQEMCRYLYNHQNVDGGWGLHVEGSST  173



>ref|XP_009102615.1| PREDICTED: cycloartenol synthase-like [Brassica rapa]
Length=758

 Score = 79.3 bits (194),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 35/53 (66%), Positives = 43/53 (81%), Gaps = 0/53 (0%)
 Frame = -1

Query  159  PLFLLHCLIIGLSVMGTINAILQEEHQKEILRYIYNHQNVDGGWGLHIEGHST  1
            P+FLL  LII LS+ G +N +L E+H+ E+ RY+YNHQN DGGWGLHIEGHST
Sbjct  121  PMFLLPGLIITLSITGAMNTVLSEQHKLEMCRYLYNHQNEDGGWGLHIEGHST  173



>gb|KHN10150.1| Cycloartenol synthase [Glycine soja]
Length=760

 Score = 79.3 bits (194),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 36/52 (69%), Positives = 42/52 (81%), Gaps = 0/52 (0%)
 Frame = -1

Query  159  PLFLLHCLIIGLSVMGTINAILQEEHQKEILRYIYNHQNVDGGWGLHIEGHS  4
            PLFLL  L+IGLSV+G +N IL  EHQ EI RY++NHQN DGGWG+HIEG S
Sbjct  122  PLFLLPGLVIGLSVIGALNEILTPEHQSEIRRYLFNHQNEDGGWGMHIEGSS  173



>emb|CDP12624.1| unnamed protein product [Coffea canephora]
Length=761

 Score = 79.3 bits (194),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 33/53 (62%), Positives = 41/53 (77%), Gaps = 0/53 (0%)
 Frame = -1

Query  159  PLFLLHCLIIGLSVMGTINAILQEEHQKEILRYIYNHQNVDGGWGLHIEGHST  1
            P+F    L+I L + G IN IL +EH+KE++RYIYNHQN DGGWG +IEGHST
Sbjct  123  PMFFTPPLLIALYISGAINTILTKEHKKEMIRYIYNHQNDDGGWGFYIEGHST  175



>sp|Q8W3Z2.1|LUPS_BETPL RecName: Full=Lupeol synthase [Betula platyphylla]
 dbj|BAB83087.1| lupeol synthase [Betula platyphylla]
Length=755

 Score = 79.3 bits (194),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 32/53 (60%), Positives = 38/53 (72%), Gaps = 0/53 (0%)
 Frame = -1

Query  159  PLFLLHCLIIGLSVMGTINAILQEEHQKEILRYIYNHQNVDGGWGLHIEGHST  1
            PLF L   ++ L + G +N I    HQKEI+RY+YNHQN DGGWG HIEGHST
Sbjct  120  PLFFLQPFVMALYITGDLNTIFSPAHQKEIIRYLYNHQNEDGGWGFHIEGHST  172



>ref|XP_002453282.1| hypothetical protein SORBIDRAFT_04g003190 [Sorghum bicolor]
 gb|EES06258.1| hypothetical protein SORBIDRAFT_04g003190 [Sorghum bicolor]
Length=761

 Score = 79.3 bits (194),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 34/53 (64%), Positives = 41/53 (77%), Gaps = 0/53 (0%)
 Frame = -1

Query  159  PLFLLHCLIIGLSVMGTINAILQEEHQKEILRYIYNHQNVDGGWGLHIEGHST  1
            P+FL+  L+I L V G +N +L  EHQKEI RY+YNHQN DGGWG+HIEG ST
Sbjct  121  PMFLMPGLVITLYVTGALNIVLSPEHQKEIRRYLYNHQNEDGGWGMHIEGPST  173



>ref|XP_006850984.1| hypothetical protein AMTR_s00025p00210690 [Amborella trichopoda]
 gb|ERN12565.1| hypothetical protein AMTR_s00025p00210690 [Amborella trichopoda]
Length=761

 Score = 79.3 bits (194),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 35/53 (66%), Positives = 42/53 (79%), Gaps = 0/53 (0%)
 Frame = -1

Query  159  PLFLLHCLIIGLSVMGTINAILQEEHQKEILRYIYNHQNVDGGWGLHIEGHST  1
            P+FL+  L+I L V G +N +L  EH+KEI RY+YNHQN DGGWGLHIEGHST
Sbjct  121  PMFLMPGLVIVLYVTGALNTVLSTEHRKEICRYLYNHQNKDGGWGLHIEGHST  173



>gb|KEH22896.1| cycloartenol synthase [Medicago truncatula]
Length=777

 Score = 79.3 bits (194),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 36/53 (68%), Positives = 42/53 (79%), Gaps = 0/53 (0%)
 Frame = -1

Query  159  PLFLLHCLIIGLSVMGTINAILQEEHQKEILRYIYNHQNVDGGWGLHIEGHST  1
            PLFLL  L+IGL V G+INA+L  EHQ E+ RY++N QN DGGWGLHIEG ST
Sbjct  132  PLFLLPSLVIGLWVTGSINAVLTPEHQTEMRRYLFNQQNKDGGWGLHIEGPST  184



>gb|KHN32928.1| Cycloartenol synthase [Glycine soja]
Length=767

 Score = 79.3 bits (194),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 36/53 (68%), Positives = 42/53 (79%), Gaps = 0/53 (0%)
 Frame = -1

Query  159  PLFLLHCLIIGLSVMGTINAILQEEHQKEILRYIYNHQNVDGGWGLHIEGHST  1
            PLFLL  L+IGLSV G +N +L  EHQ E+ RY++NHQN DGGWGLHIEG ST
Sbjct  123  PLFLLPGLVIGLSVTGVLNVVLTPEHQSEMRRYLFNHQNEDGGWGLHIEGSST  175



>ref|XP_008679955.1| PREDICTED: cycloartenol synthase isoform X2 [Zea mays]
Length=638

 Score = 79.0 bits (193),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 35/52 (67%), Positives = 40/52 (77%), Gaps = 0/52 (0%)
 Frame = -1

Query  156  LFLLHCLIIGLSVMGTINAILQEEHQKEILRYIYNHQNVDGGWGLHIEGHST  1
            +FL+  LII L V G +N +L  EHQKEI RY+YNHQN DGGWGLHIEG ST
Sbjct  1    MFLMPGLIITLYVTGALNTVLSSEHQKEIRRYLYNHQNEDGGWGLHIEGPST  52



>ref|XP_003517615.1| PREDICTED: cycloartenol synthase-like [Glycine max]
Length=767

 Score = 79.3 bits (194),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 36/53 (68%), Positives = 42/53 (79%), Gaps = 0/53 (0%)
 Frame = -1

Query  159  PLFLLHCLIIGLSVMGTINAILQEEHQKEILRYIYNHQNVDGGWGLHIEGHST  1
            PLFLL  L+IGLSV G +N +L  EHQ E+ RY++NHQN DGGWGLHIEG ST
Sbjct  123  PLFLLPGLVIGLSVTGVLNVVLTPEHQSEMRRYLFNHQNEDGGWGLHIEGSST  175



>ref|XP_010520562.1| PREDICTED: lanosterol synthase isoform X2 [Tarenaya hassleriana]
Length=761

 Score = 79.3 bits (194),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 35/53 (66%), Positives = 42/53 (79%), Gaps = 0/53 (0%)
 Frame = -1

Query  159  PLFLLHCLIIGLSVMGTINAILQEEHQKEILRYIYNHQNVDGGWGLHIEGHST  1
            PLFLL  LIIGL V G ++  L ++HQ E+ RY+YNHQN DGGWGLHIEG+ST
Sbjct  121  PLFLLPPLIIGLYVTGALDKTLTQQHQMEMRRYLYNHQNEDGGWGLHIEGNST  173



>sp|Q6BE23.1|OXSC_CUCPE RecName: Full=Probable oxidosqualene cyclase [Cucurbita pepo]
 dbj|BAD34646.1| putative oxidosqualene cyclase [Cucurbita pepo]
Length=759

 Score = 79.3 bits (194),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 34/53 (64%), Positives = 42/53 (79%), Gaps = 0/53 (0%)
 Frame = -1

Query  159  PLFLLHCLIIGLSVMGTINAILQEEHQKEILRYIYNHQNVDGGWGLHIEGHST  1
            PLFLL  L+IGLSV   ++ +L   HQ+E+ RY+YNHQN DGGWGLHIEG+ST
Sbjct  120  PLFLLPGLVIGLSVTKALDTVLSRHHQQEMRRYLYNHQNEDGGWGLHIEGNST  172



>ref|XP_010520561.1| PREDICTED: lanosterol synthase isoform X1 [Tarenaya hassleriana]
Length=769

 Score = 79.3 bits (194),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 35/53 (66%), Positives = 42/53 (79%), Gaps = 0/53 (0%)
 Frame = -1

Query  159  PLFLLHCLIIGLSVMGTINAILQEEHQKEILRYIYNHQNVDGGWGLHIEGHST  1
            PLFLL  LIIGL V G ++  L ++HQ E+ RY+YNHQN DGGWGLHIEG+ST
Sbjct  121  PLFLLPPLIIGLYVTGALDKTLTQQHQMEMRRYLYNHQNEDGGWGLHIEGNST  173



>ref|XP_003570909.1| PREDICTED: cycloartenol synthase-like [Brachypodium distachyon]
Length=775

 Score = 79.3 bits (194),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 34/53 (64%), Positives = 40/53 (75%), Gaps = 0/53 (0%)
 Frame = -1

Query  159  PLFLLHCLIIGLSVMGTINAILQEEHQKEILRYIYNHQNVDGGWGLHIEGHST  1
            P+FLL  L+I L   G ++ +L  EHQKEI RY+YNHQN DGGWGLHIEG ST
Sbjct  131  PMFLLPGLVIALHSTGALDTVLSSEHQKEICRYLYNHQNTDGGWGLHIEGPST  183



>ref|XP_006474653.1| PREDICTED: cycloartenol Synthase-like [Citrus sinensis]
Length=727

 Score = 79.0 bits (193),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 36/53 (68%), Positives = 44/53 (83%), Gaps = 0/53 (0%)
 Frame = -1

Query  159  PLFLLHCLIIGLSVMGTINAILQEEHQKEILRYIYNHQNVDGGWGLHIEGHST  1
            PLFLL  L++GL V G +NAIL  EH++E++RY+YNHQN DGGWGLHIEG ST
Sbjct  126  PLFLLPGLVMGLFVTGALNAILTVEHRREMIRYLYNHQNRDGGWGLHIEGCST  178



>ref|XP_010063690.1| PREDICTED: beta-amyrin synthase-like [Eucalyptus grandis]
Length=761

 Score = 79.0 bits (193),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 33/53 (62%), Positives = 41/53 (77%), Gaps = 0/53 (0%)
 Frame = -1

Query  159  PLFLLHCLIIGLSVMGTINAILQEEHQKEILRYIYNHQNVDGGWGLHIEGHST  1
            PL+ L  L+I + + G +NA+   EH+KEILRY+YNHQN DGGWG HIEGHST
Sbjct  122  PLYFLPPLVICVYITGHLNAVFPAEHRKEILRYLYNHQNGDGGWGFHIEGHST  174



>gb|KHG28038.1| Beta-amyrin synthase [Gossypium arboreum]
Length=693

 Score = 79.0 bits (193),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 33/53 (62%), Positives = 40/53 (75%), Gaps = 0/53 (0%)
 Frame = -1

Query  159  PLFLLHCLIIGLSVMGTINAILQEEHQKEILRYIYNHQNVDGGWGLHIEGHST  1
            PLF L  L+  + + G +N +  EEH++EILRYIY HQN DGGWGLHIEGHST
Sbjct  57   PLFFLPPLVFSMYITGHLNTVFPEEHRREILRYIYYHQNEDGGWGLHIEGHST  109



>dbj|BAB83253.1| cycloartenol synthase [Costus speciosus]
Length=759

 Score = 79.0 bits (193),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 36/53 (68%), Positives = 41/53 (77%), Gaps = 0/53 (0%)
 Frame = -1

Query  159  PLFLLHCLIIGLSVMGTINAILQEEHQKEILRYIYNHQNVDGGWGLHIEGHST  1
            P+FL+  LII L V G +N +L  EHQKEI RY+YNHQN DGGWGLHIEG ST
Sbjct  121  PMFLMPGLIITLYVTGALNTVLTSEHQKEIRRYLYNHQNEDGGWGLHIEGEST  173



>ref|XP_006474339.1| PREDICTED: cycloartenol synthase 2-like isoform X1 [Citrus sinensis]
Length=766

 Score = 79.0 bits (193),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 36/53 (68%), Positives = 44/53 (83%), Gaps = 0/53 (0%)
 Frame = -1

Query  159  PLFLLHCLIIGLSVMGTINAILQEEHQKEILRYIYNHQNVDGGWGLHIEGHST  1
            PLFLL  L++GL V G +NAIL  EH++E++RY+YNHQN DGGWGLHIEG ST
Sbjct  126  PLFLLPGLVMGLFVTGALNAILTVEHRREMIRYLYNHQNRDGGWGLHIEGCST  178



>ref|XP_006453168.1| hypothetical protein CICLE_v10007532mg [Citrus clementina]
 gb|ESR66408.1| hypothetical protein CICLE_v10007532mg [Citrus clementina]
Length=766

 Score = 79.0 bits (193),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 36/53 (68%), Positives = 44/53 (83%), Gaps = 0/53 (0%)
 Frame = -1

Query  159  PLFLLHCLIIGLSVMGTINAILQEEHQKEILRYIYNHQNVDGGWGLHIEGHST  1
            PLFLL  L++GL V G +NAIL  EH++E++RY+YNHQN DGGWGLHIEG ST
Sbjct  126  PLFLLPGLVMGLFVTGALNAILTVEHRREMIRYLYNHQNRDGGWGLHIEGCST  178



>gb|KCW70932.1| hypothetical protein EUGRSUZ_F04049 [Eucalyptus grandis]
Length=720

 Score = 79.0 bits (193),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 32/53 (60%), Positives = 41/53 (77%), Gaps = 0/53 (0%)
 Frame = -1

Query  159  PLFLLHCLIIGLSVMGTINAILQEEHQKEILRYIYNHQNVDGGWGLHIEGHST  1
            PL+ L  L++G+ + G +NA+   EH+K ILRY+YNHQN DGGWG HIEGHST
Sbjct  122  PLYFLPLLVMGVYITGHLNAVFPAEHRKVILRYLYNHQNGDGGWGFHIEGHST  174



>sp|Q8W3Z1.1|BAMS_BETPL RecName: Full=Beta-amyrin synthase [Betula platyphylla]
 dbj|BAB83088.1| beta-amyrin synthase [Betula platyphylla]
Length=779

 Score = 79.0 bits (193),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 34/53 (64%), Positives = 40/53 (75%), Gaps = 0/53 (0%)
 Frame = -1

Query  159  PLFLLHCLIIGLSVMGTINAILQEEHQKEILRYIYNHQNVDGGWGLHIEGHST  1
            PLF L  L++ + + G +N +   EHQKEILRYIY HQN DGGWGLHIEGHST
Sbjct  122  PLFFLPPLVMCMYITGHLNTVFPAEHQKEILRYIYYHQNEDGGWGLHIEGHST  174



>ref|XP_008353332.1| PREDICTED: LOW QUALITY PROTEIN: cycloartenol synthase 2-like 
[Malus domestica]
Length=607

 Score = 78.6 bits (192),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 34/53 (64%), Positives = 43/53 (81%), Gaps = 0/53 (0%)
 Frame = -1

Query  159  PLFLLHCLIIGLSVMGTINAILQEEHQKEILRYIYNHQNVDGGWGLHIEGHST  1
            P+FLL  L+I L++ G +NA+L +EH+KEI RY+YNHQN DGGW LHIEG ST
Sbjct  121  PMFLLPGLVITLTITGALNAVLSDEHKKEICRYLYNHQNKDGGWXLHIEGPST  173



>ref|XP_011006636.1| PREDICTED: beta-amyrin synthase-like [Populus euphratica]
Length=758

 Score = 79.0 bits (193),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 32/53 (60%), Positives = 42/53 (79%), Gaps = 0/53 (0%)
 Frame = -1

Query  159  PLFLLHCLIIGLSVMGTINAILQEEHQKEILRYIYNHQNVDGGWGLHIEGHST  1
            PLFL   LI+ + + G++N +L  +H+KEI+RYIYNHQN DGGWG H+EGHST
Sbjct  121  PLFLTPPLIMVVYLSGSLNTVLSSDHKKEIIRYIYNHQNEDGGWGFHVEGHST  173



>gb|EPS65499.1| beta-amyrin synthase, partial [Genlisea aurea]
Length=754

 Score = 79.0 bits (193),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 33/52 (63%), Positives = 39/52 (75%), Gaps = 0/52 (0%)
 Frame = -1

Query  159  PLFLLHCLIIGLSVMGTINAILQEEHQKEILRYIYNHQNVDGGWGLHIEGHS  4
            PL+ L  L+I L +MG +NA+    HQKEILRY+Y HQN DGGWG HIEGHS
Sbjct  122  PLYFLPPLVISLYIMGHLNAVFPSPHQKEILRYLYCHQNEDGGWGFHIEGHS  173



>ref|XP_002527810.1| cycloartenol synthase, putative [Ricinus communis]
 gb|EEF34562.1| cycloartenol synthase, putative [Ricinus communis]
Length=239

 Score = 75.9 bits (185),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 35/53 (66%), Positives = 40/53 (75%), Gaps = 0/53 (0%)
 Frame = -1

Query  159  PLFLLHCLIIGLSVMGTINAILQEEHQKEILRYIYNHQNVDGGWGLHIEGHST  1
            PLFLL  L+I L V G +N IL + HQ+EI RY+ NHQN DGGWGLHIEG ST
Sbjct  124  PLFLLPGLVISLYVSGVLNVILPDHHQQEIRRYMLNHQNEDGGWGLHIEGSST  176



>ref|XP_011096562.1| PREDICTED: dammarenediol II synthase-like [Sesamum indicum]
 ref|XP_011096564.1| PREDICTED: dammarenediol II synthase-like [Sesamum indicum]
Length=761

 Score = 78.6 bits (192),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 33/53 (62%), Positives = 40/53 (75%), Gaps = 0/53 (0%)
 Frame = -1

Query  159  PLFLLHCLIIGLSVMGTINAILQEEHQKEILRYIYNHQNVDGGWGLHIEGHST  1
            P+F    L+I L + G IN IL  EH+KE++RYIYNHQN DGGWG +IEGHST
Sbjct  123  PMFFTPPLLIALYISGAINTILTSEHKKEMVRYIYNHQNEDGGWGFYIEGHST  175



>ref|XP_010065062.1| PREDICTED: beta-amyrin synthase-like [Eucalyptus grandis]
 gb|KCW70925.1| hypothetical protein EUGRSUZ_F04040 [Eucalyptus grandis]
Length=761

 Score = 78.6 bits (192),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 32/53 (60%), Positives = 41/53 (77%), Gaps = 0/53 (0%)
 Frame = -1

Query  159  PLFLLHCLIIGLSVMGTINAILQEEHQKEILRYIYNHQNVDGGWGLHIEGHST  1
            PL+ L  L++ + + G +NA+   EH+KEILRY+YNHQN DGGWG HIEGHST
Sbjct  122  PLYFLPPLVMCVYITGHLNAVFPAEHRKEILRYLYNHQNGDGGWGFHIEGHST  174



>ref|XP_004139371.1| PREDICTED: isomultiflorenol synthase-like [Cucumis sativus]
Length=762

 Score = 78.6 bits (192),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 33/52 (63%), Positives = 42/52 (81%), Gaps = 0/52 (0%)
 Frame = -1

Query  159  PLFLLHCLIIGLSVMGTINAILQEEHQKEILRYIYNHQNVDGGWGLHIEGHS  4
            PLF +  ++I + VMGT++ IL  EH+KE+LRYIYNHQN DGGWGLH+ GHS
Sbjct  124  PLFYMCPMLICIYVMGTMDTILSPEHKKEMLRYIYNHQNEDGGWGLHVGGHS  175



>ref|XP_009409584.1| PREDICTED: cycloartenol synthase-like [Musa acuminata subsp. 
malaccensis]
Length=759

 Score = 78.6 bits (192),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 36/53 (68%), Positives = 41/53 (77%), Gaps = 0/53 (0%)
 Frame = -1

Query  159  PLFLLHCLIIGLSVMGTINAILQEEHQKEILRYIYNHQNVDGGWGLHIEGHST  1
            P+FL+  LII L V G +N +L  EHQKEI RY+YNHQN DGGWGLHIEG ST
Sbjct  121  PMFLMPGLIITLYVTGALNTVLTPEHQKEIRRYLYNHQNKDGGWGLHIEGTST  173



>ref|XP_007225523.1| hypothetical protein PRUPE_ppa025507mg [Prunus persica]
 gb|EMJ26722.1| hypothetical protein PRUPE_ppa025507mg [Prunus persica]
Length=677

 Score = 78.2 bits (191),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 35/53 (66%), Positives = 41/53 (77%), Gaps = 0/53 (0%)
 Frame = -1

Query  159  PLFLLHCLIIGLSVMGTINAILQEEHQKEILRYIYNHQNVDGGWGLHIEGHST  1
            PLF +  L+I L + G +NA+L  EHQKEI+RYI NHQN DGGWGLHIEG ST
Sbjct  123  PLFFIQPLLIALHITGALNAVLGPEHQKEIIRYICNHQNEDGGWGLHIEGQST  175



>ref|XP_006377610.1| putative oxidosqualene cyclase family protein [Populus trichocarpa]
 gb|ERP55407.1| putative oxidosqualene cyclase family protein [Populus trichocarpa]
Length=755

 Score = 78.6 bits (192),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 32/53 (60%), Positives = 42/53 (79%), Gaps = 0/53 (0%)
 Frame = -1

Query  159  PLFLLHCLIIGLSVMGTINAILQEEHQKEILRYIYNHQNVDGGWGLHIEGHST  1
            PLFL   LI+ + + G++N +L  +H+KEI+RYIYNHQN DGGWG H+EGHST
Sbjct  121  PLFLTPPLIMVVYLSGSLNTVLSSDHKKEIIRYIYNHQNEDGGWGFHVEGHST  173



>ref|XP_003573825.1| PREDICTED: cycloartenol synthase-like isoform X1 [Brachypodium 
distachyon]
Length=760

 Score = 78.6 bits (192),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 34/52 (65%), Positives = 40/52 (77%), Gaps = 0/52 (0%)
 Frame = -1

Query  156  LFLLHCLIIGLSVMGTINAILQEEHQKEILRYIYNHQNVDGGWGLHIEGHST  1
            LFLL  LI+ L V  ++N +L  EHQKE+ RY+YNHQN DGGWGLHIEG ST
Sbjct  122  LFLLPSLIVALHVTESLNTVLSSEHQKEMRRYLYNHQNEDGGWGLHIEGTST  173



>ref|XP_010244586.1| PREDICTED: cycloartenol synthase 2 isoform X2 [Nelumbo nucifera]
Length=617

 Score = 78.2 bits (191),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 35/53 (66%), Positives = 43/53 (81%), Gaps = 0/53 (0%)
 Frame = -1

Query  159  PLFLLHCLIIGLSVMGTINAILQEEHQKEILRYIYNHQNVDGGWGLHIEGHST  1
            P+FLL  LII L + G +NA+L +EHQ+E+ RY+YNHQN DGGWGLHIEG ST
Sbjct  121  PMFLLPGLIIILYITGALNAVLSKEHQREMCRYLYNHQNEDGGWGLHIEGPST  173



>dbj|BAE53430.1| lupeol synthase [Lotus japonicus]
Length=755

 Score = 78.2 bits (191),  Expect = 5e-15, Method: Composition-based stats.
 Identities = 30/53 (57%), Positives = 42/53 (79%), Gaps = 0/53 (0%)
 Frame = -1

Query  159  PLFLLHCLIIGLSVMGTINAILQEEHQKEILRYIYNHQNVDGGWGLHIEGHST  1
            PLF +  L++ L + G+++ +L  +H+KEI+RY+YNHQN DGGWG HIEGHST
Sbjct  120  PLFFVQPLVMALYITGSLDDVLGPQHKKEIIRYLYNHQNEDGGWGFHIEGHST  172



>ref|XP_007202928.1| hypothetical protein PRUPE_ppa016625mg [Prunus persica]
 gb|EMJ04127.1| hypothetical protein PRUPE_ppa016625mg [Prunus persica]
Length=691

 Score = 78.2 bits (191),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 33/53 (62%), Positives = 43/53 (81%), Gaps = 0/53 (0%)
 Frame = -1

Query  159  PLFLLHCLIIGLSVMGTINAILQEEHQKEILRYIYNHQNVDGGWGLHIEGHST  1
            P F L  +II L V G++NA+L ++H+KE++RY+YNHQN DGGWGLHIEG ST
Sbjct  62   PSFFLPSMIIALYVTGSLNAVLGQQHKKEMIRYLYNHQNEDGGWGLHIEGQST  114



>dbj|BAI48072.1| cycloartenol synthase [Polypodiodes niponica]
Length=762

 Score = 78.2 bits (191),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 34/53 (64%), Positives = 44/53 (83%), Gaps = 0/53 (0%)
 Frame = -1

Query  159  PLFLLHCLIIGLSVMGTINAILQEEHQKEILRYIYNHQNVDGGWGLHIEGHST  1
            P+FL+  L+I L V G++N IL E H++E++RY+YNHQN DGGWGLHIEGHST
Sbjct  123  PMFLMPGLVIVLYVTGSLNVILSEAHKEEMIRYLYNHQNKDGGWGLHIEGHST  175



>ref|XP_006436398.1| hypothetical protein CICLE_v10033377mg, partial [Citrus clementina]
 gb|ESR49638.1| hypothetical protein CICLE_v10033377mg, partial [Citrus clementina]
Length=705

 Score = 78.2 bits (191),  Expect = 5e-15, Method: Composition-based stats.
 Identities = 33/53 (62%), Positives = 40/53 (75%), Gaps = 0/53 (0%)
 Frame = -1

Query  159  PLFLLHCLIIGLSVMGTINAILQEEHQKEILRYIYNHQNVDGGWGLHIEGHST  1
            PLF     +I L V G +N++L  EH+KE+LRY YNHQN DGGWGLH+EGHST
Sbjct  106  PLFYNTPFVICLYVTGYLNSVLSSEHRKEMLRYTYNHQNEDGGWGLHVEGHST  158



>ref|XP_010245747.1| PREDICTED: beta-amyrin synthase-like isoform X2 [Nelumbo nucifera]
Length=618

 Score = 77.8 bits (190),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 35/52 (67%), Positives = 41/52 (79%), Gaps = 0/52 (0%)
 Frame = -1

Query  156  LFLLHCLIIGLSVMGTINAILQEEHQKEILRYIYNHQNVDGGWGLHIEGHST  1
            LF L  L++ L + G +N + Q EH+KEILRYIYNHQN DGGWGLHIEGHST
Sbjct  122  LFFLPPLVMCLYITGHLNTVFQAEHRKEILRYIYNHQNEDGGWGLHIEGHST  173



>gb|AFS49705.1| cycloartenol synthase [Paris polyphylla var. yunnanensis]
Length=760

 Score = 78.2 bits (191),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 35/53 (66%), Positives = 42/53 (79%), Gaps = 0/53 (0%)
 Frame = -1

Query  159  PLFLLHCLIIGLSVMGTINAILQEEHQKEILRYIYNHQNVDGGWGLHIEGHST  1
            P+FL+  LII L V+G IN +L  EH++EI RY+YNHQN DGGWGLHIEG ST
Sbjct  121  PMFLMPGLIIALYVIGAINTVLSLEHRREICRYLYNHQNKDGGWGLHIEGQST  173



>ref|XP_007023608.1| Beta-Amyrin Synthase [Theobroma cacao]
 gb|EOY26230.1| Beta-Amyrin Synthase [Theobroma cacao]
Length=758

 Score = 78.2 bits (191),  Expect = 5e-15, Method: Composition-based stats.
 Identities = 33/53 (62%), Positives = 39/53 (74%), Gaps = 0/53 (0%)
 Frame = -1

Query  159  PLFLLHCLIIGLSVMGTINAILQEEHQKEILRYIYNHQNVDGGWGLHIEGHST  1
            PLF L  L+    + G +N +  EEH++EILRYIY HQN DGGWGLHIEGHST
Sbjct  122  PLFFLPPLVFSTYITGHLNTVFPEEHRREILRYIYYHQNEDGGWGLHIEGHST  174



>ref|XP_006396090.1| hypothetical protein EUTSA_v10002412mg [Eutrema salsugineum]
 gb|ESQ36869.1| hypothetical protein EUTSA_v10002412mg [Eutrema salsugineum]
Length=701

 Score = 78.2 bits (191),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 34/53 (64%), Positives = 43/53 (81%), Gaps = 0/53 (0%)
 Frame = -1

Query  159  PLFLLHCLIIGLSVMGTINAILQEEHQKEILRYIYNHQNVDGGWGLHIEGHST  1
            P+FLL  LII LS+ G +N +L E+H++E+ RY+YNHQN DGGWGLHIEG ST
Sbjct  121  PMFLLPGLIITLSITGALNTVLSEQHKQEMRRYLYNHQNEDGGWGLHIEGPST  173



>ref|XP_009786280.1| PREDICTED: lupeol synthase [Nicotiana sylvestris]
Length=755

 Score = 78.2 bits (191),  Expect = 5e-15, Method: Composition-based stats.
 Identities = 34/53 (64%), Positives = 38/53 (72%), Gaps = 0/53 (0%)
 Frame = -1

Query  159  PLFLLHCLIIGLSVMGTINAILQEEHQKEILRYIYNHQNVDGGWGLHIEGHST  1
            PLF L  L++ L V G +NA+L   HQ EI RY YNHQN DGGWG HIEGHST
Sbjct  121  PLFFLPPLVMALYVTGDMNAVLSPAHQMEIKRYTYNHQNEDGGWGFHIEGHST  173



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 519368764968