BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c53407_g1_i1 len=119 path=[1:0-118]

Length=119
                                                                      Score     E

ref|XP_006395260.1|  hypothetical protein EUTSA_v10004156mg           80.5    2e-16   
ref|XP_006290962.1|  hypothetical protein CARUB_v10017078mg           78.6    5e-16   
ref|XP_010514671.1|  PREDICTED: cytochrome P450 85A2-like isoform X1  79.7    5e-16   
ref|XP_010502995.1|  PREDICTED: cytochrome P450 85A2-like isoform X1  79.7    5e-16   
ref|XP_010425768.1|  PREDICTED: cytochrome P450 85A2                  79.3    5e-16   
ref|XP_004141472.1|  PREDICTED: cytochrome P450 85A-like              79.3    6e-16   
ref|XP_008459397.1|  PREDICTED: cytochrome P450 85A-like              79.3    6e-16   
ref|XP_010029401.1|  PREDICTED: cytochrome P450 85A-like              79.3    6e-16   
ref|XP_007215412.1|  hypothetical protein PRUPE_ppa005994mg           79.0    6e-16   
ref|XP_003554965.1|  PREDICTED: cytochrome P450 85A-like              79.3    6e-16   
ref|XP_004304211.1|  PREDICTED: cytochrome P450 85A-like              79.3    7e-16   
ref|XP_010514672.1|  PREDICTED: cytochrome P450 85A2-like isoform X2  79.3    7e-16   
ref|XP_006484352.1|  PREDICTED: cytochrome P450 85A1-like             79.0    7e-16   
ref|XP_010502996.1|  PREDICTED: cytochrome P450 85A2-like isoform X2  79.0    7e-16   
ref|XP_002875528.1|  hypothetical protein ARALYDRAFT_484717           79.0    8e-16   
gb|KDO70317.1|  hypothetical protein CISIN_1g037545mg                 78.2    8e-16   
ref|XP_006290963.1|  hypothetical protein CARUB_v10017078mg           79.0    9e-16   
ref|XP_008230283.1|  PREDICTED: cytochrome P450 85A                   79.0    9e-16   
gb|AAM61160.1|  cytochrome P450 homolog, putative                     79.0    9e-16   Arabidopsis thaliana [mouse-ear cress]
dbj|BAB02270.1|  cytochrome P450                                      79.0    9e-16   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003544008.1|  PREDICTED: cytochrome P450 85A-like              79.0    9e-16   
ref|NP_566852.1|  brassinosteroid-6-oxidase 2                         78.6    9e-16   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009373786.1|  PREDICTED: cytochrome P450 85A                   78.6    1e-15   
emb|CDY19979.1|  BnaA09g02720D                                        78.6    1e-15   
ref|XP_009111802.1|  PREDICTED: cytochrome P450 85A2-like             78.6    1e-15   
ref|XP_009151760.1|  PREDICTED: cytochrome P450 85A2                  78.6    1e-15   
emb|CDX86355.1|  BnaA06g30720D                                        78.6    1e-15   
emb|CDY00084.1|  BnaC09g02170D                                        78.2    1e-15   
gb|KEH25142.1|  cytochrome P450 family protein                        78.2    2e-15   
ref|XP_007151377.1|  hypothetical protein PHAVU_004G041700g           78.2    2e-15   
dbj|BAF56235.1|  cytochrome P450 enzyme                               78.2    2e-15   Pisum sativum [garden pea]
ref|XP_008379447.1|  PREDICTED: cytochrome P450 85A                   77.8    2e-15   
sp|Q69F95.2|C85A_PHAVU  RecName: Full=Cytochrome P450 85A; AltNam...  77.8    2e-15   Phaseolus vulgaris [French bean]
emb|CAN66537.1|  hypothetical protein VITISV_029635                   77.8    2e-15   Vitis vinifera
gb|AAR13307.1|  cytochrome P450                                       77.8    2e-15   Phaseolus vulgaris [French bean]
gb|AFK33468.1|  unknown                                               74.3    2e-15   
ref|NP_001267889.1|  brassinosteroid-6-oxidase                        77.8    2e-15   
ref|XP_006601798.1|  PREDICTED: uncharacterized protein LOC100785...  77.8    2e-15   
emb|CBI16941.3|  unnamed protein product                              77.8    2e-15   
ref|XP_007139430.1|  hypothetical protein PHAVU_008G028800g           77.8    2e-15   
ref|NP_001241912.1|  uncharacterized protein LOC100785414             77.4    2e-15   
gb|KGN54634.1|  hypothetical protein Csa_4G410870                     77.4    3e-15   
ref|XP_006283674.1|  hypothetical protein CARUB_v10004731mg           77.4    3e-15   
ref|XP_004150514.1|  PREDICTED: cytochrome P450 85A-like              77.4    3e-15   
ref|XP_004162150.1|  PREDICTED: LOW QUALITY PROTEIN: cytochrome P...  77.4    3e-15   
gb|ACR20476.1|  steroid C-6 oxidase                                   77.4    3e-15   
gb|KEH21756.1|  cytochrome P450 family protein                        77.4    3e-15   
ref|XP_009759044.1|  PREDICTED: cytochrome P450 85A1-like             77.4    3e-15   
gb|KFK33214.1|  hypothetical protein AALP_AA6G345400                  77.4    3e-15   
gb|KDP24291.1|  hypothetical protein JCGZ_25587                       77.0    3e-15   
ref|XP_008455791.1|  PREDICTED: cytochrome P450 85A-like              77.0    3e-15   
dbj|BAF56236.1|  cytochrome P450 enzyme                               77.0    3e-15   Pisum sativum [garden pea]
ref|XP_006365657.1|  PREDICTED: cytochrome P450 85A3-like             77.0    3e-15   
ref|XP_009609414.1|  PREDICTED: cytochrome P450 85A1-like             77.0    3e-15   
gb|EYU44229.1|  hypothetical protein MIMGU_mgv1a004825mg              77.4    4e-15   
ref|XP_004491895.1|  PREDICTED: cytochrome P450 85A-like              77.0    4e-15   
ref|XP_010553960.1|  PREDICTED: cytochrome P450 85A1-like             77.0    4e-15   
ref|XP_010450845.1|  PREDICTED: cytochrome P450 85A1 isoform X1       77.0    4e-15   
ref|XP_006405673.1|  hypothetical protein EUTSA_v10027742mg           77.0    4e-15   
ref|XP_002868746.1|  brassinosteroid-6-oxidase                        77.0    4e-15   
ref|XP_010441026.1|  PREDICTED: cytochrome P450 85A1-like isoform X1  77.0    4e-15   
ref|XP_003598105.1|  Cytochrome P450 85A1                             77.0    4e-15   
ref|XP_010099314.1|  Cytochrome P450 85A                              77.0    4e-15   
ref|XP_010435805.1|  PREDICTED: cytochrome P450 85A1-like             77.0    4e-15   
ref|XP_004507292.1|  PREDICTED: cytochrome P450 85A-like              77.0    4e-15   
ref|XP_010552428.1|  PREDICTED: cytochrome P450 85A2-like             77.0    4e-15   
ref|NP_198713.3|  brassinosteroid-6-oxidase 1                         76.3    4e-15   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010450846.1|  PREDICTED: cytochrome P450 85A1 isoform X2       76.6    4e-15   
ref|XP_010441027.1|  PREDICTED: cytochrome P450 85A1-like isoform X2  76.6    4e-15   
ref|XP_009333667.1|  PREDICTED: cytochrome P450 85A-like              77.0    4e-15   
gb|KDP41328.1|  hypothetical protein JCGZ_15735                       76.6    6e-15   
ref|XP_011099036.1|  PREDICTED: cytochrome P450 85A1                  76.6    6e-15   
ref|XP_007032850.1|  Brassinosteroid-6-oxidase 2                      76.6    6e-15   
ref|XP_007045811.1|  Brassinosteroid-6-oxidase 2                      76.3    6e-15   
emb|CDP19976.1|  unnamed protein product                              76.3    8e-15   
emb|CDX99676.1|  BnaC04g34330D                                        73.9    8e-15   
ref|NP_974862.1|  brassinosteroid-6-oxidase 1                         75.9    8e-15   Arabidopsis thaliana [mouse-ear cress]
emb|CDY66116.1|  BnaAnng21530D                                        76.3    8e-15   
ref|NP_851105.1|  brassinosteroid-6-oxidase 1                         76.3    9e-15   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009129671.1|  PREDICTED: cytochrome P450 85A2                  75.9    9e-15   
gb|KHN30321.1|  Cytochrome P450 85A                                   75.9    1e-14   
ref|XP_006585805.1|  PREDICTED: cytochrome P450 85A-like              75.9    1e-14   
gb|AJD25206.1|  cytochrome P450 CYP85A1                               75.9    1e-14   
ref|XP_006437886.1|  hypothetical protein CICLE_v10031449mg           75.9    1e-14   
gb|KHG12212.1|  Cytochrome P450                                       75.9    1e-14   
gb|AIU96236.1|  DWARF                                                 73.6    1e-14   
emb|CDY35786.1|  BnaC02g38080D                                        75.5    1e-14   
ref|XP_010260629.1|  PREDICTED: cytochrome P450 85A-like              75.5    1e-14   
gb|KHG03323.1|  Cytochrome P450                                       75.5    1e-14   
emb|CDY15962.1|  BnaA04g11490D                                        75.1    2e-14   
dbj|BAO79854.1|  brassinosteroid-6-oxidase                            75.1    2e-14   
dbj|BAO79853.1|  brassinosteroid-6-oxidase                            75.1    2e-14   
gb|ABR25511.1|  cytochrome p450 85a1                                  71.6    2e-14   Oryza sativa Indica Group [Indian rice]
ref|XP_002525909.1|  cytochrome P450, putative                        74.7    2e-14   Ricinus communis
ref|XP_006430943.1|  hypothetical protein CICLE_v10011662mg           74.7    2e-14   
ref|XP_002273613.1|  PREDICTED: cytochrome P450 85A                   74.7    2e-14   Vitis vinifera
ref|XP_006856403.1|  hypothetical protein AMTR_s00047p00211200        72.8    2e-14   
emb|CAN73647.1|  hypothetical protein VITISV_036841                   74.7    2e-14   Vitis vinifera
ref|XP_009140176.1|  PREDICTED: cytochrome P450 85A1 isoform X1       74.7    3e-14   
ref|XP_009140177.1|  PREDICTED: cytochrome P450 85A1 isoform X2       74.3    3e-14   
emb|CDX99675.1|  BnaC04g34320D                                        74.7    3e-14   
ref|XP_006338341.1|  PREDICTED: cytochrome P450 85A1-like             74.7    3e-14   
gb|ABD62342.1|  6-deoxocastasterone oxidase                           74.3    4e-14   Solanum lycopersicum
emb|CDP00456.1|  unnamed protein product                              74.3    4e-14   
ref|NP_001234263.1|  cytochrome P450 85A1                             74.3    4e-14   
ref|XP_010315840.1|  PREDICTED: cytochrome P450 85A1 isoform X1       73.9    4e-14   
ref|XP_009762275.1|  PREDICTED: cytochrome P450 85A1                  74.3    4e-14   
gb|ABG36709.1|  cytochrome P450 CYP85A1                               73.9    4e-14   Nicotiana tabacum [American tobacco]
ref|XP_009596988.1|  PREDICTED: cytochrome P450 85A1                  73.9    5e-14   
ref|XP_010694086.1|  PREDICTED: cytochrome P450 85A-like              73.9    5e-14   
ref|XP_010032557.1|  PREDICTED: cytochrome P450 85A-like              73.2    6e-14   
ref|NP_001234520.1|  cytochrome P450 85A3                             73.6    7e-14   
ref|XP_011015762.1|  PREDICTED: cytochrome P450 85A1-like             73.2    8e-14   
gb|KCW51956.1|  hypothetical protein EUGRSUZ_J01402                   73.2    9e-14   
ref|XP_010032564.1|  PREDICTED: cytochrome P450 85A-like isoform X2   73.2    9e-14   
ref|XP_010032561.1|  PREDICTED: cytochrome P450 85A-like isoform X2   73.2    1e-13   
ref|XP_010041020.1|  PREDICTED: cytochrome P450 85A-like              73.2    1e-13   
ref|XP_010528424.1|  PREDICTED: cytochrome P450 85A2-like             73.2    1e-13   
ref|XP_002305393.1|  hypothetical protein POPTR_0004s11680g           72.8    1e-13   Populus trichocarpa [western balsam poplar]
gb|ABH01181.1|  brassinosteroid-6-oxidase                             72.8    1e-13   Hordeum vulgare subsp. vulgare [barley]
gb|AEG64639.1|  brassinosteroid C6-oxidase                            72.8    1e-13   
ref|XP_006373390.1|  brassinosteroid-6-oxidase family protein         72.8    1e-13   
gb|AGY46369.1|  brassinosteroid-6-oxidase                             72.8    1e-13   
ref|XP_011021067.1|  PREDICTED: cytochrome P450 85A                   72.8    1e-13   
gb|KHG06695.1|  Cytochrome P450                                       72.8    1e-13   
dbj|BAK03643.1|  predicted protein                                    72.8    1e-13   
gb|EMS51871.1|  Cytochrome P450 85A1                                  72.0    1e-13   
ref|XP_010032563.1|  PREDICTED: cytochrome P450 85A-like isoform X1   72.8    1e-13   
gb|EMT14731.1|  Cytochrome P450 85A1                                  72.4    1e-13   
ref|XP_010032560.1|  PREDICTED: cytochrome P450 85A-like isoform X1   72.8    2e-13   
gb|EEC75709.1|  hypothetical protein OsI_12535                        72.4    2e-13   Oryza sativa Indica Group [Indian rice]
ref|XP_011008610.1|  PREDICTED: cytochrome P450 85A-like              72.4    2e-13   
ref|XP_002316079.2|  hypothetical protein POPTR_0010s16430g           72.4    2e-13   Populus trichocarpa [western balsam poplar]
gb|EPS66987.1|  hypothetical protein M569_07789                       72.4    2e-13   
gb|EAZ27720.1|  hypothetical protein OsJ_11669                        72.0    2e-13   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003562306.1|  PREDICTED: cytochrome P450 85A1                  72.0    2e-13   
ref|NP_001050623.1|  Os03g0602300                                     72.0    2e-13   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006650284.1|  PREDICTED: cytochrome P450 85A1-like             72.0    2e-13   
ref|XP_011071271.1|  PREDICTED: cytochrome P450 85A-like              71.6    3e-13   
gb|EMS50539.1|  Cytochrome P450 85A1                                  72.0    4e-13   
ref|XP_010923635.1|  PREDICTED: cytochrome P450 85A1-like isoform X2  71.6    4e-13   
ref|XP_008811805.1|  PREDICTED: cytochrome P450 85A1-like             71.6    4e-13   
ref|XP_004982465.1|  PREDICTED: cytochrome P450 85A1-like isoform X1  71.2    5e-13   
ref|XP_004982466.1|  PREDICTED: cytochrome P450 85A1-like isoform X2  70.9    6e-13   
gb|EPS64226.1|  hypothetical protein M569_10555                       69.3    6e-13   
emb|CBI27313.3|  unnamed protein product                              68.2    7e-13   
ref|XP_008786029.1|  PREDICTED: cytochrome P450 85A1-like             70.5    8e-13   
ref|XP_008775849.1|  PREDICTED: cytochrome P450 85A-like              70.1    1e-12   
gb|ABK26932.1|  unknown                                               69.7    1e-12   Picea sitchensis
ref|XP_010937936.1|  PREDICTED: cytochrome P450 85A1                  69.7    1e-12   
gb|AGJ98215.1|  CYP85                                                 69.3    1e-12   
ref|XP_002466841.1|  hypothetical protein SORBIDRAFT_01g015040        69.7    2e-12   Sorghum bicolor [broomcorn]
gb|ACG46988.1|  cytochrome P450 CYP85A1                               69.7    2e-12   Zea mays [maize]
ref|XP_010257975.1|  PREDICTED: cytochrome P450 85A1-like             69.7    2e-12   
ref|XP_010649978.1|  PREDICTED: cytochrome P450 85A1-like             69.3    2e-12   
ref|NP_001131939.1|  uncharacterized protein LOC100193331 precursor   69.7    2e-12   Zea mays [maize]
gb|EMT14730.1|  Cytochrome P450 85A1                                  69.7    2e-12   
gb|AET06165.1|  Dwarf2                                                69.3    2e-12   
gb|EYU42117.1|  hypothetical protein MIMGU_mgv1a022195mg              69.3    2e-12   
ref|XP_009415673.1|  PREDICTED: cytochrome P450 85A-like              69.3    2e-12   
ref|XP_006856402.1|  hypothetical protein AMTR_s00047p00210610        69.3    2e-12   
gb|EMS53012.1|  Cytochrome P450 85A1                                  69.3    2e-12   
ref|XP_004507293.1|  PREDICTED: cytochrome P450 85A-like              68.9    3e-12   
gb|EMT14727.1|  Cytochrome P450 85A1                                  68.6    4e-12   
gb|EMT14728.1|  Cytochrome P450 85A1                                  68.6    5e-12   
ref|XP_009388906.1|  PREDICTED: cytochrome P450 85A-like              67.8    7e-12   
ref|XP_010936440.1|  PREDICTED: cytochrome P450 85A1-like             67.8    9e-12   
ref|XP_008785627.1|  PREDICTED: cytochrome P450 85A1-like             67.4    1e-11   
ref|XP_010939208.1|  PREDICTED: cytochrome P450 85A1-like             67.4    1e-11   
ref|XP_009397228.1|  PREDICTED: cytochrome P450 85A1-like             66.6    2e-11   
ref|XP_010923636.1|  PREDICTED: cytochrome P450 85A1-like isoform X3  66.2    3e-11   
gb|ACK44411.1|  glutamine synthetase                                  65.9    3e-11   Musa ABB Group [cooking banana]
ref|XP_010923634.1|  PREDICTED: cytochrome P450 85A1-like isoform X1  66.2    3e-11   
ref|XP_009402829.1|  PREDICTED: cytochrome P450 85A1-like             65.9    3e-11   
ref|XP_007153492.1|  hypothetical protein PHAVU_003G040300g           65.5    5e-11   
gb|EMT00039.1|  Cytochrome P450 85A1                                  65.1    7e-11   
gb|KHN29966.1|  Cytochrome P450 85A                                   63.9    1e-10   
ref|XP_006575843.1|  PREDICTED: cytochrome P450 85A-like              63.9    2e-10   
ref|XP_010091606.1|  Cytochrome P450 85A                              63.2    4e-10   
gb|KHN05627.1|  Cytochrome P450 85A1                                  56.6    6e-09   
emb|CDX85284.1|  BnaC07g25950D                                        58.2    1e-08   
gb|KEH21757.1|  cytochrome P450 family protein                        58.2    2e-08   
ref|XP_010446800.1|  PREDICTED: 3-epi-6-deoxocathasterone 23-mono...  50.8    2e-06   
gb|AFK34038.1|  unknown                                               51.2    2e-06   
emb|CAA18139.1|  cytochrome P450 like protein (fragment)              51.2    2e-06   Arabidopsis thaliana [mouse-ear cress]
gb|KHG04872.1|  Cytochrome P450 protein                               49.7    3e-06   
ref|XP_010543733.1|  PREDICTED: cytochrome P450 90A1                  52.0    3e-06   
ref|XP_002439427.1|  hypothetical protein SORBIDRAFT_09g006260        52.0    4e-06   Sorghum bicolor [broomcorn]
ref|XP_008649444.1|  PREDICTED: cytochrome P450 90D2-like             51.6    4e-06   
gb|ACG30621.1|  cytochrome P450 CYP90D10.b                            51.6    4e-06   Zea mays [maize]
gb|KEH18339.1|  cytochrome P450 family 90 protein                     51.6    4e-06   
gb|KEH18338.1|  cytochrome P450 family 90 protein                     51.6    4e-06   
ref|XP_004960929.1|  PREDICTED: cytochrome P450 90D2-like             51.6    4e-06   
ref|XP_010451031.1|  PREDICTED: 3-epi-6-deoxocathasterone 23-mono...  50.8    5e-06   
gb|KDP40788.1|  hypothetical protein JCGZ_24787                       50.8    6e-06   
gb|KCW65675.1|  hypothetical protein EUGRSUZ_G03059                   50.8    6e-06   
ref|NP_568002.1|  3-epi-6-deoxocathasterone 23-monooxygenase          51.2    6e-06   Arabidopsis thaliana [mouse-ear cress]
dbj|BAF00083.1|  cytochrome P450                                      51.2    7e-06   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010067524.1|  PREDICTED: cytochrome P450 90A1-like isoform X2  50.8    7e-06   
emb|CAB16850.1|  cytochrome P450 like protein                         50.8    7e-06   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006385357.1|  hypothetical protein POPTR_0003s03030g           50.8    8e-06   
ref|XP_011014715.1|  PREDICTED: 3-epi-6-deoxocathasterone 23-mono...  50.8    8e-06   
ref|XP_011014460.1|  PREDICTED: 3-epi-6-deoxocathasterone 23-mono...  50.8    8e-06   
emb|CDY59695.1|  BnaC07g51130D                                        50.8    8e-06   
ref|XP_010437356.1|  PREDICTED: 3-epi-6-deoxocathasterone 23-mono...  50.8    8e-06   
ref|NP_001289920.1|  3-epi-6-deoxocathasterone 23-monooxygenase-like  50.8    8e-06   
ref|XP_009144986.1|  PREDICTED: 3-epi-6-deoxocathasterone 23-mono...  50.8    9e-06   
emb|CDX75570.1|  BnaA01g01320D                                        50.8    9e-06   
gb|KGN59825.1|  hypothetical protein Csa_3G848830                     50.8    9e-06   
gb|EMT09662.1|  Cytochrome P450 90D2                                  50.1    9e-06   
gb|KHN36065.1|  3-epi-6-deoxocathasterone 23-monooxygenase            50.8    9e-06   
gb|KFK30265.1|  hypothetical protein AALP_AA7G238700                  50.8    9e-06   
dbj|BAA37167.1|  cytochrome P450                                      50.8    9e-06   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006283516.1|  hypothetical protein CARUB_v10004567mg           50.8    9e-06   
ref|XP_003538868.2|  PREDICTED: 3-epi-6-deoxocathasterone 23-mono...  50.4    9e-06   
gb|KHF97864.1|  3-epi-6-deoxocathasterone 23-monooxygenase -like ...  50.4    9e-06   
emb|CDY64922.1|  BnaAnng19730D                                        50.4    1e-05   
ref|XP_009400635.1|  PREDICTED: cytochrome P450 87A3-like             50.4    1e-05   
ref|XP_007158614.1|  hypothetical protein PHAVU_002G167400g           50.4    1e-05   
ref|XP_006412009.1|  hypothetical protein EUTSA_v10024901mg           50.4    1e-05   
ref|XP_009138419.1|  PREDICTED: 3-epi-6-deoxocathasterone 23-mono...  50.4    1e-05   
ref|XP_007024452.1|  Cytochrome P450, putative                        50.4    1e-05   
ref|XP_007046800.1|  Cytochrome P450 superfamily protein              50.4    1e-05   
ref|XP_011016740.1|  PREDICTED: cytochrome P450 90A1-like             48.1    1e-05   
ref|XP_010943062.1|  PREDICTED: LOW QUALITY PROTEIN: abscisic aci...  50.4    1e-05   
ref|XP_011014714.1|  PREDICTED: 3-epi-6-deoxocathasterone 23-mono...  50.4    1e-05   
ref|XP_011014459.1|  PREDICTED: 3-epi-6-deoxocathasterone 23-mono...  50.4    1e-05   
ref|XP_010679812.1|  PREDICTED: 3-epi-6-deoxocathasterone 23-mono...  50.4    1e-05   
emb|CDM81539.1|  unnamed protein product                              50.1    1e-05   
ref|XP_006838682.1|  hypothetical protein AMTR_s00002p00244980        50.1    1e-05   
ref|XP_008447603.1|  PREDICTED: 3-epi-6-deoxocathasterone 23-mono...  50.1    1e-05   
ref|XP_011014713.1|  PREDICTED: 3-epi-6-deoxocathasterone 23-mono...  50.1    1e-05   
ref|XP_011014458.1|  PREDICTED: 3-epi-6-deoxocathasterone 23-mono...  50.1    1e-05   
ref|XP_003572289.1|  PREDICTED: abscisic acid 8'-hydroxylase 2        50.1    1e-05   
ref|XP_004236391.1|  PREDICTED: cytochrome P450 90D2                  50.1    1e-05   
ref|XP_004146852.1|  PREDICTED: LOW QUALITY PROTEIN: 3-epi-6-deox...  50.4    1e-05   
ref|XP_004154871.1|  PREDICTED: 3-epi-6-deoxocathasterone 23-mono...  50.4    1e-05   
gb|KDO65291.1|  hypothetical protein CISIN_1g010923mg                 50.1    2e-05   
ref|XP_006426521.1|  hypothetical protein CICLE_v10025448mg           50.1    2e-05   
ref|XP_008391454.1|  PREDICTED: 3-epi-6-deoxocathasterone 23-mono...  50.1    2e-05   
ref|XP_006426519.1|  hypothetical protein CICLE_v10025448mg           50.1    2e-05   
ref|XP_004510262.1|  PREDICTED: beta-amyrin 11-oxidase-like           50.1    2e-05   
ref|XP_009342078.1|  PREDICTED: cytochrome P450 90D2-like             50.1    2e-05   
ref|XP_009761164.1|  PREDICTED: 3-epi-6-deoxocathasterone 23-mono...  50.1    2e-05   
gb|EYU21380.1|  hypothetical protein MIMGU_mgv1a005297mg              50.1    2e-05   
gb|KDO65296.1|  hypothetical protein CISIN_1g010923mg                 49.3    2e-05   
ref|XP_010275532.1|  PREDICTED: 3-epi-6-deoxocathasterone 23-mono...  49.7    2e-05   
ref|XP_010275533.1|  PREDICTED: 3-epi-6-deoxocathasterone 23-mono...  49.7    2e-05   
ref|XP_009122168.1|  PREDICTED: cytochrome P450 90A1                  49.7    2e-05   
emb|CDX70137.1|  BnaA10g24860D                                        49.7    2e-05   
ref|XP_010275530.1|  PREDICTED: 3-epi-6-deoxocathasterone 23-mono...  49.7    2e-05   
emb|CDX98856.1|  BnaC09g49790D                                        49.7    2e-05   
ref|XP_004512087.1|  PREDICTED: 3-epi-6-deoxocathasterone 23-mono...  49.7    2e-05   
gb|KDO65290.1|  hypothetical protein CISIN_1g010923mg                 49.7    2e-05   
ref|XP_010254685.1|  PREDICTED: 3-epi-6-deoxocathasterone 23-mono...  49.7    2e-05   
gb|KDO65295.1|  hypothetical protein CISIN_1g010923mg                 49.3    2e-05   
gb|ACN34126.1|  unknown                                               48.9    2e-05   Zea mays [maize]
ref|XP_004297603.1|  PREDICTED: 3-epi-6-deoxocathasterone 23-mono...  49.7    2e-05   
ref|XP_008228307.1|  PREDICTED: 3-epi-6-deoxocathasterone 23-mono...  49.7    2e-05   
gb|KDO65293.1|  hypothetical protein CISIN_1g010923mg                 49.7    2e-05   
ref|XP_009367573.1|  PREDICTED: 3-epi-6-deoxocathasterone 23-mono...  49.7    2e-05   
ref|XP_004510368.1|  PREDICTED: 3-epi-6-deoxocathasterone 23-mono...  49.7    2e-05   
ref|XP_006426520.1|  hypothetical protein CICLE_v10025448mg           49.7    2e-05   
dbj|BAF56241.1|  cytochrome P450 enzyme                               49.7    2e-05   Pisum sativum [garden pea]
tpg|DAA52979.1|  TPA: putative cytochrome P450 superfamily protein    48.9    2e-05   
emb|CDX80969.1|  BnaC03g02230D                                        49.7    2e-05   
ref|XP_006466044.1|  PREDICTED: 3-epi-6-deoxocathasterone 23-mono...  49.7    2e-05   
ref|XP_004172831.1|  PREDICTED: cytochrome P450 90A1-like             47.4    2e-05   
gb|AED99877.1|  cytochrome P450                                       49.7    2e-05   
ref|XP_002527414.1|  cytochrome P450, putative                        49.7    2e-05   Ricinus communis
gb|EMS55995.1|  Cytochrome P450 90D2                                  49.3    2e-05   
emb|CDY11332.1|  BnaA03g01680D                                        49.3    2e-05   
gb|KDO65289.1|  hypothetical protein CISIN_1g010923mg                 49.3    2e-05   
ref|XP_009130893.1|  PREDICTED: cytochrome P450 90A1-like             49.3    2e-05   
ref|XP_010689797.1|  PREDICTED: cytochrome P450 90A1                  49.3    2e-05   
gb|ABD64134.1|  cytochrome P450-like protein                          47.8    3e-05   Platanus x hispanica [London plane tree]
ref|XP_010033449.1|  PREDICTED: 3-epi-6-deoxocathasterone 23-mono...  49.3    3e-05   
ref|XP_009400447.1|  PREDICTED: cytochrome P450 87A3-like             49.3    3e-05   
ref|XP_002457181.1|  hypothetical protein SORBIDRAFT_03g002870        49.3    3e-05   Sorghum bicolor [broomcorn]
ref|XP_008337780.1|  PREDICTED: 3-epi-6-deoxocathasterone 23-mono...  49.3    3e-05   
ref|XP_006343136.1|  PREDICTED: 3-epi-6-deoxocathasterone 23-mono...  49.3    3e-05   
ref|XP_004289103.1|  PREDICTED: 3-epi-6-deoxocathasterone 23-mono...  49.3    3e-05   
ref|XP_011082182.1|  PREDICTED: abscisic acid 8'-hydroxylase 1-like   48.9    3e-05   
gb|KDO71050.1|  hypothetical protein CISIN_1g011403mg                 48.9    3e-05   
ref|XP_004158883.1|  PREDICTED: 3-epi-6-deoxocathasterone 23-mono...  48.9    3e-05   
ref|XP_004149982.1|  PREDICTED: 3-epi-6-deoxocathasterone 23-mono...  48.9    3e-05   
ref|XP_006466873.1|  PREDICTED: 3-epi-6-deoxocathasterone 23-mono...  48.9    3e-05   
emb|CDO97177.1|  unnamed protein product                              48.9    3e-05   
gb|EYU37482.1|  hypothetical protein MIMGU_mgv1a006536mg              48.9    3e-05   
ref|XP_006425595.1|  hypothetical protein CICLE_v10025479mg           48.9    3e-05   
ref|XP_003612096.1|  Cytochrome P450 90C1                             48.9    3e-05   
gb|KGN48878.1|  hypothetical protein Csa_6G504590                     48.9    3e-05   
ref|NP_001170664.1|  putative cytochrome P450 superfamily protein     48.9    3e-05   
gb|AFK48792.1|  unknown                                               46.6    3e-05   
ref|XP_008367948.1|  PREDICTED: 3-epi-6-deoxocathasterone 23-mono...  48.9    3e-05   
ref|XP_004968527.1|  PREDICTED: cytochrome P450 90D2-like             48.9    4e-05   
emb|CDY04961.1|  BnaAnng01430D                                        47.8    4e-05   
ref|XP_010107939.1|  Abscisic acid 8'-hydroxylase 4                   48.5    4e-05   
ref|XP_008797787.1|  PREDICTED: cytochrome P450 90D2-like             48.9    4e-05   
ref|XP_010242200.1|  PREDICTED: cytochrome P450 90D2                  48.9    4e-05   
ref|XP_010677091.1|  PREDICTED: ent-kaurenoic acid oxidase 1-like...  48.9    4e-05   
ref|XP_010677090.1|  PREDICTED: ent-kaurenoic acid oxidase 1-like...  48.9    4e-05   
ref|XP_002975946.1|  hypothetical protein SELMODRAFT_104642           48.5    4e-05   
ref|XP_007217520.1|  hypothetical protein PRUPE_ppa024360mg           48.5    4e-05   
ref|NP_001031838.1|  cytochrome P450 90A1                             48.5    4e-05   
ref|XP_008799522.1|  PREDICTED: cytochrome P450 87A3                  48.5    5e-05   
ref|XP_006645602.1|  PREDICTED: cytochrome P450 90D2-like             48.5    5e-05   
ref|XP_002968540.1|  hypothetical protein SELMODRAFT_89153            48.5    5e-05   
ref|XP_006660205.1|  PREDICTED: abscisic acid 8'-hydroxylase 2-like   48.1    5e-05   
ref|XP_011009162.1|  PREDICTED: 3-epi-6-deoxocathasterone 23-mono...  48.1    5e-05   
ref|XP_009388562.1|  PREDICTED: cytochrome P450 90D2-like isoform X2  48.5    5e-05   
ref|XP_009775493.1|  PREDICTED: abscisic acid 8'-hydroxylase 4-like   48.5    5e-05   
gb|ACR20477.1|  steroid 23-alpha-hydroxylase                          48.5    5e-05   
gb|EEE54049.1|  hypothetical protein OsJ_00739                        48.5    5e-05   
dbj|BAD38475.1|  putative cytochrome P450                             48.5    5e-05   
gb|KGN45533.1|  hypothetical protein Csa_7G451390                     48.1    5e-05   
gb|AAZ23260.1|  cytochrome P450 monooxygenase                         48.1    5e-05   
sp|A2Z212.1|ABAH3_ORYSI  RecName: Full=Abscisic acid 8'-hydroxyla...  48.5    6e-05   
ref|NP_001063366.1|  Os09g0457100                                     48.5    6e-05   
ref|XP_011022913.1|  PREDICTED: cytochrome P450 87A3-like isoform X3  48.1    6e-05   
ref|XP_002272143.2|  PREDICTED: cytochrome P450 87A3                  48.1    6e-05   
ref|XP_011009159.1|  PREDICTED: 3-epi-6-deoxocathasterone 23-mono...  48.1    6e-05   
ref|XP_002298408.2|  cytochrome P450 family protein                   48.1    6e-05   
gb|EYU37675.1|  hypothetical protein MIMGU_mgv1a005586mg              48.1    6e-05   
gb|EYU31170.1|  hypothetical protein MIMGU_mgv1a004660mg              48.1    6e-05   
emb|CAR92131.1|  ABA 8'-hydroxylase cytochrome P450                   48.1    6e-05   
ref|XP_011083167.1|  PREDICTED: 3-epi-6-deoxocathasterone 23-mono...  48.1    6e-05   
gb|EAZ43058.1|  hypothetical protein OsJ_27647                        48.1    6e-05   
ref|XP_009631799.1|  PREDICTED: 3-epi-6-deoxocathasterone 23-mono...  48.1    6e-05   
ref|XP_009594382.1|  PREDICTED: abscisic acid 8'-hydroxylase 4-like   48.1    6e-05   
gb|ACN28537.1|  unknown                                               48.1    7e-05   
ref|XP_010452477.1|  PREDICTED: cytochrome P450 90A1                  48.1    7e-05   
gb|ACN25205.1|  unknown                                               48.1    7e-05   
ref|XP_002873219.1|  hypothetical protein ARALYDRAFT_908485           48.1    7e-05   
ref|NP_196188.1|  cytochrome P450 90A1                                48.1    7e-05   
ref|XP_006660696.1|  PREDICTED: abscisic acid 8'-hydroxylase 3-like   48.1    7e-05   
gb|AAF89209.1|AF279252_1  cytochrome P450                             48.1    7e-05   
ref|NP_001042297.1|  Os01g0197100                                     48.1    7e-05   
ref|NP_001130598.1|  uncharacterized protein LOC100191697 precursor   48.1    7e-05   
ref|XP_002462489.1|  hypothetical protein SORBIDRAFT_02g026600        48.1    7e-05   
ref|XP_008670237.1|  PREDICTED: abscisic acid 8'-hydroxylase 3        48.1    7e-05   
gb|AHJ80846.1|  ABA 8'-hydroxylase 2                                  48.1    7e-05   
dbj|BAN81751.1|  ABA 8'-hydroxylase                                   48.1    7e-05   
ref|XP_004957013.1|  PREDICTED: abscisic acid 8'-hydroxylase 3-li...  48.1    7e-05   
gb|ABB71586.1|  ABA 8'-hydroxylase 2                                  48.1    7e-05   
dbj|BAJ86946.1|  predicted protein                                    48.1    7e-05   
ref|XP_009381178.1|  PREDICTED: cytochrome P450 90D2-like isoform X2  48.1    7e-05   
ref|XP_002867019.1|  cytochrome P450                                  48.1    7e-05   
dbj|BAN81752.1|  ABA 8'-hydroxylase                                   48.1    7e-05   
gb|KDO69002.1|  hypothetical protein CISIN_1g011522mg                 47.8    7e-05   
gb|EMT31203.1|  hypothetical protein F775_52698                       48.1    7e-05   
emb|CDO97921.1|  unnamed protein product                              48.1    7e-05   
ref|XP_006435723.1|  hypothetical protein CICLE_v10031576mg           47.8    7e-05   
tpg|DAA40236.1|  TPA: putative cytochrome P450 superfamily protein    48.1    7e-05   
ref|XP_010531063.1|  PREDICTED: 3-epi-6-deoxocathasterone 23-mono...  48.1    7e-05   
ref|XP_004957014.1|  PREDICTED: abscisic acid 8'-hydroxylase 3-li...  48.1    8e-05   
gb|EAY72890.1|  hypothetical protein OsI_00765                        47.8    8e-05   
ref|XP_010941878.1|  PREDICTED: cytochrome P450 90D2-like             47.8    8e-05   
dbj|BAN81750.1|  ABA 8'-hydroxylase                                   48.1    8e-05   
gb|KDO69001.1|  hypothetical protein CISIN_1g011522mg                 47.8    8e-05   
ref|XP_006583017.1|  PREDICTED: 3-epi-6-deoxocathasterone 23-mono...  47.8    8e-05   
ref|XP_010487143.1|  PREDICTED: 3-epi-6-deoxocathasterone 23-mono...  47.8    8e-05   
ref|XP_011072504.1|  PREDICTED: 3-epi-6-deoxocathasterone 23-mono...  47.8    8e-05   
ref|XP_006585520.1|  PREDICTED: 3-epi-6-deoxocathasterone 23-mono...  47.8    8e-05   
ref|XP_009388561.1|  PREDICTED: cytochrome P450 90D2-like isoform X1  47.8    8e-05   
gb|ABC68409.1|  cytochrome P450 monooxygenase CYP90A15                47.4    8e-05   
gb|KHN34728.1|  Cytochrome P450 90A1                                  47.4    8e-05   
ref|XP_007009007.1|  Cytochrome P450 superfamily protein isoform 1    47.8    8e-05   
gb|KDO69000.1|  hypothetical protein CISIN_1g011522mg                 47.8    8e-05   
ref|NP_001275805.1|  uncharacterized protein LOC102608450             47.8    8e-05   
sp|Q09J78.1|ABAH2_ORYSI  RecName: Full=Abscisic acid 8'-hydroxyla...  47.8    8e-05   
ref|NP_001062021.1|  Os08g0472800                                     47.8    8e-05   
gb|KHF99479.1|  Cytochrome P450 protein                               47.8    8e-05   
ref|XP_009125613.1|  PREDICTED: cytochrome P450 90A1-like             47.8    9e-05   
gb|AJA04665.1|  constitutive photomorphogenesis and dwarfism 2        47.8    9e-05   
dbj|BAI44031.1|  ABA 8-hydroxylase                                    47.8    9e-05   
gb|EPS66684.1|  hypothetical protein M569_08091                       47.8    9e-05   
gb|KFK24971.1|  hypothetical protein AALP_AA8G049800                  47.8    9e-05   
gb|ABK30931.1|  brassinosteroid C-3 oxidase                           47.8    9e-05   
ref|NP_001078535.1|  cytochrome P450 90A1                             47.4    9e-05   
ref|XP_006399027.1|  hypothetical protein EUTSA_v10013418mg           47.8    9e-05   
gb|AFW98345.1|  ABA 8'-hydroxylase                                    47.8    9e-05   
ref|XP_010423443.1|  PREDICTED: cytochrome P450 90A1-like             47.8    9e-05   
ref|XP_011022912.1|  PREDICTED: cytochrome P450 87A3-like isoform X2  47.8    9e-05   
emb|CDY23132.1|  BnaC09g18860D                                        47.8    9e-05   
emb|CBI19518.3|  unnamed protein product                              47.8    9e-05   
ref|XP_006287674.1|  hypothetical protein CARUB_v10000884mg           47.8    9e-05   
ref|XP_009414701.1|  PREDICTED: 3-epi-6-deoxocathasterone 23-mono...  47.4    9e-05   
ref|XP_011022914.1|  PREDICTED: cytochrome P450 87A3-like             47.8    9e-05   
ref|XP_011016152.1|  PREDICTED: cytochrome P450 87A3-like             47.4    9e-05   
ref|NP_001274941.1|  ABA 8'-hydroxylase CYP707A2                      47.8    1e-04   
ref|XP_002282788.1|  PREDICTED: abscisic acid 8'-hydroxylase 4        47.8    1e-04   
gb|KHG27235.1|  Abscisic acid 8'-hydroxylase 3                        47.4    1e-04   
emb|CBI25492.3|  unnamed protein product                              47.4    1e-04   
gb|AGH68822.1|  ABA 8' hydroxylase 1                                  47.4    1e-04   
ref|XP_003538460.1|  PREDICTED: cytochrome P450 90A1                  47.4    1e-04   
ref|XP_003529897.1|  PREDICTED: 3-epi-6-deoxocathasterone 23-mono...  47.4    1e-04   
gb|AJD25213.1|  cytochrome P450 CYP90C19                              47.4    1e-04   
gb|AFK48820.1|  unknown                                               46.2    1e-04   
ref|XP_002510669.1|  cytochrome P450, putative                        47.4    1e-04   
ref|XP_010491100.1|  PREDICTED: cytochrome P450 90A1-like             47.4    1e-04   
ref|XP_011005976.1|  PREDICTED: abscisic acid 8'-hydroxylase 4-like   47.4    1e-04   
ref|XP_006384409.1|  cytochrome P450 family protein                   47.4    1e-04   
ref|XP_009381177.1|  PREDICTED: cytochrome P450 90D2-like isoform X1  47.4    1e-04   
ref|XP_007163533.1|  hypothetical protein PHAVU_001G242200g           47.4    1e-04   
ref|XP_003531621.1|  PREDICTED: 3-epi-6-deoxocathasterone 23-mono...  47.4    1e-04   
ref|XP_010465234.1|  PREDICTED: 3-epi-6-deoxocathasterone 23-mono...  47.4    1e-04   
ref|XP_006378663.1|  hypothetical protein POPTR_0010s19710g           47.4    1e-04   
dbj|BAJ87475.1|  predicted protein                                    47.4    1e-04   
gb|AFK79027.1|  cytochrome P450 CYP90D18                              47.4    1e-04   
ref|XP_006340678.1|  PREDICTED: 3-epi-6-deoxocathasterone 23-mono...  47.4    1e-04   
gb|AER08631.1|  cytochrome P450 monooxygenase                         47.4    1e-04   
ref|NP_001291222.1|  cytochrome P450 90A1                             47.4    1e-04   
ref|XP_002270553.2|  PREDICTED: cytochrome P450 90A1                  47.4    1e-04   
ref|XP_002316218.2|  hypothetical protein POPTR_0010s19710g           47.4    1e-04   
gb|KEH20767.1|  cytochrome P450 family 88 protein                     47.4    1e-04   
dbj|BAG68926.1|  cytochrome P450 88D3                                 47.4    1e-04   
ref|XP_006378664.1|  hypothetical protein POPTR_0010s19710g           47.4    1e-04   
ref|XP_009408921.1|  PREDICTED: cytochrome P450 90D2-like             47.4    1e-04   
ref|XP_002311214.1|  hypothetical protein POPTR_0008s06740g           47.4    1e-04   
ref|NP_001234517.1|  ABA 8'-hydroxylase                               47.4    1e-04   
dbj|BAB01922.1|  cytochrome P450-like protein                         47.4    1e-04   
ref|XP_004232446.1|  PREDICTED: 3-epi-6-deoxocathasterone 23-mono...  47.4    1e-04   
ref|XP_011044517.1|  PREDICTED: cytochrome P450 90A1-like             47.4    1e-04   
ref|XP_011083840.1|  PREDICTED: abscisic acid 8'-hydroxylase 4-like   47.4    1e-04   
ref|XP_009414347.1|  PREDICTED: abscisic acid 8'-hydroxylase 3-like   47.0    1e-04   
gb|KCW44517.1|  hypothetical protein EUGRSUZ_L01974                   46.2    1e-04   
ref|XP_009146458.1|  PREDICTED: 3-epi-6-deoxocathasterone 23-mono...  47.0    1e-04   
ref|XP_003565459.1|  PREDICTED: cytochrome P450 90D2-like             47.0    1e-04   
ref|XP_011022911.1|  PREDICTED: cytochrome P450 87A3-like isoform X1  47.4    1e-04   
ref|XP_002534433.1|  cytochrome P450, putative                        46.6    2e-04   
ref|XP_007201968.1|  hypothetical protein PRUPE_ppa004768mg           47.0    2e-04   
gb|KHN39298.1|  3-epi-6-deoxocathasterone 23-monooxygenase            47.0    2e-04   
ref|XP_009381179.1|  PREDICTED: cytochrome P450 90D2-like isoform X3  47.0    2e-04   
ref|XP_008241768.1|  PREDICTED: 3-epi-6-deoxocathasterone 23-mono...  47.0    2e-04   
emb|CDX97511.1|  BnaA05g25680D                                        47.0    2e-04   
ref|XP_008463232.1|  PREDICTED: cytochrome P450 90A1 isoform X1       47.0    2e-04   
ref|XP_009419305.1|  PREDICTED: cytochrome P450 90D2-like isoform X1  47.0    2e-04   
gb|KGN62505.1|  hypothetical protein Csa_2G357280                     47.0    2e-04   
ref|XP_008463233.1|  PREDICTED: cytochrome P450 90A1 isoform X2       47.0    2e-04   
ref|XP_010095101.1|  Cytochrome P450 90A1                             47.0    2e-04   
ref|NP_566462.1|  3-epi-6-deoxocathasterone 23-monooxygenase          47.0    2e-04   
ref|XP_007017235.1|  Abscisic acid 8'-hydroxylase 3                   47.0    2e-04   
ref|XP_010536060.1|  PREDICTED: abscisic acid 8'-hydroxylase 1-like   47.0    2e-04   
dbj|BAJ97704.1|  predicted protein                                    46.2    2e-04   
emb|CDY37485.1|  BnaC01g37470D                                        47.0    2e-04   
gb|KCW64199.1|  hypothetical protein EUGRSUZ_G01853                   46.6    2e-04   
ref|XP_010915214.1|  PREDICTED: cytochrome P450 90D2-like isoform X1  47.0    2e-04   
gb|AFP74115.1|  ABA 8'-hydroxylase CYP707A2                           46.6    2e-04   
gb|AHA85937.1|  abscisic acid 8-hydroxylase 1                         44.7    2e-04   
ref|XP_009419306.1|  PREDICTED: cytochrome P450 90D2-like isoform X2  46.6    2e-04   
gb|ACJ84248.1|  unknown                                               45.4    2e-04   
gb|KGN50649.1|  hypothetical protein Csa_5G202330                     46.6    2e-04   
ref|XP_002510826.1|  cytochrome P450, putative                        46.6    2e-04   
emb|CDP14032.1|  unnamed protein product                              46.6    2e-04   
ref|XP_007141773.1|  hypothetical protein PHAVU_008G224600g           46.6    2e-04   
gb|EYU20018.1|  hypothetical protein MIMGU_mgv1a005728mg              46.6    2e-04   
ref|XP_004149251.1|  PREDICTED: cytochrome P450 90A1-like             47.0    2e-04   
ref|XP_006338854.1|  PREDICTED: cytochrome P450 90A1-like             46.6    2e-04   
ref|XP_007156098.1|  hypothetical protein PHAVU_003G258400g           46.6    2e-04   
ref|XP_010269909.1|  PREDICTED: abscisic acid 8'-hydroxylase 4        46.6    2e-04   
ref|XP_004240946.1|  PREDICTED: cytochrome P450 90A1                  46.6    2e-04   
ref|XP_010106667.1|  3-epi-6-deoxocathasterone 23-monooxygenase       46.6    2e-04   
ref|XP_010068615.1|  PREDICTED: cytochrome P450 87A3-like             46.6    2e-04   
ref|XP_006297518.1|  hypothetical protein CARUB_v10013542mg           46.6    2e-04   
dbj|BAF56237.1|  cytochrome P450 enzyme                               46.6    2e-04   
ref|XP_009601885.1|  PREDICTED: cytochrome P450 90A1                  46.6    2e-04   
ref|XP_002977114.1|  hypothetical protein SELMODRAFT_151754           46.2    2e-04   
ref|XP_011017209.1|  PREDICTED: abscisic acid 8'-hydroxylase 4-li...  46.6    2e-04   
gb|KHG27614.1|  Cytochrome P450                                       46.6    2e-04   
gb|AEQ94120.1|  putative cytochrome P450 protein                      44.7    2e-04   
gb|KFK38721.1|  hypothetical protein AALP_AA3G151300                  46.6    2e-04   
ref|XP_002862758.1|  predicted protein                                46.6    2e-04   
ref|XP_011017208.1|  PREDICTED: abscisic acid 8'-hydroxylase 4-li...  46.6    2e-04   
ref|XP_003629019.1|  Abscisic acid 8'-hydroxylase                     46.6    2e-04   
ref|XP_009761433.1|  PREDICTED: 3-epi-6-deoxocathasterone 23-mono...  46.6    2e-04   
ref|XP_009117496.1|  PREDICTED: 3-epi-6-deoxocathasterone 23-mono...  46.6    2e-04   
ref|XP_008778482.1|  PREDICTED: abscisic acid 8'-hydroxylase 3-like   46.6    2e-04   
gb|AFK44440.1|  unknown                                               46.6    2e-04   
gb|KDP44780.1|  hypothetical protein JCGZ_01280                       46.6    2e-04   
ref|XP_002884985.1|  CYP90D1                                          46.6    2e-04   
ref|XP_010262836.1|  PREDICTED: cytochrome P450 90A1                  46.6    2e-04   
ref|XP_009789229.1|  PREDICTED: cytochrome P450 90A1                  46.6    2e-04   
emb|CAD27417.1|  cytochrome P450                                      46.6    2e-04   
ref|XP_010939422.1|  PREDICTED: abscisic acid 8'-hydroxylase 3-li...  46.6    2e-04   
ref|XP_003629379.1|  Cytochrome P450 CYP90A21                         44.7    2e-04   
ref|XP_011030009.1|  PREDICTED: abscisic acid 8'-hydroxylase 4-like   46.6    2e-04   
ref|XP_002301185.1|  hypothetical protein POPTR_0002s12770g           46.6    2e-04   
ref|XP_006374937.1|  hypothetical protein POPTR_0014s02910g           46.6    2e-04   
dbj|BAG68928.1|  cytochrome P450 88D5                                 46.6    2e-04   
ref|XP_011072199.1|  PREDICTED: abscisic acid 8'-hydroxylase 1-like   46.2    3e-04   
ref|XP_004509492.1|  PREDICTED: abscisic acid 8'-hydroxylase 1-like   46.2    3e-04   
ref|XP_004150884.1|  PREDICTED: abscisic acid 8'-hydroxylase 3-like   45.4    3e-04   
gb|AGJ98214.1|  CPD                                                   46.6    3e-04   
ref|XP_008440770.1|  PREDICTED: 3-epi-6-deoxocathasterone 23-mono...  46.2    3e-04   
ref|XP_010939423.1|  PREDICTED: abscisic acid 8'-hydroxylase 3-li...  46.2    3e-04   
gb|AJD25242.1|  cytochrome P450 CYP707A102                            46.2    3e-04   
ref|XP_006407176.1|  hypothetical protein EUTSA_v10020591mg           46.2    3e-04   
ref|XP_007220390.1|  hypothetical protein PRUPE_ppa005060mg           46.2    3e-04   
ref|XP_008233747.1|  PREDICTED: cytochrome P450 90A1                  46.2    3e-04   



>ref|XP_006395260.1| hypothetical protein EUTSA_v10004156mg [Eutrema salsugineum]
 gb|ESQ32546.1| hypothetical protein EUTSA_v10004156mg [Eutrema salsugineum]
Length=465

 Score = 80.5 bits (197),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 37/39 (95%), Positives = 38/39 (97%), Gaps = 0/39 (0%)
 Frame = -2

Query  118  TRAVIFETSRLATIVNGVLRKTTSDIELNGFLIPKGWRI  2
            TRAVIFETSRLATIVNGVLRKTT D+ELNGFLIPKGWRI
Sbjct  331  TRAVIFETSRLATIVNGVLRKTTHDLELNGFLIPKGWRI  369



>ref|XP_006290962.1| hypothetical protein CARUB_v10017078mg [Capsella rubella]
 gb|EOA23860.1| hypothetical protein CARUB_v10017078mg [Capsella rubella]
Length=360

 Score = 78.6 bits (192),  Expect = 5e-16, Method: Composition-based stats.
 Identities = 36/39 (92%), Positives = 38/39 (97%), Gaps = 0/39 (0%)
 Frame = -2

Query  118  TRAVIFETSRLATIVNGVLRKTTSDIELNGFLIPKGWRI  2
            TRAVIFETSRLATIVNGVLRKTT D+ELNG+LIPKGWRI
Sbjct  226  TRAVIFETSRLATIVNGVLRKTTHDLELNGYLIPKGWRI  264



>ref|XP_010514671.1| PREDICTED: cytochrome P450 85A2-like isoform X1 [Camelina sativa]
Length=497

 Score = 79.7 bits (195),  Expect = 5e-16, Method: Composition-based stats.
 Identities = 36/39 (92%), Positives = 38/39 (97%), Gaps = 0/39 (0%)
 Frame = -2

Query  118  TRAVIFETSRLATIVNGVLRKTTSDIELNGFLIPKGWRI  2
            TRAVIFETSRLATIVNGVLRKTT D+ELNG+LIPKGWRI
Sbjct  331  TRAVIFETSRLATIVNGVLRKTTHDLELNGYLIPKGWRI  369



>ref|XP_010502995.1| PREDICTED: cytochrome P450 85A2-like isoform X1 [Camelina sativa]
Length=497

 Score = 79.7 bits (195),  Expect = 5e-16, Method: Composition-based stats.
 Identities = 36/39 (92%), Positives = 38/39 (97%), Gaps = 0/39 (0%)
 Frame = -2

Query  118  TRAVIFETSRLATIVNGVLRKTTSDIELNGFLIPKGWRI  2
            TRAVIFETSRLATIVNGVLRKTT D+ELNG+LIPKGWRI
Sbjct  331  TRAVIFETSRLATIVNGVLRKTTHDLELNGYLIPKGWRI  369



>ref|XP_010425768.1| PREDICTED: cytochrome P450 85A2 [Camelina sativa]
Length=465

 Score = 79.3 bits (194),  Expect = 5e-16, Method: Composition-based stats.
 Identities = 36/39 (92%), Positives = 38/39 (97%), Gaps = 0/39 (0%)
 Frame = -2

Query  118  TRAVIFETSRLATIVNGVLRKTTSDIELNGFLIPKGWRI  2
            TRAVIFETSRLATIVNGVLRKTT D+ELNG+LIPKGWRI
Sbjct  331  TRAVIFETSRLATIVNGVLRKTTHDLELNGYLIPKGWRI  369



>ref|XP_004141472.1| PREDICTED: cytochrome P450 85A-like [Cucumis sativus]
 gb|KGN52526.1| hypothetical protein Csa_5G641590 [Cucumis sativus]
Length=463

 Score = 79.3 bits (194),  Expect = 6e-16, Method: Composition-based stats.
 Identities = 37/39 (95%), Positives = 38/39 (97%), Gaps = 0/39 (0%)
 Frame = -2

Query  118  TRAVIFETSRLATIVNGVLRKTTSDIELNGFLIPKGWRI  2
            TRAVIFETSRLATIVNGVLRKTT D+ELNGFLIPKGWRI
Sbjct  329  TRAVIFETSRLATIVNGVLRKTTKDMELNGFLIPKGWRI  367



>ref|XP_008459397.1| PREDICTED: cytochrome P450 85A-like [Cucumis melo]
Length=463

 Score = 79.3 bits (194),  Expect = 6e-16, Method: Composition-based stats.
 Identities = 37/39 (95%), Positives = 38/39 (97%), Gaps = 0/39 (0%)
 Frame = -2

Query  118  TRAVIFETSRLATIVNGVLRKTTSDIELNGFLIPKGWRI  2
            TRAVIFETSRLATIVNGVLRKTT D+ELNGFLIPKGWRI
Sbjct  329  TRAVIFETSRLATIVNGVLRKTTKDMELNGFLIPKGWRI  367



>ref|XP_010029401.1| PREDICTED: cytochrome P450 85A-like [Eucalyptus grandis]
 gb|KCW56313.1| hypothetical protein EUGRSUZ_I02054 [Eucalyptus grandis]
Length=465

 Score = 79.3 bits (194),  Expect = 6e-16, Method: Composition-based stats.
 Identities = 36/39 (92%), Positives = 38/39 (97%), Gaps = 0/39 (0%)
 Frame = -2

Query  118  TRAVIFETSRLATIVNGVLRKTTSDIELNGFLIPKGWRI  2
            TRAVIFETSRLAT+VNGVLRKTT D+ELNGFLIPKGWRI
Sbjct  330  TRAVIFETSRLATVVNGVLRKTTKDMELNGFLIPKGWRI  368



>ref|XP_007215412.1| hypothetical protein PRUPE_ppa005994mg [Prunus persica]
 gb|EMJ16611.1| hypothetical protein PRUPE_ppa005994mg [Prunus persica]
Length=433

 Score = 79.0 bits (193),  Expect = 6e-16, Method: Composition-based stats.
 Identities = 36/39 (92%), Positives = 38/39 (97%), Gaps = 0/39 (0%)
 Frame = -2

Query  118  TRAVIFETSRLATIVNGVLRKTTSDIELNGFLIPKGWRI  2
            TRAVIFETSRLATIVNGVLRKTT D+ELNG+LIPKGWRI
Sbjct  297  TRAVIFETSRLATIVNGVLRKTTQDMELNGYLIPKGWRI  335



>ref|XP_003554965.1| PREDICTED: cytochrome P450 85A-like [Glycine max]
 gb|KHN04368.1| Cytochrome P450 85A [Glycine soja]
Length=465

 Score = 79.3 bits (194),  Expect = 6e-16, Method: Composition-based stats.
 Identities = 36/39 (92%), Positives = 38/39 (97%), Gaps = 0/39 (0%)
 Frame = -2

Query  118  TRAVIFETSRLATIVNGVLRKTTSDIELNGFLIPKGWRI  2
            TRAVIFETSRLATIVNGVLRKTT D+ELNG+LIPKGWRI
Sbjct  331  TRAVIFETSRLATIVNGVLRKTTQDMELNGYLIPKGWRI  369



>ref|XP_004304211.1| PREDICTED: cytochrome P450 85A-like [Fragaria vesca subsp. vesca]
Length=478

 Score = 79.3 bits (194),  Expect = 7e-16, Method: Composition-based stats.
 Identities = 37/39 (95%), Positives = 38/39 (97%), Gaps = 0/39 (0%)
 Frame = -2

Query  118  TRAVIFETSRLATIVNGVLRKTTSDIELNGFLIPKGWRI  2
            TRAVIFETSRLATIVNGVLRKTT D+ELNGFLIPKGWRI
Sbjct  344  TRAVIFETSRLATIVNGVLRKTTQDMELNGFLIPKGWRI  382



>ref|XP_010514672.1| PREDICTED: cytochrome P450 85A2-like isoform X2 [Camelina sativa]
Length=465

 Score = 79.3 bits (194),  Expect = 7e-16, Method: Composition-based stats.
 Identities = 36/39 (92%), Positives = 38/39 (97%), Gaps = 0/39 (0%)
 Frame = -2

Query  118  TRAVIFETSRLATIVNGVLRKTTSDIELNGFLIPKGWRI  2
            TRAVIFETSRLATIVNGVLRKTT D+ELNG+LIPKGWRI
Sbjct  331  TRAVIFETSRLATIVNGVLRKTTHDLELNGYLIPKGWRI  369



>ref|XP_006484352.1| PREDICTED: cytochrome P450 85A1-like [Citrus sinensis]
Length=465

 Score = 79.0 bits (193),  Expect = 7e-16, Method: Composition-based stats.
 Identities = 36/39 (92%), Positives = 38/39 (97%), Gaps = 0/39 (0%)
 Frame = -2

Query  118  TRAVIFETSRLATIVNGVLRKTTSDIELNGFLIPKGWRI  2
            TRAVIFETSRLA+IVNGVLRKTT DIELNGF+IPKGWRI
Sbjct  331  TRAVIFETSRLASIVNGVLRKTTKDIELNGFVIPKGWRI  369



>ref|XP_010502996.1| PREDICTED: cytochrome P450 85A2-like isoform X2 [Camelina sativa]
Length=465

 Score = 79.0 bits (193),  Expect = 7e-16, Method: Composition-based stats.
 Identities = 36/39 (92%), Positives = 38/39 (97%), Gaps = 0/39 (0%)
 Frame = -2

Query  118  TRAVIFETSRLATIVNGVLRKTTSDIELNGFLIPKGWRI  2
            TRAVIFETSRLATIVNGVLRKTT D+ELNG+LIPKGWRI
Sbjct  331  TRAVIFETSRLATIVNGVLRKTTHDLELNGYLIPKGWRI  369



>ref|XP_002875528.1| hypothetical protein ARALYDRAFT_484717 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH51787.1| hypothetical protein ARALYDRAFT_484717 [Arabidopsis lyrata subsp. 
lyrata]
Length=465

 Score = 79.0 bits (193),  Expect = 8e-16, Method: Composition-based stats.
 Identities = 36/39 (92%), Positives = 38/39 (97%), Gaps = 0/39 (0%)
 Frame = -2

Query  118  TRAVIFETSRLATIVNGVLRKTTSDIELNGFLIPKGWRI  2
            TRAVIFETSRLATIVNGVLRKTT D+ELNG+LIPKGWRI
Sbjct  331  TRAVIFETSRLATIVNGVLRKTTHDLELNGYLIPKGWRI  369



>gb|KDO70317.1| hypothetical protein CISIN_1g037545mg [Citrus sinensis]
Length=383

 Score = 78.2 bits (191),  Expect = 8e-16, Method: Composition-based stats.
 Identities = 35/39 (90%), Positives = 38/39 (97%), Gaps = 0/39 (0%)
 Frame = -2

Query  118  TRAVIFETSRLATIVNGVLRKTTSDIELNGFLIPKGWRI  2
            TRAVIFETSRLA+IVNGVLRKTT DIELNGF++PKGWRI
Sbjct  249  TRAVIFETSRLASIVNGVLRKTTKDIELNGFVVPKGWRI  287



>ref|XP_006290963.1| hypothetical protein CARUB_v10017078mg, partial [Capsella rubella]
 gb|EOA23861.1| hypothetical protein CARUB_v10017078mg, partial [Capsella rubella]
Length=496

 Score = 79.0 bits (193),  Expect = 9e-16, Method: Composition-based stats.
 Identities = 36/39 (92%), Positives = 38/39 (97%), Gaps = 0/39 (0%)
 Frame = -2

Query  118  TRAVIFETSRLATIVNGVLRKTTSDIELNGFLIPKGWRI  2
            TRAVIFETSRLATIVNGVLRKTT D+ELNG+LIPKGWRI
Sbjct  362  TRAVIFETSRLATIVNGVLRKTTHDLELNGYLIPKGWRI  400



>ref|XP_008230283.1| PREDICTED: cytochrome P450 85A [Prunus mume]
Length=464

 Score = 79.0 bits (193),  Expect = 9e-16, Method: Composition-based stats.
 Identities = 36/39 (92%), Positives = 38/39 (97%), Gaps = 0/39 (0%)
 Frame = -2

Query  118  TRAVIFETSRLATIVNGVLRKTTSDIELNGFLIPKGWRI  2
            TRAVIFETSRLATIVNGVLRKTT D+ELNG+LIPKGWRI
Sbjct  328  TRAVIFETSRLATIVNGVLRKTTQDMELNGYLIPKGWRI  366



>gb|AAM61160.1| cytochrome P450 homolog, putative [Arabidopsis thaliana]
Length=462

 Score = 79.0 bits (193),  Expect = 9e-16, Method: Composition-based stats.
 Identities = 36/39 (92%), Positives = 38/39 (97%), Gaps = 0/39 (0%)
 Frame = -2

Query  118  TRAVIFETSRLATIVNGVLRKTTSDIELNGFLIPKGWRI  2
            TRAVIFETSRLATIVNGVLRKTT D+ELNG+LIPKGWRI
Sbjct  328  TRAVIFETSRLATIVNGVLRKTTHDLELNGYLIPKGWRI  366



>dbj|BAB02270.1| cytochrome P450 [Arabidopsis thaliana]
Length=465

 Score = 79.0 bits (193),  Expect = 9e-16, Method: Composition-based stats.
 Identities = 36/39 (92%), Positives = 38/39 (97%), Gaps = 0/39 (0%)
 Frame = -2

Query  118  TRAVIFETSRLATIVNGVLRKTTSDIELNGFLIPKGWRI  2
            TRAVIFETSRLATIVNGVLRKTT D+ELNG+LIPKGWRI
Sbjct  331  TRAVIFETSRLATIVNGVLRKTTHDLELNGYLIPKGWRI  369



>ref|XP_003544008.1| PREDICTED: cytochrome P450 85A-like [Glycine max]
 gb|KHN08349.1| Cytochrome P450 85A [Glycine soja]
Length=464

 Score = 79.0 bits (193),  Expect = 9e-16, Method: Composition-based stats.
 Identities = 36/39 (92%), Positives = 38/39 (97%), Gaps = 0/39 (0%)
 Frame = -2

Query  118  TRAVIFETSRLATIVNGVLRKTTSDIELNGFLIPKGWRI  2
            TRAVIFETSRLATIVNGVLRKTT D+ELNG+LIPKGWRI
Sbjct  330  TRAVIFETSRLATIVNGVLRKTTQDMELNGYLIPKGWRI  368



>ref|NP_566852.1| brassinosteroid-6-oxidase 2 [Arabidopsis thaliana]
 sp|Q940V4.1|C85A2_ARATH RecName: Full=Cytochrome P450 85A2; AltName: Full=Brassinosteroid-6-oxidase 
2; Short=BR6ox 2; AltName: Full=C6-oxidase 2 
[Arabidopsis thaliana]
 gb|AAK96559.1| AT3g30180/T20F20_6 [Arabidopsis thaliana]
 gb|AAL36078.1| AT3g30180/T20F20_6 [Arabidopsis thaliana]
 dbj|BAC55065.1| brassinosteroid-6-oxidase [Arabidopsis thaliana]
 gb|AEE77620.1| brassinosteroid-6-oxidase 2 [Arabidopsis thaliana]
Length=465

 Score = 78.6 bits (192),  Expect = 9e-16, Method: Composition-based stats.
 Identities = 36/39 (92%), Positives = 38/39 (97%), Gaps = 0/39 (0%)
 Frame = -2

Query  118  TRAVIFETSRLATIVNGVLRKTTSDIELNGFLIPKGWRI  2
            TRAVIFETSRLATIVNGVLRKTT D+ELNG+LIPKGWRI
Sbjct  331  TRAVIFETSRLATIVNGVLRKTTHDLELNGYLIPKGWRI  369



>ref|XP_009373786.1| PREDICTED: cytochrome P450 85A [Pyrus x bretschneideri]
Length=464

 Score = 78.6 bits (192),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 36/39 (92%), Positives = 38/39 (97%), Gaps = 0/39 (0%)
 Frame = -2

Query  118  TRAVIFETSRLATIVNGVLRKTTSDIELNGFLIPKGWRI  2
            TRAVIFETSRLATIVNGVLRKTT D+ELNG+LIPKGWRI
Sbjct  330  TRAVIFETSRLATIVNGVLRKTTQDMELNGYLIPKGWRI  368



>emb|CDY19979.1| BnaA09g02720D [Brassica napus]
Length=465

 Score = 78.6 bits (192),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 36/39 (92%), Positives = 38/39 (97%), Gaps = 0/39 (0%)
 Frame = -2

Query  118  TRAVIFETSRLATIVNGVLRKTTSDIELNGFLIPKGWRI  2
            TRAVIFETSRLATIVNGVLRKTT D+ELNG+LIPKGWRI
Sbjct  331  TRAVIFETSRLATIVNGVLRKTTHDLELNGYLIPKGWRI  369



>ref|XP_009111802.1| PREDICTED: cytochrome P450 85A2-like [Brassica rapa]
Length=465

 Score = 78.6 bits (192),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 36/39 (92%), Positives = 38/39 (97%), Gaps = 0/39 (0%)
 Frame = -2

Query  118  TRAVIFETSRLATIVNGVLRKTTSDIELNGFLIPKGWRI  2
            TRAVIFETSRLATIVNGVLRKTT D+ELNG+LIPKGWRI
Sbjct  331  TRAVIFETSRLATIVNGVLRKTTHDLELNGYLIPKGWRI  369



>ref|XP_009151760.1| PREDICTED: cytochrome P450 85A2 [Brassica rapa]
Length=465

 Score = 78.6 bits (192),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 35/39 (90%), Positives = 38/39 (97%), Gaps = 0/39 (0%)
 Frame = -2

Query  118  TRAVIFETSRLATIVNGVLRKTTSDIELNGFLIPKGWRI  2
            TRAVIFETSRLAT+VNGVLRKTT D+ELNG+LIPKGWRI
Sbjct  331  TRAVIFETSRLATVVNGVLRKTTHDLELNGYLIPKGWRI  369



>emb|CDX86355.1| BnaA06g30720D [Brassica napus]
Length=465

 Score = 78.6 bits (192),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 35/39 (90%), Positives = 38/39 (97%), Gaps = 0/39 (0%)
 Frame = -2

Query  118  TRAVIFETSRLATIVNGVLRKTTSDIELNGFLIPKGWRI  2
            TRAVIFETSRLAT+VNGVLRKTT D+ELNG+LIPKGWRI
Sbjct  331  TRAVIFETSRLATVVNGVLRKTTHDLELNGYLIPKGWRI  369



>emb|CDY00084.1| BnaC09g02170D [Brassica napus]
Length=465

 Score = 78.2 bits (191),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 36/39 (92%), Positives = 38/39 (97%), Gaps = 0/39 (0%)
 Frame = -2

Query  118  TRAVIFETSRLATIVNGVLRKTTSDIELNGFLIPKGWRI  2
            TRAVIFETSRLATIVNGVLRKTT D+ELNG+LIPKGWRI
Sbjct  331  TRAVIFETSRLATIVNGVLRKTTHDLELNGYLIPKGWRI  369



>gb|KEH25142.1| cytochrome P450 family protein [Medicago truncatula]
Length=464

 Score = 78.2 bits (191),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 36/39 (92%), Positives = 38/39 (97%), Gaps = 0/39 (0%)
 Frame = -2

Query  118  TRAVIFETSRLATIVNGVLRKTTSDIELNGFLIPKGWRI  2
            TRAVIFETSRLATIVNGVLRKTT D+ELNG+LIPKGWRI
Sbjct  330  TRAVIFETSRLATIVNGVLRKTTQDMELNGYLIPKGWRI  368



>ref|XP_007151377.1| hypothetical protein PHAVU_004G041700g [Phaseolus vulgaris]
 gb|ESW23371.1| hypothetical protein PHAVU_004G041700g [Phaseolus vulgaris]
Length=463

 Score = 78.2 bits (191),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 36/39 (92%), Positives = 38/39 (97%), Gaps = 0/39 (0%)
 Frame = -2

Query  118  TRAVIFETSRLATIVNGVLRKTTSDIELNGFLIPKGWRI  2
            TRAVIFETSRLATIVNGVLRKTT D+ELNG+LIPKGWRI
Sbjct  329  TRAVIFETSRLATIVNGVLRKTTQDMELNGYLIPKGWRI  367



>dbj|BAF56235.1| cytochrome P450 enzyme [Pisum sativum]
Length=466

 Score = 78.2 bits (191),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 36/39 (92%), Positives = 38/39 (97%), Gaps = 0/39 (0%)
 Frame = -2

Query  118  TRAVIFETSRLATIVNGVLRKTTSDIELNGFLIPKGWRI  2
            TRAVIFETSRLATIVNGVLRKTT D+ELNG+LIPKGWRI
Sbjct  330  TRAVIFETSRLATIVNGVLRKTTQDMELNGYLIPKGWRI  368



>ref|XP_008379447.1| PREDICTED: cytochrome P450 85A [Malus domestica]
Length=464

 Score = 77.8 bits (190),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 36/39 (92%), Positives = 38/39 (97%), Gaps = 0/39 (0%)
 Frame = -2

Query  118  TRAVIFETSRLATIVNGVLRKTTSDIELNGFLIPKGWRI  2
            TRAVIFETSRLATIVNGVLRKTT D+ELNG+LIPKGWRI
Sbjct  330  TRAVIFETSRLATIVNGVLRKTTQDMELNGYLIPKGWRI  368



>sp|Q69F95.2|C85A_PHAVU RecName: Full=Cytochrome P450 85A; AltName: Full=C6-oxidase [Phaseolus 
vulgaris]
Length=466

 Score = 77.8 bits (190),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 36/39 (92%), Positives = 38/39 (97%), Gaps = 0/39 (0%)
 Frame = -2

Query  118  TRAVIFETSRLATIVNGVLRKTTSDIELNGFLIPKGWRI  2
            TRAVIFETSRLATIVNGVLRKTT D+ELNG+LIPKGWRI
Sbjct  330  TRAVIFETSRLATIVNGVLRKTTHDMELNGYLIPKGWRI  368



>emb|CAN66537.1| hypothetical protein VITISV_029635 [Vitis vinifera]
Length=463

 Score = 77.8 bits (190),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 36/39 (92%), Positives = 38/39 (97%), Gaps = 0/39 (0%)
 Frame = -2

Query  118  TRAVIFETSRLATIVNGVLRKTTSDIELNGFLIPKGWRI  2
            TRAVIFETSRLATIVNGVLRKTT D+ELNGF+IPKGWRI
Sbjct  329  TRAVIFETSRLATIVNGVLRKTTKDMELNGFVIPKGWRI  367



>gb|AAR13307.1| cytochrome P450 [Phaseolus vulgaris]
Length=496

 Score = 77.8 bits (190),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 36/39 (92%), Positives = 38/39 (97%), Gaps = 0/39 (0%)
 Frame = -2

Query  118  TRAVIFETSRLATIVNGVLRKTTSDIELNGFLIPKGWRI  2
            TRAVIFETSRLATIVNGVLRKTT D+ELNG+LIPKGWRI
Sbjct  330  TRAVIFETSRLATIVNGVLRKTTHDMELNGYLIPKGWRI  368



>gb|AFK33468.1| unknown [Lotus japonicus]
Length=138

 Score = 74.3 bits (181),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 35/39 (90%), Positives = 38/39 (97%), Gaps = 0/39 (0%)
 Frame = -2

Query  118  TRAVIFETSRLATIVNGVLRKTTSDIELNGFLIPKGWRI  2
            TRAVIFETSRLATIVNGVLRKTT D+ELNG+LIP+GWRI
Sbjct  4    TRAVIFETSRLATIVNGVLRKTTHDMELNGYLIPEGWRI  42



>ref|NP_001267889.1| brassinosteroid-6-oxidase [Vitis vinifera]
 gb|ABB60086.1| brassinosteroid-6-oxidase [Vitis vinifera]
Length=460

 Score = 77.8 bits (190),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 36/39 (92%), Positives = 38/39 (97%), Gaps = 0/39 (0%)
 Frame = -2

Query  118  TRAVIFETSRLATIVNGVLRKTTSDIELNGFLIPKGWRI  2
            TRAVIFETSRLATIVNGVLRKTT D+ELNGF+IPKGWRI
Sbjct  326  TRAVIFETSRLATIVNGVLRKTTKDMELNGFVIPKGWRI  364



>ref|XP_006601798.1| PREDICTED: uncharacterized protein LOC100785414 isoform X1 [Glycine 
max]
 gb|KHN37933.1| Cytochrome P450 85A [Glycine soja]
Length=464

 Score = 77.8 bits (190),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 36/39 (92%), Positives = 38/39 (97%), Gaps = 0/39 (0%)
 Frame = -2

Query  118  TRAVIFETSRLATIVNGVLRKTTSDIELNGFLIPKGWRI  2
            TRAVIFETSRLATIVNGVLRKTT D+ELNG+LIPKGWRI
Sbjct  330  TRAVIFETSRLATIVNGVLRKTTHDMELNGYLIPKGWRI  368



>emb|CBI16941.3| unnamed protein product [Vitis vinifera]
Length=464

 Score = 77.8 bits (190),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 36/39 (92%), Positives = 38/39 (97%), Gaps = 0/39 (0%)
 Frame = -2

Query  118  TRAVIFETSRLATIVNGVLRKTTSDIELNGFLIPKGWRI  2
            TRAVIFETSRLATIVNGVLRKTT D+ELNGF+IPKGWRI
Sbjct  330  TRAVIFETSRLATIVNGVLRKTTKDMELNGFVIPKGWRI  368



>ref|XP_007139430.1| hypothetical protein PHAVU_008G028800g [Phaseolus vulgaris]
 gb|ESW11424.1| hypothetical protein PHAVU_008G028800g [Phaseolus vulgaris]
Length=466

 Score = 77.8 bits (190),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 36/39 (92%), Positives = 38/39 (97%), Gaps = 0/39 (0%)
 Frame = -2

Query  118  TRAVIFETSRLATIVNGVLRKTTSDIELNGFLIPKGWRI  2
            TRAVIFETSRLATIVNGVLRKTT D+ELNG+LIPKGWRI
Sbjct  330  TRAVIFETSRLATIVNGVLRKTTHDMELNGYLIPKGWRI  368



>ref|NP_001241912.1| uncharacterized protein LOC100785414 [Glycine max]
 gb|ACU18653.1| unknown [Glycine max]
Length=426

 Score = 77.4 bits (189),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 36/39 (92%), Positives = 38/39 (97%), Gaps = 0/39 (0%)
 Frame = -2

Query  118  TRAVIFETSRLATIVNGVLRKTTSDIELNGFLIPKGWRI  2
            TRAVIFETSRLATIVNGVLRKTT D+ELNG+LIPKGWRI
Sbjct  292  TRAVIFETSRLATIVNGVLRKTTHDMELNGYLIPKGWRI  330



>gb|KGN54634.1| hypothetical protein Csa_4G410870 [Cucumis sativus]
Length=458

 Score = 77.4 bits (189),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 35/39 (90%), Positives = 38/39 (97%), Gaps = 0/39 (0%)
 Frame = -2

Query  118  TRAVIFETSRLATIVNGVLRKTTSDIELNGFLIPKGWRI  2
            TRAVIFETSRLAT+VNGVLRKTT D+E+NGFLIPKGWRI
Sbjct  324  TRAVIFETSRLATVVNGVLRKTTKDLEVNGFLIPKGWRI  362



>ref|XP_006283674.1| hypothetical protein CARUB_v10004731mg, partial [Capsella rubella]
 gb|EOA16572.1| hypothetical protein CARUB_v10004731mg, partial [Capsella rubella]
Length=471

 Score = 77.4 bits (189),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 35/39 (90%), Positives = 38/39 (97%), Gaps = 0/39 (0%)
 Frame = -2

Query  118  TRAVIFETSRLATIVNGVLRKTTSDIELNGFLIPKGWRI  2
            TRAVIFETSRLATIVNGVLRKTT D+E+NG+LIPKGWRI
Sbjct  337  TRAVIFETSRLATIVNGVLRKTTRDLEINGYLIPKGWRI  375



>ref|XP_004150514.1| PREDICTED: cytochrome P450 85A-like [Cucumis sativus]
Length=462

 Score = 77.4 bits (189),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 35/39 (90%), Positives = 38/39 (97%), Gaps = 0/39 (0%)
 Frame = -2

Query  118  TRAVIFETSRLATIVNGVLRKTTSDIELNGFLIPKGWRI  2
            TRAVIFETSRLAT+VNGVLRKTT D+E+NGFLIPKGWRI
Sbjct  328  TRAVIFETSRLATVVNGVLRKTTKDLEVNGFLIPKGWRI  366



>ref|XP_004162150.1| PREDICTED: LOW QUALITY PROTEIN: cytochrome P450 85A-like [Cucumis 
sativus]
Length=465

 Score = 77.4 bits (189),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 35/39 (90%), Positives = 38/39 (97%), Gaps = 0/39 (0%)
 Frame = -2

Query  118  TRAVIFETSRLATIVNGVLRKTTSDIELNGFLIPKGWRI  2
            TRAVIFETSRLAT+VNGVLRKTT D+E+NGFLIPKGWRI
Sbjct  331  TRAVIFETSRLATVVNGVLRKTTKDLEVNGFLIPKGWRI  369



>gb|ACR20476.1| steroid C-6 oxidase [Gossypium hirsutum]
Length=465

 Score = 77.4 bits (189),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 35/39 (90%), Positives = 38/39 (97%), Gaps = 0/39 (0%)
 Frame = -2

Query  118  TRAVIFETSRLATIVNGVLRKTTSDIELNGFLIPKGWRI  2
            TRAVIFETSRLATIVNGVLRKTT D+ELNG++IPKGWRI
Sbjct  331  TRAVIFETSRLATIVNGVLRKTTQDMELNGYVIPKGWRI  369



>gb|KEH21756.1| cytochrome P450 family protein [Medicago truncatula]
Length=463

 Score = 77.4 bits (189),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 35/39 (90%), Positives = 38/39 (97%), Gaps = 0/39 (0%)
 Frame = -2

Query  118  TRAVIFETSRLATIVNGVLRKTTSDIELNGFLIPKGWRI  2
            TRAVIFETSRLATIVNGVLRKTT D+ELNG+L+PKGWRI
Sbjct  329  TRAVIFETSRLATIVNGVLRKTTHDMELNGYLVPKGWRI  367



>ref|XP_009759044.1| PREDICTED: cytochrome P450 85A1-like [Nicotiana sylvestris]
Length=464

 Score = 77.4 bits (189),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 35/39 (90%), Positives = 38/39 (97%), Gaps = 0/39 (0%)
 Frame = -2

Query  118  TRAVIFETSRLATIVNGVLRKTTSDIELNGFLIPKGWRI  2
            TRAVIFETSRLATIVNGVLRKTT D+ELNG++IPKGWRI
Sbjct  330  TRAVIFETSRLATIVNGVLRKTTQDMELNGYIIPKGWRI  368



>gb|KFK33214.1| hypothetical protein AALP_AA6G345400 [Arabis alpina]
Length=465

 Score = 77.4 bits (189),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 35/39 (90%), Positives = 38/39 (97%), Gaps = 0/39 (0%)
 Frame = -2

Query  118  TRAVIFETSRLATIVNGVLRKTTSDIELNGFLIPKGWRI  2
            TRAVIFETSRLATIVNGVLRKTT D+E+NG+LIPKGWRI
Sbjct  331  TRAVIFETSRLATIVNGVLRKTTRDLEINGYLIPKGWRI  369



>gb|KDP24291.1| hypothetical protein JCGZ_25587 [Jatropha curcas]
Length=426

 Score = 77.0 bits (188),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 35/39 (90%), Positives = 38/39 (97%), Gaps = 0/39 (0%)
 Frame = -2

Query  118  TRAVIFETSRLATIVNGVLRKTTSDIELNGFLIPKGWRI  2
            TRAVIFETSRLATIVNGVLRKTT ++ELNGF+IPKGWRI
Sbjct  292  TRAVIFETSRLATIVNGVLRKTTEEMELNGFVIPKGWRI  330



>ref|XP_008455791.1| PREDICTED: cytochrome P450 85A-like [Cucumis melo]
Length=462

 Score = 77.0 bits (188),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 35/39 (90%), Positives = 38/39 (97%), Gaps = 0/39 (0%)
 Frame = -2

Query  118  TRAVIFETSRLATIVNGVLRKTTSDIELNGFLIPKGWRI  2
            TRAVIFETSRLAT+VNGVLRKTT D+E+NGFLIPKGWRI
Sbjct  328  TRAVIFETSRLATVVNGVLRKTTKDLEVNGFLIPKGWRI  366



>dbj|BAF56236.1| cytochrome P450 enzyme [Pisum sativum]
Length=465

 Score = 77.0 bits (188),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 35/39 (90%), Positives = 38/39 (97%), Gaps = 0/39 (0%)
 Frame = -2

Query  118  TRAVIFETSRLATIVNGVLRKTTSDIELNGFLIPKGWRI  2
            TRAVIFETSRLATIVNGVLRKTT D+ELNG+L+PKGWRI
Sbjct  331  TRAVIFETSRLATIVNGVLRKTTHDMELNGYLVPKGWRI  369



>ref|XP_006365657.1| PREDICTED: cytochrome P450 85A3-like [Solanum tuberosum]
Length=468

 Score = 77.0 bits (188),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 34/39 (87%), Positives = 38/39 (97%), Gaps = 0/39 (0%)
 Frame = -2

Query  118  TRAVIFETSRLATIVNGVLRKTTSDIELNGFLIPKGWRI  2
            TRAVI+ETSRLATIVNGVLRKTT D+ELNG++IPKGWRI
Sbjct  334  TRAVIYETSRLATIVNGVLRKTTQDMELNGYMIPKGWRI  372



>ref|XP_009609414.1| PREDICTED: cytochrome P450 85A1-like [Nicotiana tomentosiformis]
Length=464

 Score = 77.0 bits (188),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 35/39 (90%), Positives = 38/39 (97%), Gaps = 0/39 (0%)
 Frame = -2

Query  118  TRAVIFETSRLATIVNGVLRKTTSDIELNGFLIPKGWRI  2
            TRAVIFETSRLATIVNGVLRKTT D+ELNG++IPKGWRI
Sbjct  330  TRAVIFETSRLATIVNGVLRKTTQDMELNGYIIPKGWRI  368



>gb|EYU44229.1| hypothetical protein MIMGU_mgv1a004825mg [Erythranthe guttata]
Length=508

 Score = 77.4 bits (189),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 34/39 (87%), Positives = 38/39 (97%), Gaps = 0/39 (0%)
 Frame = -2

Query  118  TRAVIFETSRLATIVNGVLRKTTSDIELNGFLIPKGWRI  2
            TRAVIFETSRLATIVNGVLRKTT D+E+NG+L+PKGWRI
Sbjct  374  TRAVIFETSRLATIVNGVLRKTTRDMEINGYLVPKGWRI  412



>ref|XP_004491895.1| PREDICTED: cytochrome P450 85A-like [Cicer arietinum]
Length=464

 Score = 77.0 bits (188),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 34/39 (87%), Positives = 38/39 (97%), Gaps = 0/39 (0%)
 Frame = -2

Query  118  TRAVIFETSRLATIVNGVLRKTTSDIELNGFLIPKGWRI  2
            TRAVIFETSRLATIVNGVLRKTT D+ELNG+++PKGWRI
Sbjct  330  TRAVIFETSRLATIVNGVLRKTTHDMELNGYMVPKGWRI  368



>ref|XP_010553960.1| PREDICTED: cytochrome P450 85A1-like [Tarenaya hassleriana]
Length=464

 Score = 77.0 bits (188),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 35/39 (90%), Positives = 38/39 (97%), Gaps = 0/39 (0%)
 Frame = -2

Query  118  TRAVIFETSRLATIVNGVLRKTTSDIELNGFLIPKGWRI  2
            TRAVIFETSRLATIVNGVLRKTT D+ELNG++IPKGWRI
Sbjct  330  TRAVIFETSRLATIVNGVLRKTTHDLELNGYIIPKGWRI  368



>ref|XP_010450845.1| PREDICTED: cytochrome P450 85A1 isoform X1 [Camelina sativa]
Length=465

 Score = 77.0 bits (188),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 35/39 (90%), Positives = 38/39 (97%), Gaps = 0/39 (0%)
 Frame = -2

Query  118  TRAVIFETSRLATIVNGVLRKTTSDIELNGFLIPKGWRI  2
            TRAVIFETSRLATIVNGVLRKTT D+E+NG+LIPKGWRI
Sbjct  331  TRAVIFETSRLATIVNGVLRKTTRDLEINGYLIPKGWRI  369



>ref|XP_006405673.1| hypothetical protein EUTSA_v10027742mg [Eutrema salsugineum]
 gb|ESQ47126.1| hypothetical protein EUTSA_v10027742mg [Eutrema salsugineum]
Length=465

 Score = 77.0 bits (188),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 35/39 (90%), Positives = 38/39 (97%), Gaps = 0/39 (0%)
 Frame = -2

Query  118  TRAVIFETSRLATIVNGVLRKTTSDIELNGFLIPKGWRI  2
            TRAVIFETSRLATIVNGVLRKTT D+E+NG+LIPKGWRI
Sbjct  331  TRAVIFETSRLATIVNGVLRKTTRDMEINGYLIPKGWRI  369



>ref|XP_002868746.1| brassinosteroid-6-oxidase [Arabidopsis lyrata subsp. lyrata]
 gb|EFH45005.1| brassinosteroid-6-oxidase [Arabidopsis lyrata subsp. lyrata]
Length=465

 Score = 77.0 bits (188),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 35/39 (90%), Positives = 38/39 (97%), Gaps = 0/39 (0%)
 Frame = -2

Query  118  TRAVIFETSRLATIVNGVLRKTTSDIELNGFLIPKGWRI  2
            TRAVIFETSRLATIVNGVLRKTT D+E+NG+LIPKGWRI
Sbjct  331  TRAVIFETSRLATIVNGVLRKTTRDLEINGYLIPKGWRI  369



>ref|XP_010441026.1| PREDICTED: cytochrome P450 85A1-like isoform X1 [Camelina sativa]
Length=465

 Score = 77.0 bits (188),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 35/39 (90%), Positives = 38/39 (97%), Gaps = 0/39 (0%)
 Frame = -2

Query  118  TRAVIFETSRLATIVNGVLRKTTSDIELNGFLIPKGWRI  2
            TRAVIFETSRLATIVNGVLRKTT D+E+NG+LIPKGWRI
Sbjct  331  TRAVIFETSRLATIVNGVLRKTTRDLEINGYLIPKGWRI  369



>ref|XP_003598105.1| Cytochrome P450 85A1 [Medicago truncatula]
 gb|AES68356.1| cytochrome P450 family protein [Medicago truncatula]
Length=464

 Score = 77.0 bits (188),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 35/39 (90%), Positives = 38/39 (97%), Gaps = 0/39 (0%)
 Frame = -2

Query  118  TRAVIFETSRLATIVNGVLRKTTSDIELNGFLIPKGWRI  2
            TRAVIFET+RLATIVNGVLRKTT D+ELNG+LIPKGWRI
Sbjct  330  TRAVIFETTRLATIVNGVLRKTTQDMELNGYLIPKGWRI  368



>ref|XP_010099314.1| Cytochrome P450 85A [Morus notabilis]
 gb|EXB77660.1| Cytochrome P450 85A [Morus notabilis]
Length=465

 Score = 77.0 bits (188),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 34/39 (87%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -2

Query  118  TRAVIFETSRLATIVNGVLRKTTSDIELNGFLIPKGWRI  2
            TRAVIFETSRLATIVNGVLRKTT D+ELNGF +P+GWRI
Sbjct  330  TRAVIFETSRLATIVNGVLRKTTQDMELNGFFVPEGWRI  368



>ref|XP_010435805.1| PREDICTED: cytochrome P450 85A1-like [Camelina sativa]
Length=465

 Score = 77.0 bits (188),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 35/39 (90%), Positives = 38/39 (97%), Gaps = 0/39 (0%)
 Frame = -2

Query  118  TRAVIFETSRLATIVNGVLRKTTSDIELNGFLIPKGWRI  2
            TRAVIFETSRLATIVNGVLRKTT D+E+NG+LIPKGWRI
Sbjct  331  TRAVIFETSRLATIVNGVLRKTTRDLEINGYLIPKGWRI  369



>ref|XP_004507292.1| PREDICTED: cytochrome P450 85A-like [Cicer arietinum]
Length=465

 Score = 77.0 bits (188),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 35/39 (90%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -2

Query  118  TRAVIFETSRLATIVNGVLRKTTSDIELNGFLIPKGWRI  2
            TRAVIFETSRLATIVNGVLRKTT D+ELNG+ IPKGWRI
Sbjct  331  TRAVIFETSRLATIVNGVLRKTTQDMELNGYFIPKGWRI  369



>ref|XP_010552428.1| PREDICTED: cytochrome P450 85A2-like [Tarenaya hassleriana]
Length=459

 Score = 77.0 bits (188),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 34/39 (87%), Positives = 38/39 (97%), Gaps = 0/39 (0%)
 Frame = -2

Query  118  TRAVIFETSRLATIVNGVLRKTTSDIELNGFLIPKGWRI  2
            TRAVIFETSRLAT+VNGVLRKTT D+ELNG++IPKGWRI
Sbjct  325  TRAVIFETSRLATVVNGVLRKTTHDLELNGYVIPKGWRI  363



>ref|NP_198713.3| brassinosteroid-6-oxidase 1 [Arabidopsis thaliana]
 gb|AED94381.1| brassinosteroid-6-oxidase 1 [Arabidopsis thaliana]
Length=384

 Score = 76.3 bits (186),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 34/39 (87%), Positives = 38/39 (97%), Gaps = 0/39 (0%)
 Frame = -2

Query  118  TRAVIFETSRLATIVNGVLRKTTSDIELNGFLIPKGWRI  2
            TRAVI+ETSRLATIVNGVLRKTT D+E+NG+LIPKGWRI
Sbjct  250  TRAVIYETSRLATIVNGVLRKTTRDLEINGYLIPKGWRI  288



>ref|XP_010450846.1| PREDICTED: cytochrome P450 85A1 isoform X2 [Camelina sativa]
Length=421

 Score = 76.6 bits (187),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 35/39 (90%), Positives = 38/39 (97%), Gaps = 0/39 (0%)
 Frame = -2

Query  118  TRAVIFETSRLATIVNGVLRKTTSDIELNGFLIPKGWRI  2
            TRAVIFETSRLATIVNGVLRKTT D+E+NG+LIPKGWRI
Sbjct  331  TRAVIFETSRLATIVNGVLRKTTRDLEINGYLIPKGWRI  369



>ref|XP_010441027.1| PREDICTED: cytochrome P450 85A1-like isoform X2 [Camelina sativa]
Length=421

 Score = 76.6 bits (187),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 35/39 (90%), Positives = 38/39 (97%), Gaps = 0/39 (0%)
 Frame = -2

Query  118  TRAVIFETSRLATIVNGVLRKTTSDIELNGFLIPKGWRI  2
            TRAVIFETSRLATIVNGVLRKTT D+E+NG+LIPKGWRI
Sbjct  331  TRAVIFETSRLATIVNGVLRKTTRDLEINGYLIPKGWRI  369



>ref|XP_009333667.1| PREDICTED: cytochrome P450 85A-like [Pyrus x bretschneideri]
Length=464

 Score = 77.0 bits (188),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 35/39 (90%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -2

Query  118  TRAVIFETSRLATIVNGVLRKTTSDIELNGFLIPKGWRI  2
            TRA IFETSRLATIVNGVLRKTT D+ELNG+LIPKGWRI
Sbjct  330  TRAAIFETSRLATIVNGVLRKTTQDMELNGYLIPKGWRI  368



>gb|KDP41328.1| hypothetical protein JCGZ_15735 [Jatropha curcas]
Length=466

 Score = 76.6 bits (187),  Expect = 6e-15, Method: Composition-based stats.
 Identities = 35/39 (90%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
 Frame = -2

Query  118  TRAVIFETSRLATIVNGVLRKTTSDIELNGFLIPKGWRI  2
            TRAVIFETSRLAT+VNGVLRKTT DIE NGF IPKGWRI
Sbjct  332  TRAVIFETSRLATVVNGVLRKTTKDIEFNGFYIPKGWRI  370



>ref|XP_011099036.1| PREDICTED: cytochrome P450 85A1 [Sesamum indicum]
Length=463

 Score = 76.6 bits (187),  Expect = 6e-15, Method: Composition-based stats.
 Identities = 34/39 (87%), Positives = 38/39 (97%), Gaps = 0/39 (0%)
 Frame = -2

Query  118  TRAVIFETSRLATIVNGVLRKTTSDIELNGFLIPKGWRI  2
            TRAVI+ETSRLATIVNGVLRKTT D+E+NG+LIPKGWRI
Sbjct  329  TRAVIYETSRLATIVNGVLRKTTRDMEINGYLIPKGWRI  367



>ref|XP_007032850.1| Brassinosteroid-6-oxidase 2 [Theobroma cacao]
 gb|EOY03776.1| Brassinosteroid-6-oxidase 2 [Theobroma cacao]
Length=465

 Score = 76.6 bits (187),  Expect = 6e-15, Method: Composition-based stats.
 Identities = 35/39 (90%), Positives = 38/39 (97%), Gaps = 0/39 (0%)
 Frame = -2

Query  118  TRAVIFETSRLATIVNGVLRKTTSDIELNGFLIPKGWRI  2
            TRAVIFETSRLATIVNGVLRKTT ++ELNGF+IPKGWRI
Sbjct  331  TRAVIFETSRLATIVNGVLRKTTQEMELNGFVIPKGWRI  369



>ref|XP_007045811.1| Brassinosteroid-6-oxidase 2 [Theobroma cacao]
 gb|EOY01643.1| Brassinosteroid-6-oxidase 2 [Theobroma cacao]
Length=467

 Score = 76.3 bits (186),  Expect = 6e-15, Method: Composition-based stats.
 Identities = 35/39 (90%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -2

Query  118  TRAVIFETSRLATIVNGVLRKTTSDIELNGFLIPKGWRI  2
            TRAVIFETSRLATIVNGVLRKTT D+E+NGF IPKGWRI
Sbjct  333  TRAVIFETSRLATIVNGVLRKTTEDMEVNGFTIPKGWRI  371



>emb|CDP19976.1| unnamed protein product [Coffea canephora]
Length=464

 Score = 76.3 bits (186),  Expect = 8e-15, Method: Composition-based stats.
 Identities = 34/39 (87%), Positives = 38/39 (97%), Gaps = 0/39 (0%)
 Frame = -2

Query  118  TRAVIFETSRLATIVNGVLRKTTSDIELNGFLIPKGWRI  2
            TRAVI+ETSRLATIVNGVLRKTT D++LNGF+IPKGWRI
Sbjct  330  TRAVIYETSRLATIVNGVLRKTTEDMQLNGFIIPKGWRI  368



>emb|CDX99676.1| BnaC04g34330D [Brassica napus]
Length=231

 Score = 73.9 bits (180),  Expect = 8e-15, Method: Composition-based stats.
 Identities = 34/39 (87%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -2

Query  118  TRAVIFETSRLATIVNGVLRKTTSDIELNGFLIPKGWRI  2
            TRAVI ETSRLATIVNGVLRKTT D+E+NG+LIPKGWRI
Sbjct  97   TRAVILETSRLATIVNGVLRKTTRDMEINGYLIPKGWRI  135



>ref|NP_974862.1| brassinosteroid-6-oxidase 1 [Arabidopsis thaliana]
 gb|AED94382.1| brassinosteroid-6-oxidase 1 [Arabidopsis thaliana]
Length=419

 Score = 75.9 bits (185),  Expect = 8e-15, Method: Composition-based stats.
 Identities = 34/39 (87%), Positives = 38/39 (97%), Gaps = 0/39 (0%)
 Frame = -2

Query  118  TRAVIFETSRLATIVNGVLRKTTSDIELNGFLIPKGWRI  2
            TRAVI+ETSRLATIVNGVLRKTT D+E+NG+LIPKGWRI
Sbjct  331  TRAVIYETSRLATIVNGVLRKTTRDLEINGYLIPKGWRI  369



>emb|CDY66116.1| BnaAnng21530D [Brassica napus]
Length=462

 Score = 76.3 bits (186),  Expect = 8e-15, Method: Composition-based stats.
 Identities = 34/39 (87%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -2

Query  118  TRAVIFETSRLATIVNGVLRKTTSDIELNGFLIPKGWRI  2
            TRAVIFETSRLAT+VNGVLRKTT D+ELNG+ IPKGWRI
Sbjct  328  TRAVIFETSRLATVVNGVLRKTTHDLELNGYSIPKGWRI  366



>ref|NP_851105.1| brassinosteroid-6-oxidase 1 [Arabidopsis thaliana]
 sp|Q9FMA5.1|C85A1_ARATH RecName: Full=Cytochrome P450 85A1; AltName: Full=Brassinosteroid-6-oxidase 
1; Short=BR6ox 1; AltName: Full=C6-oxidase 1 
[Arabidopsis thaliana]
 dbj|BAB08653.1| cytochrome P450 [Arabidopsis thaliana]
 dbj|BAB60858.1| brassinosteroid-6-oxidase [Arabidopsis thaliana]
 gb|AED94380.1| brassinosteroid-6-oxidase 1 [Arabidopsis thaliana]
Length=465

 Score = 76.3 bits (186),  Expect = 9e-15, Method: Composition-based stats.
 Identities = 34/39 (87%), Positives = 38/39 (97%), Gaps = 0/39 (0%)
 Frame = -2

Query  118  TRAVIFETSRLATIVNGVLRKTTSDIELNGFLIPKGWRI  2
            TRAVI+ETSRLATIVNGVLRKTT D+E+NG+LIPKGWRI
Sbjct  331  TRAVIYETSRLATIVNGVLRKTTRDLEINGYLIPKGWRI  369



>ref|XP_009129671.1| PREDICTED: cytochrome P450 85A2 [Brassica rapa]
Length=465

 Score = 75.9 bits (185),  Expect = 9e-15, Method: Composition-based stats.
 Identities = 34/39 (87%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -2

Query  118  TRAVIFETSRLATIVNGVLRKTTSDIELNGFLIPKGWRI  2
            TRAVIFETSRLAT+VNGVLRKTT D+ELNG+ IPKGWRI
Sbjct  331  TRAVIFETSRLATVVNGVLRKTTHDLELNGYSIPKGWRI  369



>gb|KHN30321.1| Cytochrome P450 85A [Glycine soja]
Length=464

 Score = 75.9 bits (185),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 35/39 (90%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -2

Query  118  TRAVIFETSRLATIVNGVLRKTTSDIELNGFLIPKGWRI  2
            TRAVIFETSRLAT VNGVLRKTT D+ELNG+LIPKGWRI
Sbjct  330  TRAVIFETSRLATTVNGVLRKTTHDMELNGYLIPKGWRI  368



>ref|XP_006585805.1| PREDICTED: cytochrome P450 85A-like [Glycine max]
Length=464

 Score = 75.9 bits (185),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 35/39 (90%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -2

Query  118  TRAVIFETSRLATIVNGVLRKTTSDIELNGFLIPKGWRI  2
            TRAVIFETSRLAT VNGVLRKTT D+ELNG+LIPKGWRI
Sbjct  330  TRAVIFETSRLATTVNGVLRKTTHDMELNGYLIPKGWRI  368



>gb|AJD25206.1| cytochrome P450 CYP85A1 [Salvia miltiorrhiza]
Length=463

 Score = 75.9 bits (185),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 33/39 (85%), Positives = 39/39 (100%), Gaps = 0/39 (0%)
 Frame = -2

Query  118  TRAVIFETSRLATIVNGVLRKTTSDIELNGFLIPKGWRI  2
            TRAVI+ETSRLATIVNGVLRKTT+D+E+NG++IPKGWRI
Sbjct  329  TRAVIYETSRLATIVNGVLRKTTTDMEINGYVIPKGWRI  367



>ref|XP_006437886.1| hypothetical protein CICLE_v10031449mg [Citrus clementina]
 gb|ESR51126.1| hypothetical protein CICLE_v10031449mg [Citrus clementina]
Length=465

 Score = 75.9 bits (185),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 35/39 (90%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -2

Query  118  TRAVIFETSRLATIVNGVLRKTTSDIELNGFLIPKGWRI  2
            T AVIFETSRLA+IVNGVLRKTT DIELNGF+IPKGWRI
Sbjct  331  TCAVIFETSRLASIVNGVLRKTTKDIELNGFVIPKGWRI  369



>gb|KHG12212.1| Cytochrome P450 [Gossypium arboreum]
Length=465

 Score = 75.9 bits (185),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 34/39 (87%), Positives = 38/39 (97%), Gaps = 0/39 (0%)
 Frame = -2

Query  118  TRAVIFETSRLATIVNGVLRKTTSDIELNGFLIPKGWRI  2
            TRAVIFETSRLATIVNGVLRKTT ++ELNG++IPKGWRI
Sbjct  331  TRAVIFETSRLATIVNGVLRKTTQEMELNGYVIPKGWRI  369



>gb|AIU96236.1| DWARF, partial [Nicotiana benthamiana]
Length=260

 Score = 73.6 bits (179),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 33/39 (85%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -2

Query  118  TRAVIFETSRLATIVNGVLRKTTSDIELNGFLIPKGWRI  2
            TRAVI ETSRLATIVNGVLRKTT D+E+NG++IPKGWRI
Sbjct  170  TRAVILETSRLATIVNGVLRKTTQDMEINGYIIPKGWRI  208



>emb|CDY35786.1| BnaC02g38080D [Brassica napus]
Length=462

 Score = 75.5 bits (184),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 34/39 (87%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -2

Query  118  TRAVIFETSRLATIVNGVLRKTTSDIELNGFLIPKGWRI  2
            TRAVIFETSRLAT+VNGVLRKTT D+ELNG+ IPKGWRI
Sbjct  328  TRAVIFETSRLATVVNGVLRKTTHDLELNGYSIPKGWRI  366



>ref|XP_010260629.1| PREDICTED: cytochrome P450 85A-like [Nelumbo nucifera]
Length=463

 Score = 75.5 bits (184),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 34/39 (87%), Positives = 38/39 (97%), Gaps = 0/39 (0%)
 Frame = -2

Query  118  TRAVIFETSRLATIVNGVLRKTTSDIELNGFLIPKGWRI  2
            TRAVIFET+RLATIVNGVLRKTT ++ELNGF+IPKGWRI
Sbjct  330  TRAVIFETARLATIVNGVLRKTTQEMELNGFVIPKGWRI  368



>gb|KHG03323.1| Cytochrome P450 [Gossypium arboreum]
Length=466

 Score = 75.5 bits (184),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 34/39 (87%), Positives = 38/39 (97%), Gaps = 0/39 (0%)
 Frame = -2

Query  118  TRAVIFETSRLATIVNGVLRKTTSDIELNGFLIPKGWRI  2
            TRAVIFETSRLATIVNGVLRKTT ++ELNGF++PKGWRI
Sbjct  332  TRAVIFETSRLATIVNGVLRKTTEEMELNGFVVPKGWRI  370



>emb|CDY15962.1| BnaA04g11490D [Brassica napus]
Length=465

 Score = 75.1 bits (183),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 34/39 (87%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -2

Query  118  TRAVIFETSRLATIVNGVLRKTTSDIELNGFLIPKGWRI  2
            TRAVI ETSRLATIVNGVLRKTT D+E+NG+LIPKGWRI
Sbjct  331  TRAVILETSRLATIVNGVLRKTTRDMEINGYLIPKGWRI  369



>dbj|BAO79854.1| brassinosteroid-6-oxidase [Fagopyrum esculentum]
Length=464

 Score = 75.1 bits (183),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 34/39 (87%), Positives = 38/39 (97%), Gaps = 0/39 (0%)
 Frame = -2

Query  118  TRAVIFETSRLATIVNGVLRKTTSDIELNGFLIPKGWRI  2
            TRAVIFETSRLATIVNGVLRKTT ++E+NGF+IPKGWRI
Sbjct  330  TRAVIFETSRLATIVNGVLRKTTKEMEINGFVIPKGWRI  368



>dbj|BAO79853.1| brassinosteroid-6-oxidase [Fagopyrum esculentum]
Length=464

 Score = 75.1 bits (183),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 34/39 (87%), Positives = 38/39 (97%), Gaps = 0/39 (0%)
 Frame = -2

Query  118  TRAVIFETSRLATIVNGVLRKTTSDIELNGFLIPKGWRI  2
            TRAVIFETSRLATIVNGVLRKTT ++E+NGF+IPKGWRI
Sbjct  330  TRAVIFETSRLATIVNGVLRKTTKEMEINGFVIPKGWRI  368



>gb|ABR25511.1| cytochrome p450 85a1 [Oryza sativa Indica Group]
Length=136

 Score = 71.6 bits (174),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 31/39 (79%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -2

Query  118  TRAVIFETSRLATIVNGVLRKTTSDIELNGFLIPKGWRI  2
            TRAVIFET RLAT+VNG+LRKTT D+E+NG++IPKGWRI
Sbjct  2    TRAVIFETLRLATVVNGLLRKTTQDVEMNGYVIPKGWRI  40



>ref|XP_002525909.1| cytochrome P450, putative [Ricinus communis]
 gb|EEF36429.1| cytochrome P450, putative [Ricinus communis]
Length=435

 Score = 74.7 bits (182),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 33/39 (85%), Positives = 38/39 (97%), Gaps = 0/39 (0%)
 Frame = -2

Query  118  TRAVIFETSRLATIVNGVLRKTTSDIELNGFLIPKGWRI  2
            TRAVIFETSRLATIVNGVLRKTT ++E+NGF+IP+GWRI
Sbjct  301  TRAVIFETSRLATIVNGVLRKTTKEMEINGFVIPEGWRI  339



>ref|XP_006430943.1| hypothetical protein CICLE_v10011662mg [Citrus clementina]
 ref|XP_006482426.1| PREDICTED: cytochrome P450 85A-like [Citrus sinensis]
 gb|ESR44183.1| hypothetical protein CICLE_v10011662mg [Citrus clementina]
 gb|KDO72285.1| hypothetical protein CISIN_1g046307mg [Citrus sinensis]
Length=465

 Score = 74.7 bits (182),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 34/39 (87%), Positives = 38/39 (97%), Gaps = 0/39 (0%)
 Frame = -2

Query  118  TRAVIFETSRLATIVNGVLRKTTSDIELNGFLIPKGWRI  2
            TRAVIFETSRLATIVNGVLRKTT ++ELNGF+IP+GWRI
Sbjct  330  TRAVIFETSRLATIVNGVLRKTTKEMELNGFVIPEGWRI  368



>ref|XP_002273613.1| PREDICTED: cytochrome P450 85A [Vitis vinifera]
 emb|CBI27310.3| unnamed protein product [Vitis vinifera]
Length=463

 Score = 74.7 bits (182),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 33/39 (85%), Positives = 38/39 (97%), Gaps = 0/39 (0%)
 Frame = -2

Query  118  TRAVIFETSRLATIVNGVLRKTTSDIELNGFLIPKGWRI  2
            TRAVIFETSRLAT+VNGVLRKTT ++ELNGF+IP+GWRI
Sbjct  329  TRAVIFETSRLATVVNGVLRKTTKEMELNGFVIPRGWRI  367



>ref|XP_006856403.1| hypothetical protein AMTR_s00047p00211200 [Amborella trichopoda]
 gb|ERN17870.1| hypothetical protein AMTR_s00047p00211200 [Amborella trichopoda]
Length=233

 Score = 72.8 bits (177),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 32/39 (82%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -2

Query  118  TRAVIFETSRLATIVNGVLRKTTSDIELNGFLIPKGWRI  2
            TRAVI+ET RL+TIVNGVLRKTT D+ELNG+LIPKGW+I
Sbjct  99   TRAVIYETMRLSTIVNGVLRKTTEDMELNGYLIPKGWKI  137



>emb|CAN73647.1| hypothetical protein VITISV_036841 [Vitis vinifera]
Length=463

 Score = 74.7 bits (182),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 33/39 (85%), Positives = 38/39 (97%), Gaps = 0/39 (0%)
 Frame = -2

Query  118  TRAVIFETSRLATIVNGVLRKTTSDIELNGFLIPKGWRI  2
            TRAVIFETSRLAT+VNGVLRKTT ++ELNGF+IP+GWRI
Sbjct  329  TRAVIFETSRLATVVNGVLRKTTKEMELNGFVIPRGWRI  367



>ref|XP_009140176.1| PREDICTED: cytochrome P450 85A1 isoform X1 [Brassica rapa]
Length=465

 Score = 74.7 bits (182),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 34/39 (87%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -2

Query  118  TRAVIFETSRLATIVNGVLRKTTSDIELNGFLIPKGWRI  2
            TRAVI ETSRLATIVNGVLRKTT D+E+NG+LIPKGWRI
Sbjct  331  TRAVILETSRLATIVNGVLRKTTRDMEINGYLIPKGWRI  369



>ref|XP_009140177.1| PREDICTED: cytochrome P450 85A1 isoform X2 [Brassica rapa]
Length=420

 Score = 74.3 bits (181),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 34/39 (87%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -2

Query  118  TRAVIFETSRLATIVNGVLRKTTSDIELNGFLIPKGWRI  2
            TRAVI ETSRLATIVNGVLRKTT D+E+NG+LIPKGWRI
Sbjct  331  TRAVILETSRLATIVNGVLRKTTRDMEINGYLIPKGWRI  369



>emb|CDX99675.1| BnaC04g34320D [Brassica napus]
Length=465

 Score = 74.7 bits (182),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 34/39 (87%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -2

Query  118  TRAVIFETSRLATIVNGVLRKTTSDIELNGFLIPKGWRI  2
            TRAVI ETSRLATIVNGVLRKTT D+E+NG+LIPKGWRI
Sbjct  331  TRAVILETSRLATIVNGVLRKTTRDMEINGYLIPKGWRI  369



>ref|XP_006338341.1| PREDICTED: cytochrome P450 85A1-like [Solanum tuberosum]
Length=464

 Score = 74.7 bits (182),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 33/39 (85%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -2

Query  118  TRAVIFETSRLATIVNGVLRKTTSDIELNGFLIPKGWRI  2
            TRAVI ETSRLATIVNGVLRKTT D+E+NG++IPKGWRI
Sbjct  330  TRAVILETSRLATIVNGVLRKTTQDMEINGYIIPKGWRI  368



>gb|ABD62342.1| 6-deoxocastasterone oxidase [Solanum lycopersicum]
Length=438

 Score = 74.3 bits (181),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 33/39 (85%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -2

Query  118  TRAVIFETSRLATIVNGVLRKTTSDIELNGFLIPKGWRI  2
            TRAVI ETSRLATIVNGVLRKTT D+E+NG++IPKGWRI
Sbjct  330  TRAVILETSRLATIVNGVLRKTTQDMEINGYIIPKGWRI  368



>emb|CDP00456.1| unnamed protein product [Coffea canephora]
Length=468

 Score = 74.3 bits (181),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 33/39 (85%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
 Frame = -2

Query  118  TRAVIFETSRLATIVNGVLRKTTSDIELNGFLIPKGWRI  2
            TRAVIFET RLAT+VNGVLRK T D+ELNGFLIPKGW+I
Sbjct  332  TRAVIFETLRLATVVNGVLRKATKDMELNGFLIPKGWKI  370



>ref|NP_001234263.1| cytochrome P450 85A1 [Solanum lycopersicum]
 sp|Q43147.1|C85A1_SOLLC RecName: Full=Cytochrome P450 85A1; AltName: Full=C6-oxidase; 
AltName: Full=Dwarf protein [Solanum lycopersicum]
 gb|AAB17070.1| cytochrome P450 homolog [Solanum lycopersicum]
 gb|ABD62343.1| 6-deoxocastasterone oxidase [Solanum lycopersicum]
 gb|ABD62344.1| 6-deoxocastasterone oxidase [Solanum lycopersicum]
 gb|ABD62345.1| 6-deoxocastasterone oxidase [Solanum lycopersicum]
 gb|ABD62346.1| 6-deoxocastasterone oxidase [Solanum lycopersicum]
Length=464

 Score = 74.3 bits (181),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 33/39 (85%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -2

Query  118  TRAVIFETSRLATIVNGVLRKTTSDIELNGFLIPKGWRI  2
            TRAVI ETSRLATIVNGVLRKTT D+E+NG++IPKGWRI
Sbjct  330  TRAVILETSRLATIVNGVLRKTTQDMEINGYIIPKGWRI  368



>ref|XP_010315840.1| PREDICTED: cytochrome P450 85A1 isoform X1 [Solanum lycopersicum]
 gb|ABD62341.1| 6-deoxocastasterone oxidase [Solanum lycopersicum]
Length=440

 Score = 73.9 bits (180),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 33/39 (85%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -2

Query  118  TRAVIFETSRLATIVNGVLRKTTSDIELNGFLIPKGWRI  2
            TRAVI ETSRLATIVNGVLRKTT D+E+NG++IPKGWRI
Sbjct  330  TRAVILETSRLATIVNGVLRKTTQDMEINGYIIPKGWRI  368



>ref|XP_009762275.1| PREDICTED: cytochrome P450 85A1 [Nicotiana sylvestris]
Length=464

 Score = 74.3 bits (181),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 33/39 (85%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -2

Query  118  TRAVIFETSRLATIVNGVLRKTTSDIELNGFLIPKGWRI  2
            TRAVI ETSRLATIVNGVLRKTT D+E+NG++IPKGWRI
Sbjct  330  TRAVILETSRLATIVNGVLRKTTQDMEINGYIIPKGWRI  368



>gb|ABG36709.1| cytochrome P450 CYP85A1 [Nicotiana tabacum]
Length=464

 Score = 73.9 bits (180),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 33/39 (85%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -2

Query  118  TRAVIFETSRLATIVNGVLRKTTSDIELNGFLIPKGWRI  2
            TRAVI ETSRLATIVNGVLRKTT D+E+NG++IPKGWRI
Sbjct  330  TRAVILETSRLATIVNGVLRKTTQDMEINGYIIPKGWRI  368



>ref|XP_009596988.1| PREDICTED: cytochrome P450 85A1 [Nicotiana tomentosiformis]
Length=464

 Score = 73.9 bits (180),  Expect = 5e-14, Method: Composition-based stats.
 Identities = 33/39 (85%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -2

Query  118  TRAVIFETSRLATIVNGVLRKTTSDIELNGFLIPKGWRI  2
            TRAVI ETSRLATIVNGVLRKTT D+E+NG++IPKGWRI
Sbjct  330  TRAVILETSRLATIVNGVLRKTTQDMEINGYIIPKGWRI  368



>ref|XP_010694086.1| PREDICTED: cytochrome P450 85A-like [Beta vulgaris subsp. vulgaris]
Length=465

 Score = 73.9 bits (180),  Expect = 5e-14, Method: Composition-based stats.
 Identities = 33/39 (85%), Positives = 38/39 (97%), Gaps = 0/39 (0%)
 Frame = -2

Query  118  TRAVIFETSRLATIVNGVLRKTTSDIELNGFLIPKGWRI  2
            TRAVIFETSRLATIVNGVLRKTT ++E+NGF+IP+GWRI
Sbjct  331  TRAVIFETSRLATIVNGVLRKTTKEMEINGFVIPEGWRI  369



>ref|XP_010032557.1| PREDICTED: cytochrome P450 85A-like [Eucalyptus grandis]
Length=384

 Score = 73.2 bits (178),  Expect = 6e-14, Method: Composition-based stats.
 Identities = 33/39 (85%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
 Frame = -2

Query  118  TRAVIFETSRLATIVNGVLRKTTSDIELNGFLIPKGWRI  2
            TRAVI ETSRLAT+VNGVLRKTT D+EL+GF IPKGWRI
Sbjct  250  TRAVILETSRLATVVNGVLRKTTRDVELSGFTIPKGWRI  288



>ref|NP_001234520.1| cytochrome P450 85A3 [Solanum lycopersicum]
 sp|Q50LE0.1|C85A3_SOLLC RecName: Full=Cytochrome P450 85A3; AltName: Full=C6-oxidase 
[Solanum lycopersicum]
 dbj|BAD98244.1| cytochrome P450 enzyme [Solanum lycopersicum]
Length=467

 Score = 73.6 bits (179),  Expect = 7e-14, Method: Composition-based stats.
 Identities = 33/39 (85%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -2

Query  118  TRAVIFETSRLATIVNGVLRKTTSDIELNGFLIPKGWRI  2
            TRAVI+ET RLATIVNGVLRKTT D+ELNG++IPKGWRI
Sbjct  333  TRAVIYETLRLATIVNGVLRKTTQDMELNGYMIPKGWRI  371



>ref|XP_011015762.1| PREDICTED: cytochrome P450 85A1-like [Populus euphratica]
Length=465

 Score = 73.2 bits (178),  Expect = 8e-14, Method: Composition-based stats.
 Identities = 32/39 (82%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
 Frame = -2

Query  118  TRAVIFETSRLATIVNGVLRKTTSDIELNGFLIPKGWRI  2
            TRAVIFETSRLA +VNG+LRKT  DIELNGFL+PKGWR+
Sbjct  331  TRAVIFETSRLAAVVNGLLRKTNQDIELNGFLVPKGWRL  369



>gb|KCW51956.1| hypothetical protein EUGRSUZ_J01402 [Eucalyptus grandis]
Length=466

 Score = 73.2 bits (178),  Expect = 9e-14, Method: Composition-based stats.
 Identities = 33/39 (85%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
 Frame = -2

Query  118  TRAVIFETSRLATIVNGVLRKTTSDIELNGFLIPKGWRI  2
            TRAVI ETSRLAT+VNGVLRKTT D+EL+GF IPKGWRI
Sbjct  332  TRAVILETSRLATVVNGVLRKTTRDVELSGFTIPKGWRI  370



>ref|XP_010032564.1| PREDICTED: cytochrome P450 85A-like isoform X2 [Eucalyptus grandis]
 gb|KCW51961.1| hypothetical protein EUGRSUZ_J01407 [Eucalyptus grandis]
Length=470

 Score = 73.2 bits (178),  Expect = 9e-14, Method: Composition-based stats.
 Identities = 33/39 (85%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
 Frame = -2

Query  118  TRAVIFETSRLATIVNGVLRKTTSDIELNGFLIPKGWRI  2
            TRAVI ETSRLAT+VNGVLRKTT D+EL+GF IPKGWRI
Sbjct  332  TRAVILETSRLATVVNGVLRKTTRDVELSGFTIPKGWRI  370



>ref|XP_010032561.1| PREDICTED: cytochrome P450 85A-like isoform X2 [Eucalyptus grandis]
 gb|KCW51957.1| hypothetical protein EUGRSUZ_J01404 [Eucalyptus grandis]
Length=470

 Score = 73.2 bits (178),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 33/39 (85%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
 Frame = -2

Query  118  TRAVIFETSRLATIVNGVLRKTTSDIELNGFLIPKGWRI  2
            TRAVI ETSRLAT+VNGVLRKTT D+EL+GF IPKGWRI
Sbjct  332  TRAVILETSRLATVVNGVLRKTTRDVELSGFTIPKGWRI  370



>ref|XP_010041020.1| PREDICTED: cytochrome P450 85A-like [Eucalyptus grandis]
 gb|KCW44711.1| hypothetical protein EUGRSUZ_L01750 [Eucalyptus grandis]
Length=466

 Score = 73.2 bits (178),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 33/39 (85%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
 Frame = -2

Query  118  TRAVIFETSRLATIVNGVLRKTTSDIELNGFLIPKGWRI  2
            TRAVI ETSRLAT+VNGVLRKTT D+EL+GF IPKGWRI
Sbjct  332  TRAVILETSRLATVVNGVLRKTTRDVELSGFTIPKGWRI  370



>ref|XP_010528424.1| PREDICTED: cytochrome P450 85A2-like [Tarenaya hassleriana]
Length=465

 Score = 73.2 bits (178),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 33/39 (85%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = -2

Query  118  TRAVIFETSRLATIVNGVLRKTTSDIELNGFLIPKGWRI  2
            TRAVIFE SRLATIVNGVLRKTT D+E NG+ IPKGWRI
Sbjct  331  TRAVIFEASRLATIVNGVLRKTTHDMEFNGYFIPKGWRI  369



>ref|XP_002305393.1| hypothetical protein POPTR_0004s11680g [Populus trichocarpa]
 gb|EEE85904.1| hypothetical protein POPTR_0004s11680g [Populus trichocarpa]
Length=464

 Score = 72.8 bits (177),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 33/39 (85%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -2

Query  118  TRAVIFETSRLATIVNGVLRKTTSDIELNGFLIPKGWRI  2
            TRAVI ETSR+ATIVNGVLRKTT ++ELNGF+IPKGWRI
Sbjct  330  TRAVILETSRMATIVNGVLRKTTREMELNGFVIPKGWRI  368



>gb|ABH01181.1| brassinosteroid-6-oxidase [Hordeum vulgare subsp. vulgare]
Length=472

 Score = 72.8 bits (177),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 31/39 (79%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -2

Query  118  TRAVIFETSRLATIVNGVLRKTTSDIELNGFLIPKGWRI  2
            TRAVIFET RLAT+VNG+LRKTT D+E+NG++IPKGWRI
Sbjct  338  TRAVIFETLRLATVVNGLLRKTTQDVEMNGYVIPKGWRI  376



>gb|AEG64639.1| brassinosteroid C6-oxidase [Hordeum vulgare subsp. vulgare]
Length=472

 Score = 72.8 bits (177),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 31/39 (79%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -2

Query  118  TRAVIFETSRLATIVNGVLRKTTSDIELNGFLIPKGWRI  2
            TRAVIFET RLAT+VNG+LRKTT D+E+NG++IPKGWRI
Sbjct  338  TRAVIFETLRLATVVNGLLRKTTQDVEMNGYVIPKGWRI  376



>ref|XP_006373390.1| brassinosteroid-6-oxidase family protein [Populus trichocarpa]
 gb|ERP51187.1| brassinosteroid-6-oxidase family protein [Populus trichocarpa]
Length=464

 Score = 72.8 bits (177),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 34/39 (87%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -2

Query  118  TRAVIFETSRLATIVNGVLRKTTSDIELNGFLIPKGWRI  2
            TRAVIFETSRLATIVNGVLRKTT ++ELN F+IPKGWRI
Sbjct  330  TRAVIFETSRLATIVNGVLRKTTKEMELNRFVIPKGWRI  368



>gb|AGY46369.1| brassinosteroid-6-oxidase [Hordeum vulgare subsp. vulgare]
Length=471

 Score = 72.8 bits (177),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 31/39 (79%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -2

Query  118  TRAVIFETSRLATIVNGVLRKTTSDIELNGFLIPKGWRI  2
            TRAVIFET RLAT+VNG+LRKTT D+E+NG++IPKGWRI
Sbjct  337  TRAVIFETLRLATVVNGLLRKTTQDVEMNGYVIPKGWRI  375



>ref|XP_011021067.1| PREDICTED: cytochrome P450 85A [Populus euphratica]
Length=464

 Score = 72.8 bits (177),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 34/39 (87%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -2

Query  118  TRAVIFETSRLATIVNGVLRKTTSDIELNGFLIPKGWRI  2
            TRAVIFETSRLATIVNGVLRKTT ++ELN F+IPKGWRI
Sbjct  330  TRAVIFETSRLATIVNGVLRKTTKEMELNRFVIPKGWRI  368



>gb|KHG06695.1| Cytochrome P450 [Gossypium arboreum]
Length=432

 Score = 72.8 bits (177),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 32/39 (82%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
 Frame = -2

Query  118  TRAVIFETSRLATIVNGVLRKTTSDIELNGFLIPKGWRI  2
            TRAVIFETSRLAT+VNG+LRKTT D+ LNGF IPKGW+I
Sbjct  296  TRAVIFETSRLATVVNGLLRKTTEDMVLNGFTIPKGWKI  334



>dbj|BAK03643.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=475

 Score = 72.8 bits (177),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 31/39 (79%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -2

Query  118  TRAVIFETSRLATIVNGVLRKTTSDIELNGFLIPKGWRI  2
            TRAVIFET RLAT+VNG+LRKTT D+E+NG++IPKGWRI
Sbjct  341  TRAVIFETLRLATVVNGLLRKTTQDVEMNGYVIPKGWRI  379



>gb|EMS51871.1| Cytochrome P450 85A1 [Triticum urartu]
Length=381

 Score = 72.0 bits (175),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 31/39 (79%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -2

Query  118  TRAVIFETSRLATIVNGVLRKTTSDIELNGFLIPKGWRI  2
            TRAVIFET RLAT+VNG+LRKTT D+E+NG++IPKGWRI
Sbjct  247  TRAVIFETLRLATVVNGLLRKTTQDVEMNGYVIPKGWRI  285



>ref|XP_010032563.1| PREDICTED: cytochrome P450 85A-like isoform X1 [Eucalyptus grandis]
Length=502

 Score = 72.8 bits (177),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 33/39 (85%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
 Frame = -2

Query  118  TRAVIFETSRLATIVNGVLRKTTSDIELNGFLIPKGWRI  2
            TRAVI ETSRLAT+VNGVLRKTT D+EL+GF IPKGWRI
Sbjct  332  TRAVILETSRLATVVNGVLRKTTRDVELSGFTIPKGWRI  370



>gb|EMT14731.1| Cytochrome P450 85A1 [Aegilops tauschii]
Length=459

 Score = 72.4 bits (176),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 31/39 (79%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -2

Query  118  TRAVIFETSRLATIVNGVLRKTTSDIELNGFLIPKGWRI  2
            TRAVIFET RLAT+VNG+LRKTT D+E+NG++IPKGWRI
Sbjct  325  TRAVIFETLRLATVVNGLLRKTTKDVEMNGYVIPKGWRI  363



>ref|XP_010032560.1| PREDICTED: cytochrome P450 85A-like isoform X1 [Eucalyptus grandis]
Length=502

 Score = 72.8 bits (177),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 33/39 (85%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
 Frame = -2

Query  118  TRAVIFETSRLATIVNGVLRKTTSDIELNGFLIPKGWRI  2
            TRAVI ETSRLAT+VNGVLRKTT D+EL+GF IPKGWRI
Sbjct  332  TRAVILETSRLATVVNGVLRKTTRDVELSGFTIPKGWRI  370



>gb|EEC75709.1| hypothetical protein OsI_12535 [Oryza sativa Indica Group]
Length=451

 Score = 72.4 bits (176),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 31/39 (79%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -2

Query  118  TRAVIFETSRLATIVNGVLRKTTSDIELNGFLIPKGWRI  2
            TRAVIFET RLAT+VNG+LRKTT D+E+NG++IPKGWRI
Sbjct  317  TRAVIFETLRLATVVNGLLRKTTQDVEMNGYVIPKGWRI  355



>ref|XP_011008610.1| PREDICTED: cytochrome P450 85A-like [Populus euphratica]
Length=464

 Score = 72.4 bits (176),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 33/39 (85%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -2

Query  118  TRAVIFETSRLATIVNGVLRKTTSDIELNGFLIPKGWRI  2
            TRAVI ETSR+ATIVNGVLRKTT ++ELNGF+IPKGWRI
Sbjct  330  TRAVILETSRMATIVNGVLRKTTREMELNGFVIPKGWRI  368



>ref|XP_002316079.2| hypothetical protein POPTR_0010s16430g [Populus trichocarpa]
 gb|EEF02250.2| hypothetical protein POPTR_0010s16430g [Populus trichocarpa]
Length=465

 Score = 72.4 bits (176),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 31/39 (79%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
 Frame = -2

Query  118  TRAVIFETSRLATIVNGVLRKTTSDIELNGFLIPKGWRI  2
            TRAVIFETSRLA +VNG+LRKT  DIELNGFL+P+GWR+
Sbjct  331  TRAVIFETSRLAAVVNGLLRKTNQDIELNGFLVPRGWRL  369



>gb|EPS66987.1| hypothetical protein M569_07789, partial [Genlisea aurea]
Length=464

 Score = 72.4 bits (176),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 32/39 (82%), Positives = 38/39 (97%), Gaps = 0/39 (0%)
 Frame = -2

Query  118  TRAVIFETSRLATIVNGVLRKTTSDIELNGFLIPKGWRI  2
            T+AVI+ETSRLATIVNGVLRKTT D+E+NG++IPKGWRI
Sbjct  332  TQAVIYETSRLATIVNGVLRKTTKDMEINGYVIPKGWRI  370



>gb|EAZ27720.1| hypothetical protein OsJ_11669 [Oryza sativa Japonica Group]
Length=407

 Score = 72.0 bits (175),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 31/39 (79%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -2

Query  118  TRAVIFETSRLATIVNGVLRKTTSDIELNGFLIPKGWRI  2
            TRAVIFET RLAT+VNG+LRKTT D+E+NG++IPKGWRI
Sbjct  273  TRAVIFETLRLATVVNGLLRKTTQDVEMNGYVIPKGWRI  311



>ref|XP_003562306.1| PREDICTED: cytochrome P450 85A1 [Brachypodium distachyon]
Length=466

 Score = 72.0 bits (175),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 31/39 (79%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -2

Query  118  TRAVIFETSRLATIVNGVLRKTTSDIELNGFLIPKGWRI  2
            TRAVIFET RLAT+VNG+LRKTT D+E+NG++IPKGWRI
Sbjct  332  TRAVIFETLRLATVVNGLLRKTTQDVEMNGYVIPKGWRI  370



>ref|NP_001050623.1| Os03g0602300 [Oryza sativa Japonica Group]
 sp|Q8GSQ1.1|C85A1_ORYSJ RecName: Full=Cytochrome P450 85A1; AltName: Full=C6-oxidase; 
AltName: Full=Dwarf protein; AltName: Full=OsDWARF [Oryza sativa 
Japonica Group]
 dbj|BAC45000.1| cytochrome P450 [Oryza sativa Japonica Group]
 gb|AAT81671.1| cytochrome P450 [Oryza sativa Japonica Group]
 gb|ABF97501.1| Cytochrome P450 85A1, putative, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF12537.1| Os03g0602300 [Oryza sativa Japonica Group]
 dbj|BAG92911.1| unnamed protein product [Oryza sativa Japonica Group]
Length=469

 Score = 72.0 bits (175),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 31/39 (79%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -2

Query  118  TRAVIFETSRLATIVNGVLRKTTSDIELNGFLIPKGWRI  2
            TRAVIFET RLAT+VNG+LRKTT D+E+NG++IPKGWRI
Sbjct  335  TRAVIFETLRLATVVNGLLRKTTQDVEMNGYVIPKGWRI  373



>ref|XP_006650284.1| PREDICTED: cytochrome P450 85A1-like [Oryza brachyantha]
Length=469

 Score = 72.0 bits (175),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 31/39 (79%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -2

Query  118  TRAVIFETSRLATIVNGVLRKTTSDIELNGFLIPKGWRI  2
            TRAVIFET RLAT+VNG+LRKTT D+E+NG++IPKGWRI
Sbjct  335  TRAVIFETLRLATVVNGLLRKTTQDVEMNGYVIPKGWRI  373



>ref|XP_011071271.1| PREDICTED: cytochrome P450 85A-like [Sesamum indicum]
Length=426

 Score = 71.6 bits (174),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 30/39 (77%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
 Frame = -2

Query  118  TRAVIFETSRLATIVNGVLRKTTSDIELNGFLIPKGWRI  2
            TRAV+FET RLAT++NGVLRKTT D++LNGF +PKGWRI
Sbjct  293  TRAVVFETLRLATVINGVLRKTTQDVQLNGFTVPKGWRI  331



>gb|EMS50539.1| Cytochrome P450 85A1 [Triticum urartu]
Length=594

 Score = 72.0 bits (175),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 31/39 (79%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -2

Query  118  TRAVIFETSRLATIVNGVLRKTTSDIELNGFLIPKGWRI  2
            TRAVIFET RLAT+VNG+LRKTT ++E+NGF+IPKGWRI
Sbjct  337  TRAVIFETLRLATVVNGLLRKTTQNVEMNGFVIPKGWRI  375



>ref|XP_010923635.1| PREDICTED: cytochrome P450 85A1-like isoform X2 [Elaeis guineensis]
Length=465

 Score = 71.6 bits (174),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 31/39 (79%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
 Frame = -2

Query  118  TRAVIFETSRLATIVNGVLRKTTSDIELNGFLIPKGWRI  2
            TRAVIFET R+AT+VNGVLRKTT D+E+ GF+IPKGWRI
Sbjct  331  TRAVIFETLRIATVVNGVLRKTTQDVEMKGFVIPKGWRI  369



>ref|XP_008811805.1| PREDICTED: cytochrome P450 85A1-like [Phoenix dactylifera]
Length=465

 Score = 71.6 bits (174),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 31/39 (79%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
 Frame = -2

Query  118  TRAVIFETSRLATIVNGVLRKTTSDIELNGFLIPKGWRI  2
            TRAVIFET R+AT+VNGVLRKTT D+E+ GF+IPKGWRI
Sbjct  331  TRAVIFETLRIATVVNGVLRKTTQDVEMKGFVIPKGWRI  369



>ref|XP_004982465.1| PREDICTED: cytochrome P450 85A1-like isoform X1 [Setaria italica]
Length=496

 Score = 71.2 bits (173),  Expect = 5e-13, Method: Composition-based stats.
 Identities = 30/39 (77%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -2

Query  118  TRAVIFETSRLATIVNGVLRKTTSDIELNGFLIPKGWRI  2
            TRAVI+ET RLAT+VNG+LRKTT D+E+NG++IPKGWRI
Sbjct  331  TRAVIYETLRLATVVNGLLRKTTQDVEMNGYVIPKGWRI  369



>ref|XP_004982466.1| PREDICTED: cytochrome P450 85A1-like isoform X2 [Setaria italica]
Length=465

 Score = 70.9 bits (172),  Expect = 6e-13, Method: Composition-based stats.
 Identities = 30/39 (77%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -2

Query  118  TRAVIFETSRLATIVNGVLRKTTSDIELNGFLIPKGWRI  2
            TRAVI+ET RLAT+VNG+LRKTT D+E+NG++IPKGWRI
Sbjct  331  TRAVIYETLRLATVVNGLLRKTTQDVEMNGYVIPKGWRI  369



>gb|EPS64226.1| hypothetical protein M569_10555, partial [Genlisea aurea]
Length=295

 Score = 69.3 bits (168),  Expect = 6e-13, Method: Composition-based stats.
 Identities = 30/39 (77%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -2

Query  118  TRAVIFETSRLATIVNGVLRKTTSDIELNGFLIPKGWRI  2
            T+AVI+ETSRLATIVNGVLRKTT ++E+NG++IPK WRI
Sbjct  161  TQAVIYETSRLATIVNGVLRKTTKEMEINGYVIPKDWRI  199



>emb|CBI27313.3| unnamed protein product [Vitis vinifera]
Length=178

 Score = 68.2 bits (165),  Expect = 7e-13, Method: Composition-based stats.
 Identities = 31/39 (79%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
 Frame = -2

Query  118  TRAVIFETSRLATIVNGVLRKTTSDIELNGFLIPKGWRI  2
            TRAVI ETSRL TIVNGVLR+TT+DIE+NG++IPKGW I
Sbjct  44   TRAVILETSRLDTIVNGVLRETTNDIEVNGYVIPKGWMI  82



>ref|XP_008786029.1| PREDICTED: cytochrome P450 85A1-like [Phoenix dactylifera]
Length=465

 Score = 70.5 bits (171),  Expect = 8e-13, Method: Composition-based stats.
 Identities = 30/39 (77%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
 Frame = -2

Query  118  TRAVIFETSRLATIVNGVLRKTTSDIELNGFLIPKGWRI  2
            TRAVIFET R+AT+VNGVLRKTT D+E+ GF+IP+GWRI
Sbjct  331  TRAVIFETLRMATVVNGVLRKTTQDVEMKGFVIPRGWRI  369



>ref|XP_008775849.1| PREDICTED: cytochrome P450 85A-like [Phoenix dactylifera]
Length=465

 Score = 70.1 bits (170),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 31/39 (79%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
 Frame = -2

Query  118  TRAVIFETSRLATIVNGVLRKTTSDIELNGFLIPKGWRI  2
            TRAVIFET RLAT+VNGVLR+TT D+EL G++IPKGWRI
Sbjct  331  TRAVIFETLRLATVVNGVLRQTTKDVELKGYVIPKGWRI  369



>gb|ABK26932.1| unknown [Picea sitchensis]
Length=432

 Score = 69.7 bits (169),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 31/39 (79%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
 Frame = -2

Query  118  TRAVIFETSRLATIVNGVLRKTTSDIELNGFLIPKGWRI  2
            TR+VI+ET R+ATIVNGVLRKTT D+E+ GFLIPKGWRI
Sbjct  298  TRSVIYETLRIATIVNGVLRKTTQDMEMKGFLIPKGWRI  336



>ref|XP_010937936.1| PREDICTED: cytochrome P450 85A1 [Elaeis guineensis]
Length=465

 Score = 69.7 bits (169),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 30/39 (77%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
 Frame = -2

Query  118  TRAVIFETSRLATIVNGVLRKTTSDIELNGFLIPKGWRI  2
            TRAVIFET R+AT+VNGVLRKTT ++E+ GF+IPKGWRI
Sbjct  331  TRAVIFETLRIATVVNGVLRKTTQEVEMKGFVIPKGWRI  369



>gb|AGJ98215.1| CYP85, partial [Petunia x hybrida]
Length=366

 Score = 69.3 bits (168),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 30/39 (77%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = -2

Query  118  TRAVIFETSRLATIVNGVLRKTTSDIELNGFLIPKGWRI  2
            TRAVI ETSRLATI+NGV RKTT D+E+NG+ IP+GWRI
Sbjct  232  TRAVILETSRLATIINGVFRKTTQDMEINGYTIPEGWRI  270



>ref|XP_002466841.1| hypothetical protein SORBIDRAFT_01g015040 [Sorghum bicolor]
 gb|EER93839.1| hypothetical protein SORBIDRAFT_01g015040 [Sorghum bicolor]
Length=465

 Score = 69.7 bits (169),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 29/39 (74%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -2

Query  118  TRAVIFETSRLATIVNGVLRKTTSDIELNGFLIPKGWRI  2
            T+AVI+ET RLAT+VNG+LRKTT D+E+NG++IPKGWRI
Sbjct  331  TKAVIYETLRLATVVNGLLRKTTQDVEMNGYVIPKGWRI  369



>gb|ACG46988.1| cytochrome P450 CYP85A1 [Zea mays]
Length=465

 Score = 69.7 bits (169),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 29/39 (74%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -2

Query  118  TRAVIFETSRLATIVNGVLRKTTSDIELNGFLIPKGWRI  2
            T+AVI+ET RLAT+VNG+LRKTT D+E+NG++IPKGWRI
Sbjct  331  TKAVIYETLRLATVVNGLLRKTTHDVEMNGYVIPKGWRI  369



>ref|XP_010257975.1| PREDICTED: cytochrome P450 85A1-like [Nelumbo nucifera]
Length=462

 Score = 69.7 bits (169),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 31/39 (79%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -2

Query  118  TRAVIFETSRLATIVNGVLRKTTSDIELNGFLIPKGWRI  2
            TRAVI ET+RLATIVNGVLRKTT +++LNGF+IPKGW+I
Sbjct  329  TRAVILETARLATIVNGVLRKTTHEMKLNGFVIPKGWKI  367



>ref|XP_010649978.1| PREDICTED: cytochrome P450 85A1-like [Vitis vinifera]
Length=384

 Score = 69.3 bits (168),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 31/39 (79%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
 Frame = -2

Query  118  TRAVIFETSRLATIVNGVLRKTTSDIELNGFLIPKGWRI  2
            TRAVI ETSRL TIVNGVLR+TT+DIE+NG++IPKGW I
Sbjct  250  TRAVILETSRLDTIVNGVLRETTNDIEVNGYVIPKGWMI  288



>ref|NP_001131939.1| uncharacterized protein LOC100193331 precursor [Zea mays]
 gb|ACF80570.1| unknown [Zea mays]
 tpg|DAA50253.1| TPA: putative cytochrome P450 superfamily protein [Zea mays]
Length=465

 Score = 69.7 bits (169),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 29/39 (74%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -2

Query  118  TRAVIFETSRLATIVNGVLRKTTSDIELNGFLIPKGWRI  2
            T+AVI+ET RLAT+VNG+LRKTT D+E+NG++IPKGWRI
Sbjct  331  TKAVIYETLRLATVVNGLLRKTTHDVEMNGYVIPKGWRI  369



>gb|EMT14730.1| Cytochrome P450 85A1 [Aegilops tauschii]
Length=473

 Score = 69.7 bits (169),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 29/39 (74%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
 Frame = -2

Query  118  TRAVIFETSRLATIVNGVLRKTTSDIELNGFLIPKGWRI  2
            TRAVI ET RL+T+VNG+LRKTT D+E+NG++IPKGWRI
Sbjct  339  TRAVILETLRLSTVVNGLLRKTTQDVEMNGYVIPKGWRI  377



>gb|AET06165.1| Dwarf2 [Zea mays]
Length=465

 Score = 69.3 bits (168),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 29/39 (74%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -2

Query  118  TRAVIFETSRLATIVNGVLRKTTSDIELNGFLIPKGWRI  2
            T+AVI+ET RLAT+VNG+LRKTT D+E+NG++IPKGWRI
Sbjct  331  TKAVIYETLRLATVVNGLLRKTTHDVEMNGYVIPKGWRI  369



>gb|EYU42117.1| hypothetical protein MIMGU_mgv1a022195mg [Erythranthe guttata]
Length=467

 Score = 69.3 bits (168),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 31/39 (79%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = -2

Query  118  TRAVIFETSRLATIVNGVLRKTTSDIELNGFLIPKGWRI  2
            TRAVI ET RLATI NGVLRKTT D++LNGF+IP+GWRI
Sbjct  331  TRAVILETLRLATITNGVLRKTTQDMKLNGFVIPEGWRI  369



>ref|XP_009415673.1| PREDICTED: cytochrome P450 85A-like [Musa acuminata subsp. malaccensis]
Length=468

 Score = 69.3 bits (168),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 30/39 (77%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
 Frame = -2

Query  118  TRAVIFETSRLATIVNGVLRKTTSDIELNGFLIPKGWRI  2
            TRAVIFET RL+T+VNGVLRKTT D+E+ GF++PKGWRI
Sbjct  332  TRAVIFETLRLSTVVNGVLRKTTQDMEIGGFVVPKGWRI  370



>ref|XP_006856402.1| hypothetical protein AMTR_s00047p00210610 [Amborella trichopoda]
 gb|ERN17869.1| hypothetical protein AMTR_s00047p00210610 [Amborella trichopoda]
Length=469

 Score = 69.3 bits (168),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 30/39 (77%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = -2

Query  118  TRAVIFETSRLATIVNGVLRKTTSDIELNGFLIPKGWRI  2
            T AVI+ET RL+TIVNGV RKTT D+ELNG+LIPKGW+I
Sbjct  335  THAVIYETMRLSTIVNGVFRKTTQDMELNGYLIPKGWKI  373



>gb|EMS53012.1| Cytochrome P450 85A1 [Triticum urartu]
Length=469

 Score = 69.3 bits (168),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 30/39 (77%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
 Frame = -2

Query  118  TRAVIFETSRLATIVNGVLRKTTSDIELNGFLIPKGWRI  2
            TRAVI ET RLAT+VNG+LRKTT D+E+NG++IPKGWRI
Sbjct  335  TRAVISETLRLATVVNGLLRKTTQDVEMNGYVIPKGWRI  373



>ref|XP_004507293.1| PREDICTED: cytochrome P450 85A-like [Cicer arietinum]
Length=464

 Score = 68.9 bits (167),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 30/39 (77%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = -2

Query  118  TRAVIFETSRLATIVNGVLRKTTSDIELNGFLIPKGWRI  2
            TRAVI ET+RLAT+VNGV RKTT D+ELNG+ IPKGW+I
Sbjct  330  TRAVILETTRLATVVNGVYRKTTQDMELNGYFIPKGWKI  368



>gb|EMT14727.1| Cytochrome P450 85A1 [Aegilops tauschii]
Length=470

 Score = 68.6 bits (166),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 29/39 (74%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = -2

Query  118  TRAVIFETSRLATIVNGVLRKTTSDIELNGFLIPKGWRI  2
            TRA IFET RLAT+VNG+LRKT  D+E+NG++IPKGWRI
Sbjct  336  TRAAIFETLRLATVVNGLLRKTIKDVEMNGYVIPKGWRI  374



>gb|EMT14728.1| Cytochrome P450 85A1 [Aegilops tauschii]
Length=484

 Score = 68.6 bits (166),  Expect = 5e-12, Method: Composition-based stats.
 Identities = 29/39 (74%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
 Frame = -2

Query  118  TRAVIFETSRLATIVNGVLRKTTSDIELNGFLIPKGWRI  2
            TRAVIFET RLAT+VNG+LRK T ++E+NG++IPKGWRI
Sbjct  350  TRAVIFETLRLATVVNGLLRKITQNVEMNGYVIPKGWRI  388



>ref|XP_009388906.1| PREDICTED: cytochrome P450 85A-like [Musa acuminata subsp. malaccensis]
Length=465

 Score = 67.8 bits (164),  Expect = 7e-12, Method: Composition-based stats.
 Identities = 30/39 (77%), Positives = 34/39 (87%), Gaps = 0/39 (0%)
 Frame = -2

Query  118  TRAVIFETSRLATIVNGVLRKTTSDIELNGFLIPKGWRI  2
            TRAVI ET R+AT+VNGVLRKTT D+E+ GF IPKGWRI
Sbjct  331  TRAVILETLRMATVVNGVLRKTTQDMEMKGFTIPKGWRI  369



>ref|XP_010936440.1| PREDICTED: cytochrome P450 85A1-like [Elaeis guineensis]
Length=464

 Score = 67.8 bits (164),  Expect = 9e-12, Method: Composition-based stats.
 Identities = 30/39 (77%), Positives = 34/39 (87%), Gaps = 0/39 (0%)
 Frame = -2

Query  118  TRAVIFETSRLATIVNGVLRKTTSDIELNGFLIPKGWRI  2
            TRAVI ET RLAT+VNGVLR+ T DIEL G++IPKGWRI
Sbjct  330  TRAVILETLRLATVVNGVLRQATKDIELKGYIIPKGWRI  368



>ref|XP_008785627.1| PREDICTED: cytochrome P450 85A1-like [Phoenix dactylifera]
Length=465

 Score = 67.4 bits (163),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 29/39 (74%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
 Frame = -2

Query  118  TRAVIFETSRLATIVNGVLRKTTSDIELNGFLIPKGWRI  2
            TRAVIFET RLAT+VNGVLR+TT ++E+ G++IPKGWRI
Sbjct  331  TRAVIFETLRLATVVNGVLRRTTQEMEMKGYIIPKGWRI  369



>ref|XP_010939208.1| PREDICTED: cytochrome P450 85A1-like [Elaeis guineensis]
Length=465

 Score = 67.4 bits (163),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 30/39 (77%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = -2

Query  118  TRAVIFETSRLATIVNGVLRKTTSDIELNGFLIPKGWRI  2
            TRAVIFET RLAT+VNGVLR+TT D+E+ G +IPKGWRI
Sbjct  331  TRAVIFETLRLATVVNGVLRRTTQDMEMKGCIIPKGWRI  369



>ref|XP_009397228.1| PREDICTED: cytochrome P450 85A1-like [Musa acuminata subsp. malaccensis]
Length=505

 Score = 66.6 bits (161),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 29/39 (74%), Positives = 34/39 (87%), Gaps = 0/39 (0%)
 Frame = -2

Query  118  TRAVIFETSRLATIVNGVLRKTTSDIELNGFLIPKGWRI  2
            TRAVI ET R+AT+VNGVLRKTT D+ + GF+IPKGWRI
Sbjct  362  TRAVILETLRMATVVNGVLRKTTKDVAMKGFIIPKGWRI  400



>ref|XP_010923636.1| PREDICTED: cytochrome P450 85A1-like isoform X3 [Elaeis guineensis]
Length=452

 Score = 66.2 bits (160),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 28/37 (76%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = -2

Query  112  AVIFETSRLATIVNGVLRKTTSDIELNGFLIPKGWRI  2
            +VIFET R+AT+VNGVLRKTT D+E+ GF+IPKGWRI
Sbjct  343  SVIFETLRIATVVNGVLRKTTQDVEMKGFVIPKGWRI  379



>gb|ACK44411.1| glutamine synthetase [Musa ABB Group]
Length=415

 Score = 65.9 bits (159),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 29/39 (74%), Positives = 33/39 (85%), Gaps = 0/39 (0%)
 Frame = -2

Query  118  TRAVIFETSRLATIVNGVLRKTTSDIELNGFLIPKGWRI  2
            TRAVI ET R+AT+VNGVLRKTT D+ + GF IPKGWRI
Sbjct  331  TRAVILETLRMATVVNGVLRKTTQDVAMKGFTIPKGWRI  369



>ref|XP_010923634.1| PREDICTED: cytochrome P450 85A1-like isoform X1 [Elaeis guineensis]
Length=475

 Score = 66.2 bits (160),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 28/37 (76%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = -2

Query  112  AVIFETSRLATIVNGVLRKTTSDIELNGFLIPKGWRI  2
            +VIFET R+AT+VNGVLRKTT D+E+ GF+IPKGWRI
Sbjct  343  SVIFETLRIATVVNGVLRKTTQDVEMKGFVIPKGWRI  379



>ref|XP_009402829.1| PREDICTED: cytochrome P450 85A1-like [Musa acuminata subsp. malaccensis]
Length=465

 Score = 65.9 bits (159),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 29/39 (74%), Positives = 33/39 (85%), Gaps = 0/39 (0%)
 Frame = -2

Query  118  TRAVIFETSRLATIVNGVLRKTTSDIELNGFLIPKGWRI  2
            TRAVI ET R+AT+VNGVLRKTT D+ + GF IPKGWRI
Sbjct  331  TRAVILETLRMATVVNGVLRKTTQDVAMKGFTIPKGWRI  369



>ref|XP_007153492.1| hypothetical protein PHAVU_003G040300g [Phaseolus vulgaris]
 gb|ESW25486.1| hypothetical protein PHAVU_003G040300g [Phaseolus vulgaris]
Length=462

 Score = 65.5 bits (158),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 26/39 (67%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
 Frame = -2

Query  118  TRAVIFETSRLATIVNGVLRKTTSDIELNGFLIPKGWRI  2
            TRAVI ET RLA++V+GV+R+T +D+ELNG++IPKGWR+
Sbjct  327  TRAVILETMRLASVVSGVMRRTANDVELNGYMIPKGWRV  365



>gb|EMT00039.1| Cytochrome P450 85A1 [Aegilops tauschii]
Length=418

 Score = 65.1 bits (157),  Expect = 7e-11, Method: Composition-based stats.
 Identities = 27/36 (75%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = -2

Query  109  VIFETSRLATIVNGVLRKTTSDIELNGFLIPKGWRI  2
            VIFET RLAT+VNG++RKTT D+E+NG +IPKGWRI
Sbjct  287  VIFETLRLATVVNGLMRKTTQDVEMNGHVIPKGWRI  322



>gb|KHN29966.1| Cytochrome P450 85A [Glycine soja]
Length=385

 Score = 63.9 bits (154),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 29/40 (73%), Positives = 36/40 (90%), Gaps = 1/40 (3%)
 Frame = -2

Query  118  TRAVIFETSRLATIVNGVLRKTTS-DIELNGFLIPKGWRI  2
            TRAVI ET RLA++V GV+R+TT+ DIELNGF+IPKGWR+
Sbjct  248  TRAVILETMRLASVVAGVMRRTTTNDIELNGFIIPKGWRV  287



>ref|XP_006575843.1| PREDICTED: cytochrome P450 85A-like [Glycine max]
Length=464

 Score = 63.9 bits (154),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 29/40 (73%), Positives = 36/40 (90%), Gaps = 1/40 (3%)
 Frame = -2

Query  118  TRAVIFETSRLATIVNGVLRKTTS-DIELNGFLIPKGWRI  2
            TRAVI ET RLA++V GV+R+TT+ DIELNGF+IPKGWR+
Sbjct  327  TRAVILETMRLASVVAGVMRRTTTNDIELNGFIIPKGWRV  366



>ref|XP_010091606.1| Cytochrome P450 85A [Morus notabilis]
 gb|EXB44872.1| Cytochrome P450 85A [Morus notabilis]
Length=472

 Score = 63.2 bits (152),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 26/39 (67%), Positives = 34/39 (87%), Gaps = 0/39 (0%)
 Frame = -2

Query  118  TRAVIFETSRLATIVNGVLRKTTSDIELNGFLIPKGWRI  2
            TRAVIFETSRLA +V G++RK  SD++LNGF+ PKGW++
Sbjct  249  TRAVIFETSRLACVVCGMMRKIASDMDLNGFVFPKGWKV  287



>gb|KHN05627.1| Cytochrome P450 85A1 [Glycine soja]
Length=106

 Score = 56.6 bits (135),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 25/39 (64%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = -2

Query  118  TRAVIFETSRLATIVNGVLRKTTSDIELNGFLIPKGWRI  2
            TRAVI ET RL ++V  V+R+ T+DIE NGF+IPKGWR+
Sbjct  17   TRAVILETMRLVSVVARVMRRATNDIESNGFMIPKGWRV  55



>emb|CDX85284.1| BnaC07g25950D [Brassica napus]
Length=370

 Score = 58.2 bits (139),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 27/30 (90%), Positives = 29/30 (97%), Gaps = 0/30 (0%)
 Frame = -2

Query  118  TRAVIFETSRLATIVNGVLRKTTSDIELNG  29
            TRAVIFETSRLAT+VNGVLRKTT D+ELNG
Sbjct  331  TRAVIFETSRLATVVNGVLRKTTHDLELNG  360



>gb|KEH21757.1| cytochrome P450 family protein [Medicago truncatula]
Length=368

 Score = 58.2 bits (139),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 28/30 (93%), Positives = 29/30 (97%), Gaps = 0/30 (0%)
 Frame = -2

Query  118  TRAVIFETSRLATIVNGVLRKTTSDIELNG  29
            TRAVIFETSRLATIVNGVLRKTT D+ELNG
Sbjct  329  TRAVIFETSRLATIVNGVLRKTTHDMELNG  358



>ref|XP_010446800.1| PREDICTED: 3-epi-6-deoxocathasterone 23-monooxygenase-like [Camelina 
sativa]
Length=196

 Score = 50.8 bits (120),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 22/39 (56%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = -2

Query  118  TRAVIFETSRLATIVNGVLRKTTSDIELNGFLIPKGWRI  2
            T+ VI ET R+A I+NGV RK   D+E+ G+LIPKGW +
Sbjct  59   TQNVINETLRMANIINGVWRKALKDVEIKGYLIPKGWGV  97



>gb|AFK34038.1| unknown [Medicago truncatula]
Length=240

 Score = 51.2 bits (121),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 20/37 (54%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = -2

Query  118  TRAVIFETSRLATIVNGVLRKTTSDIELNGFLIPKGW  8
            T+ VI ET R+  I+NGV+RK   D+E+ G+LIP+GW
Sbjct  106  TQKVITETLRMGNIINGVMRKALKDVEIKGYLIPQGW  142



>emb|CAA18139.1| cytochrome P450 like protein (fragment) [Arabidopsis thaliana]
Length=255

 Score = 51.2 bits (121),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 22/37 (59%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = -2

Query  118  TRAVIFETSRLATIVNGVLRKTTSDIELNGFLIPKGW  8
            T+ VI ET R+A I+NGV RK   D+E+ G+LIPKGW
Sbjct  108  TQNVINETLRMANIINGVWRKALKDVEIKGYLIPKGW  144



>gb|KHG04872.1| Cytochrome P450 protein [Gossypium arboreum]
Length=171

 Score = 49.7 bits (117),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 19/39 (49%), Positives = 30/39 (77%), Gaps = 0/39 (0%)
 Frame = -2

Query  118  TRAVIFETSRLATIVNGVLRKTTSDIELNGFLIPKGWRI  2
            T+ VI ET R+A I++GV R+T +D+ + G+ IPKGW++
Sbjct  33   TQCVINETLRVANIISGVFRRTVADVNIKGYTIPKGWKV  71



>ref|XP_010543733.1| PREDICTED: cytochrome P450 90A1 [Tarenaya hassleriana]
Length=487

 Score = 52.0 bits (123),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 20/39 (51%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = -2

Query  118  TRAVIFETSRLATIVNGVLRKTTSDIELNGFLIPKGWRI  2
            T+ V+ ET R+A I++GV R+TT+D+E+ G+ IPKGW++
Sbjct  348  TQCVVNETLRVANIISGVFRRTTTDVEIKGYTIPKGWKV  386



>ref|XP_002439427.1| hypothetical protein SORBIDRAFT_09g006260 [Sorghum bicolor]
 gb|EES17857.1| hypothetical protein SORBIDRAFT_09g006260 [Sorghum bicolor]
Length=525

 Score = 52.0 bits (123),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 21/39 (54%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = -2

Query  118  TRAVIFETSRLATIVNGVLRKTTSDIELNGFLIPKGWRI  2
            T+ VI ET R+  I+NG++RK   D+E+ G LIPKGWR+
Sbjct  384  TQHVITETLRMGNIINGIMRKAVRDVEVRGHLIPKGWRV  422



>ref|XP_008649444.1| PREDICTED: cytochrome P450 90D2-like [Zea mays]
 gb|AFW77445.1| putative cytochrome P450 superfamily protein [Zea mays]
Length=522

 Score = 51.6 bits (122),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 20/39 (51%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = -2

Query  118  TRAVIFETSRLATIVNGVLRKTTSDIELNGFLIPKGWRI  2
            T+ VI ET R+  I+NG++RK   D+E+ G L+PKGWR+
Sbjct  381  TQHVITETLRMGNIINGIMRKAVRDVEVRGHLVPKGWRV  419



>gb|ACG30621.1| cytochrome P450 CYP90D10.b [Zea mays]
Length=519

 Score = 51.6 bits (122),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 20/39 (51%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = -2

Query  118  TRAVIFETSRLATIVNGVLRKTTSDIELNGFLIPKGWRI  2
            T+ VI ET R+  I+NG++RK   D+E+ G L+PKGWR+
Sbjct  383  TQHVITETLRMGNIINGIMRKAVRDVEVRGHLVPKGWRV  421



>gb|KEH18339.1| cytochrome P450 family 90 protein [Medicago truncatula]
Length=412

 Score = 51.6 bits (122),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 20/37 (54%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = -2

Query  118  TRAVIFETSRLATIVNGVLRKTTSDIELNGFLIPKGW  8
            T+ VI ET R+  I+NGV+RK   D+E+ G+LIP+GW
Sbjct  340  TQKVITETLRMGNIINGVMRKALKDVEIKGYLIPQGW  376



>gb|KEH18338.1| cytochrome P450 family 90 protein [Medicago truncatula]
Length=474

 Score = 51.6 bits (122),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 20/37 (54%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = -2

Query  118  TRAVIFETSRLATIVNGVLRKTTSDIELNGFLIPKGW  8
            T+ VI ET R+  I+NGV+RK   D+E+ G+LIP+GW
Sbjct  340  TQKVITETLRMGNIINGVMRKALKDVEIKGYLIPQGW  376



>ref|XP_004960929.1| PREDICTED: cytochrome P450 90D2-like [Setaria italica]
Length=514

 Score = 51.6 bits (122),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 21/39 (54%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = -2

Query  118  TRAVIFETSRLATIVNGVLRKTTSDIELNGFLIPKGWRI  2
            T+ VI ET R+  I+NG++RK   D+E+ G LIPKGWR+
Sbjct  376  TQHVITETLRMGNIINGIMRKAVRDVEVRGHLIPKGWRV  414



>ref|XP_010451031.1| PREDICTED: 3-epi-6-deoxocathasterone 23-monooxygenase-like [Camelina 
sativa]
Length=349

 Score = 50.8 bits (120),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 22/39 (56%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = -2

Query  118  TRAVIFETSRLATIVNGVLRKTTSDIELNGFLIPKGWRI  2
            T+ VI ET R+A I+NGV RK   D+E+ G+LIPKGW +
Sbjct  212  TQNVINETLRMANIINGVWRKALKDVEIKGYLIPKGWGV  250



>gb|KDP40788.1| hypothetical protein JCGZ_24787 [Jatropha curcas]
Length=354

 Score = 50.8 bits (120),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 22/37 (59%), Positives = 27/37 (73%), Gaps = 0/37 (0%)
 Frame = -2

Query  118  TRAVIFETSRLATIVNGVLRKTTSDIELNGFLIPKGW  8
            T+ VI ET RL  I+ GV+RK   DIE+ G+LIPKGW
Sbjct  221  TQKVITETLRLGNIIIGVMRKAMKDIEIKGYLIPKGW  257



>gb|KCW65675.1| hypothetical protein EUGRSUZ_G03059 [Eucalyptus grandis]
Length=460

 Score = 50.8 bits (120),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 19/39 (49%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = -2

Query  118  TRAVIFETSRLATIVNGVLRKTTSDIELNGFLIPKGWRI  2
            T+ VI ET R+A I++GV R+T +D+++ G++IPKGW++
Sbjct  336  TQCVINETLRVANIISGVFRRTMTDVQIKGYMIPKGWKV  374



>ref|NP_568002.1| 3-epi-6-deoxocathasterone 23-monooxygenase [Arabidopsis thaliana]
 sp|Q9M066.3|C90C1_ARATH RecName: Full=3-epi-6-deoxocathasterone 23-monooxygenase; AltName: 
Full=Cytochrome P450 90C1; AltName: Full=Protein ROTUNDIFOLIA 
3 [Arabidopsis thaliana]
 gb|ABJ17155.1| At4g36380 [Arabidopsis thaliana]
 gb|AEE86649.1| 3-epi-6-deoxocathasterone 23-monooxygenase [Arabidopsis thaliana]
Length=524

 Score = 51.2 bits (121),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 22/37 (59%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = -2

Query  118  TRAVIFETSRLATIVNGVLRKTTSDIELNGFLIPKGW  8
            T+ VI ET R+A I+NGV RK   D+E+ G+LIPKGW
Sbjct  377  TQNVINETLRMANIINGVWRKALKDVEIKGYLIPKGW  413



>dbj|BAF00083.1| cytochrome P450 [Arabidopsis thaliana]
Length=524

 Score = 51.2 bits (121),  Expect = 7e-06, Method: Composition-based stats.
 Identities = 22/37 (59%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = -2

Query  118  TRAVIFETSRLATIVNGVLRKTTSDIELNGFLIPKGW  8
            T+ VI ET R+A I+NGV RK   D+E+ G+LIPKGW
Sbjct  377  TQNVINETLRMANIINGVWRKALKDVEIKGYLIPKGW  413



>ref|XP_010067524.1| PREDICTED: cytochrome P450 90A1-like isoform X2 [Eucalyptus grandis]
 gb|KCW65674.1| hypothetical protein EUGRSUZ_G03059 [Eucalyptus grandis]
Length=476

 Score = 50.8 bits (120),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 19/39 (49%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = -2

Query  118  TRAVIFETSRLATIVNGVLRKTTSDIELNGFLIPKGWRI  2
            T+ VI ET R+A I++GV R+T +D+++ G++IPKGW++
Sbjct  336  TQCVINETLRVANIISGVFRRTMTDVQIKGYMIPKGWKV  374



>emb|CAB16850.1| cytochrome P450 like protein [Arabidopsis thaliana]
 emb|CAB80304.1| cytochrome P450 like protein [Arabidopsis thaliana]
Length=457

 Score = 50.8 bits (120),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 22/37 (59%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = -2

Query  118  TRAVIFETSRLATIVNGVLRKTTSDIELNGFLIPKGW  8
            T+ VI ET R+A I+NGV RK   D+E+ G+LIPKGW
Sbjct  310  TQNVINETLRMANIINGVWRKALKDVEIKGYLIPKGW  346



>ref|XP_006385357.1| hypothetical protein POPTR_0003s03030g [Populus trichocarpa]
 gb|ERP63154.1| hypothetical protein POPTR_0003s03030g [Populus trichocarpa]
Length=462

 Score = 50.8 bits (120),  Expect = 8e-06, Method: Composition-based stats.
 Identities = 21/37 (57%), Positives = 27/37 (73%), Gaps = 0/37 (0%)
 Frame = -2

Query  118  TRAVIFETSRLATIVNGVLRKTTSDIELNGFLIPKGW  8
            T+ VI ET R+  I+ GV+RK   DIE+ G+LIPKGW
Sbjct  357  TQTVITETLRMGNIIIGVMRKAMKDIEIKGYLIPKGW  393



>ref|XP_011014715.1| PREDICTED: 3-epi-6-deoxocathasterone 23-monooxygenase-like isoform 
X3 [Populus euphratica]
Length=476

 Score = 50.8 bits (120),  Expect = 8e-06, Method: Composition-based stats.
 Identities = 21/37 (57%), Positives = 27/37 (73%), Gaps = 0/37 (0%)
 Frame = -2

Query  118  TRAVIFETSRLATIVNGVLRKTTSDIELNGFLIPKGW  8
            T+ VI ET R+  I+ GV+RK   DIE+ G+LIPKGW
Sbjct  357  TQTVITETLRMGNIIIGVMRKAMKDIEIKGYLIPKGW  393



>ref|XP_011014460.1| PREDICTED: 3-epi-6-deoxocathasterone 23-monooxygenase-like isoform 
X3 [Populus euphratica]
Length=476

 Score = 50.8 bits (120),  Expect = 8e-06, Method: Composition-based stats.
 Identities = 21/37 (57%), Positives = 27/37 (73%), Gaps = 0/37 (0%)
 Frame = -2

Query  118  TRAVIFETSRLATIVNGVLRKTTSDIELNGFLIPKGW  8
            T+ VI ET R+  I+ GV+RK   DIE+ G+LIPKGW
Sbjct  357  TQTVITETLRMGNIIIGVMRKAMKDIEIKGYLIPKGW  393



>emb|CDY59695.1| BnaC07g51130D [Brassica napus]
Length=505

 Score = 50.8 bits (120),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 22/37 (59%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = -2

Query  118  TRAVIFETSRLATIVNGVLRKTTSDIELNGFLIPKGW  8
            T+ VI ET R+A I+NGV RK   D+E+ G+LIPKGW
Sbjct  359  TQNVINETLRMANIINGVWRKALEDVEIKGYLIPKGW  395



>ref|XP_010437356.1| PREDICTED: 3-epi-6-deoxocathasterone 23-monooxygenase [Camelina 
sativa]
Length=496

 Score = 50.8 bits (120),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 22/37 (59%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = -2

Query  118  TRAVIFETSRLATIVNGVLRKTTSDIELNGFLIPKGW  8
            T+ VI ET R+A I+NGV RK   D+E+ G+LIPKGW
Sbjct  358  TQNVINETLRMANIINGVWRKALKDVEIKGYLIPKGW  394



>ref|NP_001289920.1| 3-epi-6-deoxocathasterone 23-monooxygenase-like [Camelina sativa]
 gb|AID81894.1| rotundifolia 3 [Camelina sativa]
Length=499

 Score = 50.8 bits (120),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 22/37 (59%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = -2

Query  118  TRAVIFETSRLATIVNGVLRKTTSDIELNGFLIPKGW  8
            T+ VI ET R+A I+NGV RK   D+E+ G+LIPKGW
Sbjct  357  TQNVINETLRMANIINGVWRKALKDVEIKGYLIPKGW  393



>ref|XP_009144986.1| PREDICTED: 3-epi-6-deoxocathasterone 23-monooxygenase [Brassica 
rapa]
Length=527

 Score = 50.8 bits (120),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 22/37 (59%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = -2

Query  118  TRAVIFETSRLATIVNGVLRKTTSDIELNGFLIPKGW  8
            T+ VI ET R+A I+NGV RK   D+E+ G+LIPKGW
Sbjct  381  TQNVINETLRMANIINGVWRKALKDVEIKGYLIPKGW  417



>emb|CDX75570.1| BnaA01g01320D [Brassica napus]
Length=527

 Score = 50.8 bits (120),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 22/37 (59%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = -2

Query  118  TRAVIFETSRLATIVNGVLRKTTSDIELNGFLIPKGW  8
            T+ VI ET R+A I+NGV RK   D+E+ G+LIPKGW
Sbjct  381  TQNVINETLRMANIINGVWRKALKDVEIKGYLIPKGW  417



>gb|KGN59825.1| hypothetical protein Csa_3G848830 [Cucumis sativus]
Length=485

 Score = 50.8 bits (120),  Expect = 9e-06, Method: Composition-based stats.
 Identities = 22/37 (59%), Positives = 27/37 (73%), Gaps = 0/37 (0%)
 Frame = -2

Query  118  TRAVIFETSRLATIVNGVLRKTTSDIELNGFLIPKGW  8
            T+ VI ET RL  I+ GV+RK   DIE+ G+LIPKGW
Sbjct  380  TQNVITETLRLGNIITGVMRKAMKDIEIKGYLIPKGW  416



>gb|EMT09662.1| Cytochrome P450 90D2 [Aegilops tauschii]
Length=325

 Score = 50.1 bits (118),  Expect = 9e-06, Method: Composition-based stats.
 Identities = 20/39 (51%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = -2

Query  118  TRAVIFETSRLATIVNGVLRKTTSDIELNGFLIPKGWRI  2
            T+ VI ET R+  I++G++RK   D+E+ G LIPKGWR+
Sbjct  192  TQHVITETLRIGNIISGIMRKAVRDVEVKGHLIPKGWRV  230



>gb|KHN36065.1| 3-epi-6-deoxocathasterone 23-monooxygenase [Glycine soja]
Length=635

 Score = 50.8 bits (120),  Expect = 9e-06, Method: Composition-based stats.
 Identities = 22/37 (59%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = -2

Query  118  TRAVIFETSRLATIVNGVLRKTTSDIELNGFLIPKGW  8
            T+ VI ET R+A IVNG+ RK+ +DIE+ G+LIPK W
Sbjct  352  TQNVISETLRMANIVNGIWRKSVNDIEIKGYLIPKHW  388



>gb|KFK30265.1| hypothetical protein AALP_AA7G238700 [Arabis alpina]
Length=526

 Score = 50.8 bits (120),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 22/37 (59%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = -2

Query  118  TRAVIFETSRLATIVNGVLRKTTSDIELNGFLIPKGW  8
            T+ VI ET R+A I+NGV RK   D+E+ G+LIPKGW
Sbjct  383  TQNVINETLRMANIINGVWRKALKDVEIKGYLIPKGW  419



>dbj|BAA37167.1| cytochrome P450 [Arabidopsis thaliana]
Length=524

 Score = 50.8 bits (120),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 22/37 (59%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = -2

Query  118  TRAVIFETSRLATIVNGVLRKTTSDIELNGFLIPKGW  8
            T+ VI ET R+A I+NGV RK   D+E+ G+LIPKGW
Sbjct  377  TQNVINETLRMANIINGVWRKALKDVEIKGYLIPKGW  413



>ref|XP_006283516.1| hypothetical protein CARUB_v10004567mg, partial [Capsella rubella]
 gb|EOA16414.1| hypothetical protein CARUB_v10004567mg, partial [Capsella rubella]
Length=531

 Score = 50.8 bits (120),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 22/37 (59%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = -2

Query  118  TRAVIFETSRLATIVNGVLRKTTSDIELNGFLIPKGW  8
            T+ VI ET R+A I+NGV RK   D+E+ G+LIPKGW
Sbjct  385  TQNVINETLRMANIINGVWRKALKDVEIKGYLIPKGW  421



>ref|XP_003538868.2| PREDICTED: 3-epi-6-deoxocathasterone 23-monooxygenase-like [Glycine 
max]
 gb|KHN41931.1| 3-epi-6-deoxocathasterone 23-monooxygenase [Glycine soja]
Length=493

 Score = 50.4 bits (119),  Expect = 9e-06, Method: Composition-based stats.
 Identities = 22/37 (59%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = -2

Query  118  TRAVIFETSRLATIVNGVLRKTTSDIELNGFLIPKGW  8
            T+ VI ET R+A IVNG+ RK+ +DIE+ G+LIPK W
Sbjct  357  TQNVISETLRMANIVNGIWRKSVNDIEIKGYLIPKHW  393



>gb|KHF97864.1| 3-epi-6-deoxocathasterone 23-monooxygenase -like protein [Gossypium 
arboreum]
Length=490

 Score = 50.4 bits (119),  Expect = 9e-06, Method: Composition-based stats.
 Identities = 22/37 (59%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = -2

Query  118  TRAVIFETSRLATIVNGVLRKTTSDIELNGFLIPKGW  8
            T+ VI ET RLA I+NGV RK   DI++ G+LIP+GW
Sbjct  356  TQNVISETLRLANIINGVWRKAVKDIDIKGYLIPQGW  392



>emb|CDY64922.1| BnaAnng19730D [Brassica napus]
Length=542

 Score = 50.4 bits (119),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 22/37 (59%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = -2

Query  118  TRAVIFETSRLATIVNGVLRKTTSDIELNGFLIPKGW  8
            T+ VI ET R+A I+NGV RK   D+E+ G+LIPKGW
Sbjct  396  TQNVINETLRMANIINGVWRKALKDVEIKGYLIPKGW  432



>ref|XP_009400635.1| PREDICTED: cytochrome P450 87A3-like [Musa acuminata subsp. malaccensis]
Length=411

 Score = 50.4 bits (119),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 22/39 (56%), Positives = 28/39 (72%), Gaps = 0/39 (0%)
 Frame = -2

Query  118  TRAVIFETSRLATIVNGVLRKTTSDIELNGFLIPKGWRI  2
            T  VI ET+RLA IV G+ RK   DI++NG+ IP GWR+
Sbjct  274  TFQVITETARLANIVPGIFRKALKDIQINGYTIPSGWRV  312



>ref|XP_007158614.1| hypothetical protein PHAVU_002G167400g [Phaseolus vulgaris]
 gb|ESW30608.1| hypothetical protein PHAVU_002G167400g [Phaseolus vulgaris]
Length=488

 Score = 50.4 bits (119),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 22/37 (59%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = -2

Query  118  TRAVIFETSRLATIVNGVLRKTTSDIELNGFLIPKGW  8
            T+ VI ET R+A IVNG+ RK+ +DIE+ G+LIPK W
Sbjct  352  TQNVISETLRMANIVNGIWRKSVNDIEIKGYLIPKHW  388



>ref|XP_006412009.1| hypothetical protein EUTSA_v10024901mg [Eutrema salsugineum]
 gb|ESQ53462.1| hypothetical protein EUTSA_v10024901mg [Eutrema salsugineum]
Length=526

 Score = 50.4 bits (119),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 22/37 (59%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = -2

Query  118  TRAVIFETSRLATIVNGVLRKTTSDIELNGFLIPKGW  8
            T+ VI ET R+A I+NGV RK   D+E+ G+LIPKGW
Sbjct  385  TQNVINETLRMANIINGVWRKALKDVEIKGYLIPKGW  421



>ref|XP_009138419.1| PREDICTED: 3-epi-6-deoxocathasterone 23-monooxygenase-like [Brassica 
rapa]
Length=542

 Score = 50.4 bits (119),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 22/37 (59%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = -2

Query  118  TRAVIFETSRLATIVNGVLRKTTSDIELNGFLIPKGW  8
            T+ VI ET R+A I+NGV RK   D+E+ G+LIPKGW
Sbjct  396  TQNVINETLRMANIINGVWRKALKDVEIKGYLIPKGW  432



>ref|XP_007024452.1| Cytochrome P450, putative [Theobroma cacao]
 gb|EOY27074.1| Cytochrome P450, putative [Theobroma cacao]
Length=451

 Score = 50.4 bits (119),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 21/37 (57%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = -2

Query  118  TRAVIFETSRLATIVNGVLRKTTSDIELNGFLIPKGW  8
            T++VI ET R+  I+ GV+RK   DIE+ G+LIPKGW
Sbjct  315  TQSVITETLRMGNIIIGVMRKAMKDIEIKGYLIPKGW  351



>ref|XP_007046800.1| Cytochrome P450 superfamily protein [Theobroma cacao]
 gb|EOX90957.1| Cytochrome P450 superfamily protein [Theobroma cacao]
Length=494

 Score = 50.4 bits (119),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 22/37 (59%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = -2

Query  118  TRAVIFETSRLATIVNGVLRKTTSDIELNGFLIPKGW  8
            T+ VI ET RLA I+NGV RK   DI++ G+LIP+GW
Sbjct  356  TQNVISETLRLANIINGVWRKALKDIDIKGYLIPQGW  392



>ref|XP_011016740.1| PREDICTED: cytochrome P450 90A1-like [Populus euphratica]
Length=178

 Score = 48.1 bits (113),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 18/39 (46%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = -2

Query  118  TRAVIFETSRLATIVNGVLRKTTSDIELNGFLIPKGWRI  2
            T+ V+ ET R+A I+ G+ R+T +DI + G+ IPKGW++
Sbjct  36   TQCVVNETLRIANIIGGIFRRTMTDINVKGYTIPKGWKV  74



>ref|XP_010943062.1| PREDICTED: LOW QUALITY PROTEIN: abscisic acid 8'-hydroxylase 
3-like [Elaeis guineensis]
Length=511

 Score = 50.4 bits (119),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 19/39 (49%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = -2

Query  118  TRAVIFETSRLATIVNGVLRKTTSDIELNGFLIPKGWRI  2
            TR VI E+ R+A+I++   R+   D+E NG+LIPKGW++
Sbjct  369  TRRVILESLRMASIISFTFREAVVDVEYNGYLIPKGWKV  407



>ref|XP_011014714.1| PREDICTED: 3-epi-6-deoxocathasterone 23-monooxygenase-like isoform 
X2 [Populus euphratica]
Length=492

 Score = 50.4 bits (119),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 21/37 (57%), Positives = 27/37 (73%), Gaps = 0/37 (0%)
 Frame = -2

Query  118  TRAVIFETSRLATIVNGVLRKTTSDIELNGFLIPKGW  8
            T+ VI ET R+  I+ GV+RK   DIE+ G+LIPKGW
Sbjct  357  TQTVITETLRMGNIIIGVMRKAMKDIEIKGYLIPKGW  393



>ref|XP_011014459.1| PREDICTED: 3-epi-6-deoxocathasterone 23-monooxygenase-like isoform 
X2 [Populus euphratica]
Length=492

 Score = 50.4 bits (119),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 21/37 (57%), Positives = 27/37 (73%), Gaps = 0/37 (0%)
 Frame = -2

Query  118  TRAVIFETSRLATIVNGVLRKTTSDIELNGFLIPKGW  8
            T+ VI ET R+  I+ GV+RK   DIE+ G+LIPKGW
Sbjct  357  TQTVITETLRMGNIIIGVMRKAMKDIEIKGYLIPKGW  393



>ref|XP_010679812.1| PREDICTED: 3-epi-6-deoxocathasterone 23-monooxygenase [Beta vulgaris 
subsp. vulgaris]
Length=510

 Score = 50.4 bits (119),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 20/37 (54%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = -2

Query  118  TRAVIFETSRLATIVNGVLRKTTSDIELNGFLIPKGW  8
            T+ VI ET R+A I+N + R+ T D+E+ G+LIPKGW
Sbjct  374  TQNVISETLRMANIINAIWRQATKDVEIKGYLIPKGW  410



>emb|CDM81539.1| unnamed protein product [Triticum aestivum]
Length=489

 Score = 50.1 bits (118),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 20/39 (51%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = -2

Query  118  TRAVIFETSRLATIVNGVLRKTTSDIELNGFLIPKGWRI  2
            T+ VI ET R+  I++G++RK   D+E+ G LIPKGWR+
Sbjct  356  TQHVITETLRIGNIISGIMRKAVRDVEVKGHLIPKGWRV  394



>ref|XP_006838682.1| hypothetical protein AMTR_s00002p00244980 [Amborella trichopoda]
 gb|ERN01251.1| hypothetical protein AMTR_s00002p00244980 [Amborella trichopoda]
Length=441

 Score = 50.1 bits (118),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 20/37 (54%), Positives = 27/37 (73%), Gaps = 0/37 (0%)
 Frame = -2

Query  118  TRAVIFETSRLATIVNGVLRKTTSDIELNGFLIPKGW  8
            T+ VI ET R+  I+N V+RK   D+E+ G+LIPKGW
Sbjct  300  TQNVITETLRIGNIINAVMRKALKDVEIKGYLIPKGW  336



>ref|XP_008447603.1| PREDICTED: 3-epi-6-deoxocathasterone 23-monooxygenase-like [Cucumis 
melo]
Length=502

 Score = 50.1 bits (118),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 22/37 (59%), Positives = 27/37 (73%), Gaps = 0/37 (0%)
 Frame = -2

Query  118  TRAVIFETSRLATIVNGVLRKTTSDIELNGFLIPKGW  8
            T+ VI ET RL  I+ GV+RK   DIE+ G+LIPKGW
Sbjct  368  TQNVITETLRLGNIITGVMRKAMKDIEIKGYLIPKGW  404



>ref|XP_011014713.1| PREDICTED: 3-epi-6-deoxocathasterone 23-monooxygenase-like isoform 
X1 [Populus euphratica]
Length=497

 Score = 50.1 bits (118),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 21/37 (57%), Positives = 27/37 (73%), Gaps = 0/37 (0%)
 Frame = -2

Query  118  TRAVIFETSRLATIVNGVLRKTTSDIELNGFLIPKGW  8
            T+ VI ET R+  I+ GV+RK   DIE+ G+LIPKGW
Sbjct  357  TQTVITETLRMGNIIIGVMRKAMKDIEIKGYLIPKGW  393



>ref|XP_011014458.1| PREDICTED: 3-epi-6-deoxocathasterone 23-monooxygenase-like isoform 
X1 [Populus euphratica]
Length=497

 Score = 50.1 bits (118),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 21/37 (57%), Positives = 27/37 (73%), Gaps = 0/37 (0%)
 Frame = -2

Query  118  TRAVIFETSRLATIVNGVLRKTTSDIELNGFLIPKGW  8
            T+ VI ET R+  I+ GV+RK   DIE+ G+LIPKGW
Sbjct  357  TQTVITETLRMGNIIIGVMRKAMKDIEIKGYLIPKGW  393



>ref|XP_003572289.1| PREDICTED: abscisic acid 8'-hydroxylase 2 [Brachypodium distachyon]
Length=495

 Score = 50.1 bits (118),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 19/39 (49%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = -2

Query  118  TRAVIFETSRLATIVNGVLRKTTSDIELNGFLIPKGWRI  2
            T AVI E+ R+A+I++   R+  +D+E  GFLIPKGW++
Sbjct  348  THAVIMESLRMASIISFTFREAVADVEYKGFLIPKGWKV  386



>ref|XP_004236391.1| PREDICTED: cytochrome P450 90D2 [Solanum lycopersicum]
Length=486

 Score = 50.1 bits (118),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 21/37 (57%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = -2

Query  118  TRAVIFETSRLATIVNGVLRKTTSDIELNGFLIPKGW  8
            T+ VI ET RL  I+ GV+RK+  D+E+ G+LIPKGW
Sbjct  348  TQNVISETLRLGNIIIGVMRKSVKDVEIKGYLIPKGW  384



>ref|XP_004146852.1| PREDICTED: LOW QUALITY PROTEIN: 3-epi-6-deoxocathasterone 23-monooxygenase-like 
[Cucumis sativus]
Length=861

 Score = 50.4 bits (119),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 22/37 (59%), Positives = 27/37 (73%), Gaps = 0/37 (0%)
 Frame = -2

Query  118  TRAVIFETSRLATIVNGVLRKTTSDIELNGFLIPKGW  8
            T+ VI ET RL  I+ GV+RK   DIE+ G+LIPKGW
Sbjct  374  TQNVITETLRLGNIITGVMRKAMKDIEIKGYLIPKGW  410



>ref|XP_004154871.1| PREDICTED: 3-epi-6-deoxocathasterone 23-monooxygenase-like [Cucumis 
sativus]
Length=859

 Score = 50.4 bits (119),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 22/37 (59%), Positives = 27/37 (73%), Gaps = 0/37 (0%)
 Frame = -2

Query  118  TRAVIFETSRLATIVNGVLRKTTSDIELNGFLIPKGW  8
            T+ VI ET RL  I+ GV+RK   DIE+ G+LIPKGW
Sbjct  371  TQNVITETLRLGNIITGVMRKAMKDIEIKGYLIPKGW  407



>gb|KDO65291.1| hypothetical protein CISIN_1g010923mg [Citrus sinensis]
 gb|KDO65292.1| hypothetical protein CISIN_1g010923mg [Citrus sinensis]
Length=464

 Score = 50.1 bits (118),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 21/37 (57%), Positives = 27/37 (73%), Gaps = 0/37 (0%)
 Frame = -2

Query  118  TRAVIFETSRLATIVNGVLRKTTSDIELNGFLIPKGW  8
            T+ VI ET R+  I+ GV+RK   DIE+ G+LIPKGW
Sbjct  358  TQNVITETLRMGNIIIGVMRKAMRDIEIKGYLIPKGW  394



>ref|XP_006426521.1| hypothetical protein CICLE_v10025448mg [Citrus clementina]
 gb|ESR39761.1| hypothetical protein CICLE_v10025448mg [Citrus clementina]
Length=464

 Score = 50.1 bits (118),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 21/37 (57%), Positives = 27/37 (73%), Gaps = 0/37 (0%)
 Frame = -2

Query  118  TRAVIFETSRLATIVNGVLRKTTSDIELNGFLIPKGW  8
            T+ VI ET R+  I+ GV+RK   DIE+ G+LIPKGW
Sbjct  358  TQNVITETLRMGNIIIGVMRKAMRDIEIKGYLIPKGW  394



>ref|XP_008391454.1| PREDICTED: 3-epi-6-deoxocathasterone 23-monooxygenase [Malus 
domestica]
Length=505

 Score = 50.1 bits (118),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 20/37 (54%), Positives = 27/37 (73%), Gaps = 0/37 (0%)
 Frame = -2

Query  118  TRAVIFETSRLATIVNGVLRKTTSDIELNGFLIPKGW  8
            T+ VI ET R+  I+ GV+RK   D+E+ G+LIPKGW
Sbjct  368  TQNVITETLRMGNIITGVMRKAMKDVEIKGYLIPKGW  404



>ref|XP_006426519.1| hypothetical protein CICLE_v10025448mg [Citrus clementina]
 gb|ESR39759.1| hypothetical protein CICLE_v10025448mg [Citrus clementina]
Length=472

 Score = 50.1 bits (118),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 21/37 (57%), Positives = 27/37 (73%), Gaps = 0/37 (0%)
 Frame = -2

Query  118  TRAVIFETSRLATIVNGVLRKTTSDIELNGFLIPKGW  8
            T+ VI ET R+  I+ GV+RK   DIE+ G+LIPKGW
Sbjct  358  TQNVITETLRMGNIIIGVMRKAMRDIEIKGYLIPKGW  394



>ref|XP_004510262.1| PREDICTED: beta-amyrin 11-oxidase-like [Cicer arietinum]
Length=492

 Score = 50.1 bits (118),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 21/36 (58%), Positives = 26/36 (72%), Gaps = 0/36 (0%)
 Frame = -2

Query  109  VIFETSRLATIVNGVLRKTTSDIELNGFLIPKGWRI  2
            VI ET R A I   + R+ TSD+ LNG+LIPKGWR+
Sbjct  358  VINETLRCANIAFSIFREATSDVNLNGYLIPKGWRV  393



>ref|XP_009342078.1| PREDICTED: cytochrome P450 90D2-like [Pyrus x bretschneideri]
Length=505

 Score = 50.1 bits (118),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 20/37 (54%), Positives = 27/37 (73%), Gaps = 0/37 (0%)
 Frame = -2

Query  118  TRAVIFETSRLATIVNGVLRKTTSDIELNGFLIPKGW  8
            T+ VI ET R+  I+ GV+RK   D+E+ G+LIPKGW
Sbjct  363  TQNVITETLRMGNIITGVMRKAMKDVEIKGYLIPKGW  399



>ref|XP_009761164.1| PREDICTED: 3-epi-6-deoxocathasterone 23-monooxygenase [Nicotiana 
sylvestris]
Length=493

 Score = 50.1 bits (118),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 21/37 (57%), Positives = 27/37 (73%), Gaps = 0/37 (0%)
 Frame = -2

Query  118  TRAVIFETSRLATIVNGVLRKTTSDIELNGFLIPKGW  8
            TR VI ET R+  I+ GV+RK   D+E+ G+LIPKGW
Sbjct  356  TRNVISETLRMGNIIIGVMRKAVKDVEIKGYLIPKGW  392



>gb|EYU21380.1| hypothetical protein MIMGU_mgv1a005297mg [Erythranthe guttata]
Length=490

 Score = 50.1 bits (118),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 20/37 (54%), Positives = 27/37 (73%), Gaps = 0/37 (0%)
 Frame = -2

Query  118  TRAVIFETSRLATIVNGVLRKTTSDIELNGFLIPKGW  8
            T+ VI ET R+  I+ GV+RK   D+E+ G+LIPKGW
Sbjct  357  TQNVITETLRMGNIITGVMRKAMKDVEIKGYLIPKGW  393



>gb|KDO65296.1| hypothetical protein CISIN_1g010923mg [Citrus sinensis]
Length=285

 Score = 49.3 bits (116),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 21/37 (57%), Positives = 27/37 (73%), Gaps = 0/37 (0%)
 Frame = -2

Query  118  TRAVIFETSRLATIVNGVLRKTTSDIELNGFLIPKGW  8
            T+ VI ET R+  I+ GV+RK   DIE+ G+LIPKGW
Sbjct  146  TQNVITETLRMGNIIIGVMRKAMRDIEIKGYLIPKGW  182



>ref|XP_010275532.1| PREDICTED: 3-epi-6-deoxocathasterone 23-monooxygenase-like isoform 
X2 [Nelumbo nucifera]
Length=485

 Score = 49.7 bits (117),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 22/37 (59%), Positives = 27/37 (73%), Gaps = 0/37 (0%)
 Frame = -2

Query  118  TRAVIFETSRLATIVNGVLRKTTSDIELNGFLIPKGW  8
            T+ VI ET R+A I+NGV RK   DIE+ G+ IPKGW
Sbjct  348  TQNVINETLRMANIINGVWRKVLRDIEIKGYFIPKGW  384



>ref|XP_010275533.1| PREDICTED: 3-epi-6-deoxocathasterone 23-monooxygenase-like isoform 
X3 [Nelumbo nucifera]
Length=416

 Score = 49.7 bits (117),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 22/37 (59%), Positives = 27/37 (73%), Gaps = 0/37 (0%)
 Frame = -2

Query  118  TRAVIFETSRLATIVNGVLRKTTSDIELNGFLIPKGW  8
            T+ VI ET R+A I+NGV RK   DIE+ G+ IPKGW
Sbjct  349  TQNVINETLRMANIINGVWRKVLRDIEIKGYFIPKGW  385



>ref|XP_009122168.1| PREDICTED: cytochrome P450 90A1 [Brassica rapa]
Length=480

 Score = 49.7 bits (117),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 19/39 (49%), Positives = 30/39 (77%), Gaps = 0/39 (0%)
 Frame = -2

Query  118  TRAVIFETSRLATIVNGVLRKTTSDIELNGFLIPKGWRI  2
            T+ V+ ET R+A I+ GV R+ T+D+E+ G+ IPKGW++
Sbjct  336  TQCVVSETLRVANIIGGVFRRATTDVEIKGYKIPKGWKV  374



>emb|CDX70137.1| BnaA10g24860D [Brassica napus]
Length=480

 Score = 49.7 bits (117),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 19/39 (49%), Positives = 30/39 (77%), Gaps = 0/39 (0%)
 Frame = -2

Query  118  TRAVIFETSRLATIVNGVLRKTTSDIELNGFLIPKGWRI  2
            T+ V+ ET R+A I+ GV R+ T+D+E+ G+ IPKGW++
Sbjct  336  TQCVVSETLRVANIIGGVFRRATTDVEIKGYKIPKGWKV  374



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 519686539684