BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c5339_g2_i1 len=666 path=[1046:0-665]

Length=666
                                                                      Score     E

ref|XP_009593524.1|  PREDICTED: caffeoylshikimate esterase              295   6e-96   
ref|XP_011072262.1|  PREDICTED: caffeoylshikimate esterase              295   9e-96   
ref|XP_009777258.1|  PREDICTED: caffeoylshikimate esterase              294   1e-95   
ref|XP_011040000.1|  PREDICTED: caffeoylshikimate esterase-like         285   4e-92   
ref|XP_010061948.1|  PREDICTED: caffeoylshikimate esterase              283   1e-91   
ref|XP_002303266.1|  esterase/lipase/thioesterase family protein        283   2e-91   Populus trichocarpa [western balsam poplar]
gb|KDP37154.1|  hypothetical protein JCGZ_06210                         283   2e-91   
ref|XP_006427153.1|  hypothetical protein CICLE_v10026080mg             281   1e-90   
ref|XP_006465405.1|  PREDICTED: caffeoylshikimate esterase-like         281   1e-90   
ref|XP_004235722.1|  PREDICTED: caffeoylshikimate esterase              281   1e-90   
ref|XP_002298118.1|  esterase/lipase/thioesterase family protein        280   5e-90   Populus trichocarpa [western balsam poplar]
ref|XP_011035632.1|  PREDICTED: caffeoylshikimate esterase-like         280   5e-90   
ref|XP_006341666.1|  PREDICTED: caffeoylshikimate esterase-like         278   2e-89   
emb|CBI36239.3|  unnamed protein product                                275   4e-88   
ref|XP_008239016.1|  PREDICTED: caffeoylshikimate esterase              274   7e-88   
emb|CDO98101.1|  unnamed protein product                                273   1e-87   
ref|XP_007210524.1|  hypothetical protein PRUPE_ppa008845mg             273   2e-87   
emb|CAN62561.1|  hypothetical protein VITISV_001366                     273   2e-87   Vitis vinifera
ref|XP_002285258.1|  PREDICTED: caffeoylshikimate esterase              275   2e-87   Vitis vinifera
ref|XP_004302949.1|  PREDICTED: monoglyceride lipase-like               273   3e-87   
ref|XP_004507903.1|  PREDICTED: monoglyceride lipase-like isoform X1    272   4e-87   
ref|XP_007154702.1|  hypothetical protein PHAVU_003G140500g             271   8e-87   
gb|KHG02194.1|  Monoglyceride lipase                                    271   1e-86   
gb|AEA11209.1|  monoacylglycerol acyltransferase                        269   6e-86   
gb|EPS74470.1|  hypothetical protein M569_00281                         268   7e-86   
ref|XP_003542674.1|  PREDICTED: caffeoylshikimate esterase              269   8e-86   
ref|XP_006392872.1|  hypothetical protein EUTSA_v10011645mg             269   8e-86   
ref|XP_007023971.1|  Lysophospholipase 2                                273   1e-85   
ref|XP_003610038.1|  Monoglyceride lipase                               267   4e-85   
ref|XP_010535125.1|  PREDICTED: caffeoylshikimate esterase              266   1e-84   
ref|XP_006306194.1|  hypothetical protein CARUB_v10011835mg             265   3e-84   
ref|NP_175685.1|  lysophospholipase 2                                   265   4e-84   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002891714.1|  esterase/lipase/thioesterase family protein        265   5e-84   
ref|XP_006843203.1|  hypothetical protein AMTR_s00146p00105370          264   7e-84   
ref|XP_009147666.1|  PREDICTED: caffeoylshikimate esterase              263   2e-83   
emb|CDY72184.1|  BnaCnng76370D                                          263   3e-83   
ref|XP_008447481.1|  PREDICTED: caffeoylshikimate esterase              261   1e-82   
ref|XP_004166692.1|  PREDICTED: monoglyceride lipase-like               258   8e-82   
ref|XP_004147998.1|  PREDICTED: monoglyceride lipase-like               258   2e-81   
ref|XP_010099653.1|  hypothetical protein L484_003175                   257   3e-81   
gb|KFK35771.1|  hypothetical protein AALP_AA4G034000                    257   3e-81   
ref|XP_010500894.1|  PREDICTED: caffeoylshikimate esterase              256   7e-81   
ref|XP_006305362.1|  hypothetical protein CARUB_v10009746mg             255   1e-80   
ref|XP_010479797.1|  PREDICTED: caffeoylshikimate esterase-like         255   3e-80   
ref|XP_009348432.1|  PREDICTED: LOW QUALITY PROTEIN: caffeoylshik...    254   4e-80   
ref|XP_010254283.1|  PREDICTED: caffeoylshikimate esterase              253   1e-79   
ref|XP_008377606.1|  PREDICTED: caffeoylshikimate esterase              252   3e-79   
ref|XP_010479796.1|  PREDICTED: caffeoylshikimate esterase-like         251   2e-78   
ref|XP_010500892.1|  PREDICTED: caffeoylshikimate esterase-like         248   1e-77   
ref|XP_010462130.1|  PREDICTED: caffeoylshikimate esterase-like         248   3e-77   
gb|ABR16738.1|  unknown                                                 238   2e-75   Picea sitchensis
gb|ACN40719.1|  unknown                                                 237   3e-73   Picea sitchensis
gb|ABK24677.1|  unknown                                                 236   3e-73   Picea sitchensis
ref|XP_010925265.1|  PREDICTED: caffeoylshikimate esterase-like         237   4e-73   
ref|XP_008785454.1|  PREDICTED: caffeoylshikimate esterase-like         236   7e-73   
ref|XP_010909636.1|  PREDICTED: caffeoylshikimate esterase-like         235   2e-72   
ref|XP_008792151.1|  PREDICTED: caffeoylshikimate esterase              234   6e-72   
ref|XP_009407648.1|  PREDICTED: caffeoylshikimate esterase              225   1e-68   
ref|XP_009402151.1|  PREDICTED: caffeoylshikimate esterase-like         225   2e-68   
emb|CDY62163.1|  BnaA05g35650D                                          204   7e-62   
gb|EAY84954.1|  hypothetical protein OsI_06318                          198   4e-58   Oryza sativa Indica Group [Indian rice]
ref|NP_001046255.2|  Os02g0207900                                       198   9e-58   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002981014.1|  hypothetical protein SELMODRAFT_113971             176   7e-50   
gb|EAZ22175.1|  hypothetical protein OsJ_05837                          174   1e-49   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002982491.1|  hypothetical protein SELMODRAFT_155184             174   4e-49   
ref|XP_002536932.1|  conserved hypothetical protein                     139   2e-38   Ricinus communis
gb|ACF74269.1|  putative lipase                                         139   1e-36   Arachis hypogaea [goober]
ref|XP_001760039.1|  predicted protein                                  132   4e-33   
gb|EAZ40325.1|  hypothetical protein OsJ_24771                          125   1e-31   Oryza sativa Japonica Group [Japonica rice]
gb|ABR18313.1|  unknown                                                 127   3e-31   Picea sitchensis
ref|XP_009381093.1|  PREDICTED: caffeoylshikimate esterase-like i...    126   6e-31   
ref|XP_009381091.1|  PREDICTED: caffeoylshikimate esterase-like i...    126   1e-30   
ref|XP_009381092.1|  PREDICTED: caffeoylshikimate esterase-like i...    126   1e-30   
ref|XP_010533890.1|  PREDICTED: caffeoylshikimate esterase              125   2e-30   
ref|XP_010908887.1|  PREDICTED: caffeoylshikimate esterase-like i...    123   3e-30   
ref|XP_010908886.1|  PREDICTED: caffeoylshikimate esterase-like i...    123   5e-30   
ref|XP_010908885.1|  PREDICTED: caffeoylshikimate esterase-like i...    123   6e-30   
ref|NP_001060014.1|  Os07g0565700                                       124   7e-30   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002889847.1|  hydrolase, alpha/beta fold family protein          123   8e-30   
ref|XP_004978414.1|  PREDICTED: monoglyceride lipase-like isoform X4    121   1e-29   
ref|XP_008776304.1|  PREDICTED: caffeoylshikimate esterase-like         123   1e-29   
ref|XP_010492320.1|  PREDICTED: caffeoylshikimate esterase-like         122   2e-29   
ref|XP_010238841.1|  PREDICTED: caffeoylshikimate esterase-like         122   2e-29   
gb|KDO67800.1|  hypothetical protein CISIN_1g021023mg                   122   2e-29   
ref|XP_006436130.1|  hypothetical protein CICLE_v10032149mg             122   2e-29   
ref|XP_010458490.1|  PREDICTED: caffeoylshikimate esterase-like         122   2e-29   
ref|XP_004978413.1|  PREDICTED: monoglyceride lipase-like isoform X3    120   3e-29   
ref|XP_010475999.1|  PREDICTED: caffeoylshikimate esterase-like         122   3e-29   
ref|XP_006303706.1|  hypothetical protein CARUB_v10011807mg             122   3e-29   
ref|XP_010229642.1|  PREDICTED: LOW QUALITY PROTEIN: caffeoylshik...    123   3e-29   
ref|XP_010271585.1|  PREDICTED: caffeoylshikimate esterase-like         122   4e-29   
ref|XP_004977661.1|  PREDICTED: monoglyceride lipase-like isoform X4    120   4e-29   
ref|XP_004978411.1|  PREDICTED: monoglyceride lipase-like isoform X1    120   4e-29   
ref|NP_001130084.1|  hypothetical protein                               121   6e-29   Zea mays [maize]
ref|XP_007025719.1|  Alpha/beta-Hydrolases superfamily protein          120   6e-29   
ref|XP_008648700.1|  PREDICTED: caffeoylshikimate esterase-like i...    120   8e-29   
ref|XP_004977659.1|  PREDICTED: monoglyceride lipase-like isoform X2    119   8e-29   
ref|NP_172576.1|  alpha/beta-hydrolase-like protein                     120   8e-29   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002463034.1|  hypothetical protein SORBIDRAFT_02g036570          120   8e-29   Sorghum bicolor [broomcorn]
ref|XP_007025720.1|  Alpha/beta-Hydrolases superfamily protein          120   9e-29   
ref|XP_008648699.1|  PREDICTED: caffeoylshikimate esterase-like i...    120   1e-28   
ref|XP_008648698.1|  PREDICTED: caffeoylshikimate esterase-like i...    120   1e-28   
ref|XP_003635228.1|  PREDICTED: caffeoylshikimate esterase isofor...    120   1e-28   
ref|XP_002282295.1|  PREDICTED: caffeoylshikimate esterase isofor...    119   2e-28   Vitis vinifera
ref|XP_010905633.1|  PREDICTED: caffeoylshikimate esterase              119   2e-28   
ref|NP_001046256.1|  Os02g0207800                                       115   2e-28   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004977658.1|  PREDICTED: monoglyceride lipase-like isoform X1    119   2e-28   
ref|XP_008783603.1|  PREDICTED: caffeoylshikimate esterase-like i...    117   5e-28   
emb|CDY20587.1|  BnaC08g14710D                                          118   6e-28   
ref|XP_010107055.1|  hypothetical protein L484_002466                   118   7e-28   
ref|XP_006665023.1|  PREDICTED: caffeoylshikimate esterase-like         117   7e-28   
ref|XP_003591520.1|  Monoglyceride lipase                               118   7e-28   
ref|XP_011043243.1|  PREDICTED: caffeoylshikimate esterase              117   9e-28   
ref|XP_009775188.1|  PREDICTED: caffeoylshikimate esterase-like         117   9e-28   
emb|CDO99600.1|  unnamed protein product                                117   9e-28   
ref|XP_010253357.1|  PREDICTED: caffeoylshikimate esterase-like         117   9e-28   
ref|XP_006449284.1|  hypothetical protein CICLE_v10017806mg             118   9e-28   
ref|XP_009622601.1|  PREDICTED: caffeoylshikimate esterase-like         117   1e-27   
ref|XP_010554569.1|  PREDICTED: caffeoylshikimate esterase              117   1e-27   
ref|XP_008783602.1|  PREDICTED: caffeoylshikimate esterase-like i...    117   1e-27   
ref|XP_009418746.1|  PREDICTED: caffeoylshikimate esterase              117   1e-27   
ref|XP_010922429.1|  PREDICTED: caffeoylshikimate esterase-like         117   1e-27   
ref|XP_009412536.1|  PREDICTED: caffeoylshikimate esterase-like         117   1e-27   
ref|XP_006467849.1|  PREDICTED: caffeoylshikimate esterase-like         117   2e-27   
ref|XP_009123831.1|  PREDICTED: caffeoylshikimate esterase              117   2e-27   
gb|KFK43401.1|  hypothetical protein AALP_AA1G121200                    117   2e-27   
ref|XP_008809309.1|  PREDICTED: caffeoylshikimate esterase              117   2e-27   
dbj|BAJ89543.1|  predicted protein                                      117   2e-27   
ref|XP_004288899.1|  PREDICTED: monoglyceride lipase-like               116   2e-27   
gb|EAY97055.1|  hypothetical protein OsI_18977                          116   2e-27   Oryza sativa Indica Group [Indian rice]
ref|NP_001066522.1|  Os12g0262700                                       116   2e-27   Oryza sativa Japonica Group [Japonica rice]
dbj|BAJ99600.1|  predicted protein                                      117   2e-27   
ref|XP_008783604.1|  PREDICTED: caffeoylshikimate esterase-like         117   2e-27   
gb|EMT04425.1|  hypothetical protein F775_33013                         117   2e-27   
ref|XP_010921664.1|  PREDICTED: caffeoylshikimate esterase-like i...    117   3e-27   
emb|CDY20979.1|  BnaA08g25460D                                          116   3e-27   
ref|XP_006343251.1|  PREDICTED: caffeoylshikimate esterase-like i...    116   4e-27   
ref|XP_004958048.1|  PREDICTED: monoglyceride lipase-like               116   4e-27   
ref|XP_004236766.1|  PREDICTED: caffeoylshikimate esterase              115   5e-27   
gb|KDP20918.1|  hypothetical protein JCGZ_21389                         115   5e-27   
ref|XP_002316636.1|  hydrolase family protein                           115   5e-27   Populus trichocarpa [western balsam poplar]
ref|XP_006292403.1|  hypothetical protein CARUB_v10018616mg             115   6e-27   
ref|XP_009780674.1|  PREDICTED: caffeoylshikimate esterase-like i...    115   6e-27   
ref|XP_006850643.1|  hypothetical protein AMTR_s00034p00202150          115   6e-27   
ref|XP_009407468.1|  PREDICTED: caffeoylshikimate esterase-like         115   7e-27   
ref|XP_007211531.1|  hypothetical protein PRUPE_ppa008252mg             115   8e-27   
ref|XP_004516671.1|  PREDICTED: monoglyceride lipase-like isoform X3    114   8e-27   
ref|XP_008442222.1|  PREDICTED: caffeoylshikimate esterase              115   8e-27   
ref|XP_007050931.1|  Alpha/beta-Hydrolases superfamily protein is...    115   8e-27   
gb|EEE55639.1|  hypothetical protein OsJ_04002                          114   9e-27   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009610353.1|  PREDICTED: caffeoylshikimate esterase              115   1e-26   
gb|EMT25222.1|  hypothetical protein F775_13292                         114   1e-26   
ref|XP_010922433.1|  PREDICTED: caffeoylshikimate esterase-like i...    114   1e-26   
dbj|BAH20221.1|  AT2G39420                                              112   1e-26   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010686578.1|  PREDICTED: caffeoylshikimate esterase              114   1e-26   
ref|XP_006479967.1|  PREDICTED: caffeoylshikimate esterase-like         114   2e-26   
ref|XP_006444359.1|  hypothetical protein CICLE_v10020811mg             114   2e-26   
ref|XP_001760395.1|  predicted protein                                  114   2e-26   
ref|XP_009782580.1|  PREDICTED: caffeoylshikimate esterase              114   2e-26   
gb|KHG10802.1|  Monoglyceride lipase                                    114   2e-26   
ref|XP_009126094.1|  PREDICTED: caffeoylshikimate esterase-like i...    114   2e-26   
ref|XP_011096267.1|  PREDICTED: caffeoylshikimate esterase              114   2e-26   
ref|XP_009126093.1|  PREDICTED: caffeoylshikimate esterase-like i...    114   2e-26   
ref|XP_004516669.1|  PREDICTED: monoglyceride lipase-like isoform X1    114   3e-26   
emb|CDY02917.1|  BnaC04g25690D                                          114   3e-26   
ref|XP_008784749.1|  PREDICTED: caffeoylshikimate esterase-like i...    114   3e-26   
ref|XP_008224992.1|  PREDICTED: caffeoylshikimate esterase              113   3e-26   
emb|CDX76116.1|  BnaA04g03800D                                          114   3e-26   
ref|XP_004234129.1|  PREDICTED: caffeoylshikimate esterase              113   3e-26   
emb|CDY24963.1|  BnaC03g22090D                                          113   3e-26   
ref|XP_010554568.1|  PREDICTED: caffeoylshikimate esterase              113   4e-26   
ref|XP_006411167.1|  hypothetical protein EUTSA_v10016835mg             114   4e-26   
emb|CDY38132.1|  BnaC02g06410D                                          115   4e-26   
ref|XP_004146590.1|  PREDICTED: monoglyceride lipase-like               113   4e-26   
gb|EEC71757.1|  hypothetical protein OsI_04349                          112   4e-26   Oryza sativa Indica Group [Indian rice]
emb|CDY07651.1|  BnaA03g18600D                                          113   5e-26   
ref|XP_004307459.1|  PREDICTED: monoglyceride lipase-like isoform 2     112   5e-26   
ref|XP_004307458.1|  PREDICTED: monoglyceride lipase-like isoform 1     112   5e-26   
ref|XP_009139193.1|  PREDICTED: caffeoylshikimate esterase              112   5e-26   
ref|XP_010427280.1|  PREDICTED: caffeoylshikimate esterase-like         112   5e-26   
ref|XP_006361389.1|  PREDICTED: caffeoylshikimate esterase-like         112   5e-26   
gb|EMT12575.1|  hypothetical protein F775_13045                         112   6e-26   
ref|XP_009407471.1|  PREDICTED: caffeoylshikimate esterase-like i...    112   6e-26   
ref|XP_003566330.1|  PREDICTED: caffeoylshikimate esterase              113   6e-26   
gb|AFK44576.1|  unknown                                                 111   6e-26   
ref|XP_002876287.1|  esterase/lipase/thioesterase family protein        112   8e-26   
ref|XP_003634858.1|  PREDICTED: caffeoylshikimate esterase              112   8e-26   
emb|CDP19954.1|  unnamed protein product                                112   8e-26   
emb|CDX93264.1|  BnaC04g46320D                                          112   8e-26   
ref|XP_009407470.1|  PREDICTED: caffeoylshikimate esterase-like i...    112   8e-26   
ref|XP_004495954.1|  PREDICTED: monoglyceride lipase-like isoform X2    111   9e-26   
gb|EYU46661.1|  hypothetical protein MIMGU_mgv1a009192mg                112   9e-26   
gb|KFK36835.1|  hypothetical protein AALP_AA4G177600                    112   1e-25   
ref|XP_002879795.1|  esterase/lipase/thioesterase family protein        112   1e-25   
ref|XP_004977663.1|  PREDICTED: monoglyceride lipase-like isoform X1    112   1e-25   
ref|XP_010516080.1|  PREDICTED: caffeoylshikimate esterase-like         111   2e-25   
ref|NP_181474.2|  alpha/beta-Hydrolases superfamily protein             111   2e-25   Arabidopsis thaliana [mouse-ear cress]
gb|AAK43921.1|AF370602_1  putative phospholipase                        111   2e-25   Arabidopsis thaliana [mouse-ear cress]
emb|CDY55538.1|  BnaA04g29600D                                          112   2e-25   
ref|XP_009344903.1|  PREDICTED: caffeoylshikimate esterase-like         111   2e-25   
gb|KEH44505.1|  alpha/beta fold hydrolase                               111   2e-25   
ref|XP_011097201.1|  PREDICTED: caffeoylshikimate esterase isofor...    111   2e-25   
gb|KEH44506.1|  alpha/beta fold hydrolase                               111   2e-25   
emb|CDY27476.1|  BnaC04g51170D                                          111   2e-25   
ref|XP_004495953.1|  PREDICTED: monoglyceride lipase-like isoform X1    111   2e-25   
ref|XP_003636966.1|  Monoglyceride lipase                               111   2e-25   
ref|XP_011079657.1|  PREDICTED: caffeoylshikimate esterase-like         111   2e-25   
ref|XP_011097199.1|  PREDICTED: caffeoylshikimate esterase isofor...    111   2e-25   
ref|XP_003636968.1|  Monoglyceride lipase                               111   2e-25   
gb|KHG06576.1|  Monoglyceride lipase                                    111   2e-25   
ref|XP_002456602.1|  hypothetical protein SORBIDRAFT_03g039170          111   2e-25   Sorghum bicolor [broomcorn]
ref|XP_006645817.1|  PREDICTED: caffeoylshikimate esterase-like         111   2e-25   
ref|XP_009803215.1|  PREDICTED: caffeoylshikimate esterase              111   2e-25   
ref|XP_006842295.1|  hypothetical protein AMTR_s00079p00105260          111   2e-25   
ref|XP_009141807.1|  PREDICTED: caffeoylshikimate esterase-like i...    110   3e-25   
ref|XP_010693140.1|  PREDICTED: caffeoylshikimate esterase-like         110   3e-25   
ref|XP_008362696.1|  PREDICTED: caffeoylshikimate esterase-like         110   3e-25   
ref|XP_011082467.1|  PREDICTED: caffeoylshikimate esterase-like         110   3e-25   
ref|XP_009141806.1|  PREDICTED: caffeoylshikimate esterase-like i...    110   3e-25   
ref|XP_009141805.1|  PREDICTED: caffeoylshikimate esterase-like i...    110   3e-25   
ref|XP_008383790.1|  PREDICTED: caffeoylshikimate esterase-like         110   3e-25   
ref|XP_009133821.1|  PREDICTED: caffeoylshikimate esterase              110   3e-25   
ref|XP_004972242.1|  PREDICTED: monoglyceride lipase-like               110   4e-25   
ref|XP_002302714.1|  hypothetical protein POPTR_0002s20550g             110   4e-25   Populus trichocarpa [western balsam poplar]
gb|EYU27946.1|  hypothetical protein MIMGU_mgv1a026912mg                110   4e-25   
ref|XP_004489111.1|  PREDICTED: monoglyceride lipase-like isoform X2    110   4e-25   
ref|XP_002450081.1|  hypothetical protein SORBIDRAFT_05g000200          110   4e-25   Sorghum bicolor [broomcorn]
ref|XP_004489110.1|  PREDICTED: monoglyceride lipase-like isoform X1    110   5e-25   
ref|XP_006417390.1|  hypothetical protein EUTSA_v10010022mg             110   5e-25   
emb|CDX83323.1|  BnaA03g21830D                                          110   5e-25   
emb|CDX85514.1|  BnaA02g02990D                                          112   5e-25   
emb|CDX95729.1|  BnaC03g26100D                                          110   5e-25   
gb|EMS59411.1|  hypothetical protein TRIUR3_33748                       110   5e-25   
ref|XP_006375458.1|  hypothetical protein POPTR_0014s12360g             109   6e-25   
ref|XP_008440696.1|  PREDICTED: caffeoylshikimate esterase-like         109   6e-25   
ref|XP_011077926.1|  PREDICTED: caffeoylshikimate esterase-like         110   6e-25   
ref|XP_011033533.1|  PREDICTED: caffeoylshikimate esterase-like         110   7e-25   
ref|XP_004962321.1|  PREDICTED: putative monoglyceride lipase-lik...    109   7e-25   
ref|XP_001768097.1|  predicted protein                                  109   7e-25   
gb|KFK37501.1|  hypothetical protein AALP_AA4G265600                    110   8e-25   
ref|XP_006289624.1|  hypothetical protein CARUB_v10003177mg             109   9e-25   
ref|XP_006344132.1|  PREDICTED: caffeoylshikimate esterase-like         110   9e-25   
ref|XP_009133363.1|  PREDICTED: caffeoylshikimate esterase-like         109   1e-24   
ref|XP_006841721.1|  hypothetical protein AMTR_s00003p00257040          109   1e-24   
gb|AEV41020.1|  hypothetical protein                                    109   1e-24   
ref|XP_010549925.1|  PREDICTED: caffeoylshikimate esterase-like         109   1e-24   
ref|XP_007009573.1|  Alpha/beta-Hydrolases superfamily protein          109   1e-24   
ref|XP_010521005.1|  PREDICTED: caffeoylshikimate esterase-like         108   1e-24   
gb|EMT11916.1|  hypothetical protein F775_10120                         109   1e-24   
emb|CDY07008.1|  BnaA04g23070D                                          109   1e-24   
ref|NP_191079.1|  alpha/beta-Hydrolases superfamily protein             109   1e-24   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004962320.1|  PREDICTED: putative monoglyceride lipase-lik...    109   1e-24   
ref|XP_003567610.1|  PREDICTED: caffeoylshikimate esterase-like         109   1e-24   
ref|XP_004247416.1|  PREDICTED: caffeoylshikimate esterase isofor...    109   1e-24   
ref|XP_008654363.1|  PREDICTED: uncharacterized protein LOC100193...    109   1e-24   
ref|XP_003567198.1|  PREDICTED: caffeoylshikimate esterase-like         109   1e-24   
ref|XP_001765950.1|  predicted protein                                  109   1e-24   
emb|CDP20138.1|  unnamed protein product                                109   1e-24   
ref|XP_010032274.1|  PREDICTED: caffeoylshikimate esterase-like         108   1e-24   
dbj|BAJ98949.1|  predicted protein                                      109   1e-24   
ref|NP_001136742.1|  uncharacterized protein LOC100216883               109   1e-24   Zea mays [maize]
ref|XP_010278298.1|  PREDICTED: caffeoylshikimate esterase              109   1e-24   
ref|XP_002439655.1|  hypothetical protein SORBIDRAFT_09g018060          109   2e-24   Sorghum bicolor [broomcorn]
ref|XP_002977997.1|  hypothetical protein SELMODRAFT_14581              108   2e-24   
ref|XP_002442631.1|  hypothetical protein SORBIDRAFT_08g000200          108   2e-24   Sorghum bicolor [broomcorn]
ref|XP_010420292.1|  PREDICTED: caffeoylshikimate esterase-like i...    108   2e-24   
ref|XP_003541302.1|  PREDICTED: caffeoylshikimate esterase-like i...    108   2e-24   
ref|XP_006403484.1|  hypothetical protein EUTSA_v10010560mg             108   2e-24   
ref|XP_009335738.1|  PREDICTED: caffeoylshikimate esterase-like         108   2e-24   
ref|XP_010492491.1|  PREDICTED: caffeoylshikimate esterase-like         108   2e-24   
ref|XP_009357817.1|  PREDICTED: caffeoylshikimate esterase-like i...    109   2e-24   
gb|AFK33436.1|  unknown                                                 105   2e-24   
gb|ABK24479.1|  unknown                                                 108   2e-24   Picea sitchensis
gb|ABK25268.1|  unknown                                                 108   2e-24   Picea sitchensis
gb|AAM64813.1|  putative phospholipase                                  108   2e-24   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010509018.1|  PREDICTED: caffeoylshikimate esterase-like i...    108   2e-24   
ref|XP_009414895.1|  PREDICTED: caffeoylshikimate esterase-like i...    108   2e-24   
ref|XP_010509019.1|  PREDICTED: caffeoylshikimate esterase-like i...    108   2e-24   
ref|XP_010108591.1|  hypothetical protein L484_001190                   108   2e-24   
ref|XP_008358150.1|  PREDICTED: caffeoylshikimate esterase-like         108   2e-24   
ref|XP_009335684.1|  PREDICTED: caffeoylshikimate esterase-like         108   2e-24   
ref|XP_010504365.1|  PREDICTED: caffeoylshikimate esterase-like         108   2e-24   
ref|XP_010420291.1|  PREDICTED: caffeoylshikimate esterase-like i...    108   2e-24   
ref|XP_009414894.1|  PREDICTED: caffeoylshikimate esterase-like i...    108   2e-24   
ref|XP_002534516.1|  Monoglyceride lipase, putative                     105   2e-24   
ref|XP_010520169.1|  PREDICTED: caffeoylshikimate esterase-like i...    107   2e-24   
ref|XP_004983503.1|  PREDICTED: monoglyceride lipase-like isoform X1    108   3e-24   
ref|XP_006397959.1|  hypothetical protein EUTSA_v10001520mg             108   3e-24   
gb|KCW58429.1|  hypothetical protein EUGRSUZ_H01110                     107   3e-24   
ref|XP_003555156.1|  PREDICTED: caffeoylshikimate esterase isofor...    108   3e-24   
ref|XP_002268904.1|  PREDICTED: caffeoylshikimate esterase              108   3e-24   
ref|XP_002880317.1|  esterase/lipase/thioesterase family protein        108   3e-24   
ref|XP_010520168.1|  PREDICTED: caffeoylshikimate esterase-like i...    107   3e-24   
ref|XP_011070793.1|  PREDICTED: caffeoylshikimate esterase              108   3e-24   
ref|XP_009420077.1|  PREDICTED: caffeoylshikimate esterase-like         107   3e-24   
ref|XP_010520167.1|  PREDICTED: caffeoylshikimate esterase-like i...    107   3e-24   
gb|EMS63168.1|  hypothetical protein TRIUR3_26183                       109   3e-24   
ref|XP_010518470.1|  PREDICTED: caffeoylshikimate esterase-like         108   3e-24   
ref|XP_004983504.1|  PREDICTED: monoglyceride lipase-like isoform X2    108   3e-24   
gb|EMT04426.1|  hypothetical protein F775_26334                         107   3e-24   
ref|NP_566106.1|  alpha/beta-Hydrolases superfamily protein             108   4e-24   
ref|XP_008244512.1|  PREDICTED: caffeoylshikimate esterase              108   4e-24   
ref|XP_002966752.1|  hypothetical protein SELMODRAFT_85161              108   4e-24   
ref|XP_008371680.1|  PREDICTED: LOW QUALITY PROTEIN: caffeoylshik...    106   4e-24   
ref|XP_010507868.1|  PREDICTED: caffeoylshikimate esterase-like         108   4e-24   
ref|XP_010259541.1|  PREDICTED: caffeoylshikimate esterase-like i...    108   4e-24   
emb|CDP00629.1|  unnamed protein product                                108   4e-24   
ref|XP_006603994.1|  PREDICTED: caffeoylshikimate esterase isofor...    108   4e-24   
ref|XP_004494377.1|  PREDICTED: monoglyceride lipase-like isoform X1    107   4e-24   
ref|XP_008454335.1|  PREDICTED: caffeoylshikimate esterase isofor...    107   4e-24   
ref|XP_010506800.1|  PREDICTED: caffeoylshikimate esterase-like i...    108   4e-24   
ref|XP_006646463.1|  PREDICTED: caffeoylshikimate esterase-like         107   4e-24   
ref|XP_010506801.1|  PREDICTED: caffeoylshikimate esterase-like i...    107   4e-24   
ref|XP_010660426.1|  PREDICTED: caffeoylshikimate esterase              108   4e-24   
ref|XP_011027095.1|  PREDICTED: caffeoylshikimate esterase-like         107   5e-24   
ref|XP_002992473.1|  hypothetical protein SELMODRAFT_186777             107   5e-24   
emb|CAB83136.1|  putative protein                                       105   5e-24   
ref|NP_001055317.1|  Os05g0363100                                       107   5e-24   
ref|XP_003579070.1|  PREDICTED: caffeoylshikimate esterase-like         107   5e-24   
ref|XP_003575457.1|  PREDICTED: caffeoylshikimate esterase-like         107   5e-24   
ref|XP_010232535.1|  PREDICTED: caffeoylshikimate esterase-like i...    107   5e-24   
ref|XP_006292693.1|  hypothetical protein CARUB_v10018939mg             107   5e-24   
ref|XP_010519344.1|  PREDICTED: caffeoylshikimate esterase-like i...    107   5e-24   
ref|XP_004152363.1|  PREDICTED: monoglyceride lipase-like               107   5e-24   
gb|ACU24593.1|  unknown                                                 107   5e-24   
ref|XP_008381270.1|  PREDICTED: caffeoylshikimate esterase              107   6e-24   
ref|XP_004156887.1|  PREDICTED: monoglyceride lipase-like               107   6e-24   
ref|XP_010232534.1|  PREDICTED: caffeoylshikimate esterase-like i...    107   6e-24   
ref|XP_004145124.1|  PREDICTED: monoglyceride lipase-like               107   6e-24   
ref|XP_008454334.1|  PREDICTED: caffeoylshikimate esterase isofor...    107   6e-24   
ref|XP_010519341.1|  PREDICTED: caffeoylshikimate esterase-like i...    107   6e-24   
ref|XP_006577148.1|  PREDICTED: caffeoylshikimate esterase-like i...    107   6e-24   
ref|XP_011009442.1|  PREDICTED: caffeoylshikimate esterase-like         107   7e-24   
ref|XP_010519342.1|  PREDICTED: caffeoylshikimate esterase-like i...    106   7e-24   
ref|XP_010096682.1|  hypothetical protein L484_025431                   107   7e-24   
ref|XP_009348815.1|  PREDICTED: caffeoylshikimate esterase-like         107   7e-24   
ref|XP_010684530.1|  PREDICTED: caffeoylshikimate esterase              107   8e-24   
ref|XP_002521224.1|  Monoglyceride lipase, putative                     107   8e-24   
ref|XP_004497316.1|  PREDICTED: monoglyceride lipase-like               106   8e-24   
ref|XP_010545010.1|  PREDICTED: caffeoylshikimate esterase isofor...    107   8e-24   
ref|XP_006855557.1|  hypothetical protein AMTR_s00057p00221720          107   8e-24   
ref|XP_010519340.1|  PREDICTED: caffeoylshikimate esterase-like i...    106   9e-24   
ref|XP_010545011.1|  PREDICTED: caffeoylshikimate esterase isofor...    107   9e-24   
ref|XP_010524355.1|  PREDICTED: caffeoylshikimate esterase-like i...    107   1e-23   
gb|AES82137.2|  alpha/beta hydrolase family protein                     106   1e-23   
gb|KEH21543.1|  monoglyceride lipase                                    106   1e-23   
gb|KHN20397.1|  Monoglyceride lipase                                    106   1e-23   
ref|XP_006400144.1|  hypothetical protein EUTSA_v10013709mg             107   1e-23   
gb|EEE63431.1|  hypothetical protein OsJ_18244                          106   1e-23   
ref|XP_010524356.1|  PREDICTED: caffeoylshikimate esterase-like i...    106   1e-23   
ref|XP_008386696.1|  PREDICTED: LOW QUALITY PROTEIN: caffeoylshik...    106   1e-23   
ref|XP_009342659.1|  PREDICTED: caffeoylshikimate esterase-like i...    106   1e-23   
ref|XP_002990215.1|  hypothetical protein SELMODRAFT_447944             106   1e-23   
ref|XP_003636967.1|  Monoglyceride lipase                               106   1e-23   
ref|XP_006577147.1|  PREDICTED: caffeoylshikimate esterase-like i...    106   1e-23   
ref|XP_006411166.1|  hypothetical protein EUTSA_v10016977mg             106   1e-23   
ref|XP_004494378.1|  PREDICTED: monoglyceride lipase-like isoform X2    105   1e-23   
ref|XP_011021447.1|  PREDICTED: caffeoylshikimate esterase              105   1e-23   
gb|EEC79070.1|  hypothetical protein OsI_19653                          106   1e-23   
ref|XP_008459474.1|  PREDICTED: caffeoylshikimate esterase isofor...    106   1e-23   
ref|XP_004511168.1|  PREDICTED: monoglyceride lipase-like               106   1e-23   
ref|XP_011031746.1|  PREDICTED: caffeoylshikimate esterase-like         106   1e-23   
ref|XP_009625969.1|  PREDICTED: caffeoylshikimate esterase              106   1e-23   
ref|XP_004967511.1|  PREDICTED: monoglyceride lipase-like               106   1e-23   
gb|KHN20733.1|  Monoglyceride lipase                                    104   1e-23   
ref|XP_009342658.1|  PREDICTED: caffeoylshikimate esterase-like i...    106   1e-23   
gb|KHN07525.1|  Monoglyceride lipase                                    106   1e-23   
ref|XP_010069910.1|  PREDICTED: caffeoylshikimate esterase              106   1e-23   
ref|XP_004963835.1|  PREDICTED: monoglyceride lipase-like               106   2e-23   
emb|CDX76667.1|  BnaC08g32530D                                          106   2e-23   
emb|CDP11603.1|  unnamed protein product                                104   2e-23   
gb|KCW58427.1|  hypothetical protein EUGRSUZ_H01110                     106   2e-23   
ref|XP_002521403.1|  Monoglyceride lipase, putative                     106   2e-23   
ref|XP_004141507.1|  PREDICTED: monoglyceride lipase-like               106   2e-23   
ref|XP_010453765.1|  PREDICTED: caffeoylshikimate esterase-like         106   2e-23   
ref|XP_004238932.1|  PREDICTED: caffeoylshikimate esterase              106   2e-23   
gb|KFK34769.1|  hypothetical protein AALP_AA5G191300                    105   2e-23   
ref|XP_001772196.1|  predicted protein                                  105   2e-23   
ref|XP_008459473.1|  PREDICTED: caffeoylshikimate esterase isofor...    106   2e-23   
ref|XP_010512682.1|  PREDICTED: caffeoylshikimate esterase-like i...    106   2e-23   
gb|KDP46119.1|  hypothetical protein JCGZ_06630                         105   2e-23   
ref|XP_007222960.1|  hypothetical protein PRUPE_ppa006753mg             106   2e-23   
gb|KHN32046.1|  Monoglyceride lipase                                    106   2e-23   
ref|XP_009762778.1|  PREDICTED: caffeoylshikimate esterase-like         105   2e-23   
ref|XP_003534168.1|  PREDICTED: caffeoylshikimate esterase-like         106   2e-23   
ref|XP_007163115.1|  hypothetical protein PHAVU_001G207500g             105   2e-23   
ref|XP_006359844.1|  PREDICTED: caffeoylshikimate esterase-like         105   2e-23   
ref|XP_010413226.1|  PREDICTED: caffeoylshikimate esterase-like         105   2e-23   
ref|XP_007216459.1|  hypothetical protein PRUPE_ppa023287mg             105   2e-23   
ref|XP_010468913.1|  PREDICTED: caffeoylshikimate esterase-like         105   2e-23   
ref|XP_010512681.1|  PREDICTED: caffeoylshikimate esterase-like i...    105   2e-23   
emb|CDP17128.1|  unnamed protein product                                105   2e-23   
ref|XP_009786213.1|  PREDICTED: caffeoylshikimate esterase-like         105   2e-23   
ref|XP_010519345.1|  PREDICTED: caffeoylshikimate esterase-like i...    104   2e-23   
gb|KDP32952.1|  hypothetical protein JCGZ_12983                         105   2e-23   
gb|EEC70511.1|  hypothetical protein OsI_01608                          105   2e-23   
emb|CDX89152.1|  BnaA04g00340D                                          105   2e-23   
dbj|BAK01593.1|  predicted protein                                      105   3e-23   
ref|XP_009618376.1|  PREDICTED: caffeoylshikimate esterase-like         105   3e-23   
ref|XP_008674851.1|  PREDICTED: caffeoylshikimate esterase-like i...    105   3e-23   
ref|XP_008368665.1|  PREDICTED: caffeoylshikimate esterase-like         105   3e-23   
dbj|BAJ99202.1|  predicted protein                                      105   3e-23   
ref|XP_002316320.1|  hydrolase family protein                           105   3e-23   
gb|ABD96965.1|  hypothetical protein                                    104   3e-23   
ref|NP_001136909.1|  uncharacterized protein LOC100217066               104   3e-23   
ref|XP_009138711.1|  PREDICTED: caffeoylshikimate esterase              105   3e-23   
tpg|DAA54400.1|  TPA: hypothetical protein ZEAMMB73_571313              104   3e-23   
ref|XP_002450082.1|  hypothetical protein SORBIDRAFT_05g000210          105   3e-23   
ref|XP_010263962.1|  PREDICTED: caffeoylshikimate esterase isofor...    105   4e-23   
gb|KHG20460.1|  Monoglyceride lipase                                    105   4e-23   
ref|XP_006291395.1|  hypothetical protein CARUB_v10017533mg             105   4e-23   
emb|CAC01853.1|  lipase-like protein                                    105   4e-23   
ref|XP_010326576.1|  PREDICTED: caffeoylshikimate esterase isofor...    105   4e-23   
ref|XP_010505611.1|  PREDICTED: caffeoylshikimate esterase-like i...    104   4e-23   
ref|XP_011094308.1|  PREDICTED: caffeoylshikimate esterase-like         104   4e-23   
ref|XP_010505612.1|  PREDICTED: caffeoylshikimate esterase-like i...    104   4e-23   
ref|XP_010263959.1|  PREDICTED: caffeoylshikimate esterase isofor...    105   4e-23   
ref|XP_002871702.1|  hydrolase, alpha/beta fold family protein          105   4e-23   
ref|XP_002311094.2|  esterase/lipase/thioesterase family protein        105   4e-23   
ref|NP_191845.2|  alpha/beta-Hydrolases superfamily protein             105   4e-23   
gb|AFK38012.1|  unknown                                                 102   5e-23   
ref|XP_006846763.1|  hypothetical protein AMTR_s00148p00014950          102   5e-23   
gb|KHG02209.1|  Monoglyceride lipase                                    104   5e-23   
ref|XP_006383452.1|  hypothetical protein POPTR_0005s15640g             105   5e-23   
ref|NP_568327.1|  hydrolase, alpha/beta fold family protein             104   5e-23   
ref|XP_008784748.1|  PREDICTED: caffeoylshikimate esterase-like i...    104   5e-23   
ref|XP_007199970.1|  hypothetical protein PRUPE_ppa025987mg             104   6e-23   
ref|XP_006400019.1|  hypothetical protein EUTSA_v10014122mg             104   6e-23   
ref|XP_009418374.1|  PREDICTED: caffeoylshikimate esterase-like         104   6e-23   
ref|XP_010922434.1|  PREDICTED: caffeoylshikimate esterase-like i...    103   7e-23   
gb|AFW83610.1|  hypothetical protein ZEAMMB73_578732                    101   7e-23   
ref|XP_002878482.1|  predicted protein                                  104   7e-23   
ref|XP_003618750.1|  Monoglyceride lipase                               104   7e-23   
ref|XP_010517284.1|  PREDICTED: caffeoylshikimate esterase-like         103   7e-23   
ref|XP_008657928.1|  PREDICTED: uncharacterized abhydrolase domai...    103   7e-23   
ref|XP_008369015.1|  PREDICTED: caffeoylshikimate esterase-like         103   7e-23   
ref|NP_001119234.1|  hydrolase, alpha/beta fold family protein          104   8e-23   
ref|XP_009629754.1|  PREDICTED: caffeoylshikimate esterase-like         104   9e-23   
ref|XP_009779135.1|  PREDICTED: caffeoylshikimate esterase              103   9e-23   
emb|CDX69469.1|  BnaA10g18180D                                          103   1e-22   
ref|XP_006288192.1|  hypothetical protein CARUB_v10001430mg             103   1e-22   
ref|XP_011007814.1|  PREDICTED: caffeoylshikimate esterase              104   1e-22   
ref|XP_009758203.1|  PREDICTED: caffeoylshikimate esterase-like         103   1e-22   
ref|XP_010263976.1|  PREDICTED: caffeoylshikimate esterase-like         104   1e-22   
ref|XP_010509021.1|  PREDICTED: caffeoylshikimate esterase-like         103   1e-22   
gb|KFK35464.1|  hypothetical protein AALP_AA5G287400                    103   1e-22   
tpg|DAA54397.1|  TPA: hypothetical protein ZEAMMB73_571313              103   1e-22   
ref|XP_002455548.1|  hypothetical protein SORBIDRAFT_03g012970          103   1e-22   
ref|XP_006294630.1|  hypothetical protein CARUB_v10023668mg             103   1e-22   
ref|XP_010106385.1|  hypothetical protein L484_006197                   103   1e-22   
ref|XP_010505609.1|  PREDICTED: caffeoylshikimate esterase-like         103   1e-22   
gb|ACR34837.1|  unknown                                                 103   1e-22   
ref|NP_001266658.1|  monoglyceride lipase                               103   1e-22   
ref|XP_009121514.1|  PREDICTED: caffeoylshikimate esterase              103   1e-22   
dbj|BAK01745.1|  predicted protein                                      102   1e-22   
emb|CDY07007.1|  BnaA04g23080D                                          102   1e-22   
ref|XP_009613852.1|  PREDICTED: caffeoylshikimate esterase isofor...    103   1e-22   
gb|ACU19207.1|  unknown                                                 103   1e-22   
ref|XP_009357648.1|  PREDICTED: caffeoylshikimate esterase-like         103   1e-22   
ref|XP_004496283.1|  PREDICTED: monoglyceride lipase-like               103   1e-22   
ref|NP_197002.1|  esterase/lipase/thioesterase family protein           103   2e-22   
ref|XP_006378478.1|  hypothetical protein POPTR_0010s13380g             103   2e-22   
ref|XP_004140338.1|  PREDICTED: monoglyceride lipase-like               103   2e-22   
ref|XP_010534460.1|  PREDICTED: caffeoylshikimate esterase-like         103   2e-22   
ref|XP_010509020.1|  PREDICTED: caffeoylshikimate esterase-like         103   2e-22   
gb|KFK36834.1|  hypothetical protein AALP_AA4G177300                    103   2e-22   
ref|XP_002879793.1|  hydrolase, alpha/beta fold family protein          103   2e-22   
ref|XP_009335916.1|  PREDICTED: caffeoylshikimate esterase-like         103   2e-22   
ref|XP_008339667.1|  PREDICTED: caffeoylshikimate esterase-like         103   2e-22   
ref|XP_006345805.1|  PREDICTED: caffeoylshikimate esterase-like         103   2e-22   
ref|NP_565903.1|  alpha/beta-Hydrolases superfamily protein             102   2e-22   
ref|XP_004233490.1|  PREDICTED: caffeoylshikimate esterase              103   2e-22   
ref|XP_010517292.1|  PREDICTED: caffeoylshikimate esterase-like i...    102   2e-22   
ref|XP_009356844.1|  PREDICTED: caffeoylshikimate esterase-like         103   2e-22   
ref|XP_008235097.1|  PREDICTED: caffeoylshikimate esterase isofor...    103   2e-22   
gb|ABR16349.1|  unknown                                                 102   2e-22   
ref|XP_006854516.1|  hypothetical protein AMTR_s00175p00065840          103   2e-22   
ref|XP_010517294.1|  PREDICTED: caffeoylshikimate esterase-like i...    102   2e-22   
ref|XP_004292661.1|  PREDICTED: monoglyceride lipase-like               102   2e-22   
gb|KHN08683.1|  Monoglyceride lipase                                    102   2e-22   
ref|XP_003618897.1|  Monoglyceride lipase                               103   2e-22   
gb|KDO59014.1|  hypothetical protein CISIN_1g018984mg                   101   2e-22   
ref|XP_009348816.1|  PREDICTED: caffeoylshikimate esterase-like         103   2e-22   
ref|XP_010505610.1|  PREDICTED: caffeoylshikimate esterase-like         102   2e-22   
ref|XP_010516079.1|  PREDICTED: caffeoylshikimate esterase-like         102   2e-22   
ref|XP_010517285.1|  PREDICTED: caffeoylshikimate esterase-like         102   2e-22   
ref|XP_009613845.1|  PREDICTED: caffeoylshikimate esterase isofor...    102   2e-22   
ref|XP_011020624.1|  PREDICTED: caffeoylshikimate esterase-like         102   2e-22   
gb|KDO59013.1|  hypothetical protein CISIN_1g018984mg                   102   2e-22   
gb|AES75115.2|  monoglyceride lipase                                    102   2e-22   
ref|XP_007152754.1|  hypothetical protein PHAVU_004G156600g             102   3e-22   
ref|XP_009613832.1|  PREDICTED: caffeoylshikimate esterase isofor...    102   3e-22   
ref|NP_191078.1|  alpha/beta-Hydrolases superfamily protein             102   3e-22   
ref|XP_002876286.1|  esterase/lipase/thioesterase family protein        102   3e-22   
ref|XP_010427279.1|  PREDICTED: caffeoylshikimate esterase-like         102   3e-22   
ref|XP_010679109.1|  PREDICTED: caffeoylshikimate esterase-like         102   3e-22   
gb|EYU35513.1|  hypothetical protein MIMGU_mgv1a010046mg                102   3e-22   
gb|ABK22850.1|  unknown                                                 102   3e-22   
ref|XP_006296275.1|  hypothetical protein CARUB_v10025443mg             102   3e-22   
ref|XP_006346915.1|  PREDICTED: caffeoylshikimate esterase-like         102   3e-22   



>ref|XP_009593524.1| PREDICTED: caffeoylshikimate esterase [Nicotiana tomentosiformis]
Length=327

 Score =   295 bits (754),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 139/166 (84%), Positives = 150/166 (90%), Gaps = 5/166 (3%)
 Frame = -2

Query  665  FSAPLFVIPENMKPSKVHLFMYGLLFGFADTWAMMPDNKMVGKAIRDVEKLKIIASNPRR  486
            FSAPLFVIPE MKPSKVHLFMYGLLFGFADTWA MPDNKMVGKAIRD EKLKIIASNPRR
Sbjct  162  FSAPLFVIPEPMKPSKVHLFMYGLLFGFADTWAAMPDNKMVGKAIRDTEKLKIIASNPRR  221

Query  485  YTGKPRVGTMREIARQCEYVQNNFEKVSVGFLTVHGTADGVTCPSGSQMLYDKASSSDKT  306
            YTGKPRVGTMREIARQCEYVQNNF KV+  FLTVHGT+DGVTCP+GS++LY+KASS+DK+
Sbjct  222  YTGKPRVGTMREIARQCEYVQNNFHKVTAPFLTVHGTSDGVTCPTGSELLYEKASSTDKS  281

Query  305  LKLYQGLYHSLIQGEPDEDANRVLADMREWIDERVS-----CNGTA  183
            LKLY G+YHSLIQGEPD+ AN VLADMR WIDERV      CNG+A
Sbjct  282  LKLYDGMYHSLIQGEPDDAANLVLADMRAWIDERVERYGPKCNGSA  327



>ref|XP_011072262.1| PREDICTED: caffeoylshikimate esterase [Sesamum indicum]
Length=331

 Score =   295 bits (754),  Expect = 9e-96, Method: Compositional matrix adjust.
 Identities = 140/164 (85%), Positives = 148/164 (90%), Gaps = 5/164 (3%)
 Frame = -2

Query  665  FSAPLFVIPENMKPSKVHLFMYGLLFGFADTWAMMPDNKMVGKAIRDVEKLKIIASNPRR  486
            FSAPLFVIPE MKPSKVHLFMYGLLFG ADTWA MPDNKMVGKAIRD EKLKIIASNPRR
Sbjct  166  FSAPLFVIPEPMKPSKVHLFMYGLLFGLADTWAAMPDNKMVGKAIRDPEKLKIIASNPRR  225

Query  485  YTGKPRVGTMREIARQCEYVQNNFEKVSVGFLTVHGTADGVTCPSGSQMLYDKASSSDKT  306
            YTGKPRVGTMRE+ARQCEYVQNNF+KV+V FLTVHGTADGVTCP+GS+MLY++ASS DKT
Sbjct  226  YTGKPRVGTMRELARQCEYVQNNFDKVTVPFLTVHGTADGVTCPTGSKMLYERASSEDKT  285

Query  305  LKLYQGLYHSLIQGEPDEDANRVLADMREWIDERVS-----CNG  189
            LKLY+G YHSLIQGEPDE AN VLADMR WIDERV      CNG
Sbjct  286  LKLYEGFYHSLIQGEPDESANLVLADMRAWIDERVERYGSKCNG  329



>ref|XP_009777258.1| PREDICTED: caffeoylshikimate esterase [Nicotiana sylvestris]
Length=327

 Score =   294 bits (752),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 139/166 (84%), Positives = 149/166 (90%), Gaps = 5/166 (3%)
 Frame = -2

Query  665  FSAPLFVIPENMKPSKVHLFMYGLLFGFADTWAMMPDNKMVGKAIRDVEKLKIIASNPRR  486
            FSAPLFVIPE MKPSKVHLFMYGLLFGFADTWA MPDNKMVGKAIRD EKLKIIASNPRR
Sbjct  162  FSAPLFVIPEPMKPSKVHLFMYGLLFGFADTWAAMPDNKMVGKAIRDTEKLKIIASNPRR  221

Query  485  YTGKPRVGTMREIARQCEYVQNNFEKVSVGFLTVHGTADGVTCPSGSQMLYDKASSSDKT  306
            YTGKPRVGTMREIARQCEYVQNNF KV+  FLTVHGT+DGVTCP+GS++LY+KASS DK+
Sbjct  222  YTGKPRVGTMREIARQCEYVQNNFHKVTAPFLTVHGTSDGVTCPTGSKLLYEKASSKDKS  281

Query  305  LKLYQGLYHSLIQGEPDEDANRVLADMREWIDERVS-----CNGTA  183
            LKLY G+YHSLIQGEPD+ AN VLADMR WIDERV      CNG+A
Sbjct  282  LKLYDGMYHSLIQGEPDDAANLVLADMRAWIDERVERYGPKCNGSA  327



>ref|XP_011040000.1| PREDICTED: caffeoylshikimate esterase-like [Populus euphratica]
Length=326

 Score =   285 bits (729),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 132/160 (83%), Positives = 147/160 (92%), Gaps = 0/160 (0%)
 Frame = -2

Query  665  FSAPLFVIPENMKPSKVHLFMYGLLFGFADTWAMMPDNKMVGKAIRDVEKLKIIASNPRR  486
            FSAPLFVIPE MKPSKVHLFMYGLLFGFADTWA MPDNKMVGKAI+D EKLKIIASNPRR
Sbjct  162  FSAPLFVIPEPMKPSKVHLFMYGLLFGFADTWAAMPDNKMVGKAIKDPEKLKIIASNPRR  221

Query  485  YTGKPRVGTMREIARQCEYVQNNFEKVSVGFLTVHGTADGVTCPSGSQMLYDKASSSDKT  306
            YTGKPRVGTMREIAR C+Y+Q+NF KV+V FLTVHGTADGVTCP+ SQ+LY+KASS DK+
Sbjct  222  YTGKPRVGTMREIARVCQYIQDNFSKVTVPFLTVHGTADGVTCPTSSQLLYEKASSEDKS  281

Query  305  LKLYQGLYHSLIQGEPDEDANRVLADMREWIDERVSCNGT  186
            LK+Y+G+YHSLIQGEPDE+A+ VL DMREWIDERV   G+
Sbjct  282  LKIYEGMYHSLIQGEPDENASLVLKDMREWIDERVERYGS  321



>ref|XP_010061948.1| PREDICTED: caffeoylshikimate esterase [Eucalyptus grandis]
 gb|KCW68997.1| hypothetical protein EUGRSUZ_F02557 [Eucalyptus grandis]
Length=324

 Score =   283 bits (725),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 131/162 (81%), Positives = 147/162 (91%), Gaps = 0/162 (0%)
 Frame = -2

Query  665  FSAPLFVIPENMKPSKVHLFMYGLLFGFADTWAMMPDNKMVGKAIRDVEKLKIIASNPRR  486
            FSAPLFVIPENMKPSKV LF+YG+LFG ADTWA MPDNKMVGKAI+D EKLKIIASNPRR
Sbjct  162  FSAPLFVIPENMKPSKVRLFLYGMLFGVADTWASMPDNKMVGKAIKDPEKLKIIASNPRR  221

Query  485  YTGKPRVGTMREIARQCEYVQNNFEKVSVGFLTVHGTADGVTCPSGSQMLYDKASSSDKT  306
            YTGKPRVGTMREIAR C+Y+Q+NF +VS  FLTVHGT+DGVTCP+ SQ+LY+KASSSDKT
Sbjct  222  YTGKPRVGTMREIARVCQYIQDNFARVSAPFLTVHGTSDGVTCPTSSQLLYEKASSSDKT  281

Query  305  LKLYQGLYHSLIQGEPDEDANRVLADMREWIDERVSCNGTAV  180
            LKLY G+YHSLIQGEPDE+A+RVL DMREWIDERV+  G  +
Sbjct  282  LKLYDGMYHSLIQGEPDENADRVLGDMREWIDERVARYGPKI  323



>ref|XP_002303266.1| esterase/lipase/thioesterase family protein [Populus trichocarpa]
 gb|EEE78245.1| esterase/lipase/thioesterase family protein [Populus trichocarpa]
Length=326

 Score =   283 bits (725),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 131/160 (82%), Positives = 146/160 (91%), Gaps = 0/160 (0%)
 Frame = -2

Query  665  FSAPLFVIPENMKPSKVHLFMYGLLFGFADTWAMMPDNKMVGKAIRDVEKLKIIASNPRR  486
            FSAPLFVIPE MKPSK HLFMYGLLFGFADTWA MPDNKMVGKAI+D EKLKIIASNPRR
Sbjct  162  FSAPLFVIPEPMKPSKAHLFMYGLLFGFADTWAAMPDNKMVGKAIKDPEKLKIIASNPRR  221

Query  485  YTGKPRVGTMREIARQCEYVQNNFEKVSVGFLTVHGTADGVTCPSGSQMLYDKASSSDKT  306
            YTGKPRVGTMREIAR C+Y+Q+NF KV+V FLTVHGTADGVTCP+ SQ+LY+KASS DK+
Sbjct  222  YTGKPRVGTMREIARVCQYIQDNFSKVTVPFLTVHGTADGVTCPTSSQLLYEKASSEDKS  281

Query  305  LKLYQGLYHSLIQGEPDEDANRVLADMREWIDERVSCNGT  186
            LK+Y+G+YHSLIQGEPDE+A+ VL DMREWIDERV   G+
Sbjct  282  LKMYEGMYHSLIQGEPDENASLVLKDMREWIDERVERYGS  321



>gb|KDP37154.1| hypothetical protein JCGZ_06210 [Jatropha curcas]
Length=330

 Score =   283 bits (725),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 132/159 (83%), Positives = 144/159 (91%), Gaps = 0/159 (0%)
 Frame = -2

Query  665  FSAPLFVIPENMKPSKVHLFMYGLLFGFADTWAMMPDNKMVGKAIRDVEKLKIIASNPRR  486
            FSAPLFVIPE MKPSK+HLFMYGLLFG ADTWA MPDNKMVGKAI+D EKLKIIASNPRR
Sbjct  166  FSAPLFVIPEPMKPSKLHLFMYGLLFGLADTWAAMPDNKMVGKAIKDPEKLKIIASNPRR  225

Query  485  YTGKPRVGTMREIARQCEYVQNNFEKVSVGFLTVHGTADGVTCPSGSQMLYDKASSSDKT  306
            YTGKPRVGTMREIAR C+YVQ+NF KV+  FLTVHGTADGVTCP+ SQ+LY+KASS DK+
Sbjct  226  YTGKPRVGTMREIARMCQYVQDNFSKVTAPFLTVHGTADGVTCPTSSQLLYEKASSEDKS  285

Query  305  LKLYQGLYHSLIQGEPDEDANRVLADMREWIDERVSCNG  189
            LKLY+G+YHSLIQGEPDE+AN VL DMREWIDERV   G
Sbjct  286  LKLYEGMYHSLIQGEPDENANLVLKDMREWIDERVERYG  324



>ref|XP_006427153.1| hypothetical protein CICLE_v10026080mg [Citrus clementina]
 gb|ESR40393.1| hypothetical protein CICLE_v10026080mg [Citrus clementina]
 gb|KDO37355.1| hypothetical protein CISIN_1g020630mg [Citrus sinensis]
Length=323

 Score =   281 bits (720),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 129/159 (81%), Positives = 146/159 (92%), Gaps = 0/159 (0%)
 Frame = -2

Query  665  FSAPLFVIPENMKPSKVHLFMYGLLFGFADTWAMMPDNKMVGKAIRDVEKLKIIASNPRR  486
            FSAPLFVIPENMKPSK+HLFMYGLLFG ADTWA MPDNKMVGKAI+D EKLK+IASNPRR
Sbjct  161  FSAPLFVIPENMKPSKLHLFMYGLLFGLADTWAAMPDNKMVGKAIKDPEKLKVIASNPRR  220

Query  485  YTGKPRVGTMREIARQCEYVQNNFEKVSVGFLTVHGTADGVTCPSGSQMLYDKASSSDKT  306
            YTGKPRVGTMREIAR C+Y+Q+NF KV+V FLTVHGTADGVTCP+ S++LY+KASS+DK+
Sbjct  221  YTGKPRVGTMREIARVCQYIQDNFSKVTVPFLTVHGTADGVTCPTSSKLLYEKASSADKS  280

Query  305  LKLYQGLYHSLIQGEPDEDANRVLADMREWIDERVSCNG  189
            +K+Y G+YHSLIQGEPDE+AN VL DMREWIDERV   G
Sbjct  281  IKIYDGMYHSLIQGEPDENANLVLKDMREWIDERVERCG  319



>ref|XP_006465405.1| PREDICTED: caffeoylshikimate esterase-like [Citrus sinensis]
 gb|KDO37465.1| hypothetical protein CISIN_1g020633mg [Citrus sinensis]
Length=323

 Score =   281 bits (720),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 129/159 (81%), Positives = 146/159 (92%), Gaps = 0/159 (0%)
 Frame = -2

Query  665  FSAPLFVIPENMKPSKVHLFMYGLLFGFADTWAMMPDNKMVGKAIRDVEKLKIIASNPRR  486
            FSAPLFVIPENMKPSK+HLFMYGLLFG ADTWA MPDNKMVGKAI+D EKLK+IASNPRR
Sbjct  161  FSAPLFVIPENMKPSKLHLFMYGLLFGLADTWAAMPDNKMVGKAIKDPEKLKVIASNPRR  220

Query  485  YTGKPRVGTMREIARQCEYVQNNFEKVSVGFLTVHGTADGVTCPSGSQMLYDKASSSDKT  306
            YTGKPRVGTMREIAR C+Y+Q+NF KV+V FLTVHGTADGVTCP+ S++LY+KASS+DK+
Sbjct  221  YTGKPRVGTMREIARVCQYIQDNFSKVTVPFLTVHGTADGVTCPTSSKLLYEKASSADKS  280

Query  305  LKLYQGLYHSLIQGEPDEDANRVLADMREWIDERVSCNG  189
            +K+Y G+YHSLIQGEPDE+AN VL DMREWIDERV   G
Sbjct  281  IKIYDGMYHSLIQGEPDENANLVLKDMREWIDERVERYG  319



>ref|XP_004235722.1| PREDICTED: caffeoylshikimate esterase [Solanum lycopersicum]
Length=327

 Score =   281 bits (719),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 132/164 (80%), Positives = 144/164 (88%), Gaps = 0/164 (0%)
 Frame = -2

Query  665  FSAPLFVIPENMKPSKVHLFMYGLLFGFADTWAMMPDNKMVGKAIRDVEKLKIIASNPRR  486
            FSAPLFVIPE MKPSKVHLFMYGLLFGFADTWA MPDNKMVGKAIRD EKLKIIASNPRR
Sbjct  162  FSAPLFVIPEPMKPSKVHLFMYGLLFGFADTWAAMPDNKMVGKAIRDPEKLKIIASNPRR  221

Query  485  YTGKPRVGTMREIARQCEYVQNNFEKVSVGFLTVHGTADGVTCPSGSQMLYDKASSSDKT  306
            YTGKPRVGTMREIARQCEYVQNNF+KV+  FLT HGT+DG+ CP+GS++LY+KASS DKT
Sbjct  222  YTGKPRVGTMREIARQCEYVQNNFDKVTAPFLTAHGTSDGLACPTGSKLLYEKASSEDKT  281

Query  305  LKLYQGLYHSLIQGEPDEDANRVLADMREWIDERVSCNGTAV*G  174
            LK+Y G+YHSLIQGEPD+    VLADMR WIDERV   G  + G
Sbjct  282  LKIYDGMYHSLIQGEPDDAVAIVLADMRAWIDERVERYGPKING  325



>ref|XP_002298118.1| esterase/lipase/thioesterase family protein [Populus trichocarpa]
 gb|EEE82923.1| esterase/lipase/thioesterase family protein [Populus trichocarpa]
Length=326

 Score =   280 bits (715),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 129/160 (81%), Positives = 144/160 (90%), Gaps = 0/160 (0%)
 Frame = -2

Query  665  FSAPLFVIPENMKPSKVHLFMYGLLFGFADTWAMMPDNKMVGKAIRDVEKLKIIASNPRR  486
            FSAPLFVIPE MKPSKVHLFMYGLLFG ADTWA MPDNKMVGKAI+D EKLKIIASNPRR
Sbjct  162  FSAPLFVIPEAMKPSKVHLFMYGLLFGLADTWAAMPDNKMVGKAIKDPEKLKIIASNPRR  221

Query  485  YTGKPRVGTMREIARQCEYVQNNFEKVSVGFLTVHGTADGVTCPSGSQMLYDKASSSDKT  306
            YTGKPRVGTMREIAR C+Y+Q+NF KV+  FLTVHGTADGVTCP+ SQ+L++KASS DK+
Sbjct  222  YTGKPRVGTMREIARMCQYIQDNFSKVTAPFLTVHGTADGVTCPTSSQLLFEKASSEDKS  281

Query  305  LKLYQGLYHSLIQGEPDEDANRVLADMREWIDERVSCNGT  186
            LK+Y+G+YHSLIQGEPDE+AN VL DMR WIDERV   G+
Sbjct  282  LKMYEGMYHSLIQGEPDENANLVLKDMRGWIDERVERYGS  321



>ref|XP_011035632.1| PREDICTED: caffeoylshikimate esterase-like [Populus euphratica]
Length=326

 Score =   280 bits (715),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 130/160 (81%), Positives = 145/160 (91%), Gaps = 0/160 (0%)
 Frame = -2

Query  665  FSAPLFVIPENMKPSKVHLFMYGLLFGFADTWAMMPDNKMVGKAIRDVEKLKIIASNPRR  486
            FSAPLFVIPE MKPSKVHLFMYGLLFG ADTWA MPDNKMVGKAI+D EKLKIIASNPRR
Sbjct  162  FSAPLFVIPEPMKPSKVHLFMYGLLFGMADTWAAMPDNKMVGKAIKDPEKLKIIASNPRR  221

Query  485  YTGKPRVGTMREIARQCEYVQNNFEKVSVGFLTVHGTADGVTCPSGSQMLYDKASSSDKT  306
            YTGKPRVGTMREIAR C+Y+Q+NF KV+V FLTVHGTADGVTCP+ SQ+L++KASS DK+
Sbjct  222  YTGKPRVGTMREIARMCQYIQDNFSKVTVPFLTVHGTADGVTCPTSSQLLFEKASSKDKS  281

Query  305  LKLYQGLYHSLIQGEPDEDANRVLADMREWIDERVSCNGT  186
            LK+Y+G+YHSLIQGEPDE+AN VL DMR WIDERV   G+
Sbjct  282  LKVYEGMYHSLIQGEPDENANLVLKDMRGWIDERVERYGS  321



>ref|XP_006341666.1| PREDICTED: caffeoylshikimate esterase-like [Solanum tuberosum]
Length=327

 Score =   278 bits (712),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 131/164 (80%), Positives = 142/164 (87%), Gaps = 0/164 (0%)
 Frame = -2

Query  665  FSAPLFVIPENMKPSKVHLFMYGLLFGFADTWAMMPDNKMVGKAIRDVEKLKIIASNPRR  486
            FSAPLFVIPE MKPSKVHLFMYGLLFGFADTWA MPDNKMVGKAIRD EKLKIIASNPRR
Sbjct  162  FSAPLFVIPEPMKPSKVHLFMYGLLFGFADTWAAMPDNKMVGKAIRDPEKLKIIASNPRR  221

Query  485  YTGKPRVGTMREIARQCEYVQNNFEKVSVGFLTVHGTADGVTCPSGSQMLYDKASSSDKT  306
            YTGKPRVGTMREIARQCEYVQNNF KV+  FLT HGT+DG+ CP+GS++LY+KASS DKT
Sbjct  222  YTGKPRVGTMREIARQCEYVQNNFHKVTAPFLTAHGTSDGLACPTGSKLLYEKASSEDKT  281

Query  305  LKLYQGLYHSLIQGEPDEDANRVLADMREWIDERVSCNGTAV*G  174
            LK+Y G+YHSLIQGEPD+    VLADMR WIDER    G  + G
Sbjct  282  LKIYDGMYHSLIQGEPDDAVAIVLADMRAWIDERAERYGPKING  325



>emb|CBI36239.3| unnamed protein product [Vitis vinifera]
Length=345

 Score =   275 bits (704),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 126/159 (79%), Positives = 142/159 (89%), Gaps = 0/159 (0%)
 Frame = -2

Query  665  FSAPLFVIPENMKPSKVHLFMYGLLFGFADTWAMMPDNKMVGKAIRDVEKLKIIASNPRR  486
            FSAPLFV+PENMKPSKV LF+YGLLFG ADTWA MPDNKMVGKAI+D EKLK+IASNPRR
Sbjct  183  FSAPLFVMPENMKPSKVRLFLYGLLFGMADTWATMPDNKMVGKAIKDPEKLKVIASNPRR  242

Query  485  YTGKPRVGTMREIARQCEYVQNNFEKVSVGFLTVHGTADGVTCPSGSQMLYDKASSSDKT  306
            YTG PRVGTMRE+AR C+Y+Q+NF KV+  FLTVHGTADGVTCP+ S++LY+KASS DK 
Sbjct  243  YTGPPRVGTMRELARVCQYIQDNFSKVTAPFLTVHGTADGVTCPTSSKLLYEKASSEDKA  302

Query  305  LKLYQGLYHSLIQGEPDEDANRVLADMREWIDERVSCNG  189
            LKLY+G+YHSLIQGEPDE+AN VL DMREWIDERV   G
Sbjct  303  LKLYEGMYHSLIQGEPDENANLVLKDMREWIDERVERYG  341



>ref|XP_008239016.1| PREDICTED: caffeoylshikimate esterase [Prunus mume]
Length=317

 Score =   274 bits (700),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 127/159 (80%), Positives = 142/159 (89%), Gaps = 0/159 (0%)
 Frame = -2

Query  665  FSAPLFVIPENMKPSKVHLFMYGLLFGFADTWAMMPDNKMVGKAIRDVEKLKIIASNPRR  486
            FSAPLFVIPENMKPSKVHLF+YGLLFG ADTWA MPDNKMVGKAI+D  KL+IIASNPRR
Sbjct  157  FSAPLFVIPENMKPSKVHLFLYGLLFGIADTWAAMPDNKMVGKAIKDPAKLRIIASNPRR  216

Query  485  YTGKPRVGTMREIARQCEYVQNNFEKVSVGFLTVHGTADGVTCPSGSQMLYDKASSSDKT  306
            YTG PRVGTMREIAR C+Y+Q+NF +V+  FLTVHGTADGVTCPS S++LY+KASS DKT
Sbjct  217  YTGPPRVGTMREIARVCQYIQDNFSRVTTPFLTVHGTADGVTCPSSSKLLYEKASSVDKT  276

Query  305  LKLYQGLYHSLIQGEPDEDANRVLADMREWIDERVSCNG  189
            LK+Y G+YHSLIQGEPDE+A+ VL DMREWIDERV   G
Sbjct  277  LKIYDGMYHSLIQGEPDENADIVLRDMREWIDERVERYG  315



>emb|CDO98101.1| unnamed protein product [Coffea canephora]
Length=326

 Score =   273 bits (699),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 129/159 (81%), Positives = 139/159 (87%), Gaps = 0/159 (0%)
 Frame = -2

Query  665  FSAPLFVIPENMKPSKVHLFMYGLLFGFADTWAMMPDNKMVGKAIRDVEKLKIIASNPRR  486
            FSAPLFVIPE M+PS+V LF+YGLLFG ADTWA MPDN+MVGKAIRD EKLKIIA NPRR
Sbjct  159  FSAPLFVIPEPMQPSRVRLFVYGLLFGMADTWAAMPDNRMVGKAIRDPEKLKIIAGNPRR  218

Query  485  YTGKPRVGTMREIARQCEYVQNNFEKVSVGFLTVHGTADGVTCPSGSQMLYDKASSSDKT  306
            YTG PRVGTMRE+ RQ EYVQNNF KV+V FLTVHGT+DGVTCPSGS+MLY+KASS DKT
Sbjct  219  YTGPPRVGTMRELVRQTEYVQNNFHKVTVPFLTVHGTSDGVTCPSGSKMLYEKASSQDKT  278

Query  305  LKLYQGLYHSLIQGEPDEDANRVLADMREWIDERVSCNG  189
            LKLY G+YHSLIQGEPDE AN VLADMR WIDER    G
Sbjct  279  LKLYDGMYHSLIQGEPDESANLVLADMRAWIDERAQKYG  317



>ref|XP_007210524.1| hypothetical protein PRUPE_ppa008845mg [Prunus persica]
 gb|EMJ11723.1| hypothetical protein PRUPE_ppa008845mg [Prunus persica]
Length=317

 Score =   273 bits (698),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 127/159 (80%), Positives = 141/159 (89%), Gaps = 0/159 (0%)
 Frame = -2

Query  665  FSAPLFVIPENMKPSKVHLFMYGLLFGFADTWAMMPDNKMVGKAIRDVEKLKIIASNPRR  486
            FSAPLFVIPENMKPSKVHLF+YGLLFG ADTWA MPDNKMVGKAI+D  KL+IIASNPRR
Sbjct  157  FSAPLFVIPENMKPSKVHLFLYGLLFGIADTWAAMPDNKMVGKAIKDPAKLRIIASNPRR  216

Query  485  YTGKPRVGTMREIARQCEYVQNNFEKVSVGFLTVHGTADGVTCPSGSQMLYDKASSSDKT  306
            YTG PRVGTMREIAR C+Y+Q+NF +V+  FLTVHGTADGVTCPS S++LY+KASS DKT
Sbjct  217  YTGPPRVGTMREIARVCQYIQDNFSRVTTPFLTVHGTADGVTCPSSSKLLYEKASSVDKT  276

Query  305  LKLYQGLYHSLIQGEPDEDANRVLADMREWIDERVSCNG  189
            LK+Y G+YHSLIQGEPDE+A  VL DMREWIDERV   G
Sbjct  277  LKIYDGMYHSLIQGEPDENAEIVLRDMREWIDERVERYG  315



>emb|CAN62561.1| hypothetical protein VITISV_001366 [Vitis vinifera]
Length=321

 Score =   273 bits (698),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 125/159 (79%), Positives = 141/159 (89%), Gaps = 0/159 (0%)
 Frame = -2

Query  665  FSAPLFVIPENMKPSKVHLFMYGLLFGFADTWAMMPDNKMVGKAIRDVEKLKIIASNPRR  486
            FSAPLFV+PENMKPSKV LF+YGLLFG ADTWA MPDNKMVGKAI+D EKLK+IASNPRR
Sbjct  159  FSAPLFVMPENMKPSKVRLFLYGLLFGMADTWATMPDNKMVGKAIKDPEKLKVIASNPRR  218

Query  485  YTGKPRVGTMREIARQCEYVQNNFEKVSVGFLTVHGTADGVTCPSGSQMLYDKASSSDKT  306
            YTG PRVGTMRE+AR C+Y+Q+NF KV+  FLTVHGTADGVTCP+ S++LY+KASS DK 
Sbjct  219  YTGPPRVGTMRELARVCQYIQDNFSKVTAPFLTVHGTADGVTCPTSSKLLYEKASSEDKA  278

Query  305  LKLYQGLYHSLIQGEPDEDANRVLADMREWIDERVSCNG  189
            LKLY+G+YHSLIQGEPDE+ N VL DMREWIDERV   G
Sbjct  279  LKLYEGMYHSLIQGEPDENXNLVLKDMREWIDERVERYG  317



>ref|XP_002285258.1| PREDICTED: caffeoylshikimate esterase [Vitis vinifera]
Length=392

 Score =   275 bits (704),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 126/159 (79%), Positives = 142/159 (89%), Gaps = 0/159 (0%)
 Frame = -2

Query  665  FSAPLFVIPENMKPSKVHLFMYGLLFGFADTWAMMPDNKMVGKAIRDVEKLKIIASNPRR  486
            FSAPLFV+PENMKPSKV LF+YGLLFG ADTWA MPDNKMVGKAI+D EKLK+IASNPRR
Sbjct  230  FSAPLFVMPENMKPSKVRLFLYGLLFGMADTWATMPDNKMVGKAIKDPEKLKVIASNPRR  289

Query  485  YTGKPRVGTMREIARQCEYVQNNFEKVSVGFLTVHGTADGVTCPSGSQMLYDKASSSDKT  306
            YTG PRVGTMRE+AR C+Y+Q+NF KV+  FLTVHGTADGVTCP+ S++LY+KASS DK 
Sbjct  290  YTGPPRVGTMRELARVCQYIQDNFSKVTAPFLTVHGTADGVTCPTSSKLLYEKASSEDKA  349

Query  305  LKLYQGLYHSLIQGEPDEDANRVLADMREWIDERVSCNG  189
            LKLY+G+YHSLIQGEPDE+AN VL DMREWIDERV   G
Sbjct  350  LKLYEGMYHSLIQGEPDENANLVLKDMREWIDERVERYG  388



>ref|XP_004302949.1| PREDICTED: monoglyceride lipase-like [Fragaria vesca subsp. vesca]
Length=329

 Score =   273 bits (697),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 125/159 (79%), Positives = 143/159 (90%), Gaps = 0/159 (0%)
 Frame = -2

Query  665  FSAPLFVIPENMKPSKVHLFMYGLLFGFADTWAMMPDNKMVGKAIRDVEKLKIIASNPRR  486
            FSAPLFVIPENMKPS++HLF+YGLLFG ADTWA MPDNKMVGKAI+D EKLKIIASNPRR
Sbjct  168  FSAPLFVIPENMKPSRLHLFVYGLLFGIADTWAAMPDNKMVGKAIKDPEKLKIIASNPRR  227

Query  485  YTGKPRVGTMREIARQCEYVQNNFEKVSVGFLTVHGTADGVTCPSGSQMLYDKASSSDKT  306
            YTG PRVGTMREIAR C+Y+Q+NF +V+  FLTVHGTADGVTCP+ S++LY+KASS DK+
Sbjct  228  YTGPPRVGTMREIARVCQYIQDNFSRVTAPFLTVHGTADGVTCPTSSKLLYEKASSVDKS  287

Query  305  LKLYQGLYHSLIQGEPDEDANRVLADMREWIDERVSCNG  189
            LK+Y+G+YHSLIQGE DE+AN VL DMREWIDERV   G
Sbjct  288  LKIYEGMYHSLIQGETDENANLVLQDMREWIDERVEKYG  326



>ref|XP_004507903.1| PREDICTED: monoglyceride lipase-like isoform X1 [Cicer arietinum]
 ref|XP_004507904.1| PREDICTED: monoglyceride lipase-like isoform X2 [Cicer arietinum]
Length=326

 Score =   272 bits (696),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 127/160 (79%), Positives = 140/160 (88%), Gaps = 0/160 (0%)
 Frame = -2

Query  665  FSAPLFVIPENMKPSKVHLFMYGLLFGFADTWAMMPDNKMVGKAIRDVEKLKIIASNPRR  486
            FSAPLFVIPE+MKPSKVHL+MYGLLFG ADTWA MPDNKMVGKAIRD  KLKIIASNPRR
Sbjct  162  FSAPLFVIPEDMKPSKVHLYMYGLLFGLADTWATMPDNKMVGKAIRDPNKLKIIASNPRR  221

Query  485  YTGKPRVGTMREIARQCEYVQNNFEKVSVGFLTVHGTADGVTCPSGSQMLYDKASSSDKT  306
            YTG PRVGTMRE+ R  +YVQ+NF KV+V FLT HGTADGVTCPS S++LY+KA+S DK+
Sbjct  222  YTGPPRVGTMRELLRVTQYVQDNFSKVTVPFLTAHGTADGVTCPSSSKLLYEKATSQDKS  281

Query  305  LKLYQGLYHSLIQGEPDEDANRVLADMREWIDERVSCNGT  186
            LKLY G+YHSLIQGEPDE AN VL DMREWIDERV   G+
Sbjct  282  LKLYDGMYHSLIQGEPDESANLVLGDMREWIDERVRRYGS  321



>ref|XP_007154702.1| hypothetical protein PHAVU_003G140500g [Phaseolus vulgaris]
 gb|ESW26696.1| hypothetical protein PHAVU_003G140500g [Phaseolus vulgaris]
Length=320

 Score =   271 bits (693),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 126/155 (81%), Positives = 137/155 (88%), Gaps = 0/155 (0%)
 Frame = -2

Query  665  FSAPLFVIPENMKPSKVHLFMYGLLFGFADTWAMMPDNKMVGKAIRDVEKLKIIASNPRR  486
            FSAPLFVIPE+MKPSKVHLFMYGLLFG ADTWA MPDNKMVGKAIRD EKLKIIASNPRR
Sbjct  161  FSAPLFVIPEDMKPSKVHLFMYGLLFGLADTWAAMPDNKMVGKAIRDPEKLKIIASNPRR  220

Query  485  YTGKPRVGTMREIARQCEYVQNNFEKVSVGFLTVHGTADGVTCPSGSQMLYDKASSSDKT  306
            YTG PRVGTMRE+ R  +YVQ+NF +V+  F T HGTADGVTCPS S++LY+KASS DKT
Sbjct  221  YTGPPRVGTMRELLRVTQYVQDNFSRVTAPFFTAHGTADGVTCPSSSKLLYEKASSEDKT  280

Query  305  LKLYQGLYHSLIQGEPDEDANRVLADMREWIDERV  201
            LKLY G+YHSLIQGEPD+ AN VL DMREWIDERV
Sbjct  281  LKLYDGMYHSLIQGEPDDSANLVLGDMREWIDERV  315



>gb|KHG02194.1| Monoglyceride lipase [Gossypium arboreum]
Length=319

 Score =   271 bits (693),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 126/160 (79%), Positives = 142/160 (89%), Gaps = 0/160 (0%)
 Frame = -2

Query  665  FSAPLFVIPENMKPSKVHLFMYGLLFGFADTWAMMPDNKMVGKAIRDVEKLKIIASNPRR  486
            FSAPLFV+PENMKPSKV LF+YGLLFG ADTWA MPDNKMVGKAI+D EKLKIIASNPRR
Sbjct  159  FSAPLFVMPENMKPSKVRLFVYGLLFGLADTWATMPDNKMVGKAIKDPEKLKIIASNPRR  218

Query  485  YTGKPRVGTMREIARQCEYVQNNFEKVSVGFLTVHGTADGVTCPSGSQMLYDKASSSDKT  306
            YTG PRVGTMRE+AR C+Y+Q+NF KV   FLTVHGT+DGVTCP+ S++LY+KASS DKT
Sbjct  219  YTGPPRVGTMRELARVCQYIQDNFSKVRAPFLTVHGTSDGVTCPTSSKLLYEKASSVDKT  278

Query  305  LKLYQGLYHSLIQGEPDEDANRVLADMREWIDERVSCNGT  186
            LKLY G+YHSLIQGEPDE+A+ VL DMREWIDERV   G+
Sbjct  279  LKLYDGMYHSLIQGEPDENADLVLKDMREWIDERVERYGS  318



>gb|AEA11209.1| monoacylglycerol acyltransferase [Arachis hypogaea]
Length=321

 Score =   269 bits (688),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 125/159 (79%), Positives = 142/159 (89%), Gaps = 0/159 (0%)
 Frame = -2

Query  665  FSAPLFVIPENMKPSKVHLFMYGLLFGFADTWAMMPDNKMVGKAIRDVEKLKIIASNPRR  486
            FSAPLFVIPE+MKPS++HLF YGLLFG+ADTWA MPDNKMVGKAIRD EKLKIIASNPRR
Sbjct  161  FSAPLFVIPEDMKPSRLHLFAYGLLFGWADTWAAMPDNKMVGKAIRDPEKLKIIASNPRR  220

Query  485  YTGKPRVGTMREIARQCEYVQNNFEKVSVGFLTVHGTADGVTCPSGSQMLYDKASSSDKT  306
            YTG PRVGTMRE+ R  +YVQ+NF KV+  FLTVHGT+DGVTCPS S++LY+KASS DK+
Sbjct  221  YTGPPRVGTMRELLRVTQYVQDNFSKVTAPFLTVHGTSDGVTCPSSSKLLYEKASSEDKS  280

Query  305  LKLYQGLYHSLIQGEPDEDANRVLADMREWIDERVSCNG  189
            LKLY+G+YHSLIQGEPDE AN VL+DMREWID+RV   G
Sbjct  281  LKLYEGMYHSLIQGEPDESANLVLSDMREWIDQRVHRYG  319



>gb|EPS74470.1| hypothetical protein M569_00281, partial [Genlisea aurea]
Length=306

 Score =   268 bits (686),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 124/155 (80%), Positives = 138/155 (89%), Gaps = 0/155 (0%)
 Frame = -2

Query  665  FSAPLFVIPENMKPSKVHLFMYGLLFGFADTWAMMPDNKMVGKAIRDVEKLKIIASNPRR  486
            FSAPLFVIPE MKPSK+HLFMYGLLFG ADTWA MPDNKMVGKAIRD  KLKIIA NPRR
Sbjct  152  FSAPLFVIPEPMKPSKLHLFMYGLLFGLADTWAAMPDNKMVGKAIRDPNKLKIIAGNPRR  211

Query  485  YTGKPRVGTMREIARQCEYVQNNFEKVSVGFLTVHGTADGVTCPSGSQMLYDKASSSDKT  306
            YTG PRVGTMR I+RQC++VQNNF +V+  FLTVHGT+DGVTCPSGS++LY  A+S DKT
Sbjct  212  YTGSPRVGTMRGISRQCDHVQNNFHRVTAPFLTVHGTSDGVTCPSGSKLLYANAASRDKT  271

Query  305  LKLYQGLYHSLIQGEPDEDANRVLADMREWIDERV  201
            LKLY G+YHSLIQGEPDE A+ VLADMR+WID+RV
Sbjct  272  LKLYDGMYHSLIQGEPDESADIVLADMRQWIDQRV  306



>ref|XP_003542674.1| PREDICTED: caffeoylshikimate esterase [Glycine max]
Length=326

 Score =   269 bits (687),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 124/155 (80%), Positives = 136/155 (88%), Gaps = 0/155 (0%)
 Frame = -2

Query  665  FSAPLFVIPENMKPSKVHLFMYGLLFGFADTWAMMPDNKMVGKAIRDVEKLKIIASNPRR  486
            FSAPLFVIPE+MKPS+VHLFMYGLLFG ADTWA MPDNKMVGKAIRD EKLK+IASNPRR
Sbjct  162  FSAPLFVIPEDMKPSRVHLFMYGLLFGLADTWAAMPDNKMVGKAIRDPEKLKVIASNPRR  221

Query  485  YTGKPRVGTMREIARQCEYVQNNFEKVSVGFLTVHGTADGVTCPSGSQMLYDKASSSDKT  306
            YTG PRVGTMRE+ R  +YVQ+NF KV+  F T HGT+DGVTCPS S++LY+K SS DKT
Sbjct  222  YTGPPRVGTMRELLRVTQYVQDNFSKVTTPFFTAHGTSDGVTCPSSSKLLYEKGSSEDKT  281

Query  305  LKLYQGLYHSLIQGEPDEDANRVLADMREWIDERV  201
            LKLY G+YHSLIQGEPDE AN VL DMREWIDERV
Sbjct  282  LKLYDGMYHSLIQGEPDESANLVLGDMREWIDERV  316



>ref|XP_006392872.1| hypothetical protein EUTSA_v10011645mg [Eutrema salsugineum]
 gb|ESQ30158.1| hypothetical protein EUTSA_v10011645mg [Eutrema salsugineum]
Length=328

 Score =   269 bits (687),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 124/160 (78%), Positives = 142/160 (89%), Gaps = 0/160 (0%)
 Frame = -2

Query  665  FSAPLFVIPENMKPSKVHLFMYGLLFGFADTWAMMPDNKMVGKAIRDVEKLKIIASNPRR  486
            FSAPLFVIPE+MKPSK HLF YGLLFG ADTWA MPDNKMVGKAI+D  KLKIIASNP+R
Sbjct  168  FSAPLFVIPEDMKPSKAHLFAYGLLFGLADTWAAMPDNKMVGKAIKDPAKLKIIASNPQR  227

Query  485  YTGKPRVGTMREIARQCEYVQNNFEKVSVGFLTVHGTADGVTCPSGSQMLYDKASSSDKT  306
            YTGKPRVGTMRE+ R+ +YVQ NFE+V++  LTVHGTADGVTCP+ S++LY+KASS+DKT
Sbjct  228  YTGKPRVGTMRELLRKTQYVQENFERVTIPVLTVHGTADGVTCPTSSKLLYEKASSADKT  287

Query  305  LKLYQGLYHSLIQGEPDEDANRVLADMREWIDERVSCNGT  186
            LKLY+G+YHSLIQGEPDE+A  VL DMREWIDERV   G+
Sbjct  288  LKLYEGMYHSLIQGEPDENAETVLKDMREWIDERVKRYGS  327



>ref|XP_007023971.1| Lysophospholipase 2 [Theobroma cacao]
 gb|EOY26593.1| Lysophospholipase 2 [Theobroma cacao]
Length=485

 Score =   273 bits (699),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 126/160 (79%), Positives = 143/160 (89%), Gaps = 0/160 (0%)
 Frame = -2

Query  665  FSAPLFVIPENMKPSKVHLFMYGLLFGFADTWAMMPDNKMVGKAIRDVEKLKIIASNPRR  486
            FSAPLFV+PENMKPSKV LFMYGLLFG ADTWA MPDNKMVGKAI+D EKLKIIASNPRR
Sbjct  323  FSAPLFVMPENMKPSKVRLFMYGLLFGLADTWATMPDNKMVGKAIKDPEKLKIIASNPRR  382

Query  485  YTGKPRVGTMREIARQCEYVQNNFEKVSVGFLTVHGTADGVTCPSGSQMLYDKASSSDKT  306
            YTG PRVGTMRE+AR C+Y+Q+NF KV   FLTVHGT+DGVTCP+ S++LY+KASS+DK+
Sbjct  383  YTGPPRVGTMRELARVCQYIQDNFSKVKAPFLTVHGTSDGVTCPTSSKLLYEKASSTDKS  442

Query  305  LKLYQGLYHSLIQGEPDEDANRVLADMREWIDERVSCNGT  186
            LKLY G+YHSLIQGEPDE+A+ VL DMREWIDERV   G+
Sbjct  443  LKLYDGMYHSLIQGEPDENADLVLKDMREWIDERVERYGS  482



>ref|XP_003610038.1| Monoglyceride lipase [Medicago truncatula]
 gb|AES92235.1| monoglyceride lipase-like protein [Medicago truncatula]
Length=326

 Score =   267 bits (683),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 125/155 (81%), Positives = 137/155 (88%), Gaps = 0/155 (0%)
 Frame = -2

Query  665  FSAPLFVIPENMKPSKVHLFMYGLLFGFADTWAMMPDNKMVGKAIRDVEKLKIIASNPRR  486
            FSAPLFVIPE+MKPSK+HLF+YGLLFG ADTWA MPDNKMVGKAIRD  KLKIIASNPRR
Sbjct  161  FSAPLFVIPEDMKPSKIHLFVYGLLFGLADTWAAMPDNKMVGKAIRDPNKLKIIASNPRR  220

Query  485  YTGKPRVGTMREIARQCEYVQNNFEKVSVGFLTVHGTADGVTCPSGSQMLYDKASSSDKT  306
            YTG PRVGTMRE+ R  +YVQ+NF  V+V FLT HGTADGVTCPS S++LY+KA S DKT
Sbjct  221  YTGPPRVGTMRELLRVTQYVQDNFCNVTVPFLTAHGTADGVTCPSSSKLLYEKAESKDKT  280

Query  305  LKLYQGLYHSLIQGEPDEDANRVLADMREWIDERV  201
            LKLY+G+YHSLIQGEPDE AN VL DMREWIDERV
Sbjct  281  LKLYEGMYHSLIQGEPDESANLVLRDMREWIDERV  315



>ref|XP_010535125.1| PREDICTED: caffeoylshikimate esterase [Tarenaya hassleriana]
Length=325

 Score =   266 bits (679),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 123/160 (77%), Positives = 138/160 (86%), Gaps = 0/160 (0%)
 Frame = -2

Query  665  FSAPLFVIPENMKPSKVHLFMYGLLFGFADTWAMMPDNKMVGKAIRDVEKLKIIASNPRR  486
            FSAPLFVIPE+MKPS+  LF YGLLFG ADTWA MPDNKMVGKAI+D EKLKIIASNPRR
Sbjct  163  FSAPLFVIPEDMKPSRARLFAYGLLFGLADTWAAMPDNKMVGKAIKDPEKLKIIASNPRR  222

Query  485  YTGKPRVGTMREIARQCEYVQNNFEKVSVGFLTVHGTADGVTCPSGSQMLYDKASSSDKT  306
            YTGKPRVGTMRE+ R  EYVQ NF +V++ FLT HGTADGVTCP+ S++LY KASS DKT
Sbjct  223  YTGKPRVGTMRELLRMTEYVQENFSRVTIPFLTAHGTADGVTCPTSSKLLYKKASSEDKT  282

Query  305  LKLYQGLYHSLIQGEPDEDANRVLADMREWIDERVSCNGT  186
            LKLY+G+YHSLIQGEPDE+A  VL DMR+WIDERV   G+
Sbjct  283  LKLYEGMYHSLIQGEPDEEAEIVLKDMRDWIDERVKRYGS  322



>ref|XP_006306194.1| hypothetical protein CARUB_v10011835mg [Capsella rubella]
 gb|EOA39092.1| hypothetical protein CARUB_v10011835mg [Capsella rubella]
Length=322

 Score =   265 bits (677),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 122/159 (77%), Positives = 140/159 (88%), Gaps = 0/159 (0%)
 Frame = -2

Query  665  FSAPLFVIPENMKPSKVHLFMYGLLFGFADTWAMMPDNKMVGKAIRDVEKLKIIASNPRR  486
            FSAPLFVIPE+MKPSK HLF YGLLFG ADTWA MPDNKMVGKAI+D EKLKIIASNP+R
Sbjct  164  FSAPLFVIPEDMKPSKTHLFAYGLLFGLADTWAAMPDNKMVGKAIKDPEKLKIIASNPQR  223

Query  485  YTGKPRVGTMREIARQCEYVQNNFEKVSVGFLTVHGTADGVTCPSGSQMLYDKASSSDKT  306
            YTGKPRVGTMRE+ R+ +YVQ NF +V++   T HGTADGVTCP+ S++LY+KASS+DKT
Sbjct  224  YTGKPRVGTMRELLRKTQYVQENFGRVTIPVFTAHGTADGVTCPTSSKLLYEKASSADKT  283

Query  305  LKLYQGLYHSLIQGEPDEDANRVLADMREWIDERVSCNG  189
            LKLY+G+YHSLIQGEPDE+A+ VL DMREWIDERV   G
Sbjct  284  LKLYEGMYHSLIQGEPDENADMVLKDMREWIDERVKRYG  322



>ref|NP_175685.1| lysophospholipase 2 [Arabidopsis thaliana]
 sp|Q9C942.1|CSE_ARATH RecName: Full=Caffeoylshikimate esterase; AltName: Full=Lysophospholipase 
2; Short=LysoPL2 [Arabidopsis thaliana]
 gb|AAG52273.1|AC019018_10 putative lipase; 20450-21648 [Arabidopsis thaliana]
 gb|AAK96768.1| putative lipase [Arabidopsis thaliana]
 gb|AAP42742.1| At1g52760 [Arabidopsis thaliana]
 gb|AEE32849.1| lysophospholipase 2 [Arabidopsis thaliana]
Length=332

 Score =   265 bits (676),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 121/160 (76%), Positives = 140/160 (88%), Gaps = 0/160 (0%)
 Frame = -2

Query  665  FSAPLFVIPENMKPSKVHLFMYGLLFGFADTWAMMPDNKMVGKAIRDVEKLKIIASNPRR  486
            FSAPLFVIPE+MKPSK HLF YGLLFG ADTWA MPDNKMVGKAI+D EKLKIIASNP+R
Sbjct  170  FSAPLFVIPEDMKPSKAHLFAYGLLFGLADTWAAMPDNKMVGKAIKDPEKLKIIASNPQR  229

Query  485  YTGKPRVGTMREIARQCEYVQNNFEKVSVGFLTVHGTADGVTCPSGSQMLYDKASSSDKT  306
            YTGKPRVGTMRE+ R+ +YVQ NF KV++   T HGTADGVTCP+ S++LY+KASS+DKT
Sbjct  230  YTGKPRVGTMRELLRKTQYVQENFGKVTIPVFTAHGTADGVTCPTSSKLLYEKASSADKT  289

Query  305  LKLYQGLYHSLIQGEPDEDANRVLADMREWIDERVSCNGT  186
            LK+Y+G+YHSLIQGEPDE+A  VL DMREWIDE+V   G+
Sbjct  290  LKIYEGMYHSLIQGEPDENAEIVLKDMREWIDEKVKKYGS  329



>ref|XP_002891714.1| esterase/lipase/thioesterase family protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH67973.1| esterase/lipase/thioesterase family protein [Arabidopsis lyrata 
subsp. lyrata]
Length=329

 Score =   265 bits (676),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 121/160 (76%), Positives = 140/160 (88%), Gaps = 0/160 (0%)
 Frame = -2

Query  665  FSAPLFVIPENMKPSKVHLFMYGLLFGFADTWAMMPDNKMVGKAIRDVEKLKIIASNPRR  486
            FSAPLFVIPE+MKPSK HLF YGLLFG ADTWA MPDNKMVGKAI+D EKLKIIASNP+R
Sbjct  167  FSAPLFVIPEDMKPSKAHLFAYGLLFGLADTWAAMPDNKMVGKAIKDPEKLKIIASNPQR  226

Query  485  YTGKPRVGTMREIARQCEYVQNNFEKVSVGFLTVHGTADGVTCPSGSQMLYDKASSSDKT  306
            YTGKPRVGTMRE+ R+ +YVQ NF +V++   T HGTADGVTCP+ S++LY+KASS+DKT
Sbjct  227  YTGKPRVGTMRELLRKTQYVQENFGRVTIPVFTAHGTADGVTCPTSSKLLYEKASSADKT  286

Query  305  LKLYQGLYHSLIQGEPDEDANRVLADMREWIDERVSCNGT  186
            LK+Y+G+YHSLIQGEPDE+A  VL DMREWIDERV   G+
Sbjct  287  LKIYEGMYHSLIQGEPDENAEIVLKDMREWIDERVKRYGS  326



>ref|XP_006843203.1| hypothetical protein AMTR_s00146p00105370 [Amborella trichopoda]
 gb|ERN04878.1| hypothetical protein AMTR_s00146p00105370 [Amborella trichopoda]
Length=322

 Score =   264 bits (674),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 122/155 (79%), Positives = 137/155 (88%), Gaps = 0/155 (0%)
 Frame = -2

Query  665  FSAPLFVIPENMKPSKVHLFMYGLLFGFADTWAMMPDNKMVGKAIRDVEKLKIIASNPRR  486
            FSAPLFVIPE MKPS+V LF+YG+L G ADTWA+MPDNKMVGKAI+D EKLKIIASNPRR
Sbjct  160  FSAPLFVIPEPMKPSRVRLFLYGMLMGLADTWAVMPDNKMVGKAIKDPEKLKIIASNPRR  219

Query  485  YTGKPRVGTMREIARQCEYVQNNFEKVSVGFLTVHGTADGVTCPSGSQMLYDKASSSDKT  306
            YTG PRVGTMRE+ R CEY+Q NF+KV V FLTVHGTADGVT P  S+ LY+KASS DKT
Sbjct  220  YTGTPRVGTMRELKRVCEYIQANFDKVKVPFLTVHGTADGVTAPESSKWLYEKASSEDKT  279

Query  305  LKLYQGLYHSLIQGEPDEDANRVLADMREWIDERV  201
            LKLY+G+YHSL+QGEPDE++ RVLADMREWID RV
Sbjct  280  LKLYEGMYHSLVQGEPDENSERVLADMREWIDARV  314



>ref|XP_009147666.1| PREDICTED: caffeoylshikimate esterase [Brassica rapa]
Length=328

 Score =   263 bits (672),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 124/160 (78%), Positives = 137/160 (86%), Gaps = 0/160 (0%)
 Frame = -2

Query  665  FSAPLFVIPENMKPSKVHLFMYGLLFGFADTWAMMPDNKMVGKAIRDVEKLKIIASNPRR  486
            FSAPLFVIPE+MKPSK HLF YGLLFG ADTWA MPDNKMVGKAI D EKLKIIA+NP+R
Sbjct  168  FSAPLFVIPEDMKPSKTHLFAYGLLFGLADTWAAMPDNKMVGKAIHDPEKLKIIAANPQR  227

Query  485  YTGKPRVGTMREIARQCEYVQNNFEKVSVGFLTVHGTADGVTCPSGSQMLYDKASSSDKT  306
            YTGKPRVGTMRE+ R+  YVQ NF +V+  FLTVHGTADGVTCPS S++LY+KASS DKT
Sbjct  228  YTGKPRVGTMRELLRKTLYVQENFGRVTAPFLTVHGTADGVTCPSSSKLLYEKASSDDKT  287

Query  305  LKLYQGLYHSLIQGEPDEDANRVLADMREWIDERVSCNGT  186
            LKLY G+YHSLIQGEPDE+   VL DMREWIDERV   G+
Sbjct  288  LKLYDGMYHSLIQGEPDENVAIVLKDMREWIDERVERYGS  327



>emb|CDY72184.1| BnaCnng76370D [Brassica napus]
 emb|CDY62199.1| BnaA06g01500D [Brassica napus]
Length=328

 Score =   263 bits (671),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 124/160 (78%), Positives = 137/160 (86%), Gaps = 0/160 (0%)
 Frame = -2

Query  665  FSAPLFVIPENMKPSKVHLFMYGLLFGFADTWAMMPDNKMVGKAIRDVEKLKIIASNPRR  486
            FSAPLFVIPE+MKPSK HLF YGLLFG ADTWA MPDNKMVGKAI D EKLKIIA+NP+R
Sbjct  168  FSAPLFVIPEDMKPSKTHLFAYGLLFGLADTWAAMPDNKMVGKAIHDPEKLKIIAANPQR  227

Query  485  YTGKPRVGTMREIARQCEYVQNNFEKVSVGFLTVHGTADGVTCPSGSQMLYDKASSSDKT  306
            YTGKPRVGTMRE+ R+  YVQ NF +V+  FLTVHGTADGVTCPS S++LY+KASS DKT
Sbjct  228  YTGKPRVGTMRELLRKTLYVQENFGRVTAPFLTVHGTADGVTCPSSSKLLYEKASSDDKT  287

Query  305  LKLYQGLYHSLIQGEPDEDANRVLADMREWIDERVSCNGT  186
            LKLY G+YHSLIQGEPDE+   VL DMREWIDERV   G+
Sbjct  288  LKLYDGMYHSLIQGEPDENVAIVLKDMREWIDERVERYGS  327



>ref|XP_008447481.1| PREDICTED: caffeoylshikimate esterase [Cucumis melo]
Length=319

 Score =   261 bits (666),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 121/155 (78%), Positives = 136/155 (88%), Gaps = 0/155 (0%)
 Frame = -2

Query  665  FSAPLFVIPENMKPSKVHLFMYGLLFGFADTWAMMPDNKMVGKAIRDVEKLKIIASNPRR  486
            FSAPLFVIPENMKPSK+ LF+YGLLFG ADTWA MPDNKMVGKAI+D EKLKIIA+NPRR
Sbjct  158  FSAPLFVIPENMKPSKLRLFLYGLLFGVADTWAAMPDNKMVGKAIKDPEKLKIIAANPRR  217

Query  485  YTGKPRVGTMREIARQCEYVQNNFEKVSVGFLTVHGTADGVTCPSGSQMLYDKASSSDKT  306
            YTG PRVGTMRE+ R  +Y+++NF KV+  FLTVHGTADGVTCPS SQ+LY+KA+S DKT
Sbjct  218  YTGPPRVGTMRELVRVTQYIRDNFSKVTAPFLTVHGTADGVTCPSSSQLLYEKAASVDKT  277

Query  305  LKLYQGLYHSLIQGEPDEDANRVLADMREWIDERV  201
            LKLY G+YHSLIQGEPDE+   VL DMREWIDER 
Sbjct  278  LKLYDGMYHSLIQGEPDENVEIVLRDMREWIDERA  312



>ref|XP_004166692.1| PREDICTED: monoglyceride lipase-like [Cucumis sativus]
Length=325

 Score =   258 bits (660),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 119/155 (77%), Positives = 136/155 (88%), Gaps = 0/155 (0%)
 Frame = -2

Query  665  FSAPLFVIPENMKPSKVHLFMYGLLFGFADTWAMMPDNKMVGKAIRDVEKLKIIASNPRR  486
            FSAPLFVIPENMKPSK+ LF+YGLLFG ADTWA MPDNKMVGKAI+D EKLKIIA+NPRR
Sbjct  164  FSAPLFVIPENMKPSKLRLFLYGLLFGVADTWAAMPDNKMVGKAIKDPEKLKIIAANPRR  223

Query  485  YTGKPRVGTMREIARQCEYVQNNFEKVSVGFLTVHGTADGVTCPSGSQMLYDKASSSDKT  306
            YTG PRVGTMRE+ R  +Y+++NF +V+  FLTVHGTADGVTCPS S++LY+KA+S DKT
Sbjct  224  YTGPPRVGTMRELVRVTQYIRDNFSRVTAPFLTVHGTADGVTCPSSSELLYEKATSVDKT  283

Query  305  LKLYQGLYHSLIQGEPDEDANRVLADMREWIDERV  201
            LKLY G+YHSLIQGEPDE+   VL DMREWIDER 
Sbjct  284  LKLYDGMYHSLIQGEPDENVEIVLRDMREWIDERA  318



>ref|XP_004147998.1| PREDICTED: monoglyceride lipase-like [Cucumis sativus]
 gb|KGN58137.1| hypothetical protein Csa_3G539670 [Cucumis sativus]
Length=325

 Score =   258 bits (658),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 118/155 (76%), Positives = 136/155 (88%), Gaps = 0/155 (0%)
 Frame = -2

Query  665  FSAPLFVIPENMKPSKVHLFMYGLLFGFADTWAMMPDNKMVGKAIRDVEKLKIIASNPRR  486
            FSAPLFVIPENMKPSK+ LF+YGLLFG ADTWA MPDNKMVGKAI+D +KLKIIA+NPRR
Sbjct  164  FSAPLFVIPENMKPSKLRLFLYGLLFGVADTWAAMPDNKMVGKAIKDPQKLKIIAANPRR  223

Query  485  YTGKPRVGTMREIARQCEYVQNNFEKVSVGFLTVHGTADGVTCPSGSQMLYDKASSSDKT  306
            YTG PRVGTMRE+ R  +Y+++NF +V+  FLTVHGTADGVTCPS S++LY+KA+S DKT
Sbjct  224  YTGPPRVGTMRELVRVTQYIRDNFSRVTAPFLTVHGTADGVTCPSSSELLYEKATSVDKT  283

Query  305  LKLYQGLYHSLIQGEPDEDANRVLADMREWIDERV  201
            LKLY G+YHSLIQGEPDE+   VL DMREWIDER 
Sbjct  284  LKLYDGMYHSLIQGEPDENVEIVLRDMREWIDERA  318



>ref|XP_010099653.1| hypothetical protein L484_003175 [Morus notabilis]
 gb|EXB80174.1| hypothetical protein L484_003175 [Morus notabilis]
Length=328

 Score =   257 bits (657),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 119/162 (73%), Positives = 138/162 (85%), Gaps = 0/162 (0%)
 Frame = -2

Query  665  FSAPLFVIPENMKPSKVHLFMYGLLFGFADTWAMMPDNKMVGKAIRDVEKLKIIASNPRR  486
            FSAPLFV+PE+MKPSKV LF+YGLLFG ADTW  MPD KMVGK+I+D EKLKIIASNPRR
Sbjct  162  FSAPLFVMPEDMKPSKVRLFLYGLLFGVADTWPAMPDKKMVGKSIKDPEKLKIIASNPRR  221

Query  485  YTGKPRVGTMREIARQCEYVQNNFEKVSVGFLTVHGTADGVTCPSGSQMLYDKASSSDKT  306
            YTG PRVGTMRE+AR C+Y+Q+NF KV+  FLTVHGT DGVTCPS S++LY+KASS DK+
Sbjct  222  YTGSPRVGTMRELARVCQYIQDNFSKVTAPFLTVHGTDDGVTCPSSSKLLYEKASSVDKS  281

Query  305  LKLYQGLYHSLIQGEPDEDANRVLADMREWIDERVSCNGTAV  180
            LKLY G+YHSLIQGE DE+A+ VL DM+EWIDER    G  +
Sbjct  282  LKLYDGMYHSLIQGETDENASLVLRDMKEWIDERAEKYGPKI  323



>gb|KFK35771.1| hypothetical protein AALP_AA4G034000 [Arabis alpina]
Length=330

 Score =   257 bits (657),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 118/159 (74%), Positives = 139/159 (87%), Gaps = 0/159 (0%)
 Frame = -2

Query  665  FSAPLFVIPENMKPSKVHLFMYGLLFGFADTWAMMPDNKMVGKAIRDVEKLKIIASNPRR  486
            FSAPLFVIPE+MKPSK HLF YGLLFG ADTWA MPDNKMVGKAIRD EKLKIIA+NP R
Sbjct  168  FSAPLFVIPEDMKPSKAHLFAYGLLFGLADTWAAMPDNKMVGKAIRDPEKLKIIAANPNR  227

Query  485  YTGKPRVGTMREIARQCEYVQNNFEKVSVGFLTVHGTADGVTCPSGSQMLYDKASSSDKT  306
            Y+GKPRVGTMRE++ + +YVQ NF +V++ FL VHGTAD VTCP+ S+++Y+KASS+DKT
Sbjct  228  YSGKPRVGTMREVSSKTQYVQENFGRVTIPFLAVHGTADVVTCPTSSKLIYEKASSADKT  287

Query  305  LKLYQGLYHSLIQGEPDEDANRVLADMREWIDERVSCNG  189
            LK+Y+G+ HSLIQGEPDE+A  VL DMREWIDERV+  G
Sbjct  288  LKIYEGMCHSLIQGEPDENAEIVLKDMREWIDERVNRYG  326



>ref|XP_010500894.1| PREDICTED: caffeoylshikimate esterase [Camelina sativa]
Length=329

 Score =   256 bits (654),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 116/160 (73%), Positives = 139/160 (87%), Gaps = 0/160 (0%)
 Frame = -2

Query  665  FSAPLFVIPENMKPSKVHLFMYGLLFGFADTWAMMPDNKMVGKAIRDVEKLKIIASNPRR  486
            F+APLFVIPE+MKPS+ HLF YGLLFG ADTWA MPDNK+VGKAI+D EKLKIIASNP+R
Sbjct  167  FTAPLFVIPEDMKPSRPHLFAYGLLFGLADTWAAMPDNKIVGKAIKDPEKLKIIASNPQR  226

Query  485  YTGKPRVGTMREIARQCEYVQNNFEKVSVGFLTVHGTADGVTCPSGSQMLYDKASSSDKT  306
            YTGKPRVGTMRE+ R+ +YVQ NF +V++   T HGTADGV+CP+ S++LY+KASS+DKT
Sbjct  227  YTGKPRVGTMRELLRKTQYVQENFGRVTIPVFTAHGTADGVSCPTSSKLLYEKASSTDKT  286

Query  305  LKLYQGLYHSLIQGEPDEDANRVLADMREWIDERVSCNGT  186
            LK+Y+G+YHSLIQGEPDE+   VL DMREWIDERV   G+
Sbjct  287  LKIYEGMYHSLIQGEPDENVEIVLKDMREWIDERVKRYGS  326



>ref|XP_006305362.1| hypothetical protein CARUB_v10009746mg [Capsella rubella]
 gb|EOA38260.1| hypothetical protein CARUB_v10009746mg [Capsella rubella]
Length=323

 Score =   255 bits (652),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 118/160 (74%), Positives = 137/160 (86%), Gaps = 0/160 (0%)
 Frame = -2

Query  665  FSAPLFVIPENMKPSKVHLFMYGLLFGFADTWAMMPDNKMVGKAIRDVEKLKIIASNPRR  486
            FSAPLFV+PE+MKPSK HLF YGLLFG ADTWA MP+ KMVG +++D EKLKIIASNPRR
Sbjct  161  FSAPLFVMPEDMKPSKPHLFAYGLLFGLADTWAAMPNKKMVGMSVKDPEKLKIIASNPRR  220

Query  485  YTGKPRVGTMREIARQCEYVQNNFEKVSVGFLTVHGTADGVTCPSGSQMLYDKASSSDKT  306
            YTG PRVGTMRE+ R+ EYVQ NFE+V++   T HGT+DGVTCPS S++LY+KASS+DKT
Sbjct  221  YTGAPRVGTMRELLRKTEYVQENFERVTIPVFTAHGTSDGVTCPSSSKLLYEKASSADKT  280

Query  305  LKLYQGLYHSLIQGEPDEDANRVLADMREWIDERVSCNGT  186
            LKLY+G+YHSLIQGE DE+A  VL DMREWIDERV   GT
Sbjct  281  LKLYEGMYHSLIQGETDENAEIVLKDMREWIDERVKRYGT  320



>ref|XP_010479797.1| PREDICTED: caffeoylshikimate esterase-like [Camelina sativa]
Length=329

 Score =   255 bits (651),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 116/160 (73%), Positives = 138/160 (86%), Gaps = 0/160 (0%)
 Frame = -2

Query  665  FSAPLFVIPENMKPSKVHLFMYGLLFGFADTWAMMPDNKMVGKAIRDVEKLKIIASNPRR  486
            F+APLFVIPE+MKPSK HLF YGLLFG ADTWA MPDNK+VGKAI+D  KLKIIASNP+R
Sbjct  167  FTAPLFVIPEDMKPSKPHLFAYGLLFGLADTWAAMPDNKIVGKAIKDPVKLKIIASNPQR  226

Query  485  YTGKPRVGTMREIARQCEYVQNNFEKVSVGFLTVHGTADGVTCPSGSQMLYDKASSSDKT  306
            YTGKPRVGTMRE+ R+ EYVQ NF +V++   T HGTADGV+CP+ S++LY++ASS+DKT
Sbjct  227  YTGKPRVGTMRELLRKTEYVQENFGRVTIPVFTAHGTADGVSCPTSSKLLYERASSTDKT  286

Query  305  LKLYQGLYHSLIQGEPDEDANRVLADMREWIDERVSCNGT  186
            LK+Y+G+YHSLIQGEPDE+   VL DMREWIDERV   G+
Sbjct  287  LKIYEGMYHSLIQGEPDENVEIVLKDMREWIDERVKRYGS  326



>ref|XP_009348432.1| PREDICTED: LOW QUALITY PROTEIN: caffeoylshikimate esterase [Pyrus 
x bretschneideri]
Length=329

 Score =   254 bits (649),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 129/166 (78%), Positives = 144/166 (87%), Gaps = 0/166 (0%)
 Frame = -2

Query  665  FSAPLFVIPENMKPSKVHLFMYGLLFGFADTWAMMPDNKMVGKAIRDVEKLKIIASNPRR  486
            FSAPLFVIPENMKPSKVHLF+YGLLFG ADTWA MPDNKMVGKAI+D  KLKIIASNPRR
Sbjct  161  FSAPLFVIPENMKPSKVHLFLYGLLFGLADTWAAMPDNKMVGKAIKDPAKLKIIASNPRR  220

Query  485  YTGKPRVGTMREIARQCEYVQNNFEKVSVGFLTVHGTADGVTCPSGSQMLYDKASSSDKT  306
            YTG PRVGTMREIAR C+YVQ+NF +V+  FLTVHGTADGVTCP+ SQ+LY+K SS DKT
Sbjct  221  YTGPPRVGTMREIARMCQYVQDNFSRVTAPFLTVHGTADGVTCPTSSQLLYEKGSSVDKT  280

Query  305  LKLYQGLYHSLIQGEPDEDANRVLADMREWIDERVSCNGTAV*GCQ  168
            LK+Y G+YHSL+QGEPDE+A  VL DMREWIDERV+  GT   G +
Sbjct  281  LKIYDGMYHSLVQGEPDENAEIVLRDMREWIDERVARYGTKAKGLE  326



>ref|XP_010254283.1| PREDICTED: caffeoylshikimate esterase [Nelumbo nucifera]
Length=319

 Score =   253 bits (645),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 116/160 (73%), Positives = 134/160 (84%), Gaps = 0/160 (0%)
 Frame = -2

Query  665  FSAPLFVIPENMKPSKVHLFMYGLLFGFADTWAMMPDNKMVGKAIRDVEKLKIIASNPRR  486
            FSAPLF+IPE M+PSKV LF+YGL+FG ADTWA MPDNK+VGKAI+D EKLKIIA+NPRR
Sbjct  159  FSAPLFMIPEEMRPSKVRLFLYGLMFGMADTWASMPDNKIVGKAIKDPEKLKIIAANPRR  218

Query  485  YTGKPRVGTMREIARQCEYVQNNFEKVSVGFLTVHGTADGVTCPSGSQMLYDKASSSDKT  306
            Y G PRVGTMRE+ R  EY+QNNF KV++ FLTVHGTADG     GS++LY+ ASS DKT
Sbjct  219  YRGNPRVGTMRELVRVTEYIQNNFSKVTIPFLTVHGTADGAASYEGSKLLYENASSVDKT  278

Query  305  LKLYQGLYHSLIQGEPDEDANRVLADMREWIDERVSCNGT  186
            LKLY G+YHSLIQGEPDE++ RVL DMREWID RV   G+
Sbjct  279  LKLYDGMYHSLIQGEPDENSERVLGDMREWIDARVEKYGS  318



>ref|XP_008377606.1| PREDICTED: caffeoylshikimate esterase [Malus domestica]
Length=323

 Score =   252 bits (643),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 128/164 (78%), Positives = 143/164 (87%), Gaps = 0/164 (0%)
 Frame = -2

Query  665  FSAPLFVIPENMKPSKVHLFMYGLLFGFADTWAMMPDNKMVGKAIRDVEKLKIIASNPRR  486
            FSAPLFVIPENMKPSKVHLF+YGLLFG ADTWA MPDNKMVGKAI+D  KLKIIASNPRR
Sbjct  157  FSAPLFVIPENMKPSKVHLFLYGLLFGLADTWAAMPDNKMVGKAIKDPAKLKIIASNPRR  216

Query  485  YTGKPRVGTMREIARQCEYVQNNFEKVSVGFLTVHGTADGVTCPSGSQMLYDKASSSDKT  306
            YTG PRVGTMREIAR C+YVQ+NF +V+  FLTVHGTADGVTCP+ SQ+LY+K SS+DKT
Sbjct  217  YTGPPRVGTMREIARMCQYVQDNFLRVTAPFLTVHGTADGVTCPTSSQLLYEKGSSADKT  276

Query  305  LKLYQGLYHSLIQGEPDEDANRVLADMREWIDERVSCNGTAV*G  174
            LK+Y G+YHSL+QGEPDE+A  VL DMREWIDERV   G+   G
Sbjct  277  LKIYDGMYHSLVQGEPDENAEIVLRDMREWIDERVERYGSKAKG  320



>ref|XP_010479796.1| PREDICTED: caffeoylshikimate esterase-like [Camelina sativa]
Length=350

 Score =   251 bits (640),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 115/159 (72%), Positives = 136/159 (86%), Gaps = 0/159 (0%)
 Frame = -2

Query  665  FSAPLFVIPENMKPSKVHLFMYGLLFGFADTWAMMPDNKMVGKAIRDVEKLKIIASNPRR  486
            FSAPLFVIPE+MKPSK HLF YGLLFG ADTWA MPD KMVG +++D EKLKIIA+NPRR
Sbjct  188  FSAPLFVIPEDMKPSKPHLFAYGLLFGLADTWAAMPDKKMVGMSVKDPEKLKIIAANPRR  247

Query  485  YTGKPRVGTMREIARQCEYVQNNFEKVSVGFLTVHGTADGVTCPSGSQMLYDKASSSDKT  306
            YTG PRVGTMRE+ R+ EYVQ+NF +V++   T HGT+DGVTCP+ S++LY+KASS+DKT
Sbjct  248  YTGPPRVGTMRELLRKTEYVQDNFGRVTIPVFTAHGTSDGVTCPTSSKLLYEKASSADKT  307

Query  305  LKLYQGLYHSLIQGEPDEDANRVLADMREWIDERVSCNG  189
            LK+Y+G+YHSLIQGE DE+A  VL DMREWIDERV   G
Sbjct  308  LKIYEGMYHSLIQGETDENAEIVLKDMREWIDERVKRYG  346



>ref|XP_010500892.1| PREDICTED: caffeoylshikimate esterase-like [Camelina sativa]
Length=325

 Score =   248 bits (633),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 114/159 (72%), Positives = 135/159 (85%), Gaps = 0/159 (0%)
 Frame = -2

Query  665  FSAPLFVIPENMKPSKVHLFMYGLLFGFADTWAMMPDNKMVGKAIRDVEKLKIIASNPRR  486
            FSAPLFVIPE+MKPSK HLF YGLLFG ADTWA MPD KMVG +++D EKLKIIA+NPRR
Sbjct  163  FSAPLFVIPEDMKPSKPHLFAYGLLFGLADTWAAMPDKKMVGMSVKDPEKLKIIAANPRR  222

Query  485  YTGKPRVGTMREIARQCEYVQNNFEKVSVGFLTVHGTADGVTCPSGSQMLYDKASSSDKT  306
            YTG PRVGTMRE+ R+ EYVQ NF +V++   T HGT+DGVTCP+ S++LY+KASS+DKT
Sbjct  223  YTGPPRVGTMRELLRKTEYVQENFGRVTIPVFTAHGTSDGVTCPTSSKLLYEKASSADKT  282

Query  305  LKLYQGLYHSLIQGEPDEDANRVLADMREWIDERVSCNG  189
            LK+Y+G+YHSLIQGE DE+A  VL DMR+WIDERV   G
Sbjct  283  LKIYEGMYHSLIQGETDENAEIVLKDMRDWIDERVKRYG  321



>ref|XP_010462130.1| PREDICTED: caffeoylshikimate esterase-like [Camelina sativa]
Length=349

 Score =   248 bits (632),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 114/159 (72%), Positives = 134/159 (84%), Gaps = 0/159 (0%)
 Frame = -2

Query  665  FSAPLFVIPENMKPSKVHLFMYGLLFGFADTWAMMPDNKMVGKAIRDVEKLKIIASNPRR  486
            FSAPLFVIPE+MKPSK HLF Y LLFG ADTWA MPD KMVG +++D EKLKIIA+NPRR
Sbjct  187  FSAPLFVIPEDMKPSKPHLFAYSLLFGLADTWAAMPDKKMVGMSVKDPEKLKIIAANPRR  246

Query  485  YTGKPRVGTMREIARQCEYVQNNFEKVSVGFLTVHGTADGVTCPSGSQMLYDKASSSDKT  306
            YTG PRVGTMRE+ R+ EYVQ NF +V++   T HGT+DGVTCP+ S++LY+KASS+DKT
Sbjct  247  YTGPPRVGTMRELLRKTEYVQENFGRVTIPVFTAHGTSDGVTCPTSSKLLYEKASSADKT  306

Query  305  LKLYQGLYHSLIQGEPDEDANRVLADMREWIDERVSCNG  189
            LK+Y+G+YHSLIQGE DE+A  VL DMREWIDERV   G
Sbjct  307  LKIYEGMYHSLIQGETDENAEIVLKDMREWIDERVKRYG  345



>gb|ABR16738.1| unknown [Picea sitchensis]
Length=204

 Score =   238 bits (607),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 111/154 (72%), Positives = 125/154 (81%), Gaps = 0/154 (0%)
 Frame = -2

Query  665  FSAPLFVIPENMKPSKVHLFMYGLLFGFADTWAMMPDNKMVGKAIRDVEKLKIIASNPRR  486
            FSAPLFV+PE MKPS   L  YG LFG ADTWA+MPDNKMV KAI+D EKLKIIASNPRR
Sbjct  40   FSAPLFVMPEPMKPSWWRLTAYGFLFGLADTWAVMPDNKMVKKAIKDPEKLKIIASNPRR  99

Query  485  YTGKPRVGTMREIARQCEYVQNNFEKVSVGFLTVHGTADGVTCPSGSQMLYDKASSSDKT  306
            YTG PRVGTMRE+ R C + Q NFEKV++ FLT HGT+D VT P  S  LY++A S DKT
Sbjct  100  YTGPPRVGTMRELCRVCAFFQQNFEKVTIPFLTCHGTSDEVTAPESSTELYERAKSEDKT  159

Query  305  LKLYQGLYHSLIQGEPDEDANRVLADMREWIDER  204
            LKLY  +YHSL+QGEPDE+ANRVLADMREW+D R
Sbjct  160  LKLYDDMYHSLVQGEPDENANRVLADMREWLDAR  193



>gb|ACN40719.1| unknown [Picea sitchensis]
Length=324

 Score =   237 bits (604),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 111/154 (72%), Positives = 125/154 (81%), Gaps = 0/154 (0%)
 Frame = -2

Query  665  FSAPLFVIPENMKPSKVHLFMYGLLFGFADTWAMMPDNKMVGKAIRDVEKLKIIASNPRR  486
            FSAPLFV+PE MKPS   L  YG LFG ADTWA+MPDNKMV KAI+D EKLKIIASNPRR
Sbjct  160  FSAPLFVMPEPMKPSWWRLTAYGFLFGLADTWAVMPDNKMVKKAIKDPEKLKIIASNPRR  219

Query  485  YTGKPRVGTMREIARQCEYVQNNFEKVSVGFLTVHGTADGVTCPSGSQMLYDKASSSDKT  306
            YTG PRVGTMRE+ R C + Q NFEKV++ FLT HGT+D VT P  S  LY++A S DKT
Sbjct  220  YTGPPRVGTMRELCRVCAFFQQNFEKVTIPFLTCHGTSDEVTAPESSTELYERAKSEDKT  279

Query  305  LKLYQGLYHSLIQGEPDEDANRVLADMREWIDER  204
            LKLY  +YHSL+QGEPDE+ANRVLADMREW+D R
Sbjct  280  LKLYDDMYHSLVQGEPDENANRVLADMREWLDAR  313



>gb|ABK24677.1| unknown [Picea sitchensis]
Length=324

 Score =   236 bits (603),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 111/154 (72%), Positives = 125/154 (81%), Gaps = 0/154 (0%)
 Frame = -2

Query  665  FSAPLFVIPENMKPSKVHLFMYGLLFGFADTWAMMPDNKMVGKAIRDVEKLKIIASNPRR  486
            FSAPLFV+PE MKPS   L  YG LFG ADTWA+MPDNKMV KAI+D EKLKIIASNPRR
Sbjct  160  FSAPLFVMPEPMKPSWWRLTAYGFLFGLADTWAVMPDNKMVKKAIKDPEKLKIIASNPRR  219

Query  485  YTGKPRVGTMREIARQCEYVQNNFEKVSVGFLTVHGTADGVTCPSGSQMLYDKASSSDKT  306
            YTG PRVGTMRE+ R C + Q NFEKV++ FLT HGT+D VT P  S  LY++A S DKT
Sbjct  220  YTGPPRVGTMRELCRVCAFFQENFEKVTIPFLTCHGTSDEVTAPESSTELYERAKSEDKT  279

Query  305  LKLYQGLYHSLIQGEPDEDANRVLADMREWIDER  204
            LKLY  +YHSL+QGEPDE+ANRVLADMREW+D R
Sbjct  280  LKLYDDMYHSLVQGEPDENANRVLADMREWLDAR  313



>ref|XP_010925265.1| PREDICTED: caffeoylshikimate esterase-like [Elaeis guineensis]
Length=340

 Score =   237 bits (604),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 119/159 (75%), Positives = 139/159 (87%), Gaps = 0/159 (0%)
 Frame = -2

Query  665  FSAPLFVIPENMKPSKVHLFMYGLLFGFADTWAMMPDNKMVGKAIRDVEKLKIIASNPRR  486
            FSAPLFVIP++MKPS+V LF+YGLLFG ADTW  MPDNKMVGKAI+D E+L+IIASNPRR
Sbjct  164  FSAPLFVIPDDMKPSRVRLFLYGLLFGLADTWQAMPDNKMVGKAIKDRERLRIIASNPRR  223

Query  485  YTGKPRVGTMREIARQCEYVQNNFEKVSVGFLTVHGTADGVTCPSGSQMLYDKASSSDKT  306
            YTG+PRVGTMRE+AR C+Y Q NF+KV+  FLTVHGT DGVT P+GSQMLYDKASS DKT
Sbjct  224  YTGRPRVGTMRELARICDYFQANFDKVTAPFLTVHGTEDGVTSPAGSQMLYDKASSEDKT  283

Query  305  LKLYQGLYHSLIQGEPDEDANRVLADMREWIDERVSCNG  189
            L LY+G+YHSLIQGEP+E++ RVL DMR WID+R+   G
Sbjct  284  LILYEGMYHSLIQGEPEENSQRVLTDMRAWIDDRLRRYG  322



>ref|XP_008785454.1| PREDICTED: caffeoylshikimate esterase-like [Phoenix dactylifera]
Length=351

 Score =   236 bits (603),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 119/159 (75%), Positives = 139/159 (87%), Gaps = 0/159 (0%)
 Frame = -2

Query  665  FSAPLFVIPENMKPSKVHLFMYGLLFGFADTWAMMPDNKMVGKAIRDVEKLKIIASNPRR  486
            FSAPLFVIP++MKPS+V LF+YGLLFG ADTW  MPDNKMVGKAI+D E+L+IIASNPRR
Sbjct  165  FSAPLFVIPDDMKPSRVRLFLYGLLFGLADTWQAMPDNKMVGKAIKDRERLRIIASNPRR  224

Query  485  YTGKPRVGTMREIARQCEYVQNNFEKVSVGFLTVHGTADGVTCPSGSQMLYDKASSSDKT  306
            YTG+PRVGTMRE+AR C+Y Q NF+KV+  FLTVHGT DGVT P+GSQMLYDKA S DKT
Sbjct  225  YTGRPRVGTMRELARICDYFQANFDKVTAPFLTVHGTDDGVTSPAGSQMLYDKAPSEDKT  284

Query  305  LKLYQGLYHSLIQGEPDEDANRVLADMREWIDERVSCNG  189
            L LY+G+YHSLIQGEP+E++ RVLADMR WID+R+   G
Sbjct  285  LILYEGMYHSLIQGEPEENSQRVLADMRAWIDDRIRRYG  323



>ref|XP_010909636.1| PREDICTED: caffeoylshikimate esterase-like [Elaeis guineensis]
Length=342

 Score =   235 bits (599),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 120/155 (77%), Positives = 136/155 (88%), Gaps = 0/155 (0%)
 Frame = -2

Query  665  FSAPLFVIPENMKPSKVHLFMYGLLFGFADTWAMMPDNKMVGKAIRDVEKLKIIASNPRR  486
            FSAPLFVIP++MKPS+V LF+YGLLFG ADTW  MPDNKMVGKAI+D E+L+IIASNPRR
Sbjct  165  FSAPLFVIPDDMKPSRVRLFLYGLLFGLADTWQAMPDNKMVGKAIKDPERLRIIASNPRR  224

Query  485  YTGKPRVGTMREIARQCEYVQNNFEKVSVGFLTVHGTADGVTCPSGSQMLYDKASSSDKT  306
            YTG+PRVGTMRE+AR C+Y Q NF+KV+  FLTVHGT DGVT P+GSQMLYDKASS DK 
Sbjct  225  YTGRPRVGTMRELARICDYFQANFDKVTAPFLTVHGTDDGVTSPTGSQMLYDKASSEDKA  284

Query  305  LKLYQGLYHSLIQGEPDEDANRVLADMREWIDERV  201
            L LY G+YHSLIQGEP+E+A RVLADM  WIDERV
Sbjct  285  LILYDGMYHSLIQGEPEENAQRVLADMCAWIDERV  319



>ref|XP_008792151.1| PREDICTED: caffeoylshikimate esterase [Phoenix dactylifera]
Length=341

 Score =   234 bits (596),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 117/155 (75%), Positives = 138/155 (89%), Gaps = 0/155 (0%)
 Frame = -2

Query  665  FSAPLFVIPENMKPSKVHLFMYGLLFGFADTWAMMPDNKMVGKAIRDVEKLKIIASNPRR  486
            FSAPLFVIP++MKPS+V LF+YGLLFG A+TW  MPDNKMVGKAI+D E+L+IIASNPRR
Sbjct  165  FSAPLFVIPDDMKPSRVRLFLYGLLFGLAETWQAMPDNKMVGKAIKDPERLRIIASNPRR  224

Query  485  YTGKPRVGTMREIARQCEYVQNNFEKVSVGFLTVHGTADGVTCPSGSQMLYDKASSSDKT  306
            YTG+PRVGTMRE+AR C+Y Q NF+KV+  FLTVHGT DGVT P+GS++LYDKASS DKT
Sbjct  225  YTGRPRVGTMRELARICDYFQANFDKVTAPFLTVHGTDDGVTSPAGSRLLYDKASSEDKT  284

Query  305  LKLYQGLYHSLIQGEPDEDANRVLADMREWIDERV  201
            L LY+G+YHSLIQGEP+E++ RVLADMR WI ERV
Sbjct  285  LILYEGMYHSLIQGEPEENSQRVLADMRAWIHERV  319



>ref|XP_009407648.1| PREDICTED: caffeoylshikimate esterase [Musa acuminata subsp. 
malaccensis]
Length=333

 Score =   225 bits (573),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 110/155 (71%), Positives = 135/155 (87%), Gaps = 0/155 (0%)
 Frame = -2

Query  665  FSAPLFVIPENMKPSKVHLFMYGLLFGFADTWAMMPDNKMVGKAIRDVEKLKIIASNPRR  486
            FSAPLFVIP++MKPS++HLF+YGLLFG ADTWA MPDNKMVGKAI+D ++L++IASNPRR
Sbjct  170  FSAPLFVIPDDMKPSRLHLFLYGLLFGLADTWAAMPDNKMVGKAIKDPDRLRVIASNPRR  229

Query  485  YTGKPRVGTMREIARQCEYVQNNFEKVSVGFLTVHGTADGVTCPSGSQMLYDKASSSDKT  306
            YTG+PRVGTMRE+AR C+Y +  F  V+  FLTVHGT DGVT P GS+  Y+ ASS+DK 
Sbjct  230  YTGRPRVGTMRELARLCDYFKTQFRGVTAPFLTVHGTEDGVTSPEGSKTFYEMASSADKK  289

Query  305  LKLYQGLYHSLIQGEPDEDANRVLADMREWIDERV  201
            L +Y+G+YHSLIQGEP+E+++RVLADMR WIDERV
Sbjct  290  LIMYEGMYHSLIQGEPEENSSRVLADMRAWIDERV  324



>ref|XP_009402151.1| PREDICTED: caffeoylshikimate esterase-like [Musa acuminata subsp. 
malaccensis]
Length=344

 Score =   225 bits (573),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 111/159 (70%), Positives = 137/159 (86%), Gaps = 0/159 (0%)
 Frame = -2

Query  665  FSAPLFVIPENMKPSKVHLFMYGLLFGFADTWAMMPDNKMVGKAIRDVEKLKIIASNPRR  486
            FSAPLFVIP++MKPS++ LF+YGLLFG ADTWA MPDNKMVGKAI+D ++L++IASNPRR
Sbjct  168  FSAPLFVIPDDMKPSRLRLFLYGLLFGLADTWAAMPDNKMVGKAIKDPDRLRVIASNPRR  227

Query  485  YTGKPRVGTMREIARQCEYVQNNFEKVSVGFLTVHGTADGVTCPSGSQMLYDKASSSDKT  306
            YTG+PRVGTMRE+AR C++ Q  F +V+  FLTVHGT DGVT P GS+  Y +A+S+DKT
Sbjct  228  YTGQPRVGTMRELARLCDFFQTKFGEVTAPFLTVHGTDDGVTSPEGSKTFYQRAASADKT  287

Query  305  LKLYQGLYHSLIQGEPDEDANRVLADMREWIDERVSCNG  189
            L LY+G+YHSLIQGEP+E+++RVLADMR WIDERV   G
Sbjct  288  LILYEGMYHSLIQGEPEENSSRVLADMRAWIDERVERYG  326



>emb|CDY62163.1| BnaA05g35650D [Brassica napus]
Length=218

 Score =   204 bits (518),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 100/145 (69%), Positives = 114/145 (79%), Gaps = 8/145 (6%)
 Frame = -2

Query  635  NMKPSKVHLFMYGLLFGFADTWAMMPDNKMVGKAIRDVEKLKIIASNPRRYTGKPRVGTM  456
            +MKPSK HL         ADTW  M DNKMVGKAI   EKLKIIASNP+RYTGKPRV TM
Sbjct  79   DMKPSKPHLL--------ADTWTAMLDNKMVGKAIHHPEKLKIIASNPQRYTGKPRVRTM  130

Query  455  REIARQCEYVQNNFEKVSVGFLTVHGTADGVTCPSGSQMLYDKASSSDKTLKLYQGLYHS  276
            REI R+ +YVQ+NF +V +  +TVHGT DGVTCPS S +LY+KAS +DKTLKLY G+YHS
Sbjct  131  REILRKTQYVQDNFGRVIIPLMTVHGTYDGVTCPSSSTLLYEKASRTDKTLKLYDGMYHS  190

Query  275  LIQGEPDEDANRVLADMREWIDERV  201
            LIQGEP+E+A  VL DMREWIDERV
Sbjct  191  LIQGEPEENAATVLKDMREWIDERV  215



>gb|EAY84954.1| hypothetical protein OsI_06318 [Oryza sativa Indica Group]
Length=343

 Score =   198 bits (504),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 101/155 (65%), Positives = 125/155 (81%), Gaps = 0/155 (0%)
 Frame = -2

Query  665  FSAPLFVIPENMKPSKVHLFMYGLLFGFADTWAMMPDNKMVGKAIRDVEKLKIIASNPRR  486
             SAPL V P++M PS+V LF+YGLLFG ADTWA+MPD +MVG++IRD  KL++IASNPR 
Sbjct  168  LSAPLLVFPDDMYPSRVRLFLYGLLFGLADTWAVMPDKRMVGRSIRDPAKLRVIASNPRL  227

Query  485  YTGKPRVGTMREIARQCEYVQNNFEKVSVGFLTVHGTADGVTCPSGSQMLYDKASSSDKT  306
            Y G PRVGTMRE+AR    ++ +F +V+  FL VHGT DGVT P GS+MLY++A+S DK+
Sbjct  228  YRGSPRVGTMRELARVTALLRESFGEVAAPFLVVHGTDDGVTSPEGSRMLYERAASEDKS  287

Query  305  LKLYQGLYHSLIQGEPDEDANRVLADMREWIDERV  201
            L LY G+YHSLIQGE DE+ +RVLADMR WIDERV
Sbjct  288  LILYDGMYHSLIQGESDENRDRVLADMRAWIDERV  322



>ref|NP_001046255.2| Os02g0207900 [Oryza sativa Japonica Group]
 dbj|BAF08169.2| Os02g0207900, partial [Oryza sativa Japonica Group]
Length=369

 Score =   198 bits (503),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 101/155 (65%), Positives = 125/155 (81%), Gaps = 0/155 (0%)
 Frame = -2

Query  665  FSAPLFVIPENMKPSKVHLFMYGLLFGFADTWAMMPDNKMVGKAIRDVEKLKIIASNPRR  486
             SAPL V P++M PS+V LF+YGLLFG ADTWA+MPD +MVG++IRD  KL++IASNPR 
Sbjct  194  LSAPLLVFPDDMYPSRVRLFLYGLLFGLADTWAVMPDKRMVGRSIRDPAKLRVIASNPRL  253

Query  485  YTGKPRVGTMREIARQCEYVQNNFEKVSVGFLTVHGTADGVTCPSGSQMLYDKASSSDKT  306
            Y G PRVGTMRE+AR    ++ +F +V+  FL VHGT DGVT P GS+MLY++A+S DK+
Sbjct  254  YRGSPRVGTMRELARVTALLRESFGEVAAPFLVVHGTDDGVTSPEGSRMLYERAASEDKS  313

Query  305  LKLYQGLYHSLIQGEPDEDANRVLADMREWIDERV  201
            L LY G+YHSLIQGE DE+ +RVLADMR WIDERV
Sbjct  314  LILYDGMYHSLIQGESDENRDRVLADMRAWIDERV  348



>ref|XP_002981014.1| hypothetical protein SELMODRAFT_113971 [Selaginella moellendorffii]
 gb|EFJ17715.1| hypothetical protein SELMODRAFT_113971 [Selaginella moellendorffii]
Length=317

 Score =   176 bits (446),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 90/154 (58%), Positives = 119/154 (77%), Gaps = 0/154 (0%)
 Frame = -2

Query  662  SAPLFVIPENMKPSKVHLFMYGLLFGFADTWAMMPDNKMVGKAIRDVEKLKIIASNPRRY  483
            +APL VIPE M+PSK+HLF YGLL G A++WA+MP+N +V KAI+D  + K+IASNPRRY
Sbjct  164  TAPLIVIPELMQPSKLHLFGYGLLLGLAESWAVMPENNIVRKAIKDPARGKLIASNPRRY  223

Query  482  TGKPRVGTMREIARQCEYVQNNFEKVSVGFLTVHGTADGVTCPSGSQMLYDKASSSDKTL  303
             GKPRVGTMR +AR CEY+Q N EK+ +  LT+HGT+D V    GS++LYDKA S DKT+
Sbjct  224  KGKPRVGTMRNLARMCEYLQKNVEKIEMPLLTLHGTSDVVAETEGSRILYDKAKSQDKTI  283

Query  302  KLYQGLYHSLIQGEPDEDANRVLADMREWIDERV  201
            K+Y+  YHSL+QGEP+E    V  D+++W+D+  
Sbjct  284  KIYEDYYHSLLQGEPEEARAVVYGDIKQWLDDHC  317



>gb|EAZ22175.1| hypothetical protein OsJ_05837 [Oryza sativa Japonica Group]
Length=290

 Score =   174 bits (442),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 80/127 (63%), Positives = 101/127 (80%), Gaps = 0/127 (0%)
 Frame = -2

Query  581  ADTWAMMPDNKMVGKAIRDVEKLKIIASNPRRYTGKPRVGTMREIARQCEYVQNNFEKVS  402
            ADTWA+MPD +MVG++IRD  KL++IASNPR Y G PRVGTMRE+AR    ++ +F +V+
Sbjct  162  ADTWAVMPDKRMVGRSIRDPAKLRVIASNPRLYRGSPRVGTMRELARVTALLRESFGEVA  221

Query  401  VGFLTVHGTADGVTCPSGSQMLYDKASSSDKTLKLYQGLYHSLIQGEPDEDANRVLADMR  222
              FL VHGT DGVT P GS+MLY++ +S DK+L LY G+Y S+IQGE DE+ +RVLADMR
Sbjct  222  APFLVVHGTDDGVTSPEGSRMLYERPASEDKSLILYDGMYQSVIQGESDENRDRVLADMR  281

Query  221  EWIDERV  201
             WIDERV
Sbjct  282  AWIDERV  288



>ref|XP_002982491.1| hypothetical protein SELMODRAFT_155184 [Selaginella moellendorffii]
 gb|EFJ16244.1| hypothetical protein SELMODRAFT_155184 [Selaginella moellendorffii]
Length=317

 Score =   174 bits (441),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 89/154 (58%), Positives = 118/154 (77%), Gaps = 0/154 (0%)
 Frame = -2

Query  662  SAPLFVIPENMKPSKVHLFMYGLLFGFADTWAMMPDNKMVGKAIRDVEKLKIIASNPRRY  483
            +APL VIPE M+PSK+HLF YGLL G A++WA+MP+N +V KAI+D  + K+IASNPRRY
Sbjct  164  TAPLIVIPELMQPSKLHLFGYGLLLGLAESWAVMPENNIVRKAIKDPARGKLIASNPRRY  223

Query  482  TGKPRVGTMREIARQCEYVQNNFEKVSVGFLTVHGTADGVTCPSGSQMLYDKASSSDKTL  303
             GKPRVGTMR +AR CEY+Q N EK+ +  L +HGT+D V    GS++LYDKA S DKT+
Sbjct  224  KGKPRVGTMRNLARMCEYLQKNVEKIEMPLLALHGTSDVVAETEGSRILYDKAKSQDKTI  283

Query  302  KLYQGLYHSLIQGEPDEDANRVLADMREWIDERV  201
            K+Y+  YHSL+QGEP+E    V  D+++W+D+  
Sbjct  284  KIYEDYYHSLLQGEPEEARAVVYGDIKQWLDDHC  317



>ref|XP_002536932.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF25451.1| conserved hypothetical protein [Ricinus communis]
Length=94

 Score =   139 bits (351),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 61/84 (73%), Positives = 74/84 (88%), Gaps = 0/84 (0%)
 Frame = -2

Query  437  CEYVQNNFEKVSVGFLTVHGTADGVTCPSGSQMLYDKASSSDKTLKLYQGLYHSLIQGEP  258
            C+Y+Q+NF KV+  FLTVHGTADGVTCP+ SQ+LY+KASS DK+LK+Y+G+YHSLIQGEP
Sbjct  2    CQYIQDNFSKVTAPFLTVHGTADGVTCPTSSQLLYEKASSEDKSLKMYEGMYHSLIQGEP  61

Query  257  DEDANRVLADMREWIDERVSCNGT  186
            DE+AN VL DMREWIDERV   G+
Sbjct  62   DENANLVLKDMREWIDERVERYGS  85



>gb|ACF74269.1| putative lipase [Arachis hypogaea]
Length=235

 Score =   139 bits (350),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 64/73 (88%), Positives = 69/73 (95%), Gaps = 0/73 (0%)
 Frame = -2

Query  665  FSAPLFVIPENMKPSKVHLFMYGLLFGFADTWAMMPDNKMVGKAIRDVEKLKIIASNPRR  486
            FSAPLFVIPE+MKPS++HLF YGLLFG+ADTWA MPDNKMVGKAIRD EKLKIIASNPRR
Sbjct  163  FSAPLFVIPEDMKPSRLHLFAYGLLFGWADTWAAMPDNKMVGKAIRDPEKLKIIASNPRR  222

Query  485  YTGKPRVGTMREI  447
            YTG PRVGTMRE+
Sbjct  223  YTGPPRVGTMREL  235



>ref|XP_001760039.1| predicted protein [Physcomitrella patens]
 gb|EDQ75164.1| predicted protein [Physcomitrella patens]
Length=333

 Score =   132 bits (332),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 64/155 (41%), Positives = 95/155 (61%), Gaps = 0/155 (0%)
 Frame = -2

Query  659  APLFVIPENMKPSKVHLFMYGLLFGFADTWAMMPDNKMVGKAIRDVEKLKIIASNPRRYT  480
            AP+  I E M P     +    +  +A T  ++P   +V K+++D  K  +  +NP RY 
Sbjct  169  APMCKISEKMVPPWPVEYALRFIARWAPTLPVVPTTDLVDKSVKDPAKRILAKNNPHRYA  228

Query  479  GKPRVGTMREIARQCEYVQNNFEKVSVGFLTVHGTADGVTCPSGSQMLYDKASSSDKTLK  300
            GKPR+GT+ E+ R    ++   + VS+ F+ +HG AD VT P+ S  LY+ A S DKTL+
Sbjct  229  GKPRLGTVIELLRVTASLEEKLKDVSLPFIVLHGNADVVTEPAVSTFLYETAKSEDKTLR  288

Query  299  LYQGLYHSLIQGEPDEDANRVLADMREWIDERVSC  195
            +Y+G+ HSLIQGEPDE+   +L D+  W+DERV C
Sbjct  289  IYEGMLHSLIQGEPDENVAIILNDISSWLDERVQC  323



>gb|EAZ40325.1| hypothetical protein OsJ_24771 [Oryza sativa Japonica Group]
Length=190

 Score =   125 bits (313),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 62/154 (40%), Positives = 97/154 (63%), Gaps = 0/154 (0%)
 Frame = -2

Query  659  APLFVIPENMKPSKVHLFMYGLLFGFADTWAMMPDNKMVGKAIRDVEKLKIIASNPRRYT  480
            AP+  I + ++P      +   +  FA T A++P   ++ K+++   K  I A NP RY+
Sbjct  25   APMCKISDRIRPPWPLPQILTFVARFAPTLAIVPTADLIEKSVKVPAKRLIAARNPMRYS  84

Query  479  GKPRVGTMREIARQCEYVQNNFEKVSVGFLTVHGTADGVTCPSGSQMLYDKASSSDKTLK  300
            G+PR+GT+ E+ R  + +     +V+V FL VHG+AD VT P  S+ LYD A+S DKT+K
Sbjct  85   GRPRLGTVVELLRATDELGARLGEVTVPFLVVHGSADEVTDPDISRALYDAAASKDKTIK  144

Query  299  LYQGLYHSLIQGEPDEDANRVLADMREWIDERVS  198
            +Y G+ HS++ GEPDE+  RV AD+  W++ER +
Sbjct  145  IYDGMMHSMLFGEPDENIERVRADILAWLNERCT  178



>gb|ABR18313.1| unknown [Picea sitchensis]
Length=325

 Score =   127 bits (318),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 64/153 (42%), Positives = 95/153 (62%), Gaps = 0/153 (0%)
 Frame = -2

Query  659  APLFVIPENMKPSKVHLFMYGLLFGFADTWAMMPDNKMVGKAIRDVEKLKIIASNPRRYT  480
            AP+  I + +KP          L  F  T A++P   ++ K+++   K  +  SNPRRYT
Sbjct  161  APMCRISDKVKPPWPVAKFLTFLATFVPTLAIVPTEDLIDKSVKVPSKRIVARSNPRRYT  220

Query  479  GKPRVGTMREIARQCEYVQNNFEKVSVGFLTVHGTADGVTCPSGSQMLYDKASSSDKTLK  300
            GKPR+GT+ E+ R  +YV    + V + F+ +HG AD VT PS S+ LY+ A S DKTLK
Sbjct  221  GKPRLGTVLELLRVTDYVGQRLQDVDLPFIVLHGDADVVTDPSVSRNLYEVAKSKDKTLK  280

Query  299  LYQGLYHSLIQGEPDEDANRVLADMREWIDERV  201
            +Y+G+ HSL+ GEPDE+   VL D+ +W+ +R+
Sbjct  281  IYEGMLHSLLFGEPDENIAIVLGDICDWLTQRI  313



>ref|XP_009381093.1| PREDICTED: caffeoylshikimate esterase-like isoform X3 [Musa acuminata 
subsp. malaccensis]
Length=314

 Score =   126 bits (316),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 64/157 (41%), Positives = 97/157 (62%), Gaps = 1/157 (1%)
 Frame = -2

Query  659  APLFVIPENMKPSKVHLFMYGLLFGFADTWAMMPDNKMVGKAIRDVEKLKIIASNPRRYT  480
            AP+  I E MKP+ + +F+  LL     TW ++P   ++ KA+++ E    I +NP  Y 
Sbjct  139  APMCKISEEMKPNPLVIFILKLLGKLFPTWKIVPSKDIIDKAVKNPEWRMEIRNNPYCYK  198

Query  479  GKPRVGTMREIARQCEYVQNNFEKVSVGFLTVHGTADGVTCPSGSQMLYDKASSSDKTLK  300
            GKPR+ T  E+ +    +Q + E+VS+ FL VHG  D VT PS SQ LY+ A S D++ K
Sbjct  199  GKPRLKTGIELLKASLDIQTSLEEVSLPFLIVHGGDDSVTDPSVSQSLYESAYSDDRSFK  258

Query  299  LYQGLYHSLIQGEPDEDANRVLADMREWIDER-VSCN  192
            LY G++H+L  GEP E+ + V +D+  W+DER + C+
Sbjct  259  LYPGMWHALTSGEPQENIDLVFSDIIAWLDERTIPCS  295



>ref|XP_009381091.1| PREDICTED: caffeoylshikimate esterase-like isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=371

 Score =   126 bits (317),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 64/157 (41%), Positives = 97/157 (62%), Gaps = 1/157 (1%)
 Frame = -2

Query  659  APLFVIPENMKPSKVHLFMYGLLFGFADTWAMMPDNKMVGKAIRDVEKLKIIASNPRRYT  480
            AP+  I E MKP+ + +F+  LL     TW ++P   ++ KA+++ E    I +NP  Y 
Sbjct  196  APMCKISEEMKPNPLVIFILKLLGKLFPTWKIVPSKDIIDKAVKNPEWRMEIRNNPYCYK  255

Query  479  GKPRVGTMREIARQCEYVQNNFEKVSVGFLTVHGTADGVTCPSGSQMLYDKASSSDKTLK  300
            GKPR+ T  E+ +    +Q + E+VS+ FL VHG  D VT PS SQ LY+ A S D++ K
Sbjct  256  GKPRLKTGIELLKASLDIQTSLEEVSLPFLIVHGGDDSVTDPSVSQSLYESAYSDDRSFK  315

Query  299  LYQGLYHSLIQGEPDEDANRVLADMREWIDER-VSCN  192
            LY G++H+L  GEP E+ + V +D+  W+DER + C+
Sbjct  316  LYPGMWHALTSGEPQENIDLVFSDIIAWLDERTIPCS  352



>ref|XP_009381092.1| PREDICTED: caffeoylshikimate esterase-like isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=367

 Score =   126 bits (316),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 64/157 (41%), Positives = 97/157 (62%), Gaps = 1/157 (1%)
 Frame = -2

Query  659  APLFVIPENMKPSKVHLFMYGLLFGFADTWAMMPDNKMVGKAIRDVEKLKIIASNPRRYT  480
            AP+  I E MKP+ + +F+  LL     TW ++P   ++ KA+++ E    I +NP  Y 
Sbjct  192  APMCKISEEMKPNPLVIFILKLLGKLFPTWKIVPSKDIIDKAVKNPEWRMEIRNNPYCYK  251

Query  479  GKPRVGTMREIARQCEYVQNNFEKVSVGFLTVHGTADGVTCPSGSQMLYDKASSSDKTLK  300
            GKPR+ T  E+ +    +Q + E+VS+ FL VHG  D VT PS SQ LY+ A S D++ K
Sbjct  252  GKPRLKTGIELLKASLDIQTSLEEVSLPFLIVHGGDDSVTDPSVSQSLYESAYSDDRSFK  311

Query  299  LYQGLYHSLIQGEPDEDANRVLADMREWIDER-VSCN  192
            LY G++H+L  GEP E+ + V +D+  W+DER + C+
Sbjct  312  LYPGMWHALTSGEPQENIDLVFSDIIAWLDERTIPCS  348



>ref|XP_010533890.1| PREDICTED: caffeoylshikimate esterase [Tarenaya hassleriana]
Length=323

 Score =   125 bits (313),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 65/160 (41%), Positives = 100/160 (63%), Gaps = 1/160 (1%)
 Frame = -2

Query  659  APLFVIPENMKPSKVHLFMYGLLFGFADTWAMMPDNKMVGKAIRDVEKLKIIASNPRRYT  480
            AP+  I + ++P      +  L+  F  TWA++P   ++ K+I+  EK  I A NP RY 
Sbjct  165  APMCKISDKVRPRWPIDQILILMSRFLPTWAIVPTEDLLEKSIKVEEKKPIAAKNPMRYR  224

Query  479  GKPRVGTMREIARQCEYVQNNFEKVSVGFLTVHGTADGVTCPSGSQMLYDKASSSDKTLK  300
            GKPR+GT+ E+ R  +Y+    + VS+ F+ +HG+AD VT P  S+ LY++A S DKTLK
Sbjct  225  GKPRLGTVMELLRVTDYLGEKLKDVSIPFIVLHGSADVVTDPEVSRALYEEAKSKDKTLK  284

Query  299  LYQGLYHSLIQGEPDEDANRVLADMREWIDERVSCNGTAV  180
            +Y+G+ HS++ GEPDE+   V  D+  W+++R   NG  V
Sbjct  285  IYEGMLHSMLFGEPDENIAIVRNDIVGWLNDRCG-NGAQV  323



>ref|XP_010908887.1| PREDICTED: caffeoylshikimate esterase-like isoform X3 [Elaeis 
guineensis]
Length=256

 Score =   123 bits (308),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 60/154 (39%), Positives = 92/154 (60%), Gaps = 0/154 (0%)
 Frame = -2

Query  659  APLFVIPENMKPSKVHLFMYGLLFGFADTWAMMPDNKMVGKAIRDVEKLKIIASNPRRYT  480
            AP+  I + MKP  + + +   L     TW ++P   ++  A+++ EK + I SNP  Y 
Sbjct  97   APMCKIADKMKPHPIVVSILRKLCNIVPTWKIVPTQDIINAAVKNPEKREEIRSNPYCYK  156

Query  479  GKPRVGTMREIARQCEYVQNNFEKVSVGFLTVHGTADGVTCPSGSQMLYDKASSSDKTLK  300
            GKPR+ T  E+      ++ N  +VS+ FL +HG  D VT PS S++LY+ +SS DKT K
Sbjct  157  GKPRLQTAHELLMVSLDIEKNLNQVSLPFLVMHGGDDAVTDPSVSKLLYESSSSKDKTFK  216

Query  299  LYQGLYHSLIQGEPDEDANRVLADMREWIDERVS  198
            LY G++H+L  GEP E+   V +D+  W+DER +
Sbjct  217  LYPGMWHALTSGEPLENIELVFSDIVAWLDERAT  250



>ref|XP_010908886.1| PREDICTED: caffeoylshikimate esterase-like isoform X2 [Elaeis 
guineensis]
Length=291

 Score =   123 bits (309),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 60/154 (39%), Positives = 92/154 (60%), Gaps = 0/154 (0%)
 Frame = -2

Query  659  APLFVIPENMKPSKVHLFMYGLLFGFADTWAMMPDNKMVGKAIRDVEKLKIIASNPRRYT  480
            AP+  I + MKP  + + +   L     TW ++P   ++  A+++ EK + I SNP  Y 
Sbjct  132  APMCKIADKMKPHPIVVSILRKLCNIVPTWKIVPTQDIINAAVKNPEKREEIRSNPYCYK  191

Query  479  GKPRVGTMREIARQCEYVQNNFEKVSVGFLTVHGTADGVTCPSGSQMLYDKASSSDKTLK  300
            GKPR+ T  E+      ++ N  +VS+ FL +HG  D VT PS S++LY+ +SS DKT K
Sbjct  192  GKPRLQTAHELLMVSLDIEKNLNQVSLPFLVMHGGDDAVTDPSVSKLLYESSSSKDKTFK  251

Query  299  LYQGLYHSLIQGEPDEDANRVLADMREWIDERVS  198
            LY G++H+L  GEP E+   V +D+  W+DER +
Sbjct  252  LYPGMWHALTSGEPLENIELVFSDIVAWLDERAT  285



>ref|XP_010908885.1| PREDICTED: caffeoylshikimate esterase-like isoform X1 [Elaeis 
guineensis]
Length=302

 Score =   123 bits (308),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 60/154 (39%), Positives = 92/154 (60%), Gaps = 0/154 (0%)
 Frame = -2

Query  659  APLFVIPENMKPSKVHLFMYGLLFGFADTWAMMPDNKMVGKAIRDVEKLKIIASNPRRYT  480
            AP+  I + MKP  + + +   L     TW ++P   ++  A+++ EK + I SNP  Y 
Sbjct  143  APMCKIADKMKPHPIVVSILRKLCNIVPTWKIVPTQDIINAAVKNPEKREEIRSNPYCYK  202

Query  479  GKPRVGTMREIARQCEYVQNNFEKVSVGFLTVHGTADGVTCPSGSQMLYDKASSSDKTLK  300
            GKPR+ T  E+      ++ N  +VS+ FL +HG  D VT PS S++LY+ +SS DKT K
Sbjct  203  GKPRLQTAHELLMVSLDIEKNLNQVSLPFLVMHGGDDAVTDPSVSKLLYESSSSKDKTFK  262

Query  299  LYQGLYHSLIQGEPDEDANRVLADMREWIDERVS  198
            LY G++H+L  GEP E+   V +D+  W+DER +
Sbjct  263  LYPGMWHALTSGEPLENIELVFSDIVAWLDERAT  296



>ref|NP_001060014.1| Os07g0565700 [Oryza sativa Japonica Group]
 dbj|BAC22550.1| putative lysophospholipase homolog [Oryza sativa Japonica Group]
 dbj|BAF21928.1| Os07g0565700 [Oryza sativa Japonica Group]
 gb|EAZ04364.1| hypothetical protein OsI_26504 [Oryza sativa Indica Group]
 dbj|BAG99553.1| unnamed protein product [Oryza sativa Japonica Group]
Length=334

 Score =   124 bits (310),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 62/154 (40%), Positives = 97/154 (63%), Gaps = 0/154 (0%)
 Frame = -2

Query  659  APLFVIPENMKPSKVHLFMYGLLFGFADTWAMMPDNKMVGKAIRDVEKLKIIASNPRRYT  480
            AP+  I + ++P      +   +  FA T A++P   ++ K+++   K  I A NP RY+
Sbjct  169  APMCKISDRIRPPWPLPQILTFVARFAPTLAIVPTADLIEKSVKVPAKRLIAARNPMRYS  228

Query  479  GKPRVGTMREIARQCEYVQNNFEKVSVGFLTVHGTADGVTCPSGSQMLYDKASSSDKTLK  300
            G+PR+GT+ E+ R  + +     +V+V FL VHG+AD VT P  S+ LYD A+S DKT+K
Sbjct  229  GRPRLGTVVELLRATDELGARLGEVTVPFLVVHGSADEVTDPDISRALYDAAASKDKTIK  288

Query  299  LYQGLYHSLIQGEPDEDANRVLADMREWIDERVS  198
            +Y G+ HS++ GEPDE+  RV AD+  W++ER +
Sbjct  289  IYDGMMHSMLFGEPDENIERVRADILAWLNERCT  322



>ref|XP_002889847.1| hydrolase, alpha/beta fold family protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH66106.1| hydrolase, alpha/beta fold family protein [Arabidopsis lyrata 
subsp. lyrata]
Length=323

 Score =   123 bits (309),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 63/158 (40%), Positives = 99/158 (63%), Gaps = 4/158 (3%)
 Frame = -2

Query  659  APLFVIPENMKPS-KVHLFMYGLLFGFADTWAMMPDNKMVGKAIRDVEKLKIIASNPRRY  483
            AP+  I + ++P   +  F+  ++  F  TWA++P   ++ K+I+  EK  I   NP RY
Sbjct  163  APMCKISDKVRPKWPIDQFLI-MISRFLPTWAIVPTEDLLEKSIKVEEKKPIAKRNPMRY  221

Query  482  TGKPRVGTMREIARQCEYVQNNFEKVSVGFLTVHGTADGVTCPSGSQMLYDKASSSDKTL  303
              KPR+GT+ E+ R  +Y+ N  + VS+ F+ VHG+AD VT P  S+ LY+ A S DKTL
Sbjct  222  NEKPRLGTVMELLRVTDYLGNKLKDVSIPFIVVHGSADAVTDPDVSRELYEHAKSKDKTL  281

Query  302  KLYQGLYHSLIQGEPDEDANRVLADMREWIDERVSCNG  189
            K+Y+G+ HS++ GEPD++   V  D+  W+++R  C G
Sbjct  282  KIYEGMMHSMLFGEPDDNIEIVRKDIVSWLNDR--CGG  317



>ref|XP_004978414.1| PREDICTED: monoglyceride lipase-like isoform X4 [Setaria italica]
Length=229

 Score =   121 bits (303),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 61/154 (40%), Positives = 94/154 (61%), Gaps = 0/154 (0%)
 Frame = -2

Query  659  APLFVIPENMKPSKVHLFMYGLLFGFADTWAMMPDNKMVGKAIRDVEKLKIIASNPRRYT  480
            AP+  I E+MKP  + + +   L     TW ++P+  ++ +AI+  E  + + +N   Y 
Sbjct  74   APMCKIVEDMKPHPIVISILSKLSNVIPTWRIIPNEDIIDRAIKSEEWREEVRNNHYCYK  133

Query  479  GKPRVGTMREIARQCEYVQNNFEKVSVGFLTVHGTADGVTCPSGSQMLYDKASSSDKTLK  300
            GKPR+ T  E+      ++NN +KV++ F+ VHG  D VT PS S+ LY  A S DKTLK
Sbjct  134  GKPRLKTGYELFMASLDIENNLDKVTLPFIIVHGGGDAVTDPSVSEALYTLAESKDKTLK  193

Query  299  LYQGLYHSLIQGEPDEDANRVLADMREWIDERVS  198
            LY G+ H+L  GEP E+ + V +D+ +W++ERVS
Sbjct  194  LYPGMCHALTSGEPKENIDSVFSDIIKWLNERVS  227



>ref|XP_008776304.1| PREDICTED: caffeoylshikimate esterase-like [Phoenix dactylifera]
Length=325

 Score =   123 bits (308),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 63/158 (40%), Positives = 92/158 (58%), Gaps = 0/158 (0%)
 Frame = -2

Query  659  APLFVIPENMKPSKVHLFMYGLLFGFADTWAMMPDNKMVGKAIRDVEKLKIIASNPRRYT  480
            AP+  I + MKP  + + +   L     TW ++P   ++  A +++EK + I SNP  Y 
Sbjct  143  APMCKIADKMKPRPIVVSILKKLCNIIPTWKVVPTQDIIDAAFKNLEKREEIRSNPYCYK  202

Query  479  GKPRVGTMREIARQCEYVQNNFEKVSVGFLTVHGTADGVTCPSGSQMLYDKASSSDKTLK  300
            GKPR+ T  E+      ++ N  +VS+ FL VHG  D VT PS S++LY+ ASS DKT K
Sbjct  203  GKPRLKTAYELLMVSLDIEKNLNQVSLPFLVVHGGDDIVTDPSVSKLLYESASSKDKTFK  262

Query  299  LYQGLYHSLIQGEPDEDANRVLADMREWIDERVSCNGT  186
            LY G++H+L  GEP E+   V +D+  W+DER     T
Sbjct  263  LYPGMWHALTSGEPLENIELVFSDIVAWLDERTPLGDT  300



>ref|XP_010492320.1| PREDICTED: caffeoylshikimate esterase-like [Camelina sativa]
Length=323

 Score =   122 bits (306),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 63/161 (39%), Positives = 101/161 (63%), Gaps = 2/161 (1%)
 Frame = -2

Query  659  APLFVIPENMKPS-KVHLFMYGLLFGFADTWAMMPDNKMVGKAIRDVEKLKIIASNPRRY  483
            AP+  I + ++P   +  F+  ++  F  TWA++P   ++ K+I+  EK  I   NP RY
Sbjct  164  APMCKISDKVRPKWPIDQFLI-MISRFLPTWAIVPTEDLLEKSIKVEEKKPIAKRNPMRY  222

Query  482  TGKPRVGTMREIARQCEYVQNNFEKVSVGFLTVHGTADGVTCPSGSQMLYDKASSSDKTL  303
              KPR+GT+ E+ R  +Y+    + VS+ F+ VHG+AD VT P  S+ LY+ A S DKTL
Sbjct  223  GEKPRLGTVMELLRVTDYLGKKLKDVSIPFIVVHGSADVVTDPEVSRELYEDAKSKDKTL  282

Query  302  KLYQGLYHSLIQGEPDEDANRVLADMREWIDERVSCNGTAV  180
            K+YQG+ HS++ GEPD++ + V  D+  W+++R + + T V
Sbjct  283  KIYQGMMHSMLFGEPDDNIDIVRKDIVTWLNDRCAGDKTHV  323



>ref|XP_010238841.1| PREDICTED: caffeoylshikimate esterase-like [Brachypodium distachyon]
Length=296

 Score =   122 bits (305),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 60/154 (39%), Positives = 94/154 (61%), Gaps = 0/154 (0%)
 Frame = -2

Query  659  APLFVIPENMKPSKVHLFMYGLLFGFADTWAMMPDNKMVGKAIRDVEKLKIIASNPRRYT  480
            AP+  I E+MKP  + + +   L     TW ++P   ++ +AI+  E  + + +NP  Y 
Sbjct  141  APMCKIVEDMKPRPIVITILSKLSNVIPTWKIIPSEDIIDRAIKSEEWREEVRNNPYCYK  200

Query  479  GKPRVGTMREIARQCEYVQNNFEKVSVGFLTVHGTADGVTCPSGSQMLYDKASSSDKTLK  300
            G+PR+ T  EI      +++N +KV++ F+ VHG AD VT PS S+ LY  + S DKTLK
Sbjct  201  GRPRLKTGYEIFMASLDIESNLDKVTLPFIIVHGGADAVTDPSVSEALYTSSESKDKTLK  260

Query  299  LYQGLYHSLIQGEPDEDANRVLADMREWIDERVS  198
            LY G+ H+L  GEP+ + + V +D+ +W+DER S
Sbjct  261  LYPGMCHALTSGEPESNIHIVFSDIIQWLDERTS  294



>gb|KDO67800.1| hypothetical protein CISIN_1g021023mg [Citrus sinensis]
Length=318

 Score =   122 bits (306),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 62/160 (39%), Positives = 96/160 (60%), Gaps = 0/160 (0%)
 Frame = -2

Query  659  APLFVIPENMKPSKVHLFMYGLLFGFADTWAMMPDNKMVGKAIRDVEKLKIIASNPRRYT  480
            AP+  I EN+KP  + + +   L  F  TW ++P   +V  A +  EK K I +NP  Y 
Sbjct  144  APMCKIAENVKPHPLVISVLTKLCKFIPTWKIIPSQDIVDVAFKLPEKRKEIRANPYCYK  203

Query  479  GKPRVGTMREIARQCEYVQNNFEKVSVGFLTVHGTADGVTCPSGSQMLYDKASSSDKTLK  300
            G+PR+ T  E+ R    ++N  ++VS+ F+ +HG  D VT  + S  L+  ASSSDKT+K
Sbjct  204  GRPRLKTGYELMRVSMDLENRLDEVSIPFIVLHGEEDKVTDKAVSVQLFKVASSSDKTMK  263

Query  299  LYQGLYHSLIQGEPDEDANRVLADMREWIDERVSCNGTAV  180
            LY+G++H L+ GEP+E+   V  D+  W+DERV+   + +
Sbjct  264  LYEGMWHGLLYGEPEENTQIVFRDILNWLDERVATGNSRI  303



>ref|XP_006436130.1| hypothetical protein CICLE_v10032149mg [Citrus clementina]
 ref|XP_006486010.1| PREDICTED: caffeoylshikimate esterase-like [Citrus sinensis]
 gb|ESR49370.1| hypothetical protein CICLE_v10032149mg [Citrus clementina]
Length=318

 Score =   122 bits (306),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 62/160 (39%), Positives = 96/160 (60%), Gaps = 0/160 (0%)
 Frame = -2

Query  659  APLFVIPENMKPSKVHLFMYGLLFGFADTWAMMPDNKMVGKAIRDVEKLKIIASNPRRYT  480
            AP+  I EN+KP  + + +   L  F  TW ++P   +V  A +  EK K I +NP  Y 
Sbjct  144  APMCKIAENVKPHPLVISVLTKLCKFIPTWKIIPSQDIVDVAFKLPEKRKEIRANPYCYK  203

Query  479  GKPRVGTMREIARQCEYVQNNFEKVSVGFLTVHGTADGVTCPSGSQMLYDKASSSDKTLK  300
            G+PR+ T  E+ R    ++N  ++VS+ F+ +HG  D VT  + S  L+  ASSSDKT+K
Sbjct  204  GRPRLKTGYELMRVSMDLENRLDEVSIPFIVLHGEEDKVTDKAVSIQLFKVASSSDKTMK  263

Query  299  LYQGLYHSLIQGEPDEDANRVLADMREWIDERVSCNGTAV  180
            LY+G++H L+ GEP+E+   V  D+  W+DERV+   + +
Sbjct  264  LYEGMWHGLLYGEPEENTQIVFRDILNWLDERVATGNSRI  303



>ref|XP_010458490.1| PREDICTED: caffeoylshikimate esterase-like [Camelina sativa]
Length=323

 Score =   122 bits (305),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 63/161 (39%), Positives = 100/161 (62%), Gaps = 2/161 (1%)
 Frame = -2

Query  659  APLFVIPENMKPS-KVHLFMYGLLFGFADTWAMMPDNKMVGKAIRDVEKLKIIASNPRRY  483
            AP+  I + ++P   +  F+  ++  F  TWA++P   ++ K+I+  EK  I   NP RY
Sbjct  164  APMCKISDKVRPKWPIDQFLI-MISRFLPTWAIVPTEDLLEKSIKVEEKKPIAKRNPMRY  222

Query  482  TGKPRVGTMREIARQCEYVQNNFEKVSVGFLTVHGTADGVTCPSGSQMLYDKASSSDKTL  303
              KPR+GT+ E+ R  +Y+    + VS+ F+ VHG+AD VT P  S+ LY+ A S DKTL
Sbjct  223  GEKPRLGTVMELLRVTDYLGKKLKDVSIPFIVVHGSADVVTDPEVSRELYEDAKSKDKTL  282

Query  302  KLYQGLYHSLIQGEPDEDANRVLADMREWIDERVSCNGTAV  180
            K+YQG+ HS++ GEPD++ + V  D+  W+++R   + T V
Sbjct  283  KIYQGMMHSMLFGEPDDNIDIVRKDIVSWLNDRCGGDKTNV  323



>ref|XP_004978413.1| PREDICTED: monoglyceride lipase-like isoform X3 [Setaria italica]
Length=251

 Score =   120 bits (301),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 61/154 (40%), Positives = 94/154 (61%), Gaps = 0/154 (0%)
 Frame = -2

Query  659  APLFVIPENMKPSKVHLFMYGLLFGFADTWAMMPDNKMVGKAIRDVEKLKIIASNPRRYT  480
            AP+  I E+MKP  + + +   L     TW ++P+  ++ +AI+  E  + + +N   Y 
Sbjct  96   APMCKIVEDMKPHPIVISILSKLSNVIPTWRIIPNEDIIDRAIKSEEWREEVRNNHYCYK  155

Query  479  GKPRVGTMREIARQCEYVQNNFEKVSVGFLTVHGTADGVTCPSGSQMLYDKASSSDKTLK  300
            GKPR+ T  E+      ++NN +KV++ F+ VHG  D VT PS S+ LY  A S DKTLK
Sbjct  156  GKPRLKTGYELFMASLDIENNLDKVTLPFIIVHGGGDAVTDPSVSEALYTLAESKDKTLK  215

Query  299  LYQGLYHSLIQGEPDEDANRVLADMREWIDERVS  198
            LY G+ H+L  GEP E+ + V +D+ +W++ERVS
Sbjct  216  LYPGMCHALTSGEPKENIDSVFSDIIKWLNERVS  249



>ref|XP_010475999.1| PREDICTED: caffeoylshikimate esterase-like [Camelina sativa]
Length=323

 Score =   122 bits (305),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 63/161 (39%), Positives = 100/161 (62%), Gaps = 2/161 (1%)
 Frame = -2

Query  659  APLFVIPENMKPS-KVHLFMYGLLFGFADTWAMMPDNKMVGKAIRDVEKLKIIASNPRRY  483
            AP+  I + ++P   +  F+  ++  F  TWA++P   ++ K+I+  EK  I   NP RY
Sbjct  164  APMCKISDKVRPKWPIDQFLI-MISRFLPTWAIVPTEDLLEKSIKVEEKKPIAKRNPMRY  222

Query  482  TGKPRVGTMREIARQCEYVQNNFEKVSVGFLTVHGTADGVTCPSGSQMLYDKASSSDKTL  303
              KPR+GT+ E+ R  +Y+    + VS+ F+ VHG+AD VT P  S+ LY+ A S DKTL
Sbjct  223  GEKPRLGTVMELLRVTDYLGKKLKDVSIPFIVVHGSADVVTDPEVSRELYEDAKSKDKTL  282

Query  302  KLYQGLYHSLIQGEPDEDANRVLADMREWIDERVSCNGTAV  180
            K+YQG+ HS++ GEPD++ + V  D+  W+++R   + T V
Sbjct  283  KIYQGMMHSMLFGEPDDNIDIVRKDIVSWLNDRCGGDKTNV  323



>ref|XP_006303706.1| hypothetical protein CARUB_v10011807mg [Capsella rubella]
 gb|EOA36604.1| hypothetical protein CARUB_v10011807mg [Capsella rubella]
Length=322

 Score =   122 bits (305),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 63/161 (39%), Positives = 99/161 (61%), Gaps = 2/161 (1%)
 Frame = -2

Query  659  APLFVIPENMKPS-KVHLFMYGLLFGFADTWAMMPDNKMVGKAIRDVEKLKIIASNPRRY  483
            AP+  I + ++P   +  F+  ++  F  TWA++P   ++ K+I+  EK  I   NP RY
Sbjct  163  APMCRISDKVRPKWPIDQFLI-MISRFLPTWAIVPTEDLLEKSIKVEEKKPIAKRNPMRY  221

Query  482  TGKPRVGTMREIARQCEYVQNNFEKVSVGFLTVHGTADGVTCPSGSQMLYDKASSSDKTL  303
              KPR+GT+ E+ R  +Y+    + VS+ F+ VHG+AD VT P  S+ LY+ A S DKTL
Sbjct  222  GEKPRLGTVMELLRVTDYLGKKLKDVSIPFIVVHGSADAVTDPEVSRELYEVAKSKDKTL  281

Query  302  KLYQGLYHSLIQGEPDEDANRVLADMREWIDERVSCNGTAV  180
            K+YQG+ HS++ GEPD++   V  D+  W+++R   + T V
Sbjct  282  KIYQGMMHSMLFGEPDDNIEIVRKDIVSWLNDRCGGDKTHV  322



>ref|XP_010229642.1| PREDICTED: LOW QUALITY PROTEIN: caffeoylshikimate esterase [Brachypodium 
distachyon]
Length=505

 Score =   123 bits (309),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 62/159 (39%), Positives = 98/159 (62%), Gaps = 0/159 (0%)
 Frame = -2

Query  659  APLFVIPENMKPSKVHLFMYGLLFGFADTWAMMPDNKMVGKAIRDVEKLKIIASNPRRYT  480
            AP+  I + ++P      +  L+  FA T  ++P   ++ K+++   K  + A NP RY 
Sbjct  347  APMCRISDRIRPPWPLPQILTLVARFAPTLPIVPTADLIEKSVKVPAKRLVSARNPMRYN  406

Query  479  GKPRVGTMREIARQCEYVQNNFEKVSVGFLTVHGTADGVTCPSGSQMLYDKASSSDKTLK  300
            G+PR+GT+ E+ R  + +     +VSV FL VHG+AD VT P+ S+ LY+ A+S DKTLK
Sbjct  407  GRPRLGTVTELLRATDELGARLGEVSVPFLVVHGSADEVTDPAVSRALYEAAASKDKTLK  466

Query  299  LYQGLYHSLIQGEPDEDANRVLADMREWIDERVSCNGTA  183
            +Y G+ HS++ GEPDE+  RV  D+  W++ER +   T+
Sbjct  467  MYDGMLHSMLFGEPDENIERVRGDILAWLNERCTPAATS  505



>ref|XP_010271585.1| PREDICTED: caffeoylshikimate esterase-like [Nelumbo nucifera]
Length=368

 Score =   122 bits (305),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 61/157 (39%), Positives = 93/157 (59%), Gaps = 0/157 (0%)
 Frame = -2

Query  659  APLFVIPENMKPSKVHLFMYGLLFGFADTWAMMPDNKMVGKAIRDVEKLKIIASNPRRYT  480
            +P+  I ENMKP  + L     L     TW M+P   +V   I++V +   + SNP  Y 
Sbjct  194  SPMCKIAENMKPHPLLLSALDKLCHVVPTWKMVPAPNLVKVGIKEVGRRNELKSNPFCYK  253

Query  479  GKPRVGTMREIARQCEYVQNNFEKVSVGFLTVHGTADGVTCPSGSQMLYDKASSSDKTLK  300
            G+PR+ T  ++ R    ++ N  +++  FL VHG  D +T PS S++LY+ ASSSDK LK
Sbjct  254  GRPRLKTGDQLYRVSLEIEQNLHQITFPFLVVHGEKDKITDPSVSKLLYESASSSDKMLK  313

Query  299  LYQGLYHSLIQGEPDEDANRVLADMREWIDERVSCNG  189
            LY G++H++  GEP E+ + V AD+  W+ ER + +G
Sbjct  314  LYPGMWHAITSGEPPENIDMVFADIIAWLTERAAGSG  350



>ref|XP_004977661.1| PREDICTED: monoglyceride lipase-like isoform X4 [Setaria italica]
Length=252

 Score =   120 bits (300),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 61/154 (40%), Positives = 94/154 (61%), Gaps = 0/154 (0%)
 Frame = -2

Query  659  APLFVIPENMKPSKVHLFMYGLLFGFADTWAMMPDNKMVGKAIRDVEKLKIIASNPRRYT  480
            AP+  I E+MKP  + + +   L     TW ++P+  ++ +AI+  E  + + +N   Y 
Sbjct  97   APMCKIVEDMKPHPIVISILSKLSNVIPTWRIIPNEDIIDRAIKSEEWREEVRNNHYCYK  156

Query  479  GKPRVGTMREIARQCEYVQNNFEKVSVGFLTVHGTADGVTCPSGSQMLYDKASSSDKTLK  300
            GKPR+ T  E+      ++NN +KV++ F+ VHG  D VT PS S+ LY  A S DKTLK
Sbjct  157  GKPRLKTGYELFMASLDIENNLDKVTLPFIIVHGGGDAVTDPSVSEALYTLAESKDKTLK  216

Query  299  LYQGLYHSLIQGEPDEDANRVLADMREWIDERVS  198
            LY G+ H+L  GEP E+ + V +D+ +W++ERVS
Sbjct  217  LYPGMCHALTSGEPKENIDIVFSDIIKWLNERVS  250



>ref|XP_004978411.1| PREDICTED: monoglyceride lipase-like isoform X1 [Setaria italica]
 ref|XP_004978412.1| PREDICTED: monoglyceride lipase-like isoform X2 [Setaria italica]
Length=278

 Score =   120 bits (301),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 61/154 (40%), Positives = 94/154 (61%), Gaps = 0/154 (0%)
 Frame = -2

Query  659  APLFVIPENMKPSKVHLFMYGLLFGFADTWAMMPDNKMVGKAIRDVEKLKIIASNPRRYT  480
            AP+  I E+MKP  + + +   L     TW ++P+  ++ +AI+  E  + + +N   Y 
Sbjct  123  APMCKIVEDMKPHPIVISILSKLSNVIPTWRIIPNEDIIDRAIKSEEWREEVRNNHYCYK  182

Query  479  GKPRVGTMREIARQCEYVQNNFEKVSVGFLTVHGTADGVTCPSGSQMLYDKASSSDKTLK  300
            GKPR+ T  E+      ++NN +KV++ F+ VHG  D VT PS S+ LY  A S DKTLK
Sbjct  183  GKPRLKTGYELFMASLDIENNLDKVTLPFIIVHGGGDAVTDPSVSEALYTLAESKDKTLK  242

Query  299  LYQGLYHSLIQGEPDEDANRVLADMREWIDERVS  198
            LY G+ H+L  GEP E+ + V +D+ +W++ERVS
Sbjct  243  LYPGMCHALTSGEPKENIDSVFSDIIKWLNERVS  276



>ref|NP_001130084.1| hypothetical protein [Zea mays]
 ref|XP_008666998.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 ref|XP_008666999.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 gb|ACF78208.1| unknown [Zea mays]
 gb|ACL52908.1| unknown [Zea mays]
 tpg|DAA41128.1| TPA: hypothetical protein ZEAMMB73_741871 [Zea mays]
Length=334

 Score =   121 bits (303),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 60/158 (38%), Positives = 94/158 (59%), Gaps = 0/158 (0%)
 Frame = -2

Query  659  APLFVIPENMKPSKVHLFMYGLLFGFADTWAMMPDNKMVGKAIRDVEKLKIIASNPRRYT  480
            AP+  I + ++P      +   +  FA T A++P   ++ K+++   K  + A NP RY 
Sbjct  170  APMCRISDRIRPPWPLPEILTFVARFAPTAAIVPTADLIEKSVKVPAKRIVAARNPVRYN  229

Query  479  GKPRVGTMREIARQCEYVQNNFEKVSVGFLTVHGTADGVTCPSGSQMLYDKASSSDKTLK  300
            G+PR+GT+ E+ R  + +     +VS+ FL VHG+ D VT P  S+ LY  A+S DKT+K
Sbjct  230  GRPRLGTVVELLRATDELAKRLGEVSIPFLVVHGSTDEVTDPEVSRALYAAAASKDKTIK  289

Query  299  LYQGLYHSLIQGEPDEDANRVLADMREWIDERVSCNGT  186
            +Y G+ HSL+ GEPDE+  RV  D+  W++ER +   T
Sbjct  290  IYDGMLHSLLFGEPDENIERVRGDILAWLNERCTAQAT  327



>ref|XP_007025719.1| Alpha/beta-Hydrolases superfamily protein [Theobroma cacao]
 gb|EOY28341.1| Alpha/beta-Hydrolases superfamily protein [Theobroma cacao]
Length=315

 Score =   120 bits (302),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 69/161 (43%), Positives = 104/161 (65%), Gaps = 12/161 (7%)
 Frame = -2

Query  659  APLFVIPENMKPS----KVHLFMYGLLFGFADTWAMMPDNKMVGKAIRDVEKLKIIAS-N  495
            +P+  IP+ + P     +V  F+  LL     T A++P   ++ K+I+ VE+ KII + N
Sbjct  159  SPMCKIPDQLTPGWPIRQVVAFISKLL----PTLAIVPTEDVLYKSIK-VEEKKIIGNKN  213

Query  494  PRRYTGKPRVGTMREIARQCEYVQNNFEKVSVGFLTVHGTADGVTCPSGSQMLYDKASSS  315
            P RY GKPR+GT  E+ R  EY+      VS+ FL VHG+AD VT P  S+ LY++ASS 
Sbjct  214  PLRYRGKPRLGTALELLRITEYLGQKLCDVSIPFLVVHGSADVVTEPEVSRTLYEEASSQ  273

Query  314  DKTLKLYQGLYHSLIQGEPDEDANRVLADMREWIDERVSCN  192
            DKT+K+Y+G++HSL+ GEPD++   V +D+  W+++R  CN
Sbjct  274  DKTIKIYEGMWHSLLFGEPDDNIEIVRSDILSWLNDR--CN  312



>ref|XP_008648700.1| PREDICTED: caffeoylshikimate esterase-like isoform X3 [Zea mays]
Length=293

 Score =   120 bits (300),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 60/154 (39%), Positives = 97/154 (63%), Gaps = 0/154 (0%)
 Frame = -2

Query  659  APLFVIPENMKPSKVHLFMYGLLFGFADTWAMMPDNKMVGKAIRDVEKLKIIASNPRRYT  480
            AP+  I ++MKP  + + +   L     TW ++P+  ++ +AI+  E+ + + +N   Y 
Sbjct  123  APMCKILDDMKPHPIMMSILSKLSNVIPTWRIIPNEDIIDRAIKCEERREEVRNNHYCYK  182

Query  479  GKPRVGTMREIARQCEYVQNNFEKVSVGFLTVHGTADGVTCPSGSQMLYDKASSSDKTLK  300
            GKPRV T  EI      +++N +KV++ F+ VHG  D VT P+ S+ LY  A+S DKTLK
Sbjct  183  GKPRVKTGHEIFMASLDIESNLDKVTLPFIIVHGGDDAVTDPTVSEALYTIATSKDKTLK  242

Query  299  LYQGLYHSLIQGEPDEDANRVLADMREWIDERVS  198
            LY G+ H+L  GEP+E+ + V AD+ +W+++RVS
Sbjct  243  LYPGMCHALTSGEPEENIDIVFADIIKWLNDRVS  276



>ref|XP_004977659.1| PREDICTED: monoglyceride lipase-like isoform X2 [Setaria italica]
 ref|XP_004977660.1| PREDICTED: monoglyceride lipase-like isoform X3 [Setaria italica]
Length=278

 Score =   119 bits (299),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 61/154 (40%), Positives = 94/154 (61%), Gaps = 0/154 (0%)
 Frame = -2

Query  659  APLFVIPENMKPSKVHLFMYGLLFGFADTWAMMPDNKMVGKAIRDVEKLKIIASNPRRYT  480
            AP+  I E+MKP  + + +   L     TW ++P+  ++ +AI+  E  + + +N   Y 
Sbjct  123  APMCKIVEDMKPHPIVISILSKLSNVIPTWRIIPNEDIIDRAIKSEEWREEVRNNHYCYK  182

Query  479  GKPRVGTMREIARQCEYVQNNFEKVSVGFLTVHGTADGVTCPSGSQMLYDKASSSDKTLK  300
            GKPR+ T  E+      ++NN +KV++ F+ VHG  D VT PS S+ LY  A S DKTLK
Sbjct  183  GKPRLKTGYELFMASLDIENNLDKVTLPFIIVHGGGDAVTDPSVSEALYTLAESKDKTLK  242

Query  299  LYQGLYHSLIQGEPDEDANRVLADMREWIDERVS  198
            LY G+ H+L  GEP E+ + V +D+ +W++ERVS
Sbjct  243  LYPGMCHALTSGEPKENIDIVFSDIIKWLNERVS  276



>ref|NP_172576.1| alpha/beta-hydrolase-like protein [Arabidopsis thaliana]
 gb|AAB65474.1| lysophospholipase isolog; 25331-24357 [Arabidopsis thaliana]
 dbj|BAC42367.1| putative lysophospholipase isolog [Arabidopsis thaliana]
 gb|AAP68220.1| At1g11090 [Arabidopsis thaliana]
 gb|AEE28682.1| alpha/beta-hydrolase-like protein [Arabidopsis thaliana]
Length=324

 Score =   120 bits (302),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 63/158 (40%), Positives = 97/158 (61%), Gaps = 4/158 (3%)
 Frame = -2

Query  659  APLFVIPENMKPS-KVHLFMYGLLFGFADTWAMMPDNKMVGKAIRDVEKLKIIASNPRRY  483
            AP+  I + ++P   V  F+  ++  F  TWA++P   ++ K+I+  EK  I   NP RY
Sbjct  163  APMCKISDKVRPKWPVDQFLI-MISRFLPTWAIVPTEDLLEKSIKVEEKKPIAKRNPMRY  221

Query  482  TGKPRVGTMREIARQCEYVQNNFEKVSVGFLTVHGTADGVTCPSGSQMLYDKASSSDKTL  303
              KPR+GT+ E+ R  +Y+    + VS+ F+ VHG+AD VT P  S+ LY+ A S DKTL
Sbjct  222  NEKPRLGTVMELLRVTDYLGKKLKDVSIPFIIVHGSADAVTDPEVSRELYEHAKSKDKTL  281

Query  302  KLYQGLYHSLIQGEPDEDANRVLADMREWIDERVSCNG  189
            K+Y G+ HS++ GEPD++   V  D+  W+++R  C G
Sbjct  282  KIYDGMMHSMLFGEPDDNIEIVRKDIVSWLNDR--CGG  317



>ref|XP_002463034.1| hypothetical protein SORBIDRAFT_02g036570 [Sorghum bicolor]
 gb|EER99555.1| hypothetical protein SORBIDRAFT_02g036570 [Sorghum bicolor]
Length=338

 Score =   120 bits (302),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 61/158 (39%), Positives = 95/158 (60%), Gaps = 0/158 (0%)
 Frame = -2

Query  659  APLFVIPENMKPSKVHLFMYGLLFGFADTWAMMPDNKMVGKAIRDVEKLKIIASNPRRYT  480
            AP+  I + ++P      +   +  FA T A++P   ++ K+++   K  + A NP RY 
Sbjct  172  APMCRISDRIRPPWPLPEILTFVARFAPTAAIVPTADLIEKSVKVPAKRIVAARNPVRYN  231

Query  479  GKPRVGTMREIARQCEYVQNNFEKVSVGFLTVHGTADGVTCPSGSQMLYDKASSSDKTLK  300
            G+PR+GT+ E+ R  + +     +VS+ FL VHG+AD VT P  S+ LY  A+S DKT+K
Sbjct  232  GRPRLGTVVELLRATDELGKRLGEVSIPFLVVHGSADEVTDPEVSRALYAAAASKDKTIK  291

Query  299  LYQGLYHSLIQGEPDEDANRVLADMREWIDERVSCNGT  186
            +Y G+ HSL+ GEPDE+  RV  D+  W++ER +   T
Sbjct  292  IYDGMLHSLLFGEPDENIERVRGDILAWLNERCTPPAT  329



>ref|XP_007025720.1| Alpha/beta-Hydrolases superfamily protein [Theobroma cacao]
 gb|EOY28342.1| Alpha/beta-Hydrolases superfamily protein [Theobroma cacao]
Length=315

 Score =   120 bits (301),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 66/160 (41%), Positives = 102/160 (64%), Gaps = 10/160 (6%)
 Frame = -2

Query  659  APLFVIPENMKP----SKVHLFMYGLLFGFADTWAMMPDNKMVGKAIRDVEKLKIIASNP  492
            +P+  I + +KP     +V  F+  LL     T A++P   ++ K+++  EK  I   NP
Sbjct  159  SPMCKISDKVKPRWPLPQVLTFIAKLL----PTLAIVPTEDLLYKSVKVEEKKIIGNKNP  214

Query  491  RRYTGKPRVGTMREIARQCEYVQNNFEKVSVGFLTVHGTADGVTCPSGSQMLYDKASSSD  312
             RY GKPR+GT+ E+ R  EY+      VS+ FL VHG+AD VT P+ S+ LY++ASS D
Sbjct  215  LRYRGKPRLGTVVELLRVTEYLSQKLCDVSIPFLVVHGSADVVTDPAVSRTLYEEASSQD  274

Query  311  KTLKLYQGLYHSLIQGEPDEDANRVLADMREWIDERVSCN  192
            KT+K+Y+G++HSL+ GEPD++   V +D+  W+++R  CN
Sbjct  275  KTIKIYEGMWHSLLFGEPDDNIEIVRSDILSWLNDR--CN  312



>ref|XP_008648699.1| PREDICTED: caffeoylshikimate esterase-like isoform X2 [Zea mays]
Length=300

 Score =   120 bits (300),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 60/154 (39%), Positives = 97/154 (63%), Gaps = 0/154 (0%)
 Frame = -2

Query  659  APLFVIPENMKPSKVHLFMYGLLFGFADTWAMMPDNKMVGKAIRDVEKLKIIASNPRRYT  480
            AP+  I ++MKP  + + +   L     TW ++P+  ++ +AI+  E+ + + +N   Y 
Sbjct  130  APMCKILDDMKPHPIMMSILSKLSNVIPTWRIIPNEDIIDRAIKCEERREEVRNNHYCYK  189

Query  479  GKPRVGTMREIARQCEYVQNNFEKVSVGFLTVHGTADGVTCPSGSQMLYDKASSSDKTLK  300
            GKPRV T  EI      +++N +KV++ F+ VHG  D VT P+ S+ LY  A+S DKTLK
Sbjct  190  GKPRVKTGHEIFMASLDIESNLDKVTLPFIIVHGGDDAVTDPTVSEALYTIATSKDKTLK  249

Query  299  LYQGLYHSLIQGEPDEDANRVLADMREWIDERVS  198
            LY G+ H+L  GEP+E+ + V AD+ +W+++RVS
Sbjct  250  LYPGMCHALTSGEPEENIDIVFADIIKWLNDRVS  283



>ref|XP_008648698.1| PREDICTED: caffeoylshikimate esterase-like isoform X1 [Zea mays]
Length=311

 Score =   120 bits (300),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 60/154 (39%), Positives = 97/154 (63%), Gaps = 0/154 (0%)
 Frame = -2

Query  659  APLFVIPENMKPSKVHLFMYGLLFGFADTWAMMPDNKMVGKAIRDVEKLKIIASNPRRYT  480
            AP+  I ++MKP  + + +   L     TW ++P+  ++ +AI+  E+ + + +N   Y 
Sbjct  141  APMCKILDDMKPHPIMMSILSKLSNVIPTWRIIPNEDIIDRAIKCEERREEVRNNHYCYK  200

Query  479  GKPRVGTMREIARQCEYVQNNFEKVSVGFLTVHGTADGVTCPSGSQMLYDKASSSDKTLK  300
            GKPRV T  EI      +++N +KV++ F+ VHG  D VT P+ S+ LY  A+S DKTLK
Sbjct  201  GKPRVKTGHEIFMASLDIESNLDKVTLPFIIVHGGDDAVTDPTVSEALYTIATSKDKTLK  260

Query  299  LYQGLYHSLIQGEPDEDANRVLADMREWIDERVS  198
            LY G+ H+L  GEP+E+ + V AD+ +W+++RVS
Sbjct  261  LYPGMCHALTSGEPEENIDIVFADIIKWLNDRVS  294



>ref|XP_003635228.1| PREDICTED: caffeoylshikimate esterase isoform X2 [Vitis vinifera]
 emb|CBI33173.3| unnamed protein product [Vitis vinifera]
Length=319

 Score =   120 bits (300),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 61/152 (40%), Positives = 92/152 (61%), Gaps = 0/152 (0%)
 Frame = -2

Query  659  APLFVIPENMKPSKVHLFMYGLLFGFADTWAMMPDNKMVGKAIRDVEKLKIIASNPRRYT  480
            AP+  I ++MKP+ V + +  +L     TW M+P   +V  A ++ EK   I SNP  Y 
Sbjct  140  APMCKIADDMKPNPVVITVLTMLCKVIPTWKMIPTEDVVEMAFKEPEKRAEIRSNPYCYK  199

Query  479  GKPRVGTMREIARQCEYVQNNFEKVSVGFLTVHGTADGVTCPSGSQMLYDKASSSDKTLK  300
            G+ R+ T +E+ R    ++ N  K+ + FL VHG  D VT PS S+ L++ A+S+DKT K
Sbjct  200  GRIRLKTGQELLRVSLDLEKNLHKIQMPFLVVHGGDDKVTDPSTSKQLHETAASADKTFK  259

Query  299  LYQGLYHSLIQGEPDEDANRVLADMREWIDER  204
            LY G++H L  GEP E+ + V +D+  W+DER
Sbjct  260  LYPGMWHGLTSGEPPENIDTVFSDIINWLDER  291



>ref|XP_002282295.1| PREDICTED: caffeoylshikimate esterase isoform X1 [Vitis vinifera]
Length=323

 Score =   119 bits (299),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 61/152 (40%), Positives = 92/152 (61%), Gaps = 0/152 (0%)
 Frame = -2

Query  659  APLFVIPENMKPSKVHLFMYGLLFGFADTWAMMPDNKMVGKAIRDVEKLKIIASNPRRYT  480
            AP+  I ++MKP+ V + +  +L     TW M+P   +V  A ++ EK   I SNP  Y 
Sbjct  144  APMCKIADDMKPNPVVITVLTMLCKVIPTWKMIPTEDVVEMAFKEPEKRAEIRSNPYCYK  203

Query  479  GKPRVGTMREIARQCEYVQNNFEKVSVGFLTVHGTADGVTCPSGSQMLYDKASSSDKTLK  300
            G+ R+ T +E+ R    ++ N  K+ + FL VHG  D VT PS S+ L++ A+S+DKT K
Sbjct  204  GRIRLKTGQELLRVSLDLEKNLHKIQMPFLVVHGGDDKVTDPSTSKQLHETAASADKTFK  263

Query  299  LYQGLYHSLIQGEPDEDANRVLADMREWIDER  204
            LY G++H L  GEP E+ + V +D+  W+DER
Sbjct  264  LYPGMWHGLTSGEPPENIDTVFSDIINWLDER  295



>ref|XP_010905633.1| PREDICTED: caffeoylshikimate esterase [Elaeis guineensis]
Length=324

 Score =   119 bits (299),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 62/158 (39%), Positives = 98/158 (62%), Gaps = 2/158 (1%)
 Frame = -2

Query  659  APLFVIPENMKPSKVHLFMYGLLFGFADTWAMMPDNKMVGKAIRDVEKLKIIASNPRRYT  480
            AP+  I ++++P      +   +   A T  ++P   +V K+++   K K+ ASNP RY 
Sbjct  169  APMCKISDSIRPRWPIPQILTFVARLAPTLPIVPTADLVDKSVKVEAKRKVAASNPLRYR  228

Query  479  GKPRVGTMREIARQCEYVQNNFEKVSVGFLTVHGTADGVTCPSGSQMLYDKASSSDKTLK  300
            GKPR+GT+ E+ R  + + ++  +V++ FL +HG+AD VT P+ SQ LYD A S DKT++
Sbjct  229  GKPRLGTVVELLRATDDLGSHLTEVTIPFLVLHGSADVVTDPAVSQALYDAARSEDKTIR  288

Query  299  LYQGLYHSLIQGEPDEDANRVLADMREWIDERVSCNGT  186
            +Y+G+ HSL+ GE DE+   V  D+  W+DER  C G 
Sbjct  289  IYEGMMHSLLFGETDENVALVRNDILTWLDER--CGGA  324



>ref|NP_001046256.1| Os02g0207800 [Oryza sativa Japonica Group]
 dbj|BAF08170.1| Os02g0207800 [Oryza sativa Japonica Group]
Length=135

 Score =   115 bits (287),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 59/120 (49%), Positives = 73/120 (61%), Gaps = 0/120 (0%)
 Frame = +1

Query  307  VLSELLALSYNICEPLGHVTPSAVPWTVKKPTLTFSKLFWTYSHCLAISLIVPTLGFPVY  486
            +LS L A SY+I +P G VTPS+VP T +    T  KL  + +   A S IVPT G P Y
Sbjct  3    LLSSLAARSYSILDPSGEVTPSSVPCTTRNGAATSPKLSRSSAVTRASSRIVPTRGEPRY  62

Query  487  LLGLLAMIFSFSTSLMAFPTILLSGIMAHVSANPNNSPYMNKCTLEGFMFSGMTKSGAEK  666
              GL A+  SF+ S +  PTILLSGI AHVSA P   PY    T +G+M SG T SGA++
Sbjct  63   SRGLDAITLSFAGSRIDLPTILLSGITAHVSARPKRRPYRKSRTRDGYMSSGKTSSGADR  122



>ref|XP_004977658.1| PREDICTED: monoglyceride lipase-like isoform X1 [Setaria italica]
Length=314

 Score =   119 bits (299),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 61/154 (40%), Positives = 94/154 (61%), Gaps = 0/154 (0%)
 Frame = -2

Query  659  APLFVIPENMKPSKVHLFMYGLLFGFADTWAMMPDNKMVGKAIRDVEKLKIIASNPRRYT  480
            AP+  I E+MKP  + + +   L     TW ++P+  ++ +AI+  E  + + +N   Y 
Sbjct  159  APMCKIVEDMKPHPIVISILSKLSNVIPTWRIIPNEDIIDRAIKSEEWREEVRNNHYCYK  218

Query  479  GKPRVGTMREIARQCEYVQNNFEKVSVGFLTVHGTADGVTCPSGSQMLYDKASSSDKTLK  300
            GKPR+ T  E+      ++NN +KV++ F+ VHG  D VT PS S+ LY  A S DKTLK
Sbjct  219  GKPRLKTGYELFMASLDIENNLDKVTLPFIIVHGGGDAVTDPSVSEALYTLAESKDKTLK  278

Query  299  LYQGLYHSLIQGEPDEDANRVLADMREWIDERVS  198
            LY G+ H+L  GEP E+ + V +D+ +W++ERVS
Sbjct  279  LYPGMCHALTSGEPKENIDIVFSDIIKWLNERVS  312



>ref|XP_008783603.1| PREDICTED: caffeoylshikimate esterase-like isoform X2 [Phoenix 
dactylifera]
Length=279

 Score =   117 bits (294),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 62/154 (40%), Positives = 89/154 (58%), Gaps = 0/154 (0%)
 Frame = -2

Query  659  APLFVIPENMKPSKVHLFMYGLLFGFADTWAMMPDNKMVGKAIRDVEKLKIIASNPRRYT  480
            AP+  I + MKP    + +   L     TW ++P   ++  A ++ EK + I SNP  Y 
Sbjct  93   APMCKIADEMKPHPFVISVLRKLCNIIPTWKIIPSQDIIDVAFKNPEKREEIRSNPYCYK  152

Query  479  GKPRVGTMREIARQCEYVQNNFEKVSVGFLTVHGTADGVTCPSGSQMLYDKASSSDKTLK  300
            GKPR+ T  E+      ++ N  +VS+ FL VHG  D VT PS S++L++ A S DKT K
Sbjct  153  GKPRLKTGHELLMVSLDIEKNLHQVSLPFLVVHGGDDIVTDPSVSKLLHESALSKDKTFK  212

Query  299  LYQGLYHSLIQGEPDEDANRVLADMREWIDERVS  198
            LY G++H+L  GEP E+   V AD+  W+DER S
Sbjct  213  LYPGMWHALTSGEPLENIELVFADIVAWLDERAS  246



>emb|CDY20587.1| BnaC08g14710D [Brassica napus]
Length=321

 Score =   118 bits (295),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 62/157 (39%), Positives = 93/157 (59%), Gaps = 2/157 (1%)
 Frame = -2

Query  659  APLFVIPENMKPSKVHLFMYGLLFGFADTWAMMPDNKMVGKAIRDVEKLKIIASNPRRYT  480
            AP+  I + ++P      +   +     TWA++P   ++ K I+  EK  I   NP RY 
Sbjct  164  APMCKISDKVRPKWPIDRILITISSLVPTWAIVPTEDLLEKCIKVEEKKPIAKRNPMRYG  223

Query  479  GKPRVGTMREIARQCEYVQNNFEKVSVGFLTVHGTADGVTCPSGSQMLYDKASSSDKTLK  300
            GKPR+GT+ E+ R  +Y+    + VSV FL +HG+AD VT P  S+ LY+ A S DKTLK
Sbjct  224  GKPRLGTVMELLRVTDYLGKKLKDVSVPFLVLHGSADVVTDPEVSRELYESAESEDKTLK  283

Query  299  LYQGLYHSLIQGEPDEDANRVLADMREWIDERVSCNG  189
            +Y+G+ HS++ GE DE+   V  D+  W+++R  C G
Sbjct  284  IYEGMMHSMLFGETDENVEIVRGDIVGWLNDR--CGG  318



>ref|XP_010107055.1| hypothetical protein L484_002466 [Morus notabilis]
 gb|EXC53896.1| hypothetical protein L484_002466 [Morus notabilis]
Length=329

 Score =   118 bits (295),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 63/158 (40%), Positives = 99/158 (63%), Gaps = 2/158 (1%)
 Frame = -2

Query  659  APLFVIPENMKPSKVHLFMYGLLFGFADTWAMMPDNKMVGKAIRDVEKLKIIAS-NPRRY  483
            AP+  I +N+KP      +   L  F  T A++P   ++ K+++ VE+ KI+A  NP RY
Sbjct  169  APMCKISDNLKPRWPIPQILTQLARFFPTLAIVPTEDLMRKSVK-VEEKKIVADRNPMRY  227

Query  482  TGKPRVGTMREIARQCEYVQNNFEKVSVGFLTVHGTADGVTCPSGSQMLYDKASSSDKTL  303
             GKPR+GT+ E+ R  EY+     +V + F+ +HG+AD VT P+ S+ LY +A S DKT+
Sbjct  228  RGKPRLGTVVELLRVTEYLSGRLSEVKLPFIVLHGSADAVTDPNVSRALYAEAKSEDKTV  287

Query  302  KLYQGLYHSLIQGEPDEDANRVLADMREWIDERVSCNG  189
            ++Y G+ HSL+ GE DE+   V  D+  W++ER + +G
Sbjct  288  RIYDGMMHSLLFGETDENVEIVRNDILSWLNERCNSSG  325



>ref|XP_006665023.1| PREDICTED: caffeoylshikimate esterase-like [Oryza brachyantha]
Length=301

 Score =   117 bits (294),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 60/160 (38%), Positives = 93/160 (58%), Gaps = 0/160 (0%)
 Frame = -2

Query  659  APLFVIPENMKPSKVHLFMYGLLFGFADTWAMMPDNKMVGKAIRDVEKLKIIASNPRRYT  480
            AP+  I E+MKP  + + +   L     TW ++P   ++ +AI++ E    + +NP  Y 
Sbjct  141  APMCKIVEDMKPRPIVITILSKLSNVIPTWQIIPSGDVIDRAIKNEEWRAEVRNNPYCYK  200

Query  479  GKPRVGTMREIARQCEYVQNNFEKVSVGFLTVHGTADGVTCPSGSQMLYDKASSSDKTLK  300
            G+PR+ T  E+      +++N +KV++ F+ VHG  D VT PS S+ LY  A S DK +K
Sbjct  201  GRPRLKTGYELFMASLDIESNLDKVTLPFIIVHGGDDAVTDPSVSEALYTLAESKDKMMK  260

Query  299  LYQGLYHSLIQGEPDEDANRVLADMREWIDERVSCNGTAV  180
            LY G+ H+L  GEP E+ + V AD+  W+DER S    A+
Sbjct  261  LYPGMCHALTSGEPTENIDVVFADIIRWLDERASSLQAAI  300



>ref|XP_003591520.1| Monoglyceride lipase [Medicago truncatula]
 gb|AES61771.1| alpha/beta hydrolase family protein [Medicago truncatula]
Length=324

 Score =   118 bits (295),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 60/154 (39%), Positives = 88/154 (57%), Gaps = 0/154 (0%)
 Frame = -2

Query  665  FSAPLFVIPENMKPSKVHLFMYGLLFGFADTWAMMPDNKMVGKAIRDVEKLKIIASNPRR  486
            F AP+  I E +KP +V + M   L      W ++P   ++  A +D  K ++I  N   
Sbjct  138  FVAPMCKISEKVKPHRVAVSMLSGLEHIFPKWKIVPTKDVIDSAFKDHTKREMIRKNKLI  197

Query  485  YTGKPRVGTMREIARQCEYVQNNFEKVSVGFLTVHGTADGVTCPSGSQMLYDKASSSDKT  306
            Y  KPR+ T  E+ R    V+ N  +V++ FL +HG  D VT P  S+ LY++ASS DKT
Sbjct  198  YQDKPRLKTALELLRTSLSVETNLHQVTLPFLVLHGEEDKVTDPEVSKALYERASSVDKT  257

Query  305  LKLYQGLYHSLIQGEPDEDANRVLADMREWIDER  204
            +KLY G++H L  GEPDE+   V  D+  W+D+R
Sbjct  258  IKLYPGMWHGLTAGEPDENIELVFGDIISWLDKR  291



>ref|XP_011043243.1| PREDICTED: caffeoylshikimate esterase [Populus euphratica]
Length=323

 Score =   117 bits (294),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 60/156 (38%), Positives = 95/156 (61%), Gaps = 0/156 (0%)
 Frame = -2

Query  659  APLFVIPENMKPSKVHLFMYGLLFGFADTWAMMPDNKMVGKAIRDVEKLKIIASNPRRYT  480
            AP+  I +N+KP      +  L+  F  T A++P   ++ K+I+   K+ I   NP RY 
Sbjct  166  APMCKISDNIKPRWPISDILLLVAKFLPTLAIVPAASILHKSIKVERKVPIAEMNPLRYR  225

Query  479  GKPRVGTMREIARQCEYVQNNFEKVSVGFLTVHGTADGVTCPSGSQMLYDKASSSDKTLK  300
            GKPR+GT+ E+ R  +Y+  N   V++ F+ +HG+ D VT P  S+ LY++A+S DKT+K
Sbjct  226  GKPRLGTVVELLRVTDYLSQNLRNVTIPFIVLHGSMDVVTDPKVSESLYEEANSEDKTIK  285

Query  299  LYQGLYHSLIQGEPDEDANRVLADMREWIDERVSCN  192
            +Y G+ HSL+ GE DE+   V  D+  W+++R   N
Sbjct  286  IYDGMVHSLLFGETDENVEIVRQDIISWLNDRCKQN  321



>ref|XP_009775188.1| PREDICTED: caffeoylshikimate esterase-like [Nicotiana sylvestris]
Length=318

 Score =   117 bits (294),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 61/154 (40%), Positives = 94/154 (61%), Gaps = 0/154 (0%)
 Frame = -2

Query  659  APLFVIPENMKPSKVHLFMYGLLFGFADTWAMMPDNKMVGKAIRDVEKLKIIASNPRRYT  480
            AP+  I ++M+PS + + +   L     TW ++P   +V  A RD E  K I +NP  Y 
Sbjct  143  APMCKIADDMRPSPIVISILTKLCNIIPTWKLIPTQDVVDSAFRDPEVRKEIRNNPYCYK  202

Query  479  GKPRVGTMREIARQCEYVQNNFEKVSVGFLTVHGTADGVTCPSGSQMLYDKASSSDKTLK  300
            G+PR+ T  ++      ++   E+V++ FL VHG  D VT PS S++LY+KASS DK+ K
Sbjct  203  GRPRLQTGYQLFTVSMDLEQRLEEVTLPFLIVHGGEDTVTDPSVSKLLYEKASSIDKSFK  262

Query  299  LYQGLYHSLIQGEPDEDANRVLADMREWIDERVS  198
            LY G++HSL  GE  E+ N V +D+  W++E++S
Sbjct  263  LYPGMWHSLSYGEFPENRNIVFSDIISWLNEKIS  296



>emb|CDO99600.1| unnamed protein product [Coffea canephora]
Length=318

 Score =   117 bits (294),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 58/152 (38%), Positives = 93/152 (61%), Gaps = 0/152 (0%)
 Frame = -2

Query  659  APLFVIPENMKPSKVHLFMYGLLFGFADTWAMMPDNKMVGKAIRDVEKLKIIASNPRRYT  480
            AP+  I E ++P      +  ++  FA T  ++P   ++ K+++  EK     SNP RY 
Sbjct  166  APMCKISEKVRPRWPIPEILTIVARFAPTLPIVPTADLIEKSVKVPEKKITAVSNPSRYN  225

Query  479  GKPRVGTMREIARQCEYVQNNFEKVSVGFLTVHGTADGVTCPSGSQMLYDKASSSDKTLK  300
            GKPR+GT+ E+ R   Y+ +    V++ FL +HG+AD VT P  S  LY+ A+S D+T+K
Sbjct  226  GKPRLGTVLELLRVTAYINSRLSDVNLPFLVLHGSADVVTDPQVSMELYELANSKDRTIK  285

Query  299  LYQGLYHSLIQGEPDEDANRVLADMREWIDER  204
            +Y G+ HSL+ GEPDE+   V  D+ +W+++R
Sbjct  286  IYDGMLHSLLYGEPDENIEIVRGDILKWLNDR  317



>ref|XP_010253357.1| PREDICTED: caffeoylshikimate esterase-like [Nelumbo nucifera]
Length=329

 Score =   117 bits (294),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 59/154 (38%), Positives = 91/154 (59%), Gaps = 0/154 (0%)
 Frame = -2

Query  659  APLFVIPENMKPSKVHLFMYGLLFGFADTWAMMPDNKMVGKAIRDVEKLKIIASNPRRYT  480
            AP+  I + MKP  V + +   L     TW ++P   ++  AI++ ++ + + SNP  Y 
Sbjct  144  APMCKIADEMKPHAVVINVLTQLCKIIPTWKIIPTKDIIDIAIKEPQRREEVRSNPYCYK  203

Query  479  GKPRVGTMREIARQCEYVQNNFEKVSVGFLTVHGTADGVTCPSGSQMLYDKASSSDKTLK  300
            G+PR+ T  ++      ++ N  +V + FL VHG  D VT PS S+ LY+ ASSSDKT K
Sbjct  204  GRPRLKTGNQLLAVSLDIEQNLHEVKLPFLIVHGGDDKVTDPSVSKSLYESASSSDKTFK  263

Query  299  LYQGLYHSLIQGEPDEDANRVLADMREWIDERVS  198
            LY G++H+L  GEP E+ N V  D+  W++ER +
Sbjct  264  LYPGMWHALTSGEPVENINVVFGDIINWLEERTT  297



>ref|XP_006449284.1| hypothetical protein CICLE_v10017806mg [Citrus clementina]
 gb|ESR62524.1| hypothetical protein CICLE_v10017806mg [Citrus clementina]
Length=336

 Score =   118 bits (295),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 65/156 (42%), Positives = 95/156 (61%), Gaps = 2/156 (1%)
 Frame = -2

Query  659  APLFVIPENMKPSKVHLFMYGLLFGFADTWAMMPDNKMVGKAIRDVEKLKIIAS-NPRRY  483
            AP+  I + +KP      +  L+  F  T  ++P   ++ K+I+ VE+ KIIA  NP RY
Sbjct  164  APMCKISDKVKPRWPIPQILSLIARFFPTLPIVPTQDLLSKSIK-VEEKKIIADLNPHRY  222

Query  482  TGKPRVGTMREIARQCEYVQNNFEKVSVGFLTVHGTADGVTCPSGSQMLYDKASSSDKTL  303
             GKPR+GT+ E+ R  +Y+      VS+ F+ +HG AD VT PS SQ LY++A SSDKT+
Sbjct  223  RGKPRLGTVVELLRVTDYLSERLYDVSIPFIVLHGNADVVTDPSVSQALYEEARSSDKTI  282

Query  302  KLYQGLYHSLIQGEPDEDANRVLADMREWIDERVSC  195
            K+Y G+ HSL+ GE DE+   V  D+  W++    C
Sbjct  283  KIYDGMLHSLLFGETDENIEIVRNDILSWLNGVAKC  318



>ref|XP_009622601.1| PREDICTED: caffeoylshikimate esterase-like [Nicotiana tomentosiformis]
Length=318

 Score =   117 bits (294),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 61/154 (40%), Positives = 94/154 (61%), Gaps = 0/154 (0%)
 Frame = -2

Query  659  APLFVIPENMKPSKVHLFMYGLLFGFADTWAMMPDNKMVGKAIRDVEKLKIIASNPRRYT  480
            AP+  I ++M+P  + + +   L  F  TW ++P   +V  A RD E  K I +NP  Y 
Sbjct  143  APMCKIADDMRPHPMVISVLTKLCNFIPTWKLIPTQDVVDSAFRDPEVRKEIRNNPYCYK  202

Query  479  GKPRVGTMREIARQCEYVQNNFEKVSVGFLTVHGTADGVTCPSGSQMLYDKASSSDKTLK  300
            G+PR+ T  ++      ++   E+V++ FL VHG  D VT PS S++LY+KASS DK+ K
Sbjct  203  GRPRLQTGYQLLTVSMDLEQRLEEVTLPFLIVHGGEDTVTDPSVSKLLYEKASSIDKSFK  262

Query  299  LYQGLYHSLIQGEPDEDANRVLADMREWIDERVS  198
            LY G++HSL  GE  E+ N V +D+  W++E++S
Sbjct  263  LYPGMWHSLSYGEFPENRNIVFSDIISWLNEKIS  296



>ref|XP_010554569.1| PREDICTED: caffeoylshikimate esterase [Tarenaya hassleriana]
Length=319

 Score =   117 bits (294),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 59/154 (38%), Positives = 92/154 (60%), Gaps = 0/154 (0%)
 Frame = -2

Query  659  APLFVIPENMKPSKVHLFMYGLLFGFADTWAMMPDNKMVGKAIRDVEKLKIIASNPRRYT  480
            AP+  I E++KP K+ + M  ++     TW  +  N ++  A +  E  K I  NPR Y 
Sbjct  143  APMCKIAEDVKPPKIVISMMQMITKVIPTWKSVISNDIIEVAFKQPEARKSIQENPRCYK  202

Query  479  GKPRVGTMREIARQCEYVQNNFEKVSVGFLTVHGTADGVTCPSGSQMLYDKASSSDKTLK  300
            G+PR  TM E+ R    +++   +V++ F+ +HG  D VT    S+ LY+ ASS DKTLK
Sbjct  203  GRPRYKTMSELYRVSIDLEHRLNEVTMSFIVLHGEEDKVTDKEASKELYNVASSKDKTLK  262

Query  299  LYQGLYHSLIQGEPDEDANRVLADMREWIDERVS  198
            LY G++HSL+ GEP E++  V  D+ +W++ER +
Sbjct  263  LYPGMWHSLLFGEPPENSQIVFNDIIQWLEERTT  296



>ref|XP_008783602.1| PREDICTED: caffeoylshikimate esterase-like isoform X1 [Phoenix 
dactylifera]
Length=329

 Score =   117 bits (294),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 62/154 (40%), Positives = 89/154 (58%), Gaps = 0/154 (0%)
 Frame = -2

Query  659  APLFVIPENMKPSKVHLFMYGLLFGFADTWAMMPDNKMVGKAIRDVEKLKIIASNPRRYT  480
            AP+  I + MKP    + +   L     TW ++P   ++  A ++ EK + I SNP  Y 
Sbjct  143  APMCKIADEMKPHPFVISVLRKLCNIIPTWKIIPSQDIIDVAFKNPEKREEIRSNPYCYK  202

Query  479  GKPRVGTMREIARQCEYVQNNFEKVSVGFLTVHGTADGVTCPSGSQMLYDKASSSDKTLK  300
            GKPR+ T  E+      ++ N  +VS+ FL VHG  D VT PS S++L++ A S DKT K
Sbjct  203  GKPRLKTGHELLMVSLDIEKNLHQVSLPFLVVHGGDDIVTDPSVSKLLHESALSKDKTFK  262

Query  299  LYQGLYHSLIQGEPDEDANRVLADMREWIDERVS  198
            LY G++H+L  GEP E+   V AD+  W+DER S
Sbjct  263  LYPGMWHALTSGEPLENIELVFADIVAWLDERAS  296



>ref|XP_009418746.1| PREDICTED: caffeoylshikimate esterase [Musa acuminata subsp. 
malaccensis]
Length=336

 Score =   117 bits (294),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 58/153 (38%), Positives = 96/153 (63%), Gaps = 0/153 (0%)
 Frame = -2

Query  659  APLFVIPENMKPSKVHLFMYGLLFGFADTWAMMPDNKMVGKAIRDVEKLKIIASNPRRYT  480
            AP+  I ++++P      +   +  FA T  ++P   ++ K+++  EK  + ASNP RY 
Sbjct  175  APMCKISDSIRPRWPVPEILTFVAKFAPTLPVVPTADLLEKSVKVEEKRVVAASNPLRYA  234

Query  479  GKPRVGTMREIARQCEYVQNNFEKVSVGFLTVHGTADGVTCPSGSQMLYDKASSSDKTLK  300
            G+PR+GT+ E+ R  + + +   +V++ F+ +HG+AD VT PS S+ L+D A S DKT+K
Sbjct  235  GRPRLGTVAELMRVTDRLNSRLSEVTIPFIVLHGSADVVTDPSVSRALHDTARSKDKTIK  294

Query  299  LYQGLYHSLIQGEPDEDANRVLADMREWIDERV  201
            +Y G+ HSL+ GEPDE+   V  D+  W++ER 
Sbjct  295  IYDGMLHSLLFGEPDENIAMVRNDILAWLNERT  327



>ref|XP_010922429.1| PREDICTED: caffeoylshikimate esterase-like [Elaeis guineensis]
Length=333

 Score =   117 bits (293),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 62/152 (41%), Positives = 87/152 (57%), Gaps = 0/152 (0%)
 Frame = -2

Query  659  APLFVIPENMKPSKVHLFMYGLLFGFADTWAMMPDNKMVGKAIRDVEKLKIIASNPRRYT  480
            AP+  I + MKP  + + +   L      W ++P   ++  A ++ EK + I SNP  Y 
Sbjct  143  APMCKIADEMKPHPLVVSVLTKLSNIIPKWKIVPTQDIIDVAFKNPEKREEIRSNPYCYK  202

Query  479  GKPRVGTMREIARQCEYVQNNFEKVSVGFLTVHGTADGVTCPSGSQMLYDKASSSDKTLK  300
            GKPRV T  E+      ++ N  +VS+ FL VHG  D VT PS S++LY+ A S DKT K
Sbjct  203  GKPRVKTAVELLLASLDIEKNLHQVSLPFLIVHGGDDIVTDPSVSKLLYESALSKDKTFK  262

Query  299  LYQGLYHSLIQGEPDEDANRVLADMREWIDER  204
            LY G++H L  GEP E+   V AD+  W+DER
Sbjct  263  LYPGMWHGLTSGEPPENIELVFADIVAWLDER  294



>ref|XP_009412536.1| PREDICTED: caffeoylshikimate esterase-like [Musa acuminata subsp. 
malaccensis]
Length=328

 Score =   117 bits (293),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 61/158 (39%), Positives = 89/158 (56%), Gaps = 0/158 (0%)
 Frame = -2

Query  659  APLFVIPENMKPSKVHLFMYGLLFGFADTWAMMPDNKMVGKAIRDVEKLKIIASNPRRYT  480
            AP+  I + MKP  V +     L     TW ++P   ++    +  EK + I SNP  Y 
Sbjct  143  APMCKIADEMKPHPVVISTLTKLCNVIPTWRIVPTKDIIDIGFKVPEKREEIRSNPYCYK  202

Query  479  GKPRVGTMREIARQCEYVQNNFEKVSVGFLTVHGTADGVTCPSGSQMLYDKASSSDKTLK  300
            G+PR+ T  E+      ++ N  +VS+ FL VHG  D VT PS S++LY+ ASS DKTLK
Sbjct  203  GRPRLKTAHEVLMVSLDIEKNLNQVSLPFLVVHGGDDIVTDPSVSRLLYETASSEDKTLK  262

Query  299  LYQGLYHSLIQGEPDEDANRVLADMREWIDERVSCNGT  186
            LY G++H+L   EP  + + V AD+  W+D R +  G+
Sbjct  263  LYPGMWHALTSAEPPANIDLVFADIIAWLDRRTAAEGS  300



>ref|XP_006467849.1| PREDICTED: caffeoylshikimate esterase-like [Citrus sinensis]
 gb|KDO75845.1| hypothetical protein CISIN_1g021066mg [Citrus sinensis]
Length=317

 Score =   117 bits (292),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 66/157 (42%), Positives = 97/157 (62%), Gaps = 4/157 (3%)
 Frame = -2

Query  659  APLFVIPENMKPSKVHLFMYGLLFGFADTWAMMPDNKMVGKAIRDVEKLKIIAS-NPRRY  483
            AP+  I + +KP      +  L+  F  T  ++P   ++ K+I+ VE+ KIIA  NP RY
Sbjct  164  APMCKISDKVKPRWPIPQILSLIARFFPTLPIVPTQDLLSKSIK-VEEKKIIADLNPHRY  222

Query  482  TGKPRVGTMREIARQCEYVQNNFEKVSVGFLTVHGTADGVTCPSGSQMLYDKASSSDKTL  303
             GKPR+GT+ E+ R  +Y+      VS+ F+ +HG AD VT PS S+ LY++A SSDKT+
Sbjct  223  RGKPRLGTVVELLRVTDYLSERLYDVSIPFIVLHGNADVVTDPSVSEALYEEARSSDKTI  282

Query  302  KLYQGLYHSLIQGEPDEDANRVLADMREWIDERVSCN  192
            K+Y G+ HSL+ GE DE+   V  D+  W++ R  CN
Sbjct  283  KIYDGMLHSLLFGETDENIEIVRNDILSWLNGR--CN  317



>ref|XP_009123831.1| PREDICTED: caffeoylshikimate esterase [Brassica rapa]
Length=321

 Score =   117 bits (292),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 62/157 (39%), Positives = 92/157 (59%), Gaps = 2/157 (1%)
 Frame = -2

Query  659  APLFVIPENMKPSKVHLFMYGLLFGFADTWAMMPDNKMVGKAIRDVEKLKIIASNPRRYT  480
            AP+  I + ++P      +   +     TWA++P   ++ K I+  EK  I   NP RY 
Sbjct  164  APMCKISDKVRPKWPIDRILITISSLVPTWAIVPTEDLLEKCIKVEEKKPIAKRNPMRYG  223

Query  479  GKPRVGTMREIARQCEYVQNNFEKVSVGFLTVHGTADGVTCPSGSQMLYDKASSSDKTLK  300
            GKPR+GT+ E+ R  +Y+    + VSV FL +HG+AD VT P  S+ LY+ A S DKTLK
Sbjct  224  GKPRLGTVMELLRVTDYLGKKLKDVSVPFLVLHGSADVVTDPEVSRELYESAKSEDKTLK  283

Query  299  LYQGLYHSLIQGEPDEDANRVLADMREWIDERVSCNG  189
            +Y G+ HS++ GE DE+   V  D+  W+++R  C G
Sbjct  284  IYDGMMHSMLFGETDENIEIVRGDIVGWLNDR--CGG  318



>gb|KFK43401.1| hypothetical protein AALP_AA1G121200, partial [Arabis alpina]
Length=319

 Score =   117 bits (292),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 61/158 (39%), Positives = 97/158 (61%), Gaps = 4/158 (3%)
 Frame = -2

Query  659  APLFVIPENMKPS-KVHLFMYGLLFGFADTWAMMPDNKMVGKAIRDVEKLKIIASNPRRY  483
            AP+  I + ++P   +  F+  ++  F  TWA++P   ++ K+I+  EK  I   NP RY
Sbjct  161  APMCKISDKVRPKWPIDQFLI-MISSFLPTWAIVPTEDLLEKSIKVEEKKPIAKRNPMRY  219

Query  482  TGKPRVGTMREIARQCEYVQNNFEKVSVGFLTVHGTADGVTCPSGSQMLYDKASSSDKTL  303
              KPR+GT+ E+ R  +Y+    + VS+ F+ +HG+AD VT P  S+ L + A S DKTL
Sbjct  220  NEKPRLGTVMELLRVTDYLGKKLKDVSIPFIVLHGSADVVTDPDVSRELCEVAKSEDKTL  279

Query  302  KLYQGLYHSLIQGEPDEDANRVLADMREWIDERVSCNG  189
            K+Y+G+ HS++ GEPDE+   V  D+  W+++R  C G
Sbjct  280  KIYEGMMHSMLFGEPDENIEIVRKDIVSWLNDR--CGG  315



>ref|XP_008809309.1| PREDICTED: caffeoylshikimate esterase [Phoenix dactylifera]
Length=330

 Score =   117 bits (292),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 61/158 (39%), Positives = 97/158 (61%), Gaps = 2/158 (1%)
 Frame = -2

Query  659  APLFVIPENMKPSKVHLFMYGLLFGFADTWAMMPDNKMVGKAIRDVEKLKIIASNPRRYT  480
            AP+  I ++++P      +   +   A T  ++P   +V K++R   K K+ ASNP RY 
Sbjct  173  APMCKISDSIRPRWPIPQVLTFVARLAPTLPIVPTADLVDKSVRVEAKRKVAASNPLRYR  232

Query  479  GKPRVGTMREIARQCEYVQNNFEKVSVGFLTVHGTADGVTCPSGSQMLYDKASSSDKTLK  300
            GKPR+GT+ E+ R  + + +   +V++ FL +HG+AD VT P+ S+ LYD A S DKT++
Sbjct  233  GKPRLGTVVELLRATDDLGSRLSEVTLPFLVLHGSADVVTDPAVSRALYDAARSEDKTIR  292

Query  299  LYQGLYHSLIQGEPDEDANRVLADMREWIDERVSCNGT  186
            +Y+G+ HSL+ GE DE+   V  D+  W++ER  C G 
Sbjct  293  IYEGMMHSLLFGETDENVALVRNDILAWLNER--CGGA  328



>dbj|BAJ89543.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=359

 Score =   117 bits (293),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 57/159 (36%), Positives = 97/159 (61%), Gaps = 0/159 (0%)
 Frame = -2

Query  659  APLFVIPENMKPSKVHLFMYGLLFGFADTWAMMPDNKMVGKAIRDVEKLKIIASNPRRYT  480
            AP+  I + ++P      +  L+  FA T  ++P   ++ K+++   K  I A NP RY 
Sbjct  201  APMCRISDRIRPRWPVPEILTLVSRFAPTLPIVPTADLIEKSVKVPAKRLIAARNPMRYN  260

Query  479  GKPRVGTMREIARQCEYVQNNFEKVSVGFLTVHGTADGVTCPSGSQMLYDKASSSDKTLK  300
            G+PR+GT+ E+ R  + +     ++++ FL VHG+AD VT P+ S+ L++ A+S DKT+K
Sbjct  261  GRPRLGTVMELLRATDELGARLGEITIPFLVVHGSADEVTDPAVSRALHEAAASEDKTIK  320

Query  299  LYQGLYHSLIQGEPDEDANRVLADMREWIDERVSCNGTA  183
            +Y G+ HS++ GEP+E+  RV  D+  W+ ER +   T+
Sbjct  321  MYDGMLHSMLFGEPEENIERVRGDILAWLSERCTPTSTS  359



>ref|XP_004288899.1| PREDICTED: monoglyceride lipase-like [Fragaria vesca subsp. vesca]
Length=295

 Score =   116 bits (291),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 56/157 (36%), Positives = 93/157 (59%), Gaps = 0/157 (0%)
 Frame = -2

Query  665  FSAPLFVIPENMKPSKVHLFMYGLLFGFADTWAMMPDNKMVGKAIRDVEKLKIIASNPRR  486
             +AP+  I ++M+PS   + +   L     TW ++P + ++  A ++ E  K    NP  
Sbjct  139  LAAPMCKIADDMRPSPTVISVLKKLCRVIPTWKIIPTHDIIDVAFKEPEVRKQTRENPYC  198

Query  485  YTGKPRVGTMREIARQCEYVQNNFEKVSVGFLTVHGTADGVTCPSGSQMLYDKASSSDKT  306
            Y G+PR+ T  E+ R    ++   +++++ FL +HG  D VT PS S++LY++ASS DKT
Sbjct  199  YKGRPRLKTGYELLRVSTDIEQRLQEITLAFLVLHGEEDEVTDPSVSKLLYEEASSCDKT  258

Query  305  LKLYQGLYHSLIQGEPDEDANRVLADMREWIDERVSC  195
            LKLY  ++H L+ GEP E+   V +D+  W+D R +C
Sbjct  259  LKLYPNMWHGLLYGEPLENTEIVFSDIINWLDGRSAC  295



>gb|EAY97055.1| hypothetical protein OsI_18977 [Oryza sativa Indica Group]
Length=296

 Score =   116 bits (291),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 60/154 (39%), Positives = 91/154 (59%), Gaps = 0/154 (0%)
 Frame = -2

Query  659  APLFVIPENMKPSKVHLFMYGLLFGFADTWAMMPDNKMVGKAIRDVEKLKIIASNPRRYT  480
            AP+  I E+MKP  + + +   L     TW ++P   ++ KAI+  E  + + +NP  Y 
Sbjct  141  APMCKIVEDMKPRPIVITILSKLSNVIPTWKIIPTEDVIDKAIKSEEWRQEVRNNPYCYK  200

Query  479  GKPRVGTMREIARQCEYVQNNFEKVSVGFLTVHGTADGVTCPSGSQMLYDKASSSDKTLK  300
            G+PR+ T  E+      +++  +KV++ F+ VHG  D VT PS S+ LY  A S DKTLK
Sbjct  201  GRPRLKTGYELFMASLDIESTLDKVTLPFIIVHGGDDAVTDPSVSEELYTSAQSKDKTLK  260

Query  299  LYQGLYHSLIQGEPDEDANRVLADMREWIDERVS  198
            LY G+ H+L  GEP  + + V  D+ +W+DERVS
Sbjct  261  LYPGMCHALTSGEPASNIDIVFLDIIKWLDERVS  294



>ref|NP_001066522.1| Os12g0262700 [Oryza sativa Japonica Group]
 gb|ABA97354.1| Phospholipase, putative, expressed [Oryza sativa Japonica Group]
 dbj|BAF29541.1| Os12g0262700 [Oryza sativa Japonica Group]
 gb|EEE62831.1| hypothetical protein OsJ_17634 [Oryza sativa Japonica Group]
Length=296

 Score =   116 bits (290),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 60/154 (39%), Positives = 91/154 (59%), Gaps = 0/154 (0%)
 Frame = -2

Query  659  APLFVIPENMKPSKVHLFMYGLLFGFADTWAMMPDNKMVGKAIRDVEKLKIIASNPRRYT  480
            AP+  I E+MKP  + + +   L     TW ++P   ++ KAI+  E  + + +NP  Y 
Sbjct  141  APMCKIVEDMKPRPIVITILSKLSNVIPTWKIIPTEDVIDKAIKSEEWRQEVRNNPYCYK  200

Query  479  GKPRVGTMREIARQCEYVQNNFEKVSVGFLTVHGTADGVTCPSGSQMLYDKASSSDKTLK  300
            G+PR+ T  E+      +++  +KV++ F+ VHG  D VT PS S+ LY  A S DKTLK
Sbjct  201  GRPRLKTGYELFMASLDIESTLDKVTLPFIIVHGGDDAVTDPSVSEELYTSAQSKDKTLK  260

Query  299  LYQGLYHSLIQGEPDEDANRVLADMREWIDERVS  198
            LY G+ H+L  GEP  + + V  D+ +W+DERVS
Sbjct  261  LYPGMCHALTSGEPASNIDIVFLDIIKWLDERVS  294



>dbj|BAJ99600.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=365

 Score =   117 bits (293),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 57/159 (36%), Positives = 97/159 (61%), Gaps = 0/159 (0%)
 Frame = -2

Query  659  APLFVIPENMKPSKVHLFMYGLLFGFADTWAMMPDNKMVGKAIRDVEKLKIIASNPRRYT  480
            AP+  I + ++P      +  L+  FA T  ++P   ++ K+++   K  I A NP RY 
Sbjct  207  APMCRISDRIRPRWPVPEILTLVSRFAPTLPIVPTADLIEKSVKVPAKRLIAARNPMRYN  266

Query  479  GKPRVGTMREIARQCEYVQNNFEKVSVGFLTVHGTADGVTCPSGSQMLYDKASSSDKTLK  300
            G+PR+GT+ E+ R  + +     ++++ FL VHG+AD VT P+ S+ L++ A+S DKT+K
Sbjct  267  GRPRLGTVMELLRATDELGARLGEITIPFLVVHGSADEVTDPAVSRALHEAAASEDKTIK  326

Query  299  LYQGLYHSLIQGEPDEDANRVLADMREWIDERVSCNGTA  183
            +Y G+ HS++ GEP+E+  RV  D+  W+ ER +   T+
Sbjct  327  MYDGMLHSMLFGEPEENIERVRGDILAWLSERCTPTSTS  365



>ref|XP_008783604.1| PREDICTED: caffeoylshikimate esterase-like [Phoenix dactylifera]
Length=345

 Score =   117 bits (292),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 59/154 (38%), Positives = 90/154 (58%), Gaps = 0/154 (0%)
 Frame = -2

Query  659  APLFVIPENMKPSKVHLFMYGLLFGFADTWAMMPDNKMVGKAIRDVEKLKIIASNPRRYT  480
            AP+  I E MKP  + + +   L     TW ++P   ++  AI++ E  + + SNP  Y 
Sbjct  139  APMCKIAEEMKPPPIIIKILTQLSKIIPTWKLIPTKDIIDSAIKNPEWREQVRSNPYCYK  198

Query  479  GKPRVGTMREIARQCEYVQNNFEKVSVGFLTVHGTADGVTCPSGSQMLYDKASSSDKTLK  300
            GKPR+ T  E+      ++ N  +V++ F+ VHG  D VT PS S+ LY+ ASS DKT K
Sbjct  199  GKPRLKTGYELLMVSLDIEKNLHQVTLPFIVVHGGDDIVTDPSVSRSLYETASSKDKTFK  258

Query  299  LYQGLYHSLIQGEPDEDANRVLADMREWIDERVS  198
            LY G++H+L  GEP E  + V +D+  W+D+R +
Sbjct  259  LYPGMWHALTSGEPQESIDLVFSDIIAWLDDRAT  292



>gb|EMT04425.1| hypothetical protein F775_33013 [Aegilops tauschii]
Length=356

 Score =   117 bits (292),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 58/145 (40%), Positives = 90/145 (62%), Gaps = 0/145 (0%)
 Frame = -2

Query  638  ENMKPSKVHLFMYGLLFGFADTWAMMPDNKMVGKAIRDVEKLKIIASNPRRYTGKPRVGT  459
            E MKPS + + +   L     TW ++P+  ++ +AI+  E  + + +NP  Y G+PR+ T
Sbjct  205  EEMKPSPMVITILSKLSNVIPTWKIIPNEDIIDRAIKSQEWREEVRNNPYCYKGRPRLKT  264

Query  458  MREIARQCEYVQNNFEKVSVGFLTVHGTADGVTCPSGSQMLYDKASSSDKTLKLYQGLYH  279
              EI      +++N EKV++ F+ VHG AD VT P+ S+ LY  A S DKTLKLY G+ H
Sbjct  265  GYEIFMASLDIESNLEKVTLPFIIVHGGADAVTDPAVSEALYTLAESKDKTLKLYPGMCH  324

Query  278  SLIQGEPDEDANRVLADMREWIDER  204
            +L  GEP+ + + V +D+ +W+DER
Sbjct  325  ALTSGEPENNIDIVFSDIIQWLDER  349



>ref|XP_010921664.1| PREDICTED: caffeoylshikimate esterase-like isoform X1 [Elaeis 
guineensis]
Length=354

 Score =   117 bits (292),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 60/152 (39%), Positives = 90/152 (59%), Gaps = 0/152 (0%)
 Frame = -2

Query  659  APLFVIPENMKPSKVHLFMYGLLFGFADTWAMMPDNKMVGKAIRDVEKLKIIASNPRRYT  480
            AP+  I E MKPS + + +   +     TW ++P  ++V  A RD  K + I  N   Y 
Sbjct  147  APMCKISEEMKPSPLVVNILTQVEDIIPTWKIVPTKQIVDTAFRDPVKREEIRHNKLIYQ  206

Query  479  GKPRVGTMREIARQCEYVQNNFEKVSVGFLTVHGTADGVTCPSGSQMLYDKASSSDKTLK  300
             KPR+ T  E+ R    ++++  KVS+ FL +HG AD VT P  S+ LY++ASS DKT+ 
Sbjct  207  DKPRLKTALELLRTSMELEDSLSKVSLPFLVLHGEADTVTDPEVSRALYERASSVDKTIT  266

Query  299  LYQGLYHSLIQGEPDEDANRVLADMREWIDER  204
            LY G++H L  GEPD++  +V +D+  W+D R
Sbjct  267  LYAGMWHGLTSGEPDDNVEKVFSDVITWLDHR  298



>emb|CDY20979.1| BnaA08g25460D [Brassica napus]
Length=322

 Score =   116 bits (290),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 62/157 (39%), Positives = 91/157 (58%), Gaps = 2/157 (1%)
 Frame = -2

Query  659  APLFVIPENMKPSKVHLFMYGLLFGFADTWAMMPDNKMVGKAIRDVEKLKIIASNPRRYT  480
            AP+  I + ++P      +   +     TWA++P   ++ K I+  EK  I   NP RY 
Sbjct  165  APMCKISDKVRPKWPIDRILITISSLVPTWAIVPTEDLLEKCIKVEEKKPIAKRNPMRYG  224

Query  479  GKPRVGTMREIARQCEYVQNNFEKVSVGFLTVHGTADGVTCPSGSQMLYDKASSSDKTLK  300
            GKPR+GT+ E+ R  +Y+    + VSV FL +HG+AD VT P  S+ LY+ A S DKTLK
Sbjct  225  GKPRLGTVMELLRVTDYLGKKLKDVSVPFLVLHGSADVVTDPEVSRELYESAKSEDKTLK  284

Query  299  LYQGLYHSLIQGEPDEDANRVLADMREWIDERVSCNG  189
            +Y G+ HS++ GE DE+   V  D+  W++ R  C G
Sbjct  285  IYDGMMHSMLFGETDENIEIVRGDIVGWLNNR--CGG  319



>ref|XP_006343251.1| PREDICTED: caffeoylshikimate esterase-like isoform X1 [Solanum 
tuberosum]
 ref|XP_006343252.1| PREDICTED: caffeoylshikimate esterase-like isoform X2 [Solanum 
tuberosum]
Length=317

 Score =   116 bits (290),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 62/152 (41%), Positives = 92/152 (61%), Gaps = 0/152 (0%)
 Frame = -2

Query  659  APLFVIPENMKPSKVHLFMYGLLFGFADTWAMMPDNKMVGKAIRDVEKLKIIASNPRRYT  480
            AP+  I + +KP         L+  FA T A++P   ++ K+++  EK  I   NP RY 
Sbjct  165  APMCKISDKVKPIWPVAQFLTLVARFAPTLAVVPTTDLLEKSVKVPEKRIIGGRNPNRYV  224

Query  479  GKPRVGTMREIARQCEYVQNNFEKVSVGFLTVHGTADGVTCPSGSQMLYDKASSSDKTLK  300
            GKPR+GT+ E+ R  +YV +    V++ FL +HG+AD VT P  S+ LY  A S+DKTLK
Sbjct  225  GKPRLGTVLELLRVTDYVSSKLCDVNMPFLVLHGSADVVTDPEVSRELYKLAKSTDKTLK  284

Query  299  LYQGLYHSLIQGEPDEDANRVLADMREWIDER  204
            +Y G+ HSL+ GE DE+   V  D+  W+++R
Sbjct  285  IYDGMMHSLLFGETDENVEIVRGDILAWLNDR  316



>ref|XP_004958048.1| PREDICTED: monoglyceride lipase-like [Setaria italica]
Length=335

 Score =   116 bits (290),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 58/156 (37%), Positives = 95/156 (61%), Gaps = 0/156 (0%)
 Frame = -2

Query  659  APLFVIPENMKPSKVHLFMYGLLFGFADTWAMMPDNKMVGKAIRDVEKLKIIASNPRRYT  480
            AP+  I + ++P      +   +  FA T A++P   ++ K+++   K  I A NP RY 
Sbjct  170  APMCRISDRIRPPWPLPEILTFVARFAPTAAIVPTADLIEKSVKVPAKRVIAARNPVRYN  229

Query  479  GKPRVGTMREIARQCEYVQNNFEKVSVGFLTVHGTADGVTCPSGSQMLYDKASSSDKTLK  300
            G+PR+GT+ E+ R  + +     +V++ FL VHG+AD VT P  S+ LY+ A+S DKT+K
Sbjct  230  GRPRLGTVVELLRATDELAKRLGEVTIPFLVVHGSADEVTDPEVSRALYEAAASKDKTIK  289

Query  299  LYQGLYHSLIQGEPDEDANRVLADMREWIDERVSCN  192
            +Y G+ HSL+ GE DE+  RV  D+  W++E+ + +
Sbjct  290  IYDGMLHSLLFGELDENIERVRGDILAWLNEKCTLS  325



>ref|XP_004236766.1| PREDICTED: caffeoylshikimate esterase [Solanum lycopersicum]
Length=319

 Score =   115 bits (289),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 60/154 (39%), Positives = 93/154 (60%), Gaps = 0/154 (0%)
 Frame = -2

Query  659  APLFVIPENMKPSKVHLFMYGLLFGFADTWAMMPDNKMVGKAIRDVEKLKIIASNPRRYT  480
            AP+  I ++++P  + + +   L  F  TW ++P   +V  A RD E  K I +NP  Y 
Sbjct  143  APMCKIADDLRPHPMVISVLTKLCNFIPTWRIVPTQDIVDSAFRDPEVRKEIRNNPHCYK  202

Query  479  GKPRVGTMREIARQCEYVQNNFEKVSVGFLTVHGTADGVTCPSGSQMLYDKASSSDKTLK  300
            GKPR+ T  ++      ++   E+V++ FL VHG  D VT PS S++L++KASS DK+ K
Sbjct  203  GKPRLQTAHQLMTVSMDLEQRLEEVTLPFLIVHGEEDTVTDPSVSKLLHEKASSIDKSFK  262

Query  299  LYQGLYHSLIQGEPDEDANRVLADMREWIDERVS  198
            LY G++HSL  GE  E+ + V +D+  W+ ER+S
Sbjct  263  LYPGMWHSLSYGEFPENRDIVFSDIVVWLKERIS  296



>gb|KDP20918.1| hypothetical protein JCGZ_21389 [Jatropha curcas]
Length=318

 Score =   115 bits (289),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 60/153 (39%), Positives = 92/153 (60%), Gaps = 0/153 (0%)
 Frame = -2

Query  659  APLFVIPENMKPSKVHLFMYGLLFGFADTWAMMPDNKMVGKAIRDVEKLKIIASNPRRYT  480
            AP+  I E MKP      +   +  F  TWA++P   ++ K+I+  +K  I   NP RY 
Sbjct  166  APMCKISEAMKPRWPIPEILSFVAKFFPTWAIVPTADVLSKSIKVEKKKPIGEMNPMRYR  225

Query  479  GKPRVGTMREIARQCEYVQNNFEKVSVGFLTVHGTADGVTCPSGSQMLYDKASSSDKTLK  300
            GKPR+GT+ E+ R  +Y+      VS+ F+ +HG AD VT P+ S+ LY+++ S+DKT+K
Sbjct  226  GKPRLGTVVELLRVTDYLSQRLCDVSIPFMVLHGNADVVTDPNVSRALYEESQSNDKTIK  285

Query  299  LYQGLYHSLIQGEPDEDANRVLADMREWIDERV  201
            +Y G+ HSL+ GE DE+   V  D+  W++ R 
Sbjct  286  IYDGMMHSLLFGETDENIQIVRNDISSWLNCRC  318



>ref|XP_002316636.1| hydrolase family protein [Populus trichocarpa]
 gb|EEE97248.1| hydrolase family protein [Populus trichocarpa]
Length=323

 Score =   115 bits (289),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 59/156 (38%), Positives = 94/156 (60%), Gaps = 0/156 (0%)
 Frame = -2

Query  659  APLFVIPENMKPSKVHLFMYGLLFGFADTWAMMPDNKMVGKAIRDVEKLKIIASNPRRYT  480
            AP+  I +++KP      +  L+  F  T A++P   ++ K+I+   K+ I   NP RY 
Sbjct  166  APMCKISDSIKPRWPISDILLLVAKFLPTLAIVPAASILHKSIKVERKVPIAEMNPMRYR  225

Query  479  GKPRVGTMREIARQCEYVQNNFEKVSVGFLTVHGTADGVTCPSGSQMLYDKASSSDKTLK  300
            GKPR+GT+ E+ R  +Y+  N   V++ F+ +HG+ D VT P  S+ LY++A S DKT+K
Sbjct  226  GKPRLGTVVELLRVTDYLSQNLRNVTIPFIVLHGSMDVVTDPKVSESLYEEAKSEDKTIK  285

Query  299  LYQGLYHSLIQGEPDEDANRVLADMREWIDERVSCN  192
            +Y G+ HSL+ GE DE+   V  D+  W+++R   N
Sbjct  286  IYDGMVHSLLFGETDENVEIVRQDIISWLNDRCKQN  321



>ref|XP_006292403.1| hypothetical protein CARUB_v10018616mg [Capsella rubella]
 gb|EOA25301.1| hypothetical protein CARUB_v10018616mg [Capsella rubella]
Length=312

 Score =   115 bits (288),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 58/155 (37%), Positives = 97/155 (63%), Gaps = 1/155 (1%)
 Frame = -2

Query  659  APLFVIPENMKPSKVHLFMYGLLFGFADTW-AMMPDNKMVGKAIRDVEKLKIIASNPRRY  483
            AP+  I E MKPS++ + M  ++     +W +++P   ++  A +  EK + I +NP  Y
Sbjct  143  APMCKIAEEMKPSRMVISMINMVTNLIPSWKSIVPGPDIINNAFKLPEKRQEIIANPNCY  202

Query  482  TGKPRVGTMREIARQCEYVQNNFEKVSVGFLTVHGTADGVTCPSGSQMLYDKASSSDKTL  303
            +G+PR+ TM E+ R    ++N   +V++ F+ +HG  D VT    S++LY+ ASS+DKTL
Sbjct  203  SGRPRMKTMSELYRVSLDLENRLNEVTMPFIVLHGEDDKVTDKGVSKLLYEVASSNDKTL  262

Query  302  KLYQGLYHSLIQGEPDEDANRVLADMREWIDERVS  198
            KLY  ++HSL+ GEP E+A  V  D+ +W+  R++
Sbjct  263  KLYPDMWHSLLFGEPPENAEIVFNDIIQWMQTRIT  297



>ref|XP_009780674.1| PREDICTED: caffeoylshikimate esterase-like isoform X1 [Nicotiana 
sylvestris]
Length=323

 Score =   115 bits (288),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 60/152 (39%), Positives = 88/152 (58%), Gaps = 0/152 (0%)
 Frame = -2

Query  659  APLFVIPENMKPSKVHLFMYGLLFGFADTWAMMPDNKMVGKAIRDVEKLKIIASNPRRYT  480
            AP+  I E M+P      +      F  T A++P   ++ K+++  EK +I   NP  Y 
Sbjct  171  APMCKISEKMRPKWPIPQILTFFARFVPTLAIVPTTDLLDKSVKVPEKREIARMNPNGYN  230

Query  479  GKPRVGTMREIARQCEYVQNNFEKVSVGFLTVHGTADGVTCPSGSQMLYDKASSSDKTLK  300
            GKPR+GT+ E+    ++V      VS+ FL +HG+AD VT P  S+ LY KA S DKT+K
Sbjct  231  GKPRLGTVVELMHVTDFVSTKLYDVSIPFLVLHGSADVVTDPEVSKELYQKAKSKDKTIK  290

Query  299  LYQGLYHSLIQGEPDEDANRVLADMREWIDER  204
            +Y G+ HSL+ GE DE+   V  DM  W+++R
Sbjct  291  IYDGMVHSLLFGETDENVEIVRNDMLAWLNDR  322



>ref|XP_006850643.1| hypothetical protein AMTR_s00034p00202150 [Amborella trichopoda]
 gb|ERN12224.1| hypothetical protein AMTR_s00034p00202150 [Amborella trichopoda]
Length=316

 Score =   115 bits (288),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 57/154 (37%), Positives = 91/154 (59%), Gaps = 0/154 (0%)
 Frame = -2

Query  659  APLFVIPENMKPSKVHLFMYGLLFGFADTWAMMPDNKMVGKAIRDVEKLKIIASNPRRYT  480
            AP+  I + +KP    + +   L     TW ++P   ++  AI+  E+ + + SNP  Y 
Sbjct  144  APMCKIADELKPHPFVISILTKLCRVIPTWKIIPTKDIIDSAIKTQERREEVRSNPYCYK  203

Query  479  GKPRVGTMREIARQCEYVQNNFEKVSVGFLTVHGTADGVTCPSGSQMLYDKASSSDKTLK  300
            G+PR+ T  E+      ++NN  +VS+ FL VHG  D VT P  S++L +KASS+DK+L 
Sbjct  204  GRPRLKTGYELMMASMDIENNLHQVSLPFLIVHGEDDAVTDPDISKLLVEKASSTDKSLN  263

Query  299  LYQGLYHSLIQGEPDEDANRVLADMREWIDERVS  198
            LY G+ H+L  GE  E+ + V  D+ EW++ER++
Sbjct  264  LYPGMCHALTSGETQENIDLVFCDIVEWLEERIN  297



>ref|XP_009407468.1| PREDICTED: caffeoylshikimate esterase-like [Musa acuminata subsp. 
malaccensis]
Length=323

 Score =   115 bits (288),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 60/159 (38%), Positives = 90/159 (57%), Gaps = 0/159 (0%)
 Frame = -2

Query  659  APLFVIPENMKPSKVHLFMYGLLFGFADTWAMMPDNKMVGKAIRDVEKLKIIASNPRRYT  480
            AP+  I + +KP    + +   L     TW ++P   ++  AI+  EK + + SN   Y 
Sbjct  143  APMCKIADELKPHPFVVSILKKLSYIIPTWKIVPTRDIIDIAIKTPEKREEVRSNQYCYK  202

Query  479  GKPRVGTMREIARQCEYVQNNFEKVSVGFLTVHGTADGVTCPSGSQMLYDKASSSDKTLK  300
            GKPR+ T  E+      ++ N  +VS+ FL VHG  D VT PS S++LY+ ASS DKT K
Sbjct  203  GKPRLKTAHELLMASLDIEQNLHQVSLPFLVVHGGDDIVTDPSVSKLLYETASSEDKTFK  262

Query  299  LYQGLYHSLIQGEPDEDANRVLADMREWIDERVSCNGTA  183
            LY G++H+L  GEP E  + V +D+  W+D+R +    A
Sbjct  263  LYPGMWHALTSGEPPESIDLVFSDIIAWLDQRTTTQDPA  301



>ref|XP_007211531.1| hypothetical protein PRUPE_ppa008252mg [Prunus persica]
 gb|EMJ12730.1| hypothetical protein PRUPE_ppa008252mg [Prunus persica]
Length=339

 Score =   115 bits (288),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 62/158 (39%), Positives = 100/158 (63%), Gaps = 2/158 (1%)
 Frame = -2

Query  659  APLFVIPENMKPSKVHLFMYGLLFGFADTWAMMPDNKMVGKAIRDVEKLKIIAS-NPRRY  483
            AP+  I + +KP      +   +  F  + A++P   ++ K+++ VE+ KIIA+ NP RY
Sbjct  179  APMCKISDKVKPRWPIPQILTFVARFFPSLAIVPTADLMYKSVK-VEEKKIIANMNPMRY  237

Query  482  TGKPRVGTMREIARQCEYVQNNFEKVSVGFLTVHGTADGVTCPSGSQMLYDKASSSDKTL  303
             GKPR+GT+ E+ +  EYV      VS+ F+ +HG+AD VT P+ S+ LY++A S DKT+
Sbjct  238  RGKPRLGTVVELLKVTEYVSQRLGDVSLPFIVLHGSADVVTDPNVSRALYEEAKSEDKTI  297

Query  302  KLYQGLYHSLIQGEPDEDANRVLADMREWIDERVSCNG  189
            K+Y+G+ HSL+ GE D++ + V AD+  W++ R    G
Sbjct  298  KIYEGMMHSLLFGETDQNVDIVRADILSWLNHRCHARG  335



>ref|XP_004516671.1| PREDICTED: monoglyceride lipase-like isoform X3 [Cicer arietinum]
 ref|XP_004516672.1| PREDICTED: monoglyceride lipase-like isoform X4 [Cicer arietinum]
Length=262

 Score =   114 bits (285),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 61/154 (40%), Positives = 89/154 (58%), Gaps = 0/154 (0%)
 Frame = -2

Query  665  FSAPLFVIPENMKPSKVHLFMYGLLFGFADTWAMMPDNKMVGKAIRDVEKLKIIASNPRR  486
              AP+  I ENM P K+   M   +        ++P   +   A +D +K +  A N   
Sbjct  102  LCAPMCKISENMIPPKLVFRMLIAMSNVLPKSKLVPTQDIGEAAFKDPKKKEQTAYNVIS  161

Query  485  YTGKPRVGTMREIARQCEYVQNNFEKVSVGFLTVHGTADGVTCPSGSQMLYDKASSSDKT  306
            YT KPR+ +  E+ +  E ++   E+V++  L +HG AD VT PS S+ LY+KASSSDK 
Sbjct  162  YTDKPRLRSAVELLKTTEEIEQKLEEVTIPLLILHGEADTVTDPSVSKALYEKASSSDKN  221

Query  305  LKLYQGLYHSLIQGEPDEDANRVLADMREWIDER  204
            LKLY+  YH+LI+GEPDE   +VL D+  W+D+ 
Sbjct  222  LKLYKDAYHALIEGEPDETIIQVLDDIISWLDDH  255



>ref|XP_008442222.1| PREDICTED: caffeoylshikimate esterase [Cucumis melo]
Length=319

 Score =   115 bits (287),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 62/154 (40%), Positives = 99/154 (64%), Gaps = 4/154 (3%)
 Frame = -2

Query  659  APLFVIPENMKPS-KVHLFMYGLLFGFADTWAMMPDNKMVGKAIRDVEKLKIIAS-NPRR  486
            AP+  I +N+KP   +  F+  +   F  T A++P   ++ K+++ VE+ KI+A  NP R
Sbjct  164  APMCKISDNVKPHWPIPQFLTAVA-KFLPTLAIVPTADLLDKSVK-VEEKKIVAEMNPMR  221

Query  485  YTGKPRVGTMREIARQCEYVQNNFEKVSVGFLTVHGTADGVTCPSGSQMLYDKASSSDKT  306
            Y GKPR+GT+ E+ R  E++    + VS+ F+ +HG AD VT P  S+ LY++A S DKT
Sbjct  222  YRGKPRLGTVVELLRVTEHLSQRLKDVSLPFIVLHGNADVVTDPDVSKTLYEEAKSEDKT  281

Query  305  LKLYQGLYHSLIQGEPDEDANRVLADMREWIDER  204
            +K+Y+G+ HS++ GE DE+   V  D+  W++ER
Sbjct  282  IKIYEGMMHSMLYGETDENVEIVRNDILRWLNER  315



>ref|XP_007050931.1| Alpha/beta-Hydrolases superfamily protein isoform 2 [Theobroma 
cacao]
 gb|EOX95088.1| Alpha/beta-Hydrolases superfamily protein isoform 2 [Theobroma 
cacao]
Length=317

 Score =   115 bits (287),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 60/158 (38%), Positives = 90/158 (57%), Gaps = 2/158 (1%)
 Frame = -2

Query  659  APLFVIPENMKPSKVHLFMYGLLFGFADTWAMMPDNKMVGKAIRDVEKLKIIASNPRRYT  480
            AP+  I E +KP  V + +   +      W ++P   ++  A +D  K ++I +N   Y 
Sbjct  111  APMCKISEKVKPHPVVVNILTKMEEIIPKWKIVPTKDVIDSAFKDPVKREVIRNNKLIYQ  170

Query  479  GKPRVGTMREIARQCEYVQNNFEKVSVGFLTVHGTADGVTCPSGSQMLYDKASSSDKTLK  300
             KPR+ T  E+ R    +++   +V++ F  +HG AD VT P  S+ LYDKASS DKT+K
Sbjct  171  DKPRLKTALEMLRTSMSLEDGLNEVTLPFFVLHGEADIVTDPEVSKALYDKASSRDKTIK  230

Query  299  LYQGLYHSLIQGEPDEDANRVLADMREWIDERVSCNGT  186
            LY G++H L  GEPDE+   V AD+  W+D+R  CN  
Sbjct  231  LYPGMWHGLTSGEPDENIEIVFADITAWLDKR--CNAV  266



>gb|EEE55639.1| hypothetical protein OsJ_04002 [Oryza sativa Japonica Group]
Length=269

 Score =   114 bits (285),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 57/159 (36%), Positives = 92/159 (58%), Gaps = 1/159 (1%)
 Frame = -2

Query  659  APLFVIPENMKPSKVHLFMYGLLFGFADTWAMMPDNKMVGKAIRDVEKLKIIASNPRRYT  480
            AP+  IP++M+P  + +    ++   A +W ++P   ++ K  +D E  K + SNP  Y 
Sbjct  108  APMCKIPDDMRPHPIAVSALKMVCAVAPSWRIIPTPDIIDKVCKDPEMRKQVRSNPYIYR  167

Query  479  GKPRVGTMREIARQCEYVQNNFEKVSVGFLTVHGTADGVTCPSGSQMLYDKASSSDKTLK  300
            GK  + T  E+      ++ N  +V++ FL +HG  D VT PS S++L+++AS  DKT K
Sbjct  168  GKLPLKTCHELLMVSLDIEKNLHEVTLPFLVLHGGDDIVTDPSVSKLLFEEASGRDKTFK  227

Query  299  LYQGLYHSLIQGEPDEDANRVLADMREWIDERVSCNGTA  183
            LY G++H+L    PD D  RV +D+  W+DER  C G+ 
Sbjct  228  LYPGMWHALTAELPD-DVERVYSDIISWLDERSDCAGSV  265



>ref|XP_009610353.1| PREDICTED: caffeoylshikimate esterase [Nicotiana tomentosiformis]
Length=321

 Score =   115 bits (287),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 61/152 (40%), Positives = 93/152 (61%), Gaps = 0/152 (0%)
 Frame = -2

Query  659  APLFVIPENMKPSKVHLFMYGLLFGFADTWAMMPDNKMVGKAIRDVEKLKIIASNPRRYT  480
            AP+  I + ++P         +L  FA T A++P   ++ K+++  EK  I   NP RY 
Sbjct  169  APMCKISDKVRPRWPIPQFLTILARFAPTLAIVPTADLLDKSVKVPEKKIIGGMNPNRYF  228

Query  479  GKPRVGTMREIARQCEYVQNNFEKVSVGFLTVHGTADGVTCPSGSQMLYDKASSSDKTLK  300
            GKPR+GT+ E+ R  +YV +    V++ FL +HG+AD VT P  S+ LY  A S DKTLK
Sbjct  229  GKPRLGTVLELLRVTDYVSSKLCDVNLPFLILHGSADVVTDPEVSRELYQLAKSKDKTLK  288

Query  299  LYQGLYHSLIQGEPDEDANRVLADMREWIDER  204
            +Y+G+ HSL+ GE DE+   V +D+  W+++R
Sbjct  289  IYEGMMHSLLFGETDENVEIVRSDILAWLNDR  320



>gb|EMT25222.1| hypothetical protein F775_13292 [Aegilops tauschii]
Length=282

 Score =   114 bits (284),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 57/157 (36%), Positives = 93/157 (59%), Gaps = 0/157 (0%)
 Frame = -2

Query  653  LFVIPENMKPSKVHLFMYGLLFGFADTWAMMPDNKMVGKAIRDVEKLKIIASNPRRYTGK  474
             F I + ++P      +  L+  FA T  ++P   ++ K+++   K  I A NP RY G+
Sbjct  126  FFRISDRIRPRWPVPEILTLVSRFAPTLPIVPTADLIEKSVKVPAKRLIAARNPMRYNGR  185

Query  473  PRVGTMREIARQCEYVQNNFEKVSVGFLTVHGTADGVTCPSGSQMLYDKASSSDKTLKLY  294
            PR+GT+ E+ R  + +     +V++ FL VHG+AD  T P+ S  LY+ A+S DKT+K+Y
Sbjct  186  PRLGTVMELLRATDELGARLGEVTIPFLVVHGSADEGTDPAVSGALYEAAASEDKTIKMY  245

Query  293  QGLYHSLIQGEPDEDANRVLADMREWIDERVSCNGTA  183
             G+ HS++ GEP+E+  RV  D+  W+ ER +   T+
Sbjct  246  DGMLHSMLFGEPEENIERVRGDILAWLSERCTPAATS  282



>ref|XP_010922433.1| PREDICTED: caffeoylshikimate esterase-like isoform X1 [Elaeis 
guineensis]
Length=324

 Score =   114 bits (286),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 58/152 (38%), Positives = 88/152 (58%), Gaps = 0/152 (0%)
 Frame = -2

Query  659  APLFVIPENMKPSKVHLFMYGLLFGFADTWAMMPDNKMVGKAIRDVEKLKIIASNPRRYT  480
            AP+  I E MKP  + + +   L     TW ++P   ++  AI++ E  + + +NP  Y 
Sbjct  143  APMCKIAEEMKPHPIVINVLTQLSKIIPTWKLIPTQDIIDSAIKNPEWREEVRNNPYCYK  202

Query  479  GKPRVGTMREIARQCEYVQNNFEKVSVGFLTVHGTADGVTCPSGSQMLYDKASSSDKTLK  300
            GKPR+ T  E+      ++ N  +V++ F+ VHG  D VT PS S+ LY+ ASS DKT  
Sbjct  203  GKPRLKTGYELLMVSLDIEKNLHQVTLPFIVVHGGDDIVTDPSVSRSLYETASSKDKTFN  262

Query  299  LYQGLYHSLIQGEPDEDANRVLADMREWIDER  204
            LY G++H+L  GEP E  + V +D+  W+DER
Sbjct  263  LYPGMWHALTSGEPQESIDLVFSDIIAWLDER  294



>dbj|BAH20221.1| AT2G39420 [Arabidopsis thaliana]
Length=194

 Score =   112 bits (279),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 57/154 (37%), Positives = 89/154 (58%), Gaps = 0/154 (0%)
 Frame = -2

Query  659  APLFVIPENMKPSKVHLFMYGLLFGFADTWAMMPDNKMVGKAIRDVEKLKIIASNPRRYT  480
            AP+  I E MKPS + + +   L G   +W ++P   ++  A +  E  K +  NP  Y 
Sbjct  20   APMCKIAEEMKPSPLVISILAELSGVIPSWKIIPGQDIIETAFKQPEIRKQVRENPYCYK  79

Query  479  GKPRVGTMREIARQCEYVQNNFEKVSVGFLTVHGTADGVTCPSGSQMLYDKASSSDKTLK  300
            G+PR+ T  E+ R    ++    +VS+ F+ +HG  D VT  + S+ LY+ ASSSDKT K
Sbjct  80   GRPRLKTAYELLRVSTDLEKRLNEVSLPFIVLHGEDDKVTDKAVSRQLYEVASSSDKTFK  139

Query  299  LYQGLYHSLIQGEPDEDANRVLADMREWIDERVS  198
            LY G++H L+ GE  E+   V AD+  W+D++V+
Sbjct  140  LYPGMWHGLLYGETPENIETVFADIIGWLDKKVA  173



>ref|XP_010686578.1| PREDICTED: caffeoylshikimate esterase [Beta vulgaris subsp. vulgaris]
Length=308

 Score =   114 bits (285),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 57/152 (38%), Positives = 93/152 (61%), Gaps = 0/152 (0%)
 Frame = -2

Query  659  APLFVIPENMKPSKVHLFMYGLLFGFADTWAMMPDNKMVGKAIRDVEKLKIIASNPRRYT  480
            AP+  I + +KPS     +  L+  F  T  ++P   ++ K+++  EK  I   NP RY 
Sbjct  155  APMCKISDKVKPSWPIPEILTLVGKFMPTLPIVPSPDLLDKSVKVAEKKAIAVMNPLRYN  214

Query  479  GKPRVGTMREIARQCEYVQNNFEKVSVGFLTVHGTADGVTCPSGSQMLYDKASSSDKTLK  300
            GKPR+GT+ E+ R  +Y+ +    V++ F+ +HG++D VT P+ S  LY++A S DKT+K
Sbjct  215  GKPRLGTVIELLRVTDYLSSKLNDVTIPFVVLHGSSDVVTDPNVSIALYEEAKSKDKTIK  274

Query  299  LYQGLYHSLIQGEPDEDANRVLADMREWIDER  204
            +Y+G+ HSL+ GE DE+   V  D+  W+ +R
Sbjct  275  IYEGMLHSLLFGETDENIKLVRNDILAWLSDR  306



>ref|XP_006479967.1| PREDICTED: caffeoylshikimate esterase-like [Citrus sinensis]
Length=367

 Score =   114 bits (286),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 61/161 (38%), Positives = 93/161 (58%), Gaps = 1/161 (1%)
 Frame = -2

Query  659  APLFVIPENMKPSKVHLFMYGLLFGFADTWAMMPDNKMVGKAIRDVEKLKIIASNPRRYT  480
            AP+  I E +KP  V + +   +      W ++P   ++  A +D  K + I +N   Y 
Sbjct  159  APMCKISEKVKPHPVLVNILTRVEEIIPKWKIVPTKDVIDSAFKDSIKREEIRNNKLIYQ  218

Query  479  GKPRVGTMREIARQCEYVQNNFEKVSVGFLTVHGTADGVTCPSGSQMLYDKASSSDKTLK  300
             KPR+ T  E+ R    ++++  KV + F  +HG AD VT P  S+ LY++ASS DKT+K
Sbjct  219  DKPRLKTALEMLRTSMSLEDSLSKVMIPFFVLHGEADTVTDPEVSKALYERASSRDKTIK  278

Query  299  LYQGLYHSLIQGEPDEDANRVLADMREWIDERVS-CNGTAV  180
            LY G++H+L  GEPDE+ + V  D+  W+DER+S  N  AV
Sbjct  279  LYPGMWHALTSGEPDENIDIVFGDIIAWLDERMSDANAIAV  319



>ref|XP_006444359.1| hypothetical protein CICLE_v10020811mg [Citrus clementina]
 gb|ESR57599.1| hypothetical protein CICLE_v10020811mg [Citrus clementina]
 gb|KDO87207.1| hypothetical protein CISIN_1g018375mg [Citrus sinensis]
Length=357

 Score =   114 bits (286),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 61/161 (38%), Positives = 93/161 (58%), Gaps = 1/161 (1%)
 Frame = -2

Query  659  APLFVIPENMKPSKVHLFMYGLLFGFADTWAMMPDNKMVGKAIRDVEKLKIIASNPRRYT  480
            AP+  I E +KP  V + +   +      W ++P   ++  A +D  K + I +N   Y 
Sbjct  149  APMCKISEKVKPHPVLVNILTRVEEIIPKWKIVPTKDVIDSAFKDSIKREEIRNNKLIYQ  208

Query  479  GKPRVGTMREIARQCEYVQNNFEKVSVGFLTVHGTADGVTCPSGSQMLYDKASSSDKTLK  300
             KPR+ T  E+ R    ++++  KV + F  +HG AD VT P  S+ LY++ASS DKT+K
Sbjct  209  DKPRLKTALEMLRTSMSLEDSLSKVMIPFFVLHGEADTVTDPEVSKALYERASSRDKTIK  268

Query  299  LYQGLYHSLIQGEPDEDANRVLADMREWIDERVS-CNGTAV  180
            LY G++H+L  GEPDE+ + V  D+  W+DER+S  N  AV
Sbjct  269  LYPGMWHALTSGEPDENIDIVFGDIIAWLDERMSDANAIAV  309



>ref|XP_001760395.1| predicted protein [Physcomitrella patens]
 gb|EDQ74786.1| predicted protein [Physcomitrella patens]
Length=341

 Score =   114 bits (285),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 57/159 (36%), Positives = 89/159 (56%), Gaps = 0/159 (0%)
 Frame = -2

Query  665  FSAPLFVIPENMKPSKVHLFMYGLLFGFADTWAMMPDNKMVGKAIRDVEKLKIIASNPRR  486
              AP+  I E++KP  +   +   L G+  TW ++P   ++  A +D  K + I +NP  
Sbjct  143  LQAPMCKISESVKPPSIVTSILTKLAGYIPTWKIVPAANIIDNAFKDPIKREEIRANPLI  202

Query  485  YTGKPRVGTMREIARQCEYVQNNFEKVSVGFLTVHGTADGVTCPSGSQMLYDKASSSDKT  306
            Y G+PRV T  E+ R  E ++N  ++V + FL +HG  D VT P  S+ L+  + SSDK 
Sbjct  203  YQGRPRVKTALEMVRASEDLENRLDEVVLPFLLLHGEEDRVTDPDVSRALFQASKSSDKE  262

Query  305  LKLYQGLYHSLIQGEPDEDANRVLADMREWIDERVSCNG  189
             KLY G++H L  GEPD++   V  D+  W+D+R   + 
Sbjct  263  FKLYPGMWHGLTAGEPDDNIELVFKDIILWLDKRTCSSA  301



>ref|XP_009782580.1| PREDICTED: caffeoylshikimate esterase [Nicotiana sylvestris]
Length=321

 Score =   114 bits (284),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 60/153 (39%), Positives = 92/153 (60%), Gaps = 0/153 (0%)
 Frame = -2

Query  659  APLFVIPENMKPSKVHLFMYGLLFGFADTWAMMPDNKMVGKAIRDVEKLKIIASNPRRYT  480
            AP+  I + ++P         +L  FA T A++P   ++ K+++  EK  I   NP RY 
Sbjct  169  APMCKISDKVRPRWPIPQFLTILARFAPTLAIVPTADLLDKSVKVPEKKIIGGMNPNRYV  228

Query  479  GKPRVGTMREIARQCEYVQNNFEKVSVGFLTVHGTADGVTCPSGSQMLYDKASSSDKTLK  300
            GKPR+GT+ E+ R  +YV +    V++ FL +HG+AD VT P  S+ LY  A   DKTLK
Sbjct  229  GKPRLGTVLELLRVTDYVSSKLCDVNLPFLILHGSADVVTDPEVSRELYQLAKCKDKTLK  288

Query  299  LYQGLYHSLIQGEPDEDANRVLADMREWIDERV  201
            +Y+G+ HSL+ GE DE+   V +D+  W+++R 
Sbjct  289  IYEGMMHSLLFGETDENVEIVRSDILAWLNDRC  321



>gb|KHG10802.1| Monoglyceride lipase [Gossypium arboreum]
Length=304

 Score =   114 bits (284),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 58/160 (36%), Positives = 89/160 (56%), Gaps = 2/160 (1%)
 Frame = -2

Query  659  APLFVIPENMKPSKVHLFMYGLLFGFADTWAMMPDNKMVGKAIRDVEKLKIIASNPRRYT  480
            AP+  I E +KP  V + +   +      W ++P   ++  A +D  K + + +N   Y 
Sbjct  97   APMCKISEKLKPHPVVINILTKMEQVIPRWKIVPSKDVIDSAFKDPVKREAVRNNKLIYQ  156

Query  479  GKPRVGTMREIARQCEYVQNNFEKVSVGFLTVHGTADGVTCPSGSQMLYDKASSSDKTLK  300
             KPR+ T  E+ R    ++N   +V + F  +HG AD VT P  S+ LY+KA S+DKT+K
Sbjct  157  DKPRLKTALEVLRTSMSIENGLNEVRLPFFVLHGEADTVTDPEVSKALYEKARSTDKTIK  216

Query  299  LYQGLYHSLIQGEPDEDANRVLADMREWIDERVSCNGTAV  180
            LY G++H L  GEPDE+   V AD+  W+D+R  CN   +
Sbjct  217  LYPGMWHGLTAGEPDENVEMVFADIIGWLDKR--CNAVTL  254



>ref|XP_009126094.1| PREDICTED: caffeoylshikimate esterase-like isoform X2 [Brassica 
rapa]
Length=384

 Score =   114 bits (286),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 65/157 (41%), Positives = 91/157 (58%), Gaps = 6/157 (4%)
 Frame = -2

Query  659  APLFVIPENMKPSKVHLFMYGLLFGFADTWA---MMPDNKMVGKAIRDVEKLKIIASNPR  489
            AP+  I ++M P  V   +  +L G A+      ++P   +   A RDV K  +   N  
Sbjct  220  APMCKIADDMVPPPV---LKQILIGLANVLPKHKLVPQKDLAEAAFRDVRKRNMTQYNVI  276

Query  488  RYTGKPRVGTMREIARQCEYVQNNFEKVSVGFLTVHGTADGVTCPSGSQMLYDKASSSDK  309
             Y+GKPR+ T  E+ R  + ++   EKVS+  L +HG AD VT PS S+ LY KA SSDK
Sbjct  277  CYSGKPRLRTAVEMLRTTQEIEQQLEKVSLPILILHGEADIVTDPSVSRELYQKAKSSDK  336

Query  308  TLKLYQGLYHSLIQGEPDEDANRVLADMREWIDERVS  198
             + LY+  YHSL++GEPDE   RVLAD+  W+D+  S
Sbjct  337  KIVLYKDAYHSLLEGEPDEMILRVLADIISWLDDHSS  373



>ref|XP_011096267.1| PREDICTED: caffeoylshikimate esterase [Sesamum indicum]
Length=330

 Score =   114 bits (284),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 58/154 (38%), Positives = 94/154 (61%), Gaps = 0/154 (0%)
 Frame = -2

Query  659  APLFVIPENMKPSKVHLFMYGLLFGFADTWAMMPDNKMVGKAIRDVEKLKIIASNPRRYT  480
            AP+  I + ++P      +   + G A T  ++P   ++ K+++  EK  I   NP RY 
Sbjct  166  APMCRISDKVRPKWPIPQILTAVAGIAPTLPIVPTADLLEKSVKVPEKKIIGVMNPMRYQ  225

Query  479  GKPRVGTMREIARQCEYVQNNFEKVSVGFLTVHGTADGVTCPSGSQMLYDKASSSDKTLK  300
            GKPR+GT+ E+ R  +YV +    VS+ F+ +HG+AD VT P+ S+ LY  A S DK++K
Sbjct  226  GKPRLGTVLELLRVTDYVSSKLSDVSIPFIVIHGSADVVTDPAVSRELYQVAKSEDKSIK  285

Query  299  LYQGLYHSLIQGEPDEDANRVLADMREWIDERVS  198
            +Y+G+ HSL+ GE DE+   V  D+ +W+++R S
Sbjct  286  IYEGMMHSLLFGETDENVAIVRGDILKWLNDRCS  319



>ref|XP_009126093.1| PREDICTED: caffeoylshikimate esterase-like isoform X1 [Brassica 
rapa]
Length=394

 Score =   114 bits (286),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 65/157 (41%), Positives = 91/157 (58%), Gaps = 6/157 (4%)
 Frame = -2

Query  659  APLFVIPENMKPSKVHLFMYGLLFGFADTWA---MMPDNKMVGKAIRDVEKLKIIASNPR  489
            AP+  I ++M P  V   +  +L G A+      ++P   +   A RDV K  +   N  
Sbjct  230  APMCKIADDMVPPPV---LKQILIGLANVLPKHKLVPQKDLAEAAFRDVRKRNMTQYNVI  286

Query  488  RYTGKPRVGTMREIARQCEYVQNNFEKVSVGFLTVHGTADGVTCPSGSQMLYDKASSSDK  309
             Y+GKPR+ T  E+ R  + ++   EKVS+  L +HG AD VT PS S+ LY KA SSDK
Sbjct  287  CYSGKPRLRTAVEMLRTTQEIEQQLEKVSLPILILHGEADIVTDPSVSRELYQKAKSSDK  346

Query  308  TLKLYQGLYHSLIQGEPDEDANRVLADMREWIDERVS  198
             + LY+  YHSL++GEPDE   RVLAD+  W+D+  S
Sbjct  347  KIVLYKDAYHSLLEGEPDEMILRVLADIISWLDDHSS  383



>ref|XP_004516669.1| PREDICTED: monoglyceride lipase-like isoform X1 [Cicer arietinum]
Length=344

 Score =   114 bits (284),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 61/155 (39%), Positives = 89/155 (57%), Gaps = 0/155 (0%)
 Frame = -2

Query  665  FSAPLFVIPENMKPSKVHLFMYGLLFGFADTWAMMPDNKMVGKAIRDVEKLKIIASNPRR  486
              AP+  I ENM P K+   M   +        ++P   +   A +D +K +  A N   
Sbjct  184  LCAPMCKISENMIPPKLVFRMLIAMSNVLPKSKLVPTQDIGEAAFKDPKKKEQTAYNVIS  243

Query  485  YTGKPRVGTMREIARQCEYVQNNFEKVSVGFLTVHGTADGVTCPSGSQMLYDKASSSDKT  306
            YT KPR+ +  E+ +  E ++   E+V++  L +HG AD VT PS S+ LY+KASSSDK 
Sbjct  244  YTDKPRLRSAVELLKTTEEIEQKLEEVTIPLLILHGEADTVTDPSVSKALYEKASSSDKN  303

Query  305  LKLYQGLYHSLIQGEPDEDANRVLADMREWIDERV  201
            LKLY+  YH+LI+GEPDE   +VL D+  W+D+  
Sbjct  304  LKLYKDAYHALIEGEPDETIIQVLDDIISWLDDHT  338



>emb|CDY02917.1| BnaC04g25690D [Brassica napus]
Length=368

 Score =   114 bits (285),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 58/155 (37%), Positives = 93/155 (60%), Gaps = 1/155 (1%)
 Frame = -2

Query  659  APLFVIPENMKPSKVHLFMYGLLFGFADTW-AMMPDNKMVGKAIRDVEKLKIIASNPRRY  483
            AP+  I E MKP K  + M  L+     +W +++P   ++  AI+   K + I  NP  Y
Sbjct  198  APMCKIAEEMKPPKTVISMMNLVIHLIPSWKSILPGPDIINLAIKQPHKRQEIKDNPNCY  257

Query  482  TGKPRVGTMREIARQCEYVQNNFEKVSVGFLTVHGTADGVTCPSGSQMLYDKASSSDKTL  303
             G+PR+ TM E+ R    ++N   +V++ F+ +HG  D VT    S++LY+ ASS+DKTL
Sbjct  258  IGRPRMKTMSELFRVSLDLENRLHEVTMPFIVLHGEDDKVTDKEASKLLYEVASSNDKTL  317

Query  302  KLYQGLYHSLIQGEPDEDANRVLADMREWIDERVS  198
            KLY  ++HSL+ GEP E +  V  D+ +W++ R++
Sbjct  318  KLYPEMWHSLLFGEPLEKSELVFNDIVQWMETRIN  352



>ref|XP_008784749.1| PREDICTED: caffeoylshikimate esterase-like isoform X2 [Phoenix 
dactylifera]
Length=356

 Score =   114 bits (284),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 58/154 (38%), Positives = 89/154 (58%), Gaps = 0/154 (0%)
 Frame = -2

Query  665  FSAPLFVIPENMKPSKVHLFMYGLLFGFADTWAMMPDNKMVGKAIRDVEKLKIIASNPRR  486
             +AP+  I E MKPS + + +   +      W ++P   +V  A +D  K ++I  N   
Sbjct  142  LAAPMCKISEEMKPSPIVVNILTQVEDIIPAWKIVPTKDIVDTAFKDPVKREVIRHNKLI  201

Query  485  YTGKPRVGTMREIARQCEYVQNNFEKVSVGFLTVHGTADGVTCPSGSQMLYDKASSSDKT  306
            Y  KPR+ T  E+ R    ++++  KV++ FL +HG AD VT P  S+ LYD+ASS DKT
Sbjct  202  YKDKPRLKTALELLRTSMDLEDSLSKVNLPFLVLHGEADLVTDPEVSRALYDRASSVDKT  261

Query  305  LKLYQGLYHSLIQGEPDEDANRVLADMREWIDER  204
            + LY G++H L  GEPD +  +V +D+  W+D R
Sbjct  262  ITLYPGMWHGLTSGEPDINVEKVFSDVIAWLDHR  295



>ref|XP_008224992.1| PREDICTED: caffeoylshikimate esterase [Prunus mume]
Length=322

 Score =   113 bits (283),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 61/153 (40%), Positives = 99/153 (65%), Gaps = 2/153 (1%)
 Frame = -2

Query  659  APLFVIPENMKPSKVHLFMYGLLFGFADTWAMMPDNKMVGKAIRDVEKLKIIAS-NPRRY  483
            AP+  I + +KP      +   +  F  + A++P   ++ K+++ VE+ KIIA+ NP RY
Sbjct  168  APMCKISDKVKPRWPIPQILTFVARFFPSLAIVPTADLMYKSVK-VEEKKIIANMNPMRY  226

Query  482  TGKPRVGTMREIARQCEYVQNNFEKVSVGFLTVHGTADGVTCPSGSQMLYDKASSSDKTL  303
             GKPR+GT+ E+ +  EYV      VS+ F+ +HG+AD VT P+ S+ LY++A S DKT+
Sbjct  227  RGKPRLGTVVELLKVTEYVSQRLGDVSLPFIVLHGSADVVTDPNVSRALYEEAKSEDKTI  286

Query  302  KLYQGLYHSLIQGEPDEDANRVLADMREWIDER  204
            K+Y+G+ HSL+ GE D++ + V AD+  W++ R
Sbjct  287  KIYEGMMHSLLFGETDQNVDIVRADILSWLNHR  319



>emb|CDX76116.1| BnaA04g03800D [Brassica napus]
Length=346

 Score =   114 bits (284),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 58/155 (37%), Positives = 93/155 (60%), Gaps = 1/155 (1%)
 Frame = -2

Query  659  APLFVIPENMKPSKVHLFMYGLLFGFADTW-AMMPDNKMVGKAIRDVEKLKIIASNPRRY  483
            AP+  I E MKP K  + M  L+     +W +++P   ++  AI+   K + I  NP  Y
Sbjct  176  APMCKIAEEMKPPKTVISMMNLVIHLIPSWKSILPGPDIINLAIKQPHKRQEIKDNPNCY  235

Query  482  TGKPRVGTMREIARQCEYVQNNFEKVSVGFLTVHGTADGVTCPSGSQMLYDKASSSDKTL  303
             G+PR+ TM E+ R    ++N   +V++ F+ +HG  D VT    S++LY+ ASS+DKTL
Sbjct  236  IGRPRMKTMSELFRVSLDLENRLHEVTMPFIVLHGEDDKVTDKEASKLLYEVASSNDKTL  295

Query  302  KLYQGLYHSLIQGEPDEDANRVLADMREWIDERVS  198
            KLY  ++HSL+ GEP E +  V  D+ +W++ R++
Sbjct  296  KLYPEMWHSLLFGEPLEKSEIVFNDIVQWMETRIN  330



>ref|XP_004234129.1| PREDICTED: caffeoylshikimate esterase [Solanum lycopersicum]
Length=317

 Score =   113 bits (283),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 62/152 (41%), Positives = 91/152 (60%), Gaps = 0/152 (0%)
 Frame = -2

Query  659  APLFVIPENMKPSKVHLFMYGLLFGFADTWAMMPDNKMVGKAIRDVEKLKIIASNPRRYT  480
            AP+  I + +KP         L+  FA T A++P   ++ K+++  EK  I   NP RY 
Sbjct  165  APMCKISDKVKPIWPIAQFLTLVARFAPTLAVVPTADLLEKSVKVPEKRIIGGRNPNRYF  224

Query  479  GKPRVGTMREIARQCEYVQNNFEKVSVGFLTVHGTADGVTCPSGSQMLYDKASSSDKTLK  300
            GKPR+GT+ E+ R  +YV +    V + FL +HG+AD VT P  S+ LY  A S+DKTLK
Sbjct  225  GKPRLGTVVELLRVTDYVSSKLCDVIMPFLVLHGSADVVTDPEVSRELYKLAKSTDKTLK  284

Query  299  LYQGLYHSLIQGEPDEDANRVLADMREWIDER  204
            +Y G+ HSL+ GE DE+   V  D+  W+++R
Sbjct  285  IYDGMMHSLLFGETDENVEIVRGDILAWLNDR  316



>emb|CDY24963.1| BnaC03g22090D [Brassica napus]
Length=318

 Score =   113 bits (283),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 60/154 (39%), Positives = 88/154 (57%), Gaps = 0/154 (0%)
 Frame = -2

Query  659  APLFVIPENMKPSKVHLFMYGLLFGFADTWAMMPDNKMVGKAIRDVEKLKIIASNPRRYT  480
            AP+  I E MKPS + + +   L G   TW ++P   ++  A +  E  K +  NP  Y 
Sbjct  144  APMCKIAEEMKPSPLVISILSKLSGVIPTWKIIPGQDIIETAFKQPEIRKQVRENPYCYK  203

Query  479  GKPRVGTMREIARQCEYVQNNFEKVSVGFLTVHGTADGVTCPSGSQMLYDKASSSDKTLK  300
            G+PR+ T  E+ R    ++    +VS+ FL +HG  D VT  + S+ LY+ ASSSDKT K
Sbjct  204  GRPRLKTAYELLRVSTDLEKRLNEVSLPFLVLHGEDDKVTDKAVSRELYETASSSDKTFK  263

Query  299  LYQGLYHSLIQGEPDEDANRVLADMREWIDERVS  198
            LY G++H L+ GE  E+   V AD+  W+D+R S
Sbjct  264  LYPGMWHGLLYGETPENIEIVFADIIGWLDKRAS  297



>ref|XP_010554568.1| PREDICTED: caffeoylshikimate esterase [Tarenaya hassleriana]
Length=315

 Score =   113 bits (282),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 57/154 (37%), Positives = 91/154 (59%), Gaps = 0/154 (0%)
 Frame = -2

Query  659  APLFVIPENMKPSKVHLFMYGLLFGFADTWAMMPDNKMVGKAIRDVEKLKIIASNPRRYT  480
            AP+  I + MKP  V + +   L     TW ++P N ++  A ++ +  + +  N   Y 
Sbjct  144  APMCKIADEMKPHPVVISVLTKLSRLIPTWKIVPGNDIIDVAFKEPKVRQQVRENKYCYK  203

Query  479  GKPRVGTMREIARQCEYVQNNFEKVSVGFLTVHGTADGVTCPSGSQMLYDKASSSDKTLK  300
            GKPR+ T  E+ R    ++ N +++S+ F+ +HG  D VT  S S++LYD ASSSDKT K
Sbjct  204  GKPRLKTAHELLRVSLDLEKNLQEISMPFIVLHGEDDKVTDKSISKLLYDVASSSDKTFK  263

Query  299  LYQGLYHSLIQGEPDEDANRVLADMREWIDERVS  198
            LY+ ++H L+ GEP E+   V  D+  W+D+RV+
Sbjct  264  LYEKMWHGLLYGEPPENTEIVFGDIIRWLDDRVN  297



>ref|XP_006411167.1| hypothetical protein EUTSA_v10016835mg [Eutrema salsugineum]
 gb|ESQ52620.1| hypothetical protein EUTSA_v10016835mg [Eutrema salsugineum]
Length=365

 Score =   114 bits (284),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 60/154 (39%), Positives = 88/154 (57%), Gaps = 0/154 (0%)
 Frame = -2

Query  659  APLFVIPENMKPSKVHLFMYGLLFGFADTWAMMPDNKMVGKAIRDVEKLKIIASNPRRYT  480
            AP+  I E MKPS V + +   L G   TW ++P   ++  A +  E  K +  NP  Y 
Sbjct  191  APMCKIAEEMKPSPVVISILSKLSGVIPTWKIIPGQDIIETAFKQPEIRKQVRENPYCYK  250

Query  479  GKPRVGTMREIARQCEYVQNNFEKVSVGFLTVHGTADGVTCPSGSQMLYDKASSSDKTLK  300
            G+PR+ T  E+ R    ++    +VS+ F+ +HG  D VT  + S+ LY+ ASSSDKT K
Sbjct  251  GRPRLKTAYELLRISTDLEKRLNEVSLPFMVLHGEDDKVTDKAVSRELYEVASSSDKTFK  310

Query  299  LYQGLYHSLIQGEPDEDANRVLADMREWIDERVS  198
            LY G++H L+ GE  E+   V AD+  W+D+R S
Sbjct  311  LYPGMWHGLLYGETPENIEIVFADIINWLDKRAS  344



>emb|CDY38132.1| BnaC02g06410D [Brassica napus]
Length=605

 Score =   115 bits (289),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 65/157 (41%), Positives = 91/157 (58%), Gaps = 6/157 (4%)
 Frame = -2

Query  659  APLFVIPENMKPSKVHLFMYGLLFGFADTW---AMMPDNKMVGKAIRDVEKLKIIASNPR  489
            AP+  I ++M P  V   +  +L G A+      ++P   +   A RDV K  +   N  
Sbjct  220  APMCKIADDMVPPPV---LKQILIGLANVLPKHKLVPQKDLAEAAFRDVRKRNMTQYNVI  276

Query  488  RYTGKPRVGTMREIARQCEYVQNNFEKVSVGFLTVHGTADGVTCPSGSQMLYDKASSSDK  309
             Y+GKPR+ T  E+ R  + ++   EKVS+  L +HG AD VT PS S+ LY KA SSDK
Sbjct  277  CYSGKPRLRTAVEMLRTTQEIEQQLEKVSLPILILHGEADTVTDPSVSRELYQKAKSSDK  336

Query  308  TLKLYQGLYHSLIQGEPDEDANRVLADMREWIDERVS  198
             + LY+  YHSL++GEPDE   RVLAD+  W+D+  S
Sbjct  337  KIVLYKDAYHSLLEGEPDEMILRVLADIISWLDDHSS  373



>ref|XP_004146590.1| PREDICTED: monoglyceride lipase-like [Cucumis sativus]
 ref|XP_004158035.1| PREDICTED: monoglyceride lipase-like [Cucumis sativus]
 gb|KGN64644.1| hypothetical protein Csa_1G073040 [Cucumis sativus]
Length=319

 Score =   113 bits (282),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 61/154 (40%), Positives = 100/154 (65%), Gaps = 4/154 (3%)
 Frame = -2

Query  659  APLFVIPENMKPS-KVHLFMYGLLFGFADTWAMMPDNKMVGKAIRDVEKLKIIAS-NPRR  486
            AP+  I +N+KP   +  F+  +   F  T A++P   ++ K+++ VE+ KI+A  NP R
Sbjct  164  APMCKISDNVKPHWPIPQFLTAVA-QFLPTLAIVPTADLLDKSVK-VEEKKIVAEMNPMR  221

Query  485  YTGKPRVGTMREIARQCEYVQNNFEKVSVGFLTVHGTADGVTCPSGSQMLYDKASSSDKT  306
            Y GKPR+GT+ E+ R  E++    + V++ F+ +HG AD VT P+ S+ LY++A S DKT
Sbjct  222  YRGKPRLGTVVELLRVTEHLSQRLKDVNLPFIVLHGNADVVTDPNVSKTLYEEAKSEDKT  281

Query  305  LKLYQGLYHSLIQGEPDEDANRVLADMREWIDER  204
            +K+Y+G+ HS++ GE DE+   V  D+  W++ER
Sbjct  282  IKIYEGMMHSMLYGETDENVEIVRNDILCWLNER  315



>gb|EEC71757.1| hypothetical protein OsI_04349 [Oryza sativa Indica Group]
Length=304

 Score =   112 bits (281),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 56/159 (35%), Positives = 92/159 (58%), Gaps = 1/159 (1%)
 Frame = -2

Query  659  APLFVIPENMKPSKVHLFMYGLLFGFADTWAMMPDNKMVGKAIRDVEKLKIIASNPRRYT  480
            AP+  IP++M+P  + +    ++   A +W ++P   ++ K  +D E  K + SNP  Y 
Sbjct  143  APMCKIPDDMRPHPIAVSALKMVCAVAPSWRIIPTPDIIDKVCKDPEMRKQVRSNPYIYR  202

Query  479  GKPRVGTMREIARQCEYVQNNFEKVSVGFLTVHGTADGVTCPSGSQMLYDKASSSDKTLK  300
            GK  + T  E+      ++ N  +V++ FL +HG  D +T PS S++L+++AS  DKT K
Sbjct  203  GKLPLKTCHELLMVSLDIEKNLHEVTLPFLVLHGGDDIMTDPSVSKLLFEEASGRDKTFK  262

Query  299  LYQGLYHSLIQGEPDEDANRVLADMREWIDERVSCNGTA  183
            LY G++H+L    PD D  RV +D+  W+DER  C G+ 
Sbjct  263  LYPGMWHALTAELPD-DVERVYSDIISWLDERSDCAGSV  300



>emb|CDY07651.1| BnaA03g18600D [Brassica napus]
Length=361

 Score =   113 bits (283),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 60/154 (39%), Positives = 88/154 (57%), Gaps = 0/154 (0%)
 Frame = -2

Query  659  APLFVIPENMKPSKVHLFMYGLLFGFADTWAMMPDNKMVGKAIRDVEKLKIIASNPRRYT  480
            AP+  I E MKPS + + +   L G   TW ++P   ++  A +  E  K +  NP  Y 
Sbjct  187  APMCKIAEEMKPSPLVISILSKLSGVIPTWKIIPGQDIIETAFKQPEIRKQVRENPYCYK  246

Query  479  GKPRVGTMREIARQCEYVQNNFEKVSVGFLTVHGTADGVTCPSGSQMLYDKASSSDKTLK  300
            G+PR+ T  E+ R    ++    +VS+ FL +HG  D VT  + S+ LY+ ASSSDKT K
Sbjct  247  GRPRLKTAYELLRVSTDLEKRLNEVSLPFLVLHGEDDKVTDKAVSRELYETASSSDKTFK  306

Query  299  LYQGLYHSLIQGEPDEDANRVLADMREWIDERVS  198
            LY G++H L+ GE  E+   V AD+  W+D+R S
Sbjct  307  LYPGMWHGLLYGETPENIEIVFADIIGWLDKRAS  340



>ref|XP_004307459.1| PREDICTED: monoglyceride lipase-like isoform 2 [Fragaria vesca 
subsp. vesca]
Length=314

 Score =   112 bits (281),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 60/154 (39%), Positives = 89/154 (58%), Gaps = 0/154 (0%)
 Frame = -2

Query  659  APLFVIPENMKPSKVHLFMYGLLFGFADTWAMMPDNKMVGKAIRDVEKLKIIASNPRRYT  480
            AP+  I + MKPS V + +   L     TW ++P N ++  A +  E  K +  NP  Y 
Sbjct  140  APMCKISDEMKPSPVVVSVLTQLCRVIPTWKIIPTNDVIDFAFKVPEVRKQVRENPYCYK  199

Query  479  GKPRVGTMREIARQCEYVQNNFEKVSVGFLTVHGTADGVTCPSGSQMLYDKASSSDKTLK  300
            G+PR+ T  E+ R    ++   ++V++ FL +HG  D VT  S S+ LY+ ASS DKTLK
Sbjct  200  GRPRLQTGTELLRVSTELEQRLQEVTLPFLILHGEEDKVTDKSASKQLYEVASSYDKTLK  259

Query  299  LYQGLYHSLIQGEPDEDANRVLADMREWIDERVS  198
            LY  ++H L+ GEP E+   V +DM  W+D+R S
Sbjct  260  LYPEMWHGLLYGEPLENIEVVFSDMINWLDKRCS  293



>ref|XP_004307458.1| PREDICTED: monoglyceride lipase-like isoform 1 [Fragaria vesca 
subsp. vesca]
Length=318

 Score =   112 bits (281),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 60/154 (39%), Positives = 89/154 (58%), Gaps = 0/154 (0%)
 Frame = -2

Query  659  APLFVIPENMKPSKVHLFMYGLLFGFADTWAMMPDNKMVGKAIRDVEKLKIIASNPRRYT  480
            AP+  I + MKPS V + +   L     TW ++P N ++  A +  E  K +  NP  Y 
Sbjct  144  APMCKISDEMKPSPVVVSVLTQLCRVIPTWKIIPTNDVIDFAFKVPEVRKQVRENPYCYK  203

Query  479  GKPRVGTMREIARQCEYVQNNFEKVSVGFLTVHGTADGVTCPSGSQMLYDKASSSDKTLK  300
            G+PR+ T  E+ R    ++   ++V++ FL +HG  D VT  S S+ LY+ ASS DKTLK
Sbjct  204  GRPRLQTGTELLRVSTELEQRLQEVTLPFLILHGEEDKVTDKSASKQLYEVASSYDKTLK  263

Query  299  LYQGLYHSLIQGEPDEDANRVLADMREWIDERVS  198
            LY  ++H L+ GEP E+   V +DM  W+D+R S
Sbjct  264  LYPEMWHGLLYGEPLENIEVVFSDMINWLDKRCS  297



>ref|XP_009139193.1| PREDICTED: caffeoylshikimate esterase [Brassica rapa]
Length=313

 Score =   112 bits (281),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 58/155 (37%), Positives = 93/155 (60%), Gaps = 1/155 (1%)
 Frame = -2

Query  659  APLFVIPENMKPSKVHLFMYGLLFGFADTW-AMMPDNKMVGKAIRDVEKLKIIASNPRRY  483
            AP+  I E MKP K  + M  L+     +W +++P   ++  AI+   K + I  NP  Y
Sbjct  143  APMCKIAEEMKPPKPVISMMNLVIHLIPSWKSILPGPDIINLAIKQPHKRQEIKDNPNCY  202

Query  482  TGKPRVGTMREIARQCEYVQNNFEKVSVGFLTVHGTADGVTCPSGSQMLYDKASSSDKTL  303
             G+PR+ TM E+ R    ++N   +V++ F+ +HG  D VT    S++LY+ ASS+DKTL
Sbjct  203  IGRPRMKTMSELFRVSLDLENRLHEVTMPFIVLHGEDDKVTDKEASKLLYEVASSNDKTL  262

Query  302  KLYQGLYHSLIQGEPDEDANRVLADMREWIDERVS  198
            KLY  ++HSL+ GEP E +  V  D+ +W++ R++
Sbjct  263  KLYPEMWHSLLFGEPLEKSEIVFNDIVQWMETRIN  297



>ref|XP_010427280.1| PREDICTED: caffeoylshikimate esterase-like [Camelina sativa]
Length=312

 Score =   112 bits (281),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 57/155 (37%), Positives = 96/155 (62%), Gaps = 1/155 (1%)
 Frame = -2

Query  659  APLFVIPENMKPSKVHLFMYGLLFGFADTW-AMMPDNKMVGKAIRDVEKLKIIASNPRRY  483
            AP+  I E MKPS++ + M  ++     +W +++P   ++  A +  EK + I +NP  Y
Sbjct  143  APMCKIAEEMKPSRMVISMITMVTNLIPSWKSIVPGPDIINNAFKLPEKRQEIRANPNCY  202

Query  482  TGKPRVGTMREIARQCEYVQNNFEKVSVGFLTVHGTADGVTCPSGSQMLYDKASSSDKTL  303
             G+PR+ TM E+ R    ++N   +V++ F+ +HG  D VT    S++LY+ ASS+DKTL
Sbjct  203  QGRPRMKTMSELYRVSLDLENRLNEVTMPFIVLHGEDDKVTDKGVSKLLYEVASSNDKTL  262

Query  302  KLYQGLYHSLIQGEPDEDANRVLADMREWIDERVS  198
            KLY  ++HSL+ GEP E++  V  D+ +W+  R++
Sbjct  263  KLYPEMWHSLLFGEPPENSTVVFNDIVQWMQTRIT  297



>ref|XP_006361389.1| PREDICTED: caffeoylshikimate esterase-like [Solanum tuberosum]
Length=319

 Score =   112 bits (281),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 59/154 (38%), Positives = 92/154 (60%), Gaps = 0/154 (0%)
 Frame = -2

Query  659  APLFVIPENMKPSKVHLFMYGLLFGFADTWAMMPDNKMVGKAIRDVEKLKIIASNPRRYT  480
            AP+  I ++M+P  + + +   L  F  TW ++P   +V  A RD E  K I +NP  Y 
Sbjct  143  APMCKIADDMRPPPMVISVLTKLCYFIPTWKIVPTQDIVDSAFRDPEVRKEIRNNPHCYK  202

Query  479  GKPRVGTMREIARQCEYVQNNFEKVSVGFLTVHGTADGVTCPSGSQMLYDKASSSDKTLK  300
            GKPR+ T  ++      ++   E+V++ F  VHG  D VT PS S++L++KASS DK+ K
Sbjct  203  GKPRLQTAHQLLTVSMDLEQRLEEVTLPFFIVHGEDDTVTDPSVSKLLHEKASSIDKSFK  262

Query  299  LYQGLYHSLIQGEPDEDANRVLADMREWIDERVS  198
            LY G++HSL  GE  E+ + V +D+  W+ E++S
Sbjct  263  LYPGMWHSLSYGEFPENRDIVFSDIVVWLKEKIS  296



>gb|EMT12575.1| hypothetical protein F775_13045 [Aegilops tauschii]
Length=268

 Score =   112 bits (279),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 62/156 (40%), Positives = 88/156 (56%), Gaps = 1/156 (1%)
 Frame = -2

Query  647  VIPENMKPSKVHLFMYGLLFGFADTWAMMPDNKMVGKAIRDVEKLKIIASNPRRYTGKPR  468
            VI E MKP    + +  L+  F  TW ++P   ++G A R   K   I  NP  Y G+PR
Sbjct  108  VITEEMKPHPAVIKVLELVTRFIPTWKVVPTRNVIGAAYRTQAKRDEIRRNPYCYKGRPR  167

Query  467  VGTMREIARQCEYVQNN-FEKVSVGFLTVHGTADGVTCPSGSQMLYDKASSSDKTLKLYQ  291
            + T  E+ R    V++    +V++ FL VHG  D VT PS SQ+L  +A S+DKTLKLY 
Sbjct  168  LKTAHELLRASLRVESEVLTQVTLPFLVVHGGGDRVTDPSVSQLLCREAPSTDKTLKLYP  227

Query  290  GLYHSLIQGEPDEDANRVLADMREWIDERVSCNGTA  183
            G++H+L  GE  E+ ++V  D+  W+D R     TA
Sbjct  228  GMWHALTSGELPENIDKVFIDIIAWLDHRSGPPATA  263



>ref|XP_009407471.1| PREDICTED: caffeoylshikimate esterase-like isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=306

 Score =   112 bits (281),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 56/153 (37%), Positives = 86/153 (56%), Gaps = 0/153 (0%)
 Frame = -2

Query  659  APLFVIPENMKPSKVHLFMYGLLFGFADTWAMMPDNKMVGKAIRDVEKLKIIASNPRRYT  480
            +P+  I   MKP  + + +   L     TW M+P   M+  AI+D EK + + SNP  Y 
Sbjct  143  SPMCKIDGKMKPHPLVISILKKLCSIIPTWKMIPAKDMIDIAIKDPEKRQEVRSNPYNYR  202

Query  479  GKPRVGTMREIARQCEYVQNNFEKVSVGFLTVHGTADGVTCPSGSQMLYDKASSSDKTLK  300
            G  R+GT  E+ R    ++ N  +V++ FL +HG  D +  PS S++LY  ASS+DKT K
Sbjct  203  GSLRLGTGHELLRVSLAIERNLHQVTLPFLVMHGGDDKIFDPSSSELLYKSASSTDKTFK  262

Query  299  LYQGLYHSLIQGEPDEDANRVLADMREWIDERV  201
            +Y G++H+   GE  E    V +DM  W+++R 
Sbjct  263  VYDGMWHAFTFGEAPERVELVFSDMVAWLEQRT  295



>ref|XP_003566330.1| PREDICTED: caffeoylshikimate esterase [Brachypodium distachyon]
Length=359

 Score =   113 bits (282),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 59/158 (37%), Positives = 90/158 (57%), Gaps = 1/158 (1%)
 Frame = -2

Query  665  FSAPLFVIPENMKPSKVHLFMYGLLFGFADTWAMMPDNKMVGKAIRDVEKLKIIASNPRR  486
             +AP+  I E +KP  V + +   +     TW ++P   ++  A +D  K + I  N   
Sbjct  136  LAAPMCKISEKVKPHPVVITLLTQVEELIPTWKIVPTKDVIDSAFKDPVKREKIRKNKLI  195

Query  485  YTGKPRVGTMREIARQCEYVQNNFEKVSVGFLTVHGTADGVTCPSGSQMLYDKASSSDKT  306
            Y  KPR+ T  E+ R    V++   +VS+ F  +HG AD VT P  S+ LY++A+S DKT
Sbjct  196  YQDKPRLKTALELLRTSMDVEDGLSEVSMPFFVLHGEADTVTDPEVSRALYERAASVDKT  255

Query  305  LKLYQGLYHSLIQGEPDEDANRVLADMREWIDERVSCN  192
            +KLY G++H L  GEPD++   V AD+  W+D+R SC 
Sbjct  256  IKLYPGMWHGLTAGEPDDNVELVFADIVAWLDQR-SCR  292



>gb|AFK44576.1| unknown [Lotus japonicus]
Length=239

 Score =   111 bits (277),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 61/155 (39%), Positives = 91/155 (59%), Gaps = 6/155 (4%)
 Frame = -2

Query  659  APLFVIPENMKPSKVHLFMYGLLFGFADTW---AMMPDNKMVGKAIRDVEKLKIIASNPR  489
            AP+  I ++M P K    +  +L G A+      ++P   +   A R+ +K  + A N  
Sbjct  79   APMCKIADDMVPPK---LLAQILIGIANVLPKLKLVPQKDLAVAAFRESKKRGMTAYNVV  135

Query  488  RYTGKPRVGTMREIARQCEYVQNNFEKVSVGFLTVHGTADGVTCPSGSQMLYDKASSSDK  309
             Y  KPR+ T  E+ +  + ++   E+VS+  L +HG AD VT PS S+  Y+KASSSDK
Sbjct  136  AYKDKPRLRTAVEMLKTTQEIEQRLEEVSLPLLILHGEADIVTDPSVSKAFYEKASSSDK  195

Query  308  TLKLYQGLYHSLIQGEPDEDANRVLADMREWIDER  204
             LKLY+  YHSL++GEPDE   +VL+D+  W+DE 
Sbjct  196  KLKLYKDAYHSLLEGEPDEVIIQVLSDIILWLDEH  230



>ref|XP_002876287.1| esterase/lipase/thioesterase family protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH52546.1| esterase/lipase/thioesterase family protein [Arabidopsis lyrata 
subsp. lyrata]
Length=312

 Score =   112 bits (280),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 59/157 (38%), Positives = 96/157 (61%), Gaps = 5/157 (3%)
 Frame = -2

Query  659  APLFVIPENMKPSKVHLFMYGLLFGFADTWAMM---PDNKMVGKAIRDVEKLKIIASNPR  489
            AP+  I E MKPS++ + M  ++     +W  +   PD  ++  AI+  EK + I +NP 
Sbjct  143  APMCKIAEEMKPSRMVISMINMVTNLIPSWKSIVHGPD--ILNNAIKLPEKRQEIRANPN  200

Query  488  RYTGKPRVGTMREIARQCEYVQNNFEKVSVGFLTVHGTADGVTCPSGSQMLYDKASSSDK  309
             Y G+PR+ TM E+ R    ++N   +V++ F+ +HG  D VT   GS++LY+ A S+DK
Sbjct  201  CYNGRPRMKTMSELYRTSLDLENRLNEVTMPFIVLHGEDDKVTDKGGSKLLYEVALSNDK  260

Query  308  TLKLYQGLYHSLIQGEPDEDANRVLADMREWIDERVS  198
            TLKLY  ++HSL+ GEP E++  V  D+ +W+  R++
Sbjct  261  TLKLYPEMWHSLLFGEPPENSEIVFNDIVQWMQTRIT  297



>ref|XP_003634858.1| PREDICTED: caffeoylshikimate esterase [Vitis vinifera]
 emb|CAN82216.1| hypothetical protein VITISV_020423 [Vitis vinifera]
Length=314

 Score =   112 bits (280),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 57/152 (38%), Positives = 93/152 (61%), Gaps = 0/152 (0%)
 Frame = -2

Query  659  APLFVIPENMKPSKVHLFMYGLLFGFADTWAMMPDNKMVGKAIRDVEKLKIIASNPRRYT  480
            AP+  I +N++P      +   L  F  T  ++P   ++ K+++  EK  I A NP RY 
Sbjct  162  APMCKISDNVRPRWPIPQILTFLARFFPTLPIVPTPDILDKSVKVPEKKIIAAMNPLRYK  221

Query  479  GKPRVGTMREIARQCEYVQNNFEKVSVGFLTVHGTADGVTCPSGSQMLYDKASSSDKTLK  300
            GKPR+GT+ E+ R  +Y+     +V + F+ +HG+AD VT P  S+ LY++A S DKT+K
Sbjct  222  GKPRLGTVVELLRITDYLSQKLGEVKLPFIVLHGSADAVTDPDVSRALYEEAKSEDKTIK  281

Query  299  LYQGLYHSLIQGEPDEDANRVLADMREWIDER  204
            +Y G+ HSL+ GE DE+ + V  ++  W+++R
Sbjct  282  IYYGMMHSLLFGETDENVDIVRREILSWLNDR  313



>emb|CDP19954.1| unnamed protein product [Coffea canephora]
Length=351

 Score =   112 bits (281),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 59/154 (38%), Positives = 91/154 (59%), Gaps = 0/154 (0%)
 Frame = -2

Query  659  APLFVIPENMKPSKVHLFMYGLLFGFADTWAMMPDNKMVGKAIRDVEKLKIIASNPRRYT  480
            AP+  I + MKP+ +   +   L  F  TW ++P   ++  A R  +  + I +NP  Y 
Sbjct  172  APMCKIADEMKPNPMVTTVLTKLCKFIPTWKIIPTQDVIDAAFRLPQIREEIRANPYCYK  231

Query  479  GKPRVGTMREIARQCEYVQNNFEKVSVGFLTVHGTADGVTCPSGSQMLYDKASSSDKTLK  300
            G+PR+ T   +      ++   ++VS+ FL +HG  D VT PS S++L++ ASSSDKT K
Sbjct  232  GRPRLKTGYHLLTVSMDLEKRLQEVSLPFLVLHGEDDKVTDPSVSRLLFETASSSDKTFK  291

Query  299  LYQGLYHSLIQGEPDEDANRVLADMREWIDERVS  198
            LYQG++H+L  GE  E+ N V +D+  W+DER S
Sbjct  292  LYQGMWHALTYGELPENINIVFSDVINWLDERTS  325



>emb|CDX93264.1| BnaC04g46320D [Brassica napus]
Length=318

 Score =   112 bits (280),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 59/154 (38%), Positives = 88/154 (57%), Gaps = 0/154 (0%)
 Frame = -2

Query  659  APLFVIPENMKPSKVHLFMYGLLFGFADTWAMMPDNKMVGKAIRDVEKLKIIASNPRRYT  480
            AP+  I E MKP+ V + +   L G   TW ++P   ++  A +  E  K +  NP  Y 
Sbjct  144  APMCKIAEEMKPNPVVISVLSKLSGVIPTWKIIPGQDIIETAFKQPEVRKQVRENPYCYK  203

Query  479  GKPRVGTMREIARQCEYVQNNFEKVSVGFLTVHGTADGVTCPSGSQMLYDKASSSDKTLK  300
            G+PR+ T  E+ R    ++   ++VS+ F+ +HG  D VT  + S  LY+ ASSSDKT K
Sbjct  204  GRPRLKTANELLRISTDLEKRLDEVSLPFMVLHGEDDKVTDKAVSGQLYEVASSSDKTFK  263

Query  299  LYQGLYHSLIQGEPDEDANRVLADMREWIDERVS  198
            LY G++H L+ GE  E+   V AD+  W+D+R S
Sbjct  264  LYPGMWHGLLYGETPENIEIVFADIIGWLDKRAS  297



>ref|XP_009407470.1| PREDICTED: caffeoylshikimate esterase-like isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=332

 Score =   112 bits (280),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 56/152 (37%), Positives = 86/152 (57%), Gaps = 0/152 (0%)
 Frame = -2

Query  659  APLFVIPENMKPSKVHLFMYGLLFGFADTWAMMPDNKMVGKAIRDVEKLKIIASNPRRYT  480
            +P+  I   MKP  + + +   L     TW M+P   M+  AI+D EK + + SNP  Y 
Sbjct  169  SPMCKIDGKMKPHPLVISILKKLCSIIPTWKMIPAKDMIDIAIKDPEKRQEVRSNPYNYR  228

Query  479  GKPRVGTMREIARQCEYVQNNFEKVSVGFLTVHGTADGVTCPSGSQMLYDKASSSDKTLK  300
            G  R+GT  E+ R    ++ N  +V++ FL +HG  D +  PS S++LY  ASS+DKT K
Sbjct  229  GSLRLGTGHELLRVSLAIERNLHQVTLPFLVMHGGDDKIFDPSSSELLYKSASSTDKTFK  288

Query  299  LYQGLYHSLIQGEPDEDANRVLADMREWIDER  204
            +Y G++H+   GE  E    V +DM  W+++R
Sbjct  289  VYDGMWHAFTFGEAPERVELVFSDMVAWLEQR  320



>ref|XP_004495954.1| PREDICTED: monoglyceride lipase-like isoform X2 [Cicer arietinum]
Length=280

 Score =   111 bits (278),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 58/156 (37%), Positives = 87/156 (56%), Gaps = 0/156 (0%)
 Frame = -2

Query  665  FSAPLFVIPENMKPSKVHLFMYGLLFGFADTWAMMPDNKMVGKAIRDVEKLKIIASNPRR  486
            F AP+  I E +KP  V + +   L      W ++P   ++  A +D  K + I  N   
Sbjct  95   FVAPMCKISEKVKPHPVVVSVLTGLEEIIPRWKIVPTKDVIDSAFKDRAKRESIRKNKLI  154

Query  485  YTGKPRVGTMREIARQCEYVQNNFEKVSVGFLTVHGTADGVTCPSGSQMLYDKASSSDKT  306
            Y  KPR+ T  E+ R    +++   +V++ F+ +HG  D VT P  S+ LYD+ASS DKT
Sbjct  155  YQEKPRLKTALELLRTSLSLESCLHQVTLPFIVLHGANDTVTDPEVSKALYDRASSVDKT  214

Query  305  LKLYQGLYHSLIQGEPDEDANRVLADMREWIDERVS  198
            +KLY G++H L  GEPDE+   V  D+  W+D+R S
Sbjct  215  MKLYPGMWHGLTSGEPDENIELVFGDIISWLDKRAS  250



>gb|EYU46661.1| hypothetical protein MIMGU_mgv1a009192mg [Erythranthe guttata]
Length=350

 Score =   112 bits (280),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 58/159 (36%), Positives = 92/159 (58%), Gaps = 0/159 (0%)
 Frame = -2

Query  659  APLFVIPENMKPSKVHLFMYGLLFGFADTWAMMPDNKMVGKAIRDVEKLKIIASNPRRYT  480
            AP+  I E +KP  V + +   +      W ++P   ++  A +D  K + I  N   Y 
Sbjct  137  APMCKISEKVKPHPVVISLLTRVEDVIPKWKIVPAKDVIDSAFKDPIKREQIRGNKLIYQ  196

Query  479  GKPRVGTMREIARQCEYVQNNFEKVSVGFLTVHGTADGVTCPSGSQMLYDKASSSDKTLK  300
             KPR+ T  E+ R    ++++  +V+V F  +HG AD VT P  S+ LY+KASS+DKT+K
Sbjct  197  EKPRLKTALEMLRTSMNLEDSLNEVTVPFFVLHGEADTVTDPEVSRALYEKASSTDKTIK  256

Query  299  LYQGLYHSLIQGEPDEDANRVLADMREWIDERVSCNGTA  183
            LY G++H L  GEPD++   V +D+  W+D+R   NG++
Sbjct  257  LYPGMWHGLTAGEPDDNIEIVFSDIILWLDKRAEDNGSS  295



>gb|KFK36835.1| hypothetical protein AALP_AA4G177600 [Arabis alpina]
Length=317

 Score =   112 bits (279),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 56/154 (36%), Positives = 90/154 (58%), Gaps = 0/154 (0%)
 Frame = -2

Query  659  APLFVIPENMKPSKVHLFMYGLLFGFADTWAMMPDNKMVGKAIRDVEKLKIIASNPRRYT  480
            AP+  I + MKPS + + +   L G   TW ++P   ++  A +  E  K +  NP  Y 
Sbjct  143  APMCKIADEMKPSPLVISILTKLSGVIPTWKIIPGQDIIETAFKQPEIRKQVRENPYCYK  202

Query  479  GKPRVGTMREIARQCEYVQNNFEKVSVGFLTVHGTADGVTCPSGSQMLYDKASSSDKTLK  300
            G+PR+ T  E+ R   Y++    +VS+ F+ +HG  D VT  + S+ LY++ASSSDKT K
Sbjct  203  GRPRLKTAYELLRISTYLEKKLNEVSLPFIVLHGEDDKVTDKAVSRQLYEEASSSDKTFK  262

Query  299  LYQGLYHSLIQGEPDEDANRVLADMREWIDERVS  198
            LY G++H L+ GE  E+   + +D+  W+ +RV+
Sbjct  263  LYSGMWHGLLYGETPENIEVIFSDIIGWLVKRVA  296



>ref|XP_002879795.1| esterase/lipase/thioesterase family protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH56054.1| esterase/lipase/thioesterase family protein [Arabidopsis lyrata 
subsp. lyrata]
Length=317

 Score =   112 bits (279),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 58/154 (38%), Positives = 89/154 (58%), Gaps = 0/154 (0%)
 Frame = -2

Query  659  APLFVIPENMKPSKVHLFMYGLLFGFADTWAMMPDNKMVGKAIRDVEKLKIIASNPRRYT  480
            AP+  I E MKPS + + +   L G   TW ++P   ++  A +  E  K +  NP  Y 
Sbjct  143  APMCKIAEEMKPSPLVISILSKLSGVIPTWKIIPGQDIIETAFKQPEIRKQVRENPYCYK  202

Query  479  GKPRVGTMREIARQCEYVQNNFEKVSVGFLTVHGTADGVTCPSGSQMLYDKASSSDKTLK  300
            G+PR+ T  E+ R    ++    +VS+ F+ +HG  D VT  + S+ LY+ ASS+DKT K
Sbjct  203  GRPRLKTAYELLRVSTDLEKRLNEVSLPFMVLHGEDDKVTDKAVSRQLYEVASSADKTFK  262

Query  299  LYQGLYHSLIQGEPDEDANRVLADMREWIDERVS  198
            LY G++H L+ GE  E+   V AD+  W+D++VS
Sbjct  263  LYPGMWHGLLYGETPENIEIVFADIIGWLDKKVS  296



>ref|XP_004977663.1| PREDICTED: monoglyceride lipase-like isoform X1 [Setaria italica]
 ref|XP_004977664.1| PREDICTED: monoglyceride lipase-like isoform X2 [Setaria italica]
Length=343

 Score =   112 bits (279),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 62/161 (39%), Positives = 91/161 (57%), Gaps = 1/161 (1%)
 Frame = -2

Query  659  APLFVIPENMKPSKVHLFMYGLLFGFADTWAMMPDNKMVGKAIRDVEKLKIIASNPRRYT  480
            AP+  I ++M+P  V + +   +     TW ++P N ++  A R  EK   I  NP  Y 
Sbjct  160  APMCKIADDMRPHPVVVSILRAMTSIIPTWKVVPTNDVIDAAYRTQEKRDEIRGNPYCYK  219

Query  479  GKPRVGTMREIARQCEYVQNN-FEKVSVGFLTVHGTADGVTCPSGSQMLYDKASSSDKTL  303
             KPR+ T  E+ +    V+ N   +VS+ FL VHG AD VT PS S++LY  A+S DKTL
Sbjct  220  DKPRLKTASELLKVSLDVEANILHQVSLPFLIVHGGADKVTDPSVSELLYRSAASQDKTL  279

Query  302  KLYQGLYHSLIQGEPDEDANRVLADMREWIDERVSCNGTAV  180
            KLY G++H+L  GE   + + V  D+  W+D R S   T++
Sbjct  280  KLYPGMWHALTSGESPNNISTVFQDIIAWLDHRSSHTTTSM  320



>ref|XP_010516080.1| PREDICTED: caffeoylshikimate esterase-like [Camelina sativa]
Length=312

 Score =   111 bits (278),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 56/155 (36%), Positives = 96/155 (62%), Gaps = 1/155 (1%)
 Frame = -2

Query  659  APLFVIPENMKPSKVHLFMYGLLFGFADTW-AMMPDNKMVGKAIRDVEKLKIIASNPRRY  483
            AP+  I E MKPS++ + M  ++     +W +++P   ++  A +  EK + I +NP  Y
Sbjct  143  APMCKIAEEMKPSRMVISMINMVTNLIPSWKSIVPGPDIINNAFKLPEKRQEIRANPNCY  202

Query  482  TGKPRVGTMREIARQCEYVQNNFEKVSVGFLTVHGTADGVTCPSGSQMLYDKASSSDKTL  303
             G+PR+ TM E+ R    ++N   +V++ F+ +HG  D VT    S++LY+ A+S+DKTL
Sbjct  203  QGRPRMKTMSELYRVSLDLENRLNEVTMPFIVLHGEDDKVTDKGVSKLLYEVATSNDKTL  262

Query  302  KLYQGLYHSLIQGEPDEDANRVLADMREWIDERVS  198
            KLY  ++HSL+ GEP E++  V  D+ +W+  R++
Sbjct  263  KLYPEMWHSLLFGEPPENSAIVFNDIVQWMQTRIT  297



>ref|NP_181474.2| alpha/beta-Hydrolases superfamily protein [Arabidopsis thaliana]
 gb|AAL87258.1| putative phospholipase [Arabidopsis thaliana]
 gb|AAM67523.1| putative phospholipase [Arabidopsis thaliana]
 gb|AEC09673.1| alpha/beta-Hydrolases superfamily protein [Arabidopsis thaliana]
Length=317

 Score =   111 bits (278),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 57/154 (37%), Positives = 89/154 (58%), Gaps = 0/154 (0%)
 Frame = -2

Query  659  APLFVIPENMKPSKVHLFMYGLLFGFADTWAMMPDNKMVGKAIRDVEKLKIIASNPRRYT  480
            AP+  I E MKPS + + +   L G   +W ++P   ++  A +  E  K +  NP  Y 
Sbjct  143  APMCKIAEEMKPSPLVISILAKLSGVIPSWKIIPGQDIIETAFKQPEIRKQVRENPYCYK  202

Query  479  GKPRVGTMREIARQCEYVQNNFEKVSVGFLTVHGTADGVTCPSGSQMLYDKASSSDKTLK  300
            G+PR+ T  E+ R    ++    +VS+ F+ +HG  D VT  + S+ LY+ ASSSDKT K
Sbjct  203  GRPRLKTAYELLRVSTDLEKRLNEVSLPFIVLHGEDDKVTDKAVSRQLYEVASSSDKTFK  262

Query  299  LYQGLYHSLIQGEPDEDANRVLADMREWIDERVS  198
            LY G++H L+ GE  E+   V AD+  W+D++V+
Sbjct  263  LYPGMWHGLLYGETPENIETVFADIIGWLDKKVA  296



>gb|AAK43921.1|AF370602_1 putative phospholipase [Arabidopsis thaliana]
 gb|AAC27833.1| putative phospholipase [Arabidopsis thaliana]
Length=318

 Score =   111 bits (278),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 57/154 (37%), Positives = 89/154 (58%), Gaps = 0/154 (0%)
 Frame = -2

Query  659  APLFVIPENMKPSKVHLFMYGLLFGFADTWAMMPDNKMVGKAIRDVEKLKIIASNPRRYT  480
            AP+  I E MKPS + + +   L G   +W ++P   ++  A +  E  K +  NP  Y 
Sbjct  144  APMCKIAEEMKPSPLVISILAKLSGVIPSWKIIPGQDIIETAFKQPEIRKQVRENPYCYK  203

Query  479  GKPRVGTMREIARQCEYVQNNFEKVSVGFLTVHGTADGVTCPSGSQMLYDKASSSDKTLK  300
            G+PR+ T  E+ R    ++    +VS+ F+ +HG  D VT  + S+ LY+ ASSSDKT K
Sbjct  204  GRPRLKTAYELLRVSTDLEKRLNEVSLPFIVLHGEDDKVTDKAVSRQLYEVASSSDKTFK  263

Query  299  LYQGLYHSLIQGEPDEDANRVLADMREWIDERVS  198
            LY G++H L+ GE  E+   V AD+  W+D++V+
Sbjct  264  LYPGMWHGLLYGETPENIETVFADIIGWLDKKVA  297



>emb|CDY55538.1| BnaA04g29600D [Brassica napus]
Length=348

 Score =   112 bits (279),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 55/154 (36%), Positives = 90/154 (58%), Gaps = 0/154 (0%)
 Frame = -2

Query  659  APLFVIPENMKPSKVHLFMYGLLFGFADTWAMMPDNKMVGKAIRDVEKLKIIASNPRRYT  480
            AP+  I E +KP  V + +   +      W ++P   ++  A +D+ K + +  N   Y 
Sbjct  139  APMCKISEKVKPHPVVINLLTRVEEMIPKWKIVPTKNVINAAFKDLAKREEVKKNKLIYQ  198

Query  479  GKPRVGTMREIARQCEYVQNNFEKVSVGFLTVHGTADGVTCPSGSQMLYDKASSSDKTLK  300
             KPR+ T  E+ R    ++++ +++++ F  +HG AD VT P  S+ LY+KASS DKTLK
Sbjct  199  DKPRLKTALEMLRTSMNLEDSLDEITMPFFVLHGEADIVTDPEISKALYEKASSRDKTLK  258

Query  299  LYQGLYHSLIQGEPDEDANRVLADMREWIDERVS  198
            LY G++H+L  GEPD + + V AD+  W+D R +
Sbjct  259  LYPGMWHALTSGEPDCNVDLVFADITNWLDRRTA  292



>ref|XP_009344903.1| PREDICTED: caffeoylshikimate esterase-like [Pyrus x bretschneideri]
Length=315

 Score =   111 bits (278),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 60/159 (38%), Positives = 92/159 (58%), Gaps = 1/159 (1%)
 Frame = -2

Query  659  APLFVIPENMKPSKVHLFMYGLLFGFADTWAMMPDNKMVGKAIRDVEKLKIIASNPRRYT  480
            AP+  I +++KPS + +     L  F  TW ++P N ++  A +  E  K +  NP  Y 
Sbjct  143  APMCKIADDIKPSPLVISALTKLCKFIPTWKIIPTNDIIDVAFKMPEIRKQVRENPYCYK  202

Query  479  GKPRVGTMREIARQCEYVQNNFEKVSVGFLTVHGTADGVTCPSGSQMLYDKASSSDKTLK  300
            G+PR+ T  E+ R    ++   ++V++ F+ +HG  D VT  S S+ L+D ASS DKTLK
Sbjct  203  GRPRLQTGYELLRVSSELEQRLDEVTLPFIVLHGEDDKVTDKSVSKQLHDVASSHDKTLK  262

Query  299  LYQGLYHSLIQGEPDEDANRVLADMREWIDERVSCNGTA  183
            +Y  ++H L+ GE  E+   V AD+  W+DER SC G A
Sbjct  263  MYPDMWHGLLYGETPENIEVVFADIISWLDER-SCFGNA  300



>gb|KEH44505.1| alpha/beta fold hydrolase [Medicago truncatula]
Length=321

 Score =   111 bits (278),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 58/155 (37%), Positives = 91/155 (59%), Gaps = 0/155 (0%)
 Frame = -2

Query  665  FSAPLFVIPENMKPSKVHLFMYGLLFGFADTWAMMPDNKMVGKAIRDVEKLKIIASNPRR  486
             +AP+  I +++KP+   L +   L   A TW ++P   ++  A +  E  + I +N   
Sbjct  144  LAAPMCKIADDIKPNAFVLRILSALSKVAPTWQIVPTQDIIDVAFKVPEVRQQIRANQYC  203

Query  485  YTGKPRVGTMREIARQCEYVQNNFEKVSVGFLTVHGTADGVTCPSGSQMLYDKASSSDKT  306
            + GKPR+ T  E++R    ++   ++VS+ FL +HG  D VT PS S+ L++ ASS DKT
Sbjct  204  FKGKPRLRTGYELSRVATKIEETLDEVSLPFLILHGEEDRVTDPSVSKQLHEVASSKDKT  263

Query  305  LKLYQGLYHSLIQGEPDEDANRVLADMREWIDERV  201
            LKLY G++H L+ GEP E+   V  D+  WI+ER 
Sbjct  264  LKLYPGMWHGLLYGEPPENLEIVFKDIFNWIEERC  298



>ref|XP_011097201.1| PREDICTED: caffeoylshikimate esterase isoform X2 [Sesamum indicum]
Length=341

 Score =   111 bits (278),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 62/155 (40%), Positives = 88/155 (57%), Gaps = 6/155 (4%)
 Frame = -2

Query  659  APLFVIPENMKPSKVHLFMYGLLFGFADTW---AMMPDNKMVGKAIRDVEKLKIIASNPR  489
            AP+  I E+M P      +  +L G A       ++P   +   A RDV+K +  A N  
Sbjct  189  APMCKIAEDMVPP---WLVTKILIGVAKVLPKHKLVPQKDLAELAFRDVKKRQQTAYNVV  245

Query  488  RYTGKPRVGTMREIARQCEYVQNNFEKVSVGFLTVHGTADGVTCPSGSQMLYDKASSSDK  309
             Y  KPR+GT  E+ R  + ++   EKVS+  L +HG  D VT PS S+ LY+KASS+DK
Sbjct  246  AYKHKPRLGTALELLRTTKEIEQQLEKVSLPLLILHGKEDKVTDPSVSKALYEKASSADK  305

Query  308  TLKLYQGLYHSLIQGEPDEDANRVLADMREWIDER  204
             L LY G +H+L++GEPDE   +V  D+  W+DE 
Sbjct  306  KLNLYDGAFHALLEGEPDEMILQVFGDIVTWLDEH  340



>gb|KEH44506.1| alpha/beta fold hydrolase [Medicago truncatula]
Length=317

 Score =   111 bits (277),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 58/155 (37%), Positives = 91/155 (59%), Gaps = 0/155 (0%)
 Frame = -2

Query  665  FSAPLFVIPENMKPSKVHLFMYGLLFGFADTWAMMPDNKMVGKAIRDVEKLKIIASNPRR  486
             +AP+  I +++KP+   L +   L   A TW ++P   ++  A +  E  + I +N   
Sbjct  140  LAAPMCKIADDIKPNAFVLRILSALSKVAPTWQIVPTQDIIDVAFKVPEVRQQIRANQYC  199

Query  485  YTGKPRVGTMREIARQCEYVQNNFEKVSVGFLTVHGTADGVTCPSGSQMLYDKASSSDKT  306
            + GKPR+ T  E++R    ++   ++VS+ FL +HG  D VT PS S+ L++ ASS DKT
Sbjct  200  FKGKPRLRTGYELSRVATKIEETLDEVSLPFLILHGEEDRVTDPSVSKQLHEVASSKDKT  259

Query  305  LKLYQGLYHSLIQGEPDEDANRVLADMREWIDERV  201
            LKLY G++H L+ GEP E+   V  D+  WI+ER 
Sbjct  260  LKLYPGMWHGLLYGEPPENLEIVFKDIFNWIEERC  294



>emb|CDY27476.1| BnaC04g51170D [Brassica napus]
Length=347

 Score =   111 bits (278),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 55/153 (36%), Positives = 90/153 (59%), Gaps = 0/153 (0%)
 Frame = -2

Query  659  APLFVIPENMKPSKVHLFMYGLLFGFADTWAMMPDNKMVGKAIRDVEKLKIIASNPRRYT  480
            AP+  I E +KP  V + +   +      W ++P   ++  A +D+ K + + +N   Y 
Sbjct  139  APMCKISEKVKPHPVVINLLTRVEEMIPKWKIVPTKNVINVAFKDLAKREKVKNNKLIYQ  198

Query  479  GKPRVGTMREIARQCEYVQNNFEKVSVGFLTVHGTADGVTCPSGSQMLYDKASSSDKTLK  300
             KPR+ T  E+ R    ++++ +++++ F  +HG AD VT P  S+ LY+KASS DKTLK
Sbjct  199  DKPRLKTALEMLRTSMNLEDSLDEITMPFFVLHGEADIVTDPEISKALYEKASSRDKTLK  258

Query  299  LYQGLYHSLIQGEPDEDANRVLADMREWIDERV  201
            LY G++H+L  GEPD + + V AD+  W+D R 
Sbjct  259  LYPGMWHALTSGEPDYNVDLVFADITNWLDRRT  291



>ref|XP_004495953.1| PREDICTED: monoglyceride lipase-like isoform X1 [Cicer arietinum]
Length=322

 Score =   111 bits (277),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 58/156 (37%), Positives = 87/156 (56%), Gaps = 0/156 (0%)
 Frame = -2

Query  665  FSAPLFVIPENMKPSKVHLFMYGLLFGFADTWAMMPDNKMVGKAIRDVEKLKIIASNPRR  486
            F AP+  I E +KP  V + +   L      W ++P   ++  A +D  K + I  N   
Sbjct  137  FVAPMCKISEKVKPHPVVVSVLTGLEEIIPRWKIVPTKDVIDSAFKDRAKRESIRKNKLI  196

Query  485  YTGKPRVGTMREIARQCEYVQNNFEKVSVGFLTVHGTADGVTCPSGSQMLYDKASSSDKT  306
            Y  KPR+ T  E+ R    +++   +V++ F+ +HG  D VT P  S+ LYD+ASS DKT
Sbjct  197  YQEKPRLKTALELLRTSLSLESCLHQVTLPFIVLHGANDTVTDPEVSKALYDRASSVDKT  256

Query  305  LKLYQGLYHSLIQGEPDEDANRVLADMREWIDERVS  198
            +KLY G++H L  GEPDE+   V  D+  W+D+R S
Sbjct  257  MKLYPGMWHGLTSGEPDENIELVFGDIISWLDKRAS  292



>ref|XP_003636966.1| Monoglyceride lipase [Medicago truncatula]
 gb|KEH21541.1| monoglyceride lipase [Medicago truncatula]
Length=346

 Score =   111 bits (278),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 61/156 (39%), Positives = 92/156 (59%), Gaps = 6/156 (4%)
 Frame = -2

Query  665  FSAPLFVIPENMKPSKVHLFMYGLLFGFADTW---AMMPDNKMVGKAIRDVEKLKIIASN  495
            F AP+  I ++M P      +  +L G A+      ++P   +   A RD++K ++ A N
Sbjct  185  FVAPMCKIADDMAPP---WLLAQILIGIANVLPKQKLVPQKNLAEAAFRDLKKREMTAYN  241

Query  494  PRRYTGKPRVGTMREIARQCEYVQNNFEKVSVGFLTVHGTADGVTCPSGSQMLYDKASSS  315
               Y  KPR+ T  E+ +  + ++   E+VS+  L +HG AD VT PS S+  Y+KASSS
Sbjct  242  VVAYKDKPRLWTAVEMLKTTQEIEKRLEEVSLPLLILHGEADIVTDPSVSKTFYEKASSS  301

Query  314  DKTLKLYQGLYHSLIQGEPDEDANRVLADMREWIDE  207
            DK LKLY+  YHSL++GEPDE   +V +D+  W+DE
Sbjct  302  DKKLKLYKDAYHSLLEGEPDEMIIQVFSDIILWLDE  337



>ref|XP_011079657.1| PREDICTED: caffeoylshikimate esterase-like [Sesamum indicum]
Length=351

 Score =   111 bits (278),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 58/160 (36%), Positives = 91/160 (57%), Gaps = 0/160 (0%)
 Frame = -2

Query  659  APLFVIPENMKPSKVHLFMYGLLFGFADTWAMMPDNKMVGKAIRDVEKLKIIASNPRRYT  480
            AP+  I E +KP  V + +  ++      W ++P   ++  A +D  K + I SN   Y 
Sbjct  137  APMCKISEKLKPHPVVVSLLTMVEDVIPKWKIVPTKDVIDSAFKDPIKREEIRSNKLIYQ  196

Query  479  GKPRVGTMREIARQCEYVQNNFEKVSVGFLTVHGTADGVTCPSGSQMLYDKASSSDKTLK  300
             KPR+ T  E+ R    ++++  +V++ F  +HG AD VT P  S+ LY+KASSSDKT+K
Sbjct  197  QKPRLKTALEMLRTSMNLEDSLNEVTLPFFVLHGEADIVTDPEVSRALYEKASSSDKTIK  256

Query  299  LYQGLYHSLIQGEPDEDANRVLADMREWIDERVSCNGTAV  180
            LY G++H L  GEPD +   V +D+  W+D R   +G  +
Sbjct  257  LYPGMWHGLTAGEPDGNIEIVFSDIITWLDRRAGDDGNTL  296



>ref|XP_011097199.1| PREDICTED: caffeoylshikimate esterase isoform X1 [Sesamum indicum]
Length=375

 Score =   111 bits (278),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 62/155 (40%), Positives = 88/155 (57%), Gaps = 6/155 (4%)
 Frame = -2

Query  659  APLFVIPENMKPSKVHLFMYGLLFGFADTW---AMMPDNKMVGKAIRDVEKLKIIASNPR  489
            AP+  I E+M P      +  +L G A       ++P   +   A RDV+K +  A N  
Sbjct  223  APMCKIAEDMVPP---WLVTKILIGVAKVLPKHKLVPQKDLAELAFRDVKKRQQTAYNVV  279

Query  488  RYTGKPRVGTMREIARQCEYVQNNFEKVSVGFLTVHGTADGVTCPSGSQMLYDKASSSDK  309
             Y  KPR+GT  E+ R  + ++   EKVS+  L +HG  D VT PS S+ LY+KASS+DK
Sbjct  280  AYKHKPRLGTALELLRTTKEIEQQLEKVSLPLLILHGKEDKVTDPSVSKALYEKASSADK  339

Query  308  TLKLYQGLYHSLIQGEPDEDANRVLADMREWIDER  204
             L LY G +H+L++GEPDE   +V  D+  W+DE 
Sbjct  340  KLNLYDGAFHALLEGEPDEMILQVFGDIVTWLDEH  374



>ref|XP_003636968.1| Monoglyceride lipase [Medicago truncatula]
Length=380

 Score =   111 bits (278),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 61/156 (39%), Positives = 92/156 (59%), Gaps = 6/156 (4%)
 Frame = -2

Query  665  FSAPLFVIPENMKPSKVHLFMYGLLFGFADTW---AMMPDNKMVGKAIRDVEKLKIIASN  495
            F AP+  I ++M P      +  +L G A+      ++P   +   A RD++K ++ A N
Sbjct  219  FVAPMCKIADDMAPP---WLLAQILIGIANVLPKQKLVPQKNLAEAAFRDLKKREMTAYN  275

Query  494  PRRYTGKPRVGTMREIARQCEYVQNNFEKVSVGFLTVHGTADGVTCPSGSQMLYDKASSS  315
               Y  KPR+ T  E+ +  + ++   E+VS+  L +HG AD VT PS S+  Y+KASSS
Sbjct  276  VVAYKDKPRLWTAVEMLKTTQEIEKRLEEVSLPLLILHGEADIVTDPSVSKTFYEKASSS  335

Query  314  DKTLKLYQGLYHSLIQGEPDEDANRVLADMREWIDE  207
            DK LKLY+  YHSL++GEPDE   +V +D+  W+DE
Sbjct  336  DKKLKLYKDAYHSLLEGEPDEMIIQVFSDIILWLDE  371



>gb|KHG06576.1| Monoglyceride lipase [Gossypium arboreum]
Length=344

 Score =   111 bits (278),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 58/159 (36%), Positives = 90/159 (57%), Gaps = 2/159 (1%)
 Frame = -2

Query  659  APLFVIPENMKPSKVHLFMYGLLFGFADTWAMMPDNKMVGKAIRDVEKLKIIASNPRRYT  480
            AP+  I E +KP  V + +   +      W ++P   ++  A +D  K ++I +N   Y 
Sbjct  138  APMCKISEKVKPHPVVVNILTKMEEIIPKWKIVPTKDVIDSAFKDPIKREVIRNNKLIYQ  197

Query  479  GKPRVGTMREIARQCEYVQNNFEKVSVGFLTVHGTADGVTCPSGSQMLYDKASSSDKTLK  300
             KPR+ T  E+ R    +++   +V++ F  +HG AD VT P  S+ LY+KASS DKT+K
Sbjct  198  DKPRLKTALEMLRTSISLEDGLNEVTLPFFVLHGEADIVTDPEVSKALYEKASSKDKTIK  257

Query  299  LYQGLYHSLIQGEPDEDANRVLADMREWIDERVSCNGTA  183
            L+ G++H L  GEPDE+   V AD+  W+D+R  CN   
Sbjct  258  LFPGMWHGLTSGEPDENIEIVFADITAWLDKR--CNAVT  294



>ref|XP_002456602.1| hypothetical protein SORBIDRAFT_03g039170 [Sorghum bicolor]
 gb|EES01722.1| hypothetical protein SORBIDRAFT_03g039170 [Sorghum bicolor]
Length=318

 Score =   111 bits (277),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 61/159 (38%), Positives = 91/159 (57%), Gaps = 1/159 (1%)
 Frame = -2

Query  659  APLFVIPENMKPSKVHLFMYGLLFGFADTWAMMPDNKMVGKAIRDVEKLKIIASNPRRYT  480
            AP   + +NM+P  + +    ++   A +W ++P   M+ K  +D +  K I SNP  Y 
Sbjct  143  APFCKMFDNMRPHPIIVSTLKMISTVAPSWRVIPAIDMIDKVCKDPQFKKEIRSNPYMYK  202

Query  479  GKPRVGTMREIARQCEYVQNNFEKVSVGFLTVHGTADGVTCPSGSQMLYDKASSSDKTLK  300
            G   + T RE+       + N  +VS+ FL +HGT D V  P GS++L+++ASS DKTLK
Sbjct  203  GNLALQTGRELLSVGLDTEKNLHEVSLPFLVLHGTDDVVADPCGSKLLHERASSRDKTLK  262

Query  299  LYQGLYHSLIQGEPDEDANRVLADMREWIDERVSCNGTA  183
            LY G++H L+ GE  ED  RV AD+  W+D+RV    T 
Sbjct  263  LYPGMWHVLM-GELPEDVERVFADVISWLDDRVGGTATV  300



>ref|XP_006645817.1| PREDICTED: caffeoylshikimate esterase-like [Oryza brachyantha]
Length=327

 Score =   111 bits (277),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 58/155 (37%), Positives = 90/155 (58%), Gaps = 6/155 (4%)
 Frame = -2

Query  659  APLFVIPENMKPSKVHLFMYGLLFGFADT---WAMMPDNKMVGKAIRDVEKLKIIASNPR  489
            AP+  I E +KP   H  +  LL    D    W ++P   ++  A +D  K + I  N  
Sbjct  138  APMCKISEKVKP---HPLVITLLTQVEDVIPRWKIVPTKDVIDAAFKDPVKREKIRKNKL  194

Query  488  RYTGKPRVGTMREIARQCEYVQNNFEKVSVGFLTVHGTADGVTCPSGSQMLYDKASSSDK  309
             Y  KPR+ T  E+ R   YV+++  +V + F  +HG AD VT P  S+ LY++A+S+DK
Sbjct  195  IYQDKPRLKTALEMLRTSMYVEDSLSQVKLPFFVLHGDADTVTDPEVSRALYERAASADK  254

Query  308  TLKLYQGLYHSLIQGEPDEDANRVLADMREWIDER  204
            T+KLY G++H L  GEPD++ + + AD+  W++ER
Sbjct  255  TIKLYPGMWHGLTAGEPDDNVDSIFADVVAWLNER  289



>ref|XP_009803215.1| PREDICTED: caffeoylshikimate esterase [Nicotiana sylvestris]
Length=393

 Score =   111 bits (278),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 61/156 (39%), Positives = 88/156 (56%), Gaps = 0/156 (0%)
 Frame = -2

Query  659  APLFVIPENMKPSKVHLFMYGLLFGFADTWAMMPDNKMVGKAIRDVEKLKIIASNPRRYT  480
            AP+  I E+M P  +   +   +        ++P   +   A R+ +K K+   N   Y+
Sbjct  238  APMCKIAEDMTPPVLLQKVLIFVSNVTPQAKIVPTKDLAELAFREFKKRKMAPYNVISYS  297

Query  479  GKPRVGTMREIARQCEYVQNNFEKVSVGFLTVHGTADGVTCPSGSQMLYDKASSSDKTLK  300
             K RV T  E+    +Y+++  EKV+   L +HG AD VT P  SQ LYDK+SSSDKTLK
Sbjct  298  HKTRVKTAVELLNATKYIESQVEKVASPMLILHGAADKVTDPLVSQYLYDKSSSSDKTLK  357

Query  299  LYQGLYHSLIQGEPDEDANRVLADMREWIDERVSCN  192
            LY+G YH +++GEPD+    VL D+  W+D R S N
Sbjct  358  LYEGGYHCILEGEPDDRILTVLNDIISWLDSRCSAN  393



>ref|XP_006842295.1| hypothetical protein AMTR_s00079p00105260 [Amborella trichopoda]
 gb|ERN03970.1| hypothetical protein AMTR_s00079p00105260 [Amborella trichopoda]
Length=355

 Score =   111 bits (277),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 61/157 (39%), Positives = 90/157 (57%), Gaps = 6/157 (4%)
 Frame = -2

Query  659  APLFVIPENMKPSKVHLFMYGLLFGFADTW---AMMPDNKMVGKAIRDVEKLKIIASNPR  489
            AP+  I +NM P      +  +L G A+      ++P + +   A RD+EK K+ + N  
Sbjct  196  APMCKIADNMVPP---WLVTQMLIGIANVLPRHKLVPQSDLADMAFRDLEKRKLCSYNVI  252

Query  488  RYTGKPRVGTMREIARQCEYVQNNFEKVSVGFLTVHGTADGVTCPSGSQMLYDKASSSDK  309
             Y  KPR+ T  E+ R C+ ++   + VS+  L +HG AD VT PS S+ L+ KASS DK
Sbjct  253  SYKDKPRLRTAVEMLRTCQEIERRLQDVSLPLLILHGEADVVTDPSVSKALHQKASSKDK  312

Query  308  TLKLYQGLYHSLIQGEPDEDANRVLADMREWIDERVS  198
             L LY+  YH++++GE DE   RVL D+  W+DE  S
Sbjct  313  KLCLYENAYHAILEGESDEMIFRVLGDIISWLDEHYS  349



>ref|XP_009141807.1| PREDICTED: caffeoylshikimate esterase-like isoform X3 [Brassica 
rapa]
Length=295

 Score =   110 bits (275),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 58/154 (38%), Positives = 87/154 (56%), Gaps = 0/154 (0%)
 Frame = -2

Query  659  APLFVIPENMKPSKVHLFMYGLLFGFADTWAMMPDNKMVGKAIRDVEKLKIIASNPRRYT  480
            AP+  I E MKP+ V + +   L G   TW ++P   ++  A +  E  K +  NP  Y 
Sbjct  121  APMCKIAEEMKPNPVVISVLSKLSGVIPTWKIIPGQDIIETAFKQPEVRKQVRENPYCYK  180

Query  479  GKPRVGTMREIARQCEYVQNNFEKVSVGFLTVHGTADGVTCPSGSQMLYDKASSSDKTLK  300
            G+PR+ T  E+ R    ++   ++VS+ F+ +HG  D VT  + S  LY+ ASSSDKT K
Sbjct  181  GRPRLKTANELLRISTDLEKRLDEVSLPFMVLHGEDDKVTDKAVSGQLYEVASSSDKTFK  240

Query  299  LYQGLYHSLIQGEPDEDANRVLADMREWIDERVS  198
            LY G++H L+ GE  E+   V  D+  W+D+R S
Sbjct  241  LYPGMWHGLLYGETPENIEIVFTDIIGWLDKRAS  274



>ref|XP_010693140.1| PREDICTED: caffeoylshikimate esterase-like [Beta vulgaris subsp. 
vulgaris]
Length=316

 Score =   110 bits (276),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 58/158 (37%), Positives = 89/158 (56%), Gaps = 0/158 (0%)
 Frame = -2

Query  659  APLFVIPENMKPSKVHLFMYGLLFGFADTWAMMPDNKMVGKAIRDVEKLKIIASNPRRYT  480
            AP+  I ++MKP+         L  F  TW ++P   ++  AIRD E+ K   +NP  YT
Sbjct  140  APMCKIADDMKPNPYVTNFLTKLSDFVPTWKIVPGQDVIEIAIRDPERKKEARANPYWYT  199

Query  479  GKPRVGTMREIARQCEYVQNNFEKVSVGFLTVHGTADGVTCPSGSQMLYDKASSSDKTLK  300
            G+ R+ T  E+      ++    +V++ F+ +HG  D VT P  S++LY+ A+S DKT K
Sbjct  200  GRLRLKTAHELLNVSNDLEKRLNEVTLPFIVLHGEDDKVTDPEVSKLLYESAASFDKTFK  259

Query  299  LYQGLYHSLIQGEPDEDANRVLADMREWIDERVSCNGT  186
            LY G++H+L  GE  E+ N V  D+  W+DER   N +
Sbjct  260  LYPGMWHALTFGELPENINTVFNDIIGWLDERTRGNNS  297



>ref|XP_008362696.1| PREDICTED: caffeoylshikimate esterase-like [Malus domestica]
Length=315

 Score =   110 bits (276),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 60/159 (38%), Positives = 92/159 (58%), Gaps = 1/159 (1%)
 Frame = -2

Query  659  APLFVIPENMKPSKVHLFMYGLLFGFADTWAMMPDNKMVGKAIRDVEKLKIIASNPRRYT  480
            AP+  I +++KPS + +     L  F  TW ++P N ++  A +  E  K +  NP  Y 
Sbjct  143  APMCKIADDIKPSPLVISALTKLCKFIPTWKIIPTNDIIDVAFKMPEIRKQVRENPYCYK  202

Query  479  GKPRVGTMREIARQCEYVQNNFEKVSVGFLTVHGTADGVTCPSGSQMLYDKASSSDKTLK  300
            G+PR+ T  E+ R    ++   ++V++ F+ +HG  D VT  S S+ L+D ASS DKTLK
Sbjct  203  GRPRLQTGYELLRVSSDLEQRLDEVTLPFIXLHGEDDKVTDKSVSKQLHDVASSHDKTLK  262

Query  299  LYQGLYHSLIQGEPDEDANRVLADMREWIDERVSCNGTA  183
            +Y  ++H L+ GE  E+   V AD+  W+DER SC G A
Sbjct  263  MYPDMWHGLLYGETPENIEVVFADIISWLDER-SCFGNA  300



>ref|XP_011082467.1| PREDICTED: caffeoylshikimate esterase-like [Sesamum indicum]
Length=348

 Score =   110 bits (276),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 57/158 (36%), Positives = 89/158 (56%), Gaps = 0/158 (0%)
 Frame = -2

Query  659  APLFVIPENMKPSKVHLFMYGLLFGFADTWAMMPDNKMVGKAIRDVEKLKIIASNPRRYT  480
            AP+  I E +KP  V + +   +      W ++P   ++  A +D  K + I  N   Y 
Sbjct  137  APMCKISEKVKPHPVVISLLTRVEDVIPKWKIVPTKDVIDSAFKDPVKREKIRGNKLIYQ  196

Query  479  GKPRVGTMREIARQCEYVQNNFEKVSVGFLTVHGTADGVTCPSGSQMLYDKASSSDKTLK  300
             KPR+ T  E+ R    ++++  +V++ F  +HG AD VT P  S+ LYD+ASS DKT+K
Sbjct  197  EKPRLKTALELLRTSMNLEDSLNEVTLPFFVLHGEADTVTDPDVSRALYDRASSKDKTIK  256

Query  299  LYQGLYHSLIQGEPDEDANRVLADMREWIDERVSCNGT  186
            LY G++H L  GEPD++   V +D+  W+D+R    GT
Sbjct  257  LYPGMWHGLTSGEPDDNIEIVFSDILSWLDKRSGEGGT  294



>ref|XP_009141806.1| PREDICTED: caffeoylshikimate esterase-like isoform X2 [Brassica 
rapa]
Length=317

 Score =   110 bits (276),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 58/154 (38%), Positives = 87/154 (56%), Gaps = 0/154 (0%)
 Frame = -2

Query  659  APLFVIPENMKPSKVHLFMYGLLFGFADTWAMMPDNKMVGKAIRDVEKLKIIASNPRRYT  480
            AP+  I E MKP+ V + +   L G   TW ++P   ++  A +  E  K +  NP  Y 
Sbjct  143  APMCKIAEEMKPNPVVISVLSKLSGVIPTWKIIPGQDIIETAFKQPEVRKQVRENPYCYK  202

Query  479  GKPRVGTMREIARQCEYVQNNFEKVSVGFLTVHGTADGVTCPSGSQMLYDKASSSDKTLK  300
            G+PR+ T  E+ R    ++   ++VS+ F+ +HG  D VT  + S  LY+ ASSSDKT K
Sbjct  203  GRPRLKTANELLRISTDLEKRLDEVSLPFMVLHGEDDKVTDKAVSGQLYEVASSSDKTFK  262

Query  299  LYQGLYHSLIQGEPDEDANRVLADMREWIDERVS  198
            LY G++H L+ GE  E+   V  D+  W+D+R S
Sbjct  263  LYPGMWHGLLYGETPENIEIVFTDIIGWLDKRAS  296



>ref|XP_009141805.1| PREDICTED: caffeoylshikimate esterase-like isoform X1 [Brassica 
rapa]
Length=318

 Score =   110 bits (276),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 58/154 (38%), Positives = 87/154 (56%), Gaps = 0/154 (0%)
 Frame = -2

Query  659  APLFVIPENMKPSKVHLFMYGLLFGFADTWAMMPDNKMVGKAIRDVEKLKIIASNPRRYT  480
            AP+  I E MKP+ V + +   L G   TW ++P   ++  A +  E  K +  NP  Y 
Sbjct  144  APMCKIAEEMKPNPVVISVLSKLSGVIPTWKIIPGQDIIETAFKQPEVRKQVRENPYCYK  203

Query  479  GKPRVGTMREIARQCEYVQNNFEKVSVGFLTVHGTADGVTCPSGSQMLYDKASSSDKTLK  300
            G+PR+ T  E+ R    ++   ++VS+ F+ +HG  D VT  + S  LY+ ASSSDKT K
Sbjct  204  GRPRLKTANELLRISTDLEKRLDEVSLPFMVLHGEDDKVTDKAVSGQLYEVASSSDKTFK  263

Query  299  LYQGLYHSLIQGEPDEDANRVLADMREWIDERVS  198
            LY G++H L+ GE  E+   V  D+  W+D+R S
Sbjct  264  LYPGMWHGLLYGETPENIEIVFTDIIGWLDKRAS  297



>ref|XP_008383790.1| PREDICTED: caffeoylshikimate esterase-like [Malus domestica]
Length=342

 Score =   110 bits (276),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 60/153 (39%), Positives = 94/153 (61%), Gaps = 2/153 (1%)
 Frame = -2

Query  659  APLFVIPENMKPSKVHLFMYGLLFGFADTWAMMPDNKMVGKAIRDVEKLKIIAS-NPRRY  483
            AP+  I + +KP+     +   + G+    A++P   ++ K+++ VE+ KI+A  NP RY
Sbjct  179  APMCKISDKVKPTWPIPEILTFVAGYLXRLAIVPTADLMRKSVK-VEEKKIVADMNPSRY  237

Query  482  TGKPRVGTMREIARQCEYVQNNFEKVSVGFLTVHGTADGVTCPSGSQMLYDKASSSDKTL  303
             GKPR+GT+ E+ R  ++V      VS+ F+ +HG+AD VT P  S+ LY  A S DKTL
Sbjct  238  RGKPRLGTVVELLRVTQHVSERLGDVSLPFIVLHGSADVVTDPEVSKALYAAAKSEDKTL  297

Query  302  KLYQGLYHSLIQGEPDEDANRVLADMREWIDER  204
            K+Y+G+ HSL+ GE DE+   V  D+  W++ R
Sbjct  298  KIYEGMMHSLLFGETDENVEVVRGDILGWLNHR  330



>ref|XP_009133821.1| PREDICTED: caffeoylshikimate esterase [Brassica rapa]
Length=347

 Score =   110 bits (276),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 55/154 (36%), Positives = 90/154 (58%), Gaps = 0/154 (0%)
 Frame = -2

Query  659  APLFVIPENMKPSKVHLFMYGLLFGFADTWAMMPDNKMVGKAIRDVEKLKIIASNPRRYT  480
            AP+  I E +KP  V + +   +      W ++P   ++  A +D+ K + + +N   Y 
Sbjct  139  APMCKISEKVKPHPVVINLLTRVEEMIPKWKIVPTKDVINAAFKDLAKREEVRNNKLIYQ  198

Query  479  GKPRVGTMREIARQCEYVQNNFEKVSVGFLTVHGTADGVTCPSGSQMLYDKASSSDKTLK  300
             KPR+ T  E+ R    ++++  ++++ F  +HG AD VT P  S+ LY+KASS DKTLK
Sbjct  199  DKPRLKTALEMLRTSMNLEDSLHEITMPFFVLHGEADIVTDPEISKALYEKASSRDKTLK  258

Query  299  LYQGLYHSLIQGEPDEDANRVLADMREWIDERVS  198
            LY G++H+L  GEPD + + V AD+  W+D R +
Sbjct  259  LYPGMWHALTSGEPDYNVDLVFADIISWLDHRTA  292



>ref|XP_004972242.1| PREDICTED: monoglyceride lipase-like [Setaria italica]
Length=335

 Score =   110 bits (276),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 63/166 (38%), Positives = 95/166 (57%), Gaps = 4/166 (2%)
 Frame = -2

Query  659  APLFVIPENMKPSKVHLFMYGLLFGFADTWAMMPDNKMVGKAIRDVEKLKIIASNPRRYT  480
            AP+  I ++M+P  + +    ++   A +W ++P   M+ K  +D +  K I SNP  Y 
Sbjct  172  APMCKIFDDMRPHPIVVSALKMISAVAPSWRVIPATDMIDKVCKDPQFKKEIRSNPYMYK  231

Query  479  GKPRVGTMREIARQCEYVQNNFEKVSVGFLTVHGTADGVTCPSGSQMLYDKASSSDKTLK  300
            G   + T  E+      V+ N  +VS+ FL +HGT D V  P GS++L+++ASS DKTLK
Sbjct  232  GNLSLQTGSELLTVSLDVEKNLHEVSLPFLVLHGTDDVVADPYGSKLLHERASSRDKTLK  291

Query  299  LYQGLYHSLIQGEPDEDANRVLADMREWIDERVSCNGTAV*GCQLR  162
            LY G++H L+ GE  ED  RV AD+  W++ RV   G  V G + R
Sbjct  292  LYPGMWHVLM-GERPEDVERVFADVISWLEGRV---GATVPGSKTR  333



>ref|XP_002302714.1| hypothetical protein POPTR_0002s20550g [Populus trichocarpa]
 gb|EEE81987.1| hypothetical protein POPTR_0002s20550g [Populus trichocarpa]
Length=342

 Score =   110 bits (276),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 59/157 (38%), Positives = 91/157 (58%), Gaps = 6/157 (4%)
 Frame = -2

Query  659  APLFVIPENMKPSKVHLFMYGLLFGFAD---TWAMMPDNKMVGKAIRDVEKLKIIASNPR  489
            AP+  I E +KP   H  +  +L G  D    W ++P   ++  A +D  K + I +N  
Sbjct  140  APMCKISEKLKP---HPVVVNILTGLVDLIPKWKIVPTKDIIDSAFKDPLKREEIRNNKL  196

Query  488  RYTGKPRVGTMREIARQCEYVQNNFEKVSVGFLTVHGTADGVTCPSGSQMLYDKASSSDK  309
             Y  KPR+ T  E+ R    V+ + ++V++ F+ +HG AD VT P  S+ LYD+ASS DK
Sbjct  197  IYQDKPRLKTALEMLRTSMRVEESLKQVTLPFVVLHGDADTVTDPEVSKALYDRASSEDK  256

Query  308  TLKLYQGLYHSLIQGEPDEDANRVLADMREWIDERVS  198
            T+K+Y G++H+L  GE DE+   V AD+  W+DE  +
Sbjct  257  TMKMYPGMWHALTVGETDENVGVVFADIIAWLDEHTA  293



>gb|EYU27946.1| hypothetical protein MIMGU_mgv1a026912mg [Erythranthe guttata]
Length=316

 Score =   110 bits (275),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 59/155 (38%), Positives = 93/155 (60%), Gaps = 1/155 (1%)
 Frame = -2

Query  659  APLFVIPENMKPSKVHLFMYGLLFGFADTWAMMPDNKMVGKAIRDVEKLKIIASNPRRYT  480
            AP+  I E ++P      +   +  FA T  ++P   ++ K+++  EK  I   NP RY 
Sbjct  163  APMCRISEKVRPRWPIPQILTAVARFAPTLPIVPTADLLDKSVKVAEKKIIGGMNPMRYH  222

Query  479  GKPRVGTMREIARQCEYVQNNFEKVSVGFLTVHGTADGVTCPSGSQMLYDKASSSDKTLK  300
            GKPR+GT+ E+ R  +YV      V + F+ +HG AD VT P+ S+ LY+ A S DK++K
Sbjct  223  GKPRLGTVLELLRVTDYVSGRLRDVGIPFIVMHGDADVVTDPAVSRELYELAKSEDKSVK  282

Query  299  LYQGLYHSLIQGEPDEDANRVLADMREWIDERVSC  195
            +Y+G+ HSL+ GE DE+   V  D+ +W+++R SC
Sbjct  283  IYEGMMHSLLFGETDENVAIVRGDVLKWLNDR-SC  316



>ref|XP_004489111.1| PREDICTED: monoglyceride lipase-like isoform X2 [Cicer arietinum]
 ref|XP_004489112.1| PREDICTED: monoglyceride lipase-like isoform X3 [Cicer arietinum]
Length=351

 Score =   110 bits (276),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 61/155 (39%), Positives = 92/155 (59%), Gaps = 6/155 (4%)
 Frame = -2

Query  659  APLFVIPENMKPSKVHLFMYGLLFGFADTW---AMMPDNKMVGKAIRDVEKLKIIASNPR  489
            AP+  I ++M P K+   +  +L G A+      ++P   +   A RD++K +  A N  
Sbjct  190  APMCKIADDMVPPKL---LTHILIGVANVLPKHKLVPQKNLAEAAFRDLKKREQTAYNVV  246

Query  488  RYTGKPRVGTMREIARQCEYVQNNFEKVSVGFLTVHGTADGVTCPSGSQMLYDKASSSDK  309
             Y  KPR+ T  E+ +  + ++   E+VS+  L +HG AD VT PS S+  Y+KASSSDK
Sbjct  247  AYKDKPRLWTAVEMLKTTQEIEQRLEEVSLPLLILHGEADIVTDPSVSKEFYEKASSSDK  306

Query  308  TLKLYQGLYHSLIQGEPDEDANRVLADMREWIDER  204
             LKLY+  YHSL++GEPDE   +V +D+  W+DE 
Sbjct  307  KLKLYKDAYHSLLEGEPDEMIIQVFSDIISWLDEH  341



>ref|XP_002450081.1| hypothetical protein SORBIDRAFT_05g000200 [Sorghum bicolor]
 gb|EES09069.1| hypothetical protein SORBIDRAFT_05g000200 [Sorghum bicolor]
Length=349

 Score =   110 bits (275),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 59/155 (38%), Positives = 89/155 (57%), Gaps = 1/155 (1%)
 Frame = -2

Query  659  APLFVIPENMKPSKVHLFMYGLLFGFADTWAMMPDNKMVGKAIRDVEKLKIIASNPRRYT  480
            AP+  I ++M+P  + + +   +     TW ++P N ++  A +  EK   I  NP  Y 
Sbjct  164  APMCKIADDMRPHPLVVNILRAMTSIVPTWKIVPSNDVIDAAYKTQEKRDEIRGNPYCYK  223

Query  479  GKPRVGTMREIAR-QCEYVQNNFEKVSVGFLTVHGTADGVTCPSGSQMLYDKASSSDKTL  303
             KPR+ T  E+ +   +  QN   +VS+ FL VHG AD VT PS S++LY  A+S DKTL
Sbjct  224  DKPRLKTAYELLKVSLDLEQNLLHQVSLPFLIVHGGADKVTDPSVSELLYRSAASQDKTL  283

Query  302  KLYQGLYHSLIQGEPDEDANRVLADMREWIDERVS  198
            KLY G++H+L  GE  ++ + V  D+  W+D R S
Sbjct  284  KLYPGMWHALTSGESPDNIHTVFQDIIAWLDHRSS  318



>ref|XP_004489110.1| PREDICTED: monoglyceride lipase-like isoform X1 [Cicer arietinum]
Length=384

 Score =   110 bits (276),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 61/155 (39%), Positives = 92/155 (59%), Gaps = 6/155 (4%)
 Frame = -2

Query  659  APLFVIPENMKPSKVHLFMYGLLFGFADTW---AMMPDNKMVGKAIRDVEKLKIIASNPR  489
            AP+  I ++M P K+   +  +L G A+      ++P   +   A RD++K +  A N  
Sbjct  223  APMCKIADDMVPPKL---LTHILIGVANVLPKHKLVPQKNLAEAAFRDLKKREQTAYNVV  279

Query  488  RYTGKPRVGTMREIARQCEYVQNNFEKVSVGFLTVHGTADGVTCPSGSQMLYDKASSSDK  309
             Y  KPR+ T  E+ +  + ++   E+VS+  L +HG AD VT PS S+  Y+KASSSDK
Sbjct  280  AYKDKPRLWTAVEMLKTTQEIEQRLEEVSLPLLILHGEADIVTDPSVSKEFYEKASSSDK  339

Query  308  TLKLYQGLYHSLIQGEPDEDANRVLADMREWIDER  204
             LKLY+  YHSL++GEPDE   +V +D+  W+DE 
Sbjct  340  KLKLYKDAYHSLLEGEPDEMIIQVFSDIISWLDEH  374



>ref|XP_006417390.1| hypothetical protein EUTSA_v10010022mg [Eutrema salsugineum]
 gb|ESQ35743.1| hypothetical protein EUTSA_v10010022mg [Eutrema salsugineum]
Length=392

 Score =   110 bits (276),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 58/146 (40%), Positives = 90/146 (62%), Gaps = 2/146 (1%)
 Frame = -2

Query  659  APLFVIPENMKPS-KVHLFMYGLLFGFADTWAMMPDNKMVGKAIRDVEKLKIIASNPRRY  483
            AP+  I + ++P   +  F+  ++  F  TWA++P   ++ K+I+  EK  I   NP RY
Sbjct  183  APMCKISDKVRPKWPIDQFLI-MISRFLPTWAIVPTEDLLEKSIKVEEKKPIAKRNPMRY  241

Query  482  TGKPRVGTMREIARQCEYVQNNFEKVSVGFLTVHGTADGVTCPSGSQMLYDKASSSDKTL  303
              KPR+GT+ E+ R  +Y+    + VS+ F+ +HG+AD VT P  S+ LY  A S DKTL
Sbjct  242  GEKPRLGTVMELLRVTDYLGKKLKDVSIPFIVLHGSADVVTDPEVSRELYQDAKSKDKTL  301

Query  302  KLYQGLYHSLIQGEPDEDANRVLADM  225
            K+YQG+ HS++ GEPD++   V  D+
Sbjct  302  KIYQGMMHSMLFGEPDDNIEIVRKDI  327



>emb|CDX83323.1| BnaA03g21830D [Brassica napus]
Length=347

 Score =   110 bits (275),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 55/154 (36%), Positives = 90/154 (58%), Gaps = 0/154 (0%)
 Frame = -2

Query  659  APLFVIPENMKPSKVHLFMYGLLFGFADTWAMMPDNKMVGKAIRDVEKLKIIASNPRRYT  480
            AP+  I E +KP  V + +   +      W ++P   ++  A +D+ K + + +N   Y 
Sbjct  139  APMCKISEKVKPHPVVINLLTRVEEMIPKWKIVPTKDVIDAAFKDLAKREEVRNNKLIYQ  198

Query  479  GKPRVGTMREIARQCEYVQNNFEKVSVGFLTVHGTADGVTCPSGSQMLYDKASSSDKTLK  300
             KPR+ T  E+ R    ++++  ++++ F  +HG AD VT P  S+ LY+KASS DKTLK
Sbjct  199  DKPRLKTALEMLRTSMNLEDSLHEITMPFFVLHGEADIVTDPEISKALYEKASSRDKTLK  258

Query  299  LYQGLYHSLIQGEPDEDANRVLADMREWIDERVS  198
            LY G++H+L  GEPD + + V AD+  W+D R +
Sbjct  259  LYPGMWHALTSGEPDYNVDLVFADIISWLDHRTA  292



>emb|CDX85514.1| BnaA02g02990D [Brassica napus]
Length=616

 Score =   112 bits (281),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 64/157 (41%), Positives = 90/157 (57%), Gaps = 6/157 (4%)
 Frame = -2

Query  659  APLFVIPENMKPSKVHLFMYGLLFGFADTW---AMMPDNKMVGKAIRDVEKLKIIASNPR  489
            AP+  I ++M P  V   +  +L G A+      ++P   +   A RDV K  +   N  
Sbjct  230  APMCKIADDMVPPPV---LKQILIGLANVLPKHKLVPQKDLAEAAFRDVRKRNMTQYNVI  286

Query  488  RYTGKPRVGTMREIARQCEYVQNNFEKVSVGFLTVHGTADGVTCPSGSQMLYDKASSSDK  309
             Y+GKPR+ T  E+ R  + ++    KVS+  L +HG AD VT PS S+ LY KA SSDK
Sbjct  287  CYSGKPRLRTAVEMLRTTQEIEQQLGKVSLPILILHGEADTVTDPSVSRELYQKAKSSDK  346

Query  308  TLKLYQGLYHSLIQGEPDEDANRVLADMREWIDERVS  198
             + LY+  YHSL++GEPDE   RVLAD+  W+D+  S
Sbjct  347  KIVLYKDAYHSLLEGEPDEMILRVLADIISWLDDHSS  383



>emb|CDX95729.1| BnaC03g26100D [Brassica napus]
Length=347

 Score =   110 bits (275),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 55/154 (36%), Positives = 90/154 (58%), Gaps = 0/154 (0%)
 Frame = -2

Query  659  APLFVIPENMKPSKVHLFMYGLLFGFADTWAMMPDNKMVGKAIRDVEKLKIIASNPRRYT  480
            AP+  I E +KP  V + +   +      W ++P   ++  A +D+ K + + +N   Y 
Sbjct  139  APMCKISEKVKPHPVVINLLTRVEEMIPKWKIVPTKDVIDAAFKDLAKREEVRNNKLIYQ  198

Query  479  GKPRVGTMREIARQCEYVQNNFEKVSVGFLTVHGTADGVTCPSGSQMLYDKASSSDKTLK  300
             KPR+ T  E+ R    ++++  ++++ F  +HG AD VT P  S+ LY+KASS DKTLK
Sbjct  199  DKPRLKTALEMLRTSMNLEDSLHEITMPFFVLHGEADIVTDPEISKALYEKASSRDKTLK  258

Query  299  LYQGLYHSLIQGEPDEDANRVLADMREWIDERVS  198
            LY G++H+L  GEPD + + V AD+  W+D R +
Sbjct  259  LYPGMWHALTSGEPDYNVDLVFADIISWLDHRTA  292



>gb|EMS59411.1| hypothetical protein TRIUR3_33748 [Triticum urartu]
Length=335

 Score =   110 bits (275),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 60/153 (39%), Positives = 86/153 (56%), Gaps = 1/153 (1%)
 Frame = -2

Query  659  APLFVIPENMKPSKVHLFMYGLLFGFADTWAMMPDNKMVGKAIRDVEKLKIIASNPRRYT  480
            AP+  I + M+P  V + +  L+     TW ++P   ++  A R  EK   I +NP  Y 
Sbjct  151  APMCKIADEMRPHPVVVSVLKLMTNIIPTWKIVPTTDVIDAAYRMQEKRDEIRNNPHCYQ  210

Query  479  GKPRVGTMREIARQCEYVQNN-FEKVSVGFLTVHGTADGVTCPSGSQMLYDKASSSDKTL  303
            GKPR+ T  E+ +    ++NN   KVS+ FL VHG  D VT PS S +LY  A S DK L
Sbjct  211  GKPRLKTAYELLKVSLNLENNVLSKVSLPFLIVHGGDDKVTDPSVSDLLYRSAVSQDKKL  270

Query  302  KLYQGLYHSLIQGEPDEDANRVLADMREWIDER  204
             LY G++H+L  GE  E+ + V  D+  W+D+R
Sbjct  271  NLYPGMWHALTSGESPENIHTVFQDIIAWLDQR  303



>ref|XP_006375458.1| hypothetical protein POPTR_0014s12360g [Populus trichocarpa]
 gb|ERP53255.1| hypothetical protein POPTR_0014s12360g [Populus trichocarpa]
Length=300

 Score =   109 bits (273),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 59/156 (38%), Positives = 89/156 (57%), Gaps = 6/156 (4%)
 Frame = -2

Query  665  FSAPLFVIPENMKPSKVHLFMYGLLFGFAD---TWAMMPDNKMVGKAIRDVEKLKIIASN  495
             +AP+  I E +KP   H  +  +L GF D    W ++P   ++  A +D  K + I +N
Sbjct  95   LAAPMCKISEKLKP---HQVVINILTGFEDLIPKWKIVPSKDVIDSAFKDPVKREEIRNN  151

Query  494  PRRYTGKPRVGTMREIARQCEYVQNNFEKVSVGFLTVHGTADGVTCPSGSQMLYDKASSS  315
               Y  KPR+ T  E+ R    V+ +  KV++ FL +HG +D VT P  S+ LY++ASS 
Sbjct  152  KLIYQDKPRLKTALEMLRTSMRVEESLNKVTLPFLVLHGDSDTVTDPEISKALYERASSI  211

Query  314  DKTLKLYQGLYHSLIQGEPDEDANRVLADMREWIDE  207
            DKT+KLY G++H L  GE DE+   V  D+  W+D+
Sbjct  212  DKTMKLYPGMWHGLTAGETDENVGIVFTDVVAWLDK  247



>ref|XP_008440696.1| PREDICTED: caffeoylshikimate esterase-like [Cucumis melo]
Length=317

 Score =   109 bits (273),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 57/160 (36%), Positives = 92/160 (58%), Gaps = 0/160 (0%)
 Frame = -2

Query  659  APLFVIPENMKPSKVHLFMYGLLFGFADTWAMMPDNKMVGKAIRDVEKLKIIASNPRRYT  480
            AP+  I +++KPS + + +   L  F  TW ++P   ++  A +  E    I +NP  Y 
Sbjct  144  APMCKIADDVKPSPLVVSILTKLCNFIPTWKIVPTQDIIDVAFKVPEIRHQIRTNPYCYK  203

Query  479  GKPRVGTMREIARQCEYVQNNFEKVSVGFLTVHGTADGVTCPSGSQMLYDKASSSDKTLK  300
            GKPR+ T  E+ R    ++   ++VS+ F+ +HG  D VT  S S+ LY+KASS DK+LK
Sbjct  204  GKPRLNTGHELLRISLDLEQRLDEVSLPFIILHGEEDRVTDMSASEQLYEKASSWDKSLK  263

Query  299  LYQGLYHSLIQGEPDEDANRVLADMREWIDERVSCNGTAV  180
             Y  ++H L+ GE DE+ + V  D+  W+DER +   + +
Sbjct  264  RYPEMWHGLLYGETDENIDVVFGDIIAWLDERCALGNSRI  303



>ref|XP_011077926.1| PREDICTED: caffeoylshikimate esterase-like [Sesamum indicum]
Length=327

 Score =   110 bits (274),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 55/153 (36%), Positives = 89/153 (58%), Gaps = 0/153 (0%)
 Frame = -2

Query  659  APLFVIPENMKPSKVHLFMYGLLFGFADTWAMMPDNKMVGKAIRDVEKLKIIASNPRRYT  480
            AP+  I E +KP+ + +     L     TW + P   +V  A RD +    + SNP  Y 
Sbjct  145  APMCKIAEELKPNPLLVKALTSLASIVPTWKLTPSPDIVDLAFRDPKVRDEVRSNPYTYK  204

Query  479  GKPRVGTMREIARQCEYVQNNFEKVSVGFLTVHGTADGVTCPSGSQMLYDKASSSDKTLK  300
            G+PR+ T  ++     +++   ++VS+ F+ +HG  D VT PS S++LY+ A ++DKT K
Sbjct  205  GRPRLQTSYQLYEASVHLEQRLQEVSLPFIILHGEDDKVTDPSVSKVLYESACAADKTFK  264

Query  299  LYQGLYHSLIQGEPDEDANRVLADMREWIDERV  201
            LY G++HSL  GE  E+ + V +D+ +W+ ERV
Sbjct  265  LYPGMWHSLSYGELPENLDTVFSDLLDWLKERV  297



>ref|XP_011033533.1| PREDICTED: caffeoylshikimate esterase-like [Populus euphratica]
Length=342

 Score =   110 bits (274),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 59/156 (38%), Positives = 89/156 (57%), Gaps = 6/156 (4%)
 Frame = -2

Query  665  FSAPLFVIPENMKPSKVHLFMYGLLFGFAD---TWAMMPDNKMVGKAIRDVEKLKIIASN  495
             +AP+  I E +KP   H  +  +L GF D    W ++P   ++  A +D  K + I +N
Sbjct  137  LAAPMCKISEKLKP---HQVVINILTGFEDLIPKWKIVPSKDVIDSAFKDPVKREEIRNN  193

Query  494  PRRYTGKPRVGTMREIARQCEYVQNNFEKVSVGFLTVHGTADGVTCPSGSQMLYDKASSS  315
               Y  KPR+ T  E+ R    V+ +  KV++ FL +HG +D VT P  S+ LY++ASS 
Sbjct  194  KLIYQDKPRLKTALEMLRTSMRVEESLNKVTLPFLVLHGDSDTVTDPEISKALYERASSE  253

Query  314  DKTLKLYQGLYHSLIQGEPDEDANRVLADMREWIDE  207
            DKT+KLY G++H L  GE DE+   V  D+  W+D+
Sbjct  254  DKTMKLYPGMWHGLTAGETDENVGIVFTDVVAWLDK  289



>ref|XP_004962321.1| PREDICTED: putative monoglyceride lipase-like isoform X2 [Setaria 
italica]
Length=324

 Score =   109 bits (273),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 56/152 (37%), Positives = 87/152 (57%), Gaps = 0/152 (0%)
 Frame = -2

Query  659  APLFVIPENMKPSKVHLFMYGLLFGFADTWAMMPDNKMVGKAIRDVEKLKIIASNPRRYT  480
            AP+  I E +KP  V + +   +      W ++P   ++  A +D  K + I  N   Y 
Sbjct  106  APMCKISEKVKPHPVVITLLTQVEEIIPKWKIVPTKDVIDSAFKDPVKREKIRKNKLIYQ  165

Query  479  GKPRVGTMREIARQCEYVQNNFEKVSVGFLTVHGTADGVTCPSGSQMLYDKASSSDKTLK  300
             KPR+ T  E+ R    V+++  +V + F  +HG AD VT P  S+ LY++A+S+DKT+K
Sbjct  166  DKPRLKTALELLRTSMDVEDSLSEVRMPFFILHGEADMVTDPEVSRALYERAASTDKTIK  225

Query  299  LYQGLYHSLIQGEPDEDANRVLADMREWIDER  204
            LY G++H L  GEPDE+   V +D+  W+DER
Sbjct  226  LYPGMWHGLTAGEPDENVELVFSDIVAWLDER  257



>ref|XP_001768097.1| predicted protein [Physcomitrella patens]
 gb|EDQ66970.1| predicted protein [Physcomitrella patens]
Length=296

 Score =   109 bits (272),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 55/150 (37%), Positives = 87/150 (58%), Gaps = 0/150 (0%)
 Frame = -2

Query  659  APLFVIPENMKPSKVHLFMYGLLFGFADTWAMMPDNKMVGKAIRDVEKLKIIASNPRRYT  480
            AP+  I ++M P    + +  +L        ++  N +    +RD+EK K   +NP  Y 
Sbjct  133  APMCKIADSMIPPWYLVKILIVLAHIIPKAKLVSSNDIAEIGLRDLEKRKRANNNPVAYI  192

Query  479  GKPRVGTMREIARQCEYVQNNFEKVSVGFLTVHGTADGVTCPSGSQMLYDKASSSDKTLK  300
            G PR+GT  ++ +  + ++ N  +VS+  L +HG AD VT P+ S+ LY+KA S DKTL+
Sbjct  193  GNPRLGTALQLLQTTDLIEKNLTEVSLPLLILHGAADEVTDPAVSKALYEKAKSKDKTLR  252

Query  299  LYQGLYHSLIQGEPDEDANRVLADMREWID  210
            LY G +H L+QGEPD+    V+ D+  W+D
Sbjct  253  LYDGAWHCLLQGEPDDVVKNVMMDIISWLD  282



>gb|KFK37501.1| hypothetical protein AALP_AA4G265600 [Arabis alpina]
Length=348

 Score =   110 bits (274),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 53/154 (34%), Positives = 93/154 (60%), Gaps = 0/154 (0%)
 Frame = -2

Query  659  APLFVIPENMKPSKVHLFMYGLLFGFADTWAMMPDNKMVGKAIRDVEKLKIIASNPRRYT  480
            AP+  I E +KP ++ + +   +      W ++P   ++  A +D++K + + +N   Y 
Sbjct  140  APMCKISEKVKPHQLVIDVLTKVEDIIPKWKIVPTKDVINAAFKDLDKREEVRNNKLIYQ  199

Query  479  GKPRVGTMREIARQCEYVQNNFEKVSVGFLTVHGTADGVTCPSGSQMLYDKASSSDKTLK  300
             KPR+ T  E+ R    ++++ +++++ F  +HG AD VT P  S+ LY+KAS+ DKTLK
Sbjct  200  DKPRLKTALEMLRTSMNLEDSLDEITMPFFVLHGEADTVTDPEISKALYEKASTRDKTLK  259

Query  299  LYQGLYHSLIQGEPDEDANRVLADMREWIDERVS  198
            LY G++H+L  GEPD + + V AD+  W+D R +
Sbjct  260  LYPGMWHALTSGEPDYNVDIVFADIIAWLDLRTA  293



>ref|XP_006289624.1| hypothetical protein CARUB_v10003177mg [Capsella rubella]
 gb|EOA22522.1| hypothetical protein CARUB_v10003177mg [Capsella rubella]
Length=351

 Score =   109 bits (273),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 60/164 (37%), Positives = 95/164 (58%), Gaps = 7/164 (4%)
 Frame = -2

Query  659  APLFVIPENMKPSKVHLFMYGLLFGFADTW---AMMPDNKMVGKAIRDVEKLKIIASNPR  489
            AP+  I +++ P  V   +  +L G A       ++P   +   A RD+ K ++   N  
Sbjct  188  APMCKIADDLVPPPV---LKQILIGLASVLPKQKLVPQKDLAEAAFRDIRKREMTPYNVI  244

Query  488  RYTGKPRVGTMREIARQCEYVQNNFEKVSVGFLTVHGTADGVTCPSGSQMLYDKASSSDK  309
             Y+GKPR+ +  E+ R  + ++   +KVS+  L +HG AD VT PS S+ LY+KA S+DK
Sbjct  245  CYSGKPRLRSAVEMLRTTQEIEKQLQKVSLPILILHGEADTVTDPSVSRELYEKAKSADK  304

Query  308  TLKLYQGLYHSLIQGEPDEDANRVLADMREWIDER-VSCNGTAV  180
             + LY+  YHSL++GEPD+   RVL+D+  W+DE  +   G+ V
Sbjct  305  KIVLYENAYHSLLEGEPDDMILRVLSDIISWLDEHSLQAEGSVV  348



>ref|XP_006344132.1| PREDICTED: caffeoylshikimate esterase-like [Solanum tuberosum]
Length=397

 Score =   110 bits (274),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 63/160 (39%), Positives = 91/160 (57%), Gaps = 8/160 (5%)
 Frame = -2

Query  659  APLFVIPENMKP----SKVHLFMYGLLFGFADTWAMMPDNKMVGKAIRDVEKLKIIASNP  492
            AP+  I E+M P     KV +F+  ++        ++P   +   AIR+ +K K+   N 
Sbjct  242  APMCKIAEDMTPPVPLQKVLIFLSNIM----PQAKIVPTKDLAELAIREFKKRKMAPYNV  297

Query  491  RRYTGKPRVGTMREIARQCEYVQNNFEKVSVGFLTVHGTADGVTCPSGSQMLYDKASSSD  312
              Y+ K RV T  E+    +Y+++  +KV+   L +HG  D VT P  SQ LYDK+SSSD
Sbjct  298  ISYSDKTRVKTAVELLNATKYIESQVDKVASPMLILHGADDKVTDPRVSQYLYDKSSSSD  357

Query  311  KTLKLYQGLYHSLIQGEPDEDANRVLADMREWIDERVSCN  192
            KTLKLY G YH +++GEPD+    VL D+  W+D R S N
Sbjct  358  KTLKLYDGGYHCILEGEPDDRILTVLNDIISWLDTRCSSN  397



>ref|XP_009133363.1| PREDICTED: caffeoylshikimate esterase-like [Brassica rapa]
Length=317

 Score =   109 bits (272),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 59/154 (38%), Positives = 87/154 (56%), Gaps = 0/154 (0%)
 Frame = -2

Query  659  APLFVIPENMKPSKVHLFMYGLLFGFADTWAMMPDNKMVGKAIRDVEKLKIIASNPRRYT  480
            AP+  I E MKPS + + +   L G   TW ++P   ++  A +  E  K +  N   Y 
Sbjct  143  APMCKIAEEMKPSPLVISILSKLSGVIPTWKIIPGQDIIETAFKQPEIRKQVRENLYCYK  202

Query  479  GKPRVGTMREIARQCEYVQNNFEKVSVGFLTVHGTADGVTCPSGSQMLYDKASSSDKTLK  300
            G+PR+ T  E+ R    ++    +VS+ FL +HG  D VT  + S+ LY+ ASSSDKT K
Sbjct  203  GRPRLKTAYELLRVSTDLEKRLNEVSLPFLVLHGEDDKVTDKAVSRELYETASSSDKTFK  262

Query  299  LYQGLYHSLIQGEPDEDANRVLADMREWIDERVS  198
            LY G++H L+ GE  E+   V AD+  W+D+R S
Sbjct  263  LYPGMWHGLLYGETPENIEIVFADIIGWLDKRAS  296



>ref|XP_006841721.1| hypothetical protein AMTR_s00003p00257040 [Amborella trichopoda]
 gb|ERN03396.1| hypothetical protein AMTR_s00003p00257040 [Amborella trichopoda]
Length=329

 Score =   109 bits (272),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 55/157 (35%), Positives = 91/157 (58%), Gaps = 0/157 (0%)
 Frame = -2

Query  659  APLFVIPENMKPSKVHLFMYGLLFGFADTWAMMPDNKMVGKAIRDVEKLKIIASNPRRYT  480
            AP+  I + ++P         L+  F  T  ++P   ++ K+++ +EK  +   NP RY 
Sbjct  161  APMCKISDKVRPKWPIPQALTLISWFFPTLPVVPTADLLDKSVKVLEKRVVARRNPTRYA  220

Query  479  GKPRVGTMREIARQCEYVQNNFEKVSVGFLTVHGTADGVTCPSGSQMLYDKASSSDKTLK  300
            G+PR+GT+ E+ R  +++     +V + FL VHG+AD VT P  S+ LY+ A S DK+++
Sbjct  221  GRPRLGTVVELLRFTDWLSERLSEVKLPFLVVHGSADEVTDPEVSRSLYEAARSEDKSIR  280

Query  299  LYQGLYHSLIQGEPDEDANRVLADMREWIDERVSCNG  189
            +Y+G+ HSL+ GE DE+   V  D+  W+ ER    G
Sbjct  281  VYEGMMHSLLFGETDENVELVRGDILAWLKERCREEG  317



>gb|AEV41020.1| hypothetical protein [Oryza minuta]
Length=368

 Score =   109 bits (273),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 56/141 (40%), Positives = 87/141 (62%), Gaps = 0/141 (0%)
 Frame = -2

Query  659  APLFVIPENMKPSKVHLFMYGLLFGFADTWAMMPDNKMVGKAIRDVEKLKIIASNPRRYT  480
            AP+  I + ++P      +   +  FA T A++P   ++ K+++   K  I A NP RY 
Sbjct  142  APMCKISDRIRPPWPLPQILTFVARFAPTLAIVPTADLIEKSVKVPAKRLIAARNPMRYN  201

Query  479  GKPRVGTMREIARQCEYVQNNFEKVSVGFLTVHGTADGVTCPSGSQMLYDKASSSDKTLK  300
            G+PR+ T+ E+ R  + +     +V+V FL VHG+AD VT P+ S+ LYD A+S DKT+K
Sbjct  202  GRPRLDTVVELLRATDELGARLGEVTVPFLVVHGSADEVTDPAISRALYDAAASEDKTIK  261

Query  299  LYQGLYHSLIQGEPDEDANRV  237
            +Y G+ HS++ GEPDE+  RV
Sbjct  262  IYDGMLHSMLFGEPDENIERV  282



>ref|XP_010549925.1| PREDICTED: caffeoylshikimate esterase-like [Tarenaya hassleriana]
Length=352

 Score =   109 bits (273),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 60/157 (38%), Positives = 92/157 (59%), Gaps = 6/157 (4%)
 Frame = -2

Query  659  APLFVIPENMKPSKVHLFMYGLLFGFADTWA---MMPDNKMVGKAIRDVEKLKIIASNPR  489
            AP+  I ++M P ++   +  +L G A+      ++P   +   A RD+ K K+   N  
Sbjct  192  APMCKIADDMVPPRL---LKQILIGLANVLPKRKLVPQKDLADAAFRDIGKRKLAPYNVI  248

Query  488  RYTGKPRVGTMREIARQCEYVQNNFEKVSVGFLTVHGTADGVTCPSGSQMLYDKASSSDK  309
             Y  KPR+ T  E+    + ++   EKVS+  L +HG AD VT PS S+ LY+KASSSDK
Sbjct  249  CYKDKPRLRTAVELLHTTQEIEQKLEKVSLPILILHGEADVVTDPSVSKALYEKASSSDK  308

Query  308  TLKLYQGLYHSLIQGEPDEDANRVLADMREWIDERVS  198
             + LY+  +HSL++GEPD+   RVL+D+  W+D+  S
Sbjct  309  KIILYKDAFHSLLEGEPDDVIIRVLSDIISWLDQHSS  345



>ref|XP_007009573.1| Alpha/beta-Hydrolases superfamily protein [Theobroma cacao]
 gb|EOY18383.1| Alpha/beta-Hydrolases superfamily protein [Theobroma cacao]
Length=324

 Score =   109 bits (272),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 56/153 (37%), Positives = 87/153 (57%), Gaps = 0/153 (0%)
 Frame = -2

Query  659  APLFVIPENMKPSKVHLFMYGLLFGFADTWAMMPDNKMVGKAIRDVEKLKIIASNPRRYT  480
            AP+  I + MKP  + + +   L  F  TW ++P   ++  A R  E  + I +NP  Y 
Sbjct  143  APMCKIADEMKPHPLVISVLTKLCNFIPTWKIIPSKDVIDAAFRRPEIREQIRANPYCYK  202

Query  479  GKPRVGTMREIARQCEYVQNNFEKVSVGFLTVHGTADGVTCPSGSQMLYDKASSSDKTLK  300
            G+PR+ T  E+ +    ++    +VS+ F+ +HG  D VT  + SQ LYD A+SSDKT K
Sbjct  203  GRPRLKTGNELLKTSMELEQRLNEVSLPFIVLHGGDDKVTDKAVSQQLYDVAASSDKTFK  262

Query  299  LYQGLYHSLIQGEPDEDANRVLADMREWIDERV  201
            LY G++H L+ GE  E+   V AD+  W+++R 
Sbjct  263  LYPGMWHGLLYGETPENIEIVFADIINWLNQRT  295



>ref|XP_010521005.1| PREDICTED: caffeoylshikimate esterase-like, partial [Tarenaya 
hassleriana]
Length=298

 Score =   108 bits (271),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 55/153 (36%), Positives = 88/153 (58%), Gaps = 0/153 (0%)
 Frame = -2

Query  659  APLFVIPENMKPSKVHLFMYGLLFGFADTWAMMPDNKMVGKAIRDVEKLKIIASNPRRYT  480
            AP+  I E +KP  V + +   +      W ++P   ++  A +D  K + + +N   Y 
Sbjct  95   APMCKISEKVKPHPVVINLLTRVEEIIPKWKIVPTKDVIDAAFKDPIKREEVRNNKLTYQ  154

Query  479  GKPRVGTMREIARQCEYVQNNFEKVSVGFLTVHGTADGVTCPSGSQMLYDKASSSDKTLK  300
             KPR+ T  E+ R    +++   ++++ FL +HG AD VT P  S+ LY+KASS DKT+K
Sbjct  155  DKPRLKTALEMLRTSMNLEDTLHEITMPFLVLHGEADTVTDPEISKALYEKASSIDKTIK  214

Query  299  LYQGLYHSLIQGEPDEDANRVLADMREWIDERV  201
            LY G++H+L  GEPD + + V AD+  W+D R 
Sbjct  215  LYPGMWHALTSGEPDHNVDLVFADIVSWLDLRT  247



>gb|EMT11916.1| hypothetical protein F775_10120 [Aegilops tauschii]
Length=342

 Score =   109 bits (272),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 55/152 (36%), Positives = 86/152 (57%), Gaps = 0/152 (0%)
 Frame = -2

Query  659  APLFVIPENMKPSKVHLFMYGLLFGFADTWAMMPDNKMVGKAIRDVEKLKIIASNPRRYT  480
            AP+  I E +KP  + +     +      W ++P   ++  A +D +K + I  N   Y 
Sbjct  138  APMCKISEKVKPHPLVITALTQVEDIIPRWKIVPTKDVIDAAFKDPDKREKIRKNKLIYQ  197

Query  479  GKPRVGTMREIARQCEYVQNNFEKVSVGFLTVHGTADGVTCPSGSQMLYDKASSSDKTLK  300
             KPR+ T  E+ R   YV+++  KV + FL +HG AD VT P  S+ LY+ A+S+DK +K
Sbjct  198  DKPRLKTALEMLRTSMYVEDSLSKVKLPFLVLHGEADTVTDPEVSRALYEHAASTDKAIK  257

Query  299  LYQGLYHSLIQGEPDEDANRVLADMREWIDER  204
            LY G++H L  GEPDE+   V +D+  W++ R
Sbjct  258  LYPGMWHGLTAGEPDENVEAVFSDIIAWLNAR  289



>emb|CDY07008.1| BnaA04g23070D [Brassica napus]
Length=318

 Score =   109 bits (272),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 57/154 (37%), Positives = 86/154 (56%), Gaps = 0/154 (0%)
 Frame = -2

Query  659  APLFVIPENMKPSKVHLFMYGLLFGFADTWAMMPDNKMVGKAIRDVEKLKIIASNPRRYT  480
            AP+  I E MKP+ V + +   L G   TW ++P   ++  A +  E  K +  NP  Y 
Sbjct  144  APMCKIAEEMKPNPVVISVLSKLSGVIPTWKIIPGQDIIETAFKQPEVRKQVRENPYCYK  203

Query  479  GKPRVGTMREIARQCEYVQNNFEKVSVGFLTVHGTADGVTCPSGSQMLYDKASSSDKTLK  300
            G+PR+ T  E+ R    ++   ++VS+ F+ +HG  D VT  + S   Y+ ASSSDKT K
Sbjct  204  GRPRLKTANELLRISTDLEKRLDEVSLPFMVLHGEDDKVTDKAVSGQFYEVASSSDKTFK  263

Query  299  LYQGLYHSLIQGEPDEDANRVLADMREWIDERVS  198
            LY G++H L+ GE  E+   V  D+  W+D+R S
Sbjct  264  LYPGMWHGLLYGETPENIEIVFTDIIGWLDKRAS  297



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 984917279386